5TGDA

Crystal structure of folm alternative dihydrofolate reductase 1 from brucella suis in complex with nadp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
249
structure length
249
Chain Sequence
EARMVANCPVLVTGGARRIGKAIVEDLASHGFPVAIHCNRSLDEGEAIANRINDSGGNACVVQADLEGDVRGLVKQASDRIGPIRLLVNNASLFQEDKVGALDMALWDRHFAVHLKTPVILAEDMRKALPEDQDGLVVNIIDQRVWKLNPQFFSYTLSKSALWNATRTLAQALAPRIRVNAIAPGPTLPSERQRPEDFERQVSKLPLQRAPELPEFGRTVRYFWENRSITGQMIALDGGQHLAWETPDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FolM Alternative dihydrofolate reductase
publication title Crystal structure of FolM Alternative dihydrofolate reductase 1 from Brucella suis in complex with NADP
rcsb
source organism Brucella suis 92/29
total genus 92
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tgdA00
4R16A 5IXSA 5T64A 3ITKA 2O48X 5I7FA 3DOOA 4ONEA 1U5AA 5G0UA 1Q7GA 4PIVA 2GN4A 2AQKA 2PY6A 2EEZA 3AUUA 1ARZA 3NJ4A 2Q46A 1VJ1A 2B5VA 1ISHA 3GN2A 1T1RA 1JVBA 1A27A 1GYPA 3EY4A 3FWNA 4AJNA 4O63O 3L07A 2XF8A 5L9AA 2B0JA 1J6UA 3CINA 3H2ZA 4CM9D 1OAAA 2JL1A 4FBGA 4II2A 4OXYA 3AUTA 2VOEA 7ADHA 3D3WA 3VVBA 3D4OA 3VZRA 1QSGA 5L40A 3ZV5A 4PN3A 2JD1A 5JE8A 2GRAA 4BO6A 4EUFA 4IXTA 4MVJF 3ZWBA 5BNTA 4QECA 4R1NA 4DXHA 3BA1A 2I99A 4P38A 3ZNNA 1GDHA 3DDNA 4XA8A 4UEKA 3UW3A 1R4MB 2YDXA 1XYGA 2WEKA 4G81A 2I3GA 2Y0DA 4CMCA 3QJ5A 2P4QA 2P91A 1Y7TA 3C3XA 1NHGA 1Q0QA 2GZ2A 4E12A 1KIFA 1NP3A 2V65A 4NQZA 1XG5A 1QXSA 2DM6A 4XD2A 3NAQA 3RAJA 3L4SO 4BO2A 4J0FA 4RPGA 3PJEA 2F1KA 3X2FA 3RASA 3DZFA 2JKVA 2V7PA 4OGWA 2FR8A 3PYXA 3PWSA 3SLGA 3ENNA 1IHXA 1P33A 2Y1GA 4ZHSA 1B7GO 3K31A 3U9LA 5B4TA 3ROQA 3UUWA 4PVDA 1DRVA 2NVBA 4ND1A 3BAZA 4RV9A 1HDYA 1KVUA 2Q2WA 3EZLA 1OFGA 2DBRA 3KLMX 5U4QA 3OM9A 4UVEA 3JYLA 2X9VA 2J3JA 3K92A 1HDCA 3S2IA 5KKCA 2GPTA 1IE3A 2W4QA 1B0AA 4MJLA 4E2WA 3MTJA 5EINA 3M6IA 5FYDA 4TZKA 2RBEA 2RHRA 1IYZA 4DQUA 3EUWA 4PLPA 3GNTA 3H65A 4BL5A 4WEOA 2J5QA 1MFZA 2Q3EA 3WNVA 4CM8A 2NVWA 4KMSA 3H9QA 4LVCA 5L53A 4OHUA 1SMKA 3HN2A 5TT0A 1Y9AA 1NQOA 4HX5A 3V2HA 3RUEA 3DZJA 4YDRA 4E5YA 1VI2A 1AN9A 4NBUA 3ZU3A 4DVJA 2DTDA 1XELA 1GUZA 4WPGA 1GCOA 3VHRA 1YRLA 2IZ0A 3W4IA 4D44A 4MDHA 4RDIA 3DAPA 2CDCA 1UJMA 1RM5A 3BHMA 1GAEO 3BMNB 4N5LA 4OAQA 5EESA 3U4HA 3ZW9A 1A9ZA 2WD8A 4R1UA 3L6DA 4WCDA 2X5KO 3F5SA 1K6XA 2C54A 2VT2A 3RBXA 3RU7A 4LSWA 4GBJA 2QZ9A 3VAZA 3I5MA 1ENOA 3GNQA 4ZICA 1DJQA 2AHRA 5DCYA 2HU2A 4NJOA 3GUCA 4Z0TA 4H7PA 5L4NA 1KVRA 1UP4A 2NQ8A 1YL7A 2OOSA 4JBHA 4WKGA 1SAYA 2PFGA 3PP8A 1V3UA 3GGOA 4JP2A 1T4BA 3SLKA 2PGJA 4MKXA 1W4ZA 4JK3A 4L4SA 2YUTA 5IDYA 3FN4A 3PHHA 1LC3A 1DC3A 1NQ5A 2H6EA 4RPHA 2VHVA 1U28A 4J6FA 4B79A 5LCXA 4IM7A 2J6IA 8ADHA 8LDHA 5BQFA 4BB6A 2BLLA 4JIGA 1X7GA 1ZW1A 4DIBA 1GZ4A 3EGOA 1V6AA 4B4VA 2QHXA 4E30A 3HB4X 1VE9A 3JQ8B 4FJ1A 2EKQA 2O3SA 5HTOA 1R4MA 1YONA 3OQ1A 1K0UA 4UVDA 4BNJA 1NWCA 5A02A 2X5OA 4FC7A 3WG9A 5BSFA 3RQSA 4DQXA 1UZMA 4FGSA 1PWXA 2OO5A 2VWHA 3JQ7B 4HUJA 4CQMB 4DIOA 1ZSYA 1LDEA 5ER6A 3KRTA 1M66A 1GEGA 1Q0HA 1U4SA 4GPD1 5KJEA 1RJWA 1PQUA 2I9PA 1EE9A 1P1JA 4GQAA 5AOVA 4E2YA 5DBFA 2J8ZA 2D5AA 1E6WA 3RUDA 3UCFA 1QV7A 1XQ1A 3FWZA 3RSHA 1YXMA 5C7IO 2AEMA 3HN7A 3ROPA 1Y81A 4HFJA 4D7AA 3DFZA 1RWBA 5TRTA 4CMEA 3AY6A 2QYSA 1YJ8A 5CEFA 2PD3A 4RJTA 2E4AA 4ZVVA 3ZZNA 1F8GA 1R66A 1YS4A 3TOXA 2ZTLA 3GT0A 1C0KA 3JQDA 1ZK3A 3HZZA 4W9NC 2ZJ1A 5CDSA 3WGIA 4I5EA 4IDBA 3RWBA 3S55A 3BHJA 4IINA 1KEPA 2R00A 1M76A 1VJ0A 4L74A 3N74A 3AK4A 1R4NB 4CODB 3KYDB 1PS8A 3RUFA 1EEHA 1ENPA 3VTZA 2GZ3A 4R54A 3UVEA 4N54A 4N18A 5JDIC 3PWZA 3KZVA 3DZKA 1T2AA 5JPIA 4GLLA 2VUUA 3RROA 3O8QA 1FXSA 2B4TO 2DC1A 3BMNA 1C0PA 4E5NA 3ZNPA 4RQTA 1EVZA 4GKBA 4Z0HO 4IDGA 3DZHA 3G3EA 1IY8A 3NDRA 3AFMA 4GGPA 5A4DA 2P9EA 2VZ0A 4URFA 1UDAA 3AU8A 1BW9A 5I8ZA 2I6TA 1WAMA 4A5OA 4CMBA 2EERA 2O7SA 3AM5A 3PFWO 1TEHA 1U8FO 3LK7A 4J2HA 2QIOA 2UYYA 5G0VA 4AJ4A 2HJSA 2A92A 3TZ6A 1BWSA 3U4DA 2PNFA 4ZD6A 1LU9A 1K6JA 2YFHA 2O2YA 1MXHA 3A06A 3DB2A 4R4JA 3K2EA 4UEJA 4FIZA 1QV6A 3PDUA 3VZSA 1O0SA 4XR4A 2X0IA 5HWSA 2VNAA 1PJBA 1RM0A 5A3JA 4PZEA 1D3AA 4IJKA 2EW8A 1XU9A 4WLOA 3JYQA 3KBOA 1E7WA 1XKQA 2O4CA 3WGOA 2VN8A 3JQ8A 5CDTA 3LYLA 3I9MA 4FFMA 4J0EA 1VRWA 2DUWA 5FI5A 1WDKA 3C7CB 4ALMA 1P77A 3E9NA 2Y1EA 4W99A 4O1MA 1E3JA 2NU6A 4WOKA 3FRJA 1VSVA 4CQMA 1OBFO 2DBZA 2QX7A 1YB4A 4DLAA 1P0FA 5IDQA 1RM3A 3V1UA 3VPHA 1U9JA 5DZSA 3BTOA 1HEUA 1HYGA 3MEQA 4CLOB 2PK3A 4MIYA 2VWPA 1HDOA 4D42A 5B4UA 4N5MA 4XJTA 3NEPX 5TNXA 3EZYA 3OICA 5H81A 4LCEA 3HB5X 5IZ4A 2OP1A 3NV9A 5C37A 5CEEA 5L7TA 3KSUA 1ADFA 1DFIA 2FR1A 2C7VA 1HZZA 1JKIA 2AQHA 3PEFA 5JCJA 4BVAA 2PGDA 2CZCA 2RIRA 4RZIA 1A71A 3TZCA 4CL3A 1HLDA 1GD1O 4FN4A 5CG2A 1PJLA 2X0RA 2ZIZA 4BS9A 4E2XA 1ZZEA 1I36A 1ZJZA 1X13A 2OMEA 2Q50A 1ISMA 2R6JA 4EEZA 3H2SA 2CVZA 1PGNA 5JAZA 2C5EA 2X9NA 1R4NA 5B12A 2FR0A 1LRJA 2DKNA 4U0JA 2GZ1A 3E9MA 4HKTA 3WFJA 3KYDA 5IDXA 1E3IA 1KY5A 2PKQP 3EHEA 4GMFA 4OO3A 3M1AA 1VKNA 1ZUD1 1XGKA 3JQCA 4CQLB 4AVYA 3UHAA 4EEXA 4HFMA 3ZH2A 3ZWXA 4NNJA 4Q3EA 1GTMA 1YQDA 3AUSA 3PZRA 1Y9EA 2BFAA 1RPNA 1DLIA 1JW9B 3V2GA 3DBHB 4DLLA 1I3LA 1OC2A 4MINA 3GDOA 3WGZA 4YVFA 5A9SB 4JNKA 1NYTA 3C1AA 3W6UA 2ZQZA 