2ZQZA

R-state structure of allosteric l-lactate dehydrogenase from lactobacillus casei
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
312
structure length
307
Chain Sequence
DKDHQKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAPTRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Active and inactive state structures of unliganded Lactobacillus casei allosteric L-lactate dehydrogenase.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
total genus 113
structure length 307
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zqzA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2zqzA02
3TFQA 4PLFA 1EDZA 1B7GO 1P45A 3GPIA 4ZHSA 1E7MA 1X0VA 4HV4A 2C07A 4ZJUA 1OC4A 4HP8A 3VTFA 3CH6A 3OSUA 2DBZA 2EF1A 3O8QA 2O2SA 3OJEA 2A4KA 4RQUA 1S6YA 3WGHA 3ZU4A 2GN6A 4NBVA 2DTEA 4DQUA 5F1OA 1B16A 3B1FA 2I67A 2VHWA 4WKGA 3TZHA 1Q1NA 1PJQA 3WLFA 2AE1A 2W4QA 4XZ3A 4AJHA 1UH5A 1YO6A 3AW9A 2OBYA 3ENKA 3HDHA 4DPKA 1EEHA 4CLDA 2PD6A 1XELA 2X58A 3I9JA 1D3AA 1MXFA 2Q4BA 4OKIA 4CM1A 4D3SA 3KVOA 1E1MA 5JO0A 3WS7A 1NFQA 4M86A 1C14A 2G82A 5BNIA 3JQGB 2EW8A 4BNVA 1HL3A 1OAAA 4DPLA 2DBRA 4YT2A 3PI7A 3AM5A 1E6WA 4R1NA 1QV7A 1DOHA 4HY3A 3VKUA 3KSUA 4IJKA 1KEUA 4U6QA 2CFCA 1GL3A 1GQYA 3E82A 4PLCA 2C2XA 3L6DA 1B8PA 3DHYA 4CR7A 2VRCA 4IZHA 3AI1A 3NTQA 3VPXA 2CF5A 4NG5A 1LDBA 5JMWA 2Q1TA 3AI2A 1WAMA 2G17A 1KBZA 2BF7A 4PLHA 2OHXA 1XU9A 5BQFA 2GPTA 2DT5A 2ZCUA 2J3JA 3MJTA 3NV9A 3SC4A 2D4AA 1I3MA 3RKUA 1GZ3A 3PJEA 1VM6A 3OICA 4WJZA 4FD3A 5GZ3A 3M2PA 4IDFA 1SPXA 5JO9A 5FEUA 2Q99A 1DO8A 1UR5A 3RAJA 1GQQA 3ENNA 3WTBA 1QYDA 4R9RA 1WP4A 3RBZA 4NBTA 3WSWA 3AUTA 3ROKA 5JCXA 3WXBA 4PRLA 1DBVO 2IRWA 3O38A 4BNXA 2HK9A 5THQA 4LCJA 4K9DA 1PS8A 1V9LA 4BNWA 1GV1A 4XYMA 4YT4A 3ABIA 4E32A 5G0UA 3WBBA 3OFSA 3ZNNA 3R6DA 4GAEA 2NADA 1ZNQO 5A9SA 1Y8RB 5C7LO 3QV1A 3WFIA 3HE3A 4FOOA 5JC8A 3BZUA 4R1UA 4D3DA 4JNKA 3MZ0A 1C1XB 1DIGA 3C85A 1G6KA 1KS9A 1JKFA 3C1TA 1XHLA 3IAHA 4GSKA 5DNAA 3DMYA 4EDFA 1LLDA 1PL6A 2D5AA 4N5LA 2CZCA 3QE3A 5JDCA 4WASA 3A1NA 1W4ZA 4IQGA 2HK7A 1UDCA 4XWYA 3JQ8A 4OIMA 3E8XA 3ETGA 3HQ4O 5IZ4A 2NQTA 2H5LA 2UUOA 3KHUA 1HE4A 3E5RA 3K9QO 3ZW9A 1WNTA 2V6GA 1LC3A 4BKQA 4GQAA 3DFZA 1Y7TA 2GGSA 2ZJ1A 4LGVA 4I9HA 2ZTVA 3BTOA 1NBOA 2FP4A 1LQTA 4FIZA 2D8AA 5CEFA 4BNZA 1LNQA 1EBUA 4O1MA 2Y68A 2Y93A 2UVDA 1IOLA 3PHGA 1K89A 1UZMA 2WEKA 2AG5A 4U0JA 3LC7O 5TQVA 4OQZA 2JJYA 4G81A 1N5DA 4XGKA 5AYVA 4LRTB 3K5PA 3VC7A 1HKUA 1I2CA 2NVBA 4DWVA 5B4TA 3FR8A 5KKAA 3ADPA 1AHIA 4AJJA 1B26A 2A9FA 4Q3DA 4FGWA 3ETEA 5L51A 2HMVA 2ZIZA 4PLPA 4KQWA 3S55A 4TKMA 4BB6A 3HB4X 4PN3A 1EK5A 3VVBA 4TKLA 4RPGA 1IYZA 3ZWXA 4E2WA 4S1VA 2Y67A 5ADHA 3KBOA 4GGOA 4DIFA 3HZZA 3VPGA 5HRUA 3DZIA 2Z1MA 4J43A 2VTEA 1BXKA 1PTJA 3BMOB 2I3AA 1QV6A 1A7AA 1ZH8A 3EY4A 5ILOA 2B36A 2DAPA 2Y1FA 2X8LA 4ONEA 4D0SA 1HYEA 1U4SA 1H9BA 1DLIA 1XG5A 1X1TA 4JGBA 1ISMA 4A2CA 3QRWA 2J3KA 1MUUA 5F1KA 1WZIA 4PRKA 1P77A 2D59A 2PD3A 4MJLA 2E48A 1D1SA 1GYPA 1YOVA 4W82A 1DIAA 3WR5A 3GUYA 1P0FA 4FFRA 3Q0EA 7ADHA 1KEPA 4Q3AA 5I9MA 3VDQA 3GA0A 5I7VA 3E5MA 3NTOA 4MP6A 1XGKA 3D3WB 4MIEA 1KVUA 4NQZA 2CDBA 5F5NA 5JDCC 1VKOA 1Z7EA 1YDEA 2VRCD 1PZEA 3MTGA 3PVZA 3GC6A 4ZQBA 3NDIA 2XXBA 4PLWA 1JAXA 2GN8A 5L7WA 2PZJA 3TNLA 2C0CA 3ZZNA 1VJ0A 4NMHA 4J2HA 1GU7A 1GYRA 3JQEA 3KSZO 1A4IA 4CJXA 3O9ZA 1PQPA 1YL7A 1O89A 4WLOA 4PVCA 2AE2A 2AEMA 1Y5RA 1DIRA 2WYWA 1BVUA 2OMEA 1GUFA 1UXGA 1YQGA 4MP3A 2W2KA 4C7KA 5KKCA 4KOAA 5K6AA 1RJWA 1UDAA 2PZLA 2Q4EA 4NH4A 5KIAA 4W99A 4XDYA 1T4BA 2PWZA 2ZJ0A 4FFNA 4UVGA 4XGNA 1PJCA 3T7EA 4BL5A 2AXQA 3LK7A 3G3EA 3RVDA 5COQA 2J5QA 1J49A 3VZRA 3RWBA 5G4KB 1U3UA 2FPGA 2FSSA 4PLVA 3TN7A 2FPIA 2EG9A 5JPIA 1HDZA 5BR7A 3EVTA 1NQTA 2OO5A 4NBWA 1B0AA 1CIVA 1IHXA 3MOGA 4GH5A 4MPDA 3UH1A 1T24A 2QRLA 4FC7A 4GX0A 3GDOA 2IXAA 2VHVA 3EMKA 2GERA 5F5LA 3HFSA 1YQDA 3ZN2A 5GY7A 1PS0A 1FF9A 4WLNA 3QWFA 1J5PA 2DVMA 2NLOA 5EQFA 2YJZA 4E0BA 4XJTA 3QHAA 2AEJA 3OM9A 5CDTA 1FK8A 2PV7A 3PWSA 5I8ZA 2Y0DA 2FR8A 2JFHA 4J1TA 4A03A 4CLOA 1PGJA 2HMUA 3NUGA 3VTZA 5IZCA 3INGA 1A9YA 1PJTA 1BXGB 2OL4A 5COAA 4Z0TA 2JHGA 3KYCA 4DBVO 2HSDA 5MGBA 4ZRMA 1JTVA 3UUWA 4EUEA 2E37A 3PWKA 4YT5A 2PA3A 4R1TA 2O3TA 1T2CA 3D4NA 3DONA 1XLTA 3W8EA 1M75A 1ZK3A 1WXDA 1EUDA 4II2A 4RQTA 1ZJYA 4R1SA 4U8GA 5IXYA 3EZLA 4IJWA 4ESOA 2A92A 3WG9A 4EUHA 1JVSA 3GDGA 3RD5A 5A4DA 1CJCA 2NU9A 1ENOA 5TT1A 4B4WA 1N9GB 1G1AA 2X5OA 1I2ZA 4UEKA 2LDBA 3SX2A 1R12A 3ZDFA 4JBIA 3ZH2A 5K6AC 2BFMA 1DIBA 4NBUA 3JQ7A 4LSWA 3U09A 5IN4A 4WCFB 3OBBA 3QVTA 1IHYA 1A72A 2HDHA 3WGTA 4D46A 3SXPA 1CETA 1WVGA 3ONFA 3G79A 4MKXA 3RBVA 1NVTA 4BO3A 4IQ0A 4BGUA 1ML3A 1OC2A 3AFNA 3DOOA 3A4VA 4WEQA 1EUCA 3PGXA 3UGKA 4KTVE 3GFBA 4B3JA 1QYVA 3MJCA 5DN9A 3R3SA 5CEEA 4I9UA 2EGHA 2FWMX 4IMPA 4L76A 3QWBA 5AXDA 1KC3A 1EBFA 2I9PA 4E13A 4YVFA 3VH1A 2FPPA 1DPGA 5JAQA 1Q2XA 1P74A 1SEPA 1DFIA 4DIOA 1CWUA 1DC4A 4EJ6A 1S7CA 2JHFA 4JP3A 2PH5A 2IDZA 3K96A 3QVOA 4BNFA 4R01A 2JD1A 3QVWA 4I1IA 1KEVA 1BXZA 4HNHA 4B8ZA 4QSMA 4IDGA 1HDRA 1NAHA 5CDYA 3PWZA 3V8BA 4CQLB 5DBIA 3QA9A 2ZB3A 4NFHA 5EINA 3TJRA 9LDTA 3DAFA 1LI4A 2H63A 1ISFA 3PYLA 