2WSIA

Crystal structure of yeast fad synthetase (fad1) in complex with fad
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
304
structure length
285
Chain Sequence
MQLSKAAEMCYEITNSYLHIDQKSQIIASTQEAIRLTRKYLLSEIFVRWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYFFIKAQNSFPMQRLPTVFIDQEETFPTLENFVLETSERYCLSLYESQRVNMADAFRDFIKIYPETEAIVIGIRHTDPFGEALKPIQRTDSNWPDFMRLQPLLHWDLTNIWSFLLYSNEPICGLYGKGFTSIGGINNSLPNPHLRKDSNNPALHFEWEIIHAFGKDRSSAINTSPISVVDKERFSKYNYYPGWYLVDDTLERAGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Yeast Fad Synthetase (Fad1) in Complex with Fad.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords FAD SYNTHETASE
total genus 89
structure length 285
sequence length 304
ec nomenclature ec 2.7.7.2: FAD synthetase.
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2wsiA00
4QREA 2QUKA 1NUUA 1NYLA 1N2BA 3DPIA 2CSXA 1WKBA 4NATA 1ILEA 1X8XA 1M83A 4MUEA 3ZJTA 1KP2A 3SZ3A 4S1OA 2A1TS 1N75A 3MLAA 4KR9A 3DV2A 5KCMA 1MBZA 1XNGA 2WSIA 2A88A 1D2RA 2J09A 4Q16A 3VRHA 5TEWA 1M8JA 1SURA 4ZCPA 1CT9A 2G36A 4GU5A 4BWVA 4OJMX 2DXIA 2A1TR 1U7XA 4DDHA 2YWBA 1Q19A 5IJXA 4P2BA 4XFJA 2JA2A 5KHAA 3RK1A 3CVVA 3A4IA 3AFHA 1I6LA 3Q10A 3LE8A 1R6UA 2IJGX 4KPUB 2H29A 1VBNA 1TYCA 1QRUA 1IFXA 1MAWA 4XFDA 4QBTA 5H7XA 1WJGA 1I6MA 1T6XA 2QJTA 1KH3A 3CLSD 3AKZA 1O96B 1WQ3A 3FETA 4MVWA 3PXUA 1N1DA 4K0RA 1XJQA 3TQOA 4NDAA 2VTBA 1EFPB 4MW6A 3HMQA 3L92A 3X1MA 4DLPA 1M8GA 2YY5A 1ZJWA 2CYCA 1M8FA 1PFUA 4YP6A 2J4DA 2VTBB 1I2DA 2ZUFA 1N78A 3LCJA 4ZT7A 5LM3A 4ZT6A 3PNYA 3FG9A 2GKSA 1YULA 1NUTA 4TS1A 3GLVA 1KP3A 3FOCA 5JBNA 1MB9A 1QRTA 4A91A 4X0EA 5IHXA 1BS2A 1WXIA 1XNHA 2QUJA 3BL5A 3DLAA 3RK0A 5HUJA 3IVXA 1O6BA 4MUFA 3AIIA 3CLRC 1F7VA 2XRZA 2E89A 1T9GR 3SEQA 4EGAA 1N2JA 3CLUD 3PNVA 1MAUA 3H9BA 4J76A 2PG3A 1PFYA 1OWMA 3MXTA 1EJ2A 1O95C 4MWDA 4OUDA 1GTRA 2PZAA 4YBRA 1PFWA 4H3SA 3RBAA 4DNXA 3CLUC 4R0NA 2V0CA 3IOEA 1GTSA 3QE4A 1JMVA 3FIUA 4U7JA 3HV0A 3TZLA 4JFAA 4MAFA 3G59A 4ZT5A 1N3LA 2O8VA 2E21A 2H2AA 3G5AA 4EG7A 3QTTA 3CR8A 1J70A 1OBHA 3IOBA 4KPUA 1OWPA 3AL0C 3ZJUA 1JECA 4K03A 1KR2A 1GZUA 3IOCA 4RUKA 3FHJA 5H16A 3K9WA 1QU3A 4I6JA 4MW0A 1ZH6A 3H99A 1A8HA 2C5SA 3IMGA 1WXFA 2GOYA 1J1UA 2DUMA 4UZFA 5LLTA 5HUHA 3KT6A 4ND6A 3IMEA 3P0IA 3AG6A 1MRZA 1JZSA 3VU8A 4PBSA 2D5BA 2CV1A 1QQTA 3ZIUA 1WXGA 4DDKA 2WB2A 1FYDA 4Q93A 3IDFA 2JAXA 2D13A 2X3FA 3IUBA 1H3NA 3D6VA 1U7DA 3ZXSA 3NBKA 3FWKA 5DASA 2Z09A 2TS1A 1EFPA 4I6GA 3NV7A 3X1KA 1G8FA 3CLTD 5EKDA 2J08A 1J09A 2HZ7A 1HYBA 2CV0A 2NZ2A 3OTWA 1QRSA 1G8GA 4MW7A 4AS1A 2QTNA 3E27A 1T9GS 3K32A 4YMIA 3MMXA 1EE1A 3CVWA 1V47A 1VL2A 4PY2A 1QU2A 1Q15A 4YP5A 1TYAE 2JANA 4JZYA 1O97C 1PG0A 3L93A 1EUQA 2PXHA 2PZ8A 4MW9A 4J75A 1YI8A 1KORA 1TYBE 1ZH0A 3PNBA 3A04A 2AZXA 1KH1A 1N77A 2CUZA 3COVA 3CVYA 2CFOA 4ZCTA 3P0JA 1X6VA 1H3FA 3SDBA 1GLNA 3P0HA 2EJCA 1KQNA 4EG3A 3RHSA 2QTRA 1J1ZA 1O0CA 4F4HA 4YP7A 2D54A 3HGMA 1K4KA 3HFJA 1WZ2A 4ND7A 4JXXA 1YIAA 3M5WA 5HG0A 4NX2A 4F3RA 3A05A 1I6KA 3DO8A 3KT3A 5DB4A 2QUHA 1NUPA 3MUEA 2RD2A 3ELBA 4ZCQA 3CVXA 2IELA 3AG5A 1WQ4A 1GAXA 3JXEA 5KWVA 1MC1A 4OUDB 4WSOA 4MULA 3KT0A 3ISJA 4E1AA 1FFYA 4PBRA 4CQNA 1N2IA 3CA8A 1OWLA 4MUKA 4PBTA 1H3EA 4G5FA 4EG1A 2EL7A 3H9CA 3X1JA 2A1UB 5FO1A 1U3DA 1T6ZA 1EFVB 1QNFA 4MUJA 2RE8A 1IQRA 1RQGA 2DEUA 3UOWA 3Q12A 4JYZA 2OV4A 3SZGA 1VBKA 1DNPA 1JHDA 3VGJA 2A1UA 3COWA 1M8PA 1K4MA 2OQ2A 1OD6A 4ZT3A 4G5YA 4MVCA 1NSYA 4MVYA 3OP1A 5TGTA 1JIIA 3IVCA 4ZT4A 5LFAA 3ZXIA 4GRIA 3ND5A 1LW7A 1Q77A 3TQIA 3IODA 3RFFA 1YIDA 4MVXA 2YXNA 2X0KA 3IVGA 4CT0A 4DDMA 4ARIA 4L2IA 4ARCA 1O94D 4JXZA 1U3CA 1JZQA 1NP7A 4NAUA 2DPLA 2A7XA 1QTQA 3ND7A 4L2IB 4G6ZA 1B6TA 5FO0A 4KR6A 2HGZA 4WNYA 4FZJA 3LOQA 2QTMA 3Q4GA 4I6EA 2B7LA 2E0IA 1NI5A 1KQOA 1N2EA 1JIKA 5J5AA 4QRDA 2CV2A 4AQ7A 1ZUNA 5J59A 1LI5A 1G8HA 5K0SA 5DK4A 3TZEA 1IH8A 1JIJA 3KFLA 4MW5A 1OWOA 2E18A 1VLHA 3H97A 4MWBA 1IVSA 5FNZA 2Z3VA 1TEZA 1JEEA 3D6UA 1TYDE 1T6YA 1WXEA 1PFVA 4R2MA 3CLRD 3N05A 1JEDA 4U63A 3UY4A 1WOYA 4KR7A 5J58A 2YWCA 2DLCX 1KAQA 3MLBA 2V0GA 3G6KA 4MQ6A 2AG6A 2QJOA 2CT8A 1M1ZA 1Q11A 3N2YA 1O95D 4CDNA 4RPIA 4MWEA 3SP1A 1QJCA 1NZJA 4DE5A 1YUNA 4EFKA 3ZGZA 1EUYA 3KT8A 1KAMA 3COYA 4HJRA 4CDMA 1KKUA 2IP1A 3U1VA 3H05A 1N2OA 2PIDA 1NURA 1UFVA 4MUHA 5TEVA 2DETA 4MLPA 3ILVA 1O5TA 4U8HA 2PZBA 5BNZA 1R6TA 4ZCRA 3S3TA 1O0BA 4XSVA 1J21A 1R6XA 2WQ6A 4HK4A 1TQ8A 3CVUA 1N2HA 1KQPA 1YUMA 4NAHA 1KH2A 2A4MA 4EG8A 1OWNA 2R5WA 3ND6A 1JGTA 4NZPA 2GM3A 3N9IA 2A86A 4MUNA 2BTEA 1F9AA 1LI7A 2WQ7A 3ZJVA 1WXHA 1IHOA 3INNA 1COZA 1O94C 3QTBA 1PG2A 4ZT2A 1H1TA 1MOPA 3COZA 4EG4A 3UK2A 2CYAA 3CLSC 2X1MA 3IUEA 3FY4A 1G59A 4HPWA 1F7UA 2VXOA 4MW4A 1IQUA 3P52A 2J07A 4DJAA 2NSYA 3IMCA 4HJXA 2BYTA 3RJZA 2A84A 1TFUA 3A2KA 1V8FA 3UC5A 2XRYA 3C8ZA 1MB2A 4UZEA 3SEZA 1EXDA 2DERA 2ZP1A 4KKVA 1EFVA 2J5BA 1IRXA 3ZUGA 4R2LA 1JILA 2HMAA 1K92A 3SYTA 5F23A 4MUIA 2Z08A 3PRHA 1N2GA 2ZUEA 1O96A 1ULHA 3FH0A 4MUGA 5AHWA 3FNRA 4EF6A 2DR2A 3GUZA 1XNJA 1P7PA 3I05A 5DEOA 3UMVA 4MW2A 4EG5A 1O97D 3HZRA 1M8KA 2QUIA 1WY5A 1OBCA 3FDXA 2X1LA 1NUQA 1MJHA 1NUSA 4MW1A 3F3MA 5TS2A 3HL4A 2AKEA 1Y42X 2CYBA 3CLTC 4ZCSA 2O5RA 3GMIA 3N8HA 3IH5A 2I1LA 3FI0A 4MWCA 5K0TA 1VBMA 1U0BB 3TNJA 4EG6A 1K97A 1F4LA 1GPMA 1GN8A 3NBAA 1S4MA 3TS1A 1J20A 2PFSA 1IQ0A 2QJFA
