4FJ0A

Crystal structure of the ternary complex between a fungal 17beta-hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
260
structure length
260
Chain Sequence
YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords 17beta-hydroxysteroid dehydrogenase
publication title Structural basis for inhibition of 17 beta-hydroxysteroid dehydrogenases by phytoestrogens: The case of fungal 17 beta-HSDcl.
pubmed doi rcsb
source organism Cochliobolus lunatus
total genus 106
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fj0A00
5JYDA 5A5FA 4U0KA 1MUUA 2WSBA 2X5JO 3MWEB 4PLVA 3VAZA 2J3KA 3ST7A 3AUTA 4DC1A 2ZTVA 3RUCA 4IBOA 4BNVA 2B37A 2ZKLA 2YHIB 1U28A 2PKQO 4UEJA 2JFFA 2ZIZA 2Q4EA 3QE3A 4DIBA 3QWHA 5L7YA 4R01A 1DEHA 1KETA 1JWAB 1JDJA 4U6QA 4NR0A 3H5NA 2VNAA 4JN6B 3LQFA 3TL3A 3H7AA 4CQMA 2NSDA 3QW2A 3V1YA 3ZWXA 3ICPA 5EQFA 1BWSA 3CPSA 1I01A 1N9GA 4ZGWA 3BHJA 5COBA 3U09A 5BSGA 1U4SA 3V5NA 4AJ2A 5CEJA 3E8XA 3BTUA 4R9RA 3IL2A 1O94A 3HJAA 4FFLA 1EVYA 4XB1A 1WDKA 4O6VA 1MG5A 3NGXA 2RBEA 4Q3CA 1HF3A 4HBGA 4LVUA 1IE3A 3ADPA 2IE0A 4MP3A 4A26A 5I9NA 4Q3EA 1E77A 2Q1SA 3ZN2A 4Z0PA 3LT1A 1PL8A 1B0AA 4YJGB 1E7RA 1YBAA 1NTOA 3FHLA 3INTA 2SCUA 3JCZA 3TRIA 2ZK7A 3BXXA 2WYVA 4I9NA 3S1LA 4HNHA 4R1UA 4OH1A 3SX2A 3VZSA 2WTBA 3ZWAA 3KYDA 4RGBA 1LA2A 2A92A 5ILGA 3HDJA 1SZJG 4ALLA 5C3MA 5A03A 3D3WB 2Z1NA 4A73A 2DVMA 2P9GA 4D42A 1K6IA 2AE1A 4FIZA 3LLSA 4WUVA 5F5LA 4LMRA 5JS6A 4N7RA 3RC7A 4J0FA 3AU8A 2Q49A 2Q4BA 2X22A 3AM4A 1BW9A 5A9RA 3GG9A 3NTQA 1WDMA 3E5RA 1P44A 2PKRA 2Y66A 4BNGA 4JQCA 2AE2A 3AUSA 2JL1A 1QRRA 1HE3A 3E1KA 4QO8A 1KIFA 5A05A 3QQPA 4IJVA 1TEHA 2TMGA 4K26A 4HV4A 3KOUA 1UDCA 3CKYA 2EW8A 1V8BA 3H9EO 2WWRA 3I1JA 2YDXA 4BNTA 2BFPA 3ZV6A 5KIAA 1KEUA 4Y6SA 5A4DA 3NAQA 4PZDA 4Z0TA 1B26A 3H2ZA 3N58A 3DFUA 3T4XA 3NKLA 3F1LA 3PJDA 3RU9A 1ISHA 4N5MA 1H94A 1P1IA 4FSHA 5ICMA 2FMUA 2FWMX 1TLTA 4GI2A 3S8MA 3HB4X 3W8EA 4QT0A 4N5NA 1HL3A 1OZAA 4LSWA 2AQHA 3L9WA 4Z3KA 3H5RA 3Q0EA 3BMOB 3KVOA 4NZ9A 4CV2A 5H82A 5TJHA 4B4WA 1NBOA 2CDAA 1DFHA 1JVSA 4YBZA 5FF9A 2ZTUA 4P22A 4MIOA 3RC2A 1ISJA 2O4UX 1DIRA 1V9LA 1HYHA 5IDWA 1ENOA 1I2CA 4PLHA 4MP8A 3RBXA 2O23A 3CE6A 3AFNA 3IP3A 1FDWA 3DZKA 3G0OA 3G17A 3E6AA 1GZ4A 1KS9A 3QVXA 4WGGA 1R15A 3GFGA 1MV8A 1P1RA 1Q7GA 4IDEA 5CEFA 1CDOA 2IZ0A 1QG6A 4WEQA 4XYEA 1GQQA 2YV3A 1FDVA 1NFRA 3GDOA 3K96A 1ISMA 4J4BA 4YTEA 4JJIA 4YXFA 5JY1A 3GRPA 3OIDA 5CPFA 5CDSA 3I9MA 5I7SA 3KYCB 4R1SA 4CM6A 3H9QA 2GASA 2Y1OA 3KEQA 2X86A 2WJPA 3OF2A 4BS9A 3QV1A 1YGYA 5IXSA 3ZWMA 4RZIA 4E0BA 4MO2A 5JCXA 1ID1A 3WNQA 1ADGA 1N7GA 1X0VA 3GLQA 2PR2A 1HE5A 3AI2A 3K2EA 1KOLA 3WG9A 5HM8A 1ML3A 1PJQA 2UUOA 3CZMA 4CM4A 2LDXA 3JD4A 4RL6A 1V0JA 3PZBA 1X7HA 3NDJA 1R66A 3BHMA 1BVRA 3GEDA 4TSKA 4E32A 1GADO 1YOVA 5IDYA 2D8AA 4BKOA 3I9JA 4YAEA 3BTSA 3DBLB 3QJ5A 2D4AA 2X1HA 2X9NA 1GZ3A 4CLOB 5KCZA 4U5QA 2RH4A 3QVTA 1KEVA 1LDGA 2EGGA 3GY0A 4ONEA 1QYVA 3IKTA 3KYBA 3V2HA 3GNSA 1YL7A 5L40A 2UUPA 1SOVA 4RF4A 2GGSA 1T2FA 4XYGA 1ZEJA 2D5CA 2PFGA 5IFLA 1VKOA 2IRWA 3L77A 4NBUA 3OHSX 4DMLA 4IGFA 1BXKA 2P68A 3LT0A 4XKJA 3DBHB 2X0IA 4H16A 3H6KA 1I10A 1MX3A 4P8RA 3ZW9A 4CODB 1NWCA 1E1NA 4XIYA 4DREA 9LDBA 4WOKA 4WLVA 1FF9A 4OO3A 3QWFA 2P5YA 4IJKA 4IZHA 2CDCA 4QO7A 3BMNB 4FD3A 2VZ0A 1EEHA 2HK9A 2VHWA 1E3WA 1VL8A 3DAGA 1A27A 5CDTA 5BSHA 8ADHA 3GUYA 1Y1PA 3WIDA 2BGLA 2QZZA 5JW6A 2VRCD 5L95A 1QORA 5KWEA 4BO2A 4DBZA 2PD3A 3I9NA 3GEGA 4E12A 1OC4A 3ABIA 3FWZA 1WNTA 4DRYA 2BELA 3ULKA 4JIGA 3JQ8B 2VHZA 3H4VA 4E5PA 4NK4A 5L9AA 3S2FA 3PZRA 3JQCA 4IQGA 1VL0A 4AJHA 3HG7A 4MVJA 4C4OA 1ZBQA 2C7GA 5ER6A 3WXBA 4EI2A 1U5CA 1NHWA 3K6JA 1O5IA 2PH5A 2I65A 5L53A 3AM5A 3ZHBA 1F17A 1ZK3A 4W6ZA 4BO9A 5G4LA 3ZU4A 4XJSA 3QIVA 3WB9A 4YQZA 3DBRB 1LJ8A 4GMGA 5JDCC 5A9SA 5L7TA 4IINA 2JAHA 1ZCJA 5TJ9A 3WQQA 1MGOA 1PX0A 4FN4A 4JCOA 4WLEA 5I8WA 4DC0A 1M6WA 3RUFA 4D46A 3WLFA 1UZLA 3DZJA 4MVJD 1HLDA 4L4SA 1D3AA 4GLOA 3GT0A 4ALJA 5TNXA 4DPLA 3QY9A 3HHPA 4OOEA 1HE2A 4E31A 4RQTA 5BSFA 2EJVA 4HFMA 3UF0A 2YHUA 3R0IA 2YHIA 1L7EA 2W98A 3D3EA 1W73A 5AVOA 1XWFA 1CETA 4N5LA 4CQMB 1Q7CA 4DQXA 3RJ9A 3LC2O 3ETDA 2EGHA 4DLLA 1NAHA 1N9GB 3OJ0A 1DC3A 4ZN6A 3PGXA 4B79A 2HQ1A 1GEEA 1YJ8A 1XU7A 4E5MA 2VHVA 3A06A 4PFJA 4XZ3A 3BTVA 3ONDA 4YT8A 4MIYA 1LQUA 2BHLA 3O38A 4J49A 5KJ6A 1FK8A 3SEFA 5DF1A 3E9MA 2HCTA 4PN3A 1PWZA 5A9TA 2RHCA 2NM0A 4XEHA 3GH3A 4OHUA 3PYMA 2CUKA 4UREA 4IXTA 3JQ9C 2DBRA 1P77A 3LC7O 2Z1MA 1LQTA 1HYGA 2HMUA 4GVLA 3PFWO 4NJOA 4MVJF 3DOOA 3QLJA 5EMHA 4FGSA 4XR4A 2O3UA 1ZJZA 1M6HA 3KYDB 4ZQGA 1C14A 5DT9A 2JCVA 4PLTA 4E13A 4I5EA 5JNLA 3H8VA 3RI3A 5F3RA 5JCJA 3WWZA 5DBIA 1QP8A 1VLLA 1R0SA 3P5SA 3GGGA 3JD2A 1ZXBA 2OFPA 1LRKA 2DUWA 1U9JA 3GR6A 4IXWA 4TWRA 4YRBA 4R1TA 3LVFO 2EEZA 3P2OA 2DT5A 3JYQA 2HMVA 1M67A 1E7WA 1PJ2A 2V6BA 3WFJA 4AJPA 2AW5A 1ADFA 1T2EA 4ZU3A 1TB4A 2VWHA 4UUPA 1HSOA 1DLIA 1G0NA 2QIOA 4IDDA 1N5DA 1G6KA 2V6GA 1K5HA 3RAJA 4NU5A 1QYWA 1PSDA 4UVDA 1GYRA 3ZWOA 3ZU5A 5JCJD 1JU9A 3K9QO 2W2KB 3SC6A 3H3FA 3K92A 4JLWA 4Q3AA 4YDRA 3RIHA 1PS0A 4A27A 4ZQHA 5JDCA 5IDXA 3GAFA 3CTMA 2Q45A 2O3TA 3RWBA 5G4KA 5I9MA 1AHIA 