1PGNA 4PVDA 1WMBA 4NK5A 5HWSA 4NHEA 4J7UA 3BHIA 5TLSA 2X5KO 2QZ9A 1W6UA 3E9NA 3BHMA 4PZEA 3BAZA 1TB4A 4IMRA 3RROA 1CQJA 1K6IA 3RUIA 3CMCO 1U2GA 3NX4A 3PPIA 2BGKA 4FQ8A 1JDJA 4KTTE 1XWFA 4DMLA 2GLXA 4FFLA 2EXXA 3WB9A 1U28A 3Q11A 2VWGA 3TZKA 2GDZA 2QRJA 1JKIA 2YHIA 2NVUA 4BO1A 2A35A 1LA2A 3L4BC 1W0CA 1O6ZA 3IP1A 5IDWA 3H7AA 3ITKA 4YJGA 4IGEA 4L4SA 1I3KA 3AUUA 4BV8A 3QJ5A 5ER6A 4GKVA 5IN5A 4BNMA 3C1AA 2YHUA 4ZQGA 4ND5A 1P1JA 2J5RA 4Z9YA 4WGGA 2C5AA 3F5QA 4OXKA 5F3RA 2BKAA 3BHJA 2I66A 3GN2A 2QX7A 5B4UA 2A94A 1GZ4A 2Q46A 5A3VA 4E33A 1ISGA 3FPLA 4B79A 2ZB4A 1EZ4A 4DUPA 3CEAA 1A27A 1R0LA 4BGVA 1HLPA 1PJSA 2GN9A 4A7PA 4AJOA 4CM8A 4CMIA 3S8MA 3WGIA 1NM5A 4CM6A 1A7KA 8LDHA 3BMNA 4N5NA 5I7EA 5JAIA 5K9ZA 3P2OA 3GVXA 4TZKA 3MTJA 1OFGA 2TMGA 3U4DA 1NYTA 5JMPA 1I01A 3U62A 1UZLA 1DRWA 3HN7A 1LLCA 4UVEA 4DLAA 3RI3A 1GCUA 3DEYX 3ZV6A 3LT4A 4NNJA 3INTA 5C3MA 1ENZA 2ZQYA 1X7DA 4N54A 3RU9A 2DU8A 4CV1A 4GKBA 2Y1OA 2BFAA 5KNLA 1WZEA 4YR9A 1NP3A 2Q2VA 4PG6A 1F12A 5KCZA 4FFPA 1IY8A 1KY4A 1UAGA 3KSDO 4EITA 3DR3A 2DFVA 2PNFA 1DAOA 1NHGA 4EJ0A 2YDXA 5ENDA 1CQIA 3EZYA 3WGGA 1M6HA 4Y6SA 4K1LA 3PHIA 4UUOA 2X0JA 3O8QB 4Z0HO 1LLQA 4AJ2A 1JQBA 1V6AA 2CMDA 1YB1A 2P2SA 2PGLA 1IPEA 1SBYA 2DPGA 2GD1O 2J3IA 2O4CA 1KY5A 2HO5A 1FDWA 4ROSA 1Y8QB 2V6MA 3LYLA 3OMLA 3UCFA 3V2HA 4YXFA 3C3XA 4NJMA 1V3TA 4FGSA 4IXWA 5ITVA 2JD0A 2UV8A 1DIHA 1H2BA 5TC4A 3ZWVA 2D5CA 3R3JA 1CERA 2FZWA 3RQSA 3WJ7A 4CL3A 2PFGA 3KUXA 3I3OA 5CEJA 2WM3A 3WNQA 2I3GA 2P9CA 3ZV5A 3RKRA 4NPCA 1ZSYA 3QWIA 1ZSNA 3GGOA 4D42A 3ICPA 5BNFA 5ENVA 1ZSVA 2CF6A 2GR9A 9LDBA 2OUIA 3ZWOA 5JDIC 2ZKLA 4CR8A 1RM5A 5KTKA 2NTNA 3F4LA 4RPLA 4NU5A 3K8ZA 1PGQA 2NU8A 3UCXA 2G1UA 1E1KA 4WNIA 4F6CA 3GHHA 1SZJG 3GEDA 3V2UA 2VT3A 4L0QA 5IDYA 5JAZA 2VQ3A 1E7QA 1X1EA 4J7XA 3CPSA 3M1LA 1D7OA 1ZJZA 3FCOA 4RZIA 5ES3A 5F21A 3TOZA 3MJVA 3RUEA 3GDFA 4J1NA 3U0BA 4BO7A 3KEQA 4MVJG 4JCOA 2C54A 2ET6A 4TVOA 5EL0A 1F8GA 5JCJA 4CQMB 3ANMA 1VLLA 3AU8A 1FDTA 4PIVA 4H3VA 1JA9A 1UXKA 2E82A 5ICSA 2E49A 2BD0A 1WDMA 4J1QA 5DT9A 4ND1A 1P1HA 4OSPA 5JE8A 3PJGA 1PL8A 3AJRA 5T57A 4Z3DA 4GGPA 5FI5A 4WLVA 2RH4A 1WMAA 5KVQA 1MGOA 3IIEA 1EVJA 4CM4B 1PJ2A 4TRJA 1TT7A 2PZKA 4GWKA 5HS6A 2ILTA 3OJFA 4RPJA 3JQAA 4YAJA 3WGOA 1K6JA 2ZTMA 4J4BA 5C37A 3ZV3A 4WE3A 2RHCA 4EUFA 1NWHA 3NAQA 4E5MA 3WMXA 5A3JA 4UVDA 5DP1A 4CUZA 1MP0A 4ZA2A 3Q1LA 1MFPA 4LMRA 3TDKA 4N7RA 1ZMOA 1YRLA 3GAZA 4AVYA 2VZ9A 1GQ2A 5EPOA 1Y9AA 1T4DA 5BSEA 2YV2A 4ZQFA 1I0ZA 2VN8A 3PP8A 4HKTA 1EVIA 2Q1UA 3GT0A 1YJQA 3NDRA 1DJNA 1RKXA 3CE6A 1YBMA 4XD2A 5L4LA 4P4GA 3B6ZA 1H6DA 4E30A 3VHRA 1DC3A 3GF4A 1W8DA 3QLJA 4CMBA 3WOHA 5JXWA 3C24A 3ICCA 4CLRB 1WWKA 5BT9A 1V8BA 2CD9A 2P4HX 4LVCA 4URFA 3S2EA 5IJZA 4KWHA 3SBOA 1W73A 4CLXA 3DZFA 2Y1DA 1BRMA 4AFNA 5AOVA 4RORA 2C7GA 3FSRA 3KOUA 3L6OO 3OQBA 3RFTA 3TZ6A 1PEDA 2PLAA 3H6KA 2YV3A 1HF3A 2O3JA 3RBXA 2AQKA 3CZMA 2WE7A 1KYQA 1C1DA 2ZYGA 3QP9A 5TJ9A 2CDCA 1ZK1A 4INAA 2EKLA 4BB5A 3G1UA 3KM0A 3WQSB 3PDUA 5TIIA 3HHPA 1HT0A 4IBOA 2J3HA 4FB5A 1CYDA 2VCYA 3NT4A 5KWEA 1C0PA 2BRUA 3AY6A 3RFXA 1NWCA 5AXBA 2X1HA 1PJBA 2I99A 4Z0PA 1L7EA 4ALLA 4GI2A 4IY1A 1NPTO 4Q3BA 1LX6A 3WGQA 2PKQP 4J3FA 3H9JA 1F06A 1UDBA 3IMFA 1UP6A 1VJ1A 1GADO 2XAAA 1ZZEA 1GDHA 3EHEA 3KO8A 4YB8A 2ZCVA 3BMQA 1PU2A 3HSKA 4BO9A 2QG4A 3O03A 2GO1A 1X7HA 5TT0A 3DC2A 5TX7A 4YA6A 4JQCA 1MA0A 4R5HA 1E3SA 4GPD1 1BVRA 1DXYA 5HA5A 3JYPA 1WDKA 1YDWA 3FTNA 4BNLA 4JIGA 3U4IA 1MB4A 4GVLA 5KVVA 2Y1GA 1IZ9A 5G4LA 1ADBA 4AL4A 3GOHA 5A9RA 4RGBA 1ISHA 1LSJA 4BO2A 1DDOA 1ADGA 2H6EA 4IIUA 5LCXA 4B4VA 1DAPA 2I6TA 3N7UA 2IODA 2X9NA 3LC1O 4IS2A 4XB2A 4CLEA 4YCAA 2P5YA 3RC1A 2VRBA 1E3JA 1ONNA 3S2FA 2NVWA 5ITWA 2IZ0A 4TVBA 1OI7A 2PGDA 3IJRA 1J0XO 4Y6RA 2VUSA 3RUDA 1JU9A 1IL0A 1VL8A 1YL6A 3WJAA 2YY7A 3KLPX 1E3WB 3CUKA 3KTDA 1IUKA 4EBFA 5JCJD 1R0SA 2C59A 4O6VA 2C29D 1PJLA 4NR0A 3H5NA 4OHUA 1A4UA 1B15A 5L7TA 4M55A 4E5PA 1ZVMA 3EK2A 3GZNA 1YB5A 2RBEA 3W4IA 5H81A 1UXHA 2GN4A 4AJEA 3T4EA 3D4PA 1RYEA 4OH1A 3V1YA 2TMDA 3PZBA 3KYDB 1O94A 4UUPA 2FR0A 5IF3A 3SC6A 2JCXA 4DRYA 3D5QA 4OXYA 4A10A 3ORFA 3JQAD 1E5QA 1U1IA 1HETA 1ZK2A 3C7CB 4Q9NA 2DTXA 1PIWA 2JCYA 4KDFA 3DBLA 2JFGA 2C2YA 3R1IA 1LU9A 3WWZA 3MWDB 5DZSA 3D0OA 1E3EA 4DTIA 4QECA 4BV9A 1XKQA 1LDYA 2X7HA 5BSGA 2B4QA 3JQFA 1N7GA 2VZ0A 3FNFA 4L8VA 1H0KA 4PG4A 3G49A 5HBRA 5A06A 1AGNA 1Z45A 2QQ5A 5DDIP 5TGDA 4IQ8A 1ZKMA 2WE8A 2RHRA 4P38A 3WGZA 2FRDA 3JQGA 4TMFA 3GRKA 2X0RA 2BFPA 2O3UA 4MP8A 2X5JO 4NI5A 4E5KA 5A05A 1TLTA 2I65A 2XPCA 3GVPA 2HAEA 3ETDA 5T6BA 3GG2A 4ZU3A 4AICA 1LLUA 4DLBA 3W1VA 3I1JA 4HXYA 3KZVA 3RC7A 4EEZA 3CSDA 3CXRA 3JQ6A 4R16A 1I10A 5I8WA 5A02A 1ZXLA 1PZFA 2HMTA 4YQYA 3FI9A 1NQAO 1LEHA 1IB6A 1YE3A 4AJ4A 4CLHA 2HCTA 4YQZA 1ZK4A 2X9GA 3U49A 4P8RA 1V0JA 2BFOA 4J49A 4L9RA 3ZWYA 4BNIA 4J7CA 4ITUA 4W7IA 3H9QA 4JP2A 4KQXA 5HM8A 3H3JA 2BLLA 2RIRA 4RCVA 4BKRA 2YFHA 4MVJI 1EQ2A 2O7SA 2G76A 1TEHA 3F1KA 1YVEI 1NVGA 3GY0A 4JJIA 4QQRA 4DVJA 3FNGA 4YJHB 3BTVA 3JYNA 2PR2A 1OZAA 3GUCA 4OM8A 4BMNA 1P3DA 1WLYA 3S1LA 3B70A 3DDNA 3E18A 1MXHA 1E6UA 4YPOA 3RC9A 2VHYA 1BSVA 4KWIA 4K26A 1D4FA 4RVUA 4RVDA 