2ZQZA

R-state structure of allosteric l-lactate dehydrogenase from lactobacillus casei
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
312
structure length
307
Chain Sequence
b'DKDHQKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAPTRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
molecule tags Oxidoreductase
source organism Lactobacillus casei
publication title Active and inactive state structures of unliganded Lactobacillus casei allosteric L-lactate dehydrogenase.
pubmed doi rcsb
total genus 113
structure length 307
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zqzA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2zqzA02
3IC5A 5IDQA 4WOKA 5KJEA 1R4MB 5ILGA 2ZTMA 5JCXA 5TGDA 3EW7A 1LTHR 4UUPA 3C3XA 1HSOA 2Y93A 5LCXA 1MLDA 3ZWWA 1P33A 2V6BA 1ISJA 1R37A 4F45A 3JYNA 1LC0A 3UCEA 1N7GA 2EHDA 4XKJA 1SEPA 3I23A 2WE8A 3WDSA 1U1IA 4Z3DA 2UUOA 1B26A 3PEFA 2NM0A 2VTDA 4R01A 1EFKA 4E2YA 2AEMA 2Q1WA 4NBRA 4PGFA 3MJSA 3PWZA 3PJEA 2ZYGA 4GGOA 3WLFA 2NU9A 4XZ3A 1ENPA 3KSZO 3MWDB 1P0FA 1HDCA 3L9XA 4CM8B 3FNGA 3HE3A 4F3YA 5EPOA 1GAEO 3LC7O 2XOXA 4GQAA 1VM6A 5C37A 2VUUA 3ZHYA 1GR0A 1DEHA 4Y8VA 3K30A 3Q1LA 5EJ2A 3EAGA 4AJKA 3RAJA 4W6ZA 1BWSA 2HAEA 2I6TA 4CM4A 3G17A 1JWBB 3JYOA 4Y98A 2RBEA 4PRKA 1ZBQA 3SVTA 2E49A 3DO5A 5CAEA 2A9FA 3PK0A 4IDFA 5JO9A 4O63O 1N7HA 4XEHA 5B4TA 1PJSA 1U7TA 1JKFA 1A7KA 1KS9A 1JAYA 1B3BA 2AQKA 1LEHA 4PLVA 4ND5A 1I2BA 1YRLA 5A1TA 5T8KC 1EQUA 3LF2A 5BNIA 1SNYA 3AI3A 1ZSVA 4J43A 4OH1A 3TOZA 1ZZEA 1T2CA 3P19A 4RVHA 5JYDA 4CM5A 3B70A 1PZHA 5G2OA 3HHPA 1WDMA 2FOIA 2HMUA 4YJFA 2X5OA 4L4XA 4E3ZA 2R00C 3DAPA 3FBTA 2B0JA 5JPIA 2AG8A 3VZQA 4IPTA 4GMGA 4B4VA 3KYBA 1JWAB 1UAGA 3BMQB 3VZPA 2I76A 4YEDA 1E6UA 4J16A 1WMAA 4AJJA 2ZTUA 5IN5A 3LT4A 4OSOA 4DC1A 1NNUA 3U4CA 4QFDA 2HSDA 4H15A 4FPXA 4CM1A 2AG5A 3GHYA 3ZWVA 4RDIA 4YQZA 5EL0A 3F6YA 4JQCA 2Y1DA 4ND3A 2X5KO 3DZIA 5HS4A 4A03A 4WASA 1UXHA 4ONEA 4XQGA 3RBXA 1MA0A 1PIWA 1EBFA 4LSWA 2YHIB 2YHUA 4YCAA 4N54A 1AN9A 4TZTA 3QWBA 1X7GA 4QECA 3PWKA 1OBFO 3G3EA 1BGVA 2HK7A 3RROA 3ZNPA 1AGNA 4NR0A 1I2CA 1M67A 2PKRA 4IQGA 1JQBA 3BTOA 2NSDA 5GMOA 1KEUA 2P5YA 2C7GA 1H6CA 1V3VA 4Q3CA 2FSSA 2IZZA 1NFRA 3KUXA 3E6AA 1HYEA 2UV8A 3H5NA 4U6SA 1K0UA 3ZWPA 5DOZA 2BLLA 1UZMA 3ETEA 3G1TA 1XSEA 4W7IA 2HKIA 1E1MA 1PGJA 2BGLA 5IXYA 1YXMA 2EW2A 3PTZA 1MXFA 1DLIA 3A9WA 1XHLA 1BVUA 2O2YA 2E48A 2Q50A 2J3KA 3DBVO 3NUGA 4Y6SA 5B4UA 1HT0A 4PG6A 4LK3A 1XEAA 1E6WA 3OHSX 1KEPA 3KV3O 4BO5A 1PQPA 1XELA 1UZNA 2Y0EA 4BVAA 3JQGA 1SBYA 4URFA 5KVQA 5I9NA 1S7CA 4L73A 4BQRA 3RIHA 4WOJA 2OUIA 2O7QA 3SC4A 4HNGA 3NT5A 4R69A 3ITKA 4DGSA 5A5FA 5CDSA 3JTMA 2YW9A 4QUKA 4OQZA 2C20A 3TL3A 4D0RA 4J1NA 5IN4A 3LT1A 4NBUA 5B1YA 3BAZA 2VHWA 5HS6A 5BQFA 4R1SA 5BSEA 3K5PA 1C1XB 4Z9FA 5K6AA 3IL2A 1H6AA 4NBWA 3UCXA 4R51A 3VOSA 4YA6A 1NAHA 1KVTA 3SBOA 5AXCA 3BMQA 2VZ0A 3E5MA 1EK6A 4KOAA 3ANMA 3JQBA 1WMBA 2XAAA 4DLAA 5BSGA 1UXGA 5H82A 2EEZA 3ABIA 3VPXA 2CY0A 2V6FA 4WLFA 3SLGA 4CM6A 1TT5A 1QYVA 2YFHA 3AUSA 3GA0A 3DWFA 3U9LA 4LRTB 5IDWA 3GPIA 2AQIA 3B1JA 1X13A 1HDRA 2I3AA 4FFMA 2VZ9A 3GEGA 4XGKA 3ZWXA 4XYLA 3WFJA 3FNFA 4D43A 2OOSA 3D3WB 3QWIA 4IXTA 2W2LD 1W73A 4GX5A 3T4XA 2G82A 3WWZA 3JD3A 3INGA 1YQDA 1ISHA 2X86A 2VZ8A 1U5CA 1YH3A 2UAGA 1I33A 4S3MA 2VYND 1G1AA 3WR5A 2Z1MA 1E1KA 2PK3A 2EKLA 4BOYA 3WIEA 2NV6A 3PDJA 3RJ5A 3NV9A 2ZJ1A 4J2OA 4L75A 3RC2A 1PR9A 5AXBA 2WWRA 4OOEA 3MTJA 4WJZA 4IQ0A 4M8SA 3EVNA 3I9KA 4PIVA 5C7OO 4BV9A 4W9NC 3C7DB 3MCVA 2X23A 3DBLB 3EK2A 2P68A 3P2OA 3D64A 2BRUA 3IQDB 1UZLA 1YKFA 4LRSB 1HF3A 2DKNA 4NNJA 5CDUA 3DZGA 2DT5A 3ZU2A 2E37A 1N2SA 3NT4A 5ENVA 2VT2A 3HJAA 3QIVA 3JYPA 4D45A 2Z1NA 5BSFA 1T1RA 1W8DA 2J5RA 2V6MA 4W9NA 3GAFA 4XYBA 3VAZA 5CDTA 4D42A 1WAMA 2AQHA 1K2WA 2DPHA 1Y8RB 1I8TA 2AMFA 4JBIA 4M55A 4OIMA 2ZB8A 1PJCA 3TFQA 4WE3A 5CDGA 2FMUA 4NJMA 1N92A 1GPDG 2I5PO 2OBYA 3E1KA 5KCZA 1E3EA 1RM3A 3ZNNA 1I0ZA 1ZEJA 1QG6A 2HK8A 3DBRB 3H5RA 3SEFA 4DMLA 5B4VA 1F14A 3VZSA 4WLVA 2GERA 3QWFA 3KTDA 3E9QA 1G6KA 5DT9A 2OFPA 4OKIA 4F6LA 4N7RA 5IZCA 2CNBA 4IIUA 3FCOA 3FHLA 2YZ7A 2AQ8A 3KLMX 3H65A 4M49A 3ZCXA 1ZK0A 2JHGA 3D5TA 1JW9B 4RORA 2JCXA 4U5QA 3ROQA 4GL4A 3D5QA 1LX6A 5COQA 1SMKA 5H81A 5K6AC 4B8WA 4FOOA 1A4UA 4GH5A 1HWYA 4LCJA 2AEJA 2B4TO 2CVOA 3GNSA 4BO1A 4BO4A 3FPLA 4IGFA 3CZMA 3K31A 1HYGA 1Q7BA 4XQ9A 4HY3A 2Y1GA 4O0LA 3WXBA 1W6UA 1ENOA 1I30A 2PH5A 4Z6KA 4CV3A 4O5OA 1GY8A 1GQ2A 1ONOA 2Y1CA 1QLHA 4JP2A 1JVSA 1A7AA 4R1UA 3LF1A 3PZRA 4ZU3A 2DTXA 1IL0A 2WE7A 4J4TA 1U8FO 5T57A 1PR3A 3RKRA 3ANLA 4NU6A 1HLPA 2GN8A 3S2FA 4EJ6A 5ICSA 3DOJA 4DQUA 5L95A 4N5NA 1M66A 2FR8A 3HB5X 3OMLA 5TRTA 4E0BA 4EGFA 1Y8QB 5CEFA 2ZB3A 2GPTA 4AVYA 4DREA 5I8ZA 4YPOA 2EV9A 2Y67A 2B4QA 4WPGA 3RFVA 3U0BA 4BQPA 5MDHA 3RD5A 4DXHA 1P1HA 2A4KA 5KKAA 4EBFA 1N5DA 1P1JA 4FN4A 1AHHA 1KY4A 1IUKA 4TRMA 4O59O 1Y9AA 4G65A 3WNVA 3HQ4O 4FS3A 5L3ZA 1MG0A 4AJEA 1ENYA 2D5AA 5AQ1A 3WTBA 1B3RA 4E30A 3DHEA 3NGLA 4MJLA 4WLUA 4JIGA 4AJPA 4DBZA 5JDCC 2HK9A 2QRLA 3L9WA 5F5LA 1RKXA 4A73A 1WNTA 2WSBA 3IKTA 2O4UX 3IIEA 4A5OA 3QRWA 4LW8A 1Q1NA 2PKQP 2HRBA 5JY6A 2VCYA 1W0CA 