chains in the Genus database with same CATH superfamily
5AI6A 2I2BA 1SVLA 1U90A 3ASVA 4XOIA 1U0FA 2EKQA 2Q1YA 2TECE 3GDWA 2Q5QA 3BE8A 3FPLA 4LOAA 1ILEA 2W2TA 3EXHA 1V4VA 3JU3A 1M83A 2FJ0A 2TMGA 4PYQA 4F5YA 1DV1A 2I1VB 3KPYA 1X7XA 4WCFC 4NABA 1RBMA 1OYOA 1OXKB 1Z22A 3AW8A 1WHTB 3F4KA 3JWJA 3MPOA 1GU7A 3VTKA 3W2TA 2A1TS 2DY0A 4PHGA 2QZ9A 3C4QA 3OEED 1KI6B 2WSIA 1E7MA 4XM0A 4YAUA 4K6FA 2D7CA 4XWYA 2VF7A 2FP4A 3SJCA 3LYHA 4OGLA 1KZHA 2FUKA 4BOYA 3ILXA 2XE8A 1BSVA 2XYVA 1HI9A 4K9KA 4R84A 3V4FA 3W7AA 4B73A 3GLRA 4NG5A 4R54A 4YK7A 4X20A 1J33A 2YWBA 1DWOA 5KHAA 3T1QA 3HMKA 4UHFA 4D9KA 1JHRA 1T1RA 1L8QA 1V1RB 1VBNA 2HJWA 4PYJA 2ZRHA 4KI7A 3HRHA 3CZRA 5AW3A 2W42A 1XTUA 5CDHA 3PVSA 3ZIAA 1DC7A 3SF0A 3WK8A 2J1LA 2VK4A 4HVAA 3FGOA 1YDGA 2CK3A 4QBTA 5AOAA 5TQVA 3S1LA 4D3YA 3V46A 1WJGA 2GXQA 2XY4A 4HX9A 2ZG6A 3RANA 4PNEA 3NI2A 4WKGA 4G4JA 1EEHA 5AOBA 4DT1A 3M3HA 3STXA 4L6CA 4PS0A 3ZS9A 2VXBA 5LDGA 1M1YA 1MQ9A 1A4IA 1H22A 3KKNA 4W5TA 1GFWA 1H2YA 3IPAA 4FD3A 4Q9AA 1KQFA 5F98A 1Z88A 1ZA1A 2WU3A 4LRQA 1ZA2A 4PHHA 3N39C 2I6UA 3OQHA 1JU3A 4XJXA 5FULA 2AR0A 3Q8LA 1GDTA 4KE7A 3AFMA 4NAVA 4E5PA 3E9CA 1ICIA 5DTJA 4PAWA 2ZBQA 4PGGA 1A2QA 3EB9A 2GNAA 4MUAA 3UKOA 2YOHA 3C6QA 5ITSA 2J3MA 5A6SA 4CMGA 1QHXA 4HAXA 3R3HA 5EESA 3TG2A 1BW9A 1LTKA 3EJWA 2RHGB 2IZ0A 4X1IB 1KJJA 3OOHA 4I8XA 4DLZA 4HXYA 2WM2A 5F3RA 4Z1MA 4ETMA 3LF1A 3BL5A 1Q1QA 4YHBA 2XCUA 5L45A 3AEQA 2WUEA 1F7VA 5BNFA 3TJRA 3JVDA 4KODA 4N5HX 4V38A 2GK3A 4MR7B 3GUHA 4WE3A 3AESA 3LVRE 4A5OA 4YASA 4KR0A 5MHTA 1W2WB 4QPNA 4HFRA 5CDYA 3G7SA 5LB4A 2COUA 3EVDA 4Y6GB 2BT4A 3SSAA 3OPMA 5HDQA 1TB4A 1JH8A 4E6EA 2PV7A 1FDWA 2R4TA 4JBHA 3B9QA 1ISJA 1R8JA 3QW4B 2C82A 1J23A 1LU9A 1O95C 2QS9A 2FQWA 2G07A 3VTZA 2VCEA 3FB4A 4OUDA 3W2FA 3T12A 4Z7OB 1S1MA 1PFWA 4EPRA 4MZDA 3EODA 3N2ZB 2XMQA 4GMFA 4NOKA 4ZHSA 2DTDA 4P3KA 1P5FA 1KR5A 4DPKA 5HZMA 3M70A 4J0GA 4GS5A 3W77A 4D9IA 3BWBA 3NYRA 3UHFA 1AO3A 3JQFA 1AHIA 1LVHA 2E21A 3I72A 4REMA 1Y8RA 1KMHA 5CB6A 1UBTS 4A8TA 4DNQA 2DQKA 3V8PA 3DS8A 1OBHA 2C7QA 1MQ8B 2D3TA 4Q9DA 1JDSA 4FPXA 3O7WA 4X71A 4F11A 4HTFA 2JIMA 3WL8A 3ORFA 3AKYA 1JI3A 1CZHA 5KTSA 4MCAA 3ILSA 4TTSA 1KR2A 3C1UA 2B8WA 1U4SA 4DQDA 1E0SA 3HVHA 4OBBA 1Q1BA 1GRVA 4HWTA 4FMPA 1R9MA 4LYAA 4A2WA 5EFOA 1ZMRA 3QFCA 4WK6A 2D2VA 5ENZA 4G4GA 1HYGA 1PFKA 4IW3B 3UV3A 4YJGB 4L78A 4U2CA 4KQEA 4UM9B 1FNMA 4UZFA 3TUIC 1K2VN 3AOEA 3GF4A 4YRQA 5FYQA 3GT7A 4NS4A 4FWBA 1GZ3A 1UKZA 1YB6A 4MVJM 3AG6A 4BKRA 1R0KA 3MYYA 2W6CX 2XGJA 1D2GA 4MNTA 2ZJ8A 2CFCA 2D5BA 1E92A 4PQRA 3ZIUA 1P62B 3HKDB 1XPJA 1Z0JA 5I48A 3RADC 3HCAA 2VH1A 4GWLA 5FBZA 5E2BA 5HUJA 2FU5C 4HDKA 1WXWA 3JZMA 1XK6A 2XVMA 3PUJA 4U2GA 4TS9A 1FDTA 3T52A 1KI4A 3ADDA 3FWKA 1C30B 2B94A 3FJ1A 2BZGA 2Z09A 2PDAA 5DNDA 5CX1B 4EJSB 2M1ZA 1EHCA 2EV9A 3WTBA 4QQFA 3ZY4A 2PH1A 3GVHA 4CBVA 4Q9KA 4QBKA 1X9IA 1VLJA 5DNEA 5CXUA 1HYQA 4DZTA 2DHRA 4ZGBA 5IASA 4MV4A 3PPWA 3NS7A 1C7RA 1JUDA 1PUXA 5C1IA 5HGXA 4ZV4A 1Z0AA 1CS0A 4F6RA 4GX5A 5DP2A 2FUG6 4LCJA 1U63A 1HV8A 4QUAA 4QOGA 4R1UA 4W9RA 5I9TA 5JAQA 4OPMA 4UVDA 5JPCA 3CVWA 3DMGA 4P0QB 3WLHA 2ZSUA 1U2ZA 3ZGYA 3OQNA 2OYSA 3ZZNA 4YT2A 2P2YA 4DMUB 1OXTA 1CUFA 4C5CA 5K01A 2A5GA 4H35A 4LYFA 1M1YB 2ZATA 4JBXA 1VRWA 1L3CA 2D5LA 2ZWPA 3ZHCA 3W5JA 3BIWA 4DPMA 1NW9B 1FTSA 1YQGA 2QRVA 1JYFA 5TLSA 1FFXA 2PQ6A 1YD7A 2OZPA 3R3YA 2WJ4A 2EXXA 3HU5A 4WTOA 4C6HA 4TROA 5A3JA 3QVKA 1RIFA 5LD2B 1L4MA 2ZT7A 4RKFA 1PR0A 1R0XA 4MWTA 1N7JA 2CL6X 1QE3A 1YB2A 4RDIA 2VSFA 3RTBA 4Q7LA 2LV8A 3RKSA 4B8YA 3LUDA 5F2EA 1PWYE 2IEZA 1YR9A 3QENA 1MTOA 3MB5A 1E2UA 1K9SA 4IDQA 5K3OA 3ABIA 3L8YA 1E7YA 2BGUA 3WKEA 3QEMA 2YRXA 3I42A 4MWZA 1ORIA 4WAUA 3M5WA 4PRYA 4BDSA 1BRMA 3RR2A 5HZHA 5DBOA 3QUSA 4QO8A 1VKHA 5TQ2B 1YRAA 3TIGA 4IIVA 2Z4SA 4GPBA 4EMBA 2AQKA 4JQCA 2BFCA 1R6VA 4OMFG 4PAGA 2J9XB 5LMCA 1B43A 1I4EB 1ADYA 3C7DB 3KAQA 4UTXA 1BS1A 1Z5WA 5F4BA 3T5BA 4AL4A 4MHTA 1BQ3A 4ARBA 4LWOA 4JB3A 1VHLA 2DWUA 2G3YA 4ZYZA 5GGXA 1WQ4A 5CU7A 4L07A 3BILA 1B7GO 3S2IA 2YWFA 3A3YA 4PG4A 5J2UF 3NGLA 2QSUA 4E1AA 5A4DA 1FFYA 2PY6A 1EZZA 3TOXA 1A9TA 1MH1A 1TMKA 1E9CA 1YZQA 1Z7GA 4Q7MB 5JJKA 3NT4A 2JLXA 3FDFA 3M1YA 1AQIA 3EXG1 5JMWA 5A0TA 2VSOA 4KNWA 3GRRA 2IUTA 3II6X 3O3NB 1U3DA 2CD7A 3NHKA 2P3QA 2VDQB 4B47A 1YS7A 2CD9A 4KXMA 5JSQA 4B6JA 1P7VA 2C9DA 3L0PA 2I6SA 5IM4F 2Q6KA 3FF4A 5FQOA 2Z0MA 2A1UA 4QDKA 1R74A 4PG8A 3IXQA 3HXLA 3DAPA 3GP5A 4UQLA 4RMGA 3F7OA 2O1WA 3I01M 5KTMA 1K4MA 4B76A 5C51B 4B2YA 1QKJA 5FI1B 2I2AA 4U6NA 2LW7A 1P2SA 2R2GA 1UJ6A 5EFZA 3IVCA 3EQZA 1X1AA 2APJA 2OCDA 4NHOA 1W73A 3VNSA 5C1PA 2ZB7A 1N9KA 1I7QB 3O8DA 3RYFB 2WYUA 3O1JC 2Z56A 4IDNA 3R6DA 3W79A 3IT3A 1A5BB 4LX0A 3K5HA 2GXAA 1CE8A 3E23A 3U3MA 2X22A 3PYLA 3A27A 4TL7A 3OUTA 5B4VA 4Z8XA 3LDGA 4U00A 5L3SA 2ZTLA 3DFUA 4H2DA 1K7YA 3TD2A 3E81A 1SU6A 1EESA 1F6BA 5B1EA 2P3LA 4HLQB 1TW3A 3BB1A 3K1JA 2DYKA 4X66B 3SR3A 1BCSB 1M1NB 1RW4A 3RWMB 3EG9B 3UWDA 3ZWQA 5JQWA 1UBCA 4C21A 1W5TA 3MFQA 1LPAB 1OAAA 5J2UB 2QROA 3ROQA 3MF4A 3O8LA 1VCMA 2OHXA 5U4QA 