2ZQZA

R-state structure of allosteric l-lactate dehydrogenase from lactobacillus casei
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
312
structure length
307
Chain Sequence
DKDHQKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAPTRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Active and inactive state structures of unliganded Lactobacillus casei allosteric L-lactate dehydrogenase.
pubmed doi rcsb
source organism Lactobacillus casei
total genus 113
structure length 307
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zqzA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2zqzA02
3OA0A 2GGSA 3FHLA 4QO8A 4YJGB 1ZJYA 4MVJG 3RJ9A 4LVCA 5JXWA 3KVOA 3TFOA 3O8QA 4BHTA 4UUOA 3OETA 5DOVA 5KNLA 1F8FA 1HRDA 4E6PA 3K2BA 4FJ0A 1GR0A 4C7KA 3I5MA 1O9BA 1HDYA 3ENKA 4WLUA 3PYMA 2HQ1A 1PR9A 3CIFA 3H8VA 1I24A 4WK6A 1MG5A 1ZO8A 2EWMA 4E2WA 3F1KA 4NJOA 4FC7A 3I9JA 1U3TA 4OJNA 4GSLA 3EW7A 4ITUA 1C3VA 1QRRA 1PJBA 3GK3A 3RIHA 3DDNA 3MJTA 2BD0A 2BLLA 1NFRA 2DC1A 1JWBB 1BGVA 2EW8A 3PFWO 1XKQA 2HSDA 1TA4A 1U2DA 3QV1A 4ZVVA 3T7CA 4IDBA 1B14A 1FF9A 2D1YA 7ADHA 2YY7A 3UGKA 3BMQA 5F1PA 3NEPX 5TNXA 3D4NA 3PIDA 3ZNNA 3HUDA 2ZYDA 3F9IA 5DULA 4YQYA 4KDFA 2YUTA 4U0JA 3OIDA 2J5RA 5JE8A 2PD3A 5CDSA 3ZV5A 4I9HA 4K1LA 4Y98A 4FJ1A 1LLUA 3GZNA 1ZW1A 3P2OA 4J4BA 1ZH8A 1MC4A 1DHRA 4XA8A 5JS6A 3H6KA 4BNZA 1W73A 1JU9A 2EP7A 1DAOA 2Z1NA 4R3NA 3LLSA 1P0CA 4QSMA 2DFVA 1PZHA 3U0BA 5HTOA 3F3SA 1B7GO 3RFXA 1N7GA 3GN1A 3PHIA 2EKQA 4CM7A 3KHUA 4NPCA 4RF2A 1TT5A 2GN8A 3MOIA 3ZWXA 5KVQA 1WDMA 3UH1A 4CMJA 2G1UA 1MB4A 2X58A 3INGA 3E9MA 1X15A 1E77A 3PJGA 1HZJA 5GZ1A 3AI2A 5ICMA 1GQ2A 5TJ9A 3VZPA 1T2DA 3A9WA 3ZWOA 4I08A 1LEHA 4DYDA 3IMFA 1K3TA 2FR0A 2PZJA 1I3KA 1NVTA 1JA9A 3CKYA 1DLIA 3FTNA 2VZ9A 4CLDA 1PJ3A 1LRLA 1CJCA 3B1JA 4XYBA 5HWSA 2B4TO 3D4PA 5ITVA 4R1UA 2G5CA 5CDGA 1KETA 4EEZA 1QV6A 3ZN2A 3OJLA 3BHIA 5CEFA 4J16A 2JL1A 5F5NA 3WYBA 1YWGO 2G17A 2CFCA 3FNEA 1D8AA 3HB5X 4CMHA 4HV4A 3MWEB 4MIEA 3SC4A 8LDHA 1KYQA 4MJLA 1E1MA 1WPQA 4JLWA 3FTPA 1SB8A 4KWHA 1UH5A 1YBAA 4NJMA 3KSUA 3RSHA 5L7YA 3Q11A 2D5CA 4OHUA 4HXYA 2NADA 3JSAA 3F4BA 4U5QA 4KTVE 2GERA 2PZLA 4PZCA 3W8EA 1DOHA 4GGPA 4B8WA 2RIRA 1CETA 3LT4A 3NTQA 4RVDA 3TZHA 1N1GA 1K89A 4OSPA 1EQ2A 1I5RA 3LF1A 2C20A 5EJ2A 5I9NA 2DFDA 5TIIA 5T8KA 3OM9A 3DO5A 4S1VA 3DBHB 1XELA 5AXCA 3WGQA 1Y9EA 1DRVA 4IIVA 4D0SA 1I36A 4HNGA 4IXTA 4ND2A 3SXPA 4DLBA 5IJZA 1QYWA 1QYXA 1E7MA 3AY7A 1E3LA 4I9UA 1GZ4A 2Q1WA 3LVFO 4G2NA 5DCYA 1Y1PA 2CVQA 4GH5A 2BFMA 1ZJZA 3C1OA 3ETEA 3OEWA 3WLFA 5T6BA 3HHPA 3G1UA 2YV2A 3Q2IA 3ZWNA 4B3IA 2HUNA 4GX0A 1TI7A 2Y68A 1GCOA 4PVCA 1JKJA 2ZB4A 1RJWA 4E32A 1YQDA 2UV8A 1W0CA 1C0LA 3U4CA 3DXFA 4O0LA 3VPFA 5IG2A 4NG5A 5B4VA 4U0KA 3NKLA 1K2WA 3MTJA 4J43A 3G3EA 3IAHA 4CLRA 3PXXA 1UUFA 2OGUA 4RVGA 2EKLA 5FI3A 1Z74A 3WICA 4BNWA 4MDHA 1U28A 3F46A 2H6EA 1DRWA 3MWDB 2I9PA 3LT2A 1B2LA 4EUHA 3A28A 2ZJ1A 5CPBA 5DDIP 4R1NA 3HSKA 1NWCA 2YV1A 4IMPA 2PD6A 2EHDA 4MVJD 2EF1A 5F5LA 3K8ZA 5KJ6A 5JDIC 3TL2A 1DIAA 4XEHA 3RQSA 3WS7A 4OIMA 2B5VA 3PYXA 3W4IA 2NVUB 2Y67A 2VRCA 2FR8A 4B4UA 1XYGA 4CM9D 4FSHA 4NNJA 1PR3A 5EIOA 1PQWA 2AG8A 4WNCA 3ZV6A 3O4RA 3Q1LA 5I9LA 1XR3A 4D42A 1GYPA 4O59O 4MP6A 2YQ5A 1Y6JA 1SAYA 3HNPA 1YDWA 1Y8RB 2ZB3A 3FR8A 3HDYA 4NFYA 5JC1A 1A9ZA 2O3RA 3DFUA 4ZRMA 3NYWA 4XR9A 5IN5A 1CDOA 4D43A 4AJNA 3VOSA 1SB9A 4OSOA 1VJ1A 4YT2A 2CY0A 3VPGA 3BMNA 3JQ7B 3RWBA 4J6FA 2AHRA 1PJCA 2BHLA 4RF3A 2Z5LA 2X9NA 4Q3EA 4BOYA 5A05A 3WG9A 4GBJA 4E13A 1ZVMA 1ISJA 3OEYA 4TRJA 3BZUA 5TQVA 4DYVA 4CM6A 5IDXA 1U4SA 1LBEA 1K6XA 4W9NC 1XIVA 2GPTA 4M1QA 3Q3CA 1DFIA 5CHEA 2BGLA 1XDWA 4CUKA 1PQPA 3DMYA 3UHAA 4II3A 1QSGA 5ILOA 1OC4A 3S55A 4JBHA 4BNXA 3LDHA 4CLOB 5L3ZA 3VC7A 1DSSG 5DZSA 3PFFA 4PG5A 2C7VA 1ENOA 4IUYA 1BVRA 4BB5A 1FJHA 4NHEA 1EFKA 1H2HA 2O48X 1ISGA 4IGFA 3S8MA 3GY0A 1BXKA 4E3ZA 1S7CA 3ULKA 1E3IA 1PS8A 4NU6A 1PTJA 2PV7A 4MINA 3FNHA 1HEUA 4ID9A 4L74A 1LNQA 1JWAB 5L9AA 2A94A 2X9GA 2GR9A 3E18A 2F00A 4WCFB 4CMIB 2J3JA 4HNHA 1E1NA 2R00C 1YBMA 2FMUA 4BNMA 3E1KA 4FN4A 1WMAA 2J3HA 2NLOA 3DL2A 3H5AA 3KOUA 5L53A 1LDBA 4FFNA 2B5WA 2Y99A 3TF5A 4LK3A 2HRBA 4CQMB 4E21A 4YJGA 4DL9A 2Q1UA 2XXBA 4WNIA 3V2HA 5DNAA 1ID1A 5JNLA 2E48A 3PHGA 4M49A 3GNTA 1IHXA 4ALNA 1GZ3A 1N1EA 5GZ3A 5BT9A 2J3IA 1NQOA 3PI7A 1T1RA 2P5UA 1KEUA 5F1OA 5JO0A 4CMGA 5A3JA 4F3YA 4YACA 4U6QA 2V6MA 5DBIA 1VI2A 1QV7A 2H5LA 5BSFA 3H9EO 1DC4A 1Z6ZA 3EHEA 1PGPA 1XGKA 5A1TA 2RAFA 3H5NA 1PEDA 2NTNA 4YAIA 4NMHA 3E8XA 1N8KA 3QIVA 4TROA 3OJ0A 2LDBA 1I3LA 1VLLA 5DP2A 1Y8QB 4J1NA 1G6KA 1E7SA 1WZIA 4PLWA 3QVSA 5DOZA 4WUVA 5JY1A 1ZK0A 2HDHA 3B20A 4NQZA 2OBNA 1P3DA 3FPCA 2BMAA 3V1UA 1P33A 2NTVA 3WGZA 1CEQA 2Y0EA 5U1PA 4CLHA 3OECA 3JQ9C 3OA2A 1PJSA 4E5KA 5H81A 3PVZA 4IDAA 4ILKA 3PGXA 2VOJA 1GTMA 3JQBC 3D5QA 3TQHA 1UR5A 3DB2A 1E7QA 4F6CA 1BXGB 1I0ZA 1P45A 4CM4B 4QXMA 3NDRA 1LSUA 3W8FA 1R0KA 1P1RA 3GGOA 2VT3A 4OXNA 3AM5A 2QHXA 1AXEA 1NPYA 3E5RA 3AUUA 3JTMA 1Y7TA 1MXHA 5CEJA 4XDYA 1WP4A 4IGEA 2VOEA 2CF5A 5JYEA 7MDHA 1KERA 1GPDG 1HDGO 1NPTO 4DPLA 3IP3A 2D4AA 3BTSA 3DFZA 4R69A 3OIGA 4W99A 4Z3KA 