5DCYA 2AEFA 2ZIZA 4XGIA 2AA3A 3JQCA 4EYEA 2Y99A 3OECA 9LDTA 1BXZA 5JY1A 3AOGA 1M2WA 4BNMA 3LC2O 4CMCA 4Q3BA 1DB3A 1KC3A 3GVXA 2A35A 5EQFA 5AVOA 2PGLA 2JD1A 4LISA 4CV2A 3VPHA 4LMRA 1ZH8A 2GZ3A 1H9BA 4AG3A 7MDHA 2EG9A 5T64A 5DBGA 1WPQA 1YO6A 1YVEI 1I10A 1HE4A 1AHIA 3JQAB 1PSDA 4J9UE 4BNHA 1FDSA 3JD0A 3EHEA 4TQGA 4GBJA 1Y81A 3CPSA 2AE1A 1GUZA 4R16A 4E13A 1D4FA 4B4UA 3PPIA 1T1SA 4GSLA 3IUSA 4R41A 3RU9A 3PIIA 4LGVA 1LC3A 3ZH2A 2PZLA 3RASA 2O48X 4ZRMA 5F1OA 1LLDA 3JQAA 2FZEA 1ADBA 4IQ8A 1EVYA 4E21A 2ZQZA 4XJTA 4BNGA 2H1SA 4I8XA 1MX3A 4M89A 4CQLA 3AU8A 4I5GA 4CQMA 3Q2IA 3DBHB 4NFHA 4YT4A 5G0TA 2OP1A 3UFXA 2P9GA 5MGBA 1KEVA 1BDMA 4GAEA 3I6QA 2VHYA 4IJVA 2BD0A 5JDIA 1FDUA 2PZMA 3O9ZA 3ZN2A 5JMPA 1U8XX 1JA9A 3MZ0A 4WLNA 2IZ1A 1MC5A 1NTOA 5HRUA 2C82A 3FN4A 4J6FA 4IMRA 3Q0EA 5DNAA 4FJ0A 4B7XA 5JAQA 5JDIC 2VWGA 5C3MA 5IZCC 2XPCA 1YE3A 1K3TA 3JQ7A 5ENDA 5BSHA 4K1LA 3FPCA 3O03A 4KP7A 3PDUA 1P1KA 3PZBA 4LVCA 4DRYA 2NLOA 1C1DB 3WYEA 4CR7A 5TJHA 4EJ0A 3KM0A 5T6BA 4J1SA 4AJOA 4UREA 3I9LA 4B8ZA 3LU1A 1DHRA 3Q9NA 2O3TA 4GWGA 5KVCA 3OFSA 2H6EA 3DXFA 5HWSA 4U6QA 4C7KA 4J90A 4CLRB 4E5YA 2X0JA 2Q3EA 2CZCA 3RBVA 1HDXA 3L6EA 5TS3A 1Z7EA 3U49A 1NVMB 4WEQA 2FZWA 1W4ZA 4H7PA 4DC0A 3CMCO 3HNPA 5ER9A 3D4PA 4GSKA 1XYGA 4ZQEA 2B69A 4N5LA 2Z95A 1HTBA 1DIGA 2B36A 2EXXA 4XA8A 1ZSNA 1J0XO 5EIOA 4GMFA 2I99A 1JKJA 1ZJZA 3S1LA 4QSMA 2A94A 4TKLA 3EC7A 5DBFA 3PXXA 4NHEA 1T4DA 3O8QA 5HA5A 2O3UA 3QVXA 4N18A 1Q0QA 4CJXA 1T4BA 2G5CA 1BW9A 3AM3A 3GK3A 2IYOA 3FNEA 4PLWA 3KHUA 4UAGA 3M1AA 3ZZNA 3H9UA 1VPDA 3OA0A 3TDKA 2PZJA 5EERA 3ZW9A 3WSWA 4Z0TA 2I3GA 3G1UA 3WWYA 1QXSA 3E03A 1NWHA 2Q45A 4FJ1A 3PQFA 4YJGA 4YYZA 1ZEMA 1JAXA 4XYGA 1CJCA 1PL6A 4E6PA 1XLTA 4EEXA 1T2AA 4MVJH 4QEDA 1Q0LA 4BNVA 3AJRA 2DFVA 1GZ6A 1E7MA 1NQOA 2WD7B 1DIBA 1KVRA 1IHXA 2D2IA 2VRBA 1Y8QA 3M1LA 1L1FA 4NJMB 3ROPA 3DHYA 1N1GA 3DZFA 3S8MA 3VKVA 3OEYA 2Y1EA 4OGWA 3VPFA 4CM9D 2UVDA 4E31A 4GKVA 4MIYA 2VYVA 4LN1A 1B2LA 4IDDA 2J6IA 3T4EA 1PWZA 4XJSA 1R0SA 1GV0A 2Y0DA 1DBVO 3L4BA 4NBTA 4JNKA 5U1PA 3JQ7B 3UN1A 1HDGO 3IJPA 4CMJA 1QKIA 1LSJA 5G4LA 1SC6A 4IZIA 1EUDA 3DBLA 4WGGA 3KYDB 5JYEA 4NZ9A 4D44A 2PV7A 4II3A 4MKRA 2DU8A 4YJDA 1VE9A 4A0SA 4BB6A 2HRZA 4XYEA 3HFGA 8LDHA 3L4BC 5HM8A 3L07A 1R16A 1UUFA 3AI1A 2PWZA 3PIDA 1MXHA 4A10A 3WGIA 1MGOA 4Q39A 1HKUA 1GUYA 3Q11A 3JCZA 1IULA 3OJLA 3RUCA 1YOVB 1U3WA 1TEHA 4R1TA 5F1KA 1RM4A 2BI7A 4WNCA 4MO2A 2XXJA 3TF5A 2J5QA 3OQ6A 1X1TA 1A72A 3G79A 1VLLA 3WG9A 1Y5RA 4A27A 4FGSA 3F47A 4TRRA 2WYUA 4YWJA 4TZKA 2PA3A 1TVEA 1JTVA 2X6TA 2YV3A 3GQVA 4FBGA 4IJKA 3PGXA 1U28A 3RCBA 4HNHA 3GGOA 3RUEA 2VRCA 2PD4A 4EEZA 4D41A 3EZLA 3MJEA 2CDAA 4I9NA 3H3FA 5CG2A 3U5TA 4BL5A 1QMGA 4MKXA 4S1VA 4DQVA 3TSCA 3GVHA 2EP5A 8ADHA 3BMOB 3RJ9A 4OOFA 3VVCA 1AE1A 3H8VA 1NX6A 4UVIA 1GEGA 3PJFA 3AY6A 1GCUA 1NWCA 2IE0A 4PZCA 4RZHA 1Y7TA 1QRRA 1XDWA 4ZGWA 3IS3A 2BGKA 4KUGA 1Y5MA 2GZ1A 1E3LA 4M86A 4BIIA 4EJMA 1GQYA 2EJVA 2GNAA 3MOIA 2FPIA 3OICA 4CMGA 2NTNA 3W6UA 4RVDA 1KETA 1Q7CA 1E77A 1QYXA 2Q49A 3LVFO 5C5IA 1PS0A 4YJHB 5JDCA 1ZIDA 3IJRA 2FWMX 4KQXA 2JCYA 4J9VA 3Q2KA 4MVJD 3P2YA 2QRJA 4XIYA 4CLXA 3VDRA 5A9SA 3WOHA 5EQDA 2NVUB 3LYLA 4BO6A 4PLCA 2IYPA 5CDYA 1ZJYA 1DPGA 1PS9A 1SO8A 1J4AA 2JFHA 5THQA 1LRJA 5T8KA 4CM3A 3H6KA 4IS2A 1NVGA 5A9RA 4KTTE 1DC4A 2BFMA 5A06A 1VC2A 1D1TA 1YQGA 3DTYA 4NDNE 1L7EA 4BNFA 1ORRA 1LBEA 1V3UA 4IIVA 3PQEA 1I36A 1JN0A 1NQ5A 5GZ6A 3UUWA 4Q3AA 3HDHA 4K26A 1F12A 3ZWAA 3ST7A 4NPCA 1X0VA 1SEVA 4TVOA 1FJHA 2ZATA 2GSDA 4ALJA 5KNLA 4IBOA 1QYWA 2QIOA 2X58A 1DDOA 1NASA 3FF4A 3TZCA 1C14A 1F0YA 2BELA 3GDGA 3G0OA 4K28A 3MTGA 3PHGA 2NTJA 1NBOA 4E2WA 2W4QA 4J7XA 2B4RO 1YBVA 4FDAA 2GASA 4BGIA 1NFQA 4M54A 2RIRA 3AI2A 4XYMA 3UH1A 2J3IA 2P4HX 1PL8A 1D1SA 3G49A 4WCFC 1I2ZA 3MOGA 3RUDA 3KSDO 1F06A 1ULUA 4YB8A 2YHIA 3VH3A 4ROSA 4D7AA 1QYCA 2G0TA 4PLPA 5JO0A 2JAPA 1K5HA 1EEHA 1Z74A 3DEYX 4XRRA 3TOXA 4KZPA 3DZKA 5I7VA 4UEKA 3K6JA 4DYDA 3OETA 4CR8A 3TL2A 3U4DA 4R54A 4IXWA 3BYZA 5TX7A 1AXGA 5IZ4A 2RHCA 5DBIA 1XGKA 1VL0A 4A2CA 1ZXLA 4YAKA 2JCVA 4BV8A 1GCOA 1E7SA 4JP3A 4DQXA 3TRIA 3PHLA 4YAIA 3AY7A 3HDJA 1EUCA 3DQPA 2J3HA 2CMDA 2CSUA 2PKQO 5I8WA 2BH9A 2Q4EA 2DQ4A 3H2SA 3KOUA 4YAGA 3WJAA 4YACA 3MWEB 1NFFA 2H63A 5G0WA 3FD8A 4BNZA 5DP2A 4CQMB 4CMBA 1I3NA 4E2XA 1B0AA 1RJWA 3EUWA 5JMWA 5L53A 3KYDA 3HWRA 1E1NA 1MFZA 4OXYA 1O95A 1U2GA 4BUCA 2IRWA 3TJRA 1ISGA 3CMMA 4I5DA 3D3EA 1UAYA 3QVOA 5JCJD 3CINA 3PFWO 5TJ9A 3I1JA 4MVJI 4UVHA 1GZ3A 1I01A 3OM9A 1NP3A 4EUFA 3ZGYA 5CPBA 1V0JA 3GVIA 2IDZA 2O50A 4NH4A 5KJFA 2EP7A 4ZVVA 1KBZA 1CDOA 3GRPA 3ZDFA 3WGQA 4BKPA 4MP8A 4MP3A 5JCJA 3IKVA 1HE5A 3FTNA 3QA9A 3JQ8B 3U62A 2X0NA 5IFLA 4IY1A 2CUKA 3I9MA 4J49A 1YDEA 2WD7A 3GF4A 4LSMA 1CWUA 2H5LA 4YQYA 3QW2A 4AJNA 3DHNA 2QG4A 3W8EA 1IPEA 4O6VA 1ZK3A 1OI7A 1OC4A 3VVBA 4Y67A 1PGOA 4IDAA 1H6BA 2JFFA 1A71A 3ONDA 4RQTA 5AXAA 4BNTA 1A9ZA 5COBA 3JV7A 4MOWA 1GL3A 1YOVA 4FD3A 2EIHA 1GQQA 3PP8A 1DFHA 3ZHBA 1VKOA 2CFCA 2HU2A 2CF5A 3R3JA 4BKQA 3RUIA 1CERA 4INAA 2VNSA 4BS9A 1HDZA 4FJ2A 1WVGA 1N9GA 3F4BA 1ZFNA 4OJNA 1GDHA 5L4SA 4W4TA 4R4JA 1Z6ZA 1BTOA 1LU9A 2Q2WA 