1X7ZB

Crystal structure of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
329
structure length
329
Chain Sequence
EYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-oxoisovalerate dehydrogenase alpha subunit
publication title Molecular mechanism for regulation of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase complex by phosphorylation
pubmed doi rcsb
source organism Homo sapiens
total genus 127
structure length 329
sequence length 329
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1x7zB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1x7zB01
2PGOA 5I4IA 2PANA 2JIBA 3HWWA 3D7KA 2VK8A 1W88A 2WVGA 1B0PA 1V11A 2G28A 1QPBA 2Q5LA 2QTAA 3ZHRA 2YICA 4K9OA 1NI4A 1UM9A 2BP7A 2OZLA 2Y0PA 3EY9A 2JI8A 4K9MA 1PI3A 2C3MA 4K9KA 3EXIA 1Q6ZA 2BEVA 1X7ZB 1TKBA 2O1XA 4RJKA 2V3WA 2AG1A 3F6BX 1X7WA 1RP7A 1V16B 3RIMA 1T9CA 3MOSA 3LQ2A 5IMSA 4XEUA 3EXHC 3DVAB 1OLUA 4JD5A 4KXUA 3M7IA 5FEMA 2WVHA 1YBHA 5K3SA 1N0HA 2VBIA 1X7YA 4C7XA 3DVAA 1V1MA 1OZHA 3LPLA 4K9NA 4KGDA 1V1RA 1JSCA 2BFFB 5I5GA 2VBFA 4GPEA 5EJAA 5HGXA 4GM1A 1POWA 1U5BA 2DJIA 2G67A 4D5EA 1WCIB 2EZ4A 1YI0A 1X7XA 2R5NA 3UK1A 3HWX1 1UMCB 1UMDA 2JI7A 2UZ1B 1W85B 3AHFA 3EXHA 1UMBA 3FLMA 2IHVA 1X80A 5DGTA 2C3OA 2O1SA 1TKAA 2UZ1A 3AHDA 1DTWA 4GM0A 4KXXA 5HJEA 3M49A 2EZTA 2R8PA 3M6LA 5K6TA 1NGSA 1GPUA 1YI1A 1UPAA 2Q29A 1YD7A 3ZHUA 4JU9A 1YHZA 1OLXB 4KXVA 4GP9A 1PVDA 2BFCA 3LQ4A 3OE1A 2BFDB 2VK1A 1TKCA 3L84A 1T9DA 1MCZA 5I51A 3IAEA 1ITZA 5DEIA 3KOMA 4JUCA 1V5FA 3F6EX 3LQ1A 2W93A 1OZFA 1AY0A 2VK4A 2YIDA 2VJYA 1X7ZA 3DV0B 3EXEB 5AHKA 1V5GA 2EZ9A 4RJIA 1OLSB 1V16A 2JLAA 5EXDA 2FN3A 1POXA 3DV0A 5EJ9A 5HHTA 2C3PA 2J9FB 4RJJA 1IK6A 3AHCA 2C42A 2R8OA 4MPJA 1OZGA 3EXFB 3E9YA 4GG1A 5EJ7A 2Q5QA 2C31A 5EJ8A 1UPCA 4JUFA 3EXFA 2IHUA 2C3UA 3FSJX 2Q27A 4MPRA 1OVMA 2PDAA 2BFFA 2G25A 3AI7A 2X7JA 1L8AA 2VBGA 3AHEA 1ZPDA 4FEEA 4WBXC 3DUFB 1WCIA 1BFDA 1UMCA 1YNOA 2BFBB 1QS0B 1W85A 2BFEB 2JI6A 5EXEA 1QGDA 3M34A 4D5GA 2C3YA 1QS0A 5EJMA 4KXWA 2BFEA 2PGNA 5ERXA 2BEUB 3UPTA 5C4IA 4C7VA 2JLCA 2EZUA 3OOYA 1OLXA 4K9LA 1V11B 4KXYA 4JU8A 2BFDA 2Q28A 1NI4B 1UM9B 2BP7B 2OZLB 2FWNA 3FZNA 1YHYA 4Q9DA 2JGDB 3EXIB 2BEVB 2AG0A 3AHJA 4MZXA 1X7WB 1T9BA 4MPPA 5ERYA 4QPZA 2JI9A 2JGDA 5I5EA 2QTCA 3EXEA 2WVAA 5HYVA 4MQ5A 1OLSA 1TRKA 2NXWA 1PO7A 4QQ8A 1UPBA 2J9FA 3ZHVA 3HYLA 3IAFA 1OLUB 4QELA 3EXG1 1V5EA 2IHTA 3ZHSA 1X7YB 2XTAA 1V1MB 5EJ6A 2IEAA 1V1RB 4JUAA 4K9PA 5ESDA 1R9JA 3EYAA 3JU3A 1PYDA 4GM4A 1U5BB 2E6KA 5EJ4A 3EA4A 1X7XB 3ZHTA 5K2OA 2XT9A 5DGDA 3AHIA 3EXG2 2BEWB 1UMDB 4COKA 2Q5JA 2UZAA 5EJ5A 3DUFA 4JUBA 3EXHB 1UMBB 2EZ8A 1X80B 4ZP1A 2BEWA 1KEKA 4JUDX 2BFBA 3ZHQA 2Q5OA 2XT6A 1Z8NA 3AHGA 4FEGA 1DTWB 3AHHA 1T9AA 5K6RA 1Y9DA 2BEUA 4K9QA 2BFCB 1W88B
chains in the Genus database with same CATH superfamily
2VHZA 2IQIA 1NUUA 4NFLA 5ESRA 1ODKA 1T5OA 3ESZA 4RPJA 4Y2GA 4CDMA 1NBIA 1J4AA 4I5DA 4HDQB 4WI1A 1IJFA 4JLVA 3U62A 2AEEA 3PGKA 5D5QA 1S0UA 1ND5A 1C1XB 2QKYA 2F3RA 4PZCA 3SR3A 4X97A 1MO5A 1E62A 1Y1TA 5H1YA 3IRUA 3AKDA 2WVGA 2FQQA 1GPDG 4QYWA 5FA5A 1PJLA 3L7IA 2GF0A 2NPIA 3ZXSA 1O1YA 1GTL1 5D3MA 4DDVA 2CCKA 2Q5LA 4FDVA 3S8YA 1GXSB 4CXMA 2HSWA 3SFTA 2CFOA 2B37A 1ELOA 2ZPTX 2BR4A 3A36A 3DLAA 3GYGA 2ODWA 4S12A 4C9BA 4F8YA 3QVSA 1K88A 4O2AB 4JC5A 2VXBA 1JN0A 4KQMA 4MV9A 3MJDA 1NW7A 4DAEA 3Q2OA 1LY1A 4TUYF 3WYCA 4BU1A 3THYB 4KX3A 4F8EA 4TXMA 4TMYA 4EPVA 2WOOA 2C98A 3EA0A 5BNTA 1BWQA 2N47A 3ROEA 2G4CA 3EUEA 1A8UA 2SICE 4KOEC 4ENQA 3IUNA 4AECA 1O5OA 3RYCA 3H9CA 4PGHA 4AY2A 2DBVO 4M88A 4BY9E 2I4TA 1BWSA 3WIDA 1UBFA 3D8TA 2FZVA 4CMAA 1NXPA 3MTEA 1XXHA 9LDTA 2ACEA 4EYSA 5CDFE 3IBCA 4TTSA 1SVUA 1T9CA 3DZFA 1MG5A 3QPUA 5LR6A 3EOAI 3D6NB 4GOJA 4UHDA 5TPZD 2OFFA 3PDJA 3PITA 1TNDA 2SECE 1TB4A 2PFGA 3VU3A 2BGGA 2H1RA 1NPYA 2HF9A 1JRLA 4MS3A 5C8DA 4BNFA 2PGLA 1BH2A 4PGFA 4RAOA 3OJFA 3ZE2B 1J00A 3FFWA 5IULC 3QI2A 4LFAB 4DNXA 4Y9SA 3EC7A 2BBTA 3D6VA 2VSNA 3N0TA 1JA1A 4TVBA 1PN3A 2YHIA 2ZRPA 2NUBA 3EXHC 1T9ZA 1TVMA 4JT9A 4QTXA 4HS4A 8OHMA 3VDQA 3LO8A 3H2YA 1NBEA 1P0FA 4K6CA 1DS6A 4GRIA 5FTKA 4BNUA 1DQPA 3EIFA 1KSHA 3DZDA 1HYGA 3OWHA 3A3KA 5EPUA 1ZD9A 2ZE6A 3K0EA 5JPIA 4QU5A 1HURA 4C30A 4MKGA 5F35A 3IQDB 1H93A 4KHPB 1XK6A 1KR2A 2P2ZA 3H2HA 3IUQA 1NPTO 4FMDF 1A0OA 3BFPA 3DGFC 4ND8B 4U00A 4WE3A 2B2NA 2FKAA 4LVOA 1E2EA 2PRKA 3Q1LA 2NV2B 1XLWA 3FY4A 2ZUVA 3DEJA 2JATA 3EIXA 1BJRE 1JA9A 2VPWA 3IUJA 4NOMA 1Q1AA 2PEYA 3U7IA 1C4XA 1LD3A 2H1FA 3O84A 4KJZA 1H5NA 1RJ9B 4M6WB 3RGWS 3HL4A 3A11A 1I0IA 1K06A 4X0EA 5ABPA 4CLRA 3TYXA 1Q7GA 1U5BA 3LY5A 4NWIA 4OG2A 1PJ3A 4MW5A 1YGYA 1VHQA 4N7RA 5KKAA 3PEUA 1SUCA 3A1VA 4RKQA 1Q17A 3FYDA 3C6YA 2D1TA 3P96A 3FDZA 4E33A 1VKRA 2GCGA 2XA2A 4HKTA 4LJSA 3OD5A 5FAXA 5FUBA 3VVBA 3DAOA 5CVVA 1GGHA 3VA7A 3T5TA 3IE0A 1JL3A 1SRRA 1NDQA 2VUHB 2VWHA 3I2KA 3DTVD 3BIFA 2UZ1B 4PE5B 1FCJA 3F78A 5B3JC 1I7SB 2DTXA 1U2PA 1OHHD 3WBBA 3I1YA 1EH5A 3NQ41 4E1BA 4ZEVA 1T5IA 2VUUA 5BW8A 3QW2A 1LJLA 3BJIC 3U1VA 1CJBA 3Q3GE 5CTJA 1P9OA 1Q44A 2R25B 4FSHA 5P8WA 4QGBA 2E9SA 4CQLA 1PR6A 2BOVA 5CA0F 4QUKA 5A3SA 3VTZA 1JIJA 2WU1A 6AT1A 3TPFA 