1X7ZB

Crystal structure of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
329
structure length
329
Chain Sequence
b'EYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-oxoisovalerate dehydrogenase alpha subunit
publication title Molecular mechanism for regulation of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase complex by phosphorylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 127
structure length 329
sequence length 329
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1x7zB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1x7zB01
1OLSB 2E6KA 5ERXA 1X7XB 4GM4A 1X7ZB 4C7XA 1UPBA 5IMSA 1YI1A 1YHYA 3DUFB 1T9BA 4RJIA 2Q5JA 4KXYA 3EXIA 1WCIB 4K9KA 3LQ1A 1BFDA 1POWA 1ITZA 1ZPDA 1YD7A 3LPLA 2JI8A 2J9FA 3EXHB 5EJ9A 4K9LA 3ZHQA 1TKBA 4JUBA 2BP7A 2BFBA 4D5GA 4GM1A 3UK1A 2JI6A 3LQ2A 2UZ1A 3AHHA 3FLMA 1U5BB 2VK4A 1JSCA 1X7WA 2PDAA 3AHFA 3OOYA 2EZ9A 1PYDA 2X7JA 1V11B 1T9AA 3EA4A 2PGOA 1Q6ZA 1OLXB 1PO7A 4MPJA 5DGDA 2WVHA 1X80A 1V1RA 4GP9A 1UMBA 1OZGA 2DJIA 1X7YB 2BFCB 2BFFB 1V16B 5C4IA 2PANA 2XT9A 3FZNA 2Q27A 2Q29A 4GM0A 1UMDB 1UMCA 3DV0A 2QTCA 1YHZA 1PVDA 3M6LA 4K9PA 5K2OA 1B0PA 5EXDA 3EXFA 3D7KA 2C3OA 3ZHTA 1V5EA 2EZ8A 1W88B 1W85B 3ZHSA 2BEWA 4K9MA 2C42A 3FSJX 4JU9A 1OLUA 2VK8A 1L8AA 1POXA 5EJ4A 3EXIB 4KXVA 5HGXA 2R5NA 2AG1A 2Y0PA 1MCZA 3IAEA 2EZUA 2BEUB 2XTAA 2J9FB 4RJJA 1OLSA 3HWWA 2VBFA 1OZHA 5I5GA 2JI7A 4XEUA 5DGTA 1X7XA 3DVAA 2VK1A 1DTWB 3EXEA 2BP7B 1V5GA 1OVMA 2BFBB 1UM9A 2Q5OA 2BFEB 2PGNA 4Q9DA 2UZ1B 2C31A 2V3WA 4MPPA 1TKAA 5K6TA 1V1MB 5I5EA 4JUCA 4K9NA 4MPRA 1TRKA 2C3MA 1X80B 1V1RB 2C3YA 3AHDA 1QS0A 4JU8A 1UMBB 2IEAA 2G25A 3JU3A 1Z8NA 1NI4A 3EY9A 2JGDA 3M7IA 3AHIA 1UMCB 1R9JA 4KGDA 3M34A 3DV0B 3IAFA 2O1XA 2EZTA 2BFDA 2VBGA 3EXFB 3ZHUA 2AG0A 1GPUA 1OZFA 1KEKA 5ESDA 2OZLA 2BEWB 1YI0A 4WBXC 3UPTA 1AY0A 4COKA 1OLUB 5AHKA 4JUFA 2Q5QA 3AHCA 2O1SA 4JD5A 2Q5LA 3EXG1 5DEIA 4QELA 3RIMA 1N0HA 2G67A 4KXUA 2BEVA 5EJ7A 2WVAA 2IHUA 1T9CA 3E9YA 3AHEA 2G28A 2NXWA 3AHJA 5I51A 3DVAB 3LQ4A 5HYVA 1T9DA 2JI9A 5EJMA 2JLCA 3OE1A 2VBIA 3EXEB 3EXHC 3F6BX 1UM9B 2FN3A 1X7ZA 2JIBA 5K3SA 2YICA 3ZHVA 4D5EA 3DUFA 3L84A 2XT6A 4K9QA 2C3UA 5HHTA 1X7WB 1YBHA 3AHGA 1WCIA 1UPAA 2BEUA 2Q28A 2QTAA 4FEEA 4QQ8A 1V5FA 2R8PA 1QS0B 1DTWA 3EXHA 4K9OA 1NI4B 2R8OA 2JGDB 4GPEA 2BFEA 5EJ6A 2UZAA 1TKCA 5ERYA 2EZ4A 5FEMA 4QPZA 1V1MA 4MZXA 4GG1A 2BFDB 1U5BA 3M49A 2JLAA 4FEGA 4KXWA 1QPBA 5EJ8A 4KXXA 3HWX1 5I4IA 1RP7A 5EXEA 2VJYA 3ZHRA 1NGSA 2OZLB 1V11A 1OLXA 5EJAA 1Y9DA 1YNOA 5EJ5A 3EYAA 2IHTA 2YIDA 2IHVA 2W93A 3KOMA 1X7YA 1PI3A 2BFCA 2BFFA 1V16A 4C7VA 2FWNA 5HJEA 1UMDA 3EXG2 3F6EX 4ZP1A 1QGDA 2WVGA 2BEVB 4JUDX 1UPCA 1IK6A 4RJKA 5K6RA 3MOSA 2C3PA 3AI7A 3HYLA 4MQ5A 1W88A 4JUAA 1W85A
chains in the Genus database with same CATH superfamily
2PYDA 4QPCA 2JLBA 3WNVA 2IBMA 1P72A 5ISMA 4QNRA 5CURA 1JVBA 5BN4B 3TQOA 5HTKA 1CZUA 2C0QA 3TZLA 3WGOA 1TD9A 2P4UA 5HMLA 4BTVA 3JXEA 2NUPB 3Q7TA 1XL1A 3ROTA 5G0WA 4F5WA 5JD5A 4GRDA 2G4CA 3KFVA 4FSHA 4KGZA 3ZKAA 1NMZA 1KFEB 3M5DA 4BO3A 2IS1A 2XJ9A 3ADDA 5CYGA 1TM7E 4RJIA 2H0RA 3K20A 2GYWA 1ZHOA 2P2YA 2IPMA 2CLCX 5KWIA 3BFVA 2J3MA 2XAAA 3DE0X 4IM7A 4YLGA 3UUGA 1RQXA 1LW7A 2VYQA 3BCRA 2VPIA 4C29A 3I28A 4OJMX 3PICA 2YV4A 2NU6B 2ZWPA 5FBKA 5AVWA 1V25A 4AJOA 1QMGA 2MYPA 2JH9A 3CUSA 3HEBA 1AQIA 2IYUA 4G97A 3F6SA 5EIEA 3HU3A 821PA 4XM1A 5DH9A 3P0RA 3S68A 4B81A 5A4KA 3OUZA 3U37A 2WMDA 4L7QA 1PNTA 3TN7A 2O5VA 1HG1A 2B1QA 2QMOA 3B36A 2REBA 3E4CA 3L7YA 1SU6A 1RR6A 1ZQ9A 3P0IA 4FNAA 3LK7A 4HYTA 4MUGA 4P84A 1KDYA 4B17A 4BE7B 4EHFA 1A9PA 2E87A 5IH7A 1IM2A 1CJBA 3NC0C 2QG4A 2BTEA 3KETA 2R2GA 4RQAA 4EEKA 1THMA 2CFRA 4WKBA 1DL5A 2GWRA 4OL0A 3QEAZ 2HA5A 2XWQA 4Y7CA 2XMBA 4F97A 3TB4A 5SZJA 1HFEL 4EELA 3EEOA 3D7RA 4KNWA 1UP6A 4L9RA 4QLAA 4TTIA 1S2DA 4LJ4A 3HO1A 1SRQA 4CEJA 5BOSB 2OKGA 4MYRA 3UK1A 4NI5A 2GN4A 4J0IA 4DWOA 4M3NA 3B1JA 4WKNA 4YUYA 4A5SA 5F7XA 3RO7A 5C1IA 3MGKA 5AKEA 2FMUA 3F0TA 3VSEA 1X7WA 2MINB 3AUFA 3LSTA 4X90A 4PW0A 3D43A 3NNNA 2LE0A 2F8SA 3PXBA 1XRPA 5DVZA 2ZT8A 1LBHA 4L2IB 4RSHA 1QHYA 3AKEA 1CE8B 2II6A 3F78A 3MUEA 3W8DA 3ZGXA 3ZX5A 3LUFA 4EY6A 4BASA 1U2DC 3A28A 1XZJA 3L4BC 4HG2A 2ZK7A 5D6OA 2KX7A 4AL4A 3FTQA 1GGHA 2J30A 2Y1OA 4ZOLB 2FXIA 5H9WA 2M1ZA 2Q3FA 2GFHA 3DPUA 3ELUA 2P5SA 2YMMA 4QE3A 3S2IA 1X74A 2ACWA 2HX1A 1JNYA 1DEKA 3F1KA 3VDXA 4EBFA 1P4SA 1CUCA 3O3MB 5LQNA 3CRMA 1VYTA 1XHLA 1GG9A 3R5JA 2Q6LA 2YYAA 1OZ0A 1QNLA 2IYSA 4P83A 4G5GA 4KN6A 3SJAA 3SM9A 3R0ZA 4DRZA 6REQB 3KT3A 2CVPA 2OBXA 4P8RA 5H81A 1V71A 1YZUA 1J0DA 4OI4A 1M2WA 2QSZA 1PWXA 5KOHA 4LYHA 4JBYA 5PNTA 1AE1A 3DT9A 4CR8A 3PLNA 1PTKA 5G0TA 3NGMA 2RHJA 2B21A 1KR5A 4GM0A 4B6GA 1XKLA 1AMUA 3BB1A 1RDFA 4FD2A 4MUXA 1PYOA 3HCBA 5I9TA 2CBXA 4E0BA 4MVXA 1QOQB 3QEKA 1UJ2A 1D04A 1T2AA 2RG1A 3Q9NA 1SOAA 1Z56C 3RIGA 4DILA 2TMKA 5J4VA 3DQZA 1YVEI 5HMMA 3WKDA 5LMUB 3QMWA 4OATA 3BAFA 4K88A 2PHZA 1UDAA 3DE4X 5AI8A 5FP0A 1RAFA 4O4JA 1ZJ6A 4BV8A 3O4GA 4DNOA 1M0WA 3ILHA 1OU4A 4Q3AA 1KBQA 2JJ8A 1U1EA 1V5EA 2FOLA 3LRXA 1B3RA 3PEUA 3VX3A 2OESA 4AG3A 4HLCA 2C9DA 4XI9A 5B4TA 3KLOA 