3HS3A

Crystal structure of periplasmic binding ribose operon repressor protein from lactobacillus acidophilus
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
264
structure length
264
Chain Sequence
b'KKSKMIGIIIPDLNNRFYAQIIDGIQEVIQKEGYTALISFSTNSDVKKYQNAIINFENNNVDGIITSAFTIPPNFHLNTPLVMYDSANINDDIVRIVSNNTKGGKESIKLLSKKIEKVLIQHWPLSLPTIRERIEAMTAEASKLKIDYLLEETPENNPYISAQSALNKSNQFDAIITVNDLYAAEIIKEAKRRNLKIPDDFQLVGYDNNILCGYTSPTISTIDQNPKLIGQTAAHRLLDLMSGNNSTRNSIIDVLPIKRDSTEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose operon repressor
publication title Crystal structure of periplasmic binding ribose operon repressor protein from Lactobacillus acidophilus
rcsb
source organism Lactobacillus acidophilus
molecule tags Transcription regulator
total genus 99
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hs3A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hs3A01
2PLNA 3IPAA 2E4WA 4RK4A 5DKFA 4OLBA 4KRFA 3ROFA 4FE4A 2IDMA 2MSLA 2HJ9A 3C3WA 2MYTA 1EFAA 4YCSA 5TPWA 3BBLA 1QP0A 1Z12A 1QQAA 2W42A 2CHEA 3F6CA 2HQRA 3LUKA 1DP4A 3KHTA 4MRMB 4KMRA 1MB3A 1USIA 3I09A 3OQMA 3MMNA 2ZAYA 5T3YA 4QPJC 1YMVA 4KQ9A 1R8JA 4EYKA 3BRQA 2JVJA 3QX9A 1KRXA 2NZVG 2QR3A 3OO0A 1NATA 4PYRA 3NHMA 4WUTA 4L85A 2A9PA 4KNYA 2FLWA 1C4WA 5C5CA 4YP9A 3C97A 3OQNA 2IKSA 1W25A 1B00A 5IX8A 4MLCA 4OG2A 5CNIA 5TPZA 2QU7A 4XASA 3KLNA 3HM9A 5HKOA 2A9RA 1GUBA 4DADA 3DLHA 3CTPA 1ZN2A 3C3MA 1GUDA 3Q9SA 4D74A 6CHYA 4XFKA 4NCBA 1RXIA 3NHZA 3D02A 3JVDA 1ZHHA 5KQMA 1VPWA 1OXKB 1ZGGA 4MGEA 5FWXB 1RXEA 2L17A 4JOQA 4RXTA 1KMIY 1QQBA 3O1HB 3OMWA 3EULA 3LOPA 4FE7A 4RKQA 4CBVA 3FFXA 4QICA 4XLTA 3DGFC 2Q5CA 4EVQA 2VUHB 2WY2D 5I4CA 3GL9A 5JS2A 1LBHA 1LJLA 4RK5A 3DGEC 3K4HA 4W5RA 4HYEA 2PUFA 1IIBA 3CU5A 5EWLB 2F8TA 1TMYA 1JYEA 2ID7A 1DBQA 3DLBA 1LK0A 1VRVA 2WRZA 4TLMB 5IC5A 3MQ4A 4MYRA 1ZY2A 2FQWA 2IPLA 3ROTA 5JNWA 3H1FA 4MRMA 1U8TA 2ZWMA 4FB4A 4EVSA 2FN9A 1Z18A 3H5OA 4Y9TA 1JWLA 1NXVA 4PEVA 4RY8A 4LE2A 3IP9A 2MSWA 3OLVA 3RVMA 3C6QA 2XDYA 1DCMA 3GRCA 5HM6A 3JS5A 3O2JA 3N0RA 3Q7TA 2RJOA 1NXWA 4LE1A 4KREA 2CHFA 3DBIA 4HNSA 3RVOA 1A2OA 5D2CA 1ZITA 4N47A 3A0RB 4L4UA 2MYUA 5F64A 1I3CA 2FQXA 1DBPA 4EUKA 2FSPA 4G0XA 3HVRA 2QVCA 1TLFA 4W5OA 3URMA 3FFWA 1BDHA 2PL9A 3LUFA 1NXSA 3M9XA 4RU1A 4ZYLA 3N53A 1Z16A 4RXUA 2PJUA 2A9OA 3EJWA 2JB9A 5FWXA 4EGSA 2PKXA 1JFVA 4IILA 2FTKE 4RXMA 4WXEA 4MS1B 4KVFA 4YLEA 5HQJA 4Z4IA 1P6QA 2E4ZA 2AYXA 2X7XA 3H1EA 4MR7B 1TJYA 3MYYA 4RK1A 1M2FA 3QELB 4ETIA 2WJAA 4Z4CA 1E6KA 1GCAA 1T34A 3KCNA 3JTEA 2FMIA 2FMFA 2R47A 5EWLA 3SY8A 3FFTA 1OXBB 4ZMRA 4JAVC 3FDFA 2WWVD 1QKKA 3KJXA 4UHJA 2L2QA 2O20A 1WETA 3R0JA 5TPZD 1JF8A 3SQNA 2VK2A 4Z0NA 1AB5A 4RKRA 3OO1A 1FQWA 4E7PA 4Q7EA 1QP4A 1JBEA 1SXGA 1YS6A 2LIVA 3JY6A 3O2SB 3BREA 1RPJA 2R25B 1YVUA 4Z9BA 1DZ3A 3O1IC 3RVRA 3CKMA 3I42A 4YS6A 1H9CA 1DBWA 3QLUA 3KYJB 3MM4A 2NZUG 4RK0A 3LKBA 4YV7A 4RK7A 3EAFA 3RQIA 4O1HA 1ZH2A 4G97A 2JVIA 2PUBA 3A0UA 4M88A 3CZ5A 3N0WA 9ABPA 2VUIB 4S05A 5DTEA 3KSMA 4IRXA 5KQPA 2F8SA 2J48A 1MAVA 4MQEB 1USKA 5CNJA 3OLXA 4WT7A 3RVKA 3HUUA 3T8YA 4G0PA 4OATA 2FMHA 5B3JC 3CFYA 3RVPA 1D5WA 1RZRA 2QSJA 3NNNA 1SRRA 2R4QA 4JB0A 2GBPA 3H1GA 1LBIA 3N6VA 3O2QB 4MQFB 4NCAA 3F6PA 1PHRA 1K66A 3RVSA 1E6MA 2FEKA 2JCGA 4MLDA 4MS1A 4KPYA 5BQ3A 2PMCA 1K68A 1SXHA 1USGA 4NICA 1EHCA 4MR7A 1FSPA 4RY0A 3GYBA 3Q41A 3EGCA 3QELA 1J56A 1M5UA 1NTRA 1U2QA 5JNSA 1P8AA 3EDCA 4DN6A 1F51E 5JS1A 1L5ZA 4B09A 3QLTA 3KKEA 1MIHA 3LKVA 2FMKA 4PE5B 2FLKA 3F73A 1BA2A 4MS4B 4MS3B 4O5AA 3DZDA 1JFSA 2RJNA 3MIZA 4OBBA 4QYMA 4ZMSA 3O75A 1PUXA 2FEPA 1ZAYA 2JK1A 5DCLA 3VNAA 2RDMA 3QEKA 1QO0A 3IP5A 2B4AA 1ZVVA 3KLOA 3GBPA 2PUAA 3UK0A 4F8JA 3M9WA 1U0SY 4RY9A 4G0QA 3C3KA 3NBMA 4XARA 4OLAA 4Z4EA 3A3KA 4MPTA 3RVQA 3KTOA 4N41A 3HCWA 4RS3A 1BAPA 4MAAA 5IEBA 3H75A 4ZPJA 1YIOA 3K9CA 1APBA 3VNBA 3CG0A 3N8IA 2A9QA 3O21A 5CNMA 4MQEA 2CWDA 5B3JA 3GV0A 3QEMB 3QLUC 3HDVA 3TX6A 3FGZA 3SNKA 4XXHA 3RH0A 3OQOA 2QVGA 4JB2A 3ILYA 2RGYA 6ABPA 4LE0A 2BGGA 1P6UA 3HSYA 2FEWB 3Q15C 3CHYA 3D8UA 4MQFA 1PNRA 3LTEA 2AYZA 5TQ0B 1QPZA 3LUGA 4IMIB 1VLZA 1GCGA 1C0EA 2QV0A 1P2FA 3SAJA 4ETNA 1JDNA 3H5LA 5BRAA 4G0MA 7ABPA 5GQSA 2OENG 3GA5A 1Z15A 1EAYA 2E4XA 4OTZA 2LBPA 4YO7A 5E3JA 1E6LA 4F12A 5C5EA 3H5IA 4Z4HA 1ZDMA 2PUEA 2NT3A 1E2BA 3T6KA 4G0ZA 4MS4A 4MS3A 2WJWA 1DC8A 2MYNA 1FFGA 2QW1A 4MR9B 3GBVA 1QNLA 1DG9A 2FQYA 3L49A 4KFCA 3LUDA 3LMKA 3NNSA 3G85A 1JHZA 4JASB 3HK2A 4EYOA 3EODA 3MA0A 3O1JC 2ID9A 2N9UA 4KV7A 4RWEA 4TN5A 3BRSA 3TMYA 5PNTA 4ETMA 4YR7A 5KC8A 1RZRD 3SM9A 5T7BA 4IF4A 2YHBA 4Z9AA 1YK1A 1QP7A 1Z26A 5EWMB 4YWHA 1KGSA 2VYCA 4XAQA 3HJFA 4G0OA 4KK3A 1CYEA 1LJUA 1JFTA 3HO1A 3LUAA 2L19A 3T38A 4QYWA 1Z13A 3RVJA 1MB0A 1XHFA 4H3KB 5DGCA 3HZHA 1NXXA 2P9HA 5TE9A 2HPHA 1Z25A 4EVRA 3JPYA 1NXOA 3QEMA 2B1JA 1VKRA 5BRJA 3H5VA 3EQ2A 1ISSA 4HNQA 3N75A 1PEAA 1DC7A 4LX8A 5IUKC 3HUTA 4KZKA 2I6FA 4MR8B 2QXYA 3CLKA 3QLVA 2MSKA 2V0NA 3M6MD 5TQ0A 4EYQA 1QO0D 4P98A 3CNBA 2GWRA 4WXMA 2L18A 1DCFA 2NT4A 3QK7A 5CNKA 3UUGA 1Y1LA 2HSGA 1URPA 1CEYA 5FBHA 2GI4A 4Q6WA 2HQBA 1ISRA 4GNRA 1PNTA 2M98A 1YTUA 3A10A 4EY3A 3IPCA 4JP1A 2HQOA 3T95A 2LUOA 5JNRA 