3COSA 1ZUD1 2VRCD 3LSYA 1E7QA 4B3HA 5CEEA 1WWKA 1BG6A 4L9RA 3ROMA 5I7SA 1HDYA 1KERA 3AFMA 3L4SO 3LT2A 1N8KA 1K6JA 2O3JA 3EGOA 3ZNQA 4BNJA 1ISFA 3ULKA 3U4IA 4CLEA 4E4YA 4Y6PA 3PLNA 4ZJUA 2NVUA 4RPLA 2O3SA 3HN7A 4HP8A 5TT0A 3BHIA 3VPGA 4E33A 3S2EA 3KEQA 3ANNA 1E3WB 3AUAA 3DAGA 3UVEA 3UGKA 3FI9A 4CUJA 2CVZA 2QX7A 3WX0A 4HKTA 3DAFA 1F17A 1H5QA 3ZW8A 1WDKA 3ASVA 3BMNA 1H94A 1U4OA 2EW8A 4R3NA 1LSUA 2DTDA 1LUAA 3GT0A 2C29D 3W8DA 1CEQA 5FEUA 3V2UA 2AW5A 3FWZA 3HZZA 3QQPA 4WCFA 4WK6A 3CH6A 1SCUA 1WZEA 1XR3A 3QWHA 3BIOA 4Z0PA 3UHAA 2V6GA 3TZQA 1E3IA 3BMNB 4OSPA 4DWVA 3AU9A 5A02A 1DRVA 1YJQA 4EDFA 1GADO 4ZHSA 1RWBA 1D8AA 4GWKA 2D1YA 1R6DA 3SC6A 4G81A 1PQUA 3OQ1A 2R6JA 3MJVA 1U7HA 3S55A 4J7UA 1DRUA 4FGWA 1R4MA 4DIOA 3P7MA 1C0IA 4IGEA 4TWRA 1O89A 2Q1UA 3C7AA 3WGGA 4GX2A 4BNKA 1LNQA 1MFPA 3M2PA 5F1PA 4CLHA 3LLVA 3ENNA 4D3SA 4OYRA 4J1QA 1H2BA 3GNQA 1ONPA 4UVEA 2VWQA 3TFOA 3I83A 2QRKA 1YBAA 1ZCJA 3OIDA 4AJIA 1MC4A 3AOEA 2DBQA 4RPJA 5U4QA 4XRGA 3BA1A 5TLSA 5TSDA 1QORA 4AJ4A 5KJCA 3JQ6A 5A03A 2BHLA 3WBBA 2EERA 3NJ4A 3RC9A 3VH1A 3ASUA 1HDOA 3VHRA 3ICCA 1QV7A 4ILKA 1HZZA 3JQFC 3QP9A 4IDEA 4PN3A 4JJGA 1GU7A 2O3RA 1DJQA 5L7WA 1FF9A 3NTRA 4CQLB 5IF3A 2OO5A 4LMPA 4J3FA 1UP6A 3LDHA 3ICPA 1IPFA 4Q3DA 4RPKA 2GN9A 4NFSA 4NK4A 3TZHA 4AICA 3OIFA 4K6FA 1CRWG 3WQSB 4PVDA 5FYDA 4IJWA 3CZRA 1LDYA 5U9CA 3DZHA 3BXXA 2IXBA 5TF4A 4XD2A 3UICA 5F3RA 1X14A 3GUYA 4PLHA 5THKA 2WJPA 4W82A 1Q0HA 2V7PA 4OAQA 2GN4A 2B5WA 3WTCA 5L4NA 4L8VA 4KQWA 1PTJA 2D4AA 5DULA 3RC7A 3AW9A 1C1DA 2WTBA 4XB1A 3WS7A 3ZV5A 1K6XA 3GRKA 2Q4BA 1J5PA 3OF2A 4Y9DA 5I9LA 3RUFA 4JJFA 4FC7A 4ZA2A 4B4OA 3A06A 2IZ0A 3TZ6A 4JROA 4PVCA 5KOIA 4HUJA 5DCUA 2BGMA 2YYYA 5DDIP 3RWBA 3ONFA 4F46A 5FWNA 1X0XA 2I66A 3PYXA 1U3UA 2DBVO 5AXDA 1MV8A 1ZK1A 4AL4A 3ETDA 4DMMA 5JXWA 2J8ZA 3DOCA 3WGHA 1IZ0A 4DLBA 1QP8A 3ZV3A 2H9IA 5H83A 1HZJA 3W8FA 2QZ9A 3E8XA 2J3JA 3N74A 5FF9A 3K9QO 3WQRA 1YB4A 3VC7A 4YXFA 7ADHA 2ZCUA 1KVSA 3K73O 3RI3A 1DJNA 3E18A 5BNFA 3UCFA 1U2DA 4CR6A 2GF2A 2HJSA 1NXQA 3EDMA 4YAJA 5G0VA 1UJMA 1YGYA 1AXEA 3NDJA 2PNFA 4UVDA 4X54A 4JLWA 4BMVA 2W2KB 1OFGA 1X15A 4XCVA 1T2EA 3E9NA 1E92A 1K6IA 2YV2A 5JFOA 3KEOA 5LC1A 2DBZA 1AUPA 1M76A 3IDSA 3WIDA 3C8MA 4ALLA 3TZKA 3INRA 1QR6A 2HQ1A 4BNYA 2IEBA 1I24A 2NQTA 3F4LA 4AJLA 5I7EA 1YS4A 1E5LA 2IODA 2BFOA 3D7LA 4Z9YA 3X2FA 1F8GA 1E0DA 1YL6A 3GC6A 3JQDA 3LT0A 1TA4A 1U5AA 3KYCA 4L4SA 2XF8A 1XQ6A 3GY0A 3B1KA 1O6ZA 3F3SA 1T2DA 3F1LA 5EINA 1ARZA 4ND4A 1CIVA 1ADCA 2HO5A 4WNIA 4MDHA 1VKNA 4CV1A 2OBNA 2PH3A 4XQEA 1XU7A 2E82A 1DIHA 4XR4A 3SLKA 3U4HA 2C2XA 4IINA 2NACA 2X9GA 4N5MA 4ZQGA 4MIEA 4J4HA 4XR9A 1DXYA 2C5AA 3U3XA 4E12A 2RAFA 3C1OA 3RFTA 3V1YA 4DYVA 3WICA 4ZD6A 1GD1O 3RUAA 1SOVA 4BO3A 3NRCA 4CLOA 1PL7A 2PTGA 1Q7GA 1KYQA 1C0KA 1VL6A 3KYCB 1LQUA 5FI5A 4D3DA 9LDBA 3GN2A 1IZ9A 2PZKA 1X7DA 2HLPA 2ZTLA 3AOEC 3FBGA 3PLRA 4E32A 1YB1A 1PJQA 2DTEA 3C7CB 4L4RA 1ISMA 4MP6A 3SX2A 3T7EA 5ITVA 1WP4A 2D5CA 4CMIA 5ES3A 4MIOA 4HFJA 1BW9B 3BHJA 2C2YA 2JL1A 2NVWA 1T2FA 3PRJA 4W99A 5T5QA 3C85A 1DC3A 3E5RA 5DZSA 2B5VA 3P5SA 1BSVA 1Z82A 5TT1A 3N7UA 5B12A 3F46A 3EZYA 4CMIB 4P22A 1A4IA 4R9SA 2JAHA 2EKQA 1Y1PA 5IAAA 4NMHA 4YBZA 4C7JA 1OAAA 4XWYA 3WSVA 4CUZA 1PU2A 3BMCA 4R5MA 4R1NA 3L6OO 1XWFA 5CPFA 5DCWA 3H7AA 4Z3KA 1LSOA 2PR2A 1D3AA 3QV1A 1P45A 1U4SA 1I3LA 2VN8A 5L45A 2VUTA 4YJHA 1SB9A 3PHIA 1EE9A 1DOHA 1NAIA 4R3WA 2F00A 2QZZA 3ZHXA 1JDJA 1M6WA 4LCEA 6ADHA 1FXSA 2NTVA 4E2ZA 2VNAA 4P8RA 4P38A 1TT7A 4PLGA 4II2A 1K89A 1I5RA 3A14A 1HSZA 3KZVA 1J6UA 3JYLA 3JQ8A 1EUZA 2YQ4A 1H9AA 3GNTA 3W4KA 2UYYA 1YQXA 1EVIA 3ZV4A 2VHVA 4GVLA 3GUCA 3LLSA 4M87A 1KVQA 4GKBA 3S2IA 5L40A 3QSGA 2EGHA 2ZCVA 3S2GA 3WGZA 1X7HA 1IE3A 1P77A 1F8FA 3NDRA 3PQDA 4NU5A 1MG5A 4WEOA 5I7FA 2GGSA 1LXCA 3JQAD 4RLHA 2GYYA 3I9JA 5JC8A 2JD0A 1Y8RA 1KC1A 1P9LA 3VH4A 3ZU5A 5C7IO 2EJWA 1DHTA 5CP8A 1B8PA 1LLUA 3JD1A 1LDBA 4J7CA 4B7CA 2Y68A 4IDGA 1TT5B 4PFJA 4PZDA 3WQQA 3GAZA 2JHFA 3GHHA 1KEWA 1TI7A 4XB2A 2CDBA 1RPNA 2GR9A 5G4KA 4F6CA 2Q1SA 3ONEA 5EN4A 4FQ8A 2VUSA 4MINA 4DIFA 1LLQA 4RVUA 4ITUA 1DFIA 1CQIA 4B4WA 3GEMA 5ICMA 1E7YA 3GDFA 2VOEA 3OQBA 2HMWA 2GCGA 3V8BA 5JW6A 4IDCA 3GLQA 1B8VA 2YFQA 1H2HA 3KSUA 4OKNA 1J49A 4NFYA 4RGBA 3ZWCA 3K92A 3NYWA 4UEJA 3JD2A 3DZJA 4JBHA 2QYSA 4B79A 1EE2A 1DC5A 2ZB4A 1R4NB 3FWNA 2BI8A 4Z9XA 4B3JA 2IEDA 2VYNA 3ZWBA 5L7YA 4CM4B 4UUMA 2OZPA 1BHSA 3IP1A 4BHTA 2GN6A 4PCVA 3RC1A 2AE2A 2NQ8A 5KVSA 1X1EA 3SXPA 1P1IA 2WMDA 3HADA 4OL9A 2OMEA 4UEOA 4BNWA 1I3KA 2NU8A 2VHXA 5A9TA 1D7OA 2NADA 1NPYA 5JBIA 1YBMA 4CLOB 3L77A 3UW3A 3AUUA 3LZ6A 4ALMA 4BGVA 4GLLA 1HE3A 1Z45A 1BXGA 3HDQA 3NTOA 3ZU4A 2I65A 4FFPA 4TVBA 1P1RA 4UUOA 2ILTA 2X0IA 2ZQYA 3JQFA 5EESA 4BNUA 2HUNA 4RF2A 2TMGA 3OJOA 1V9LA 1DFGA 5C7LO 3I4FA 1P31A 1PJ2A 4GVXA 4OXKA 1GEEA 4YRAA 5KJ6A 1BXGB 3INTA 3EYWA 5EMHA 5J23A 3O38A 3AFNA 4NIMA 4ZQBA 3WMWA 3OP4A 4OO3A 2RH8A 3EY4A 2VQ3A 4DBVO 1RYEA 5L7TA 1Y6JA 2HMVA 3PJDA 1CQJA 4FB5A 4KUHA 1XU9A 4PZEA 1NYTA 3I52A 4TRJA 3V2HA 2PY6A 1EBUA 3N58A 3PYMA 4OM8A 2PGDA 4DUPA 1JVBA 3NAQA 4KUEA 4Q9NA 3IUPA 4NI5A 3U09A 3CSDA 4RPGA 2WYWA 1R0KA 1E3SA 2FN7A 