4L8VA 2Y93A 2X0NA 4WLOA 4GPD1 4ESOA 3VH2A 4CLEA 4J3FA 4A2CA 4Q3DA 4ZICA 4Z0TA 1EE2A 3WXBA 4YVFA 1H0KA 1VL0A 3D0OA 5TLSA 5BNTA 1EMDA 3MJVA 1YL6A 5ENVA 1B8VA 3JQ6A 2GASA 3R1IA 1Y81A 3V2UA 2IEDA 1O94A 3O26A 3WGGA 2XF8A 3CINA 1LDMA 4IM7A 1MA0A 5CP8A 2GZ1A 2DAPA 4CM5A 1O95A 1ADBA 1UZNA 2WYVA 4CV0A 3KBOA 1CYDA 1E3SA 3MJ4A 5JDCC 5K6AC 1T4BA 3TOXA 3PZBA 1GV0A 3GR6A 5G0TA 3FPLA 2GZ3A 5DP1A 3H9JA 1U9JA 4TRNA 1NFFA 4E0BA 1PZEA 2PNFA 1H5QA 3EUWA 4KMSA 4XJSA 3JQEA 3ZNQA 2PLAA 2EERA 4JP3A 2BGMA 2BGKA 4EDFA 3CPSA 4AJJA 1NQTA 4GI2A 4J4TA 2I6TA 1U7TA 1E92A 2E4AA 2VRCD 1HWYA 1WMBA 3O03A 3G49A 2JD0A 1A72A 4H7PA 1GU7A 3ZU4A 2FPGA 4PLYA 2HRZA 3O9ZA 2B4QA 1FMCA 1CF2O 1ZSVA 4PLTA 2EGHA 3ROMA 3B1KA 3DAFA 4R5MA 4XYEA 4YJFB 1SC6A 3DBHA 3FSRA 4ZJUA 4WLEA 2OO5A 1GUZA 3ZWVA 1Q2XA 4DC1A 2AEMA 4CMKA 3JD3A 2VCYA 1IULA 5L7WA 2PY6A 3RUDA 4DRYA 5C7IO 5CDTA 1LDYA 1D7OA 3T7EA 2NTJA 4HBGA 2LDXA 3HN7A 5G2OA 4DIOA 3EVNA 5A9SA 4ALJA 5HRUA 4TZKA 3TZKA 5IDQA 4XKJA 1B8UA 4G65A 3WR5A 5T64A 1PL6A 1KY5A 3H2SA 4DC0A 1PJTA 4J9UE 1L7DA 4Y9DA 1DAPA 4DLAA 3VH4A 3JQCA 4CPDA 4JK3A 2WSBA 2GCGA 5JAMA 4AVYA 4IDFA 3GVPA 4J0EA 4BL5A 2BELA 2Z95A 3NDJA 4DBZA 1QLHA 4XQ9A 5CEEA 2Y0CA 4RZIA 3RBVA 4K9DA 5IZCA 4KZPA 1HZZA 1VSVA 3QWBA 4MKZA 3WNVA 4DPKA 1B16A 1IZ9A 1U8FO 3GPIA 4W6ZA 2GSDA 1MP0A 1WXDA 3ANLA 3B70A 4XB2A 5DCWA 1MV8A 2JCVA 4N7RA 5JO9A 1IUKA 2R6JA 1R0LA 3PK0A 4G81A 1R4MA 1Y5MA 3ZGYA 3VKVA 6ADHA 3E6AA 4NU5A 3X2EA 2GRAA 4G5HA 2BH9A 2Q45A 3LC7O 1SNYA 4BO1A 4TKLA 4BKPA 3WSWA 4WLFA 1XQ6A 2VQ3A 4JIGA 4MVJM 2Q2WA 3GH3A 1DIGA 1G0NA 3SVTA 5FYDA 3TJRA 4CR6A 3VPSA 3JQ8B 3WBFA 3ZU2A 2NVUA 2I66A 4J7UA 4AICA 3JQAD 2FPIA 4ALIA 3I3OA 1V3VA 4MVJH 3DZHA 1E1KA 5EL0A 2NVBA 4PN3A 3TOZA 4JQCA 4D0RA 1R16A 1OFGA 4XGKA 3LT1A 5T67A 1KIFA 3VPHA 3RUFA 1UXJA 2NM0A 2FHSA 1T4DA 1DO8A 1I2CA 2C7GA 3QW2A 4MP8A 3RBXA 4C4OA 2Y1EA 2QIOA 3BAZA 1Y8RA 4EI2A 2H63A 2WM3A 1Z45A 4GQAA 1FDWA 3ZWYA 4D3SA 3LC2O 2VHYA 3MJCA 4B4WA 5CG2A 2WYWA 5F1KA 2CDCA 1QKIA 3MCVA 3DMTA 2YQ4A 4PZDA 3NTRA 3OICA 2FR1A 4BO4A 1LLCA 1X1EA 1YBVA 5TC4A 4RJTA 4Q3AA 3H3FA 3GC6A 5I7EA 1H9AA 3L07A 4LMPA 4BO8A 2XPCA 3FF4A 1HSZA 4XWYA 4WLNA 3ONDA 2YFQA 2Q50A 3FNFA 1CQIA 1JKFA 4BNNA 2X5OA 4CV1A 4PVDA 4BKRA 4XRRA 1P1FA 3EGOA 1EEHA 3RROA 4CMEA 5GY7A 3E5MA 4ZQHA 1E0DA 4BQPA 1A4UA 2EIHA 3ADOA 3PDUA 3AJRA 2X0JA 1Z7EA 1R6DA 1Y9AA 3VVBA 3GNSA 4JGBA 3UN1A 1H9BA 1I2BA 4INAA 4CL8A 2DU8A 2DM6A 5A06A 4YTEA 4KP7A 1T2FA 4CLOA 3H9QA 3AI1A 5GZ6A 1X0VA 2ZCVA 3HZZA 4E2XA 1V6AA 3NDIA 4UVEA 3PWZA 1PJQA 3CZRA 4GMGA 4M55A 3VH3A 4D79A 1AUPA 3DAPA 5LDHA 5L7TA 4JX8A 3AWDA 4I9NA 1N92A 1P1HA 1UAYA 1ZK3A 4EITA 1Z73A 4NBWA 1HETA 1HE3A 4IS2A 4FOOA 5KIAA 4PG7A 2OP1A 4ND3A 2HJRA 4JJIA 2ZTUA 4URFA 2IYOA 2Q2QA 2FWMX 3ROKA 2O3TA 4WCFA 3T4XA 4CMIA 4E5MA 1V3TA 1CWUA 2P2SA 2C59A 3RC1A 5L51A 4CQMA 1YL7A 2XOXA 5F21A 4RPGA 1LSSA 4J90A 4QT0A 5TRTA 2PH5A 4FBGA 4Y6PA 1O0SA 5G4KB 4ND5A 3I83A 5EINA 5T8KC 1E1LA 3ANNA 4J4HA 1C0KA 1MFPA 4M87A 4EUEA 3QP9A 3AFMA 1TEHA 3P2YA 1JAXA 3F5SA 4R16A 4J7CA 3W6ZA 1UAGA 5JCXA 1TXGA 3IL2A 4MKRA 4IJWA 4XGNA 4YWJA 3LC1O 1TT7A 1ULUA 3AW9A 4DLLA 4R9SA 4PZEA 1DXYA 1WZEA 2NWQA 4FGWA 1EE9A 2TMGA 3OMLA 2YDYA 4W7HA 1Q7BA 4XX0A 4HADA 3GEMA 2ZTLA 5H82A 2DQ4A 3AM3A 3C24A 2R2GA 2NSDA 1T25A 5B12A 3GQVA 3GDGA 1B3RA 2P4QA 1WDLA 2GN4A 2OOSA 3IJRA 4PLGA 4OQYA 3WFJA 4YPOA 2EGGA 4LISA 1I33A 1N2SA 5HS6A 4KWIA 2O4UX 3ON5A 2PKQO 2P68A 3GVCA 4A5OA 1B26A 3VPXA 1J0XO 2PFGA 3GLQA 4FFPA 2GN9A 2J3KA 4KOAA 4UEKA 3A06A 3UCFA 3OQBA 1XLTA 1BXGA 4WOJA 4CM4A 1V0JA 3INRA 2IXAA 2Q49A 1KY4A 2AW5A 1EVJA 3I4CA 2WYUA 1KOLA 5ENDA 3QY9A 1LXCA 4WECA 4BV8A 3A1NA 3GRPA 4Z6KA 2YHIB 4J49A 1YS4A 4BVAA 4BGIA 1GZ6A 1M76A 3D5TA 4ND1A 4WOKA 2VUSA 5C7OO 3DAGA 3BTUA 3IC5A 4YRAA 2X5KO 1QR6A 2DVMA 4OM8A 2V7PA 2HJSA 4A27A 3NGXA 1FXSA 3ROQA 4AJ2A 3GVHA 2CVZA 3R6DA 1P31A 2H9IA 1K6JA 3TZCA 3E9QA 4OGWA 3TZ6A 5EERA 3ZHBA 1NWHA 1LDEA 3WLEA 1DRUA 1EUZA 1KEPA 1LX6A 2XAAA 4GVLA 4NK5A 4DUPA 4PRKA 1PGJA 5BQFA 1R37A 5JMPA 3IUSA 4ZRNA 4ALKA 2E37A 1E3WB 3OP4A 2X4GA 4EZBA 1EDOA 3RJ5A 2V6BA 3JD2A 1OC2A 1RPNA 2PZKA 1YE3A 5ILGA 2QRJA 5LDGA 3L9WA 2FZEA 5BNFA 5HS4A 2RCYA 3KM0A 1SPXA 4N54A 3KZVA 2WEKA 1ZZEA 1BSVA 3NT2A 2CD9A 3JQFA 4U6SA 3VZSA 4W82A 1JAYA 2X0RA 3H5RA 1K6IA 1GD1O 1SEVA 2J5QA 2QYSA 1RM5A 3FNGA 4O5OA 4K6FA 4N5MA 1IPEA 3ICCA 4IY1A 4XZ3A 4WEOA 1HLPA 1W4ZA 5JAQA 2P9EA 4I1IA 5FI5A 1E7WA 1LRJA 2OHXA 1XSEA 3PDJA 1C1DB 1EUCA 5EN4A 2O4CA 4NDNE 3P5SA 3ONFA 5KJEA 1QG6A 3WQRA 3GZ4A 3OQ1A 3AY6A 4FD3A 4CV3A 1YJ8A 3U4HA 4Q9NA 4PLZA 1JVBA 3DOCA 3IOYA 2O2SA 3JYLA 4C7JA 3SLGA 4BUCA 3RC2A 4ALLA 3GHYA 2EKPA 4RLHA 5DBGA 3GG2A 1SBYA 4YJFA 3AM4A 4TZTA 1R66A 1UXKA 4BNYA 1YOVB 1PZFA 1H6AA 3ZV4A 3ZW8A 5CDUA 3BMCA 1HDZA 3GVIA 5IDWA 3U5TA 2YYYA 1M6HA 5JBIA 5AXBA 3PZRA 2ILTA 1W6UA 2W4QA 3HG7A 1ZIDA 3FN4A 4R41A 3I1JA 4E30A 1PGNA 2OUIA 1Q0HA 4OXKA 4FCCA 4JNKA 1PIWA 3RU9A 2CNBA 1NPDA 4YT8A 4RF4A 4DWVA 4ZD6A 4I5EA 4KUEA 1PQUA 4CUJA 2X86A 3M1LA 2P9GA 4D46A 3EVTA 3K2EA 1HDOA 2AQIA 2Q4BA 4BKQA 3PJFA 5I7VA 1Q1NA 1QORA 5G0VA 4A73A 3RFTA 2X5JO 3PEFA 1ISMA 4W7IA 4L4RA 1EBFA 5MGBA 