1SD5A 5JNVA 4RV5A 3TO5A 1YS7A 4EYGA 1NXPA 4MR9A 5EWJB 5KWSA 3HV2A 4TMYA 2IYNA 2OQRA 3LUHA 1UDRA 4G86A 4E7OA 4IGAA 1GLGA 4PZ0A 4YRZA 3OLZA 4LZLA 5JNTA 2R48A 3IP7A 1JLKA 1JH9A 4NV3A 2JBAB 2NUBA 3OLYA 3P9YA 1M2EA 2E4VA 3S99A 1EWTA 5IBQA 4UHKA 2P4UA 4RSMA 2PUGA 5IUJC 5KQGA 4LDAA 4IMJB 2PUCA 1CHNA 1PEYA 2FXIA 3H5WA 3I5AA 1ZESA 1DJMA 3HEBA 2M1ZA 4N0QA 1JX6A 4Q6BA 4RDCA 5EWMA 1YMUA 1YK0A 2H0AA 1Z2DA 2LP4Y 3LFTA 4GPAA 4N76A 3GT7A 4DQDA 4W5QA 1Z2EA 2PAFA 2PE5A 1BVHA 5TQ2B 3OM0A 2JRLA 5FWYB 2FVYA 3G1WA 2E4YA 1JYFA 4KQCA 5IUNC 2PL1A 3H6HA 3OLWA 1U2PA 3KYIB 2JVKA 3FMVA 2GKGA 4H60A 3NNDA 4Z4FA 1D1PA 4P1ZA 2DRIA 4RZSA 4WWHA 4G0YA 4H3HB 4MR8A 4YGXB 5IULC 4S04A 1BDJA 1DCKA 5GOTA 3JVIA 3N0XA 3RVLA 3HXMA 3CZCA 2IOYA 2IPNA 1EWVA 1XWWA 1TVMA 1AB6A 4F3TA 1D2AA 4D6YA 3GWGA 4N03A 1F4VA 3ILHA 3CS3A 3B2NA 1A04A 5TPWB 1FFWA 3HDGA 3IDOA 1BDIA 3QX8A 2MYPA 5ED4A 3KG2A 3L6UA 3QLVC 1Z17A 2CD7A 1ABFA 3W9SA 1NY5A 4N0PA 5KC9A 3EQZA 2QZJA 5EWJA 5FBKA 3SG0A 1DRJA 5TQJA 1D1QA 4ML3A 4F06A 4ZJPA 1U04A 4PICA 1EWKA 3MF4A 1S8NA 3Q7RA 4LRQA 1W9HA 4F11A 3KS9A 2PUDA 5KQLA 2GX6A 2JBAA 3O74A 1JDPA 5HSGA 1NXTA 2LPMA 3Q7SA 1MVOA 4HNRA 1FFSA 8ABPA 1RNLA 4WZZA 4Z4GA 5KI6A 4D6XA 2H3HA 2IPAB 4LDZA 1ZGZA 5CHYA 3TD9A 1JL3A 3BILA 1ZH4A 3JPWA 3F7NA 3RVNA 2E4UA 2IPMA 3I45A 4RK6A 3HS3A 3UKJA 4W5TA 1KRWA 1ABEA 2FN8A 2KYRA 4TLLB 1SXIA 1A0OA 2FKAA 5TQ2A 5FWYA 1XHEA 2FW0A 2YHAA 3OMXA 1QMPA 1D4ZA 4KK4A 5BR1A 3LUJA 4Z99A 5IEJA 2WMYA 4NQRA 3LUCA 3H5TA 2TMYA 5DLEA 3E61A 1TM2A 1DRKA 1HEYA 4JA2A 3H6GA 3TB6A 3E3MA 3CRNA 4W5NA 3CG4A 2WB4A 1M5TA 3IP6A 3OM1A 1L5YA 5ABPA 5JNUA 4O1IA
chains in the Genus database with same CATH superfamily
1N0VC 4RK4A 4B6OA 4P3YA 3ZX5A 1FNCA 2FPUA 4MWOA 1QYVA 4AKSA 1VL5A 2ISQA 2P1DA 2ZDHA 1MJ5A 2PKQP 2HJ9A 1SXJC 4CQNA 5JAOA 3GRZA 3H8JA 1RFGE 5GP1A 4RZIA 4C08A 1OA1A 2FU5C 5IM5A 2BFMA 4RVNA 5T41A 2QMUA 1VSQA 3OTOB 2B8WA 3OUTA 3ENKA 1G3QA 1YCGA 3QF4A 4V03A 4WJLA 2CL0X 1GSHA 3L92A 1VKZA 4CMJA 1CW2B 2I2XB 2C1EA 3TFQA 1PAUA 2O2XA 3BM5A 3C5VA 3HZRA 5HS4A 3NHMA 2F59A 4BZPA 1KO5A 4NZMA 2QUIA 2FLWA 2HSZA 4FFOA 4LGVA 3ON5A 4PSDA 1JR3A 4AUMA 2FOLA 2EKBA 1NI3A 1SXJE 2WAOA 4UD2A 4AY5A 1C30B 4YRBA 3QKTA 2C59A 2H4YA 3TX2A 2PL3A 3WS7A 2D74A 1ZVJA 4L5AA 2DPGA 3S8MA 1UBKS 4LZAA 5AHRA 1TMGE 1XZNA 3Q11A 3OJEA 2RGEA 3FKSD 1K6MA 2Q21A 2Q3BA 4MEAA 8ATCA 4GC9A 3AR5A 3Q9SA 3A1TA 3OY2A 1VIAA 2Q41A 3Q8XB 5GONA 5JT1A 5FFNA 4JHLA 2PIAA 3E3AA 4YC7A 4XD2A 3SXJA 3WE7A 4BMCA 4DBVO 1I5EA 4I4IA 2O5RA 2D4AA 4G5FA 1P1RA 1X70A 2UYOA 2OAQ1 3ZLJA 3HRHA 3LCRA 5B64A 1FS4A 1GGMA 4HPJB 1KZ7B 1P1IA 4WTOA 4X94A 4BE7B 4Z3OA 3NIDB 2D1QA 3TNJA 4OSEA 3GEDA 1ZQ1A 2FZ4A 2GZSA 2VVTA 3K20A 4H3VA 4HYEA 2G25A 1S2DA 3Q7PA 3KAPA 4M21A 3SX2A 3DLBA 1GGKA 1U8AA 4JEMA 5ERYA 5K0CA 2NZWA 3BMQB 1UP6A 3KJIA 2HK8A 2XMZA 2CUKA 2X42A 4TLMB 4YJKA 3V9AA 2GZDA 5F2KA 4GG1A 1OX5A 3QV1A 4CR6A 1I13A 2XKBA 3VU0A 3DMFA 2CXNA 4I9FA 1QHIA 3I0ZA 2DKNA 2ZWMA 1NNLA 1WX1A 4NEQA 3LFUA 1JALA 2PO5A 3S8EA 4RH0A 5J2TA 1RS0A 2ZJYA 2UXBB 1JB9A 4ZV4A 2FN7A 2BFDA 4ZO7A 1EK6A 1V9LA 1M54A 2XWBF 3L7AA 4Q4DA 2R44A 3FHOA 4YMWA 4BLSA 2C7QA 3LHIA 2RI6A 3WJAA 3JQGB 2JAPA 3SJBA 1UXOA 3VDXA 5EMHA 5HM6A 5DRYA 3KKLA 2PRSA 3L7IA 3B3JA 2EL9A 4FFBB 2OXRA 4LE1A 5AVZA 2H29A 2JFGA 2OAP1 3GJYA 4Q9DA 2V3VA 2B3TA 2I7DA 2Y1KA 3FNRA 4XOUA 2AGVA 4KTVE 5AKKA 2PIDA 3VU9A 5C1BA 1LQ2A 1U7DA 5D3MA 4ZQBA 2TS1A 3ZXXA 4ALLA 4Z2AA 1DAEA 2UKDA 2PL9A 2R7LA 3JYQA 2IYLD 2PT7A 2XNKA 4I1OA 1XMXA 4RU1A 2YN2A 3JW8A 3UHAA 1A9YA 4AKHA 3ZD9A 2EG9A 3NIFB 3V4LA 4PSCA 1BXZA 1NPDA 3BB3A 5ALVA 5J2UB 2AC2A 4F8EA 4Z0TA 3A6PC 4WX2B 1YO6A 1HH4A 2IOHA 4ZVSA 2G9VA 2ZUSA 2OXFA 2QT0A 4KV9A 4ZAWA 2IHJA 4BKMA 3KLPX 4ZV7A 1WMSA 3A6DA 4RXMA 3LP5A 1J2TA 2C2ZA 2GAFA 4RVFA 1Z2CA 4JLJA 2IUTA 2AYXA 3PHGA 5FPTA 3IXQA 3WWPA 1TJYA 2PR7A 3ZXYA 5AESA 4ETIA 1MO2A 3B5EA 1S4MA 1GCAA 2BC9A 2F17A 2XOEA 3FNHA 1NI5A 3OI7A 2JGJA 4GXRA 4HB0A 3TLJA 4TZ0A 4JAVC 2FRDA 4G0UA 1KXJA 2DQSA 2KJQA 1L1EA 1S01A 3EGEA 1M8GA 1TJPB 4V1CB 5D84A 1Y6FA 2L2QA 2FWJA 4EHIA 1N3BA 5HOQA 1Q7CA 3KAKA 1WB4A 5CP8A 1KFKB 4MVJG 5F78A 4I4TF 4V2IA 1SC6A 1WDKA 1U2TA 4Z0NA 1AV6A 2CFTA 4LV8B 2O3QA 4TWIA 3TLMA 5COAA 1NBWB 4IOKA 3STUA 2WV7A 1QJ4A 1RC0A 1UK6A 3J7TA 3ZPXA 1KGDA 3O92A 4A15A 4R0NA 3UWMA 3G68A 3H86A 2OB1A 2AW5A 2HC9A 4C01A 4CIAA 2J6BA 3QLUA 4OUDA 3S2SA 3OZTA 1QE5A 4G24A 5JXIA 3RANA 1IXKA 5E95A 3W6UA 4YV7A 1PQPA 1QGOA 3MT0A 4F9GA 2YVKA 2H4WA 3NV9A 3Q98A 1TIPA 2F1OA 4JBWA 5AWFC 3TE6A 1SUBA 3WVNA 3CR7A 3EMVA 5EPUA 3A37A 2HSEA 5B1IA 4D2IA 3N0WA 1TT5A 2ZRNA 3TNLA 5CB4A 2PV7A 1ZC3A 1W4AA 2XMDA 1GPWB 4UUBA 5KQPA 1VKOA 3L9XA 3AUFA 3ZHOA 2XCLA 1ZLXA 3C8UA 5E8JA 1LNZA 2AYYA 2RHMA 3A9VA 1A69A 1T9CA 4HQ6A 3IBSA 1AOXA 1MG5A 3T3OA 3BSYA 2EGHA 4IR7A 4OATA 1WD5A 1NXQA 5KYXA 1MNQA 1UWVA 1M8JA 1D5WA 2AOVA 2WHXA 3MS2A 4MSUA 4R0VA 1IQPA 3WIDA 3CEHA 5KTMA 1KZYC 3LHFA 5CVVA 1A5BB 1LPNA 3QU4A 3DP9A 3O5AA 3KALA 2Q1UA 4K6GA 4EK9A 3U2QA 4RAOA 2B8EA 3TSYA 5BN4A 1PJ3A 5HCUA 2QLBA 4R81A 2A9KA 2FSIA 3SYTA 1GR1A 2BAGA 4CQLA 1G7CA 3PGLA 3EGCA 4GI5A 1U7HA 2Y4NA 3A6EA 3FUTA 3VHXA 2FG6C 1NQVA 4U2GA 4DN6A 4N3BA 2JLSA 2JKZA 3CH4B 4XKJA 