1JFFB 4RSHA 4L8WB 1JU3A 5F5XA 4G0QA 4G5HA 1LA2A 1V2HE 3CLUD 4ZRDA 3W1VA 3SQNA 4KH0A 1NATA 2I4NA 3TOVA 3OX4A 1O6FA 2ROQA 4BGDA 5K6TA 1JEYA 3ROGA 2RGYA 3O2NA 4YUAA 3BBLA 1CC1S 2YC2C 3Q72A 3H9GA 1Q22A 4Y8VA 1EVIA 1VKHA 2FSSA 1PZFA 3C39A 3I45A 4CKCB 3QITA 1TM4E 3CB2A 1BOFA 4RABA 4YLYA 3RS0A 4W9MC 1GNVA 1T24A 1T8YA 2H48A 1WSWA 5DK4A 2WHPB 3T6KA 5JUWA 3F2IA 5KPJA 4DY4A 2QOEA 3EBPA 1L7VC 5GJBA 4B6SA 1HDYA 3NS7A 3PQCA 4TRNA 3OZCA 1I1OA 1PTJA 3ZGXA 4PY2A 1ZS9A 3BGOS 1QG0A 2QUZA 3IYLW 2RHWA 4DLYA 3HABA 3L77A 3DEKA 3ZIDA 5I7UA 1Z36A 3E2IA 3LVFO 1T1EA 5JSHA 4JKOA 1NKTA 1JQLB 4ZVLA 5JD3A 4ACAA 4FSXA 5DEIA 4E4TA 2O19A 1JDNA 1W25A 2IYPA 3E9MA 5KSZA 4K87A 4XB6B 2WT8A 3PTLA 3W6PA 4CN9A 1AUXA 3DEAA 3G6KA 3KOMA 4AX4A 4DUGD 5ALSA 1TU3A 1N0VC 2FXVA 1HE4A 1IU9A 5KNCH 2XLBA 4G4GA 5JQWA 4ICIA 3T1TA 3LLVA 1CY1A 5L3SA 1EXVA 1OZFA 1USKA 4LV8B 5HG0A 2O07A 4ZCIA 1FP4A 2A5DA 1OB5A 1JYFA 3DTYA 1XTZA 3WWDA 4BV8A 1T4CB 2IE0A 4YR9A 3GCXA 1YL5A 4ZTUB 3M3PA 5IC4A 3ROXA 4TV8A 1JHVA 3PXGA 3W8FA 3A4MA 3IP1A 1MVOA 1V5GA 1RWNA 2V96A 2ZYIA 3GJZA 4ISCA 2AS0A 2EW2A 3Q7PA 3T7IA 4ZK2A 2CNBA 3HE3A 4YMWA 1OLSB 1V16A 2OM2A 3MD9A 1TK3A 3CHYA 2FFQA 1LVHA 1N2OA 1UPXA 4ZV4A 1QP0A 4ESHA 1TM7E 1A5ZA 3O7WA 4MMXB 5B6PA 3IV6A 4IP0A 4AULA 2JCXA 4HFJA 1RWPA 1XCGB 3EZLA 2D8MA 2FU5C 2H59A 2C3PA 2OAP1 3GZ4A 3KO8A 1PG5A 2Q4RA 4HZIA 1K8YB 3H6HA 4O1MA 3AL3A 1FS6A 1Z6QA 3AZPA 4UEWA 3VHXA 4PAMA 3BAZA 4DM7A 4BX9A 4BEWA 2D7DA 3R7SA 2BGNA 3D43A 3HVKA 3T94A 4WESB 5KHOC 3NYIA 3ZWOA 2R8XA 4OJTA 1W59A 2A88A 2JGIA 2Q2OA 1PWEA 4RQUA 3BPSA 4ZV9A 1EA5A 3GJ8A 2O06A 1GZSA 3FWZA 4GX0A 4GG1A 4DQ0A 3O1LA 4DG9A 1CRZA 1D09A 4ILEA 1Z18A 3L5OA 5G1OA 2GTIA 2QMQA 2WD8A 1D0IA 1ZIXA 2REBA 3W8RA 4LOLA 2CYCA 1NG1A 3QE2A 3NHFA 1TA9A 4I9HA 2D2IA 4P84A 3SSNA 4DXAA 1ESDA 3VXKA 5J2TA 3GFQA 2ASVA 2GESA 1QYDA 3AOEA 4XUEA 5DPMA 3WIVA 2AI3A 5KNDH 2ODBA 4PTLA 1G1MA 1YQXA 2FVXA 3F8TA 3H6KA 4F6LA 4BLOA 4KXFB 2CJPA 1JIUA 1YBAA 2J87A 3ZJYA 1TQ4A 3FYTA 1ENOA 3CINA 5F33A 3RSZA 1DAMA 1KO4A 1SOMA 1EEXB 2BJVA 4C1BA 4EI9A 1KU0A 2QE7D 1RAIA 2KW5A 3GPCA 1OE0A 4DMGA 3RABA 2C9DA 2DPLA 3Q0EA 4MA5A 5CW1A 3QLUC 4B87A 3CRQA 3KYCA 1MR3F 3P9ZA 2JFYA 1SKBA 1L4MA 3RUCA 3ZK9A 2XXBA 3LUJA 2PYZA 1NC3A 3DZKA 3IURA 3R5HA 4OGFA 2AFIB 3NWEA 4M54A 4TS4A 2O0MA 4OI2A 3I6IA 4UXHA 3KELA 3QWHA 1W4AA 4XJXA 4HMPA 2O0KA 3THXA 4K26A 3IT3A 3L7OA 4TN5A 3PJRA 4NBTA 1CDEA 1R8YA 3E5HA 1YJBA 3H8JA 3GFSA 4LIPD 4XWWA 1WL8A 4I50F 5BN5A 2XCTB 3RU2A 4NS4A 5K3FB 3IAM1 3FRHA 4C0JA 1OXXK 2JJMA 1B6SA 3PDCA 4AUKA 2ZM5A 3KZKA 4A10A 4DR2B 2QRPA 2O2HA 3HPQA 1T36A 1X8XA 3IUYA 1PSZA 3R7BA 2QMZA 4WKGA 4F96A 1ZCZA 4BVLA 3WYGA 2DH6A 5DM70 5T4FA 5C37A 3QOXA 1G3QA 4IQFA 2BEUB 1XCLA 3AKCA 3HUUA 3L6DA 2BWJA 1KAQA 4GHWA 3UPTA 4Q7LA 4A2QA 2EQ5A 1KFJB 1R0RE 4UARA 5SZIA 4EG8A 1MC8A 2VP3A 3RU9A 2IE8A 2P1RA 3EXAA 4MIOA 4YJHA 3VNSA 3R6WA 1ONNA 4HEQA 3ANSA 2CHEA 1C2TA 2AFRA 4KC0A 1L7AA 2DR3A 4XYBA 2V55B 5LZ9A 3T3OA 1KO7A 2NTYC 3AFHA 4ZOCA 4C2TA 4O02B 2WC1A 5CLGA 2W6MA 5NLLA 5EIXA 1FYVA 1BHJA 3AUSA 4NCKA 1BO6A 1DKRA 2D0PB 4PZEA 3L49A 4YONB 4BFWA 2HA2A 3SC2B 2ZUBA 5IUNC 1XZAA 1ZZEA 2RD2A 3AEXA 1EFDN 1I0LA 3CLRD 1LDMA 3SVTA 1QVZA 4II3A 3A04A 4TYNA 1JJFA 2IS1A 4OREX 2FJUA 1CR2A 3IVRA 4AZWA 3HP7A 3OC0A 3FTEA 2A0YA 2YOHA 1YDMA 1Z8DA 3JSXA 4YI3A 6YASA 2FMTA 1J0CA 4UTNA 3THRA 1XN1A 3KYIB 4XIYA 3AILA 4Q19A 1WLSA 2WAMA 2V5UA 5EQJB 2XZLA 3PB3A 4YRZA 4DV7B 4WKBA 5KJFA 5IVKA 1Z35A 5JHGB 1RFGE 2XEDA 4KLZA 3GGOA 2UUPA 2FY8A 4G63A 4ZK6A 5GONB 4M98A 1USGA 2ONKA 2XZOA 3ZE6A 1DG1G 3LW7A 2GPBA 2WEKA 3AOGA 4B2YA 3DQPA 4HBGA 3MG9A 4HC4A 3IHKA 5E95A 5ERYA 1QH1A 5DTRA 4D98A 3NI2A 3RADC 1TZKA 1FYDA 1L7NA 3CLRC 2G77B 3RUPA 4ER0A 2GT1A 1QOZA 1XQ6A 4F86A 5I5EA 1LUAA 2V3CC 1ZI8A 1PYOA 4QYXA 3GCWA 2QN1A 2GNPA 4GU5A 5CIYA 4H15A 1Y3DE 5AVKA 2G0AA 4RFSB 4A6EA 1ID8A 3H3JA 3MHPA 4GW3A 1T29A 2QYHA 2NXWA 4R2WA 3UH0A 3VH3A 3WIUA 3D2LA 3T38A 1TMYA 1V8ZA 1ULSA 4PLHA 3A37A 2Z1MA 4QL3A 3WICA 4QEZA 4MQBA 2ZIUB 4NJMB 5DN9A 3WGZA 1ZN2A 2JAHA 5M34A 4BN5A 3TI9A 5KQPA 4GKKB 1HLPA 1DKOA 4IHJB 3ND5A 1EWTA 1GNTA 4C0QC 5KC9A 4NZZA 4DR5B 2YTZA 4EQ6A 1TM3E 3GOHA 1J33A 2VP4A 4R2IA 3K8YA 3R5SA 1TZCA 4MRMA 1LI5A 3SHVA 1G3UA 2FPIB 4BNTA 2RMKA 1A9OA 4R8RA 4RY9A 1FUEA 3D5TA 5H16A 1JWBB 3U16A 4PYRA 2PXCA 3RS7A 3X43A 5JTTA 4ERNA 3HBAA 2O8BB 3W6UA 1QLJA 1J2UA 4I36A 1GCAA 1FTSA 1NYRA 5BVGA 3RVOA 4LSMA 5ALIA 5TJ9A 3WSWA 5BN3B 1H2EA 1ZCBA 1G3MA 1LZKA 3K0SA 3DF7A 1TAUA 1EFCA 4A7PA 4FKZA 2AN5A 2QD1A 3HTXA 3CWQA 3R20A 3QUQA 3HB7A 3JU3A 1KJJA 2VOJA 2ZSAA 3KR1A 3IEMA 4N54A 4UEKA 2HJHA 3ZD9A 4CCWA 5LVAA 1ZD1A 2P9TA 5JD6A 3KKMA 3GV0A 3AY0A 1PD1A 5C0OE 4KJXA 2IPMA 1U98A 3DC7A 1TCUA 3GDHA 4BO1A 4EK9A 2ISSD 5JDIA 1GA6A 1QH9A 1PS9A 4KV7A 4JJIA 3PEFA 4NAUA 2FEKA 2KS6A 3M9XA 4EB6B 4AF6A 3MRVA 4NIMA 5D7BA 3KP1A 3QWFA 4GMDA 1UMDB 5D5HA 3RG2A 3SDBA 1XQ9A 3GLGB 1E3IA 2C20A 4HCJA 4MKZA 2IFTA 1H42A 4KXMA 3OZWA 3WQRA 2YWEA 1E66A 1D6JA 3B6JA 4GWKA 4KQCA 5G0SA 3ZDCA 4EYQA 4CMJA 2DHRA 1E4OA 1VL5A 2I67A 1DC5A 4BLUA 4EG5A 2HZ7A 3HYTA 1MH9A 1XTBA 4JUDX 5LWQA 4YBRA 1Z2AA 1L7OA 1N9KA 4JJAA 1PV4A 