3ANMA 4RPGA 3VH2A 2JCXA 4H7PA 4E21A 3Q3CA 4R51A 2V6FA 3JQDA 2GLXA 3UHAA 4JP3A 1YL6A 1H9BA 1V3UA 1V3VA 2HSDA 1T2DA 1OOEA 4ALNA 4G65A 4FFNA 3V2UA 5K6AA 4AL4A 2E48A 1MP0A 3C85A 2GRAA 4KQWA 4ZRMA 1I2BA 4DYDA 1YH3A 5I8ZA 1LBEA 1HDYA 1XSEA 2ZB7A 4RJTA 1YS4A 1GV0A 4GX1A 4ID9A 4XB2A 2ZJ1A 3E03A 3HQ4O 4GX0A 4KTTE 4BMVA 4R41A 5JXWA 1LLUA 1HDXA 2Q1TA 1NNUA 2NU9A 1HZZA 1ORRA 2HK8A 1LLCA 2I76A 1HT0A 2Y05A 2GPTA 4L75A 4DTIA 5TLSA 4CV1A 4ZQBA 3L6DA 1JAYA 1EBUA 4MVJE 3HADA 1AUPA 4DIFA 1CJCA 3TSCA 2TMDA 4K6FA 2QW8A 3PHGA 2QRKA 2G82A 4EUHA 3GEMA 5HBRA 4YWJA 4G5HA 4KQXA 2XF8A 4TVOA 1NPTO 3DZHA 5G2OA 2NU7A 1KVUA 3FTNA 3KYCA 4E2ZA 4MVJH 2I3GA 1PL6A 4QQRA 4A10A 1WDLA 4YPOA 2P9EA 2CY0A 4CM4B 5EINA 4J4HA 3KTDA 4E6PA 5CDYA 1UDAA 3JQ9A 2NU8A 1YOVB 2OGUA 3FPLA 1IOLA 3NJ4A 3PLNA 3G49A 3KB6A 4IDGA 3B1FA 1GQYA 2BH9A 2FPGA 3U62A 4LGVA 3NRCA 1A72A 3FPCA 4XGNA 1GCUA 4BNJA 1BXGA 1T4DA 3MJSA 5ADHA 4OIMA 4BNZA 2YJZA 3N74A 4F46A 4UVIA 5JDIA 5ENDA 4B7XA 4Y98A 1PGNA 4U8GA 1DLJA 3ZWVA 4YJDA 3A9WA 5IF3A 1HDZA 3T4EA 1LDEA 3PWSA 2PTGA 3C7DB 4FBGA 3PIDA 4CM3A 3A14A 1IPEA 3E18A 4JJGA 3VPHA 2CF5A 4TRJA 1WZEA 3ITDA 7MDHA 2VWGA 4GL4A 1DJNA 1U2GA 2Q99A 2O7QA 5DP2A 1A4IA 1LUAA 2PY6A 5TSDA 4OM8A 5L4NA 1F12A 2YUTA 1T24A 1HDOA 5TQVA 5A3VA 3GHYA 5HS6A 3ETEA 3MWDB 3NDRA 2LDBA 1GPDG 2G5CA 2I6TA 3U5TA 1T26A 3EHEA 3AOGA 4J1SA 4IJUA 4F3YA 1I0ZA 2UVDA 4B8ZA 4MVJM 4EDFA 4B4OA 1E3WB 2BLLA 3H2SA 3RVDA 5IZCC 4OSPA 2VOJA 4ROSA 4XQGA 4BQRA 3DC2A 3TWOA 2PZMA 2HKIA 1J0XO 4FB5A 4PGFA 1SB8A 3IMFA 3A28A 1Z73A 5L3ZA 2ZYAA 3RCBA 2HMWA 5KKCA 1H5QA 3OJEA 4RVUA 1NM5A 3QVOA 4ND3A 1I33A 3WIEA 4CR6A 1E1MA 1Z7EA 4MKRA 1FDTA 2UYYA 2Q1UA 1GCOA 3PQFA 2CZCA 3C8MA 3UW3A 1D1TA 3PFFA 5EPOA 1NP3A 3L4SO 2X7HA 4BO0A 3KXDA 4BUCA 4D43A 4UUNA 1LX6A 1ENPA 3BYZA 3I3OA 3CXRA 5ICSA 2CFCA 3U0BA 4ND4A 1SBYA 5BSEA 3IKVA 5JFOA 3WLEA 1DPGA 5KJCA 1BTOA 4DLBA 4WPGA 3BMQB 2DBVO 2WMDA 1ZSNA 3PXXA 1C1XB 1Z75A 4PZCA 5A9SB 2EXXA 4I9HA 5HS4A 3EZYA 5A02A 3U9LA 4QEDA 2BFOA 4DLAA 3ICCA 3VOSA 1JKFA 3HFSA 5AXBA 3OQ1A 3MEQA 2NQ8A 2RAFA 5ES3A 4QFDA 4MIEA 3PHJA 4ZHSA 2JD2A 2VHXA 2W4QA 5JYEA 1YBVA 1Y6JA 3PRJA 1V35A 4UUOA 4GSKA 2R00A 3DBVO 4HNGA 4KUGA 4L76A 4DL9A 5T6BA 3WJ7A 3SVTA 4EW6A 2V6MA 1XEAA 1TT7A 3GA0A 2R6JA 4WOJA 5BR7A 1N1EA 1YXMA 1SAYA 4MVJP 4RVHA 4YB8A 5TF4A 2FRDA 2O3JA 1B14A 3LT4A 2NVUB 4KDFA 1TA4A 2E6UX 1U4OA 2Z5LA 4NBRA 2FZEA 2GN6A 1JA9A 2J6IA 3B70A 4YA6A 3ZGYA 3WGZA 3AY7A 4WKGA 1PR3A 2GZ1A 4WLOA 4I5GA 3UICA 4AG3A 1B16A 5F1KA 1ENZA 2AEJA 3TF5A 3MOIA 4GX5A 4FFPA 4MJLA 3U3XA 1UR5A 4MVJI 5TT1A 2HRBA 1MC5A 1RM0A 2E49A 2IYOA 1E7SA 4EITA 4RPLA 3FTPA 1O6ZA 2D59A 3O8QB 3U4DA 2DPHA 1ZEMA 3CEAA 5GZ3A 5THQA 4BO5A 5BNFA 3W4JA 2EKQA 3VDQA 1IULA 3DB2A 5MDHA 2JD1A 4PCVA 1U2DA 2VT3A 2B69A 5THKA 5JMWA 5COQA 2W8ZA 1OI7A 1VC2A 3UN1A 4CQMD 5C7LO 3ONFA 4KZPA 4XQ9A 3WSVA 4FFOA 2F1KA 2NNLD 5IZCA 3F5QA 1MA0A 4FJ2A 3BZUA 3ENNA 4L74A 1UAGA 3F5SA 1LSSA 3K30A 3ONEA 5DCUA 1O95A 5IAAA 1VSVA 5G0UA 3I5MA 4HKTA 1DIGA 1BDBA 3MJEA 4OXYA 1JAXA 1GV1A 1E3SA 2JJYA 2QQ5A 3ROMA 4KUHA 4MDHA 3PJFA 1EK6A 3L4BC 4IJWA 3KSZO 4TZKA 3ROQA 1K6JA 2C29D 5KJFA 1MFZA 2PKQP 9LDTA 4B4UA 3GC6A 4BNHA 4JX8A 2HJSA 3SJ7A 4FR5A 4II2A 5L4SA 3TOZA 1ZNQO 3GVXA 3PVZA 4FQ8A 4RQUA 1M66A 1DB3A 1I32A 2X0NA 4A2CA 3GZ4A 3ZNNA 1YRLA 1PJ4A 5TIIA 1XLTA 3RSHA 4L73A 5DOZA 3KEOA 1F06A 3JYOA 3RFXA 2IDZA 4KTVE 3DMTA 2VT2A 2WD8A 4CL8A 4DYVA 5B1YA 1C0LA 3FD8A 4YJFA 3VZQA 4NG5A 1PZGA 1WXDA 3PJEA 3RC1A 2RH8A 3INGA 2ZB4A 4YT2A 3GF4A 4I8XA 1E5LA 2W2KA 5G4KB 2J3JA 3HDHA 2DU8A 1OFGA 2YQ4A 5AXAA 1YQXA 1F0YA 2NQTA 3RKUA 4D45A 4E33A 5AXDA 1RPNA 4ALKA 2I3AA 1XIVA 2ZCUA 1KVRA 2VUTA 3HUDA 1DBVO 2DAPA 1UZMA 1GZ6A 2FHSA 1XQ6A 4R5HA 4RCVA 4RLHA 3GQVA 3VKUA 2W90A 2OBYA 3GDFA 1WPQA 1UP7A 4DA9A 1GR0A 4XA8A 1O0SA 1VL6A 3QHAA 4FDAA 3WBFA 1ZKMA 3Q2IA 4M1QA 3H5AA 3VZRA 1H0KA 3K73O 4XYMA 3F3SA 4TQGA 3H9JA 4CUJA 1TXGA 1GTMA 1LLDA 4Q39A 3G1TA 4IUYA 5AOVA 1U8XX 4RPJA 1AN9A 4BO7A 4D0SA 3W8DA 3M6IA 4J9UE 4BKPA 1IYZA 3F1KA 1GAEO 1VRWA 2C59A 4GMFA 4U7WA 3HSKA 5EQDA 3UOGA 1WAMA 4BNXA 1SC6A 5JBIA 1B15A 1DXYA 3C24A 4CM1A 4PG6A 4AICA 3PP8A 3OMLA 1NWHA 3LYLA 4GBJA 3RBVA 4BGIA 3TFQA 3FCOA 5CDUA 5T8KC 1EQUA 4JROA 2Y1GA 2P4HX 1E7QA 2YFHA 2OORA 4EEZA 2WD7B 3KHUA 1EVJA 1BHSA 1NR1A 1PZHA 4X54A 2NLOA 4E3ZA 1BMDA 2YQ5A 3P7MA 5IZ4A 1LU9A 1LDMA 1PL7A 3FN4A 4YEDA 4E5KA 2VWPA 1LDBA 5ITVA 2Q50A 3Q1LA 4RVDA 4BO3A 3RUDA 5G0TA 5H83A 2JD0A 1IB6A 5A5EA 3V1TC 1BXGB 2UAGA 2IZ1A 4IDAA 4MPDA 4W4TA 3U4IA 2UV8A 1W0CA 1N92A 3QWBA 1HTBA 1ZJYA 3VTFA 3GPIA 3L4BA 2EIHA 3MJ4A 1O9BA 2P9CA 3EUWA 4EEXA 1P9LA 4XR9A 3DEYX 3KLMX 4Z9XA 2CDBA 1LDNA 3GGOA 2YYYA 2GYYA 2PD6A 3EC7A 4E2YA 3WGOA 1ZO8A 3WYCA 1SOWA 4M86A 4BNLA 3Q9UA 2B4QA 2VZ8A 4BHTA 5B4UA 5K0ZA 1QYDA 1WW8A 1VM6A 4I1IA 4CUZA 4CJXA 1E3JA 1T2AA 1EVIA 5IN5A 1DIBA 1RYDA 2H1SA 4FFMA 4TRRA 3KBOA 2OMEA 4ZRNA 4OJNA 3RUEA 2AA3A 3AOEC 3ZHZA 1CWUA 2OBNA 5AQ1A 1HZJA 4MKZA 1KERA 4JBHA 2NVBA 1JTVA 3L6EA 4I08A 3OECA 1CRWG 4NNJA 2EHDA 2DBZA 5KVSA 4O5OA 4DIOA 1XA0A 4DUPA 5A06A 2EF1A 4AVYA 4GX2A 2FR8A 5I7FA 2HK7A 3RUAA 2NWQA 5G0SA 2GUGA 3HN7A 