2ZQZA

R-state structure of allosteric l-lactate dehydrogenase from lactobacillus casei
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
312
structure length
307
Chain Sequence
DKDHQKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAPTRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Active and inactive state structures of unliganded Lactobacillus casei allosteric L-lactate dehydrogenase.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
total genus 113
structure length 307
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zqzA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2zqzA02
5A02A 1UAYA 3SC6A 1UP4A 1XA0A 1AHHA 1CWUA 3TFOA 1D1TA 1E3LA 4Q3EA 2X9NA 1BDBA 3F5SA 3IUPA 3DBLA 4G5HA 4BNZA 5CDSA 5IDYA 2HJSA 3GZNA 4D43A 1R4MA 1K6XA 3ZHXA 3LYLA 4XGNA 1BW9A 2BI8A 4J49A 4WK6A 5TJ9A 4IM7A 4CM9D 4U0JA 4HNGA 3CTMA 1ENZA 1KOLA 3EMKA 1CDOA 2A4KA 1IYZA 4MDHA 5A9RA 3LVFO 3QWAA 1VKNA 2JD1A 1ZIDA 1D7OA 4BNJA 3BMQB 4BO7A 1GCOA 3TZCA 1DXYA 2P91A 1I3LA 1I24A 2WE8A 4PGFA 2Y0DA 1Y5MA 4WCFB 3EY4A 3RC2A 3E48A 3B70A 2PZJA 4FDAA 1D3AA 3LT2A 1X7HA 2V6MA 1YBAA 8LDHA 3FBTA 4AJIA 1P1FA 4NK5A 2V6BA 1KC3A 4HV4A 4E30A 2I76A 1ZBQA 2YY7A 3BMQA 1IE3A 3F4BA 1MX3A 4DIOA 4Z9XA 4CQMB 3C85A 2ZK7A 4RGBA 4B4WA 1TT5A 4BNMA 1C1DA 4FFOA 2H9IA 3O4RA 5I9LA 1MV8A 3KRTA 1AUPA 3DHEA 4E3ZA 1C1XA 2WM3A 4N18A 1AXEA 3W8EA 4AJ4A 3DZJA 4HP8A 4CM3A 3NV9A 4WLFA 3VVCA 3JQGA 4L0QA 4D44A 2ZIZA 4L73A 3GN2A 2BF7A 1X15A 4GWGA 4WOKA 2P4QA 3WGZA 4CL3A 2JKVA 3FHLA 1SCUA 1XGKA 3ZI0A 1Q0HA 2NUAA 4A5OA 5THQA 3NT5A 3RC9A 3ZHYA 3U62A 1NFQA 3WJAA 3RVDA 4HFJA 3GRKA 5DZSA 3AJRA 3MZ0A 4QUKA 4TVOA 4YRBA 4H3VA 4L75A 3EYWA 1FDUA 3I4FA 4MKXA 2IZ1A 1CRWG 3PRJA 4PLVA 4MPDA 1HTBA 1Q0LA 1XLTA 3NT2A 1NFFA 3GY0A 3GEMA 1U4OA 1H6AA 1WZIA 1I2CA 3OJEA 2JCYA 5ICMA 1U2DA 2D8AA 1MB4A 2I99A 5CDGA 5CDUA 1D8AA 3PDJA 4QO8A 2NACA 4Q3NA 1RM0A 3GGGA 3W8DA 4IS3A 3A06A 5EPOA 1UAGA 3HDJA 2PV7A 3P5SA 4ZN6A 3C24A 3OMLA 3GUCA 2F00A 4U6SA 1XYGA 5KJCA 5L7TA 5I7SA 2NQTA 5IZ4A 1AXGA 3CEAA 2O3QA 4GH5A 1YDWA 3H9UA 3K6JA 5JCXA 2B69A 1MC4A 5L4SA 3BIOA 2FP4A 2GN9A 5JS6A 1TVEA 4NJOA 3S55A 3ANNA 4MVJE 3NUGA 4WLOA 2AHRA 4E2YA 5GZ1A 4DPKA 5DNAA 2ZB4A 4X54A 1NQ5A 3KYDA 3VPHA 4IZIA 1NPDA 4XD2A 1GEEA 2DFDA 2VUSA 4G2NA 3D5TA 4R5MA 3V1UA 1MXFA 4IXWA 3HADA 1I5RA 4RDHA 4NZ9A 1G1AA 4BO1A 3CUKA 5L40A 4EEXA 5G0SA 3WNVA 1DIBA 2ET6A 2UVDA 3C7DB 1L7DA 2GLXA 1YB4A 2CY0A 3UCEA 4E2WA 1RKXA 3JYLA 1M76A 3H5AA 1P0CA 3TZHA 5DBFA 3W4JA 2Y1OA 3KSDO 2CVZA 5L51A 1PIWA 3W6UA 1NASA 4XEHA 1PTJA 3BHJA 4HFNA 3IIEA 1E7MA 4BO2A 1Z75A 2ZB7A 4NR0A 2YJZA 3JYNA 3FTNA 2NV6A 3PVZA 3SC4A 2D1YA 3WGYA 1IL0A 3ZWYA 4YRAA 1PS9A 3HSKA 4OXYA 5I7EA 4HNHA 3E6AA 3QSGA 4PLTA 4GBJA 3RBXA 2YHIB 1T4DA 1YGYA 5L4LA 3I4CA 4IDDA 3ZWCA 1HDZA 3DZIA 1Q0QA 1Y9EA 3H5RA 4JXKA 1KY4A 4ZQHA 2ZYGA 4QEDA 1VL0A 4RJTA 3NJ4A 2Q1UA 3ZNPA 1EE9A 1PQUA 3AM4A 2J5RA 5KJEA 3U09A 4N5LA 4F3YA 5GZ3A 4P4NA 4YBZA 3AK4A 4NH4A 2C0CA 2IRWA 3GUYA 2IZ0A 2YHIA 2YW9A 3DBVO 1SO8A 4J0FA 2X0IA 1QP8A 1O95A 3UXYA 2UDPA 5JE8A 1E1MA 1LRKA 1JW9B 5JFOA 1E3WB 1RWBA 4P8RA 2Y66A 2C54A 5TLSA 2GZ2A 3PLRA 1KIFA 4EDFA 3FWZA 2G0TA 1KEUA 4CM8B 3F9IA 1XU7A 4B79A 1UR5A 4PLZA 1QXSA 2EIHA 2C20A 4CV0A 2Z95A 1A9ZA 1J4AA 1GCUA 1KEPA 2DTDA 4I8XA 3GFBA 4RVFA 4E2XA 3Q9NA 1NVTA 3CKYA 2DTEA 1DRWA 5JPIA 1E3WA 3INRA 4JP2A 3O9ZA 4XKJA 3DMTA 3DZKA 1ZJYA 3S2EA 5CHEA 2GN6A 4CM8A 2OMEA 4CMHA 3RFXA 4IJWA 3QLJA 4KQWA 5DOVA 1GY8A 1HDXA 2I6TA 1HEUA 1MP0A 4ND4A 4ITUA 4BV9A 1UUFA 1F06A 1A27A 3L9XA 4WCDA 4IPTA 2FRDA 5CP8A 4A26A 3F4LA 4HWKA 5IDWA 4C7KA 4M8SA 2X58A 2GSDA 3FNHA 3MOIA 5B4UA 1HE4A 1VM6A 4ZU3A 2VCYA 2B0JA 3KHUA 2NU7A 3VH3A 1MG0A 1P9LA 3WBFA 3RI3A 1ISIA 3JYPA 1I33A 4FB5A 3HWRA 3NDIA 5I8WA 5JY6A 4J6FA 4J1TA 1LC0A 3E5MA 1LBEA 3JYOA 3DBRA 3PK0A 3QWFA 1ZZEA 4EUEA 5CG2A 2X5OA 1BSVA 3MJCA 3WDSA 3H2SA 3ZDFA 2EJVA 4A73A 1IPFA 2WD8A 3M1LA 2XOXA 2RH4A 4D45A 4PG6A 1IZ0A 3D1LA 1Z7BA 4LRTB 3RKRA 4QFCA 1YBVA 2OBNA 3NT4A 4CV3A 4FFMA 1Y5RA 2JFFA 2PLAA 1FK8A 4ONEA 4Y8VA 5HWSA 4NJMB 5DP2A 3TNLA 4BNWA 1RJWA 1I3KA 1E92A 1U7HA 4S1VA 3VZSA 5ER9A 5CEEA 3SEFA 1LSUA 1O94A 3L0DA 5BSHA 2B83A 4CLRA 1B14A 5ITWA 1SNYA 2VOEA 4NBWA 2GRAA 3TZKA 2FR0A 4J4TA 4DYDA 1EK6A 2YDXA 4RV9A 2NU9A 2H6EA 3PPIA 5AXCA 3I9MA 2VNSA 3WGTA 3KLPX 4XDZA 4I5DA 4NJMA 3KYCB 4IQ0A 5ILGA 1D4FA 3RJ9A 3RUHA 1ADBA 4XQEA 3TL2A 4TRMA 1NHWA 5DULA 5K6AA 4RVGA 1B26A 2OZPA 3I52A 3UFXA 4Q9NA 4BNTA 3F46A 2JCVA 3D4OA 3MEQA 4LMRA 3N7UA 1KC1A 1B8VA 1IUKA 1YQDA 4CQLB 4NI5A 1U3TA 4XWYA 5JDCC 1QYCA 3A9WA 2EERA 1E6EA 4BGIA 2GR9A 1H2HA 3FPLA 3DOCA 1ISJA 3OP4A 1HE2A 3KYCA 1MC5A 3HDHA 3IDSA 4B4VA 1FDSA 1HYHA 1O5IA 3DMYA 4WCFC 2WSBA 5F5LA 3A28A 3GG9A 4PG4A 4R5HA 2X9GA 4CUJA 4YJDA 3WB9A 1CEQA 5BNFA 3I83A 4AJ1A 4GX0A 3D0OA 4J7UA 4DLAA 4HFRA 4CQLA 1DFGA 5L45A 3AWDA 5C3MA 2QW8A 4YEDA 1O0SA 4E12A 4YAGA 1P31A 1QSGA 4KOAA 1OBFO 5JNLA 3ONFA 4DLLA 1E3JA 2JAPA 3E9QA 2FHSA 1JKFA 1JWBB 4R1NA 1R4NB 1WXDA 2BRUA 5THKA 1N1EA 3BTVA 4CM4A 5JC8A 2JCXA 2AG8A 2VOJA 1A5ZA 2OP1A 1RM5A 4R1SA 4RPGA 1JU9A 1EEHA 4KUGA 3UH1A 1MA0A 3OIDA 4WLEA 4XYLA 