3IKLA 4OA5A 3PJDA 1PR1A 3WLTA 1NF2A 2PT9A 2FI1A 3I28A 1H2YA 2HL6A 3PXUA 1DTWB 2EYUA 1M6WA 5FRDA 1M2KA 2KSQA 4J76A 3REQB 4E94A 4X24A 1FFXA 2OE2A 1SU4A 3UZUA 1Z06A 1VYUA 1YA6A 1SCUA 3L82B 5DTMA 4UQPA 3V7NA 5CLIA 2FJ0A 2QRLA 1G5HA 3G49A 5DP1A 4BO3A 3F1LA 3FCXA 2X2PA 1KI2A 4IKPA 5BSKA 2Q6VA 2IDJA 5I9IA 5LIPA 3V1LA 5D8DA 1YZ3A 3I8SA 3UUGA 2NAPA 4ZO6A 1F8UA 3F74A 2ZWMA 4H1WA 3VI3B 3OQJA 4UBNA 1BX1A 2VN8A 4QJ3A 4RS4A 4WZAB 2H2DA 2WIBA 4FFLA 2C4KA 2ORED 3V48A 2LE0A 1T2UA 4U7GA 4IKOA 5F76A 1N2JA 1ORHA 1X8LA 3U44A 1SBNE 1YB5A 2R8EA 3AYZB 4CL8A 1WHSB 5BSWA 1UODA 2OHIA 3KOYA 4EF4A 2E48A 1M0WA 2J46A 2W22A 4YJFB 1IN7A 3GT0A 3Q7QA 5DLEA 3RWMB 4EY3A 3O4JA 2AD5A 4PXSA 3TL6A 4B45A 2IDKA 1M2VB 4TUYB 5FPYA 4OSOA 4ACBA 4EEXA 4EVSA 3MWLA 1CVLA 4WDQA 1NW6A 3HJCA 5REQB 3QHAA 4X1OA 1F60A 4K9KA 2XBMA 1B42A 4H17A 3OZRA 2FFHA 4YIKA 2X9NA 1E4YA 2QN9A 1HKHA 3FNIA 3BXZA 5JH7A 3ZE1B 2C5EA 4I1OA 1DUSA 1FUIA 1G20B 2GPJA 3NO4A 4JKIA 3GW8A 1ODLA 3TX6A 1CY2A 1TVCA 1SXIA 5DHRA 2C9BA 1DAFA 1E5DA 1LRKA 3MERA 3HJGA 4UJ3A 1BS9A 4Q4JA 4YMHA 1NVBA 1B4DA 2AF3C 2LIVA 2P9CA 3LQ2A 1J2RA 3AEQA 5U4XA 4IVPA 2RB4A 2EHJA 4PYQA 3PVSA 1D4OA 2G08A 3C98A 3PJEA 1TPYA 3VPBA 1KMHA 2DG2A 4NH0A 3GT7A 3PFCA 5KPDA 2A9JA 4ON9A 1EHIA 1L7RA 3H0EA 3QQPA 4KTVE 2WSYB 3FDFA 4QUEA 4CIAA 4RETA 1VE9A 4AO7A 3WFJA 2CLKB 2QLLA 5C8ZA 4QREA 1X42A 1O89A 4JI2B 3ZWYA 4CDGA 3I6QA 4ZO9A 1VIYA 3KVVA 3K0AB 4X8OA 1T0IA 3HBMA 1W36D 2VYVA 3BE5A 2FR0A 4LRQA 5H68A 4H6WA 3W79A 5JQGF 3T7RA 4L27A 5AJYA 5BV0A 1RAAA 2GK4A 2DH5A 4HUQB 4JENA 1KEVA 3CNBA 5CYOA 2F9FA 3TR0A 4X44A 2BCEA 4C4ZA 1Q0LA 4RSMA 2L2QA 4W63A 4F6RA 4RNDB 4I55F 3SZOA 3NUGA 3VKVA 2X2EA 4C7XA 4FMDB 5G40A 1C3EA 1K8XB 1QIJA 5KJEA 1OZHA 3IVGA 4XFKA 1CEEA 3L46A 4L02A 4UATA 4LG1A 3NTRA 2OQRA 2PMKA 5K8TA 1DRJA 1RQ2A 4W7HA 3FWPA 1O95A 1BQ3A 1JR2A 2NU6B 2IS2A 1PNQA 3SYNA 1EK1A 4YEDA 4F5DA 5GMOA 2DWPA 4MSUA 3G0GA 3KJXA 1BZYA 1J39A 1PSWA 4YUXA 1W36C 3G0CA 3ZX4A 5G3YA 2AT1A 4FOSA 4JXKA 5AO9A 4YT5A 1I01A 5DGXA 1GL7A 5TGTA 1WCXA 5BMVF 4LGMA 4ZOLB 4TL9A 4F71A 5FWYB 1V48A 4NMXB 1NN0A 3OM9A 1EJ2A 3W8NA 1KSFX 1I2AA 1RC1A 1P3JA 1PUJA 4EJSB 4CM5A 3EG9B 2WLTA 2O2GA 1J9ZA 2ZJFA 3C6ZA 5H81A 2ZI6A 3B9PA 4LOHA 4NNOA 1S7CA 1OKKA 1PBTA 5CVJA 4EEZA 4ZCTA 2IVZA 4ZANA 1VJ5A 3V2HA 4CHGA 1AUPA 4PC6A 4E5KA 5CA0B 3MAAC 1TKAA 3AX6A 4HX5A 2R6DA 4FFPA 1ZWLA 5K0JA 1P81A 1AA9A 3ZLVA 4PFSA 1VP9A 1KY5A 2A4MA 3NHRA 2DGDA 3FZEA 1WP4A 2O6HA 3WGLA 1X1QA 2JBHA 5BQPA 1K3TA 2JI4A 4IX9A 4CF7A 2W2VA 3MINB 4LX8A 3T5DA 2F90A 3NBKA 3H4IA 5CITA 1GPAA 1O94A 2A9FA 3L1IA 4FZ3A 4YRMA 3GNQA 4D8XA 1OFIA 3AIIA 1YD7A 2JIRA 1VYVA 2A7XA 1FTGA 2YBEA 3K4QA 4V1CB 4J7XA 4QATA 3IEKA 1JEEA 4HRXA 1IEQA 3KXLA 4W5WA 1VSQA 2J6IA 4UD6A 1DDGA 4NNPA 4QFMA 2NGRA 1FLDA 2JASA 2OBFA 4F04A 2Y71A 3QOFA 5AM3A 1S2LA 5LUAA 1N2HA 3OQBA 2VK1A 2AFHB 3QLEA 4TVSA 1H0RA 3Q3JB 5G1NA 3W06A 1KJIA 1P2FA 3P0IA 5DNYB 4RVUA 3TSZA 5A1TA 5JD5A 4KYTA 1N2ZA 5TX7A 4YRKA 1RM0A 2YWGA 1GXSA 4D0LB 4XDHA 4NG5A 3TTVA 4PYMA 5DW0A 5T8KA 1ZQ9A 3FCOA 5AOCA 1NQTA 2LR0A 3VV3A 4O2AA 1SXGA 1JDTA 3UK7A 3OIUA 3IP8A 4A8JC 3WMRA 2E4ZA 1UXHA 3THYA 5A0VA 4OHVA 3K2EA 4DM3A 1YS1X 1FXUA 3CRW1 4FW8A 2BMWA 4OOEA 3VPSA 5BN1A 4X00A 2IZ7A 3H6GA 1RE1A 4Q15A 2HU2A 1NM5C 1G17A 4M22A 1AKWA 2WG1A 4OFWA 4FHGA 5SY6A 1Y9JA 4DNOA 8GPBA 3ZXXA 1T1IA 3QBTA 4W99A 5TE9A 5FAKA 4DUZB 1HFJA 2OHOA 3BBPA 1T6ZA 4G6ZA 3FUWA 4KLNA 3OZFA 4O25A 3AWDA 4FD2A 3TB6A 3ZWBA 4P7BA 3K1ZA 3N58A 5BO5A 2B92A 3GFPA 4FDUA 3C1TA 4R5HA 3SM9A 3PLNA 3IIJA 2C07A 4DC9A 3W5CA 2AXNA 3KYDB 2ATXA 3GDGA 4ARAA 5LMZA 1W0JA 2WFAA 3I9V6 3O74A 1N1DA 1E6UA 3CT6A 2WABA 4NR0A 3CURA 2Q2QA 3DZIA 5FBQB 3WRYC 1SK8A 2GD6A 5LN1A 2JPDA 3DWEX 5LZ8A 1UXOA 3AF2A 1UH5A 4J0FA 2B30A 1XRQA 3MSXA 4RIEA 4FEAA 1NWHA 2GRUA 1RI2A 2IF2A 1BVYF 3FMGA 4HGOA 3CX7A 1GUZA 2ZSUA 4L72A 4YQYA 2QZSA 3U7EB 5TMDA 3LCRA 1OAOA 2ZYUX 3EVCA 1O7JA 3AR8A 3K7EA 4R3NA 4YDRA 2CK3A 2AC7A 1Y3CE 2OKGA 1A98A 4DMUB 3LK6A 4M7RA 3VAAA 2HRRA 5JJBA 2MMCA 1H65A 2P9YA 3JQ7B 1D2HA 4BE7B 2IHUA 2VDOB 1CUEA 2E87A 1IK4A 3C8HA 4UASA 4MPRA 4Y0AA 1U3GA 4ND8A 2LTAA 4M89A 1JIXA 1IHXA 4RANA 3PDIB 5I7WA 1NXSA 2HA3A 1X14A 3ZW8A 9LDBA 3JSAA 5KAMA 4Q05A 3SS7X 2BUBA 1WCYA 3CRNA 5DSXA 2YWCA 2C7RA 3LDHA 3PGVA 3V1UA 4U5QA 3V4OA 4M6WA 4OJNA 1A9XA 1RJ9A 3RTBA 3HO6A 3TR6A 3OIFA 1I8TA 3I1JA 3IUSA 2O7NA 3DPUA 3G1WA 3BOSA 3PIIA 1J5EB 1AD2A 3FYSA 3L8CA 4LYFA 5MF6A 3GP8A 1X1BA 2FWBA 2H5JA 4X9XA 3EFBA 4CIVA 4ETNA 5TT1A 1Y6GA 1OB2A 1WQ4A 1PKEA 3GA0A 4TLBA 4WPGA 4FQ8A 3ZE7A 2JGAA 1X15A 3MMSA 2HLDD 4GPIB 2PRJA 4U2CA 5C9ZA 1H3EA 3RQSA 3UAVA 2DKNA 3P9YA 3ZUGA 2Q1YA 2YUIA 3PC7A 3QXGA 2C1EA 3HBJA 3KOUA 1U0LA 2GMWA 4OHPA 4YMIA 3OWOA 4I99A 4I50B 5FO0A 3VO1A 2CNNA 2HCJB 2PYIA 3ABSB 3LUBA 3SIRA 1JXOA 3LY8A 4IWXA 4KK3A 5DM1A 1GVNB 4CM6A 3H4VA 2QR5A 1IUNA 3U7JA 4AC9A 1CUSA 4DVJA 1I33A 3SP1A 4ZICA 1AQLA 1LPNA 3PXAA 4J1TC 4S0XA 5AJXA 3ME5A 2WY2D 1UBGA 2JAXA 4KRYA 5FB3A 5FFFA 1SC4A 1HL7A 3N76A 4JDPA 1SC6A 5A02A 1NQOA 4KIWA 4U9UA 4RWEA 3OPYI 3CYFA 3IGFA 4QVIA 1JFFA 4RK5A 4KR6A 1Z47A 3I04M 1Q12A 1I2MA 1ACJA 2I55A 1ZCJA 4BPBA 4KV9A 3LUDA 