4FJ0A

Crystal structure of the ternary complex between a fungal 17beta-hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
260
structure length
260
Chain Sequence
YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17beta-hydroxysteroid dehydrogenase
publication title Structural basis for inhibition of 17 beta-hydroxysteroid dehydrogenases by phytoestrogens: The case of fungal 17 beta-HSDcl.
pubmed doi rcsb
source organism Cochliobolus lunatus
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fj0A00
3GR6A 4DPLA 2JHGA 1X7DA 3QWFA 5L40A 2DC1A 3EUWA 4L74A 2NQ8A 1ZKMA 4IS3A 4OHUA 3AI3A 3OECA 3WG9A 1ULUA 5JFOA 4IDFA 1YOVB 4KUGA 4D41A 3TZ6A 1RPNA 1WW8A 2QZZA 3C1TA 4IZIA 1M2WA 1E3JA 3KYDB 3GDGA 4PRLA 1X7GA 3IUPA 2CDBA 1NHGA 3NJ8A 3WGGA 3ZDFA 4GL4A 1GZ6A 3B6ZA 1T2CA 3BHJA 2EIHA 3VH2A 2UDPA 5HBRA 1E7RA 3NYWA 5ENVA 3LT1A 4XX0A 4YAKA 3CIFA 1R15A 4YRAA 5K6AA 1ENPA 4A27A 1IUKA 2G82A 1K89A 1C1DB 1VL6A 2NVBA 4KTTE 4XWYA 3FCOA 4JGBA 3ENNA 1NAHA 2CF5A 3IMFA 2Z5LA 3E03A 3QVTA 1SBYA 5JDIA 3JQAA 1P45A 1HE4A 5C7OO 5AOVA 4IQGA 4OL9A 5CHEA 1X7HA 3AFMA 4PLCA 4NH4A 1EVJA 3ZHYA 4HP8A 3ZW8A 4WLOA 3TL2A 3KSUA 3DBRA 1HDGO 3WBBA 2AE1A 1LDMA 2BRUA 4UUMA 2O3UA 1GYRA 2B83A 1PWZA 3U4HA 5JNLA 4E13A 4BGIA 3BTSA 1T2FA 3A06A 1W6UA 2FZEA 1BXGB 1PJTA 4DUPA 1Z73A 4YT8A 4IDAA 4MVJA 1F0YA 2AA3A 1EUDA 4AJOA 4BUCA 5KVSA 5FWNA 3PRJA 2H1SA 4L75A 3QE3A 4J2OA 4OKIA 4XR4A 2NLOA 2OBNA 3SC6A 4CMAA 2PZLA 1JKIA 4YTEA 1UZLA 1JDJA 4XCVA 1LC0A 5IFLA 5K6AC 1NQ5A 3GRPA 3K6JA 1JA9A 4W7HA 2WE7A 2I9PA 2BFAA 2X9GA 3AI1A 1SPXA 3DZBA 3ROMA 1GQQA 1H93A 4E2ZA 1TI7A 3WQSB 2AQIA 2EXXA 1IZ9A 1FXSA 4I08A 3WDSA 2W2KA 3P7MA 4NG5A 1PJBA 5JDIC 3N74A 1BTOA 1PQWA 1V35A 3JQGA 2GN9A 4ZJUA 1P1IA 5DZSA 1DFIA 1MXHA 2E49A 1NBOA 5EMHA 5TF4A 1CQJA 1VSUA 1YJQA 3RCBA 4TZTA 3C1AA 2R6JA 4A7PA 3QRWA 4AJPA 1XU7A 1YB1A 4QT0A 3ZNOA 2A9FA 4CMBA 3BA1A 3OEYA 1EMDA 1HTBA 1BHSA 3D0OA 1LJ8A 4YRBA 2P9GA 1DHTA 2CY0A 1KEUA 4WCFA 4XGIA 4J7CA 3IUSA 2X8LA 4FPXA 5A5EA 3KZVA 5CAEA 3HJAA 4E2XA 3ZWPA 1O94A 1YVEI 4OQYA 1C1XA 3ZV6A 4IS2A 3BMNA 5L4SA 2JHFA 2CF6A 1EE2A 3DFUA 4M55A 5JPIA 1KBZA 1XQ6A 4GVLA 2ZTMA 4QXMA 1FF9A 3GVXA 1VL0A 4FC6A 5EERA 1V3VA 3GA0A 4ZU3A 3WIDA 2G0TA 4BS9A 1HDZA 1IULA 3HE3A 4ND2A 1DSSG 4FIZA 2NQTA 4GQAA 4Y67A 5F1OA 4HKTA 3TN7A 2BELA 4E32A 3RC1A 1ZO8A 4XR9A 5DP1A 4ZVVA 2NTNA 5JYDA 4P4GA 4UVHA 2AG5A 3GQVA 4RVGA 3UGKA 2CFCA 3GG2A 3Q6IA 1LBEA 2PTGA 4RDHA 1UP7A 1E3WA 2O3QA 2QYTA 3A14A 4J49A 2I76A 3I5MA 5ICSA 3PHIA 1PZGA 4J90A 4RF5A 3X2EA 2PLAA 2EGGA 3F4BA 2O3JA 3HZZA 1NQAO 4WCFC 1NNUA 5B4VA 1U3TA 5B4TA 1P3DA 3M2PA 1W8DA 3RKUA 3EVNA 3WWYA 2Q2QA 3E9NA 3GN2A 5JO0A 4BV8A 1ZW1A 4MPDA 1TT5B 2EP5A 1GQ2A 1D7OA 3PP8A 4J91A 2HMTA 2O4CA 2VN8A 5I8ZA 2ZB8A 3PHGA 4PG8A 4K6FA 1MGOA 3W6ZA 1Y81A 5A9SB 3I83A 4TWRA 3ZNQA 2BD0A 2ZJ0A 3S2GA 4B79A 4BNNA 1JAXA 2I99A 3M6IA 3JYLA 4XJSA 3JQ8A 1YJ8A 4C7JA 2D0IA 4B7UA 1P1FA 1I0ZA 4XKJA 1BXKA 5I7VA 3JQAD 1LDYA 4RDIA 3VZPA 5BQFA 1DIRA 5DULA 5DOVA 1YBVA 3GDFA 1HKUA 4BKRA 2B4QA 4YVFA 5GMOA 2Q1TA 1O95A 2DUWA 2W4QA 3LSYA 2VYNA 3OIGA 1LTHR 4NIMA 2D2IA 5L7TA 1WVGA 2EF1A 3N58A 4FJ0A 4K6CA 2BKAA 3NX4A 5L4LA 4MIOA 5I7SA 3H4VA 4M54A 1IL0A 2D8AA 4CUZA 3FF4A 1JVSA 2DQ4A 3QWIA 4MVJD 2CDAA 4MP6A 5G0VA 3VZQA 1G0NA 4Q3AA 1PL6A 3DQPA 2G76A 5IZCA 4XQCA 4AG3A 4PZCA 4ALMA 1IPFA 5KJFA 1X1EA 3OQBA 1ZJYA 1LRLA 3RFVA 3OJEA 3I9LA 4N5MA 2RAFA 1KVSA 3OIFA 1NPTO 2BLLA 1YE3A 4D42A 1F8GA 1DIAA 4YJGB 3LVFO 4FN4A 2PD4A 2B35A 1UP4A 3GVCA 1R4MA 5ILOA 4E5YA 4KP7A 4BNUA 1YDEA 5JLAA 1ISGA 1E3SA 4CLRB 1I5RA 4FCCA 4CMJA 4KUHA 1MA0A 2Y1OA 3A4VA 5DP2A 2YZ7A 1AXGA 2QZ9A 2Y0DA 2DM6A 5L51A 3NTQA 4XIJA 3RROA 1EUCA 3JQEA 2X9NA 4WECA 4PLFA 1CQIA 1U5CA 4J6FA 3UHAA 1C0LA 3AUTA 3JYOA 4IDGA 3ROQA 3SLGA 4B3JA 1DJQA 4TRMA 3MCVA 4GWGA 3LC1O 1J0XO 1RM4A 4LW8A 5TSDA 2D1YA 3SX2A 1XHLA 4E33A 3ROKA 5KKAA 2XOXA 4W6ZA 4DREA 1DAPA 3ST7A 3EC7A 1I24A 2Y99A 2FRDA 4JXKA 1ZXLA 4W9NA 2HMSA 4JX8A 4WE3A 5IZCC 3S2EA 1B16A 5A5FA 1T4DA 1LX6A 1AE1A 2DUUA 4CODB 2FZWA 4OXYA 1WLYA 2XAAA 4DL9A 5JE8A 2YV3A 5KVQA 5THQA 3G0OA 4ONEA 4P22A 3JQAB 4L4XA 1HLPA 1TXGA 3VKVA 1QYVA 4GMGA 1QV6A 3ZWWA 4Q3NA 1BMDA 3NTOA 5FI5A 2QX7A 4U8GA 3HWRA 2ZTLA 3DBRB 2FOIA 2BH9A 1Y8RA 1LC3A 5CG1A 2NM0A 3E48A 1XR3A 4FFRA 4GLLA 4PIVA 5HS4A 2QRJA 3MWDB 3OF2A 4R68A 4EEZA 5DBGA 5KNLA 1I2BA 3GEMA 2HUNA 3DOJA 4HADA 2Q1UA 3RSHA 5KVVA 1KOLA 4DPKA 1GFSA 3OP4A 3EW7A 4IXTA 1DIGA 5T5QA 2Q46A 4XZ3A 1ONNA 4J9VA 1K6JA 2GN4A 4LGVA 3PJEA 1I3MA 3GVPA 4DIFA 2C20A 3VAZA 1MV8A 2VUUA 1IHXA 3GGOA 4W9NC 5IXSA 2HSDA 5THKA 1I2ZA 4TVOA 3GHYA 1E6UA 5L7YA 2BFOA 2W98A 2E4AA 3K31A 3VTFA 1O9BA 1U8FO 1VJ0A 3AY3A 4MP3A 1C0PA 4BO4A 4E31A 4II3A 5DN9A 2Q1SA 4NFYA 2TMDA 4CV2A 1R0LA 2W2KB 1B26A 1SEPA 5CG2A 5KWEA 1LSSA 3KRTA 3H2ZA 3G79A 2W90A 3SEFA 4BNYA 4GAEA 1Y8QA 2FWMX 3JQGB 3TSCA 3VH3A 5B12A 1NYTA 3INGA 4RZHA 1EE9A 3SC4A 3JD4A 2E82A 3GT0A 3Q11A 1DRWA 4KDEA 4EJ6A 2WD7A 2F1KA 1MLDA 5U4QA 2YV2A 3ON5A 4FFPA 4RPHA 1UDBA 1ZK3A 1PGOA 4O59O 4OJNA 1AUPA 4O1MA 3EDMA 1FDUA 1DLJA 3DB2A 3FBTA 4TRRA 3VH4A 2QRLA 4DQVA 4BO2A 4LVUA 3E1KA 