1C14A 1YQXA 1FDWA 3ZU4A 3GK3A 4LN1A 4R3NA 4BV8A 1XCBA 2R00A 1O6ZA 4J1SA 2A94A 3AUSA 2Z1MA 4CJXA 4DIBA 1T1RA 4JN6B 4ZGWA 4TWRA 1ADFA 2X6TA 4A0SA 4IBOA 4DPLA 1U3UA 1Y81A 4BO6A 3PXXA 2UV8A 5EIOA 4QXMA 2FMUA 4XYGA 3WTBA 3QV1A 5A5FA 2NM0A 4U5QA 3GA0A 4PLYA 4XRRA 3SLKA 4M86A 1IY8A 1T2DA 1PWXA 3IJRA 4CM1A 1PJ2A 4CR8A 3TL3A 3R3JA 5JW6A 4EGFA 1LDBA 2PZMA 4R1UA 1H93A 3LF2A 4XA8A 2OHXA 3WGGA 3TPCA 2OP0A 2W4QA 2ZKLA 4UUMA 4CM9A 1E5QA 3OETA 2Q46A 3RUFA 1GZ6A 1SPXA 3GDGA 1ZNQO 1YVEI 4IIVA 4AJ2A 5JXWA 1Z73A 4BL5A 3AFMA 4D79A 3K30A 3QVSA 1B15A 2NU8A 4YJFB 3WLEA 3UW3A 4IDEA 4ZICA 5CAEA 3VDRA 1JWAB 1UXGA 2X4GA 4UVGA 2NADA 2EJWA 4BNIA 2O2SA 1GYQA 1WLYA 5COBA 3DZHA 1ZFNA 5BNIA 2HU2A 2A35A 1R6DA 1I36A 5GMOA 2FSVA 4PZDA 3ONEA 1XHLA 1JKJA 3E5RA 3ZHZA 4KZPA 1PJ3A 3JQ7B 4OMUA 3DBHA 4Y67A 4EEZA 1FF9A 4LK3A 1EVIA 1TXGA 4OGWA 5AOVA 3V8BA 3O8QB 4GL4A 4YJFA 3WYBA 3ON5A 5BNTA 3IKTA 1ULSA 4WLNA 2J5QA 3LLVA 3A14A 1UJMA 4CUZA 5COAA 8ADHA 1B8UA 4OYRA 3PWSA 4KUHA 3ABIA 3UCFA 3GN1A 1K6IA 1J5PA 2HRBA 5KKCA 2PA3A 1E6UA 1HDYA 3F1KA 3H8VA 1GFSA 1ZSVA 4JIGA 4DPMA 1D1SA 3O8QA 2PY6A 4RF4A 4PCVA 4UREA 4GGOA 4E21A 4RL6A 1Z45A 5EESA 2VHYA 1B0AA 5K0ZA 4XB1A 3H9JA 4B7XA 3ZN2A 3VH2A 2NTNA 2QYSA 5DOZA 1GEGA 1ULUA 4BO4A 1VSUA 5A1TA 1DLJA 3KSZO 3E8XA 2BFPA 3D5QA 1DO8A 3GMDA 2IE0A 4FFNA 4JGBA 3GLQA 3R0IA 3WGIA 1Q2XA 4EUFA 3V2UA 2DM6A 1ISGA 4E5YA 1QMGA 1X14A 4XYEA 5HBRA 4BNGA 3PFFA 2HMSA 1K5HA 3ANLA 3W4IA 2C82A 4DGSA 3B20A 5A9SB 1OI7A 4AFNA 1Y7TA 2LDXA 3DHNA 3TQHA 4RPHA 2BFMA 2DBVO 2W2LA 3L6EA 3PQDA 3QIVA 4BNUA 3GH3A 3WFJA 1EE2A 1JVSA 2ILTA 4UUPA 1ZCJA 3G0OA 3PJGA 3H2ZA 4UUNA 1H94A 2C59A 3HQ4O 5JY1A 4IQGA 3NEPX 4BKUA 4DIFA 4W9NA 4U6QA 4UEOA 3VZQA 2GZ3A 3KEQA 3GR6A 2VZ0A 4B3IA 1P1KA 3BMCB 5TJHA 4JNKA 4ALKA 3JQEA 5KOIA 3PGJA 1N7GA 4LSMA 1UDCA 2DT5A 4BMVA 1H0KA 2EP5A 2J5KA 4DQXA 1EBUA 2VTEA 1JTVA 2P9CA 2PKRA 3L4SO 1GADO 4E33A 5FWNA 1VJ0A 1ORRA 4FS3A 4ND2A 4O59O 1IOLA 4WJZA 1NPTO 1LX6A 4XJTA 1GQ2A 1N5DA 4QQRA 1ZK3A 3TJRA 2VN8A 1EUDA 5B12A 3GZNB 3F6YA 4IDAA 4XYBA 1R4MB 1BW9B 2NWQA 1VLLA 1Z7EA 4MVJF 2X0NA 4U7WA 4OH1A 2DBZA 1HL3A 3OJ0A 1LSOA 3UKOA 1XWFA 2J6IA 2PD4A 1G0OA 5CEFA 2D0IA 5B37A 1M6HA 3I3OA 1E1KA 1HT0A 1OZAA 3GPDG 3NDJA 1WAMA 4MVJH 1UH5A 1LDGA 3PIIA 2QZ9A 4NPCA 3ZNNA 3WYEA 2O7SA 2Q2WA 3ZNQA 3JQCA 3MJVA 1JDJA 4AJLA 4J2HA 1P74A 3BYZA 3U49A 1GU7A 3G3EA 4CMIA 3LC1O 4R3WA 1E3EA 3NGLA 3RBZA 3Q9UA 3GEGA 2AE1A 4MVJM 4D3SA 4NU6A 4Z0HO 1PX0A 2DAPA 3I5MA 4QSMA 3RUCA 1HZZA 4FC7A 5DCWA 4D41A 4ROSA 2YFHA 3GVCA 4YYZA 2AEMA 4FIZA 1EBFA 1HF3A 1TT5B 1UZLA 1C1DB 4FOOA 1R12A 3EVTA 1PL7A 1U5CA 3D3WA 3I9OA 4CMCA 2V6GA 1UP7A 1C1XB 1KVRA 2DKNA 2VT3A 5BQFA 5JDIA 3L4BA 3JQGB 3PWKA 4D46A 4TRNA 1ZKMA 1AHIA 4Q39A 1JN0A 3MJ4A 4I5FA 2GNAA 4Y6SA 4I5EA 1WWKA 4ZRNA 2HRZA 3BA1A 1Y1PA 2X86A 4BS9A 5KNLA 3PIDA 3H9QA 5FYDA 2HDHA 4BKOA 2SCUA 1WZEA 3N74A 4XIJA 3FSRA 1GAEO 1DRUA 5IXYA 4M49A 3HJAA 3EUWA 5EQDA 5F1PA 3EW7A 2C2XA 1EUCA 1Y9AA 2YFQA 4FC6A 1CF2O 4CPDA 1HDCA 3DOOA 2DPHA 2B37A 3OSUA 5A03A 4MP8A 1R0SA 1L1FA 3K8ZA 3LF1A 3V1TC 4AJHA 3JSAA 2NVBA 3DEYX 1UXKA 2HMUA 3JQ9C 1GR0A 5CG1A 4UVIA 1F0YA 4JK3A 3A4VA 1T2AA 3PLNA 3OJOA 3UAGA 3BHMA 2P68A 1PJCA 1PEDA 3CIFA 3U4IA 4TMFA 1GTMA 3AOEA 3E9MA 3PGXA 4R16A 4ZA2A 3RD5A 4W4TA 5FEUA 1O9BA 1HE3A 3RSHA 5IZCC 1ENYA 2CSUA 4FFRA 1VRWA 4N5NA 4Z0PA 1U28A 1UXJA 2P2SA 5I9NA 1FDVA 1WNTA 5JAIA 4ZJUA 2X7HA 4NFHA 4ID9A 2WYVA 2D59A 4OIMA 1BVRA 1M66A 2W2LD 3G1UA 2BLLA 2I67A 3KYDB 5T6BA 1JA9A 4YT2A 1LEHA 2GZ1A 5C5IA 5KVQA 1GPDG 4J7XA 1QG6A 4WKGA 1ISMA 1Y6JA 3COSA 4BQPA 2DPGA 3H4VA 2I5PO 5TIIA 2VUTA 5JSFA 2DTXA 4PLHA 1QLJA 2P5UA 3ZZNA 4Z6KA 4UULA 3UGKA 4B8ZA 2NTJA 2B4QA 4IDCA 1KYQA 1VJ1A 5F1OA 2BHLA 4XZ3A 4MIYA 4MVJA 1V6AA 1KS9A 3VC7A 1GV0A 1XR3A 2IYOA 3H6KA 3TN7A 3W1VA 1LRLA 4IINA 3PYMA 2RCYA 3DQPA 4OKNA 3JD2A 3KYBA 1YXMA 3WIDA 2PD6A 2IEBA 1ID1A 3DAGA 3BTUA 1RM3A 2VWPA 4IJVA 4OM8A 3H3JA 1DLIA 2H1SA 4NG5A 5KKAA 3FTPA 1YB1A 1NWCA 3SLGA 1JAYA 1KETA 3ZW9A 1NBOA 2POQX 1V3VA 4EYEA 1WMAA 3JQFA 4ZHSA 3RC7A 4JX8A 4J90A 3WMWA 2XF8A 3K2BA 5EJ2A 1KVUA 3MJSA 5T5QA 1HDRA 3PZRA 4J2OA 3U3XA 1PS0A 1C0IA 3FR8A 3FWNA 4CMEA 4Z3KA 2PKQO 3JD3A 1TLTA 3RROA 3WYCA 2RBEA 4UAGA 2Q4EA 1XKQA 3G49A 2FWMX 1HYEA 1XSEA 2TMDA 2FR1A 1JVBA 4WPGA 2C5EA 2AA3A 1V3UA 3MJTA 1FJHA 3DTYA 5ES3A 4D0RA 4URFA 4KWIA 4INAA 4CLEA 1GL3A 4FFPA 5F21A 1JLLA 1NXQA 3QRWA 4JQCA 5T8KC 5JO9A 2Q45A 4NDNE 3UCXA 5C7OO 1LI4A 1LDMA 3INGA 3BAZA 3AM3A 3DTTA 3WIEA 1NYTA 4E32A 3I6IA 3DONA 4CLOB 1PL6A 1E3IA 2X22A 2HUNA 2JFGA 4GKBA 5G0TA 3OJLA 3ZWOA 1EVZA 3K31A 2Y1DA 4XQ9A 3VPGA 1K6JA 2X0JA 1BHSA 4JBHA 5T64A 2DVMA 4DVJA 2AEFA 2VYVA 3VHRA 1R66A 2QHXA 4XIYA 4QTZA 3D64A 6ADHA 1PQPA 1TB4A 3GEDA 1KY5A 2CUKA 4UEJA 5GZ6A 2GD1O 1ZXLA 1YS4A 3Q2IA 1DOHA 1GYPA 2IDZA 3C1AA 1RM4A 3S1LA 4CLOA 1ISFA 2QRKA 1N7HA 1ADGA 4L74A 5DP1A 1DHRA 1N8KA 1LTHR 4M54A 3AY6A 2X5KO 3NRCA 2UAGA 5KVVA 2GCGA 3VTZA 2AQKA 1G6KA 4YJGB 3S2FA 2ZQYA 5TSDA 1KVTA 4IDFA 3SX2A 4J1NA 2VQ3A 2J8ZA 2H5LA 3R3SA 4GWKA 4MVJG 3TWOA 2J3HA 3E03A 4JBGA 3WTCA 4ZRMA 1PZFA 1PZEA 4TQGA 1YOVA 2Y0CA 5JAQA 4XJSA 1KVSA 2BKAA 