3HS3A

Crystal structure of periplasmic binding ribose operon repressor protein from lactobacillus acidophilus
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
264
structure length
264
Chain Sequence
b'KKSKMIGIIIPDLNNRFYAQIIDGIQEVIQKEGYTALISFSTNSDVKKYQNAIINFENNNVDGIITSAFTIPPNFHLNTPLVMYDSANINDDIVRIVSNNTKGGKESIKLLSKKIEKVLIQHWPLSLPTIRERIEAMTAEASKLKIDYLLEETPENNPYISAQSALNKSNQFDAIITVNDLYAAEIIKEAKRRNLKIPDDFQLVGYDNNILCGYTSPTISTIDQNPKLIGQTAAHRLLDLMSGNNSTRNSIIDVLPIKRDSTEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose operon repressor
publication title Crystal structure of periplasmic binding ribose operon repressor protein from Lactobacillus acidophilus
rcsb
source organism Lactobacillus acidophilus
molecule tags Transcription regulator
total genus 99
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hs3A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hs3A01
2F8TA 4Y9TA 4YGXB 3C3MA 3CG4A 1JDPA 4RY0A 4HNRA 4HYEA 3GRCA 1A0OA 2NT4A 3MA0A 1QQBA 3OLZA 5EWMB 4ZYLA 3HM9A 2PUAA 3T95A 2IPAB 3FGZA 4OLAA 1SXIA 4LDZA 1QMPA 5IX8A 4NV3A 4G86A 2A9QA 4UHJA 1E6KA 4TN5A 2OENG 3CFYA 1EHCA 3RVSA 3I42A 3OLXA 1D1QA 4PEVA 3GBVA 5BQ3A 4KK4A 1P6UA 3M9XA 3OLYA 3QX8A 2MSWA 1U2PA 3C3KA 4RS3A 2PL1A 5FWYA 3G85A 4RXUA 1YTUA 2B1JA 2WY2D 3VNAA 3OMXA 1YVUA 3Q7TA 4Q6WA 4IILA 1P2FA 3JS5A 3E61A 1U0SY 3BRSA 1XHEA 3F6PA 2L19A 3GT7A 7ABPA 5EWMA 1F51E 5B3JC 4W5OA 3OO1A 2X7XA 1W9HA 1D5WA 2FQWA 2JRLA 2FKAA 3FMVA 4Q7EA 2GX6A 3GBPA 2PUEA 4G97A 4RK4A 4KPYA 2R48A 3EQ2A 4F11A 1DJMA 2E4UA 4RWEA 1CHNA 3HO1A 2PJUA 4KFCA 2QXYA 4MS4B 3TMYA 2CHEA 3FFWA 3H1FA 5IUNC 4UHKA 1VLZA 3GL9A 1DRKA 5C5CA 3LTEA 3QLTA 3URMA 1S8NA 3HJFA 2B4AA 3Q15C 4YR7A 2A9RA 5DTEA 3F7NA 5TQ2B 5JNWA 3UK0A 3W9SA 5DGCA 2H3HA 1Z13A 2FMFA 4KK3A 2FMHA 1ZITA 4ZMRA 1CYEA 3LUKA 3QX9A 1JYEA 2KYRA 3C3WA 4EY3A 1SRRA 2LUOA 5CNIA 3Q41A 1C4WA 1P6QA 3DZDA 5HM6A 5KC8A 1JFSA 1JYFA 2LP4Y 1ABEA 2WB4A 1JF8A 3K9CA 2R4QA 2F8SA 1DBQA 3N8IA 3KLNA 1YK0A 5BRJA 4Z4CA 3N0WA 5IBQA 3C6QA 4D6YA 4IF4A 3LUAA 1BA2A 3H5WA 5GOTA 4MS3B 1QO0A 1C0EA 3CZCA 1APBA 4Z99A 5TQ2A 5HKOA 1TJYA 3BBLA 3QEKA 1E6LA 5CHYA 3H1GA 3OMWA 2N9UA 2PL9A 2FVYA 1DCKA 3BREA 3C97A 4M88A 4F06A 4EVRA 1DCMA 1RZRA 2PUFA 1NATA 1T34A 2HPHA 4H3KB 5BRAA 1RXIA 4NCBA 1JBEA 3DLHA 2LBPA 5IC5A 4D74A 4N47A 1LBIA 3P9YA 4Z4GA 3T6KA 4DQDA 3H6GA 3DGFC 4ZMSA 3RH0A 1JFVA 3R0JA 2FSPA 4LRQA 4WZZA 3OLVA 2JBAB 1EWVA 3KSMA 3OLWA 4HNQA 4F12A 4MS3A 1JWLA 2HSGA 2PUCA 5CNMA 3HK2A 1CEYA 1A2OA 3BILA 1MB0A 4KQCA 5JS1A 2ZWMA 1TM2A 3LMKA 3QLUA 2FLWA 3H75A 1ISRA 4OTZA 4RU1A 3RVNA 1U8TA 4LE0A 4FB4A 1M5TA 4EUKA 4KMRA 1U2QA 3H5IA 4Z4EA 1QKKA 1Z18A 4MGEA 3IPAA 2NZUG 1RPJA 3FFXA 3M9WA 2A9OA 5IUJC 4XFKA 4G0ZA 2IDMA 4ZPJA 4W5TA 1FSPA 3L49A 3NNDA 4G0MA 3RQIA 3TD9A 3A0UA 3SM9A 3H5TA 2JBAA 4RKRA 5TPZA 2XDYA 2MSLA 1QPZA 1BDJA 1Z17A 2GKGA 3KS9A 2L18A 3MM4A 2PMCA 2QR3A 3CNBA 4RK5A 3GYBA 2MYPA 3D02A 3I45A 1RXEA 1GCAA 5TQJA 4ETIA 2R47A 4YP9A 1GLGA 4Z9BA 3NBMA 4RY9A 3GA5A 4P98A 2VK2A 4LX8A 4MAAA 4WXEA 9ABPA 3HCWA 1BVHA 3LOPA 5FWYB 2WJAA 4QPJC 3CKMA 1ZGZA 5PNTA 1YS7A 3HZHA 4WXMA 3CS3A 2L2QA 1D1PA 3EDCA 3KJXA 4HNSA 3JPWA 3IP7A 3HUTA 1YS6A 4KRFA 4B09A 3CRNA 4YS6A 1DP4A 1GCGA 3N53A 3I5AA 2R25B 3Q7SA 4RK1A 4OBBA 2LIVA 2JB9A 1TVMA 4JP1A 4KNYA 3A10A 4XLTA 2PAFA 1K68A 5KC9A 3CU5A 2NT3A 1ZESA 5BR1A 5KI6A 1NXXA 3NHZA 4PICA 4G0QA 2ID9A 3HXMA 2FMIA 3H5LA 4JB2A 3T8YA 1VPWA 4XARA 1D4ZA 4N03A 3EQZA 2QVGA 3HV2A 3S99A 3E3MA 4EYQA 3QEMB 5FBHA 2JVIA 4ETNA 1EAYA 3O1JC 4Z4IA 4MYRA 2RGYA 3RVOA 3EJWA 3LUJA 4Z0NA 1H9CA 1XWWA 1E6MA 3LUDA 4JAVC 3LUGA 2WWVD 1DCFA 1D2AA 5CNKA 1KRWA 1JHZA 2WRZA 3RVPA 3RVJA 1Z26A 2QSJA 4MLCA 4GPAA 4Z4HA 1AB5A 4JOQA 3EGCA 5TPWB 3H5OA 1M2FA 3SAJA 2L17A 4PE5B 1M2EA 4MR9B 3H6HA 1FFWA 2W42A 4L85A 2J48A 1XHFA 2CHFA 3HS3A 1MVOA 4E7PA 3NNNA 3QEMA 1NXWA 3LKBA 5KQPA 4YV7A 4S04A 2ZAYA 2O20A 1LBHA 1EWTA 4MQEB 1QNLA 2FN9A 3O2JA 5CNJA 5EWLB 1UDRA 3BRQA 2PKXA 5F64A 6ABPA 3MIZA 2OQRA 3JVDA 4KREA 3QLVC 2CWDA 3CZ5A 2MYTA 4RZSA 4CBVA 3O2SB 1SXHA 4LE1A 2FXIA 1ZY2A 1AB6A 1FQWA 5GQSA 5TPWA 1FFGA 5IEBA 4O1IA 3VNBA 4WWHA 2VUIB 3ROTA 1ZH2A 4MR9A 4WUTA 2E4WA 3HDGA 4NCAA 1K66A 4PYRA 3F6CA 2FMKA 2IYNA 5JNVA 2IKSA 2PUDA 2P9HA 4IGAA 3SG0A 4MQEA 1YIOA 3RVRA 1ZAYA 2IPMA 5EWLA 3JVIA 4KV7A 3EULA 4MR7A 3ILYA 3ILHA 2QU7A 5KQGA 3TB6A 1SXGA 3KTOA 3DGEC 3MQ4A 2FW0A 3CTPA 1BDIA 2IOYA 2WMYA 1Y1LA 2RJNA 1JLKA 3Q7RA 4MS1B 3HDVA 2HQOA 1QP7A 4W5NA 3OO0A 4JA2A 4EVSA 5FWXB 3O1HB 1B00A 1ZDMA 1I3CA 3G1WA 4RK7A 3EODA 3KLOA 3N0RA 5KQLA 2TMYA 3QELB 1L5ZA 2MYUA 1WETA 3KG2A 4LZLA 4L4UA 3LUHA 2QV0A 1LK0A 1URPA 3CHYA 1DBWA 3RVLA 2FTKE 2VYCA 1F4VA 2A9PA 4RSMA 1BAPA 4RXTA 4G0OA 4TLMB 4OG2A 5DCLA 5TQ0B 4EYOA 4QYWA 3TO5A 3RVKA 3IDOA 1M5UA 2GBPA 1KMIY 2JK1A 4H3HB 4ML3A 4MRMA 4N0QA 5ABPA 3HVRA 2FLKA 2FEPA 3KKEA 2NUBA 1W25A 3EAFA 3MF4A 4MPTA 2VUHB 2MYNA 4RDCA 1USIA 1YK1A 4MS1A 1VRVA 2FEWB 3A0RB 3MYYA 3OQMA 4Z4FA 5FWXA 3K4HA 1P8AA 3GWGA 1DRJA 1EWKA 4IRXA 3QELA 4RV5A 1ZVVA 1JX6A 3HSYA 1HEYA 4F8JA 3IP6A 1NTRA 2IPNA 4W5RA 5TQ0A 1DG9A 1DZ3A 1PUXA 2PUGA 3SNKA 5TE9A 1Z25A 4QICA 5TPZD 2HQBA 5KWSA 3OM1A 4W5QA 2PUBA 4RK0A 