3P2OA 2VYND 5A1TA 4WCFB 1LDNA 1NFFA 2P9EA 2LDXA 1T1SA 1FDSA 4IJKA 4PLTA 2X0NA 4YA6A 4B4OA 1C1XB 3LQFA 2PV7A 3ITKA 3D4PA 4WEQA 4YWJA 5H83A 5JCJA 4PRKA 5J23A 3BMNB 2FSSA 3PJFA 3B1FA 4MOWA 2AW5A 3AK4A 4A26A 2GASA 5ENDA 4L76A 3K73O 1GDHA 2WD8A 4RORA 4WLUA 1UZNA 3TJRA 4NI5A 1KEVA 4JBIA 3GVIA 1NFQA 2VTEA 3EZYA 3FNEA 2AEMA 5F1KA 1U1IA 3FD8A 1HWYA 4XQGA 1CYDA 8LDHA 3IL2A 2P68A 2WYWA 3IC5A 5A9TA 2X0RA 2EKLA 4CQMA 1YL7A 1FMCA 2E6UX 1E3WB 2GUGA 3KVOA 3QVSA 3UCXA 4UVEA 4YYZA 2AG8A 2GZ2A 3K96A 3G49A 4U6QA 4UEOA 3VHRA 4B4WA 1GTMA 4E2YA 1GEEA 1H0KA 2C2YA 3F6YA 5JMWA 2G17A 3RI3A 4CV0A 4KTVE 1H6DA 4OH1A 1H6CA 3L9WA 3LDHA 3U9LA 4RPJA 3U09A 2V6BA 1F12A 3KO8A 5HS6A 2A35A 4OIMA 2AE2A 2EGHA 1H6BA 2D4AA 3PIIA 4L0QA 4LMRA 4W7IA 5A05A 4F3YA 1HZZA 4DYVA 2JFFA 4ZQGA 3ANLA 4ALNA 4RGBA 3JQ7A 1YB4A 2YYYA 2HJSA 4HUJA 4J9UE 3CEAA 4RO0A 4C7KA 1EDOA 1P9LA 4ZRMA 5JC8A 3RAJA 4GX2A 2PGLA 1TA4A 1E6WA 3JQ8B 1R12A 3WGHA 3RBXA 1PU2A 3FI9A 4NJMA 2OHXA 3K2EA 1K0UA 5KIAA 1G6KA 4MKRA 3ITDA 4PG4A 4BMNA 1TVEA 3L07A 1YQGA 3QP9A 4DPMA 3GN1A 3T7CA 4JP2A 1DJNA 4IJVA 3Q0EA 1MXFA 4Z9XA 3DO5A 3DZHA 5H81A 2OO5A 3DOCA 1NP3A 4CL3A 4RZIA 5DF1A 1LRJA 1Y5MA 2VWHA 1AXEA 2GDZA 2PD3A 3DBHA 3PPIA 1EK6A 3TZCA 3UKOA 4CPDA 2JCYA 1RWBA 2CSUA 3NRCA 2X22A 4ROSA 2BGLA 4IIUA 1JTVA 3HADA 4YJHA 3DHYA 3O38A 2VZ8A 4A03A 2DFVA 2OP1A 3U49A 3WFIA 4EITA 1GV1A 1PS0A 4CMCA 5AXBA 3KLPX 4CM1A 1UXHA 3WYEA 5ITVA 3QLJA 4IQ0A 4RPLA 4EW6A 4GSKA 5B1YA 3NTRA 1WMAA 3OM9A 2O3SA 2YHUA 1PZEA 1GQYA 2I3AA 5JS6A 1F17A 3IAHA 3GZNA 4Z0PA 5C37A 5AXAA 3GUYA 1UDCA 3BTOA 4YDRA 1HE2A 1GCUA 1L7DA 2AEFA 2HK7A 4XDZA 5TT0A 3ETEA 2JD1A 4CQLA 1R4MB 1LQTA 1E5QA 1T2DA 3KSDO 1YQXA 3SVTA 4BO5A 1EVIA 5B37A 2WYVA 1NPYA 3TWOA 1OZAA 1V9LA 3PGJA 1RYDA 3T4XA 4ITUA 4CMIA 4DWVA 3FPCA 2EG9A 2YFHA 4TRNA 5IDXA 1H2BA 4GSLA 1KC3A 1BG6A 5CPFA 5KJ1A 3PIDA 1HEUA 5T67A 4DBZA 5A04A 4HNHA 1HDCA 2PGDA 4G65A 3HUDA 3RU7A 4FJ2A 2H5LA 4INAA 1Q7CA 3OEWA 5IN5A 2NTVA 1O5IA 3EZLA 5GZ6A 4E0BA 4XYBA 3V2GA 3L77A 3W1VA 4IQ8A 4ND1A 3S55A 5F5NA 4Z3DA 3A28A 3STHA 2PKQP 4RPKA 3NV9A 5JCJD 4GVXA 3C1OA 3ORFA 3DMYA 1GV0A 3PWZA 1YL6A 3VPHA 4E2WA 4EDFA 1U2GA 2JAPA 4CLXA 4YACA 2VHWA 3GPIA 3ZHZA 1HXHA 1Z7BA 3ICCA 2P4QA 2Q4EA 2UAGA 5JY1A 3V5NA 3H2SA 1ADBA 3OJLA 3MWEB 2QIOA 1CF2O 3FR8A 3PGXA 2VWQA 2G5CA 2NU6A 2IZ0A 1Y8RB 3I9MA 1I01A 2HMVA 4QQRA 2O7QA 4BO9A 4LSWA 1BW9A 3QA9A 1SO8A 4MKZA 1VC2A 1P0CA 1PWXA 3H65A 5EQDA 5A3VA 3Q1LA 4CQMD 5G0UA 3GF4A 3DDNA 3U3XA 5JAMA 3FBGA 1C14A 4KDFA 4N5LA 4BMVA 1M67A 1U7HA 3KYCA 4R9SA 1E1KA 2W2LA 3PDJA 3O8QA 3KLMX 1PS9A 2GZ1A 4WCDA 3B1JA 2RIRA 3C3XA 5A02A 3L6EA 1P74A 1Z7EA 1XELA 3EY4A 4BQRA 3SXPA 2D5CA 4PLHA 2PK3A 3ZU2A 2NSDA 2V65A 4XYGA 1M6HA 2HMWA 3H3FA 3AW9A 4BO1A 4FJ1A 3COSA 1DIHA 4BVAA 4FOOA 4ZICA 1I32A 1M6WA 1ULSA 1DB3A 1LNQA 3ZU5A 3RASA 2FSVA 5T6BA 4BGUA 1E1NA 5JXWA 1KEWA 3AOGA 1G1AA 1Y8QB 3KTDA 3JQDA 3PQFA 1E92A 2WWRA 1NFRA 4KQXA 1XQ1A 1M66A 2Q4BA 1PZHA 2EWMA 4YT2A 4PFJA 3ZWNA 2B4RO 4QTZA 2WD7B 3VH1A 1EQ2A 1DAOA 3LU1A 4OKNA 2CVZA 4TSKA 3LC2O 3L9XA 4F45A 3TNLA 3K30A 3ETDA 1A4UA 1K6XA 2Y1GA 4CR8A 4RJTA 3PQDA 4XGNA 3ZU3A 1ZK4A 5HA5A 4CM6A 1A7AA 1JWAB 4AJ1A 1YBAA 3WS7A 4BNGA 4OXKA 1N1EA 4WGGA 3LT4A 5I7FA 4UAGA 1QYCA 2VHYA 4NQZA 1QXSA 4NMHA 4WKGA 3VKUA 3DFZA 4JBGA 1MP0A 3HDQA 3RIHA 3DAPA 1UJMA 4A0SA 4BIIA 2ZJ1A 3I9KA 1XIVA 2IE0A 3F5QA 5GZ1A 3IS3A 2OGUA 5KKCA 2VT2A 3KSZO 1I10A 1Y1PA 2EKQA 2DBQA 1Y5RA 3DZIA 1RM0A 2WTBA 2WSBA 3ZNNA 3AUUA 2HLPA 4CUKA 2Y66A 2NNLD 1GCOA 1YH3A 4JIGA 1BRMA 2Y1FA 3AI2A 3HDJA 3QJ5A 4G81A 2VWGA 4CQMB 2R00A 4DMMA 4Q9NA 3BXXA 1JAYA 5CDYA 2AQHA 4LRTB 4IMRA 1I33A 5AQ1A 1T26A 1K3TA 5FYDA 5DOZA 4UVIA 4XRRA 1I2CA 1T1RA 4WLNA 5TLSA 4OQZA 1EBUA 2BI8A 1ZCJA 4YAEA 4CM8A 2IXBA 5FEUA 1J5PA 5G0SA 3W4IA 4I5EA 3WYBA 3WYCA 2CVOA 1E3EA 1SAYA 3KEOA 4GKBA 5T8KA 4FFOA 2O4UX 1FDWA 2VOEA 4G5HA 3PI7A 1HSZA 3GMSA 3JQ7B 4J2HA 4R1TA 3WIEA 2Y0CA 4OOEA 3VPXA 4XRGA 1QORA 2VQ3A 2Q1WA 1H9BA 3UH1A 3PYMA 3LT0A 1N1GA 1L7EA 4M8SA 1QYDA 4GX5A 3PJDA 2WMDA 4NJMB 1Y9EA 3O4RA 2VHVA 4EJMA 3PDUA 3GH3A 1B8PA 3F9IA 2YV1A 1NASA 2BMAA 1L1FA 3CE6A 5C3MA 1ARZA 4YXFA 1GPDG 3IIEA 4L8VA 1DLIA 1B8VA 5TS3A 1XG5A 1YWGO 1UZMA 2R00C 5TQVA 3DBHB 3NT5A 1QLJA 1MFPA 2EW8A 4MJLA 2DPGA 4OYRA 4R01A 4WLVA 4DQUA 1D1TA 4RF4A 1GADO 3ZHBA 1WDKA 2X1HA 1LXCA 5C5IA 3VDQA 4YJHB 2X23A 3N7UA 3DAFA 4B7XA 3PYLA 1VL8A 2R2GA 4JP3A 4ILKA 1A5ZA 3OH8A 4L4SA 3AM3A 3F47A 1DRVA 5TNXA 4F6CA 2W2LD 4CR6A 3H9JA 1ZVMA 4EUHA 5T8KC 3QY9A 2V6FA 3INTA 4QX6A 5KJEA 1WNTA 1PJLA 3ZZNA 4XA8A 1Y7TA 3GZNB 2FHSA 1HRDA 3GEGA 3GNSA 3U4DA 4FBGA 2J6IA 5ER6A 3PJGA 2RCYA 2CNBA 2VYVA 1XYGA 5L7WA 1TB4A 5K0ZA 4UUPA 4CQLB 4DLLA 3RWBA 2NWQA 3WMXA 4NHEA 2C0CA 2YFQA 2PR2A 1M75A 4R1SA 3E9QA 3ZWBA 2Q49A 3LZ6A 3ZWMA 3OA2A 1JVBA 3WGOA 2UUOA 4HFMA 4BNJA 1QYXA 5C7LO 5I9MA 3PHLA 4CMIB 4BQPA 5ADHA 1VKNA 4JROA 1LDBA 1YXMA 2YY7A 1U4OA 4AFNA 3K8ZA 2OL4A 4Z6KA 4M87A 4WOJA 5DCYA 2V6MA 3CMMA 3HFSA 4FR5A 3ZW9A 3NGLA 4EYEA 5GZ3A 3JQBA 3IKTA 2FMUA 4J43A 4Q39A 3UICA 1U5AA 2YQ5A 4PLPA 4JJIA 1F06A 1AN9A 3G17A 4GX0A 2X0JA 1N5DA 1WMBA 2CZCA 1WPQA 1T2EA 3PHJA 