4IDGA 3NYWA 4JROA 1NWHA 1NQOA 4ZQFA 3CMCO 1T24A 3OICA 3ZWMA 4I9HA 4GVLA 3I6QA 1V0JA 2YYYA 3ICPA 5LCXA 3GOHA 4OQYA 4YJGA 3DBRB 2FPGA 5BSEA 2BELA 4PLWA 1U1IA 5TT1A 3GRPA 1EQ2A 3DL2A 4LVUA 1P44A 4RF2A 5T67A 3UUWA 5DT9A 3GNTA 1YONA 2ZYAA 3AI1A 2C7VA 2ZB3A 3P2YA 3VZRA 3T7EA 2CZCA 1PZGA 2O3SA 3GHYA 4F46A 4XGKA 4J4BA 2NVUB 2QQ5A 2GYYA 1ZUD1 2Y05A 2VRCD 2W98A 3G1TA 4RVSA 1C0PA 1HLDA 3AUUA 4EUHA 2IYPA 2AG5A 2VTDA 4PG7A 2AE2A 2BFAA 3GPIA 4KWHA 3P19A 4AL4A 2C2YA 3E9NA 2WYUA 5MGBA 4CLRB 2IXAA 2GO1A 1LXCA 2NVUA 4YWJA 1E5LA 1TA4A 2JHFA 1HRDA 1OAAA 3JQBA 3ADPA 4GGPA 4ZD6A 2IXBA 3DOJA 4MVJD 4BO9A 1Y8RB 3O26A 5GY7A 1NAIA 4PG8A 1H9AA 3QA9A 4DYVA 3M2PA 1MUUA 4LMPA 5H81A 2FZWA 2YQ5A 5BSFA 1I2ZA 3BMOB 3DC2A 1DAPA 1I2BA 1A71A 3QVOA 4W99A 5TT0A 3CSDA 2I3AA 1MFPA 3CMMA 3PI7A 1Y8RA 2O50A 4GSKA 1U8XX 3G17A 4Q3DA 4W7IA 3WR5A 1VL6A 3OH8A 1OMOA 2WE7A 2XXBA 4MVJI 1N1GA 5DN9A 3S2GA 4AG3A 4L4SA 3STHA 4K28A 3ANMA 5FFFA 1GD1O 3BMOA 2D5CA 2C29D 2PNFA 4U0KA 4XX0A 1N9GA 4DRYA 5HRUA 1KBZA 4IDBA 1GUZA 1YJ8A 5EQFA 4I1IA 3OHSX 3E1KA 3GDOA 1U3WA 3JV7A 2VUUA 4IIUA 4YQZA 3RWBA 3VPFA 1QV6A 4CUKA 3P7MA 3MCVA 1U8FO 4MKZA 3FI9A 3WOHA 1EUZA 3ZU5A 1Q7CA 3U4DA 2HMVA 2B5VA 3HB4X 4BNLA 4D3FA 3FN4A 3PJEA 4AJOA 1BTOA 4XYMA 3VH4A 3CINA 3VPXA 3ZWBA 3Q1LA 1HYGA 1ZK1A 3ENNA 2VT2A 4FJ1A 3LT0A 3QVWA 4FJ2A 4CM4B 2AXQA 1QV7A 5CEJA 5DBGA 4D7AA 2O48X 4RCVA 5IG2A 1SC6A 3K96A 3EZLA 3HFSA 3KTDA 4KDEA 2NQ8A 1N2SA 1SB9A 1X7DA 1BDMA 1ZEMA 3OFSA 5IN5A 4OOFA 1KEVA 1PGQA 3GVXA 4ND3A 2ZQZA 2CVQA 4LCEA 3HN2A 3OQBA 1NTOA 1Q1NA 2B4TO 3AU9A 3FCOA 2P5YA 3ORFA 2AQHA 4J43A 3W8FA 2VYVD 4H16A 4E5NA 3ZH2A 4L76A 2EEZA 4BNFA 3ZWNA 3OM9A 4O5OA 4OOEA 4PVDA 3RUDA 3L6DA 5LDHA 2VRBA 4JLWA 3BTSA 4M87A 4M89A 1Z6ZA 1QYVA 4IGFA 3QJ5A 3VKVA 4A10A 3TZQA 2HCTA 5JYEA 4RPKA 3QVXA 4XR9A 2B4RO 3WGHA 3K92A 1WPQA 3HDYA 2D3TA 2P4HX 4XQGA 4WECA 2D4AA 4YCAA 3KUXA 2J3IA 3MWDB 4I9UA 2F1KA 2QZZA 3M2TA 1VL8A 4IJUA 4JCOA 4YTEA 5EINA 1OC2A 5JMPA 2Z5LA 4B7UA 4M1QA 2EKPA 4KTTE 1ML3A 2VNAA 5A4DA 3AI2A 4ALNA 2J3JA 3FRJA 1QRRA 3H5NA 1GV1A 3GT0A 5L4NA 3WICA 1SOWA 4D3DA 3NAQA 1MFZA 2E82A 1P1HA 1U5AA 3E82A 2B5WA 3LZ6A 2FR8A 3PTZA 3QQPA 4NBUA 5HTOA 1NQTA 2EF1A 3QWHA 4HY3A 5L3ZA 4W82A 4CV1A 1FDTA 3DBHB 3PZBA 5A04A 2OUIA 5CPFA 5JMWA 1J6UA 4II2A 2CF5A 4Y98A 5I8ZA 2JHGA 1W4ZA 1E77A 3GDFA 3KOUA 3PP8A 1CQIA 3PHJA 4BO0A 1E0DA 1B7GO 5IXSA 1DIRA 5F5NA 4XRGA 5A06A 2AQIA 5KJFA 2QIOA 1T2CA 2NU6A 1DC3A 1NQAO 4UEKA 4G81A 4OQZA 4DQVA 3IUSA 1DIAA 1PR3A 2FSSA 2ZTVA 5TNXA 3BTOA 1AGNA 2Q3EA 1MG5A 2CF6A 4KUEA 1XIVA 4YRDA 4E5PA 5JLAA 1JKIA 3AUTA 3RCBA 3S8MA 1HWYA 2O3RA 1R0LA 4TRJA 4TVBA 2OO5A 1Z82A 4WE3A 4YB8A 3D4PA 5F1KA 5JC1A 3WJ7A 2HKIA 5CFZA 4HXYA 4KTVE 1S7CA 3JYQA 1CERA 4MKRA 4HADA 4UVDA 2ZATA 4MO2A 2QYTA 2VWGA 4LGVA 2HK7A 3BMNA 1B2LA 3CXRA 4UUOA 5JCJA 5T57A 2D5AA 1G0NA 2V7PA 4K26A 2DC1A 4GX2A 4TKLA 3PYXA 4EJ6A 2OOSA 2ZTMA 3VZPA 2X8LA 1F8GA 1O89A 3R1IA 5HS6A 4DWVA 1YJQA 3I9KA 1P77A 2LDBA 2GDZA 4BNNA 1GDHA 1E7SA 1WW8A 2VWHA 2WMDA 4DC1A 4QECA 3ROKA 4CLXA 4EI2A 3RUIA 1OFGA 4XB2A 2E49A 4RPJA 3H7AA 1WMBA 3JQ8A 1C0KA 1Z74A 4FSHA 4MJLA 1I10A 2Q4BA 4O0LA 5JAZA 1EQUA 4FFLA 1LQTA 3ZU2A 1H6CA 1HXHA 4B3HA 2G17A 3DMTC 3UVEA 4YT4A 4YDRA 1M2WA 1KVQA 1P33A 3PDUA 1UZNA 1DAOA 3Q6IA 4ALLA 3QWIA 1CETA 2YZ7A 5BSGA 2DU8A 3HN7A 1DB3A 1ZSNA 3GAZA 3MJEA 1DBVO 1ENPA 4OKIA 5DF1A 3V2GA 4E31A 3IJPA 4B4UA 1A9YA 4RORA 4WNIA 4K6CA 2JAHA 4PRKA 1XQ6A 1UDAA 3JQ6A 3KEOA 4CMKA 5EMHA 2OL4A 2XAAA 2YDYA 2WDZA 3FR7A 3Q0EA 4W7HA 6LDHA 5AXAA 3UICA 3AM5A 4BKPA 1PJQA 4PVCA 4J1QA 3DZGA 2NSDA 2WD7B 1R37A 2EXXA 3WX0A 2W90A 1KEWA 2V6FA 2O7QA 1A7AA 3SJ7A 3ADOA 1EK5A 4KMSA 4Z9FA 1RPNA 3ONDA 3RUAA 3L07A 2J3KA 4L4RA 1MLDA 1W0CA 1PS8A 1ONNA 4HX5A 4EJ0A 2P9GA 2Q49A 4EJMA 2JL1A 4IY1A 4JJIA 2W2KA 1ZO8A 3WG9A 4DTIA 1H9BA 1A72A 3CZMA 1WDKA 2PGLA 4CMIB 9LDBA 2NLOA 1HETA 2ZB8A 1ZK0A 4JP3A 4TZKA 1J0XO 4E5MA 4RQUA 5A05A 5U9CA 2WD7A 1V9LA 1BXKA 3W4KA 1VPDA 4BNYA 2CFCA 2G1UA 2C7GA 2PWZA 3FF4A 1V8BA 3LC7O 3WBBA 2D2IA 5KCZA 4BKQA 4RO0A 3X2EA 4PFJA 3KXDA 3NTRA 3ASVA 5HS4A 2YV2A 1PSDA 3IKVA 2JD2A 2OBYA 3RU7A 1VSVA 4NBTA 4BGUA 1RYDA 2Y1CA 3D3WB 1ARZA 3PJDA 1K0UA 4BNKA 2FOIA 4NK4A 3OEYA 3N58A 1DC5A 3L77A 4Z0TA 1VJTA 3A1NA 3U4CA 3WLFA 4YJHB 1DFHA 4CLDA 2OORA 3OQ1A 5TQVA 5L95A 5TS3A 4BOYA 1KERA 1P0FA 2YUTA 3KM0A 4E0BA 3H65A 2HAEA 4BIIA 3DZFA 3OF2A 1X1TA 3RFTA 3C7AA 3NTOA 3GVPA 1ZJZA 1LLQA 1ZH8A 3F1LA 5KIAA 5EL0A 2DBQA 2WWRA 1YL7A 1LDNA 4I08A 5ILOA 3AOGA 1SAYA 1AE1A 3F5QA 1LU9A 3I23A 3TOXA 1E7RA 2UYYA 5K6AC 3ROPA 4YJHA 1NR1A 3LK7A 1LDEA 1EVJA 1GUYA 1N92A 1C0LA 1ZEJA 4PZEA 1SZJG 2FPIA 1FXSA 4CMGA 5TX7A 2CDAA 4R51A 3QVTA 3DWFA 2O4CA 4F45A 4YR9A 2O4UX 2Q99A 3GQVA 2GF2A 4QT0A 3U9LA 5U1PA 4GLLA 3PWZA 2ZYDA 2CD9A 3IC5A 1HLPA 4PN3A 1BVUA 3DFZA 1PR9A 1XDWA 3RASA 3RFVA 3U5TA 4OJNA 3I1JA 1YRLA 1CJCA 5JDCA 1PGNA 1XELA 3X2FA 4QFDA 2E48A 5JCJD 5KVSA 2EW8A 3ZV5A 1O8CA 2VZ8A 4R1TA 4XQCA 2DQ4A 4LCJA 3RKUA 2JFHA 4WCFA 1K2WA 5IAAA 4FR5A 1NHGA 3ETEA 3K5PA 3M6IA 5KVCA 4AJKA 4J91A 4Z3DA 1Y8QB 1PGJA 4IS2A 4Y6RA 4YACA 5FF9A 4BNXA 4YXFA 5KJ6A 3FBGA 3DAFA 1ISHA 4YPOA 