1NTOA 3K9QO 3ZU2A 1CF2O 4L76A 3GVCA 1GPDG 1ZCJA 3VPXA 1M6WA 4F6LA 1WLYA 1JA9A 2WYVA 3D0OA 3GRPA 3JD1A 1ZBQA 1LRLA 1U3VA 2DPGA 3ETDA 4Y67A 4BGEA 2ZCVA 4MP3A 1N2SA 5IJZA 2I67A 2Y1OA 4CMHA 2W2KB 1J0XO 3H5RA 1HYHA 1NR1A 5AXDA 3AW9A 4ITUA 3JQEA 2H63A 2ZYAA 4MO2A 3FTNA 3KVOA 5IN4A 3I23A 3GGPA 4PVCA 4E5PA 1EBUA 1DC4A 3ZV6A 1E6EA 3Q11A 2YZ7A 4DTIA 1MG0A 4MVJP 4B8WA 1C1XB 1CRWG 1RYDA 2E82A 5AVOA 1ISFA 1C14A 1E7MA 2Y1CA 4Q3NA 1ONOA 5FF9A 2UUOA 1HE4A 2P4HX 3BIOA 3PFFA 6LDHA 2YW9A 5ILOA 3DFUA 2X86A 4TVOA 4ND5A 1B3RA 2JFFA 2ILTA 3W4JA 1R15A 4B3IA 4NIMA 4IMRA 4DMLA 2GR9A 3JYPA 4TVBA 3ZNQA 2AE1A 4JXKA 4TKLA 1MC4A 1RM4A 4CLOA 2P9GA 3PHLA 4HFNA 1T2EA 1NNUA 2HJRA 2VWGA 4YEDA 3DR3A 3V1YA 1ZSVA 1K89A 2YQ4A 1YB5A 1G6KA 1LSJA 3MTGA 2Z1MA 5BSGA 4CMIB 1ZSNA 3CTMA 1YBMA 3D4PA 3ZU5A 1I10A 3TFOA 5JAIA 3SEFA 1E3SA 1EDZA 3DC2A 3F6YA 4CV3A 4ALNA 4ZQGA 2BH9A 4PLFA 4YQYA 3DO5A 4NK4A 5IG2A 1D4FA 1ONNA 1EE2A 4EYEA 3GLQA 4GL4A 3VKUA 2YJZA 1QYVA 4CMGA 4LW8A 3QVOA 1Z82A 2OUIA 1EUZA 5BT9A 2EF1A 5JBIA 3IC5A 1EZ4A 4CLRB 5ER9A 2UAGA 4D0RA 4J1QA 5L45A 1E1LA 1X14A 1B26A 3NTQA 2YHIB 4CQLA 9LDTA 3TSCA 1XQ6A 1W8DA 3WYCA 2O7QA 4DMMA 2GN6A 2P68A 4I5DA 3OIDA 4MIEA 1Z7EA 2PWZA 4INAA 5COBA 1HKUA 4Q3CA 3Q9NA 2VUSA 5ENVA 1HE5A 3OJOA 3VDQA 3GMSA 5A9SA 2Q45A 1PS0A 3H6KA 4L4RA 4PFJA 4XKJA 5KWEA 3QQPA 4FPXA 4WLNA 1IULA 1PS9A 4D46A 2WSBA 5DULA 5G0WA 2JFHA 2HK7A 4JJFA 5JY6A 4J1NA 5L51A 2DTXA 4G5HA 2RCYA 3PPIA 1F06A 2DU8A 2W2KA 1L1FA 3RJ5A 1MG5A 2NU8A 1T25A 3TL2A 1DC5A 3I9KA 4U5QA 3LLSA 1XWFA 4DPLA 2CVQA 3MJSA 1KBZA 2YV2A 3IDSA 1OOEA 3FNFA 4IQ0A 1SO8A 4R1TA 3WGHA 4YA6A 1C1XA 4M87A 2DTEA 5G4LA 5HA5A 1B8VA 2WE8A 3ABIA 4AJOA 2X9GA 1V3VA 2GCGA 1UZLA 1DAPA 3O4RA 3WSVA 3SXPA 1Y8RB 2LDBA 1ZNQO 3E82A 1VLLA 3Q6IA 4IJUA 3PHJA 1NHWA 2Y99A 3K5PA 4Y6SA 5B1YA 1L7DA 1MUUA 1QP8A 1P0CA 3A14A 1ULSA 3UAGA 2EKLA 2CFCA 4BV9A 4J4TA 3FNEA 3UOGA 3KSDO 3ZWYA 2BI8A 3OJEA 3UCXA 1ML3A 2ZQYA 4ILKA 4P4LA 1SNYA 1J49A 3TDKA 5L95A 5DBGA 4XQ9A 4FFRA 4XJSA 3M2PA 2J5KA 4BKOA 3KB6A 4B4OA 5K6AC 4OKIA 1WZEA 1OI7A 1DFHA 2YYYA 2ZATA 1F0YA 4CMIA 1LTHR 1S6YA 3LT2A 5I7SA 1E5QA 4CUJA 1ZVMA 1KETA 2V6FA 4PLHA 3AOGA 4OSPA 4WOJA 5TLSA 5A5FA 1WVGA 2V6MA 3A9WA 1N8KA 4DUPA 3IJRA 4IPTA 3KTDA 3GVHA 1Y5RA 4NU6A 4JBGA 1ADCA 2NQTA 3ZN2A 3U0BA 4FS3A 4YTEA 2Q1WA 3GFBA 1N9GB 3TL3A 4OOFA 5G4KB 1WMAA 2WYWA 4UUNA 4CLRA 1P1RA 5DOZA 1MGOA 1SEVA 4Q3AA 1KVTA 3R6DA 3WJAA 4YAEA 3F1KA 5DCWA 4IZIA 2EKPA 3FTPA 3Q3CA 2YHIA 3L6OO 5IZCC 4EJ0A 2ET6A 3WLFA 4D41A 3G1UA 2VHZA 4TWRA 3WSWA 4IBOA 4BNXA 3JQ9A 1WW8A 1Z75A 2DBQA 3HDQA 2UDPA 2EWMA 4DYVA 2VHXA 3QIVA 3OEYA 1A4UA 4NMHA 2FSVA 1X0VA 3TOZA 4KUEA 3U09A 4K26A 2C20A 1DB3A 1SBYA 4C7KA 1SB9A 1U3WA 2X58A 4CJXA 1UDCA 3L9WA 3ANMA 1E77A 1YBVA 4JROA 1CERA 3F5QA 2OGUA 3DL2A 4CM9A 4Y98A 2IODA 2LDXA 2RAFA 1BGVA 3RUIA 1O9BA 4CMJA 1JKFA 4PG5A 2WYUA 3WYBA 1DBVO 1R16A 1HL3A 1Z6ZA 3C7DB 3KUXA 1YDEA 5FI3A 2P2SA 2X7HA 3LF1A 1PZEA 3Q1LA 4FJ2A 4HADA 3NT5A 1R37A 1SCUA 1BVRA 4QEDA 4HFRA 4RORA 2BFMA 2EGHA 2C0CA 5I7VA 2OFPA 2OBYA 1R0LA 2PD6A 5L4LA 2FSSA 3ZWMA 3FR8A 3LQFA 3W4KA 3WTCA 1Y8RA 3AFNA 4YJFA 2GGSA 1X1EA 3E03A 3OJ0A 4TRMA 2HK8A 4WASA 4P22A 3RI3A 4PRLA 3H5NA 2NU9A 3JQFC 4XRRA 3O26A 1KC3A 1PGJA 4GX0A 4K28A 4Z9FA 2HMSA 5A9RA 2X1HA 1JTVA 3E48A 4NH4A 4HWKA 1ISGA 1XHLA 1Y5MA 3V2UA 3WNQA 4W7IA 3GUYA 4PLCA 2WTBA 1ADBA 3GEDA 5JMWA 3GZNA 1LLCA 3P2YA 2BF7A 4ZRNA 1E7QA 1ZEJA 2DQ4A 2HK9A 4A2CA 4YAKA 1YL5A 1XDWA 3RUHA 1K2WA 3JD4A 1X1TA 5CAEA 1P3DA 4WGGA 5TJHA 3I4FA 5EN4A 3G1TA 2Z1NA 4WCFB 1QYXA 5EMHA 4LRTB 3B1KA 3F1LA 4W7HA 4IDFA 1P1IA 4QQRA 4IMPA 2XPCA 4GWGA 3GF4A 4E5KA 1N9GA 4R9SA 2YV3A 5G4KA 3GVXA 1QR6A 4P4NA 5BNIA 1FMCA 2EIHA 2WMDA 4YJHB 4BQPA 4A03A 3F9IA 3GA0A 4BNHA 1TLTA 3GY0A 1EK6A 1J5PA 4WNCA 3DOJA 3RVDA 1F12A 1N92A 1NASA 3INRA 3QWFA 4LISA 2PA3A 1GR0A 4QSMA 2Y93A 3BXXA 1ORRA 2B83A 2I65A 3HHPA 1T26A 2EV9A 4NG5A 2NSDA 1U8XX 3UGKA 3ZHBA 1V35A 2FY8A 4UUPA 4YQZA 5C5IA 4CM6A 2A35A 3HDYA 1YO6A 4MOWA 4MP6A 4OJNA 1EVYA 1W0CA 5COAA 3VTFA 2FN7A 1GL3A 2AW5A 3JQ6A 2VHWA 2WD7A 1LUAA 5IFLA 3UKOA 2NTVA 4IS3A 4PRKA 1YVEI 4II3A 1GUFA 2JAHA 3OJLA 1TT5B 4KDEA 1AGNA 1PGOA 1E3EA 3EDMA 4EW6A 1XCBA 4WE3A 3RU9A 4PLYA 2Q4EA 3JD0A 1O89A 3NX4A 3CKYA 2VOJA 1SZJG 1A7AA 2I3AA 3BTVA 1ENYA 4CM4B 3E6AA 5CDGA 3CMMA 3QP9A 4NU5A 2GF2A 4XCVA 1Z7BA 2WDZA 1P1HA 1VPDA 4OMUA 3HSKA 3V5NA 1NBOA 4ZJUA 4QO8A 5GY7A 3VKVA 3R1IA 3RUCA 2VNSA 1F8FA 4AL4A 1E0DA 4YACA 5TJ9A 2EHDA 2VYVD 3O8QB 4FFLA 3TJRA 3SBOA 4BNTA 3SJ7A 4FJ0A 2WM3A 2CNBA 4YRAA 2R2GA 1DAOA 4ALKA 2UUPA 3IP3A 1E3WB 3PQEA 1BW9B 1LA2A 2VHYA 3UXYA 4Q9NA 1V3TA 3ZNOA 1ID1A 5CHEA 2CUKA 2E48A 4JN6B 4MP8A 2W98A 4J1SA 2EP7A 2ZTUA 2CF6A 2D8AA 4BO3A 4EJMA 2GLXA 3PHGA 2CSUA 2O3UA 4PLGA 1HDGO 3L77A 1E3LA 1PZFA 5EIOA 4EUHA 3KETA 2Y0CA 1ZFNA 2ZTMA 4WCFA 1HF3A 5LC1A 1B8UA 1P1FA 1D1SA 2Q49A 4D0SA 3I3OA 2JCYA 2ZCUA 4QFDA 5K9ZA 1ISIA 3WR5A 2V6GA 3I1JA 1D7OA 3ENKA 1KVSA 4QO7A 6ADHA 3E18A 4GVLA 2Q1SA 4YJHA 1I3NA 3FI9A 4BMSA 1GYQA 2VWQA 3K30A 3HFSA 1UXJA 2AMFA 4JCOA 5T8KA 1I30A 5F1KA 1EK5A 3ZHYA 2PV7A 3F3SA 5IN5A 4EZBA 1I8TA 2X22A 1BHSA 2IYPA 2ZJ0A 5JC1A 3WLEA 3HE3A 5EL0A 3CUKA 