3OF2A 4LRSB 2TMDA 1I32A 2GNAA 1XA0A 3DHNA 4A0SA 1P1KA 5DT9A 3ZCXA 3PQFA 4TRRA 1FDUA 1B3BA 1NBOA 4R5HA 3SLKA 1IY8A 2Y1DA 1HYHA 1JN0A 1RYDA 1C14A 5KKAA 2YZ7A 2D5AA 4PG6A 1ADCA 2AQKA 1BVUA 2Z1MA 4IMRA 4NBTA 3UF0A 2DBZA 5K0ZA 4CV2A 1XHLA 2JFHA 3JQ8A 4M8SA 2P5YA 1ONPA 3BXXA 1HYEA 5TS3A 1EQUA 1A7KA 2IZZA 3DZGA 4BMSA 1ZK1A 3GFBA 3SJUA 2HU2A 4FR5A 4OO3A 5A03A 1KVRA 3FCOA 3WNQA 3T4EA 3JYQA 1VKOA 1Y5RA 2AEFA 3JV7A 2Q1SA 4YRDA 1JKIA 2AG5A 3STHA 4BNGA 3NT4A 3MJEA 4CQMD 5B4UA 1LU9A 3HFGA 4EUFA 1L1FA 1GEEA 2Q2VA 4R1TA 3Q6IA 5I9MA 5JLAA 3WDSA 4FQ8A 2QRLA 4BB6A 5IAAA 2EG9A 4AJLA 2V6GA 4PLPA 4XD2A 2UYYA 1P1JA 4JBIA 1A9YA 1JLLA 3VHRA 3VDRA 3W4KA 1NR1A 2CMDA 3MOGA 1F17A 3PGJA 4BKOA 4J0FA 4D45A 6LDHA 1NR7A 3WTBA 1ZXLA 4FB5A 1CERA 2WJPA 2DTDA 1IYZA 4H15A 4CQLA 5T5QA 3LSYA 5FF9A 3WOHA 5FEUA 2BFOA 2W2KA 3L4BA 3QWFA 2NUAA 3VVCA 4M54A 4E5YA 4CM8B 4E2YA 3DR3A 4S3MA 4XJTA 3FI9A 4YJHB 5TF4A 3BIOA 1PGOA 4PFJA 1CQJA 1A7AA 1NFQA 2HMVA 4ZQBA 1H94A 4J7XA 3F6YA 5AQ1A 3CH6A 2W98A 1L7EA 2QG4A 1QYVA 4L73A 4KTTE 1MG0A 4L4XA 4ZU3A 2EV9A 4CLXA 5C7LO 4ZQEA 3GEDA 1A71A 3QA9A 4YA6A 4HFMA 4OXYA 1GYRA 3AOEA 4LRTB 2OZPA 2EJVA 4PCVA 2HMSA 3Q0EA 4Q3CA 4CL3A 4BS9A 2DUWA 3QQPA 1IE3A 3RI3A 2X9VA 5GMOA 4OMUA 1TB4A 4YAJA 3ZU3A 4RVSA 4YXFA 1JDJA 2VHVA 4RQUA 3VH1A 1DC5A 3HWRA 1VSUA 1ZFNA 4Y67A 4OKNA 4F6LA 1C1XB 5CG1A 4LW8A 4ROSA 4RVHA 3AU9A 2ZQZA 2VRBA 3COSA 4J91A 5JAZA 1KS9A 1E6EA 3GZNB 4NK4A 2GF2A 4FDAA 4GX5A 1WVGA 3ONEA 5BR7A 3GMSA 4IJUA 1DC3A 5L4NA 2QZ9A 5L4LA 4KDEA 5IXSA 4L9RA 1UJMA 3DHEA 4DMMA 1RWBA 5KWEA 1X7HA 1RKXA 4B8ZA 4XDZA 4FGSA 3ORFA 5IN4A 2PWZA 5F3RA 4BO3A 1YDEA 4IDCA 2SCUA 2ZQYA 3KETA 3GG9A 3TPCA 1PJLA 1E6UA 1TT5B 1DJNA 1U3WA 4UREA 2ZJ0A 4PG8A 4CUZA 2I76A 1A5ZA 3NV9A 1ISIA 3AFNA 5BSGA 3GMDA 1BG6A 2EEZA 3E03A 2PTGA 2VWQA 1VRWA 1FDVA 1ONNA 4XQCA 5HBRA 3QVWA 3AI3A 4MVJI 4W9NA 4BMNA 1LUAA 1D4FA 4N18A 2YJZA 4BV9A 2O3JA 2JHFA 4Z3DA 2OFPA 4D41A 3S2IA 2D3TA 4J9VA 2AQ8A 1OBFO 3HFSA 4WASA 3TSCA 3V5NA 4LN1A 1LQUA 2ZCUA 3FD8A 4HFNA 4IS3A 4UUNA 3RUHA 3CMCO 2VHWA 1O5IA 1E5LA 1PX0A 2C0CA 4AJ4A 4AJPA 3BMOB 2FP4A 3C8MA 4DQUA 2B0JA 1FDSA 3H3JA 1AGNA 1MUUA 3RU7A 4O6VA 5IZCC 4RL6A 1XCBA 3UKOA 4K26A 1EVYA 4DIBA 1OZAA 4F46A 1NM5A 4OAQA 4IJKA 4ZGWA 1UP6A 3NJ8A 2NACA 4RF5A 3A14A 5DF1A 3DOJA 5CAEA 1GCUA 1GV1A 4Z9YA 4ALMA 4OKIA 5KKCA 2I3GA 1G0OA 4IDEA 3L6EA 4L75A 2Y1OA 4NJMB 4UVIA 1B0AA 3ZWCA 4QO7A 1EZ4A 3H9UA 4MOWA 2PR2A 4R1SA 4ND4A 2X22A 3KSZO 1NNUA 3ZHXA 2PD4A 3GHHA 1J5PA 2YHIA 1NHGA 3FWNA 4U7WA 4RO0A 3L4SO 4JROA 2E82A 1YQGA 3H4VA 5A4DA 3PQDA 3ZI0A 2W8ZA 2ZKLA 4BO7A 4MIYA 1NAHA 2DT5A 4KUGA 4TWRA 3VTFA 3DONA 3JQGB 3WB9A 4DTIA 5I8WA 1N7HA 1WNTA 2CZCA 4WKGA 3W8DA 3IUPA 3WMWA 5KVCA 3AUAA 3DMTC 2J6IA 2OORA 3LK7A 3I6QA 1BXZA 3LT0A 4YBZA 3S2FA 3UXYA 2AE1A 2JKVA 1R15A 4R3WA 2JFGA 1ENZA 3JCZA 3CEAA 2PGLA 1E3WA 1DPGA 4DGSA 3QWIA 4KQWA 4QUKA 4EGFA 3RUAA 1GUYA 5LC1A 2YW9A 4QFCA 4YEDA 3IKTA 3L0DA 2CDBA 1XEAA 2VN8A 3C3XA 3KYDB 4LCJA 1U3VA 3TRIA 1OAAA 1Q7CA 3TNLA 1OMOA 4GAEA 5L40A 2GYYA 5JAIA 1UP7A 3WYEA 4MKXA 4P4GA 9LDBA 2RBEA 4CMEC 1UP4A 4NBUA 5L4SA 2RH8A 2BI8A 5AXAA 4D3DA 1UDBA 1MXFA 3FBTA 3C1AA 4IIUA 4Z0HO 2FY8A 4I5FA 4CLRB 5KJ1A 2I5PO 1PJ4A 5EQFA 1LTHR 3NGLA 3WFIA 3JQBA 3B6ZA 2IODA 1C1DA 1VM6A 2VYNA 1LC0A 3ITDA 4DQXA 4PLCA 4I8XA 1VKNA 4BNVA 3ZHZA 2QYTA 1UDAA 1ZKMA 3WQQA 3WGIA 1GFSA 4AJOA 3WQSB 1PS0A 3LU1A 3JYOA 2B69A 3DC2A 1R4NB 4KUHA 5B37A 1KVSA 3KUXA 4U8GA 4O63O 5A3VA 3VDQA 2HLPA 4XQEA 1YOVA 4ZA2A 1GAEO 4NFHA 4BNJA 4WCFC 4BIIA 4EYEA 2OL4A 4YYZA 4X54A 2WD7B 3KYBA 4K6CA 3IDSA 3AOGA 2VNSA 1ISFA 4W4TA 3RBZA 2IRWA 1HTBA 3RVDA 2OMEA 3OSUA 2VHXA 4BO9A 1ZUD1 2IXBA 4Z0PA 2B37A 5AYVA 4LVUA 3ROPA 4XQGA 3RD5A 3EC7A 2GLXA 4CJXA 1LLQA 1ADFA 5CDYA 2VHZA 1WLYA 3WWYA 1NVMB 1EVIA 4FS3A 1JQBA 3PIIA 3ANMA 1V3UA 4QEDA 3ZHYA 4CODB 1H6DA 1PSDA 2AEJA 4B7UA 3OJFA 2ET6A 4AG3A 3PTZA 1T2AA 1YO6A 2B83A 2DBRA 2ZATA 3JQ7A 3L9XA 1KEWA 1J6UA 5THQA 5A9TA 2BKAA 4QX6A 5G0WA 2JJYA 5ADHA 1BWSA 2I67A 3TN7A 3GGPA 2DPHA 4IBOA 4K28A 1UXIA 3I9LA 2IDZA 1BW9B 3N7UA 2I65A 3W6UA 5I7SA 2X23A 5G4LA 3D64A 1HE2A 1ULSA 1V8BA 2B4RO 4JCOA 1U2GA 2A4KA 3R3JA 1E7YA 3UW3A 1M6WA 5G0SA 4YAEA 2JD2A 3EZLA 3OJOA 1I01A 1SZJG 2Y05A 5JY6A 3L77A 1QXSA 5I8ZA 3Q9UA 1LLDA 4AJEA 3BA1A 5ES3A 2NU7A 4J2HA 2E49A 4NR0A 4GWKA 4I5GA 1O6ZA 2CUKA 4D44A 4UAGA 4NIMA 2NQTA 3GUCA 4ZQGA 4XYMA 1UZMA 3ZV3A 3JQDA 3R0IA 2VZ8A 3JQAB 4PIVA 3RUEA 3C85A 3PPIA 3TWOA 2C29D 3IKVA 3Q9NA 4XRGA 1UDCA 1HE5A 1PS9A 2WDZA 2X8LA 2FRDA 1U3UA 1U7HA 1C0IA 4HP8A 4B79A 4JJGA 1KVQA 4HKTA 5A5FA 3A4VA 1KVUA 4M89A 2V65A 5A9RA 2DUUA 3PHJA 3UCXA 5A04A 4P8RA 5MDHA 1DIBA 1X7DA 3K92A 4KQXA 2X1HA 1Z75A 3WIDA 1Q0LA 1ZXBA 3PP8A 4GVXA 3QWAA 2JD1A 2H1SA 3KLPX 2I99A 4J1QA 1F0YA 4JN6B 3RCBA 4OL9A 2BRUA 3GUYA 1K5HA 1XQ1A 4GMFA 5TX7A 2NVWA 3X2FA 1MC5A 4R01A 4CM8A 3LZ6A 1W8DA 3LQFA 4YJHA 5JC8A 3KV3O 2AMFA 1I8TA 3ASVA 4RPHA 4RDHA 1ZK2A 3K31A 4QECA 5L95A 2ZB8A 3CTMA 3HN2A 4IDGA 3LYLA 1Z82A 2OP0A 4JXKA 1FK8A 3SX2A 5AOVA 5ER9A 3ZWPA 5CPFA 1N9GB 2C2YA 2VUUA 1U1IA 5B1YA 1H6BA 1ZEMA 3HADA 4F45A 2WE7A 4MIOA 4GL4A 4BGUA 4E2ZA 3CZMA 