3OFSA 4BKQA 4W82A 1QV7A 3U4IA 1BSVA 1I36A 4JN6B 4BGEA 2X58A 3EMKA 2I67A 1U7TA 3PZBA 2OP0A 3L6DA 3E8XA 4GKVA 2ILTA 4I5GA 4IUYA 4D0SA 1JN0A 3K2BA 3G1TA 1NVGA 1W73A 4D0RA 4R3NA 1OC2A 3PFFA 2WYUA 4BHTA 1KEPA 2O7SA 4U5QA 4K1LA 1GYQA 2AXQA 3O26A 3DXFA 4ALLA 3D4NA 2B37A 3R1IA 2J5KA 4CMEA 4S3MA 4YPOA 5IDQA 2J5QA 1LUAA 2IEDA 3ZWYA 1BW9B 1VM6A 4B7CA 1P1JA 5ICMA 2X6TA 3DOOA 4RQUA 3VZRA 2OFPA 3KXDA 4TZKA 2C2XA 3KYCB 1XSEA 1TEHA 4NK5A 4QEDA 3O8QB 4KZPA 3JQBC 2H63A 3EAGA 1I3NA 3OQ1A 2J8ZA 4A10A 5T57A 3AWDA 3RBVA 1IPEA 4UUOA 1Y9AA 5U9CA 1GZ3A 2Y0EA 2B5VA 4S1VA 3WBFA 4ESOA 1H2HA 3HB5X 4CM4A 3LF1A 1FDTA 3C24A 4DC1A 3QVXA 1B2LA 2NU9A 2X7HA 3TPCA 1BDBA 3UXYA 4WNCA 4MVJH 1HF3A 1Z82A 2HU2A 4J1SA 4WUVA 2RBEA 3H9QA 1H94A 1ISJA 3EYWA 3R6DA 3SJUA 1VI2A 2OOSA 3RJ9A 3PK0A 2DTDA 3RC2A 3UFXA 4BNXA 3UUWA 4ALKA 2Q45A 1ZEMA 1YGYA 4DYDA 1D1SA 1SB8A 2HDHA 2IZZA 1NR7A 5JAQA 3WX0A 2Y93A 4WPGA 3ANNA 4CMEC 4CMHA 2VT3A 4IDEA 3CPSA 5G2OA 1JU9A 2PFGA 1LLDA 3WGYA 5A9RA 5CDUA 3LK7A 1UAYA 4LMPA 2DTEA 2PH3A 4DGSA 3EK2A 1W0CA 1VLLA 2J3KA 4FFLA 1U9JA 4IINA 1LRKA 5DBFA 3I1JA 2VUTA 3CZMA 4RCVA 2DLDA 3RUHA 4A5OA 1V8BA 1XCBA 3JSAA 4BO8A 1E1MA 4MO2A 4DC0A 3L4BA 4IJUA 4MINA 4ZHSA 3F4LA 1P77A 2OORA 4MVJE 1LDEA 2HMUA 1OAAA 3LT2A 4BO3A 4H15A 5DT9A 2PZJA 1P33A 3Q2KA 4E3ZA 3I23A 4IJWA 2I5PO 2WEKA 2HCTA 1GYPA 2IEBA 3OJOA 3D64A 3K92A 1U3UA 2VYVD 1Q7BA 3TDKA 3DWFA 1X0XA 4IGEA 1K6IA 2GNAA 4YCAA 4D45A 2PD6A 3R0IA 5KJCA 2OZPA 1KVQA 2X5KO 2D3TA 1WDLA 3E18A 4AICA 4FQ8A 3V8BA 3GGPA 1AHIA 3HFGA 3H5AA 4RVHA 2A92A 2Z95A 3KBOA 2GERA 4O5OA 3RUFA 4E12A 4TMFA 5L9AA 1BVRA 4N54A 2B5WA 3HSKA 4FFMA 4CMKA 1QSGA 2GN6A 4NFSA 1IB6A 5G4KA 4FSHA 4OMUA 3MJTA 4GWKA 1GR0A 4EI2A 5COBA 3CUKA 5KTKA 4O63O 5HM8A 4CM8B 3CXRA 2PY6A 3KHUA 1OMOA 4XGKA 2P91A 1ONPA 3WSVA 3WTCA 5HRUA 3PQEA 3G3EA 4J1NA 3L4BC 4GI2A 5F5LA 3GAZA 3PEFA 1ZEJA 2NUAA 3AM4A 3SJ7A 4K26A 3QVOA 2C5AA 3DZKA 4I9UA 1PJ4A 2UUPA 2VOJA 3T7EA 3A9WA 4GX1A 2DU8A 3H6KA 3JYNA 4CLOA 1LLQA 3ZNPA 4Z3KA 3FR7A 1SZJG 1I30A 5JDCA 1OFGA 2AQKA 3BAZA 4NU6A 2PZMA 5F21A 4BO0A 2GZ3A 4E5KA 1DBVO 1N7GA 1YS4A 3E6AA 4GMFA 3D7LA 3ONEA 8ADHA 3D3WA 2Z1NA 4LN1A 2DBVO 2B36A 3Q2IA 3ICPA 3K5PA 3NEPX 2Y1EA 4I8XA 1HL3A 5EL0A 1PQUA 3DAGA 3INRA 4OM8A 4Y9DA 3BYZA 4OO3A 1U28A 5CP8A 3WR5A 1X13A 1LA2A 5TGDA 3DL2A 1NXQA 4IMPA 2Z1MA 5JW6A 3H8VA 4B3HA 1KIFA 3FWNA 2DPHA 2BF7A 4LVCA 1DFGA 1LU9A 1Z6ZA 3M1AA 5DNAA 3V2UA 1UXIA 1QKIA 3DBLA 1ZH8A 2GO1A 1DEHA 3BMQA 3DZJA 2EJVA 4BNFA 5F3RA 2CMDA 1XGKA 4E21A 2J3IA 2NTJA 3IDSA 3D4OA 3LF2A 1KY5A 1E7MA 3QIVA 3BIOA 4P4NA 1E1LA 2EHDA 1A27A 2V7PA 4PG6A 5EN4A 4D7AA 3BMOA 1BXZA 4PG7A 4UEJA 4C4OA 3W8FA 3C7CB 4E5MA 2FPGA 5JDCC 3GMDA 1PEDA 4ND5A 5TJ9A 4YT5A 2VTDA 3OA0A 3WTBA 4BKPA 4DXHA 2B0JA 4RVSA 1IOLA 2QW8A 4BV9A 1NQTA 4GPD1 1VJ1A 1JKJA 4LCJA 2OBYA 1ENYA 1HYHA 4U0JA 1KVTA 4NDNE 3S2FA 1EVYA 2HO5A 3QW2A 2PWZA 4CM7A 5A4DA 2PKQO 3CTMA 3WGQA 2VRBA 3UVEA 4RF2A 3TZHA 1WDMA 1BVUA 4HFJA 2JAHA 2JKVA 4M49A 7MDHA 1OI7A 5JAZA 3ZWVA 1PL7A 4L4RA 1R4NA 2EEZA 1T4BA 5CEEA 3CKYA 4CJXA 2X9VA 1YKFA 3ROPA 1SCUA 3VZSA 5CPBA 4Z0TA 3R3JA 1GY8A 2NVUA 5CDSA 2HRZA 3AFNA 3HHPA 4II2A 3WICA 1SC6A 5EESA 3RUAA 1CEQA 3MEQA 1EBFA 4AJEA 2JCXA 3U5TA 1CWUA 4OXNA 4I5DA 1HE3A 1RKXA 3WJ7A 2BGMA 3DHNA 1D4FA 4NBVA 4LCEA 5EJ2A 3JQ9A 2GSDA 4E30A 4J1QA 1K2WA 1E7YA 1SEVA 4DA9A 4OGWA 4GGOA 3TRIA 1PJ3A 4KQWA 3BTUA 5KVCA 1ZSVA 2VCYA 3S2IA 1NR1A 1E3LA 5DCWA 4BB5A 1DC5A 3W4JA 1QP8A 3AUSA 1X15A 4ZA2A 2DBRA 3DMTC 3GFGA 3C7DB 1C0KA 1J6UA 1U3VA 1LEHA 4JQCA 1UDAA 3VTZA 2AMFA 2DT5A 1TLTA 3ZV5A 3QSGA 2C5EA 1ID1A 1ADCA 2J3HA 1XWFA 3ZWCA 1E0DA 2D59A 5G0TA 3GUCA 2PZKA 2P9CA 2HQ1A 1WXDA 4CMGA 2JFGA 2SCUA 3F1KA 1VPDA 4RV9A 4MP8A 1Q7GA 1GEGA 3ZCXA 1ML3A 1A7KA 3MJEA 3A1NA 4D46A 3D5TA 4R54A 1EEHA 2ZQYA 3AUAA 4JCOA 4N7RA 4CM4B 2OUIA 4WK6A 2G1UA 1PGNA 3RKRA 3ETGA 3V1TC 1T25A 3AY6A 3RBZA 3PZRA 3P2YA 2B69A 4AJ4A 2H9IA 4R5MA 4HV4A 1ADGA 2EW2A 4YRDA 1GUZA 1Q2XA 2XF8A 3DBVO 1TT7A 3JQ9C 2X5OA 1Y6JA 2H6EA 3I3OA 5JMPA 1V0JA 5LDGA 9LDTA 5IG2A 5JAIA 3M2TA 2F00A 1PL8A 4RVDA 2BHLA 2IODA 1QG6A 4WLFA 3QV1A 5EINA 3VPFA 4D3SA 3FNHA 4BKOA 4R1NA 4BO6A 4PLZA 3WQRA 3NDIA 4B4UA 3DZGA 2VNAA 4PLWA 3WFJA 3ZWOA 2GPTA 5TIIA 3JQFA 2AHRA 3WOHA 3FN4A 1ENOA 4BKUA 2P2SA 5BNIA 4WEOA 5KJ6A 4WOKA 1R37A 1DFHA 1XLTA 2YJZA 3L4SO 3KV3O 4H16A 3DTTA 1GZ4A 3C85A 2ZTUA 3H3JA 3VVBA 1UH5A 2QG4A 2NVWA 4R1UA 1EDZA 1MFZA 1UXGA 1N9GA 1Z74A 4EUEA 4IBOA 1NTOA 2FR8A 4W4TA 3DONA 5TRTA 5IDYA 4ZRNA 2GYYA 1JKFA 3PFWO 3UOGA 3JQ6A 4DMLA 1SOVA 2EERA 4HX5A 4NNJA 1QMGA 1PZFA 3OQ6A 5CFZA 3NDRA 1XU9A 1P0FA 1VKOA 2O3TA 2HKIA 4H3VA 3GZ4A 4LK3A 1PJSA 4UVGA 1CERA 3NJ4A 1PSDA 1D3AA 1GU7A 3GRKA 2XXJA 3RVDA 3RD5A 3R3SA 4ID9A 3OIDA 2QQ5A 3LLVA 5EQFA 1RM5A 3GY0A 3JQFC 5G4KB 5DDIP 3B20A 1WWKA 1VE9A 4EGFA 3TZQA 1ORRA 1OOEA 1ISMA 1AHHA 4XDYA 1H6AA 4ZQHA 4D43A 3BTVA 4FW8A 4GGPA 1P1KA 5A03A 1D8AA 1WAMA 5ILGA 1HLDA 1B7GO 4J7UA 4IXWA 1OBFO 3OBBA 3CH6A 3JCZA 2NU7A 4BMSA 4J0EA 4HBGA 2X0IA 4I5FA 3UW3A 1E3IA 4IY1A 7ADHA 1KYQA 3H9EO 1C0IA 4CLOB 1QR6A 2C7GA 4IM7A 1SMKA 3PWKA 1H9AA 4UUNA 4D3FA 2YQ4A 3W8DA 4ND3A 