5ESDA 3ANSA 1E9SA 3KO8A 4OHCA 4C0JA 2ZTMA 4ALJA 4Y30A 4DWOA 1GSIA 4Q4JA 1Z28A 3VFDA 1RXCA 3Q1KA 4D3XA 2FPIA 1GR0A 4WINA 1BYIA 1QR6A 1YQUA 5CT8A 1M8KA 1XTZA 2ZIGA 4M98A 1EFUA 1JLHA 5TMBA 5LWHA 2COKA 3CVJA 4MV8A 2DJIA 2RDMA 2W22A 1J2EA 3FNIA 3HXQA 1WXFA 4B8YA 2G17A 1RJ9A 3B5JA 4B6GA 1W59A 4M6WA 3WGNA 3KPWA 1Q3KA 5J9FA 4H0NA 1ZCAA 4XX1A 2D1TA 1R6XA 2K2QB 3DB2A 3F3YA 3PVCA 3LCUA 4DYVA 3P27A 2H57A 1RP7A 3DMTA 1RYHA 2ORIA 2QAGA 3HDHA 3KRTA 2IV2X 1DHTA 3CRRA 2IXFA 2ZZKA 3IUBA 4U9UA 1ARZA 3BHJA 3CEMA 5L3QA 4QHYA 1SUFA 1FNBA 4LAFA 1TGVA 4CRWB 1K6XA 5FFFA 1IBMB 3E15A 3VC3A 3WKDA 5EIHA 5IKPA 1XJ0A 2VATA 3BGOS 3EW7A 5JC1A 2HRBA 3VZSA 1J9ZA 4M9CA 4HEHA 1RYYA 1W34A 3SNKA 4JU8A 2QVGA 1TA4A 2ZWAA 3CLRC 1BU5A 1YQWA 3EEBA 4DCSA 3GRVA 3GT4A 1IN4A 3PGMA 4NFHA 4CLEA 2I3GA 2WIGA 4GZ6A 1DT3A 4RPIA 2X5KO 3GRUA 2IOFK 3DPIA 4N3AA 3TFWA 3B20A 2GJ4A 2Q50A 3JQAB 3OVMA 5KUTA 5JMWA 3FTFA 4HDMA 1SO8A 4TTQA 3Q3GE 4YXFA 1R64A 1AMNA 1V7PC 4KRXA 1GL7A 1NM5C 3H5LA 3O4VA 5KYKA 1II8A 2X8LA 1YUBA 3MINB 4BMXA 1BKYA 4OTZA 4F12A 1JEJA 1XDUA 3PSHA 4OMUA 1ZUWA 2EL7A 4Y1GA 4G9BA 4PO8A 1YAHA 2A5LA 3BTSA 5TT1A 4ZCTA 5HVNA 4A2QA 2XKKA 3KXIA 3QITA 3U7EB 1ZD1A 4IP0A 4WCFB 3P2EA 5LKAA 3B6EA 1TC2A 4NBSA 3VYSB 1O5OA 3U56A 1E9DA 2OCLA 1PTJC 2YVQA 3NNSA 4JLVA 3U37A 2Y1DA 5AVRA 2SNIE 5FKJA 4NOLA 4U7GA 2WWRA 1U9ZA 3KB6A 4WGFA 2YOHA 1E5DA 2BGNA 3KHKA 1MC4A 4MI9A 2C9OA 2R8RA 2C03A 1ITZA 1VXRA 3L6RA 1ONBA 1KA9H 2GCPA 3TTUA 3OCZA 3DVSX 1OAOA 1I33A 1XNJA 1UDXA 3PC8C 4QU9A 4A16A 4E14A 4ZZ0A 5BVGA 1K4KA 2IS2A 5IKOA 4J1TC 2JJQA 2QTMA 3LLVA 2WMDA 3PYMA 3E3OA 4BRSA 2HMVA 2CLOB 3PNPA 4R6XA 4LWZA 2BR4A 2V7VA 2YUIA 4HWRA 4G1FA 4HZUA 2X86A 2C8VA 4JELA 1SG9A 2N75A 1CHDA 1LDNA 5TE9A 4Q7JB 1Z25A 4L9RA 3KLBA 4LJKA 1OB5A 2QI9C 4TXNA 2NUAA 2HDOA 5EJMA 5AOCA 4PQGA 4URHA 3F0TA 4ZK6A 2C5FA 3FHCB 2XXAB 1TUBB 4H6VA 4KR2A 2GJAA 1RQ2A 2I6FA 4QYIB 3ZD8A 3S7ZA 1E2JA 3ET5A 3R5KA 3TB4A 1G5QA 1NVTA 1ESDA 3QMVA 3ANNA 2VDLB 1OB2A 4HB3A 1ORHA 4PYMA 1RWMA 1KQGA 3L06A 2ZS9A 2YJZA 5D87A 3FOWA 3SS9X 4U8HA 4P54A 4NONA 3I2YX 2HQBA 4TUYF 4N49A 2FJ0A 4JHXA 5SY4A 4D4KA 5FOQA 3BCUA 4EKGA 3A3YA 3QVJA 4BO7A 4CGYA 3I5XA 4B6PA 5JNRA 4CIWA 4QLAA 1Y6ZA 2PZGA 3LZDA 3TO5A 2NXJA 2VJMA 5GMOA 5LBIA 1PKEA 5EZYB 4EYGA 1QZTA 2WVAA 4L50A 2W0SA 1ACJA 1DFIA 3WZMA 4DLZA 2ZI3A 4L6CA 2YN0A 3VKVA 4KO1S 2VHVA 4MVJF 1U4SA 1YVDA 1A71A 4R1QA 5EC8A 5FV7A 4EARA 2Q3LA 2X6TA 3TZLA 3PE4A 3DCNA 4NY1A 3VKGA 3L8FA 4HYTA 5JJ5A 1VPEA 4HGNA 2VZLA 1O54A 2R6R1 4WEQA 5C0OE 3F71A 2H4FA 3W5SA 3PUJA 3K8QA 1JU9A 1P7CA 1Q0LA 1ZISA 2NO7A 3MJVA 3NHRA 3OPYA 3ZKWA 5IF3A 1K88A 3N8GA 1TM4E 3HEBA 3BWDD 1ZIYA 1TE2A 1JZSA 4EPTA 2EJVA 2PLFA 4WQMA 3AG5A 1ZONA 1A72A 3WIVA 1PSZA 4KXXA 4C0HA 3W8NA 5HJEA 4F21A 3B6IA 1LVHA 1M2VB 2FG7C 2LV8A 4ZKEA 2I6UA 3B13B 5ECWA 3RKRA 4KAFA 5FDFA 1KU6A 221PA 3DEJA 4NJMA 4HX2A 2XA9A 3EZLA 5J43A 5AKIA 1A8IA 3PDWA 3DYVA 2LD4A 2VQSA 4PO1A 2JVKA 5I7AA 4KN8A 1A8SA 1N2JA 3NORA 4UUAA 3C14C 2ZYWX 4XM2A 1DEOA 5G4KB 2FI1A 2M6LA 1RKUA 4OI4A 3O91A 4ASUD 1RCFA 3MK31 4DLXA 1DBSA 4HH3C 1H4VB 3KT8A 1WLYA 2BVNA 1TA9A 4EKYA 5DM2A 4TV9B 2GARA 4FDAA 1BA3A 5K6AA 3Q8MA 3FJYA 1Q1AA 2DUUA 4ZU6X 1F38A 4L0MA 4LXGA 2Q4BA 4F3TA 4FR0A 2OV8A 2KMLA 3BK1A 4G4SO 1IMJA 1BZYA 2YRWA 2G71A 3HBMA 1TXGA 4S24A 1VCOA 1D2CA 3D2BA 2C3MA 1BJTA 1LZLA 1UMDB 3IDOA 4OIMA 1WP4A 1OF1A 1FRNA 3R0ZA 2LKDA 1A4UA 4HYYA 3TGWA 1DKUA 4WZAE 3A1CA 1Z17A 4JKIA 1IUOA 2WUWE 3EGDB 4NCKA 4QLOA 5K0ZA 1ELOA 1NVDA 3C2QA 4J0CA 4WV3A 3VR4A 10MHA 1UOPA 2RG7A 3FJOA 4E2XA 4HDCA 5DWVA 1DQRA 2FZKA 3RYFB 5EINA 3WYNA 4GICA 3NCHA 5LUAA 3I72A 4U7TB 3M4NA 1ENZA 4KYIB 1PF7E 3PYLA 5E4TA 5JD4A 4OKNA 2PBLA 3T35A 3WTCA 1J39A 2HU2A 1ZGZA 1XEXA 2WTEA 4NC9A 1VJCA 4IJ5A 4E6EA 1K7FB 3G0BA 4ZHQB 4GMFA 3I9JA 2GNPA 4PLCA 5DSXA 2KWIA 4IJKA 1BGVA 4DDHA 3QV2A 5F3WB 3JRNA 1GPBA 2KYRA 3JWPA 5JZBA 1SXIA 1T24A 2E7ZA 3MGCA 4RVUA 3P0HA 4MWDA 1H8EA 3C70A 3FIJA 3K9HA 4RZHA 4WJKB 1N6NA 3O95A 1EGHA 4GS5A 1FNSA 2OORA 3LUCA 4DLPA 2Z3VA 4MIEA 5JRJA 4E08A 1UZNA 4EPXA 2I54A 1UDWA 5FV4A 1SIOA 4LHZA 3PUWA 1T4DA 5IKEA 2V0GA 1ND5A 2GLXA 3QI2A 3AH8A 2XJ4A 2GBFA 2NOAA 1B76A 4EY6A 5BW8A 1SXJB 4JT8A 4CHTA 3JASA 3SICE 4FE4A 4IVQA 5THQA 4R2IA 3TIVA 2VSFA 1RVDA 4HV4A 4YXWD 2Z4TA 5IDXA 4IDCA 4TTPA 2FJPA 3T7AA 1JIQA 4QYXA 4YJGA 3F6CA 3RSLA 4JJIA 2GZRA 1ZJZA 4PINA 4YRLA 1X8XA 3LPLA 4LF4B 3I09A 4BFZA 3UOGA 1TTTA 5B7PA 1EINA 4L57A 4WEOA 2OOKA 1BVUA 1ZJYA 4JXXA 2JVJA 2HCFA 4B4WA 3AZQA 3D6UA 3SJ7A 1PZNA 1AKEA 1VC2A 4L85A 1WDLA 4GOJA 4QRIA 4NSNA 5A4IS 2D59A 4FR2A 1CDDA 1FYDA 2X7HA 4CMHA 5EZQA 2IEDA 3WGIA 3CX4A 4LXIA 1U02A 5HUQA 1DIOB 1W25A 3AETA 1HX7A 4UDNA 3CKYA 3THYA 3D81A 5CLJA 2CHQA 2QR2A 4L7QA 1Z82A 3H9QA 1ESCA 4OHVA 5HKOA 3OFNA 3FTPA 1ZUD1 4URZR 3ZD7A 4D0LB 1JSZA 4OXXA 2PQMA 1E3TA 2W2XA 2AOTB 4Y2RA 1VPWA 1TQ6A 2D13A 5JW6A 1XVAA 1J22A 1VKNA 3P20A 4BXOA 4MO9A 3NV7A 5FWXB 5JAUA 1N2EA 1KNXA 1VLQA 1GZUA 3D1LA 2EJBA 3H2IA 2XHZA 1G21E 1E1QA 5CYPA 5HFNA 5I01A 2QX9A 4MINA 2GN6A 2UYCA 3DR3A 4B3XA 2C9MA 1G9XA 2QLMA 2R8PA 2GH1A 1ZKMA 5FBWB 3D7MA 5KTYA 3TVTA 2JD2A 1FQOA 1MORA 2RHTA 1Q14A 2G83A 1XZHA 1MXHA 1LVUA 2GTIA 2Q9CA 2V74B 