1VJ0A 3AM4A 3W1VA 1XG5A 1WXDA 1A9YA 5COAA 1UDBA 3MEQA 4Z0HO 2EWMA 4JN6B 3ZWOA 1WZIA 4HX5A 1U9JA 4QO8A 1HLDA 1UP4A 1T24A 1GPJA 1EQ2A 3JQBC 2CDCA 4L76A 2FP4A 1HEUA 1GYPA 3VTZA 2P9CA 4BKRA 3VZRA 1GYRA 3H9JA 5KKCA 1V8BA 2W98A 1VL8A 1I32A 3C24A 3ROKA 3EMKA 3GG9A 2PLAA 1M6HA 3F5QA 3KLPX 1LLCA 1LDEA 1XKQA 2YUTA 5LDHA 4EI2A 4KMSA 4JCOA 1H0KA 4RF3A 5KWEA 2HCTA 3ZWMA 2YV1A 2RHRA 4YRDA 1ULSA 5G0SA 1B7GO 4DLLA 1C3VA 2R00A 4MKZA 1DLJA 4LVUA 3R3SA 1XQ1A 2D59A 3GMDA 1SAYA 3LC1O 4IMPA 4I9UA 1VJTA 4RDHA 4WKGA 1UXKA 1ZO8A 2DM6A 2SCUA 1OMOA 1L7DA 4BNXA 3V1UA 1DIAA 3L6DA 1ADFA 1UDCA 3GZNB 5HBRA 3GEDA 2BKAA 2NUAA 5L4LA 3HB4X 1YB5A 3NGXA 4U7WA 1XCBA 1BRMA 2Z5LA 5T67A 2ZB7A 1R4NA 4BB5A 2AHRA 3QVTA 2X0RA 3Q6IA 4XDZA 1WW8A 3CUKA 3QVSA 3TPCA 5KJ1A 4P4NA 3F5SA 4MVJG 1T25A 2FHSA 1IHYA 4IDBA 1PJTA 1HXHA 1EDZA 4J91A 3BHMA 3Q9UA 5IJZA 4L74A 5IDYA 3WLEA 1GTMA 1UH5A 4XGNA 1R12A 4OMUA 5DP1A 3L0DA 4AJ2A 5ITWA 3D4NA 3JSAA 3JYQA 1NQTA 4RLSA 4C4OA 2EKPA 4HBGA 2UUPA 1PJBA 4YJFB 3NDIA 5JNLA 4FW8A 1SPXA 1PGPA 3B6ZA 3NTQA 2DUWA 3QLJA 4RZIA 1O8CA 2DFDA 3KETA 3I9NA 5G4KB 1IOLA 5JAIA 4I08A 3D4OA 1GZ4A 4L0QA 1YL7A 2QHXA 2TMDA 4ND1A 1XA0A 4I5EA 1JLLA 4EZBA 1DAPA 2I9PA 1B14A 1KOLA 1QSGA 2AXQA 1ISIA 1E3JA 1CYDA 3ORFA 2B37A 1FDVA 2QYTA 1YJ8A 3UF0A 3RQSA 4BO9A 4D0SA 4R68A 2RCYA 2ZTVA 4BO8A 4BMNA 4NK5A 1DC6A 3JQEA 4DPLA 4J0EA 1LDGA 4BO7A 1NPDA 4YJGB 1R66A 1DSSG 3OJEA 1HE2A 4RQUA 4YT8A 4XDYA 3GOHA 2O7SA 2W8ZA 1LDNA 5I9MA 5K9ZA 2JD2A 4HADA 4PG7A 1MB4A 2FR1A 3PVZA 1B16A 1GUFA 2BFPA 5FI3A 4IZHA 4WUVA 3W4IA 1C1XA 4RO0A 1EFLA 2DAPA 3PGJA 1PX0A 2C5EA 2NU7A 5GY7A 4BGUA 1LA2A 1G0NA 2GLXA 2GRAA 3DR3A 4MVJE 2JFGA 2GZ2A 4RPHA 3CE6A 3GGGA 3PHJA 4Q3EA 4PLZA 1NVTA 4U8GA 5GZ3A 1NQAO 2OL4A 5FFFA 4ND2A 4IUYA 2CVQA 2XXBA 4ALNA 3HDYA 3FSRA 4J0FA 3WBFA 1P74A 1T26A 2PGJA 4UULA 5DN9A 4DIBA 3JQGB 1E5QA 4QFCA 1ZXBA 5ADHA 3NX4A 4Y6RA 3QY9A 4PG8A 3VH2A 4CLRA 2ZKLA 1ZK2A 4Q3NA 4RF5A 1YL5A 3BTSA 4CMEA 2HMSA 1SB8A 3GFGA 1JU9A 4WLEA 2ZYDA 4JGBA 3W6ZA 3GH3A 2OORA 3JQ9C 3PFFA 1UDAA 3ZV6A 1TXGA 5KIAA 3ADOA 3HN2A 4FSHA 2GUGA 4NG5A 2UDPA 4BMSA 1LRLA 3TN7A 3PWSA 4HFRA 3WB9A 3DONA 4CM9A 3OIGA 4D79A 1DIRA 3HG7A 1I3MA 1PZFA 3JQ9A 4ZQHA 1IB6A 1EZ4A 4RVSA 1WDLA 1V35A 3DBRA 2ZJ0A 4P4LA 1WLYA 2Q2QA 4BGEA 5CHEA 1U3TA 3OJ0A 4PG5A 2OHXA 4BO2A 5TIIA 1N1EA 3DMTA 2P9EA 2DC1A 3MJ4A 1EVZA 2G76A 1XIVA 1ML3A 1O5IA 3E48A 2OP0A 4RVGA 3PJGA 1DRWA 3ENKA 4NQZA 1JKIA 4DVJA 1PJ4A 2LDXA 2Q99A 3JD4A 1C0LA 3IMFA 2C0CA 3K8ZA 4OHUA 3RBZA 4GGPA 4DA9A 3D3WA 2GDZA 2BFAA 2WD8A 4YR9A 1EMDA 5K0ZA 1HYHA 3DMTC 1ZVMA 2VHZA 1CF2O 3QWAA 3VKUA 3ZHZA 4FFLA 4K6CA 2P2SA 4MVJA 3DFZA 2GD1O 3O4RA 5LDGA 3TQHA 3ZWYA 3EVTA 3PYLA 1MUUA 3VPSA 3DDNA 2W2KA 3H9QA 5JS6A 2WM3A 1ADGA 1LDMA 4JX8A 2IXAA 3F1KA 3KVOA 4E5NA 2BF7A 1UXIA 1NHGA 4ID9A 1BMDA 5HTOA 3H9GA 3KB6A 3GGPA 2VWHA 3PHHA 4FCCA 4KDEA 2POQX 5L51A 2FR0A 3DMYA 1PGQA 3B1FA 2DBRA 2WDZA 4RV9A 3WGOA 1RM5A 4KWHA 5A4DA 5A5EA 1BVRA 3BMOA 3HSKA 2JKVA 1HL3A 4ALIA 1DO8A 1ZMOA 3LK7A 1LSSA 2CD9A 3DL2A 2W90A 3GVCA 4J2HA 3KRTA 1GYQA 2WYVA 3C1TA 1RM0A 3R1IA 2J5KA 3GFBA 1ZSYA 1NPTO 3Q3CA 2OXIA 3WYCA 4B7UA 1A5ZA 4TMFA 1VJ1A 2VOJA 2O2SA 2C54A 3GMSA 3MJCA 4CMAA 5DOVA 1OZAA 4DL9A 3QHAA 4ZICA 3I6IA 1FK8A 3FR7A 2YDXA 4NJOA 3HFSA 4TROA 2VTEA 3DC2A 3RKUA 4KTVE 1U3VA 3DTTA 3TWOA 1P3DA 4FOSA 2Y05A 2C7VA 2E6UX 4BKOA 1FMCA 4XIJA 5G0UA 4CL3A 5IDXA 5B37A 5IG2A 1VRWA 2FPPA 1LRKA 4FR5A 5TC4A 3ZI0A 5L9AA 2QW8A 4QO7A 2Q1TA 4H3VA 1LQTA 1PGNA 2A92A 1R0LA 6LDHA 2E4AA 3ADPA 4R5HA 5A3JA 1A27A 1ONNA 3GN1A 5AYVA 1PJ3A 2ZYAA 3I3OA 2X9NA 4IS3A 3X2EA 1NHWA 3CIFA 4CMKA 4B3IA 4HFNA 1QV6A 3V2GA 5JAMA 1G0OA 1PJLA 4YT5A 1S6YA 1Y9EA 1NM5A 4IJUA 2FY8A 3OEWA 2P4QA 3BMCB 1EVJA 5F21A 1ZNQO 2P91A 2Y1OA 4ZQFA 4QXMA 2DPGA 2D3TA 4CMEC 4YT2A 1DAOA 4FFRA 3MJTA 4ESOA 3WJ7A 1B15A 5BR7A 4CV0A 3B20A 4E5PA 2NVBA 4DPMA 3DOOA 1NR7A 1QLJA 4ZRNA 1ZW1A 4K9DA 1OC2A 3I9OA 4JK3A 4RF4A 2X8LA 3VDQA 3WMXA 4BKUA 5TQVA 4YRBA 1P1FA 2PFGA 4MVJM 2Y1FA 4TSKA 3T7CA 3TNLA 4AJ1A 4CMHA 1Q2XA 2X9VA 2HDHA 3VTFA 2F1KA 4GLOA 1LI4A 3H4VA 2Y0CA 3A1NA 2YDYA 3QE3A 4EW6A 4RJTA 1H93A 4H16A 4J1TA 3GPDG 1KVUA 4GPD1 1UR5A 2V65A 5A04A 3OBBA 3UXYA 1Z73A 1E1LA 2FPGA 3HUDA 4CL8A 4PRLA 1SZJG 3OH8A 4NBVA 4I1IA 3H2ZA 1ZMTA 2HJRA 1Z75A 2BMAA 1UXJA 1KY5A 3DFUA 1OOEA 4W7HA 5KTKA 1YONA 3AK4A 3AUTA 1EK5A 3FRJA 2FRDA 2O4CA 4RVFA 3NKLA 3K96A 4YTEA 1UP7A 3D1LA 1Z7BA 1H6DA 2YY7A 2R2GA 2DVMA 1P0CA 1PQWA 1O9BA 3QVWA 3RFXA 4D3FA 4CUKA 4O1MA 5A9SB 4TKMA 4WCDA 3RU7A 3FR8A 2FSVA 3ZNOA 4R9RA 3KXDA 4XQCA 3UKOA 1YWGO 3STHA 3ZWNA 1IYZA 3E9MA 1NR1A 1FDWA 4JBGA 2RH4A 2VYVD 3WYBA 3O26A 1VSUA 5KVVA 4PLTA 1TB4A 3DBHA 1O94A 4CM8A 3NT2A 4QX6A 2NWQA 5DF1A 5IXSA 4JJIA 2YQ5A 3AWDA 3A28A 3CTMA 2X7HA 3FNHA 4CPDA 4G2NA 4HV4A 4HFMA 5JSFA 3CEAA 4HXYA 4A7PA 2HMTA 3OSUA 1GV1A 2X5JO 3BTVA 1HETA 4G5HA 4AJHA 2C59A 3BTUA 3RSHA 2WEKA 2OGUA 3V1TC 3AM5A 4RL6A 2EGGA 1ENZA 1ID1A 3H5AA 3KBOA 4J4BA 3DB2A 3M2TA 3RVDA 1B8UA 3W4JA 3WGTA 3WNQA 4MVJP 2PD3A 5ER6A 4DTIA 4A26A 4YDRA 2YJZA 4BO0A 4ZN6A 4EUHA 4E5KA 4WECA 3WFIA 1V6AA 2I67A 1O0SA 2VT3A 3OJFA 2GO1A 4EITA 3IP3A 2LDBA 