4ARCA 4NK5A 2UUAB 5EFOA 5JS8A 1Z2NX 1RPTA 5E4JA 3I1FA 3K1JA 4Y2YA 1KZ6A 3KOXA 5TS3A 2C5GA 2PGAA 4ZEXA 3ORQA 4CKCA 1ZQ1A 3HFRA 5HKKA 4E46A 1AO3A 3OPMA 2IBTA 4AKTA 2PKWA 5DBHX 3ZZ1A 4X45A 1DC4A 1DXHA 5H9VA 5AHWA 2WIAA 1PV2A 4DJJA 4EI8A 5C53B 5L4NA 3RCBA 3ETDA 3KR0A 1XJWA 3EZ2A 2OLJA 5DK6A 1G16A 4A0FA 2EDAA 3I9V1 1DQNA 3CW8X 4XM1A 4C29A 2Q28A 3QMWA 1CK4A 4Q5IA 2CL5A 4BQPA 3BX1A 3LWZA 1YZKA 2DFNA 1JE1A 3UUFA 4QJBA 1UOQA 5TEVA 1L6IA 1CYEA 4YWHA 2C4HA 3RUAA 1VFNA 3U81A 2XDQB 1GNLA 1P2TA 3AGPA 2FSGA 3CF4A 2K7ZA 1OGIA 4LXYA 4M53A 3I92A 4YUVA 3RWOA 3CBQA 3KBBA 3RANA 1PLKA 3QX9A 2GNAA 3RIHA 1WW2A 3QA9A 2W70A 2FVYA 3EVBA 5F64A 5LLDA 5F9MA 1ZN7A 4TKVB 3PJGA 2PKEA 1AC5A 2YYZA 1MO3A 1QRDA 2IUEA 4MQ4A 5F1YA 2FEWB 3RH0A 3SQDA 3TEJA 1Z33A 1T4CA 5A2GA 4B4WA 3VKWA 1NVEA 2HJSA 2QTCA 3GARA 1KOFA 1DO8A 3W2IA 2E4YA 2G4LA 4XCXA 4UTVA 5JY6A 2VNAA 3EC2A 5KVVA 1CD5A 2WTEA 1OLSA 1UKZA 3D0QA 1PO7A 4NCBA 5LP6C 4ALKA 2PN1A 3C5CA 5KVQA 2PNJA 2H1WA 4GEKA 1QRAA 3QVXA 1UDAA 3JAWA 4J2TA 4P5PA 5F21A 3N0RA 2BI4A 4GC5A 3CT4A 3PQDA 4I7EA 3ZDEA 4UKDA 5BV2P 5D7NA 4Q00A 4I4CA 1QTIA 1QXSA 3EWSA 4WESA 2IODA 3U60B 1V5EA 4BQNA 1WF3A 5B7PA 3AINA 3DXZA 4RGYA 3O9MA 3NHUA 2F48A 4NOKA 1YQGA 1N6PA 5T3UA 5KI6A 5JI2E 3DMHA 2EHDA 2QZZA 1A8IA 1FRQA 1WSBA 4IMPA 3SQOA 1IBSA 3BSSA 5AQEA 4DA4A 2IEAA 2RGBA 4JV5B 4WLVA 3RC8A 1W44A 4OIMA 1Y42X 1M6VB 2PL9A 4K9PA 4XWOA 2NO9A 1X3LA 3DZGA 3AJ8A 4L0QA 4UAVA 2C2ZA 3AR4A 3MUOA 4IS3A 2FK7A 3AVQA 4CT0A 2WK1A 1G8AA 1RBMA 4Q3EA 1QTRA 1AUQA 1KWGA 3C3YA 1EWVA 2C82A 2Y0DA 3Q3VA 4H7HA 3WGIA 2COUA 1G21E 2RI6A 3FI9A 2HPHA 3KQUA 3RYIB 1BE6A 1L5SA 1Q0ZA 3S2IA 3ZHOA 1NLZA 2HK7A 4GLBA 1EYZA 1N5JA 4RD4A 1V7PC 4EW2A 2H0AA 2GCPA 1E8DA 3R4VA 4ROTA 3X1ZA 2JLVA 2FUG6 4UAGA 2G76A 1ZITA 4A9AA 3ANMA 3HV0A 5ITSA 4H3HB 1S9HA 2OGTA 1XQXA 3SJ7A 3WGOA 1KDTA 3QTBA 4TVOA 2WWRA 3HU1A 3TIGA 2J3IA 4MUAA 1Y8AA 2AFIA 4TYYA 1TYDE 5KINB 4B84A 5C35A 2Q6OA 2AOWA 3RC3A 1ST3A 2H7VA 2Q5EA 4L76A 5CFQA 3VDNB 4US2R 3KFLA 5AVSA 2RGRA 3CVUA 1U65A 1C4WA 2TS1A 4MCAA 3M1LA 3LBYA 3ISTA 1JHQA 4LGVA 3JAMA 1YMVA 2FEXA 2XMQA 3PD0A 1BEZA 3WYFA 3EQ7A 4FQ5A 4QTZA 5K3FA 4JJ6A 1XP5A 3ASVA 3IT2A 1DC8A 4FEGA 2Y1OA 1A27A 2ZITA 1XZLA 4EGFA 4RKWA 2CHVA 2H3EA 5FOVA 5CD9A 1IWPB 2C2KA 3ICPA 3WAGA 2OSVA 1EHYA 4YCLA 2J33A 4ISBA 1OGYA 2IPLA 2O8DB 2BEUA 2ISCA 3NU1A 4H18A 3LHDA 5IDYA 2ZT7A 3QE9Y 4I9NA 4XLLA 1FVOA 1ZRNA 1OGJA 4ZXPA 3ROFA 3TLZA 1S8FA 4FN4A 1VI5A 4E4RA 3PU6A 4MLCA 3PUZA 1GNRA 1JSXA 3EAGA 1O6BA 3FN4A 1YVDA 3VNRA 3TRFA 3R3VA 1S2DA 3IDZA 2GPYA 4LDPA 5DH9A 2O7VA 2IU4A 5E1OA 4AIIA 3A3YA 4UAUA 1IN8A 1RQNA 1W88A 4DLAA 1KE1A 2FWAA 3SC2A 4KAJA 2RC6A 2ZROA 5HF5A 2QR3A 5EJIA 2WJ6A 4S35A 3PD7A 3SJCA 2VATA 3GHYA 4WAUA 2ECFA 3ANYB 3N05A 4HNHA 4PFJA 4WZBE 4D9IA 2FSUA 4MWDA 4QQNA 4CM4B 1WKBA 4GAEA 4JL8A 1ZRMA 5DFAA 1AQJA 1BVRA 2FWRA 4L8VA 3S1SA 3KKQA 3EY9A 2FSVA 1YVRA 3WBJA 2Z1NA 4AN1A 3MWKA 3UJ7A 2HQRA 1Z74A 2VF8A 2Z9CA 5BORA 2B99A 2FTKE 4JLSA 1MB0A 4HDOB 1R50A 4Y0VA 1GCUA 1N2SA 1NXVA 1P73A 1Z08A 5KTKA 3SX4A 1QSGA 1N2EA 4BVKA 1L5OA 2A35A 5I8PA 5GONA 1J1IA 2O1XA 1FSSA 3A9CA 2JIZA 1RP7A 1MZVA 2E6UX 3NHZA 1RSZA 2ZTMA 3LQYA 1XJ0A 1LBTA 1WQ1R 3TDKA 2I65A 3SXUA 4BKPA 1FMLA 1XRSB 1L9KA 1FLNA 4CG3A 4F3YA 2PWYA 5JS1A 3C4VA 3ZCVA 4XQ9A 4OQ4A 1F8GA 4N03A 4RFSA 1RYNA 3HNPA 4FYXA 4DDTA 1P4RA 4JODA 1Q0QA 1V6SA 4JJZA 4JR0A 3H0CA 5T4HA 3NHSA 2X1VA 3EZ6A 4NJMA 1ZM3A 4D4GA 4L7QA 2VJCA 4KIUA 5FBLB 1Q19A 1I36A 1U1GA 3DT9A 2XOKD 2QRKA 2XYHA 4ZZ3A 3PUYA 1OFGA 4R9NA 4XH9B 2H4HA 2VF4X 2ENWA 3FWKA 5JQGB 5CB6A 2YVQA 3EGEA 1UM8A 3PXDA 5EQDA 4FWIB 1Z5GA 2FPIA 2C84A 2CXPA 2D74A 2IBMA 4EMTA 4BQOA 1MOSA 2CV0A 4LJYA 1XVTA 2PZMA 3FWHA 1O96B 4I55B 2O8BA 1L3BA 1K5HA 4IFEA 3SBXA 2CLHB 4MIKA 2XEXA 3NCTA 5EWLB 5BN3A 1G7CA 1NSTA 3D7SA 3GX1A 5LA6F 2IUUA 3S3TA 2Z6AA 1V5WA 3JVVA 1M6NA 1UT5A 2JCYA 3LPMA 1WU8A 1XHFA 4PAOA 4J0KA 4CU5A 4LF9B 3ISVA 1C0KA 2QSZA 3BHJA 1I10A 4L5AA 3WHKA 4DEXA 3UHFA 4CKBA 5ADUS 2AUNA 1G98A 2JKZA 2Y66A 3BL8A 2YN4A 4M0LA 1YVEI 4PHCA 4V3BA 1RBQA 5U1PA 4ENVA 1LWNA 2IKSA 4MUYA 1AG9A 5DYNA 2XUQA 2HMVA 1ZVKA 2WFLB 5EKSA 3WMGA 3KAKA 3HVUA 1V71A 5ETJA 4Z3KA 3M4YA 5D6NA 4DMKA 1GT6A 1BYIA 3NC4A 3C3BA 5EJ2A 3E3AA 3NR2A 5BMVB 1PTJC 4HB4A 2LPMA 3I53A 3UEOA 4EB6A 1TLFA 2GEBA 1PLJA 2M9MA 3TZEA 1UMDA 1IAQA 4QNNA 2VHJA 4C87A 3GLGA 1OASA 3A2LA 3KTFA 3RC1A 4OV6B 2WD9A 2D4HA 4EY7A 1XNHA 3QPWA 1PJSA 3FLMA 4G23A 1Z22A 1HDGO 1WVIA 2XD9A 3HUFA 3NPAA 4DR3B 4RZ3A 2XYQA 2R96A 3HCCA 4O08A 5IUJC 2OGUA 2BZ0A 4YC7A 3OQVA 3ZIAA 3MUEA 2ZRQA 1OH8A 4OX9Y 3C4JA 1SAYA 4F85A 3ROPA 4NYMR 4O8CA 4ZVNA 2PQ2A 1AGNA 1DTWA 2OXTA 1HZZA 1N0UA 1Q2UA 1QZUA 1XIVA 3QYJA 3NBYC 3REQA 4KBYA 4DC1A 2BGMA 3TOXA 3BHNA 1O9BA 4M1MA 1NOIA 4H7FA 3T8YA 5BSVA 1RRVA 1RVV1 2XUKA 2YZKA 3B9QA 4ZVMA 5JBQA 1PRYA 1PK9A 3P97A 5KC8A 2VHCA 3SOPA 4QPDA 1AKMA 4M7OA 4ENUA 5JAMA 1Y7HA 1NXXA 4BB5A 3B2NA 3MTDA 1PS8A 3TM4A 5FF9A 4D43A 3RS9A 3AI3A 4BFSA 1KTIA 3FPBA 3UO8B 3E6AA 1TKCA 4WZAA 3Q10A 1P1RA 4GIBA 4QSMA 3ZGYA 2LUOA 3BIOA 4N47A 4NULA 3BE8A 3QU7A 2FPXA 1M2WA 3LQQA 2PUVA 4G5FA 1TIPA 1O4WA 1RMQA 3DR3A 5IMBA 1WHSA 