2WJ4A 4JQCA 5KYUB 2G04A 2CZCA 5AVKA 2CBXA 3RHTA 4MVJP 2VEDA 3P2OA 3TLZA 4DRZA 5FI5A 1Y37A 4OSOA 5AO9A 4PF1A 3H3JA 3OQVA 4HEA1 4MYRA 3LOQA 2QJTA 4RFSA 1T8SA 2ERCA 4XCXA 4UE2A 4ENQA 5LQJA 2PPVA 3FRIA 2JA1A 1QLHA 3RUHA 4CKYA 5CD1A 1Z7EA 2FCRA 5LMNB 1MFZA 1R3DA 1NUQA 1L7NA 4WPGA 1Q1BA 3VVCA 3VISA 2O1WA 4Q9NA 5LLTA 2DY1A 4PEVA 4MUHA 1FNMA 5HZHA 1YBVA 2X77A 2IHBA 3LBAA 1IB6A 1TL7C 4URUR 4I2NA 3DWIA 1E3EA 4OJQA 2WW8A 4IJUA 4EMSA 4Z9YA 3LUBA 4GEKA 1GFZA 3IE0A 4PANA 4JNKA 5CLLA 1DTWB 1GZHB 3UXYA 5CDUA 4FDMA 3DYBA 1B2LA 4KYTA 2AH5A 4L4UA 4MZXA 2G5PA 2UZAA 2QXUA 5F64A 3K53A 4QBHA 3FPGA 4FFWA 4DMLA 2CW5A 4EJ0A 3RU3A 1DO0A 3VR5H 1R0ZA 5DM60 5IH3A 1SQ5A 2W2LD 3DDHA 4EY4A 3L1VA 1H1DA 1YI1A 1Z8DA 3VO9A 3R09A 1HDCA 3O4GA 1SCUB 4OREX 5FBVB 1HXHA 5JEDA 3D8RA 1XRRA 4MA4A 3WLTA 3BMNA 2FSHA 3H4IA 3MSXA 1G17A 1TU3A 3IEKA 1WOYA 2QZ9A 5KO2A 5IMSA 2WAYA 3BMCA 4LYFA 4A8HA 4MR7B 1ZJ5A 3ZU4A 5SZHB 2A5DA 3P45A 1W4BA 4MCAA 3FWPA 1MCZA 4KE8A 3PHLA 3HCEA 4PHTA 5E7JA 2LVBA 7REQB 5EVJA 2ORWA 2R47A 3BXZA 3NEJA 3SY8A 4BX2A 3PFNA 2IZZA 5FOVA 4FCTA 2F8LA 4B85A 2JANA 1JHUA 2PKCA 3MRXA 3K6RA 4YJ3B 3SSNA 3H8SA 3UA3A 3F5FA 2WICA 1EDZA 5IN5A 5JRDS 5KQRA 2F00A 3HBFA 3RM3A 3VKUA 4RPKA 2H1FA 1F7UA 2KI5A 5TPZD 3TUZC 5JAHA 3L1JA 4QBFA 1KIMA 3D0QA 1QP4A 4M9ZA 1RQXA 1KDRA 1B4DA 2JJ1A 4DG8A 2VNAA 3O2NA 4UFNA 5E1DA 4K81B 2Q62A 2AZTA 4R8SA 2IXEA 3SF8A 4L5JA 5I48A 5JIBA 4QJ5A 4HDNA 3GMDA 4NZNA 1EG2A 5H3HA 1C9NA 3LQQA 4MV7A 4QFBA 4D8UA 1Y1TA 2VJLA 2Y9MB 2OO5A 2P9TA 4TS3A 2ZPTX 3L7MA 3GLGE 2XUDA 1R5NA 4L07A 1P45A 3OJ0A 1KQ3A 2Q07A 1HMYA 3W5BA 2IZ6A 3RKUA 4E12A 1I1QB 5B1YA 2PKYX 1ZNQO 3MGGA 1XRNA 2E3JA 4ALMA 4YMUA 5HIMA 2F1IA 2HIHA 4RKYA 3OLXA 1KF0A 3ZDEA 5FOSA 2VSQA 4J0JA 3G2IA 4LMPA 4J4TA 2HJVA 2P2LA 5D01A 2FHSA 4KQ6A 2BFCA 3UT6A 1ZR2A 2F1KA 3VI4B 3RDPA 1UBNA 1SRRA 2VJCA 2YIVX 1ESEA 2I1VB 4HXYA 4MQFB 4CEHB 2PAAA 3BTUA 4ILKA 1KS2A 1WW2A 1FUYB 2PS1A 1NYQA 3W90A 1E6MA 3K5PA 4HHEA 4MLDA 4E2YA 3BEDA 3T15A 1J23A 2OO3A 1R74A 2PWAA 2Q5OA 3LC0A 1CUCA 3W6PA 3BWCA 1ULZA 4YACA 5ALLA 4BVEA 3PD0A 1M5UA 3F98A 3GJTA 6YASA 2I2BA 3D6HA 2PX5A 3EDCA 2GPSA 2VEOA 1UZAA 3ENWA 4NCJA 1Z37A 1YR9A 2C78A 3VSAA 3KKEA 1XJ5A 4JZKA 1BEZA 1PJTA 4XJXA 3BVPA 1D0IA 2GO1A 2PGXA 2XOKA 2VAWA 4AJJA 4DANA 4MS4B 4MS3B 1KE2A 5L7YA 4DQUA 3AIOA 4XQCA 4HDKB 3UMCA 1J5XA 5IJWA 3AM1A 2O54A 4OQPA 2JBHA 1E60A 1GZ3A 1TW3A 3CM0A 3GVXA 4RD1A 4QGSA 3RW9A 2O7VA 4MYHA 4CTMA 1AQNA 2X13A 3QU5A 4M38A 3U7GA 3K9NA 2DUWA 3FSEA 4OQDA 4LRUA 4PV7A 1YOVB 3AFIA 2QRJA 3KR0A 2Q5EA 1QFXA 4JWTA 5F33A 2O8NA 3QFHA 4CMKA 4RA9B 5TRTA 1RJEA 4J7CA 3T7TA 4Z4EA 4M49A 2R86A 3DDSA 5K20A 1KKMA 1OX4B 1J09A 1NUPA 1FLNA 1QANA 1GV0A 3GIWA 3OCUA 4IM7A 4XPZA 5IEBA 3FB4A 1TOAA 4EGJA 5EFOA 3UV3A 4CPDA 2ZETA 1APBA 4TMTA 1KOLA 2JW5A 2VT3A 4J94A 2J3EA 2XVYA 3AHFA 1YKGA 2D2FA 3G2HA 4DSOA 3QBVA 1XE3A 1RI3A 4Y6LA 4A0HA 4KIGA 4EG7A 1GARA 1CJUC 4K87A 4D6PA 4DYHA 3HDVA 5I9IA 5JS7A 5KHLB 4MDEA 3Q3JB 3DWEX 4OI0A 1NASA 1GTZA 3M1YA 2IH4A 3U4IA 1GQFA 2RGGA 1E9RA 3G8CA 2V97A 5EUBA 2NU8A 5AI4A 2RH8A 1Z38A 4TSRA 1GM5A 3RRYA 2HA0A 5AXAA 9LDTA 1DWPA 1TCVA 5JDCC 1BCRA 1RI2A 4V2UA 4I5IA 5BRAA 1KR2A 2FK7A 4GYYA 1ZOOA 4O1MA 5ULLA 2V59A 1IEQA 3FVWA 3VPBA 2ZRGA 2FZLA 5FHRA 1EUYA 5DULA 3ELUA 1F12A 3N2NA 4PQEA 2GDZA 4AT1A 3TCNA 2VQFB 2WMNB 1G3UA 3SZUA 3NC1C 1HMPA 2Y99A 4M8SA 4MKXA 4I8DA 4MLZA 5E9JA 2JL1A 2WWIA 4NMHA 1JHZA 4NCIA 4ND8B 4Y9RA 5LQNA 1RU3A 3TWOA 3MT9A 4RLQA 1IHOA 3AF2A 4H4CA 3TBHA 4P33A 4TN5A 2C07A 2CV1A 5KC8A 3BWEA 2ZZNA 2JIRA 3KTFA 3HU3A 1IFXA 1Q1QA 4BV2A 5TXGA 5KOJA 4YALA 2O19A 2PD6A 3JXEA 4MV4A 4BB9A 4Q7KA 4MLPA 3A28A 2UU9B 4WY8A 1EGAA 5LBTA 2PT9A 3DV0A 4J16C 4K6CA 4KLNA 4KVZA 1E99A 5L53A 3AYXB 5JVDA 3AHJA 4YB8A 1M34B 3NU1A 3OAAA 4S3MA 4FVTA 3L3BA 1KSJA 3BAZA 1KJQA 5JH7A 1KP2A 1G5PA 3SBDA 4IF6A 2H2HA 4AU1A 2WJVA 5EFZA 4OQLA 4HGQA 2GJ8A 2H7XA 2W6OA 3FCYA 4V0ME 4HDSA 1PHPA 5IZCA 3I9V6 1VJ1A 1FY2A 2OMEA 4RTKA 2PMWB 3T0GA 4UHEA 1VMEA 5G2OA 1KE1A 1J1UA 3GR6A 5KKNB 1ZJJA 4GOXA 3HB5X 3Q0EA 3ZHUA 1H2AS 4RAQA 4L5IA 2XB2A 4GYKA 2BI8A 4NU8X 4L2IA 4FYIA 4DE5A 1W0JA 2X41A 2IHVA 3K2BA 4MCIA 3KC2A 1G63A 5FOUA 1E98A 1LU9A 3C3AA 5GV7A 1VJTA 3SCZA 5BVHA 3Q2OA 5JCPA 1KIFA 4DUGD 4HLDA 1FCJA 3KOOA 2VKQA 2OHOA 4XEHA 4BNYA 5H9VA 5C18A 5KWSA 4V3CA 1DMSA 4LWQA 5C8XA 3IOYA 5ARBA 4QQKA 2ZDGA 3WL8A 3VC7A 3VTFA 4E7OA 4PAOA 1DKRA 1U9YA 4WBNA 5D3KA 1G6Q1 2OG1A 4N65A 4NL4H 1ZMTA 1ZIDA 2JIQA 2XYVA 1DXOA 1POWA 3MSCA 1XL1A 4QBTA 1JHPA 4CL2A 1UM9A 1CY7A 5JAQA 3KQHA 4BNJA 3TDNA 4L27A 3ZX4A 3R41A 4BTVA 2P27A 1JX6A 4F9TA 4FBLA 2DY0A 1YMUA 2PU7A 5EWMA 4A2PA 1C3OB 1J0CA 1K4MA 4UAUA 3H17A 5B3AA 4E2FA 5K8UA 2FFHA 2ZIEA 4G37A 3OPNA 4MVJH 3QXCA 4AO8A 1G8SA 1R4MB 2IHUA 2Q4EA 3K6SA 1RC1A 2ZYHA 3NRCA 5ECDA 4ZYUA 1KBOA 4BVFA 4NIMA 4TSFD 4EQ6A 4ZZ1A 2JRLA 2R5FA 5FWYB 3HKBB 1TX4B 2EKZA 2GKSA 3BGVA 1C1DA 3OEYA 4UW9A 4EPWA 5B1EA 2OZLB 1WR8A 3K0CC 5IUNC 4TZ6A 5AOAA 3GK3A 3FPKA 3L7NA 4PTLA 3QMPA 1NZDA 1RXYA 4P31A 5AKYA 3HV0A 1KP9A 1K8QA 3ZGNA 1R66A 1BDJA 2W4MA 3H9EO 4DBZA 1K9VF 2IF2A 3B3FA 3N0XA 5E6UB 5EXPA 3O93A 3RVLA 1IQUA 1TO2E 1YR6A 2Q7OE 2YMQA 3CUYA 4CDMA 4U7HA 4WRRA 1GGVA 