4HWKA 3GDOA 1E7WA 4I5FA 4KDFA 3E82A 1CETA 2ET6A 4BNLA 5JC1A 3R6DA 5AOVA 1FDTA 5JLAA 4E5MA 4UVGA 5A05A 3V5NA 5CFZA 2JJYA 5GZ1A 2X1HA 2DLDA 1VSVA 4M1QA 3LQFA 4ALKA 1E6EA 3OA2A 4PG4A 3DZBA 2Q2VA 2G17A 3SJUA 5A3VA 3ITDA 1IY8A 4BNIA 3I5MA 4TRNA 1ZK4A 1RYDA 1YDWA 2Q46A 2X22A 4FFNA 4QQRA 4AFNA 2B83A 4GX1A 3K2EA 1BDBA 5F5NA 3PI7A 3ZU3A 3CKYA 4CM7A 4CODB 3C1AA 3NEPX 3F9IA 3QJ5A 1R15A 3RUHA 3UOGA 4JXKA 1PZEA 3IAHA 2B35A 2EF1A 5ILOA 3CXRA 1KIFA 2NNLD 3R0IA 3O8QB 1PZGA 4U0KA 3NJ8A 2O23A 3ON5A 2CF6A 2QQ5A 3AY3A 4FC6A 1ZKMA 4GX0A 5JAZA 3GG2A 4MVJF 3GZNA 1EDOA 3I4CA 1PEDA 4WCFB 2G1UA 3H3JA 4I9HA 4OQYA 4FFOA 1HRDA 4YVFA 1PWXA 3UAGA 3KO8A 1E7RA 2C07A 3D0OA 4KWIA 4QTZA 5BT9A 5BNTA 3SJ7A 4D46A 2D0IA 4P4GA 2NU6A 5CG1A 4UUNA 3FTPA 2P5UA 4PLFA 5CEJA 4BNNA 1E3WA 1N9GB 3GZ4A 4QT0A 5JE8A 3H9EO 4WLOA 3IOYA 3WGYA 1TLTA 4OXNA 2X4GA 4XX0A 2Y66A 5TNXA 2ZK7A 1GFSA 2PD6A 1MP0A 4EUEA 1SOWA 2W2LA 4IM7A 1C0PA 1V3TA 3GR6A 4DPKA 1M75A 3GVPA 1PS8A 4CQMD 1LJ8A 4RCVA 4YAEA 1BXKA 2O3QA 4FIZA 4PLYA 4CLDA 1QYDA 2VWPA 1VI2A 3ETGA 3BZUA 2DUUA 1P44A 4U0JA 4MPDA 2D8AA 3A4VA 4GI2A 3M6IA 3K2BA
chains in the Genus database with same CATH superfamily
2JF0A 2WAOA 4WOKA 4AG5A 2ZTMA 3NTVA 2HQSA 1C7ZA 3GD7A 3EXFB 4H7IA 1XO1A 5L3RA 3RTCA 4UUPA 5KOYA 4Z1OA 1K8XB 1X42A 4MXDA 2Y93A 5LCXA 1MLDA 3MMPA 3L0BA 1XL1A 1QZZA 4ZOQI 1R37A 1U6IA 1JVNA 2VJQA 3RSSA 2PGAA 1N7GA 3CLSD 1E9FA 4KSBA 2WE8A 4G1CA 1U1IA 4Z3DA 4UE6A 1B26A 2EBFX 3FSEA 3IV6A 3OCCA 4OJTA 4Y2QA 4O02B 1DBSA 3O1JC 3RGGA 2JJ2A 3M89A 1EFKA 4MQEB 4ZYUA 1QCDA 2Q1WA 5B3AA 3U56A 1NLUA 1LY1A 2C2HA 2ZYGA 2LWIA 3LHFA 4XZ3A 1GTJ1 2OTCA 4M7OA 5ERYA 3TTYA 3B2EA 3MWDB 4JZYA 1P0FA 1V47A 1HDCA 1PTJC 7MHTA 1WZNA 3DXYA 6ABPA 4F3YA 4KYUA 3UMJA 1XWWA 3K1TA 4GQAA 5C37A 1XCLA 3OVMA 1MNQA 4Y8VA 3K30A 5EJ2A 4PC6A 1GRQA 3GU3A 2DECA 1FX0B 1G3UA 2XUPA 3AIIA 3ELUA 1NKTA 2GAJA 2HAEA 3EGCA 3G17A 2ZRKA 1CULC 2QEQA 4R8VA 4ZOBA 4PHTA 2RBEA 2FQ1A 3NHAA 2GVZC 1JQLB 3IBYA 3ZHVA 3HYTA 7YASA 4EKEA 4Q37A 1UWCA 1K7XB 4DB2A 1JBKA 3DO5A 3OZGA 3PK0A 4N47A 2P4EA 2XX3A 5AUNB 4L95C 2ILVA 1TCBA 2BGUA 5JS8A 2SCUB 3L6CA 4XEHA 4C4RA 5LP6B 3RC8A 5FQOA 2C03A 4I8DA 2O1EA 1JKFA 3IE2A 1UC8A 1I13A 4V39A 1PV4A 4AJ9A 4B3MB 1NXOA 1ZM4A 2D0OB 1HE1C 3D2LA 5A1TA 2Y2VA 1C4KA 3W34A 3LI2A 2CL6X 2PQ6A 1ZSVA 4J43A 2A84A 4OH1A 1Z5OA 1ZZEA 2Q27A 3TOZA 3UM9A 2XYHA 1T2CA 1JBQA 1JJIA 4HQ6A 4RVHA 4BX3A 4CM5A 3B70A 5JR3A 1Y89A 2GI4A 2PUTA 4Q7QA 3ZDRA 1J5EB 2QTNA 5G2OA 4C2UA 1QDEA 1E9EA 1WDMA 3NO4A 4PBTA 1HURA 1ZMRA 2FOIA 1RYYA 3QYPA 4W8GA 4L4XA 4OVKA 1NJ1A 3IB6A 4YK7A 2AG8A 4RE5A 1KOGA 4X6YA 1OH7A 1N8TA 3E3MA 4B4VA 1P6XA 5D5HA 2ODAA 1GFZA 3UNXA 5GONF 3KV1A 3BMQB 4KXWA 5CM2Z 1NMZA 1G5QA 4ANFA 1TVMA 5KSWB 4IRMA 3L0CA 3A70A 3LQ1A 2B25A 1E6UA 5FBVB 1DJMA 3HWX1 3D6JA 4AJJA 5IN5A 1JBEA 1RXUA 4LYHA 5JNRA 3IAAA 3U4CA 3MERA 4H15A 1JP7A 2F4NA 3HR8A 1Z0SA 4P9NA 2H8KA 2I2BA 1KTVA 2JH3A 3AR9A 2HMAA 3PGVA 2H4HA 2NX2A 2Y1DA 5I45A 2YCLA 3Q3GE 4FQ7A 3TPZA 5AI4A 1NIJA 4XQGA 3CLKA 3P0RA 1PIWA 1E5XA 3DDSA 3JWJA 3MAGA 3Q88A 4YCAA 4N54A 1AN9A 3QWBA 1RLOA 2XMCA 3LIIA 4QECA 4X20B 4ZIRA 4CNQA 1C9JA 2GAIA 2IZ6A 2NO9A 1QCYA 4P93A 2FETA 3ZNPA 3AJ9A 4HNTA 1M67A 2MYUA 3NCHA 4IFBA 5GMOA 4Q19A 3VJMA 2P5YA 2XMQA 1PW5A 4CTOA 1NFRA 4XIIA 4KO2S 4EFDA 4BFWA 3PI6A 5BMVA 2O5EA 3A8TA 2POCA 4QJBA 5SY9A 4F7WA 4I1UA 2FN8A 2QTVB 4HLCA 5DOZA 2NXJA 2BLLA 2IHYA 3NNDA 4D3YA 3GLGA 3G1TA 2ZBDA 3RVBA 2QAGC 3BJEA 1ACJA 3HEMA 4W7IA 2HKIA 3C6MA 2FGKA 4IIEA 3WRWA 2BGLA 5IXYA 2YBDA 2UUBB 4QPDA 2C4MA 5J43A 4RA6A 1XHLA 1XC7A 1KYZA 2QG6A 4AO7A 4BZWA 2O2YA 3I0MA 4V1CI 2ODEA 2VEOA 3GCXA 4KAFA 3NUGA 4TWZA 3RQIA 3JRNA 4KXLA 2JGJA 1AHPA 1GPBA 1HT0A 2PRZA 4LK3A 1XEAA 2IWHA 3UOWA 1SXQA 1W0JD 3TRHA 3WWCA 1PUXA 4GRDA 3GPBA 2WIJA 1E6WA 3K9GA 4A15A 4HDMB 4YI3A 3QF7A 2DR0A 4LXUA 1GCGA 3NM4A 1UZNA 1Z26A 2V0NA 1SVOA 4BVAA 2GEVA 4DBLE 1W4CA 2Q5EA 2B2NA 3JQGA 2OECA 1USKA 5EA2A 4NP6A 5I9NA 1N5JA 4RSRA 3RFUA 5A3SA 1BAPA 2LUOA 4X94A 2O7QA 1T2UA 1TU0A 2C94A 3R5KA 4HNGA 5ALKA 5BVGA 5JRJA 5LVAA 1STOA 2Z6QA 4X90A 3GUVA 3I04A 3O73A 1HPLA 4QDOA 4B6PA 4DLXA 3DOFA 2I1WA 3R40A 4ENTA 1ILWA 1GTZA 1TKBA 3L01A 4FR0A 3ADCA 5B1YA 3SK0A 4XM2A 1K86A 5DLEA 1VL5A 2A1IA 1FNDA 1C1XB 2VBGA 4A2PA 1H6AA 5ERGB 4LQCA 3Q0TA 2MSDB 2PVCA 1AKYA 1J0DA 3CZAA 4YA6A 4W1SA 5EIHA 1GXSB 5C32A 3OO1A 3P71T 2QAJA 1IOZA 2VZ0A 1P7CA 4UCFA 3TOCA 3PEUA 4IG9A 4KOAA 4B6EA 4F21A 3L8FA 5HCNA 2J0QA 1URPA 4ENPA 2OPHA 2ZIXA 1L8XA 1FFAA 1UMBA 1Z68A 2DWQA 3ZLJA 3TLAA 3EEBA 5BSGA 1E8MA 2ZAMA 3VPXA 4PQEA 4ZT3A 1CR0A 2V6FA 2WIAA 3SLGA 1SVWA 2WRZA 8MHTA 4D4JA 3AUSA 1WD5A 1AV7A 3GA0A 3KPYA 3KOZA 2J30A 4QREA 3GPIA 5K8JB 1O1YA 2AQIA 4OBEA 5BPFA 4M7WA 4MS3A 2XRMA 2AX3A 4ARUA 1A96A 2WJYA 4G41A 4M8LA 4NCIA 4XGKA 2PX4A 5CW1A 3VDMA 3KZCA 3WFJA 3QUTA 3KB2A 3O8DA 5J9FA 4GX5A 3T4XA 2HDNB 1YS9A 5KYGA 4DC9A 2LTAA 3JD3A 2SKDA 3INGA 5DM70 4UXIA 4PNPA 2XZTA 3H75A 3T15A 4WFIA 2KYRA 4YCBA 2QJFA 4B3GA 2OOKA 1UANA 4JYPA 4S3MA 4BB9A 5SYNA 4OHVA 3WR5A 1UKVY 2WJ3A 5FOTA 4OEHA 2PK3A 2FSUA 4M9QA 4D4MA 2NV6A 2HREA 4L15A 2H06A 5H80A 4G0UA 1Z38A 4UHFA 4GEGA 4F71A 3SFVA 