1F8GA 2AQKA 2IZZA 2FN7A 3Q6IA 2X9VA 4M87A 3JQ6A 3WGQA 2Q46A 4CQLB 3ASUA 2VUSA 1ISFA 5TGDA 1LDYA 3WYBA 2FPIA 2PA3A 5MGBA 5DULA 2NACA 1VSUA 2XOXA 4E2WA 1DHRA 4OMUA 4OOFA 3KUXA 4C7KA 3O26A 5T5QA 3ORFA 2AMFA 3JQFC 2FZWA 3FF4A 1LRJA 3BIOA 3LT2A 3I4CA 1A7KA 1KBZA 1NR7A 1JKIA 1J4AA 4PLPA 1HE4A 1AGNA 1PGQA 1U3WA 2YDYA 2ZB3A 1A9YA 4LK3A 4TVBA 3RC9A 2D2IA 2DLDA 3R3SA 1ZK0A 5KOIA 2DBQA 4W99A 4BO4A 3BMQA 3C3XA 3CZRA 2BF7A 4LCEA 5ITWA 1C1XA 5TC4A 4GWKA 3VZPA 3KO8A 2AEMA 1R4MB 1Q2XA 4J1NA 3WGIA 1BVUA 3NEPX 1PJBA 1T1SA 1PJCA 2Y1DA 1PJ3A 5BT9A 3WS7A 5EJ2A 2IXAA 3GDGA 1D4FA 3A1NA 3PDJA 3ZWBA 1GPJA 5DDIP 3C1AA 5EL0A 5KJEA 2OO5A 4XQEA 4D41A 2Y1CA 1NX6A 1JW9B 1Y7TA 3NDIA 1PEDA 2FSVA 5DZSA 1L1FA 3W6UA 1PR9A 3ZU3A 3TZHA 3MJCA 4L4XA 5I7EA 1PJLA 3WOHA 1ONOA 2CVOA 3QWIA 2OUIA 1PJTA 4RDHA 2NVUA 3JYNA 2HRZA 1ZSYA 4MP6A 2QYTA 3I23A 2X4GA 2EP7A 2ZB8A 5GZ6A 2GZ2A 5H81A 1X1EA 3FR8A 3ZW8A 2YY7A 1P45A 3P2YA 3RBZA 3NUGA 1GD1O 3JSAA 3COSA 3GVPA 3JQAB 4J16A 3W8FA 4XYLA 3TZCA 1DC4A 2PV7A 1QR6A 2DQ4A 1EUDA 4PLZA 4FGWA 2YV1A 1D1SA 1OAAA 3ON5A 1MC4A 2ZYDA 4YRAA 5K9ZA 2CVQA 2C54A 3HWRA 1H6BA 3KLPX 5KKAA 4PLYA 4OGWA 4NMHA 1YB5A 4GWGA 4EJ6A 2A94A 1EDOA 3O8QA 1SCUA 1NASA 4L4RA 3WMXA 5KJ1A 2GD1O 1KY5A 1I36A 3EYWA 2C7VA 4B3IA 1GY8A 1H6DA 3WJAA 2DFVA 4HY3A 4R3WA 4CV0A 3KRTA 3AOEA 3NTOA 1GUZA 2I9PA 3O03A 4IDCA 3WGTA 3I4FA 2JFGA 4QFCA 2FR1A 3DOJA 4QUKA 3E5MA 2XXJA 3B6ZA 3OQBA 2OHXA 3VC7A 3LC1O 4E4YA 2OXIA 2CF6A 2ZCVA 4BNMA 3P19A 3S2EA 3INRA 4HP8A 4BGVA 3S55A 1KC3A 3HN2A 2Z95A 4OQYA 1S7CA 3DL2A 1WLYA 4FOOA 4H3VA 4A0SA 2X58A 1LSJA 3B1JA 4CR8A 3IOYA 3GUCA 5COAA 4KDEA 4PRKA 4ITUA 2IYPA 2ILTA 3C1TA 1KVQA 1I24A 3QWAA 2X23A 4JNKA 3KSUA 4O63O 2DKNA 2AQ8A 3ZV3A 3MOGA 1K3TA 3F46A 1BRMA 1H9AA 2D3TA 4RDIA 3UGKA 3H3JA 4YJFB 5G0VA 3CUKA 2W2LA 4EGFA 4OAQA 3DWFA 3EAGA 4NDNE 4LMPA 1I3NA 3OP4A 4Z0HO 5TS3A 1I5RA 2Y0DA 1KC1A 1UXIA 3WGYA 1X7GA 3ZDFA 4NFYA 1V3TA 4A5OA 1Y8RB 4P4NA 3NV9A 3GVCA 3V8BA 2GN4A 4QECA 4IIUA 3I9LA 3AU9A 3BA1A 3WGGA 2A9FA 1EUZA 1ULSA 4FC6A 4CMBA 3AM3A 2OOSA 1U3VA 1Z82A 2GERA 3G3EA 4IM7A 4A03A 2CNBA 1ENYA 1YE3A 2W2LD 2X8LA 4IPTA 3LLVA 1LSOA 3UUWA 3JYPA 5JAMA 1ZK2A 1CIVA 4J6FA 4E5YA 5ENVA 5U9CA 4BV9A 1PJSA 3WICA 4K6CA 1YB4A 1M2WA 3D4NA 3M1AA 3U49A 3WMWA 4CMKA 1CF2O 1E3EA 2Y67A 3ROKA 2WE7A 1DHTA 1DO8A 5JAIA 3VVBA 3BMCA 1MLDA 1RYEA 4R16A 4YRDA 3ZZNA 4BNYA 1YBMA 3MTGA 3NT2A 1Y5RA 2QZ9A 5FI3A 3ZV5A 5BQFA 2PLAA 1UJMA 1X14A 3IIEA 4R5MA 5EN4A 2YFQA 1B8VA 1JN0A 1SNYA 4KP7A 3QVWA 4E5NA 5JC1A 1CQIA 1U3UA 4KUEA 2CMDA 4LCJA 1WWKA 2X5KO 3M2TA 3RFTA 4XDZA 3KM0A 1DRVA 4CMEC 4JBGA 2I99A 2HDHA 2C2XA 4WCFC 1N7HA 5TRTA 2WDZA 3I9OA 2B83A 2BD0A 3KV3O 4NK5A 1M76A 5A04A 3EGOA 2C0CA 4RV9A 1U1IA 2R2GA 2VZ9A 1IL0A 2WD7A 4BMNA 1VPDA 3JQGA 1PS8A 2OP1A 2CVZA 4ZD6A 4LN1A 2EG9A 3FWNA 3GRKA 4HUJA 1RWBA 3KZVA 3H65A 3DAPA 4BNUA 1EFLA 1B2LA 2H5LA 4XRGA 3DTTA 3IUSA 4R9SA 3TQHA 4QXMA 3WDSA 4EJMA 2Q3EA 3ANLA 4CLEA 1Y9AA 1UXGA 1N1GA 3DR3A 2FSSA 3RUIA 3TL2A 1U5AA 4F6LA 1I3KA 4A7PA 1Q0HA 2B5VA 4LISA 3RASA 1WMAA 4CLRB 5GZ1A 3CH6A 2J5KA 2VOEA 1D7OA 3U4HA 1YB1A 4R3NA 5F5NA 1YQGA 4Y8VA 1DIHA 5C7OO 3HNPA 4BNWA 1PZFA 4NFSA 4TRMA 5CPBA 2EJWA 2WM3A 4XGKA 1W6UA 4XDYA 2JAPA 4IDFA 4LSMA 2HMTA 1GUFA 3PYLA 4TROA 2PK3A 4J1QA 2WEKA 3OJOA 2DM6A 4URFA 3ZNOA 3LF2A 1Z7BA 1DC6A 1LXCA 1QXSA 3DZIA 1Q7BA 2VCYA 1PTJA 1LLQA 1G0OA 1P0CA 3PJGA 4OYRA 3IP1A 3GK3A 1Q0LA 2X6TA 4RVGA 3SLGA 4DWVA 3WQRA 1QLHA 2ZJ0A 2O2YA 4R69A 3AY6A 4FFRA 3F4BA 4INAA 1D8AA 3WWYA 4H15A 4BNFA 1N2SA 1S6YA 2AG8A 1JKJA 1DDOA 3W4IA 1MXHA 1Z45A 4YVFA 4BMSA 4BGUA 1P31A 4GLLA 5C7IO 2VTEA 1VJ1A 4LRTB 3IC5A 2BFMA 4ALMA 1ZIDA 1T25A 4B7UA 3ADOA 4EBFA 3NYWA 1IZ0A 1LEHA 4UEKA 5LDHA 1GDHA 4CQLA 4BOYA 1SPXA 1C1DA 4Z9FA 3GZNB 3G79A 1ZMOA 3DTYA 3AI3A 4CMCA 1B8UA 4WE3A 2A35A 4CM5A 3N7UA 2NU6A 2J8ZA 3GNQA 3TJRA 3HB5X 4MVJG 3CMCO 1UAYA 1X0XA 1ZK1A 1HLPA 1O89A 4TKMA 5BNTA 1Y9EA 4TMFA 2PNFA 1H93A 4CMEA 4AFNA 1T4BA 2D0IA 4GSLA 3RJ5A 4KOAA 4WCFA 5JY6A 3PK0A 4OL9A 2HLPA 4GGPA 4WLUA 1ISIA 4JJFA 5JMPA 1XYGA 1IHYA 4AJJA 2J5QA 1R4MA 3MCVA 1CYDA 1KVTA 3NT5A 4G81A 1E6UA 3FNFA 4BO8A 5IXYA 1XKQA 2QRLA 1VE9A 4PIVA 3AFMA 4CMJA 1UP4A 4PG5A 4GKBA 5T57A 4BGEA 3NTRA 1E0DA 5AXCA 2NTJA 2HMSA 3UAGA 1YONA 3ASVA 2EKPA 4P4GA 1E3IA 1HKUA 1VKNA 3DAFA 1DFGA 4O1MA 3JQBC 1AE1A 4FJ1A 1X7DA 1KEWA 3DHNA 3WR5A 2P4QA 1K0UA 4LRSB 3WSWA 4PLCA 2I66A 3QP9A 4YAKA 1O8CA 3EZLA 3H9GA 1DSSG 1ZVMA 3K2BA 1C0PA 1RM5A 4ZICA 1F8FA 3RQSA 2Q2VA 4RF5A 4R54A 4PG4A 4B8WA 3WBBA 3F47A 2PGLA 3UXYA 4M89A 3JQAA 1HYEA 3WYEA 2NADA 1QMGA 1GYQA 4AJ4A 4XCVA 4XQCA 3L07A 3D7LA 4J2HA 1EQ2A 2C5AA 4D3DA 3M2PA 3OA0A 1QSGA 3IUPA 4BB5A 2HU2A 4PLFA 2PGDA 2C82A 4J7CA 3GMSA 1UP6A 8LDHA 2J3IA 3ETGA 3PI7A 2Y99A 5G0WA 4Q9NA 3WQSB 3R3JA 4XD2A 4YCAA 3JV7A 4W9NC 5CHEA 2HAEA 4UAGA 2BGMA 2OZPA 3AK4A 1K89A 4TRNA 4BKRA 4E2XA 5F1PA 4AJOA 1F14A 3JQAD 4BIIA 1PGPA 1HRDA 1JWBB 3JQ7B 1A9ZA 4FW8A 2O4CA 3L0DA 4KMSA 2EP5A 3X2EA 2PWZA 5B4VA 5T64A 1E6WA 4PZEA 1UXKA 2O3RA 1GL3A 1K6XA 1B3BA 5HTOA 3I52A 1EE2A 1JVBA 3QSGA 4LW8A 2EV9A 3C1OA 3NT4A 3UFXA 1LSUA 5HRUA 3I6IA 3ZI0A 2HJRA 