2O54A 3PVZA 2NV2B 2A0KA 3BXFA 4MUYA 5EIBC 2JBHA 3SOPA 1FU7A 2IXFA 2YYYA 1W85B 1H9AA 2A33A 1Y4ZA 4IHJB 3ETCA 4K9PA 4CLHA 2ZUVA 4DANA 3CWQA 3AETA 1LV8A 1KA9H 2AK2A 3R0XA 1MX3A 2R11A 2R6GA 2IGTA 5IBQA 3J81k 3E22A 1DDGA 2H2FA 3KQSA 3EIQA 1IVNA 2VDNB 1B8VA 2V6BA 5EP4A 4LRSB 1H1LB 3P2MA 1L9KA 4G0QA 4M7RA 2CMKA 4TXJA 1M6NA 1ZH4A 1WF3A 2AFVA 4Y1GA 3DZGA 1CUJA 5FNZA 1KOGA 1NSTA 2FOLA 1UZAA 4I0WB 2XDQB 3JQ7B 3T7AA 1JEDA 1L4FA 4Q12A 1KSHA 4HFJA 4ZD6A 3VQTA 4D3DA 1WOYA 3OTOB 4XVQA 1ECGA 1WMAA 4RF5A 1NQAO 1UANA 2DLCX 4ZVKA 2PUVA 3DBVO 4IJVA 4UE3S 2B20A 3NHSA 4X8OA 1OQAA 4DV1B 4Y2XA 4XWKA 1IUKA 3G6KA 3WYBA 1CR1A 5GOTA 4C07A 4EW2A 3IE1A 2V9ZA 3D02A 3OPXA 5CEFA 4CDNA 3JYOA 2Q6TA 5C7OO 4QFMA 2HQSA 4CT5A 2R8PA 1FVXA 5ESWA 4JXJA 4JYMA 3GVXA 2R5FA 3WYFA 5F4ZA 4DE5A 3OO1A 2CUKA 1NXSA 1ODLA 3UMJA 5I7WA 4RTNA 4LOJA 4IDHA 4G5HA 4W7HA 4N3AA 5DBIA 5DTIA 5JC1A 4XQEA 3CUTA 1NPYA 2BEUB 2GK4A 1NY5A 2P9FA 1O6CA 2OFFA 1K63A 5L3QA 4YALA 3KQYA 4YMHA 1G41A 2OBYA 2AJCA 1ODJA 1PX2A 2KBEA 4JLBA 2ZSBA 5K09A 1E1RD 1OLOA 2OK7A 3KS9A 4RQBA 5B2ZA 3T5MA 3UUEA 5LP1A 1Q95A 2ZT6A 4DCVA 3SJ7A 1AF7A 3S7TA 5T4HA 1FZQA 1ADFA 1RPNA 5GOZA 1OVGA 2DU8A 2ZRNA 3NAGA 2XCSB 4NL4H 2VJYA 1OWNA 4KB5A 3TL3A 4LHZA 3O4RA 2IS1A 1EYZA 2CJWA 1VTKA 2QYOA 5D2CA 3WP1B 1B2LA 5AFSA 4X65B 3MA0A 4HDSA 1MPXA 5FBHA 3MMNA 3NDIA 4BNYA 2BGWA 4X1YB 3VNQA 4J2OA 2H1FA 3U7IA 3K73O 2FWNA 3DE0X 4KU4A 4OYYA 3H1EA 1PG2A 2V3WA 4E5NA 4PXSA 4WDQA 5ED4A 3MOGA 2GLXA 4DIFA 4B40A 3E6AA 3ZHOA 2K5UA 4OA5A 2HMYB 5F7XA 4YQFA 2BUBA 2O4UX 1ZOSA 2WVGA 2YY7A 3C3CA 3P52A 1Y8RB 3AQIA 3FFXA 2BYTA 3BORA 4MDFA 1CRLA 5JMPA 1SU8A 3QU7A 1LPNA 4GG1A 4XIIA 3TLMA 3ZHZA 2VHUA 1WR8A 2V4MA 3DEAA 4II7A 3TQTA 5CH5A 2BSAA 2C97A 2KQUA 5B57C 2XRYA 4UZEA 2O07A 3MS7A 5JFTA 1CS0B 1Z25A 4J8PA 5GWXA 2HHJA 3LC1O 4ZZ2A 2X8BA 2DP4E 2I2WA 1ND5A 5FWNA 3FDIA 1QPGA 2D59A 2G9RA 1OLSA 4DQVA 1ZDMA 3HKEB 3MOSA 3CPEA 3HLTA 3AR6A 3A1EA 1POXA 1UM9A 4PO8A 3NPAA 4R8VA 4HL6A 3IO3A 1P7PA 4NMHA 5KVAA 5L4NA 1QR6A 3QBEA 1XO1A 1K88A 3SF8A 4O02B 3CCBA 4OHPA 2IV2X 3VDRA 5BN1A 4K9NA 4FEYA 4LMBA 3ESRA 2DE0X 1JRLA 2CHGA 5ALVA 4AMBA 1SFRA 1NUSA 1LDNA 3UHJA 1O54A 1TF7A 3DHVA 4NVRA 1KDRA 2AKEA 5TMBA 3PHJA 1P74A 3AP3A 3U9SA 5JWHA 1U7OA 5LMZA 2EG5A 5DTEA 4CKZA 4DV0B 3P2YA 2YC4C 3OM1A 5BN5B 1RLIA 4F5EA 2DG2A 1GN8A 2VT6A 4LZNA 2P9QA 1UODA 1U0LA 1NC1A 2ODAA 2BY4A 2WZCA 2XKAA 2ZEJA 3M9WA 4MLZA 5FD8A 3UAWA 3PS9A 4DLTA 1TPYA 1JLMA 2PVSA 1ORVA 2P78A 3KO8A 3PU6A 3DE6X 3QX7A 4BNGA 3K35A 2L2QA 3N7AA 3MLAA 5FOQA 4MDYA 1JAZA 3IAM1 3L1HA 1FRZA 1QTRA 2GFQA 1RWBA 4QRHA 2FPGA 2HD4A 4EW3A 2ZR7A 3MCTA 5BT8A 2JI6A 2Q5CA 1JBQA 3TLGA 1UXGA 1CUXA 4ZGWA 4E14A 3L1UA 1VPVA 4RGQA 4AWBA 4F86A 3UWKA 3JVEA 5AMXA 3TSWA 2IXEA 4IG9A 1JA1A 3R3WA 1PWXA 2DBQA 3B1XA 5L3RA 3FTQA 3WYEA 2VDPB 2RKWA 3CVVA 1AHNA 4LJ8A 1FQWA 2ZQ5A 4AY3A 1L7DA 3C6YA 2GBIA 5B55A 2OZLA 4B1FA 3QGMA 4UU7A 4BV3A 3JQQA 3U7QA 4QX6A 1EINA 1C7JA 1P0MA 1OGYA 1PF7E 1XQWA 4IS3A 1RXVA 1UMCA 2HT1A 2FQXA 2QJRA 3PVCA 2VQSA 4YJFA 3K0HA 4K6OA 4QHYA 2OTCA 4JL5A 2OVFA 1ZIPA 2XZPA 1SB9A 4CZ2A 3TLBA 1E64A 2ZZMA 2X8JB 3UQZA 5EZ6B 1G5IA 3BTVA 2M32A 1NW8A 4MVWA 1QCZA 5DW3A 1IBMB 2GVDC 4UBKA 3KV1A 1R9NA 1PT8A 4CGYA 5AVXA 3T7JA 1Q5PA 1P2FA 2VHVA 1MLDA 4BX3A 4ZYUA 4DLYA 3IUQA 1Z0DA 2MJLA 4GOKA 4LVCA 4Q02A 5I7VA 2G4CA 1H69A 1Z75A 5BWBA 3TNFA 2YY5A 3I9FA 1ZJWA 1PI3A 3I39X 4QARA 3OIYA 2BMWA 4UEQA 3A1NA 1OH8A 1UMKA 5GP1A 3G2MA 3SHQA 2YXDA 5I9LA 3BPSA 3GLQA 1SZDA 2FWJA 5LM3A 4ZT6A 1M5UA 3LAWA 3KFXA 3NBXX 4L3WA 3GGGA 4AY2A 1BZYA 2X0JA 1ND6A 2GHRA 1EI9A 1A8UA 1AC5A 3JYPA 3NIDB 3QKSA 4JLUA 5JBNA 1K98A 2HCJB 3O9ZA 1FE8A 1QHNA 4Q9JA 3TLZA 5I3CA 1QRTA 1YS6A 3CKMA 4X0EA 3U40A 1HNWB 2HBYA 4EO9A 2J33A 1I1QB 3IUMA 3LT4A 3P2KA 2QUJA 4XW2A 4ZQFA 3WWOA 3D8UA 4K9DA 2IV3A 1PQUA 4CM1A 2JCVA 4WOJA 4DVGA 3BF7A 4M7OA 2R1UA 3HPQA 1I5OA 4PZPA 2BF7A 1Z4IA 3ZJ5A 1EFAA 4EGAA 1CQWA 1N3YA 1JQAA 1Q16A 3GUYA 4TQAA 3WLPA 2BBTA 5IBPA 3OOYA 1IHDA 1LH0A 3A1CA 4IIGA 1TJ5A 2RB5A 1YMQA 1MN6A 3CT4A 1XFAA 2IDZA 3KD3A 3K9FC 1LZKA 1MTZA 1ZAKA 4HVCA 1C1XB 4R8RA 4CM8B 3F73A 3QI7A 2AC4A 2P1RA 5AI9A 3DV0A 3Q0EA 3LQFA 2FUCA 4OG2A 5E9WA 5CX1A 3RBAA 1K3TA 2X7XA 3E5NA 3OEYA 4YO7A 2HU7A 1PDWA 3WLQA 1CUAA 2X1VA 3ZNQA 1GPLA 3FWPA 1TX4B 2PT6A 5CTAA 4ZZIA 1QZZA 1NQWA 1VL1A 3UK1A 4DR2B 3EZYA 5TGZA 3RVJA 3L0CA 2G8LA 1MRNA 1WS6A 2GZRA 3TTYA 4Z49A 2LXNA 4H0NA 2YX1A 1JR3D 1HFKA 4TYMA 1Q0TA 2EQBA 4EOGA 5AI5A 3K6JA 1OXXK 2OCLA 3ABSB 4X91A 3MWLA 1EDBA 2PJUA 4KPUA 1GAWA 1Q0SA 3RK4A 3I37X 3EXHC 5A4IS 3CZ9A 5BN4B 3HWX1 3ZJUA 1G19A 1UM8A 2REXB 4YJ3F 4ZQGA 5FHRA 2BW0A 5HK9A 4X94A 2NXCA 1GZUA 3NDRA 1QHFA 4DCPA 2VPZA 1L7EA 1URPA 4ZHQF 4DZRA 3JRWA 4HAWA 4FOSA 4H16A 5ESXA 1X0VA 3LQ1A 5JPIA 4F3YA 4B4WA 1HOXA 3JY6A 3O9MA 4OHBA 3WWEA 4JR1A 4A8JC 1I3LA 1GKIA 3L7LA 2IXBA 4WBNA 3S81A 1TUGA 1D6NA 1W4CA 4WLOA 3AUUA 4H3KB 5GONA 2X2PA 4CCWA 2ZIWB 3KRTA 3WO1A 2WNIA 3AERB 3Q8KA 3AY7A 4OI0A 1WB5A 3GQBA 1TK2A 1L4HA 3KSZO 1T2DA 2I2XB 5AUOB 3O8OA 4RULA 2Q3HA 3EXIA 1XXLA 3UJAA 5GV8A 2PUEA 1RABA 1XHLA 4ZHQA 2FPPA 4FYKA 4Q93A 4H7DA 2W2KB 1J90A 4GL4A 2O7VA 5TC4A 1GFZA 1W6RA 2VQ3A 4AMVA 1P5RA 