8ABPA 2FEKA 5B3JA 1ZHHA 3KYIB 4TLLB 3RVQA 4GNRA 3HEBA 6CHYA 2MSKA 3H5VA 1ZGGA 2HQRA 1NXTA 1DC8A 4O5AA 4OATA 1NXPA 4RK6A 2QW1A 3O21A 3IP5A 4WT7A 3CG0A 3GV0A 2AYZA 1RNLA 4EVQA 4YO7A 1USKA 2I6FA 5DLEA 1PHRA 1NY5A 1QQAA 1NXOA 3OM0A 2P4UA 4N0PA 4XASA 4NQRA 1PEAA 2E4VA 2AYXA 1MIHA 1Z15A 4JASB 1LJUA 1GUDA 4RY8A 4TMYA 3SY8A 3B2NA 3TX6A 3KYJB 1Z12A 2M98A 3D8UA 4G0XA 3JTEA 4DADA 5IUKC 5T3YA 3O74A 1TLFA 5JNSA 1BDHA 1TMYA 5KQMA 3N6VA 5JS2A 4YRZA 4D6XA 2FQYA 4LE2A 2QVCA 3O2QB 3FFTA 3QK7A 3KHTA 4QYMA 3F73A 1KGSA 3UUGA 3L6UA 4DN6A 4RKQA 4P1ZA 1R8JA 1PNRA 2IPLA 4XAQA 3IPCA 1MAVA 2E4YA 1Z2EA 1QP4A 1PEYA 1KRXA 1YMUA 2E4ZA 4OLBA 4MR7B 2BGGA 1DBPA 3JY6A 3O1IC 5HQJA 4KVFA 3SQNA 2JVJA 4EGSA 4ZJPA 5C5EA 1YMVA 1ABFA 3H1EA 2NZVG 3LKVA 4MS4A 3UKJA 4MR8B 1JFTA 2QZJA 1PNTA 1E2BA 1A04A 4MQFB 1EFAA 5JNRA 1OXKB 3QLVA 5DKFA 3Q9SA 4N76A 4F3TA 1U04A 2E4XA 3NNSA 3N75A 1USGA 2LPMA 1MB3A 1ZH4A 3MMNA 4RXMA 4XXHA 2YHBA 5IULC 4IMIB 2PLNA 3RVMA 5T7BA 4E7OA 2V0NA 4YLEA 1IIBA 2FQXA 2H0AA 4Z9AA 1LJLA 4FE7A 1QP0A 5JNTA 2JCGA 1GUBA 2YHAA 2FN8A 3OQOA 3I09A 1QO0D 5EWJB 4MRMB 4S05A 4Q6BA 4IMJB 3T38A 1OXBB 4MR8A 1FFSA 4MLDA 3HUUA 3LUFA 4YWHA 4MQFA 4ETMA 4G0YA 2M1ZA 3OQNA 2HJ9A 3DLBA 3FDFA 5JNUA 1RZRD 2GI4A 2DRIA 5E3JA 3JPYA 1Z2DA 1J56A 3LFTA 3QLUC 3NHMA 4G0PA 1Z16A 3M6MD 1VKRA 1JH9A 1ISSA 3KCNA 3LUCA 4KQ9A 4N41A 3A3KA 2JVKA 3DBIA 3IP9A 3CLKA 4FE4A 1JDNA 3ROFA 4KZKA 2RJOA 1DC7A 4NICA 4EYKA 5HSGA 4EYGA 5I4CA 5EWJA 2PE5A 1JL3A 5IEJA 3O75A 1NXSA 1ZN2A 2GWRA 4H60A 2ID7A 1SD5A 2CD7A 4YCSA 4JB0A 1NXVA 4LDAA 5FBKA 1L5YA 2Q5CA 5D2CA 4O1HA 5ED4A 2WJWA 2RDMA 3N0XA 4PZ0A
chains in the Genus database with same CATH superfamily
1YQGA 2Z2XA 3B48A 3T7DA 3C3MA 2ET6A 3WGQA 1WXDA 1Q1AA 2GSWA 2Q7DA 5JZBA 1TAQA 1KOJA 2G08A 3HY4A 4HYEA 3WYAA 2OORA 1A0OA 4QYSA 3AHIA 4ZYTA 1ODCA 3ZQKA 5LU8A 4L9WA 1U7UA 3SBDA 3TVDA 4NQZA 2A94A 2G1UA 1FJHA 2F59A 2ZEJA 1B8UA 2ASVA 4LDZA 4XM2A 5TY0A 1KFKB 5HOQA 4DMKA 2OR3A 2VFAA 1YL6A 4MB2A 4IJVA 6ADHA 4CF7A 4Q1FA 1BWRA 4TTRA 4TS1A 4ZOEA 4XWKA 2X9QA 4KH1A 2ZJ7A 5D6NA 5FA5A 3ZLTA 4CNQA 2PL1A 4U3JB 3PS9A 2XB2A 5L3SA 2D7JA 4IEFB 3RARA 2ZQYA 4G5FA 2WY2D 4D6PA 1U5BA 1J8YF 5IMSA 2XZTA 1FXWA 4NCNA 4ZOCA 4BKQA 3PXUA 3AUYA 1DLIA 3BRSA 2XKBA 3JQFA 4W1SA 1C0LA 1ODTC 1YQ9A 3CT6A 3ES9A 1G6OA 3CZMA 3G9QA 3GT7A 1RQXA 2I71A 3H18A 5EWMA 4EFLA 4C2UA 3DOEA 2FQWA 1EBFA 3TZHA 3J81A 2UUOA 2X41A 3EGXA 5CURA 1RRVA 2QYSA 4OP2A 3L1VA 4TLAA 1HX7A 2WHYA 1T6NA 3M1YA 5FHRA 2B1IA 3HO1A 2H06A 2YR0A 3WLAA 3EIOA 2G1JA 2GKSA 3A1WA 3QVSA 3MAAC 4M0DA 1NVEA 5FYQA 3WICA 1GAWA 1IUPA 3DNFA 5ARCA 1BE8A 3E9YA 1CQJA 4DDWA 2ONKA 2HMWA 2NQ2C 4NZMA 4P58A 1JHVA 4JKIA 4ANFA 3MQFA 5F2NA 2WJ6A 4IWNA 3KBOA 3KKKA 3DWEX 3JQAA 5IJZA 1EB9A 3E23A 3D3JA 1E7RA 4I9HA 3NEPX 2PX0A 2B92A 5KYUB 1JDSA 5TQ2B 2OUIA 4JR0A 3OM9A 2VPIA 3UCEA 5ESRA 4TX1A 4X0EA 5J40A 4J0DA 2JPDA 1KO5A 3TLMA 2ZXEA 1IPHA 1E89A 5BVGA 1TFUA 2ZUCA 1VKHA 5BYKA 1L4MA 1ZICA 3IQFA 3RU9A 2OBFA 3FDJA 4CTNA 3Q41A 3KDPA 2XQFA 4LYEA 4TLCA 4UUMA 4TYNA 3EPHA 2XCIA 1IBKB 4G5YA 4CI0B 3GNSA 3HGQA 1VJCA 1AZLA 4BO0A 4TS3A 3HBAA 1J0XO 1CUXA 5KAPA 2O8DA 4D25A 1G16A 2DJIA 3A32A 4EEXA 4EDFA 2XTNA 4B6JA 1L5QA 2FPXA 2LCIA 2XNSA 2J45A 1XALA 1UDBA 3NIBA 5CK5A 5DHRA 1FBNA 3G9XA 4NXNB 1W88A 1GG5A 2OMEA 2ZB7A 1TJYA 3BFJA 2PZEA 3BTVA 1E60A 3C8DA 1DHRA 3CBGA 5CAEA 2P3LA 5I4IA 1CRLA 2PLWA 2ZJBA 3OX3A 2SHKA 1BXZA 3BJRA 1WEHA 4BP1A 3KWMA 2VWHA 1DCMA 4RADA 4QD3A 3U7JA 2RSLA 1I2AA 3WRVA 1HEIA 4KJXA 3KR9A 3E7WA 3SHWA 5JMWA 3DLHA 4DMHA 1MAHA 4DRZA 5CB8A 5GVSA 1KEZA 4Z4GA 2B0JA 1F9EA 1XCPA 4FYJA 2D8AA 3M6IA 4DG8A 1YS9A 2BFMA 3H5RA 2ZRIA 1B16A 1R18A 3ZHSA 4DSTA 1P75A 3CYFA 4JLJA 1NFFA 2M6RA 1CPYA 5JAQA 2IDKA 2BM9A 4IIVA 5I9SA 2V65A 3Q8WA 2X0JA 1DBSA 1IOVA 1QYVA 5FQNA 2PPVA 3CVVA 1K27A 2HDHA 4FXOA 4H1HA 3HSKA 3H75A 3UHAA 5HTOA 1AE1A 1PW5A 2I3GA 2WSBA 3O4HA 2OXTA 1HE8B 2Q5QA 1FP1D 2PH1A 2PZMA 1M0SA 2TMKA 3EWIA 2BCEA 2IV3A 3T1VA 4CHGA 2ZCVA 1Z4KA 1V7ZA 4GI3A 3W2EA 3WXBA 3PUYA 4ZO4A 4ZVQA 1P7PA 1RLIA 4Q37A 5HA5A 1KDYA 3VZBA 3OOYA 3WQSB 4C4TA 2XWJI 4ISCA 1JE1A 1HG0A 3KLMX 4OQ4A 2Z9CA 5T4EA 2CKMA 4IDNA 1WHTA 3BH7A 2WJGA 2A1IA 1NPTO 3TM4A 4I1UA 3HPRA 2FUG6 4I08A 4GYKA 4M87A 1XMOB 1IZ9A 4G8JA 1TCBA 4YPFA 3D7MA 3ZXSA 2Q4EA 1Q57A 4UTRA 2W8ZA 5CBKA 7ADHA 5K8UA 3IKTA 3T5BA 1XMQB 4MUMA 5G1PA 3FG9A 3LOPA 4JLOA 1Z7WA 4YP6A 5LB2A 4YAKA 1U8UA 3RKUA 4B6EA 5K05A 1IU9A 1BN7A 1MJHA 3I0MA 1J0BA 5HCUA 3VKHA 3CS3A 3A04A 3KJXA 3M8KA 3EC1A 2VHWA 3CB2A 1C7RA 3BJIC 1G1MA 2X0IA 3EGWA 4IJ5A 1KSJA 3S2FA 1X8XA 1OVMA 3HB0A 1VCMA 4PF1A 4CIXA 5AIAA 1DP4A 1IG0A 3F3KA 5C1OA 4Q4HA 1KZ7B 2YN2A 5GPBA 4DDTA 2HBYA 2ID4A 1MKYA 2ZBVA 4IXTA 2CJWA 3O26A 3SIXA 3Q8KA 2GN2A 4BYMA 2BOVA 1FFAA 1VSVA 3A10A 4AJPA 1DAPA 3ZW7A 1KKUA 1FVOA 4N9WA 3DVAA 1BQ4A 1GL6A 5KI6A 3ZS8A 4BVKA 2OQ2A 3L43A 3MTGA 5DV9A 1G41A 2ID9A 4BV8A 5B4VA 1UL1X 1YS1X 4P38A 1VPWA 2VZEA 4BHTA 1I2DA 4ARZB 3N3BC 3Q7PA 1UJ4A 5DSXA 2X5XA 2ZSDA 4E6EA 3EDOA 1A88A 1LBQA 1NE7A 5FBHA 4LF5B 3ITNA 3IMGA 3CNNA 2VT6A 5TGZA 3V1MA 3AHJA 4IZIA 2J1LA 3OZUA 5C46F 3GLFB 4CKBB 2JS7A 1XWWA 2VP5A 5IW8A 2QRHA 5KTMA 1UFKA 2BUBA 3CA8A 1ZGAA 4KTTE 