3B9RA 1IN5A 3D3EA 2FZVA 3PCRB 1XCMA 4GC9A 2ZBQA 2DLNA 1H5NA 4M98A 1L9XA 3ZHSA 1RI1A 2RIRA 5KTNA 3DVQX 4HX9A 2HNBA 1ZKMA 3ZWKA 1CP2A 2C2KA 3NDJA 4DSZA 3LQKA 4O8ZA 4BKMA 3ZV6A 2A7XA 4D81A 4RSRA 3L7DA 4XLLA 4BZQA 2ZI3A 3W9BA 4DMCA 3V7FA 1T5IA 4KVZA 1PZGA 5CCEA 4AECA 2ATXA 4X20B 4HUTA 3GLKA 4K81B 2R4TA 1JIJA 4OUDB 4ZVUA 1DIOB 1K27A 1KEPA 3NIBA 2BKXA 2OM6A 4WE3A 4EQZA 1F12A 3DYIA 1H2RS 4LYYA 4JOBA 5HJ5A 1I94B 2H11A 3VC1A 3CKYA 1SBCA 1EFKA 3KR9A 4W5HA 2W4IA 4KZKA 2H2IA 4ND7A 5FJJA 5KNLA 1OR8A 2XE7A 1QVRA 3BIOA 5FTMA 3R7WB 4M99A 1KQPA 1TCAA 2AQHA 1EXDA 1ZH4A 1CUZA 1MOSA 3L82B 3TG8A 4AN0A 3A1UA 2E4WA 3MWYW 4XWYA 1A9RA 1ZD3A 3S1AA 3PUXA 3KQHA 3IBGA 5FFFA 3L4JA 1RYHA 1NKSA 4LRQA 2JGNA 5AXCA 3J7AC 2TMYA 3O1HB 5EWMB 2NTJA 1TLLA 4RNCA 5AI9A 4JUIA 3HKEB 3A6EA 4ZCLA 4KQMA 3G02A 2J0EA 1PFWA 3K0CA 4MHOA 4GQAA 4EOGA 2OLJA 2O8BA 1YWGO 1VPLA 2BP7B 3G5UA 1DAHA 1V5GA 2AJCA 3NWJA 2BFBB 2C92A 2R97A 5ALKA 3TPZA 4DLTA 1USGA 4JGIA 4EY3A 3Q3IA 4PBRA 3L7CA 4DLBA 2PGNA 3RS7A 4Q9KA 1K9SA 3VVLA 4BP1A 5DFAA 1UJ4A 4QG7A 1EB9A 2H1RA 4F06A 1PAUA 3FX2A 4PWYA 3T7EA 5L4LA 1YB6A 4M9UA 4MPPA 4LF6B 3AERB 3V97A 2ZGVA 1Z0KA 1EG7A 2HLDD 2O2GA 1Y3DE 4GMXA 4N12A 4P7KA 4XH9B 2GCPA 4O3FA 1XP8A 5BO5A 4RTMA 4KUEA 2H4XA 2P5TB 3ROMA 4AUNA 5ALHA 5E4FA 2JG3A 1SCUA 1V8FA 1ZL2A 3ETGA 1PJ4A 2QTVA 4IDFA 2IOQA 2GK7A 2G76A 2W22A 3H1PA 3R3HA 3WRXC 2EC5A 4DG9A 2ASVA 1T8UA 1A2OA 2XUHA 3FTCA 3L8EA 4MPRA 3R9WA 4KMRA 2O4UX 3QA3E 1UC4B 4NKRA 4RTRA 4YQZA 1V2HE 3RS8A 1BHSA 1D9XA 4Z2YA 1J24A 3K2BA 3R0JA 1S01A 2OG1A 4OK5A 1CY6A 4Q9NA 5FULA 3WLSA 3BAZA 4X1IA 4PV7A 4REOA 1ZD2P 5EUMA 3QE0A 2WILA 1RAAA 3I39X 3FKQA 1XAIA 1OX4A 1CB0A 1C0IA 4PZLA 3TRKA 1SVSA 1K8ZB 3QKSB 5DDIP 3SE7A 3SG0A 3D81A 3PGKA 4Z4QA 3E7WA 3AYZB 1XMQB 2FSHA 3ON5A 3SYLA 4C0HA 3WWPA 3ZGYA 4KGXA 4CGZA 3U7IA 1N5LA 3OZBA 1FY2A 4RORA 1E64A 2XQJA 1LKZA 1E1LA 1NSFA 1AQLA 1Z5NA 2CEAA 1OC2A 2MSDB 1EM6A 2QTBA 1GA1A 5BQ5A 1HDZA 5I7EA 3V1UA 5HKKA 5CFZA 1RM3A 4KDRA 2PSSA 5H3LA 2XOKA 4D96A 2VZ9A 1XNJA 4IJVA 3O9ZA 3GGJA 2GM5A 1GPAA 2J41A 2XYHA 1VMDA 3H8SA 4G67A 4HNAB 4RFVA 2XGJA 3PRHA 5IKXA 3W2IA 4MI6A 5EZYA 1VMIA 2PPLA 1GTMA 1B26A 2ON6A 4LV6A 2W2OA 3F96A 2F9LA 3G6KA 3LHKA 4LWZA 2FCRA 5AHWA 2BEWB 2CF6A 3C1TA 4MGKR 3HG7A 1AC5A 3T3EA 4C7OA 1MRZA 2GDZA 4N6GA 1PFYA 2D2FA 5EKUA 2I2CA 5HG0A 4D42A 4W1SA 2I62A 1ABBA 1PT9A 2P2NA 2YW2A 1IYZA 1OW3B 3H5TA 4J3FA 1E7QA 3V7WA 3SZ3A 5FUWA 3RVKA 2M6LA 3M1YA 3ECCA 3FHTA 2C9YA 2XWJI 3EULA 1RQPA 2GJSA 4IUBS 1XXHA 3H05A 5BYAA 3DVSX 4HXEB 4YJ2F 3R7BA 5ILOA 1BX0A 1DTSA 1RJWA 5IHPA 3DOIA 2CMHA 1DOHA 4ACAA 5JTUA 2R8YA 4PPYA 4GWGA 2GM3A 2KW5A 4JB2A 3M1AA 4IQ0A 3IQEA 4PO8A 1VGVA 1P60A 3FNQA 2R3SA 4Z51A 1EQUA 2PZJA 4JLBA 1YO6A 1RBQA 2QTWB 4OXNA 3WZLA 1I4DD 1SCKA 2I65A 1N5OX 3QLVA 2AKEA 1X7GA 3ZU5A 1E0DA 5FBWB 3GLGE 4AKGA 3M89A 4M1TA 4HO1X 4FC6A 4TLMB 2NIPA 4L78A 4URHA 2B9VA 3LFTA 3I6BA 4GLLA 4JXXA 4FFRA 1F4LA 3B3GA 5JLAA 3JQFC 4ZXFA 1KYZA 1LRLA 2QQFA 4IIJF 2D0PB 2DBYA 3D7NA 5AUOB 4Y30A 5A5VA 5KDOA 4YP6A 1NZFA 3TZQA 3UMYA 3NMUF 1Y1RA 1RNLA 3NTXA 3SZUA 1T29A 4FJ0A 1OVGA 2Z4TA 2JBAB 1H2AS 4PG5A 2P4HX 2V7XA 1ZMTA 3IUJA 4BO7A 4CCAA 4PYJA 3LC0A 4H59A 4DMKA 2Y8EA 4ZC8A 2J4FA 2BUBA 2EGUA 2GF0A 5TSDA 1WEHA 3FKJA 2BE7A 2HM7A 3PBKA 3FD8A 4ZRMA 2ENWA 4FOSA 5EFOA 1AZTA 4BECA 1HORA 4A73A 2IHJA 4CKEA 1E6CA 1D6JA 3PEEA 3W6OA 1Y6JA 1EE2A 1SU7A 3ETLA 3W34A 1YJQA 2IBSA 3SQOA 2ZDGA 3JQBC 5I9BA 1GHTA 1HSZA 2ZSJA 4GLBA 1DKUA 1W59A 3U4QA 1UPAA 3NWBA 3H1EA 4MEJA 2AKAB 2YFKA 5IM5A 4OCZA 2C2ZA 3JWEA 3WDSA 1DBWA 1JFVA 3Q7RA 3KB8A 3Q3HA 4P0PB 1V8PA 2ZJYA 1I51A 1UP4A 3MFQA 1L3BA 5A2QA 4I50F 4JJ4A 3E3MA 2HU7A 2VTKA 2YTZA 2R11A 4B6PA 2J0UB 1JW9B 3LMKA 1XCJA 3MILA 5DYIA 5CITA 2ZZKA 1XTVA 1Z6GA 2WHPB 3TW8A 4LJRA 2IUSA 1DXQA 1FUKA 1RIIA 3CCCA 3UYLA 3RJTA 3LP5A 3I8XA 1LS1A 2VAPA 3HJAA 1CRZA 4BUZA 4G4JA 3AEKA 4WL0A 4Y6GB 1RYYA 2E1RA 4OJTA 2X7HA 2NUBA 2MSNA 4BNWA 4DHEA 1U0FA 1C9DB 5CT6A 1KI8A 5D85A 3V55A 3OQ6A 3OF2A 1ZCFA 4PCUA 1QH1A 5IUJC 4X00A 1OXSC 2FPWA 3V1NA 1RI5A 3H2YA 4Y2QA 1K89A 2FLWA 4MZXA 4YP0A 4PC2A 1F4PA 4ZA2A 4JXZA 2IRWA 3WP0A 5BP7A 3K73O 1V6CA 4R2IA 1O8CA 1MN6A 4ZT6A 5L40A 4ARIA 3U7FB 1THGA 1K5DA 1GOTA 2QTTA 1Q0LA 3E18A 4MYHA 4TQAA 1F0PA 3ZVRA 2Q5HA 4WD3A 3BWEA 3S40A 1GUZA 1D07A 1NBMD 2PKQO 2QAJA 1V1JA 1QK5A 5HQ3A 3ILYA 1DC8A 3WGZA 3QTBA 1CF2O 3ZX4A 1N9GA 3IMFA 3NHRA 1NLUA 1XJ5A 1W48A 3B1YA 4W9NA 3TTSA 1AMOA 5M7EA 1BN7A 2G63A 2H4WA 1FB5A 2ZFUA 4BNVA 1KXZA 4D99A 3A58B 4QUHA 4PRYA 3NAZA 1EFRA 2QW0X 4ZCPA 3T1VA 4INAA 3T7CA 2R7MA 2BTQA 4CUKA 3R3VA 3NXKA 1PV1A 4HXFB 1T5HX 2CHUA 1Y4AE 4O4IA 3OUTA 4R1NA 3QLUA 4LXHA 3EPKA 5GJVC 2CUZA 2XOEA 3MBKA 1YRQA 4JFRA 1RJEA 2J8ZA 4MWBA 2A9OA 3G5AA 3DLCA 4MWZA 4RW0A 5JSYA 2HWKA 3RVLA 3I1YA 1KZYC 3GROA 4BYMA 5IT0A 4PZUA 1MX1A 1XQ1A 4G0PA 5FA5A 3O5AA 1MP0A 2XX3A 1TIPA 5AUPB 2YV2A 3KAPA 3IQHX 4PONA 4B0PA 4BWGA 3ZLBA 4D43A 4CQLB 3NTLA 1IK6A 3ZJUA 3EZGA 3VR2D 5FUQA 3DKPA 4I66A 4UNNA 4RJKA 2XB2A 2XNDD 4DT1B 4BPBA 2Q8PA 5K3EA 4FQ5A 4W8GA 3RBAA 3DOJA 2NQTA 3DEAA 1CDEA 1N1EA 2ZRMA 2OECA 3ACBA 1XA0A 5IUKC 3FSGA 4YAUA 2ONJA 3OQJA 