2ATIA 3TB4A 4Z51A 3GJ6A 3KS9A 5CT6A 3C87A 3E1KA 1RR6A 1V5FA 4NU8X 3PHGA 1HYEA 2QPOA 4E3ZA 3TW4A 3NTXA 3V2GA 3PUHA 5HRAA 1BDHA 5HIMA 1SXJE 1FRZA 4NLLA 3E3OA 1M2VA 1UKYA 4Y30A 4GOMD 2QB5A 1LNZA 3CR8A 2C4WA 1XDGA 1Y48E 2PLNA 5GZ1A 1DFHA 1VL6A 1O0SA 1IZYA 4IDHA 5CH5A 4L5BA 3OOEA 3ZXUB 4EGJA 1GL9B 1NBME 4Q9AA 3UGTA 5EKTA 3J81k 2NZ2A 4BFCA 3NDBB 1TQ8A 3CLVA 3KZXA 1LH0A 2A1TS 3O4FA 1G20A 2OQVA 4EPTA 1ZOSA 4OBBA 5TY0A 5HFAA 1ZICA 3LLUA 1E1QD 1UEXC 3HU2A 3UB3A 4J0GA 5LOVF 1EK5A 4YAWA 1Y6JA 3SAJA 2JFBA 3OF3A 2X0NA 4EDFA 4INZA 3UGJA 1JHDA 2BKLA 2QQ0A 4JHLA 2X15A 1RI5A 3EISA 2P77A 2G5CA 4IFIA 1G64A 1O8CA 3W3AA 1XR3A 3QEMB 4YO8A 3DAYA 3PSAA 4YREA 4PCLA 2DSNA 3A1CA 3RKSA 1DADA 1C8KA 3ZK7A 4OP2A 1BQEA 1RQXA 3GWGA 4K6FA 3TO5A 5JMTA 1XF1A 1B0AA 5HOQA 2PWZA 4OXQA 5DX1A 1KOLA 4UULA 1JEQB 1DBWA 1EQUA 4UUPA 3RC7A 3TLBA 1HE5A 1GPYA 3PI7A 1U0TA 1ORWA 3ZN2A 4GKJB 3D6TB 4NFYA 2IS4A 2C8KA 4MR8A 3B1XA 4JBYA 1GUFA 2HRQA 4HWRA 5BR8B 3ZNNA 4EKDA 4HUQA 3QF4B 3AH8A 4HSGA 2XGSA 3BH0A 3FYHA 3L43A 1FQJA 1KH1A 4LDNA 3CF0A 1SURA 3F7MA 3L7NA 1RHMA 2X5OA 4HRAA 3WGTA 2GJSA 3HVHA 4NU0A 1JX6A 3SDZA 4D9CA 2MSNA 3PUWA 3Q3EA 3U3XA 3JQEA 3ZDFA 2HR1A 3IQFA 1L4EA 2IHZA 5CCDA 1OBCA 2QTBA 3LYAA 1O77A 1RXSA 4HAUA 1RMTA 4RIHA 1XNJA 2NU6A 3CMMA 1N78A 4CKXA 5M7EA 4J4BA 1Q1ZA 2C97A 1K1EA 4MUEA 5IABA 5AESA 4C78A 3A70A 2ZVJA 5JSKA 1OXVA 3EBLA 3G79A 3HJFA 3O1IC 4QGGA 3VHQA 3DMTA 4HS9A 1FW6A 3W7AA 2QQEA 4D3DA 1PUXA 1BA2A 2J48A 4MROA 3NHYA 5KU1A 1WAMA 3U37A 1MKYA 4NBRA 2BPOA 4Q37A 4LDRA 4HLUA 4TXNA 1TQDA 4ZYTA 3T4PA 3F9IA 1TEZA 5ALJA 1WPQA 4ZOLA 2WQ6A 4MO9A 5FWYA 2MSKA 2DCUA 4IFTA 1H4QA 2JEZA 4KUHA 3ZDYB 1BD3A 2XMPA 4B74A 1T3GA 2CVHA 3HZOA 4IVQA 4LRTB 1R0YA 1Z4KA 1HE1C 2IYFA 3EG9A 3USES 3VOBA 3ZW7A 4RF3A 4BMYA 3DZBA 4R71A 2EFEB 4L1KA 1OFUX 1EM8B 3TLGB 4IIVA 4YB8A 3TX2A 4BAZA 5C81A 3QYAA 3NORA 3WHPA 2VTEA 3RC2A 1UDBA 1SQGA 4PRLA 5CA0A 1Z26A 2BDUA 1J0BA 2CFIA 3NETA 1VGQA 4LDJA 4UFOA 2TMKA 4AZTA 9ABPA 4MAMA 1ADCA 3A9VA 1BHO1 4BRUA 5C4IA 2ZG6A 1SXQA 2RG7A 1PGPA 2I4MA 3MINA 2J5QA 1L5YA 5BOVA 4G4SP 1WMAA 3D9QX 1KK0A 3ZNPA 4CJXA 4XOUA 1EBUA 1P1JA 1JJAA 3PKJA 2X0DA 3Q7IA 3HXTA 1LF0A 2CL6X 2VBCA 2WAXA 1JXAA 5K8LA 3GUHA 4AICA 4V1CA 5A7FA 2IY9A 1P91A 1G2PA 2QT9A 3M6AA 1KSJA 4RO0A 1TYBE 5AOBA 2YQ4A 5ER9A 1UBHS 2ZT8A 3G2OA 5HCIA 2BJHA 4D6XA 1I3MA 2JCSA 2TRSB 4YRIA 4GYYA 2P35A 1DXYA 1ODJA 3TW8A 5KS2A 4UUNA 3CUEF 1CLEA 1YMUA 2FN4A 2AFHA 1U7XA 4LDQA 1LDNA 2AV6A 3CMCO 3DWIA 1X1CA 4LZLA 4N0MA 3ZNOA 4WACA 1BXGA 2OMKA 3E4CA 3EASA 2G1KA 1QX3A 4DIFA 1ZIPA 3MVEA 2H63A 1A82A 2C1ZA 1ZI6A 3USCS 1WNFA 3FCUB 1GTRA 1JQ3A 2OHFA 3HB5X 4U9HS 4Q9DA 4P33A 4XKJA 5A1JA 4WMLA 4KMOA 4I6EA 3U19A 5I48A 1ZGHA 1E6WA 5IFKA 3IHTA 1DC6A 2UYGA 1NRWA 1OTHA 4MW0A 3U26A 3VVCA 4CHTA 1RIFA 5C7IO 5JNWA 2IT1A 4FLFA 4PF1A 4D02A 1PT9A 3L9WA 4IL5A 2AOXA 2FWIA 5LJIA 3R5TA 4PX2A 4E11A 3D4OA 1PVOA 5HKLA 5FEUA 4MEJA 3SVZA 5B1DA 3MRXA 1QF9A 2C04A 4BO9A 1FRNA 2WWWA 1XF9A 2JIOA 4MB0A 5B2ZA 4CTNA 1YFJA 4AIRA 1E3TA 3T3EA 1K5GA 1FX1A 3ELDA 2VH5R 4Q66C 3VMMA 3HB9A 1RXYA 4PANA 1CUWA 3DW1X 2WUDA 2PCLA 3BRQA 3GH1A 5FUWA 4XZ3A 3VR6A 2H52A 5IHXA 1H4TA 2Z2KA 1J56A 2MYUA 1RXCA 4DV4B 3KYDA 3MT0A 3E1GA 5CW2A 2GYWA 1P3Y1 3TIVA 2GJ9A 2WUEA 4KE9A 2PUJA 2PS1A 2WTAA 3DL0A 3KOOA 2VI5A 4JVNA 1VRVA 2CXHA 3BZBA 3VHRA 4DBLE 1MB3A 4FUTA 3H2BA 4AZ3B 4J2HA 4IEIA 1OU0A 3GJYA 4I4TF 1MRNA 2O8FA 3CRMA 5B1YA 5ALWA 1QHSA 4CL0A 4HNRA 5EJ6A 1IQRA 1KNQA 3MGGA 2E2WA 2PL5A 4MRSA 4S1PA 1A96A 4YRQA 1P8AA 3V9PA 3IPYA 2JFFA 3JQ7A 4XWKA 3G1UA 1SD1A 4I5GA 5FI0B 3ZTWA 5HX7A 5ITZB 4S1NA 3U6KA 3ZI4A 3C8MA 1TMKA 3BT7A 2J0QA 3FYCA 1CF4A 2A57A 3HKDB 2CJFA 2F8MA 4LKRA 1D2EA 3W2FA 2GBLC 5ALYA 2G82A 3C85A 1D03A 2PO7A 1H2AS 2C77A 1PEKE 3N1UA 5A9RA 4RHYA 3K9LA 2WHQA 4EIWA 4DRXB 3AHIA 1D4AA 2FW1A 4YMLA 3RPEA 2FOLA 3DO6A 3CF4G 3SXJA 2WDZA 4CYMA 3B48A 1GTVA 3ONVA 3BVPA 4RJTA 3SU8A 2EX0A 3OT5A 2ZP1A 3Q8KA 3EWAA 1UPUA 1RJDA 4YVFA 2E4XA 2IGTA 4FDLA 3SEFA 3KETA 1V26A 1XB2A 3FMFA 3ENWA 1C9DB 1SUPA 2R11A 4FOLA 1KP9A 2BSXA 2EQAA 4TRMA 5T6BA 2OYCA 3D7NA 4M8SA 4C88A 2RGNA 3QK7A 4GMXA 4XYGA 1RFLA 1OTYA 3EGDB 3H1BA 2H7YA 4R84A 5EIAA 4AQ7A 2QRQA 2XGJA 2N9UA 2OP0A 4I50A 3LKBA 3SLKA 4DJFC 5EHZA 1ZK0A 2DEUA 1F0PA 1T5HX 2AW3A 3ZOKA 1Z39A 5I3ZA 4B6QA 4JYMA 2HXYA 1A1VA 2O8VA 4NYIQ 4BMPB 3DE0X 2PD4A 4XXHA 1YCGA 2B2CA 4L3VA 2VYVD 1KL7A 1BFUA 2VHVA 1JQAA 4Q4AB 1YJQA 1A88A 4K6GA 2XB2A 5B4TA 2BDEA 3NM4A 1YS2X 4BMDA 3LJKA 3IV7A 1CNMA 5LMUB 4LF5B 5AIBA 1JR6A 1ZW6A 4GX1A 1BS2A 5SICE 1AKNA 2IYTA 1LSUA 1VG8A 2YWFA 3INRA 1TU0A 3UT5B 1XMOB 3R3UA 1YTLA 2JEYA 2WKSA 3K9NA 2XIQA 3KDAA 3EOZA 4WXHA 4ESEA 3W9YA 1ZVQA 3AMVA 4CCAA 2HBRA 3HB4X 5ICSA 1TJ4A 1O95D 2EIHA 3O9VA 2YRWA 4R6WA 4B71A 5SV2A 3ZDQA 2VXYA 5IXJA 3F6YA 4GZ5A 4B82A 2NVBA 3UCXA 4P5EA 1E79A 2R6CA 2YN0A 3OJLA 2G28A 5GM1A 1EP1B 1UZAA 1CBUA 4G85A 4IEFB 3GDFA 2YR0A 4HGYA 2RBEA 1AK9A 2RAFA 2IWRA 3VZSA 1RKUA 4MV8A 4IPTA 2YICA 1QOQB 3OPQA 3UXYA 4WA7A 4GXNA 3DL4A 2O7RA 4C14A 1IQPA 5KYKA 2GBIA 1EFRA 1KC1A 1M6EX 5LUBA 4P2BA 5CFMA 4DKJA 3OIVA 1UBKS 4D8VA 2XDQA 1P1KA 1XG5A 3RNLA 3C3WA 3AJ9A 