3GF4A 4KHPB 4OBEA 3G17A 4D6YA 1J2YA 4UXHA 2XMGA 2OTCA 3A2KA 2DULA 4JQOA 3G8DA 1WZCA 1JHYA 1T5IA 2OV4A 3C39A 4TQGA 3N7TA 5B2ZA 3RREA 5FAKA 4PWZA 3RIHA 3TVYA 3OP4A 2VZ0A 2H1LA 3DF7A 1DI0A 3EIOA 4S1TA 5HILA 4AX4A 1E5VA 4Y2TA 1E20A 2PX8A 1PWYE 2V7QD 4QPNA 3DLTA 4IIEA 4KB5A 3FDJA 3ZE0B 4A2CA 1AHPA 2QZJA 1SM4A 1L1QA 2XE6A 3ZDAA 4BMDA 3HTXA 3HUDA 1FQKA 1U04A 1FMCA 3ILXA 2G1UA 2O8CA 2LW7A 1XTRA 1AQIA 4Y0AA 4NCXA 4F7WA 3G8AA 4W1PA 3NHBA 4FLFA 3TD6A 2DZDA 2CDAA 1PWEA 2C2HA 2QAIA 3NG1A 4HNRA 5HF6A 3ZHSA 3OCCA 1RWWA 4BQQA 1SC1A 5JHGB 5KSZA 4MV0A 4DHEA 1NLFA 5AM4A 1LPSA 1P4JA 2JFFA 1JAZA 1KIAA 1XEWX 4L4ZA 3PICA 5BWLA 3KQUA 3NDJA 4BEBA 5BMVF 1WBDA 3IPXA 2ZP1A 4WLVA 1I94B 2QE7A 2OG2A 3ESDA 4XSHA 3U7QB 2EFCB 2QTLA 2FN8A 1TCBA 5FOTA 1A0OA 2QMYA 1Q12A 3Q3EA 3PGA1 3ZHVA 1XCOA 2YIJA 3KYDA 4B33A 2ZU6A 4CU5A 1KZGB 1LWOA 2RCYA 2YHAA 3FHTA 1FSGA 2FEOA 4B9EA 4GMKA 3ANXA 4QWMA 2Q6LA 3EGXB 1E58A 3NFRA 1JPUA 1EFPB 5EEHA 1E92A 4M37A 3GN2A 4P3NA 1T2UA 4B6RA 1JSLA 2ZYAA 2FF7A 3NHJA 1LRLA 3DP7A 1EDDA 3WRXA 3CG4A 1CRWG 5BNFA 4OAQA 1AS0A 1P61B 3TIGA 1RLTA 2BTOA 4ZVPA 3HB0A 3KWMA 1E0JA 3D4BA 3BGIA 2IV7A 4CMBA 3PFFA 1VBMA 4HX9A 3IL2A 2IHTA 3TOXA 5JD5A 4CL8A 3FPCA 1P5RA 2YMLA 2EJUA 4DLBA 2X23A 3TUIC 1F0KA 4NMXB 1JI0A 5C7IO 1BVRA 4L0QA 4TV8A 4X3CA 1DWOA 1ADBA 4IIBA 2ZVDA 5CCDA 1OBFO 4MRMB 5CXUA 3H13A 3NAZA 4EIWA 1AKQA 2VBIA 2XGOA 3QPVA 2DQKA 3KR2A 4IG4A 4XM0A 2R3SA 2K2WA 2Y66A 3CBGA 1SG6A 3FDXA 5T3YA 3ZGYA 2F43A 2HWYA 5AD1A 3P9CA 3ME5A 4YT2A 2W2QA 5DM0A 3D6NB 4HDRB 3U0BA 1KERA 3ELWA 4DMFA 1G21B 4CHGA 2DWQA 3ZIAD 2HEGA 4S1VA 3SQMA 5A9SA 1NBME 3A3PA 4XD7A 3W1WA 1OXXK 1X7XB 2VO1A 5AHXA 1YZTA 5BSTA 3I76A 1B00A 3KL4A 1K89A 3QWAA 5L3SA 1Y4SA 4N4AA 1GU0A 4I55F 3GQVA 4MLCA 3CWZA 3IAXA 4PC1A 4HS4A 4FMDB 2FX5A 3MPUA 1E8MA 3TLBA 5J47A 3C5EA 2HJRA 1GYRA 2KBEA 4MEJA 2O1EA 3K35A 2Q29A 2Q7DA 5B7GA 4WASA 3ZZTA 1LKZA 2GZMA 3WJ1A 1G5RA 2C9YA 2CFOA 3F46A 1CUDA 2YR0A 4L5BA 4CM4A 6CHYA 3D02A 3JVDA 4U8GA 1O87A 4X8MA 4CV0A 5FNVA 4EEXA 3U3OA 1RLOA 4DIUA 2W2VA 3QPWA 5EY5B 4J8PA 1W1UA 3F47A 3VZQA 3ZS9A 1WHSB 2H63A 3FOZA 4XYBA 3RLIA 2OCDA 421PA 4KPUA 4NENA 1I3OA 1IZ0A 3MRVA 1BN6A 1OZFA 3KUXA 2IXGA 3UAGA 3KZ1E 1DWQA 2YN4A 5I4CA 1XTJA 2ABWA 2GOYA 2L42A 2V6FA 4E5PA 3AERB 5A6SA 1V7QA 5TSDA 2W9XA 2YJ3A 3O4FA 1OILA 3PF9A 2PZKA 2I91A 1C0KA 2GERA 3C3CA 1F20A 5CB6A 3WA6A 2NSYA 2EATA 5LPNA 2JLYA 4DR1B 3G0GA 2WUDA 3KKPA 5ESRA 1V71A 1P3Y1 5CXQA 2NLOA 2ZSFA 1CLUA 1A9XB 1ULTA 3OJFA 3OZRA 4JB3A 3WYAA 3C43A 1E5QA 2W48A 3CVOA 1YV9A 2JIBA 2GEUA 2HNBA 2WHQA 3H1FA 1TZJA 3BB4A 2HCBA 1IAQA 2FN9A 2B9EA 2P11A 5LVAA 1XXHE 1BIFA 3ZY3A 3KSRA 4MUGA 1P9NA 3IVGA 1LLCA 4IIFA 1OSNA 4MYUA 4RE6A 1IWPB 3LSYA 4I7EA 4BQIA 3QVWA 4NAUA 1FP6A 2I76A 4WN3A 3RIGA 4QQRA 3CXUA 2A0UA 3EF0A 1JDZA 1GADO 1FU4A 1LLFA 2GPWA 2ZQ5A 3AR2A 1Z0UA 5ILGA 4BATA 3ESQA 3EX7C 2HCJB 4YO8A 4IS2A 3RVOA 1CDZA 5K0LA 3UK6A 8LDHA 1FYXA 1CXZA 1LBTA 4ACBA 1EFHA 5LA6B 1FP2A 2GR9A 2WK1A 3RWOA 2V9PA 2IPXA 3LWNA 2LCIA 3HKCA 3N70A 1RYMA 5C1IA 2P8SA 4FBGA 2K87A 1N6RA 2JJ2A 2Y6UA 1JR2A 3ANLA 2AJ8A 2EIXA 4LDNA 3P71T 4KXLA 3A9RA 2JGNA 3PNKA 2NXWA 4F3CA 3DDWA 4CTNA 3GP8A 2OILA 4EKNB 2W2KA 3CGGA 4DZZA 4AF7A 3PIIA 3OJLA 4J0EA 3SJUA 5HE9A 4MVJE 3U3DA 2CDNA 1YUNA 4IILA 4QUIA 3G2OA 3ZTWA 2A5YB 1TUEA 2JGDB 4HGYA 4A7PA 5G40A 1KMCA 3IVRA 4S1NA 2XYGA 3B1YA 2DPMA 3IAS6 1FFEA 2FZGA 4RJTA 5K4HA 2JIMA 3BHNA 4OK6A 4OQEA 4ECEA 4BO0A 1PV1A 1I7SB 1NQWA 1X1DA 1MT0A 3STTA 2Q0SA 1DX9A 4BQPA 3O0DA 4IIJB 1ZMOA 3L01A 5AHKA 5FX2A 3M5WA 3MELA 4J0HA 5DJ5A 4HQOA 2Q49A 1IMOA 4KOEC 2RB5A 2WG1A 3AIKA 1XU4A 2QTRA 2FKNA 3LXRA 3BFJA 4FCWA 1RYBA 5K2MA 3FLBA 3DFZA 1A76A 4UU7A 2FW1A 1GILA 2NU9A 3ECCA 4PWYA 4KR7A 2POCA 4ZI7A 1QK5A 2GTPA 3R0VA 1EKXA 4OV6B 4ZVUA 3P8ZA 4NG5A 2NQ8A 1O08A 3D6TB 4K9KA 4L76A 2V5UA 3HRIA 5EXTA 3WSVA 3IR6A 1G38A 4PCLA 1FVXA 1Z68A 3LQ4A 4GD3Q 4R2KA 2AQHA 2IU0A 4BAZA 2GESA 3T5AA 1Z8FA 2AXQA 1QK4A 3QVKA 4MW1A 3DB1A 1G7SA 1Y3BE 4XR4A 5FADA 3TIFA 4BKPA 3VJRA 1PV2A 3B70A 3B48A 3PF8A 5D7BA 1QCCA 1LI5A 1GNLA 2OFWA 3DKPA 1RZUA 1OTXA 1VL6A 3K7EA 4D3YA 2Z6UA 2QLFA 3DT9A 3EDQA 1T9BA 1W5AA 3FSGA 1E6UA 3GA7A 2PBRA 5TQVA 3X44A 1U7PA 3EVEA 2DR0A 2KBFA 3AO0B 4QGAA 4UJ3A 3FZGA 5KYTA 3O8CA 1CR2A 1FA9A 2GM3A 2ICAA 2O5VA 4OEHA 5JFTA 1UFKA 2VF2A 3GXBA 3NDRA 3OF3A 3LFHA 2O7NA 1DDGA 1HNNA 1SXHA 1FFDA 1W0KA 1YBHA 2QVYX 4C6TA 2QVBA 5JZMA 5JXJA 1C9MA 1T8PA 3GX1A 4DV7B 3CLSC 3HLKA 2OP1A 2YZ2A 2P9YA 3EIEA 1GU7A 1W29A 1PTJA 2FP4A 2OXEA 3RROA 5BUCA 2AR7A 1XA0A 1JIIA 1T4CB 2QYTA 4KXMA 5HCNA 3SC6A 3UT5B 2AIRA 2FGJA 5DM1A 2VJAA 1FFXB 3NLLA 1X42A 4F5YA 2PH5A 3PKJA 4ZA2A 1IPHA 4BB6A 1TK2A 2VRCA 3SHFA 2NO9A 4OX9B 2A86A 2G40A 2RAUA 3DTVB 2JZCA 4JY7A 4TT8A 3E7PA 2PA0A 5MGBA 4CKCA 4L16A 3D7KA 4XH9B 2C84A 3MTQA 4F2HA 5B4TA 5BWMA 5A3QA 5K3CA 3IKLA 2FOIA 3IP5A 1GXSA 1BW9B 1W93A 3QX7A 5KOIA 3KLOA 4P84A 3D4IA 4PYJA 1IBLB 3INTA 2Y0DA 3M9WA 1MB9A 3BMXA 4NDZA 1M73E 3FMFA 3OA2A 3NANA 3G2QA 4Y2UA 3GLVA 4BE4A 3A3KA 2OBXA 3E4DA 4IGKA 4TTSA 1EFVA 1ODLA 4KFRA 5K0NA 4KO3S 3HI4A 1T4MA 4EFKA 5AHWA 2O7SA 2ZJ1A 3FUVA 2BZ0A 2H4ZA 3HPRA 2VOJA 3NTUA 1WW8A 2OQVA 1ZD2P 3JARB 4F1WA 4EL5A 