3ZXSA 4O4HF 4YJ3A 1J0DA 1NULA 4KXUA 5E7JA 1J2JA 5LIRA 1MC4A 2TS1A 821PA 2OVBA 2QJWA 3DNMA 3I1YA 4H6WA 4M1KA 1ZEJA 5EUBA 1BDHA 2IYXA 1JU4A 2HA7A 2AN1A 1KRHA 5J2TB 4AKGA 4KQIA 2HF7A 4ESHA 4OYHA 3NHRA 2Y1XA 2XCQA 3OTWA 2IE8A 4HLUA 4PQEA 3ANMA 2Z2ZA 3ITEA 3JD4A 521PA 5EHQA 4EPYA 2QTNA 3JQ6A 1C1DA 4NMMA 2NYAA 4MGEA 4YMIA 1SXJC 3ZIAD 5DNUA 3AUAA 1NW4A 5DGIA 5LLDA 2DSNA 5IC5A 1OU4A 2HREA 2C5HA 1XVAA 2NUAA 3CKLA 5TE9A 2R1TA 2AHOA 4HQOA 3QVXA 5KNDH 3WBBA 1AZTA 2FWRA 1ZINA 1B93A 2GGSA 4BBZA 1G1AA 1RR6A 1MOSA 5BQOA 2Y6VA 3W5HA 3DCNA 1I7NA 4Z2YA 1USWA 2GEFA 5ILQA 3W6OA 2LD4A 2P3OA 1ZMTA 1OMOA 2O05A 4YI5A 4BQSA 5BP7A 3C1TA 3HDJA 3VX3A 4BLWA 1SOUA 3ZQ4A 4EHKA 1KS9A 3H8VA 3LOPA 3O2SB 4BFSA 1CUIA 1MEOA 2G88A 2G70A 2Q3BA 3EDMA 3H6KA 1YJ8A 4HZUB 1RPJA 1RMQA 1UXKA 3SQNA 2V8BA 5A1JA 1AUXA 1SHJA 2EJCA 2H06A 2H2IA 3HI6A 1YS9A 3MXOA 3X0DA 5LKAA 1EXNA 1QP0A 4D0GA 1N0VC 2D54A 4FFOA 2W2XA 2I4OA 2NGRA 2ZM6B 1WZ2A 5AJVB 3W8EA 1KBZA 1KETA 3TSZA 5FV4A 3OZ7A 5G3ZA 3GN1A 3WWDA 3BA6A 2HADA 1I6KA 4C0SA 5L53A 4H27A 1M34E 4EJ2A 5DB4A 2X9LA 2HSGA 3TW6A 2I6FA 4M76B 1SKUA 4PZEA 4LJ4A 3FVRA 5F21A 4NFHA 2BKXA 3KEFA 3WNDA 3WYNA 3ZOZA 4C3UA 1QCCA 3ELBA 4MV6A 3O0TA 3DWFA 2IK8A 2JEYA 3CNQS 2IELA 4GYKA 4V02A 2WZDA 3MQ2A 2ZI9A 3GL9A 5FT9A 4CG2A 1H2XA 5CH3A 3BCUA 4ARZB 2OBNA 1SXGA 1A4UA 2NZ8A 3A6LA 3K5WA 3S27A 1Z18A 2PSSA 1PBTA 2JJ1A 5AK4A 1PT7A 1EHIA 3F8WA 3WADA 1O87A 4CM5A 3WISA 3H6GA 1IN5A 1ONSA 1PWEA 3D7SA 2QW1A 4FD2A 1N2IA 1G66A 3FYUC 2CBZA 2HYIC 1VYTA 2MYPA 4Q01A 5DNVA 3PJDA 4IV0A 4G1VA 4D44A 1XEAA 4X1KA 1RP1A 5TMDA 2J7PD 3KOXA 1TECE 3N87A 1EFVB 3OHSX 4O2AB 4RACA 5EIAA 2OORC 2ZIFA 1TC2A 2HLDD 3AJDA 4BPBA 3IERA 1H4VB 4BO2A 5HWSA 2IZ7A 2P6PA 2R1ZA 4OX9B 3A8TA 4H31A 4DM3A 2WHRA 1V6AA 2ZYDA 3D5QA 4RK7A 3L82B 4PLGA 3BSFA 4DA4A 4TS4A 5EYPA 3ZQJA 4R6WA 5TGTA 4BP1A 3T94A 5E9QA 4U39A 3NWPA 3BFKA 4A73A 4H7KA 3GXBA 4QL3A 4BO3A 4C05A 5BWMA 5CBPA 4O4LF 3OIWA 5AOVA 4U9IS 4LMRA 4LDZA 2SNIE 3ECAA 4U2FA 3M4NA 1JIXA 2A8YA 3QUCA 4JXKA 2F2TA 4BCBA 1B8NA 4L27A 3GDHA 4R9NA 3G8BA 1PJ2A 1DBSA 1W0JA 4AG5A 4V39A 1BEUB 4KQ9A 4ALJA 3VC1A 4IRUB 3LDAA 3T1VA 3AR9A 2O8CA 1F2TB 2IYAA 2W6ZA 3BIOA 1XZDA 1XDDA 1S6YA 3L0ZA 4ID9A 4JIMA 4JUDX 4URFA 3UXMA 1VPTA 3OY2A 5T3YA 4CM6A 3OQOA 4F4CA 2CVFA 2RHHA 5JS2A 2XWJI 4WNYA 2OK8A 4FZJA 3OZBA 1ZNXA 4G5RA 4HGNA 4A5SA 3DWEX 1NVGA 2BMDA 2XNDA 3IFSA 1SM4A 2O9JA 4S2UA 4UCXA 3TRKA 1L0BA 2H48A 2VKQA 3OBBA 1KEUA 1ABFA 1KQOA 3IQZA 3QVMA 2GXSA 3KQTA 4L4UA 4XTCS 3VGPA 3W2HA 3E82A 4ZICA 2J4FA 5DTRA 3X1DA 1HOTA 1COWD 3TUZC 4OOEA 2YICA 3OLYA 1S8NA 3DYIA 3QYJA 3VJLA 1DC6A 1HLDA 3G1WA 4I5IA 4WL0A 1QLWA 2L82A 3CWZA 3OURA 4MJ7A 5K0ZA 3GLFE 3K70C 4ZOLF 5CNKA 2OV6A 3IP3A 3W3AH 1B26A 3C87A 4L0QA 2ZRKA 3G7UA 4GX2A 3TM4A 1JHMA 1F3OA 2QB5A 4IIXA 4EGSA 1QTNA 5C3UA 2HPZA 3FR8A 1QVZA 4IH1A 4EM6A 3NDPA 1J8MF 3NVDA 1N32B 3QEMB 4FE7A 5AK5A 1CXZA 1P4JA 5I9IA 1Y4UA 4F4UA 1CK4A 4UTPA 3DT6A 3FZGA 2DHDA 1US8A 1YQEA 1RM5A 3DMTA 4RE6A 5GQSA 4B3RB 3UC9A 4H0FA 5JXHA 4BL5A 4YPOA 2HJRA 3I5XA 3EY9A 2WV9A 3PGXA 1BC5A 2ZRLA 3OCYA 4EF4A 1L8OA 2AEJA 5LNK1 4FNAA 4I3GA 4I1IA 3RIEA 3CV3A 2BKUA 5HRUA 2JIOA 5HCIA 3K0FA 4GW3A 1Z06A 3EFEA 1XQ9A 2YFHA 1L7XA 2CVZA 4M9UA 4CCYA 4QRIA 1ULTA 3PUIA 3ONDA 1P9RA 2IGBA 3MHTA 1X94A 3U1VA 3NWJA 3CO0S 2E1PA 3KDSE 2PIDA 1KZ7B 3FM9A 4K9SA 3IBFA 3UVEA 5HFNA 1JG7A 1KO7A 1QK3A 2O23A 4MUHA 2IL1A 5EJ6A 2GF2A 3RBVA 1LLDA 1VCHA 5I7UA 4YRAA 4B84A 2OCPA 2GZ1A 2XKJE 2ZR9A 3K4PA 4KITB 3AWIA 2MMGA 2YCLA 1YJCA 5KSOA 1YRBA 2VIIA 1QBKC 1V35A 4OQXA 4IQ4A 2O3RA 5A0VA 4GZ6A 4R9VA 3ZEIA 1R6XA 3BDAA 2PQ0A 4PFJA 3L6EA 5DM1A 3RVPA 3UJ3X 2RH4A 4EG8A 1FJGB 4KX3A 2YIMA 2C4MA 5M5BA 1YBVA 4MYTA 4PCVA 3VR4A 3U39A 3N9IA 4K9RA 1ZMOA 3W78A 2ZJYA 2Y1OA 4TXHA 4PO9A 2V7VA 4RTOA 3KZOA 1KDTA 1BKYA 2O7SA 1EX6A 1PR2A 2OO5C 4GM0A 4M1EA 3CUKA 1SQGA 2ZUSA 3CONA 3IDZA 3F1LA 4IS2A 4Q4HB 3A7EA 3PGJA 5LZ8A 3KUCA 2ZU6A 1H5NA 3P9IA 4R16A 4BCCA 3FFAA 1YRLA 2XW6A 2Q2QA 4U7FA 3VR6A 1EM6A 3JZAA 5FL7D 2H7YA 3R1IA 4PFQA 1OYVA 5TT1A 2XGGA 3L1KA 4RL4A 4RVGA 4U0KA 1SZJG 4QXMA 3W34A 3HCOA 1U2PA 4LJAA 3KVRA 1TZKA 1OA0A 1BE1A 1ZWLA 4F2GA 5JJCA 1MX9A 3SEZA 5CCEA 2JL1A 1WHSA 4Q1EA 3QELB 3I2HA 4C4XA 4MRPA 1GPBA 5HS6A 2O8FB 1K92A 1L1FA 4KO8A 3V8MA 4CHGA 2X41A 2W8ZA 4N39A 1ULHA 4E46A 1Q44A 2BIFA 3B53X 4ROTA 4G0NA 1GAEO 2YN0A 3O2JA 5JSFA 1V1MB 2DR2A 1LBEA 5JCJA 2H1WA 2R7KA 3UMVA 4IVPA 4LCEA 2VHEA 4A10A 4D4HA 3DFIA 1B14A 2BKLA 3HE3A 1XOIA 1YCFA 2JPDA 1VRVA 1YASA 2G0NA 3K71B 2B4RO 1GQQA 4FWTA 2FQ1A 4RZIA 3L49A 3BL8A 3NDBB 4B45A 4EJ6A 4OAPA 1SCIA 4A0SA 5K0GA 4Q6WA 2VPYA 4RMNA 2C1EA 3PEVA 2VZLA 2HSEA 2JBWA 3LIIA 1W4BA 4MWCA 1W7AA 4UDNA 1VBMA 3QWBA 4B80A 5FLYA 2YZ7A 3D6HA 1NW3A 2V03A 1J8YF 3RO7A 4G0WA 2EW8A 1BYIA 3AEXA 4XWAA 1YFKA 1J20A 3AIKA 1FJXA 2QJFA 4XGQA 1NI3A 3RRFA 1NJ2A 3FOFC 4BKQA 4HN9A 3PNQA 3KP1A 3RBZA 1UAGA 4LYYA 1E7SA 3KDPA 2RHJA 3RLIA 3K92A 3SX2A 1N5DA 3MTAA 4CKWA 2VQFB 3USZA 5CLGA 3UM9A 4NWIA 1QWSA 3ELWA 1SG0A 1RKBA 3L0DA 2O5VA 2P4SA 4JLPA 3TSYA 5BVGA 3BQMB 1U3VA 2YXPX 2HQOA 1Q7RA 2QTVB 3D8RA 3HXKA 5CJPA 1N6LA 3BULA 3GZTB 2I33A 2YVQA 3QBVA 4MS3B 5D87A 1IXZA 1PZHA 5ALZA 