4E5DA 1U2TA 4OMCA 5GVRA 1X7ZB 1Z6PA 2Y77A 1NJFA 4OB8A 4PLYA 3UCFA 5KQSA 3SEAA 1O95C 4G41A 4GT1A 2W8ZA 2RKBA 4ND1A 4AJ2A 5C4MA 4L8LA 1OKKD 1B3RA 3JYOA 1NZDA 3F6BX 5C5IA 5C34B 4TKVA 2PJZA 3PYLA 3MPOA 3I1IA 4FR0A 4IZ6A 4ZPJA 5ICCA 1VMAA 4DNPA 2JGLA 1WZCA 4RZHA 1V9SA 2PJDA 4A92A 5I4BA 1X7HA 2C2MA 1XEWY 4CG0A 3GMDA 3LOQA 3TZHA 4BWGA 4LJRA 1K7CA 3MJSA 1MIOB 4BRWA 2X3FA 1D6NA 3QEAZ 5F3WB 1MBZA 3PNKA 2QT0A 2WIGA 2HAEA 3DEZA 4HJXA 5JDCA 2BKXA 4FDMA 5DKFA 3N2KB 2X1LA 3OFJA 3M6VA 2I6SA 3HDGA 1RQ7A 2CXSA 4NP6A 4RESA 4DAOA 1QGAA 3H8WA 4NSNA 2OWDA 4GLFA 2O8EA 1XZ8A 2G8NA 3FPLA 3KCQA 5CGQB 2C7PA 2VNHA 1KFCB 4D3FA 2R8RA 3BG5A 5LQUA 2CLIB 2NW6A 1QFSA 3AJRA 3B13B 4EG0A 4BN0A 1XLVA 2Q46A 1IBCA 2GX6A 4QDKA 4PONA 3ESBA 2AN4A 4TVKA 3SSOA 3ZY6A 3I2YX 3JQDA 1EX9A 1WABA 3K0CA 1B1CA 1ODIA 2I7DA 2X8LA 5CFZA 1BX3A 4N0DA 4CI0B 4KPUB 4GBGA 1A72A 2C2XA 3JXEA 1M1YE 2VBIA 3PQ2A 1M54A 1T2EA 3QFRA 1LV8A 2X8JB 1B8VA 5LA6B 2JLYA 1F7VA 4MGIR 2NU7A 4PSVA 4B7CA 4LVNA 2XQJA 2YDXA 1KI8A 4EKEA 4FFRA 4MS4B 5C8VA 1O94C 3GRCA 5ALTA 2VBFA 4O33A 4YJ3A 1Y8ZA 2VYCA 1WVMA 3PXCX 4CKEB 3C5WP 3FJYA 4MJ3A 1CUVA 4GF5A 4IR7A 3IMFA 4CKYA 1A5TA 1RMYA 3VDMA 2FHSA 2XZPA 4I0WB 1NX9A 3LRTA 5CLHA 4KNVA 4FOPA 3VPDA 2FMFA 4ZEMA 1V2GA 3RYIA 3D4NA 2RE8A 1JA0A 4HZUB 4CV1A 3GAAA 1GJRA 2CUKA 5DT9A 1LDGA 1WCIB 1XI2A 2XYPA 2HO5A 3WZ2A 3GGSA 1HUQA 1QVRA 1F6DA 1L4GA 2I6UA 3K3PA 2ODEA 4IJVA 4JT4A 3L9XA 4EUFA 2PVSA 4TYPA 1P31A 5DHUA 3CKKA 3SF8B 3DPSA 4HDSB 2CVQA 5FPTA 3V97A 2YWXA 2G9UA 2OCKA 2KPOA 3ND7A 5FI5A 1Y9AA 1JVNA 3OKCA 1R4AA 5I9TA 4LRSB 2VRWA 1II9A 1F17A 5T8KC 3OQHA 4F0JA 2C8LA 3WG9A 3GPBA 4C21A 5EXPA 5TEWA 1M2NA 2I7XA 4YRNA 2IYWA 2NN3C 4CLOB 3BDVA 3ETEA 3DM5A 4GVLA 1DMRA 4QGSA 5LPNA 4QYIB 4X92A 3D3QA 2DHQA 3EDYA 1YE8A 3RSFA 1TEHA 2EEZA 3CF2A 2Q8NA 4PNPA 3R0JA 1YR9A 4WWHA 5ECYA 4O6VA 1RCTE 3L7YA 1MABB 4OYRA 1TK9A 4GBED 4JKYA 1ZD2P 3G6WA 4I9GA 1LRLA 4M60A 1JDSA 5B57C 4OFXA 2MJLA 4WQMA 4RTQA 4Y2PA 4C05A 3OPVA 1MJGA 4Y2QA 2QTFA 3JQBC 5AVTA 2O8DA 2A9VA 2EVWX 3EUFA 3FF1A 1QPZA 3DHYA 2XX3A 4FONA 4RU1A 4Y1EA 2XCSB 1GN8A 3A1FA 1PVDA 2WT4A 4ZAXA 1G7TA 3S2GA 1V3UA 2R9VA 5IJ0B 3ZD6A 4BXOB 3WHIA 1M2JA 1RVDA 3OKPA 4DV5B 4RLSA 4D92A 1PT5A 3IALA 4GLLA 5E1BA 2P9EA 2Z8YM 2YCLA 1ITZA 3H11B 5DMXA 2W37A 5EE0A 4F2DA 1PGJA 4R1NA 3TRHA 4C22A 1ND6A 1EAMA 3WRVA 1JQ5A 2NZ8A 4HDNB 1DBVO 4EVRA 3ELBA 2P9HA 1ZD5A 2P4SA 5K2MA 5C51B 4CM4A 1UWCA 3ONDA 5DMHA 3KQLA 1CQXA 1T2VA 4JS0A 3GUVA 3GC6A 3LE8A 4I1PA 1QYVA 5ILOA 4BDTA 3BEDA 4EY5A 3NNDA 5IH7A 1KTVA 3P0FA 4MEBA 2FW8A 5KYUA 1XTPA 3BMNB 4RS3A 2YIDA 1O8BA 3P9KA 1P5ZB 4G5XA 5AYVA 2B8WA 2EOAA 2Q6LA 1IY1A 1YSCA 1HT1E 1AQIA 1JEJA 1YA4A 4LBWA 3O2QB 1XXHE 1YXMA 2NNWB 4Y1RB 3TLCA 1GKKA 2VL7A 2ZTVA 1E7RA 3BERA 1LLQA 1I4DD 1Z5ZA 4EFDA 4F91B 5LOVB 3W7BA 5AVQA 5J2UA 2I34A 1AGRA 3PE6A 5EXDA 1R8JA 4N0PA 3E05A 4CG1A 1UPFA 5J1SB 3N8DA 4F7WA 2FMIA 1T8SA 3PUKA 3A1EA 4OYYA 2XDWA 1FEZA 1QTNA 4AB1A 4B80A 3LSTA 1ZMOA 1FNDA 2J9FB 4NEHB 2OENG 3SMVA 4BQFA 4PIVA 3SM3A 1ZLYA 3AHCA 1TMOA 2C42A 3U0VA 1JR3A 2G9VA 3WKDA 4OLJA 4PN7A 4ZYZA 5GJWC 5HVNA 4EPRA 4EX7A 3AEKB 3LDAA 1R88A 4MUBA 4EJ0A 2PUTA 3R9XA 2W6QA 3Q6IA 4QOFA 1RZRA 2IYVA 2Q2NA 4LVCA 1XWFA 4HGQA 4JT8A 2W6OA 3PC3A 5GPBA 5HKKD 5JQGA 2JFPA 2Q5QA 1ADYA 1IONA 5JXIA 4UUMA 4NENA 4DLLA 1BC5A 3N3AC 1I9CA 2B9VA 3UMGA 1RRGA 3VUFA 4PPGA 4JR2A 2WIKA 1E2NA 3EDCA 4PLVA 4I9FA 3DG9A 1CKEA 1WU7A 2VP9A 1O96A 4I55A 2Q9UA 2EFCB 1Y80A 3CH7A 4HXGA 4X3OA 2BBOA 4WCFB 5AVJA 1KYQA 3QTTA 2BMFA 1USWA 1NP7A 4XGIA 1L8LA 4V0RA 5EWLA 5HUHA 3EPJA 1W87A 4MDEA 2O4CA 1H6BA 1YNSA 4G1BA 3ZKWB 2XE6A 4HAZA 4U9IS 1G5PA 3NHKA 3VR2D 3N75A 2Y67A 3U4MA 2Q50A 3QRWA 4KU4A 1AGYA 2R85A 4JA0A 3PEYA 2UYOA 1OD6A 4ER6A 1GTG1 2AXPA 4ECEA 1U0FA 1G18A 2VBGA 1ZK2A 2VJMB 2WFLA 5L51A 4HXFB 3DDHA 1L3IA 4MYHA 3I12A 2P5SA 3PHLA 2IZ6A 2DTDA 2XYRA 3QELA 3UYLA 3LA8A 4D1YA 2G8LA 5BMVA 1SHJA 2JLSA 5T5QA 2HSDA 4G24A 3LKZA 3ND6A 5IM4F 2WSBA 1SWVA 3S2ZA 1VCMA 4HWPA 1VL0A 1YNOA 2HMTA 3J81A 1QS0B 5IEBA 2QN7A 1Y8RB 4KZPA 1IQUA 4G01B 3FOCA 5AXDA 4C5AA 1FSZA 2QPTA 3GK3A 1G63A 4J91A 4DLVA 5C2JB 3DDNA 1QGDA 4HQOA 1QX4A 3UPUA 2Z30A 4L8FA 4M9ZA 2E3JA 1LNSA 4AY3A 3I3SR 3LC0A 3OHMA 2X7HA 4HWKA 2OMEA 2PRYA 3GN1A 3MM4A 1LTHR 3DWGA 2IOHA 3DZJA 2YJZA 2QENA 4Q9KA 1Y4DE 1PJAA 1ZM4A 3KT6A 4QUIA 4EFKA 3B9RA 3K73O 1JH9A 2P5YA 1KK2A 4OB7A 3C45A 4CQJA 2BFNA 2PZAA 3DJFA 3IHLA 3OLCX 1VKOA 2GVNA 3ISJA 5C3UA 4M0FA 1IDOA 2PH5A 4ABYA 2ZYRA 2ZAMA 3U5ZB 1KNXA 1M8KA 2WU4A 3OY7A 1XTSA 1W49A 5KSOA 1EFTA 3RTAA 3K6KA 3HN7A 4INPA 3VTAA 4B3HA 2AE1A 4Y2JA 4QYSA 3U3ZA 2HW8A 4OBEA 1UK9A 1WJGA 2FF7A 1FMCA 5IASA 2QTGA 2LKCA 1V11B 4GI2A 4D80A 2O23A 1NRXA 3D2AA 5F3DA 1PJCA 1XMVA 2AL7A 1N5RA 2FZ4A 4ZEOA 5B1IA 4JNKA 3VDXA 1X1EA 3MD0A 3ZBQA 1Y33E 2WWHA 1KIFA 3IPXA 1AE1A 1F8XA 1VHLA 2ZREA 1ZR2A 5HCNA 2AG5A 4KSYA 1KEWA 2C7QA 3OUZA 1N8KA 2KBEA 1SFRA 3EIHA 2QLTA 3LRXA 3E9EA 1DG9A 2W6NA 3QG1A 4CT4B 4RTLA 5LWHA 1P6QA 2F62A 3FZNA 1NUAA 3VGJA 2OR3A 4NH4A 2J3QA 3NDIA 1DJLA 2QW0X 3OZ7A 3PTAA 3OA0A 2H51A 1ULBA 4N76A 4DS3A 1F0NA 4RZQA 2YJ3A 2HXSA 3QKSB 4NPAA 2C0CA 2I6GA 3DXXA 