3HS3A

Crystal structure of periplasmic binding ribose operon repressor protein from lactobacillus acidophilus
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
264
structure length
264
Chain Sequence
KKSKMIGIIIPDLNNRFYAQIIDGIQEVIQKEGYTALISFSTNSDVKKYQNAIINFENNNVDGIITSAFTIPPNFHLNTPLVMYDSANINDDIVRIVSNNTKGGKESIKLLSKKIEKVLIQHWPLSLPTIRERIEAMTAEASKLKIDYLLEETPENNPYISAQSALNKSNQFDAIITVNDLYAAEIIKEAKRRNLKIPDDFQLVGYDNNILCGYTSPTISTIDQNPKLIGQTAAHRLLDLMSGNNSTRNSIIDVLPIKRDSTEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Ribose operon repressor
publication title Crystal structure of periplasmic binding ribose operon repressor protein from Lactobacillus acidophilus
rcsb
source organism Lactobacillus acidophilus
total genus 99
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hs3A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hs3A01
5T7BA 4RKQA 2PMCA 5KC8A 4B09A 2A9RA 4WXEA 1YIOA 3T95A 1JH9A 3RQIA 3O21A 3URMA 4RY9A 3OM0A 4JA2A 3NHZA 3DGEC 4LRQA 3CZ5A 3KTOA 5BRAA 1DBQA 3LUAA 1E2BA 1MB0A 3N53A 4F12A 4G86A 2FSPA 3KS9A 2R48A 3CKMA 4YWHA 1BAPA 4G0XA 3N6VA 2WJWA 3MA0A 5TQ2B 2WB4A 2R25B 3QX9A 2JCGA 2L19A 3L6UA 3GWGA 3L49A 1Z17A 4TMYA 4MGEA 2M1ZA 1ABEA 5C5CA 2PUFA 1K68A 1D4ZA 3RVJA 3KJXA 4MS4A 1DC7A 5TPZA 1IIBA 4O1IA 1EAYA 3HV2A 4MQFA 4G0ZA 3H6GA 1QNLA 2P4UA 2FN8A 1PNRA 1D1QA 3D8UA 1T34A 4KQ9A 4MQEB 1ISSA 2YHBA 4PYRA 1ZY2A 3DGFC 9ABPA 4Z4HA 3RVOA 3MYYA 5E3JA 1Z12A 1GCGA 1TJYA 1LBIA 1C0EA 1QQAA 4TLLB 2NZUG 5IC5A 1RXEA 3TD9A 1GUBA 3EAFA 2B4AA 1RNLA 3HXMA 2DRIA 2MYNA 1Z2DA 3CS3A 2PKXA 2VUIB 1W9HA 4O1HA 3C3MA 3LUJA 4E7PA 4IILA 5TPZD 4RU1A 3K4HA 2RJNA 5IBQA 3H5WA 1AB5A 4ETNA 4MS3A 1URPA 4QICA 3TB6A 4MR9A 4XASA 2IDMA 5JS2A 1P6QA 1XWWA 1YS7A 2FQYA 2NT4A 5TQJA 6CHYA 3GL9A 4NQRA 4PICA 1DCFA 4S04A 5DLEA 4JOQA 2H3HA 1NXTA 1UDRA 4G0QA 3FFTA 3A3KA 4MS4B 5FWYA 2H0AA 5TPWA 3KYJB 2LPMA 4Y9TA 5CNIA 4MQFB 2E4UA 3OLZA 1MAVA 