3PL5A 4CW7A 1P7YA 2BKEA 4FMCB 1XC7A 1VRCA 2QP4A 4C2UA 2CMFA 4LXHA 1JN0A 3I5UA 4PIVA 4C05A 1NNEA 4A10A 5JQGF 2CY0A 4UQPA 1NBHA 1XKXA 4OHKA 4ATNA 1CQWA 3Q3VA 1CTQA 1EJBA 2RAVA 3HA3A 2Q3JA 4DMUB 5JS8A 3FF4A 4CLDA 2IH2A 3OFVA 2WHPB 1T2FA 1Y7PA 3LP6A 4GDFA 2Q6KA 2X4IA 4PLWA 1K5GA 2GPTA 3EGVA 2P3LA 4M83A 4ETNA 5GJWC 2QX6A 3DS8A 3R6TA 1GA4A 2J0VA 2PJDA 4O8CA 3UAYA 2HWXA 1P4SA 4C2BA 2VP4A 3PFGA 3IVAA 2D5LA 3WBKA 2IYFA 4Z4HA 1L4KA 2V3WA 2ZR0A 1Y5NA 3GGCA 1REQA 1CUAA 4NYJR 4JGGA 3VH4A 4LNUB 3ZWPA 4LF7B 4JT4A 4LWOA 4D02A 1N0WA 1Y7HA 2UVDA 2YL2A 5ALQA 5FPKA 3R5HA 4WMLA 4BMNA 2IWHA 5DK4A 2EZ8A 4LTDA 1Q0PA 2ERXA 1NQTA 2LE0A 2GNAA 3AUKA 2RHGB 1NJ1A 3GDHA 2XQGA 3DXFA 4J90A 4Q7MB 4REQA 2O8BB 1T8RA 2XUHA 4QZVA 1QFYA 1M8PA 1OAAA 1PR3A 4J43A 1X19A 1RZ3A 3RD5A 1JDSA 1RZRD 4HAZA 3VM6A 1HQCA 2HREA 3HKEA 4GDMA 2VIIA 3Q3IA 4JD5A 3KPJA 4WZAA 5DYNA 4ZT7A 1NG9A 2YHBA 2H3EA 4IFIA 3IJ5A 4D0NA 2GJ9A 4RA6B 1N6OA 1RJFA 2JFHA 4NOKA 4AG6A 4MKIA 1R37A 1A8QA 4HMOA 4LOIA 1LJUA 3AVPA 4YJFA 1JFTA 4ER6A 1B41A 2DKFA 4PGGA 5JBIA 3Q2KA 3ORFA 1RHJA 4Q9IA 5BURA 3U62A 3A05A 1G4HA 1TJ5A 1CUJA 1N5RA 2WTXA 3HEAA 3QTLA 1MAAA 2HPHA 4I6JA 3O84A 4L8YA 1VMKA 4OA5A 4Z4QA 4YYEA 1RQ7A 1TZ2A 3KOXA 3TZEA 4JT9A 2HHAA 5DGIA 1IN6A 3G7NA 4P58A 2Y1WA 4QULA 4ZI7B 5KSYA 2DR2A 4ACAA 3BDAA 1ILWA 3GJ8A 4FDVA 5ECGC 1LDEA 3N9IA 1EK5A 3M81A 2QXYA 3NIGB 3KJZA 1CNFA 1D6JA 4FKMA 4IIHA 5JWRA 1L7OA 4N7MA 1EVIA 3H83A 3L1KA 4O4LB 5TQ0A 3RE1A 5LZ9A 4AY2A 2W93A 2WJGA 3LD9A 3KXLA 1DPGA 4B34A 1OHHD 1H2RS 1KYYA 4IX9A 5AVSA 4BP8A 3H0KA 3E22A 2CFRA 1NBOA 2XB9A 3J7AC 1K27A 4KJZA 1L4HA 4Q3OA 4R1LA 1ISRA 1Q16A 4P4LA 4CI9A 1QIJA 1C7ZA 1V39A 3P7MA 1FB5A 4BQFA 3LWDA 4I3HA 5B7QA 1JPNA 1T5BA 1T36B 3EQ9A 3STHA 2AKEA 2YQ4A 1UPFA 2FPGB 3C16C 3IDQA 4I5GA 2YV2A 2QL9A 1YS7A 4YQYA 3OQIB 1N7GA 4O4IB 2OYRA 5HNKA 1T2NA 3T1VA 3AESB 3SP1A 3K70C 1H3FA 2CXQA 2GLUA 3GBSA 3UYLA 3THOA 4B5KA 5LZ2A 1G5IA 3QM1A 4QQNA 4AQDA 3OLZA 2J85A 1T3GA 2YBEA 1KK3A 4NARA 3QY9A 3S99A 2NUBA 1GLNA 2WVJA 1XELA 5CM9C 3TSOA 4HQRA 3GEBA 3EVAA 3K0FA 5BNZA 3ADKA 2UUOA 4LMAA 2WA2A 5BOSB 2CDBA 5BQXA 3THRA 3X1XA 3MCVA 1J8FA 3CXRA 2BDUA 3MD9A 4N0QA 5SV2A 1PJ4A 2OR3A 3B60A 1F4LA 1L4LA 3I2HA 3MTAA 2GCEA 4CDNA 5J5VA 3EDMA 5HOEA 1YI0A 4UZFA 1BFKA 1E2FA 1MRZA 3DULA 1U9JA 1PO7A 4I50A 2HJSA 5TB5A 1HL7A 5DM4A 3PCXA 4Y8VA 3RHSA 1N2HA 1OLUB 1TF7A 2R5WA 2X4GA 1HA3A 3K1AB 1UAGA 4HJRA 1R1DA 4WZBA 1JLLA 4OF4A 1UPXA 2PXXA 3GGPA 4RE5A 4YRAA 4CLOB 2E4YA 2EV9A 2J9YB 3FCXA 4HBZA 5TVGA 4QPPA 4X6LA 3WMFA 3DMPA 3QUAA 2XUIA 4BU1A 1CRZA 3FWYA 4BGEA 1P4HA 1E2UA 5GGYA 4ZQHA 4KLRA 4F84A 3T52A 3O3CA 4JKYA 2GPAA 3NJ4A 5DHUA 3V55A 4LYJA 3KJGA 4E11A 3BJIC 4IWYA 2HJHA 5DOZA 4LFAB 1G2PA 5L7TA 2GN2A 3F3MA 2I3AA 1C41A 1NPTO 3HWRA 3W2GA 2GXQA 2REQA 1TIBA 4LNAA 3D0OA 4WLFA 4CEJA 4OHXA 3FKSA 1LV7A 1GRQA 3HB1A 3QBDA 4JYBA 4DQXA 4ZFNA 3UWOA 3ZJ4A 5GV8A 1UKEA 2W8BA 3FETA 1BO6A 1CWUA 3CX8A 3WNCA 2P9CA 2ZYRA 1CR4A 2N42A 3EXG2 4GSKA 4RLSA 5I9SA 3F5MA 4QXRA 4N0PA 5FULA 2FP3A 1YJCA 1GZ7A 3N6RA 4EHNA 1AKWA 4R98A 2WJHA 2XADA 5AW2A 5B1SA 1UKVY 3M0EA 1MRSA 2WUGA 4ID3A 4JODA 2CMHA 4MK4A 3ZK7A 4D4GA 5CA1B 1MABB 3D3QA 4LYEA 3PR1A 3RUDA 4F11A 4QEZA 2I2FA 2ZTSA 2Z2JA 3ORQA 3CPEA 5JV5A 3U6BA 1O7JA 1V16A 2IYUA 2O1XA 2VN8A 4N54A 3X1MA 1IHDA 2O2CA 2NSLA 5K1ZA 3PNMA 4TXMA 1U9IC 1VSVA 5BQFA 3IUJA 1XNHA 3OZGA 1ZIPA 3O38A 4R7GA 1E2DA 1YDWA 1YRBA 3KZVA 4NEHB 3LPAA 4R40A 3VR6D 3N28A 1JTVA 1BE6A 1PW5A 2I4NA 4NBRA 1P2VA 2IPMA 4QT4A 3FNQA 1NMYA 4QDOA 1KK2A 3ADCA 1A5AB 3V8BA 1M2JA 2OMKA 1YHYA 3HGMA 1V37A 4JITA 3GLSA 3IX7A 2O57A 4JQYA 4LJAA 2BFBB 5DCYA 3UB2A 4N5NA 2VYVD 1NI4B 1YDFA 2FW0A 3W6ZA 1F1JA 1NV8A 3LUJA 3V34A 5IEJA 1FVFA 4RVSA 1KZ6A 3SIPA 2DJ5A 1W75A 2TMYA 4LPKA 4YK7A 5I7EA 4FMPA 2ZROA 3H6GA 1GNQA 3QKUA 5BY2A 4XE5A 4O08A 1ZW6A 5EKSA 4CM8A 1OIWA 2C5LA 1ND6A 3ROQA 1OY1A 4M4SA 4BNUA 2GN9A 1ZNXA 4HMQA 1UP7A 5EIWA 4GX2A 3HCFA 3VU8A 1L5WA 3QPDA 4K7JA 5AIAA 4DV5B 1QH8A 2CLDX 4HQFA 4IFTA 4F45A 2QVZX 2QLNA 1EFAA 3PNBA 5ANRB 4IQ4A 2WWXA 2X1VA 1YQXA 2I4OA 3HMQA 3Q7EA 4E31A 1M1NB 4JUDX 4D45A 2JEZA 2FETA 2YW2A 4NBUA 4UBMA 3GY0A 2ZW9A 3B8HA 4TMZA 4FB5A 2YWRA 1TJ4A 3E9CA 3T3MB 5TIIA 1FTSA 1RRFA 4IHJB 3DQZA 5MDHA 3VPSA 4LVCA 3ER8A 4PX5A 3IIJA 2O0HA 3WYGA 3MUFA 5DHRA 1J9EA 1TM7E 2P9ZA 1WW3A 2A5JA 4DR6B 2QR3A 1UC8A 3JQ7B 1COWD 3CSUA 3L02A 5HGJA 4IMRA 3LTNC 5EUMA 3UQZA 1A3CA 2HF2A 1O4VA 2OUKA 3D3KA 1XLTA 1R9GA 1HWYA 1YDMA 2EW1A 3Q0TA 1X1CA 4LBWA 2D8AA 4CIYA 4N48A 4MZDA 4WOJA 3F8TA 4CF5A 1NW5A 1FTWA 1BE0A 4NECA 1CULC 3S55A 3ZYCA 1M33A 3BFPA 3VSCA 2EOAA 2J5RA 2XEXA 2DU8A 3AR7A 1H22A 2P90A 3H04A 5JJBA 2A9RA 1HDRA 4KQGA 4KH1A 3KD3A 2HRRA 1CLEA 1MMFB 1NWHA 2GHRA 4G5GA 4RESA 4FJ1A 1ZX1A 3U61B 4PAQA 4NE2A 5TGDA 2VYFA 3CLUC 2V6GA 3DM5A 2N46A 1MB2A 1XRJA 3Q7QA 3FUUA 4E03A 1PW7A 1E1CB 2CLFB 3H65A 5SZJA 3UJ3X 1DSSG 1I1OA 5D8DA 3RFTA 3CIFA 3R6DA 4C4YA 2MMGA 1ISIA 3OMWA 2CBZA 3EULA 2H52A 2OCBA 2Q3HA 1N5DA 3GQBB 3FFXA 1NQAO 2EBWA 2OVFA 3DGFC 5F12A 2GZAA 5EVCA 3D7NA 3U39A 3ZV6A 4ZAZA 1IIRA 3BF8A 3LRPA 3P19A 3I92A 4CKBA 3WQQA 4W7IA 2QD2A 3RUPA 1E4EA 2PRJA 3KL2A 3RG8A 1U28A 5BV2P 4E5DA 2W0MA 4MKFA 4ARZA 