3PTZA 5KJ6A 4TQGA 1ID1A 4PLGA 3H9GA 3FRJA 1R4MB 3E03A 1QP8A 1KVRA 4ALJA 3JQ9A 1Y8RA 3TFOA 1JWBB 1Y81A 2CNBA 4UUNA 3IJPA 3JYQA 2VNSA 1YJ8A 1C1XA 4QX6A 1Z75A 3IKVA 1WPQA 2IEDA 4ZQHA 1KVSA 1JVBA 2OP0A 3DOCA 3DWFA 3LDHA 4FBGA 1Q7BA 5T5QA 4OO3A 1NFFA 1EVZA 5FI3A 2E4AA 5FWNA 4BO6A 1FDUA 3QY9A 1KIFA 3OF2A 3H5AA 1PX0A 3H9UA 3GMDA 3WICA 1ZEMA 3GPDG 3ZCXA 1TI7A 4ZRNA 3B1JA 1B2LA 2FN7A 4WOJA 4J1SA 1SOWA 3JQFC 4PZCA 4FFMA 3WNVA 2WD7B 1NQ5A 2HMWA 4XRGA 3JD0A 4EGFA 5TSDA 4TZTA 3OP4A 4J0FA 3W8FA 4RDIA 5C7OO 1DC5A 3F6YA 1RM0A 2O48X 3MCVA 4F6LA 1I33A 4AG3A 1QMGA 5KJ1A 3I52A 5DBFA 1X14A 1SB9A 3GHYA 1E7YA 1VI2A 2Y66A 2HKIA 2AHRA 3QIVA 4YJFB 2J6IA 3FTPA 4J4TA 1PR3A 3PQDA 4HUJA 3RC2A 5JAMA 2V65A 2IZZA 3H8VA 4Q3CA 1BW9B 1HZZA 2DPHA 4MVJM 1FMCA 4HFNA 1T25A 4W9NA 1N1EA 1C0KA 3Q3CA 4MKRA 4G65A 4DYDA 4ZD6A 4U7WA 4BQPA 4HWKA 2P4QA 4U6SA 3PJDA 1D1TA 1E3IA 1E7SA 4BS9A 5EJ2A 4BNJA 4J91A 3D1LA 2NQ8A 4FJ2A 4FOSA 3EUWA 4I5GA 4PZDA 2O3RA 3K2BA 1H6BA 1A9ZA 2HJSA 3BIOA 4XYGA 2GZ3A 1YS4A 1I3NA 4R3NA 4EW6A 4EYEA 5B4VA 5TJHA 3DFUA 3BMOA 4FW8A 4NU6A 1EE9A 3L4BA 3ANLA 1E3LA 1NTOA 2O2YA 4OOEA 4E21A 1ZO8A 2VWHA 2YQ4A 2V6BA 1ZEJA 2QRKA 3SEFA 1QYXA 4B8WA 3JQ9C 3EW7A 1K5HA 1NFRA 4Y9DA 4W6ZA 4BKUA 2H9IA 4EEXA 3AUSA 2R00C 4PG5A 4OL9A 2YFQA 3VZPA 3S2GA 1VSUA 3IC5A 4JXKA 2Y1EA 3DQPA 5T67A 1LSUA 1XYGA 3LQFA 4J0EA 4NJOA 4RPKA 4PLYA 3L9WA 4XX0A 5AQ1A 1F14A 1I36A 3JD1A 4FN4A 4BGIA 1B8UA 2OFPA 3DHNA 3BXXA 4LRSB 4E31A 5G0WA 4L75A 3ZNOA 2H1SA 1BDMA 4LCEA 1U5AA 5CPFA 5KJEA 4DBZA 3C1OA 3UVEA 3UN1A 4DIBA 5DF1A 3VH3A 2CVQA 1U7HA 1YONA 3VPSA 1TT5B 1YH3A 4TSKA 3RU7A 4D44A 1AXGA 3DBHB 3ZW8A 1I2BA 1Q7GA 1DRUA 3OIGA 4I08A 3WIEA 4B7CA 3H5RA 4JK3A 4XYLA 3BMCB 3OQ6A 4W9NC 1BG6A 2OOSA 1O5IA 3DBRB 5G4KA 3ZWMA 2JCVA 3DAGA 1GPDG 4IM7A 5JSFA 1N7HA 6ADHA 2Y05A 4CMEC 5JY6A 3WSVA 3H9EO 5JNLA 3DMTA 1K6XA 4KUGA 4AJLA 1VPDA 2VZ8A 1VE9A 5HTOA 3U9LA 1SO8A 4L73A 5A03A 1MX3A 5IFLA 3CTMA 3TQHA 4B7UA 4ALIA 2NNLD 3F3SA 3W8DA 3P7MA 3GN1A 3F4BA 3BA1A 3GMSA 3Q9NA 4GLOA 4C7JA 3ONDA 1P1IA 2HQ1A 2I5PO 4IGFA 4XQ9A 5AXCA 1GR0A 3PIIA 4OOFA 3FR7A 1NASA 1X13A 1E6EA 2Q45A 1NAIA 2B0JA 3U4HA 4W7HA 3OECA 3HN2A 3TPCA 3LF2A 4CMAA 4AJKA 4D7AA 4W4TA 2X23A 3JQCA 1R6DA 1B14A 3KYBA 3E6AA 2P5UA 3RCBA 2F1KA 5IXSA 1A71A 1LRJA 3AWDA 3IUSA 3PK0A 3I4CA 1QXSA 1BXGA 1H6AA 4NIMA 4WUVA 1JN0A 1R4NB 5JDIA 3AI3A 3DZKA 4WECA 4DMMA 1SNYA 2EKPA 2YW9A 1WDLA 3I9KA 1GTMA 2DQ4A 2EP5A 3WYCA 4FSHA 5BNTA 1DFHA 1GEGA 1JKJA 1PL7A 4PGFA 3QVSA 4Y67A 4E5YA 3KV3O 4CM9A 3IQDB 2D1YA 3WQQA 2FY8A 3DB2A 3KLMX 3LLSA 5K0ZA 1N9GA 1Z74A 5FYDA 3PQFA 4CV0A 5LDGA 4CPDA 5DBGA 1QYWA 3EVNA 2VOEA 4WLUA 3DZGA 3D5TA 1P0CA 3WWYA 4OYRA 1VSVA 2W98A 5G0VA 3FF4A 4Z9FA 5L7YA 3RIHA 1NPYA 5A1TA 3DTTA 2P9EA 3AM4A 3LT0A 1HDXA 1HWYA 4WCFA 2ZATA 1XIVA 3V2GA 4Y6PA 3FPCA 3G1TA 4K6CA 5T8KC 2JKVA 3GNTA 4GX5A 2P91A 2AMFA 3WDSA 4LW8A 3QVXA 2DUWA 3CKYA 4WPGA 5THKA 4ALMA 1PJ3A 3VAZA 3DMTC 1P9LA 4R69A 3NTRA 1C0IA 1BMDA 1T2AA 5IAAA 4H7PA 4YAIA 4M1QA 2VYVA 2HMSA 1U2DA 3ANNA 2DM6A 2O3SA 4PFJA 2GF2A 3X2EA 3AM3A 3ASUA 1UXJA 2FSVA 3F47A 1HDCA 1N92A 1KVTA 4KP7A 2OORA 4D41A 4YRBA 4B3IA 2BHLA 3GEGA 1O0SA 3RJ5A 3MWEB 1KC1A 2QZZA 2EERA 2IZ1A 4FPXA 1MFZA 1SEVA 2O7QA 3HDYA 4I9NA 1LJ8A 4KZPA 4BO0A 5AXAA 3S2IA 1HTBA 5B1YA 1R0KA 1YL5A 3OEYA 3KETA 5F1PA 1DJQA 3Q9UA 3GFGA 3DZHA 3A06A 4RF4A 1I32A 2QYTA 2X6TA 1VRWA 2VOJA 1Q0LA 1T1SA 1XSEA 3PZRA 3G17A 2Z95A 2XOXA 3L77A 4R5MA 5JC1A 3AFMA 1SOVA 4J9VA 1RWBA 3SLGA 1MC4A 3JCZA 5L40A 1GCOA 1E7RA 2C82A 2W90A 4Q3NA 3QSGA 4TRRA 4DA9A 2ZTUA 3DZBA 3IOYA 1TXGA 3VPFA 1YBAA 3JV7A 4F3YA 4XGIA 2PZMA 3W6ZA 1UUFA 4NZ9A 4RF3A 1ONPA 1UAYA 2WYUA 1E5LA 3BMQB 1LRKA 3DTYA 3TSCA 1NHWA 1Z7BA 4LN1A 2FR1A 4WCFC 5AVOA 5CDGA 1AE1A 3OJLA 1SCUA 1B3BA 4GWGA 3IL2A 1M76A 3FNEA 1XR3A 2J8ZA 1Z73A 4BO5A 1UP7A 4RVHA 2D0IA 3I9LA 4I5DA 3D3EA 4XRRA 3DAPA 4E6PA 4E2YA 3PQEA 3M1AA 4XKJA 3FBGA 4MVJF 3GH3A 5B12A 1ZMTA 5EMHA 2O23A 2R6JA 5DP2A 2DKNA 1GY8A 4IINA 4CUJA 4AJPA 3HNPA 5A9SB 2OGUA 1Y5MA 1E77A 1XDWA 4YT8A 3PDJA 1HSZA 1RM4A 2GZ2A 4HX5A 1LSSA 1H5QA 2Q3EA 4J9UE 4UVHA 3EYWA 5CPBA 3NYWA 3WQRA 4B3HA 1UZNA 4KUHA 1QKIA 3B20A 5CP8A 5I9NA 1HRDA 4OJNA 1Q0QA 2GASA 3JQ8B 3OJ0A 2VWPA 3IP3A 3W6UA 4CM9D 2B5VA 3Q2IA 4HFJA 3GNQA 1EVYA 1U3TA 4FCCA 4RL6A 3UF0A 4E2XA 1PQWA 3E9MA 1L7DA 2QYSA 4U5QA 1FDVA 5B37A 4F46A 2YUTA 3JD3A 3VZQA 4E3ZA 3RSHA 3H65A 4XJSA 2B4TO 2DBVO 3K2EA 3WYEA 1SB8A 2VT2A 3V1UA 3PHLA 1AHHA 4ALKA 5DOVA 4WEOA 3RUAA 2JD2A 5CG2A 4DQVA 3ZU5A 1CF2O 2EHDA 2XXJA 3GNSA 3LVFO 2GRAA 1AN9A 1LBEA 4UEOA 3WMWA 4DC0A 4LMPA 1GD1O 3VVCA 1XQ6A 3TL2A 4TRMA 4Q39A 1I3LA 1XQ1A 1OOEA 4JROA 5DULA 4IIVA 1Y8QA 4RPHA 3DBLB 5CDUA 5IDXA 5DCYA 3ZWBA 1C0LA 2VYVD 2YDYA 3TF5A 1HEUA 4AJIA 2GNAA 1IZ0A 2O50A 4HFRA 2PD4A 4ND3A 2ZYAA 3I83A 1P1FA 1V3VA 1HLDA 4RJTA 1QRRA 4I8XA 2HK8A 3ROQA 1P1RA 1GV0A 2Q2WA 4DLLA 3UW3A 2X22A 3HUDA 4X54A 4BKPA 4CMHA 4L74A 1PQUA 4CUKA 4Z9XA 5G0TA 4L4RA 5U1PA 2CDAA 3RUFA 1DRVA 1P44A 1VJTA 3I9OA 3LZ6A 3K30A 4E5NA 4ALNA 2BELA 3ZV4A 4EJMA 1IULA 2ZTLA 4MVJP 5BSFA 1DEHA 4E4YA 4UEJA 3VOSA 4YRDA 3O26A 4RVGA 4HADA 3I6QA 1H6CA 3GR6A 2B35A 