1YWGO 4J9UE 2OFPA 3C1TA 2Y1FA 1LUAA 3GZ4A 1Q7BA 5CDYA 4YA6A 5JYDA 2RAFA 2C5AA 1HKUA 2PZLA 3KV3O 3V2HA 4CQMA 2X5JO 5COQA 4DUPA 2ZCUA 2DLDA 1M67A 2Y1EA 2QRLA 3PHLA 1ZVMA 4EW6A 5C7LO 2O23A 4WLVA 1Y8QA 2VHWA 3TSCA 4DXHA 5FI3A 2VRCA 5AXDA 4RLSA 1NVGA 4GSLA 2R00C 1NFRA 1U3VA 1U9JA 3ST7A 2A92A 1ONPA 3WGOA 1T2EA 1IPEA 3KO8A 3WFIA 3WSVA 2ZTLA 3SVTA 4OL9A 4AICA 2EGHA 3KZVA 1CIVA 3DHYA 4JBIA 1DDOA 3SBOA 1Q7GA 2UUOA 2EG9A 2GN8A 3W6ZA 3DAPA 3PQEA 4GMFA 1E7QA 4NFSA 3ZWPA 4C7JA 1EDOA 2VZ9A 4O63O 3PFWO 4BB6A 1F12A 4BGVA 1JAXA 3GHHA 5AXBA 1I01A 1MXHA 1M6WA 4YT5A 1LLUA 4GMGA 4FD3A 3NKLA 4KDFA 4NMHA 1U7TA 4FCCA 1K3TA 2PH5A 5CDTA 4QX6A 1PU2A 3HB5X 4OXNA 1CQJA 1F17A 3INTA 1GZ4A 1V35A 3BHIA 2EV9A 5DCUA 2OGUA 5B4TA 2R6JA 4BVAA 1DC6A 4AJNA 3DZBA 4FBGA 3AFNA 3Q3CA 1IB6A 2Y0EA 2BMAA 2PZKA 4AJEA 1BXZA 3KVOA 1HSZA 2WYWA 3FNEA 3OBBA 4RVHA 5DCYA 3SJUA 5IJZA 1QYWA 4GQAA 1P1JA 2DBRA 4R9RA 1LSSA 4O1MA 4RQTA 5I7FA 1LC3A 4II3A 3B1FA 4ALMA 3WWZA 4DMMA 2HMTA 3OA0A 4YT8A 5ICSA 3LQFA 5IDXA 2E4AA 4BQRA 4DBVO 1UXHA 2AW5A 3GVHA 4WEQA 1GYRA 5ER6A 5J23A 1P1IA 1XG5A 1GUFA 1PZHA 4WEOA 1PJLA 1LNQA 4AJPA 4ND1A 2NTVA 1I8TA 1A4IA 3ZCXA 1J49A 4FJ0A 3ENKA 3C7CB 4J3FA 4FGWA 3AY3A 1F14A 3NDRA 2O3TA 1ZMOA 1DJQA 4HFMA 3GC6A 1H5QA 4BB5A 1DEHA 4BHTA 4WLUA 4CMAA 3PQFA 3HHPA 1NP3A 4Q3BA 2H63A 1DRVA 1HDOA 4D42A 1BG6A 3JCZA 5TC4A 4P4GA 1SEVA 1IHXA 1I3NA 3AY7A 3T4EA 3M1AA 3EHEA 4NFYA 4XR4A 4N54A 1NPYA 3V1YA 4M55A 1DPGA 1ZW1A 3WWYA 1PQWA 4DA9A 4U8GA 4XCVA 5JO0A 3OQ6A 1BRMA 1B3BA 3H9EO 5AQ1A 3DFUA 4NBRA 1I3MA 1WDMA 3ZWXA 4O6VA 4OSPA 2VHZA 3IP1A 1XQ1A 1QYDA 4KQXA 3HZZA 1OC4A 3NGXA 4PZCA 3U4HA 1DHTA 3GNSA 5G4KB 1BXGB 5I9MA 1GZ3A 4PRLA 1YOVB 3C1OA 2VYNA 4YVFA 3ZV6A 1HSOA 4RDIA 1E1LA 1NVMB 3IS3A 1T26A 4RZIA 5A5EA 3DXFA 2CMDA 4TZTA 3P2OA 3WMXA 4MP3A 1I30A 3NX4A 2X9VA 5AVOA 5G0UA 4BO3A 1DFIA 7MDHA 1RYEA 3ZNOA 5G4KA 2GASA 1BXGA 4Y9DA 3ICCA 1R16A 5G0VA 2YV3A 2A9FA 1LLCA 3WQSB 3T4XA 2Y99A 3VKUA 1R0KA 2B36A 2UUPA 3L9WA 3RAJA 4IMPA 1E3SA 2Z1NA 1NX6A 3DR3A 4HUJA 3IL2A 5L7YA 4W9NC 2WTBA 2BGMA 3GVIA 2I65A 3JD1A 3IOYA 3ZHBA 3UF0A 5ADHA 3FD8A 4BKRA 1TT7A 4OXKA 4ZQGA 5C7IO 3ETGA 4OO3A 3TDKA 4NU5A 5K9ZA 4RPLA 4K6FA 4IJKA 5F3RA 4QO7A 3D4NA 4CQMD 4E6PA 3EDMA 1TEHA 4MIEA 3IMFA 4ZQEA 1A4UA 2QRJA 3FPCA 4GVXA 3HE3A 1PGPA 1VE9A 1NM5A 3EZYA 3WQRA 3C8MA 4MIOA 2HSDA 3UOGA 1JQBA 3GFGA 3L6OO 1UP6A 4LISA 4L9RA 2CVOA 3B1JA 2RH8A 3WNQA 2R2GA 1SMKA 4RVUA 2TMGA 4CM5A 1EFLA 4G65A 2BGKA 1SEPA 3WS7A 3WQQA 4B8WA 1WP4A 2FPPA 3ASUA 3OIFA 3IAHA 2Y68A 4E13A 2B35A 4WOJA 5FI5A 4L4XA 1ZSYA 4FN4A 5H82A 3FNFA 1LRJA 1DIHA 2G76A 3Q11A 4R41A 3S2IA 3ULKA 4TROA 4WUVA 4NIMA 1X1EA 3DDNA 3QW2A 4E4YA 3GAFA 2P9EA 2Y93A 3DB2A 4TKMA 5LDGA 3ZWAA 1AN9A 3RC1A 4FQ8A 1ONOA 1YH3A 3QP9A 4BO8A 2AEJA 5B4VA 2WJPA 3IQDB 5TGDA 3MOGA 4CODB 2I9PA 3K2EA 1N9GB 4ND5A 1LDYA 2CNBA 2YQ4A 2BI7A 3LLSA 3MTGA 1WVGA 3PHGA 4I5GA 2E37A 4D0SA 4WGGA 2AQ8A 1LSJA 4J4HA 1ADCA 4GX5A 4UVEA 4BMNA 1BMDA 2EGGA 2IZZA 4OHUA 4PG5A 1IULA 3VAZA 2I3GA 1U4SA 1YBMA 2PH3A 4JJFA 2O3JA 2X1HA 2C07A 5IN4A 5G0WA 3UN1A 2JD0A 4GLOA 5ENVA 1B16A 1EVYA 4A7PA 5JDIC 5HA5A 3ITKA 3OECA 3L4BC 4IQ8A 3RIHA 1YE3A 4IZHA 4IMRA 2GN4A 4RVDA 4S3MA 5A3JA 3EC7A 1U2GA 3BXXA 5JBIA 2GUGA 3KETA 3G79A 1QORA 4GAEA 3I9NA 4P38A 4BMSA 3K73O 2FN7A 3V5NA 1PJTA 4ESOA 3PJFA 2BFOA 1B8PA 3HDQA 1P1RA 4DC0A 4RF5A 3JQAB 1P45A 4NHEA 2QX7A 3GGOA 3F47A 1TI7A 4JJGA 3TFQA 2PD3A 3LDHA 4UVHA 1YDEA 4FW8A 3RBVA 5L9AA 1NNUA 2NNLD 2HK8A 4XDYA 1BGVA 2VWQA 1UZMA 3WGQA 4NBVA 3GNQA 4CV2A 1K89A 4YAJA 1HDGO 1LLDA 4YQYA 4EZBA 2ZCVA 2GGSA 4R01A 3D7LA 1ZK2A 2HLPA 2I66A 2PGDA 4LSWA 4LW8A 2Y67A 3ZWVA 3JQAA 1ZXBA 3NJ8A 3PYLA 4FOSA 3ETDA 3AOEC 1E6WA 2CDCA 1VC2A 4PLGA 3JQDA 2PTGA 4A03A 3JQ9A 1LJ8A 2VYND 4Y6PA 4Q3AA 3B1KA 3VVBA 5L7WA 4GPD1 1HZJA 3C3XA 1NAHA 4ZQBA 1H2BA 1YB5A 2NVWA 5B1YA 5U4QA 1MGOA 1T1SA 4YAKA 2EKLA 4YAEA 3QHAA 1YO6A 3CH6A 5IZCA 4F6LA 3AW9A 1S6YA 4PLFA 2G82A 3O38A 3BZUA 1SBYA 3MWEB 1XEAA 3Q2KA 4MINA 2WEKA 1E1NA 4R54A 1FMCA 2ZJ0A 7ADHA 2JJYA 3HFGA 3VPSA 1YL5A 3HUDA 3KBOA 4BNVA 1R4NA 3EGOA 4GKVA 5JAMA 3VOSA 3T7CA 4CL8A 1H6DA 2HMWA 4DQUA 5TRTA 1PL8A 4MP6A 4B4OA 3VDQA 3DO5A 2IODA 5BR7A 4PLPA 3EVNA 2Q50A 4J16A 4F6CA 5MDHA 3B6ZA 4RZHA 4MOWA 2BD0A 4A27A 2PGJA 3NTQA 4LRSB 3ZGYA 5C37A 3IP3A 2EP7A 4K9DA 4OAQA 2XPCA 4BUCA 4RF3A 3H3FA 5A3VA 3WXBA 1X0VA 2DFVA 2YV1A 3JQFC 5G2OA 4AJJA 3SXPA 1OOEA 3KLMX 3PHHA 3ROQA 3GF4A 2AMFA 3I9LA 5HM8A 4CR7A 2BH9A 4CM7A 4W6ZA 3CZRA 4B7CA 3VTFA 2G5CA 3E18A 1XU9A 2DUWA 5A9TA 3BMNB 5H83A 4IGEA 1PJBA 3GMSA 5IFLA 4CMEC 3CE6A 4OSOA 5DDIP 3O03A 2O3UA 4CMJA 3UHAA 5KJ1A 4DBZA 5KWEA 1X0XA 4WNCA 3JTMA 4N5MA 2BGLA 3ROMA 4A2CA 1F8FA 1EFKA 3ITDA 3H9GA 3AI3A 2CDBA 2PR2A 1QYXA 2V65A 3QE3A 4Q3CA 4XGIA 1E7WA 5EERA 1L7EA 5IDQA 1X7GA 4HBGA 1DSSG 4TSKA 1YKFA 5BT9A 4ZVVA 3RJ5A 5AYVA 1I0ZA 3F3SA 4ILKA 1DIGA 2O2YA 4CMBA 4P22A 4BO5A 1PJSA 1EDZA 1R15A 3JQ8B 4PIVA 4PLCA 2EWMA 1NR7A 3QWBA 2EW2A 5L53A 2FZEA 2X0RA 1HE5A 3R6DA 1W8DA 3U0BA 5ITVA 4R9SA 4CLHA 3JQ7A 1VI2A 2HQ1A 3I9JA 2XXJA 2ZJ1A 2OXIA 3ZW8A 3EK2A 3HG7A 5T8KA 4C4OA 1GQQA 2VHVA 2HK9A 4GI2A 1QR6A 