5L95A 1FJHA 2NACA 3TF5A 1DO8A 1E6EA 1MB4A 4DQXA 2E37A 3D3WB 4NK4A 4RF3A 4IZHA 3RFXA 4J7XA 5AXDA 4CV3A 1NPDA 4AJNA 1A9ZA 5EIOA 5JY6A 2EKPA 3V2HA 4KOAA 3SLKA 3WJAA 2FPIA 2WDZA 3IJRA 2RHCA 4BNVA 1GL3A 4YJDA 5JBIA 3FHLA 3KB6A 3WB9A 4Z0HO 3K9QO 4F46A 4JBHA 4FOSA 1E77A 4O6VA 1PJ2A 1P1RA 1RM3A 1JLLA 3V1UA 2ZATA 4MIYA 3X2FA 1VSVA 4K28A 3CSDA 2RH4A 1ZK2A 3AJRA 5ES3A 4YB8A 1Z45A 1X14A 2AEJA 3GFBA 4FFNA 4XYMA 3FNFA 1O0SA 3DBLB 1U4SA 3NUGA 2GLXA 3IP3A 3I4FA 3BMQB 4OSOA 1I3KA 2IDZA 5FI3A 1QRRA 2O48X 2DTXA 1LLUA 4ZQEA 3IP1A 2FN7A 2A4KA 2HAEA 4B3IA 1NQOA 3H9GA 3WLFA 4MVJG 4I1IA 3ZGYA 3BMOB 3F1LA 3KETA 1MC5A 2YUTA 4NFHA 3W4KA 1HDXA 1EFLA 9LDBA 4RVUA 1W4ZA 1E5LA 4KWIA 1E7QA 1GD1O 3GDOA 2BI7A 1UXJA 2J3JA 1ISIA 3I9JA 1HSOA 1KERA 1MG0A 4JNKA 4CLEA 3ZU4A 4CM5A 5I7EA 3OHSX 1NWCA 5BSGA 1YDWA 3MJVA 4PLGA 2Y67A 4CV1A 4TQGA 5KOIA 3I4CA 3KUXA 3C7AA 3OJFA 3H7AA 2D5AA 5AYVA 4BGVA 4XB1A 1DC3A 4NBWA 3GGGA 5BR7A 3HG7A 4DLBA 3ADPA 4ND4A 1R4NB 1CIVA 1LSJA 3EGOA 2RHRA 4R5HA 4B8WA 2XPCA 3ASVA 4YEDA 3VVCA 3ZV3A 3ZWXA 1LSUA 2PNFA 1YB5A 4DIOA 3JYQA 4D3DA 4XJTA 3I9OA 4CUJA 4PLYA 1IHYA 3PLNA 4RLHA 1IE3A 1YRLA 3GOHA 3UN1A 4YJFA 3PYXA 2NVUB 3D1LA 4DTIA 1EQUA 1WP4A 5G4LA 5LDHA 1ZZEA 2XXBA 3CINA 2GRAA 4RVFA 1LDGA 2Q50A 5L3ZA 2UVDA 1ZMTA 1CDOA 2HK8A 3QVWA 1I8TA 1MUUA 3AM5A 5IN4A 5DCUA 2OXIA 3BHMA 1Q0HA 1EZ4A 4U7WA 1A71A 1PR9A 3NGXA 3WWZA 4Q3EA 1QYWA 4ZQFA 2Y1CA 3BMCA 3UCFA 5BNFA 1DC6A 1PIWA 4TVBA 3S8MA 1JW9B 4CM9A 4PN3A 1FK8A 1XA0A 1VRWA 4UEKA 4YAGA 5ITWA 4YAJA 4PZEA 1N92A 1I3LA 4N18A 3RUIA 3OJ0A 3P19A 1XKQA 5EPOA 1HETA 4IDDA 3TQHA 4BNIA 3VPGA 4TKMA 4Z9YA 4BOYA 3WGIA 2P5YA 3ZH2A 1RJWA 3RFTA 3DTYA 1WZIA 4YQZA 3UAGA 1PJQA 5U1PA 5TX7A 1CETA 2FP4A 2VHZA 2ZKLA 4Q3CA 5DBIA 4XEHA 3TFQA 1N2SA 2YDXA 4ALJA 2YHIA 3GG9A 2FY8A 2PH5A 3GVHA 3RUCA 3S1LA 1U8XX 4HFRA 1HDYA 1PGJA 3CZRA 3PWSA 4R69A 4ZGWA 5CEFA 2I66A 2VZ0A 4ZQBA 3WNVA 3EHEA 2A94A 2Q3EA 2VNSA 2GCGA 3GC6A 3AY7A 5I9LA 4G2NA 4XYLA 2HK9A 4CLDA 2DBZA 3ZWAA 2C82A 1PR3A 3IJPA 4XYEA 3ANMA 3JQCA 5BNTA 4AJIA 1B14A 2EJWA 4DBVO 3F3SA 3OSUA 1P44A 2GD1O 1KETA 4Y6SA 2O2YA 4OSPA 1R0KA 1HE5A 3ABIA 4AL4A 4OOFA 1GUYA 3Q9NA 4IPTA 3Q9UA 4GLOA 3IOYA 3B70A 4FDAA 1EFKA 2CD9A 2JFHA 5IDWA 2O3RA 3NT2A 2J5RA 1HZJA 4TKLA 3RUEA 1PX0A 1FDVA 5JC1A 2OMEA 2JL1A 2YW9A 3O9ZA 4YAIA 1VJTA 4Z9FA 1V6AA 3JTMA 2WE8A 3NKLA 2B4TO 1MC4A 5LC1A 3QWHA 1M76A 1SOWA 1ZXBA 4NBTA 2NADA 4XIYA 5GY7A 1E7SA 2GN8A 1B8UA 2Y05A 3MJ4A 3FNGA 3JYPA 4PGFA 5T64A 2P5UA 3JV7A 4QFDA 3OMLA 4I9NA 1MX3A 4FC7A 3ZV4A 3M1LA 2UV8A 5BT9A 2ZYGA 1MG5A 1DPGA 1N9GB 3ONDA 1N7HA 4BNZA 5FF9A 2DFDA 2ZB7A 5HWSA 2X5JO 2ZYDA 2C59A 4R51A 5TC4A 1T24A 3H9UA 3IQDB 4R3WA 4PVDA 4UVDA 1PGPA 2C7VA 5TJHA 3E82A 1J49A 2I65A 3MTGA 4WJZA 4QO7A 4IDCA 4HXYA 4D79A 1YONA 3GK3A 1KVUA 3RU9A 2C29D 4WNIA 4BNTA 3QWAA 4NZ9A 4BNMA 4P8RA 2HJRA 1NX6A 2HRBA 1DXYA 1YOVA 3FPLA 1Q0LA 3FTPA 3RJ5A 4RLSA 4H7PA 4YT4A 3GNTA 3KYDA 3QQPA 2ZYAA 3TOXA 1S6YA 4PCVA 3I9NA 3P5SA 1UR5A 4F6LA 1NHWA 1QLHA 4OAQA 3D3EA 1SNYA 1DIBA 4HFNA 3ZN2A 4J4HA 4QFCA 3QHAA 1KC1A 1UAGA 1EVZA 1N8KA 4HNGA 1PJCA 1C1DA 3U62A 1V3UA 4BNKA 3NAQA 5F1PA 3NDJA 3PVZA 4LRSB 1IY8A 2Y1DA 4D44A 1NWHA 3Q3CA 4J3FA 4TRJA 4PLVA 5COQA 4QECA 3V1YA 5CEJA 2FPPA 1R6DA 2VRCA 1YL5A 2YDYA 4BNHA 1P31A 4GH5A 4EZBA 2BGKA 1LSOA 3PHHA 4BO7A 5CDTA 2VWPA 2GR9A 3C8MA 4E5NA 5JCXA 3T4EA 2IYOA 4DRYA 3DEYX 3FTNA 4MVJM 3AU8A 4NR0A 3ULKA 1ONOA 3U0BA 2CVQA 3LLSA 3F5SA 3FSRA 1ZNQO 2FR0A 3ASUA 4IIVA 1BXGA 2VUSA 2BFPA 3HB4X 4URFA 5G0WA 4CM9D 4RPGA 3HQ4O 1CJCA 4W99A 4BNLA 3GLQA 2ZIZA 4M1QA 5K9ZA 1HYEA 1Q0QA 2FR1A 2PA3A 4J16A 2EP7A 3ONFA 4KWHA 4XB2A 3G1UA 1WZEA 4KUEA 1UP6A 4J1TA 4NPCA 4NBUA 1JQBA 3E9MA 1R16A 1ADFA 5B4UA 3BZUA 2IZ1A 4MVJP 4RL6A 2EV9A 3W6UA 5ER9A 4YR9A 2E48A 2V6GA 4U0KA 3E5RA 4MVJF 2AQ8A 2UYYA 2IRWA 4P38A 3I52A 3AOEA 1ZUD1 2DVMA 2Q99A 1YBMA 2DKNA 4P4LA 4R16A 3I6IA 1ISFA 3PXXA 4JK3A 5IXYA 3D5QA 5BSHA 5I9NA 4J0FA 2X86A 3MZ0A 4AJHA 1J4AA 1OC4A 1ZSNA 4J4TA 4EUFA 3HDHA 3VOSA 4EBFA 3LC7O 1BWSA 4XQ9A 4DIBA 5JSFA 4FB5A 4XD2A 3KEQA 4MIEA 1NVTA 3WGZA 1XEAA 3HN2A 1K5HA 4AJLA 4LISA 1DHRA 1V3TA 3SBOA 2JCVA 4QSMA 3ZI0A 4B8ZA 4L9RA 1RYEA 5A06A 5TT1A 1ZBQA 2Q2VA 3JD2A 3VPSA 3L6OO 1IZ0A 3JD3A 1BDMA 1SB9A 4BNWA 5IF3A 1KS9A 3ZHXA 4EEXA 1HDOA 1UXKA 4N5NA 5IZ4A 1DDOA 4ALIA 4UULA 4HWKA 3WMWA 5BSEA 2ZCVA 3WNQA 4A73A 1X1TA 1O6ZA 1PTJA 2PGJA 2TMGA 3QWBA 4QUKA 5AXCA 3WGTA 4DLAA 3ENKA 3VC7A 1NM5A 3HN7A 3F46A 2BFMA 2JJYA 2ZCUA 4Y6RA 5BSFA 1ZK1A 3EVTA 1ISHA 1UUFA 4CLHA 4EJ0A 4Q3BA 5IAAA 4BB6A 4YJFB 4JJGA 4WASA 1JWBB 1EK5A 1DRUA 1HYGA 2I3GA 3AOEC 3DC2A 3GNQA 1O89A 3MOGA 4JLWA 4R4JA 4E4YA 2GF2A 1HT0A 2NV6A 2W8ZA 2CUKA 2CDCA 4FGWA 4MKXA 2O2SA 2QRKA 3RC7A 3VDRA 2WM3A 1DC4A 1B3BA 5H82A 3TL3A 2Q2WA 1ZK0A 1B15A 3DMTA 1ENZA 3DR3A 1ZMOA 3HNPA 3GPDG 2JD0A 3HDYA 3BMCB 2C54A 3TOZA 3CMCO 3RUDA 4Y8VA 5L45A 5HTOA 1A9YA 1KVRA 1LLCA 1Z75A 3GAFA 4R41A 4Y6PA 4E6PA 3TZKA 1IYZA 3GHHA 1XDWA 2I6TA 1U2DA 3PTZA 2ZB4A 3KYBA 4FS3A 4M89A 5MDHA 4AJ2A 3MJSA 4L73A 4DVJA 2P4HX 4LSMA 4YBZA 2NU8A 1B0AA 4BL5A 4NU5A 4JJFA 3JD0A 1YO6A 4TROA 3IKVA 1PS8A 4J4BA 4ZD6A 