1ENPA 3E9QA 3ON5A 2YYYA 1YOVB 3AOGA 2IYPA 3L0DA 4MDHA 3AY7A 5A5FA 1JWAB 3TOXA 1LTHR 1I30A 1QORA 2LDXA 1B8VA 2POQX 2QHXA 3LF1A 3NGLA 3AY3A 4UUMA 4BNTA 4J4HA 4PG7A 2R2GA 4YACA 4XQGA 1RM3A 3T4XA 5JS6A 4CMJA 4N5MA 2HJRA 3DZJA 1QG6A 4CQMA 2CVZA 3NGXA 4FC6A 4IDCA 1UXIA 1V3UA 2WYVA 3GGPA 4R41A 3ZNPA 4BKOA 2D2IA 4WCDA 3FNHA 5TF4A 4B4OA 4CMKA 1TVEA 3A9WA 2VYNA 1PS9A 1T2EA 1E7WA 2ZB8A 2AA3A 1BTOA 5ER9A 2UYYA 4S3MA 1NQOA 3K6JA 4D79A 4IUYA 4N18A 1EUZA 2W2KB 1ARZA 1H94A 1E0DA 3WFJA 1UP4A 3H2ZA 4CM4A 1I5RA 1LC0A 1N8KA 1ZFNA 3GAFA 2DTDA 2NU6A 3ONEA 3PGJA 4DYVA 1ADCA 4JBHA 4A73A 3KXDA 3IUPA 3V5NA 1R37A 3NKLA 1LQUA 4II3A 3ZHYA 1GEEA 3U3XA 1PGPA 1K3TA 2IEBA 3ZWCA 1KERA 2NACA 4YAKA 3GEMA 2BI7A 4JBGA 5GMOA 3WBFA 1X0XA 4BO8A 1M2WA 2EJWA 3JQBA 1U5CA 2UDPA 3C8MA 3OEWA 4FFOA 4G2NA 5KVCA 3MJSA 5L9AA 3FD8A 4R9SA 3OHSX 4CM7A 5DCUA 2XF8A 1EMDA 1YKFA 4O63O 2PKRA 3INRA 3C7AA 1GUYA 4XCVA 1VC2A 4D3FA 4RDHA 5DCWA 3WTCA 4DL9A 4E12A 2I76A 3MOIA 1XU7A 3QWHA 2Y0EA 3M2TA 4GX1A 4MVJE 3I9MA 4TWRA 3ZHZA 1P1KA 4M49A 3RASA 1F0YA 4CLRA 1QLJA 2V6FA 1ULUA 4HNGA 4QFDA 2EGGA 3GGGA 5CFZA 5JLAA 4BMSA 2NWQA 4B7XA 4WK6A 1FDSA 2NSDA 4UVIA 1VL6A 2C7VA 3TL3A 1B3RA 2E6UX 4RZHA 3C7DB 4XDZA 3ZI0A 1SMKA 3FHLA 1YB4A 4CLOB 1DFGA 2D3TA 1Y1PA 4K28A 5EESA 4RV9A 3LLVA 2DFDA 3I5MA 4BUCA 1H93A 3DXFA 4CMCA 3KYCB 3FBTA 4YWJA 4J2OA 3IKTA 1A5ZA 4MIYA 5L4NA 1H9AA 3SJ7A 1F17A 1HDGO 3K73O 2X0IA 4K6FA 3NJ4A 1PWZA 1T2DA 3ZWNA 3W4KA 1HZJA 2CUKA 3HWRA 3PFWO 1P31A 2FOIA 4QXMA 5A04A 2WMDA 2VHZA 3UOGA 1SAYA 4Z6KA 1U9JA 3LC2O 1V35A 1YGYA 4PLZA 4HFMA 2V7PA 3AU9A 3PYXA 1CRWG 1NR1A 4R4JA 3F9IA 3TZQA 4OXNA 3JQ7B 2Y1CA 3LU1A 3MJ4A 3E48A 4IPTA 4R68A 4RVSA 2RAFA 1LSOA 1GPJA 3MJEA 2ZQZA 4UULA 1VL0A 4PLTA 2AW5A 2IYOA 2GUGA 4JN6B 1M66A 1M6WA 1MV8A 4UAGA 1HE3A 3JQBC 2C5EA 4IZIA 3VH2A 1NNUA 1LDEA 3JYOA 4QO8A 3JTMA 3W4JA 4M8SA 3R0IA 1R16A 2Z5LA 1FXSA 3PHJA 2R00A 4J90A 4M54A 5L4SA 4DGSA 1ONOA 1YWGO 4P4NA 3VPHA 4GLLA 5TNXA 3BYZA 2WTBA 4JLWA 3G0OA 2B5WA 1E3WA 4ID9A 1FJHA 4AJ1A 2RH8A 4XQEA 1ZUD1 1Z6ZA 4GX2A 4D43A 4DQXA 5U4QA 2EKQA 4D0RA 4CQMD 5FFFA 3VH4A 1EK6A 3GK3A 3PFFA 2WSBA 2O3QA 4ZVVA 4OMUA 4MVJH 3H4VA 3ZU2A 4RLHA 5GZ1A 2CY0A 1LDMA 4F45A 2VYND 4TRNA 2OXIA 2B37A 4YEDA 1YBVA 5I9LA 3TZCA 1EFKA 3U5TA 2HRZA 2GYYA 4A26A 4IS3A 3KYDA 2FHSA 5MDHA 2GZ1A 1MG5A 1L1FA 1HSOA 4IJVA 3NRCA 4MO2A 2BH9A 5C7IO 4ILKA 1TA4A 1T1RA 3PJFA 4A0SA 2PY6A 1Q7CA 3PXXA 3U4CA 3OETA 4GBJA 3NT2A 4D45A 4RLSA 5C5IA 5IG2A 1Q0HA 4CMEA 1K2WA 2ZYDA 2WJPA 2FMUA 4MOWA 1U8XX 3D64A 3PYMA 3LT1A 1LDGA 4XIJA 2YHIB 3NT5A 4XR4A 3L6EA 2NVUB 3VZSA 4YRAA 4GSLA 1AXEA 3PIDA 4U0KA 3NDJA 3L4SO 1R66A 4WLFA 4YJGB 5H82A 2JAHA 3UKOA 3X2FA 3F1LA 3JYLA 3A14A 2IXBA 1CDOA 3DO5A 4Y8VA 2C20A 2EEZA 3ZU3A 3M6IA 3UAGA 4CV3A 1GYQA 1BDBA 4BHTA 1MC5A 1KOLA 3UHAA 3LSYA 2ZK7A 3ZWPA 4L4XA 3OJOA 3HFGA 4YJDA 2NM0A 4BNGA 3RUHA 1PR9A 4YAGA 5CAEA 2B83A 1IE3A 1NXQA 2NU7A 4LK3A 3JD2A 3K92A 4WNCA 3GZ4A 4BO4A 2B4RO 1ZW1A 5EQDA 3OQ1A 2IE0A 1NX6A 3BTUA 4CM8B 3D3WA 3FWNA 1HDYA 1M67A 3KB6A 2B69A 4CMIB 4IDAA 1XEAA 4BNUA 4CV2A 4IDEA 4YTEA 2AQHA 4YJHA 3KEOA 1U3VA 3BMNB 5ILGA 4QTZA 1HE2A 2NV6A 1G0OA 4OKNA 2DC1A 1BWSA 3AOEA 2Q49A 3COSA 2X4GA 1JW9B 1QR6A 3ADOA 7MDHA 4MINA 5A9TA 3ZHBA 1H2HA 1Y6JA 3IS3A 5LC1A 4CR6A 3H2SA 1DB3A 2Y99A 2EJVA 5BSHA 2VUUA 3SLKA 5A5EA 1EFLA 1R4MA 1PWXA 4NDNE 5U9CA 4FR5A 4B4UA 2QW8A 2WD8A 2VUTA 4UREA 4CM3A 2Q1WA 1EQUA 5T8KA 2NTVA 5TRTA 4DC1A 1OBFO 3UCEA 3OA0A 1ISIA 3NEPX 4MVJA 1CEQA 1U7TA 3RFVA 5JYEA 1YXMA 2RCYA 1PZGA 4WOKA 4E2ZA 4AJNA 2PTGA 1P33A 3QWAA 5JBIA 2WD7A 4MKZA 5JW6A 6LDHA 4G5HA 4NJMB 4QO7A 5TS3A 1ZK0A 3B1KA 2WDZA 2VWQA 2AG8A 3PRJA 3QW2A 3UFXA 5T64A 1XA0A 4IDDA 2X0NA 1WW8A 1X15A 4RF2A 4CMGA 1K0UA 1U4OA 1GZ6A 5G0SA 3MEQA 2QIOA 4R3WA 1GUZA 4ZN6A 5JFOA 2W2LA 2WWRA 3AUAA 1QSGA 4JX8A 4YJFA 3ASVA 4LVUA 5H83A 5IZCC 3OA2A 3UICA 3UXYA 1BW9A 4XB1A 1QLHA 1LRLA 1UJMA 3JQDA 2VNAA 1HYGA 4TROA 3N74A 3ZNQA 3T7CA 2EIHA 5G2OA 5KVSA 2EV9A 3I23A 3ZWAA 3D7LA 3K31A 4O5OA 1PJ4A 1SC6A 4DXHA 4EZBA 3EGOA 2JL1A 4WLEA 5IDQA 3F5SA 4DREA 1QYCA 3IDSA 1DC6A 4YBZA 1DLJA 1T26A 3ZWWA 4ZGWA 3P19A 2BI8A 1O9BA 4J6FA 4ND4A 1G0NA 3ZHXA 4O0LA 2PGJA 1U8FO 4H16A 4ND2A 4M89A 4M87A 1NPDA 3AOEC 3PHHA 2FZEA 3GVIA 3CINA 3H3FA 4XYBA 3DL2A 3WX0A 2HU2A 4CM5A 4OQYA 1AUPA 4RVFA 1LUAA 4Q3EA 1E92A 1N1GA 5L3ZA 4I5FA 4R54A 4C4OA 1J6UA 3ST7A 1ZBQA 3CZRA 3BTSA 5COBA 3PLRA 3GRPA 5EIOA 5L95A 5CG1A 5DOZA 3OIFA 1BHSA 5L53A 3EDMA 3RJ9A 2J5KA 3ROPA 3PEFA 4RO0A 2JAPA 1HE5A 4YDRA 2GCGA 2VTDA 3ROMA 2Q1SA 2DBQA 3VKVA 3P5SA 4OAQA 3JQAB 3GVCA 1GFSA 2VHXA 2AEFA 2DLDA 2OZPA 3CMMA 4BNKA 1U3WA 5I7FA 3PLNA 3FN4A 1MLDA 4KUEA 1KEWA 3GQVA 3NJ8A 4RF5A 5HS4A 4YAEA 1O8CA 2EP7A 3QQPA 4BVAA 4DPMA 1T2FA 2AQ8A 1DHRA 1KETA 2HLPA 3GLQA 4H15A 4I5EA 4PCVA 3V1TC 5CDSA 5LDHA 4NFSA 3LT2A 1DSSG 3P2YA 1E1NA 1LXCA 3JSAA 1X7GA 4EI2A 2YQ5A 1TT5A 4XEHA 1KVQA 4IDBA 3CIFA 2DUUA 4ZICA 1C3VA 2JFFA 3DBHA 2W8ZA 5EERA 2HRBA 1E1LA 1EE2A 3OIDA 2UUPA 3VDRA 2SCUA 5CHEA 2OP1A 4XA8A 1HDOA 2F00A 3BMCA 4QFCA 3WLEA 3HG7A 3HDJA 4R51A 4CQLA 4P22A 3ZGYA 1JLLA 3DBRA 5KOIA 4BMVA 3HB5X 5ICMA 3Q6IA 