2IEYA 4HGQA 1P1BA 3JWPA 1U0HC 5BW5A 1O2DA 2QRQA 1A8SA 4OL9A 3VNAA 1V95A 3DB1A 3NONA 2FQQA 2FF5A 2Q5IA 4XEUA 4FFSA 4UFPA 2BGJA 1OOEA 5FL7A 3A4IA 2DWPA 3PHGA 5T7BA 4C6SA 4C2TA 4BNVA 1SCBA 5IS2A 4RTMA 3HABA 1TYCA 1ZO8A 1G8KA 5LU8A 2FJPA 4WY8A 2BMFA 2IH4A 3LXXA 2ZS8A 1M72A 3W8FA 4G0VA 3PL1A 4UXJA 1MAWA 1UXOA 1YJAA 5JNVA 3EIUA 4NI5A 5IN4A 1U3TA 4H1HA 3LTEA 2CE2X 2RC6A 1AGRA 2Y2UA 4ZAZA 2CLLB 4F5WA 5KYYA 1CUEA 1CS4C 1Z63A 4WVLA 3SBOA 2G77B 4Y0VA 1GG2A 5AK6A 1KPIA 5AXBA 2B69A 2J0VA 2C94A 4QJ4A 1JFVA 1L6RA 2CLHB 4L15A 3QVJA 2EP7A 5AHKA 5LOVA 4GI5A 4D8TA 2H8GA 5B7NA 4EL5A 2C58A 3V2HA 1G20B 3DE7X 3W7VA 1X14A 3F9CA 1LZLA 4OCZA 2YXBA 4RA6B 3L40A 4UASA 4DV7B 1T3TA 4HRAA 4MMYB 3RRYA 4CODB 1E1CA 2VTDA 3HDHA 4XCXA 3BM5A 4B0OA 2HF8A 4RHTA 5DYGA 3WDLA 3JD3A 4KO4S 2ZT5A 3LV8A 4NNJA 2LDXA 2Q7XA 4MWSA 5TRTA 4DYHA 5GZ3A 3FG9A 3A1FA 4YUXA 1Q6ZA 5JUWA 5FUYA 2RI6A 1KP3A 5SYMA 3QBTA 4G86A 3R7WB 2Q3LA 3JAKB 2B5OA 3QF4B 5CYGA 1XTIA 1JJ7A 1JKFA 4W9NA 2XHEA 3A3KA 2LDBA 4PO1A 4RVSA 4UMDA 3LBYA 3WVNA 5ADVA 1N34B 1XYVA 4LF9B 2RGYA 3KDAA 4JOSA 4JWKA 1FSSA 3UPUA 5FA5A 4Q19A 5KYTA 3DFMA 3WBKA 2JVIA 2DFKB 3FVQA 4F8JA 5JDCA 1N2JA 3K9GA 3RHTA 1LJLA 1ECPA 1Z4NA 1J00A 2XB4A 3H9BA 3IP5A 3K96A 3RUPA 2V8OA 4RSHA 1KF0A 3CNOA 1E3LA 4HKTA 3RNLA 3D0RA 4R3WA 1M2VB 1DUSA 2VUSA 2YRWA 4PG5A 2F4VB 2AQIA 2RGNC 3PUWA 4B6OA 2R6AA 2CCGA 4FC6A 2V0CA 1GPAA 2L18A 3IOEA 1I13A 4FOTA 4OGKA 3SVZA 1QLJA 3D64A 3TG8A 4BV8A 1M0TA 1M6YA 1KJQA 1JYEA 3D3NA 3HV0A 4YP0A 4LF4B 2EJVA 1OJ7A 4MAFA 2W2OA 2B99A 2QPTA 3OAAD 4KO2S 1D1SA 5L4SA 2B98A 5AJUA 2Q1SA 1TM3E 2AD1A 4LBYA 5ALGA 5F2OA 4M9SA 1VSVA 1JIQA 1MA0A 3RDPA 5FWYB 2QD1A 3NM6B 2J8ZA 1ZX1A 2VP9A 2EX4A 1U5BA 3COPA 4Z0NA 3J80A 1JXQA 3AETB 4MMXB 4NCXA 1KS2A 1B76A 1SN7A 4TTJA 5BUQA 4W5OA 4JLWA 3I12A 3VHLB 4J2HA 1SH7A 2DBVO 1YGYA 3QX9A 4GPEA 4FYXA 4V0SA 1V9SA 2XQJA 4D0NA 1QU3A 2BGTA 2IPOA 4HB0A 2R84A 4FZ5A 4W1SA 5DTQA 3IMGA 1QP4A 1ZZGA 5B1HA 1Z07A 2B0JA 1O89A 2DFLA 4GMKA 3UMFA 4I50B 5JAPA 1GFIA 1EUDB 4L4RA 1ZIDA 4XKJA 2VTEA 5EIHA 4BVEA 4D02A 4JHXA 1E0AA 1OAOA 2Z2YA 4W5HA 1VKJA 2JK1A 2MSLA 3P94A 4DYDA 1R00A 1JR2A 3EF3A 1Z7BA 2MCFA 1P2GA 1P17A 3FCYA 3L18A 3KR9A 3QKRA 3V8RA 1VJGA 3ROZA 3ROKA 4QGAA 3FZEA 2DM6A 4JC5A 4IDFA 5TJ9A 1C3OB 4U2BA 3UW3A 3RKUA 4BWYA 4F4IA 3RU7A 4YUZA 4HHEA 4II3A 4O29A 5K51A 4CIVA 4CTOA 4B5LA 4PYIA 5AM5A 1ES9A 1HNNA 1PZGA 2VUTA 1A9ZA 5HKLA 3SPXA 3V9AA 2ODPA 5K20A 1D2NA 1I5RA 4I6GA 3NV7A 1BFUA 1G55A 3W8RA 3X1KA 1Y98A 3OZCA 2PH7A 4AKEA 3H5NA 3IUNA 1H93A 2R8BA 2OUIA 2TSYB 4HFMA 1QH8A 2EFHB 2Z2XA 4JVLA 2F1KA 2WJAA 3GJZA 1U5BB 3MWGA 5EGSA 5LXTF 4R1QA 1BXGB 3GZJA 3GNQA 4D7AA 2NZ2A 4KX5A 3KWLA 1U8FO 4AY6A 1JQJC 2D6FA 2XA9A 3L05A 1WPQA 4WKPA 4W5RA 1NMEA 3WSWA 4B71A 2H9IA 2QT1A 4UU1A 1SUIA 1J42A 1A5SB 1ZJ5A 2FRDA 4D6YA 1ILWA 2Q3EA 3LUBA 4IJKA 3UB4A 4J29A 3OE4A 1V11B 3FIJA 4FB4A 4D41A 1KIMA 2W6IA 1IONA 4TWZA 3ETDA 1T0PA 2I22A 3T7CA 5JS1A 3L7BA 4GZ3A 4OHXA 4N3GA 4XLZA 4NBWA 3RIYA 3RAPR 2EYQA 2PS9A 4EQZA 1UDWA 3UHOA 3LOUA 3R9WA 1YI8A 2IYUA 3MN1A 1IM8A 2FFBA 5IVKA 1E0KA 6Q21A 4F4FA 3BRQA 1FVOA 4WXMA 4EQ6A 1UAAA 2GJSA 2WE7A 2UZ1A 3CF2A 2E37A 2CF5A 1OY1A 3IS3A 4CMEA 3EWSA 4IH4A 3D4IA 1TCUA 1I3KA 2B9EA 4DLVA 5EJ5A 4AN0A 3RQSA 4MAAA 3SDBA 1G6HA 1HMPA 2Q1TA 2ZUDA 3H5LA 4TLDA 1KQNA 4O3MA 5F7JA 3OPYA 5CAEB 5ICSA 1W0JD 4A92A 2AJTA 3B9BA 5GONF 1ZRSA 1AKTA 1BH2A 1XRRA 3GBVA 4JP3A 2XEDA 4WBNF 1M2FA 1OJLA 1D5CA 1Q7BA 2Y0EA 5IT9A 4J3FA 1JG3A 1IY1A 1GGJA 2XMZA 4QXAA 1FP4A 1FS4A 1RVDA 1U0RA 2GT1A 2H7CA 3GCGA 6GPBA 1CUWA 4EH1A 3LGXA 2QQGA 4FZRA 4CYMA 3GH1A 4LSGA 3LZ6A 3MUEA 5LU9A 5CH8A 1HA3A 4N3BA 3OG9A 4NV3A 3TE6A 3QBJA 3F0TA 1FL9A 3ZCTA 4BDTA 2AE2A 1U65A 1ZWKA 2XGMA 3E0QA 3CQ9A 4CQNA 2EERA 3A4LA 4UVHA 3WLAA 2MSKA 4ALIA 4YMGA 4GKJB 4WBXC 1YAHA 1YTLA 3N2LA 4L0MA 4M9ZA 1DQRA 4YS6A 3ST7A 1ZOOA 3TGLA 5FTNA 3LRTA 2B37A 1SAYA 1XDWA 3JVVA 3RS2A 4HNTA 4D4GA 1ISHA 2QIPA 3EX7C 2IU0A 4OMUA 5ERYA 4RXTA 2IYEA 4LJLA 3UOWA 4GT1A 5JD6A 1BH6A 5JR3A 2PA3A 4RORA 2I6TA 1LX6A 4EUEA 2JAPA 1ISFA 4PVDA 3GQBB 3EZXA 3QKWA 3GGDA 5KQSA 1L7OA 1V6CA 3BQNB 1ADBA 1O9GA 3K6RA 4EGFA 4PRLA 2FSFA 2CNKA 1IJKA 2OO5A 3N5CA 1FQJA 4J7UA 1QHEA 4IJQA 4K3VA 1XCMA 3C4JA 4MVYA 2D3WA 1B73A 1JVSA 1U6IA 2NO6A 1VE9A 3KALA 4M83A 4TKZA 2UV8A 5HF6A 4KPYA 3ENZA 3JSAA 4OJTA 2GZMA 4XE5A 4WEOA 2PL1A 2AG1A 3JARB 1I33A 4GRIA 1GDHA 1Q0LA 3DW3X 3UHPA 1Q77A 2FYTA 1M54A 1SUFA 2J5RA 3JQGA 3N8DA 4KDFA 2O3TA 3X2EA 1QVAA 1FA9A 4MVXA 3M6LA 1RLTA 3DO6A 3N2GB 3NP7A 1D8TA 4JQSA 4QFCA 5LP6B 5DMXA 1RZRD 1XI2A 3BCRA 5AJHA 1OT3A 1O94D 2WZQA 3PEFA 2P0YA 4NESA 5E6RA 1QO9A 1VI6A 3NBMA 5K3SA 3C6XA 4D9GA 1J4AA 2A7QA 2FX3A 4QAQA 4CKBB 2JGMA 3VPFA 2V55B 4G6ZA 4LIPD 4AJLA 2JKYA 1XZJA 2V97A 5J23A 2P0EA 4FFWA 5FPHA 3SFTA 2EKPA 1W96A 1MR3F 2IZ6A 3K16A 2O19A 1SXJA 4XTRA 4PAMA 4XYGA 4DSUA 1MFZA 4R3NA 1PTKA 1YGPA 4E5DA 1DXQA 5U9CA 1JIKA 3E3MA 4TYQA 1SBZA 4U6QA 4MYSA 1P75A 2VA9A 5GGYA 5EMJA 4BQRA 2ZTSA 4UFOA 5DK4A 3AQ4A 3KOYA 1HT0A 2XUKA 5F5NA 4A0QA 4H7PA 2REQA 1HXHA 5IABA 2IHUA 4OMDA 1DIOB 1ATZA 1Y6FA 3RUAA 3U62A 2A9QA 3LBAA 4KI0A 4LTDA 4PN3A 2V5UA 1KYQA 2PKQO 1KK0A 1D4FA 2EFCB 4UNRA 