3OICA 1R0SA 4AJJA 1LQUA 4E5PA 3LYLA 1TT5A 1C3VA 4I9HA 1ZSYA 6ADHA 1U3WA 1E7WA 2IXAA 1S7CA 6LDHA 1BGVA 5JO9A 5A3JA 1R66A 3ADOA 4R9RA 2YHIB 5A9SA 2QHXA 5C7IO 4YQYA 5CDGA 2DAPA 2Y68A 5COAA 4Q3DA 1A72A 3GEDA 1DOHA 2ZK7A 1A4IA 1GPJA 2O23A 1AGNA 1GUFA 4MDHA 3WQQA 3UF0A 1ZJZA 3W8EA 4WLEA 1O8CA 4IDBA 1B3RA 4HY3A 2VRCD 2X4GA 3TFOA 3KM0A 2ET6A 3H5NA 3WLEA 2LDBA 4CL8A 2ZB3A 1EUZA 5KCZA 1LI4A 2RH8A 1F8FA 4X54A 3DZFA 3NT4A 4RQTA 4FD3A 4UREA 1ZIDA 3AU9A 2QYSA 2GGSA 4NJOA 2JD2A 3RQSA 5I8WA 1P1HA 2VHXA 4PG5A 4CR7A 4M86A 3L0DA 4IGFA 3DHEA 3E5MA 5L53A 2C07A 1GAEO 4PZDA 3MJCA 3MTJA 1Q1NA 4NBRA 1PQPA 4XQEA 4AJKA 4AVYA 5IJZA 4K9DA 4CM3A 3FRJA 5LCXA 3PLRA 3WSWA 3MOIA 3U4CA 2VZ9A 1YQDA 4QO8A 4GBJA 1HDRA 3OETA 4A2CA 1PGQA 4KMSA 5AVOA 2IYPA 3UCEA 5L4NA 2ZQZA 3KOUA 5FFFA 4U6SA 1CRWG 4B4VA 1G0OA 4Y98A 1ZFNA 5MGBA 4YJGA 3FWZA 3WXBA 3BHIA 4O0LA 4CLRA 4MVJI 1NVMB 5JYEA 2O50A 3H5RA 2PKRA 3I6QA 1KY4A 1H5QA 2POQX 3O03A 4ZN6A 3JD1A 1X0VA 1F14A 2ZTVA 4FGSA 1T2AA 4PVCA 3B1KA 2WJPA 1NAIA 3RC9A
chains in the Genus database with same CATH superfamily
1DL5A 2XDQA 1T8WA 4M1YA 3QWFA 5L40A 1Z63A 5K0FA 1I0LA 4QJ3A 3KOOA 2WUVA 5C7YA 1Q19A 3HBFA 1PI3A 3TZ6A 1ZOOA 1JLSA 1WW8A 5CA0F 1JQKA 4IZIA 5ALOA 5DPMA 3QPUA 5I6DA 3PXBA 4O4HA 1E3JA 2IOFK 3F5FA 3O75A 5FUQA 4O5AA 1TUBA 1X7GA 3IUPA 1NHGA 3ZDFA 2UUCB 2DWUA 4F5YA 4UCFA 1TC2A 1T2CA 3Q9SA 2EIHA 2IPXA 3I09A 3T7IA 4A6PA 2IBTA 2WNIA 3GI1A 2P3QA 1PEYA 4JBYA 3ZW7A 4J29A 1YK1A 3TQQA 1FNSA 1D5WA 2HA6A 2Q3DA 1IBCA 1CIPA 2OZVA 1LI7A 2LZ0A 3CIFA 2IE8A 3ECSA 1PT6A 2YASA 3LOQA 1UPAA 2CJFA 1VL6A 1D2RA 3DP7A 1M2FA 2F9FA 1NVFA 4ZOLB 2DZDA 1ZUWA 4ZVOA 4GDFA 4N3GA 1NAHA 2A9JA 3AL0C 1JSXA 4ACAA 2EBWA 2Z5LA 2D2VA 4UBNA 3ZK9A 4GBMA 3NP7A 3P2IA 3ZLUA 1LWOA 3WO0A 1O58A 2GN0A 2FZLA 4DV5B 3Q7QA 3CLTD 3ZLJA 2GFHA 1Z29A 3DYBA 1QP7A 5CHEA 3AFMA 5HUHA 3CF2A 3N76A 1OW3B 1EVJA 2EWWA 5B30A 4C2UA 1ZUNA 1EWQA 2JZCA 3FPHA 5HE8A 3KSUA 4MCAA 1EB9A 2ZWAA 3IT2A 1WMEA 4FI3F 3SKXA 1LDMA 5JVDF 1SVUA 2OZKA 3I64A 3MCTA 2O3UA 1GYRA 1Q92A 1UKAA 4FYYA 4M1KA 3W9BA 1C9YA 5JZMA 3S8EA 1E1CA 1XD9A 4TM8A 1T8PA 1SQ5A 2QQGA 1EX6A 1K4YA 3AF4A 4Y2QA 5E7JA 3DLIA 5FADA 3VJKA 1BXGB 2F3UA 4XSHA 1AMOA 4KE9A 1IQUA 2XJ9A 5TJ9A 1Z73A 2B82A 4YT8A 2C7OA 4IDAA 3HU2A 4HXEB 1F0YA 3C3JA 3PENA 4JQYA 4MVJA 1X1RA 4XH9B 5KVSA 1UC5B 1X7XA 1KQ3A 1WVIA 1GZVA 2H1SA 4C88A 4J2OA 2H9YA 5FLXA 4P33A 1HT3A 1TQ2A 1RXUA 2IIPA 3ABOB 1DWUA 3N3AC 5JSZB 3LNTA 3MMNA 4P31A 2YZ2A 4CL2A 3ERCA 4ND7A 2G28A 1SCKA 3AHGA 4WXEA 3HA7A 4F3TA 5IUKC 1T9GR 2XD4A 3WVNA 2M1ZA 4H9GA 2YHAA 3MTBA 4M9CA 5K6AC 1NQ5A 5JJ5A 2GAJA 3KVOA 1R10A 2AJTA 5ECWA 5FEUA 4W7HA 4EHJA 4LS3A 1RP1A 3Q8WA 4M2LA 4LXYA 1ID8A 3AI1A 1SPXA 3ROMA 4B3BA 1OXMA 1II8A 3EZ9A 2FEOA 2AQIA 3OCWA 2FEWB 1FXSA 1H1LB 3BWDD 3BXZA 3O4VA 1Y4AE 3HZHA 3U80A 3WDSA 3KE8A 3SZRA 4AMGA 5CDHA 4LQ4A 3ZJVA 2VF2A 2Q6VA 2HHLA 1YFZA 2C9DA 1A8PA 1BTOA 5HDBB 3RIGA 3JQGA 2ONCA 4HGYA 4ZJUA 1P1IA 4KYTA 1MXHA 2DECA 1NBOA 2E49A 5DYIA 3L49A 5CIWA 5TF4A 3BE8A 2XCRB 2YVUA 3BK2A 3RRMA 2JH8A 2WKRA 5ITZA 1JKMA 5FV7A 4RKWA 1H1TA 2QJFA 1JFVA 1U0FA 2W22A 2FW9A 3C3KA 3ZNOA 2A9OA 2PLRA 2EU8A 4RY9A 4CMBA 1JNYA 1FRNA 2C4HA 2W2OA 5FH9A 3OEYA 1JG3A 3L40A 3RHZA 1EMDA 1HTBA 2AS0A 3U13A 2GBLA 4EYOA 1PHPA 1LJ8A 3H1AA 4LDRA 3IAS6 1VP3A 2I22A 2C5BA 2P9GA 2J31A 2Z43A 1J07A 3NOQA 1ODCA 4M3NA 1MMFB 5H8WA 5TQ2B 4J7CA 5CAEA 4FPXA 3WAJA 3KZVA 2R0QC 4HSEA 3FHJA 5HZHA 3JX9A 1XMXA 4CHTA 1DAMA 2IYFA 3ZWPA 3GJ7A 3OZCA 4OQYA 3WRVA 3BIJA 2DHDA 1B93A 3QUCA 5BQXA 2QM0A 3EJ6A 1GNSA 3ELYA 4E22A 2RHDA 4KXXA 4IH1A 2CF6A 1Y98A 4G4GA 4M55A 2VAMA 1XQ6A 2XZOA 2W6NA 3SJBA 1ZR2A 3F98A 3BIXA 1TRHA 3TTSA 3THYB 1VL0A 3C3EA 1ETHA 3SS8A 3UJCA 3WBBA 3KKKA 1ZH0A 2G9RA 3GUVA 1BXRB 3TD6A 3MHPA 3WIDA 1T2NA 3Q3GE 3V1KA 4BS9A 4PE5B 3OPVA 1IULA 5M3BA 4P36A 4FIZA 3URMA 4PR0A 1BCSB 4P7BA 4PQEA 4UTVA 4F1WA 4TUYF 1JYSA 3H5WA 4PNZA 5EIFA 1EDDA 3OE7A 3H42B 1VL5A 2OHJA 1P62B 2BELA 1Y3BE 5K2MA 3OTGA 4BCCA 1M2VB 5KC9A 3RIMA 5MN4A 2NTNA 5AVWA 4ENSA 5HNKA 3FOAA 4MROA 1F8UA 2PX2A 2PVSA 4LHWA 1OIXA 1QH0A 2LCFA 3CVJA 4NKRA 4QOSA 1RAGA 2CFCA 3UGKA 2HH9A 2P1RA 4R2KA 4EQ6A 4JOCA 4M8LA 4ZZ3A 2VEOA 3MFQA 1LBEA 3AIIA 1UP7A 4LTMA 1USKA 2LE0A 3A14A 3A2LA 2ZJ4A 5KOHB 2I76A 2WUWE 5ICSA 1RRKA 1PJZA 3G6WA 3IEPA 4JVLA 3PHIA 4L6AA 5AW6A 3X2EA 2DWOA 1BE6A 1CIJA 2EGGA 4MEBA 4TS4A 3BZWA 4RHCA 3WIUA 1JHAA 3NHWA 1NQAO 1CSEE 4P7KA 3RSGA 1T13A 1U3TA 3A26A 2EZUA 1P3DA 2J4CA 3GEHA 3M2PA 2EJCA 4JKOA 3RKUA 1NJ2A 1INLA 2OC4A 3GN2A 4WI1A 5B3JC 1Y0BA 2VS1A 1EGAA 2PSSA 3QKSB 3EMBA 1DE0A 3AEUB 3QVUA 1XD2B 1EH5A 3QITA 1ZGHA 1GQ2A 1D7OA 2GLUA 4F72A 2HMTA 5BYAA 2WWVD 3HGTA 5I8ZA 3W34A 3EX7C 2O8VA 2RGUA 2ZB8A 3AI7A 1QQBA 4K6FA 1MGOA 1XHEA 3W6ZA 4EHLA 3DKKA 4TWRA 5GOTA 4PY2A 4JEHA 5DRTA 1U0GA 1FYVA 2CUZA 4BNNA 2G71A 2DP4E 3M6IA 4QBGB 1S8OA 1QFMA 3VNAA 2NQ2C 4ZZ0A 2D0IA 2NYVA 4DMUB 1XTVA 2NZUG 4EPRA 3M8KA 3HXQA 1J0DA 4UD6A 4LYFA 5REQA 2ONYA 3DMGA 1LDYA 4RDIA 1YJAA 2IUYA 4Q4HA 4G56A 3NAZA 3PQ6A 1TKCA 1YC2A 2FK8A 2V7VA 3KELA 5GIPE 4J7AA 1NYRA 1V3QE 1AUVA 2QLBA 3GDFA 2IOQA 4BKRA 1FRZA 2B4QA 4YVFA 4N9WA 