2Q2QA 2G0TA 3O4RA 3SJUA 3WYBA 1J4AA 3FWZA 5I7SA 4HBGA 1NVMB 1R15A 4GMFA 4O59O 1C1DB 3Q2KA 1D8AA 1ISJA 3GG9A 5JY1A 4BGEA 4OGWA 4P4LA 4XIYA 4KMSA 1HYHA 1XCBA 2PH3A 1ZXBA 3EAGA 4MVJD 2YZ7A 4NBRA 1BGVA 1F8FA 4J16A 4JJFA 3DBVO 3HJAA 3SVTA 3JD4A 2OBNA 1ADFA 5JYDA 4KDEA 1JAYA 4JJGA 3STHA 4A5OA 1EDOA 3RUCA 1MG0A 1I8TA 2HUNA 2Z1NA 2UAGA 4GL4A 3TRIA 1ORRA 2BGLA 3A28A 1LDNA 1PSDA 2NTJA 3N58A 2Q50A 1RPNA 3DHEA 3EC7A 4BQRA 3WGYA 3AK4A 3OH8A 1I24A 4NFYA 2P68A 3HADA 2YV1A 4IXTA 4MIOA 3E1KA 1NR7A 4BIIA 1ZIDA 2W2LD 5KJCA 4CODB 4NK4A 3TWOA 2P9GA 4A27A 1R4NA 2PKQO 3L07A 4BNYA 4OSOA 4LSMA 3WIDA 2BGMA 2X86A 3I9NA 1GAEO 1HXHA 3KRTA 4XR9A 2ZB7A 4FDAA 5L45A 4ZQEA 1RYDA 4BNNA 3ITDA 3DOJA 5FF9A 1OMOA 4YYZA 1ENYA 3I4FA 2CSUA 2EWMA 3L9XA 4Y98A 4CL8A 2Y0CA 3D4OA 1ULSA 4FJ1A 2NUAA 4FJ0A 2X9VA 2PK3A 4XQCA 5J23A 3F46A 3HDQA 2O4UX 1DHTA 4GVXA 4XYEA 1YQXA 4BNHA 1PGOA 2CVOA 1O95A 4BOYA 1IPFA 2EW2A 5GZ6A 4QEDA 4Z3KA 1ZCJA 1PZHA 2AQIA 4IJUA 4LISA 3ULKA 3I6IA 1VKNA 2GSDA 2BMAA 4PG8A 5EN4A 1Y9EA 2G5CA 8ADHA 5KJFA 4QUKA 3GVHA 4QT0A 1N2SA 3GZNB 1Z82A 4FS3A 4GMGA
chains in the Genus database with same CATH superfamily
2ZPTX 3G85A 5MF6A 5FLKA 3DCJA 1G6Q1 3JZIA 1LI5A 1P45A 4ZHSA 5IT5A 2JGFA 1E7MA 1PDOA 5JTUA 3O7MA 2H29A 2UZ3A 2YXNA 2BEKA 2BR5A 2P2NA 5CA1F 5K20A 2G4VA 4MRRA 4JI0B 1KK1A 3IPYA 2EF1A 1FSZA 4RK4A 1G5QA 4YUYA 4OQMA 2R7KA 2O2SA 1PFYA 3HKCA 3EVAA 3ZU4A 2GN6A 3O82A 4DQUA 2HIAA 5F1OA 1MX9A 2V7BA 5G3ZA 5FQOA 1Z18A 5K8CA 1NF9A 4Y2SA 5E6UA 4HH1A 4Q01A 1HBJA 2DECA 4C7OB 1Q1NA 1PJQA 4WZAB 1NVDA 4MRVA 2AE1A 2W4QA 3MWEA 3AMVA 1UH5A 4JLAA 4LYHA 4TN1A 1L3IA 3UPUA 1EFVA 4UNIA 3HUFA 4IV8A 2B2NA 1KU6A 5CIWA 1RHRA 4B80A 2WK1A 1D3AA 5J59A 4OKIA 4D3SA 3CJQA 1TAQA 1E1MA 2ANCA 3KVOA 1Q77A 4KQEA 3BXHA 3I64A 5EP2A 4YCCA 3O83A 1Q83A 1NFQA 1GCGA 3GFOA 2J9XB 4M46A 2A4MA 2C9YA 1XZIA 4OJKA 5BNIA 2BFDA 2JFWA 1WW2A 2XE4A 4C89A 4F91B 3PQ3A 3AM5A 3MHTA 3OHMA 1E6WA 3PPVA 1EGAA 4GUAA 4IDPA 4R1NA 3MGAA 4XE5A 2CBGA 1KEUA 2K2WA 4RHFA 2HJVA 3VSBA 1NXVA 4KR2A 1SU8A 1GQYA 3E82A 4URYR 2XRYA 3V00A 1BEEA 1B8PA 3LHIA 4YMIA 2Y92A 5E3JA 5CLJA 3ISVA 3AI1A 1ZXXA 1WR8A 1JS1X 1Z4QA 3VPXA 2CF5A 4K9RA 5IBQA 3OJXA 1GU1A 4Q4AA 2NXJA 2G17A 4IF4A 3T3GA 1YR9A 4L95C 4Q05A 3OQNA 1Q7EA 3EFBA 5BQFA 3B1VA 4P2BA 2CBXA 5KCMA 1V11B 1SN7A 3FDXA 5EGSA 3ABZA 3EULA 1NW5A 3E9YA 1N8SA 1ZGCA 1IWPB 4EL0A 3RKUA 3MLEA 3MMNA 5AJHA 4WJZA 3OICA 4DUGA 3AERB 4HNAB 1X8LA 2YOFA 4MH0R 4HRXA 1KI4A 3CLUD 3V8MA 3M2PA 5B64A 5LFAA 4GPZA 2Q99A 1WG8A 4D6PA 1UR5A 4EH1A 1Y3DE 3WTBA 1M2FA 1W1IA 5DEIA 4GKJB 1TMKA 3WGUA 4R9RA 1C8BA 1FTSA 4KQ2A 3TG2A 3KZCA 1J42A 2ZU0C 3AUTA 1P2VA 1EIZA 1Q1BA 3E70C 2IHVA 3I62A 2AOXA 2CLFB 3ID6C 3AHDA 1RRGA 1E61A 3E58A 2G36A 1Q1GA 2G4CA 1UOQA 5B1SA 1KYYA 4TQ9A 2H7CA 4AKHA 3I04A 2CYCA 2ZR0A 4GXNA 2AC4A 2QRUA 4YT4A 2B8NA 3RJTA 5KQGA 4TWZA 2BZ1A 2HF8A 1L5QA 3GIDA 4KLNA 1PW7A 3USES 3WFIA 5JMOA 4WD3A 4QIHA 4WL0A 2VRNA 3HE3A 1JDTA 4FOOA 2ZSEA 3BZUA 1EGHA 3R5HA 2N1BA 1ZVKA 5CLGA 1GM5A 4KIJA 1VSTA 3BD7A 2VPTA 1KKLA 3AXTA 4N65A 4N8DA 4XGQA 2Z9BA 2O0MA 2O2XA 5GJVC 5DNAA 2E4UA 2D5AA 5JDCA 1XROA 2BUAA 3MAJA 2OAQ1 1AY0A 1JXQA 2CLLB 1YS9A 2HK7A 2OR3A 4MAMA 3M6WA 1QFSA 4UUBA 2BGWA 4Q12A 3QELA 4R98A 2VHTA 4BQFA 2PM8A 2RC5A 2R751 3O4VA 3E5RA 4K1XA 3ZW9A 2R44A 1D0IA 2DT8A 1RTKA 4DMLA 1WV1A 2YV4A 1HUQA 1BA3A 4BKQA 2ETXA 1J8QA 2FWRA 4GQAA 1Y7TA 3AX6A 1G6HA 1QTIA 3ZVMA 4IKPA 1P0IA 3G23A 4WZBE 4PX2A 5FTNA 5FYQA 4KH0A 4DR5B 4KO1S 5IBRA 1R6XA 1H05A 1AKVA 2D8AA 3UT5A 2JEYA 1JRLA 2VJMA 4FN5A 3B6EA 3GU3A 1YZLA 3W9YA 1T8TA 3RM3A 4RVOA 5AHRA 4X60A 2Y68A 3QVJA 1JXOA 1TU0A 1K89A 2WEKA 5DGTA 4OHOA 1R64A 1MEJA 2VK2A 1P18A 1ZN2A 2GEFA 4JDPA 3B13B 5FADA 1FFGA 5GM1A 4MWCA 1DBQA 4B6GA 1BYUA 1ABFA 2BMVA 1H5NA 1HKUA 1QP7A 4MICA 2GFIA 4DWVA 2ZS7A 5KKAA 4AJJA 1F7VA 1B26A 2GTPA 3DYVA 4G24A 5L51A 1Z2AA 5HX7A 1OFUX 2UZIR 2IIPA 3TM5A 3HB4X 4ACAA 1PBTA 1UT6A 2QMOA 4OQLA 3VVBA 2IHYA 3PXGA 1IYZA 3IXLA 2C4TA 5KMGB 1AC5A 4FZVA 3VPGA 3OHPA 1GUAA 4TWBA 1AK9A 2ZPUA 1B93A 1KQOA 2VTEA 2QJFA 3ZD7A 3CJRA 2XB8A 2E2WA 2QD5A 3CZ4A 1AURA 1PTJA 4I4TF 4PINA 1EXMA 4NECA 4Q24A 1QV6A 4OI4A 1A7AA 5CJ2A 1T3SA 5B3JA 1R27A 1YR6A 2DAPA 3UGQA 2Y1FA 4ONEA 4BLOA 5EKTA 2XBUA 4D0SA 1H9BA 2ZYVX 4M3NA 1TUBB 2QW0X 1SHUX 1W2GA 1I2DA 3DPIA 2XITA 5JRJA 2MSDB 1SCJA 3NYQA 4LE1A 1MUUA 3R7FA 4FP9A 5F1KA 1M8GA 1WZIA 1S2DA 1P77A 2D59A 1NVEA 2PD3A 4MJLA 1UM9B 2E48A 1D1SA 1PX2A 1DIAA 3INNA 4NU0A 3WR5A 421PA 4HQLA 3M4XA 4OHPA 4Q3AA 1OGIA 5I9MA 1Z0JA 3GA0A 3U7IA 5I7VA 4U2FA 2AEEA 4PAOA 1P3Y1 5D5PA 3P0EA 4EY8A 4NCNA 2XVXA 1L3BA 5E9JA 1QH8B 4C7VA 2APJA 4HG2A 1M7GA 3JWIA 5M34A 4LFCB 2HPHA 5KDLA 3R3XA 4HBZA 3FX2A 3GC6A 4OK3A 5AKIA 5DXFA 4ZQBA 1V37A 3WRXA 3FOEC 2HSWA 2WT9A 1SBTA 4PLWA 4G8JA 4GDFA 3NMUF 4ZWNA 2OMKA 3WQHA 4KMOA 2PZJA 4NQRA 3I9FA 2C0CA 3P2EA 4NMHA 5CCXA 2BEWB 3PNOA 2F9MA 1OIXA 1YE5A 4QOHA 3U7QA 4MRMB 2PUFA 1M2OB 3CPHA 2R5WA 4J0CA 5J58A 2X9LA 4WLOA 1CUUA 3C7KA 4PVCA 2AE2A 1TLFA 2AEMA 4RAQA 1SCDA 4RKRA 5K3CA 1Q21A 4DUGD 3CG0A 4NDAA 1FMJA 5EHIA 1Q3HA 3SHVA 1FYVA 4C22A 2Q1YA 1UDAA 4J07A 5LZ5A 1LWNA 2O8NA 1E5XA 