2VNSA 3P9PA 1H66A 2NADA 4BMSA 4N3GA 1ZP6A 4ZMRA 2FZ5A 2IOFA 2KI5A 3GEBA 1TCVA 3QFHA 2WKQA 1V4NA 3N2EA 1V4VA 3IDAA 3P0EA 1KVSA 3CZAA 1XJQA 4MLZA 5J47A 3O9ZA 1N5KA 4Q02A 1T6NA 5GAJA 5EMMA 3PQEA 2M1XA 4J43A 5JZ9A 4JY7A 1QIMA 2IA5A 3G0DA 2XUHA 3PC4A 3DTVB 4W5RA 3EC1A 2C7VA 4PAWA 1OYYA 3U2QA 5K99A 5DNDA 2HNKA 4FZJA 2QDKA 4EB0A 1TAGA 4HB2A 2PUDA 1AN9A 1YV9A 2EGGA 2ECOA 1BVUA 3FNGA 3KD3A 4HEJA 1CQIB 4WLUA 5AOVA 5ECGC 1IEXA 4C0HA 4X1IB 3DT8A 3S81A 1VI2A 2FMKA 3EXG1 4HTFB 2EERA 2C59A 3O94A 1GZDA 2F2TA 1RXUA 4EEKA 4F5YA 2FB9A 1BCRB 3B12A 4XTRA 2G1UA 2WHEA 1JEQA 3TL3A 4MGZR 1T8UA 3WDMA 4I4TB 3OPXA 3KSBC 3SQXA 2IS6A 3BGWA 4F2GA 3CRRA 3DAHA 1TECE 4V38A 3LLCA 4H4CA 5LXTF 1X0XA 1V1MB 3JQ6A 1ZU4A 4F9FA 3OQ6A 1KA9H 2G9ZA 2XRYA 3T5BA 4WK0B 3VZCA 2FE4A 4W5HA 5E0OA 2WJGA 1I30A 3QF4A 4OHYA 4HVAA 4DPLA 4HNTA 4X20A 4KQEA 1U2GA 1Z0FA 1I4WA 3C41J 3IKTA 5B6JA 1NLUA 4AJ4A 1DCKA 1IHDA 1TYEB 3FZQA 2ZJZA 3DKPA 1GG8A 4NOJA 1Z0AA 3PRJA 1Y7TA 4DLNA 5ADVA 3JD2A 2MT9A 2WJHA 4DR1B 1A7UA 1N6NA 4KYVA 3V00A 1U8FO 1XT6A 1JPJA 4AP6A 2WG0A 2YIJA 3DVLA 3MTQA 2G7ZA 4NCXA 1VRCA 4IGFA 4RNCA 4JDUA 2UXCB 1P2GA 5AH0A 3UJ3X 1HNZB 3OZIA 2BEWB 2ZYWX 2IGBA 2VF7A 3OUTA 1EINA 2BELA 2WV9A 2Y2VA 3CA8A 2UZAA 3F5MA 4L4RA 3OIYA 5DM2A 5IEJA 2WYUA 1DOHA 4IV5A 4OMDA 1L5KA 5JXWA 2HK6A 4A0RA 3FNQA 1XQVA 3DS8A 2DQ4A 4J7CA 2H29A 1I7NA 1SVOA 2D4AA 3D0OA 1AZWA 1ZAYA 3HVJA 4HLNA 1KEKA 3G5UA 3RARA 1OWOA 5AW3A 3DBHB 2OM6A 1GLGA 1PQWA 2FV8A 1Y5RA 2J5BA 2MYPA 2FSVC 2WDPA 3WYBA 4KPYA 3KZ1E 3P4XA 5IAAA 2BM0A 1IOLA 1V43A 4GPBA 4XOIA 1PR4A 1YU6A 3IXQA 1L5NA 4LOIA 3O2SB 3NAGA 1EVKA 1KDVA 1EM8A 4EUNA 3OZBA 1ZH8A 3EJ6A 4D9EA 3HVRA 2AR0A 2AMVA 2IH5A 3KVRA 3MB5A 1S2IA 2AB0A 4MX8A 2WWVD 4A2WA 4OY3A 2ZPUA 2AG6A 2QTTA 2OG1A 2N0SA 5LCXA 1Q1GA 4GOLD 4H7JA 1EZ4A 2J3DA 1EVEA 2IEZA 1P62B 1JXMA 1P4AA 3M70A 5H0IA 5DBIA 1Y5IA 1QO0D 2OOSA 2YVLA 2NSYA 2PGOA 4WOCA 5JEDA 5KNDA 4DV6B 4A6PA 3AV3A 3AESB 3TQTA 1E2FA 2BZGA 4J49A 3Q7SA 3JWHA 5JZMA 1T3LA 3TNYA 4WGGA 4FB5A 1PK7A 3D3NA 3PGXA 4G1UC 1EMDA 2WWIA 4NI5A 4TSKA 4YPFA 1UBOS 3KRTA 2V4UA 3NP7A 8ABPA 3FLAA 5HM6A 2YJTD 1SEPA 1CE8A 1SQSA 2PUBA 2FDCA 4XCVA 3KHSA 3NASA 1E4VA 4B47A 1GU1A 4MQEB 2R2GA 4EECA 1EFUA 3B82A 3D5QA 4GBMA 4LQ4A 3W2EA 3WKAA 3EEBA 3GLHB 1XTUA 4JIMA 2B8TA 1NV8A 1PI3A 3GEPA 3GPLA 1RNLA 1KI4A 3PE4A 1X1SA 1USIA 1GZ3A 2OD2A 2A9PA 3QU5A 3SZLA 4Q01A 2ZBDA 4KE6A 1MAAA 4F45A 3V4LA 3BWDD 3M4XA 1U8AA 1PFUA 2HV9A 2I1WA 1R9MA 2OLEA 2I4LA 3GGGA 1RQRA 2ZBVA 1H8ED 1FFEA 5IBPA 3TPZA 4DCUA 5KTMA 2X2FA 3MELA 4IRMA 4M1YA 2JHCA 3IVMA 1RDFA 1RRKA 1XVLA 2CUZA 1DRKA 3OFSA 4YRLA 5LL6P 4NXNB 2HHHB 1WLYA 1NMEA 1GAQA 1FPMA 2R87A 1UZMA 1UINA 2CMFA 2I3BA 3IIIA 4U7HA 2BYTA 3VYWA 1KVUA 3BICA 4RXMA 3VR5A 4UCWA 1CS0B 1MPTA 3F9RA 3OX3A 1YB6A 2QTVA 2FPRA 3EA5A 1GEEA 3FKJA 4M7PA 4GYKA 3S0JA 1MW8X 4F3TA 2P9QA 2GUGA 3AM4A 5AICA 3I23A 4QBFA 2G80A 1EPUA 1HFEL 4OMUA 2ZK7A 3DD1A 4Q3DA 1DQSA 4N39A 5FBKA 1KI6B 5CG2A 4RYDA 1OQAA 4YNBA 1TM1E 3WKCA 5JSZB 1QAOA 1A71A 2DE0X 4KVAA 4WFJA 4JBLA 3SF0A 5CXQA 3C1AA 3SSAA 5CDYA 3ETLA 3I05A 3R3JA 5K7SA 2ZBQA 3QVGB 2BHSA 1G0OA 2CEAA 2XVYA 1CUBA 1NXTA 2PU5A 2Z5LA 3C2QA 4KQ2A 1H1TA 6ABPA 1IDN1 1E7WA 2EF1A 2R47A 1TJYA 4EVQA 4BGUA 1N92A 3EZ7A 2B20A 1IVYA 1JBKA 1V9CA 4AZ3A 4G0UA 3R7FA 2PX4A 2VAVA 5HMLA 1ANKA 3HZRA 4G0NA 4EPXA 1XHLA 2V6MA 2AOVA 2XUGA 2YXDA 3FA2A 1KJ9A 2PBLA 3ZCXA 2VPIA 4EMSA 1HZZC 3KXIA 4WECA 3EQ6A 3GNLA 3G0IA 2VDWB 2F1IA 2HIGA 4IGAA 5SZJA 3UJBA 1EDZA 2LDXA 1TPZA 4W9NC 5ITZA 4ZQIA 2P6NA 3RI3A 2FRXA 5JWRA 1E3LA 3EPRA 1E2LA 1GKYA 2A86A 4W5TA 2C5AA 2GN0A 4URHA 5KHAA 3V42A 3HKDA 4AURA 2DWOA 1UWLA 1SKQA 2H8KA 3AP2A 4DABA 4NQZA 1OJLA 4I14A 2D06A 4PRZA 3M1AA 4Y3UA 2JHGA 2ZS7A 4IO1A 3SYLA 3R6DA 4GKVA 1A8QA 3VR3D 4DRXA 3LUAA 2VDMB 3SR0A 3UOAB 3DMRA 5DNCA 1K6MA 1X1RA 4POAA 3DFFA 3AIMA 4CV3A 4PZ0A 2DMRA 1U2RA 2NZYA 2VH2A 3IOBA 4N40A 4UE2A 1JKJB 4R83A 1MORA 5DNVA 3ZPXA 1CEQA 1PR3A 1VPVA 1UMKA 3B1YA 3GFGA 4V3CA 3MN1A 4CI9A 4Z4IA 3Q4GA 3MSCA 4NZNA 2QL6A 1X7GA 4M0EA 1CR0A 3LT4A 1Q1BA 3D54D 3OIWA 4L4SA 3OZUA 2BEJA 3MUFA 2PT6A 2IP2A 4YP7A 2ZI5A 4OQDA 1K7SN 4YCSA 3EGDA 5KNBH 4QJ4A 5DB4A 2P4HX 4Q3KA 3AXTA 4KQIA 4Q7KA 3SBDA 1CW2B 5ALFA 2ZRLA 5FX2A 4L5YA 1N1EA 1PQUA 4M2LA 3TZQA 4I1YA 4R2LA 4OLBA 3ZQJA 2XWBF 4D57A 2RC5A 4P54A 5HJEA 3DXYA 4MRRA 1VIDA 3AF4A 4G0WA 5FH9A 4OCZA 4GOXA 3M6LA 4Q4AA 2XOEA 1NGSA 3KJEA 1WKVA 3TJZA 4G5QA 3DBRB 5L95A 4I1RA 3T99A 2ZE7A 3BXPA 5FYDA 3VKUA 4GI1A 3UT5A 1J7KA 4P3OA 4AKHA 3FETA 5HJ2A 3WLJA 4BJ1A 1P8JA 5FULA 1F5SA 1P9WA 3OBIA 2IW1A 3PIDA 4EGQA 3HCOA 2Z43A 2I1LA 3HCDA 1I2ZA 4EHAA 3IAEA 4RC9A 3E8XA 4WOPA 3CNEA 2O2JA 5AXCA 2N3ZA 1R4MA 3C3DA 3A6LA 2AQ8A 1QANA 1LW7A 4ZOBA 1M7GA 1E1RD 2ZATA 3QA3E 4XWYA 3U7QB 5H4GA 1AO0A 2AZXA 4EA6A 4YDSA 2D00A 2AX3A 2DFTA 4HAXA 4G4JA 4MW6A 4OHWA 1FYFA 3OCXA 3R5XA 2NM0A 4YAKA 1RBYA 1E9CA 4R2KA 1MHTA 3W5HA 4QYTA 4QTYA 5BWLA 1HEUA 4X66B 2OHJA 2B8NA 2FW7A 4MV5A 2EX1A 2ZWAA 3HCAA 3U4CA 4F46A 4QOIA 1Q6YA 4OQEA 1X7ZA 2YHUA 1YKSA 2L19A 2C7BA 5KDLA 4IHAA 3PXBA 5JNSA 4MQUA 3G5MA 3U6BA 1SEVA 4KN6A 2HJRA 5DU2A 2EBWA 3OCJA 2C57A 4RJIA 