3JYPA 5A02A 3OQ6A 2PKQP 4NBVA 2UUOA 3BHMA 1NTOA 1WDKA 4CR7A 2IEBA 1DJQA 1U8XX 3AK4A 3SJ7A 1YQXA 3JQFC 4E4YA 4BNHA 2O7QA 2NU8A 4EJ0A 2O2YA 3NAQA 1I2ZA 5B4TA 4R68A 3N74A 1C1XA 1O8CA 4H3VA 4NBRA 1I30A 3HE3A 1Y8QA 1AXGA 1NQ5A 1OI7A 3HDJA 1ML3A 3HQ4O 4PRLA 4RORA 1X7GA 4EW6A 1ZK4A 3TZQA 5FWNA 2VWPA 2JAHA 2WTBA 3I23A 1DB3A 3D3WB 3PWKA 3RKUA 5KJFA 4DPMA 1YONA 3PLRA 2Y1GA 3H7AA 4II2A 3N58A 2Y1FA 4BO0A 1YVEI 3VTZA 3K5PA 5TJHA 4UUMA 1PU2A 1YB5A 1EFLA 4J1TA 1QMGA 4YDRA 3CUKA 3QE3A 4CMAA 5L45A 4WJZA 4B7CA 4D3FA 2Y66A 4IPTA 1MGOA 4TQGA 4HX5A 4O1MA 2HKIA 4MVJF 4LSWA 3OIFA 3IP1A 3DZJA 1T2EA 4BGVA 3UICA 1K0UA 2DTEA 3BMOA 5C37A 4HWKA 3AY3A 4QTZA 2BF7A 3GDFA 5H83A 4OOEA 4BO6A 1ZEJA 3V2GA 1TLTA 3NTOA 1QYCA 4Y8VA 4DVJA 3BHJA 2Q1TA 3GFGA 4LMRA 3MZ0A 2VYND 4XR4A 2VNAA 2QW8A 1B8PA 2HMWA 1BHSA 3RUCA 4N5LA 4Z9FA 5K9ZA 5TGDA 4YT4A 2HK8A 4WLVA 2JHGA 3I52A 3WIEA 3OHSX 2PA3A 1LSJA 4UVDA 3DOOA 4Y6RA 2NU6A 3UCEA 1P74A 3WX0A 4FOSA 5JYDA 3DBRB 3OBBA 3NJ4A 4N5NA 4BNLA 1PWZA 4OOFA 3DBVO 4PLFA 3KYCB 3RC7A 1GQQA 3PHHA 4ZN6A 3GGGA 3H9GA 1SCUA 1X13A 2YFHA 2B35A 1FDTA 3ETGA 2VTEA 5IZ4A 5KOIA 2FPPA 1X0XA 2GN6A 3FBGA 1KC3A 3W4JA 1PZGA 3JQGA 4MVJP 5EMHA 2VWGA 1HLDA 2FSVA 1F12A 2Q3EA 2VWHA 2Y1CA 3ITKA 3SBOA 2C5AA 2RH4A 1SOWA 2RHCA 3RC9A 1NVGA 2FOIA 2QX7A 1VE9A 1VL6A 3DZFA 1LDNA 4GKBA 4XGIA 3AUTA 5COBA 2DPGA 5IXYA 5KVVA 5THKA 5HA5A 2ZTVA 3BTVA 5ER6A 1BDBA 5C3MA 1E7RA 4WEQA 3RKRA 1ENYA 3ZWBA 1DEHA 1U4OA 3DZBA 3OFSA 3CXRA 1BTOA 3I9MA 4PLVA 1DIRA 1SMKA 4PLHA 4RPJA 2C54A 4GLOA 3ADPA 2HMTA 4FFRA 3KYDA 4QQRA 5JMWA 2DKNA 3AUSA 3GEGA 3L4BC 1NHWA 4Y6SA 5C5IA 2J8ZA 3MTGA 4FPXA 3KB6A 2IE0A 2GD1O 2UUPA 3EAGA 3F1LA 3WJAA 4OH1A 3QLJA 4DXHA 3PYLA 4UEJA 1KC1A 1E6WA 3UAGA 1ZMTA 3GRKA 3I9OA 5JSFA 1IZ0A 3U4IA 4DIFA 1R4MB 2D8AA 2VUTA 4XIYA 2NQ8A 1JVSA 2JFFA 3QSGA 1WW8A 4YRBA 4IDDA 4YJDA 2D59A 4MO2A 5KCZA 2A9FA 2YDXA 4Z9XA 3AOEC 1EK5A 2POQX 1F8GA 1VPDA 4XIJA 1X14A 1PGQA 2WMDA 4YB8A 2PGDA 4B4VA 4B7XA 5AXDA 3KXDA 4GGOA 4NFSA 1JW9B 1RYEA 4P22A 2IZ0A 1ZNQO 5AVOA 1R4NA 3KEQA 1GUFA 4HFJA 1A4IA 1GQYA 3LF2A 1AE1A 2G76A 3ZW9A 4WCDA 3RUIA 2VT2A 3V1TC 4YCAA 2ZYAA 2W90A 2WD7A 2HMUA 5BNIA 2JCXA 4GX2A 3D3EA 1NASA 3TDKA 1M66A 4CM1A 3UUWA 3GOHA 1A27A 1IL0A 2ZIZA 2UDPA 4WE3A 4RLSA 4RPLA 4IZIA 3L6OO 1VL8A 3F47A 3H2ZA 1VJTA 3M6IA 2B36A 4Q3BA 4TVBA 1MFZA 4BNIA 4BGEA 4CMBA 3O38A 2V6FA 4OQZA 5EQDA 5CFZA 1KVTA 1H93A 4AJKA 1AHIA 1LA2A 3U09A 1PWXA 2EP5A 3NRCA 5JCJA 1YRLA 3QVXA 2EXXA 2C2XA 1CIVA 1SEPA 2PK3A 5DCUA 3EYWA 1GDHA 3DBLB 5IFLA 3VAZA 3I9KA 3S2EA 1YH3A 1HYGA 4ONEA 3QRWA 2I3AA 4HY3A 4FW8A 1GY8A 1XWFA 1BW9A 3DWFA 3O8QB 4MP3A 5JPIA 1DIHA 2GZ2A 3QVTA 1HDCA 1HDRA 4RV9A 4A7PA 3ABIA 3K30A 4IZHA 4A10A 3KLMX 3SEFA 3TFQA 3DTYA 1T24A 3ASUA 2Q46A 1P1IA 1QP8A 3I6IA 1GEGA 1XG5A 2O3UA 1YB1A 2ZYGA 5TT0A 2NU9A 3D7LA 3HJAA 2W2LA 1UZLA 4R51A 4TSKA 1DFGA 3JQAA 3OH8A 4OYRA 2Q99A 4HUJA 4UVHA 1LRKA 3ETDA 4DBVO 4FJ2A 4WPGA 2Y0DA 3GF4A 3WGYA 3M2TA 4AJHA 3INTA 1EBUA 2DBVO 5JDIA 2IZ1A 1I3NA 4NI5A 5JW6A 3PWSA 1HDXA 4TKMA 3IJPA 3EY4A 3BMQB 4GKVA 1C0PA 3FWZA 3P19A 1ZCJA 3IQDB 4LSMA 4GWGA 2ZTMA 1EUDA 1RM4A 3DHYA 4J1SA 3WWZA 5DBFA 5JFOA 3WTCA 4BNUA 4AFNA 1E5QA 4RZHA 3NUGA 1ARZA 2IYPA 1T1SA 5BSEA 2P91A 1M2WA 2HK7A 2AA3A 5DN9A 2ZB7A 1PL8A 2VYVA 3I9NA 4AJ1A 1QLJA 1QYDA 1VJ0A 4BO5A 3ZU5A 1KBZA 5KJCA 1SO8A 5G4KA 1WAMA 1P44A 4FFOA 4FFLA 4AL4A 3D1LA 4UUPA 1BMDA 3V1YA 3ZWMA 2GO1A 1N9GA 1R0SA 4B4OA 3ZH2A 3NX4A 3I4FA 5LCXA 3B1FA 1RM0A 3GN2A 3L6DA 1UXGA 3M1AA 2CSUA 2X0IA 1ONOA 1J49A 3BYZA 4A03A 4DREA 4YR9A 2OXIA 2FSSA 2X7HA 3RAJA 4BNTA 3WJ7A 1HL3A 3DZKA 3ICPA 4MVJE 3ST7A 3FRJA 4IXWA 4QFDA 2O7SA 1SOVA 1DHTA 3C7CB 3K73O 1NQAO 3K9QO 3U62A 4XYLA 1IB6A 1YKFA 3ZDFA 3QVOA 3U3XA 5I7FA 1IPFA 2O3QA 5ICSA 5U4QA 1M67A 1XU9A 2BFAA 1DBVO 1MLDA 2QQ5A 4BNKA 3NT5A 1V9LA 3DQPA 5KVSA 5TSDA 2VZ0A 2CVOA 2PH3A 5T57A 1D3AA 3D3WA 3HDQA 1IOLA 1PJ2A 2CDAA 2X6TA 3GT0A 4GX1A 1JTVA 3U9LA 4YAGA 4EBFA 4CM3A 4PGFA 3SC6A 3QWHA 4LGVA 1BDMA 1E3JA 4BKUA 4P4NA 4PG4A 3PJEA 2AXQA 2FZWA 3W1VA 3V8BA 1ENPA 3PLNA 3QJ5A 2XXJA 2AE2A 1KEVA 1NXQA 5IDYA 3JD0A 1GL3A 5HM8A 1N5DA 2NNLD 2R00A 1EK6A 4L0QA 1M75A 1U5AA 1ZMOA 1ISHA 2A92A 4R4JA 3ZNPA 4YT5A 2RHRA 2JCYA 4FIZA 5J23A 4E5NA 5BSHA 1HT0A 2O50A 4UVGA 4TMFA 1NP3A 1LSOA 3KTDA 1HF3A 1YL5A 2A35A 1BRMA 3WMXA 3C7AA 4J2OA 1I10A 1RM3A 3Q2KA 1S6YA 1OOEA 1ZSNA 1PL7A 3IS3A 4JP2A 1LI4A 4M86A 2BFPA 1HKUA 1LQTA 4MPDA 1Q7GA 2C5EA 3PJDA 2AQHA 3GPDG 4ZHSA 5U9CA 3GDOA 3KO8A 2F1KA 3KSDO 2PZMA 3QHAA 2NV6A 1D1SA 1EVZA 3VZQA 5IF3A 3UFXA 1D1TA 3E48A 4XYGA 3S2GA 1DDOA 2FN7A 3PQEA 1R12A 4YQZA 4JJFA 4UULA 5TT1A 1ZSYA 1MX3A 3PRJA 4R9RA 3G17A 3WBBA 3ZZNA 3H65A 2JAPA 4R54A 1YGYA 1H6CA 1NX6A 3JD4A 2BI7A 4IQ0A 4L76A 3S1LA 3DBRA 3F4LA 1GADO 3LLVA 4BQRA 1GYQA 3CSDA 1LJ8A 3D4OA 2P9CA 1U5CA 2GUGA 3KYCA 2DLDA 2G82A 3MJSA 1DC6A 4LCEA 3WGTA 3GA0A 3IIEA 1NYTA 1P0FA 3ENNA 3RFVA 4DMLA 1Z7BA 4GLLA 1I3MA 3JQ9A 3BTOA 1ADGA 1J4AA 3JD1A 2DBQA 5G0UA 3C7DB 1H2BA 1P9LA 5EPOA 3U4DA 3VZRA 5FFFA 4NH4A 4IQGA 4E33A 3BMCB 1LDGA 1YJQA 3MEQA 1YB4A 2C82A 5A5EA 2WD8A 4RDIA 4IJVA 1F06A 3DEYX 3JYNA 1E3EA 4ZQFA 