3TDKA 1UXJA 4WNIA 1QKIA 4IGEA 4CL3A 4YR9A 4F45A 1GYPA 1GFSA 3B20A 4IS2A 2G76A 4J43A 1B7GO 5AYVA 4HADA 4QSMA 5JSFA 2YZ7A 3AJRA 3LDHA 3PIIA 1QV6A 1I30A 2ZYGA 3TN7A 3ZWWA 3LF1A 5U1PA 2GCGA 4RVSA 1NVGA 2YV2A 1KYQA 3BHIA 3PWKA 1ZZEA 3HFGA 1BXZA 4I5FA 3MJVA 1Y8RA 2Y93A 3HE3A 3LZ6A 2ET6A 1PQWA 1R0KA 1E3LA 1TT5B 2EW2A 1OMOA 2POQX 2V7PA 3FNEA 1SEVA 4ZQFA 3UCFA 4U6SA 4C7JA 1P0FA 1GUYA 4L9RA 4NJMB 2B4RO 5CG1A 4RPHA 4YACA 3UCEA 5HWSA 3GNTA 4CMHA 1DJQA 4ND2A 1Y8QA 2O50A 1GQ2A 5CAEA 3FR7A 3Q9NA 4NFHA 3EVNA 3OA2A 4CV3A 2ZATA 1EBFA 1LI4A 2WYUA 5J23A 1DFIA 1CEQA 3OBBA 3BMCB 3FBGA 3JQBA 1G1AA 4K1LA 4DQUA 1PGJA 2X0JA 4ZJUA 5CDGA 4S3MA 2J3HA 1P1FA 1XHLA 1Y5MA 4W7IA 1HSZA 3GVIA 5LC1A 4XWYA 3FNHA 1LRLA 1VI2A 5I9LA 2NTVA 1ONNA 3SBOA 4K28A 1U8FO 1P74A 3DZBA 3DQPA 2AG5A 1FMCA 1TI7A 2XAAA 3SC4A 3TZKA 4XJTA 4W82A 2VN8A 5DBGA 1KVSA 1UDBA 5DCYA 4BNIA 4YYZA 1R4NA 2E37A 4NBWA 1HDCA 4UULA 3GG2A 1E92A 3JQGB 3GN1A 5CEEA 1EMDA 1E7MA 3KETA 4DQVA 2GN8A 2O3QA 3RFVA 3VTZA 3ZHYA 3WNVA 4W9NA 5CFZA 3DZFA 4IQ0A 4R1NA 1BGVA 4M8SA 4Z6KA 2VYVA 5KVQA 4BKQA 1J5PA 1Z6ZA 2JHGA 4XRRA 4E30A 4IY1A 3U4CA 4YJHB 3OH8A 3DONA 1T2CA 4D79A 1P1HA 3LK7A 4MKXA 3S2IA 3E48A 3QRWA 5L51A 4R68A 2DC1A 3DZGA 1YWGO 4IQ8A 4Y9DA 3E82A 4BL5A 2VYNA 3IQDB 2P2SA 5IDQA 4CMIB 4CM8B 1GU7A 3CSDA 1R6DA 2H9IA 4CLRA 4NU6A 3KSDO 5JO9A 3OETA 3TFOA 2NTNA 2O48X 3ITKA 4U0JA 3RD5A 3ZCXA 2VYVD 2O7SA 3K5PA 4HFNA 1HETA 3W4KA 2VRBA 4WNCA 1CQJA 1YKFA 1DAPA 2B5WA 3EMKA 2DUUA 4WEOA 4YAGA 4YAJA 1DOHA 1NPYA 2VQ3A 4OQZA 1YJQA 2C07A 1EUCA 3AW9A 4Y6RA 3VPGA 3VPFA 4J7UA 1PZEA 1UH5A 1NYTA 4CPDA 3OIGA 3OEYA 1C0KA 2VYND 3ZWPA 4CLDA 4EYEA 4DPMA 1H6AA 1WMBA 3E9NA 3HDQA 3I6QA 4GAEA 1JLLA 4JXKA 1X1TA 4JP2A 4MINA 4NPCA 4XGIA 1P1KA 1EFKA 3GFBA 3D5TA 4OKNA 1FJHA 5DBFA 4DBVO 5TX7A 5C37A 1SEPA 3F6YA 1A4UA 4CMAA 3PDUA 1QLJA 1I8TA 3F9IA 3WTCA 3JTMA 2VRCA 2Y0EA 4I9UA 5LDGA 2GZ3A 2WYWA 1I2ZA 1IHXA 3B1KA 4BB6A 1FDSA 4NIMA 3DFZA 1YO6A 3FBTA 1XDWA 2Y68A 3FSRA 1MB4A 3I9KA 3QVSA 3ZHXA 4J90A 1C1DB 4D7AA 2BRUA 2WE8A 2X5OA 3UH1A 2F00A 4J9VA 3MJTA 1K2WA 3D5QA 1BSVA 2EKLA 4PLGA 1MG0A 1T1RA 2Y1FA 1LNQA 3GMDA 1EVZA 2G1UA 4M55A 1XCBA 3S2GA 1E5QA 3GZNA 3TNLA 2IODA 4O59O 3OJFA 3EVTA 1C0IA 3GPDG 3GVHA 4IMRA 4WK6A 4FJ0A 1LTHR 1PS9A 1TVEA 4IZIA 3GN2A 2D5AA 4PRLA 5A1TA 1VJTA 4WCFB 1NFQA 2RIRA 3O4RA 3M1LA 3VDRA 1BG6A 4QX6A 2FY8A 4EUEA 4J3FA 4OKIA 5T8KA 1NXQA 1H2BA 5L4LA 4PLWA 4KWHA 1QYXA 3FNGA 1R12A 2EERA 3K8ZA 3DDNA 4K9DA 3K31A 4P38A 4FC7A 5HA5A 2CD9A 3D64A 1NQOA 2UDPA 1KY4A 4XYBA 4HFJA 3LU1A 1JQBA 3JQEA 3Q11A 1NFFA 4UVGA 3QA9A 3D4OA 3PHHA 2ZTMA 1DRWA 4UEOA 4W7HA 4YT4A 2GN9A 4BO1A 3FI9A 2QRJA 5DNAA 4OSOA 1OBFO 3OM9A 1XELA 4DXHA 5EESA 1R37A 4L8VA 3PLRA 4J2OA 1CERA 4ND5A 2X9GA 3ZV4A 3A4VA 2QG4A 2V65A 2JHFA 1PWXA 4FPXA 4J0EA 4QTZA 4RF3A 3ROPA 1SB9A 1WP4A 1XGKA 4OXNA 3RU7A 5K6AC 4NBTA 1M75A 4RZHA 5DP1A 3IAHA 5ILOA 3BAZA 2QX7A 4JGBA 2VWQA 1EE9A 5EIOA 4DPKA 3DO5A 1SMKA 2IEDA 1C3VA 2NVWA 3AI1A 5ER9A 3WGHA 1DRUA 2DFDA 1V6AA 1UXHA 1IY8A 4DMMA 1R16A 2DTXA 4NBVA 2GR9A 3EW7A 3ENKA 2A4KA 2Y0CA 1AXEA 3ANNA 3WTBA 2JFHA 5DCWA 2B36A 4CUKA 3OICA 5B37A 4AJIA 4D0RA 2X0RA 3TPCA 3TOXA 2E4AA 5KTKA 5B12A 3F4LA 4XIJA 1U3TA 5I7VA 1E1KA 4GGOA 5F1OA 3V1UA 3V2GA 7ADHA 1PU2A 2GF2A 3RROA 3R6DA 3T7CA 2OL4A 2YW9A 1HXHA 2PH3A 4J7XA 5JE8A 3JQ7A 1KEPA 6ADHA 4J4TA 2DTEA 5U4QA 4PG8A 3JD1A 3EY4A 3DHYA 1ZSVA 3DHEA 3VPSA 5KVVA 5CP8A 4YJGA 1A5ZA 3AWDA 3PWZA 1BDMA 3I83A 1HEUA 3OJLA 3L6OO 2C20A 5FEUA 4NH4A 3UVEA 3AUUA 5B4TA 4N54A 4B3HA 4F6CA 2P91A 1ADCA 3PHLA 4RPKA 2DPGA 1DIAA 3SLKA 3VH4A 4EJ0A 5JC8A 5L7WA 4IIVA 3JQFA 4BKUA 1B3RA 5JDIC 4AJ1A 4D3SA 2XXBA 1P33A 4HFRA 3GOHA 3PHIA 4FS3A 6LDHA 4CMGA 3PQEA 2O3SA 3D3WA 1BW9B 1XR3A 1L7DA 1XG5A 3IJRA 3MZ0A 4PVDA 5GY7A 5LCXA 1PGOA 4BQPA 3SXPA 1P3DA 4GVXA 2O2SA 1WVGA 1ARZA 1J49A 4HX5A 5FWNA 3E9QA 2ZTLA 4WASA 4HWKA 3ZWNA 5L45A 1TT5A 4BNNA 4WCDA 5JPIA 2AHRA 2GO1A 1Y8QB 1VJ0A 2PGJA 3HZZA 4NJMA 4TKLA 5CG2A 2GSDA 1A71A 2BI7A 3PYXA 3JD3A 4WJZA 1ZW1A 5IJZA 1H6CA 2PZKA 4O0LA 4R4JA 4AJKA 4ND1A 5IN4A 1UZNA 3CIFA 3RUHA 3D4PA 3D1LA 4AJEA 5IG2A 1E6EA 2VUUA 2FP4A 2E82A 3W6ZA 3OFSA 4AJNA 2RHRA 2QHXA 1RM4A 4AJLA 1Q1NA 4DVJA 4BNKA 1XQ1A 2J5RA 3FRJA 4UUMA 5FFFA 3OSUA 1ZH8A 4WLNA 3IDSA 1ULUA 3BMOA 4B7CA 4ZA2A 3H9UA 3STHA 4CM9A 1DAOA 3OIFA 1W4ZA 4NI5A 4M49A 1QYCA 4TZTA 1R4NB 3R1IA 2G17A 4JK3A 1YDWA 3T7EA 3PQDA 2P5UA 2CSUA 4YQYA 3VH3A 3ZNPA 3GGPA 4BVAA 3C7AA 4DGSA 4BO6A 4NQZA 1B8PA 2H63A 5KNLA 1AHHA 1YVEI 2BFAA 2AXQA 5C5IA 2EWMA 2FOIA 4RVFA 5JLAA 1P1JA 3EDMA 3EK2A 3VPXA 4PG7A 3VH1A 2HO5A 3CINA 2VHYA 4HXYA 1RKXA 4GH5A 4MOWA 4CM9D 2B0JA 2JCYA 3O9ZA 3TZ6A 4S1VA 3VVCA 3MTJA 1E1LA 2VTDA 1PQPA 5BNIA 2OP0A 3AY3A 1WZIA 1IZ9A 4GQAA 1IPFA 4YJHA 3DMYA 2C2YA 1YQDA 1YL5A 2PZLA 3OEWA 5EERA 5JO0A 1FXSA 1UUFA 4IMPA 4Z3DA 3BTOA 3W1VA 4Y6PA 1I3MA 4FOSA 4IS3A 4L0QA 4CR7A 1H2HA 2BGKA 3IS3A 2NUAA 1E7YA 4GPD1 1DC5A 2R00C 4CMIA 4CM8A 1HDGO 4RLSA 2FR0A 4M54A 4OXKA 1U7HA 2BKAA 2HUNA 4NHEA 2IEBA 1W8DA 3ZNQA 1PQUA 2I67A 2GNAA 1ZK4A 1Q0QA 3D0OA 3SJUA 3RKRA 4GKVA 1I3LA 4YT5A 2XPCA 4I5DA 1NQ5A 4B4VA 1ADBA 3DBLA 