2Q1TA 4NQZA 2HO5A 2W8ZA 1M75A 4RLHA 3PEFA 1T25A 5CPBA 4EITA 3LU1A 1QKIA 4H15A 1H6BA 1X13A 4MVJP 2HJRA 4YAIA 4B3JA 3MTJA 3KSUA 4K1LA 4ALIA 4GX1A 4NNJA 2VHXA 1P3DA 1UDBA 2QG4A 3LT1A 3TOZA 1IZ9A 4DMLA 4L8VA 4E2ZA 3AU8A 3VH1A 1LA2A 2EHDA 3ZV4A 4BGEA 4DREA 4AVYA 3OA2A 2YHUA 2Q1SA 3ZWWA 1A7KA 2RHRA 5G4LA 1VKOA 3PHIA 4CR6A 2PFGA 1GQYA 1T4BA 3LT4A 3EAGA 4TRRA 3WSWA 2X23A 3KB6A 2GERA 1EMDA 3OIGA 4IXTA 1YQGA 2Q2VA 2PKQP 1PJ4A 1SB8A 1ZK4A 3AUAA 1E7YA 2Y1GA 2W2KB 3LC2O 3QY9A 1DJNA 4J9VA 3JQAD 1LQUA 4E5KA 3ZV3A 4IUYA 4KP7A 2EKQA 1B3RA 5DBIA 1EZ4A 4ALJA 3K9QO 1YL6A 3CPSA 2IEDA 3RU9A 1IHYA 2RIRA 4R69A 3JD4A 3OEWA 5A9SA 1BWSA 5KTKA 4J7CA 4FGSA 4WASA 2PK3A 2FY8A 4EBFA 1PWZA 2GPTA 4P4LA 1CYDA 3RQSA 2ZTUA 1C3VA 1V3TA 1W6UA 5TF4A 4CM6A 1DC4A 1PGOA 1WDLA 1T2FA 4R4JA 5ENDA 4I9NA 4Z9YA 2RHCA 5EN4A 5IF3A 4N7RA 3OJFA 3GGPA 1SOVA 4BNHA 2DUUA 5I7VA 3DBLB 3FNGA 3HNPA 3RUEA 4H7PA 4LVCA 3BMCA 4DLBA 1QLHA 1I32A 1ZMTA 4FPXA 4J0EA 3JQBC 1UXIA 2Q2QA 4R68A 1W73A 1ENOA 3TRIA 5LC1A 3TF5A 3ZU3A 9LDTA 3D3EA 1GPJA 3JD0A 2Q1WA 4HKTA 3GG2A 4DL9A 3TZ6A 2E6UX 3LSYA
chains in the Genus database with same CATH superfamily
4QDJA 4MZDA 3VSBA 4EIWA 3WHIA 1UAYA 5LNK6 1CVIA 2V7UA 1GNQA 1QK5A 2H9YA 2Y6UA 3FRIA 1D1TA 1Y9DA 3ZE0B 1KZYC 2R48A 1BDBA 2Z3VA 1SUDA 1SELA 3F5SA 3IUPA 3PNSA 4G5HA 4YI3A 1WCYA 4ENSA 4RY0A 4D43A 3A7DA 3IDQA 4BLOA 1Y3HA 4MYDA 2QMUA 4KB5A 4WK6A 1IEXA 1MVOA 1NF3A 4CM9D 3ELBA 4U0JA 1I7NA 2E9SA 4PWZA 5B7PA 4FBMA 5FORA 4BEVA 1ENZA 1RYZA 3CH5A 2G40A 2PCLA 3EGXB 4QYIA 5E3IA 5DLPA 3G59A 3MMNA 3REOA 4E22A 4B44A 1IYZA 3RE1A 5HOQA 4KO1S 3ZHOA 3LVFO 3OOSA 3I45A 2HPVA 2PLFA 3CVUA 2GPNA 4X1OA 3T3OA 2P77A 4Q24A 1D7OA 3OURA 2P67A 3BMQB 3CZCA 4BO7A 3QVMA 3TZCA 1IPHA 2P91A 3SF0A 4JSRA 1XRRA 3W7AA 1QGUB 1OXTA 4AT1A 1IBRA 2K2WA 3T41A 4MYTA 2Y0DA 1Y5MA 2WWFA 2ZAGA 1QPGA 3E48A 3UUEA 1AQIA 1KU6A 4Z1OA 5K0CA 1I1OA 3AHHA 3NXSA 1QWSA 2P41A 1QB7A 2WLSA 3GIDA 5CYFA 1D3AA 1ZOIA 3PLAE 1W5AA 5B1DA 5IT9A 4O1IA 4GI7A 4ZKEA 1G3MA 1P1FA 4MCJA 2V6BA 5HZHA 1O97D 1PHPA 4W5JA 2I1VB 4KVFA 5EE9A 3CJTA 3FOZA 1MX3A 2JJ2D 3AV0B 4DIOA 5BQ3A 2BHNA 2ANBA 1FFXA 4I9GA 4TYQA 1OWLA 2J85A 4IKOA 3L0YA 4R7GA 4HWSA 4RGBA 4FOTA 2FN3A 1TTQB 2VDRB 4UXHA 4ZVNA 1R2QA 4KYTA 2RGBA 4CTNA 2WABA 3NM4A 5F7JA 2QY6A 3LUPA 1C1XA 4RS3A 5IX8A 5LP6C 3W2GA 2JEYA 2WM3A 5EMLA 3DZJA 3TD9A 1EP2B 1OBOA 4RUKA 3VVCA 5JNTA 3ILSA 3JQGA 1QH1B 3ZWKA 5AI0A 4UHCA 2ZIZA 4L73A 4YP1A 3SZGA 1EFPA 2BF7A 2WI8A 1PCXA 2GJAA 2ZAOA 1ZINA 2B99A 2Z8YA 3K2IA 1NY6A 3WGZA 2RMKA 4EK9A 3L1HA 2RHWA 2XGJA 4CL3A 4KX3A 1FFYA 2YINC 4D8TA 1W5EA 4GG1A 3N87A 4MUGA 5K0LA 1NBAA 2J3DA 3R8CA 4ZPJA 2NUAA 2IU3A 3O2QB 2OHJA 3QVVA 4PV7A 1B8OA 4V3BA 4A5OA 2TRSB 3ZHYA 1GIAA 2BSAA 2H1WA 3GLSA 4QT4A 3MM4A 3MB8A 4HFJA 4AUEA 3GRKA 1NL3A 1XVIA 3PTLA 3AJRA 1TO1E 3ROEA 3QFFA 3PQCA 4H3VA 2ZRNA 4L75A 3PBKA 1L4YA 5FPHA 3PT5A 2R86A 1XBTA 3ILXA 2VPQA 3QLVC 1Z0AA 3QPUA 4OA5A 4FTWA 1XLTA 3K0FB 2GKSA 3NW9A 3GEMA 4RD2A 4HNTA 4WXMA 4UHFA 4LKRA 5FOQA 2B6HA 4DUGA 1V1MB 1WZIA 3ZHQA 2B30A 2GJKA 1UKAA 3MRTA 5ECWA 4BUJA 1BHQ1 3CB4A 1U2DA 2D8AA 2XBUA 3M49A 1ZIXA 5J63A 4DCGA 5CDGA 3OQJA 4ZYYA 5IT4A 2QPAA 4Y2PA 1VECA 3MLAA 1FRQA 2NACA 3K0HA 1YR8A 2QD5A 3L1UA 1USVA 1MZPA 1UAGA 2D8MA 3NI2A 1NVVQ 1T3GA 3OMLA 4J0QA 2Y4OA 2F00A 3KQKA 5L7TA 5E4TA 4AZ0B 1XXLA 1E4OA 2NQTA 2BEVA 3CRMA 4FMPA 5J47A 1BCSA 2MSDB 1YDWA 4R83A 2B69A 1GSOA 3NTXA 3SZLA 4BATA 5JS6A 1TVEA 5IEBA 1CHNA 1TYAE 3MTQA 4EFNA 1RI4A 4NJOA 4HB0A 5JVDF 2AHRA 4PX9A 4P82A 1A9OA 1QRTA 3H17A 4KQ6A 2ZB4A 3C0KA 2V45A 3E5NA 4HN2A 4RH3A 4BLWA 3P27A 3C74A 1WW2A 1GEEA 2DFDA 3MMPA 4XD2A 1XHFA 3D5TA 3FMOB 3V1UA 5HM6A 4ENVA 3GMTA 3G9UA 1IEWA 2R6CA 4QPZA 2Y76A 4NCAA 1SUSA 3GXBA 4HEHA 1Z0UA 1Z0FA 1Z7WA 2C03A 5ED0A 4B74A 5F77A 3WNVA 2ET6A 2GPAA 2JBWA 3E84A 4EPRA 2JKYA 2UVDA 3AFOA 3MT8A 4BCCA 2BGUA 1L7DA 1ZN8A 2GLXA 1TAQA 3ANXA 2PRKA 4GI1A 2CY0A 3IX7A 1B42A 4HLUA 4QBFA 3TRJA 4BFTA 1T9AA 4Z51A 1BIFA 2PEYA 1RKXA 2I4IA 3OLVA 1E2MA 1E18A 4AO7A 1GVNB 5IJWA 3LKDA 1QOZA 1UL1X 2FYTA 5FD8A 2CVZA 3R5HA 2GXSA 4ZQIA 1NASA 1ACMA 2Q3HA 3P26A 4YRQA 4HFNA 3IIEA 4BO2A 3P52A 2IDKA 4HN9A 4BJ5A 4I99A 5IT5A 4JC0A 1ZNZA 1I1QB 1T36B 2HV9A 1NOKA 1UBFA 3CCCA 3KOZA 3OP1A 3RGWS 1HMYA 3PE4A 3A58B 4QXRA 3T5PA 4O3MA 3JYNA 3FTNA 4HOYA 1RJDA 3E3LA 1IL0A 1IDOA 1UBJS 2DHQA 4YRAA 1IJEA 4PSUA 5P8WA 3A05A 4RHCA 1T15A 3R8FA 3K0CA 2Q8QA 4V02A 3CURA 3BWVA 3RBXA 2YHIB 3HJGA 1T4DA 1O0BA 1O08A 3CLUC 3RRBA 2AOTA 1EGHA 5ALOA 4N7JA 1WIWA 2P8JA 4IDDA 4FWTA 1HDZA 1BZYA 1BJTA 3KR0A 1IY1A 2OTCA 1N9KA 1DEOA 1Y9EA 3AO0B 5ALGA 4HBZA 1KY4A 2DSNA 2XUHA 2ZYGA 1KWKA 1ODSA 4Z7NB 3IBSA 4RJTA 4UHJA 4AD8A 4JYMA 2H1FA 1EE9A 3BS4A 4KV7A 3W5UA 1CZNA 4I4NA 1FS5A 2C9OA 2GNPA 2PSDA 1N5RA 3T3EA 4TVKA 3R7DA 4EMBA 1PE0A 4P4NA 4ASUA 3WLQA 3AK4A 3JAWA 3KX2A 2EX4A 3DV9A 4O2AF 5AK3A 1UWKA 3PE6A 3I73A 4NXNB 2V9CA 1U04A 4MLDA 5ALSA 2RGRA 3I58A 3OZGA 3C3MA 3UXYA 1JHPA 4ROTA 4ZAXA 1UEXC 2BUBA 1GGVA 2FWNA 4UBIA 4DA0A 1JW9B 1TMKA 3OOJA 1JKMA 1PNVA 3CO5A 3WKAA 3JAKB 1KIFA 4EDFA 3FWZA 2G0TA 4DAOA 4CM8B 4L50A 1XU7A 3NKVA 3TI7A 4QHYA 3FTQA 3H5LA 1QXSA 