3RVOA 3P9PA 4BX8A 3BD7A 1EIWA 3A7EA 2O0MA 4GUDA 4X92A 1N8KA 4Y2HA 1M33A 3KPVA 3WBFA 3ABOB 3FVRA 1NBWB 3A36A 4HQLA 1X9IA 4NR0A 5C4MA 1QHIA 3KZCA 4QECA 4Z7QB 4IGEA 3WWZA 5B1YA 4QU5A 1EFLA 1LJLA 1JJAA 3QBEA 1PZNA 4J90A 4EKGA 1E3DA 1HZZA 3G7NA 1G3MA 3GRKA 3TGWA 1FDOA 2A78A 4S0ZA 5ESWA 2VYNA 4A1FA 4HF7A 1JB9A 3AM4A 4AROA 3TAUA 3C24A 4B09A 1P1IA 3NIFB 4MIKA 3RHSA 4BNHA 4ARBA 1UANA 1I24A 4Q18A 4X7PA 1RHKA 2BY4A 3COSA 3FH0A 4YXWD 4XJVA 1ONBA 3KTAB 2D5CA 1VTKA 1YQUA 2JLXA 5KQPA 5DM4A 1PQUA 4J1TA 3PVZA 3DBLB 4B84A 2WK1A 1NOIA 3QXJA 1NN1A 3ESBA 3NWEA 4XWKA 3HXTA 1A7AA 3I1IA 3R09A 3U48A 1T4CB 2J9GA 1KAMA 2FEKA 4MWOA 1N8NA 3SPXA 5F2EA 5I6DA 3HVJA 3ZQKA 2ZBGA 1KDOA 1PZEA 3WLIA 1ADBA 4NBTA 2HQSA 2D0IA 1QV7A 1RQ2A 2HWUA 2P1ZA 3SBOA 4BE9A 1QR2A 4FDLA 1SOMA 2B25A 3WK8A 4D4GA 1L5MA 2NU7B 2QGNA 3PF8A 5BMOA 3KQPA 1FZQA 4IW3B 1C3EA 1DE0A 1RRGA 1VYHA 3BK1A 4GP7A 5KNDA 3OLWA 1U02A 1H5UA 2OO5A 3EPHA 4ZYWA 4DJ5X 4D8TA 2R6CA 2PR2A 2IWHA 1AGYA 3LCUA 3PPWA 4KAAA 1LS6A 3RABA 1FYEA 3UTDA 2BEJA 4LY9A 4NJMA 2IEBA 3E8MA 3FRHA 4G0YA 3TR6A 2JDIA 4F4CA 2IYLD 2HTFA 2PDAA 1FXSA 1QDEA 2R87A 1BEZA 2NYAA 1OKKD 5FCDA 1WZEA 3NM4A 1NVKA 4KR7A 1NN5A 2RAFA 3VHXA 3ESZA 4DV7B 3M6VA 4BMVA 4HRAA 1E2KA 1EFVB 4KH1A 2AKYA 5GM1A 4GU5A 2BGKA 521PA 4JC0A 1NXQA 1T2CA 3SIPA 4J0GA 3ICWA 2EGHA 2PSFA 3QMVA 1SC6A 4LWQA 1TDJA 4JKOA 3L0PA 4TYWA 4G4SP 3M4XA 4RYDA 3JASA 3PC8C 1WP4A 4ID3A 1UMBA 4KN9S 1PX2A 1UAYA 4LAFA 3S29A 4YDQA 1NY6A 3IMCA 1ULSA 1A88A 1NR7A 4AZ3B 3QH4A 4YGXB 4TTRA 1QE5A 1U9CA 2BFFB 2W6QA 1RPZA 4BLUA 1TA4A 2O59A 2AN9A 4J0HA 4PC1A 2I4TA 4ZMBA 1YZLA 3LDAA 3PGVA 3GT3A 3KHSA 3ZV3A 2VDWB 5B36A 2C4MA 4R9NA 1GUYA 1Q11A 2OILA 4AXXA 1YAHA 4WEOA 5F23A 4BVFA 2PU5A 4QIHA 3K1AB 4IDNA 3NHYA 2W0SA 4H6XA 3EUEA 3M6LA 2E49A 4IEFB 4K9PA 1B0PA 1OFTA 3G5LA 2R00C 4NMXB 4TRRA 3ZWVA 1ZWKA 3Q40A 4OSPA 5G0UA 2PNJA 2Z09A 1KORA 3E3NA 1E1CA 1BGWA 2O2XA 4F3KA 5J4LA 1Z07A 3L6CA 1SB9A 2GRJA 2NYRA 3ZDFA 4CMIB 2A94A 2XB6A 1HG0A 3QPUA 1SD1A 3TZHA 1I2MA 3WLQA 4DPLA 2Q5FA 1IXKA 3M2TA 4HFJA 4YP1A 3WMEA 5JAUA 3G59A 1ZN8A 3DMTC 1Q16A 5L3QB 1DC7A 2I6QA 1B8PA 4RVUA 1ODKA 3PRYA 4NBRA 5T8KA 4AG5A 5AXAA 1P1KA 1RI3A 1WD5A 1UJ6A 3WKBA 3FE2A 1WV0A 1SR8A 1KOGA 4L73A 5A6SB 1RQRA 2W6NA 2Y0CA 4JP3A 1F1JA 2O2CA 4R0NA 4OQDA 4C3UA 4H0NA 5BT9A 2BC9A 3JYLA 3PQ8A 4TXLA 5JCJD 5KREA 1NDQA 1KDTA 4XQCA 2VWHA 3FMVA 4MI1A 4FWIB 1Q5PA 2OV2A 3DDZX 1W30A 4FONA 4C4ZA 4KWHA 1U1CA 3AU9A 3DE1X 1VI2A 3PU6A 4M8LA 3WX0A 2B1GA 1SBQA 4Q7EA 4X8HA 5DX8A 1T6ZA 1IOZA 4Q66C 4NAVA 2YJZA 1U81A 5E6SB 1WHTA 3ILSA 1XTTA 4ZJYA 3WQRA 3BZWA 5JADA 5H02A 3I2HA 4NARA 4M0LA 4ZAZA 3CF2A 4H16A 1J07A 1B8VA 3JAWB 4YCAA 5E6UB 2YXBA 3OZIA 5EFZA 2QBYB 2ZBUA 1R6UA 2Q0QA 2VJAA 3GWZA 2BEUB 3RDPA 5FNVF 1CJKC 1NURA 4RPIA 4XGRA 2PMKA 1OLSA 1VMEA 3EQ9A 1ST3A 1FSSA 3PF9A 4RFSA 3ZJVA 2GF2A 4MUBA 5DGTA 1GCOA 1YUBA 2RGDA 5FORA 1XVLA 4QRIA 1PNRA 1H0SA 2AR9A 1PQYA 5EE5B 5L3ZA 3JQDA 3UMGA 4NZPA 4PICA 3USES 1RKQA 2ZXUA 3WWDA 1NLMA 4AY5A 4II7A 1GTSA 1M34B 1G0OA 3KU1A 3OZTA 3P8ZA 1H23A 4M0MA 4MSUA 4LJLA 3VDQA 5JXGA 3QF4B 5FWXA 5IKEA 3UVEA 4L9SA 3IQIX 4JS0A 1DC5A 5CNKA 1E63A 4ARAA 5C7IO 1EX1A 5LQKA 3OPYI 3H9CA 4IJMA 4LXGA 4QYWA 3S3TA 4LK2A 4IVRA 3HCAA 3HABA 1V7PC 1QGZA 1VIAA 4EW1A 1UEIA 4YV0A 4E5UA 2G80A 4JP5A 5MHTA 1XX6A 2WWWA 3AF1A 1IRXA 3DL4A 1BOOA 4RVOA 4UNIA 2CSUA 4I81A 4HNQA 3P9IA 9GPBA 1GAXA 1BFUA 3A32A 3DM5A 1C3XA 4DR7B 5KJ1A 2CFOA 3FTEA 1GFWA 3PKJA 3UJCA 1ZK2A 4LKRA 4CM6A 3FTFA 2GBLC 3R3YA 1QOZA 2QL6A 2RG7A 2PZMA 3D0QA 3KTOA 4FNGA 4K9NA 4BVBA 3JD4A 3JQGB 3GLIB 2W2TA 2HRDA 1I0LA 4WX2B 1ZKDA 1GSOA 5BUZA 2AMYA 1CEQA 1XRJA 3OH8A 4R1SA 2AOWA 2ERXA 1AQ6A 2LP4Y 2WSIA 2H1FA 3U7RA 5LXTA 1E9VA 5JNRA 1CWUA 3NH9A 2Q49A 3A9TA 3CW8X 3CUUA 3TXYA 1I7SB 1R8YA 1Z8NA 4QYTA 4YECA 5B57C 2PQ0A 5J2TB 3QHQA 2QNRA 3BK2A 2WTEA 5C5IA 3TYXA 4I4TA 3U49A 1PFQA 2QT9A 2I22A 1E77A 4INOA 4RKEA 1E0JA 1E3WA 1SN7A 2HMVA 3M7IA 1QH9A 4Q1EA 1UMCB 4QFDA 4C6TB 2Z5VA 4ESEA 4RK7A 4NY1A 3JAMA 1YDMA 5FPHA 4ZDIA 5KSWB 4ZO4A 1Q0ZA 3PI6A 5DW0A 4DR4B 4ACBA 2WJPA 3X1XA 2A1UA 1JNXX 3OPYA 2EFHB 4B3BA 1E0SA 1GTVA 4I1OA 2VYCA 3WWOA 1U6JA 1YZNA 3U7GA 3KJIA 3PRJA 1GPUA 3HUUA 1OZFA 4BGIA 5F51A 3TQFA 3ZIDA 1EA7A 4GIBA 5FWYA 1CKEA 2FPSA 1VE1A 1YS2X 3BEOA 2PQ2A 2ZCVA 3GJTA 1G6OA 1ZM7A 3T7RA 4S05A 4ZHQA 4UM9D 1IZ7A 2HMWA 3LBYA 2V98A 2AFIB 2OCGA 2ZUDA 3DGFC 1I4WA 4G0WA 3DO5A 3C6KA 2CSXA 1JT2A 4ZEVA 5KBYA 3N2EA 4F12A 2OV8A 4BXOA 5TJ9A 2OBMA 3AI2A 5D6NA 3ZVMA 2G1JA 1U7UA 3B1XA 1PR3A 3AJ8A 3BGSA 5C51B 3I05A 2GBFA 1WAMA 1W36B 1P9LA 5BSKA 4H31A 2FZLA 4MVJA 2RONA 3EFEA 4WZZA 3T9DA 1K5PA 1UK7A 1USWA 1XNHA 2HU2A 3B78A 4PAWA 4IZOA 3LT0A 4RE5A 3SDZA 4F9FA 3CJTA 3LGAA 2ZSUA 2PUFA 4MGYR 1JHVA 2G5GX 3T52A 1SK9A 3IBCA 4F4HA 1PT7A 1EI9A 1FU8A 1XTIA 2WHXA 3ECAA 2JFUA 3JWHA 1X1TA 1Y34E 4YWJA 2DEUA 1GCIA 2QSJA 5ALZA 3LUDA 4P31A 3VKWA 2OLKA 4KIJA 3VOTA 4HI0E 3CGWA 3NEJA 3GVXA 4KPUB 3TTYA 1EVZA 4UQPA 3LNCA 5AK5A 1JWAB 3NEYA 3QXXA 2GK6A 2AD5A 5CIYA 2CGEA 2XT0A 3L01A 5F2OA 1NQ5A 3K5IA 1ECPA 1KI6A 1RBYA 2EKBA 4N0EA 3CEAA 1NM5A 4R4JA 5IC6A 3W5VA 4B0OA 3KDAA 1QCDA 2JH8A 