3ZWYA 5A3JA 3JYLA 4CLOA 1IUKA 4N18A 1GEGA 1LC0A 2NV6A 4PVCA 4YAIA 3NJ8A 2JKVA 4EZBA 3C7CB 4KWIA 4RORA 3DXFA 1MXFA 4UVEA 1ZXLA 5JAQA 2AEFA 1Z74A 2H6EA 1RJWA 3ZH2A 4Q3DA 3PTZA 2AQIA 3Q2KA 4XX0A 3UKOA 4CM7A 1PIWA 4Q3NA 1NHGA 1ONPA 2RCYA 5KVCA 1NPDA 2DTDA 1QV7A 2VNSA 1HDRA 3DBHA 4WLFA 3ZU2A 4G2NA 1NQTA 1EZ4A 3AUAA 1ISGA 3GAZA 5FI5A 4CLXA 4ZVVA 4RO0A 1AXGA 5DN9A 2PZJA 4IDBA 3BMNA 3VKVA 2Y1EA 1RM3A 2I5PO 1EK5A 1ZFNA 4WECA 3PEFA 3WFIA 2Q2WA 2GDZA 5TT0A 3ZWCA 4CLHA 4EUFA 3WX0A 4ILKA 1J6UA 1N8KA 3JD0A 5FYDA 1ZMTA 2D1YA 1YDEA 3LSYA 4RF2A 3UCXA 1R0LA 1X15A 4UVHA 5GMOA 5JAZA 3X2FA 2Q2QA 4P4LA 1XU9A 2G0TA 3NX4A 1SO8A 4Q3BA 4ALIA 4Z9YA 3HDYA 2C5EA 1HWYA 1U7TA 1NQAO 3GHHA 4BV8A 1FDUA 3JQ8A 3OQ6A 3TZQA 1NAIA 3IJPA 2FPPA 5DOVA 2ZQYA 3L9XA 4LVCA 1EDZA 4J91A 4B3JA 4ESOA 4D44A 2ZQZA 3DMTC 1X13A 4J1TA 5T67A 3CMMA 5F21A 1NVMB 2BMAA 1MFPA 4II3A 2PD4A 3DOCA 2B4TO 4FCCA 1Y81A 4Y67A 3VHRA 1LC3A 3NGLA 3PGJA 3G1UA 4JBIA 2B35A 4D3FA 1ZUD1 1OC2A 4ZQEA 2IXBA 3DBRA 2QYSA 2BI8A 2Q1WA 3PPIA 1NVTA 1A7AA
chains in the Genus database with same CATH superfamily
1FFAA 1I9CA 1RWMA 2XUZA 1MUUA 1PSZA 2CK3A 3MVEA 2ZU0C 1BGWA 1JJAA 4FINA 1X38A 2J3KA 3I5YA 3ST7A 2ZTVA 3GUZA 4IBOA 3BFJA 1OX4A 1X80A 2Q4OA 2WIAA 3CNLA 1IN4A 3MTBA 5CURA 1U28A 2PUAA 4MQEB 3KOMA 3Q8WA 2QRVB 3QWHA 4LRYA 5BVGB 4OX9B 5LA6F 5BR8B 2W2XA 1X1SA 2M98A 4AO7A 4IRXA 2R85A 4FR0A 4C5BA 2DE0X 1ZOIA 5FR1A 2XBUA 5GJCA 3IPXA 3OPYI 1SHLA 4NR0A 3W5IA 1Z3IX 2ZPTX 4OQXA 2C7PA 2PX4A 5DEOA 3ESYA 3RG8A 3LQFA 4I2VA 2RJOA 5EQFA 1S1MA 3CSSA 3R0XA 4KRGA 5IHXA 1NE2A 2WYIA 3CPSA 5F9FA 3T7DA 1F20A 1MJGM 1N2ZA 3ZK9A 3HTXA 2I2BA 2VO1A 3BBPA 1XPJA 4MR7B 5BSGA 5HKBA 5IJ9B 2ZYTX 4ZCLA 1JQ5A 1FL9A 3E8XA 1Z28A 1O94A 3HVJA 1KH2A 1JIQA 5EQJB 1I80A 2A57A 2OCKA 1EVYA 4QIHA 2OM6A 1YIAA 3EXHB 3TGWA 1EK0A 2XUIA 3WADA 4GKJB 2V74B 4LVUA 3DKPA 3HYCA 5AJVB 1UBKS 1YU9A 3E9RA 2JVKA 3KPYA 2IE0A 3HS3A 4FSXA 4NOJA 4TMZA 3ZHVA 1IY9A 1JDTA 4P7KA 2YZNA 2HWUA 1SK9A 4QTUB 4LC0A 4RXUA 1YBAA 4QDZA 3BWDD 5ALMA 5DX0A 1UDXA 3FDZB 3INTA 1KQPA 2RAPA 5B1IA 1OZ0A 1WXXA 2Y6VA 2FPXA 1UMDB 1FYWA 5CLIA 3DP9A 2G8LA 1JDVA 1X70A 5KYWB 1P61B 1C80A 1R3DA 421PA 3SX2A 1A9RA 1E8DA 5EHQA 3IAAA 3VZSA 3IEVA 1ZOOA 3Q72A 2OT3B 3KYDA 3HXPA 5AVWA 5D7BA 1EG7A 2J09A 3W2TA 3PNOA 4OB6A 3EIQA 3FF1A 1PKEA 1TMKA 2Z1NA 3R3HA 2DVMA 4MX8A 3ZCSA 1TQDA 4XCXA 2AE1A 4W63A 1NJ2A 1T8YA 4LMRA 5CRIA 1N5IA 2YZGA 1BH6A 1NW8A 2WLSA 4WV3A 4C3ZA 1C50A 2P6PA 2V4ZA 3UPDA 2Q49A 1XMVA 2MDTA 1PD0A 2X22A 2YVUA 5A9RA 1LS6A 3FTDA 3NTQA 3VO9A 3FNQA 4KPGA 4R7GA 5C7LO 3W05A 4FX2A 1ZD8A 4YRIA 3SYKA 1NI4A 4OBWA 1P80A 1IJBA 3E1KA 4DSZA 4A4DA 4DLYA 2X13A 1R88A 3S1SA 1P5FA 3NBXX 4K26A 1RHKA 3EFOA 4HV4A 1OJ7A 2WSSA 2ZYIA 4UDXX 1K7SN 1V8BA 2AG6A 1FRFS 1A2OA 1SQSA 1TF2A 1F8XA 2V7EA 2WWRA 2ZYRA 3KWFA 4HLCA 1SUWA 2RMKA 4MCHA 3UG6A 5JV5A 4MUGA 1KYVA 1JI3A 1SUFA 3NAQA 2OWDA 4Z0TA 1B26A 4G23A 4M7WA 4CDNA 1M0EA 3NKLA 5ENZA 5LXTF 1SG6A 1U1EA 3EA0A 3GROA 3AVUA 2P2NA 4UZFA 4MPRA 4OQPA 1NI5A 2P30A 1OKKD 1Q44A 3VKWA 1TLTA 2O14A 3U6BA 2RGGA 3V8NA 2FV8A 2XE8A 1PK8A 3CT4A 3ESBA 4JBYA 4UNSA 1OZAA 1YZUA 2AQHA 3FNBA 3HO1A 4HWSA 3H5RA 3IO3A 3BMOB 5FWAA 5HZGA 1R8YA 4W1QA 5H82A 5DK6A 4ETIA 2MR5A 4LYJA 4XLLA 1J1UA 1IZZA 4ZJZA 1K4MA 2CDAA 5C51B 4GBED 4WESB 1DFHA 5DN6D 3KQYA 4G0XA 2QZ4A 3AF6A 1C81A 4URUR 1YFZA 5FF9A 2ZTUA 3VXKA 3NKVA 4XPZA 3K9GA 2ZI7A 3RC2A 1DIRA 4GGMX 4LHWA 2G6BA 4WK0B 3U1TA 3TBKA 1XK6A 2XLCA 1S3FA 1TMGE 2VF2A 3H17A 4MP8A 3CE6A 2DR2A 1N5RA 3AFNA 3EZ6A 2AN4A 3PT5A 4RXMA 5CYPA 4RE6A 3RE1A 1WZ2A 3E6AA 1JJ7A 3ZIDA 2ZU6A 1DQSA 3G0HA 2Q5OA 1M1NA 4IKPA 4RGVA 1FRVA 2NSHA 1MX5A 3JVDA 1SIUA 1V43A 3F0TA 3FCYA 2P3QA 3GFGA 3OY2A 5DLPA 5C8DA 2VQFB 2VTKA 3L4KA 2PUVA 4LJSA 3R7WB 1NFRA 2F1OA 3AHCA 1QQBA 3K96A 4HQLA 4PW0A 3VSCA 4KNWA 1ZI9A 3E8MA 1F0NA 3ELDA 2VPYA 3SE0A 3GRPA 3OIDA 4EO7A 2NU7B 3ZK8A 1P0MA 1PT9A 1QIGA 3I9MA 4GQIA 4BFWA 5I7SA 1EE1A 3OG9A 4CM6A 2YS6A 4EMBA 4HZIA 3MERA 4TLBA 3TTSA 2Y1OA 3WKAA 4D57A 1ECPA 4BS9A 1BKYA 1MN6A 4HGZA 3B3QA 3P52A 3ZWMA 3TUIC 2ACEA 1CY2A 5I9SA 3TQRA 1XQVA 1C9EA 4RZIA 4E0BA 3PXGA 1W36C 5CDHA 3WNQA 1ADGA 2QSZA 1X0VA 2Z4RA 2BFBB 3Q7QA 2PR2A 3SEZA 3E4CA 3WG9A 5A1JA 4H0CA 2YINC 1VJ5A 3EBPA 4PX2A 1OVMA 5CCEA 1V0JA 3N2EA 1OI2A 1XXHA 4PYIA 3AVOA 4C07A 3PEWA 2M9MA 3GEDA 3PR1A 4PC3A 1E0JA 4BKOA 4TLEA 4BFUA 4D99A 1THZA 5H4HA 1CYEA 1ZD1A 6NULA 2EFHB 1LPOA 1A9OA 1TZCA 1L8XA 1P72A 4NVRA 2LKCA 4M0EA 5IBQA 3QVTA 1OROA 1I1NA 1KEVA 4HS9A 4KN6A 4GYJA 3CVYA 2DCUA 1UJCA 4IDQA 3V2HA 1JIXA 2MSDB 2NG1A 3GNSA 4LWQA 1YRBA 4OHXA 3Q10A 4KN5A 1JG2A 2O6HA 1DKNA 2YX1A 3D8SA 4RF4A 3EVCA 3W1WA 2JLZA 3LUCA 2QPLA 2GTHA 4TV8B 1ZEJA 3U1BA 2C2ZA 1GSAA 2ERXA 2RSLA 2XUAA 4YGXB 3GLFE 1XZEA 2PUTA 4ZKEA 4MWTA 4A8TA 1QGUB 2GILA 1SA0B 1ZHFA 3K3PA 3NZEA 3DDCA 4NKRA 4TS1A 4DMLA 2R4UA 2WHPA 3T7SA 1ZKDA 2CKMA 1N8NA 4NS4A 2P68A 3L0IB 4XKJA 4H16A 1AKVA 1UFKA 3H6KA 4R9VA 2WF8A 1I10A 3ZXYA 1FVXA 1R6UA 4LC1A 3ZW9A 4CODB 4P80A 4XFKA 1FRQA 3MWDA 5K0CA 2GEBA 4EYKA 1DO0A 1MC1A 3WV4A 4KGXA 2YJ5A 3DDZX 3KVRA 3L0CA 3QWFA 2P5YA 4BP8A 5B55A 2QK4A 2PJDA 2QV0A 3RF6A 