1A8HA 2BPOA 5AYVA 5CNKA 1GTJ1 2HT1A 1WXIA 3LG2A 1QGYA 4IZOA 1L7BA 2HU8A 1FZQA 4LGMA 3RS5A 2HD4A 5HWSA 2R00C 2X2FA 4WCDA 1H93A 3SM3A 1GN8A 1YCDA 2ZULA 1EXVA 2F43B 2L17A 4N9QA 4CVNA 1M2EA 4F7WA 3BWVA 1FFWA 3UA3A 2W42A 1S7CA 2HQ1A 2Y6VA 2REXB 1XZCA 3MT0A 1AK9A 1UMDB 2WEKA 4FCVA 4Q7LA 3UCXA 5L8VA 2BTQB 2FR1A 1HFEL 1NASA 1OHHD 3DEIA 1G7RA 1B93A 1E9RA 2NU6B 2VZ9A 3O2JA 2QDKA 3K2EA 3WGJA 4C7KA 3Q72A 2CVZA 3GXBA 3Q8LA 1FXWF 4DNQA 2O0LA 3VR6A 4NOJA 5LKAA 1A95A 1SOUA 3R0XA 1OAOC 3M6LA 4HG2A 1XQYA 2CWDA 3CZ5A 3F49S 1JEJA 2P2NA 3IPXA 4HNAA 5KWJA 1XEFA 5FL7A 4WWHA 2KWIA 2JI4A 1D8TA 3N2ZB 2QMEA 4WK4B 2OM6A 3MJCA 1XCBA 1GR0A 4F4JA 5EGSA 3F46A 1Q7TA 2PUCA 3O31A 1A4IA 4AQYB 2NUAA 2RC6A 5B4TA 4EEZA 3EOBI 1R6AA 3N58A 2JD0A 2QSZA 4OHRA 1AU9A 1ZD1A 3VDMA 3OAAA 4RETA 1HDIA 4MQEA 4O2AA 4XSVA 4DHWA 3TI9A 4D9KA 7GPBA 3BH6A 4ZJUA 4NBNA 1DKPA 1ETHA 3HFJA 3E7PA 1Y34E 4C7VA 1QH9A 1RWWA 4S1TA 1TYCA 5F23A 2W37A 2GD2A 2CVFA 3CJQA 4P5PA 5HMMA 4LMAA 2PWBA 1H2EA 3U7EB 2O7SA 3CTPA 3COJA 4MVJP 3MC1A 4HH3C 1D0IA 4M55A 4TSKA 3GJRA 3TL3A 3KJQA 2C00A 5DX8A 2QVYX 5KKNB 4GG1A 4J4TA 3A8TA 4AW9A 1R6BX 4R7TA 3OZVA 4B2YA 3TQHA 5EZ6B 5SICE 1F6WA 4ZYZA 3O4JA 5HIMA 2LD4A 1RFLA 5F7OA 2A5YB 4QRIA 2I2AA 1LK0A 1UWKA 3AXTA 4PZLA 3RVLA 2FTKE 3FTQA 3S55A 1MPXA 1U2TA 3L0DA 4GKKB 5IT5A 3AF4A 3OTWA 2AUMA 1WAMA 3L1HA 3EF0A 5JSZA 4GRIA 2RG1A 5H8WA 4JN6B 3AZQA 5JAIA 4KIWA 1OBOA 2QAIA 4JBHA 2E4AA 3MF4A 5L7YA 4EB6A 1JIUA 5A4FS 2H51A 4L6AA 1G8AA 1K4YA 1L7RA 1R9GA 4EOGA 1OTXA 4XJSA 1XZJA 5IUJC 4FGJA 1VRVA 1FP4A 2HFKA 2HX1A 4RLSA 4L75A 3AFNA 4KYVA 1PSZA 5B1HA 3VKFA 1RWMA 2QRLA 4WK2B 1XHLA 5AM5A 3RCBA 1J1UA 1U2RA 3S1AA 1SVIA 2BW0A 4QG7A 4ZU6X 3WIDA 3NTOA 1C1YA 4O2RA 4LC1A 3IMEA 2B36A 4RTNA 2AOUA 2ZBEA 5D1NA 3DT9A 1HE2A 3SZOA 1EM6A 5AD1A 3ME5A 1FQKA 5ARBA 4IOJA 3AFGA 4LX0A 5CH8A 1CUWA 4L6IA 3CUWA 3EIEA 4HN9A 3G2LA 3VV3A 4GL2A 4MWSA 1TECE 3D6AA 3FCYA 4Q3DA 2V55B 2JAWA 3UXHA 4R4JA 3W9BA 5JZOA 4PFJA 2ZIXB 3JVVA 1V5FA 3CF4G 3MUFA 1YB4A 3OE5A 1WS6A 1P4RA 2PD4A 3C0KA 3LIIA 4NY1A 2BDTA 2IYVA 3JWHA 2H1OA 2AFHE 3P8ZA 4HDSA 4O5AA 2J6CA 4OFZA 1CF9A 3DQZA 1FXSA 3QMVA 1V37A 3AI3A 4LRWA 5AJZA 5FLEX 3THWB 1SY7A 3CXUA 3QOXA 4DQKA 1V5GA 4X65B 2IXDA 1UP6A 4YO7A 1Y9JA 1ZD8A 1MC8A 1E9CA 2HIAA 3DPUA 1BGXT 3E9QA 2P4UA 4FLMA 3SX0A 3UATA 3QLEA 2O57A 4XASA 4I55F 4ZZ1A 2EKDA 2HJHA 3FYTA 2WUGA 2DJ5A 1RXWA 4LAFA 5FL3A 4FCWA 4TMYA 3SY8A 2QTAA 4LGYA 1Z6AA 4A36A 1EE9A 5IK2D 4I4TA 4G0XA 2PLRA 1W4ZA 2C0QA 4Y6RA 5IUKC 3MUEA 3QEOA 4YAWA 4G0VA 3I73A 4QDTA 1WBBA 5IAOA 4PAMA 4CMCA 4ZO7A 1Q1NA 4DV6B 3P19A 1TQ6A 2Q1TA 2ZUTA 2VTDA 3QK7A 2FZVA 3AEUB 3GJSA 4Q34A 1MGPA 4FBGA 3I72A 1EI9A 3T12A 5M29A 3ADDA 4KHZA 1HL7A 1NJFA 3EEFA 3PNKA 3AR4A 2V03A 1K89A 1U11A 1ZUWA 3CN9A 3CZRA 2C5EA 3PVSA 5L3RA 3A06A 3TTTA 4AD8A 3U7QA 1Q95A 2DBQA 3Q87B 1T1GA 4TYMA 1EDOA 4XFDA 1QP4A 3D4PA 4L95C 1SB8A 2JCBA 1PGNA 3RAGA 2G63A 2JVJA 2OKGA 1CG6A 1C3OA 1VPDA 2AC2A 5AKGA 3RBAA 1Z33A 2GWHA 3C8ZA 1E2BA 4DMCA 3AI1A 4UEWA 4CTKA 2NSYA 2ODQA 3HVIA 3K73O 5SZKB 4G5HA 3QLVA 3EA0A 2JIQA 2ZI9A 3CRZA 2NG1A 3VOTA 2O8EA 1TK9A 5I7EA 1KORA 4ALIA 3B2QA 1MB3A 3Q3CA 1EG2A 1M5RA 4LZZA 4I9GA 2C99A 2GN9A 1CJUC 2X5NA 2ZSKA 4FQ5A 5AHKA 4Y67A 2C2HA 4NCHA 3WL7A 1ZHOA 2O5CA 2OZPA 5KTRA 3OX1A 1QF7A 2H0AA 1C8VB 3D8TA 1EJ6A 2BGRA 3HE3A 3PX7A 1GUBA 4JSTA 1S2LA 3HVHA 2EJCA 1VHLA 5H9VA 3DUFA 1SUPA 2QZZA 1NBME 1WF6A 1YZUA 1ID1A 3L6EA 1JLSA 3E3AA 3WI7A 3O6VA 3G8CA 3CSDA 3DD1A 2FSSA 4ND1A 1ZXLA 4P33A 2ONZA 2Z5VA 1WJGA 1SVOA 2Z56A 4RGBA 5JNUA 5K6AC 4OQXA 3QVUA 1Z2DA 5TGTA 3VR4H 3WGVA 5FPPA 1MJGA 4UULA 2PBZA 1JBQA 3JVUA 4HSGA 3GH1A 4X8OA 5IKOA 2EHJA 1SXJE 4KQ9A 2JLAA 5HIKA 1J8MF 4L0MA 1GXSA 4WI1A 1JDNA 3A11A 3DM9B 4MV6A 2IELA 4BVJA 4DLTA 2E7ZA 2QAJA 3DEHA 1QHFA 4F6RB 1TVCA 4N0MA 3FM9A 1KSGA 3B6MA 1SHUX 1MJ5A 3KLPX 2AQKA 4QTXA 3CISA 5LXTB 1V1RB 4LDAA 5JC8A 1W59A 1W0KD 1LU9A 2F17A 3WYCA 3W2FA 4LXGA 4O4JA 5DM4A 3MS7A 3EFOB 1L7XA 5D84A 3TDKA 2YZMA 4F91B 1FMTA 1TX4B 4Y9TA 5BO5A 2XEDA 3LQQA 3R24A 1MC4A 1C9DB 3CVOA 4YDHB 2G0TA 2JRCA 2JFYA 3D81A 1N0UA 2FXVA 3KYCB 4B34A 1VMIA 5AOVA 1L7MA 1XRPA 4XGKA 3WWPA 3RKRA 2ZBQA 1JQBA 3HJHA 2EZ9A 3GDFA 3SVZA 1T6BY 1XRMA 3OPMA 3W05A 1K7SN 3ED1A 4M53A 4O2AF 5CH5A 3FGZA 3UC9A 3PKJA 1VOTA 1YD7A 1YJQA 4IO0A 3KPVA 4UU7A 3RIEA 1BHJA 3AX6A 4W1QA 4LHWA 3MINA 3AV3A 3BXPA 1D1QA 1QC5B 5J2TB 3N7TA 4HH0A 3OP1A 3C3KA 3QU7A 5E6SB 2AQ8A 3VYWA 2B9VA 3RUIA 4DIOA 2ERYA 1IBRA 1RC0A 3T9CA 5FRDA 1V8BA 3PUZA 5H70A 2PL5A 5L3VA 1KEVA 4KC0A 5LQRA 2P3SA 4JKYA 5BR8B 2ZETA 1PHPA 4LJ8A 2AFIB 3NOOA 4BLWA 1KNXA 1CJBA 1SUDA 3B53X 4ADSG 4D99A 2BSQA 2ZSEA 1E9VA 2N0SA 1FCJA 1GL9B 2HHCA 3UHOA 1RTKA 5TVKA 3LLSA 4JUCA 4OHOA 3GLVA 2KI5A 2BCJQ 3IILA 2AV6A 1ZVJA 1HOTA 3V48A 3EPKA 1L8AA 1K63A 3NWEA 5KYKA 2P9ZA 4ZO8A 1VLZA 1B26A 4F72A 2V7GA 4M21A 1PZFA 3A27A 4U2KA 1GY8A 3DCNA 2QUJA 2GH1A 3MWDB 5EHQA 1S8NA 2H1CA 2B4AA 3Q15C 2IC5A 3R5FA 1UEXC 3EIQA 1L5FA 721PA 3DE0X 2A9RA 1QG6A 2D0OB 3AF5A 1L7EA 1TVEA 4R8SA 3TJRA 4DIKA 2R2AA 1I9CA 2XB9A 3WFJA 1MABB 1Q0HA 1ZK4A 3FNQA 3N2KA 2C95A 4C4RA 1ZITA 3OHSX 1Q11A 2OESA 3F2IA 4XKJA 2Q3EA 4YNBA 5KOYA 5KC8A 2VDRB 3ZW8A 3GRFA 