4L75A 2RC6A 1SUEA 1X77A 3BILA 3BS4A 2WKPA 5AXBA 4Q4HA 5IAKA 1BA2A 2ATVA 2OO3A 1GVNB 3DP9A 1LI5A 3OZCA 3SSAA 2G6TA 3EVNA 2J67A 2PRSA 3ER6A 3N8NA 4FHFA 4GZMA 1TMGE 2NYAA 4BV9A 1J21A 2G07A 4CTMA 3C7DB 1TJ3A 2X23A 1R64A 3H04A 2P68A 4B7ZA 2JLZA 2VRNA 4F85A 3D64A 2BRUA 4GW3A 3IQDB 1UZLA 1FTGA 1YKFA 1HF3A 3PQCA 4UUAA 5LLDA 4TTTS 2DT5A 3TW8A 4FEYA 1TO2E 2E37A 1N2SA 3NT4A 2CV1A 4UU7A 3HJAA 3V8NA 2YN0A 4NJEB 3K5IA 1KTIA 1MJNA 2P6MA 2P0AA 3IIJA 2Z1NA 4TLBA 4D4IA 4ZTUB 4MHTA 4LTMA 3CYFA 4Y2JA 5C4IA 1JUDA 5CDTA 1ZI8A 4EX7A 1YZ3A 3P2KA 3HTXA 4C4XA 5FCDA 2AFIB 2ZB8A 1PJCA 4WE3A 1M74A 1HQCA 4PPYA 3PG5A 3OT5A 1VLJA 5ABPA 4ZAFA 1N92A 4LKRA 1HH4A 1E2IA 4TSRA 2ES4A 4PY2A 4H1VA 1GTG1 4NE7A 1VHDA 2VK1A 3C8DA 1FVHA 2E89A 1KPGA 1O7JA 1K4MA 1RM3A 3F6PA 3H7IA 2WFZA 3HLYA 2J59A 3LPAA 4QUIA 3S3TA 2YWBA 5KQMA 1ESZA 3QWFA 3PEWA 4FMDB 3RS3A 1G6KA 3LUDA 2QTCA 3HUEA 5BP7A 4NU8X 5IZCA 1KK2A 2CNBA 3PF9A 3SNHA 4AIRA 3FHLA 3SSNA 4BVEA 2OD2A 2PX8A 4PCUA 4DWOA 5BWOA 3KLMX 1ZK0A 1Y4ZA 2JHGA 4RORA 3CT4A 4V0MA 1VIMA 2C9CA 4EVRA 1LX6A 1T6NA 1Z0IA 2KLHA 1WDTA 3EPRA 4W9RA 2K7FA 2R97A 3AETA 3LKZA 4B8WA 5JBQA 4LCJA 4JFRA 2QGFA 5AHKA 4XOIA 5EVJA 4BO1A 5IKEA 3FPLA 4XFJA 5E9WA 7REQA 3TZLA 4D74A 3PQ5A 5BUCA 1Q7BA 1T9ZA 4XQ9A 3TBFA 4XARA 4HY3A 4GLFA 3ZCSA 2O8FA 2YJGA 4O0LA 5E6SB 3OZEA 3QEOA 3UUFA 4AULA 2PH5A 4YFYA 3S7ZA 1QBKC 4CV3A 2O8BA 2XXAA 3CUWA 1Z5ZA 2NO6A 3EZ2A 2FR8C 1IBCA 2VSNA 4JP2A 3LF1A 1UF9A 4O2LA 1XF1A 5K3OA 2CLIB 3LKBA 2CMGA 3DMNA 4WX2B 1W35A 3LW8A 1F38A 4MMZB 5CMLA 2OQRA 5H3CA 3WAKA 1I6KA 3X0DA 5K6RA 1EX7A 3GLVA 3CVXA 3HABA 2JFBA 1G2PA 2X3UA 1ZD3A 3KKMA 1DTWA 3KSMA 3O9MA 2OWDA 4K6GA 4A2WA 3N2KA 1N6NA 3KDSE 4DMFA 2ZB3A 2ALJA 5EHIA 4EGFA 1ZVKA 2ETVA 3M4JA 4KIUA 3WV4A 4AVYA 1XQXA 3TIFA 2G8LA 3VKWA 5LNK1 2EV9A 5KNBH 3VYWA 3TXXA 2WHQA 4TUYF 3CE9A 4C76A 1WV0A 3R23A 3MGCA 4D0GA 5K6TA 2A4KA 4N3GA 3RKSA 1V7PC 3OURA 1GNPA 1P1JA 1PNOA 2BY4A 4S12A 4B2YA 1BRTA 4JXJA 4YMHA 4JLUA 4FN4A 3K1JA 4HDKB 1KY4A 4I19A 3R2JA 3GMTA 1N0HA 4LYEA 4RD1A 4WXHA 3BT7A 1Y9AA 3D6MA 4G65A 4AF8A 3HQ4O 4FS3A 1G63A 2GBLA 5L3ZA 1T5SA 1WKVA 2HA6A 3BGWA 5FADA 2D5AA 4BB0A 8ABPA 1B3RA 3DE5X 4R2HA 1DAMA 3DHEA 3KTAB 4AJPA 3A10A 3Q7QA 1JEOA 2QVYX 4JYBA 1SCUB 5JDCC 4ZEOA 3VOBA 4A73A 5LYJF 5J59A 3ROZA 3EULA 4I55F 2FWNA 2OQIA 1CX9B 4ZQCB 5H0IA 2JI4A 4EVIA 3ENVA 4JSYA 4F93B 4MKFA 1JHVA 1YR2A 2VCYA 4QGGA 5DCYA 3N76A 2CK3A 1CKEA 4ZCIA 4TTRA 8OHMA 1KZ4A 1P3JA 3OECA 9LDTA 3LO8A 3AOGA 2JGIA 3THWA 1VKRA 3L7IA 1M2WA 1RS0A 4LMBA 3LC2O 3DVAA 2H2IA 4O4IB 1BCRB 5EQFA 2X7JA 2PGLA 4LISA 2FQXA 3EQ7A 4WINA 2W2PA 4GLBA 1H9BA 1KI4A 1SGWA 1BH6A 2I2FA 2QL6A 2EG9A 2W2TA 3OPNA 4G4IA 3PNLA 5T64A 1YO6A 1I10A 1HE4A 5LMCA 1USGA 5B6JA 1H2XA 2FNAA 3JD0A 2VP4A 4MCHA 4PYNA 4TQGA 1Y81A 5D51S 2AE1A 5DLYA 3ZZ1A 5G40A 3P26A 2FQWA 1N0WA 1D4FA 5C8YA 2JIRA 2H17A 2C1EA 2YVQA 1Q1ZA 2NUPB 4J0IA 3RU9A 1SUCA 1NBMD 4QOSA 1LC3A 4QOJA 3RASA 1G291 5LIPA 2ERXA 2VH1A 4H7KA 5F1OA 1RPAA 3IXQA 3QIAA 4CXMA 1P9OA 2BMJA 3PXEA 1U2RA 5FT9A 1G5PA 1Y0BA 4JS0A 4X91A 4EGQA 4H7EA 3FW1A 4HZGA 5C8YB 1HV8A 2H1SA 4P0TA 2GFQA 2WIFA 5IX8A 2H5JA 5GV7A 3WNCA 3U3ZA 1F7VA 1A1VA 4QQNA 3EA5A 4GDFA 1XMJA 3Q2IA 4NFHA 3RSZA 5G0TA 4LTDA 2OP1A 521PA 1KEVA 5FLXA 4UE3S 1RLIA 2OCIA 2BD0A 4EB8A 1P61B 3T3PB 1AURA 1FDUA 1H4TA 5K0FA 5KSOA 1Y5LA 3ZLUA 4Y9TA 1FFWA 1JA9A 1A9SA 1MC5A 2C0PA 2QJTA 5FOXA 1OXVA 5YASA 5HRUA 4EX6A 5EXPA 4TTPA 4G07A 1XQ9A 3FN4A 1V8FA 3B3JA 1IN6A 3Q0EA 3UQZA 3UWSA 5CA1A 4B7XA 1SZCA 1E1RD 1VECA 4QE3A 3WOVA 2PE5A 2VWGA 4QNNA 5C3MA 3NYQA 2WAXA 1ESMA 1KL7A 1SXJB 2ERCA 3KCNA 4IXNA 5C1IA 3TCXB 3QGMA 4LV5B 5BNZA 3H1BA 2NGRA 3B5EA 3PTAA 3EBLA 5ED0A 3O03A 4KP7A 3PDUA 1P1KA 2O5VA 1OE0A 2NLOA 1X38A 3EG9A 4PO8A 4DJFC 3UYLA 4CR7A 2IYZA 5DM1A 2FOXA 1NKVA 1M34B 1YJCA 2WHPB 1KZGB 3RYHA 2OLJA 4BFSA 3KUDA 4J1SA 4UREA 1W88A 4OAPA 3LU1A 5DFAA 1P7VA 2NXEA 4FGUA 3UT5B 3ZD9A 2QLTA 4BRUA 5AI0A 1NOKA 2WJ4A 4RVNA 4MVYA 1UOOA 4PZAA 4P3KA 2Z2JA 1G2IA 4F5ZA 3QKSA 1J20A 1CHNA 2LV8A 5KOJA 2MINA 4J90A 2XEXA 5LWQA 2G9NA 1G66A 2Q3EA 3DKRA 1Z7EA 3OQOA 3IJ5A 5CVEA 4EFNA 1F0KA 3KQMA 4LQDA 1ZG3A 1TD1A 2FW9A 2O20A 1W30A 3N2KB 3QUQA 4IIDA 5ER9A 5FWAA 4HXEB 4CVNA 4M53A 4L6CA 3LQRA 2HW8A 4I46A 4ZVLA 4N5LA 2CLFB 1HTBA 1DIGA 2B36A 2AXPA 2EXXA 2PKXA 4FBLA 4XW2A 4RTPA 3EIWA 1E2PA 1J0XO 13PKA 3QU7A 2XE7A 1OBVA 2WHYA 5FPQA 3I5YA 1IEVA 1UOEA 3C3PA 3HJCA 4L5JA 3S1LA 3OKPA 3P9SA 4B43A 2D6FA 1XI2A 4MA0A 2BM9A 5DBFA 1FCJA 4RIIA 2GM3A 4I4TA 2VDKB 4J3NA 4X93A 4N18A 4WTOA 1Q0QA 3N7TA 1M2HA 4MYUA 1T4BA 1ZDMA 3OJXA 3DMGA 2ZDHA 2G5CA 4QXRA 3D8BA 2RJNA 3QU2A 4WWHA 3EXG1 5HW0A 3PNPA 2IYOA 4PLWA 1ONBA 4CIBA 3MILA 2BFDA 4L4ZA 1WV1A 4PCAA 5KREA 1VPDA 1GA4A 2DPYA 3DJYA 3K1AA 3L0ZA 1UJ2A 4DY6A 4EKGA 3WKEA 1M6VB 3N7AA 3VNSA 1PBNA 1E2NA 1ZP6A 121PA 1T13A 3DEFA 4DAOA 2J3MA 4Z7QB 3IEMA 4HDKA 3WWYA 2Z5FA 2HIMA 1QXSA 3PKZA 3E03A 4JB3A 3UGTA 4TMVA 5BN1A 3ORSA 4P6VF 5CIQA 2KLBA 3IAS6 2WWYA 3PNSA 3Q7EA 1W76A 4R2LA 2O8CB 1FSGA 3SS8A 4Z4FA 3PNMA 1PL6A 5EMLA 1XLTA 4HQLA 2LKDA 1A82A 1CUIA 1N5IA 1T2AA 3E05A 3AJRA 1QRDA 2P6NA 3K09A 1QVVA 3T3OA 4XEUA 3QA3E 1TA9A 4M9RA 