1GYRA 2BFPA 3IKVA 3D7LA 2A4KA 2YHUA 2BI7A 4I1IA 5A1TA 1KERA 3IKTA 1PJTA 1NWHA 4XGKA 3TZHA 5KVQA 4JX8A 5KNLA 3GDGA 3FNGA 3GG9A 4OXKA 2B35A 4R1SA 4G2NA 5B37A 3I6IA 4MVJI 1NM5A 2QQ5A 4PG8A 4JQCA 3FR7A 3I4CA 1Q1NA 1V9LA 3MCVA 4AJKA 2GN9A 3WOHA 5HM8A 1EUDA 4O59O 1TT5A 3RD5A 4O5OA 3EC7A 3ST7A 2F00A 3MOGA 5KVVA 2IE0A 3G0OA 4RF2A 2B5WA 3DBLB 4CM4A 1C3VA 1JAXA 1I33A 5JDCC 1ZMOA 1FDUA 3VH2A 3IIEA 4JJIA 4KOAA 2RHCA 3QWHA 3W8EA 1GEEA 4D43A 2Y1DA 2UV8A 4NBVA 4EBFA 1ONPA 3JD3A 3U5TA 4B8ZA 1ZJYA 1MP0A 3H4VA 4BMVA 4CLXA 3IUSA 3DMYA 3X2EA 4OIMA 3NDIA 1DHTA 4E6PA 4K1LA 1PIWA 1DO8A 3TQHA 1BDMA 1TVEA 2GO1A 1E3WA 2HSDA 3H9GA 5L7WA 5IF3A 2C2YA 1H5QA 3G49A 3RUAA 7MDHA 1U7TA 1X0XA 4D3FA 3FCOA 2XAAA 3DTTA 4LMPA 2HLPA 3JQBC 1NAHA 2DVMA 1HETA 2Y05A 1HRDA 2HDHA 1ZH8A 3SX2A 3KEQA 3KM0A 4UUMA 3I83A 4J9UE 3GHYA 1H6AA 5DT9A 5KVCA 1P74A 2EJVA 4J4HA 3VC7A 3I9NA 4Y6RA 4GKVA 3G17A 4IGFA 4ZQFA 1YQGA 4BGIA 4KWHA 1KOLA 1E1KA 1MLDA 1Y6JA 4DC0A 4E33A 1SEPA 4J7CA 1WDLA 1AHHA 1ZO8A 1DHRA 1VL6A 4Q3BA 5JLAA 5AXAA 3STHA 1UDBA 4BIIA 4XGNA 2Y0EA 1F17A 5AXCA 4XIYA 5KOIA 2AEJA 4BNMA 1JVSA 2E37A 3DHYA 1HE3A 1HSZA 5EERA 4YRBA 2HMUA 2RH4A 1LDGA 3B6ZA 5T57A 4FB5A 2O23A 3WQQA 5TSDA 2PKRA 4YR9A 2O3RA 1GUYA 1LXCA 3R3JA 4RVSA 2GASA 1YOVB 3P5SA 3SVTA 1A5ZA 1FDTA 4BO7A 4K6CA 4E32A 1LC0A 1KEUA 3IQDB 4XB1A 3CZRA 2BGKA 4AG3A 5TT1A 3W1VA 2DBVO 3DBRB 2CDAA 1D8AA 5TGDA 1GY8A 3VOSA 5BR7A 4HNGA 2PZKA 4Q3DA 5TX7A 3IS3A 1PR3A 1M75A 1UAGA 4ND2A 3GAZA 1EVIA 3CH6A 4X54A 3DBLA 1NPTO 3AOEC 4OKNA 4QX6A 3HDHA 3Q9UA 2TMGA 2GN8A 4RPKA 3OP4A 3ZV3A 2PZMA 4A10A 3RKRA 2NM0A 3OSUA 3WBBA 1PJQA 3P19A 3D3EA 3PDJA 5A05A 4B3JA 2H5LA 2J5RA 1HYEA 3FBTA 1GADO 4WJZA 4EUEA 1DEHA 1PJCA 3FNHA 2AEFA 4XDZA 4YPOA 1ADGA 1HWYA 2OHXA 2W8ZA 4PG7A 4XIJA 5H82A 5T67A 1PEDA 1WMBA 2HRZA 2WE7A 4N5NA 4OQZA 5U9CA 4AJ2A 4XZ3A 1NR7A 2JFGA 5IXYA 1PR9A 4TQGA 3TWOA 2G5CA 4RF5A 4RZHA 5DN9A 1XR3A 3TZKA 3W8FA 5C7LO 1WNTA 1U3TA 5HS6A 3CPSA 1BVUA 3LDHA 4CR6A 4O0LA 1O5IA 4M1QA 1WXDA 2Q1TA 4BB5A 2IZZA 3N58A 4NBWA 2YFQA 2VRBA 4AJJA 4R01A 4ZGWA 4M54A 1IZ9A 3HJAA 4J4BA 3PYLA 2OP0A 3UICA 4RVGA 3ZDFA 3K8ZA 3RFTA 4M86A 2ZTVA 1FDVA 3KLPX 3NDJA 1FDWA 2YDYA 4AJLA 4CM3A 3E5RA 4XYLA 5KTKA 4U6QA 4YAGA 3IJPA 3TNLA 1LX6A 4TKMA 4XX0A 3WDSA 1N1EA 4GVXA 3U62A 5F21A 3WFIA 3QVSA 4YB8A 4DIFA 1DRUA 3WWYA 4D79A 2QRJA 2BHLA 1VSUA 1C0LA 1T1SA 1GCUA 4ZQEA 3QWIA 3C85A 4UVHA 4E21A 4MIOA 2X8LA 5AXBA 1HDXA 2EJWA 1Z73A 3JV7A 4GWKA 2VTEA 4BNYA 4J7UA 4Y6PA 4F45A 2B37A 2FRDA 1YOVA 1DIHA 1Z45A 1H9BA 3DAGA 4A26A 4W9NA 4BNVA 1LBEA 1NFFA 3DZBA 4U6SA 3NJ8A 1H93A 4RVHA 3OMLA 3QVTA 1AXGA 4RF4A 4Z3DA 4OOEA 1N7HA 3LZ6A 4LCJA 2DLDA 2HCTA 3DBRA 1Q7CA 1YQXA 2G1UA 1S7CA 5AQ1A 3MWDB 1RYEA 4LK3A 4RVUA 1B3BA 1EDOA 1O6ZA 3W8DA 1IOLA 2IEBA 2G76A 1LLUA 4R5MA 1NXQA 3GQVA 5JAQA 4I5GA 1UXIA 5BNFA 1E7YA 4TRJA 3AM3A 5JDIA 4CLEA 1D1TA 4EGFA 1H6CA 4J91A 4L4XA 3MJEA 4H15A 1J4AA 4Z9YA 4NI5A 4DC1A 1DIAA 2AE2A 3OF2A 2X4GA 3V1TC 1TA4A 3C24A 3U4IA 5JFOA 5DBIA 4H3VA 5GZ6A 3WQSB 5HRUA 4NR0A 1IPFA 3S2FA 4BUCA 1X7DA 1DSSG 4CV0A 2BGLA 1NPYA 1LDYA 4RQUA 4GH5A 3JQBA 1FF9A 1PJ2A 2HMVA 3IMFA 1C1DB 3BMOB 4AICA 1UUFA 3TF5A 4KTTE 4BO1A 2EXXA 1G0NA 2Q2VA 4PLWA 4U8GA 2AXQA 2AQ8A 3VH3A 1ZK0A 1HE2A 3D64A 3HG7A 3GVIA 4MVJD 3GEMA 4YT4A 1TB4A 3H3FA 1HDRA 4UREA 2AA3A 3GN1A 2ZB8A 4OM8A 4XQEA 1LSOA 4B7UA 1LJ8A 3AI1A 1HZJA 5KJCA 2BKAA 5L4SA 3ZWWA 1OC4A 4KUHA 9LDBA 4KWIA 4L9RA 4W6ZA 1B15A 4NFHA 5JNLA 4BO5A 1KEVA 3PYMA 1NFQA 4KDFA 3MJTA 1HT0A 3OA0A 1Y8QB 2JD2A 2VRCA 4MVJM 4UAGA 5C3MA 3PJGA 4YJFB 1AE1A 1NQAO 2HKIA 3LT0A 1BTOA 4L75A 5JC8A 1NAIA 1IHYA 3H9JA 3QVXA 2IRWA 4EJ6A 4RDHA 4DGSA 1V8BA 2NUAA 4GSLA 2ZKLA 3UN1A 3JYNA 4BKPA 4FDAA 3UH1A 1HSOA 3DZGA 1FK8A 2DT5A 1CJCA 1DC6A 4C4OA 5LDGA 3DHEA 3ONFA 5KJ1A 4RLSA 1UH5A 4UULA 4LGVA 4R51A 4ZQHA 4BNWA 2QG4A 2X23A 3AM4A 3GZNB 1UAYA 1CEQA 1UXHA 2IXAA 4I8XA 4QXMA 1PQWA 2IDZA 2O50A 1I3KA 1UXGA 4UVGA 1DIGA 1N1GA 3ZGYA 3JYOA 1UR5A 2HRBA 3ADOA 3I9JA 1K3TA 1YE3A 4MPDA 1PWZA 5K0ZA 1HXHA 2HUNA 4XYMA 3CSDA 3MJ4A 1P9LA 1WPQA 3OH8A 1HDZA 4AJIA 4R69A 3AY3A 1JDJA 3TFQA 1LQTA 2VRCD 3UCEA 1PX0A 1EQUA 1PGPA 3I9OA 3KXDA 2NV6A 3M2TA 5MDHA 4PZDA 2HQ1A 2JD0A 2P5UA 1C1DA 1KC1A 5A5EA 3BMOA 4FSHA 2JHGA 1NFRA 1UP7A 3FHLA 4L0QA 4A27A 4OSOA 1XA0A 5F1PA 1I2ZA 1PJ4A 2VQ3A 4YCAA 3DAFA 4WECA 4BNKA 1I5RA 5JXWA 2ZB3A 4TZTA 3PI7A 4RVFA 5CFZA 2WD7B 4QT0A 3ANNA 3ASVA 3NT4A 3NRCA 2PZLA 4CMKA 2I76A 5JY1A 4LVUA 4YT2A 1Q2XA 3VPSA 1ZMTA 3I52A 3AJRA 2O3QA 4LRSB 3HDJA 4BNUA 1T4DA 5DP1A 3HUDA 3FF4A 2P9CA 4F46A 3WGQA 1QKIA 2PZJA 1OMOA 4IJWA 3C1OA 4TRRA 3EMKA 1I2CA 1Y8QA 5DP2A 3R0IA 1DLJA 4ESOA 4YJGB 4BNGA 1NVGA 5F5NA 3WBFA 2E6UX 5L3ZA 1UZNA 3P7MA 2VTDA 1QYDA 3LLVA 4XR9A 2NLOA 4PGFA 4BQRA 4CL8A 1YH3A 4GI2A 5CP8A 2OORA 3NTRA 1KS9A 1JQBA 4PCVA 4E3ZA 4CMEC 4HXYA 3LT1A 3VH4A 1H6DA 3AI2A 3ZI0A 5TIIA 5EQDA 5CG1A 4IS2A 2BGMA 4J16A 2QZZA 3K6JA 1W6UA 3RC1A 1GU7A 4IDDA 1VM6A 4K6FA 5TS3A 2XOXA 4JBIA 4HV4A 1A4IA 3FSRA 2R00C 3KOUA 3FPCA 3VZQA 4RLHA 3G79A 2POQX 4KTVE 5T6BA 4J9VA 4NFSA 3WICA 2PD4A 5TC4A 2GERA 1YJQA 2C29D 5G0SA 3T7EA 1CWUA 1QLJA 5TF4A 3H3JA 3QLJA 3BZUA 3INTA 3OJFA 1LQUA 4RL6A 