3PNSA 2CVZA 2LXNA 4QQRA 1TUBA 3E1SA 3OD5A 5KHAA 1QORA 2AN3A 3UIEA 1PBNA 5E9QA 3UAWA 1EZ4A 4EA6A 3WO1A 2PA0A 1Y5LA 4FK8A 1ZS9A 5KYUA 3I01A 1F2UB 3OZCA 3PFCA 4D57A 2PZAA 1SZCA 2BSQA 4ARCA 1K8RA 3CEJA 2P2SA 3ADOA 3TCXB 1EG2A 2OKCA 4B76A 3L84A 5EC8A 1I3LA 4LYJA 3LQRA 2Z08A 2CL5A 1GSIA 2VDJA 4KBYA 5IVIA 3IQZA 5C37A 4YAOA 2FSFA 5MGNA 2P2DA 4BMXA 2PXAA 3E3LA 3HV0A 2EIHA 1XAHA 4FFLA 1RS0A 1W25A 2JFHA 1YBHA 1CUBA 3GLVA 2B83A 5HFNA 1G2QA 1C41A 1T4DA 5DLYA 2JA1A 3HRKA 1PEAA 2V4UA 1C4WA 3IT2A 3MM4A 4FX5A 5ALLA 1W0KD 2P62A 1RWMA 1VLLA 5KYXA 3O4IA 3B3AA 4W5JA 2VDNB 1I4OA 4QQ8A 3TSOA 3CX4A 1ID1A 4YCBA 1EM8A 1T8YA 2AC4A 3T7SA 1O03A 1C81A 1MHTA 3HU1A 1JTEA 1UOQA 1ZAYA 2WE7A 2VUSA 4K9OA 4I6EA 1OC4A 5K0ZA 2WTUA 3DB1A 4QTXA 5DT9A 3C97A 2EJVA 4ZHQB 1BCRA 3CF6R 3NVKI 1QMPA 4B6FA 2VR1A 3R0IA 1BXGB 3R40A 3AV0B 4HSEA 3C5WP 5AHRA 4JLAA 1JPJA 4UVEA 4ZQHA 3ZDQA 3DLHA 1F5SA 4X1OA 3PQCA 2YJNA 4QYXA 2CBZA 4HNUA 4CKCA 1VL6A 3N2IA 4TN5A 1KO1A 4JBWA 1ZITA 2ZI7A 3VPBA 1G7CA 4JMLA 3WLOA 1IEWA 2OM2A 3ZI4A 4E1BA 5CA1B 1B93A 1YBFA 3VPCA 1R18A 4DDVA 3NT2A 2VA9A 1OJLA 4KN5A 4MIOA 4E70A 1FX0B 1YIDA 2R1TB 3UWDA 4DDWA 4RJLA 1MIOB 1SM4A 4KXXA 4OFWA 3E7FA 1TFRA 3U5TA 3HVRA 3F6YA 5CX1A 5E8JA 3ZHZA 1V35A 3DP7A 4R69A 5IH3A 3H6HA 4YO7A 1LDGA 2ICAA 3WLTA 1OLXA 2DY1A 2P77A 4RJ2A 1K3TA 1QQ5A 4LECA 4Q48A 4CLOB 5TQ0A 2O1EA 2VHEA 1V3UA 2AYXA 3ZE1B 2OCKA 4EGFA 2HIHA 4KOAA 4DPMA 5BWBA 1O6CA 3JARB 3HL4A 2I1QA 5EE0A 5SZKB 1N6NA 4Y9DA 1Y4SA 3GZNA 1I0IA 3TMAA 3ZWPA 4CEIB 5REQB 3U7JA 2FUEA 3RS3A 4X6XA 2HD4A 3H1GA 5AESA 3D8HA 1U4NA 2KE5A 4IOKA 4Y0NA 4LF9B 3PXCX 2Q2VA 1ZNZA 4PR3A 4WUTA 3Q7SA 2JLWA 1B00A 1IEVA 3KYCB 4BHTA 3H7IA 3EZ9A 2OWDA 1PHRA 3OC6A 2VS1A 1QO0A 4LTDA 4BOYA 3BRWA 1JLKA 2XUZA 3DAOA 5COQA 5LDGA 3WL8A 3O1LA 1Y6RA 4F1KA 4BLSA 4UMFA 4DIOA 4LKOA 3U19A 2XUKA 3VBEA 4RHXA 3BQ9A 2QRLA 1U0SY 4QOGA 1TEVA 3D8SA 4JT8A 3U44A 1KPGA 2FSSA 3P20A 2ZRPA 1S1CA 3EGXA 3HJGA 1PFVA 2HV8A 2QE6A 1AF4A 4ZRNA 2CD7A 1Z63A 4J76A 2J5KA 5DTIA 2AEJA 2P75A 3VH1A 1MXFA 2EJUA 4EEXA 1FP1D 1KFCB 4Y2PA 1E66A 1XHEA 2PWAA 3NHFA 2CHEA 2UZ3A 1GKIA 2B20A 3L1KA 4MYTA 1H9AA 2WLSA 3P97A 5CVCA 2VJCA 3AR8A 5AUQA 3ZY4A 4PG4A 4CI0B 1V3VA 4S1VA 2H1SA 1DAGA 2P6NA 4LN1A 2IV7A 3VNRA 4DSTA 1LDYA 1VHJA 5A9SA 1PD1A 2PH3A 1OB2A 2Q6OA 5CD1A 1FFXA 2R8XA 2QVCA 2Q0XA 3URMA 1MH1A 1RBZA 3VR5A 5B7QA 2QD5A 3P2MA 5KYYA 4TZ0A 1ZOSA 4V39A 4MAMA 1RRMA 1YE8A 7GPBA 2I3AA 5H3CA 2WWIA 3OMWA 4QUKA 1T3TA 4C14A 1DG1G 2CNNA 2ZYSA 1QTIA 3MT7A 3PXEA 4GO1A 1SG9A 2E5WA 1ZDMA 1AXRA 3EXIA 1G8PA 5FI1B 2VNHA 2F67A 4FBGA 4J9UE 4Q1DA 2QRPA 4GX2A 1UBJS 4QJIA 1GO2A 1RRPA 2LIVA 3HYNA 4Q9HA 1UC8A 4MI9A 4BJ5A 1UBTS 3MCUA 1CU1A 1GPYA 4ND3A 4ZWNA 4UUAA 3VI3B 1AMNA 4EABA 1EFPB 1QKJA 2D7CA 3GRYA 3IKMB 4FFWA 4QYIA 3PNPA 4G23A 4HK4A 3RJMA 5FTJA 4RUKA 4WCVA 2HRBA 4ME6A 3G8CA 4MWGA 3ZLUA 3FMIA 4A0GA 4RVSA 4DSUA 1UC5B 2VFAA 4N9QA 1HM5A 5K51A 2HJRA 4C43A 4KYUA 4D4LA 1SQFA 1S4MA 4OUKX 2B61A 1SMKA 4Y67A 3SQNA 1ZI6A 2ECPA 3O8OA 2O8EB 3TEFA 1SKYB 2Q4DA 3DFZA 4U2DA 5HUHA 4TYQA 1R0ZA 4BNFA 3IXQA 4US2R 4J9VA 4NU5A 3P26A 4FN5A 1YJ8A 5KWVA 1LBQA 5ADUS 1ZVVA 1JXMA 5CYOA 2CK3A 1AKYA 3FLAA 4GX5A 3H5LA 3D1LA 4LRSB 2ZIXB 4N1AA 4J1SA 1U1DA 5LA6A 4D41A 3A2LA 1VBNA 3MWDB 4N18A 1NMQA 2JFYA 5A2GA 1H93A 3GL9A 1ZICA 4R2MA 3NBQA 2BGGA 1U2TA 2R9VA 2FOXA 3OHSX 1OILA 2IHZA 1UOEA 4KSBA 5CXSA 5D86A 4S3MA 4XSGA 4V38A 5JSKA 5DSXA 4BBZA 1XDDA 2P5UA 2VK4A 4NU6A 3WBBA 2O2IA 4FZVA 1N2GA 1M67A 4KFUA 1NNUA 1Q44A 4WLEA 1GT91 4N5LA 2O8FB 4Y6PA 3HB9A 1N4AA 2ZJ7A 2IS2A 5D1NA 4JHXA 1Q22A 3RKSA 1KSHA 1JIIA 4HEA6 1XLTA 4A7PA 4JROA 5LDDC 1QC5B 5DE3A 1PR6A 2QL5A 4U8HA 3IL2A 3W4IA 4R1QA 1U0JA 5IANA 3TIIA 1T9AA 3D02A 3F6CA 4HDQB 1WEKA 5TPZA 1F38A 1KEZA 1T4BA 1J1ZA 5EQFA 1KI2A 4BGUA 3GH1A 4LOAA 3RSCA 4BNDA 1QJ4A 1QO9A 2H52A 2RI6A 4H1WA 1NVVQ 3GDWA 4LOHA 3DAPA 4QEDA 3V9PA 4AKTA 5HRAA 4IRXA 4RXTA 2BGIA 3FA2A 1Y5RA 1W1IA 1XU7A 1N5KA 4DG8A 4RMJA 1EHIA 2DJIA 2IEIA 1GZ3A 2EF1A 3OWHA 3OC0A 4FTWA 1M2GA 2ZTMA 4KLZA 2XWBF 4DUGD 3RFVA 3MINB 3BICA 1DT5A 1TAHA 3N2KB 1M2VB 1DOAA 1H2EA 2Q6IA 1F5NA 2X2OA 5D3QA 5LQAA 1M0TA 2V58A 3AETB 4J2TA 3R8XA 1BCSB 3AFIA 3BMQA 1AKMA 1LVGA 4B3HA 4NOJA 2GEKA 3I30X 4RY2A 3PQEA 2AWNA 3ZDDA 4TRMA 3GUUA 1KPHA 3K9HA 1RZRA 1GR0A 3A31A 2GN0A 5EXDA 4G84A 3DOEA 1X2EA 1EBUA 3D7KA 5DOZA 4AWBA 3KAQA 4MS4B 2FFAA 3GGGA 1CEYA 3LK6A 2Z8ZA 3KHTA 1XMPA 2P4EA 2ZJ5A 4XVQA 3W8FA 3W9SA 1PL0A 1EB8A 3I34X 4KMSA 4WZ6A 2XRFA 3I5YA 2F62A 2HMTA 5F5LA 1OYOA 3HGTA 4NG4A 2NN3C 2P9TA 2VJNA 2V0NA 2V55B 3DDSA 1EUCB 4I8DA 5KOJA 1ECBA 3TSZA 2H1LA 4NMMA 4Y18A 1LLDA 3DF9A 3UTCA 4C5CA 2DUWA 2DX7A 1AS2A 1P73A 1VJ5A 2CDNA 2HDOA 3BDIA 4GVPA 1T6NA 4UAUA 1Y0BA 3DEYX 2WF6A 4LC1A 1RRFA 5EMMA 3GLHE 4YRSA 3IIIA 1UOOA 3LWBA 5EHGA 2B3TA 3MCVA 4HDSA 4HGYA 2EDAA 2RBEA 4BQQA 4R9VA 4KXVA 3G82C 1U2ZA 2C5GA 1PKEA 1OAAA 2ZS7A 2AG1A 2HBYA 3BE6A 2I4OA 2QM0A 1IN1A 3NTUA 1JLLA 4KAXA 1AQJA 5KMGB 1WF6A 1Y6FA 2QD1A 4O2BF 2MJLA 1KMMA 1MORA 4BB5A 1Q0PA 2G8NA 2FDXA 4UULA 5LB4A 3ZWOA 3ZVNA 3L1HA 1YB2A 3GJ8A 5AW5A 4WK4B 4DWVA 2IDZA 3AY3A 1OGYA 1OROA 1C1YA 1Z0UA 4K6GA 