1USVA 2WICA 2HHHB 1L1FA 3O3NB 3X1DA 1U8CB 3DHYA 3EVFA 3DZFA 4K9QA 3S8MA 3V00A 3VKVA 1QZTA 3OEYA 3AJEA 1D2AA 4OGWA 2ZAGA 3OIYA 1L5HB 4MI1A 3ZXUB 1JAHA 2UVDA 5CNJA 1QP0A 4GKVA 4H1HA 1L5YA 2QSYA 1PWZA 4YY3B 4A1FA 2CXOA 4XJSA 1ZUNB 3HCCA 2WAYA 2FMXA 2FFBA 4RD2A 4LUCA 4M9XA 3MOSA 3K3PA 4JSTA 1GV0A 4PINA 2Y0DA 3CVYA 1J8FA 1Q44A 3PNBA 3L4BA 4NBTA 3UMGA 4JNKA 5AKIA 2WPDD 4QC2A 1YQ9A 1XTVA 1KDZA 1LPOA 1LSJA 4EI8A 1UPCA 4I3FA 4ETMA 2JFZA 1TYAE 5FEMA 2AD5A 4CW7A 1E2DA 2XUKA 3RFCA 1C1HA 3F7OA 4KL8S 2PV7A 2UZAA 3HVHA 3HJTA 4C20A 1VE9A 2L19A 4L07A 1NVFA 2DPXA 3OFNA 5K3AA 3RVSA 4A0SA 1R8QA 4E7PA 2NPOA 2WNHA 3L07A 1YA4A 3L4BC 4DDWA 5HM8A 1T1JA 1ULBA 3VR3D 1MXHA 3UOAB 4FIDA 4MROA 5MFZA 4DLVA 1S1MA 1JDBB 2QIPA 4HJXA 4MI6A 5I7WA 1ICEA 4Q39A 2VG8A 4A6XA 2E4ZA 1GA1A 3I2KA 1P4JA 4AUNA 2FPSA 2ACWA 5M29A 1EFCA 3A9RA 5IP5A 2X2PA 1T4GA 3HY6A 3IQWA 3LXXA 4MVXA 1LBSA 5JSKA 3NONA 1DS6A 3T3HA 1FP6A 2F67A 2AWOA 2BHNA 2OCGA 3FKQA 2X2OA 3JASB 4RS4A 2FGJA 4TXLA 4FGSA 4CIDA 4MLDA 3EWSA 4FINA 5FLEX 3T41A 4N1AA 5K01A 3CR8A 1TVEA 2Q3JA 3BOSA 3KQVA 3KVNA 3PVSA 1FQWA 4LV6A 1JECA 1R5BA 2P9ZA 3BIFA 3GLKA 4TLMB 3AVOA 2GF9A 1IPHA 2MSNA 2Q5CA 3PENA 2Q2NA 3WRVA 5G3ZA 3PGXA 1U28A 2X8JA 1N2ZA 3FH0A 3P9IA 5ALWA 1GQFA 1YVUA 2IYFA 1P6QA 2PXAA 1DTEA 2ONJA 1TK9A 2PD4A 3RUEA 5JH7B 5L3QA 3MJEA 4FD2A 3WLOA 2CDAA 4N39A 4RVCA 5CAEB 4OL0A 4JVOA 3F6EX 4D0LB 4P08A 1E2QA 3T52A 3ZHUA 4EYGA 5CG2A 3MINA 4TV9B 3U5TA 1DKMA 1Q0RA 3L8CA 3BQ9A 3OTWA 3W5IA 1QMGA 3BD7A 2JGKA 2MR6A 4A9AA 5EJ4A 5BMOA 4QYTA 4KEAA 1GNVA 1V7QA 1VPLA 3MLAA 3JARB 1T8SA 2VVTA 1QGOA 2NG1A 1RVV1 3B6MA 4KACA 3L1JA 5EVCA 5ESDA 3UENA 4GG1A 2NZXA 3AY6A 3AC0A 3VR5D 1T6ZA 2BFBA 4ZVPA 1Y7TA 3K4HA 2YR0A 1FJ2A 4LZLA 5CLJA 1SU8A 5EJ8A 1SOAA 3OEHD 4G01B 4KX5A 5AQEA 4KUGA 1Y5MA 4M86A 4U7TB 3MCAA 3R3XA 3BSSA 3OICA 5KI6A 3MOIA 2PMWB 2IQ5A 1UJBA 1UKBA 1VMIA 1NW7A 2MTBA 3M6UA 4ZI5A 2NVOA 4JI5B 1QO0D 1IBSA 1X8JA 1TZMA 1ZIDA 3L1HA 2FWMX 3TDMA 2JCYA 3WIVA 4J9VA 3GLHA 3Q2KA 4PRZA 3C87A 3BCHA 3P2YA 2EYUA 1J2RA 2PR7A 3VDRA 5A9SA 1OWMA 2Y4OA 4LYFA 1KJ8A 4OHMA 4BO6A 5CDYA 5CUQA 1ZJYA 3EIUA 5KQPA 1I3OA 1U7XA 1JJ7A 1PS9A 3U7FB 1BU5A 3KQNA 1LRJA 5KWVA 2SKCA 2IPNA 4DCSA 1Y7LA 1THZA 2HT1A 1CYEA 4OK6A 5A9RA 1N32B 1U0RA 2BFMA 2RGCA 1GHTA 2H1LA 3IUEA 4RYLA 3PUZA 4M9ZA 1G8SA 1OFIA 1ORRA 4RK6A 5A0VA 3ZJ4A 2A0WA 1F12A 3UAWA 3ZWAA 1QLWA 3AJ8A 3ST7A 4ZYZA 1CRPA 4JJKA 4TVOA 2ZATA 3DTNA 3NBAA 5KNLA 3JRWA 1VE7A 2HM7A 5C1DA 1GGMA 3NM6B 1DDOA 1MIHA 5EJ6A 3K8QA 1ZVJA 1GU0A 1GZSA 2CEKA 4ZV7A 3TZCA 5AW1A 2EDAA 3N8HA 4PSVA 4EKYA 3W5BA 1KJWA 2GZRA 2JFXA 1A7JA 1M2KA 4E2WA 1ZD2P 2I22A 2W4QA 4J7XA 3R7WA 5LA6F 1VBKA 2JAWA 4BGIA 5BN5B 4M54A 5DNWA 5BUZA 2AG6A 2NV2B 2RKOA 3GJSA 2P4HX 1DUIA 3G49A 4WCFC 2BCEA 4K9NA 4OXIA 4X1KB 3LWDA 2C57A 3B5IA 1ULUA 2X6RA 4NENB 1Z5GA 4PLPA 5I47A 1AUXA 3DBOB 5LQCA 2AKAB 4BQEA 4UEKA 4WBSA 5IRCD 4EHKA 3EF1A 4JB8A 3AF0A 1B0PA 1WXEA 3IQGX 3OETA 2EG5A 4CR8A 3TL2A 5JFGA 4R54A 5A0FA 3LUAA 2JBAA 1G2OA 2WLSA 1X7WA 3BYZA 4MUIA 5TX7A 4OHFA 5AVQA 2RHCA 3HBFA 4O4HF 5DBIA 2HI0A 3G2JA 4HH4A 1ZXLA 1J22A 4RXTA 1E7SA 3ELBA 4DQXA 3NKVA 4DYHA 4FM9A 3L7MA 4TLLB 2C98A 1AUQA 3LY5A 2J3HA 3FOCA 4TVSA 4HB0A 4YP7A 2XWPA 1W44A 5AW7A 2JG3A 2QMQA 4RA6B 3IP8A 3KOUA 3ZC3A 2A5JA 2PX3A 3PC8A 3ACBA 3WJAA 4YACA 1E4VA 5G0WA 2H63A 2H5IA 4KRFA 2I7VA 2I54A 2QPOA 4WKPA 4MVWA 5DP2A 4B71A 4G5QA 4CMBA 1I3NA 5LZ5A 2ZYUX 3CLRC 2R6R1 3HWRA 1MO4A 1KI9A 4OXYA 1W52X 2IRWA 1S3FA 2VP2A 5DI3A 3MIZA 1DINA 3CMMA 2PBZA 3LBFA 2NSHA 4AMYA 3CUSA 1FFXB 1BX3A 5IEJA 3K20A 3A05A 5FO0A 3PFWO 2R1ZA 4HYYA 4MUEA 4PICA 5EPUA 1SVLA 2B7LA 1N2IA 1NMSA 3KIPA 2DQYA 4Q4CA 5AHRA 5BW5A 1ORTA 3EHDA 3KZMA 4W5WA 2H07A 4J0QA 4ND8B 5IM5A 4R1LA 2XNCA 1V0JA 1IATA 4OMCA 1UDXA 2IDZA 3GVIA 4NH4A 4ZOCA 3PBKA 1XZBA 1KBZA 3GRPA 3DOIA 3GRFA 3GXOA 2QL5A 3VTKA 5IAGA 4YAUA 1RC0A 1Z2NX 2E4XA 5JCJA 2F55A 3FTNA 3SOPA 3WBKA 1XDDA 5DTIA 5IFLA 2PQ0A 3OMWA 4QKQA 2CUKA 4Z1MA 2EJUA 1DKOA 2FZ4A 1EP2B 4J49A 4UHBA 5DXAA 1AZSC 1YDEA 4LSMA 2NZ2A 2HSEA 4MAFA 2XV1A 1U9YA 2P0EA 2JAUA 5CFMA 1DGQA 1N6KA 3GOQA 1U1GA 5I3CA 3CLSC 2JLWA 1IM5A 2BP7A 3SC2A 3GIWA 2QG4A 3QFHA 1IPEA 1DJPA 4O6VA 1QTQA 4LWQA 4OQNA 2GZHA 3S40A 1U9IC 2VO1A 2A5GA 3DG9A 4BNTA 1NYRA 5COBA 3D2AA 1SQ5A 3GV0A 5A71A 4C4YA 1GL3A 5B1HA 4I36A 1GQQA 4DABA 5BVHB 2P0YA 4XJVA 4KE6A 2CFCA 3R3JA 2CF5A 1YJBA 1Z12A 3RUIA 3KJQA 3JR3A 4BS9A 2XVAA 1UM9B 2GQ0A 3OT1A 2SKEA 1JXAA 2QMEA 2QVCA 1KAQA 3EFBA 1GDHA 3A6DA 3F4BA 4OJNA 1KSGA 4A16A 4EA6A 5ARBA 4M1MA 1BTOA 1DWQA 3NHPA 4CKEA 3COSA 5H1YA 5BR1A 1X86B 1ZJ6A 3FF1A 5HOQA 3NBQA 3RH0A 1E59A 2DSTA 4W5OA 3ANTA 4WL0A 5KTOA 1EFUA 2R6CA 5KMGA 4JEHA 4OYYA 3KQSA 4P58A 4RTQA 3NANA 4L9RA 3RT7A 1QAOA 5KEIA 5ES4B 5LPNA 1N7IA 1P62B 1W2HA 1HDYA 3AFMA 3L4SO 2HF8A 3V7WA 1S2OA 1K6JA 3H0CA 2JJ2D 2WJIA 4N8EA 3RS9A 3VV2A 1Y7PA 4H1UA 3ZNQA 1ISFA 1FDRA 2AMYA 4V03A 3ULKA 3L7YA 3U4IA 4MQFB 5KNDH 4G24A 3QFSA 4GYKA 4HEA6 4WACA 2CXHA 2O3SA 1UJ6A 4E33A 5FWXA 3HU1A 3S2EA 1NN3A 1QH1B 1PO7A 2J0VA 5CNIA 4ZU1X 5EMKA 3KJHA 1OGYA 2P7HA 1WIWA 4KRXA 1ZUWA 4LX8A 4QASA 4B6SA 4LNUB 2GESA 2JRCA 3DAFA 1F17A 