1OC4A 2ZT6A 2VH5R 2ATIA 2ZT8A 3GLIA 1PR4A 4R2XA 1X80A 2J33A 2QU8A 5KX5F 3CVVA 4DA0A 3OECA 4FB4A 3EEOA 5J3JA 2HHLA 2ZJ3A 3PFIA 4O2AA 5H5JA 4DA4A 3CNNA 2X5OA 3OOYA 5F2NA 4TVSA 4Q18A 4LE2A 3IP9A 4RHXA 2Z9BA 3EB9A 2VA9A 2V5AA 3PFWO 1YB1A 2PA3A 2Z57A 1SBIA 1T43A 2A57A 2FWRA 2O3TA 3E18A 5T4FA 1S0UA 3L8DA 1O2DA 2CHFA 4RQBA 4KG7A 3ND9A 3C3JA 1AT1A 4IDNA 4KXNA 1PL8A 3KETA 2Q45A 1UDBA 1S9HA 2Z2XA 4KDFA 3RS2A 4WXYB 2YUTA 2ZUTA 4DAEA 1E1RD 2WYVA 4HN4B 1UF9A 1NRJB 3ET4A 4RL4A 5EMKA 3GUVA 3ELBA 1ZL0A 3T9FA 3ND8A 5AM3A 2A5FA 5D85A 2BM9A 3WAJA 1ZZGA 4JH0A 4LRYA 3NR2A 1P33A 1YS2X 5JJCA 3A9CA 1OUMA 4EB6B 4Z7QB 1J0EA 1UPCA 2JAOA 1YGYA 2WILA 2D1RA 2QWXA 3IP3A 4Z1OA 3ADPA 5AJWA 4QA9A 5CG2A 4C7OB 2NV6A 4JOCA 4MUIA 5ALIA 1Q0TA 1VLLA 3JQDA 1JFVA 3L7LA 1TLLA 2PZAA 1EGQA 2D2IA 4FC7A 3VGJA 2QMZA 3AZPA 4W5WA 3RSSA 5CB8A 5KPJA 3H1EA 1D04A 3A26A 4PGFA 2K6GA 3P4XA 4X1IB 5FI1B 2TECE 2PYDA 2XH8A 4KQKA 1D9ZA 2BIFA 1KP3A 2CXHA 2ZVQX 4ISBA 4GP7A 1S02A 1E6KA 4S1WA 3GLKA 7ABPA 3GLFB 1DC3A 4LZJA 1J21A 2C3PA 3QVGA 2J7PD 4H4DA 3DT6A 5DO9A 3WAGA 2CVOA 3D2CA 3UVEA 2HTEA 1P2GA 1WNFA 5IC6A 3CO5A 1IN1A 3FBWA 1WETA 4DIEA 5HBGA 1D4OA 2QD5A 1KEEA 2QKYA 4EF5A 3UGTA 3T9CA 2RH4A 1CF2O 2C5SA 1YS6A 1FQJA 2XAUA 521PA 4RETA 3TQSA 1I4OA 2XDQB 4DIOA 1WPGA 1U2ZA 5D3ZA 5DLQC 2QRUA 4KACA 3UPTA 4M0KA 5G3YA 1XD9A 1X1BA 1KY3A 3KOZA 4H6WA 1U1FA 3MWDA 1TFRA 1ONSA 1K08A 3N7UA 2B98A 4NATA 4F38A 1I1HA 1W581 3U4MA 5EMNA 4C7KA 4P7BA 1N78A 2BCEA 2OXIA 3NC4A 2R79A 4LBZA 3TAUA 1XP5A 2QJWA 1FS5A 3OU6A 1OR8A 3F49S 4JP3A 4W8OA 4F4JA 1EP1B 4B81A 1H3NA 3H5RA 3SIWA 1SK8A 2HXGA 1FYEA 3KCQA 2Q28A 3IJPA 1W2WB 2V8OA 2HR1A 4IH9A 5JDCA 2NV2B 2HHHB 2Q2NA 4FZ5A 2C4UA 4G0PA 4ZEWA 3RAPR 1K92A 1U3UA 4GL2A 1TVKB 3ZE6A 1FX0A 3MWKA 5JZVA 5K4GA 2G4VA 2GBPA 3NEYA 2BF7A 3OT4A 4JC4A 5EHGA 3NYRA 4GYWA 2QNBA 3P26A 4NH4A 1POXA 1RRKA 2H0QA 4D44A 2BEVB 2ZBQA 4S12A 3LL4A 3NT2A 5GY7A 1KKUA 3W5CA 1AQLA 2FPLA 3EJ6A 1J56A 1NTRA 4KPFC 1XZGA 1U2QA 2J46A 1SULA 2QUAA 2YWCA 2HEIA 4WN9A 4XJTA 2R8ZA 3WISA 1FSFA 4KXVA 3OKAA 5IVHA 4ZC1A 1CUVA 1H3EA 4GWGA 1PT6A 1DL5A 3HFJA 4QOEA 1MVLA 1IK4A 2JCBA 2QTVB 1UP4A 4JOSA 3T4PA 3MGKA 4Y2SA 5IMBA 1EHIA 2QROA 4MRSA 5FPYA 5CA0B 2QN6A 4Q01A 4E21A 2WKQA 4GRAA 3EZ2A 3CZ9A 1HPLA 3L43A 1L9XA 3EGOA 1MX9A 3OX3A 4GMGA 4TKZA 5DTMA 4ZVVA 4I08A 2PFGA 4MWZA 4RGVA 5A71A 3I4LA 3E84A 5IP5A 4C22A 1HYQA 4J16A 3V32A 2JS7A 4K9NA 1NOJA 1Q7GA 2A5GA 2L69A 5JD3A 4D9JA 1YD7A 2VT2A 3I6MA 5DW0A 3KR9A 1KR5A 3TZQA 2YY5A 5BN3A 5TX7A 3CRW1 4AJKA 2C98A 6GPBA 4OLAA 1NBIA 3M1AA 3QE4A 5JSKA 1E6EA 1USUA 1O9HA 3HG7A 4AJPA 5J4KA 1KY2A 2RGNC 2R1VB 5BSUA 4JROA 3WFJA 4XPIA 4G8CA 2Z5GA 2PD4A 1VCHA 3FRJA 2QUKA 2WSLA 1WUYA 3IPLA 4MIKA 4NYIR 4ZU1X 5KNCH 4RKFA 1YT5A 4HSGA 3FGZA 1NMQA 1U8FO 1XO1A 4N9QA 5BYJA 4BDSA 4KWCA 1Z3IX 4X24A 4HDOB 5KSOA 2ZSIA 4CXMA 2FEWB 3A1NA 4N3NA 5IASA 3AK4A 2B94A 2RGCA 1CU1A 4CF4A 5ADWA 3EPPA 1WF6A 3NEAA 1V9CA 1KZ9A 1CQIB 2B4QA 1NC1A 3HY6A 1WE2A 2Z1MA 3KEOA 3NWOA 4IUDS 2O6LA 4O4HF 1M7BA 1RIFA 3KVOA 5BSFA 5F7OA 1LDGA 5IJ0A 4ZEXA 1QU2A 3FMGA 2ZJ6A 2PUJA 2BD0A 3T61A 2P1ZA 3AKDA 1LX7A 1ODCA 2A2ZA 2X8WA 2GEDA 1Z15A 1EAYA 1W6UA 2Q9BA 3SC2B 1JDUA 1E6LA 3SSMA 2FUG6 4LI3X 5CFPA 1N0IA 4I4TA 2ODNA 3OX2A 3BKWA 3MFQA 2CC2A 1MQ8B 1US8B 3KTAB 1QHXA 1IULA 1XCPA 4DZRA 1XUOA 1Q3HA 1PK9A 4ZOAA 2AMJA 4QBKA 5HMMA 1L7VC 2PZMA 1AGPA 3HFGA 1S1MA 1V96A 2F67A 2YWDA 4ZCSA 3H9BA 1QH1B 5CW2A 1SVLA 3JQPA 5SICE 4BNWA 1VG1A 2GRUA 3RYIA 1RQGA 1VHDA 1B2RA 3EC1A 5PNTA 2PX2A 2HLDD 1E2GA 1EFKA 4MVWA 4CCSA 2E21A 5T7BA 1LD3A 4URXR 4IF4A 3RADC 4GECA 1K2VN 3Q9UA 3PUKA 2SICE 1XMSA 2P5UA 3CUTA 3P9XA 4UXIA 1VSBA 4K8RB 5IT0A 2IITA 1CVLA 2L19A 3BN3A 1U3CA 4JQSA 4QYWA 5C8VA 1Z5OA 3BZBA 4DMMA 1XV5A 1Z6YA 2QF7A 4H3KB 3HZHA 3A4NA 4KFSA 4PPFA 3GDWA 3UCXA 3UATA 1PD1A 5LDDC 1NXOA 3QEMA 2B1JA 2VBGA 4FWTA 3FPLA 3G23A 4MEBA 4CT5A 4EA7A 2EGUA 4KAJA 1SQ6A 3L7DA 1ORDA 4EUSA 1CRPA 2Q8QA 4D74A 1GFWA 1SHKA 3DFMA 4AKIA 3EY9A 1HTWA 5T3UA 1PEAA 4NESA 2ZFUA 1S8AA 3G1UA 4MR8B 1X15A 4D4MA 4X1YA 1XZJA 3OIGA 4RMIA 4XQ9A 4JI1B 3ZJYA 4XSVA 2Q5HA 9ATCA 5BSEA 1A9RA 1PRYA 1FLDA 2GWRA 1MO5A 2NT4A 1TYBE 1WQ4A 2OLEA 2TSYB 3QK7A 2FEMA 1B0UA 1T5TA 1WRBA 4HEJA 4PNZA 3I2IA 3E1KA 4Q6WA 5ERXA 1YJBA 2Z4SA 4TLDA 3T54A 4U3JA 4Q1FA 4DIBA 2G1KA 5I3ZA 1X77A 1JEQB 2YJ5A 2ZJAA 1X8JA 2GRAA 1ZRMA 3MQ2A 2BEWA 5CJJA 3FOFC 5CBKA 1I2BA 5H70A 4IJ6A 3K70B 5DBEX 1G60A 2B36A 3VQTA 3IDZA 2HW8A 1B14A 3DPUA 4JU9A 3TH5A 3TBFA 1OFVA 5HJ2A 3KSAC 1V5GA 2C3OA 3MWFA 1AHHA 1F7VA 1PE0A 3H11A 3MEQA 1GRVA 2NSHA 5ALNA 5E9WA 5IBRA 1KEPA 3W06A 4F6RB 4LZLA 1D0VA 2ZE7A 2C61A 3OLYA 1XQ9A 3P9YA 3ELYA 2E4VA 4NLLA 4N9WA 3GEEA 3ADOA 3DXYA 2H4XA 2V6BA 1T6YA 1AH2A 2F64A 3ED1A 5EE1A 3PNVA 4YXWA 3FG9A 2XMRA 1CHNA 1XGKA 4YV0A 2FXIA 5KYYB 3E0QA 4AWBA 2CVZA 3A14A 4LOJA 4CM5A 121PA 7ADHA 1U8XX 1WUKS 3BERA 2DH6A 4H7HA 2ON6A 3E53A 4RDCA 3AVVA 2J41A 1XN1A 1YDHA 5DYYA 1Q92A 1PT7A 2X2EA 2AX4A 5CVEA 1GAQA 2BLLA 2D62A 5GGXA 3PQ2A 4MW6A 4QO8A 1BS9A 3K96A 4JLMA 4MW7A 4YP1A 1W30A 2ZXUA 3HR4A 1KJJA 3B1FA 1N5IA 4PLZA 1ORRA 4FD3A 4ZARA 2ZKIA 3NS7A 3PP8A 1XVLA 4DLYA 2ZSAA 4TTJA 3BCSA 3WL6A 3L6OO 3PGXA 3SIRA 