1KYIA 4G65A 4HCJA 1TE2A 2CLLB 5FQOA 1DDIA 2RGNA 4RZIA 1IZ0A 4OHOA 4EYSA 2WF7A 3OCVA 3QPCA 4GECA 4PRZA 1SKQA 3I53A 1Q95A 2AMFA 2WHRA 2OHIA 1DTWB 3KXIA 2Q4BA 5J47A 2JFWA 4D7AA 3D3QA 3THWB 1IBRA 5DYNA 2HRZA 3FYUB 1N2CA 1SBIA 5JOQA 4N5DA 1SBHA 2B4TO 1SIUA 2QVZX 5CT4A 3K9NA 5EUCA 2G06A 1SKBA 2CLIB 5H4GA 2VJBA 4CCYA 5LU9A 1NQVA 2GETA 3TW6A 2C7OA 4G25A 1ZD9A 1USIA 4OOFA 5FOXA 2YMQA 1BS9A 4N8SA 3EG9A 1QIDA 3PFKA 1SUAA 2REOA 4U1RA 2HCTA 5JWHA 3Q7EA 2PU7A 1A5TA 1VE5A 3KAKA 1QF7A 4HNHA 4CEHB 1NOKA 1GGNA 4DWWA 2REQB 1GQRA 1P2UA 3KJGA 2G1KA 4E03A 4N7RA 3TTWA 2QUJA 3EC2A 1DI0A 3T5TA 1GRQA 3BXOA 1NPTO 4XA8A 1GIAA 2AOTB 2VOEA 5DHAA 3P0HA 4KKVA 3IT3A 3AP1A 4KODA 1FRQA 2JI4A 1W1UA 3IUBA 3LBAA 3BZBA 4MO9A 3F47A 5AI6A 5CBPB 3AKYA 5JT1A 1QTQA 1VDMA 3LVRE 5A02A 4YN3A 4W9NC 1GQFA 3MAJA 1KZGB 1XPOA 2BCJQ 2WJGA 4BO5A 1XPRA 2D5BA 4RIFA 3W3ZB 4Z4GA 3U0BA 2FWIA 2IEAA 2AI2A 1CHDA 3SYRA 4IV5A 1AJEA 3JWPA 1KY3A 1SC3A 3ABQB 3NHAA 3QLUC 4KQXA 1LBTA 2H92A 1JIXA 4LUCA 4DM3A 1CQXA 7REQB 5E0OA 1DV1A 4OHRA 1WZIA 4WXHA 5C5CA 5AW0A 4ZOEA 5JDIC 4REQA 3RYCB 1ZX1A 1RD4A 5HFJA 1ZD1A 2WBLC 3RUFA 3Q15C 3HN6A 1IDOA 5JBQA 1U3FA 4IX9A 3L7JA 2ZYUX 3OTGA 2HBRA 4EB8A 2D74A 4IQGA 3R7DA 1R4ZA 4KB5A 2SCUA 3K72B 4EENA 2FQQA 3RVSA 1GDHA 3PGA1 3LLUA 3HWRA 1K5GA 4IJKA 3IILA 3R77A 3AGQA 3HZOA 4XUDA 5DCUA 2PAAA 1SBYA 2YHIB 4KYTA 4YRDA 3ZU3A 1ZR4A 4DIMA 2ZRJA 4YONB 2HJHA 1MV8A 3RAPR 1OT3A 2B6HA 3ZD8A 4QU8A 3ZS8A 4EPWA 1Y33E 4D82A 2RC5A 3KFLA 1PR0A 2MDTA 2IXFA 4G0MA 4GYJA 1AKTA 4DMFA 2VN8A 2HGZA 4YJKA 5KX5A 4Q5IA 3O26A 4DQUA 2SBTA 4F85A 1SBZA 4OHFA 4ENTA 3A1CA 3PC2A 4O3MA 4KK3A 3NC4A 1RYEA 2HCBA 3GIDA 1U1FA 3LXXA 2XOKD 1NRXA 1OI2A 2VTVA 1F8YA 5JBIA 4CMAA 3DWFA 1YZ3A 4B35A 1IUKA 3KQLA 1ETHA 1SWWA 2PWBA 2QSYA 2QNBA 1BHQ1 4KPGA 4TMWA 1MC4A 2RHLA 3G49A 1JQBA 2FSGA 1NG9A 1N2ZA 1XWIA 1ISGA 2OOSA 4OM8A 4C76A 2IFTA 1AUPA 2H08A 3GJ4A 5KTPA 3TX2A 1I10A 4AYXA 5BN5A 3CRZA 2W7TA 2OENG 1XDZA 1BIFA 1JEQA 4FE7A 3IVMA 3LY8A 3P7MA 2YJ6A 5GZ3A 5U4XA 1JAYA 3SZLA 4B46A 1XMSA 3E05A 5TARA 1Z5UA 4CKWB 3IMGA 3KJEA 2E7ZA 4BRUA 2VDMB 3OBIA 2JGMA 3NM5A 1XD2B 3K32A 1FNDA 2AOXA 4JA2A 2XKKA 4ENWA 3A6HA 4JVOA 1W47A 1M6WA 1ISFA 1QGED 2C9BA 3DBHA 4C6HA 1E1YA 2GCIA 4D0LB 4DREA 3GJ5A 3KEOA 2IQ5A 3OTQA 2VXYA 2XDYA 4H7IA 4XKJA 3M83A 4CWAA 2OBLA 1PX0A 1R88A 1SUSA 3I4LA 2NXWA 1X77A 1WVIA 4BMZA 5I51A 1Z5PA 3M5CA 4MCIA 4FE4A 4G5YA 4WK0B 4YI3A 3UM9A 5AUNB 1LBIA 4CM7A 2PZKA 3LY7A 4YP9A 5K0SA 4ZXPA 3ETHA 4KLRA 4JJIA 2QLBA 4I1VA 4XIGS 4R05A 1U7XA 5KNCH 3BQNB 1T1RA 1ZW1A 1S6YA 1N6KA 3LPAA 3LZCA 1KAQA 5AVKA 4FMCF 1AGXA 3OTWA 3NBFA 3V4ZA 4QJBA 4ZT7A 4UBIA 4BAUA 2R4QA 4PSCA 3T54A 1C30A 1IXSB 1G5QA 3AY0A 2VNKA 4HDMB 4LDNA 3MS2A 1RM4A 1QK4A 2YUIA 3PE6A 1YL7A 4ENRA 4ZVKA 4FLFA 5DI3B 1K97A 2QAGB 2MYNA 3BB4A 3N28A 3QE2A 4IH4A 1XRRA 3A11A 2I2WA 4G36A 4GGPA 1D2AA 1R6XA 2DPLA 4PQYA 1XR3A 1MNQA 1H4SA 1NHWA 1X7WB 3FCYA 2GNAA 2IHKA 3CLRC 1EJ2A 4J0FA 5E9JA 4FLEA 1FF9A 2WF9A 4DA4A 3C4JA 1AKEA 3RNOA 4QHYA 4BQPA 1MQAA 2Y9PB 3GYGA 2F3TA 5I9IA 5D3MB 3RTEA 3VJLA 4FI3F 4D3XA 5IT5A 1CNEA 2P0AA 4HTAA 1KQNA 3ROXA 2AF4C 3O2NA 4CR6A 2GHTA 1N5DA 2AGVA 3AJEA 2XCRB 1MIHA 3N7TA 4UTPA 1LW6E 3SC3A 4K5QA 3C3KA 4X41A 1GQSA 2GN8A 1EGHA 2OQRA 2IE8A 4E5YA 5IF3A 4FS3A 5LWQA 1M6VA 1ZJ5A 2OV3A 1QU3A 3DV9A 1E2LA 4UTRA 4CIBA 2A5YB 5ENVA 1ZI8A 3MN1A 1G8HA 3IS3A 1XKXA 2J59A 3THWA 5LD2C 1FDUA 2C61A 4EJSA 1SAYA 2FGKA 4P3PA 4NBSA 3AF4A 4V02A 5FPTA 5HE9A 1VRCA 1GGMA 1QBKC 3N2LA 4CM5A 5JAIA 1E8DA 3QENA 3VFDA 3NASA 3J81k 1V8OA 3D2CA 1NVEA 2JLAA 2F8MA 3E5RA 4OHXA 4KOEC 4TLDA 3RU7A 4D1YA 3BHNA 3ZZMA 4GDFA 3I3SR 2AH5A 1L7BA 1WKVA 4D8VA 1TW3A 7AT1A 1NFFA 1TJ4A 2IU4A 4F9GA 2XOXA 1C3OA 1Y4DE 2JJYA 4NOLA 4CFZA 1HMYA 4HBZA 5AJVB 4Q7LA 2APJA 2VF8A 3C74A 3RRFA 5IRCD 3CRNA 3EHEA 2X3YA 1BE1A 1X86B 3C8UA 1PUJA 4HEQA 5EMLA 1E89A 3G2LA 5T8KC 3EFOA 1ENOA 1F2DA 5AW7A 1QE3A 4IHJF 1YNOA 4GLFA 3ZK9A 4ECAA 2OT3B 2GD6A 3FGOA 3CF4G 4YCLA 3RIEA 3EF0A 3PUKA 1XWWA 1XZQA 1WY5A 3F7TA 4TVKA 2PL3A 4V2UA 1SOWA 2DR3A 3LCVB 2K7FA 2E37A 3FNHA 3LLMA 4WACA 4EHAA 3FCUB 1YL5A 5JZSA 2R60A 2Y27A 2D5LA 2AW3A 3HZRA 3CINA 4G4SO 5IU6A 3BJRA 4LHVA 1SQ0A 4NE7A 4BCCA 4LDPA 4RA6B 3RS0A 4O33A 1P1BA 2CXRA 2RARA 4EUKA 4H60A 3EXG2 4AD8A 2HW8A 2X4DA 4Y98A 5JQGF 3R3SA 2DH5A 1MVOA 2YY5A 4HBGA 3H2KA 2NP7A 5LLTA 3RU9A 3HB7A 1J0BA 2CY0A 2PJDA 1CEXA 2YNMA 5HGJA 1RLUA 3HP4A 3K5PA 4CMEA 3I9FA 3M9WA 4UUBA 1YB1A 2DYKA 1LPAB 4M36A 1IONA 1FFDA 1WJGA 3LFUA 1NXSA 4V0SA 1JHDA 4FZ5A 3T5CA 4D92A 4XWWA 3SICE 4OH1A 2D2EA 1J00A 3KUXA 4KQFA 4DTIA 1EDBA 1JU4A 4KREA 3V48A 2JLZA 2C98A 3IUQA 2C1ZA 3NAQA 2F1JA 1YB4A 4IVPA 3GEPA 4JLMA 4TV9A 2GZ3A 5ARCA 2CDBA 1SKYE 1Q19A 4F2GA 3PC3A 1JT9A 3NV9A 1N33B 3EMBA 1GTG1 4J0QA 1FLAA 1VCHA 3BQMB 1AKWA 3QEOA 3LSYA 4UD2A 1ONOA 3RS2A 3SBEA 3WKCA 1C9JA 3E8XA 1LV8A 2LDXA 3RADC 1QIGA 1VGQA 2O8BB 4P58A 5IK2D 2VHTA 3UYKA 2VZEA 3LKVA 4NTZA 1Y7HA 2WTMA 5JASA 2B37A 3CXUA 1P39A 3OZSA 1T9BA 2X77A 5DISB 3EDYA 5KJFA 1ZWLA 2CYAA 4IHAA 1KSGA 2GPJA 3UK0A 4ZVLA 1SVLA 5KQMA 1RTKA 2NUTB 4XLZA 2R7KA 1Z5ZA 1L7DA 1NIPA 3E4DA 4U0JA 4DCTA 5L9AA 3GPLA 