2GDZA 2YV3A 3AU8A 2WWRA 1LC3A 3G1TA 3CE6A 1F14A 3HB4X 4GSKA 2QRKA 4XCVA 3RASA 2UVDA 4AJIA 5JCJD 1HSOA 2EJWA 1Q0QA 2OBYA 2HO5A 1GPJA 1TVEA 3M2PA 4IINA 3K96A 4Q3NA 2UAGA 4H16A 4EJ6A 1ORRA 4E31A 3EK2A 4EJMA 3UOGA 4D7AA 1YXMA 1AN9A 4DA9A 1WWKA 3BMNB 3DTTA 4RPKA 5COAA 4BMVA 4FFMA 3F5QA 1P77A 2J5KA 4E12A 5ITWA 3U49A 1G1AA 1UXHA 1DFHA 2CF6A 4I5DA 4L4SA 4RCVA 3WYCA 4UEOA 1T26A 4P4LA 4XB1A 3OJEA 3EMKA 5JDCA 5K6AA 1T2CA 4P38A 2PKRA 3ZWWA 4RVFA 4RGBA 2W2LD 2HAEA 9LDTA 1ZBQA 3P7MA 2D2IA 2D0IA 4IQ8A 4TRMA 1VC2A 1HXHA 4CR8A 3E82A 2EW2A 3ZWAA 2VTDA 2O3SA 3UVEA 1IHYA 2P4HX 4B3HA 4YAKA 2Q4EA 4RVUA 3R3SA 2HK9A 3E9NA 3GAFA 3K6JA 5COQA 3TL3A 4BO2A 3WSVA 4CMCA 8ADHA 4EEXA 4RQTA 3GNQA 4HFRA 4NZ9A 3KRTA 4TVOA 3EZYA 1B15A 4BNFA 4JBGA 1HE4A 3GAZA 1V35A 2G0TA 4MVJA 3ZNOA 2HCTA 5KTKA 4A26A 3G79A 3KEOA 2PGJA 4E5PA 2YHUA 4DQVA 3VKUA 1O89A 3C1TA 2O23A 3G0OA 2VYVD 2C07A 3FR7A 4FC6A 4Q39A 2ZK7A 1AHHA 1DLJA 4CM9A 4CQLB 5EESA 2W2KB 3DZIA 3WGOA 1XU7A 3GVXA 2DTXA 1CRWG 2WE8A 4B3JA 3DBLA 1EDZA 3CMMA 1X1TA 3EDMA 3HDHA 1NAIA 3PHLA 2E6UX 3WGHA 4WGGA 5A9SB 2QZZA
chains in the Genus database with same CATH superfamily
4QO8A 3KTAB 4RTPA 5K3EA 4IAOA 2EW1A 4HNSA 1E66A 4TTQA 4P4UA 4F1JA 5CB4B 5JXWA 2DLCX 4BVBA 4BHTA 5E6UA 3OETA 1IXSB 2R85A 1F8FA 4MXDA 5KNLA 3ESDA 3UJBA 2W0SA 3LNTA 1DRKA 1B00A 1IFXA 1USVA 5LZ8A 3SPXA 3L1HA 3CO5A 2CK3D 1PR9A 4UFOA 5E3HA 2DT8A 4YMWA 3FDIA 1UJ4A 3QPVA 3HVKA 2OENG 1Y1TA 2PLFA 3QYFA 1ZO8A 1OE0A 2EWMA 4AIRA 2GSWA 2V8BA 1PX2A 3LWDA 4IKPA 5GINE 1FU7A 1YVDA 4DLZA 3VYSB 4OJNA 2ZYRA 3R7DA 1E9EA 3EW7A 4HGQA 2ZS9A 2VPYA 4A0FA 4D8UA 3GK3A 1PJBA 3NW9A 4ABYA 3T54A 2UYOA 4ZHQB 2BD0A 3F5MA 3JTEA 1NOIA 2W2MA 1Q0UA 5D01A 4KNYA 3TX2A 2AVNA 5DLPA 2X6QA 2XE8A 1ZZGA 4KU4A 4FMCF 2LUOA 1VDMA 2H51A 3QV1A 4ARVA 1PG5A 1LBSA 3T7CA 5GTDA 4N47A 1X86B 3H2JA 7ADHA 4RY2A 1T15A 2Z0MA 2QD5A 3CRZA 1R0BA 3D4NA 2FFRA 1G4UR 3F9IA 4ZCLA 2BDEA 3PFNA 1YE5A 2QYOA 4LJ9A 3SR3A 3L8CA 5FQNA 1TAQA 3TAXA 1V7PC 2J5RA 1ADYA 1K8ZB 5BWBA 2FSVC 1JXMA 1M33A 3ZV5A 1R0ZA 4K1LA 3N87A 5KYTA 4QM7A 5J2UB 1ZW1A 3QPWA 4TTRA 2GBFA 1XZQA 2QM3A 3RVQA 1FFXA 1IZYA 4Z2YA 2YZGA 2XMQA 4BLUA 2ZSJA 1NI3A 4XDGA 5C8DA 1W73A 3KL2A 3TIVA 1Z88A 1EFUA 2J9ZB 4Y1EA 2OYCA 1I9CA 1SCDA 3D2AA 4GPTA 4HZGA 4R3NA 1D4AA 5ELXA 3NHUA 2FW6A 5FPPA 5JRZA 1TU3A 4NFLA 3UV3A 3FMIA 1G2IA 1B7GO 2ST1A 3RFXA 4HWPA 4EW3A 4H7HA 1K6EA 1XTPA 1MO3A 1S89A 1RI2A 3FI0A 1EG7A 4TSFA 1SZCA 1MX1A 3MOIA 4EHDA 2FSGA 1IOWA 2ZVDA 3OJWA 3AUJB 4Q4CA 4L4ZA 1R9MA 2J41A 5DT2A 4ZEXA 4ZMRA 3OZUA 3FTFA 1CZHA 2G1UA 4QGBA 4WNAA 3LJKA 3E9MA 4ENRA 2ZBDA 5ARBA 1V1RB 1HZJA 1K7EB 5EJFA 2JJ1A 5ICMA 1AIPA 2IBMA 2PUVA 3EVFA 3EEYA 5BN4A 3A9WA 3DB1A 1LEHA 2AKYA 5CXQA 1HX7A 1T3TA 2P2CA 3JZIA 1L1RA 3U4QA 4P0TA 3HLTA 2O8NA 1JA9A 2ZYSA 2WY2D 2FSHA 1GL6A 5IC6A 1ZGAA 3RF7A 1GSAA 3HXQA 2LNDA 2MIIA 4RNCA 2ONKA 4ZOAA 3VPDA 5DHUA 4C0WA 4QATA 2FZKA 4CDMA 3SDBA 1L5WA 1ZUNA 1QRAA 1NUUA 2JIDA 2IZ5A 3T9DA 3NFRA 5K3FB 2ZSIA 1OV6A 2QRQA 1UC4B 1P0MA 3N8GA 3D9QX 4BC0A 3DWGA 1VE6A 3ZN2A 3HM9A 3LDAA 4KO1S 3UWPA 3QV2A 3E5NA 1KY3A 2WQ7A 2V9ZA 2GH1A 3PFHA 1UMBA 3QLVA 1YWGO 2VTVA 4AW9A 1KMCA 3ICEA 4WN9A 2I8AA 1U6IA 2I8LA 1D8AA 1K7CA 2UZ1B 2QM7A 1MOZA 1CY4A 2ZDQA 3T52A 1U2TA 3SC4A 2MSLA 3B3JA 8LDHA 4WY8A 2H0QA 4Y2JA 4OUKX 5DHPA 4CEJB 2UYCA 2AFHA 1XZLA 4H3SA 2ADMA 3FTPA 4QOEA 3ADCA 2FFJA 2H5EA 2FHPA 4WZ6A 1IIRA 4M8NE 3Q11A 1ZOIA 5C31A 2NADA 3JSAA 1JHAA 3KEMA 4LV5B 4PZCA 1IM8A 3W8EA 1DOHA 2PQ6A 5FI0B 3DXYA 1DG3A 4IFTA 1J8QA 5EP2A 4C14A 2FPGB 2OO3A 4C9BA 1K0FA 1N1GA 1S4MA 1JQLB 1K89A 4L0CA 2BP7B 2P2LA 1BDJA 4TZ6A 5DXJA 1EQ2A 2AN1A 2ZBRA 4K86A 1N4AA 2C20A 3M1YA 4DRXA 1D6MA 4INOA 4IHQA 4YLGA 1JHZA 1JBQA 4M0PA 2O0MA 1Z5GA 4WVLA 3OM9A 3DO5A 3VC3A 3UOAB 1ZJWA 1Y9EA 2GEDA 4YRJA 5KQPA 5ERGB 3C70A 2VBGA 2XYVA 3NRJA 1F20A 4IXTA 4ND2A 4YQFA 5IJZA 1QYWA 3DE5X 5LOVF 3W8NA 1NZFA 1E3LA 4I9UA 2Q1WA 1GRRA 2Z98A 3CN9A 2WF9A 1MDBA 1XZNA 3AXTA 4D4MA 1JPNA 3FRIA 3BOSA 3ZHUA 1I4OA 2CVQA 2LP4Y 2YCLA 1QJ4A 2AZ4A 2ZUUA 1SHZA 3PUJA 4GH5A 5KQSA 2ILVA 4ZVMA 4HGOA 4GRDA 5T6BA 3CS3A 5M7EA 3HHPA 1SY7A 1X42A 2MR5A 3JARB 3ZVNA 4MRAA 3Q2IA 1PQ4A 1L4MA 3VHXB 4XJXA 4G37A 1V7QA 1RWVA 2HSEA 2XGSA 2Y68A 1SUDA 4AD8A 1AGPA 2GYUA 2IXTA 2Y1XA 2ZYVX 1P4SA 3V8EA 1RJWA 4F97A 1L3BA 5JFTA 1W0CA 5AOBA 5J5CA 3PX3A 4ADSG 2C57A 5LU8A 3KQPA 4TV9B 5I01A 2JLYA 1ESDA 3GEEA 1NG1A 3CU5A 3AB7A 3H05A 3NWJA 5JEDA 5CNMA 1FB5A 1CK4A 4P3XA 3TQSA 1K2WA 3MTJA 4IIEA 3FH0A 2BWJA 1U2QA 2WWYA 3PXXA 4S1TA 3TEFA 2OGUA 3JU3A 4CRWB 5KYWA 3UAXA 1L1QA 3ED1A 3HR7A 1QG0A 2CCKA 4U7HA 3LT2A 1JMKC 1QHFA 3H19A 1E3TA 2MSNA 2QP4A 5EC8A 2QNBA 1GG5A 1NWCA 2J48A 2YV1A 3CRRA 4IMPA 2I33A 3VI3B 2QGNA 1SQ0A 3AETA 4MVJD 3WLAA 5BVHA 5CA1B 3RGWS 3FPEA 5KBYA 5F5LA 2CV2A 3K8ZA 2XUKA 3THYB 4PFKA 4HRXA 5PNTA 3RQSA 4HRAA 2X7JA 2PS1A 5AVQA 3G6WA 5EKTA 2Y67A 4W5TA 3HYTA 1XYGA 3O5AA 5LBTA 4FSHA 4AYXA 1SM4A 5JNWA 1PQWA 3CEJA 4WNCA 1NUSA 1W76A 3PPXA 1YE8A 2C77A 2XA1A 4F5WA 2FMTA 3ADBA 2OHVA 4D42A 1RBQA 3COZA 1EK2A 4M1KA 3TX6A 3ZK9A 3CVVA 2YQ5A 1Z12A 1SAYA 4CIBA 1YDWA 2ZB3A 2P5SA 3JPWA 4R8KA 3A37A 4HVLA 4JXZA 