5DGHA 3I39X 1EBUA 3IA7A 1ORHA 3H1TA 4LJ5A 1U7ZA 4AWAA 4KWIA 5HZMA 2XRMA 5AI4A 2NU9B 4LWQA 4EB0A 3ZEAA 2H2IA 2Z83A 2CUZA 1XN4A 4N0EA 4XYEA 3ASVA 1MN6A 3OPNA 4FNGA 3O95A 4FIZA 1P3JA 3D3WB 3I53A 5GOTA 3ZCSA 2JCSA 4RQUA 2PO5A 4FFBB 2A9FA 1E2IA 1QDUA 3O4FA 1F2VA 4FX2A 4J2HA 1NUUA 3VPCA 3V7NA 2HRQA 2HA2A 2IUYA 4FNMA 2GS9A 3SQLA 4FNAA 3SJ7A 2VDNB 1DCKA 1XTQA 2QUBA 3CT4A 1EVZA 2NSJA 2Z4TA 3LX5A 1YR3A 4PY2A 4EG7A 4ZOQI 1U0NA 1XTKA 1A76A 2P4EA 3TLEA 1O5IA 5BRAA 2JASA 2R66A 3PT9A 1N6PA 4JJZA 4K9KA 2V8BA 3H1AA 3MTAA 2JFNA 1LBIA 2GNAA 2ASEA 3OD1A 3Q3HA 2ZR0A 5TR9A 4KPFC 4YACA 5IU6A 4IGKA 5AW7A 4OYYA 1SHJA 2YJ4A 2YHSA 4S2UA 4HWPA 3BWMA 4I4TF 6LDHA 4FKMA 2X9VA 4YMTA 4IHQA 1IFXA 2DUMA 1FP2A 4PPYA 2CD9A 3OZRA 2G9RA 4P0TA 5E95A 2JKVA 1CEYA 3WK7A 3BHMA 2RMKA 1U3FA 3FW1A 1ADYA 1XZMA 2RHBA 1X7ZB 3NXSA 1H2BA 4DRXB 2R8PA 3DZHA 4QXQA 2BMJA 5HF6A 3V4ZA 4C04A 3IXMA 5BV7A 2BDEA 4H59A 1JEEA 1P5FA 1CNFA 1T10A 3WB1A 3ZCPA 4FFMA 3UV6A 3HBLA 1R12A 2IXEA 4UUBA 2IT1A 2CNLA 4RZ3A 3FF4A 2XE6A 3QQPA 3FXAA 2FAXA 4A6PA 4M1MA 4XFKA 4BKRA 4C0WA 4Z2AA 3UB4A 4BLOA 2JGAA 2PPLA 3QE3A 3A9RA 2XVXA 1Q1EA 1T5DX 2J6BA 4MVJI 2GJAA 2FJUA 2JBAA 4QXRA 4MJLA 1ODKA 1A5AB 4QPZA 1XDGA 1IRXA 2BRUC 1PRYA 2ZLBA 3C3EA 3L8DA 1NY6A 2VPQA 3M4ZA 4N8DA 5D3MB 4QOSA 3BGSA 4GC5A 1UFVA 3GYBA 2BE7A 4QDOA 3ZK8A 4LXIA 2EL9A 1UKZA 7REQA 3FBTA 1UP4A 2J0EA 3R7WB 1XO1A 4D9CA 3DAGA 1RXCA 2GBIA 5JDCA 1GSOA 2Y1KA 4C3OB 2FZLA 2GPWA 3T0IA 2QF7A 1X8LA 2ACWA 2ZJFA 1TVKA 1KZ9A 1BC5A 2WA2A 3QUTA 4MAAA 3NKFA 4HDKA 2H1FA 3OWXA 5L3QB 1EESA 4GX5A 1QBGA 4WNYA 3TSAA 4MZDA 4FMDB 1TA4A 5KJ1A 4URVR 1P1RA 4IGEA 1U8XX 3PGA1 5DTMA 2FX3A 1PD1A 3TQSA 4G01B 5JD3A 3W7BA 3WL5A 4WBNA 2AT1A 4YK7A 3L05A 3EB9A 4PFSA 4YS6A 4TRMA 5IK2A 4DQLA 4TROA 2YZGA 5HMLA 2NO6A 2ZI4A 1XFDA 2WM9B 3DCJA 1SZPA 1JW9B 4BJHB 5LQJA 3CKKA 4KNYA 3LXMA 5LQCA 3CJTA 4C05A 4NHEA 2PAFA 4V39A 5HK9A 2UYGA 1J97A 1ULSA 3CU5A 2H5IA 4WASA 4PZEA 4HSEA 3F97A 4I8DA 5EOVA 4XVUA 1TZBA 1N1DA 4CF5A 2QLLA 3A6FA 3CW2A 3VO9A 5CEEA 1M6HA 2FPSA 4H7DA 3QXSA 2R5FA 2H11A 2ZSAA 4QUIA 2P62A 3S99A 1EK5A 1OE0A 2CNBA 2R68A 4A6XA 3NOXA 2Z2YA 4F93B 1SG6A 4HAOA 2Q9CA 3S27A 4HAUA 2J3MA 4O4JF 3WDKA 3K70D 1I2BA 2ZDHA 1OYVA 4L8YA 1L4GA 3LFHA 4FD2A 3LWZA 1YZFA 2C88A 4J0GA 1G18A 3HB9A 2GRAA 4GD3Q 3ZGVA 1H2FA 2PMEA 3MCAA 2D5AA 4F9TA 3UJ9A 4H4DA 1PGOA 1YNOA 1Z73A 3BFPA 3WMXA 3UJPA 1QJCA 1T8RA 1WDKA 2C42A 2IHTA 4TQAA 5EVCA 3S2UA 2GUWA 2QY6A 4D4MA 4RULA 2AEMA 2A5DA 2JCVA 2JGKA 1TIBA 4LIPD 3B60A 4R8VA 4ALMA 1J22A 1P18A 2B8TA 3JQBC 4U7WA 4DA8A 3A9WA 2C9BA 2VQDA 3RK4A 1KARA 5SY9A 4P4TA 4NNJA 1LI7A 1Z4LA 3W9YA 4RTSA 3DMTA 1IN5A 3C3YA 4GAEA 2I6QA 4EUEA 1V11A 3ZWWA 4EHKA 2YS7A 3KJNA 1NV9A 1YVPA 1KPGA 5IWCA 1H65A 2PGLA 2B1QA 3LYAA 4WXHA 4C6RA 2CLOB 3NKVA 2QD4A 3IUBA 3MIZA 4IMPA 4EG6A 1HFJA 2G8NA 4RPCA 4GBJA 1ECFA 4EHIA 2Y2VA 4YRQA 4LJYA 2XLBA 1GPNA 3ELYA 4LE1A 4XJVA 1BJRE 5TT1A 1J23A 3OPYA 4DWOA 5LLTA 1KEWA 5LZ7A 2IP2A 1EA7A 2I7VA 1BD4A 2JDIA 2W2TA 1G38A 5TMBA 1OLOA 1QZXA 9MHTA 1WSDA 4B40A 3W34A 4E5KA 3O8RA 5LLDA 5REQA 2KS6A 2WD8A 4X6UA 3OOWA 4EGAA 4N3GA 5LYJA 1CP3A 1YIOA 1VSBA 3ZVRA 4R1OA 4J4BA 4JXZA 3X1MA 5F5NA 2JIBA 1PR3A 2WD7A 3WHKA 4V3BA 3RS2A 2XMQA 3GRAA 2ZREA 3L41A 3L8YA 4O59O 1VBKA 5JZVA 2EBHX 2XBUA 5E4JA 1YI1A 3VNRA 5H81A 1GKKA 2B34A 5JO9A 3UXYA 3HO6A 1QK5A 3EXIA 4D8VA 2YIVX 4MUFA 3E05A 2X42A 4X45A 4X1KA 2FG6C 4EVSA 1SH7A 1X6VA 3WP0A 4CMJA 1T2DA 2RI0A 4RK7A 4KQ2A 3LVQE 2VK4A 4TLLB 3TL2A 1JWBB 4ZGGA 1V3QE 3D4IA 5EP1A 3TTSA 3SVTA 1I2ZA 4C0BA 2QQ5A 4ER7A 1KBZA 1WXEA 1AN9A 1N0IA 2A1UB 2TRSB 1XKTA 3PFGA 3L6BA 3JWJA 1OFIA 3MTJA 5DCLA 1YSCA 5AW2A 3WOVA 4GE3A 3I61A 3ANMA 2X3FA 4DDHA 4TXLA 4M1TA 4OP3A 2UYCA 1JR6A 2D2XA 2MIIA 2XDQB 2YBDA 2GZ1A 3B8HA 2PNJA 2JJ8A 3STUA 1WMBA 3MWFA 4XIYA 5F7JA 3WLEA 4B84A 1XRQA 1FPQA 3TNDA 3G8DA 1QV9A 3EZ2A 3KJHA 4RE5A 1SWVA 3TE6A 3GW8A 2BTEA 4F3KA 3U44B 4IM7A 3D6JA 1P3Y1 4RKYA 1R0BA 4OUKX 3BA6A 1SUIA 3E2PA 3SC4A 2FVXA 2ZAOA 4IRXA 2ZB3A 3L5KA 4WHMA 5AKKA 2YKGA 4GEGA 1K2VN 3FR7A 4CW7A 2O8FA 3RT7A 4AMZA 4NXMB 2AW3A 4K9OA 4B3RB 2DWUA 3SNKA 3VU9B 3SD7A 4HN4B 3ZYCA 5JXWA 1NF9A 1OOEA 4H6XA 4MJXA 4DYVA 1ZD9A 4D8WA 1O08A 4NATA 1M2HA 1XX6A 3LNCA 4KI0A 4RK0A 3DYBA 4A91A 4C7JA 2ZAMA 1KVRA 2ZVJA 2ZUSA 1RZ3A 3FMPB 3I9JA 3R3SA 3T3PB 5C2JB 1OQAA 4WA8A 1HG1A 1E1CB 3ODGA 4JLSA 1ZHHA 4E5NA 4EHNA 2PUTA 4GOMD 2CLIB 4MTLA 3ZDYB 5CT4A 2XE8A 3EDQA 5AFSA 4M8LA 1I9GA 1ZQ9A 2IXGA 3BKWA 1A82A 3BXZA 1KMHA 4EVQA 4FDMA 2ZDQA 1DRUA 4JDPA 4C88A 5CYFA 3T3OA 5EY5B 2R79A 1USKA 2WHPA 2AJLI 2VN8A 2X7HA 5F51A 5GY7A 1T4DA 3RFCA 3B1ZA 1O57A 2EW2A 3W7AA 3WZLA 4DLWA 3L7IA 1PEAA 2GZMA 2E4VA 1I3MA 2AE1A 3ONWA 5FBZA 2BHRA 5ICFA 4CFSA 4UFPA 1GUDA 2XMPA 1J8DA 4TLDA 4WEOA 1NMQA 4EUHA 4KYIB 3O74A 3U48A 4MW4A 5JNSA 1WMDA 1E9BA 1QE3A 1SHTX 3I0NA 4E51A 4AJOA 4Q9JA 1UADA 2D1SA 3R5JA 3N07A 3ENWA 3G89A 3H8WA 1M1YB 4XFJA 2NZWA 5CUQA 5EIFA 1ZOLA 4BO4A 1E9SA 3U49A 4V0MA 3L6UA 2EC5A 1OZGA 1JE0A 4WBNF 2IPLA 3IPCA 2W2XA 2Z08A 1SVSA 2Y67A 4KLZA 4OO3A 4QBHA 1K7EB 4N01A 2FMTA 1Z0ZA 4J8PA 4PAOA 4G1BA 3T1QA 2ZM5A 4LW8A 2EQBA 2KLHA 2QWXA 4HXYA 1DQPA 2Q8PA 4NBVA 4RBNA 5HUHA 4Z51A 5F9FA 