4I1VA 2FWRA 3WHKA 3X1XA 3FSJX 2B4KA 1NG9A 2EW8A 1PFVA 1ZICA 1LSUA 1A9OA 3O6VA 3K0FA 3GT0A 4QBHA 5FKJA 2C29D 3W8DA 5AW6A 1CEQA 5L6LB 5FEUA 1PZMA 1Y34E 5EE3A 5EP2A 1KSJA 3PNVA 1N5RA 5BOVA 1FIUA 5BSVA 2AW5A 1L4LA 1T5LA 1W94A 3HZZA 4Q12A 4WK6A 1RJFA 3AGPA 1A77A 1JDBC 1WZEA 1XR3A 2CJYA 3CZ4A 4UBIA 5DYIA 4ZAWA 3UV6A 5LLSA 3TZQA 3BMNB 1GG5A 4LA4A 3TIIA 3AYZB 3A4YA 4FYPA 4P33A 3RYIA 4YP5A 3UHFA 3WL5A 3AU9A 1Q57A 3ZDDA 4GWKA 2O8NA 2XB4A 3L02A 2H65A 2WF8A 2R6JA 3P0IA 3RS2A 1Z5WA 4K46A 2R25B 4HDRA 1JFLA 2RBGA 3TMYA 3BE5A 2I2WA 4BZQA 1EE1A 1YAJA 1C0IA 3B1XA 4IHKA 4YBRA 5E9JA 3TECE 4GE0A 4NESA 4TWRA 5BURA 2I4OA 2GXSA 2RFLA 3W7VA 2G71A 1RBZA 3M2PA 3OLCX 5F1PA 1VZ3A 5JZOA 3WK6A 5IVKA 3BL5A 2IEGA 2VSYA 3GP3A 4OYRA 5G1PA 2NW6A 5CB0A 3PRKE 1ONPA 1ZONA 4UVEA 2IX9A 2FLKA 1Z7WA 3EXIA 3TFOA 4YRSA 5CFLA 1QU2A 2OY0A 4IIGA 3GLRA 2Z6UA 2Q9BA 2YMLA 4J2TA 4FILA 2ZWPA 3V42A 1JI3A 4AJ4A 4B45A 5JALA 5KJCA 4U7FA 2ZREA 3OOEA 4LY9A 1NXSA 2W6QA 1CB0A 1S8FA 5IJWA 1CRQA 1UWLA 1XVUA 2B30A 3UC9A 3FFXA 1JIUA 1HZZA 3JQFC 1N2OA 2QAIA 4CFYA 1M1NB 4WZAB 1C7IA 3QXSA 4NJEA 2PZFA 3LBYA 1JB1A 4ZDKA 3N2LA 4LF9B 1AKMA 3GP8A 4ETWA 1C9YA 1CC1S 2Y9MB 1R8YA 3I0NA 4K81B 4FGLA 1X1BA 2BL4A 3KVRA 4J3FA 4ZO4A 5EWJA 2HLDA 1IPFA 3HP7A 3OFND 4Q3DA 4ZVKA 3KOOA 5UKDA 3TSOA 1DUSA 3IIIA 4A6DA 2GN2A 3UY4A 4BRZA 4K6FA 3Q6MA 1R5OA 4RHTA 3C48A 2NXCA 2QMHA 5DWDA 5CA1F 3DZHA 2IXBA 221PA 4XD2A 5TF4A 3UICA 4CG0A 1AO0A 2CLMB 1TM4E 3OT1B 1W9MA 3FUWA 4A1OA 3VYSB 4L5AA 2WJPA 2XNSA 4W82A 2OAQ1 5I4IA 3WTCA 2B5WA 4BJ3A 2JLUA 2DULA 5L4NA 3PXAA 1S4MA 4LFAB 4G0OA 4IGAA 2YYZA 4LZPA 2XJ9A 3I5AA 3GRKA 5ALSA 1J5PA 5E7JA 5K45A 4GSYA 1YJXA 2ACKA 2VP6A 3R5TA 4PX5A 4B4OA 2IZ0A 4JROA 4PVCA 4UHCA 5IUKC 3ENZA 5JCOC 5KOIA 2XYVA 1KSHA 1AQUA 1R7RA 4J07A 3LBAA 3NFYA 3R77A 3GUZA 3H5TA 1N5KA 2Z3VA 1WXGA 2XUIA 3MRTA 3PYXA 5B58T 1U3UA 2DBVO 1K8YB 1I3CA 2R1VB 3B7WA 1YVDA 3T3IA 1ZK1A 2JGEA 5DI3B 4Q05A 5KHOC 3DOCA 2B1IA 1OB5A 3M4NA 2A8YA 3ND5A 2OXEA 3G1WA 4XTCS 1QP8A 1L4FA 2ZRBA 2K2WA 2H9IA 2PSEA 2YIJA 4G8DA 1HZJA 3CF4G 4YJ2F 1KI7A 1EH5A 3WQRA 3K9QO 1FBNA 2XCIA 4I50A 4WY2A 1QJCA 7ADHA 4HVCA 4KU4A 3CBGA 1DJNA 3IMKA 3LCMA 4FE3A 4NMLA 2QN9A 1XZLA 2GF2A 2BJWA 4LOHA 3C8ZA 1PG5A 2BKEA 3V32A 3EDMA 1V9SA 3TIXB 2VPPA 4GM0A 3ZE7A 4KXVA 1Y3FE 1UJMA 1D0SA 1YGYA 4TUYB 5CJPA 3G2NA 1JG7A 3T9EA 3GJ0A 1EM8B 3HDGA 4JLWA 5HGXA 1WULS 1OFGA 1X15A 3A9UA 4XCVA 1X8KA 5CLQA 3E9NA 4ROTA 1E92A 1K6IA 2W00A 2VJCA 1IY0A 2YV2A 2ZM6B 5JFOA 1UPAA 2V7GA 4MUJA 5F73A 2GS9A 3O2JA 2QTZA 1U1EA 2B82A 3AESB 3C8MA 2OB2A 2WW8A 4PS1A 3RV3A 1XT6A 4ALLA 5KSZA 1GZHB 3BGDA 2MSEB 4AJLA 3F4LA 3REOA 1DWPA 5I7EA 2RD2A 3QXHA 2QMYA 4CEJB 3ZJVA 1ZD9A 3BEOA 1J07A 1W1UA 4OK3A 3GC6A 3ZDYB 2O0KA 3LT0A 1U5AA 1BFKA 3TXAA 1F7UA 3GY0A 3UPUA 1QHXA 2JFYA 1ZGBA 2ZI4A 3C3YA 4BCDA 4Y6GB 1T2DA 3F1LA 4GKJB 2FPUA 3FHTA 4ND4A 2YVUA 2HO5A 4JKIA 1JG4A 1ZD8A 1JSZA 1VA5A 1XRNA 2GK7A 4PO3X 3CPJB 3S0JA 4MDHA 1T29A 3VJKA 2OBNA 1VGVA 3ESRA 2FF7A 3COVA 4YIHA 4HNUA 2PH3A 4PBSA 2BUAA 3L7CA 3TBKA 1Y5NA 3U4HA 4IINA 2JB9A 2NACA 2HHCA 2X9GA 3KHKA 3G2QA 5AO9A 3TKLA 3W0LB 3Q98A 2C5AA 4IZOA 4BN0A 3MS2A 2QS9A 2R7KA 4ZVRA 3RFTA 1YZKA 4PF1A 5DTMA 4CLOA 1FPQA 2PWYA 2ZI5A 4G25A 1L4YA 3F49S 3ETNA 4NULA 2C2OA 3O8OB 3S1SA 3AWIA 1FQOA 2G9VA 4MAAA 4AYWA 5TEWA 1PN3A 1G38A 1EXMA 2QRNA 1C9MA 4DJEC 1PX2A 1VLZA 3IUNA 4MYHA 2PIAA 2VF5X 3FCEA 3WZLA 1WHTA 3EVAA 2GCEA 4BX0A 4P4SA 4TM8A 2OFXA 3ZYZA 1RE1A 1IZ9A 4E32A 9LDBA 3MXTA 1A2OA 2ZWOA 3H4MA 4MRVA 1JH8A 4PNHA 2DTEA 2OLEA 2OXFA 4L4RA 4MP6A 4OB8A 1ULAA 2IP1A 5ITVA 2D5CA 1IOVA 4Y0AA 3X1JA 1FRFS 3IKJA 1A9RA 2WU8A 3ZVLA 5AUPB 4D9GA 4IEIA 2YINC 3WWPA 4C5CA 3IEIA 3R20A 2DERA 3DXZA 2C2YA 3GRAA 3C85A 3GT3A 3HNRA 3K70D 1LKZA 2HWYA 1BSVA 1EFAA 4WV3A 5BO5A 5B12A 3VO2A 1GTVA 5EXTA 4CMIB 4P22A 2D7DA 5AUOB 2JAHA 4YRIA 1Y1PA 2YX1A 5HKLA 4YBZA 2HYDA 5FBLB 3FPAA 4C7JA 5BWNA 5AVXA 1ABBA 3BRWA 1K97A 1KRHA 1WQ4A 4XWYA 5BWLA 4LJ4A 4X3PA 1CUFA 3K8YA 2DXIA 4QPZA 4IIXA 4JB0A 4D8VA 1V16B 2CL5A 5DMHA 2FPIB 4Z3KA 1TMYA 1JQ3A 1OA1A 2X8AA 3QEMA 2VN8A 1ORVA 3DL4A 2VUTA 5DGXA 4R98A 1Z6YA 1SB9A 2ZGVA 2WKQA 5TVKA 3K0BA 1OXKB 2XQJA 1DOHA 1V7CA 2NQ2C 4R3WA 4X3OA 1JDJA 5BQXA 1L5KA 3K5HA 6ADHA 4IJMA 1RAHA 3NZEA 1FFDA 5FLYA 4LOLA 4NCBA 4PLGA 4II2A 1K89A 2DE0X 2ERYA 2F3SA 2W2OA 3OEEA 4A8PA 4Q02A 6YASA 1GR1A 4OLBA 4MUNA 3EIFA 4MEBA 3ZCTA 1JKMA 1OUMA 3FWYA 5EZ5A 4TMYA 1XZFA 1Y4SA 2PL5A 4IZ6A 4JBNA 3JQ8A 3RIEA 5I6DA 2YQ4A 1KO4A 3DMPA 1NU8A 2AS0A 4FK8A 3R7FA 1YQXA 2F48A 5KDLA 5BQ3A 1QH0A 3KUKA 1KO5A 1EVIA 4FX2A 4QTXA 4RIGA 3LLSA 2IP4A 3HKDA 5L40A 2VDPB 1G8AA 1XNHA 2H48A 1CQIB 2R68A 3G0DA 5CVDA 1EBBA 1P77A 3VJRA 1F8FA 2EQ5A 3Q5GA 1MG5A 4TT3D 2NZJA 4BCBA 1LXCA 1O9GA 1JXQA 3JQAD 4RLHA 5MGNA 1WZ2A 2WVHA 2GYYA 2JD0A 4DDUA 1CY7A 2R6HA 1FXUA 1NJ8A 1P9LA 1V25A 5ERXA 2NUBA 1KWKA 3T7DA 3U48A 1D6SA 2EX4A 3WGNA 2R6DA 1HK7A 3X1MA 3JD1A 4XVCA 2WLTA 3G2OA 1UJ5A 2AN9A 2DOKA 4FYKA 4M0LA 1RJGA 4PFJA 3WQQA 3LO5A 1LBQA 3GAZA 4ZARA 2BEKA 2JHFA 1LD3A 5KPJA 1E61A 4TKZA 3W2IA 2ECOA 3LW7A 3NM5A 3GRZA 1CQPA 1TI7A 3NWOA 4QTTB 2PFKA 3LTNC 2FLWA 2WM9B 2FMIA 1RPNA </