3DKKA 3NYWA 1L8OA 1KE2A 1W30A 1XTIA 2R6DA 4D43A 1RYYA 1T4CB 4OGFA 3PGA1 1VJ1A 4NNPA 1CUXA 1NA5A 4IV0A 5AH0A 4Y6GB 3BMNA 4LXUA 2P3OA 1WMEA 2A8YA 5GONF 1LI7A 2C7OA 2R1VA 4P5DA 2FQ1A 1OB5A 3COJA 4JJ8A 3AC0A 2BHLA 1AGXA 2Z5LA 1EJ2A 4NV3A 2X9NA 1DI0A 1R9NA 2CFTA 1OT3A 3TD9A 1ZW6A 3V9AA 1T8TA 2G07A 1KK3A 2G6TA 2XADA 5AW6A 2XCSB 5DHTA 5IKMA 1X1DA 421PA 1VG8A 4ZZ0A 1W7AA 3IX7A 3WKEA 4BX3A 2DERA 5DI3B 3ISJA 5LQCA 4OMCA 1ZVMA 4OHMA 1A04A 1A82A 2LBPA 3WXMA 1RE1A 4DYVA 2H4YA 2WA2A 5HFJA 3T12A 1U4SA 2G09A 3O8DA 1W9HA 5EMNA 3DMNA 1LBEA 3ZQUA 4C5AA 4AP6A 4CKBB 5BYAA 1N77A 2BBWA 1ZL2A 2WILA 4M1QA 3OPXA 3ET5A 4R2HA 1LPBB 5JNSA 1DAIA 1XDBA 2HOQA 2BGLA 2DY1A 5I7WA 3JZMA 1BEEA 4GKJB 1XN1A 1ZH6A 3HCCA 4YJ3B 4XH9B 4N7MA 4RDCA 1OC4A 2W8BB 4ZOQI 2O8EB 3KAPA 1RW4A 2AMLA 3G2IA 4JBHA 3LDHA 4UM7A 1FFDA 2DUNA 1QBGA 2ZP1A 1GPBA 4DV0B 1SU8A 1WB4A 3WHLA 1XTBA 3IR6A 1K97A 1BVRA 3DW1X 4BB5A 2B82A 5A3RA 4FDTA 4NHEA 5AT1A 2XXAA 1DO0A 1NM5C 2ZS8A 3EWSA 4MV4A 1S8FA 1HTWA 4QJIA 2V7WA 2VJNA 3UWDA 4CF7A 3N8HA 3I9FA 1EIWA 4KPUA 2QW1A 1PTJA 4MINA 2YHBA 4UMDA 1RWXA 2QE6A 3PQ8A 1HEUA 4ID9A 3KSAC 2H4JA 4IJ5A 5A0TA 4ZAVA 4LG1A 1JSZA 5L9AA 2XOEA 1AU9A 1NZDA 1OLUA 2X9GA 2CVPA 3DEFA 3PTLA 4MW0A 4Q4JB 3NKFA 5C35A 5EIWA 2ODQA 3LUBA 2XHEA 4L9WA 4WCFB 2JG3A 2V5AA 1P17A 1YBMA 2FMUA 2PRZA 2R00C 4HNHA 3BMXA 4J0DA 4BNMA 3F96A 5ED4A 1CUEA 1BD4A 4FN4A 1ESEA 2F2TA 3KOXA 4Q3KA 2N9UA 4X0EA 1LDBA 4QRHA 4S1WA 2PJRA 3WL3A 1G64A 4J75A 1RHQA 4YJGA 4ZWNA 2KMLA 1XCGB 1E62A 2XXBA 3HP7A 4OTZA 2AOWA 3ILSA 5DNAA 2IHZA 4WXPA 5JNLA 2XVYA 5A0FA 4M49A 1R9JA 2QTHA 3WNZA 4ZEVA 1YZKA 1T8WA 5AM1A 1V1JA 3ROZA 1BMQA 1KKUA 4ALNA 1GZ3A 3TAHA 1EX9A 1S2MA 1T0UA 4QPJC 4TUYB 1JFFA 2VHJA 1JHXA 5F1OA 2P5UA 4LDZA 1NQVA 3KR0A 1TM2A 3SBDA 3SYLA 2IUSA 2WHEA 3DYIA 1N6OA 4OI1A 1OYVA 3BK7A 1GZUA 5DBIA 1VI2A 2DGDA 1FMTA 1EPUA 1U31A 2Y92A 2GA9A 3OCUA 5AESA 2O5EA 2YNMD 5A71A 2VC2B 3W5DA 1U8CB 3W5JA 3ZEAA 2QX6A 5HKKD 5IJ9B 3Q6MA 4N6NA 3M5PA 3ZY5A 1PGPA 3BZWA 4OJYA 1X38A 4BFWA 4BV3A 2C4UA 2HIAA 4M37A 3KWJA 2IKSA 4JC5A 5B53A 3THSA 4TROA 1GG2A 4QL3A 1W2GA 4EW1A 1NVEA 4GRAA 3VR0A 2R84A 3NG1A 3N7AA 4ETMA 2WZQA 3BERA 1WZIA 1E4OA 5I7UA 1PNQA 5DOZA 4WUVA 5JY1A 2JFWA 2NT3A 2WT9A 4K7JA 4BZPA 1CP2A 4NQZA 1QGDA 4RSHA 2OBNA 2EX1A 3FPCA 1UDWA 3NBUA 2JVKA 4P7GA 3V1UA 4E11A 1CEQA 2Y0EA 4TXHA 4KHPB 1SC9A 5EWLB 4TLLB 3QZUA 4J0GA 2RGGA 4HDSB 3V4ZA 4JVSB 3T3EA 4DR6B 4CIAA 2VTBA 1JJ7A 1GTMA 1HT3A 3D5QA 3TQHA 2M32A 3ONNA 4QVKA 1ZGZA 4EGQA 3AF1A 3LM8A 3FHOA 5DYGA 4EL0A 1KHTA 2J0SA 4DLRA 5JXJA 3GGOA 3EXHA 3KPWA 4OXNA 3AM5A 4Q4DA 4TKVA 2ZRIA 1AXEA 5DN6D 1PG2A 5KHOC 5CEJA 1J1UA 4H18A 4HH4A 3K16A 4AQYB 3OE7D 4RSRA 2CF5A 2HW8A 2DQSA 3WWPA 1M6NA 3OQIA 1H1LB 2ZI4A 3B6KA 5FNVF 1Q15A 4D9CA 1HKHA 1QGOA 5K7SA 2XCTB 1U63A 1HDGO 1NPTO 2HF2A 5IEJA 3IP3A 4X91A 2D4AA 4D57A 4R69A 1R6AA 5JNTA 5E2AA 2OCIA 2VDJA 3UEOA 4BV2A 1H9CA 3GCWA 2HPHA 4ISBA 1DT3A 3QJGA 2W42A 1H2YA 2B9EA 4CLEA 2ACKA 1C30B 4Q3DA 3EQZA 3SS9X 4H60A 1EE2A 1P6QA 3ZIUA 4ZICA 4KR7A 1H0KA 1YJAA 4P32A 1N2JA 1TM5E 2XBMA 1NBMD 4RHEA 1EMDA 1I2DA 1UM9A 2ZRNA 2GASA 2P4UA 1Y81A 2WVHA 3NXSA 3E9ZA 3PDHA 3WVNA 4HVAA 5ED0A 4MHSA 2B3DA 2GEVA 1GLNA 3ZH9B 1KH2A 5FOXA 1O95A 1ADBA 4GW3A 2YVAA 2PU7A 5CNIA 1J42A 2VDRB 1KEZA 3OT1B 2PX0A 4U6NA 2OESA 2KS6A 4YV0A 4PICA 4QARA 3GR6A 2OY0A 1JLRA 3BUSA 4QUHA 2D54A 1N6RA 2J1LA 4FFVA 1CP3A 1AVTA 1WMSA 2ATXA 1GUDA 3BKWA 1FQOA 2E4ZA 2F8TA 4TRNA 1J0EA 3FDJA 1F4PA 4NEQA 4MWEA 4PPYA 4BJ3A 1PZEA 3PEVA 3KD3A 4GI3A 2OD2A 1SCUB 2A86A 5DM70 4C7BA 1QCZA 3PUKA 1NBEA 3SF8A 5A5DA 4YP0A 1NQTA 4GI2A 2P9BA 1NW3A 2ZT8A 1E92A 2IH5A 2VYQA 1U4NA 2E4AA 2VRCD 4Y9TA 1WMBA 1L1EA 2ZROA 3G49A 1B43A 3MWYW 1JQJC 4MQMA 2X41A 3NTUA 3PNMA 4KKXB 2ONCA 3ZU4A 3EISA 2B8WA 3OUUA 2AYYA 4HDKB 3RIYA 2GAFA 2PDAA 3QKRA 3UGQA 2JHCA 3ELDA 1CF2O 3TLKA 4BJHB 3QMVA 2IYFA 4BFLA 1G2QA 1RVV1 2F43A 3JY6A 3B1KA 3UJ9A 5KINB 2CLSA 3NBQA 4Q1DA 1TFUA 3AEYA 2BFCA 3ZGXA 2J6HA 2Z9DA 5KWSA 4UFPA 2B7CA 4FBMA 1ZCZA 4ZODA 5HCNA 5JEEA 5BN5A 3ZWVA 3IV7A 4MTLA 1V5IA 2GLTA 3TQCA 2JLZA 1G4AE 1IULA 1W0JD 4R0NA 3NCHA 3RUDA 3S5JA 1E8NA 2PMDA 5C7IO 2F8MA 2FP3A 1I6WA 1D7OA 2GZRA 1OI3A 4H3KB 4HBGA 2J9RA 1Z5PA 3HN7A 3P27A 2Q3DA 5G2OA 4ZI7B 1FFGA 5HJEA 1U6KA 3DL0A 4TZKA 4ALJA 3TZKA 5ALUA 2FQXA 3KOZA 1OF1A 1DCMA 2UVQA 2V7XA 1B8UA 3PHCA 4XKJA 3UHJA 3ZGZA 2PXAA 1KY5A 4DUZB 3LY5A 4MRMB 3EWIA 5FBZA 3LCCA 2GZDA 4WZBB 5FA6A 3EPLA 2RAVA 2BTEA 1PG0A 2WSBA 3LUCA 3P71T 3UJAA 3RVPA 3HP1A 4N0EA 2RK3A 4L5JA 4RJ2A 5HJ2A 3ISTA 2Y0CA 2QTVA 3AHCA 4F0JA 5IZCA 3ILHA 3I64A 4GE3A 1VSVA 3QWBA 2WRZA 3WNVA 5JZMA 1YFZA 3S6JA 4DPKA 4DLUA 4OA8A 1U8FO 3OTWA 3WDLA 1MAVA 1KF0A 2GSDA 2R79A 3OC6A 4RVCA 3I8SA 2EDAA 4JLJA 5HUHA 1XRRA 5DCWA 5JO9A 1MV8A 1N0UA 1X7YB 2JCVA 3BEDA 1DKNA 3NHSA 3PK0A 3W2EA 3MWDA 4IEIA 4NZMA 2OCGA 3AF2A 3DPIA 4CT0A 1U2EA 1Q0RA 3KOWA 3X2EA 1IY9A 3MINA 3KOOA 1J21A 1U80A 4DCTA 1QU3A 4BO1A 3LC7O 4I99A 3CTPA 4BKPA 3Q98A 4DWOA 1CUAA 1XQ6A 2YWEA 2CYAA 4JIGA 1G8AA 3FOCA 1DIGA 5JAUA 2BMDA 3ZU2A 3JQ8B 5JLJA 4F84A 2NVUA 1ZN8A 3SS7X 2I66A 2ZT5A 1R8YA 4E46A 4Y6QA 1K98A 3MGCA 1QPZA 