5C5EA 5KOJB 4Q9HA 3IODA 1IK4A 3D2CA 4MS4A 5JOQA 1RRMA 1ZCFA 4MR8B 1MQ9A 2WQ6A 4OXNA 2B3DA 1C3VA 4YUWA 5JFOA 2BFPA 2CXUA 2ZYTX 5MGNA 4JP3A 3D6NB 3X1YA 4BFSA 4J6FA 1IY2A 2JGJA 3ZWQA 3L4BA 3O7MA 4NG5A 3PDJA 1FDTA 1CWUA 1TMKA 4NI5A 2FFJA 1Y63A 2WU8A 2I4LA 5KNBD 1FX0B 3NR2A 1QRSA 1FBTA 2IDJA 2BKLA 2OCKA 4PZZA 3ZVMA 1HQKA 5FOVA 2QMZA 4R1LA 2HHLA 1SUCA 3LQFA 4LZAA 5C35A 5KNDD 2IS6A 1EX9A 3PC2A 2YHAA 3R6LA 1DJPA 4PR0A 4UARA 3GJTA 4ECAA 1TM4E 3P9XA 1R00A 2IQIA 2PX5A 1IJEA 4CR7A 1R16A 4LFCB 2G83A 1UFOA 1O89A 2C3UA 4YJKA 2G17A 3UT5B 1EVEA 3HYSA 2WTAA 9ATCA 1RKBA 3ROMA 2E2WA 2VWPA 1AZSC 4OHFA 1VQ1A 2DRIA 5I48A 1UJ2A 5JD6A 2DT8A 1NVMB 4HDMB 2R8BA 3PJDA 4QUJA 3M6MD 5I7FA 2WHXA 2FSVC 1U7DA 1T1SA 3FWZA 4CV2A 5JBQA 5FOTA 4CG2A 1V3TA 3A31A 4XDGA 4E12A 1R5JA 3ZJTA 2QAGA 3GLKA 2CFTA 4PN7A 2W2LA 1DC7A 4WK6A 5F2OA 2HMSA 1E9FA 3WTCA 3ZU6A 5CK4A 1G20E 2FPUA 2Q3LA 4AJLA 4C3VA 3FNRA 1M8KA 5FI5A 2BFOA 5FFMA 3VU8A 4YCCA 4NJOA 3JYPA 3BN3A 3QJ5A 1AC5A 2TYSB 4OJQA 4H31A 4MYUA 4BWYA 1LVGA 2PXXA 3LPMA 1Q0RA 3GLUA 4BX9A 1PG0A 3PHLA 4QLAA 4QWWA 1U2ZA 3W1VA 1DAFA 4LFBB 1AQ6A 2HMYB 4NAHA 4RPHA 5DLPA 2DPYA 2WWIA 3LU1A 4LKRA 4RY0A 1DRVA 4DSUA 4E46A 1RR6A 1OUMA 2OFOA 1YACA 1J90A 4F2WA 4DHEA 2C5HA 4N7BA 4OXIA 2AUTA 4JQZA 1FSZA 3EJ6A 3SR3A 1Z0UA 5LYJF 1N75A 5IF9A 1W0CA 3LC2O 4UNIA 2MR5A 3PL1A 3FTFA 1Z34A 4U7PB 1Y5MA 4IH9A 5FAKA 3QTBA 3PGMA 2QLMA 3CRVA 3IUQA 3W5JA 5EUBA 5LMUB 4J90A 3ACCA 5FXMA 5HPYB 4ZRMA 4L73A 1BWQA 2PEYA 3M5WA 3L6CA 5AKXA 2CLHB 3MGGA 3ND6A 4HQRA 3FGPA 4M7PA 1YA6A 3REQA 3IHLA 3PX3A 4U7JA 2VQ6A 4MW5A 4P4UA 3F5MA 3X1XA 5CG1A 4NIMA 2F1JA 3E8MA 5EL0A 4HLDA 4KSCA 2G0AA 3ETDA 4LCBA 4Q6WA 5HKKA 5T64A 4DIBA 4E32A 2L19A 2NUTA 5AW6A 2QHXA 4I50B 3W2TA 2VATA 4W5OA 2ILVA 4CT0A 3FMVA 2MHCA 4BFLA 1DX4A 4JZKA 3HDQA 1C1DA 4M60A 3FZGA 3GCXA 5DSTA 2H2DA 1T3GA 3GJYA 1C0PA 3C4VA 5A4IS 4GLBA 2VHCA 4MRVA 3L0CA 1TIKA 2ACKA 1R6XA 4PLTA 5DNVA 1EXDA 3ROPA 1MNQA 2BZSA 4B7XA 2ZTMA 4DPLA 4OXQA 1NJ8A 5I3CA 1AXRA 3HV0A 1YONA 4XWGA 1X9GA 3QU9A 4JXXA 2B21A 2R6AA 1EWRA 1VJ5A 1U4NA 3M2PA 2NWQA 4PN3A 3OLCX 2LNDA 2RGUA 1PNQA 1RP1A 3I32A 3IVRA 4UPDA 1PR4A 2IXFA 2X8AA 3P5BA 1NLZA 4B79A 2RAPA 5EJEA 2V5AA 3NT2A 1NT2A 1SOWA 2XVAA 4FM9A 3B6EA 2FUG1 2JLCA 1N78A 2XUKA 4G9BA 3LUKA 5EJIA 3I8XA 1N5RA 2KYRA 2FW8A 5KNCA 4OVKA 1RABA 1E2GA 2POQX 4QPNA 2RGCA 3AMVA 2O8BB 2QJRA 2GILA 3KQNA 3WVNA 1KSHA 3Q3GE 2EFEB 1TMOA 3CUKA 4TMXA 4AUMA 2O8CA 1LBTA 3O4IA 3K9NA 4PRZA 3QNUA 4K6KA 1KAHA 3LS2A 3R4VA 2PDAA 1OV6A 1U5CA 3G17A 2I6XA 3C6QA 5DBEX 4W6QA 2HHJA 5D1HA 3CW8X 3R9XB 4KX3A 3P2MA 3AXSA 3L6OO 2C1EA 5LMZA 2P5TB 2UDPA 3OIUA 5KKAA 4Z99A 3TQIA 2ZI5A 3D2BA 3FUVA 1A9QA 4MYDA 1BMFD 2ISQA 1L4NA 1ZONA 3BORA 3AY3A 3PPIA 4U8GA 2I29A 3H8VA 4YT2A 1SHLA 3EWNA 4GZ6A 1GPAA 4US2R 1RSZA 3F5SA 1DS6A 2VTBB 4TUYA 2I03A 2CXPA 2AR7A 2Q5IA 2RH9B 1NA5A 3TN7A 1L3IA 3C1TA 1U3CA 3FVQA 1I14A 1SOVA 1J33A 4OMDA 4PNZA 3GMTA 5HTKA 4G4JA 4XX1A 3ZXYA 1Q6YA 2XBMA 2UUCB 3PEUA 1YJBA 1C7JA 3LIPA 4KR6A 2WV7A 2X3UA 2JJ1D 3ILVA 1YA4A 3E9EA 3HI4A 2AQIA 2F8MA 2G6BA 1ZU5A 3SYMA 3BL6A 1SXQA 1T26A 3HYLA 3TSYA 3I83A 3VPXA 5ER6A 1G8PA 2RIRA 1LSOA 1MB0A 4IEEA 3COYA 2PZ8A 4UZSA 3S29A 2Z57A 1K3UB 4BO6A 3F47A 3FCCA 6REQB 4DJAA 1EUDB 4PAWA 1SCUA 1KJWA 2AOTB 2NYVA 1RQNA 2V7WA 3FB4A 2YC2C 4HMPA 5KCZA 5LQNA 3RIGA 3I5XA 1ODLA 3WFZA 3BXXA 1LA2A 4ZEOA 5DXFA 5ITZA 3RSSA 1FLVA 3DCYA 1KP3A 4Q3KA 3VX3A 5B36A 3VPGA 4ZI7A 2ZVDA 2OPBA 4K1LA 1ZIXA 2ZBGA 4KVZA 1T6XA 1NFRA 2ZB4A 3B8EA 1T3LA 1TZJA 4G0MA 3A0UA 3SF8A 1IAVA 1ACLA 2HA7A 1MG5A 4ZIRB 3QXGA 1JALA 4S1WA 3RDPA 4KLCA 2Y1GA 4YIHA 4NWIA 4IFBA 1R8SA 4UNNA 1K7YA 3G68A 3NPMA 5AKEA 2CCJA 2HTFA 1M2VB 3C1AA 3CNBA 4MB0A 4YJHB 3UXMA 1TTTA 3ESBA 4KR2A 1RZUA 5EJ9A 1Y1PA 4MVJD 4A8HA 1E2DA 5I5EA 1KK3A 3B1FA 1P9RA 3P2IA 2FSGA 2GK3A 3I6YA 4E70A 1QG0A 2VK2A 4KXUA 1H9AA 2W6QA 1EVQA 1I01A 1BVHA 2JFOA 2YOFA 2VO1A 1NOIA 4EFKA 5KMGB 4IOKA 2PZKA 1YS7A 2YICA 1EU1A 1EFPA 1D1PA 1UPXA 4OAOA 3V8PA 2IEYA 5P21A 4MQBA 4B6PA 3FGNA 3U39A 1UPBA 4B3BA 1YV9A 1Z4OA 2PYZA 4B09A 1O5TA 4FDTA 4EZIA 2HSZA 1VHTA 2QQ0A 2EEPA 3RTDA 1RJ9B 1V3UA 3NTVA 3BX1A 1CVIA 3Q7SA 5LQMA 3IOEA 2JHFA 3FUTA 4D0LB 5UKDA 5D6OA 4EG5A 1VI5A 2PGJA 4CI9A 1PCXA 4GSYA 4ED9A 1QPBA 4DIEA 4LNUA 4ZFNA 1F60A 1GU7A 3R0ZA 5BSRA 3KR1A 1ML4A 5LWQA 1T4BA 2VDMB 2IZOA 1DJLA 4G65A 4BP3A 3HB5X 1VM6A 3H5LA 4HB4A 3VU1A 2C31A 5ELMA 3B9PA 2BI8A 1J2YA 2YVKA 4IDQA 5T8KA 5AJUA 3M1AA 1BXRA 4YLGA 5B58C 1RKQA 1K86A 3ER9A 2F64A 3OY2A 1ZMTA 1TYBE 3HKEA 3BZUA 3K31A 1XCGB 4NYIR 4QYIA 2M6SA 4R6XA 4BBPA 1TGYA 5LA6F 3C3PA 3IC5A 4FR0A 2VH5R 3JD4A 3IAS6 5IBCA 1RRCA 3EJWA 3RG8A 3T7TA 4KMSA 3ER8A 3VAZA 2AFVA 1JHMA 5C8YA 4F85A 2WTXA 3J7AC 4B3FX 1OSNA 1UBRS 4J75A 1NBAA 2G9ZA 5B58T 4EARA 1NJ1A 1H5NA 5JS7A 5EZSA 4CKZA 1S2OA 5AVKA 5THXA 1IDOA 3A6DA 1XVTA 2ZT7A 3GAFA 3EGCA 3OFVA 4K88A 4IIFA 4B87A 5JUWA 3PXXA 3OQVA 3FVTA 1T3SA 4V0OA 2EKPA 3PIIA 1EWYA 2HLHA 4B2IA 4UHBA 3KOUA 2OFWA 5A9SB 4C1BA 3A1VA 2PUWA 2X40A 1EWTA 2GKOA 2BFEB 3A70A 3ZGNA 3RBVA 3BHIA 4YAOA 4QGHA 3MXTA 3QXXA 2XT9A 3ZCVA 5CXUA 2IU3A 1X1TA 4ZVLA 3VPSA 4AIIA 2B8EA 3AFOA 3KM0A 4G1FA 3JRWA 1E1LA 1GZ5A 4RJIA 5AKYA 