2HT1A 3UICA 1M6VA 3UN1A 3N2GA 1RHRA 4LJ8A 2PUTA 1T1IA 3R5XA 4UPVA 3R7AA 3ZQ6A 4S04A 2DWOA 1JR4A 4G0YA 2R11A 2CLLB 3T4EA 3JAKA 1ULSA 1XZ8A 1DCKA 3JR3A 4J7XA 4OMCA 1Y81A 3EIUA 4WLNA 2MR5A 5GOTA 1ULBA 1BX0A 1ZA2A 3KWJA 1LV8A 3BK2A 3PZRA 3BA1A 1Z0ZA 3DXXA 2WWGA 2IT1A 4AZ0A 1MTOA 4A0GA 2EW8A 4F60A 4FUQA 1P0FA 4NVRA 3PWSA 1YIAA 3F3KA 4S1PA 4C88A 1JGTA 1IXZA 2FWNA 3LA6A 3QENA 1P6XA 4NMWA 2IF0A 3ROMA 4DR2B 1JEYA 1QGUA 1HT2E 1B6RA 1RYFA 2PHZA 1QH9A 3GUYA 4CMEC 2PYZA 1FXWF 2I33A 3QQ5A 1YQDA 4X6YA 5DF1A 4F97A 3U7RA 1T9DA 5FBLB 2X8BA 3IDSA 4IZOA 4I0WB 4PQYA 1O6FA 5AW5A 1P1KA 1ZS9A 4Q1AA 4XR9A 1Y8QA 3R7NA 4EH1A 2O52A 1PQUA 2P35A 1ZK3A 5IYZF 5SY9A 3R9KA 1YFLA 1N8KA 1UWCA 1K6JA 2VJYA 2K7FA 1H6DA 1FLAA 2GX6A 3NDPA 2R65A 3W8RA 2FPRA 2ONYA 5KJCA 2WPDD 1S2OA 3OIWA 2ATVA 3G82C 4G0WA 3N05A 3OU2A 1Z3CA 2QRMA 7YASA 2HA5A 1MW9X 1SU8A 1VJDA 3KDSE 5IHPA 4GKKB 1ZH4A 1RRGA 1XQVA 2WE7A 4AN4A 1XXHA 3S27A 2B92A 3QSYA 1C1YA 1M1YB 1JA9A 4Y2QA 3TR5A 1XD2B 3LG2A 3TECE 4R7TA 4OYRA 4QG7A 4KGXA 2WF7A 4JJ4A 3JWHA 4ZYYA 1PL7A 2XUZA 5LCXA 4XB1A 3PHIA 5K6TA 1H5NA 1F48A 1Z4JA 3GCWA 4GL4A 4QXPA 3QH4A 1K63A 4UTOA 1QMPA 1D4ZA 1L3BA 2WABA 1OGIA 3IS3A 4MHSA 2CGEA 2D2XA 5CVCA 4Z99A 3WBJA 4JI8B 1WSBA 4O4JF 1JLRA 1RI1A 3K0BA 3E61A 3M6VA 4Z8YA 1N1MA 4MUFA 2ZYSA 4YUXA 3CRNA 4W5NA 1U8ZA 2P62A 3I73A 2OHFA 4MRNA 4B0OA 5ILOA 2CV0A 1OKKD 2XA2A 2NUPA 4TL6A 3X1JA 2VOEA 2Z8ZA 3DLAA 3KV3O 3PFCA 3R5JA 2KW5A 3I34X 3N2LA 4TUYA 5T67A 4WFQA 3CX7A 2NYUA 1PL0A 1XMJA 1BGWA 3VJLA 5A4JA 3ESAA 4P22A 1O4WA 3WNZA 4C76A 4MDFA 4MB0A 4CVNA 2FRXA 1T6BY 4F92B 3TQFA 2HUNA 3ZOZA 1CQJB 2W2LA 1Z12A 5HKLA 1G8PA 3L6CA 1RRPA 2W42A 2CHEA 1TPZA 2YXNA 1DAIA 1MRNA 1OIXA 1GQSA 1Z4OA 2IHZA 2ZCUA 3KXKA 3KOYA 1JDBB 3TPZA 3U26A 3AUSA 4C6HA 4ND1A 2UZIR 4YAOA 4DJFC 4TKUA 4B7ZA 1UDAA 4C14A 1ONOA 1PLLA 4AKGA 3DJYA 1DO2A 1EU1A 1DBRA 3V4SA 3QYPA 3BRQA 3WIEA 3KQPA 1YDEA 3QX9A 4KOAA 3ZCPA 4PYRA 5DCWA 4HK4A 3THXB 5JARA 3ZWKA 1Q6ZA 2RGUA 4AMZA 1ADFA 3SGLA 4EPYA 2RHOA 2QRGA 3BE5A 4IINA 3LPNA 2O8VA 2JJ8A 4PBRA 1CERA 1FRFS 2Y1CA 1X7GA 1ZK1A 4REMA 3WNQA 1W4RA 3CZAA 2ATCA 1NMEA 2NADA 4IX1A 4ME6A 1CZKA 1T91A 5TPZA 3RFCA 2CHGA 2B37A 5HPYB 1ML4A 1XMVA 3F7OA 4LJ6A 3SK0A 1PBNA 4M86A 4P86A 5ALDA 3CTPA 4Y0NA 2BBTA 3N5CA 2X8JB 3WP1B 2IEZA 2O06A 5B3KA 5HIAA 4XFKA 4OKSA 2ZJFA 3O3NB 3WGUA 2DHDA 3MMZA 4HY3A 3WMWA 4L0CA 5E6SB 5BMOA 5KQMA 1CZLA 1M5RA 3AVQA 4QPCA 4LV5B 3UPDA 5I7SA 1M72A 4MUAA 1K9SA 2R7KA 3BQ9A 5DEIA 1B0ZA 1AGXA 1E3DA 3I62A 1NRXA 4G5YA 4MGHA 3R7DA 1LDBA 5IARA 4V0LA 1U1DA 3OURA 5AUPB 3IB3A 3MJDA 3BGDA 4WNYA 1CVRA 1N3YA 2GILA 1K3TA 1OZAA 1J8MF 1QHHB 3EQ7A 4R51A 5KMGA 1E7YA 1AQYA 2WM3A 3DAYA 1BMTA 3DGEC 4J1QA 1CRQA 4W5RA 3BXFA 3QFFA 3K0EA 5LZ7A 3GJ6A 2OPBA 3PRJA 1LS1A 3FDZA 1N6LA 3V1NA 2F9LA 3PLNA 1ABBA 2O0MA 3GC6A 3AB3A 3TNDA 4R5MA 3W79A 3BXEA 3OFJA 4EF6A 1RWPA 1ZY2A 5KNBA 4XWKA 2IPLA 4M87A 3MB8A 1DXHA 1YA4A 2QV7A 1CIPA 4WA8A 4ENRA 2O8EA 3DCYA 2V1XA 1P62B 1KVSA 2ZJOA 4JXJA 1HBJA 3UV6A 1KI6A 3UMGA 1NW3A 1NXVA 2Z4RA 4OBWA 3AEQB 3S5UA 2BSXA 1I51A 1PJBA 1T1JA 4J6FA 3VTKA 2WD7B 3VNSA 5AVXA 3NT4A 2AI3A 3NRBA 5JLAA 2MSWA 4IFBA 4PRLA 3VV3A 3REOA 4XA8A 1EE9A 2VDNB 2VRWA 3B1VA 2A3NA 3TSCA 1CB7A 4G5RA 3UBMA 4D8VA 3GRCA 4QNRA 4WXPA 3JS5A 2V96A 1O8BA 3GD5A 4OYHA 4BECA 1TLTA 1KI3A 2XQVA 3WWEA 3T7RA 4EA6A 3DBIA 2HSWA 2XHEA 3B1ZA 1CK4A 4FCVA 3AP3A 4HNSA 4J0KA 4Q16A 5D2CA 5EYPB 3T7EA 5A05A 3ZG6A 5BNTA 3I30X 2PL5A 3ENNA 2AL7A 1DBPA 4F0JA 1HQDA 2GAJA 2EERA 4KO8A 4NI5A 4DCMA 4MAFA 1QS0B 4E33A 4CKEB 3FMOB 3DKIA 3U0VA 4XX0A 1C4XA 3R44A 4MUJA 4Q3BA 4RL6A 5DT2A 3SBXA 2CJYA 1JILA 1VJGA 3B51X 3LLMA 5BN5A 1PNOA 3C7DB 5BYKA 2QN1A 4L74A 1OYOA 1YBMA 3LQ2A 2X9LA 3PYXA 4FGLA 4JA0A 4OHBA 4YDRA 4PW0A 3X1DA 3AHCA 5T6MA 5JJLA 1RAEA 3PLAE 3GPBA 1G7RA 1FP1D 4L8WB 1BGXT 2D5CA 4IOMA 4X1KA 1OI7A 1QM5A 1F6DA 4ND3A 4P82A 1E9EA 4P3KA 3TEJA 3ZGOA 4Z4IA 2J0QA 3DQQA 1Z2AA 4KIUA 2RKBA 4MWTA 2P6NA 4XQGA 4EAQA 5CJ2A 5LJIA 3HA7A 1SRQA 1HI9A 3W1VA 1OXBB 5JY6A 1P1FA 3H1PA 1QWOA 5EMMA 4HUQB 5DGDA 3BIJA 2BWJA 1TI7A 1TPYA 3MWYW 1SU4A 1JNYA 1MX3A 3D43A 4TV9A 4OJKA 3R0JA 2A8YA 1G6OA 2FA9A 1RTTA 4OU4A 1PFUA 5LOVF 1P5FA 4GT1A 2MINB 4BLPA 4UDOA 1N8TA 2AFIA 1TQ8A 1CFZA 4BGUA 1J1IA 3NBFA 1ZI6A 4G67A 4BASA 1QLJA 4P4SA 3L0DA 5FFMA 3G0OA 5IS2A 3LE8A 4OXQA 2ZYIA 1DBWA 3SVZA 5F1PA 3WKAA 1UC5B 2IELA 1SVOA 1HDOA 3HDQA 4KGDA 3PC6A 4RK7A 1N8NA 4L3WA 3QOXA 4HVTA 4O1HA 1M0SA 1GVHA 2OSBA 1P0MA 3TKLA 1FDRA 2B0JA 3QY0A 1WWKA 3V1LA 5HJ5A 3VMFA 2XMBA 4P4TA 2VUIB 4Z9FA 3WLQA 3SZOA 4ALKA 4BMVA 1E6CA 2BF4A 1XFDA 3D3JA 3T9DA 2J4DA 1R4NB 4YP6A 3SLRA 3EUAA 3SX0A 4UDXX 1JWAB 3G2NA 4AM8A 2XWQA 4XUDA 4DEYA 3ZVNA 2EJCA 1QKJA 2NACA 1P39A 2ZRHA 1XVIA 4I5DA 3I01M 4K9LA 3PNSA 5IXSA 2I7CA 3DO6A 3R7FA 4WESB 4ZQCB 2DPLA 5BUZA 5DYWA 2REBA 1IQ0A 1Z8HA 1TYAE 4TYYA 2QRHA 2P9FA 1PGPA 3F9RA 3JATA 5DE3A 1KMNA 4TL9A 1I4TD 2NG1A 4DLSA 2GAIA 3GNQA 1N7HA 5EIOA 1R8XA 2C5EA 1DRWA 4G4SP 1CY8A 1XRMA 1Z0JA 2FFRA 4KLZA 3ZW9A 5JNSA 2AOUB 5JS1A 3O8QA 1U0FA 5IJ9B 2R8BA 2BH9A 1M67A 3HWX1 4RLFA 4Y7CA 5K45A 3PEVA 5I7HA 2I1LA 1PFYA 4ZMSA 3AEKA 5FORA 4Y1FA 3D3WB 5GINE 2ODQA 4N0EA 1BJKA 1QG6A 1Q0ZA