3A1SA 1DQPA 4NH4A 5KIAA 4W99A 1E1CB 4XDYA 1Z37A 4BL5A 4GEKA 4RFLA 4UVGA 4XGNA 5C52B 2Z8XA 2XTJA 3FSEA 2WY2D 4OUDA 4MW4A 5LQJA 4HPWA 1OYVA 2A5YB 5BOSB 2YVAA 4G4GA 2E7ZA 1U8TA 2PMBA 4PC1A 2W6MA 4QU8A 1AKQA 3KPWA 1J49A 3HBAA 4ZVSA 1GTZA 3VZRA 1QCDA 3RWBA 4KEAA 5G4KB 4BYGA 5ITZB 5IANA 1LK5A 2BBTA 4U1RA 5D5QA 3TN7A 4OFBA 4DEVA 2EG9A 2RHWA 1UWKA 4PTZA 2PNJA 2XD4A 3EQ6A 3MUOA 3R0QA 1GZ5A 1NQTA 1O5OA 1X7ZB 2XUZA 3CUYA 4MLPA 5TF0A 2BR4A 1XPUA 4MVWA 5JADA 4MS1A 3BULA 1H4QA 3WO1A 2ZWOA 2GNOA 1DEXA 1IHXA 5FAXA 3K32A 3GDHA 4OHXA 1BU5A 1GUDA 4GH5A 1XZCA 1N3LA 3A1UA 4MPDA 4JQOA 4P36A 2HT1A 3E9DA 1UWCA 3S4YA 2HRRA 4HATA 4FEYA 5DASA 2ZP1A 1ZGAA 2JFZA 2JFOA 1UBTS 3TLMA 2GERA 5K0JA 4BQOA 5GV8A 4X65B 3P9QA 1VMKA 5CFLA 1PS0A 4E07A 5HGJA 1B1CA 1Z0IA 1US8A 1J5PA 2AFIA 2J3MA 3EIHA 3RHTA 1PUXA 2NUBA 2W2QA 3WLMA 5LQDA 4KNYA 4MARA 4NMWA 3TOVA 1GQRA 5AK6A 3U40A 1OASA 3RRZA 2PV7A 5I8ZA 5CW2A 1NKVA 2FR8A 2JFHA 3MWGA 1PGJA 4HVCA 4IIJF 4L27A 3VUEA 4F2DA 3TLZA 2V9CA 4RM3A 5J47A 3GUVA 5DNEA 2IV7A 3U9TA 1JU3A 5IZCA 1VE5A 3WK9A 4OK5A 1WB9A 1BXGB 2OL4A 2M6LA 4R2IA 1M8FA 2JHGA 3KYCA 5BQ3A 2EW1A 2YVQA 4ZRMA 1JTVA 2DY0A 2ZSHA 3R9IA 2E37A 1VIAA 2FETA 3ADDA 1YJXA 2WU3A 3DONA 3JAKA 3W8EA 4A6DA 2IPOA 3OQVA 1M75A 2K6GA 5A4AA 5F2NA 1MDBA 1WXDA 4FVTA 3HJRA 4F4HA 4RQTA 5IULC 2J7PA 3K70D 3ZI4A 1WUHS 5IXYA 4LXHA 4NRDA 3EZLA 4IJWA 4DLVA 4RA9B 4ESOA 4Y2TA 3WWPA 2X3UA 5BQXA 2XQFA 3BICA 4IYJA 1Z5GA 4YS6A 4EUHA 3GDGA 1CHNA 4IHKA 5CXXA 1XDSA 1DARA 1N7IA 2WFAA 3RD5A 3HHEA 1A8QA 3K8OE 2BM8A 3ODGA 3QMVA 3SAJA 5JRZA 4KXWA 3X3HA 1AKNA 4ENRA 2MYUA 4YRSA 4AZVA 1SA0B 1Z62A 3ZX4A 3SX2A 2LDBA 2ZUTA 4JOQA 3ZDFA 1WTCA 4JBIA 1SG0A 4L5IA 4Q9HA 5K6AC 2BFMA 3VV3A 4DCOA 4FHEA 2XGMA 3WV4A 4DMFA 4PGHA 5D84A 2ALJA 5BN4B 3P2IA 4WCFB 4KIFA 1E3TA 2GXSA 4UDNA 1A72A 4XEUA 4D46A 5C4GB 3EXIB 2P7IA 4C4ZA 1AS3A 1CIJA 4MKXA 1YVUA 3RSCA 4PYJA 5JJ5A 4DR1B 3P9RA 3EXG1 2JGNA 1NU8A 1UBGA 4I55F 1ML3A 1V8FA 3AFNA 4HLQB 2IHKA 4IV5A 5JZ9A 1JDNA 2V4UA 4UHEA 4UDXX 2CXXA 1EUCA 3N0WA 4URZR 1N5JA 1GFWA 2EDAA 3MJCA 2JLQA 2OWEA 3CF0A 4FYXA 3R9KA 2IGTA 4IMPA 4YV1A 5AKEA 4L76A 4AZSA 4C08A 5AXDA 4F2HA 2C03A 4P4SA 2FUCA 2ZRCA 4G5SA 4H6PA 4GYWA 1FFEA 2Q5JA 1W76A 3SHQA 1UMDB 2EC5A 4YVFA 5K5EA 2XXAB 2Q5OA 1DCTA 5E6SB 1KI3A 3W2HA 5CUQA 1SEPA 3DSRA 2AN4A 3IP9A 3JPYA 4ARZB 5JR3A 1CD5A 1Q7TA 4F6RB 4JP3A 1DX4A 2IT1A 3JQRA 1K9SA 3V1NA 5GWXA 2YWBA 1OBHA 3EDYA 2JD1A 2ZROA 3F8WA 3QVWA 3ZEAA 5SICE 3VX4A 2P4SA 4IGKA 2OXTA 3WXMA 4B8ZA 5EZYA 2WWHA 4QSMA 1HZZC 1ZMBA 3ZHUA 1HDRA 1NAHA 4MCAA 5D3KA 2H1LA 4EI9A 4ODIA 5KYYB 2QRPA 1LV8A 2ZYTX 3DKVA 3QA9A 1PNTA 1T1JA 3QLEA 4YDSA 5AT1A 1JEOA 1K08A 2A1IA 1H1LB 3DAFA 4D8XA 1ZICA 1QHYA 4PVDA 2FKNA 1IBMB 1H3FA 2LZ0A 3AEZA 4CIDA 2QZ9A 1W6UA 2VHQA 5AVTA 1IY1A 2HMYB 3LPNA 3EIWA 3RROA 2CJWA 1H9CA 1QFJA 3VNRA 4JLNA 5TPWB 1QS0B 4WBSA 1JDJA 1V4BA 1ECJA 1M34E 1X42A 1XWFA 1QDEA 1XLTC 2J9ZB 3IE1A 2IEGA 5LYYA 2VSYA 3ZCSA 2J4DA 1SOUA 1U7OA 1VZ3A 1ZVQA 3HCDA 1U28A 1FUIA 3Q11A 5LQNA 2GDZA 4FCWA 2QRJA 3PUHA 5CVEA 5IAEA 1GGKA 5B53A 1PDWA 3ENVA 4QEKA 4RMJA 1AOXA 2NVUA 2PS0A 3LLMA 3L4BC 1Z5OA 1W0CA 2NYAA 5DN6A 5IDWA 3PD0A 1NSYA 4AY5A 3AR3A 3LVBA 4IGEA 1Z0FA 2JANA 1R0CA 4L4SA 1I3KA 3AUUA 3DP9A 2I2XB 3T3NA 5JZMA 3CLRC 1INLA 1GVNB 1OH5A 3UH0A 4GKVA 4BNMA 2N3ZA 1FY2A 3JALB 3K5IA 4LECA 4YI5A 2OGZA 3DL0A 2A5GA 3I5XA 3WA7A 3HA3A 4PV7A 2QVYX 5EE9A 4Y2PA 4BFYA 3R4VA 5CXUA 2PKYX 3I61A 4QAJA 2V98A 2CUTA 3F5QA 2F8TA 3LCJA 1UBNA 2ZRFA 2DQYA 4TWJA 2QENA 2JVKA 2LIVA 2Q4RA 2WAYA 2I66A 2BUCA 2P62A 4LOJA 3L49A 1Q0ZA 3IE0A 2A94A 1GZ4A 4JNCA 5A3VA 2BFEA 1WJGA 3CUWA 4PNHA 4BAUA 4E33A 5CBPB 1Q6YA 1GPUA 1N32B 3CFYA 4OYHA 1IBKB 2BM1A 1BD3A 3PNBA 3A0RB 1CJTC 1U2ZA 2FFRA 4KAJA 1HV8A 3URMA 1EZ4A 1I4LD 5F12A 3CEAA 2XCSB 1R0LA 1HLPA 4AJOA 4I4TB 4HAYA 4EPVA 3F90A 4JSTA 5T41A 3S8MA 5BMVB 1E59A 1V1MB 3DFFA 1S4MA 4EB6A 1LNSA 4CM6A 1B4DA 3DTNA 2K7FA 3L2OB 4R0NA 4UOEA 1N2ZA 3NZEA 4EY4A 4F4CA 2CCKA 3VI4B 5JAIA 5K9ZA 3U7EB 3P2OA 1A1SA 2YWCA 2AI1A 1KTIA 3LLCA 1V26A 2ECFA 3FPKA 3KZOA 4UD2A 2QSYA 3G2PA 4UVEA 1A3CA 1KXZA 2J7PD 4FI3F 2GZSA 1RJDA 1T9GR 2ZUUA 3KKEA 1E79A 3QLUA 5C3MA 3Q3EA 3BXFA 3ABRB 4N54A 1YQQA 2DU8A 4DT1B 1LI7A 1J06A 2O5EA 1KK2A 2BFAA 4P3KA 3OFNA 4GGMX 4D9BA 4YR9A 2VJOA 1L7QA 4KE7A 1BS9A 3L7AA 3V9AA 2GCIA 2BAGA 4LNHA 4LF7B 1NHGA 1HO3A 2FQXA 4EJ0A 5LMNB 2YDXA 4IV0A 5IVKA 6ABPA 3OX4A 1GWNA 1CQIA 1KFEB 2OG2A 3DMHA 3D7KA 3ACBA 4L85A 4ZTBA 1JT2A 1TD1A 2X0JA 3O8QB 3X1DA 1U2GC 3OQMA 2JGIA 2VQSA 1JIUA 1JT9A 1T6BY 2CMDA 4J0GA 2P2SA 4IIBA 2QVBA 3IT0A 1KY5A 4XH9B 1FDWA 4MW5A 3OMLA 3V2HA 4YXFA 3DP7A 1NZJA 4NJMA 4TYQA 1V3TA 3A27A 4YRTA 3HN6A 3PFIA 5CXSA 4ADSG 1EXVA 2X3YA 2UV8A 1O57A 4F97A 3OFVA 3U7RA 3ZWVA 2D5CA 2PXAA 3K16A 2A0YA 3ELDA 3PUZA 2FZWA 4KX3A 2ILVA 3QTLA 4PF1A 3RQSA 3THOA 1ZRHA 4BFCA 4C5AA 5CEJA 3GLIB 3SU8A 1II9A 3MBKA 3RKRA 1V7CA 2QTRA 1OXMA 1BQ4A 2CL7X 2QLTA 4NPCA 4M1OA 4Y7CA 2DETA 2E89A 3T5AA 3FGOA 1A97A 4D42A 2WKQA 5FOUA 2NT4A 5DM2A 3UJNA 2GR9A 4B6FA 1NBME 2OUIA 3TKAA 5KSZA 1XFAA 2WU0A 1T2VA 2JARA 3ISJA 4EHKA 3IT3A 4OI2A 4DA0A 4RPLA 2UYQA 1HK7A 2IYYA 