2B69A 2JAPA 3GH3A 5JYEA 1XLTA 4LMRA 5CPBA 5I9NA 1W73A 5JW6A 2HO5A 1IUKA 1GV1A 3MOIA 4I9UA 2OXIA 1XIVA 1LNQA 2DAPA 4DRYA 2VYVA 4S1VA 4Z6KA 4GLOA 1QRRA 1EQ2A 4DBZA 5GZ3A 4OQYA 1P45A 4YT8A 2Z5LA 3UFXA 2D3TA 1JAYA 3Q2KA 3RC9A 1U3UA 1L7EA 2AG5A 1BXGB 2IXBA 3WTBA 1U2GA 3KHUA 2VUTA 1H2HA 4YRDA 4EITA 3CIFA 1IPEA 1NX6A 2PGLA 4RF3A 3O38A 4NBRA 4NPCA 2C2XA 2GYYA 3COSA 4IDEA 3CXRA 2J3KA 3JQAD 4KQXA 3T7CA 3C7AA 3D1LA 4YJDA 3RIHA 5MGBA 1HLPA 3PLNA 5KJFA 4BKRA 3K73O 2D4AA 3PXXA 4FR5A 1JWAB 4OYRA 3E1KA 4XYGA 3CE6A 3LVFO 3QY9A 1WP4A 3VPFA 1SC6A 3WXBA 4MVJG 2ZB7A 5DOVA 4YJGA 5CPFA 5I7EA 3E8XA 3FPLA 4G65A 4IQGA 3ONDA 4HNHA 5JYDA 4YAJA 3VZPA 2C7GA 1VL8A 4CLHA 5K6AA 2J3IA 2UVDA 3OFSA 3PQDA 4RPLA 4EI2A 1BXZA 4IUYA 4J3FA 3TRIA 4YXFA 3DBVO 3HNPA 4CUZA 3K2BA 4ZU3A 1SOVA 3DMTC 4TMFA 1K6IA 2D5CA 3ETEA 4AJEA 2D0IA 4QUKA 3VPGA 5GMOA 2ZB4A 3QW2A 3DONA 2ZYDA 2Y68A 2DPHA 4F3YA 2C5AA 1I0ZA 3VVCA 4CM1A 1DIRA 2CMDA 1CQJA 4E13A 5J23A 4R3NA 3ZW8A 3O9ZA 3L9XA 1FJHA 4GMGA 1LSSA 1PL8A 5IZCA 1GZ6A 3KEOA 3L0DA 3R3SA 1EFKA 1JWBB 1CIVA 2FOIA 1R12A 2XXJA 3O03A 4A0SA 1YL6A 1I2BA 1ZK4A 2G17A 1MX3A 1X7HA 3PIDA 1BSVA 1DJNA 2W90A 4GSKA 3U3XA 5JCXA 3PZBA 4NDNE 4JJGA 2AQIA 1B16A 2NADA 3ZWNA 3DHNA 1EMDA 1Y1PA 3V8BA 2YV1A 2Z95A 4FQ8A 4GX1A 1IL0A 1YGYA 3OQBA 4XQGA 3SJUA 4B7XA 4PLZA 1AHIA 2TMDA 1ZK2A 3DZIA 4TROA 3Q0EA 4PZCA 1QORA 5IDWA 3U4CA 1DPGA 4CMAA 4B7CA 2A94A 3QRWA 3CMCO 4J1TA 1SOWA 3NT2A 4R68A 3OIFA 3RFXA 3QV1A 3JD2A 4RGBA 1BXGA 1DOHA 2CY0A 1MFPA 4I9NA 4XYEA 4BGUA 1I32A 3F47A 1YDWA 1LDMA 1M67A 4CV1A 1A7KA 1ZIDA 3PTZA 2CF5A 5ILGA 1BG6A 2J3HA 3RKUA 3RFVA 4E2ZA 4FFNA 2B4QA 3KYBA 1B14A 4LN1A 3H8VA 1PU2A 1T2CA 1GQYA 3B1FA 4I9HA 3ROKA 3SC6A 2Q99A 3E9QA 3ETGA 4FFPA 4F6CA 5GZ1A 2QYTA 3OEWA 4GAEA 3WIDA 4ND3A 4HY3A 2Q1UA 3ZV4A 3ITDA 4CV2A 3K96A 2PKQO 3JQFA 5LDHA 2PLAA 1M6HA 2X0NA 1CQIA 3ZWVA 3GMDA 3OETA 2B4RO 3GGGA 3W6ZA 4N7RA 1JKJA 3DEYX 3EW7A 4BOYA 1NVMB 1NQTA 1BXKA 1MC5A 1PL7A 2O2SA 3N7UA 4CM5A 3OECA 4NZ9A 3ZWOA 3DXFA 4OL9A 4ZN6A 4XDYA 4M55A 1AXEA 2C07A 4JP3A 1KVQA 3ORFA 2Y1FA 3D4NA 4ROSA 3ZWCA 5A06A 2DUUA 4R5HA 1LSUA 3H7AA 4UEOA 1I24A 4CPDA 1T24A 2VYNA 1VKOA 2EW2A 2WJPA 4TSKA 1G1AA 4IJVA 1MB4A 5JO9A 4Y9DA 4BO9A 3BYZA 1MV8A 2IYOA 3ZHZA 1E92A 1VC2A 2DFDA 3WS7A 2E49A 4PG6A 1KYQA 3FBGA 5F3RA 4E31A 5CDUA 3L4BC 3ANLA 1LDNA 3GRKA 1EFLA 5JMPA 3H9UA 3BHIA 4ZRMA 2RH8A 1EBFA 4DPMA 3WX0A 3L6EA 5JAMA 1E5LA 2H1SA 5G0TA 1PGQA 4J43A 2FWMX 1SB8A 1QG6A 1UP6A 3S2EA 4E0BA 3ZWPA 3UF0A 1O8CA 3D5QA 1V0JA 3JQGB 1P31A 4WEQA 2W2LA 3I9LA 4U0KA 3GPIA 1BRMA 3EK2A 4ALLA 4FCCA 4H16A 4XQCA 4WUVA 3B70A 1KEWA 3JCZA 3LC1O 4BV8A 2JCVA 5L7YA 1PTJA 3DTYA 3GAFA 4DPKA 1DRWA 3JQ7A 2VZ8A 5B4VA 2H9IA 3NKLA 3ZU4A 4HBGA 4XB2A 4NFYA 3RC7A 2VYND 2BD0A 4AJ1A 3SC4A 4YAIA 4IY1A 4J90A 3Q2IA 5I9MA 3TN7A 3NYWA 1ULUA 3BTUA 3ICCA 1X15A 3QHAA 2IEDA 1DDOA 1ENZA 3NTOA 3ROMA 3QVWA 3WJ7A 2IZ1A 4BO0A 4FGWA 5T5QA 3AUAA 1PSDA 2I5PO 4M89A 5ICSA 3C1TA 3DMTA 1G0OA 3RJ9A 3ASUA 5C7OO 4XRGA 3B1JA 2X6TA 5I8WA 1Q0LA 1HTBA 3GDFA 5ITVA 3H5AA 3GR6A 2FHSA 3AI3A 4XYBA 1ZEMA 4RCVA 2CDBA 4W82A 3T4XA 2D59A 1WDMA 5JS6A 2O3JA 2FPPA 2O3TA 1E7SA 3RBZA 3GG2A 4D3SA 2EGGA 1EUCA 5ITWA 4ZA2A 4Z3KA 1PJSA 4D3DA 1WZIA 4BKUA 2GD1O 4FD3A 2A9FA 2BMAA 2FMUA 2W2LD 3IP1A 3WWZA 1PL6A 5ADHA 5FFFA 1CYDA 3AY7A 4KZPA 4S3MA 3KV3O 1JN0A 1OZAA 5FEUA 2NVUB 3IOYA 3GOHA 3GK3A 3WMWA 2GSDA 4OH1A 3ADPA 4CQMD 4R3WA 4O6VA 1GV0A 1UXKA 5U1PA 3LU1A 3HQ4O 3CZMA 1QMGA 4Q39A 2ZYGA 4P4GA 2PTGA 3WGYA 4DLBA 3F4BA 5EPOA 4BNNA 3AU9A 5DCUA 5JO0A 2Y66A 3PJDA 2BFOA 3JTMA 2BELA 4WK6A 2SCUA 3GZ4A 1GQQA 1E1NA 4C7JA 1H94A 3LSYA 4MVJE 1R6DA 3PHIA 3JQ9C 3ZCXA 2FZEA 4AFNA 3IUPA 5THKA 4IGEA 2JJYA 4I5FA 5COQA 3M1LA 1TT7A 3ICPA 5A3VA 5KIAA 5JCJD 3IAHA 3WIEA 1N7GA 5A03A 3ZWAA 4IIUA 2OBNA 3S1LA 1U5CA 4IZHA 4J49A 1LLDA 3RBVA 3C8MA 3PK0A 3PGXA 3JQGA 3PGJA 2QRLA 4HP8A 3WGGA 4B3HA 1LLQA 2WWRA 1H2BA 4MVJA 3NUGA 1E1MA 3GVPA 5HBRA 4R41A 4R9RA 3F46A 4DA9A 4L73A 1PQPA 1VL0A 2EP5A 3H9EO 1WWKA 3TPCA 5JDCA 4A7PA 2JCXA 3MWEB 4CLDA 2YQ5A 1CDOA 3OBBA 3NGXA 3PQFA 4M8SA 3B20A 4MKZA 4Z9XA 4DYDA 5KVSA 1YBAA 3PRJA 4KUGA 1U7HA 3BMCB 1F14A 3AWDA 3T4EA 4A73A 2CD9A 4K9DA 4IDCA 4DQVA 1VJTA 3OQ6A 2C82A 3GNSA 3MZ0A 3VH1A 1BMDA 3QWBA 3MJCA 4BKQA 4CM7A 3WMXA 2OZPA 3A28A 4RVDA 4ZQBA 1QYWA 3OHSX 5DNAA 4IIVA 4IXWA 2Q2QA 4BNFA 1H0KA 1M2WA 3RCBA 1K5HA 1O94A 1H6BA 4FW8A 2BRUA 4YWJA 4Z0PA 2C59A 1R0KA 4BGVA 3TZQA 4DL9A 3BTSA 3HADA 5G2OA 1A72A 5CDYA 1QLHA 4ND4A 2NNLD 2G0TA 4GX5A 4WLEA 4L8VA 5JSFA 3PIIA 2O4UX 1YKFA 2P5YA 4BNIA 4EDFA 4I08A 4W4TA 4MVJH 3D5TA 2NTJA 1QYCA 2JHFA 2NVUA 2X0JA 4B4UA 2FZWA 3GEGA 2GUGA 3CEAA 4FFOA 2OL4A 5ES3A 3L4BA 3KYCB 4CUKA 2X5JO 3DBHA 4AJHA 5DF1A 4JLWA 1E7RA 1JLLA 1PJ3A 1XU7A 1ZK1A 2HMWA 1DFGA 2DFVA 1H9AA 1NPDA 1GPJA 1T2DA 3GC6A 2I66A 3QA9A 2HAEA 3OIGA 4NJMB 4XGIA 1ISJA 2PH5A 4RO0A 1Q7BA 4XEHA 1T2FA 5KKAA 3BMQB 5EQFA 4FOOA 5FWNA 2GNAA 2ZK7A 5ENDA 1DIBA 2NU7A 4LSMA 4PLTA 4UVIA 2Q4BA 2QW8A 1LI4A 3PVZA 1BDBA 1ZXLA 5KCZA 4CR8A 3KSZO 4J7XA 3FD8A 4RPJA 3DQPA 3HFGA 4IDAA 3EVTA 4YYZA 2B36A 2D2IA 3ZHXA 3P2OA 4U7WA 4M49A 1MA0A 4ALJA 3AOEA 3JQAB 4J2OA 3MJVA 4CR7A 1YWGO 5THQA 