1RXIA 3DZHA 3KJQA 2NO5A 2ZJBA 5EL0A 3D7MA 2HDWA 3PGLA 2BMFA 4QT4A 1LJLA 1OFGA 1Z17A 1IB0A 3LT1A 4XGKA 3PDWA 1BH2A 3SZUA 1KMHA 1UXJA 2FHSA 2HIHA 1DO8A 1I2CA 3OQNA 4C4OA 1W85A 5TF0A 3WK7A 3ZJTA 2GARA 2Q9BA 4WZZA 1KSFX 5IAOA 4GQAA 2XE4A 2LD4A 1R8XA 1FDWA 3OLWA 5MF6A 4D3SA 3PUHA 1Z22A 3IHKA 3MJCA 3TTXA 2C1XA 1M72A 3F78A 3VJKA 5CG2A 4JKOA 3MCVA 1QNLA 2XQGA 4NONA 1N1MA 3P94A 4I1UA 4FCWA 4QTYA 1SELA 3HA3A 5TC4A 3HUTA 2JIRA 5AP9A 3P0RA 3V1KA 3ZBPA 3H3FA 1H23A 2R7KA 2WQ6A 5I7EA 3VKHA 1YS9A 5D6NA 3L07A 1M6EX 1VZ2A 2EFJA 4Z2AA 2IFTA 2F1OA 1FUUA 2G0NA 2LIPA 1QGED 2HYIC 2Q50A 3D6FA 4FI3F 1TMGE 4AMBA 1CQIA 2XLCA 4RZXA 5C34B 3T3OA 3L7CA 5FTKA 2X5OA 4UTRA 3GAMA 4PVDA 2RJNA 3KQSA 5JHHB 3EGOA 5EYPA 4B45A 4E07A 3HUFA 4Y1RA 4BQPA 3BK2A 2CNKA 4ZKDA 2P69A 3PDUA 4NKRA 1KQPA 1YA8A 1Z7EA 4HTFB 2VSXA 3VVBA 4MR9B 4E5SA 2PRSA 3ZW7A 4ROTA 4CU5A 4TMWA 1ZMXA 2Q4DA 2GA8A 2YY6A 2ZI3A 3NHKA 5FWYA 5J4KA 1XTKA 2I4LA 3GLGA 2FEXA 1DEOA 2B6HA 3PQ4A 4YTEA 4XWKA 3I12A 1T2FA 2QROA 3Q0IA 5CD1A 3AFIA 5CUQA 2YNMC 3QLEA 2G9RA 1X0VA 1WB9A 2OO7A 1U0EA 2PVPA 1MRZA 3CUTA 2IOHA 2WAYA 1BJKA 2J30A 3BPSA 4MH0R 4RY9A 1EUQA 2IPXA 1JUDA 3DAPA 2QW0X 4BPRA 1Z39A 5KNCD 5L7TA 5GQSA 4YDSA 4YV1A 5CM9C 5EHXA 4D02A 1GDTA 4B84A 1UAYA 1OAOA 1CUHA 1USWA 4JYBA 4EITA 2E1PA 4RV4A 1RI4A 1Z73A 1HETA 3FETA 3PUXA 1CF9A 3TRFA 3AF6A 2YYSA 3EOZA 3N2KA 1Q0SA 1P0QA 2CLHB 4LVOA 3IIMA 2OP1A 3CW8X 5LZ5A 4DS3A 3TBFA 5IF9A 4OUDB 2ZTUA 2HR1A 1Z83A 4J8PA 5FBQB 1ZD2P 5C52B 1WCYA 5C4GB 3FSGD 4B3MB 2O3TA 4FHDA 3LA8A 3ZJ5A 4C01A 2O2CA 1ZLXA 5FH9A 4Y2QA 4C4SA 3CJQA 5J4LA 4C87A 3VMFA 4DCPA 2I55A 5D2CA 4IWNA 3RC1A 1L4UA 3AHJA 5F51A 4B6PA 2QMOA 3L2OB 4MJ3A 3I30X 3KPYA 4YCSA 3RSGA 3X1KA 4D8XA 3TSZA 3K5WA 4B6GA 1O0SA 2JGJA 1XZ8A 3H2BA 4ZP1A 1XTZA 5TPZA 2Z6UA 1FP7A 3TTTA 1Z28A 4FYWA 4M87A 4MUYA 1VGRA 2YWXA 2E0IA 5JR3A 1UDXA 3AFMA 1K5DA 3G2MA 3P2YA 1PW7A 3PFBA 5C3UA 3UK0A 3FHCB 4DGQA 3W6ZA 4PZUA 4MVWA 4OQQA 3W79A 1ZYUA 2P62A 3DD5A 4KXFB 3TL6A 2A3RA 4KR0A 2OBLA 4Y6OA 2OB2A 1ISPA 1S5PA 4IJWA 3ESAA 5IKEA 4LJ5A 3FMVA 1KU6A 3GCGA 4Q7EA 3UT5A 3AW9A 2L17A 2XODA 1GN9A 2ZM6B 4WW0A 3L92A 3KQLA 1UPCA 3EA5A 3ZUPA 2XJ9A 2TMGA 2Q6TA 2Z2JA 2C83A 3J7TA 2DBYA 3OVMA 3K71B 2WAMA 5DSXA 2WVGA 4RKFA 4JBWA 2B30A 2ZTLA 4I1RA 4OJTA 5H82A 3VVMA 3CUYA 3F9CA 4HCJA 3CCCA 4GPEA 1J7JA 3GDGA 2GN4A 2OOSA 3OZIA 1C7RA 3IAFA 3IUBA 4OQYA 5DNWA 3NDPA 2H17A 1TO1E 4IICA 1EHIA 4PIPA 4KWIA 1J09A 3U17A 2YIDA 2HQRA 2QBYB 4H7KA 4MWTA 5T41A 3BFXA 1T9ZA 2PKQO 5HUQA 2FFAA 1B26A 2GZSA 2Q7DA 4PHHA 1J0XO 4FFPA 3GEIA 4LBYA 5L3QA 4FYYA 5K0FA 5AVTA 4V1CB 4N5IX 4UHFA 3OQBA 1RKUA 1CUZA 4MPPA 2VEDA 2GBCA 3RVLA 1V0JA 2A0XA 3INRA 4C20A 2IXAA 2OXRA 1PFWA 3ROXA 4DMHA 4F9GA 4XIIA 4R1LA 4CN8A 1QGUB 2ZG6A 3I4CA 1S0UA 1GTSA 3GROA 1IQ0A 4U2EA 4D5EA 3QTTA 5DMXA 2A1UA 1LXCA 3CLUD 5KSZA 1NN1A 4QRDA 2YHIB 4S1NA 3SR4A 2C31A 4O2BA 4BVAA 5I4CA 5KTRA 1N5RA 2PWPA 5IXYA 1U9IA 4YCJA 1VL2A 4L5AA 4WOKA 3SHQA 4BAZA 4UNRA 5C7OO 3DAGA 4JBLA 3AKZA 2H9AA 3IOCA 3BTUA 4AYWA 5BR1A 2VIIA 3BRQA 4U63A 3BWYA 2RHDA 1W46A 1O4WA 3GFOA 3QE0A 3H0EA 4KDRA 5CK5A 1S3GA 3NNSA 2HJSA 4ZCPA 4ZTZB 2JDIA 3REFA 3NGXA 4RIHA 2B7LA 3ZGOA 5JCOA 4LA4A 1H4QA 2VDWA 1QDEA 4EKYA 5HIKA 2H9IA 3TZCA 5LQRA 5DYIA 3JAKA 4G8BA 3E9QA 5K0TA 3LOUA 5HDQA 3IP9A 4CKWA 2IHYA 1RQNA 1C8VB 5M29A 3EOBI 4IHJA 4EB0A 1H4SA 2XAAA 3WK4A 3IEKA 4HG2A 2GAAA 3K0FA 4DUPA 1O1YA 1H4TA 5HXAA 5L8VA 3OAAD 1DU4A 4LOJA 2DXIA 1KK1A 3L1UA 1W5BA 1QVVA 2RGDA 5BN3B 2X4GA 2JIPA 3R4CA 2XF2A 3JD2A 1OC2A 5A1JA 1THGA 3BH7A 3T5MA 2HXSA 1RJ9A 4LMAA 5HTKA 2RCYA 4WL0A 3B1XA 1T0JB 2NW6A 2JI8A 1KFCB 1ZY2A 1P9RA 4N54A 2ZOSA 4MW2A 3HB9A 1DPFA 3GIWA 1BSVA 1NJSA 2RCNA 4QGGA 4X7PA 5EMKA 1FYWA 4NXNB 3AKYA 3PSHA 2CD9A 3CZCA 4U6SA 3H4IA 1WB6A 1SU4A 2XB9A 3K9BA 3THRA 4Q1BA 4OX9B 1QB8A 2QYSA 5EP1A 1C9YA 1I6KA 4N5MA 3DMRA 4EGAA 4WEOA 1DEXA 1HLPA 4FONA 4GXRA 4IF4A 3EXIB 2P9EA 4GOKA 4NZZA 1E63A 5D1HA 3PDJA 1C1DB 2BEUA 5EA2A 3D8RA 5EN4A 3VYUB 4RC9A 5ALMA 4NDNE 1RHJA 5CD9A 3KAQA 1T6BY 2Q4RA 3P5SA 1T6NA 4JVNA 4LDQA 5AW8A 4FD3A 5JH7F 4Q9NA 2JFPA 2OG2A 2PWYA 3DOCA 3O9VA 4LDRA 4CIXA 1N2EA 2O2IA 4CTNA 1C7JA 4C7JA 3SLGA 3NVDA 3SLRA 3AR8A 3KB2A 1EKXA 4NZOA 2ATCA 2EKPA 4RLHA 1CLUA 4Y0NA 4YJFA 1QOZA 3ZCSA 4DR7B 4M9RA 1YRHA 5EHNA 4L0MA 2IYLD 1MIOA 1BMFA 2GMWA 2HCBA 2C58A 1V1MA 4QU8A 3KHSA 4HX9A 1SG6A 5K01A 1H6AA 5EWJB 4HH0A 3ZW8A 5AM0A 4OGKA 2DUMA 5CX4A 5AJHA 5IDWA 4RWZA 4U3JA 2ESRA 2D3WA 5AXBA 3PZRA 2ILTA 2VXBA 1OA0A 3QEAZ 2W4QA 2X8JA 4HATA 4QFBA 3FN4A 4REOA 2QUBA 2B20A 4EATA 1QQBA 1KJ8A 4UZEA 1W88B 3QKSB 4KIJA 3T3PB 1E89A 1P9NA 5H68A 4V1CI 4FCCA 1NRXA 1U0GA 1XMJA 2GJKA 4N6GA 4NE9A 4WHMA 5U4XA 1PIWA 1O9GA 4WFKA 2PH7A 1TL7C 5FA8A 5FD8A 3EGWA 3H9BA 4R81A 4RF4A 2Y9PB 4E51A 1VKZA 4ZD6A 4I5EA 1NKTA 2I3ZA 4KZKA 4KUEA 4CUJA 2X86A 4HZUB 3KT6A 4MQ6A 1OWPA 1TGVA 4H1HA 2JLUA 4D46A 2REQB 3A4MA 1ACJA 1WZ2A 3RVKA 2B94A 2W4IA 1HDOA 4BKQA 1RQRA 4P2GA 821PA 4RJKA 4LHXA 2OVFA 4X3OA 1W4RA 1A9QA 3RFTA 3WJ1A 1YU9A 3B5JA 3PEFA 4ZPJA 3W9BA 1ISMA 4L4RA 4RH3A 1EBFA 2V7UA 1E9BA 2G04A 3H1GA 3R3HA 1WB5A 2TMDA 4LRSB 4KQ1A 1RVDA 1BGWA 1XA0A 4IVRA 