3UW1A 2P4HX 1FA9A 4Q82A 4K6CA 4XTCS 4C0LA 2FWMX 4LCJA 3VXKA 2G70A 2VHEA 1Y9ZA 1PP4A 4BP9A 5GQSA 1WO8A 3VNBA 2R1TB 4HBGA 2GYYA 5B5SA 4A6EA 2ZJ0A 3HABA 4C6SA 1LSJA 3FPEA 5G1OA 4JGIA 4MR9A 4R8KA 5FR2A 2Z4RA 1GKIA 1UBTS 1QDEA 2J5RA 3DONA 1WZNA 1BHSA 3F6CA 1FSGA 2JA2A 2CK3D 5L40A 2H85A 1E5VA 1G64A 3IQHX 1SKYB 4QSMA 2C4TA 1FPMA 4IGAA 3JQGA 5EUCA 4S1PA 4YPOA 3ITEA 3LHIA 2EW8A 1QFMA 1U2DC 4BRZA 5EWLA 3ZIAD 4BC1A 4QLOA 1EFVA 4AY2A 4KV7A 3GROA 2C4HA 3I52A 4XSGA 3SBXA 3VU0A 3NV9A 1D8AA 2C1XA 1ENYA 4ROSA 1Z0AA 1YZ3A 2FR0A 4AFNA 1FSFA 1DEXA 4F3RA 2IOYA 3QA9A 1WVIA 2PGOA 3TQQA 2ADFA 1NW4A 3P2OA 4I5IA 2IU0A 3DXFA 3RREA 1O6ZA 4W5NA 4JOBA 1B00A 3PHGA 4LBVA 3RC2A 1UBCA 2XW6A 4R54A 2PSEA 3TOCA 1ZR4A 5EGNA 5JD5A 4MVXA 4XDHA 3GHYA 4RXTA 1E4VA 5IJXA 3ZKWA 3UGQA 1E5XA 2QGNA 3UB3A 4B3HA 1RKXA 3G2JA 3AF6A 4F46A 3GVPA 4MP3A 1EGHA 1KMIY 2COEA 1GUFA 2R62A 1Y42X 3HJNA 3KIPA 4N0QA 4WMLA 3WBJA 2VNIA 4CCYB 2B30A 1RWQA 4N49A 3T1HB 2YWBA 1KU0A 2VAMA 1VGQA 1UOOA 2V45A 1H8ED 2J09A 3TRFA 4IDDA 1RLJA 1UMBB 1NUSA 2ZWAA 2AG0A 3DTVD 4BEJA 3QEAZ 2IXAA 1ZBDA 4BX8A 1ZIOA 5FEMA 3S1SA 4RE6A 3GRZA 2C2OA 1EHYA 4U63A 1DG1G 5SZHB 2R60A 3QELA 3UT6A 4V3CA 1JX6A 1UT8A 2I9PA 5DCWA 4X8LA 3N7AA 1Z4NA 3G9TA 1O77A 4KITB 1Z7EA 4RTMA 3DS8A 4W5RA 1JXMA 1TT5B 1USUA 5BN4B 5BV2P 4F5ZA 3PUHA 4N5IX 1BCSA 4UDYX 3R23A 1FUKA 2OZKA 3L1IA 3CRW1 4EMBA 4F4UA 3O93A 1N32B 2YMPA 5CT8A 1VLJA 3GB9A 4GM4A 3AEQB 1UAAA 2GNPA 4B3SB 4B0OA 4LQDA 3BSWA 1CD5A 3UUFA 4IKEA 2XUHA 3QWIA 4X54A 3PZBA 4O0LA 2WJ4A 1SZDA 1UODA 5AK5A 2CLEB 4DEVA 4U2BA 1GFZA 1BU5A 4HVLA 3T9DA 5EYPA 1G7CA 4FYHA 2A2ZA 4FYIA 5L45A 1NVXQ 3BL8A 4G1EB 2P5UA 1L6IA 3C3XA 2W6CX 1AGPA 1GDTA 4N4AA 5CYOA 1QQAA 5H4GA 4IJQA 1POWA 1IEQA 4LOHA 1AUXA 3QMMA 4H77A 4JASB 3W4IA 4EO7A 1LQ2A 3E0XA 4KXFB 5TB5A 4HNAB 2YWCA 2X1LA 4TMKA 5IJ9A 5T3UA 1M2JA 4KLRA 2Y1WA 1BMFA 3DSRA 4J3NA 1A7UA 2XA1A 3KDAA 4NEQA 1H2RS 3U3OA 2FZEA 1GKUB 3NC0C 1DPFA 1SVKA 5JMPA 2XNCA 3G5MA 3PFNA 2ZRNA 5K5EA 3I58A 3KD3A 3F4KA 1DFHA 4MV4A 1N77A 1H3NA 3FD8A 3D0QA 1OXMA 1PI3A 1U28A 5CT5A 4M6WA 4RC9A 4AK9A 1TC1A 1ZQ1A 2QROA 3CR8A 3CZ9A 3E7XA 5DHUA 4PGAA 4A0SA 2RB4A 2PCLA 4DV2B 4L5JA 3ILSA 1B8PA 2CUKA 2C07A 3FNIA 1IZ7A 4L22A 5CD9A 3HA2A 3AWDA 3BH0A 3QHPA 4FJ2A 3NBXX 3ADOA 5KYNA 1DBPA 2DQ4A 1FJ2A 2LCFA 3BSFA 3C43A 2AEEA 1NE2A 1P4HA 4WVFA 1BOOA 1E9DA 1PDVA 1TO2E 2F4NA 5CT6A 1G5QA 5H83A 2ST1A 1OLXA 4CIYA 3BRWD 4GUAA 3WYGA 3BT7A 1E4YA 2Q1YA 3D4BA 3FPLA 1N2HA 1GTZA 3DMHA 1CU1A 5FO0A 2D7DA 1E66A 1JDBB 3KB8A 2C84A 2QMQA 1O0CA 2GESA 3Q9SA 4DLKA 5IZCC 2O52A 3EGDA 4R5MA 1THZA 3S5UA 1USGA 3G0CA 4E07A 1V39A 3DV0A 3WAGA 4E21A 3K6SA 5JFGA 4JC5A 1YJXA 4PC6A 2PD6A 4C89A 2EX0A 3U4IA 1HY3A 3ETEA 1DQZA 3QJYA 5A05A 1VJ1A 4CKCA 2VXCA 1B0ZA 4RWZA 1KETA 4FE7A 3DTVB 3PPWA 5MN5A 5JWHA 5AIBA 1HDZA 3I09A 3NT5A 3AHHA 4R2MA 5EFOA 1NDUA 2ENWA 1QO0D 2GASA 3IHWA 3RR2A 5B1YA 9GPBA 2ZU6A 2NZJA 3MEQA 5ALLA 4S05A 3Q0IA 3ZHOA 2VWGA 3HUUA 4UHEA 4R8RA 4J9VA 3WL8A 4FZ5A 4HYQA 2VNSA 4ODIA 1HWYA 1MMFB 3ZHZA 3BCHA 4RESA 2I1QA 2R6ZA 2BF7A 1J56A 5HDQA 2J0VA 1U1IA 2YHUA 1XLWA 3U19A 1DCTA 5H0IA 2SKEA 3D3QA 1DC4A 4LWPA 1NMXA 2Q4TA 3ICOA 1U2GA 1XTIA 5BV1A 3RS9A 5A5DA 3AC0A 1TKBA 1CQIA 2WW8A 3G2NA 4YY3B 3OE1A 5ALVA 2GM4A 4PG4A 5B37A 4YREA 2EJUA 3DMPA 3VMFA 1U7HA 3NS7A 1N33B 5JCJA 1CW2B 1RBQA 1K8QA 2RJOA 2ZR7A 3INRA 4RJ2A 3EC2A 4OKSA 3WMGA 2EGHA 1IQRA 2FE4A 3MUNA 3QE0A 4TTAA 4XVCA 2PWYA 4HEQA 1VYHA 2NXJA 4YCSA 4JWKA 4Z4QA 1R4NB 1HPLA 3QVGB 5ALKA 4ND3A 5F4ZA 2WI8A 3IO5A 1PWHA 1ISHA 4FEEA 4XOIA 1XPUA 4R41A 2Y4NA 4IGFA 1WQ4A 3UEOA 2UZ3A 1SK8A 1QH1A 2NT4A 2RBEA 2CLDX 4OYHA 3N6XA 4MWTA 4B8ZA 2W6PA 4LYYA 1G1AA 1GN9A 3VNVA 2IHBA 4W5WA 1CJCA 4BLQA 4WN9A 4ZQBA 2IQ5A 5ERXA 5EZQA 2BEVA 4DDKA 1ZO8A 4JI1B 4ZAXA 2NVUB 4GRDA 1P60A 1OYOA 2WAAA 3CN7A 4J0HA 1E18A 3W5IA 1ZINA 3H2JA 2O0MA 4FT4A 4KOAA 4XQCA 3SHFA 2FPGB 3AUTA 4D9GA 5F98A 4AF7A 2MSWA 3A4MA 4LN1A 5D3QA 2JLYA 2CMHA 5FWYA 1J9EA 1N2CE 1TOAA 2Q4BA 3LSYA 4TWJA 1YTUA 5BUSA 3AFIA 3JZFA 3OMXA 5EIWA 3KPYA 3WKDA 1GPBA 2X6QA 3AVPA 3L0SA 4YRCA 5K8IA 4X3PA 4LNAA 4WINA 1XHEA 3R8FA 2ECOA 2HNAA 1I32A 1FTWA 5BN5A 3WQQA 4NONA 1E77A 1SPBS 1MV8A 2VYVD 4JEHA 4R5HA 2CY0A 1V4VA 1OTYA 1KZ1A 3LF2A 2GX6A 2SKDA 3VR6H 4F45A 4G97A 4DUZB 4XYMA 2YCLA 4HR7A 4IQ8A 3ENQA 5LQAA 3AKEA 3LDUA 2ZYAA 5H3LA 1AQNA 2DBVO 2IL1A 4H6VA 4KLAA 3ROEA 2DHEA 2JLBA 4YGYA 4CM4B 1VYVA 2XUQA 1HKUA 3FMIA 2VPTA 3KU4A 4RCYA 4BMVA 2ZCJA 1G5PA 1YS2X 4FFSA 1H4TA 4CEIB 5BSFA 3EMVA 5IWAB 3ZX4A 1Z3IX 1E5TA 5DP2A 3QA3E 1NSFA 4M0LA 2HADA 1B15A 3BMXA 4HAXA 4XX0A 4ZDIA 2D8MA 3MELA 5CBPB 1Y3HA 4QTZA 3TAXA 1BMDA 1L4EA 3C8HA 3EA5A 3FB1A 5AOAA 5KREA 1RAFA 1RADA 1U0FA 3DAPA 5J63A 1JFSA 1JEQA 3PFKA 2VKQA 1ABEA 2WJPA 5J5VA 3M4XA 1YQUA 4LA4A 4P4NA 2OFXA 2GRJA 1WKBA 5EJ4A 4MPJA 3KLNA 4KE9A 4EO4A 5FUMA 1N2SA 3SVLA 2Q6TA 4I5EA 1F6BA 4FDVA 2FN4A 3ROXA 1T3TA 3WWOA 3GZTB 5B6IA 3KB1A 2DAPA 1I7QB 1JA9A 1P39A 2ZRQA 4FJ1A 1BWPA 2JCYA 4INPA 5FORA 2JFPA 3UB2A 4C22A 4CQMB 4DV0B 3JARA 4G5OA 3QOFA 2PMFA 3N59A 4I14A 3HU5A 2IPXA 3QEKA 4NE7A 4OLFA 5B7GA 2WILA 2QD2A 3GQBA 3W3AD 3UK6A 3BREA 4KJZA 1IJKA 3WGGA 1AK2A 4D4LA 1X1SA 4HBZA 1GYQA 