1JU9A 2EG9A 2Y67A 1ZXBA 1ZKMA 4BHTA 5A04A 3DOCA 3F4LA 5DDIP 5ICMA 3BMCA 4WLVA 4D45A 4XWYA 3RC2A 3LC7O 3ULKA 3PJFA 1I01A 1LEHA 3DWFA 3PWKA 4DREA 2PR2A 1E6UA 3NGLA 3WYEA 5KJ6A 4WLFA 1LRKA 4PLVA 3OA2A 5IAAA 3U49A 1DXYA 3HWRA 4JGBA 2VZ9A 2AG8A 1CETA 4DWVA 4E5MA 1U1IA 3VDRA 1B8PA 1TXGA 3JSAA 4NBTA 3IL2A 1YB1A 3A4VA 4YT5A 2XXBA 1NVTA 3D3WB 1R0SA 1GZ3A 2FP4A 4P8RA 4KQWA 5A9TA 3ONEA 5AYVA 3S2GA 2NTNA 1A9YA 4PG4A 1GQ2A 1XSEA 3I6QA 3S8MA 4KP7A 3GPDG 1IZ0A 4BNLA 1PZHA 2G82A 2PH3A 5CEJA 2V6BA 4E4YA 1SPXA 3GHHA 5BSHA 4Y8VA 4YBZA 1FDSA 1MXFA 4ALIA 4B4WA 1XEAA 1TI7A 4QTZA 4UUOA 4WCFC 4BO4A 4OXNA 5F5LA 5BSEA 5F1OA 3E5MA 4WLUA 4GGOA 3INGA 4MKRA 3WGTA 3QSGA 5I9LA 3PLRA 2GDZA 3KYCA 3KO8A 4WNIA 5H83A 5HS4A 4FOSA 1KY4A 2FPGA 4QFCA 1GFSA 1IB6A 3WQRA 3A1NA 4IQ8A 5T8KC 1AUPA 1P44A 2CVOA 4NJMA 3EVNA 4BNZA 5EJ2A 2D1YA 2VT3A 4ID9A 1B2LA 3LF2A 2YY7A 1N5DA 4NK5A 3BMQA 4GX2A 1P1KA 1PZGA 4BMNA 3QE3A 4DBVO 4NHEA 3LC2O 4TRNA 3LT4A 1O95A 1RKXA 2QRKA 2VCYA 4AJPA 4FC6A 1I3MA 3EYWA 1U2DA 1LDBA 3EAGA 2NACA 4CM8B 2FPIA 5TQVA 3ON5A 4BO8A 1Z74A 3QWAA 3WB9A 2HMTA 3GFGA 1C0IA 1EVJA 2NWQA 3JQAA 1U4OA
chains in the Genus database with same CATH superfamily
1SCJA 1GOTA 2FUEA 1FZTA 5T64A 2I7TA 2V9PA 1L4UA 1P4SA 2GUWA 2IOQA 4RTRA 5HFJA 5KNDA 1SUAA 4MCAA 3KDPA 8ABPA 2GN4A 1GZ7A 4QDUA 2FG5A 1ARZA 3NJ4A 1KOGA 3WE7A 3V00A 2KB0A 5CEJA 4US2R 1F8XA 2B5VA 1ISHA 2VCHA 4M7OA 1NBMD 5ECYA 6GPBA 4JUBA 1S8FA 3SZUA 1IXYA 1UMCB 1V48A 2YC4C 3ROXA 4B3MB 2I2WA 1A27A 3S68A 5EWLB 1UT8A 5ESWA 2CE7A 2F8SA 1ZGHA 3EC1A 1Y6QA 2WJAA 3Q5DA 4DUZB 2ZU0C 3B9RA 1KA9H 2QTNA 3KB1A 3NW9A 4IUCS 4DKJA 2H5JA 3SICE 1U80A 2AF4C 6NULA 4R8RA 1REQB 3KQKA 2WJ6A 3SSMA 2JL1A 4FBGA 1NJSA 3K16A 2WB2A 4OREX 1Z2NX 1DJOA 3IR6A 3OEED 4QJ3A 5C8DA 4DV5B 3D4OA 3VZRA 1T9AA 3OEHD 4G23A 4IYRA 5ETJA 3D8TA 1KZ4A 1WKCA 2FK7A 2I87A 3IILA 1N5LA 2JD1A 4MQLA 1U1FA 4J0DA 4LIPD 2BSXA 3OLCX 1ZINA 4NZYA 4BO6A 5G40A 3W3ZB 3ZWBA 5BNTA 3EOBI 2VEDA 3DQQA 4UZFA 2WIAA 2WTMA 3A9SA 1FRQA 3IRUA 3ISJA 4PTYA 1L5LA 4H7KA 2I99A 1CIPA 2EARA 3NS7A 2SKCA 7ABPA 2EBHX 1A8UA 1R4MB 2YDXA 1XYGA 4HQLA 4BTVA 3VDXA 4CMCA 5F4ZA 1XF1A 2VF2A 2FZGA 1OAOC 2P4QA 3QJ5A 3UANA 4AO7A 5JZVA 3WLQA 5BVHA 1MVOA 1V37A 1Y7TA 2WWIA 4Q9IA 4E12A 2VH2A 1KIFA 3AXSA 3N28A 4A1OA 2F48A 1B4DA 4AROA 1XG5A 3NKVA 3M6VA 3A37A 5FXMA 3H0KA 3ACCA 4H1UA 2J5XA 2EVWX 3RASA 3DZFA 5KNDD 2JKVA 2V7PA 1TZKA 2VEOA 2PLFA 3AH8A 1A9QA 3PYXA 4XM2A 4YMSA 4EB0A 5JSZB 3SLGA 2UVPA 2XZTA 4FYKA 1P33A 4IJ5A 4R9VA 4RIGA 5B4TA 3K31A 3W3AA 4LC1A 3Q3VA 3ROQA 3A9CA 3HYLA 3M83A 3C3YA 1KVUA 2Q2WA 3MN1A 3TLZA 3H6HA 1LBIA 4L15A 1RQXA 4UVEA 4KIGA 3JYLA 1K0FA 4L5IA 3DPUA 4B6PA 1HDCA 1Q15A 4M7PA 1TLLA 5A6SA 1ZIXA 3SC3A 4Q1DA 3SI7A 2PJUA 1P7WA 4H31A 4MJLA 1L5GB 4ZCIA 2QM3A 1XEFA 3RIXA 2J3MA 3VVLA 5LZ4A 2RBEA 1A2KC 2RHRA 4BLPA 3U31A 1LF5A 3EUWA 2HNKA 4M36A 4DQUA 3EDYA 4PZPA 3H65A 1RHKA 4G0XA 2HLHA 4UPEA 1MFZA 2DBYA 1SKQA 4JI6B 5IH7A 1ZRNA 3KT8A 1YJBA 2H07A 3U7IA 2X76A 1FFHA 3OZVA 1DKLA 4GD3Q 1WQ4A 1FP4A 5GIPE 4E5YA 1A5TA 3DM5A 2VJOA 3OM8A 4IP0A 3V2HA 1SKMA 1EFAA 2HHJA 1AN9A 1KH1A 1TD9A 4DVJA 1E8MA 1V8DA 1GUZA 2DTDA 1V39A 2H1LA 2O0LA 3NHPA 3L02A 5IDVA 4HAZA 4K9NA 4D44A 2H5IA 4OFWA 4RW0A 1L5FA 3RLIA 3T5DA 1SXPA 5AMXA 2AOTB 4HN9A 1HR0B 1OXSC 2XNHA 4X3CA 2H92A 2WD8A 5ESDA 2C2GA 1GTZA 2DE0X 1TQ4A 3PB3A 5FT9A 2VT2A 4JSYA 3I42A 4OBXA 3RU7A 2QZ9A 1ORHA 3I5MA 3SIPA 1WULS 1E0JA 3DWEX 4FXOA 4OUDB 4NESA 1YQEA 1A4RA 3Q9LA 1U2SA 1FSGA 4V2UA 5L4NA 1KVRA 2PLNA 1OY1A 2YINC 2ZULA 4MJ7A 2NQ8A 1Y4SA 5CB6A 4RCZA 4GQIA 1SAYA 4WKGA 3UOAB 3PP8A 4NOLA 4XVUA 3GGOA 3PNOA 1T4BA 5TS2A 2F55A 2Z3WA 3KQOA 4ZVUA 4JVLA 4JK3A 5HZMA 5IDYA 2EDAA 3MWLA 1R0BA 3PRKE 1EJBA 1JU3A 1UDWA 4RS4A 1NQ5A 4BNDB 4ZKDA 4RPHA 3X1XA 2HC9A 2VHVA 4J6FA 4D98A 1ZUIA 1SPBS 1IHUA 3RS8A 3TUJC 5BQFA 2BLLA 3VI4B 4D8WA 4MRMB 1X7GA 1ZW1A 4HN4B 3IB6A 2IDMA 1GZ4A 2QK4A 4KK3A 5SZJA 2MJLA 4C3VA 4YAOA 4JIMA 3HB4X 1TUEA 2YIMA 1JIVA 1GGNA 1VE9A 1T1GA 2QX9A 4N47A 2PBRA 4OX9B 3IJEB 1WMDA 4QXQA 3OQ1A 4TTJA 4AK9A 1DBQA 3M1IA 1R6BX 5LA6B 1LK5A 1NJ5A 1NWCA 1SJ9A 3P4YA 4HEJA 2X5OA 4JL5A 1LNZA 5A02A 4BGDA 1EJ6A 3IX7A 4BFLA 1V43A 1IN6A 1JQKA 1N3IA 1PWXA 2N42A 2OAEA 2QN1A 3AEUB 1UODA 4J2TA 4PIPA 5IABA 3NI2A 3MRXA 2A1UA 2C4UA 4DG9A 3KRTA 1M66A 3KAJA 5CA1B 1HNWB 4M53A 3DE5X 3QBVA 4INJA 1Q0HA 3ZIUA 4F56A 5JI3E 2XWSA 3K8OE 3LRTA 5EHGA 4GG1A 4GQAA 4LG1A 5K03A 5SYMA 3IDZA 4BLVA 1VIAA 1EFVB 1YXMA 4MAAA 3BQ9A 4JB8A 5TMEA 4P53A 3GLGA 1Y81A 3V4PB 2G6TA 3GRFA 4D7AA 4MVWA 2QTHA 4WY8A 1RWBA 2ZWOA 3AY6A 3RG8A 3ZK8A 4RJTA 3ZZNA 1QIMA 1YS4A 3GLVA 3GT0A 4JU9A 2OFWA 5TGZA 4WNAA 2P6NA 1XMSA 3HZZA 3N05A 3PPXA 2ZJ1A 4IMIB 4FZ3A 2B3TA 4B3CA 3WGIA 5KYWB 1P7VA 4I5EA 4LJSA 5KQPA 4MGYR 2XZLA 3EQ7A 3HU2A 1VCNA 2GCIA 5DI9A 5L3RA 4NEHB 3DE4X 1JHDA 2HU7A 2XCTB 1M76A 1QK3A 3N74A 1WXFA 3CU5A 1R4NB 3LP6A 4K7JA 3TXYA 4F71A 5AJYA 1BS2A 1H0SA 2YJ4A 4PPQA 5CH8A 1O5TA 3PUKA 3KYDB 3R8XA 1JSZA 1EEHA 2FEAA 4MS4B 4XVQA 2ZYTX 3FVRA 3MTAA 3QUAA 1ZOSA 5BYKA 3LUKA 5JDIC 3HRHA 2VXBA 3WA6A 2RGWA 3OTQA 4PSDA 3V8EA 3FHOA 3U3KA 4D02A 4GLLA 1RCFA 4PC2A 3THWB 3RROA 5EWMA 2Y6VA 4HZIA 3TVTA 5K7SA 