4AWXA 2Q21A 2CFRA 4D9IA 1PDOA 5B6PA 4YRIA 3VISA 4KKXB 2EP8A 3N0WA 2SKDA 2W4QA 1NRXA 5J40A 4X3OA 4DSZA 1P7WA 2VYNA 1RRGA 3EQ2A 3LSYA 4LECA 2NZ2A 4NIMA 2WY2D 3PBKA 2EF1A 3FWKA 1P6XA 2Z2ZA 3T5AA 1EM8A 1N1MA 2GYUA 4OGFA 4TYQA 3NX4A 1P9WA 3OD1A 5L4LA 3IIKA 1DP4A 1RAHA 1RRMA 2OBFA 3A2KA 1MD9A 2D5IA 3KUKA 4RKRA 3V4RA 3RO7A 1NURA 3T5DA 1R6VA 3LI2A 5IH7A 2HFJA 1PV4A 2A30A 4GDMA 5FWXB 2B9VA 1G0NA 3LHIA 4GLBA 1IBLB 2ZYSA 3FJYA 4XW2A 1P4SA 5GJWC 5LOVA 4XQCA 4ZO8A 1Q17A 3HP1A 5KJFA 1X1EA 1LRLA 2JGFA 2QVGA 4MSUA 4RYLA 5JZOA 3I9LA 3MT7A 2ZIEA 3NNSA 4DT1A 4DDUA 4PX2A 1MQ9A 5AJTA 3SYMA 5BV8A 1CRZA 3PHCA 5AJWA 1NPTO 3HVKA 1FP2A 1F8GA 1QYIA 2ZJFA 4I4NA 1NVEA 2REQA 3AEQA 4RS3A 1Y80A 3LQ2A 3LVFO 2FFBA 1ZJJA 2GCEA 3GVCA 2ALJA 1S8AA 1UP4A 4LHXA 4M53A 2P2GA 3TOCA 3EVEA 3GBSA 4KP7A 3D7SA 3FW1A 3WLRA 5AVSA 5T7BA 3SBDA 4RKYA 4FGLA 1M2OB 3VZDA 1U81A 3U0VA 1CYEA 3IDFA 1L8XA 2YWFA 3MB5A 5CJ2A 3ZHQA 4L5CA 1WSBA 3CZ4A 1YIDA 4V24A 1W35A 4RAQA 1L5NA 2I2FA 4J8PA 1PT8A 4O29A 2PT5A 2Y0DA 4KLCA 4TWBA 1WE2A 4CDGA 2DMRA 2FJUA 2XDQB 2VH1A 2VTKA 1VE3A 1C0LA 3ABSB 4IDGA 1G4AE 4R81A 1YAHA 4AN1A 1DJQA 1O95C 4BEVA 1QTIA 1GT91 3UK1A 1RM4A 4LA4A 4A1OA 1ORWA 2QVBA 2WOOA 2HI0A 3HCWA 2WF5A 1QVVA 5CH3A 4O4HB 1TC1A 3GGSA 2KW5A 2CXUA 2QTTA 1TUBB 4W6ZA 5EMMA 2X42A 5H5JA 4MARA 2YRFA 3L2OB 2AJBA 3FZYA 1XFAA 2Y99A 2JLUA 4V2IA 2QZSA 3SFVA 1P29A 5LQNA 3FOBA 2BGIA 1G5QA 5FL7A 3DMHA 2HMSA 2W4IA 4JX8A 4WE3A 3ZS8A 1G38A 2DXIA 1FL9A 1WA5A 2PL9A 3AINA 3S2EA 5A5FA 1T4DA 2SBTA 1K6MA 1LX6A 3JSXA 3BL6A 3LUGA 3Q15C 1XXHE 3EZFA 2IYAA 1QYRA 5THQA 5GV8A 3QMMA 3KB8A 4ONEA 4P22A 3AB3A 1MCZA 4QYSA 1W6RA 2NYUA 4QJ5A 2R8YA 2WAXA 1C8BA 4PTZA 2QN2A 4ESHA 4YRNA 1Q1QA 1D2AA 1TLFA 4URZR 1BWQA 4Q3NA 1BMDA 2MU1A 4U8GA 1DC8A 2P9JA 4MIKA 1ZUNB 2HIAA 2ZTLA 4GYYA 2PN1A 1SD1A 1L3IA 3FPEA 4LZNA 1F9EA 4LIPD 4NNOA 1Y8RA 1W36B 1T4MA 2Q0XA 1RFLA 3E48A 1T34A 1E1CB 2B7BA 4OBBA 4PIVA 3OF2A 5C80A 2QYHA 3IULA 1I2BA 2AF4C 4OQDA 3WYGA 4B9EA 2Q1UA 4L78A 3F4KA 5UKDA 3PC4A 1MOQA 1Z0DA 2PGNA 1C7QA 4ZMBA 2EZ8A 2QT1A 3MK31 3CLRD 3N0TA 3PUVA 4UHKA 4IXTA 5C34B 1X7XB 3TM4A 3TTYA 3WXMA 5IX8A 1JT9A 3LLUA 4XZ3A 4OAPA 5IM4F 3EIOA 3R4VA 4AD8A 4LDZA 1I3MA 2OOKA 4PNHA 1UPUA 3TIIA 3V4ZA 4BMDA 1TGYA 2FRDC 3PQ8A 3VAZA 3R7NA 1MIOA 5SICE 5IXSA 4RC9A 5THKA 1PRYA 4LYDA 1CCWA 1I2ZA 2XW6A 4P4UA 4TVOA 5K3BA 5IM5A 2MYPA 4ZI3A 5L7YA 3MLAA 2BFOA 1POXA 4AG6A 1V71A 1VHDA 3IRVA 4FI3C 2VRNA 3Q40A 1C0PA 2F3SA 2FX5A 4HI0E 4K5QA 1ECBA 1FSSA 3UTCA 4EAAA 1II8B 1KPGA 4NFYA 4HD8A 5FEMA 2TMDA 2L69A 2OGWA 4DIDA 3I58A 2H54A 4XVQA 1B26A 4BVJA 4TLAA 4EGCB 1RWOA 3KRTA 1IOVA 3H2ZA 3G79A 5DX1A 5FJJA 3SEFA 2W48A 1G8SA 3JQGB 3TSCA 5LQAA 5IVHA 1SHJA 4L08A 3AKDA 2A6PA 3SC4A 2BYTA 3JD4A 3R74A 2NT3A 3R3XA 2PH7A 2XJ4A 3Q72A 4US1R 4KDEA 3X1JA 2MMGA 5CBPA 3AZOA 1N4AA 2OV2A 3CRRA 5ITZB 2I3DA 2HBZA 5C4GB 1G291 4FFPA 4NJEA 3OX1A 2KMLA 3GLFE 3ISTA 1T9KA 1RAIA 2BISA 3DFKA 5I9SA 1XPOA 4OJNA 3C4JA 1FDUA 2K6GA 3EQ8A 4C3UA 4WKBA 4CTKA 1N6NA 3LDUA 4DQVA 4BO2A 1T2UA 4DV7B 1V4BA 1LZLA 3K1ZA 1N6RA 1WCIA 5HKKA 4ZREA 5H80A 1LDNA 1OH6A 3GD5A 4X93A 5CAEB 1KK0A 3RVLA 1SXIA 2HJHA 3L6BA 4RTJA 4U7JA 2JCGA 1GNTA 4F5WA 1WXGA 1WZUA 2HPAA 1DWQA 3D4PA 3P94A 4YWJA 5A71A 1Y1SA 5C0OE 3AGQA 3PJFA 1V25A 4DIMA 2BFBA 2XYHA 3B1FA 1CEEA 2QVXX 4BFTA 2AW5A 3AK4A 4A26A 3DL7A 3K5IA 3RUPA 1FFHA 5FLKA 3HUEA 3SYNA 5HZGA 3WRXA 4ZK2A 4GFDA 3P1JA 2PKCA 4L76A 4BDTA 2HA3A 2WINI 1D9ZA 5HEKA 1V7CA 3ZCVA 3IPCA 5AM5A 1G1MA 4TYPA 3N8GA 4NI5A 3T7TA 1B6RA 3GVIA 2FSUA 2HF7A 1MA3A 2LGJA 4G0NA 4HS4A 4Y0VA 3MTEA 1EP2B 1Z25A 2C95A 2AEMA 4KAJA 4MW4A 2II6A 4YV0A 2ETVA 4Y30A 2YBDA 4S1OA 2ERYA 2D1SA 1PK7A 2NO1A 1I4EB 2RC5A 1JEAA 1S9HA 2FETA 3IC5A 4NYJR 4C3VA 2BGNA 2JBHA 1ZHOA 4M0DA 4EQ6B 4MRPA 2VP3A 4R6WA 1FMCA 5CIQA 1Y3CE 3KFVA 4YYZA 3ZBPA 1E96A 3AHIA 3G49A 4UEOA 4B2LA 5CFRA 4FBLA 5CCBA 3OOWA 2BMDA 2YYSA 4K9SA 3NVKI 2G17A 1YCFA 3RI3A 3CU5A 1O54A 1F20A 1ZCBA 4KTVE 2YN0A 1XZEA 5HIAA 1KAOA 3BFJA 5I9BA 5IYZF 3M0EA 2YN2A 1Q0RA 4PF1A 2OK8A 4TMVA 3P4XA 4YCJA 5T4EA 3TQCA 2UXDB 2V6BA 1F12A 4PHHA 3T1TA 1GQFA 1GLGA 3GRYA 2A7QA 2IYVA 4L0QA 4F3YA 1HZZA 1WLSA 5AKZA 5CXUA 4ND8A 1K63A 4K3VA 3DVLA 3PUZA 4KN8A 2JGKA 2XCIA 4RGBA 1IXYA 1E9DA 3IAUA 5CNIA 1YB4A 1UMCA 3DQQA 3WOVA 2MT9A 3HJGA 2I6GA 1VRVA 4J9UE 5ABPA 2DQZA 1HT1E 4N03A 5JC8A 4A2QA 3HJHA 4UCQA 4XWKA 1YA4A 1VL1A 2QQFA 1E6WA 1J09A 4JUAA 4WW0A 3RBXA 3FI9A 3H0KA 2OHHA 1G6KA 4BMNA 1JT2A 2E9SA 4CG0A 3RH0A 4ZYZA 1FJXA 2HLDD 3VOBA 1BHQ1 1NVDA 1Q91A 1JE0A 1RQXA 3EIEA 3JASA 1BS9A 4KQIA 4TS3A 4Q4HB 4CQJA 4JP2A 3B3AA 2OV6A 3Q0EA 4LY3A 3R0QA 3S5JA 1KJQA 3NRBA 4G1CA 5H81A 2OO5A 3DOCA 5DF1A 4AUKA 3L0IB 2VWHA 1EK2A 1UXOA 4HRVA 1XTBA 4DJEC 4NEGA 4HLDA 1AXEA 3DBHA 4ZVMA 3IDZA 4EDHA 4HRXA 1EK6A 4CPDA 4UTZA 1ZRMA 3A9RA 1RWBA 2CSUA 2QTWB 1CY0A 2X22A 4KQGA 4YFYA 1MX9A 1QGDA 2BGLA 4H6XA 4IIUA 1G8YA 1RQNA 2C78A 4LSZA 1EM8B 3HUTA 4HZUA 4M7PA 3R76A 1QVRA 4BU0A 1P8AA 2AMJA 3VR3D 1WEKA 2GVNA 3ZLVA 2JIZD 4XIGS 3M4ZA 4RIIA 3QF4A 4LDQA 4RYDA 4DWWA 4G1BA 1PS0A 4TOIA 4CMCA 1QK5A 3KLPX 4C30A 5HQJA 3I6BA 4ZDIA 4F2HA 3QLJA 1J33A 1JJBA 