1APBA 3EGCA 5FBHA 1Y3AA 1QQBA 4CV0A 3KEGA 2Z95A 4H08A 5DHQA 4KO2S 5H9WA 1GCUA 2H4XA 1LKZA 4LHYA 4E2XA 5AVJA 4ER7A 1NVTA 3CKYA 1CY4A 3QU2A 5C8VA 4OB6A 4WACA 1YMVA 4RSRA 3R2JA 4MUEA 5IUNC 4FZRA 1Z4QA 4HGQA 1J1UA 1SCAA 2B98A 5KOHA 1FFHA 2VLBA 5KYYB 1ZJYA 2QVBA 1JQEA 3A0UA 3WL6A 1LPNA 4CBVA 4HAYA 3K1YA 4ZCRA 3PEWA 3OVMA 4LHEA 4DANA 3RFXA 3FHCB 2LXNA 4DBLE 2FPPB 5J4LA 1XL1A 1NI4B 3A32A 1EQAA 1YRWA 4N0EA 1DC7A 2DUNA 1GNSA 3DVAB 1P4HA 4Z9BA 4BTVA 4A0FA 3NIFB 3CW8X 5D6OA 4HQ0A 4IPTA 1A50B 5LMZA 3F6EX 2X6RA 5CP8A 4HQRA 1UMDA 4C7KA 1JDUA 1U1GA 3IUYA 3RVRA 1FUIA 1CY1A 2GSDA 3FNHA 4FHCA 1HEIA 2YC2C 2AOWA 2PZBA 2Z3ZA 2Z0MA 2OV6A 1C7FA 1N0WA 1VM6A 4CKEB 3QEAZ 3KHUA 3SCZA 5MF6A 4MGYR 1MG0A 5TQ2A 1SY7A 3VO9A 3AI7A 3WBFA 3RI3A 2W2OA 2B8WA 5I7RA 1L7XA 4WOCA 1T8SA 3ND6A 4X93A 5JVDA 3LFTA 3NDIA 4HGYA 4KVZA 3P97A 2WVGA 4X24A 4Y2VA 5BO5A 4IMJB 2MSLA 4KXVA 2GM9A 3KVNA 4UBLA 2R9VA 3H99A 2P69A 3QEMA 2IS6A 1LBEA 1Z6GA 4XM1A 4UE6A 1ZZEA 5I7OA 1XTZA 2BMDA 4NP6A 4FEEA 4C2TA 1DJMA 2EG5A 1BSVA 3AP2A 1GKKA 4LTNA 2X8JA 4KSCA 4REQA 3H2SA 4OXQA 4BN5A 3D3KA 5GPBA 4MPJA 1EJ0A 3KWMA 4KQJA 4G1BA 4D9KA 2XOXA 2RH4A 3HFJA 1SIBE 4KR3A 3RTDA 1PYOA 2OK8A 2PGAA 1YBVA 1FJGB 2ARKA 1O58A 4MQEA 1W5BA 3MC1A 2AFIE 3A6ZA 5ALUA 3REQA 4B2LA 5LU9A 1Y5RA 2JFFA 1PT9A 4EVQA 3W7BA 1A9XA 1LZLA 4JBWA 1ST3A 4MKGA 1FK8A 2PEZA 1QH8B 3FJYA 5H16A 5HTKA 2I9KA 3WDLA 1X19A 2NAPA 2GM5A 1E1CB 1JH9A 3EXFB 2QL7A 2IOQA 3HDTA 1VE7A 2XA2A 5D5QA 3RARA 1LF0A 2OAP1 3UKJA 2IITA 5KNCH 1LSUA 2WZQA 3CNBA 3U3RA 3LFUA 4LSZA 4ATNA 4CLRA 5JNWA 2Z09A 1B14A 1DAKA 3S5UA 5ITWA 2VOEA 2A0XA 3Q6MA 1W9HA 4NBWA 3WXMA 3QNMA 2FR0A 1PQYA 5E0KB 4D80A 1RRCA 1EK6A 4FSXA 2PU5A 3OUZA 5FPSA 5AK6A 2NU9A 2H6EA 1J97A 4LEIA 3I9MA 4BX0A 3I4LA 3NVKI 1NSFA 1X38A 3QKRA 1EFHA 3LTEA 2FDXA 2JARA 4GXTA 2O5RA 5B1SA 5JJ5A 1OH6A 2F3UA 4INJA 1N2HA 5DULA 1Q6ZA 1T0JB 1XN1A 4RVGA 4B3MB 2GAJA 2GHQA 3I52A 4XCQA 3ZJ4A 4BNTA 2JCVA 4DCUA 2XTMA 5E1OA 3N7UA 2BH2A 2WB4A 3DE0X 3IPXA 3KAPA 1B8VA 1VIDA 4CQLB 4QD3A 2JGAA 1KY3A 5I3CA 5F73A 1M1NA 5TARA 1UOEA 4OBBA 4D8VA 1U4NA 1AGYA 3IPCA 5FPTA 2OV4A 4Y2RA 3OPQA 3ZBQA 4O2AA 2GR9A 3F7MA 1AMNA 3DOCA 4LY6A 2NO7A 3KYCA 3HDHA 3NATA 4WCFC 3OC6A 3FCSB 1KMIY 2Q6OA 5BYJA 3SKYA 3RYCB 2M6SA 4R0VA 4YJDA 3TLGA 5U4XA 4JSTA 1B0ZA 1NKVA 2CXHA 2YOFA 3WK6A 1SXJB 1V96A 4QOSA 4DLAA 4GW3A 2PYDA 1GPH1 4ND7A 4I1OA 4F8EA 4BRZA 5B53A 3EOZA 1I0LA 1E3MA 4HAUA 2A9VA 2XB4A 1QQTA 3M6AA 2QLJA 1HQKA 1SBIA 1XVAA 2A88A 4K6MA 1S2LA 1CNFA 2QW8A 1QIHA 3GPCA 2V8OA 5EKUA 4R6XA 1UDRA 1QSGA 1G60A 2ZE6A 1RXEA 3Q3JB 1ZD3A 4DLLA 3RAPR 1UPTA 1E3JA 1MKYA 3E9QA 5C5DA 2FSFA 5FO0A 1VSQA 4JLPA 4K46A 3TG8A 1R4NB 4X7MA 1ZI8A 3KQQA 3F2IA 1RDFA 4CM4A 2IX9A 1MBZA 2LKDA 4ES6A 2J9GA 2J0EA 4MUKA 4M8LA 2HH9A 3W9YA 2GJ4A 2G83A 2XKAA 3NIGB 4LHXA 1T2UA 4QTUB 2ATCA 3OKCA 4R3NA 4EYOA 4FFWA 1YZGA 4J1SA 3L0CA 1TM1E 2GKGA 4PN7A 2IV7A 2YN2A 3KG2A 4V0NA 2OXTA 3ZY2A 2X6TA 4IBOA 1IUNA 1AUXA 2CHEA 4DPLA 4L9SA 2HFKA 4X1KA 4KK3A 4BO6A 2CXPA 2QG9A 4FN5A 2QJTA 2UV8A 1L5MA 1U0EA 4H4CA 4XYGA 1RMYA 3GT7A 3SKVA 3WTBA 2WAAA 4ZTUB 4ZIRB 1QRDA 3R75A 3GA0A 3E22A 4PLYA 4XRRA 2ADMA 3SLKA 2BONA 1IY8A 1NR5A 2C9YA 1PWXA 3QVKA 5KYUA 5C1OA 1CR2A 2GD6A 4CR8A 4PBSA 2PAFA 1FS4A 5DNUA 5DLDA 3YASA 4HGZA 2PZMA 3SX0A 5KIAA 1L5NA 1UT5A 3EZ7A 2IH4A 5JI3E 5CAEB 2GESA 2FMXA 2G5GX 3LF2A 2XUOA 4GHWA 4MDYA 3LY5A 2ZKLA 4UUMA 3L8FA 1OWOA 1TRKA 4CIWA 1TUBA 4X64B 3R5SA 2G1KA 3C3KA 1E9CA 4QARA 4ZZ2A 3VR5A 1F2VA 2VHCA 2ZM6B 1FQOA 2Q5EA 4EL0A 2V98A 4DLTA 3MSXA 2IHVA 4DG8A 4MA5A 1YVEI 3LX6A 4IIVA 4AJ2A 3U7QA 3VPDA 3MWDA 4MQ6A 1Z73A 4RVCA 5B1EA 1VMIA 3KWJA 5BMOA 4D79A 4F4UA 3UJCA 5IAEA 2PTHA 3K30A 2F3SA 4WY5A 3ORHA 2WU1A 2FE1A 3ZY5A 2IXEA 2GWRA 3N7AA 3DOIA 3NHRA 4BKMA 2FLKA 3PNMA 3FB1A 3DXYA 2POCA 5EZYF 5LM3A 1VJDA 2EZ9A 1JAHA 1LVGA 2HU2A 4K0RA 4EPWA 1K5PA 1XHLA 1JKJA 2F8SA 2DERA 2YMPA 5DEIA 1Q0RA 4JB0A 5DMHA 1SBZA 2PE5A 2Q41A 4Q7LA 3V1LA 1ODKA 2QTBA 3R4VA 1RXCA 2R62A 3BD6A 4CFYA 1GQOA 2R96A 4OGWA 1E9VA 4R8KA 3O8QB 3KPYA 3JU3A 4GL4A 2C4UA 2HBQA 4YJFA 1GQFA 2M2IA 3HTXA 1BHJA 2FWJA 2HWUA 2ID4A 1KI8A 2UVPB 4Q5IA 3K9NA 1PUIA 4QELA 5BNTA 3DAYA 1L4MA 4WXHA 2J5QA 5JAHA 4D3YA 4DQLA 2ZVPX 4BQNA 5LD2B 3DWIA 1C4OA 2VUIB 2QPLA 2ZW9A 3LZDA 1BD3A 2D6FA 4HXFB 2GCOB 4IO0A 4DG5A 1A97A 3L0PA 3EIWA 3GN1A 1JFFB 1JXMA 1K6IA 1PFQA 3QBJA 3RS3A 2HRBA 4L16A 1NW4A 4MGIR 1E6UA 3U3JA 1Z08A 4JA0A 3LKVA 5FWXB 5KQRA 5KNDA 3TW6A 5KQSA 1SHZA 1E63A 2X0KA 4PCVA 4RULA 4GGOA 2Y9MB 3B89A 1HE8B 4YRFA 1AX9A 1Z45A 2VHYA 3PL5A 4HEQA 5LQSA 5EE3A 1LWNA 4XB1A 1G20E 1QKJA 3EQ6A 3VH2A 1YCGA 4EF5A 5C4MA 2BR4A 3NHLA 1GEGA 4DCNA 3S1AA 1MV5A 3L7JA 1GKIA 4GOMD 2AFRA 2F1HA 5HBGA 1ZS9A 4WZBB 2CL6X 1T29A 1TFUA 1ILWA 2ZJ4A 3AILA 4JQYA 1KJIA 2IE0A 4JGBA 3GLQA 2QN3A 3WGIA 1T9CA 3WAGA 2G67A 5EJAA 1L7BA 2W0MA 621PA 4GYJA 3TINA 3GD5A 1VCHA 5IMSA 3WLKX 3ZJYA 3RT1A 2HMSA 2ZUUA 3W4IA 3Q7QA 2P6OA 5A9SB 1OI7A 1NATA 3VHXB 1Y7TA 2C04A 3RSZA 1MRNA 1CRPA 1AH2A 3KTOA 1EVEA 5DYGA 3EBLA 5BPHA 4QEKA 3K1ZA 3W2HA 3MMXA 1E9DA 3BILA 2QPTA 1E1RA 1FXWF 4G36A 5KTTA 3WGJA 3FSJX 4UU0A 3A4MA 3OX4A 1JVSA 1UBEA 