3EDOA 3MJ4A 3THWB 1SA0B 4KOEC 3T9FA 3GFPA 4AROA 1TK3A 2A58A 4XQCA 1KDVA 1M0SA 3T9AA 4AS3A 1OFUA 3T3DA 1L3IA 4FFDA 2H2HA 2VS1A 2ZUBA 3QWHA 4M38A 1KPHA 4LHEA 1K86A 2Y67A 2KW5A 2OP1A 4LRUA 4HDMB 5G1OA 3V55A 4TPKA 4CLXA 1G2PA 2PZGA 5DT2A 3OX4A 4RANA 5C35A 4GGPA 4MSUA 1TM1E 3UENA 2JFPA 1WV1A 4BBJA 4L5AA 2BVNA 3FHTA 3KAKA 2Z2IA 5I9BA 1NXVA 4Z7QB 5I9MA 3UOAB 4PX2A 3FYTA 2P6MA 2XODA 5P8WA 3E8SA 1KU0A 4GPAA 3EHDA 3CZ5A 2PUTA 1AJEA 3S1SA 5EE0A 2ILVA 3IAXA 1UBGA 1G1MA 2FEKA 1XZKA 5FNVB 3GPCA 1T10A 2D7JA 5G2OA 3VPSA 2D1TA 3BYZA 4R2IA 1WW8A 3WA7A 1NQ5A 5DM70 1Y8QA 2FFRA 2HJ9A 4FTWA 3A6KA 4L73A 1HT1E 4P4TA 4PFSA 5IM5A 3T0FA 1IJBA 1QE0A 5A5GA 1UJMA 3BTOA 3EVAA 3KTDA 3AR7A 4IOJA 3KYDA 4PZYA 5L6LB 2W22A 3KYIB 5LYYA 5BNZA 1J49A 4UBOA 2AE1A 3I6IA 4NKRA 4W9NC 1MJGM 2RGCA 2W2LA 4JX8A 4XQ9A 2OO3A 1KEEB 3R7NA 2FN8A 3W5AA 3I5MA 1PCXA 1TMOA 3LVFO 1MPTA 3IPRA 1JGTA 1X80A 1XDBA 5T5QA 3R3SA 4GX1A 1XZEA 1DELA 1JWAB 1KTIA 2G25A 2A0XA 4MUNA 5J4HA 1QZUA 1F9AA 1CHNA 1RT9A 3B6MA 4AZWA 4J7XA 2UYGA 1G5QA 4MV1A 3TQQA 1TMYA 3NHUA 2FQYA 3B2QA 2WJ3A 4PGMA 4F5ZA 2PLRA 1E4EB 5EKXA 4ZT2A 3WL7A 1PUIA 4V03A 4C7MA 1BMQA 3I83A 3UK2A 4JT9A 5EWJA 2GA8A 1RQLA 1BIFA 2PS1A 2ZBFA 1YC2A 4IXMA 3B48A 4Z86A 1UKBA 2Q3JA 4G1FA 3UYKA 2AR9A 1L4EA 1Z36A 2H5LA 4IMRA 2AOXA 2J07A 3SKXA 1E1YA 2YNMC 3I6QA 4HJXA 3E5MA 4B7ZA 2DFNA 3DG9A 3GOQA 2AFRA 2ZYAA 3DQPA 4JUAA 2QXTA 2WAOA 4RPHA 1WAMA 2A84A 2WKRA 2ZAIA 1LVGA 2NU7A 4UNNA 3RVRA 3SXPA 1U5AA 5TMEA 3DVRX 4KVZA 2QTVA 3C8ZA 2W6MA 1UUFA 2IX3A 5F2KA 1T9DA 2C42A 2JGEA 2Y4OA 2B35A 2J5BA 1MNQA 2X6RA 3LI2A 4JCCA 5KVQA 1EP2B 1ENPA 2BCEA 5TPWA 4CLRA 5HW0A 4B3SB 1O7JA 3A2MA 2XOKA 2X15A 4RH1A 5LP6A 1PNRA 5FIUA 3IE0A 3U9TA 3Q7SA 4BKUA 3E8MA 2PR2A 3NAZA 3OFSA 4UEKA 2OQRA 4ZMSA 1W36B 2ATXA 5A4FS 2ZJ2A 1W0CA 4JT2A 4R40A 1I0LA 1US8B 4C0HA 4DCMA 1KK2A 1BXKA 4BZWA 1J56A 2W8BB 1R4ZA 1WVMA 2CCJA 3ZD7A 4WFIA 4FYHA 3GT0A 3ZVMA 3FDXA 2P27A 1A27A 1MJHA 1YDFA 4JNCA 5SYAA 4C08A 5CM9C 5H3HA 4LFCB 3E5HA 2PYDA 3NDJA 2FEWB 2CYBA 3SIWA 4G4SO 3PLNA 1TCVA 1P8AA 1YB5A 2QSZA 3ABQB 1W0KA 3AKCA 3KKPA 4P6VF 5IYZF 4B75A 4ES6A 3I9JA 4F7DA 1QHIA 4QQRA 2YV3A 2JLBA 2O0MA 4M1TA 1D0IA 4MZXA 1WE2A 4ZALA 5AJZA 1BAPA 4BEJA 3QK7A 4EMTA 1A72A 2YVUA 4XDYA 4DBZA 2UVPA 4XARA 4D4KA 1I01A 3DB2A 5ENDA 1EGHA 1R4NA 3ZJTA 5HQ3B 1M2KA 2OILA 3DOOA 3LF2A 5THXA 3MJEA 2NYVA 4CCYB 1C3EA 1YRYE 7GPBA 2NU6A 2J0UA 3O3MB 4FNGA 1A5AB 2VYCA 3OE1A 4QLAA 2YASA 3EW9A 3GP3A 1DAFA 3W5CA 5LMNB 3TKAA 1N8NA 3NHFA 4MINA 1Y0BA 3C43A 3GFRA 4B8WA 5JECA 5DM2A 3JQ8B 2J3KA 4WLNA 1I4DD 4M0UA 1XEWY 3C3WA 3QV2A 4F93B 5KBYA 3T3GA 3AYZB 3TLEA 4GNKA 1PVDA 5K2MA 4RVDA 4F1KA 3U4AA 2ATEA 5K05A 621PA 3Q10A 4OO3A 3UCFA 3B13B 2WWVD 4DDTA 5AW0A 2FUEA 2VDVE 3DONA 1WA5A 1X1BA 4MS4B 1RE0A 1YDWA 3MG9A 3QHQA 5PNTA 4YO8A 3ADKA 1RKXA 2PMBA 1O6GA 1ONOA 4FI3C 2IYVA 1ZZEA 5ECGC 3OHPA 3H0EA 1JPNA 4QLBA 3LWDA 3QEOA 5KYXB 3TD9A 3H4MA 2QF7A 4X63A 2X42A 2ADOA 5LCXA 1UZLA 2BLNA 3LH5A 1T6XA 2Q0XA 3UG6A 5F52A 1MO6A 1DG3A 3IJPA 4RTJA 5TNXA 5D7NA 4CMIA 1WCYA 4FLEA 1V7CA 1D2CA 1HPLA 3AM4A 2RGRA 1XEXB 1ZK1A 3L92A 3Q41A 4JR2A 4KYUA 5KKCA 2ESRA 1H8ED 4BX9A 1FLVA 4PLCA 2Q3DA 3TF5A 4CQJA 4RDXA 2YHIB 2AXQA 2AZ4A 2Q07A 1BJRE 4V2IA 1P1HA 4Y9SA 4A0RA 1P31A 1PFUA 1U2GC 2DCUA 4NEHB 5A6SB 3RF6A 2PUGA 1K6JA 4ODIA 2VTBB 4FZ3A 1N78A 4F1WA 1VCIA 2VBCA 1HBJA 2XA2A 3EIHA 2C77A 4X5OA 3CINA 3E53A 4QSHA 4I1PA 2FMTA 1KJWA 1N9GA 4KWCA 4YGXB 5H1YA 3B7GA 3RVDA 3W4KA 3U7HB 4BVFA 3HFRA 3A32A 4KDCA 4XRGA 3OD1A 5DFAA 1GPKA 1QGYA 1QLHA 2G4VA 2PLNA 4YTEA 3L6BA 4LISA 5A5EA 4BAZA 1LRLA 2QSYA 2JIZD 2VI5A 2VTVA 2ECOA 2HWUA 4K9QA 4NP6A 5G0SA 4J16C 1N7GA 1IZ7A 1ZRHA 2AI3A 3QF7A 2HV9A 2G6TA 1I7PA 2E89A 1JKJB 4XSHA 1GR1A 1L4YA 1W85A 2VDJA 2PBRA 5CDSA 2WF9A 4CMAA 4M1QA 4BMDA 3Q3VA 4QYIB 5BQFA 2VK1A 2LWIA 3QW2A 4EZEA 4BEBA 2G0TA 1W59A 3DMPA 3E22B 5HBRA 2OAQ1 5IM4A 2HMWA 2BDUA 3WB2A 1RNLA 4N54A 1RM3A 1EJ2A 3JV7A 4UOZA 5K7SA 3K2QA 3UWMA 1YKFA 1SD2A 3FMFA 4FE4A 2WWIA 1YKGA 2O4CA 4UBMA 5G02A 1EVYA 3KXLA 3K30A 4FU0A 1HDIA 2G9NA 3TAUA 4C88A 3VR1A 5J4KA 3OZDA 2CXSA 5CEJA 3F78A 4BNLA 3KB2A 4J4HA 3EPLA 5DRYA 2AFHE 2QLLA 4FYWA 3NHJA 4OJQA 4DIOA 3AO0B 4MQ4A 1DU4A 2BFCB 3BVPA 1QVWA 1R2QA 3QKUA 3LA8A 2YCBA 3AK4A 1N0IA 2FFQA 1WLSA 1LLUA 2PKEA 3UA4A 4ZPXA 3TRHA 4X6YA 4FXPA 4M0LA 2GLTA 4FN4A 1XZPA 2Q2NA 1DHTA 4JI7B 3PQ7A 4FCCA 5K6TA 1G0OA 1T25A 4P4LA 3WNCA 4IVQA 1NLYA 3LUCA 5EXDA 4FBMA 1EFRA 1QV7A 4O5OA 4HNSA 2D0PB 4KPEC 1JECA 3LO8A 5FAKA 2HJSA 2QL6A 2XCRB 2BV3A 1F17A 1X1RA 2YINC 5AUNB 3NOXA 4KQ2A 4AKHA 3FHJA 5EIEA 1HDRA 1CD5A 2R4QA 2R87A 1UJBA 2ZCVA 3K9WA 4FIZA 5E4TA 5EE1A 2F59A 5B1IA 2W90A 3TZHA 1QYXA 3WLMA 1J1UA 1ZUNB 3CZAA 1XRQA 2CXPA 1A77A 1VRCA 1ZRMA 3TVTA 1UDXA 1CDOA 1TAGA 4O63O 5AI4A 1FTWA 5PGMA 1JDNA 2D00A 1YR3A 1ULBA 1RRCA 2JIRA 1E20A 3LTNC 3R6WA 5EP3A 2IYRA 3UUFA 9LDBA 1XF1A 1SQ6A 3G49A 3MB8A 3W6UA 4AJKA 3WGQA 3PJEA 1MENA 1MJFA 2Q0HA 1X7DA 4OI2A 1YZ3A 2EX0A 4I46A 3V48A 1IL0A 1U7DA 4TYNA 2QGZA 4H0CA 2GUGA 3AVXA 1USGA 3U81A 2EC5A 1T0UA 4GC9A 1D03A 2IE0A 4DADA 3H2IA 3RS3A 3Q7PA 2NZWA 2PV0A 4DWJA 3EUEA 2H0QA 5JS7A 3NT5A 4C7KA 3DJFA 2JGNA 5JASA 