1BQEA 3V32A 3RS5A 1J0AA 2ODQA 4H2DA 1VECA 3NG1A 2GB4A 4MROA 1KQFA 3HI4A 2GCNA 3MGBA 4O4HF 3WAJA 1V5WA 1GTZA 3M3PA 4IOJA 5JAQA 1AB6A 1VG0B 2GHQA 3WQQA 1PDVA 1J8MF 3OHMA 1J8YF 4AS2A 1FUYB 1B3BA 5JYCA 3E03A 3LPLA 2WT4A 2WPNA 3QVWA 5LOVF 2VF5X 4HJRA 1D6NA 1U1IA 2J9FA 2IP4A 4PSUA 4AN4A 4E4RA 1LSSA 2XCTB 2PTGA 1NVGA 4WVFA 4JBLA 1JA0A 1I7QB 1W73A 3PXUA 2Z8YM 1EFDN 3M81A 1GFSA 2QN3A 4EHBA 4R3WA 1Y37A 1Z25A 1TCUA 3DLPX 3ZKWA 2OGSA 2QZ9A 3CLHA 5E1BA 4D4MA 2IKSA 2PBZA 2VHYA 4RPCA 4AKHA 1E2MA 1M0SA 1ZUHA 2VDUE 3OEYA 4D9BA 1Y8AA 2Q3DA 5FAKA 1BJTA 2AWOA 5GADl 4Q1BA 1KOJA 1WQ3A 1JQAA 4OHCA 4UM8B 5ALQA 3SK0A 2FRDA 3MUFA 1KEWA 1S2MA 1Y7PA 3S2YA 2C8VA 5B2ZA 1ZM9A 5IASA 3EWNA 3P52A 1XZNA 4U7WA 1M1XB 2WY2D 1HDRA 1HNXB 3OO1A 3A70A 5G4LA 4JR1A 3JYOA 4D9MA 1QQAA 1RRCA 2WG0A 2DHQA 4DRXA 3ZDCA 2W4MA 3KBOA 4PZ0A 1YQEA 1IG3A 2ZAOA 3A6DA 5DTJA 4EG6A 3GLFE 3W5UA 1TF7A 1GUFA 2ZWIA 1L5HA 3KALA 2COEA 3ODPA 1RPAA 4XD7A 3QKUA 4I46A 2YYZA 4WFQA 5EMHA 1N2SA 1G8GA 4MP6A 4N3CA 3JQ7A 1Z38A 3TM4A 3FDJA 2CLFB 2WMNB 1VM6A 3BJMA 3IUSA 3U13A 4ILEA 5BRJA 4ZDWA 5L3RA 3THXA 1G6Q1 5B3LA 1KS2A 4KNYA 5AQEA 1BZYA 1UKYA 3NYQA 5E7IA 3CLRD 1PN3A 3LYUA 5HJ7A 2JGRA 5A5EA 1U2EA 4WZAB 3LGSA 4FM9A 4EQ6B 4YYEA 4GP9A 2AI1A 3G2MA 1EUDB 1H42A 2CDCA 4J29A 3T3PB 3IJPA 4RPJA 3BE8A 4YJ2B 2NU8B 3JSXA 3X1MA 2VP0A 1DO2A 1FDWA 4D9CA 1W87A 1SQGA 1T0PA 1VPWA 2FJPA 3I9V6 5KS2A 3DOCA 2WYIA 1DNPA 4L4XA 3INGA 2IIBA 4TM8A 3G9UA 4RH1A 1CJMA 1XXHB 2W2KB 2MTBA 1ZQ1A 1FVXA 2SKDA 3SYTA 2LV8A 3N58A 3U3KA 4BV3A 2GSDA 2YRWA 1NW3A 4X60A 4UXIA 2NP6A 5K3FB 1NJFA 3EG5A 1ADGA 2P1DA 3EC7A 3IXLA 5ER6A 2CV1A 3TNLA 3U3ZA 3ND9A 4G1UC 5BMVB 1E5DA 4KV9A 1UPFA 5A5GA 4IIJB 1G66A 1W88B 4JX9A 2CXNA 3OZ7A 2Q4OA 4V0ME 3AZOA 3FZQA 1U5AA 2X58A 3ZCUA 1M9NA 2WEKA 2D3WA 5KJEA 2VRNA 2GJ8A 4BX9A 4HQKA 4R9SA 3R6GA 4MW4A 4JDUA 3ZCRA 4QOIA 1GRNA 2H07A 2HSEA 4JLJA 5I7SA 4DJTA 5IABA 1P0FA 4MICA 1KH1A 4QHSA 3MCZA 2IZOA 5B1HA 3SVTA 2JC3A 3SEAA 4OB7A 4TL6A 1EFAA 1L1QA 4UE3S 4XGIA 2ZROA 5K9ZA 3AVPA 5KPJA 4UBLA 4NOMA 1Z75A 1KI3A 4HWTA 5CK5A 5EEGA 5FOUA 1Z4MA 4BFCA 4A5OA 1GPH1 1V8ZA 1XFAA 2VNSA 3GZJA 3OQIB 3UANA 2CV0A 3K70B 1FX1A 4JN6B 4YUXA 2VP5A 1U0GA 3BRQA 3MAAC 4HGRA 2YOGA 1QUEA 4NSNA 4P9NA 4KUGA 1NQUA 5SYMA 3UEOA 3WS7A 3C7KA 2F1OA 1NUQA 3JQ8A 5AJHA 5IN5A 3IKTA 1CQZA 3ORQA 2ZCJA 4YVFA 2FXVA 4MCJA 4CMCA 4G09A 4AI6A 2P78A 1A7JA 1U2PA 2EX0A 1C8KA 4IIHA 2IV3A 4K03A 5G40A 3CJRA 5CGZA 1R00A 2GO1A 3PNYA 2H2GA 4Z6KA 2LVBA 2G6TA 1E79A 4URXR 1OAOA 1NTRA 3MVEA 5G41A 6PFKA 4YJHA 3PXGA 4XEUA 4UDXX 1GAQA 3E81A 2FSVC 1MB9A 1K8XB 5EMNA 4DLPA 1L7OA 4JL5A 4XYEA 3THYA 2VQEB 2GEVA 2C7BA 5AI5A 5JPCA 3QM1A 4C03A 3CLVA 3CWCA 3FBWA 3EX7C 2PUBA 2OZKA 5HVNA 4QUDA 1AUQA 4ZT4A 3BIFA 1DBQA 1HFJA 4NMWA 5ELXA 3IELA 2NXEA 3A6JA 2IP1A 4HNSA 3AFHA 3ROGA 4XIFA 1E94E 3OICA 1E8NA 1GAWA 4CXMA 3CURA 2UZ0A 4RQUA 3RT1A 4P7BA 4Z0NA 3GRUA 2BF7A 4WASA 1SHZA 2AUNA 2C7GA 3F3MA 2RD2A 3P0EA 3QIVA 4H3KB 4MHSA 1R6BX 2V3WA 4XJTA 4G1BA 3T41A 5JRDS 3F4BA 4EA7A 2PXHA 3BN3A 3IKJA 3K35A 5EUBA 3RF6A 1Z6AA 3GHYA 3OWXA 2Y99A 3L8GA 3VMMA 3ZE0B 1Q14A 3DHYA 4FGWA 4GI7A 4WINA 2OBYA 3EAFA 3HA2A 1BDBA 4ENSA 1LA2A 2CLSA 2H1VA 4Y2JA 3W8EA 3WGNA 5DYWA 4DKXA 2G70A 2WJYA 5DN6D 1VKRA 2WLTA 2AE1A 3VPHA 1A9QA 4A8JA 5HIKA 4X65B 4OOEA 1ANKA 1HDYA 3ENZA 1NVAA 1AK1A 4ALIA 3LYAA 4MWCA 4W7IA 1WQ4A 3GP5A 1P9RA 2W2PA 4DM7A 2P68A 3Q4GA 1BVRA 1LQTA 2RFLA 3JU3A 3H87A 3LH5A 3PT9A 3E6AA 4FIDA 4PBSA 1ZMBA 1JR2A 4BP3A 4NNPA 4FW8A 4O4IB 1ORVA 2F1KA 3RJZA 3CVXA 2BE9A 3HB4X 4HWGA 1UAGA 4HQ0A 3UK6A 4F4DA 4BIIA 3H2BA 3B12A 3QPAA 4KGDA 5LBUA 1ISMA 2HJ9A 4HRYA 3INNA 2V3CC 3AF5A 4RZXA 4ZYZA 2Q7DA 4IUDS 4A1OA 4NCNA 5C8VA 3EZXA 5L3SA 2RAVA 3UMVA 1RM0A 2ZJ4A 1N5IA 3HADA 4XGQA 2QUZA 4ALKA 5JV5A 3PKZA 5INTA 3WB2A 2FK7A 1O6GA 1LK0A 4W5QA 1IIRA 1EE9A 1VLJA 1KKLA 4HDKB 3GRCA 4UARA 1MKYA 3PNLA 1M76A 3N8DA 3ZE2B 5E8RA 1OYVA 2GRUA 2WM3A 3BILA 3PR1A 1XP5A 4HHEA 4RKFA 4OXQA 2C7QA 2O7VA 1T1IA 3DXYA 3H04A 1YTLA 2BDUA 3ND5A 2HCJB 1A95A 1NMSA 4P2BA 4AQDA 2QHXA 4OHBA 4C88A 3T9FA 1CZLA 5F4ZA 4LNHA 4IJ5A 4ZJZA 3BWCA 3C5CA 5EIXA 4WBXC 3B9PA 3T8YA 1OYYA 4IINA 1L6IA 1V7CA 1M1ZA 2QEQA 3DMDA 3I9NA 4PQFA 3WO0A 4B87A 4RQBA 4BMYA 1KO7A 5MF6A 1DAEA 1OUMA 5TS3A 5JCXA 4I1YA 5FR2A 2MIIA 2H7XA 2PT9A 1E7YA 2Q2WA 2X9NA 2ZUVA 3BWXA 3CR3C 3KLNA 3L0YA 1DPFA 3N70A 1TEXA 2BBSA 4MWEA 4CV2A 4ES6A 1WABA 3E82A 1FEZA 1NBEA 4R2LA 1NX9A 1CVRA 1DRJA 3LUGA 3N2GA 4GEKA 5ALMA 4Y1RA 1C80A 1J2JA 2JATA 3FKSA 5K3CA 1WHSB 1GG5A 2WFAA 3F2VA 4FUQA 1WOYA 1LWOA 2LTAA 3LIPA 4LY0A 1RAIA 2NUAA 1SIOA 3SN6A 1XUOA 5AJTA 4CYMA 3NHZA 2NU9B 4DV0B 2ASEA 4GX0A 1XTPA 4WPGA 1ZNWA 2EV9A 4PGGA 3QBVA 4DN6A 3TM5A 1A97A 1F4VA 4LZAA 1Y8QB 3C6XA 2OXRA 2JHFA 4RGQA 4XYMA 5AIAA 2CJXA 3R5TA 1NZJA 4MVJD 3WHKA 4RTSA 1H66A 5JXWA 1D2MA 1FMLA 2AJDA 2HU5A 3AHEA 3WLMA 3AIMA 1N34B 4AAYA 1BX3A 4ZARA 1AV6A 2JFFA 1JPNA 3FB1A 4HZUB 4KJZA 5KVQA 3U09A 4EB6A 3H2GA 1R9MA 4DBLC 3ND6A 1ZMRA 2R7AA 3OE1A 3KYDA 5L7WA 2FUCA 2ZUEA 1HT2E 3T1OA 2R8RA 1F6BA 1JX6A 4EFMA 4U0KA 1T36A 1PP4A 2SKEA 4JBIA 4BLTA 4POOA 2F00A 4DLKA 1L5SA 1IOWA 4FT4A 3UJ7A 