4IG9A 3PUWA 1U7WA 1T34A 2BFCB 4JLMA 4L5AA 3UHFA 4CQLB 3O94A 1Z4QA 1O97C 4C43A 4CLRA 1JLHA 2ZTLA 2ZI6A 2LV8A 1EAMA 4DQDA 1ZRNA 2J4DA 4GIBA 4BNNA 5ICCA 5LZ9A 3DGFC 3TECE 2DUJA 4Q1EA 4TTTS 4BGDA 2QLNA 3MJFA 3QRWA 4URYR 2AR0A 1HETA 2I3AA 2AJCA 3PU6A 4LNHA 1V2GA 4IWYA 3AFMA 2WWRA 1FMCA 1D04A 3M6XA 1JHXA 3LSTA 5E7IA 1JR2A 3HK2A 3QV1A 1S3IA 1GOTA 4PX9A 1JQJC 1O5OA 3I8SA 3WLFA 1ZL0A 2RKBA 3IXQA 5EVJA 4O8CA 1E3LA 3QLUA 1PK9A 5E8RA 2GF9A 2V1UA 3HCAA 2FPRA 1OX4B 4IKOA 2FEXA 4H15A 3OZ7A 3CKYA 4Q3OA 4D2IA 4FMBB 3BCRA 4IXNA 4DAOA 1P44A 3PC6A 3ZXXA 1ODJA 1YDHA 3NV7A 3HN2A 3M9WA 3NHFA 3LDGA 4OHCA 3B1KA 4KO3S 2I4IA 5EERA 1XK7A 4H7EA 3V8VA 4B46A 1QO9A 2V4ZA 3UMRA 1G6KA 1P5ZB 1HO3A 2Q0XA 3PQ4A 2WR8A 5HE8A 3RV4A 1GTVA 5BN3B 2AG5A 3PK0A 3GLHA 3MRVA 2QR3A 2V4MA 3TJZA 2WG1A 4RK5A 3TXXA 3PD0A 1L5RA 2PRJA 5M04A 1SBQA 2EWMA 5TQJA 4ENTA 1CB7A 1PG5A 3S81A 1GZUA 2G1PA 1TZMA 2NO7A 3Q0TA 4XYBA 4BV3A 1BRMA 1EX6A 3NBMA 2GDJA 3FOZA 2GB4A 2YIJA 1HDRA 1M7GA 2IZ1A 3C39A 3HDHA 4D3XA 4Z7QB 7MDHA 5LNK1 1NVDA 4ZJZA 5EA2A 5DCUA 4PC2A 4GYWA 3KPWA 1JHDA 3JZIA 3QEJA 2QL9A 1XLVA 4UBMA 4CG1A 4MHOA 3KAJA 2QIOA 3ZNQA 3GFVA 1IK6A 4F8YA 3W04A 2AR9A 2QT1A 1G9XA 2K4MA 1ULAA 2V7QD 3K0AB 1SD1A 3MCVA 4UJ5A 5K3EA 2H08A 3N8DA 4B8YA 1DXOA 1YCHA 1NU6A 4HFRA 5SZIA 3RSQA 1CRPA 1E9EA 1OZFA 4Y2HA 3QWAA 2XUDA 3GH3A 4J1QA 4UTPA 1GIAA 4MYSA 1E63A 1PYDA 1Q74A 5DX0A 4C0XA 4D5EA 1U65A 4C4ZA 4DMMA 6YASA 3EZ9A 3OPXA 3TD6A 3LY8A 4GBGA 4MUGA 3UMFA 1QVWA 3QBVA 3H84A 3T1NA 4R69A 4QDJA 5CDGA 4YCJA 5MHTA 2Y9MB 4D82A 1EK1A 5DBOA 4DR4B 1P9WA 1LC0A 1Q7EA 2XRYA 3NTQA 1H05A 4AS3A 1EGMB 3TWOA 1JPNA 2B4RO 1E4EA 2NMVA 1ZK3A 1HTTA 5KVVA 2XCQA 3EASA 5DWDA 1L7DA 3KSZO 2W6JD 2HU7A 2DLDA 1GPJA 3TK1A 4Q93A 4CUJA 1M74A 4JR2A 5BY2A 4F2PA 3SI7A 1GA4A 3LUJA 2I2DA 4LVCA 1OC4A 4Z0NA 5AJVB 3COPA 3DB2A 3U6KA 4PAQA 3I2FA 4I5GA 5JSFA 1AKEA 3ZE8A 3Q5DA 2QTZA 1CS4C 1Z2CA 2YXBA 2M9MA 1AXEA 1R6DA 4WJZA 5I9BA 5C1IA 1Z0DA 3L0YA 3RVJA 4GPAA 3T5CA 4A8JA 3NCHA 4LY0A 5DULA 4A15A 1AB5A 2H1WA 3I30X 2ZSIA 4G4GA 3H97A 3ISJA 3MJ4A 1RLUA 2HDOA 5A5EA 3IJRA 3OZEA 4UHHA 2J48A 3SNHA 3FHCB 4M9ZA 4DA9A 3IS3A 1ESEA 2B4YA 3NNNA 3QEMA 3PHCA 5GV7A 2ZAYA 4FC6A 4FIDA 2Z8XA 3UPTA 1A5BB 4OJYA 1LGYA 3W5CA 4QQRA 1QNLA 2FN9A 1NUAA 2DCUA 3M6UA 4KTVE 2ZS7A 1NNI1 2B5OA 1HT0A 2WHRA 4ARCA 4HQ6A 1O03A 2DR0A 2Y71A 3AEKA 3NI2A 5F64A 5IAEA 4YA6A 4BGEA 1JR3E 1ZD5A 4H6WA 1KZYC 5E2AA 3DFFA 2VJYA 3DBHA 4O1IA 2REQB 3JQEA 2EJTA 1NBMD 1JQLB 2QP9X 1OPRA 3QY9A 2AOXA 1TB4A 1G4UR 3FN4A 4KXVA 1N2IA 2I55A 3VJRA 1BZYA 2XITA 4EF6A 3UMVA 4ZYWA 3R7DA 3WNZA 1OY1A 2J9GA 3CX3A 1ZJWA 1XNGA 5JZ9A 1T0UA 4RHYA 3QY0A 4EYEA 1W4CA 3KSRA 1SUFA 4JV5B 1SXJD 1UPCA 3CH6A 4M7OA 1T9GR 3SQXA 4P31A 4FW9A 2OTCA 5TMEA 5BWOA 5F35A 1G8JA 3KTOA 3RRBA 5CX1B 5BOSA 2AFHB 1YZKA 3ZWBA 2DPHA 2QVXX 3DZBA 2WMYA 1PUIA 4RS4A 1YOBA 2QZSA 2IYRA 4AZ3B 1Z08A 2WF7A 3D8RA 1R9JA 2FPIB 3OO0A 2GCOB 2OMKA 4NARA 5ALDA 4BLUA 4MXDA 1UKVY 1JS1X 2DP4E 2XVMA 2HF7A 3P52A 3ZQUA 1V41E 3AY7A 4GI2A 2RCNA 3QLJA 3QVWA 1PJZA 2A4MA 2EWWA 1OLUA 2CDNA 2X5JO 2HNBA 4M36A 4F2HA 3WJ7A 5LWHA 4PGMA 3HMKA 1KHTA 4C0AC 1AQJA 2F62A 2O2SA 4XGQA 1U7XA 4YJFB 1WULS 1NHGA 3KQMA 1MT0A 4E31A 1AT1A 1ZUIA 2OVBA 2W5UA 1J0DA 3T0GA 4RF2A 1DBRA 3ETCA 4MRMA 5DNDA 5TF4A 4ZI2A 2ZZNA 3VKUA 1Y80A 1XVLA 1RPTA 5CVUA 2Q2NA 1J42A 3G0IA 3TQTA 4YJ2A 4H3VA 2XX3A 5F33A 1FVFA 2XWQA 2RHCA 1JAXA 1LLCA 2EP8A 3LO5A 3VNQA 3WAKA 1XD2A 4CU2A 3MYYA 5CVCA 4DBZA 2NP7A 3AJEA 1S3FA 1W46A 4XSHA 4YXFA 3VX4A 5AM2A 3WAJA 1IEWA 3Q8MA 2ATIA 1KTVA 3NASA 3HCNA 5GOZA 4CLEA 5EHXA 3JWEA 1ADFA 2BZ1A 4FFRA 3AHEA 1RCUA 1NI4A 1RQ7A 1I1OA 1Q1GA 3L0OA 1JG3A 3T8YA 4BB5A 5FLKA 2PUGA 5TE9A 4ID3A 2NM0A 1OAAA 2R8EA 4KPUB 1KI3A 5KEIA 1RKUA 2PUBA 4AULA 1D4AA 1I2MA 1IHUA 2OHVA 5F73A 3TFWA 5JHHB 4IUBS 3U3MA 2IXTA 4QBTA 3B1XA 2FEKA 3OJFA 1ZGCA 3L7DA 1MDFA 5E1OA 4IQFA 3GG2A 5B3JA 1MO4A 1UBHS 3I6MA 4RSGA 5K0NA 5K0LA 4BO5A 1GYRA 1CK4A 1BHO1 1G3RA 3A9CA 3JQFC 4KV9A 2Y8EA 1MOSA 2Q29A 3TZKA 2IS2A 4ND6A 1FFYA 3SXJA 2DGDA 1LPNA 2O1EA 3QNWA 1XXLA 1XKXA 1KZ4A 3P2KA 5FP0A 4EW6A 1K5HA 3F5QA 5EQJB 4J0FA 3JYOA 2OOKA 2VHTA 1R0WA 4BAUA 3GLGA 3IDZA 1HKHA 4Q7MB 5HFJA 3ELDA 2ATEA 1EZ4A 3CE9A 2XUPA 3VMMA 2OP1A 4BZQA 2FB9A 5CJJA 3L77A 5DBGA 3L8CA 2DPXA 1P8JA 1XTJA 1WDMA 4M4SA 4JC8A 1F8UA 4YRZA 3DT8A 5DM60 1OFTA 2W98A 4M49A 3DOHA 4TS4A 3PP8A 4CF3A 1H0KA 4KQFA 5DK6A 1KGSA 3OURA 3UJDA 2X6TA 1NULA 2Q4OA 4X8MA 4Y2VA 1UKCA 4DSAA 1A5ZA 3TLKA 1PGPA 2B6HA 1DG3A 1SBYA 1SAYA 2RGWA 1Z2EA 3M6VA 1LTHR 4RLFA 3H9BA 2ONCA 4TKVA 1F4LA 4DCTA 3WLJA 1U0EA 2LKDA 4OGKA 2OCLA 1JB9A 1OIWA 2F3SA 4F1KA 3SQNA 1D07A 1UK6A 2Q6KA 2VDJA 3PQ7A 3H1EA 4YVFA 1QG4A 1W49A 4JQSA 1UZAA 4XGIA 3T99A 3OUZA 1FTYA 1A04A 4RA6A 1OI2A 1X86B 1MZVA 2F1KA 3QIAA 3MGBA 4DJ5X 3GNLA 1E61A 3E15A 3FTNA 2XAAA 4J7XA 1EQUA 1F8XA 4X1KB 4NRDA 4C7OA 1VJTA 2X1MA 1LPPA 3BWXA 4CKEB 4V1CA 2JGDB 4J1NA 1E96A 1DUSA 3KV3O 4C6TB 1TPZA 4LQLA 1ZMBA 1R8QA 4YLEA 2IGBA 3VH2A 4YMSA 4AJNA 5AHRA 1MV5A 1HNZB 3NHKA 3UIEA 2WT8A 1CFJA 3I1IA 1E1NA 1BH2A 3VTZA 4C5BA 3ZE6A 3L6DA 1E32A 4AU1A 5I01A 5IHXA 1JIQA 1F14A 2AI3A 3DVLA 3VM6A 4Q03A 4JI3B 6GPBA 3LUFA 2QMUA 1O3YA 