5JAHA 3KJGA 1GNTA 1RKQA 1FDRA 1NBAA 2ABWA 1GAQA 2JB9A 3BSWA 1FFAA 2X58A 4LMAA 1ZL0A 1KWKA 4R1NA 2O2JA 4DCJA 4TVSA 2YS7A 4QUBA 4D5GA 4EHFA 2R7AA 3R7SA 3MJHA 4TV8B 1EE1A 3EVGA 1VL2A 1L4NA 2EL9A 2FZGA 1IZ9A 1DXHA 4IVRA 5A5VA 1Y6ZA 2OZKA 4G26A 3MBIA 1GQRA 4JZYA 1ECFA 3VZRA 3F2IA 1AKRA 3NM5A 5C2JB 2QN9A 5CCDA 4YQEA 3I8XA 4A6EA 2B30A 4B44A 3CRVA 1U8AA 2PZ8A 2DTEA 2CJPA 1RCTE 1S7GA 3PYXA 1FNDA 4R8SA 4WKBA 1PR6A 3PQ3A 1WULS 5BNTA 4LC1A 1Y33E 3NAMA 4GXNA 3G0IA 4FQ5A 3EAFA 2J5XA 4BMXA 1NBIA 4XVUA 4AX4A 3A6FA 2AMLA 5HX7A 5HK8A 3DQZA 4TKVA 5TF0A 1HE5A 3IDAA 4I5DA 4L0DA 1XPOA 2J3JA 1V8OA 4N3CA 4JXXA 1YIAA 2PVPA 2NG1A 3FCXA 4Z9XA 5KQLA 1NF2A 4JOBA 3ZW9A 2FRXA 4LXXA 4W5WA 2QRJA 5KWSA 4LFAB 4HDQB 4UEWA 3R0QA 4RK1A 2XBMA 1XQYA 3UGTA 1G2IA 4HDAA 2QX8A 5JG7A 1M1UA 4BO7A 2ZQZA 2E4YA 4JUCA 5AVUA 1GKKA 5ANRB 4Z3DA 4HZGA 3A31A 3ZGLA 3AM5A 3GNTA 2OPBA 2J9ZB 3NQ41 4ZTBA 5F9MA 4LZPA 2EQ5A 3QVVA 3KT0A 5KOHA 5ECWA 5LA6B 4RMJA 1POWA 2OOKA 1OT5A 1DJPA 2CHFA 2N1MA 2QTBA 4PBTA 3K70B 3VR3A 3CRQA 1U1IA 3A7DA 3RVSA 4IRXA 4CI9A 1F12A 1P44A 1WDTA 3HP1A 4JASB 4B8ZA 4J9VA 4U3JB 2B1JA 4MV3A 4JP2A 4KN9S 1T6ZA 4YMWA 4BRZA 4BIMA 2RE8A 1IQRA 3FSEA 1HUQA 3K05A 1HNXB 4NECA 1LX7A 4EVIA 3Q12A 1PW7A 3KYCB 4I36A 1FRVA 3B85A 4O4IB 1JMKC 2I54A 1OAOC 3UJDA 3LHSA 2A9OA 5CB8A 3SC2B 3ZXXA 3T1YB 3R2JA 3PXXA 4R98A 2QL7A 3R9IA 2EX1A 2RGAA 5DNWA 2ZJ0A 5D86A 1G3IA 3BE4A 5CB4A 4QG3A 3QLUA 1PVOA 3VR5D 1DTEA 3F5DA 3I5YA 3DLBA 3SSNA 1Z2PX 1ZHHA 1U0GA 2GZDA 5A3SA 1RKUA 3ZYZA 4EA7A 3ND5A 3HVJA 3ASYA 3G88A 4IDCA 1GL6A 3GDFA 4UKDA 3SFVA 5BOSA 1FLDA 1YOVB 1IULA 1QG6A 1KHTA 1G6OA 2WJYA 4HUTA 1X70A 3QXCA 5BUZA 2VRBA 5I7HA 2IH5A 4MGIR 1X77A 2P11A 2VT3A 2SKEA 2UZ4A 3RS4A 3MUNA 2GN6A 4GKAA 2A6PA 3VMMA 1I2BA 3CB2A 4ARIA 4HZIA 4A2QA 3T1HB 3SS8A 1T9BA 2B1QA 1CIPA 3OMWA 1TQ4A 3MT0A 4NAUA 3DGEC 4QJIA 3U49A 4RD0A 3HXMA 3DTVD 1NV9A 4ZOLB 5HRCA 3UB3A 1JJIA 1UC8A 3L0OA 4C6TA 3MUFA 3VHXA 2F8LA 4AJEA 1P5ZB 4UM5A 4URZR 1H65A 2UZIR 3GN2A 5ICEA 3I4FA 1BDMA 4D2IA 1DIBA 4Z53A 4JP5A 4I6EA 3HB1A 2EBHX 2JD1A 3QHAA 1EJ0A 3I4LA 4YP1A 3L7OA 4YDHB 4BNNA 4TQUS 3DKRA 1OASA 4HMQA 1JAIA 4K9LA 1ZD4A 4O59O 1OX4A 4R7TA 3WQSB 9LDTA 1MB4A 4I5EA 3WYAA 2X5KO 3ZEAA 3FPJA 1E5QA 3F5QA 1IUNA 4UTZA 4LEIA 1VLHA 1RJ9B 1G8PA 3BEDA 3O6VA 2ON6A 4JS0A 2GN2A 4WZAE 1NVDA 1AT1A 3FYHA 2EBUA 3MNFA 4UEJA 1TYDE 1ST3A 2NAFA 4XJSA 3OLZA 4J0IA 4ZIRB 2OHJA 4N65A 5F9HA 3MRSA 2WG0A 2O50A 2H5JA 3LCCA 1AGYA 1EDEA 2VDOB 1Z3CA 1G4UR 1N4DA 2XNDD 1E2MA 2QVZX 3CUVA 3HR7A 4KGXA 4PLHA 2GM4A 5SY6A 1MD9A 2JGFA 1JALA 2JIPA 2Z4RA 4XIGS 2IHTA 4RZSA 3WGOA 4AZSA 1Q1EA 5C7IO 2ZB3A 3AY6A 4O8ZA 4LN1A 1LLCA 1DPGA 5JC8A 1O95D 1ZMBA 2N9UA 2GDJA 2QTCA 5BRJA 3V7FA 4F56A 5L95A 5EZSA 3EGWA 1RWVA 1BROA 4ZO9A 1N7IA 1GZSA 2PWYA 3E9MA 4QHSA 1T3ZA 3WRXC 4EUKA 3FPCA 3GEEA 2ILTA 1V3VA 3GJ5A 1GLGA 4RFLA 4O6VA 1TT5A 2HNAA 4YMLA 5A1TA 1H23A 2RBEA 4J4BA 5CW1A 5K3CA 3SK0A 2QVYX 1VP3A 2V4UA 2VHZA 1Q3HA 2WU0A 3GAMA 1N2XA 3KOUA 3PNMA 5AOCA 4EENA 1GDDA 5LQCA 1FYEA 1I32A 4W8HA 1FQKA 5IT0A 1WBDA 1VFNA 4ZU3A 1KMIY 1L8LA 1JFLA 3DZKA 1HQYE 4OXNA 3GRKA 2O20A 2HDHA 1APBA 3K4HA 4LC0A 3IHLA 4ZEWA 2JCXA 1XX6A 1ZYUA 2AR7A 4DLUA 1U0NA 1JT2A 8ATCA 1M2VA 3CKKA 3OSUA 1QE5A 3OLCX 3SZOA 3NC0C 5LL6P 1DVRA 5G41A 1WVIA 4X1YA 3EASA 1PK7A 3PC2A 3R3ZA 1P4HA 4A6PA 4LK3A 1H8HD 5ALUA 3ZTTA 2FKAA 3GPIA 2XCOA 1WQ1R 2C2MA 1BEEA 2Y8EA 3DE4X 1V16B 1QG0A 4CKBA 1YQXA 3OBIA 1JA9A 4QGSA 1I3CA 1VBFA 2OHGA 3H3XA 3PDCA 4J1TC 1QV6A 3PR2B 1F48A 4KGVA 3UMSA 3ZHVA 1AQLA 4BRUA 1O94C 1J0XO 1GNSA 1NTRA 2GS9A 2B25A 1QDEA 1T8WA 2Q4BA 3ABRB 1H1TA 1R9JA 4ICIA 2I67A 2RGDA 3NP9A 3MCAA 4R83A 3WNZA 4UARA 1MHPA 2QW0X 4D79A 4ND3A 3GEDA 3VAAA 2FCAA 7ADHA 4XPIB 1Z4OA 3PC6A 2BH9A 1ZIYA 2I71A 3NHPA 3N8IA 2F43B 1LFDB 5BWLA 2G9ZA 4FT4A 4AJ2A 4Q7JB 3IIKA 1WD5A 1W5BA 4GPIB 2XYGA 4BO1A 2F90A 2PZMA 3AHDA 4L75A 2D1SA 2BEUA 2EP5A 2OV2A 2QTLA 3NIWA 4P2GA 5ALDA 5L3QB 1JU9A 1SK9A 2BFBB 2JRCA 2WWTA 1QK5A 4Y2GA 1TZ2A 1OXSC 3NPMA 3O4IA 5C1DA 4K9OA 5J1SB 2IQIA 2YWJA 2VDKB 3UT0A 3IKTA 2OKCA 4RO0A 1EFVA 1SQFA 4RTKA 2NO1A 1TRKA 2FR8A 2JFHA 3IUPA 5JFGA 1Q92A 3AL2A 1S0UA 5J5CA 5CDFA 5JLJA 3ROEA 3D6AA 2I78A 3RTGA 5LJLA 4IILA 2HR1A 1NYRA 2D2IA 4HDRA 4OQNA 3VVBA 3VSAA 1KMHB 4HFNA 4DM7A 2Y0CA 4RZHA 3QUTA 4FNOA 2GEDA 1I3NA 4NBNA 1DOAA 3G79A 1HDZA 4Q3BA 4WGGA 1E1CB 1JHPA 3N59A 4JJKA 3OJLA 1NNEA 1KAEA 1TF5A 2A78A 1YHYA 1O97D 1YMVA 2QV0A 3G82C 2BISA 4AFNA 2P9JA 3BKWA 3BRWD 1OBCA 1AKUA 1OV4A 2CLKB 1OYYA 4JB8A 4DB4A 3H42B 1RWKA 4QG7A 2I4MA 4MW1A 4FB5A 2VJLA 4U9HS 4M86A 5CNMA 5DBEX 5BSUA 5FX2A 2J3IA 2ZUCA 1TO1E 2GNOA 5AKYA 3ZHQA 4BU1A 5K4HA 4NXMB 5CIQA 4I14A 2BPOA 3KOMA 3GLFB 2UU9B 1N2ZA 2XXAB 1Q0PA 2A9PA 1DKUA 1OX5A 2C96A 2EGGA 3H1TA 4EG6A 1Z0SA 1GPMA 4RYDA 2ZYGA 4UJ5A 3LX5A 2R8RA 1D7OA 2I7TA 2O3JA 2VPXA 4MIOA 1IQ0A 2VJPA 4TWAA 2BFBA 5JALA 2QUKA 6PFKA 2M98A 1D9XA 3ZDAA 4HPJB 5K0JA 5DIFA 2Y76A 3QEBZ 1KRWA 2ZXEA 1ZISA 1ZH8A 1Q1GA 3EDCA 1P1IA 3K0AA 3NTVA 2VZ0A 1BN6A 2PKWA 3P9QA 5CA1A 3INGA 2J3DA 4AF8A 2H1OA 3KHKA 1H6CA 5K45A 1ZM9A 5KCMA 2VNJA 1Y9EA 2BTQB 2OMEA 1MBZA 2PCJA 3T15A 1JEYB 2A88A 3AC0A 3MT9A 3AUSA 3FNBA 1M6VA 3H13A 