5JXGA 2X1VA 3TLKA 2ZSKA 3BMNB 4JEIA 4BDTA 4JZYA 2AJ8A 1MF7A 3LV8A 4G1FA 2VHWA 2C3MA 3AVPA 3HU5A 4K81B 4L6AA 4ZODA 3JZFA 4CKXA 3EEYA 3TMYA 3DV9A 4LBYA 2R6DA 1PK7A 5BSHA 5JYCA 1K8XB 1ODCA 2TMKA 1SVIA 1G7SA 1SOMA 1Y1PA 1TRHA 4KVAA 3J7TA 2R65A 3WIDA 4MWBA 4DMRA 5LQRA 2D5LA 2Q0SA 4NJEA 5L95A 1K8ZB 3D1VA 3SFVA 3S81A 2ZXUA 3EODA 3FGNA 3N3AC 2HF9A 1SFRA 3BDAA 4BV2A 1ZGCA 2WPNA 2DLNA 5EAIA 3ZQUA 1E5VA 4B0OA 2YWFA 1EFDN 1Q3KA 2CNNA 2WWFA 3WRVA 3P2MA 4KFCA 2BELA 4KB5A 4RNDB 3O31A 4YMUA 2B21A 1UJ4A 2XMGA 3KKZA 2B8WA 2WSLA 4B5KA 3HJGA 2GJ9A 3PZRA 4YMHA 2NYRA 4WI1A 3JQCA 4HDNB 6REQB 2C7RA 5EIFA 4KQ9A 1SUBA 5FBKA 5JAHA 4MVJA 3HRKA 3PTAA 3OD1A 4YJ2A 5ER6A 2F64A 1U5CA 3QX7A 1NHWA 1Z35A 1YFKA 1LNZA 1O5IA 3B7WA 4I3GA 5L53A 2J67A 1II8A 3AM5A 1F17A 3GFFA 3AKDA 4B85A 5LQDA 4KR3A 5M34A 4Y2RA 5KNCA 1KWKA 5K8VA 3E70C 4BBZA 3THXA 1CUYA 3VNBA 4GMGA 2NZ2A 5JDCC 2AOWA 4RTSA 4QGGA 3R5FA 3R75A 4I9FA 3CF6R 3AINA 3FA2A 2ZR9A 4RHFA 1DS6A 4U4AA 4JCOA 1T5TA 4WLEA 1V95A 2XDYA 1OI3A 4DC0A 3RUFA 4D46A 4OI0A 1D6NA 2BM1A 2BM0A 3LGAA 1XMSA 4YMWA 2D5IA 2PG3A 5AW2A 4AY6A 2OSVA 1X80B 4B7ZA 3QY9A 4FKZA 4DPLA 4N8DA 3QVJA 3N0RA 4OOEA 4RQTA 3NHYA 3OQOA 2IHJA 5AI8A 1LW7A 1QYRA 2XTNA 2QD2A 3D6HA 4PTZA 3QYFA 4ZKDA 4JSTA 1E8NA 2MWMA 3ROZA 4WXRA 1S9HA 2ODPA 1OLXA 4HZUA 4MRMB 3IT1A 1Y37A 3LCJA 1XZIA 1JEJA 1QKJA 1V16B 3C39A 4V0NA 4EPWA 1Q74A 1Z2PX 2PWYA 2GRJA 3RJ9A 5F7JA 2H1CA 1IEXA 1XZ8A 3DYIA 1NAHA 4B1FA 2VXCA 3PFIA 2FQQA 1GG9A 1PL0A 2IQ5A 2XB4A 4ZDWA 5IC4A 1PR4A 3QU2A 5F4ZA 1AGPA 2QVYX 3B5IA 4ASUA 2RHBA 1X87A 4U39A 4D4GA 2HXYA 4R8KA 2JVIA 2VHVA 1FIUA 4HAYA 4PFJA 3UMBA 4MVXA 3PNSA 3EVAA 1RJEA 3Q87B 5TY0A 4DRXB 4MIYA 1LQUA 1P19A 5KMGA 2BHLA 2IEGA 5FI1B 2KYRA 1TEZA 3C97A 2PUHA 2LW7A 1R0RE 4DCMA 4WY5A 5KEIA 2IBTA 4GM0A 2IBSA 2HCTA 4BVBA 3L0SA 3ZV7A 2XCIA 2LGJA 2ZT6A 3GPCA 5A9TA 2XVAA 3TKYA 4DHEA 2NM0A 4P34A 3CLVA 1J8VA 4IIHA 4XEHA 5J9FA 1CPYA 2LKDA 2WF7A 2WY2D 3ROEA 4V3BA 3SXJA 4UREA 3QTBA 4GD3Q 3JQ9C 4L7QA 3LC7O 4RCZA 1PZMA 4L22A 1DEOA 1DTSA 4G89A 1QE5A 5CTJA 2DEUA 3WJ1A 1S3GA 3QLJA 4DA8A 3NHLA 4JY7A 4FR2A 5DASA 3MXOA 2O3UA 5LYJF 3NB0A 4ZQGA 1JG7A 3KYDB 1RHMA 1NUQA 3V4VB 5KVAA 1IG3A 3IQXA 1JHYA 1QZZA 2DQKA 3C7KA 4G01B 1NSFA 3UV7A 3A1DA 3GRYA 5FWXB 2ZREA 3BWBA 3C5VA 2OBBA 1Y5LA 1GZUA 1L5HB 1QP8A 5D6OA 1SN7A 1WZCA 2QY6A 2WZCA 3P5SA 4F72A 4LHYA 3GGGA 2ZCJA 1ZXBA 2OFPA 3BGIA 1SVOA 2QAJA 3U7IA 4IXWA 3NHFA 1VHTA 5JQGA 4R1TA 4E7PA 1TZJA 2ZWAA 3TQOA 2FN4A 4LJ5A 1E7WA 3TDMA 3E2PA 4HQKA 1NI4B 3WFJA 2IUYA 3R7AA 2W4MA 1CJKC 4EA8A 2AW5A 1T2EA 2JBAA 2LZ0A 1AS0A 2GRUA 2VCEA 3HRIA 1DTWB 3LKDA 4OMFG 1YRQA 2REXB 4UUPA 1G0NA 3HPQA 3CUEF 3RC3A 1CR2A 1IMOA 1P7CA 1N5DA 4IDDA 3UJ8A 1K5HA 3N87A 4F8EA 4Z7JA 4NU5A 1OZFA 2R48A 5KU7A 5ISMA 4TQUS 3SMQA 1JU9A 5D8DA 2W2KB 3SC6A 4IVPA 3K92A 4JLWA 2VZEA 1SQ6A 2I55A 4Q7LA 2EG5A 3B3AA 3C0KA 3M4NA 4RKWA 3WRXC 4U2FA 2E6KA 4K6OA 3SDZA 2Q45A 1SD2A 3A27A 4P3KA 3RWBA 3UHPA 1S2LA 4DKXA 1U5BA 3O83A 3LCCA 1VMEA 4TXLA 4A8PA 2ZUFA 1CF9A 2P11A 5FUXA 3VH2A 2OFWA 3SPXA 3L1IA 3Q3CA 1Y4DE 4KYVA 4R51A 4HATA 3PD1A 2GLXA 5KDOA 5J2TF 4MV8A 5C2JB 2ZYWX 4JP3A 1WTCA 1H9BA 1V3UA 1YTLA 3ICVA 4JR2A 2VP2A 2BYTA 4HZGA 3EFEA 1PR6A 2ACVA 3FVQA 2E48A 1MP0A 3C85A 1VLJA 3OZ7A 5PNTA 1I2BA 4PICA 1YH3A 4LGMA 1NW7A 2QF7A 3RANA 2IY9A 4PGMA 10MHA 1KS2A 1R7RA 4RJTA 5JXHA 2WYOA 3CTPA 3REFA 1PT8A 3ZDZB 4NXNB 3ED5A 1E20A 4KTTE 1ZJ6A 4R41A 5JXWA 4EHNA 3W77A 2FDCA 3NOXA 4P3XA 1UXOA 2Q1TA 5E6RA 2F43A 2NU9A 4EKYA 2B2NA 4IH1A 4QSHA 3OEEA 5E9WA 2GPTA 4JI8B 3F9CA 2Y9PB 5AI5A 5TLSA 4ZQBA 4EFKA 5A6SB 3ZIUA 1ESCA 5LYYA 4MSUA 1R6BX 1QFYA 1QO7A 4OH7A 4A6PA 3RRNA 3IT3A 5F7XA 3IELA 1AKTA 5B58T 4QA9A 2R1TA 3UUFA 1RJDA 3LG2A 4D4IA 1VP9A 5IAEA 4GT1A 3LLCA 3KT3A 4EUHA 2JLQA 3GEMA 3W5CA 2XX3A 3X1DA 4H2DA 1NPTO 3QMVA 3DZHA 3SS8A 4AU1A 3HJFA 1KVUA 2ADMA 4PNHA 3FTNA 4EYGA 2P9TA 2NIPA 2I3GA 3COPA 4RL4A 2WM2A 2Z5FA 4OXXA 1WDLA 2Z6QA 1O5TA 1VMAA 4XAQA 1F1BA 3A6JA 4YK7A 1G5TA 1JQKA 5A6VA 3C41J 3VUFA 3CR8A 2EDAA 3THYA 1JJFA 4LYHA 1FRNA 5IT4A 1SKYE 3I1IA 1IOLA 3RTGA 3KB6A 3UH0A 1IPHA 5FHRA 3TAUA 3B1FA 1GQYA 3HKBA 1E9FA 2PZFA 1A72A 3BJRA 1Q92A 1Z25A 3KHTA 5C1PA 1XCLA 5K3FB 3CU5A 5K51A 4MUHA 2GM9A 4OQQA 3SZMA 4HR7A 4BNJA 4LRQA 1P6QA 4ND8B 3LOQA 1N4AA 1IY1A 1AVTA 3AHIA 4FIDA 3N74A 1NDQA 4B6QA 4F46A 1Y8AA 3IT2A 1H66A 5IF3A 3A9WA 1J9GA 1SQFA 2IYFA 3KJHA 2ZSDA 1A9QA 2ARKA 2YHAA 3A10A 3INYA 4JELA 4NARA 2J9ZB 4C4ZA 2X77A 2EF0A 3NATA 4PQFA 2VP4A 3OTWA 3OIUA 3PEVA 3VPHA 5BN3A 2XB9A 3JSXA 3KKKA 1ZCBA 1QZUA 1R10A 1ZH0A 4OFXA 4US0R 2PXAA 3P9XA 4GL4A 4UZSA 2WHPB 3EGDA 4LYGA 3IJEB 4ZT4A 2YHBA 4J0QA 1F12A 5L4NA 2WM8A 1IQPA 3A0UA 3ZDYB 1TVCA 4XUGB 5C80A 5LD2B 1EUQA 2CUNA 4Q7EA 3QLTA 3R9WA 3MWDB 2GVNA 1U2DC 2LDBA 4RGQA 1GPDG 1NJ5A 4FGJA 4HGRA 3U5TA 3UQYS 2G04A 2JIBA 2E5FA 3PI6A 1Q57A 1JBEA 3II6X 5E6UA 1MT0A 4IJUA 4F3YA 5A5GA 2BKXA 1W88A 2W6JA 4B8ZA 5JD4A 2PMEA 4EMSA 4CIYA 4MVJM 4EDFA 2A5FA 3UV3A 2BLLA 1CZUA 4I1SA 5BW4A 3F96A 4LAFA 2H29A 2QTZA 1HMPA 2JFXA 1VJDA 1ZR4A 2HKIA 5HJ5A 2ROQA 1KP9A 1JQDA 1SB8A 4KR2A 4NJEB 4O29A 4JB8A 2Q9UA 3PNQA 5EWJA 1R6VA 5BYKA 