2XHEA 4JJ6A 2C2WA 4XPIB 3M4NA 4H6WA 2HM7A 1IM8A 2QD1A 2RGYA 2NU8A 3UCXA 1Y3AA 2ATIA 2P9QA 4G37A 3GHHA 3BDVA 3WAGA 2OKCA 3UPDA 3ASYA 2W2MA 3HKEA 3LC0A 3V2UA 2VT3A 1XZPA 3WYFA 1OYYA 1XCOA 2QKYA 3AR8A 1X1EA 1Z28A 3P0HA 4TTIA 3TMAA 1D7OA 1ZJZA 4RZIA 1GG8A 3RUEA 1R18A 1HOTA 2HBYA 3GDFA 4J1NA 1SQGA 5KQMA 1IBLB 4CCYA 4UBKA 5IABA 1TM2A 4B17A 1GAXA 1H2YA 2FMKA 4EJSA 1Z5ZA 4MVJG 2C1EA 3BB3A 4B34A 2XRFA 3OPQA 4IIJB 4PEVA 3H6HA 2QUKA 2ZVQX 3TDMA 1GGEA 4GPEA 3SR4A 2VDLB 2F43A 4HDAA 4B8YA 2XWBF 2E49A 1GSAA 2GHRA 3HKBB 4OSPA 3IALA 5DN6D 2C4MA 1AQLA 1CB7A 3SXJA 3G82C 3O8RA 4KNVA 1BN7A 3KZ1E 3TM4A 2RGNC 1U31A 2VP3A 4GGPA 4Z3DA 4EKGA 1JDBB 2AXNA 3NM4A 3PUWA 4WLVA 4RK1A 5FNVA 2WIJA 4RWEA 1WMAA 4CIWA 1MGOA 5K4AA 5K3FB 2XIQA 2WIFA 2J3EA 8ATCA 4Q1EA 5A0TA 2CCGA 1KAMA 1TT7A 5HS6A 1XDBA 4ZOAA 1NI4B 1QU2A 1U2DC 3JQAA 2IEIA 3OTIA 2Q6LA 4MGEA 1BCSA 3CNEA 4J4BA 4YAJA 1VLJA 3KZXA 2CZQA 3W3ZB 2RHCA 1QBKC 3BJRA 4UEWA 5CCDA 4R2HA 1MP0A 4ZA2A 4ZYTA 2R7AA 4W5HA 1G3IA 2IZ7A 3Q1LA 3C5WP 3UMRA 1AMNA 4KFSA 4F3TA 2H7YA 1H2EA 5IC4A 2C3MA 3AEYA 3IQWA 3LUCA 3LKBA 3QU7A 4JB0A 3R7AA 1ZMOA 1YRLA 1KJNA 5TGTA 4AVYA 1N6HA 5EIFA 1PCXA 3VZDA 4AAYA 1SELA 3NXKA 5AM0A 1U0EA 1JHUA 1Q16A 4ZT3A 4OLHA 1I0ZA 4MPJA 1GPKA 1UT5A 4HKTA 2Q1UA 4I55B 4M9CA 4Q4LA 3NDRA 1FP4B 4AS2A 1YRBA 2EBFX 4TL6A 3UG6A 2FFJA 4GC9A 5T6MA 3KB2A 3M3HA 5A2QA 4E30A 1DC3A 2IYZA 1RHMA 4G5QA 4CYMA 4C0KA 5JXWA 3WOHA 2XJ9A 4CLRB 1E79D 1PZNA 2HC9A 4KFTA 5BT9A 3REOA 2CD9A 1FPQA 4URFA 3S2EA 5A6VA 3HR8A 4HHEA 5IJZA 3N86A 4KWHA 3SBOA 3GZTB 4LHYA 1XP5A 5FUVA 1BRMA 4CN9A 4YMUA 4HNVA 3OFND 1MOPA 1MQ8B 3HCRA 2J3LA 1ZHHA 3SQXA 2QTLA 2W71A 5BVGB 3NHJA 4FD2A 1YS2X 4H6XA 1I7QB 4Y2XA 3DFIA 3C16C 4JVOA 4JJKA 4FE3A 4ZVTA 4D4MA 4PGAA 5AIBA 4WDQA 2ZBRA 5TJ9A 3KS9A 1J23A 1UWLA 2CDCA 3P9PA 1SKMA 3AHFA 4O3MA 1GPH1 1JDSA 3AP1A 1RSZA 2WWXA 1C9NA 1XD8A 3PDUA 4HVLA 1HT0A 2J6HA 3M6AA 2XCTB 2W2NA 1IAVA 2GYWA 2ZT8A 3GARA 1GGMA 5JWOA 3AY6A 2HLNA 3LTEA 4YJ2A 1M8PA 3K9HA 4QU0A 3V8QA 3HYLA 2VO1A 4I36A 3OQOA 3UAZA 1IK4A 1TDJA 1TZ2A 3TSZA 1JJIA 2BGJA 1PLKA 2NIPA 2Z5GA 5L9AA 5LQCA 3ADKA 4UTNA 1UP6A 1DQYA 4ZKDA 4EGSA 2O8DB 1G5FA 3CW2A 3LYHA 2X2EA 3DE3X 4BFUA 3VA7A 1GDHA 1RVDA 1U2EA 3S68A 4BO9A 4P08A 4WAUA 2HQRA 3MTIA 2ZVPX 3PCRB 3DC2A 2C0QA 4WJLA 3P9YA 4YA6A 4CF5A 4R5HA 5B1DA 1QHHB 4GPD1 1FNCA 1GNRA 5C1OA 2O9JA 4MWDA 4UQLA 5ALTA 3JYPA 1KYWA 2QBYA 2G8NA 1WDKA 1YDWA 4NYIR 5DLEA 3FTNA 4BNLA 4JIGA 3U4IA 3C4QA 1IB0A 2B8EA 2JLVA 3OZDA 4O1IA 5G4LA 1LS1A 1EYZA 2CXQA 1EFRA 3GOHA 3KZKA 4KDRA 4KQJA 3URKA 3N53A 4BO2A 4DMCA 5EHZA 1UOPA 1DDOA 4HAIA 1E2DA 2H6EA 3DKKA 5LCXA 2W22A 4ER7A 2I6TA 3IPLA 4IZOA 3N7UA 4DABA 3DNFA 2X9NA 1VI6A 4YCAA 3RC1A 3U3DA 4NCAA 4NBKA 4O2AB 1DKUA 5I9TA 2AR0A 3V7UA 4B7ZA 3ACDA 2PJUA 3KJGA 1HEYA 2A57A 1Y9DA 5TQ2B 1WHSA 2ZKIA 2ZE8A 4L6IA 3GP8A 2QD2A 2NUTA 5JNSA 1UBSB 2IZ0A 4TVBA 3CRNA 4PQGA 1Q6ZA 4DV2B 2QTGA 1P1BA 3BFVA 3IIJA 4MR7A 4RX1A 5C7YA 1JU9A 1X6VA 4YRLA 3SXUB 4F8JA 3B9QA 3KLPX 4E11A 1BFKA 5E38A 4BWYA 3E3NA 2JAQA 4EBFA 4GPAA 3N1UA 3DUFA 4M7WA 3H5NA 1TPYA 1B15A 1QLWA 2OV1A 3SEAA 4M55A 1T8PA 2G83A 3KUKA 4YHBA 3ZWDA 2B3TA 4DCSA 2FZVA 4MQEA 3L8ZA 3H4TA 1V5FA 1FYDA 2DKOA 1M73E 3D4PA 4B3MB 3OTOB 4AMVA 1PSWA 1KRHA 1RLOA 3ZQ6A 3GBSA 1D1QA 4RCZA 2WKPA 2NZUG 3KYDB 4DB2A 2AV6A 2LV8A 2ZU6A 3CW9A 2NG1A 4EY3A 1N1DA 1HG1A 3LPLA 1TNDA 1PR5A 3LO8A 1BH2A 3QPWA 4A10A 4DRYA 3JQAD 4JXZA 4UMVA 5DNCA 3KTAA 1W5AA 2OYRA 5FV7A 4DMUB 4IOKA 1XF9A 2Z4TA 3TCXB 1XMSA 4P9NA 2V8BA 2R86A 3MOSA 3PGMA 4BLSA 2OZEA 5TMPA 2VTBB 3R1IA 3WWZA 1NUTA 1C4XA 2W6QA 3U60B 2CBZA 4N0QA 5HFNA 3RWMB 3WHIA 4LRUA 4C88A 4KLZA 2IIVA 2X7HA 4JJZA 4REQA 2V9ZA 5ALNA 1XRLA 1MA3A 3FETA 1NURA 2WR8A 4OJQA 5HBRA 3ZKAA 4R84A 3FKJA 1AGNA 4PSKA 3LDFA 5DDIP 3DQZA 4F9TA 1KY2A 2NZXA 4IQ8A 3D8HA 2RSLA 2Q07A 4P38A 2FRDA 3JQGA 1RPZA 2X0RA 3EIUA 3ZDRA 4NI5A 2J7KA 3KVRA 4B46A 4DJFC 1P9RA 3OESA 4EVQA 3ETDA 4YRRA 3WDKA 2HNAA 4RSHA 4ZU3A 5T6BA 1AK2A 4AICA 2BFCA 3W1VA 3BDAA 3GPLA 1UWVA 2RONA 1VE3A 3KZVA 5DLQC 4CG1A 3CSDA 4G56A 3CXRA 3LKVA 4R16A 1I10A 2PMFA 5EXTA 1G8FA 3W9BA 5F2EA 3ZHCA 1ACLA 2F59A 3ZLTA 4EKEA 1J90A 1RBMA 5FH9A 1QVZA 3FI9A 3S44A 1E99A 1YE3A 3P0RA 4NICA 1YJ5A 2NU7B 4W8OA 2EOAA 3EDQA 1ZK4A 3GP5A 3DZDA 2XUIA 4YQZA 4YIKA 3U49A 2HN9A 3K09A 4P8RA 2IYRA 2P35A 5D51S 3U4GA 5BUCA 3DT6A 4BNIA 3SBDA 4J7CA 2RG1A 3VR6H 3IHKA 3EG9B 2BHSA 2RK4A 3CT4A 2QAGB 2OM2A 3GT7A 4YDQA 4DUPA 2G76A 4LXXA 4C29A 1VBNA 2W37A 3C8HA 3V55A 3E8MA 1QZ3A 3GY0A 4KMRA 4QQRA 3RRYA 5JHGB 5LLTA 1EWTA 1NXWA 2COEA 2R9VA 1E60A 3EJWA 4JI2B 3EFOB 3L0OA 1E9BA 1OZAA 3AI7A 3GUCA 4OM8A 3RYTC 2A5FA 2W6OA 1UPCA 2G08A 1G21B 1MXHA 1E6UA 4P7BA 3B6MA 3RC9A 1U9CA 2VPZA 1IN4A 1BSVA 4HSGA 3DWGA 3OCWA 1LF0A 2GAIA 5EPEA 4K26A 4PC7A 3L6CA 4RVDA 1ZZGA 3ZI7A 3CURA 2PH7A 5FDFA 4XPZA 4IEFB 3TBKA 1ORTA 3O8OA 2PS9A 2VSOA 4LRWA 4YQEA 3S2ZA 1K8RA 3ZK8A 3IJ5A 5C1IA 3BF7A 1T2NA 4YI3A 4ETNA 2YWJA 3E03A 1Y8ZA 5K0BA 3FGZA 2X1LA 1I1OA 1KVRA 3DV0A 5K3AA 1RWVA 2JFVA 2JGKA 2XUKA 3L1UA 2WABA 3WGZA 1BOFA 2HA3A 2OBMA 3IJPA 2H0AA 1IJFA 3JYQA 4MV9A 4MWEA 1C1XA 4NPHA 5CNKA 2W2VA 3CRQA 3EOZA 