3G2PA 2WWYA 1CR6A 2REBA 3QTLA 3TAXA 1EVZA 5E3IA 5DX8A 1IY8A 2PM8A 2PMEA 3NDRA 5A4DA 1CK4A 2OQIA 1UBRS 5FOSA 2MYNA 4URFA 1UDAA 3PV0A 4R8VA 1SQ5A 3E9DA 5YASA 4EHJA 5ALNA 1BW9A 5I8ZA 4GO1A 3WJ2A 1SWVA 3ADCA 4K6GA 4N7JA 2QTGA 3QE4A 2CXQA 4LBZA 3ZHQA 4PYQA 4J2HA 4N6GA 1OPRA 3ISTA 5G0VA 4H60A 1DQRA 2UYYA 2VHCA 5FFNA 2G07A 3CTPA 3TQOA 3AP2A 2A92A 1PK8A 4FYXA 4BASA 2PNFA 3Q7QA 1IJFA 3I9FA 4ZD6A 2PE5A 2O2YA 2NO6A 4M0CA 5H9VA 2ZRLA 3Q15C 1CS0B 4GKJB 2PX6A 4R4JA 1FTYA 2QIPA 2QE7A 1CY2A 1NLYA 3K2EA 1FW8A 1U94A 1V45E 1XXLA 3H3XA 3UMSA 3KSBC 5CT4A 3SSOA 4XR4A 1KFKB 1G20A 3UNXA 1N36B 1E5DA 2Z4TA 2GM5A 3K1AA 4IJKA 2ZWPA 4PZEA 5FD8A 4F2HA 4Z54A 3IR7A 4GUAA 5FV7A 3KBOA 5HUHA 1E7WA 3HA7A 1OBVA 4F1KA 1JR3A 3I9MA 1XU4A 4D8VA 3B13B 2DPLA 3FPKA 2DUWA 3FOZA 5FI5A 3C7CB 3O75A 2OV8A 1XZGA 3A9RA 2Y1EA 1CRPA 4W99A 5DTIA 2V7WA 4NENB 4Y9UA 1IY1A 3DCJA 4WOKA 5HFAA 1VE7A 1ZDMA 1VSVA 3BD6A 3LRPA 1EWTA 1RI2A 3LVRE 2G25A 2DBZA 4AO6A 2C00A 5AVZA 1PFYA 1YB4A 1ZI6A 4WAUA 1X9IA 5LQMA 3P9KA 2ISSD 5FTWA 1Y6GA 2AKEA 3BGDA 3L7OA 1HYGA 2J09A 5GM2A 3N2KA 4WX2B 3AEXA 1PV1A 1RYFA 1T43A 2Z04A 3SXUB 2C61A 4PYIA 3TEFA 3IEIA 1CSEE 4M9SA 4GMDA 5B4UA 4D42A 1W0KD 1ONSA 3P9PA 2DEUA 2UUBB 4XJTA 3ZQ4A 2CCKA 1FTNA 1Y33E 4JT9A 3S5UA 3T54A 1DTWA 3VOTA 3BIWA 3NV9A 3WKEA 2FMFA 5IZ4A 3OESA 2D00A 1ADFA 3PIRA 1TMKA 1Z5NA 2C7VA 2JIQA 2W0SA 2XOKA 3IIMA 1LNSA 4QYWA 3QHQA 4CL3A 1Q3TA 4RDXA 2HT6A 4KYUA 2BUCA 5IAJA 1PJLA 2FGJA 2X0RA 2B7LA 5TEWA 4BS9A 1ZZEA 1ISSA 1I36A 2B0CA 1X13A 2QE7D 2R6JA 1ISMA 2XSZA 4EEZA 5K8VA 1OLOA 4XOUA 2C5EA 3LCCA 3PGKA 3SQXA 4XCQA 3C3AA 1L7NA 3G89A 3E9MA 4HKTA 2H2DA 5KTPA 2K6GA 2FRXA 3EHEA 3HCPA 4OLBA 4XXHA 3M1AA 3G0IA 4AS3A 3IPCA 4CQLB 3GLFA 4D6YA 1XTZA 2XYQA 3K0CC 5CYFA 1JTFA 5FH9A 3UW1A 3CRW1 4Q6WA 4GGMX 1NA5A 3DDZX 4B48A 3HXLA 4ZOLF 1YQDA 4YP7A 1RWPA 4JLBA 3EMVA 4UAVA 3PZRA 1Y9EA 3F71A 1NNEA 1RPNA 2XMPA 2PL3A 1QO0A 1JW9B 4IEFB 2CD7A 2CJWB 3GUHA 3V2GA 3M5DA 4DLLA 4M0DA 4MINA 3MCAA 3O92A 5A9SB 4JNKA 4PO1A 2WHQA 3IP6A 3PRYA 1RQ7A 5K3EA 3ZU2A 2YWJA 1C7RA 1YDMA 2CFSA 4C3OB 1WLYA 5EGNA 2AJ8A 3D0OA 2VJPA 3JD1A 3BF8A 4X41A 4DDWA 3B2EA 4IGKA 2DPGA 4Y67A 1NRJB 1VE3A 3TTUA 3VKGA 4MP3A 3SZ3A 4BNDA 1N2SA 1Y1KE 1JBEA 4CMHA 1JDSA 2W2KB 3H5RA 2H9AA 5HPYB 2V7TA 1E9SA 2CT8A 3CX8A 2CYCA 1FZQA 4XI9A 1FX0B 4ITUA 2ZI7A 1JS1X 2H63A 2ZYAA 4QGHA 5E95A 3KVOA 4H77A 3R3WA 5F51A 1EJ0A 2VKQA 3HBNA 3I23A 1OU4A 3E05A 3GGPA 4C2AA 4E5PA 2NUTA 1EBUA 4IJ6A 3T1OA 5I45A 3Q11A 3L6BA 1UBKS 4R98A 4Z4FA 1CE8B 2N1MA 2PBZA 1MG0A 2FRVA 2XSZD 4L9WA 4MVJP 5EUBA 1C1XB 1CRWG 3S7ZA 3NH9A 4JVMA 3R7BA 2OGTA 2PT6A 4L57A 1L5ZA 1E60A 1UEXC 5FF9A 3L0BA 5A2GA 3HJCA 1G5HA 2QQFA 5KYUB 4DV3B 2Q4TA 3PI6A 2H06A 2P35A 3H8WA 3RS4A 1TC1A 4Q21A 5H16A 1T9BA 3ZCTA 2ZIXB 3QEMB 1Q0UA 1B3RA 3SIXA 4Q4HB 2LIPA 2Z3VA 1V16B 2GETA 4NS1A 4F1JA 4FKMA 3G8DA 3W4JA 1JAHA 1BVYF 1D2AA 2I1WA 2WU3A 2YHBA 5EG5A 4C21A 3NBXX 2MDTA 3C87A 4RTJA 1S7GA 4FGUA 1V1RA 4JXKA 4JBNA 3UKJA 1MC4A 1RM4A 1QO0D 1FQKA 1TZBA 4BX8A 1GLNA 3SEQA 721PA 1C9YA 3OUTA 4YEDA 3V1YA 4S1TA 3DR3A 4TWZA 1ZSVA 2C4WA 2GPYA 2P4EA 2YQ4A 4BEJA 4YECA 5BXQC 1W0JD 2H1WA 3TINA 4C89A 2C88A 3H75A 5AKEA 3M89A 1W5TA 1LBSA 3JZFA 3TO5A 4A0RA 3W5AA 1K92A 3I64A 1I10A 2PRYA 4KWCA 1ICEA 5BW5A 5F12A 4CV3A 5JAIA 4S2UA 4XAQA 5LZ7A 4FQ5A 5BV7A 4BWFB 3A6DA 2Y2UA 3VC3A 1QS0A 2WLTA 2NYAA 4J16C 3LBIA 2AX3A 1D4FA 1SXJB 2WKRA 3QFRA 2PBFA 2FEMA 4XFJA 4EYEA 2AG0A 2O8CB 5B3LA 3WL7A 2Q4DA 2FN9A 4HB4A 1VIYA 3HSYA 3ZXSA 3EMBA 3WC4A 2WQZA 3REOA 2EF1A 2HA4A 1FPQA 1IVNA 3IC5A 3QU5A 2YJNA 2NSHA 2UAGA 3F8WA 3P9NA 4OFXA 4J1QA 5L45A 3U7GA 1E1LA 4J03A 2KLHA 3DTVB 3NTQA 4US1R 5FOQA 2BZGA 4I1UA 1FLDA 1GFIA 1E2HA 2FCAA 1FP6A 3GMIA 2VBGA 3NHYA 4D9NA 5EFOA 4P7BA 2R66A 5IM5A 3A8TA 3GJRA 3V8MA 3SVLA 2VUSA 1KRXA 2WI8A 5ENVA 5FI1B 4YWHA 1HE5A 1JEYB 5CNIA 3GT4A 4PU0A 2IIQA 5SICE 4BOYA 2XBMA 3H6KA 3NHWA 1Z7WA 5ARBA 4NRDA 2B8TA 3PRHA 2PR7A 4RPCA 5KYYB 1NBEA 2WG2A 1TPYA 3H7IA 1E62A 1CY1A 3MMSA 2QBYB 3TB4A 2YJ6A 5IC6A 3S5JA 3HWSA 4JJFA 2M2IA 4J1NA 2WICA 4G5HA 1XC7A 1FUKA 5JANA 3H05A 1L1FA 1NUPA 1OCEA 1MIOA 1MG5A 3PQ7A 5CNJA 4Q48A 3X1YA 1T25A 3KYIB 4UBKA 4C04A 3LLSA 3CV3A 4DPLA 4M8NE 4CG2A 3OE5A 3UUFA 4E46A 3URMA 4F4FA 2SBTA 1EM6A 1OOEA 1MJFA 4KMMA 4C0JA 5FUYA 2J9FB 4LF8B 3R23A 1XZLA 4I55A 2DTEA 2QP4A 1T8YA 2C5FA 4NZZA 3IBTA 1U2EA 3Q72A 3UHJA 3VSCA 1US8A 1XDGA 3A4NA 3N2LA 3P9XA 5EZ5A 4LSGA 4IJUA 4W1SA 1M8JA 1ZI8A 2AOWA 3I1IA 3VJRA 3PHJA 4A91A 5JZOA 3QEBZ 2DUNA 2ZUDA 2QENA 3O95A 4Y6SA 4XE5A 5B1YA 1QF9A 4UDXX 3IT1A 4INZA 3SN6A 1Z6PA 1CZOA 1P0CA 3NYQA 4CBVA 2EKLA 5K99A 3O2QB 3QFHA 1IWOA 4BV9A 3CVYA 2XJ4A 2VJNA 4J4TA 4EABA 2NU9B 2XGMA 3OJEA 1ML3A 3RVSA 1NG9A 4UMEA 5CVJA 4Q3LA 3TDKA 3VR6A 1Q14A 1J7JA 4BXOA 4OCZA 2A88A 3B1YA 2C1XA 1L8LA 4QT4A 2CV0A 3M2PA 1JWLA 1T3LA 3A4TA 4BKOA 1UFVA 5AUPB 1WV0A 1II0A 2DCMA 4TV8A 4EECA 5BVGB 1WZEA 2YYYA 4CMIA 1JQ5A 5J4LA 1S6YA 1RSZA 3Q2OA 4F21A 1UBNA 4JUFA 4ILEA 5LMUB 1ZVMA 3MT0A 4TV9A 5IKXA 4PLHA 1Q1ZA 5A5FA 3E5NA 4DNFA 4DUPA 4XDGA 2O6HA 3EWAA 1E9EA 3AF6A 1J97A 3KTDA 4NU6A 1Q95A 1ADCA 2GCNA 3EGCA 2FEOA 3U0BA 4FS3A 1GNPA 4ZAWA 4MYSA 1U2RA 4UUNA 4NOJA 