3FYUA 2ZAGA 5LUAA 3WRXA 5CTAA 4DAEA 3DLBA 4UM9D 2CWWA 3QKTA 1EFRD 4MRAA 4BVFA 4LRTB 5DU2A 2PGAA 5TDHA 4O4HA 4EG1A 5FYDA 2XY4A 3FPKA 4AY3A 5JJBA 2YWFA 4UOZA 1UINA 3NPAA 4CODB 1U9ZA 1QJ4A 2D0PB 5D85A 5DH9A 3ZQJA 2ZROA 5B1EA 2C8LA 1SRQA 1WB4A 2IYZA 1WW8A 2P9CA 2RKOA 3FVWA 3OT5A 3R7AA 1OFGA 2GZ2A 3WIVA 3ZDRA 3GD5A 1C0IA 3KQKA 3KQQA 3GGOA 2BLNA 1GVHA 1RYZA 3KZCA 4H35A 4JKOA 4UEOA 3STTA 1KS9A 1BHQ1 1D7OA 1JL3A 1LVHA 1GT6A 1NXSA 2BN4A 5JRZA 3GCDA 4M8SA 3GO4A 3IT0A 1VI2A 1YDGA 2WWGA 5CDYA 2QN6A 2DPLA 4QBFA 5FBKA 2I3ZA 4DLXA 5BWCA 3H5NA 2QZ4A 1B1AA 4JWTA 3FKSA 1P31A 4E1AA 4DWVA 4B5KA 3U5ZB 1OAKA 4Z8YA 3I05A 3Q4GA 2OEPA 2PJZA 1E5DA 2XBLA 4TSFA 3SK0A 3ZU4A 3C7DB 4E5PA 2WFMA 4QODA 2WKRA 3FPAA 4ND4A 1PVVA 1KMHB 2UYOA 3HYRA 2Q2QA 1UPAA 4HAWA 4HDCA 3VR3D 4YYEA 1XEWX 3WC4A 2QPAA 5ERYA 1BD3A 4GM1A 4MEJA 3BMQA 3QI2A 1UXHA 2N3ZA 1ZGBA 1U80A 2PSDA 3BD9A 3TZLA 1TQDA 1QMPA 2VXBA 1NKVA 4A2PA 3WQBA 4ENRA 5IX8A 4COKA 3DO8A 2AG8A 2G1KA 1VKOA 1X94A 4UVHA 4D4GA 1DEKA 3GP3A 4ZZ0A 4HB0A 1ADJA 4LFAB 1MG0A 2VDQB 3DDWA 4KK4A 2XT0A 2YN0A 1K75A 2D4AA 4II2A 5B7PA 3LY7A 1JVBA 4CR6A 3OBIA 3P4UA 2XECA 1FMFA 4NTZA 3TVTA 1Y8QA 4PYQA 4BP8A 4NYMR 4B75A 4HVTA 3Q7TA 1A1SA 5KYXA 1VL1A 2CN1A 3VHXA 3S7ZA 1JU3A 3VYSB 1DNPA 4P82A 2H92A 2SECE 4AUEA 1X7DA 2PT6A 1ESZA 1I36A 1NONA 5JQGA 3CLUC 2JRLA 4HJXA 3GGJA 4L0DA 4RKWA 2OC4A 3DFZA 4U02A 4D98A 2JL1A 4QECA 2HRRA 1QCCA 3KALA 2REOA 3EQ2A 3KZKA 3UBMA 4WLEA 1CHNA 4M46A 1NR1A 2P2YA 2FWPA 3PTZA 5K3FA 2X0EA 3EXAA 2YYYA 4MS4B 3NETA 4W7HA 4EAAA 1T36A 4BNMA 4JJGA 5HJ5A 4NJEB 2I1VB 3FFWA 5BQOA 3S70A 1GM5A 1ESCA 1WKCA 2J0UB 5BRNA 3QLTA 3W6OA 5JLJA 2R0QC 2DLCX 4YJ2F 4X7PA 5KVAA 2D4HA 4Y2XA 3KOYA 1N8NA 2X86A 1ZR2A 2PKYX 4FUTA 3QU4A 3HWX1 1N2OA 3LBFA 1B6RA 1I6WA 3BF7A 1KJNA 3LY9A 2UUBB 2DE0X 4UMFA 4D0NA 2VF5X 2FP4A 3T3EA 1ZCBA 1KI6B 4UM9B 3DFIA 1PZXA 2R6DA 3T3GA 3SZRA 2V7PA 3RUFA 4KAAA 3ZNPA 4A2WA 5CCBA 3K9HA 4TXMA 1H5QA 1XNJA 2FWRA 1NBEA 3HU2A 1XLTA 3RODA 2MDTA 1FFCA 3GRKA 3LV8A 3MGAA 1TYAE 4JJFA 3N8IA 3DQQA 3K2BA 2XOKA 4JJEA 4KQEA 3UXEA 3NIDB 3SR4A 3QYAA 3O9VA 4MWBA 3GFTA 2ONJA 4DC0A 3EXEA 5IJAA 5KYYB 1SXJA 3QWHA 5EP2A 3WL6A 1FFHA 4IF4A 2MR6A 1ADBA 1C9EA 5K3DA 3P96A 1KAQA 1AX9A 1O7JA 3BKXA 3O5AA 1YBFA 3F98A 4UAJA 2NSHA 4WFIA 1JIKA 2D2FA 2QE7D 3QF4B 3ZIUA 3OQHA 3NOVA 1J1ZA 4AKTA 1NQXA 1R1DA 3RU3A 2IZ6A 1MB9A 4HGOA 1O9HA 3U4AA 1FMLA 4BOYA 2PVPA 2QUZA 1FOEB 3SS8A 2QN2A 1K0UA 3GEHA 4C20A 4X1IA 1Z2AA 2CE2X 2HLNA 2OSBA 1U4SA 2GNOA 1IXZA 4QG3A 1GQRA 4N47A 3V1UA 5AVQA 4ZVKA 4IDHA 2DWPA 2C0CA 3AYZB 4KVAA 4OP1A 4Y9UA 1K5DA 3VR2A 5C5IA 2QU8A 3AB3A 4I4IA 1UXIA 3VNUA 4BNKA 2GHRA 5HHTA 1VSQA 3I2GA 4C0SA 1V16A 4DNOA 2ZRJA 5CNMA 3T7EA 1A2OA 2X9NA 2LCQA 2FRDA 3QU2A 3RV3A 3IAS1 4FZVA 1MRSA 3PYMA 4HQKA 5IH7A 4FWTA 1X8KA 5JS1A 3O92A 2JHPA 3ZY2A 2EGUA 3AT1A 4OTZA 4Y1GA 1XNHA 4DV7B 2H1HA 2PMBA 1N4DA 3GLFE 1EVLA 4A8TA 3SX4A 2XZLA 5DCYA 4XR9A 5D51S 4O2BA 3I12A 3LL7A 3QXJA 3L3BA 3H42B 3PNBA 4IZHA 1G2OA 1DC3A 1IBCA 2EKBA 3GIWA 2RGBA 1EP1B 1PWXA 1P7WA 2JJMA 3K94A 4PS0A 2BEWA 5IJWA 1UBJS 3PYLA 1E2FA 1YWGO 5AESA 3OZIA 3RRYA 3U3DA 4B82A 2Z98A 3KEOA 2HRCA 1EEHA 2AX3A 3FWYA 3GIDA 4MGKR 4TT8A 3TRKA 3ZWVA 4PBRA 1PJSA 4R1TA 3X2EA 3HJTA 4DFDA 3ESQA 3WLTA 2W43A 3AETA 3DEAA 2G8LA 3DWFA 3E84A 4IICA 4RD0A 4BE9A 4YRBA 4BVLA 3R3XA 4RY9A 3GA5A 1G6HA 1LXCA 2GGSA 3LI2A 1HYEA 1QLHA 5J5CA 1XRSB 2A6PA 3TCXB 3G23A 4INAA 2BUAA 4QPJC 5BR7A 3LUBA 4HXFB 3CLSD 4BNDA 5CDUA 1HYGA 4WDRA 5KZMB 5HRCA 2YJ3A 3PWSA 1KEPA 2P9JA 3HZHA 4ND8B 4U5QA 5DOVA 3X0DA 1Z4IA 5A1JA 3JPWA 2FFQA 3IEUA 3IALA 4WY5A 1P2VA 4C0HA 1TQ8A 2L82A 3I8OA 1B1CA 2QMOA 1ATZA 1RHRA 2BMFA 3GNQA 4D97A 4QDKA 2H8GA 4J07A 3G9UA 3QVTA 4EENA 2IUTA 3OP4A 1GCGA 1QGED 4O4HF 4M2LA 2ENUA 3R75A 4E5UA 3MB5A 4FN5A 4H7HA 4Q3NA 1BMTA 1XWIA 2NZYA 1OXXK 1Z2NX 3L0BA 4FUQA 5HJ2A 3WMEA 4EQ6A 1EGVB 3RS4A 5I4KA 5C1DA 1L4FA 1CCWA 2BBTA 3KVOA 1SA0A 4OGLA 1JXOA 1WW2A 1QCYA 1QIFA 2IYAA 3O9MA 4AG6A 3ZWCA 1ADGA 1SOMA 4B4UA 4MA0A 4KX5A 5BPFA 2C98A 2CBGA 4AL4A 4XARA 1XN1A 2BJHA 1U8CB 1VPVA 3C6BA 5LBUA 5C3UA 2CKDA 3EQZA 4D4HA 4HL6A 4MARA 1FSSA 1Q20A 1UXGA 2RGYA 2CXNA 1C8KA 1TUIA 4FS3A 4IIDA 3U0VA 3EGIA 4ZCIA 1WDTA 3QMWA 5MN6A 5H16A 3FTPA 5KPJA 2JKYA 2C5LA 4NFLA 3FVRA 4JAVC 1D2AA 2IYYA 3O8OB 3ZI4A 3IAUA 1IVYA 3BE6A 2VYQA 1E2MA 3H5OA 5IXYA 3FI9A 4YMHA 3IJEB 4LSMA 1HMPA 3E70C 3T4UA 3OEHA 1AKMA 1FYFA 1Y1KE 2BELA 3L8ZA 4GVPA 4L85A 4MKZA 4ZC1A 1TYEB 2BMWA 1O0SA 2J5BA 4HMOA 4AF8A 1NXWA 4MA5A 1JG6A 4OQNA 2HKIA 2WZQA 1CHDA 3GEGA 4RYDA 3GPDG 1TDJA 3UTCA 4AF6A 4E0BA 3KOXA 1ISGA 1QWOA 4RF3A 2PRKA 3PI6A 3EW9A 1A9YA 2FHPA 2YXNA 3WGIA 3NB0A 3LT2A 4M0EA 1Z39A 2VI5A 3F78A 1N1MA 1V8FA 3GOQA 4B3MB 1T2NA 4C6HA 2R7LA 4RA9A 2JA1A 3RHSA 3QLVC 1I4WA 4MYCA 2C2YA 1ULHA 1SXHA 1WZCA 4JJ6A 4LV5B 4UAUA 2P9TA 3KOOA 5ESWA 3T7CA 2ZE5A 3GF4A 1XMXA 2WM3A 2H7XA 5JQGF 4ECEA 2VAXA 2BM8A 1DE0A 4HWTA 2CNOA 3V8BA 4HQLA 2IIPA 1BFUA 1BX0A 1ZN7A 4ZI7B 2ZRGA 4MQUA 3H6KA 1CUSA 1H8HD 2Y1FA 1HT1E 1K66A 5FNVA 4TYWA 3EVGA 3BMOB 3NP7A 2ZZKA 2XEXA 2X0DA 4BBAA 2Q2WA 3FTEA 1JHQA 4M0FA 4K9RA 3B13B 3GLSA 1CEQA 1BA3A 3ZU5A 5DHQA 3T5DA 4M8NE 4B3JA 1N92A 1T24A 1KVSA