2XWJI 5BYJA 4S1VA 1W2GA 2BONA 2GDZA 4RORA 4QNMA 4AF7A 3DMTC 2ZRHA 4UU7A 1O2DA 4YASA 2MSEB 1YOVB 1MIOA 1TJPB 2C58A 4CUJA 5JYBA 4V2IA 4HLUC 2GCEA 2I2CA 2JGKA 1MQ8B 1ODTC 3FAKA 3I58A 4ZRNA 2GBCA 4D8TA 3OE7A 2YKGA 3N2KA 4NONA 3H2SA 5BQOA 3VJMA 1YE3A 5G02A 3VVLA 2ZIXB 3FWNA 3K4HA 1XX6A 1WDWB 3W4KA 5E3IA 2OB2A 4REMA 2FEAA 3ICOA 5DLPA 1RWOA 4EJSC 1FU4A 4IWYA 5KMGB 3VZRA 4YX9A 3PQFA 2V7WA 5CFLA 2Y92A 3A28A 3NOOA 3CLHA 4KZKA 1TRHA 4D9JA 4P4LA 1LW6E 2CB0A 3ZZUA 1NJ6A 4G37A 2JFGA 2XUIA 1V7CA 2AXQA 4RV5A 3RSCA 4N9QA 1VG9B 1DDOA 4L4ZA 1M6YA 3V8NA 1HZJA 1FJXA 3SKXA 2CNOA 1FC0A 4NYJR 1IZZA 2Z6VA 5JAOA 1HTTA 2BCGY 2O5RA 3HG7A 4LCJA 4FI3F 3ZV5A 1C1YA 1C1DB 1Y6RA 1COWD 4PR3A 4FGZA 121PA 1G3RA 3DYBA 1IVNA 1UKBA 2X8JA 2ZQYA 5LA6A 1Z7EA 1W4LA 5E2IA 1Z4OA 2P40A 3JS5A 1C7RA 2CL7X 2VAWA 4J3JA 1SCIA 3HA5A 3TQRA 1Z88A 2HC9A 1IY9A 1NT2A 4I4LA 2VLBA 2ID7A 2P69A 2HIMA 2JDID 2Y0BA 4MS4A 3GFTA 3VSDA 1QJ4A 2G17A 1YDWA 3LL4A 4I1SA 4UUQA 4YRFA 1BKDR 4F97A 4HYYA 2O2SA 4CKEA 4HD8A 3LUPA 3LBFA 3TZ6A 2HTFA 1Z5WA 1HOTA 2Z1DA 2Z56A 1GV0A 3E2PA 1C4OA 2XH8A 1MQ9A 2R6R1 2XCLA 2O3JA 1T5BA 3K96A 3L4EA 1KRWA 3P27A 3ZCRA 1XN4A 1D7OA 1NN3A 4BE4A 4EYOA 2Q07A 4TTQA 1WCIA 4WK4B 4UTPA 3L04A 5B2EA 1YGPA 5DRTA 4MVJH 4ZAYA 4BO4A 5A9SB 3GL9A 4GUAA 4Q3BA 1HY3A 3W78A 4LZNA 2HI0A 1SBQA 4XFJA 3LY7A 5FBRB 5FIUA 5CLFA 2ZUUA 2ZUFA 1X9IA 1U31A 1ULUA 3UB2A 3KLMX 4HDSA 1MMFB 3OCVA 1SPXA 3O47A 3T5MA 4KN5A 1E77A 4PLPA 2M98A 1XDDA 2BFEB 3BHMA 2WWGA 5KX5A 1NJ8A 3GMIA 5EXEA 1XJ5A 2FN9A 1CEXA 2PWPA 2Z95A 1CDOA 2J5XA 4YGXB 3LOUA 3KQYA 2R86A 3RJMA 3A14A 3INYA 3DKRA 3UK0A 2JA2A 2ZRDA 1DWOA 4CLOA 3AONB 1P19A 1OX4B 2Q0XA 3AF0A 4LY6A 5KVAA 4QYIA 1ZG3A 1P9LA 1UPTA 2RHBA 3P2EA 2AC2A 5JXHA 4CKWB 3NT4A 3GHHA 1LTKA 1QC5B 1LEHA 1UXKA 2Q6IA 2QROA 3P9QA 3QH4A 1K4MA 3QNUA 4KODA 4WVLA 3ZBTA 3ZKAA 4ARUA 1V8DA 2A9QA 3PLRA 4BX8A 3NVDA 3H83A 4FX2A 5F9FA 2M6SA 4N3NA 3TCXB 3QY0A 4L0CA 4QDTA 3GMSA 2X5KO 1TYCA 3IP3A 4ZVKA 5IS2A 2G7MC 1AF7A 1DNPA 1GUYA 4ZKEA 2OGWA 4M9CA 2XYVA 3QUSA 1G5QA 1WXGA 2DBQA 1QR6A 3RRFA 1W36B 4BB9A 2ZIZA 1UP7A 4IUYA 4YRBA 2DLNA 3GGDA 1KARA 5IJ0A 1O0CA 1OW3B 1WTAA 1U02A 5JXJA 4JSRA 2XHZA 1O58A 2P2CA 3ZD8A 4BXOA 1VGVA 2C4VA 3NTQA 4OSPA 2AYZA 3EH2A 1HDZA 3Q8WA 4KQXA 1F2TB 4HWOA 5AJUA 1H4VB 4IUCS 1NBWB 3RHZA 3OLQA 1JLKA 1JZQA 5TF4A 1KYXA 3BJEA 4Z6KA 3S29A 2NQ8A 1PR0A 1CP3A 2PSEA 2XUDA 3E4DA 3GRZA 3H11A 3OZAA 5DO9A 1F3LA 3WLMA 3NJ4A 3SXPA 3IPAA 2W2OA 3VPAA 3ZWDA 4NU6A 4CF3A 1KPHA 2CMGA 2IHBA 4HDNA 1NVWQ 2OG2A 1A4XA 5LB4A 2XIJA 1JKMA 2JIDA 5SYAA 5FWNA 3WXBA 2JFWA 5LDHA 2BEVB 2KMLA 1ABEA 1DFGA 1Y4SA 2PUGA 1ISJA 2DF8A 3AHJA 4QLOA 1R7RA 2FEPA 2F55A 1CXZA 1GOTA 3O8DA 2BKUA 3P52A 4J16A 3PEVA 4K9SA 3VPFA 3WBKA 2OZVA 5AK0A 1VE6A 3BMNA 1G5RA 4DWOA 1TXGA 1ZW1A 5AKEA 1KQPA 4F11A 2CYBA 1YL7A 3B1KA 4UCFA 5DTEA 3ZY5A 2BLLA 3FPCA 5I7OA 1YDGA 3L8YA 2YCBA 2ZSFA 4YCBA 2LWIA 9MHTA 2W71A 3EFOB 1P1CA 1VL8A 4Z7NB 4WKCA 1E9EA 4Y1RA 5SY4A 2FMHA 3VNQA 4D4KA 1TZ2A 5ALGA 4ZCPA 3WLOA 3GEHA 2NYVA 2QT1A 4K88A 5CTAA 5AKLA 1HA3A 1L0BA 4AROA 1E7QA 1KWKA 4RVFA 4PO3X 5ERGB 3SY8A 3LF2A 3MCWA 4PW0A 3BSYA 2ZCJA 3WNCA 5AK3A 2D6FA 4TTTS 4UNPA 1YMQA 1RLIA 1YO6A 4XCQA 2J7PA 3UWKA 2J9FA 2Y1CA 3IAFA 3M5CA 1JLLB 1HDXA 1C81A 2G63A 1BCSB 1W34A 3AM1A 1UAGA 2O3SA 2V6FA 2OESA 1TE2A 2PX8A 1P61B 5F1PA 1XDZA 1W1IA 3FJOA 3TJRA 3AEKA 1MOQA 4TRRA 2GGSA 4OHXA 3SLGA 5HZGA 1C29B 1KGSA 2IHTA 3NDJA 2HNBA 2LGJA 2V6IA 3DKIA 1X7YB 2C2WA 2XA1A 3ECCA 4OQYA 3TCKA 3PHHA 4BTLA 4EG6A 5LXTB 1XGKA 3TLJA 4P0PB 4K0KB 2H08A 1B8OA 1C1HA 1UKAA 2W5UA 2ERXA 3EIEA 4UNRA 2QNRA 4A8JB 6PFKA 4WDRA 1ZK1A 2Y6UA 3AUUA 1QV7A 1NHGA 4L22A 4E2YA 2B1JA 3H3XA 5C8XA 1VHWA 2PJRA 2YWRA 1ZXLA 3WLHA 3QU2A 3FSGD 5DCUA 5KQLA 4WCFA 5HP4A 1YZQA 1NVDA 1QDEA 2OV6A 1YKGA 2X22A 3ANLA 3ODPA 4MI1A 4PZUA 2SCUB 5CNMA 5KOJB 2EWWA 2P3SA 2XMCA 3ZKWA 4JCOA 1V41E 1QFXA 2NYRA 3ZE9A 3G23A 4Y2TA 1OY1A 2O7QA 4RY8A 5LC1A 5KOHB 2EKZA 2C8JA 1HF3A 5DXAA 3DDUA 2CDNA 4HNVA 1H2BA 1WPRA 2PYDA 4IWNA 4ROSA 4BJ3A 3FOEC 2HWYA 2J4FA 3NHBA 4HMOA 4MW4A 3HUEA 1UKVY 3KJIA 2QPLA 4H6VA 3GVIA 3LRPA 4O3FA 2Q5JA 2VJMA 1SRQA 2H1VA 4EUSA 2PRSA 1NBAA 2HQOA 3OP4A 4OQXA 1UF9A 1ZD8A 2Y4NA 2H2IA 2CNKA 4K40A 1Z4LA 5EIOA 4DILA 1GPNA 1G8HA 2FQYA 1D3AA 3H04A 3T3IA 3G2QA 3ZD7A 2BV3A 4PC7A 4AS2A 4BUJA 2D0OB 2ZI7A 4MCIA 3COSA 1CRWG 3U9SA 2XDYA 2ZVDA 3IILA 4JLUA 2R4TA 4YMVA 3ASZA 3BHIA 1Y8RA 3E9ZA 1NUSA 2J67A 2V7XA 4FE3A 4H77A 5CJJA 3IIKA 1NFFA 1BN6A 1O03A 3PZRA 6Q21A 2A84A 1P6XA 5EUQB 4JH0A 1NXQA 4DF3A 3ENKA 3UVEA 3TVTA 4EKYA 3UT6A 2GARA 3N6XA 1VLMA 3K1TA 4IOLA 5JROA 2R7NA 3SHQA 1OZ0A 3GQBB 1U6JA 5KTYA 4R9SA 1Y9DA 2OD9A 4ND3A 4B0PA 2FSHA 1FPQA 1B8PA 1QQ5A 1ZJ6A 1M6HA 1ZUIA 3IXMA 4IIUA 4JX8A 4K9QA 3X1DA 2QM7A 4RKYA 5AW4A 1ADGA 1SVKA 1JHYA 4MW2A 1LPBB 1CRQA 1DQZA 4FNAA 2EU8A 5HUJA 5JFTA 1XEFA 4RK6A 5FL7A 1QHFA 4R01A 3T3GA 3O03A 3CV3A 3EWIA 1LDBA 3JALB 4D4IA 3EZYA 5ELLA 4GGOA 1A9YA 1L4BA 4EA8A 5H3HA 1Y1LA 5T6MA 2HF2A 3BA1A 3TNFA 2F4VB 3JD3A 2FPPB 1XKXA 1B0PA 1KKUA 1TO1E 1V11A 2GZAA 3V8QA 3I9OA 5IJZA 2FPMA 3TZLA 1JU4A 3TSOA 4B4OA 2IK8A 4G56A 2NP6A 5B36A 4P82A