1CYEA 1X7ZA 2DR2A 1CUGA 2YYYA 4EL0A 3RYFA 1R5NA 1KI4A 1SBNE 2DFNA 4W9MC 1JAHA 3LOUA 3LQQA 2FK8A 4QEZA 1XYGA 5CH8A 3I62A 4YA6A 1REQA 4OJNA 5ARDA 3UATA 1Q7EA 5LQSA 1GPBA 4MS3A 1FNCA 2GZDA 1DTEA 3G23A 4AZ0A 1J4AA 2I6UA 4ZJUA 3HTXA 1KFJB 1PS9A 2QMYA 3NCHA 4LMPA 2Z57A 2IDKA 4GPAA 4NJMB 3RASA 3ZXUB 1FRNA 1WCIA 3L7LA 4JB3A 2XLCA 4JBNA 1XLTC 2ORED 2N1MA 1T6XA 1FP7A 1XZLA 5J1TB 3FNFA 4KTTE 5P8WA 5ELMA 4L0CA 2QZ4A 2Z0MA 3W7VA 5JHHB 3VHXB 3SDBA 5AT1A 3A6PC 1HK7A 4MS1A 1KERA 2JFVA 2FE4A 4PS0A 1SQ5A 1V5FA 4XARA 4CDNA 3WICA 3TIGA 4W5NA 2HRQA 3L7BA 1V7ZA 3K0KA 2R6ZA 4R2HA 3BOSA 3KSBC 2A92A 1G8FA 4KP7A 3RK0A 2GXQA 1BE6A 2Z5LA 4R7TA 4WUVA 5IZCC 1XNQB 1NI4B 2HQRA 1EGAA 2VNJA 4W5OA 2R8OA 2PUGA 4GPEA 3RVJA 2Z6VA 4GYYA 3PTAA 4YRTA 2W2MA 2CNLA 3URKA 4CT0A 1QRRA 1TO6A 1KVUA 4HWSA 1NONA 3AVXA 2NXCA 5GVRA 3ZDBA 1YS1X 2AC7A 3G2IA 4F0JA 5EKSA 2EZ4A 3LQYA 1Z0JA 1U11A 4BO6A 5C46F 1J42A 3CQ9A 1IFXA 2FPGA 2V9PA 3AUTA 4ZZ0A 2C9CA 2LGJA 3GYBA 4LYAA 5SZHB 3WWEA 1NUSA 4YPVA 1ISSA 1V1MA 1HDIA 3Q0TA 3K6SB 1SC9A 4JZYA 3HYSA 5FD8A 1GA4A 1J2TA 3CZMA 3TNYA 1PSZA 3DFUA 3L6DA 5CDTA 2W8BB 3N8NA 4JAVC 4LQLA 4XRRA 4B3IA 2CXOA 1FSZA 1D1TA 2E55A 3CLSC 4LZNA 4GD3Q 3KM0A 3OEEA 4U2EA 1OT5A 4G1EB 2A4MA 5G1PA 1JLHA 1H6CA 4PGMA 1AA9A 5P21A 5IKOA 1UWCA 4UXJA 3SMQA 4FGJA 5IX8A 4GKKB 4HADA 2WTAA 1F2TB 2NO9A 3OFVA 4RLHA 1O96A 3QHPA 2VDOB 1KNXA 3LUHA 1E2JA 2IYQA 1ZUNA 3CZAA 4I4CA 2HMAA 3ST7A 3DEHA 3NJ4A 3KQUA 5DJ5A 1K3UB 3Q5DA 2VHJA 4YMUA 4UTXA 7MDHA 2KI5A 1FYXA 1TOAA 2I87A 3Q1LA 2ZBPA 1ISRA 7ADHA 4O4LA 1ZBDA 3OLQA 2VDQB 4H18A 5BQXA 2DETA 4U02A 3DWIA 5EQDA 3KKPA 3OE4A 3WGLA 5EJFA 2F4VB 1LZLA 3GY0A 4LJKA 3HB0A 5ARBA 3RSZA 4GSLA 3RYIA 2W6JA 3C8ZA 4U7DA 3JRWA 4MQMA 3ADPA 1IPEA 2IEGA 3RE1A 1XMXA 3N7AA 2BEVB 2CMKA 5I45A 2VF4X 1LPSA 2CFTA 4NYJR 3HBLA 1OASA 2V6FA 2YY7A 4TOIA 2XVZA 4H77A 3U6KA 4TT3A 2Q9CA 2BBTA 3OMXA 3KB6A 2ZULA 4FKBA 4LRWA 2QRKA 3FLBA 3MCAA 3CUTA 2R7NA 3AR9A 4G0ZA 4WOBA 2XXJA 3WNBA 2QN8A 3PD7A 2JGJA 4YH1A 3BRWD 3EIUA 1ZVMA 1R0LA 3CVJA 2GVNA 3MQ4A 1T3LA 1CBUA 1N2XA 3NGXA 4QQFA 4F9TA 2WJZB 2JKVA 3K53A 5FNVA 3IP7A 4XPIA 2XZOA 4M1OA 2V65A 5A7HA 1OLSB 1KJNA 5CM9C 4D3FA 5ERXA 2PKCA 9MHTA 2C8JA 4H1TA 4NESA 2RK3A 4XB1A 4CLHA 3UFXA 2FETA 1YBMA 1H1TA 2Z3VA 4ZRDA 4NCAA 3IBYA 4BFXA 3S2FA 1VIMA 2VJDA 4G9EA 3A4MA 2EQAA 1AQYA 3H5VA 5EWLB 3PEYA 3TW0A 3LT1A 4WCFC 2J46A 5AOBA 5FWXB 1O77A 2H1WA 4AG6A 1NF8A 4Z5XA 5DGCA 2ROQA 1AGNA 2FPRA 3O8LA 3P71T 4ZT5A 2TRSB 4R31A 3IEMA 3PX7A 3OTOB 4NH4A 2Q9AA 3JVIA 4IIYA 4U2BA 1LK5A 4MV4A 5AM4A 4NXMB 2GERA 3KHUA 3KR1A 2OOKA 4UU8A 1XXLA 2G36A 4GYWA 4KWCA 2XE4A 3BXHA 1CJUC 3FB4A 2CXQA 1PT5A 3OA0A 3PL5A 1T91A 2LCIA 3D3WB 4A6XA 5JI3E 1K6IA 3LQ1A 4MW9A 3B3FA 4R0MA 4DUPA 4OJYA 2FPKA 4WFIA 3ZIAA 4DCVA 3B53X 3QKIA 5JARA 2PBLA 2RAPA 5DYGA 1M1YA 4ZTBA 4W6QA 2D1YA 2IXBA 3MJRA 3VVBA 3UQYS 3GFOA 2OWEA 2ZUBA 3GP8A 4AB1A 4KQCA 3ZPXA 3G0IA 2C04A 4WZAE 2V1XA 5LMZA 5JJKA 1TVKA 4UZFA 4TTQA 4CG3A 2BGJA 1UH5A 3HA5A 5K6AA 1HE4A 2CMGA 3CZRA 2ATEA 1K7FB 1PG5A 5CNJA 3MTQA 5CB4F 4BS9A 1IXRC 3NT4A 3LM8A 1I5EA 1YNSA 2AEMA 3PKIA 2FUG6 1Z0AA 3IPYA 4JUBA 3PEWA 1E9DA 1DBSA 4GS5A 2FPIA 4WSOA 4HXGA 4Q6BA 5AR1A 4G5RA 2JIRA 1AA6A 3W5AA 3ESRA 2XF8A 3LC1O 1XXHE 5AO9A 4MJLA 3DCJA 4QYSA 1IN8A 1RW4A 2OK7A 2XF2A 3CBGA 2OAEA 1B42A 1ORWA 2WDPA 1WZ2A 2WP8J 3BWYA 2PJRA 2CK3D 2GMWA 4YRPA 4B4UA 2NSYA 3LT2A 2YHSA 1D1PA 2A9VA 4M6WA 1JHXA 4CIYA 5KYWA 5F7JA 1EVYA 2DG2A 3QU7A 3I4CA 4KXFB 2D1QA 4HEJA 3R3ZA 2A2ZA 3OPYB 3OCJA 4N0QA 5GAJA 4GRIA 2XPCA 1Z4NA 2XUPA 2Y77A 2DC1A 5J5VA 4L8LA 5C80A 5JEEA 2XZDA 3UCFA 4Z4CA 1OJ7A 1MTOA 4M1MA 2NZYA 3I8OA 5UKDA 4FQ7A 1R50A 4ZZIA 3OOWA 3BDAA 1MC1A 3A1FA 3ASUA 3MJTA 3G68A 3OJLA 5EZ6B 3TLYA 3IESA 1JLMA 1Y3FE 1V1RA 5FHQA 3UZUA 1PJSA 5C34B 2JJ1A 4K6HA 2B1RA 2VCEA 3B6MA 1KQGA 2FEWB 1GP2A 2H5IA 2QR3A 3DVLA 4YRBA 1G98A 1I1QB 4ON9A 2B5WA 2WZDA 4YY3B 3KXLA 2JAQA 2O2YA 5AJYA 3GFSA 4RK5A 3A2KA 4AIRA 3U6BA 3H9UA 5LN1A 3F9RA 2X1HA 3D6FA 4PAOA 2G9NA 3CZ9A 3O0TA 3FZNA 1A8PA 4LRTB 4Y1GA 3DXXA 1CP3A 3JQPA 4RKWA 3L7MA 5DX0A 3ROKA 3J81A 1JG1A 1G5PA 2OZEA 3DFFA 3STVA 4E13A 1Z5WA 4I3GA 1UZUA 3PUJA 3DV0A 2NTVA 4KQGA 3L4SO 2QKYA 3FMOB 1F2VA 3U0VA 4GQBA 4PC7A 1FJXA 1NVFA 2NACA 5HJ2A 1Y8RB 1Z7GA 3F3KA 4NICA 1HWYA 1T0JB 2IPAB 2W00A 2JGKA 3W79A 5LSAA 4DMRA 3C7AA 4M1WA 4Z4HA 2XEDA 2QJTA 2E82A 2YVUA 4GR9A 1FS6A 3HJCA 1KYYA 3H5OA 3IE2A 1UBUS 2NSHA 4MWDA 2WSYB 3MJCA 5EKDA 4JITA 1SHUX 1EWKA 2AMLA 4IDBA 3NTOA 4L3VA 3X0DA 1EK5A 1GGEA 3CLSD 3V4SA 2DB3A 1IUOA 2VHQA 2ZR9A 5K01A 2C7VA 1P2TA 5JCZA 1KEEA 2L17A 4YRJA 2H2AA 3BFPA 2B1IA 2XUGA 3A3NA 3O84A 5ECDA 4I9NA 3DAFA 3CNNA 3EJ6A 5DWQA 4BO0A 2NZXA 4F4JA 4HD8A 5JS7A 4JP8A 4D0GA 2FGJA 5EIAA 4F2PA 2NZ2A 3HH8A 3ZI0A 3I1JA 4WGGA 1B2LA 2QX4A 2CNBA 3FGNA 3ORFA 4GPTA 4IIUA 2GEUA 2PZLA 3IEIA 4G9BA 4OFZA 3ND8A 3PE4A 5JY1A 1Z5VA 3L7KA 1BROA 3W6PA 3M5WA 1WXWA 3DAYA 3BMCA 1U6KA 3DFMA 2NGRA 3N5KA 2OSVA 3VH4A 3WYFA 4DFDA 4DYDA 4LVCA 4EIWA 4IOLA 2X4GA 2XXAA 1XAJA 3DEJA 3ZNPA 4R84A 3VUFA 2ATIA 5G0VA 4QKQA 3K2IA 2OGWA 4J2OA 3MTDA 4KO4S 4M9XA 1SIBE 2O7QA 2DAPA 2NQ2C 3WLRA 4L5CA 5KC8A 