3PNBA 5CRIA 3NHZA 2H0QA 3QKIA 1BFKA 3G0OA 3JY6A 3H2ZA 4JJAA 2C59A 4FKZA 2Z08A 3GZTB 5LUAA 2XQKA 4BKUA 4H0CA 1IN8A 2F3RA 3GDWA 4U6QA 3KEQA 4QASA 4UEOA 3MCTA 2OBFA 3WHKA 3FWHA 4ZTZB 2XRMA 4PXAA 2QAGC 1P1KA 3B78A 5EJIA 3LOQA 5DRYA 5TJHA 3RSGA 1LNSA 3JQEA 1NM5C 4L2IB 5EE0A 4ALKA 4UBNA 1EIWA 2HPAA 3IV9A 2PO5A 4EM6A 4TMXA 4LSMA 4W8HA 2AZ4A 2M6KA 2F43A 3KJIA 4UBJA 1N6OA 3RC3A 3QE2A 4V2IA 2PL5A 2VTEA 3CRVA 1JTVA 2PKRA 4PRZA 2Q3FA 4MS3A 5FWNA 7YASA 2BVNA 1P80A 5E0OA 4FS3A 4KN9S 4ND2A 1Z0DA 2VF8A 2YV4A 1FVHA 2WYIA 1LX6A 4BFUA 5K0FA 2VQEB 1Z62A 1N5DA 1ZI9A 2TMYA 3LBNA 3HP1A 1ZK3A 3E4CA 4QQRA 3TJRA 1EUDA 1ULTA 4HQFA 3DFFA 4B3FX 3RLFA 5KREA 3MTEA 2HA0A 3TR5A 1JBKA 4H60A 1JDTA 4PYKA 1NUHA 3V4LA 1BX0A 2DH6A 2NWQA 1VLLA 1POXA 5EP2A 3BG5A 4NENA 5D3QA 2M32A 4LOLA 2QW1A 4LXUA 5K3SA 5L3RA 5JS2A 3OIWA 1GCIA 4RIHA 1QIKA 2BBSA 2GEBA 1EFTA 2GRUA 5D51S 1QH0A 3SR4A 1XWFA 2Q27A 4QYIB 3UV6A 2J6IA 4RZUA 2LWIA 3OUTA 5B37A 2ERCA 1QQAA 3I3OA 3QSYA 5EUCA 3GPDG 3NDJA 2QB5A 5AKLA 2GHRA 4BQEA 3ZZ0A 1KEZA 2FWIA 3CLSD 2FPXA 2F6RA 2W6MA 3NP7A 4WKBA 3TEMA 5DX8A 3NIBA 4QU0A 2PL9A 3E9CA 2AJ8A 2RKWA 2IXFA 3DD1A 3HVJA 1H2RS 4URVR 3A04A 1HO3A 5EZYA 4ZT6A 2FMIA 1HTTA 1LVHA 1MIOB 1JDJA 5AHXA 3K0SA 4IH1A 1A7UA 1NE2A 4PE5B 4AQDA 4D8WA 4R3WA 1D07A 2FQQA 3RFUA 3NGLA 3RBZA 3Q9UA 2ZJ7A 3GEGA 4LPSA 5CVJA 3AVVA 2O2IA 3IRVA 3VHQA 2PJRA 3A6EA 5B6PA 4X60A 4N5IX 4NU6A 4PAMA 1VA4A 4A1OA 1PX0A 2DAPA 3DLHA 4LRWA 5H70A 1JMKC 3IVMA 3RUCA 1RYBA 2FU5C 4HYQA 4XQ0A 4EHDA 4RX1A 1FFXB 4UNQA 4V1CA 4R71A 1V7PC 2FUKA 2GBIA 1BNCA 1YRQA 4FIZA 4MWDA 3LO5A 5L3SB 1RAHA 1AOXA 2Q7XA 3M6WA 2IHBA 3I9OA 4O29A 4XFKA 5ENZA 5IABA 1C1XB 2OBLA 2R8OA 5BVHA 1FRZA 3W5SA 2VT3A 1RKBA 4DUYB 1T9DA 2FSIA 3LI2A 4C7VA 2VXCA 4JENA 5JSKA 3JQGB 3EEOA 4I14A 1X86B 1QHIA 5ALVA 4C7OA 4DSZA 4V0OA 2ZIGA 4P83A 2V7TA 5SYAA 4I5EA 1CT9A 1NJ1A 1WWKA 4ZEWA 1PNQA 3I8OA 3KAKA 1AB6A 5K3AA 2X41A 1AO3A 2R5FA 2RK6A 3TB6A 1AQNA 2QI9C 2XVAA 1QFSA 4WHMA 4WZAA 5LUBA 1YZKA 1WZEA 2AZMA 4HDCA 4CETA 2V7BA 1USIA 2GB4A 2ZS9A 1F20A 2H1IA 4AB1A 3EUWA 3S4YA 2Q0QA 5F1PA 3EW7A 5BV0A 2DLCX 4AK9A 1EUCA 1Y9AA 4FC6A 4DIEA 3UK6A 5KYXA 1GUBA 1HDCA 2MIIA 1R0SA 4TYYA 3K8ZA 1P18A 5DTRA 2ZSBA 4EY3A 1FY2A 1UXKA 1U3FA 2XTJA 3CLUD 4IQFA 1KMQA 3UJ8A 4R0NA 4BBZA 1GR0A 2Z5GA 5ERGB 4AP6A 4N0QA 1D9ZA 1PFYA 4MRVA 3GJSA 3B8EA 2HRDA 2WG2A 3ETCA 4O2RA 4UHHA 4QUAA 3BHMA 3ZCRA 1QU2A 2P68A 1K9SA 1IEQA 1PJCA 1FXWA 4OGLA 3RIEA 3V7NA 1JLMA 1S8AA 3U4IA 1GTMA 3UK2A 1SN7A 3PGXA 2EFEB 3OBIA 3V00A 2ERXA 2IYLD 4TLAA 4ZA2A 3RD5A 1DKNA 3VDMA 2BEVB 5EJ7A 2E6KA 4U9UA 1OXMA 1HE3A 5IZCC 1HGXA 4DMCA 4N5NA 1WCIA 3ZX5A 5AI6A 1ABFA 3CU5A 4X6LA 1DUVG 4JV5B 1XD9A 3A1UA 5GJVC 1Q20A 4YRCA 4ID9A 2D59A 4OIMA 3UJ9A 3K0EA 1M66A 3LUFA 3P9CA 2AWOA 5H59A 5TMBA 2FWBA 1U2RA 2JK0A 3D7NA 4OMFG 2OV2A 4WWHA 4GYYA 1E1RD 1RYMA 2GZ1A 2HUPA 3CBQA 3IVRA 4LWQA 4NS1A 1F5NA 1CZHA 4F7DA 4E5VA 2DPGA 4Z6KA 4XXHA 3E15A 3TGLA 2Z5VA 4OJMX 5TEVA 3UXMA 4UULA 2DBYA 4B8ZA 4HEA1 3W90A 2EBFX 4CEHA 4RXTA 3ADKA 3LLMA 1QU3A 1FP1D 2IU6A 5EEGA 1XKLA 3UK0A 4EKNB 1XRJA 3PFBA 4XZ3A 4QPPA 1ZAKA 2INGX 3LQ2A 1FU8A 1Y42X 1V6AA 221PA 3VC7A 4B4DA 2XUDA 3EOBI 1YA4A 5ITZA 4G4SP 1U2ZA 4ZREA 3PYMA 4UW9A 4OKNA 3WIUA 2WU4A 3JD2A 4OLJA 4EO4A 3EEFA 3IE2A 3RF6A 1XF1A 2I6QA 3WIDA 4AF8A 4B1FA 2VJDA 4IUCS 5AW8A 1U0FA 4QLBA 3PC2A 4Q18A 3BTUA 1RM3A 1IM5A 2GEVA 3OT1A 1X2BA 4DNXA 2VC2B 1E2HA 4LHWA 3TLAA 4NZNA 3LCVB 3KQLA 1IRIA 3OT5A 2SICE 1U2QA 2EJBA 2H0RA 3G8AA 3ABQB 5KKAA 4LZNA 5E4JA 2GBLA 4X85A 4MV0A 3DNPA 4YCCA 3RT9A 2OV8A 1LGYA 3SLGA 3VU9B 3ZW9A 1NBOA 2POQX 2QLFA 3SICE 2WAMA 5EEHA 4EYEA 3JQFA 1XMJA 3DFKA 1G291 3RC7A 3C41J 4EZEA 2HM7A 4DV5B 4C4AA 3WMWA 3WRYC 1JQ3A 1BYUA 1Y82A 3RH0A 5LWQA 5EJ2A 1Q21A 3KEFA 4GRIA 4M6WA 3FYUC 3MJDA 3MJSA 5T5QA 5EHXA 3PZRA 4G01B 3LBFA 1NNSA 1S96A 3U3XA 3NHWA 3TG2A 1CXZA 4QBTA 4DR4B 4F5EA 1U0LA 2ATEA 2YV5A 2NSJA 4Q47A 5ILQA 1TLTA 3V4PB 3JAWB 1XZMA 3R24A 3DVRX 5B7GA 1D2RA 5DX0A 5FFNA 4R8RA 4UQPA 2VPWA 2WJVA 4ZT7A 5IBCA 1JVBA 2AA3A 3EIOA 2AR0A 1E9EA 1JEYA 3OKAA 3T9DA 3CVYA 1TF7A 2XR1A 4LZWA 5KJ6A 3EMVA 3O93A 4URFA 4D0RA 4A8JC 3EDYA 4DV6B 2RIPA 3IQEA 4KNVA 4F21A 3K70C 3N39C 4A4DA 2HMAA 1K06A 5T8KC 5JO9A 2Q5FA 2GM4A 1TK9A 1UMKA 2QGNA 3B5JA 3MQ2A 4IVRA 3DLIA 4JC8A 2CFRA 1KOGA 5CLQA 1CUFA 2DFNA 1PR1A 3EGVA 4CI9A 4B6PA 3KQOA 4Y30A 4F5ZA 4NE7A 2YN4A 4GKBA 1C3EA 1KAEA 3HVIA 3KB2A 3KSMA 3NQ41 3QLEA 3QYJA 2VDVE 2QF7A 4C1BA 5CIYA 1P91A 1PBTA 5KOHB 2BMJA 1P60A 2Y1DA 3K31A 2AD5A 2JJMA 3VPGA 4NMMA 1RPZA 2O8FA 1A88A 4NE9A 3H11A 3BN3A 3PT9A 4OGKA 5T64A 4DVJA 5JECA 2OQRA 2VYVA 2XQIA 2PKEA 1NN5A 1FVOA 2B1QA 2IOHA 4XIYA 1YCDA 2OLJA 5CLGA 1TB4A 4RYLA 3IFSA 3NHUA 5AVKA 4V1CI 1YS4A 1X9IA 1EFAA 3C1AA 3S1LA 4WFIA 3AHFA 4PYQA 4CLOA 1N7HA 1ADGA 2I29A 1XZJA 1DHRA 1N8KA 2C1ZA 4K9MA 4NJEB 4H59A 3AY6A 3VJMA 1RKUA 4QM6A 2GCGA 3HL4A 1UMDB 2WZCA 1L7NA 2KBFA 4FMDF 1CUYA 3VTZA 2FPGB 4HX2A 5TSDA 5LBTA 3OD5A 2WM8A 4IDFA 2VQ3A 4J1NA 2H5LA 4Q9IA 3ZXYA 3PPVA 2CWWA 4C7MA 1N5OX 4C76A 2Z43A 2V5UA 5MN4A 4ARIA 2J3HA 3JATA 3AHDA 1C5KA 2GAFA 1PZFA 3MOSA 1ZHFA 2WY2D 4BX8A 2Y0CA 1VJ5A 4YMIA 