1AA6A 1WCV1 2DWUA 2LNDA 5AJXA 4Q5IA 1BC5A 4B6EA 1G8PA 4REOA 3N6VA 3GXBA 1UDWA 4WXHA 2PUDA 1XTJA 5SY4A 3QVOA 3RT9A 2UXBB 3A6EA 1AUOA 2OHGA 1WRBA 3FCSB 2I6UA 5I01A 4MKRA 2UYYA 5AESA 3FCXA 2VA9A 5EZSA 4YRTA 3C8MA 2XYGA 4Y6OA 1AKNA 1WW3A 1AMNA 1NP3A 3FVVA 1INLA 2QDXA 1Z4KA 2RGUA 1U8UA 2XQGA 1LX6A 1ENPA 4Q4AB 1JPNA 3VPDA 2CFCA 1I1OA 3TTUA 3U0BA 5AT1A 1D4ZA 1Z34A 4LOHA 3H4TA 1P7WA 4YYEA 2ZJ7A 1VPTA 3NM4A 5BSEA 4OHYA 2HIHA 4RV5A 3TLAA 2GBIA 2VPPA 1BTOA 4DLBA 2DBVO 3ZEAA 4URWR 1CV2A 4DLSA 4MKIA 4PZCA 2EXXA 4I9HA 4FYWA 2YYAA 3ILSA 4QEDA 3V80A 2BTQA 1YS2X 5B7PA 1TAUA 1JKFA 5SICE 3HFSA 5GV7A 3OQ1A 4WD3A 4BWYA 4UOZA 4EFLA 2RKBA 5LKRA 1HT3A 1CP3A 1PT5A 4QFDA 4C05A 3DEIA 4X5OA 3RHFA 4ARBA 5H16A 2JD2A 1E58A 2W4QA 4BBJA 1O03A 1YBVA 2HF8A 5FR2A 4QFBA 5K45A 2WJJA 4HPJB 1H2EA 3M6MD 2AJTA 4ZFNA 3DBVO 3ETJA 2ABWA 2JAQA 3A04A 2XQKA 1CJVC 3QMMA 5BR7A 5G53C 4LUCA 1G41A 2E0IA 5FBRB 1NUHA 4RVHA 4YB8A 1M5UA 3PC8A 2PIAA 2FRDA 4ZC1A 1B14A 4FVTA 2NVUB 4KDFA 4BU0A 1E2JA 1CS0B 4MRSA 3DYBA 2ADFA 4MQ5A 4N8SA 3F74A 2GN6A 3T9CA 2WF6A 2J6IA 1F2UA 2IOQA 3BRCA 5E2AA 4JASB 3ZGYA 4GI3A 2GZ1A 1E99A 4HEA6 4ME6A 1CR4A 2CK3D 3PUHA 3SGLA 3UICA 3ZOKA 4C01A 3GU3A 3UENA 2AEJA 5HFJA 3W9BA 2BGTA 3TF5A 5ABPA 3BSFA 4FFPA 4DQDA 4Z7NB 5K99A 1UR5A 1WUYA 4XSGA 4YH1A 5KMGB 3JVVA 1E7SA 2YJGA 1JG4A 3M8KA 4RPLA 3FTPA 5C81A 2G40A 4AM8A 5DYGA 1ZEMA 3CEAA 4L72A 5GZ3A 4ZYYA 4JQSA 3A3YA 5F9MA 3HR7A 3KSMA 1KO1A 2EKQA 3VDQA 2GJKA 1BWQA 3UQZA 1CY7A 2OORC 4X91A 1FFXA 5BWBA 5MDHA 2C42A 1SBHA 1SWVA 4BJ6A 2BEVA 2Y4OA 5KC8A 3LUBA 2XYHA 1MRSA 1NUAA 1OFUA 1T8PA 4YO8A 4YRQA 1T5IA 5H70A 3UHFA 5BN5B 1TVKB 5BMVA 3KLBA 5DXAA 4GBGA 1ZINA 1YDHA 2ZRDA 3H83A 1EI9A 2NNLD 3WB2A 5KYUB 2FETA 3W90A 3P9CA 4MW0A 1PT7A 2ZT8A 1GTJ1 5CFMA 2DUJA 4MGEA 1J0DA 2AI3A 1UAGA 3I2GA 3K30A 3PFBA 1U80A 5D84A 2X4IA 4C6RA 1O94D 4EVIA 1RRFA 5EJ5A 4XVCA 3AFGA 3RPEA 1NG1A 3P96A 1DIGA 1KJYA 1BDBA 1M6VB 1XTTA 1DV1A 2FVXA 1E1CA 1GG5A 1S02A 3I2FA 1GV1A 4K86A 4JVLA 3HWSA 2H7XA 2ZBDA 3HBAA 4DUGD 3M6LA 2BFEB 3PJFA 1EK6A 2BJWA 1KKLA 2P4SA 4MDHA 3KSZO 4TZKA 4Y18A 5IVIA 4CT0A 1K6JA 1TOAA 5JQGB 1M2VA 3FMPB 4IMJB 5LLSA 3TQQA 3ZZ0A 4EWLA 2H06A 4MVCA 1WQ1R 2I2DA 3GC6A 2Q4TA 4JYZA 1O0BA 4B82A 4P7FA 2FUKA 2A9KA 3PVZA 4RQUA 2JIOA 5JR3A 5FUQA 4EJSA 5AVUA 3RJMA 3GZ4A 5IMSA 1P4GA 1ZIPA 2ERYA 3RKSA 2BMDA 4RK5A 1G59A 3KEOA 2J31A 2CDRA 4JV5B 5C34B 3RFXA 1XD2A 3RS4A 2IDZA 2C4WA 4A15A 1BROA 3MF4A 2ZZMA 1EWQA 2CFSA 1HKHA 3BAFA 4CL8A 1C0LA 3AG5A 1RBMA 4ZOEA 3LXXA 1ZVJA 3PWTA 1G19A 2ONZA 1FP2A 2V3WA 3CC8A 3INGA 3O84A 3RJTA 1RTTA 1PEAA 3HUTA 4EVRA 2HQOA 1YU6A 1SJ9A 3G5UA 3OMWA 3QBEA 1MB2A 3LPAA 1OFGA 3TB6A 3HUUA 1L7OA 1QDLB 4F3KA 1HM5A 1KHHA 3E3AA 3OFNA 4N9WA 5KTPA 1KMIY 1J0EA 3IALA 3E1GA 4WJKB 4BMPB 3X0DA 1M8JA 2CXHA 5IS2A 4G0PA 3HUDA 3EXIB 1DBVO 1QE0A 2FHSA 1OD6A 3DAHA 2UUAB 3GQVA 1KDOA 5DYNA 5FLKA 4MRNA 2OEPA 1WPQA 2FWIA 4AMYA 4DA9A 1RBYA 1VL6A 1BDHA 1E3DA 3WBFA 1E9SA 2GBLA 2PUJA 3Q2IA 4M1QA 3BD8A 1P4JA 2X76A 2CHFA 5I3ZA 2X4DA 1H0KA 1NBMA 1W47A 4PFKA 2XNDA 1NY5A 1GTMA 4LNUB 4Q39A 1TTHA 1JDPA 3QX9A 5A7GA 3AONB 4ZVUA 1TKBA 5E6RB 2BW0A 2F43B 2B7LA 2H31A 1WETA 3DE6X 3HVIA 3ZHOA 3CX7A 3HP7A 3MSCA 4BKPA 3DWIA 2J87A 3F1KA 4B6PA 1VRWA 1KL7A 2C59A 1USIA 2NW6A 4MYRA 1NKSA 4U7WA 4RHXA 3UAWA 3HSKA 1SKQA 3V4PB 4BCDA 2GH1A 4R40A 1HYQA 1ZM3A 1YK1A 3SKYA 2PXXA 3Q9SA 3TR5A 2YJ6A 1B15A 1RLMA 1TIBA 3VOTA 1DXYA 1VLVA 2N46A 1ZLYA 3LYLA 4WRRA 2MSCB 2G9NA 4BGIA 4J0KA 3NASA 3OT4A 3MTEA 3SQNA 2IPNA 2PBZA 3TFQA 2BC9A 3L0BA 4JLMA 5KQSA 1IAVA 2P4HX 2W6IA 3EDQA 2ZRIA 2RC5A 4EEZA 1GNRA 3H9CA 2QM7A 2Y2UA 1PZHA 5GGYA 4M9RA 4HYQA 4ZOLA 1BMDA 3EMDA 3P7MA 4YV7A 1LU9A 3W2FA 2XE4A 3COWA 3CZCA 4Y2TA 4DSNA 3THYB 2VWPA 3ZGNA 2M1XA 2Q50A 1QRAA 3IVCA 3Q1LA 3O1JC 2FUEA 4B71A 3E3LA 5ELXA 2XZLA 5SYMA 2GAIA 5J4LA 5EXEA 2WZDA 4ZV4A 5H59A 5E7MA 4KWEA 1CZOA 3RV4A 5CH8A 2IZ1A 4WZBA 1CUVA 4H6VA 2EGUA 1L7NA 1PDWA 2OGSA 2WVJA 5DISB 4W4TA 1QG0A 3U4IA 2KLHA 2QNRA 4FOTA 1UK8A 1RQRA 1T4CB 2XOKA 3KDAA 3VTFA 3GPIA 3D7SA 3M3HA 3HU2A 2GDJA 4J29A 1EFTA 1WOYA 1XTVA 2HQBA 1P9LA 5D87A 5NULA 3A05A 2CDBA 2JEYA 2PSFA 3BIWA 4MICA 1ZCAA 4AMVA 1ABFA 2PD6A 5BN3B 1ULAA 2GLUA 1NZDA 1C1YA 4X95A 3CLUC 5EP3A 2FEAA 4M86A 4BNLA 2UVPB 3Q9UA 1C3OA 3ZJ5A 1P4RA 5B4UA 621PA 5K0ZA 1DTEA 4Y2VA 2FMKA 3AEXA 1GPUA 3L2OB 3T1QA 5KQMA 4CJXA 3V4FA 3AIIA 4AF7A 3MM4A 4MJXA 3H11B 1PQ4A 2QN6A 1W34A 2PLWA 2XGSA 1YKGA 1R0CA 2IE8A 3F98A 2XY4A 2OE2A 4FDUA 4GPBA 1YS1X 1EVIA 5IN5A 4D0NA 1LBSA 4LOAA 4FFMA 5E6UB 1KOGA 1C3JA 1GKKA 1H3FA 1RE0A 2HD4A 1T0BA 4LZZA 5EMNA 2X6RA 3LQ4A 3UJDA 4G84A 1P0QA 4NDZA 2IUTA 3PE3A 2GEJA 4EYQA 3HU1A 3OFKA 4AN4A 1KO4A 3NNNA 3OQIA 3BJEA 4I08A 4I1UA 1CRWG 3IRUA 2ZLBA 1TCUA 3OLVA 2CXNA 4Z5XA 5K0GA 1ZMBA 1NL3A 4FEGA 4CRWB 1J7KA 4H6WA 2Y71A 1NF9A 2O2HA 4MS3B 4JLOA 4AVYA 4CQJA 3PQCA 3QVUA 4QJIA 2QU8A 3GBVA 4JLNA 2OB2A 4Q37A 3D5EA 3H8SA 4P81A 4RFLA 2NYUA 2XWBF 4YREA 5M04A 5G0SA 4G24A 1F8GA 4IDHA 3UHOA 1P9NA 3NHBA 1E3QA 2IZZA 1DNPA 2FN7A 3G9ZA 3QUTA 5C53B 3MYYA 1XMPA 3JQ6A 4Q3KA 4ROTA 5A4KA 3WGQA 4RFVA 2AS0A 4C2AA 2XT9A 4CQLB 1QOPB 1LK0A 