2I1WA 3FRIA 5LOVB 3IOMA 4HH0A 4GXQA 4EW6A 4B87A 4ZAVA 4N3NA 1WMAA 3OM9A 4DR6B 1ELOA 1PZEA 1GQYA 2AOXA 2I3AA 1C8VB 3N8NA 1MOZA 4DT1B 4GXRA 3GZNA 1G21E 4P5EA 1HE8B 4XWTA 4DCNA 4DG9A 1N5JA 3EXFA 2WWWA 4OF4A 3WGZA 3VBEA 3HR4A 1E8NA 1HE2A 1AQIA 1SOUA 2AEFA 2F1HA 3QLUA 5TT0A 3SLRA 2REQB 3AEQB 5JPDA 1MTZA 1YRWA 2JD1A 3I2KA 4CQLA 2OYCA 1RZUA 4GLFA 3ELBA 3I30X 5JR3A 1YQXA 1Z3IX 1GLVA 9ATCA 3T9CA 1P18A 1NPYA 2FOXA 4UHEA 3GD7A 4Q05A 1OZAA 1V9LA 2EBUA 3PGJA 2HEGA 4H3SA 4LV8B 4JLAA 3S7ZA 4WFKA 1I7DA 3T4XA 2E5FA 3M6MD 3RJZA 3WLNA 1RHUA 4FNAA 4F1JA 2D1RA 3BD9A 4XQ0A 3NR2A 1XZFA 3FPCA 3QE2A 2GVZC 1H2BA 1RIIA 1IZ8A 1FYFA 2P9ZA 3EH1A 4MWTA 5KJ1A 2ZRNA 1Q77A 5T67A 1MQSA 3M6UA 1AKWA 3FCYA 4JLBA 1IATA 3VI3B 3PC6A 1SCAA 2GK6A 3HUDA 3HU3A 1GG9A 2H5LA 2LW7A 4FJ2A 4GZLA 4INAA 3EZLA 5IN5A 3SDZA 4N41A 2F3RA 5GZ6A 1XRRA 4FEYA 3PL1A 3V2GA 3NM6B 3W1VA 2IS2A 4KQKA 4KQ9A 3RG2A 3RU3A 1XYYA 1V47A 2H5EA 4MEAA 5ETJA 3OKFA 4HDAA 1E2KA 2NSLA 5LU8A 3STHA 1XFDA 5FR2A 3CW9A 3QJYA 2PKQP 3QPBA 4RPKA 1K68A 4Z9AA 3HWSA 3NV9A 3V9PA 4GVXA 3KLOA 2YOHA 2Y2VA 4RPIA 1QNLA 4ZYVA 3EQ6A 3G2IA 2IKSA 1OD6A 4FKMA 4TVSA 5DHRA 3VAAA 4EVSA 1WQ1R 3A7DA 1KFEB 3FUCA 4XD7D 5DGIA 5AD1A 1P1BA 3O8CA 1MHTA 2VHWA 2FZCA 2NSJA 2JEZA 2OCAA 4QNRA 1HXHA 3IOBA 3OLZA 4FYJA 3V4FA 4EA8A 3ICCA 2X2EA 5DCLA 3NTVA 4PM4A 2IU6A 3HK2A 3BREA 5JY1A 2QRHA 3TH5A 1ADBA 3OJLA 2P0YA 1Z8FA 2QIOA 5CLLA 3MT9A 4BNDA 1AQJA 2VWQA 3LMKA 2NU6A 4II7A 2P0AA 4NOJA 1J2UA 5BR4A 1Y8RB 4YCNA 1ML4A 2I78A 4KFTA 4EMTA 1PWHA 1OILA 1UKEA 2F7SA 2H4FA 1H8ED 3OG9A 4KRYA 3A4YA 3ZVRA 3ZHUA 4CKYA 3DP9A 1BW9A 4ZVPA 1T8YA 1ZM2A 1FFBA 4JJ8A 4NU8X 5EQDA 1PWXA 3H65A 3L7CA 5CNMA 5A3VA 5G0UA 3DDNA 1XMQB 2HW8A 2AEEA 3FBGA 4ZCLA 4P9NA 3ZGLA 4KDFA 5JNUA 1JEEA 1YDMA 1M67A 1TYAE 2I8AA 3UH0A 1E1KA 1KI8A 4IV8A 3PNPA 2OWEA 2AKAB 3QLTA 1T9BA 3LBNA 3O8QA 2V0NA 1NSTA 1PS9A 1U0BB 3L1JA 5AHRA 2RIRA 4PFQA 1ZAKA 3IO5A 2XRMA 2WF7A 4QOJA 1TJPB 4CTOA 1AO0A 1LNZA 3ETLA 1MIOB 3ZU2A 1ZN2A 3HCDA 4FX2A 1HNZB 2V65A 4MB2A 1QO0A 1IWOA 4KO2S 1JG1A 2FUKA 3MBOA 4EATA 2GTHA 3H3FA 4YP1A 3AW9A 1O08A 1XZHA 2V7EA 4R8KA 1Q11A 1NUUA 1ULSA 2EVWX 5EJ8A 1EK0A 2H7VA 3PF9A 4WN3A 1GR1A 2E89A 3GYGA 3ZU5A 1R7RA 4CTJA 4C2TA 1KEWA 5A7GA 1PVDA 1VB5A 2ODNA 4OJTA 5KTMA 1L4KA 1IK4A 1EFDN 4OY3A 1G1AA 3RTBA 3JQDA 3JVVA 1SUEA 4NVRA 1E2UA 5LMZA 2XYQA 3FIJA 1EJ2A 2GARA 3EULA 2EWMA 4AXXA 1NG9A 4EMSA 1S3SA 4MQLA 1V8PA 5CBPB 4B85A 3OEHD 2PQ2A 3GT3A 5D84A 4ZYUA 2O2HA 1Z6PA 2B34A 3L6CA 1SRRA 1E1DA 4NJEB 2Q5EA 1D6MA 1SG0A 2HWUA 2RI1A 4YO8A 4H1HA 2WJWA 4IIDA 4YDSA 2WABA 1VSTA 5A2QA 5LXTA 1Q6ZA 4QEZA 1V4VA 3L9XA 4MS4A 4F45A 4JFRA 2Q9AA 3K0CA 2LTAA 3P27A 5LZ2A 1LVHA 5DBHX 3GJSA 2C2GA 3ETDA 2B21A 4TMXA 3H0EA 1N7JA 1WCIB 4O4IA 4EKNB 2JG3A 1M6EX 3MTAA 3OPNA 4WINA 1M2JA 4XGNA 4CM6A 1I9CA 4HAZA 3IMGA 1A7AA 4XTRA 5CB8A 4UD2A 4FHGA 3WS7A 4B3DA 2M6RA 1N2GA 1NJFA 3AL2A 2QLMA 4BQEA 3LS2A 4UDNA 1HDIA 3LT4A 5EKSA 2C9MA 5IVIA 1IH8A 2B8JA 2BFBB 1QXSA 3AYXB 4YMHA 3N6XA 3VKUA 3VPCA 3DFZA 3SWWA 4FSDA 1N0WA 4C1NA 4XFJA 4MNTA 2Y77A 1J21A 1GSIA 3JRXA 3QA3E 3BWEA 1ZNZA 5GZ1A 4YMTA 3IS3A 1JFFA 4KBYA 5KKCA 2VT2A 4CDMA 2HHAA 3LKBA 5J4KA 1Y1PA 3KQSA 4KQ6A 4B1FA 2ERCA 3A9CA 1GO2A 1RM0A 1PZXA 4YMUA 1E18A 2YWHA 3FLBA 4U6NA 3SMQA 2CNOA 3AUUA 3ABRB 3HR7A 3IV9A 2ATEA 2LCIA 3V48A 4ZI7A 3IR6A 3KQOA 2VNJA 3ZWQA 5JPCA 1ZIOA 4KVZA 1JR6A 4DVGA 3JWJA 5C51B 5DMXA 4MQ6A 3TQRA 5IJ0A 2V4UA 1R5JA 3ADKA 3KUCA 2FWAA 4JITA 1NI4A 4BVGA 2R00A 5C3UA 3SXUA 4OQXA 3U9SA 2GYWA 4ARCA 2ZWVA 1OUMA 4UOQA 1JAYA 5KHAA 4B2YA 1Z36A 4UM9B 4IMRA 3KAPA 1ESDA 3IE2A 5AQ1A 2GM5A 5CT9A 1OJ7A 1Z0FA 3B85A 5DOZA 1Z39A 3P26A 2P4SA 3KVVA 4HH1A 4V3CA 5FA6A 4D4HA 1T1RA 2NZ8A 2Q5FA 1SBTA 4KACA 3SSNA 4OQZA 4L6CA 2BI8A 4YAEA 2H7CA 2AI1A 3C6XA 1J5PA 3O8LA 2Q4DA 3Q7PA 4I5EA 4E07A 5B5SA 4KIFA 2BONA 1P5HA 3L84A 2FU5C 3KEOA 3SK0A 4N7MA 4U02A 5JMOA 3D3NA 4G5HA 1QRSA 4ND8B 2QX4A 3MBIA 4DKXA 5IASA 1TMGE 1YDFA 4J2HA 2Q3HA 1H2EA 1RCFA 3WIEA 3U44A 2VXCA 1UMCB 4IHAA 1I7NA 4U4AA 3VPXA 4XRGA 1KEEA 2PUGA 2IHYA 2Q1WA 1P5JA 3GJ8A 4TPKA 1U0JA 4M6WA 1NMYA 3QUBA 1XT6A 3AVYA 3DOFA 2EC5A 4A8PA 2HF9A 3AJ8A 3PJDA 2WMDA 1E3MA 1Y9EA 3LCMA 3O4RA 3ZDZB 3PDUA 4F9GA 2WT9A 1RACA 2XQGA 2O8FB 4Q12A 3USZA 3JASB 4JUIA 2PXXA 3R20A 2Z9BA 2ZBEA 3F9CA 4QC2A 1S8FA 4G01B 2JHAA 1Z37A 4Q6WA 2H1WA 4PO3X 4CF3A 3I12A 1DLIA 2BIFA 4IO0A 2HA5A 4L8VA 1M3SA 1XG5A 4JP1A 5TQVA 2PZ8A 3DBHB 3OPYA 2EW8A 3LTEA 4ES6A 4R01A 4WZBA 1NN0A 2ZU6A 4FXOA 4IAOA 5DK6A 4YJKA 4DQUA 1QF6A 1WDKA 1WCYA 2GAFA 3GRUA 2VBIA 3EC1A 3H17A 4HZUB 1UADA 5C5IA 4U2EA 2ON6A 2XQVA 1UFOA 3PYLA 4M1MA 3QFHA 4JP3A 2C00A 1JGTA 1UOQA 2XTAA 3WLPA 3QF4B 3AM3A 3BFVA 4L4SA 2O1SA 2OFWA 5KBYA 2V6IA 4GIBA 1FUUA 3NBFA 4CR6A 2Z83A 4HDQB 2CVHA 5BT8A 1II9A 1ZVMA 3HA2A 3R9XA 1TCAA 4FP9A 1D0VA 1M1UA 3QY9A 3SZLA 2O54A 1WNTA 2NXWA 3HACA 3QG1A 3ZZNA 3FMOB 1Y7TA 2BPOA 3N39C 5F7XA 3GZNB 2E0IA 3IKMB 5TXGA 3HRHA 3LDGA 3TB4A 4R54A 2GBFA 3EXFB 1XCOA 3PJGA 2VYVA 3B2NA 4XUGB 5LBUA 2B4YA 4PCLA 3RARA 5JEEA 3X1KA 1WRBA 3KG2A 2QVZX 5GWXA 4CQLB 1A77A 4K9LA 4AZTA 3E0QA 5IHXA 3R4CA 3O6VA 3WMXA 4DJJA 4EPXA 