3W5DA 1MNAA 1XC7A 2V6GA 3ELDA 3N0RA 1Z0ZA 2P0YA 3ZZUA 4CG1A 1OMOA 1ZK3A 2JI7A 2ONZA 3G13A 4PZEA 1M5RA 1T1JA 3DVAA 3JR3A 4JQCA 2I2DA 2HF7A 3LNTA 4IIVA 1ZGJA 3PSAA 4MQBA 2PVCA 4BDTA 2D1TA 3MJSA 1N0WA 3TJRA 4ER7A 3T7TA 3V4VB 3IOMA 3IHLA 2AI3A 1QDLB 3PVSA 5GONF 3JW8A 3U7QA 8ATCA 4MWSA 4OKSA 4L5JA 1O95A 5JSHA 2QYOA 1F1BA 3B5JA 1KZ7B 1A5AB 1Z35A 2BDTA 2WKWA 2PMBA 3UW1A 5IJ0A 1WNTA 3WYAA 5K0TA 3HY3A 2FR0A 3P4YA 5HUQA 4G6ZA 4NZOA 1PTJC 4O2AF 4DCCA 1FYFA 2R6AA 4JJGA 1AVTA 4D74A 4GE0A 3ENKA 3K0BA 4RXMA 4P3OA 4O08A 3LWNA 2CT8A 1J7JA 2HCFA 4IEEA 4OP2A 1GQOA 5BYJA 1NC3A 2JK1A 3VZCA 4K1LA 3F71A 4CHTA 4IV8A 5L95A 1NWHA 3A10A 1ZL0A 3SJZA 3A1NA 1DG9A 4GBJA 4KDFA 1UKEA 1G21A 4E3WA 4J8PA 3DKKA 3QWFA 5LVAA 3EVDA 5FJIA 4PZAA 4U3JA 5JVDF 5HRCA 5FBLB 3ERCA 3JQ6A 4UHJA 3CSSA 2PKYX 2FN8A 5HIJA 4CODB 4ML3A 1C50A 1SGWA 3MHTA 1A5BB 2YJ5A 2VYVA 3IPRA 4PX2A 1JEOA 2H0AA 2P67A 2QY9A 3B1VA 3FOCA 4HWRA 1CUWA 1XKQA 4QO7A 3VHQA 4HWKA 1P6XA 2MT9A 3WR5A 3QK7A 3EY9A 1DHTA 3H2ZA 2F7SA 1C9YA 3C3BA 3HXMA 4NATA 2I71A 2OA0A 4AJ9A 3MYRA 3KLPX 2DFPA 4OMUA 4QZVA 1V8BA 5JZOA 4I1IA 3V1MA 4UEKA 2OBFA 1MA0A 1UK9A 3AY6A 3D2LA 4HQ6A 2JVIA 2HFKA 1KP2A 3CT6A 3KEFA 1V2GA 3PG5A 4GAEA 3TPFA 2BFDA 4TROA 4FHEA 3SCZA 4ZKDA 2C5LA 2DM6A 2Q6KA 2ZTUA 4QVIA 3IEUA 3IUYA 1Z3IX 1LTQA 4MVJG 1FBNA 4GZ3A 2H63A 1CDZA 3OPMA 1ONSA 4RDCA 3KK0A 3V8MA 4R0VA 2UUBB 3GFFA 1YVRA 1L4FA 3AESB 3OTHA 4E51A 3DLTA 5K3OA 1L5VA 1B76A 5ICGA 2AA3A 1DMSA 1R8SA 1SXJA 5FPKA 5AOAA 3IBFA 2HHLA 1YSCA 1U7PA 2BZSA 2VL7A 4A10A 3GAMA 4RH0A 3HYCA 3PX2A 1IOLA 1PNQA 2OMEA 1TM1E 1HYGA 3ANNA 4LTNA 1IJFA 2R1ZA 3UAXA 4RCYA 2P7HA 4FB4A 3DLBA 1I7PA 1Z06A 1R0BA 3BD8A 1YA8A 5KB3A 4FR0A 2FZ4A 1YJBA 1RCUA 2CL7X 1U7WA 1YAJA 3KOZA 2EGGA 2DKOA 3A06A 4JI5B 4E11A 4RE6A 1JQ5A 1CY1A 1CULC 2OEPA 1N5RA 2IJGX 2YV3A 4TL9A 3GJSA 3QXGA 5F52A 1WDLA 3DH0A 4JUFA 2WA2A 3X2FA 4WGFA 3VR3D 2OP0A 3H8WA 4Z8YA 1QFXA 3BXXA 1N4DA 4V1CA 5L3VA 1HQDA 4BNKA 5IG2A 1E1KA 3PTZA 1QFSA 4BAGA 4KE7A 3JQAA 3QQ5A 4CM9A 2WVAA 5AI0A 1MTZA 5JNSA 5JMOA 3AW9A 2D0DA 4Q19A 4PNZA 4JEHA 5F12A 2YVKA 1RJ9B 1SG0A 1V3QE 2BSAA 4EGQA 1FMJA 1PD0A 3WLKX 2CZQA 2IPXA 5J9FA 2JNWA 2QXTA 1JJIA 1Q77A 2JFPA 2NWQA 3NBUA 3TE7A 4PG8A 3SJCA 1FNSA 5DBIA 1R12A 4D4JA 3ZU2A 3CB4A 2GJ9A 3IO3A 1ECGA 3LCRA 1NVWQ 1TVEA 3K9QO 3E3AA 5HIIA 2D06A 2XTJA 4PO9A 4RENA 4GKJB 2HA3A 3GDHA 3DULA 4GR4A 1IUPA 4TV8A 4DEYA 5J5CA 2ZXFA 1E9RA 1KZ9A 1AIPA 1XQ6A 3HFJA 3HR4A 1F06A 1GUDA 1MVLA 1OXUA 4MGIR 4YT2A 1KY5A 3REQA 2SICE 3DCNA 4DSNA 4RSMA 2AB0A 3OJOA 1M2OA 2QDXA 4CLXA 2RH4A 2XB4A 5I7VA 3PXDA 3AC0A 2DQYA 2P0EA 3VR6A 5LKAA 1UXOA 5JROA 2C3UA 1TQ8A 2IU6A 4IL5A 2A9PA 1Y9JA 2WMYA 2O06A 2ZLBA 2PZFA 4OHUA 1NU8A 4D97A 2QTNA 4ZEMA 2NVWA 3ADBA 2RHBA 2W2XA 2Z1MA 5EMKA 1Z08A 1Y82A 1I6MA 3ELBA 4D26A 1L5RA 3HC7A 2FFHA 4Q7KA 4LVOA 2HJVA 1Z2AA 1GY8A 2QRHA 1LI5A 1QVWA 3RBXA 3CY6A 3QG5A 3JRNA 3UN1A 1QONA 3CVWA 3DEIA 4WY5A 1L3CA 1QS0B 1CVIA 2LBPA 2QTLA 2R8PA 1W2GA 1VG8A 1JAXA 3JQ9A 1JVNA 3O2JA 3R3JA 4ZT3A 2OZVA 2RGRA 4ENUA 3OAAA 4BX2A 2PCLA 2MR5A 4J3JA 2IYAA 4IJ6A 4ER0A 4OQQA 3TQSA 2Q3JA 1ECFA 4JVNA 1VB3A 5HNKA 1JHRA 3KUDA 3MS4A 4D8WA 2ORIA 2C2MA 2OYRA 4HNGA 5C2JB 1QGUA 4KFCA 1M10A 1E6UA 2UZAA 4G5SA 1DQZA 4XIYA 1P4HA 4MV8A 3ZZNA 5JS2A 1X1AA 3PUIA 1U98A 1VE9A 2NO7A 1SUEA 1UEJA 2AUMA 2IEZA 2JBHA 3B89A 4PQRA 2OCXA 2YV1A 3LOQA 5D7NA 2F3SA 2B3DA 2J3LA 2O7NA 3D9QX 3ES9A 2R751 2ENUA 2JCSA 3V1YA 5A0VA 1UBMS 1IM8A 4N01A 1QP7A 5TEWA 1RADA 3FYCA 3UC5A 1NYTA 4JJ8A 4QBHA 5DK4A 4GMKA 1D0IA 3GPIA 2ODAA 2FZGA 3RAFC 2CJYA 5GV8A 2MCFA 3KXPA 3HWX1 5EHNA 1I0ZA 2VJYA 4RXUA 2IIQA 1GARA 5IVKA 4R81A 3VQTA 3ZWQA 5C8YA 3KOYA 3SZGA 1GL9B 4HLNA 1OXXK 2A1TR 4I1UA 3UJ8A 3OG9A 2R6R1 2XUDA 3GV0A 1JFTA 1SB8A 1ZSVA 3HJRA 3UHFA 1Y9DA 5GIPE 2B6NA 1DIGA 3GEEA 1G9SA 1B41A 1J9ZA 1FS5A 4QQKA 1YR1A 4N76A 1APBA 1N6HA 1G42A 2BHRA 5IXJA 3RLFA 4KQWA 1ZCBA 2VDLB 2AFHA 1OWPA 2D3TA 2VCHA 3O03A 4AY3A 5HKBA 5JDCA 3IVAA 3LQFA 5EZ5A 3UY4A 1XQ9A 2Z04A 1A2QA 4KPYA 1QHXA 4LSGA 3TMKA 3DFIA 3EOZA 4X1KA 1ZIDA 1ULHA 2CDAA 3B1KA 5CK4A 3BZUA 4O2BB 4Q3OA 4KVFA 2H9IA 5B6IA 2HDHA 3F6EX 2D8AA 1G0NA 1G5TA 1L1EA 1QYWA 3ER8A 1BU8A 1P4RA 4K26A 2F90A 1PR2A 4KAFA 4IRUB 4PG7A 1JLLB 5H83A 4QOJA 1EK1A 2QGFA 1N3IA 1Q3KA 2AOVA 2C20A 2E48A 3FWNA 1X7DA 1YACA 2CNKA 4PYIA 3V80A 2IHNA 2KYRA 4WEQA 3KSMA 4TMFA 4ER3A 3B6IA 4BNMA 3IKVA 2JD2A 2GYYA 1UK8A 1BXZA 2BMFA 3TKAA 4J03A 3SX0A 4KPEC 3L6UA 1NSYA 1QRDA 2PD4A 3W0LB 3I3OA 1SXGA 3PDHA 4QXRA 2J3JA 3GZTB 4ZIRB 3LRPA 1AO0A 1W46A 5EXXA 1IWPB 1P1RA 1R5JA 2CXSA 2PA3A 3L40A 3FG9A 2ODBA 1YKSA 1HTWA 3LCCA 3MQ2A 1QTNA 1V3TA 1HE3A 3AUUA 1G7TA 1NKTA 3L8ZA 3R8FA 1MABA 1GILA 4NDNE 5FRDA 3OIWA 5FLXA 2ODNA 5DHFA 1WMSA 4G4GA 1O9GA 5BNFA 4CCYB 3DTNA 1YHYA 3DUFB 2DH6A 3PP8A 4D9IA 3A27A 2ERCA 4QULA 3DAHA 1CLUA 4N3BA 4AX8A 2WIBA 3BA6A 5K8LA 3TGLA 2YWRA 3WBJA 4B2YA 1BKSB 2ZVPX 5AK4A 2PZ8A 4P4NA 3D8NA 2F43B 1WR8A 3SF0A 2BR5A 3T61A 5CXUA 1D1QA 3HFGA 2B2CA 1XQWA 5HCIA 4IAOA 2PS3A 4ANFA 4E5SA 5KYNA 3INYA 1RTTA 1RAGA 3H11A 5BR7A 4F91B 2OPBA 3OM9A 2QRZA 1HLDA 2Q45A 2H4YA 3AJDA 3JSAA 3WMFA 3CZ5A 2Y6UA 1SY7A