4ML3A 1M2EA 2PUGA 2IYNA 4F3TA 3QELA 4YO7A 3KLOA 3OO0A 4XARA 5JNWA 3Q7SA 1E6KA 3HK2A 3O2JA 4RK1A 4RK7A 3OQNA 3OM1A 5FWXA 4NICA 8ABPA 3H5IA 1C4WA 3GV0A 3C6QA 2FMKA 3Q15C 4JASB 4MRMA 3RH0A 2HSGA 1DCKA 1W25A 5KC9A 1ZAYA 3LFTA 2MSWA 1U2QA 3KHTA 4YS6A 5EWLA 4XLTA 3FMVA 2FW0A 3HVRA 4IGAA 1KMIY 4IRXA 1GLGA 3GA5A 3GYBA 1L5YA 4Z4EA 4G0PA 2PJUA 1ZH2A 4HNSA 1K66A 1DBWA 2IPNA 3C3WA 1TLFA 2NZVG 4HNRA 3FGZA 3HO1A 4MS3B 4HYEA 6ABPA 1BDJA 4RK6A 2PLNA 3FFXA 2HQBA 1EWTA 2PUDA 3OMXA 4MR9B 4RV5A 2IPAB 1QP4A 2E4VA 3H6HA 2NT3A 3M9XA 5FWYB 4MR7A 5TPWB 4QYWA 5DTEA 1EWVA 1NXSA 1PEYA 3HEBA 4TN5A 3SY8A 5GOTA 5FBKA 1ZITA 3H1FA 4ZPJA 1EFAA 1FFWA 1SXIA 3O2QB 4HNQA 4MS1A 2FMIA 4LDAA 1A0OA 4MQEA 2HQRA 2PAFA 3G1WA 4LX8A 3RVPA 4Q6BA 3H1GA 1M2FA 1L5ZA 3JY6A 3EODA 5JNVA 4KVFA 2HJ9A 2CHEA 5FWXB 2BGGA 2R47A 3R0JA 4MRMB 4W5OA 5EWLB 2LP4Y 2FVYA 3O1HB 5ED4A 3HUTA 3GT7A 4N0PA 4L85A 3T38A 4Z99A 1FSPA 4KREA 2PUAA 2JBAA 3IDOA 1PEAA 3HDVA 1JF8A 3KYIB 4F11A 2FEPA 3LUDA 2E4XA 1JFVA 3I42A 3IP5A 3N8IA 3BREA 3LUHA 1EWKA 4RS3A 3OLYA 4PZ0A 1JHZA 1PUXA 3TX6A 5KQLA 3H5VA 1USKA 3F73A 1YVUA 3N0RA 2WY2D 3C97A 5CNKA 1JL3A 4EVRA 3A0UA 1YTUA 1AB6A 3SM9A 4ZYLA 4TLMB 3OMWA 3QEMA 5HKOA 2GI4A 3BBLA 2FEWB 4KQCA 4MR8A 5CNJA 3ILHA 4DN6A 5IX8A 4MR7B 4EYKA 3EQ2A 3UUGA 5HSGA 2E4ZA 4EGSA 3CHYA 4KV7A 2IOYA 4KK3A 4LZLA 3ILYA 4F06A 4MS1B 2FMFA 4EYGA 2JB9A 1QO0A 4JB0A 4O5AA 4WXMA 3CU5A 3CTPA 4ZMRA 3DLHA 1XHFA 1MB3A 4P1ZA 1CYEA 1Z2EA 3H75A 1FQWA 1JYFA 2L18A 2F8SA 2FMHA 2GKGA 4XXHA 3KLNA 4MYRA 4W5TA 3GBVA 1BDIA 3NNDA 2PUEA 5B3JA 2JBAB 4YCSA 2LIVA 4RK0A 5PNTA 5DKFA 2JVIA 3F7NA 4LDZA 4RY8A 3MF4A 4KNYA 4Z0NA 2V0NA 2QXYA 2A9QA 1J56A 2PL1A 3C3KA 3K9CA 3LUFA 3QEKA 5EWMB 1QO0D 1Z18A 4WZZA 1ZHHA 4G0OA 4WUTA 3Q7TA 4PEVA 3IPAA 3GBPA 1TM2A 3H5LA 2CHFA 1F51E 2TMYA 1RZRA 4QPJC 5JNTA 1P2FA 2RGYA 3F6PA 3H5TA 3QEMB 1S8NA 2JVJA 1ZESA 3JS5A 2E4WA 2FLWA 4MR8B 1WETA 4YGXB 4MLCA 4N41A 1JX6A 3NHMA 4XAQA 