1BGXT 2QT1A 1IN7A 1FUKA 4G89A 2H0RA 3I8OA 1QFSA 1XE3A 3P4XA 2XEXA 3LC0A 3E05A 3PQFA 5DASA 1O0CA 4B0PA 2BCGY 4FNOA 2PVCA 2JGIA 3RS4A 2UXCB 1IY8A 5GJCA 3R9WA 5FKJA 1RYDA 5MFZA 3AF5A 1CLEA 1RKQA 2D5AA 4PG6A 1ADCA 2AQKA 3FKJA 4NBTA 4F72A 3WZMA 2A9VA 2PX5A 4DA8A 5M2QA 3D7SA 4CV2A 4YMGA 2FEKA 1MX9A 2PRKA 2HZBA 2XECA 1HYEA 5TS3A 1PBTA 4IWYA 4JZYA 3W7BA 2IVZA 1ZK1A 4MO9A 3VR6D 1HO3A 4QJ3A 3DJFA 2EHJA 2C94A 2HU2A 4I8DA 2O0KA 3WNQA 1T6YA 3CGWA 3O95A 2H9YA 3MGGA 1JKIA 2FE1A 1IZ7A 3C2QA 3T06B 4QWWA 4QM6A 1A5BB 2QQGA 5UKDA 1K7XB 3QHPA 5C2JB 1JI0A 1KARA 2IYRA 2B8TA 3K4PA 1L1FA 4EUFA 1OW3B 4R1TA 5I9MA 2AZXA 4FQ8A 1E1CA 2EG9A 2YV4A 1MEJA 1T2NA 3N0TA 3A0RB 4V0NA 5A2GA 5D8DA 2G5TA 4PLPA 2B2CA 4PTLA 1US8B 1WTCA 3T9BA 3W2IA 4FQ7A 3FX2A 1F8UA 2GILA 3KWMA 4BN0A 1A9YA 4C30A 5BQ3A 2XT0A 3CLKA 4QPNA 3V7WA 2VBIA 4KPYA 1EM6A 1LQ2A 3PGJA 4MB0A 3RVJA 4J0FA 2CJFA 4QUEA 4JITA 1NR7A 1HMYA 6LDHA 2G1PA 3WTBA 1ZXLA 4FB5A 1X8LA 2R7MA 1YR1A 1HY3A 2DTDA 1IYZA 4H15A 3VYWA 1YJ5A 1FLNA 4CQLA 2P2NA 5FF9A 4BUJA 5LQMA 2PIAA 3AEUA 3BC1A 5EZ5A 2BFOA 2W2KA 4KEAA 3RH0A 3SVZA 3SXUA 2ZRKA 3L4BA 3QWFA 4C5CA 4EPXA 4P58A 4NP6A 5CT6A 4L5IA 4M54A 4E2YA 3IQEA 4XJTA 3IPXA 3I1IA 4Q48A 2GHQA 2WZDA 4PFJA 5ALYA 3SC2B 3IE1A 3G82C 3FNQA 1A7AA 1L5ZA 1JHYA 3L1KA 4JXXA 1KR2A 4RADA 4J7XA 4UCXA 3CH6A 2QG4A 2ZUVA 1X1CA 1E6MA 4MRNA 2C4MA 4ZVQA 1YA6A 1Y63A 3PVSA 2OFWA 4WD3A 4L4XA 4Q9IA 2XCOA 1RACA 3O9MA 2OC4A 4HK4A 3QA9A 4YA6A 4ZQEA 1YZTA 1F0PA 5LMUB 4F3TA 1GYRA 3PE4A 2WFMA 3AFOA 5DHSA 1YA4A 3W90A 1G3UA 2NMVA 2J4DA 4PCVA 1KYXA 2SHKA 4MW4A 4M6WA 4HQNA 2QE7D 1FTYA 1HDEA 4WRRA 3SY8A 2DUWA 2PKEA 5DTJA 3D6MA 1IE3A 3LMKA 1MABB 1X1SA 5HX7A 4DCOA 5GMOA 4BXOB 4DQ0A 1TB4A 2YL2A 3FUWA 3ZU3A 4JEIA 1ORWA 2VHVA 4GYJA 1KPIA 4XFJA 1OPXA 2WTXA 3WLSA 3UB3A 4AS3A 1ETHA 4HTAA 3I2FA 4OKNA 4F6LA 4UTNA 4KFTA 3LSTA 4LMBA 1CNEA 4Y2XA 5HCIA 3AU9A 1CZRA 1GU0A 1KH1A 1ND5A 3NWBA 1J8YF 1W87A 2J0UB 2X0FA 1FVOA 2GF2A 2QUKA 4GX5A 3TSAA 3IT0A 4D9BA 3J7AC 1W1WA 2OYRA 3EX7C 1WHSB 2CSXA 1FZTA 4HLUA 4L9RA 2J7KA 2XLBA 3DHEA 5EZYB 1SXPA 2WOJA 1Z34A 1Z6PA 4NPHA 3ZKWA 2JA1A 2X9QA 4N03A 4EX7A 3ORFA 3VISA 2H54A 2JAOA 3ZY6A 5IN4A 3FLAA 4X1KA 4O2AF 5F3RA 2HYDA 1AO3A 4HMPA 2BKUA 2SCUA 3BH0A 2OO5C 3M0EA 2XB6A 4MUJA 4IYJA 3KETA 3U7GA 1TT5B 3CLUC 5FTJA 1Y3CE 4D9KA 3G5UA 5C9ZA 5J2UA 3NV9A 1ISIA 4U7GA 3ZZMA 1G3QA 3KJXA 4M38A 3IC5A 1P81A 2VWQA 3IP8A 4EJFA 1VRWA 2Q6LA 3B3AA 3AFHA 4XQCA 2JLAA 3DEKA 1ST2A 2Z5VA 4L7VA 3K9HA 4NYMQ 1SZDA 3TRDA 5E3IA 4A3SA 1D4FA 3K0AB 3PG5A 2YJZA 4N18A 3LW7A 3W78A 1QF6A 2XITA 1G8YA 3PL5A 4C4TA 1L4YA 4NTZA 2OFPA 2EARA 4UNSA 1I6LA 2D3TA 3PCTA 3TSWA 2AMYA 3QITA 1IEWA 1KI1A 1XC7A 2QTMA 3TSCA 1A7JA 2HQBA 3EC1A 4LN1A 3G9TA 5AK6A 1KA9H 4UUNA 3V5NA 3UMRA 2P4EA 4GMXA 2VHWA 4K9OA 1CVLA 2W93A 5KYGA 4AJ4A 2C0CA 4MKFA 5CVCA 3KCNA 4AJPA 1IXYA 1L5OA 1C50A 4DQUA 4JOQA 2E1RA 2Y76A 4XIGS 3PR2B 3TTYA 2CNNA 4AG6A 3H3JA 2EAUA 1RQ7A 2XVZA 4QXOA 1QKJA 1XCBA 1M34E 2HIGA 4K2AA 5EVJA 4JI6B 2MJLA 4DIBA 2WZCA 4FKMA 4OAQA 1IWBB 1H85A 2BR3A 4BLQA 2ZZNA 2HF9A 1UP6A 3W77A 2DB3A 4UDNA 4RF5A 4UEWA 4DR4B 4OHZA 4EA8A 2XGGA 4C88A 4QUJA 3N53A 4IDEA 2AR7A 4FGKA 4N39A 5HQ3B 2FDXA 4L75A 3GMTA 4K6OA 5K3FA 3N05A 4OK6A 2C4WA 4POOA 1AQIA 2VEOA 3FYCA 3L5KA 1RLOA 4R1SA 1TJ3A 2X22A 4NQRA 1TD9A 4FOTA 1SHUX 2ZAGA 3F5FA 4JEHA 4PXAA 4RH1A 5F9FA 2Q8NA 3WHKA 1XL0A 1Y4SA 1NVFA 2VKQA 1NHGA 2PCJA 4KK3A 3FWNA 4HR7A 4EGSA 1Y4UA 1IUNA 2UZ1A 4MS4B 2O14A 2OSBA 3M3DA 1L4EA 3AEQA 2C2MA 3PRKE 3QPUA 3L7MA 1NF2A 4DIUA 3PQDA 1Z0AA 6REQA 1ZVVA 2W8ZA 3PRHA 4MUMA 4ASUA 2DQKA 1D2AA 1KQ3A 2NO4A 2WMYA 4ZEOA 4TWRA 1PP4A 5DTRA 2BEWB 1TOAA 4YH1A 4X7MA 3WB9A 3ZVKA 1YIAA 2AI1A 2QSYA 1I7LA 2B2NA 2CZCA 2H2GA 3E3OA 4WKGA 3B78A 5I8WA 3GLHB 2JCSA 1KZGB 2NZ2A 4A9AA 3WMWA 3EPKA 4P3OA 2E55A 3AUAA 1UDRA 3GJ4A 3DMTC 3C8HA 3K15A 1QE3A 3HU1A 4ZVNA 3SHWA 2OORA 2BP7A 3NIDB 4JU8A 5I4IA 3S2FA 4YBZA 2BKEA 2J59A 5KOHA 1R15A 3WGNA 2JFGA 2C98A 3EZNA 4GI1A 3JCZA 1XWIA 4TL6A 3X3HA 1DPGA 2OLEA 1R8SA 1F6DA 4QUKA 2CUNA 3A26A 2W0MA 4YLYA 3K70D 4YRGA 1OHHA 4HB3A 4LHWA 4UNPA 3RS3A 4QFCA 1H2FA 3EGDB 4QQNA 4LXYA 3WGKA 4C04A 1FFYA 2DETA 5HJ5A 1YD7A 2Q3FA 3ZS8A 5K0GA 5F7ZA 4GF5A 4EL5A 4R3UC 5AVVA 1OMOA 2C8JA 2WTAA 4C2AA 4P4GA 1D0SA 5AJZA 2RBEA 3F6CA 4CMEC 5BV0A 1ZVKA 2QI9C 3CEHA 1YZQA 1YZFA 3O1HB 4FMPA 4JP8A 4NBUA 2JFNA 4QSHA 4EG4A 1IUPA 4ZAZA 4D3DA 3MC1A 4TLAA 2ENWA 4HLCA 1L3IA 2CLOB 3SSMA 4CLRB 3THXB 1B76A 1K92A 2I5PO 3VHXA 2YINC 3LO8A 1LTHR 4ZYWA 1N25A 1YMUA 3JQBA 3B5EA 4YUVA 3LQQA 2XKBA 3G88A 4L51A 4CG3A 2VYNA 1LC0A 4DQXA 1RAEA 1R6VA 1YRWA 3OPYB 4PLCA 4KAXA 2BEVB 2I6SA 4TV9A 4BNVA 3T1YB 3KKPA 1NMXA 3V4FA 2QYTA 4DF3A 4I4TF 1UDAA 1ZKMA 2ZAIA 3IQHX 5ALPA 5A0VA 3UAZA 1UBNA 3VR5A 3V34A 3LYHA 2ZAYA 3R5JA 4YP5A 1JR3A 4YIKA 3JYOA 3G0BA 3DC2A 3SZRA 3WADA 2I54A 1L7BA 2QZPA 1A97A 5CYFA 2A5LA 2DSTA 3VDQA 2AUNA 2YN4A 3RVBA 3F6SA 4C1BA 4Z4QA 1TQ4A 1L5HB 2C2GA 4FQ5A 3U4AA 1XZCA 4J0JA 1SBIA 2QR2A 3I0MA 4WCFC 4EYEA 5F1YA 1VKRA 4MW9A 4X54A 1KS2A 5EQTA 4BE4A 3AOGA 2OCYC 2YUIA 1DBQA 3KU4A 4W4TA 3RVDA 4YUYA 2QDXA 1E32A 1KSHA 3OSUA 3NO4A 2R11A 2VHXA