3UICA 2C8LA 1S5PA 4TRJA 1N3BA 1C1HA 1LF0A 3T99A 4C1NA 4D80A 3MM4A 4GLFA 2PNFA 4HNAB 2A1TR 1DQYA 4KAXA 2B8TA 3EXFA 5HIAA 4LJYA 1JKJA 2HL6A 4JP1A 4MKZA 4XFJA 3H5AA 5BQPA 1XELA 1ZL2A 1GNQA 4Y1EA 1T5IA 3NHYA 3KXKA 3LE8A 1P0CA 4RSRA 5AVJA 5T4FA 1KWGA 2CDBA 5AM2A 1U8YA 2IPMA 3PEUA 3KUDA 4N5MA 1UDAA 4UCWA 4WZZA 4BRWA 3VFDA 1T3HA 2E6KA 1AXRA 1WZUA 4TLCA 1ML3A 2I3GA 3DEFA 4MXDA 4E2XA 2G04A 3IURA 2KWIA 2H08A 4XFDA 3FUTA 4QGBA 3QNMA 1Z2DA 1YVUA 3KQLA 1WSBA 2Q8QA 3VOAA 1U0SY 3QYAA 2PIAA 2JFYA 3OPQA 3QJ5A 2QGNA 3AVYA 4BE9A 3IQWA 4GXTA 4Y2TA 5AJYA 5EP2A 2WF5A 3K15A 3O1HB 2GCEA 2C07A 4P5PA 1M8GA 4QQKA 2AF3C 3R5FA 3GRVA 2Q8NA 2CYCA 1M8FA 2QRPA 2W2LD 1GO2A 4JA2A 4KQJA 3H5VA 1EK2A 5GAJA 1Y7IA 2K4MA 2Q9BA 1I2DA 3SIXA 3QKSB 3T0IA 1PDVA 3PZBA 3PC7A 3RARA 1H1DA 2H5EA 3CZMA 1HORA 3QPUA 1C9JA 1W19A 4DMFA 1YR7A 4RWZA 3PNYA 1NATA 3FBGA 3PNLA 4OP3A 5H3LA 1XN1A 4HWRA 3T06B 3EXEB 3N28A 1E61A 1XYGA 4L1KA 2SKCA 3GAZA 2WHPA 5TQ2A 3RKRA 3M1LA 1H5UA 1NXPA 1YBMA 2XOKD 4G4IA 5FUBA 1P3Y1 3NHZA 1FX0B 1VFPA 2AMYA 2MMCA 1RYNA 2AUTA 2OESA 3L4BC 3L6DA 3DAYA 3DLAA 5KCZA 4KC0A 4Q4AB 3IVXA 4GF5A 4WRRA 5JYCA 2TMKA 3CLRC 3WRVA 2V1UA 3C5WP 5BWNA 4J94A 1E6KA 3R0ZA 2XAUA 1OB2A 1S3GA 5BV7A 3PUHA 2I2CA 3LHFA 4OJKA 5HQTA 1D1QA 1UZMA 3KKOA 4CF4A 3E7XA 2FPXA 1N2SA 1YHZA 3G2PA 3HJUA 3LWZA 2REBA 4K6HA 3V1YA 5JNSA 4J76A 2B61A 2ENUA 4V0NA 4BQFA 1PFYA 1FS6A 4KQ1A 3GCWA 4E33A 1I9GA 2H2GA 3EQ6A 3ZWXA 2PMFA 1NZDA 3BZBA 1TUBB 3TMYA 1BEZA 1YR6A 1JR3A 5HRAA 1RU3A 3OFNA 4R68A 2E4VA 2POQX 5NULA 2OYRA 3B6EA 3FTCA 1QQAA 1FUIA 1LC0A 4Y2RA 1JS1X 1C81A 2JHCA 3DEIA 3O8BA 1H0HA 2Z4TA 2I76A 1ISMA 4PSAA 4BO8A 1PKXA 1GTSA 3VYUB 3EZFA 3WS7A 1KO1A 5B64A 3HWSA 3ZBPA 4OJNA 1A1VA 5JJIA 3OU7A 1Z4KA 2H2AA 1E5VA 5KX5A 4OP1A 1Z47A 4BIIA 5DHSA 3QTTA 2QU8A 2XD4A 4K2HA 2O0KA 3PJRA 3F96A 2DT8A 2BBWA 1T4CA 2VF4X 3RW9A 3WGKA 4NU5A 4X97A 1UPAA 5KYUA 3ANLA 5BUSA 3EC2A 3GRUA 3IAHA 2RH9B 1PZNA 4NU6A 2PMCA 4DTIA 1JZTA 1TKBA 4ENQA 1LA2A 3L5OA 1NTOA 5G1NA 3FDJA 2KMLA 5JFOA 3R41A 2AEEA 2QR2A 3EIFA 1DL5A 2J3HA 3FFTA 1A8HA 3QHPA 3WMGA 2QRKA 2YMMA 1FW6A 3MELA 1W5SA 1DAKA 4LXGA 4ZAFA 2AYZA 3OWOA 4H60A 2A0UA 1L5HA 5GY7A 2YL2A 5BYAA 5HUQA 1AA6A 5SICE 4BFTA 1N5KA 2XXJA 2GXUA 4TL6A 3ZVLA 2VATA 3DZFA 3H2BA 4G89A 3S2EA 3N86A 3DL7A 4PGAA 5EHNA 3BBLA 1HE2A 3Q0IA 2GHTA 3GIDA 4IOMA 5GJWC 2Z57A 1EGMB 1ST2A 2DFVA 5DSXA 4AZ0B 2BHTA 1EAMA 5FPKA 3QG1A 3PNSA 3CO5A 2D13A 4Q3OA 4GDMA 3WMFA 3TBFA 5BYJA 4BU0A 5FP0A 3WFZA 2OECA 1F5SA 3HKDA 3TJMA 3L7YA 3ZCRA 4BFXA 2X14A 2MU1A 5FPTA 3KCQA 2QE7D 1N1EA 4LRWA 4Q9HA 4EB0A 2J08A 4RLHA 3WWPA 1UOQA 1QYDA 1T3SA 3BWDD 4LYHA 4KK3A 1KYIA 2IXDA 5EE3A 1HYBA 4EVRA 1JDUA 2AMVA 4DLAA 4GQBA 2HT6A 2XV1A 2MINB 2FFAA 3OP4A 3E27A 3ED1A 4FINA 2J0SA 3M2TA 4JZKA 1E96A 2PX0A 4RGVA 4TRRA 5LPNA 2OZLB 3MMXA 4B5KA 2VHQA 1VC2A 2D74A 4P36A 4R01A 3WWYA 1MABA 4A2PA 4L4ZA 3H9GA 4QOEA 1RACA 5EJ9A 3BHMA 4R8LA 1NFRA 3CF4A 4MYDA 1M75A 3HUFA 5D3MB 3OO0A 3SY8A 4XR4A 1F20A 3JPWA 1M0WA 3MS2A 5FF9A 5I7OA 5L51A 2P3SA 1U1FA 1CDDA 4UBIA 5TDHA 5DYTA 4ZFNA 4ZCMA 1ZJZA 3GO4A 2QT0A 4P92A 5AKIA 3V4PB 4OGGA 5F1OA 1C8KA 1RC8A 2XUZA 4NHEA 2YR0A 1NIJA 1Z5ZA 2HPVA 2OBLA 3BRWA 3QPVA 4FGSA 5JWOA 2I4RA 1F51E 4ZCTA 4IBOA 3G3EA 4G5QA 4KLAA 4NQRA 4NCBA 3VH1A 2WAYA 2J48A 3K8ZA 2YWXA 1CIVA 5DBFA 4GZLA 1T1IA 1Y4AE 4S1PA 4CR8A 2O5CA 8GPBA 3C98A 5EJ2A 1TUBA 2CZGA 4YI3A 1Z17A 2NW6A 3HB5X 1YK1A 4HGPA 4BNHA 4LY6A 5H8WA 3ME5A 2PNJA 5HG0A 4X7BA 3CCFA 5HE9A 3WXBA 1B2RA 2PEYA 1T2CA 3URMA 1JFFB 4EY5A 2RK4A 4OJYA 3V1MA 1WUKS 2WIKA 3NIFB 2A92A 5JTTA 1T5OA 4UNSA 4NNPA 4XGKA 4YJ2A 2PT5A 1Q7CA 3TI9A 3DLPX 2HPAA 5I7AA 4O2BA 4DB2A 4EDHA 5KJFA 1MO3A 2VPTA 4RHEA 4G5XA 4IDDA 2AG8A 1AGXA 1QK4A 3EZNA 3QMVA 4Q37A 5DCWA 5HFJA 5HM8A 4D3SA 4KFUA 1Z6PA 4IIFA 4HLDA 2HOQA 4MV5A 1T3GA 3ZZ0A 1TL7C 1E1RA 2D8AA 5IK2A 2JVJA 5ALWA 1DBVO 1YONA 2HI0A 2HLDA 2ZAOA 4Q9NA 1UEJA 3UJ6A 4I4TA 5K3BA 3F6SA 3UCEA 3KETA 5K5EA 1MT0A 1VMKA 5EJ8A 4BB9A 3TNYA 5JXGA 4RHUA 3U3KA 2CLSA 4WLUA 4ETNA 2VUUA 4BC1A 4CL3A 4JJFA 2WY2D 2EWVA 2V59A 4XQGA 3NUGA 2GD6A 4Y6SA 2X0NA 3JD1A 1DNPA 10MHA 4CCAA 1Y1LA 1OI7A 1NC3A 3IEKA 2BFEA 2CB0A 2HWYA 1U9IA 1E69A 1QIKA 1RVV1 2ACWA 4S35A 2AL7A 2OD9A 3NLLA 4J16A 4L8GA 4NIMA 4PC2A 5FBKA 4DA9A 3HJGA 2XT9A 4MDHA 2WKPA 1YR1A 2RHBA 3NVAA 3VVCA 4ZT4A 3G6WA 5IBRA 3ZE1B 4O4JF 4YAJA 4FGZA 3AJAA 5LFAA 1KSGA 2GPAA 1NXWA 2ZTHA 3MFYA 1LW7A 3O8RA 1QYRA 3O1LA 2QTTA 3GA0A 1YIDA 4N7JA 2GJ8A 5CXQA 4CT0A 3IVGA 4UTOA 3OZTA 3MJSA 1J8DA 3ZBTA 3OHMA 2RGUA 4KQKA 1XE3A 1XVTA 3OZSA 4TN1A 4FSDA 1NP7A 1XMOB 1SHLA 3TRIA 2DPLA 3LDUA 1XZBA 1LI4A 4IJMA 1Y4DE 3HYTA 1NXTA 4HRVA 3V80A 1QTQA 5JYDA 3KWJA 2JJMA 4P84A 5FO0A 2QI9F 4JK3A 2BTQA 2RHWA 1FB5A 3UJBA 2LVBA 1YB7A 2RIPA 4RTLA 5LQNA 2YYAA 5I8ZA 2G6BA 1MVLA 2E9SA 2P1DA 1CJBA 3HJNA 3BOSA 3UG7A 5EZYA 1DCFA 1MXHA 2EJTA 4HB3A 5ALJA 1EUDA 2VEOA 1ZW6A 3RUIA 4Q9IA 1II0A 2P2LA 1G5HA 4JI3B 5K0FA 3LSTA 3VAYA 4C0AC 4CEIB 4KIGA 5JRZA 2I2DA 1N5RA 2QL5A 3OIGA 4BGUA 2MR6A 4YIKA 3ZHUA 4QEZA 3GA7A 5EQDA 4ZWNA 4PX3A 5K8JB 4M8KA 1XJWA 3U7RA 3DSRA 4PR0A 5AICA 4UE6A 1LXCA 1M10A 2MT9A 2DJIA 2ZJ1A 4UMEA 3R5SA 4KSCA 4BN5A 5DLDA 5B36A