4RY0A 3E61A 5CNMA 1TMYA 3HJFA 1Z25A 2MSKA 4NV3A 4RK5A 3VNBA 4KRFA 1DJMA 1OXBB 4UHJA 2WJAA 5C5EA 3P9YA 1NY5A 1DC8A 3OLVA 2QVCA 2QV0A 2IPMA 4YP9A 2ID9A 4KK4A 1NXVA 3RVNA 1SD5A 1ZDMA 2CWDA 5B3JC 3KKEA 2MYUA 4LE0A 1JFSA 2I6FA 1RZRD 1R8JA 1B00A 1U8TA 3D02A 1VRVA 1OXKB 2GX6A 5KQGA 1RXIA 1SRRA 3HCWA 4GPAA 1EHCA 1Z16A 2GWRA 1Y1LA 2KYRA 3NBMA 4D74A 4EVSA 1DRKA 4WWHA 4NCBA 5IEBA 4RWEA 4ETIA 5IUJC 4IF4A 4EYOA 4W5RA 1BDHA 1D5WA 3O1JC 1A2OA 1BA2A 3LUGA 2PUBA 3JVIA 4WT7A 4Z4IA 3EULA 3KSMA 3JVDA 1LBHA 3O75A 3B2NA 3VNAA 2FTKE 4L4UA 2AYZA 3DZDA 4JAVC 1KRXA 3S99A 4N76A 3EDCA 3N0XA 4Z9BA 3ROFA 2JK1A 4RK4A 5ABPA 5KWSA 3OLWA 3TMYA 1JBEA 3BILA 1DBPA 1ZGZA 1APBA 1JLKA 3I45A 5IEJA 1Z13A 2P9HA 3CZCA 3G85A 3LTEA 1TVMA 1BVHA 1YK1A 1QPZA 1NXPA 4E7OA 5KQMA 3CFYA 4MLDA 3ROTA 5DCLA 4ZMSA 5JNSA 4RDCA 1YMUA 4D6XA 1JFTA 1YS6A 3EJWA 3H5OA 1DRJA 1Z15A 2QVGA 3A0RB 4GNRA 4H60A 3HS3A 4FE4A 4MAAA 3OQOA 3BRSA 4G0MA 2OENG 2QU7A 2O20A 3E3MA 3DLBA 2X7XA 2W42A 5TQ0A 2M98A 2QSJA 3N75A 1QQBA 4NCAA 4Z9AA 4RXUA 3UKJA 2NUBA 4G97A 2JRLA 4EY3A 2FLKA 5EWMA 2ID7A 3HM9A 5EWJA 4N03A 2L2QA 1JYEA 4KZKA 4IMJB 1NATA 2QZJA 4YRZA 4S05A 1USGA 2PUCA 1LK0A 2IPLA 1M5UA 4EYQA 4LE2A 2MSLA 4Z4FA 2A9PA 3MM4A 1Z26A 2F8TA 2B1JA 4XFKA 4N0QA 4QYMA 4OATA 1PHRA 2JVKA 1SXHA 3O74A 1GCAA 3QX8A 1F4VA 5GQSA 3HSYA 3HUUA 4M88A 3JPYA 3RVKA 1QMPA 1GUDA 3HDGA 2CD7A 1NXXA 3RVQA 3QLVC 3M6MD 3IP9A 2LUOA 4MPTA 3NNSA 2HPHA 4DQDA 3LUCA 4P98A 3MIZA 1A04A 1ZN2A 3T6KA 1MVOA 2IKSA 1P8AA 2QW1A 2R4QA 2WWVD 2L17A 1DG9A 3MQ4A 3M9WA 5JS1A 5TQ0B 2VUHB 4RSMA 1USIA 3LUKA 3LKBA 2PL9A 2Q5CA 3CRNA 4JP1A 4RXTA 4KPYA 1PNTA 2E4YA 4JB2A 2OQRA 2LBPA 2N9UA 3IP7A 3Q9SA 4FB4A 5EWJB 4UHKA 1VLZA 5FBHA 4OG2A 3QK7A 5DGCA 3IP6A 1XHEA 3SG0A 3H1EA 5TE9A 1KRWA 1E6LA 3CNBA 4H3KB 3JTEA 3QLUA 3I5AA 1YMVA 3NNNA 2FQXA 5BRJA 1ABFA 5BR1A 5JNRA 2XDYA 1D2AA 4G0YA 4RZSA 1FFSA 2FN9A 3LKVA 1VKRA 3MMNA 2FEKA 5HQJA 3LMKA 4ETMA 1DP4A 