3KHTA 4OTZA 3UBTA 1XRMA 2JAOA 3ZWBA 3HBJA 5AW5A 4WXRA 2ZAOA 4BBPA 4Z7NB 3GOQA 4PZZA 4YK7A 5CCXA 1MPTA 2M32A 2A1TS 4BLUA 1QYXA 3MB8A 4POOA 2AJCA 4EWLA 2IC5A 3ESDA 2PBLA 3TR6A 5FA5A 1OFVA 2ZE7A 3PHLA 1FPMA 4KH1A 4DHEA 3AVQA 5SZIA 1E9CA 3B48A 3N8IA 4C21A 2Z5FA 1CY8A 2I2XB 4XLLA 2OL4A 2XUFA 5FPHA 4Z6KA 3OKPA 1N4DA 1UKBA 3VRHA 4UFPA 5BOSA 2GNPA 4JY7A 1B76A 4M98A 4PINA 5DE3A 2QK4A 3RFCA 1A9XA 4OB8A 4UHFA 2O5VA 1XLUA 3EXHC 4J43A 1WXIA 3OPQA 4XUCA 4QGSA 1EFRA 3AHFA 4PLPA 4XWOA 3WLIA 1F06A 1AN9A 3K2QA 2X0JA 3B7WA 2LCQA 3MILA 3ZEAA 1WMBA 2AUTA 1KTIA 4L5IA 4QXAA 4MJXA 1WPQA 1T2EA 2CLFB 1GZSA 2JLCA 3U1BA 4W82A 3NHPA 2NAPA 2EQAA 5EZYA 4JN6B 5KQRA 1G63A 2Y0PA 2I67A 5I5EA 4LJAA 1MT0A 1U7TA 1YI1A 2AG0A 3PZBA 3A6HA 5FBHA 2KLHA 4D0SA 4FMBB 1JN0A 3B3GA 1PG0A 2GAOA 1XJCA 1ZA2A 4KVGA 3HFJA 1SURA 3NBMA 4DSAA 3FMPB 5FO0A 1PT7A 4I1UA 4KV7A 4U5QA 4ZHQB 4KREA 2Y9MB 5ALYA 4K1LA 2AW3A 2IL1A 1NIPA 2PYIA 4R0MA 4LOIA 4BNDB 2P3OA 2B37A 2NU6B 3R1IA 2YV5A 2NNWB 5CVTA 4YPOA 2RHBA 5KC8A 4HNRA 4RSGA 2AOVA 2ATXA 3TXYA 1PLLA 3HUUA 3WNCA 2IEDA 3K70B 1K8ZB 1BW9B 1NLFA 1VM6A 4QYXA 1P1JA 4B7CA 2ZOSA 1XF9A 2I2DA 4DWOA 4LRQA 3Q3IA 3VZRA 4OP3A 4YP9A 5KX5A 4DXAA 4RGQA 3OZDA 2YVLA 3KXDA 4D56A 5AP9A 3MWKA 2C2XA 1TMYA 3BE6A 3UZUA 5K20A 3VR4A 1TEHA 4AI6A 1L4GA 1RE1A 2HRQA 1E89A 1QDEA 2WFMA 1YZNA 3GLUA 3O8QB 3P9NA 3ZE8A 1OZGA 2Q6TA 5D00A 3JAKA 1KHTA 5DSZA 4OLJA 3AWDA 2Q5IA 5EKDA 4LZAA 4UUOA 1Y9AA 3PUYA 1H8HA 4K2AA 1AG9A 3WBFA 5J2TB 1IN1A 1TCBA 3RRZA 1H2HA 3HB1A 1QPGA 3HB5X 2O2XA 2HA4A 3RHSA 1PK8A 1DJMA 5EFZA 4HVAA 3G7SA 4C7BA 4Q3LA 1B4DA 1Q74A 1GRRA 4WCVA 3P97A 2PUAA 3GJYA 4KYUA 2QN8A 4C0XA 4WNCA 3VGJA 2YCLA 3VR6A 4G5RA 4GRDA 5AVRA 3ETHA 3I01M 1IBRA 3NTLA 2QF7A 5HRAA 3O3CA 2QLNA 4TSFD 3ENVA 4MDEA 1X74A 1H94A 3UHFA 3ZY5A 1ISJA 3EYWA 3R6DA 2JCSA 4H60A 1U2QA 4M1WA 5F98A 1DKUA 2OOSA 4KXMA 3RC8A 3QOXA 3IAFA 5KYXA 3IEKA 4PSKA 4R84A 5C53B 2CNWA 1YR9A 4MYUA 3SP1A 4BNXA 1VKRA 3KD3A 4ALKA 1VJRA 1GJRA 1KDVA 1FDOA 4JLVA 2C88A 4DYDA 4KODA 1L4YA 2CWWA 2VP2A 3EQ7A 3OZSA 5BMVA 1FC0A 1NR7A 1KGDA 3DLPX 2H0RA 2VPWA 2ZIVB 2GSWA 1D09A 3PFKA 5I7RA 1G5PA 1LVUA 1T0IA 2VT3A 4P4SA 5AH0A 3H1TA 4EA7A 4EF5A 2PFGA 3S2SA 4MS4B 3UPDA 5JS7A 2H1RA 2Q4TA 2ST1A 2W58A 1R4AA 2WJ4A 3MIIA 5E1MA 1UAYA 1ZM9A 3RYIA 3OQPA 4DGSA 5TGTA 4O4IB 2Q6IA 2Z1DA 4GMXA 5JLJA 1LPNA 2PLFA 4XPZA 1W0CA 3OFVA 1W1IA 2NO7A 1U9JA 4K81B 4B6RA 5CT5A 1SXJD 1ZW6A 2AOTA 3O74A 2Q7DA 3I1JA 3UJ6A 4BVLA 4QGFA 4RCVA 4OYHA 2XCSB 1IAVA 1VE7A 3JSAA 1RCUA 4RD4A 4TLDA 4E5SA 4EJFA 3OLWA 2I91A 2ZE6A 4IJUA 2XGSA 4YAWA 3F4LA 3GMTA 1EEXB 1VHWA 1P77A 2OORA 2RHTA 4E7OA 1Y63A 1YNOA 2PUTA 2XDAA 3QNMA 4HQLA 1LDEA 1OAAA 2SNIE 2DT8A 2RI0A 4H15A 4M60A 3CPEA 2PGIA 1XTRA 3FXAA 4YRTA 2WUFA 5HX7A 2B99A 1MB2A 1QV9A 2R8ZA 3G68A 1FPQA 1JFFB 1P33A 3Q2KA 2GPNA 2I5PO 4Y2RA 3NHRA 2HCTA 3ZH9B 2RKBA 4I6JA 2NSHA 4GMHA 1Q7BA 4NECA 5DXFA 2WF6A 1RMTA 1POWA 4UNPA 4EFMA 2W2XA 1MH9A 3FLAA 4ZI7B 2FRVA 3T4UA 4Q01A 1EYZA 1XMPA 4K7JA 1T8UA 2D3TA 3C74A 5HFNA 4AXBA 5DEIA 5C4MA 2OXFA 5LVAA 2JA1A 3VR5D 4FQ8A 5IJ0B 1HMYA 1NI4B 1JQAA 1VLHA 3SXUB 3FSGA 1K86A 1S9DA 1XDGA 3QU2A 4ZCSA 1CQPA 3N7AA 4FQ5A 4HWOA 3RUFA 4TMFA 3PA6A 3DLCA 3CFYA 4N54A 2HB6A 4JGIA 4FFMA 2J0SA 2HSJA 1EA5A 2BMWA 1STOA 4NFSA 2AZXA 4K1XA 5IAKA 2GJKA 5ESRA 4A82A 4ZJZA 1ZHFA 4FSHA 4OMUA 4U7HA 3MJTA 5E3JA 2O8CA 1K66A 1K8QA 3LX4A 5COBA 4ZOEA 3STXA 5D2CA 5KTKA 1IIRA 1SXQA 3CXRA 2PY6A 3R6LA 4XGKA 5C4IA 3ZI4A 1NVAA 4B4KA 1T4GA 4Q82A 2P91A 4WACA 2G8NA 1CXZA 2ZI7A 1A8UA 1LX7A 3WSVA 1N77A 5ALFA 2TECE 1KPHA 4WMLA 2XUGA 1NN3A 2ZG6A 1ZKDA 1JG2A 1O97D 3BORA 3DYIA 3IX7A 1V8FA 4H3HB 2I7CA 3BXGA 3HU1A 4GI2A 1X19A 4ZXPA 1NVBA 1K4KA 2A9KA 2DFLA 4BKMA 3U44B 3PEFA 1IJBA 5DGTA 1KEEB 2WA1A 4LV5B 2VQFB 1T36A 2VOJA 3LY5A 1QO7A 4UEWA 5JQWA 2Q3BA 4M6WB 4QODA 1V48A 1W5BA 4XB6B 4K9RA 1I30A 2EZTA 4JI3B 5IFKA 5IK2D 2ACVA 2PZMA 4YRZA 3E0XA 4F3KA 1MJFA 4A36A 3G8DA 2XWJI 4MUFA 1E0SA 5F1YA 3OOEA 4E5KA 2JIRA 1RZRA 1JX6A 4QDXA 4QUJA 2L17A 1E59A 1MVLA 3GNLA 3UV3A 1PNQA 2N46A 3E6AA 4GMFA 1E66A 8ADHA 3CRVA 3D3WA 4PPYA 3PIRA 4D99A 1ODSA 4CKZA 1DTSA 3Q2IA 4L0MA 4QBHA 3NEPX 4F97A 2IGBA 2PMCA 2Y1EA 1ONSA 4KQCA 3O4GA 1F1BA 1LBSA 1LW6E 3V00A 3OPYB 1E9RA 4K6HA 4Y9DA 2YKGA 2ZE5A 4WZBB 4E46A 3U17A 3S28A 4RPCA 1AUOA 1MO2A 1UBOS 3TW0A 2NYRA 4UNNA 2QE6A 3BRWD 3DL2A 1XTIA 3FCXA 3VO1A 3CR8A 2CCJA 3B1YA 4IMPA 2XLCA 4KHZA 1J8MF 4MRRA 4D8UA 1TA9A 4KWCA 2RMKA 3D6UA 1U3GA 1X9IA 2HM7A 1Z6ZA 3M1AA 4JMLA 4EM6A 1UT6A 4Z5XA 5HSGA 1RXVA 1QKIA 1E3TA 3ZD7A 1P0QA 2VG8A 3BMQA 2R6R1 2RJNA 4DANA 5J2TA 3DZJA 1Y82A 2XLBA 3R9XB 3OAAA 1MX5A 4HGOA 4MRNA 1QX4A 4MWEA 3IDSA 1F1JA 1KY5A 3OESA 5HG0A 1QHXA 1W19A 4C78A 1E7MA 4LNAA 3BIOA 4AKEA 2FPXA 2ZCJA 1R74A 3LE8A 4P4NA 4AY4A 3DL4A 2EHDA 4UCWA 1A27A 1FRFS 2AMLA 2V7PA 4PG6A 5DTIA 1ULBA 1BXZA 3GAAA 2W4MA 3KKNA 3AEZA 3W8FA 5FPKA 3GMDA 1PEDA 4MMYB 2Q5QA 4XLTA 2CMFA 2VTDA 3OA0A 2VDMB 2PA0A 4YT5A 1P9NA 1L6IA 3VGPA 4PPNA 5KU1A 1OI2A 2QW8A 4XIFA 3ZQ6A 3IBYA 4YO7A 1NOIA 2V98A 1T1IA 2G77B 3K09C 2AI2A 2PZBA 3K16A 4N6OA 4HTFA 4CNQA 3IEMA 4NDNE 3NUZA 1KZGB 3IQFA 3TR0A