4O3FA 3OUTA 4OI0A 4QU9A 3ABSB 2ZR8A 2VJDA 5IJ0B 1EFRD 3EISA 3GRCA 1A0OA 2CXOA 3GELA 1I5EA 3CF2A 1NFFA 2YYZA 2WHEA 3BM5A 5FI3A 3GGDA 4JVLA 4DCUA 3DEKA 4MTLA 4PY2A 1CUVA 1KIFA 1PX0A 1Z34A 4PSUA 2FPPB 3E5HA 1E4EA 2OC9A 1B2LA 3L8YA 4L2IA 4BFZA 3JQFC 1K7YA 2H54A 4EENA 3RTAA 2F3RA 2PPVA 4RANA 1NF3A 4QT4A 3DE5X 1Y48E 5ECDA 2VDWB 5C7OO 1GXSA 4CHTA 1M1XB 3F6YA 3WL3A 1TJ5A 1T6YA 5M7EA 1Z5NA 1FFAA 2XUAA 1I33A 3ENZA 3MCVA 4D3YA 4ESHA 5EIBD 3ZXUB 1KZHA 4MW0A 4NWIA 1DP4A 1Y7IA 4WINA 1W35A 3G2OA 1L4UA 3GHYA 1E7YA 3IP6A 3R3ZA 4FMPA 1TU4A 2Y66A 4YUWA 2FUNB 2AHRA 3QH4A 1IZ7A 4D4GA 1D4AA 1IH8A 5LP6B 1KFKB 1OWPA 2BLNA 4N49A 5BRNA 4P3XA 2J6IA 3RNLA 1W0KA 4HUJA 1SIUA 2IZZA 3DFMA 3IHLA 4M1MA 4EKYA 1HZZA 1ML4A 3IUEA 4MVJM 3UUFA 3FF1A 3W05A 2CJPA 4CEHB 5JOQA 1ZIOA 3OT1A 2BTEA 1JIJA 1WULS 1VXRA 2BTQB 2CCJA 1IWBB 3KQYA 3Q3CA 4DYDA 4WFQA 3M9XA 1LKZA 4GXTA 2AJTA 2V4MA 1NC3A 1CT9A 4BQPA 1OW3B 1S1MA 2GCOB 4GR9A 2P4QA 3TOSA 2VS1A 1D1TA 1X86B 1E7SA 1Y1RA 2KLHA 3RU3A 3STVA 1OVGA 3PPWA 1EWVA 4J91A 3D1LA 4FOSA 5KINB 4UFPA 3EUWA 4MWGA 1E0SA 4PZDA 2A5DA 3GRYA 2ZJ5A 2QE7A 2BMDA 3K2BA 1FXWA 4P92A 4AYWA 4DEYA 3WLPA 4JI7B 3MRVA 2HJSA 3L0BA 4H1WA 1FZQA 1RE0A 4E5VA 2GZ3A 4KW7A 4P7KA 4Y7DA 4EW6A 1O2DA 2FX3A 4EYEA 4DV3B 3RC8A 5B4VA 4BATA 3C3KA 3AUKA 1U3FA 1WXEA 1A4XA 3MQ4A 2TMKA 5BR8B 1IRIA 2NTEA 1MIOA 1NATA 2YH2A 2AX4A 3L4BA 4LZJA 5DU2A 3UWKA 3JRXA 5TGZA 5JH7A 1MB0A 3JASA 1E3LA 1NTOA 1R6TA 1YU9A 3G0CA 4XM2A 2O2YA 4OOEA 4E21A 3CNHA 4IIDA 2VWHA 2YQ4A 3ZY3A 2RGGA 1ZEJA 5F98A 4PO3X 2GCNA 3SEFA 1MU0A 2PQ0A 1WZNA 3BXZA 3VR6A 5MFPA 3WLOA 3A6GA 4O4JB 1UPBA 1CFZA 3BD9A 1JAZA 1VKJA 5DTIA 1JQEA 2H9IA 4EEXA 2Q0SA 3LFUA 1M3SA 3AUSA 3ZLUA 1NN0A 2R00C 3QGMA 3ZTTA 4WN3A 1U0SY 5CRIA 3ZD6A 4IHQA 1IDN1 4I3FA 3VZPA 3PEWA 1NDHA 1WEKA 4R8MA 5F3WB 1RLUA 2P9YA 1ZN8A 3KPYA 3IC5A 3IIKA 1E2QA 4HTFB 2Y1EA 2PX2A 4JXKA 1J39A 4MAFA 1M1ZA 1Z4JA 1XYGA 2YN4A 1ANKA 4J0EA 4RPKA 4PCUA 3L9WA 1YUNA 2H85A 4ZANA 4W5RA 2O8CA 1F14A 4YP1A 3ZBPA 1I36A 4FN4A 4D3XA 3IEVA 1PT8A 2MYTA 1B8UA 1PF7E 2OFPA 4U7FA 4H7IA 3IX7A 5C35A 5LN1A 3AIMA 4P58A 1I7SB 3HNOA 3ENQA 5CVDA 1LY1A 5CJPA 1QZTA 4K3UA 5TMEA 4R2LA 5JISA 1KJWA 4Q9KA 3UN1A 3VPDA 1Y89A 5DF1A 1MO3A 1U7HA 1JJVA 1P17A 4ZC1A 3VPSA 3DH0A 1QVAA 2G09A 3ORRA 2VDUE 4K9QA 5CYFA 4DG9A 3RU7A 2FWBA 3WIBA 2UVPA 2ZJ3A 3BE5A 5AK5A 1G2PA 5AJVB 2XWPA 4BLVA 5JNTA 1O7JA 3F8TA 2KI5A 4X97A 2GWRA 2IW3A 4I08A 4L5CA 4LPKA 3WIEA 4FSDA 4IFTA 1ZH6A 3OQ6A 4W9NC 4KXVA 5AJXA 1LS6A 1NX9A 4BVLA 2G0AA 1KR2A 3FYUB 4QJ3A 1GPDG 4IM7A 4CTOA 6ADHA 5GTDA 4N9QA 4C04A 2HCFA 5JNWA 5C5DA 3UJAA 5JY6A 3UAOA 2V58A 2E4WA 3L0PA 5KQSA 4AJLA 1VPDA 1ZIXA 2ZM6B 4OX9Y 1VE9A 3GLHE 4RHXA 3TQIA 1CEEA 2PUEA 1F20A 5A03A 4UPDA 2O2DA 3CE9A 3OC0A 2M32A 3PXAA 4B81A 4EB3A 4ZMSA 4Y2GA 1G5TA 4EP1A 3VKGA 2PIAA 2WJ6A 2NNLD 2HXSA 1R0BA 2GPSA 2J4CA 3P1JA 5LJLA 3VI3B 4A2PA 4Z54A 1TX4B 3ONDA 3FFTA 1SD1A 1SG9A 4N4AA 4K9NA 3ZKWA 3TR5A 3EPLA 4EBBA 2D7DA 2I5PO 4FILA 2V5AA 4IGFA 2OHGA 1M9NA 3QXHA 4HJRA 2ZPAA 2FQWA 4BTLA 2D00A 2XRMA 4S2UA 2X8JB 2AVNA 1W7AA 2XUQA 3HN2A 1JHYA 3SYRA 1KH2A 4FQ7A 4H0NA 3BH0A 4AJKA 3OM0A 4D7AA 2P9BA 2FQYA 2PKXA 1KWKA 3P9ZA 1SC1A 1T8RA 2REBA 3RCBA 4AURA 5L3SB 2ODTX 1TMYA 1HE1C 4NIMA 1OREA 1QXSA 3I4CA 3UHOA 4CEIB 3NG1A 4V2IA 3T4PA 2OO7A 2OGSA 4L28A 1W0KD 4K5QA 4MLZA 3N2IA 2ODNA 5C8YA 2AMYA 2C9CA 2OCIA 4PWYA 4YRFA 1FRQA 1SNYA 2VXCA 2YW9A 4HDNA 4HWOA 1GTMA 1B6SA 2DQ4A 2EP5A 4LTMA 3THXB 1MABA 1SQSA 5KQLA 1DFHA 1S8AA 4JIMA 4PGFA 5AVUA 3QVSA 4Y67A 4E5YA 4CM9A 2V59A 4PYNA 5AICA 5JROA 2QM8A 2FN9A 2JATA 4BCDA 2Z1DA 4I6GA 4RTMA 3ONNA 2WUVA 3W6OA 2I29A 3AF4A 3B38A 13PKA 1V9CA 5GOTA 4I14A 1N9GA 3MTAA 2YICA 5LDGA 4CPDA 1XHFA 1GA6A 1AIPA 1QYWA 2QE7D 2VOEA 4YAFA 1XDGA 5DBGA 3WWCA 1NW6A 3ZVKA 4CKCB 1ESEA 2QAIA 1VSVA 1ESDA 2YMLA 4I4NA 5L7YA 4FS8A 4G9GA 1Q5PA 4MKIA 1JPUA 2P9EA 3A3KA 3DTTA 1NZDA 3KQPA 3SYKA 4UAVA 1W59A 4WK4B 3TAUA 3I53A 4QELA 3FPCA 1E2MA 2JKVA 3RJMA 4YRGA 2QV7A 5HR5A 3CC8A 4RKEA 3ZGOA 4CL0A 5M04A 4COKA 1K63A 2XDWA 3GBVA 2UZ4A 3H99A 2P77A 5K0EA 4GX5A 3QVGA 5K8UA 2VSFA 3H18A 4GLFA 3VR6D 3VYVA 1YR2A 2DUWA 2QQFA 4WPGA 2YBEA 1QV9A 3W79A 3ZCRA 3MAGA 4ALMA 1FDIA 5EP1A 1NYQA 1D2AA 4R69A 3VAZA 1WKBA 4M1EA 1KEEA 2C9OA 1VSBA 5D6OA 5FBVB 1KAHA 2ZRLA 3KQKA 2ORED 2Y3IA 3CR7A 2BCJQ 2VYVA 4M1QA 1U2DA 2XSZA 3R74A 5HOQA 4QTXA 1KNXA 3HKCB 1KYTA 4QBKA 5CYPA 4YCNA 1XLUA 3U31A 1Q0PA 1OXXK 5DW0A 4BVGA 1U7WA 5FLXA 4TYYA 1TM7E 1UXJA 2HHJA 2OG1A 1HDCA 3LGXA 5E6UB 4D41A 2OORA 1KO1A 2PGAA 2J31A 4XTRA 3SG0A 2DB3A 4EFMA 4PYKA 4BLTA 2B82A 5HZMA 1UAAA 3MWEB 1EFAA 5EPUA 4OHVA 2FI1A 3VBCA 2J09A 2QZZA 1HH4A 2IZ1A 1EFVB 3FH0A 3MD9A 3JVDA 3ANXA 1SEVA 1UPUA 1D0SA 3EFEA 3IUQA 3R0VA 4U6NA 4I9NA 4RPIA 4F21A 4GP9A 1KDZA 1G17A 4YPFA 3S2IA 1JKMA 1QE5A 1RCUA 2ZG6A 4I46A 3KETA 5J4HA 2XMCA 2IZ5A 1YS7A 4PQYA 1PTKA 2H9AA 4UOZA 1KRWA 2WF8A 2L17A 4KR9A 3J7AC 4RF4A 1Y8AA 4OP2A 4IICA 4E7PA 4BTVA 2X6TA 1U1FA 1ZI9A 2OC4A 1DEKA 4GMKA 1U6IA 4KBYA 5E4FA 1T1IA 2FLVA 5CK5A 2AZMA 2ZUBA 2H1OA 1R5JA 2CSXA 1S3IA 4P5DA 2IGBA 3TBHA 3TNFA 4EZEA 1MJGA 1J1ZA 5JC1A 3C1UA 4J9VA 3UC9A 1T6NA