2RKWA 3GMTA 4LHSA 1LDYA 5TGDA 2A5LA 2FPIA 1WXQA 1B73A 1UJBA 2NACA 3JWEA 4E2WA 4JUIA 4X7BA 4OMUA 3ERCA 4C3UA 3G0CA 4YIHA 2VSQA 5KWSA 4RC9A 4OOFA 2C8VA 4TKUA 1FSSA 2NU6B 1TCCA 3ORFA 4TL9A 2CMFA 2VYCA 4ZAZA 1K66A 1LRJA 1R1DA 2P0YA 1BQ3A 3WWOA 2Z9BA 1ZCZA 2ZYVX 1TLLA 3OC0A 2P9FA 1A7KA 1TYBE 1NR7A 1J4AA 2NAFA 3DYVA 1PV1A 2FFAA 1PGQA 4G25A 1U3WA 4RELA 2V3CC 3NFRA 3TSZA 1P2FA 2I87A 4YCMA 4HB2A 4HGNA 2DLDA 3GFRA 3R3SA 4EECA 5KOIA 4MUJA 4BO4A 3CZRA 4E14A 4LCEA 1DT3A 5ITWA 3THOA 1U0GA 1ONSA 4G5YA 1DOAA 1D09A 1TCAA 4UBJA 3U4QB 2HCRA 2PSDA 3WZMA 5LOVA 1R4MB 3T3DA 1E2UA 3LA8A 2PYZA 3DV0B 2EX0A 3NEPX 1PJBA 2IT1A 4K40A 4MS4A 3FGOA 4Q3LA 5BT9A 3WS7A 4DAOA 2V8BA 2JZOA 4OJTA 3PDJA 2VBGA 3A1NA 1GPJA 5DDIP 1FX0B 4L1KA 2OO5A 4D41A 2ZYSA 1Z6AA 1VBMA 4G4SO 1W4BA 1WEKA 4WFKA 4O4JF 1YZFA 5EHNA 5KNCD 4ODIA 5AKLA 3CVUA 3VTKA 3ZDCA 3W6UA 4KE7A 1L1FA 3MJCA 4L4XA 1I6KA 1PJLA 1ONOA 4P9NA 3KXLA 3T3HA 1TM7E 5DM1A 1WA5A 4F12A 3KXKA 4LHXA 4UM9B 1Z6QA 3FHOA 2QW1A 3AIKA 3OSZA 3FCUB 4FWTA 1KSHA 3GLGA 2NO0A 5H81A 3GNLA 3C45A 3RODA 3ZW8A 5AM4A 1UKBA 3P2YA 4LWZA 4XDGA 2XXAA 3ELYA 2XCRB 2HWXA 4GNRA 3PFCA 4OLFA 3JSAA 3FFBA 4LZAA 3W8FA 1J8QA 1BAPA 1L5GB 5FFNA 5IJAA 1DC4A 2DJ5A 2WK1A 3UAOA 1FLDA 5BW5A 2DQ4A 1T3LA 4QRDA 1W4LA 4CHTA 1IFXA 1OT3A 2YV1A 1D1SA 5BSVA 3ENWA 2NVOA 4PO8A 4YRAA 2CVQA 3HWRA 2CCKA 2IDJA 3E0QA 2FG5A 4K6GA 3V7YA 3V8VA 2NP7A 1YB5A 5FUWA 3KAKA 1R3UA 1Q1BA 1COWA 3P9KA 4L07A 2BEVB 1NVKA 3K6KA 3VO8A 3WK5A 5KJ1A 5KYXB 5EHZA 5C1IA 3DOEA 2C7VA 5BMVB 3G9UA 1GY8A 1H6DA 5ICFA 3WJAA 2I2AA 2WJWA 3HXKA 2I1VB 4UUBA 4UXJA 1RR6A 3PKJA 2I9PA 1HFJA 1RMYA 4O4IA 1Q6ZA 2QPOA 3L49A 3I4FA 4FP9A 3IXMA 2E4XA 5AW6A 2FR1A 4MA5A 4ASUD 1GILA 1OFHA 1TYCA 2E4YA 2PLRA 4UNNA 3FDFA 3L6BA 4IO0A 2P35A 3CCBA 2OHXA 3OQBA 1KZHA 3VC7A 3VHXB 4D9FA 3JZMA 4E4YA 1QU3A 3P19A 4Q9KA 3INRA 1E1CB 5LBIA 2VJDA 1QQ6A 2V7GA 4ZRDA 1P2TA 1OGYA 2H4WA 1HPLA 4AYTA 1A5AB 4LKOA 5EOVA 3P2EA 2HY7A 4FOOA 1B6SA 4HF7A 1LSJA 3MLEA 3W3ZB 4BLVA 3TTYA 5B2ZA 2Q28A 1USWA 2QD5A 4EJSB 3T7KA 2O2DA 4BQSA 5HIMA 2OBXA 4ZCPA 2EVWX 1CVLA 2FMIA 3BRWD 4O63O 4ECEA 1G20A 3SJBA 3QBTA 4YMTA 3ZV3A 4F9EA 5HZKA 2CE7A 3LBNA 1FYXA 1U0SY 3MOGA 4MYTA 3F46A 3E2MA 4MYDA 2D3TA 3GJYA 1GDTA 1GT6A 1QVVA 3W5HA 4ENPA 2J7PA 5G0VA 5EFZA 1L0BA 3CUKA 3AXSA 3G8BA 4NCXA 3DWFA 1M1YE 3C6ZA 4EFNA 1FLNA 3U9TA 3OE1A 3BXFA 4CG1A 2CNKA 2OLKA 1I5RA 2Y0DA 1KC1A 3I2YX 3WGYA 3ZDFA 4YJ3A 1GLNA 5FJJA 3G8YA 4AP5A 3HEAA 5K0NA 1RSZA 3V8BA 4EA7A 2GN4A 2WAAA 2SKEA 3KQNA 2YWDA 5AP9A 2BMWA 1DKUA 3WDKA 5LFAA 1TC2A 3ZVKA 4GMKA 3DVAB 2N75A 2XZPA 1T9CA 3FUCA 3I32A 5HQJA 5KSWB 3OQNA 4GZ6A 1V47A 4CMBA 3ORSA 2PAFA 3AM3A 4DUYB 1U3VA 3TX2A 4A03A 1KF0A 5JADA 2CNBA 1YE3A 3GP8A 1BH2A 5L3QA 1G8YA 3AR4A 1Y3CE 2BFWA 2XGMA 3JYPA 1DEKA 2J33A 1ZK2A 4OJQA 1CY4A 4A6DA 4E5YA 5JUWA 4BV9A 1D2GA 1Z6XA 1AZSC 1G17A 1NXSA 1SZDA 2R7MA 2RDMA 1ABEA 3KDSE 3WICA 2NUPA 4C0SA 4Q7QA 2UYCA 1CF2O 4RY9A 1XZJA 5ESRA 1D6SA 4V0QA 1E3EA 1NJ8A 5HXAA 1NLYA 1MIHA 2VEDA 3D31A 3Q6NA 1DHTA 2QS9A 1DO8A 5JAIA 2QUJA 1Z4NA 3K9LA 3HYRA 3ZZNA 3MSXA 4Q21A 3CB2A 3GWGA 1QJCA 4GPEA 3PNPA 2PLAA 1UJMA 3FMIA 3QTTA 2OTCA 2I54A 3QMPA 4KO8A 5EN4A 4ZVNA 5DHRA 5KOYA 2BF4A 3MRXA 4HDMA 5JC1A 3ZJVA 4REQA 4QOJA 2H57A 2P8SA 3GLSA 3H2IA 3GFQA 3RU3A 4BJHB 1FA9A 1K8RA 2GAFA 1PHPA 1XN1A 1YZ3A 2GTIA 2NXCA 2WG1A 2XA2A 3EIUA 1AKRA 4Z8YA 2B3TA 4HAZA 4DLPA 3QIAA 3R24A 4KXLA 3BEDA 5LZ5A 3IVGA 1FP4A 3AKEA 3FCEA 3LGSA 2ZETA 4KW7A 4JWKA 2JGJA 4QRHA 4RVNA 1P75A 2R2GA 4QPCA 2FW0A 3Q5GA 3D8NA 3STXA 1HORA 3WHKA 5K4HA 2QDKA 5F2EA 4JXZA 4F91B 4OTZA 5EUMA 5KNCH 5JJ5A 2IHUA 1TTTA 3Q3GE 3RYTC 3HKCB 1DKPA 1B2LA 1EFLA 1FNNA 1KY2A 2WHRA 3B48A 3OPVA 2H4FA 4KXYA 4WZBB 4S05A 2PWPA 1EM8B 1N2CA 1OASA 2D74A 1WUTA 3IUSA 3S29A 4MZXA 1KO7A 4TXNA 1IEWA 3CX6A 3RSLA 3RTCA 2Q3EA 3GT3A 4EABA 1O77A 2EKZA 1NN5A 4M0PA 3M4YA 1Y4ZA 1CE8A 2GCPA 3AF3A 4OYLA 3RUIA 2P7IA 4GP7A 2I2XB 3TL2A 1TM3E 2BSAA 3OBIA 4MYCA 4B17A 4A7PA 4EL5A 4IVQA 1AG9A 4LISA 1QTNA 3KR9A 1J0CA 5GZ1A 3BF7A 1M10A 3GIWA 5FBZA 4FHZA 1HL7A 1D7OA 1NUTA 1HK7A 3LS2A 2G72A 3OKCA 4X63A 4XPIA 5ALJA 1OT5A 4I4IA 4I46A 3GX1A 4B3TB 3PQ3A 1IBRA 1YQGA 2PYDA 2ANCA 4Y8VA 3ETNA 1QYIA 1E79A 2V7BA 1NN0A 1PZFA 2GD2A 3I01A 1Y3AA 4RK1A 5CPBA 2O2GA 4AZWA 3NJRA 4TTIA 3QPWA 1GRQA 1O4VA 5TQ2A 2A0KA 4QLOA 1W6UA 2DB3A 1U0OC 4IDFA 3QEAZ 1W25A 4Q6WA 1GUFA 1CB0A 4RSHA 4J1QA 4TROA 1IH8A 4QDKA 5ECWA 2EFDB 1CVRA 1PVVA 3CH4B 3AETA 1YI8A 3QLVC 3UJBA 5I4IA 4Z53A 4U7PB 1TU4A 4ZYVA 1TM1E 5F3WB 5IG2A 4F4JA 3C6XA 1FU4A 2ISSD 2GMWA 1G0OA 4GUDA 3ZCVA 5CD9A 1DU4A 5KYUA 2CBXA 3EG5A 4G1UC 4WK4B 5ALOA 3S1AA 3ZS8A 3KE9A 4LI0A 2P9HA 1Q0LA 1OZGA 2XCLA 1BEEA 4RSGA 1T0JB 4DWVA 4LECA 3A9SA 3WQRA 4C7XA 2H8KA 2O1XA 2B94A 1QLHA 3H5TA 2ZJ0A 2O2YA 5IYZF 4YUZA 1LS1A 2X8BA 3AY6A 2HSEA 3NWJA 2PJRA 1N4DA 2Q2OA 4BNFA 1KI2A 1N2SA 2CN1A 5EP1A 1S6YA 2FX5A 4XD7A 2O5CA 4G63A 3NBMA 4NSNA 3VAYA 1NY6A 2E7ZA 5C7IO 4TS4A 4L50A 2VTEA 1J23A 4LRTB 1UC4B 2BFMA 4KFSA 4ALMA 5HDBB 3GXOA 1MIOA 2G3YA 3I37X 3FVTA 4I55A 1T25A 1RJ9A 2W6JD 4I99A 1UOEA 1IZ0A 4BLUA 3N70A 4DSOA 4P53A 3K8QA 1W5EA 1MAAA 5IEBA 1XMQ