3DVRX 3RHFA 1P1RA 4CLRA 4G0PA 3W2EA 5B7NA 1JH8A 3HC7A 5DOZA 1SEVA 2LKCA 4PFQA 1YR9A 3AVVA 4JNCA 3HMQA 3I05A 1JHAA 4DV1B 1CR0A 3DCIA 3QYFA 4EJ0A 1J8DA 2ET6A 3BGWA 4QRHA 4EF5A 3TUZC 4IRUB 4C76A 1WZCA 1QVAA 1OZFA 1Z13A 2WSSA 2YWXA 3IQIX 3QVGB 3G1UA 4E11A 1M34B 3VZBA 3L7NA 3WWPA 1QANA 16PKA 1Z75A 1VHTA 2DBQA 2XVYA 3OQIA 1L7OA 4DYVA 2VHXA 3C8UA 4N4AA 1BHO1 3P1JA 1ZHOA 1N0UA 2YOFA 4CQNA 2HWYA 1W75A 4FE7A 4TWJA 3HM2A 2FDCA 3U09A 3OCVA 1FYVA 1E2NA 1YZLA 2C20A 2VF7A 4GM4A 2H2HA 2V1UA 1OI4A 3PD0A 1U3WA 4MI9A 4CHGA 4WXHA 5BSRA 3X3HA 4CJXA 4IJMA 3MGKA 5DTQA 1E77A 3L06A 3PXCX 3EVGA 2L0XA 1CERA 1H0HA 3RRZA 2LNDA 3DL2A 5JNWA 4DV0B 2IODA 4FYJA 3A6HA 4P2GA 1E2GA 3RUIA 2PUGA 1RT9A 1O9BA 3UAZA 1JKFA 1J09A 2FUG6 5A0FA 1FMLA 1EAMA 4KOEC 3BE6A 1DBVO 3U1BA 2WUGA 5FADA 4YUAA 3FMIA 1LK0A 1P9RA 1C9MA 1CUBA 1YDEA 2P2SA 4DHWA 3NT5A 3EHDA 3O1LA 1B0PA 2HRDA 1J07A 1J9GA 4HFRA 2BFMA 2C0CA 1BCRA 3DXYA 3FMOB 4JAVC 1RJFA 3I2KA 2PD6A 1T9KA 3P2JA 4JQYA 4HLUC 1HTWA 1XV5A 2FSSA 5CIQA 5DJ5A 2R1ZA 1UFKA 2Z43A 3KX2A 2R6HA 2B82A 3V3KA 5FBVB 3W34A 1OWNA 3JVUA 5MHTA 3AFNA 3PEEA 2GGSA 1AT1A 2XNDA 5MN6A 2G72A 3AZOA 1M0EA 1G8HA 1Z15A 3AETA 2HK8A 3FDZB 4KWEA 4DLVA 5JS2A 2YWFA 1EE1A 3O7WA 3RI3A 4BE9A 2GLUA 5IJ9A 3P2EA 3P26A 1EM8A 3KAQA 4BQOA 3O26A 4K9RA 1E8NA 2C2BA 2HMYB 4K28A 2W6JA 1DE0A 2YXLA 3VO2A 3E9EA 4DIKA 4W9MC 4FONA 1QQ5A 4Y9SA 4KNYA 4HWKA 2XCSB 2QUIA 5FHRA 3B3AA 3O4IA 5CBPA 1XEXB 3SYKA 1LTQA 3LOPA 3PFKA 2Q2NA 3W5CA 4MW6A 1W4CA 1C1HA 2XMRA 1HQYE 1NC1A 1ES9A 2F3SA 1UT6A 1W49A 2PDAA 4LRQA 3A2LA 4DG8A 1KEEA 4YAKA 1YL5A 1XDWA 2QAIA 4HLNA 3EZNA 1JHRA 3JD4A 4R7GA 3L8GA 2W5UA 5FUBA 4MH0R 1VKHA 5TJHA 4YXWA 2OESA 3G1TA 3GBSA 2XKJE 3C3KA 5EN4A 3C43A 2ZJOA 3KZOA 4IDNA 4OU4A 1Q3KA 1NV9A 4LRTB 4W7HA 3BWYA 3F1LA 1F4LA 4IMPA 2Q7OE 4E5KA 2IEAA 3UXMA 1N9GA 2I7CA 3NIBA 1NUSA 1SG9A 3E8SA 2BGUA 1SQGA 1OTYA 4P4NA 2ZYHA 3NV7A 2Z8YM 3AM1A 1ZONA 3DPSA 4YJHB 3ABZA 3GFRA 4Y9RA 1Y3DE 5KWVA 1M2JA 5GJCA 1OLUB 3QOWA 1SUIA 1TLTA 3NDBB 3DSRA 1NLUA 1EK6A 3V7FA 3DOJA 1MTZA 2RAPA 4RD0A 4NICA 5BT8A 1F12A 2MCFA 1AKRA 3INRA 3PA8A 3P9YA 4LISA 1QRDA 1YZNA 5AIAA 2QL6A 2VXOA 5AVXA 5HIIA 4AKHA 2I65A 2IEGA 1QFJA 2EV9A 4Y0VA 1ISPA 1A1VA 2V9ZA 4PZUA 3TB6A 1U8XX 3FGOA 4HNRA 1VHWA 3IQEA 4RM3A 2QLLA 5H4GA 2OFFA 4L5AA 2W6JD 4CM6A 2WPDA 1ZX1A 3ZCPA 3QKRB 1PRYA 2QN8A 4EI9A 2D1QA 4MP6A 2AH5A 2WJ3A 2GBIA 2H7XA 3G02A 4LJ4A 2OYCA 1GL3A 1SH7A 2DKFA 2ZI6A 5LP1A 1U9ZA 1E4EA 4ND6A 4PRKA 2FKNA 4YHHB 3M5CA 5FA5A 1GJRA 4KNWA 2YC2C 5F76A 2ZR9A 3P4XA 1E3EA 4EW6A 1XCBA 1AK1A 4WE3A 3RU9A 1A50B 3MJFA 4P80A 2C04A 2V0CA 3LDAA 5DO9A 2B5OA 3DKRA 1MO4A 3CKYA 2VOJA 4J7AA 1SZJG 1A7AA 2NZ8A 4D9HA 4F2DA 4UCFA 5AHXA 2EZ9A 3E6AA 5CDGA 1W6RA 1GZDA 3QP9A 5JNVA 2I4TA 3VYSB 3UMBA 1DT3A 1XCGB 2GF2A 4AO8A 2AMJA 4Z4CA 5CK5A 5GY7A 1L1EA 4PQGA 1KYWA 3FVWA 4Q7KA 3R1IA 2WHYA 521PA 2YNMA 4IG9A 1F8FA 3RUCA 1RADA 4YDQA 2H5EA 4RD2A 4E2YA 4MHSA 4OMDA 2VYVD 2RK4A 1X86B 1WSDA 5EJ7A 1VCMA 4H0FA 3TJRA 4Z4EA 3ZE6A 3CW2A 1D5CA 4FJ0A 1BROA 1JT2A 5U4XA 1QF6A 4JKYA 2WM3A 2CNBA 3AIMA 1P72A 2R2GA 1NX9A 2EKDA 2IHYA 4XDHA 5ALQA 3BH6A 5DGCA 2QB5A 3IP3A 2I03A 3V1KA 3W7AA 4EUSA 1HG0A 2B99A 3Q85A 2OBMA 5BV8A 1LA2A 3R6LA 3T06B 4BLRA 4ZHQF 2HYIC 5D6OA 3CH4B 1BA3A 1V3TA 3CRNA 3ETCA 3QYAA 2WPDD 3KDSE 2GRUA 3LHFA 3ZNOA 1ZCBA 1MORA 1RI1A 1Y1RA 3D2CA 1RPTA 3UTDA 3FZQA 3WK7A 2VHEA 4GXQA 2A5JA 1V26A 1P19A 1L4MA 3E3OA 2O3UA 3K9LA 1MDFA 1HDGO 1Y1QA 2RONA 3PHGA 1S3FA 4MVXA 4PLGA 4R1PA 3W1EA 4ZJPA 1D9XA 2IK8A 2PBLA 1SCBA 2JI6A 3GH1A 1QHGA 4TGLA 5E4YA 4ZDIA 1ZFNA 4IJQA 4WCFA 1HF3A 5LC1A 4AUEA 1JI3A 1D1SA 2Q49A 3NHAA 1D5WA 4FBMA 4GFDA 1RZRA 1L5NA 4G8CA 5GINE 1ISIA 2BFDB 3WR5A 4Q1AA 4B3DA 3ZHTA 2ZR8A 3R75A 3AKZA 5GQSA 1MO5A 1NSTA 1XWIA 3E18A 4LOKA 3Q7EA 4KGZA 1P9OA 3Q3EA 4BUZA 1KDRA 2JG3A 1E32A 1I30A 5F1KA 1EX9A 3G2QA 3UY4A 3LX4A 3F3SA 5DEOA 3HJUA 1TW3A 3GDWA 3M82A 2YNMD 3N2IA 1I8TA 2X22A 4DMHA 1P2FA 4E22A 5KOHB 3PC8A 4LJ7A 3RDPA 1V4BA 3QFSA 3HE3A 4M1EA 2IS2A 3U3RA 5LMCA 3HM9A 3VVMA 4I1IA 2PRKA 3B8EA 3DE3X 3QKWA 2MYPA 4H6WA 5A1TA 4IVQA 1PJTA 4XGKA 1DVRA 1I5EA 3GJ6A 4JX8A 5KNLA 5CLJA 1HE1C 2EBFX 1VI6A 3FNGA 2GN1A 2PUAA 1ML4A 1N8TA 3A1SA 2IZ6A 4TTTS 3WVNA 1COWD 1NM5A 2QQEA 5B3JC 1WQ1R 5ERYA 2QN7A 1FTSA 2WVGA 3PFBA 4JLJA 4AJKA 3MAGA 2FMIA 5D00A 1TT5A 1TM3E 1WHSA 3OHMA 4C6SA 1KJNA 3ST7A 2F00A 3OQVA 3AB3A 3THYB 2EIXA 3GXOA 2ZUSA 1OLXA 2Z30A 3G0OA 1I7QB 5TY0A 2L69A 4X90A 1GU0A 3DBLB 4PNPA 5FYQA 4ED9A 4C88A 1BKSB 3GRCA 1I33A 1CP3A 3JARA 2AJLI 4E09A 2F1IA 3C0KA 4JJIA 4HDCA 4KOAA 2RHCA 4P2BA 4U2CA 2R751 4YO8A 2DOKA 4UTVA 1N77A 1TQDA 1C5KA 4OB7A 1WKVA 3L8CA 4YGYA 3SMVA 1ONPA 3JD3A 4ESOA 3PEVA 3OCJA 4GC9A 3TCKA 1ZJYA 2NO9A 4HYTA 1D09A 5H7XA 1LY1A 2YVLA 5BMVA 2XI4A 1YBHA 3DJYA 4H0CA 4CLXA 4DLNA 3GQBA 2W6MA 1LS6A 3IUSA 3AG5A 4TL9A 5HIMA 3RS9A 3X2EA 1G3MA 1ADJA 1UAAA 3DVAB 5CB4A 3KV1A 3GDHA 4BV3A 5DM0A 1Q7RA 3VHQA 1PIWA 3VJKA 2IV2X 4ER0A 1GO2A 5T4HA 1BDMA 4RE6A 2HSDA 1QKKA 1QIJA 3RVNA 4BZPA 1H5QA 4UTNA 2VJMA 1UBJS 1ACJA 1RTKA 5FPHA 3TTWA 4CF5A 4OSEA 2AJBA 1A2QA 2XAAA 3HR8A 2AXPA 2R8RA 1VB5A 2HLPA 3MS7A 3A6ZA 3JQBC 4M0KA 3UJBA 1U9IA 2ECKA 1T36A 