2GS9A 1KVSA 3HXTA 4M8NE 5AM2A 3OEHA 4IOKA 2D3WA 1OSNA 4IDGA 1NWHA 4ZQFA 5JU6A 3ZWMA 3EB9A 4I9HA 4GVLA 3RADC 3RIYA 4B43A 4EVSA 2OV1A 4CTMA 1N77A 3QEMB 4G1VA 1W9MA 1KYIA 4OQYA 1D4AA 4YJGA 1L5YA 5BSEA 2GTIA 2X8JB 3FUTA 1M34A 1CQWA 1S2NA 2LE0A 4REQB 4WA8A 5CB4F 2ZYAA 3AI1A 2C7VA 3GLTA 4PGGA 1RZRA 3V34A 3QLTA 2JFPA 3EFOA 1MNAA 2WFAA 4ZYXA 4RD6A 1ORVA 4XGKA 3AJAA 1DBIA 2QQ5A 4MQEB 1DCMA 5DTQA 3F6CA 2Y05A 1ECLA 3FPAA 4QEZA 4DCJA 1P2BA 2EARA 4Y18A 4GR4A 4NCKA 1OVGA 1TQHA 4EUHA 2VTDA 5KQMA 4QREA 3N0VA 3KVYA 4F56A 2Q28A 1SVUA 1TQ2A 2GBGA 5LMUB 1NW9B 1AB5A 5FBWB 3RAFC 3OM0A 4KH1A 4ZODA 3RF7A 3HP7A 2ZYUX 4HH0A 4LYDA 1M1YE 4OQEA 3UO8B 1T13A 3NBYC 5MGBA 2G88A 2Q8PA 1QTNA 2DHEA 2X7XA 3OZAA 1VHDA 4G63A 4CLRB 1JIUA 3PICA 2GO1A 1LXCA 3SVLA 3UGTA 4TV9B 2IF0A 1Q83A 5T4BA 1OAAA 1KO7A 2MYNA 5FLXA 2ONYA 5JBNA 2IXBA 4BO9A 2B82A 1GGHA 1Y8RB 3A6KA 2NU9B 2W6JA 1OGYA 3UUFA 1TGVA 1VCOA 3GDHA 3LPAA 4FQ5A 4GWLA 1K4KA 3S8EA 2QENA 3I6ZA 3QKRB 1YVUA 1TQ8A 2W00A 2X0EA 3UJPA 3QA9A 5CU7A 2IWRA 4GXRA 5AVVA 5TMDA 2C2OA 1Q0PA 1WX1A 2FZWA 3OOWA 2GPBA 1VCNA 5GVRA 1A71A 3HPRA 2AMVA 2PRIA 3DCNA 4FCTA 2XCSB 1WV1A 5TT0A 1K27A 1HQCA 2I3AA 2W4IA 3ILYA 5F9MA 1BVHA 4MR9B 4Z0NA 4Y2HA 3CNEA 3AVUA 4GOJA 5CJJA 4UMEA 4H7EA 4PGHA 3A7EA 4Q3DA 1DWUA 2PWPA 4UM8B 2B9EA 1VL6A 1P2FA 2FCAA 4J03A 4MR8A 4GPIB 4RWEA 4AYWA 2AYXA 2JLCA 4MB0A 5JNVA 3HV0A 2JNWA 1SHTX 1XYYA 2HDNB 2P4UA 3S2GA 3WL4A 4AG3A 4DS3A 4K28A 4G0YA 4YLYA 5C8ZA 5BR8B 3G1WA 3HKCA 3TX2A 3TLGB 1K5DA 2PNFA 4U0KA 4BEBA 1N9GA 2HRRA 4BFZA 1LD3A 3BAFA 4KQ9A 5AESA 1JUDA 1GUZA 5AWFC 4TXMA 1L6IA 4JYAB 3OLZA 2EATA 4TWZA 3JV7A 2VUUA 4R98A 4YQZA 1F8XA 3VPFA 3ZLJA 3KKNA 3HWX1 1QV6A 2XE8A 2EW1A 3IUJA 4HRXA 2G1PA 1DX4A 3ZW7A 2G77B 2JJ8A 4HTFA 3GUUA 3AZQA 1F0PA 4GOND 1BDHA 1G5IA 2NO6A 4XYMA 3GFSA 1ZOPA 4JMLA 4IH9A 3VPXA 5FBKA 3E7WA 5K8CA 1J8MF 1YGPA 1HYGA 3IHLA 4QDZA 3VYVA 2H2AA 3D8TA 1XEFA 2G9RA 4CM4B 4MUFA 4G5GA 3FVQA 1IN6A 2AXQA 4R2XA 4JBNA 8MHTA 1FYXA 4P7JA 4A2QA 2F8TA 1Z07A 1VPVA 3F5DA 1L5KA 4U39A 3A10A 4L07A 3FHOA 3BBPA 5KPDA 3MPUA 4ZI7B 5EXXA 2GDJA 4KDEA 4LF5B 2P78A 2ZZKA 3WZ2A 2AZDA 4Z49A 2PUAA 4D8XA 3OFSA 5FRDA 1TAGA 1CJUC 1KEVA 2ONZA 3JR7A 1PGQA 3CZQA 1GL9B 2CFOA 4L8YA 2QXUA 3P2IA 1U7DA 2B7CA 3RPEA 4PY2A 3UB2A 4MUXA 3BPSA 3JTEA 3LHFA 3P9KA 3R7WA 4RTSA 3N0RA 3PPXA 1Z4OA 1FBNA 2VYVD 2WNSA 1AS3A 2NSYA 4GMDA 4JT2A 4MGKR 4ACBA 3L4KA 2WG1A 4E5NA 5GJBA 8ABPA 3LS2A 2HTFA 1KDPA 2PKXA 2DHDA 3E22B 5E4YA 2ZWVA 4AY3A 4E4RA 4NZMA 1OB5A 1J8QA 4GGMX 3W34A 2QRMA 3ECSA 1BN7A 3RUDA 2ACKA 4C7BA 3E9ZA 3AJ8A 5LDHA 1C41A 5JNSA 2VRBA 1JE0A 3BICA 1KH1A 4Z7JA 5DIFA 3MTIA 3VKVA 1TUBB 3B7PA 3AF6A 3IT2A 3TTXA 2PN1A 5C53B 2F9LA 2CWDA 3DCJA 2QDKA 3M6MD 3PUJA 3Q7RA 4MQFA 2G9VA 1P0IA 1N7JA 2A9QA 1V25A 2RSLA 1P5ZB 3OEHD 1TYCA 3MWDB 3Q1KA 4KIWA 3D8RA 4R1OA 3M2TA 4YTEA 3VHLB 1G1MA 1OC2A 3MJHA 3V3KA 3L04A 2BR3A 2ENWA 2H4FA 2JH9A 3R7SA 4CTOA 1GFIA 3A2MA 3FRJA 4A92A 1R7RA 1QRRA 4BZXA 3S3TA 4EY6A 5KVAA 3O83A 1W25A 2ODAA 1AVTA 4R2HA 3RT7A 4EAAA 3WBKA 2OYRA 4D3DA 3NAQA 4J7AA 1P1HA 3E82A 5CVCA 1JI3A 4B5LA 3D1JA 3LRPA 3WVNA 1UMCA 2CBXA 4R7TA 4O3FA 1RZRD 1YQWA 4Q7KA 1IN5A 2DQKA 3DKKA 2CV2A 1QB8A 3FYCA 2H2DA 4CV1A 3I34X 3PZBA 1U6JA 2ZUEA 5JPDA 2X40A 4QFMA 3O8DA 1RBMA 2QGZA 1FUUA 2ZJ3A 3H4TA 4HNRA 2CF5A 4II2A 5BSUA 4EB6A 1SR8A 4QGSA 5IHPA 1DOZA 5LZ7A 3GLHB 1BMTA 2JHGA 2HCBA 1ADYA 1PHRA 3U17A 1W4ZA 1E77A 1A04A 1HBJA 1SD2A 3NBMA 1AT1A 4DCSA 4BO0A 1E0DA 3L4EA 3N0XA 4LDJA 1SVWA 5ADUS 4XRGA 1MQAA 4KGVA 2QIOA 4Z4HA 3GGDA 2BJWA 4PM4A 2QNRA 3SQXA 3A2KA 2Q4DA 3KQYA 2C98A 4YIKA 2C5GA 1C50A 1DIAA 1PR3A 1Z16A 2D1SA 5DNCA 2GETA 3TTYA 3UWPA 1Z13A 1MG5A 3ZCQA 1JGTA 2Z04A 3HEBA 3FCAA 3V32A 2W6JD 4D4IA 4FX2A 1QIDA 1KZ4A 3F7TA 1GDDA 4J29A 4K88A 4KMRA 4XIGS 3RCBA 1OLUA 2DWUA 3S8MA 4AS3A 3D6HA 4K87A 1KOFA 3QXSA 1R0LA 1DXOA 5FL7A 4B2PA 3U7HB 3WIVA 2C2BA 3S1AB 1NC3A 1Z82A 4OXIA 4WE3A 1JMYA 3T7AA 1YC2A 1DAMA 1OFHA 3IULA 2OCKA 4N6GA 3NAMA 1SIWA 5EXPA 2I6UA 1JA0A 2ZATA 4XSHA 2J5XA 4G89A 1II8A 3MD9A 2XNSA 3MERA 2HK7A 4MGZR 1DWQA 2DCUA 1C8LA 1HKHA 2D5AA 3DT9A 2IFTA 2IOFK 3FPSA 6REQA 4YIHA 2CV0A 4K26A 1MVNA 5FDFA 1NLFA 4QFBA 4HDSA 3FOWA 3HUUA 4TKLA 2Q0XA 5HIJA 1Y8ZA 2PZFA 1TF2A 3PYXA 4UTPA 3S28A 3NTVA 4QPJC 2A1UA 2X8LA 5LB2A 1F8GA 1O89A 3BKXA 1NMSA 4UE3S 1M72A 1CDDA 1CRZA 1U1EA 1O95C 2IY7A 2W2QA 1PNTA 4FLMA 2VFAA 1HTWA 1TKCA 1BOOA 2CLEB 5ADWA 1E7SA 3GLGE 3PGVA 5LL6P 2DH5A 2Z9BA 1HYQA 4WFKA 4CLXA 3AH8A 5BWNA 2XEDA 2J67A 4HB2A 3F7OA 1OFGA 4EI2A 2YIVX 3N1UA 2PJUA 3PC4A 1NDUA 3H7AA 5E1DA 1NLYA 2F8LA 4TMZA 3Q8XB 4FNAA 3ADCA 4YMGA 4JJ8A 5SY6A 1I10A 5C5CA 2XE6A 5EZ5A 4O0LA 1B6GA 1OA0A 2DT8A 2X3UA 2GTPA 1HFJA 4N49A 3X1KA 3ZEIA 2I1WA 5JAZA 3ZU2A 1F2DA 4HH1A 2N1MA 3WP1B 4MS3B 4RQBA 4DMFA 2ECQA 3HO1A 2YS7A 2RI1A 1M2WA 1KVQA 1OILA 3SHFA 4P5PA 4PC6A 3U3ZA 3VC2A 3RRZA 3DEZA 5DTMA 4BE9A 3Q15C 3TDMA 5I4KA 4GM1A 2Q07A 4ER5A 2DU8A 3OO1A 1W5FA 3EODA 1DB3A 1EUDB 2Q2OA 2YXBA 3MJEA 2AUTA 1DBVO 3LXRA 1R0ZA 5ETJA 4OUDB 3SEAA 3V2GA 5EIHA 3HCBA 1UPAA 2RKOA 4OUKX 4RORA 4C3OB 4K0KB 4ACAA 1F60A 2RJOA 1N3LA 4ZZ3A 2JAHA 2YIDA 3O75A 1XQ6A