2HDHA 1ZH8A 4URHA 3ZQKA 3FCSB 2CWWA 1JIXA 1UJ4A 2AZMA 3V4VB 4LJRA 4FFVA 3DBIA 2BR4A 2F8LA 3PPWA 1KI9A 1RDFA 1TO2E 4QYTA 4TLBA 5FO0A 1OAOA 2YCBA 4Y6RA 3Q8WA 4RANA 2A9PA 3I0MA 3R9WA 1Y6JA 4MRSA 4AKSA 3T5TA 4F4JA 3V4LA 1SEPA 4J7CA 1G66A 2O8VA 5JEEA 4OPMA 1K8ZB 1QZZA 3C8ZA 3PTLA 1O54A 1VL6A 4LKRA 1PDVA 1L4YA 5E6SA 5ALZA 3PKIA 4TLAA 3RUPA 1C80A 2ZSDA 4MYRA 1CJBA 4XCXA 3W04A 1O3YA 4Q12A 4R40A 5B1IA 5AXCA 3EDOA 2JJ2A 4BNMA 3IXLA 3IAM1 1N2CE 5E6RB 3AHGA 4H3HB 2E4YA 3PNVA 3SKXA 5EERA 2HMUA 3D0RA 5B30A 3ED1A 4FB5A 3LHIA 2E5WA 2IYNA 2Q5EA 1QRAA 2PT7A 3INNA 1Y7IA 1YAHA 2PKRA 3WQQA 4B74A 5MN4A 2GAAA 4EG7A 1D03A 3AR3A 3LDFA 3QNMA 2WT4A 3OFND 4W1QA 4RVSA 2NUPA 2REQA 2HIAA 3BL6A 4ZP1A 1B8OA 3FGZA 3KG2A 1FDTA 1VHQA 3TTXA 4LWZA 4RZXA 3TX6A 3GLHE 4EMTA 3LXUX 1E2KA 1TJYA 4E32A 3F6SA 3EIQA 5LXTA 1VG9B 3G6KA 3RFUA 3JZMA 2ZTHA 3DR5A 2VXCA 3THRA 4DW8A 3D7MA 2WJWA 2ZFUA 4DSTA 2EJBA 2J45A 4Y6GB 3CN9A 1D8AA 1PBTA 5TGDA 2XGJA 5BR7A 1AGPA 1Z47A 2PZKA 4XM0A 1YRHA 1JHVA 3KPVA 3WL3A 4LXYA 1TNDA 4ZO9A 4HAVA 5TX7A 4P54A 1GSIA 4FKBA 4X54A 3GAZA 2OXCA 4FMDB 3WRVA 5EGSA 1SWWA 1QK5A 1NPTO 1U2QA 3ZHRA 3Q9UA 3E3MA 4QQKA 1GNVA 2D74A 2GN8A 1DX4A 3OP4A 3ZV3A 3M6AA 2H52A 2C9BA 2GTHA 1XNGA 4B3JA 4OJMX 5CT9A 4PEVA 1HYEA 1NDHA 2G8NA 1GPH1 1FRZA 3O4FA 1IRXA 1PJCA 2AEEA 4ZOQI 5HKBA 3FNHA 1ZD8A 3NYRA 2A14A 3R5JA 4ZAGA 2OHXA 2JCBA 5M34A 1D2RA 4WZAA 1XZAA 4JKIA 3G5UA 5T67A 1WU7A 1JEQA 1WMBA 2HRZA 2AZXA 3R77A 4OQZA 5CA0A 2NTEA 3ZBUA 3ZY4A 5A4KA 5U9CA 4HGNA 4PO8A 2JFGA 2I0FA 4JLAA 1XPRA 1BO6A 4ZEMA 2BL4A 3TZKA 5DN9A 1AKMA 1XR3A 3KCQA 3W8FA 2PQ2A 1PWYE 1WNTA 2ZRAA 5IHXA 4FR2A 3ANYB 3ESRA 3EZ6A 3LO5A 3WFZA 5SY9A 2IYQA 2VDKB 1FP7A 3PTAA 1OH6A 4GR9A 3UUGA 3L1UA 1O5IA 1MOQA 1M2VB 2FPXA 3PUJA 1DP4A 1LBQA 1E1QD 2HEIA 4GYKA 4LHYA 4AJJA 4GXTA 4EY7A 4ZGWA 1ZD2P 1IZ9A 1PT7A 3UICA 4LQDA 2IPLA 2PYDA 3QXSA 4Y1EA 3Q3JB 5TB5A 1YACA 3OY7A 3JAKB 1PVOA 4WY5A 3KBBA 1AMUA 3DVSX 1R0ZA 4JVOA 3IJPA 2X0DA 1BE1A 1LX6A 4TKMA 2O8EA 3WFIA 3QVSA 4LY9A 3IESA 1XVLA 4D79A 1LCIA 1B6RA 1USGA 1VSUA 2XB6A 3O91A 1T1SA 3U7QB 3HKEA 3V8VA 1IRIA 2WWWA 1G7CA 3VDMA 1E9AA 4UVHA 2OYRA 4FS8A 2X8LA 1EXNA 5DYIA 5DM4A 3UT6A 4Y0NA 3RVOA 3FTFA 4Z9BA 4TWIA 3FROA 1VRVA 4RK5A 3E84A 4LYAA 5CB0A 2MSEB 4JD5A 3U6KA 4QM7A 2B37A 1WBDA 2NUAB 4PRZA 5ELMA 4E5UA 2OLEA 2O8BB 1DIHA 1JZSA 2PPVA 4BNVA 1I1NA 1KYZA 1S02A 1TU0A 3D2AA 3AEYA 4TYWA 1NXTA 2I6SA 4U8HA 3OMLA 1LPNA 4W5JA 1YVPA 4O4LF 4OOEA 2Q3JA 5HVNA 3E4CA 3LZ6A 5GAJA 3KOYA 2I55A 3WWDA 2MR5A 1YQXA 2XYHA 1O95C 5CXXA 1GDTA 3QOXA 3A6GA 3QELB 4RMIA 4RVUA 3EGWA 1O6ZA 2IEBA 1L3CA 3G8AA 2ARKA 1LLUA 2XKBA 5FBHA 4H1VA 2ZJYA 3GQVA 5AW2A 5BR4A 3LH5A 1GGHA 5JDIA 2PX8A 1GZVA 4U02A 4F5EA 2WHPA 5CXUA 5B57C 1J8YF 1QJ4A 2P7HA 4CLEA 2UYOA 4EGFA 2CB9A 5J4YA 4PAGA 4ZAXA 1CYEA 5EIWA 1E1CB 1VZ3A 3NEYA 1PSWA 4M9RA 2LE0A 1QGOA 4QUDA 4DC1A 2OVBA 2AE2A 3FOEC 4REMA 3WK5A 2C5SA 3MRVA 2QN9A 1NE7A 3C24A 1PEKE 1UPFA 2FW8A 3LIIA 3U4IA 3D43A 4NZPA 2HCBA 1I13A 1QZUA 4H3VA 3OZXA 5TV2A 3RS7A 3PDIA 1JG2A 1BWRA 3D6HA 4BFUA 4BX2A 3IKMB 3KPUA 3KXLA 3GJSA 3O8CA 1PNRA 1IPFA 3RJMA 3S2FA 5K6TA 4PBSA 1XZNA 1E2MA 2PO7A 4WJKB 4PV7A 1DSSG 5F7ZA 4ECEA 1YC5A 4LOHA 1P2GA 4CKCA 1TTQB 3K9NA 1FFXB 1LDYA 4LJKA 2QTCA 5IKEA 4GH5A 2ZJ3A 1OH7A 1MO2A 1TFRA 1KU0A 3PITA 2JGDA 3QVJA 2IYWA 4EX7A 2GMWA 2O5CA 4ENWA 5IW8A 2OHGA 5H80A 4XGRA 1OXMA 2EXXA 4Y2QA 1RLOA 5K8CA 2RKBA 1ULAA 4R8KA 2AXQA 4U4AA 5EHNA 2PX3A 3UHPA 3AVYA 4V3BA 4DLTA 2QEQA 4ID3A 1BE6A 1ZK0A 1HNXB 3D64A 1HT3A 1NIJA 1VPVA 1YZHA 1ZD4A 2ZJ6A 3GVIA 3HBLA 4G85A 4RZ3A 3ROFA 1RPZA 1J00A 3H3FA 4KFRA 4CEHB 5EJGA 2AA3A 1NQXA 2F62A 1MO6A 3PGMA 2RGGA 1E59A 2IIVA 3HU5A 4K86A 3WDLA 5KX5B 1OASA 2OV4A 1ZVJA 4HWOA 3CLRC 3EGDB 4MICA 2NV0A 1I2DA 1Z5GA 3FPFA 4KWIA 5IMSA 4QC2A 2GM9A 1P4RA 4FGZA 1GNTA 1B15A 2FLVA 4NFHA 3GWZA 1OBOA 2BDEA 4RU1A 4MYTA 3A3KA 1USKA 1KEVA 3DCNA 3PYMA 2XNCA 1KQNA 1NFQA 1V1MA 1GRRA 2VJQA 4LA4A 3J7TA 1OXVA 5B55A 2JD2A 5IYZF 3WA7A 2Y9PB 4MWTA 2VRCA 1IATA 4GOLD 5INTA 3PJGA 4MRRA 4AZ3A 4LVNA 5CDHA 5PGMA 3T1HB 4YJFB 3PENA 3EEQA 4CTKA 1DG9A 1NQAO 1NTRA 2XMZA 2WPNA 3DYVA 1MF7A 3LT0A 4QDOA 4OMFG 1BTOA 4GYYA 3O83A 3AUXA 3V55A 2GEBA 1YZQA 2JIZD 1NAIA 5G02A 3RYTC 3H9JA 4A23A 1CW2B 1D0IA 3QVXA 4MEBA 2IRWA 4RMJA 2ANBA 2QOEA 1LWNA 2QRUA 4DGSA 1JPJA 3B7WA 4EYOA 4GSLA 1CB7A 1P0MA 3KKEA 1FYXA 2WU1A 4HQ6A 3Q8LA 1DS6A 3HZOA 3JYNA 4MS1B 4BKPA 3F3MA 4JYAB 4NV0A 3BE4A 2YIVX 5HQTA 1FK8A 1RRFA 1DC6A 3A2MA 4B4DA 5LDGA 5HR5A 1IM8A 1M1YB 3DHEA 3BXOA 3ONFA 5C8YA 5H9WA 1RWNA 4QPNA 3KQYA 4MJXA 3RT7A 4BNWA 3ZG6A 2X23A 3AM4A 2AG1A 3O4HA 3MWDA 2PGOA 1ZWLA 3I2JA 1CEQA 1UXHA 3K0BA 4BVLA 2XEDA 2BUBA 3E15A 3G5AA 4D57A 2ZVDA 1MTOA 3K0CA 3RK1A 2XHEA 3IDFA 4UVGA 4BC0A 2FA9A 2NXJA 1N1GA 4K6HA 1NYLA 2IGTA 1UR5A 2HRBA 1UWCA 3I9JA 2D1FA 3KFXA 3RF6A 1C8LA 5LA6F 1J70A 4B09A 4L0MA 4IEIA 3PBKA 1A8SA 4CF4A 1BFUA 1HDZA 1V5FA 3C97A 4BJHB 4IV5A 4ZCMA 1RWXA 1SCDA 5AJWA 1WRBA 5CA1F 1LQTA 1HMYA 4FCVA 2VRCD 1CPYA 4RXMA 3UCEA 3W6OA 1PX0A 3WSTA 1MOPA 5HJ7A 3LFHA 5G1OA 1N5MA 4XB6B 1DJMA 5BYJA 1C8KA 4G1FA 4WA8A 3IAAA 1Y6ZA 3M2TA 4B75A 3F7OA 5ILQA 3F67A 3IO3A 2P5UA 2JI7A 2QUBA 4GOOD