3LOPA 1ZH4A 3OO1A 4Q6WA 5KQPA 3O1IC 1MIHA 4F8JA 4Z4GA 2AYXA 2RDMA 3N0WA 1E6MA 1U2PA 2GBPA 3A10A 3UK0A 4ZJPA 1U0SY 3KCNA 1FFGA 1NXWA 2ZAYA 2YHAA 4OTZA 3SAJA 3SNKA 3JPWA 1ZVVA 3RVLA 1P6UA 2ZWMA 4IMIB 1ISRA 1CHNA 2FXIA 1JDNA 4H3HB 5HM6A 3BRQA 1CEYA 5T3YA 4YR7A 4Z4CA 1NTRA 4D6YA 4OLBA 3QLUC 5KI6A 4DADA 4YV7A 1QP0A 4OBBA 3IPCA 7ABPA 3CG4A 3CG0A 5IUNC 2MYTA 3SQNA 1JWLA 2QR3A 4W5QA 3DBIA 4YLEA 3EQZA 2VK2A 3RVMA 3Q41A 3HZHA 5IUKC 3RVSA 4RKRA 3Q7RA 2HQOA 4OLAA 2VYCA 3QLTA 3CLKA 3FDFA 3FFWA 2WRZA 2PE5A 4FE7A 1KGSA 1YK0A 3EGCA 2FQWA 4RXMA 2MYPA 3OLXA 1DZ3A 4CBVA 2RJOA 1H9CA 5TQ2A 3T8YA 4EVQA 3TO5A 1LJUA 3OQMA 1SXGA 1M5TA 1QP7A 4KFCA 1D1PA 3QLVA 2A9OA 3F6CA 5JNUA 4N47A 1LJLA 1RPJA 3GRCA 3RVRA 4KMRA 1DCMA 1VPWA 3W9SA 5F64A 1I3CA 2J48A 5I4CA 2WMYA 4PE5B 5D2CA 2FKAA 3I09A 1HEYA 1JDPA 3KG2A 1QKKA 3QELB 1NXOA 5CHYA 4EUKA 4W5NA 4Q7EA 1ZGGA 1U04A 5BQ3A 3O2SB 4LE1A 5IULC
chains in the Genus database with same CATH superfamily
3RM3A 4PZDA 3F4BA 1THZA 2J5QA 4DA8A 3FZNA 1JPNA 1MGPA 1T35A 5A04A 2WP8J 2MMCA 5DV9A 3BEOA 5KQSA 1KMHB 2EP5A 4BNKA 2ZR7A 4DL9A 4MYTA 3AR5A 3LPCA 4IXNA 1OH8A 4OO3A 1CU1A 2XUFA 4HN2A 1YR9A 3SLRA 1QO9A 1YFKA 1KO8A 3BQNB 5EERA 3WNQA 1T8TA 3UYKA 4I1IA 1O54A 1K8QA 2OTCA 1U2SA 2J9XB 4QGSA 1YB5A 1UDXA 2VRBA 3DOHA 3GN2A 1Y4ZA 4X1KB 4HLQB 4PGAA 5FI1B 4OXQA 3A6ZA 5BUCA 4OKIA 4DUPA 5IANA 1RI4A 3AERB 4QGAA 4QUGA 2YV5A 4CUKA 4D9IA 3FG9A 1J1IA 1UQUA 2DPHA 3K70C 4KFTA 1K63A 2X5KO 4UDXX 5E8JA 4NARA 4AROA 1L6RA 2X0JA 1KPGA 4JBHA 5KOHA 3CE6A 1CTQA 2E2WA 2ZE5A 4MRSA 4O1IA 4Q9DA 3FWPA 1JDTA 1SBNE 5IMSA 3GEEA 4OM8A 2VHXA 3KXKA 3Q5GA 2SCUB 1ZN8A 1MVNA 3AP2A 1T34A 4J9UE 3EPJA 2H6EA 4LKRA 1YB7A 1ZY2A 3MCTA 4F4JA 3HCFA 4YUWA 1CJTC 3C4VA 3RUAA 3D6FA 1B1AA 4AXBA 1DRWA 2GLTA 2ZRQA 2FWAA 5J5AA 1NTOA 2XB9A 4KYTA 2OXIA 2JKYA 1LFDB 1WXFA 2WSMA 3HCPA 4OAPA 4Z2YA 2MYNA 3LBYA 4WECA 3C6BA 3IAEA 1VGQA 4PQFA 5TR9A 4D26A 1KU0A 3H3JA 3STWA 5KYYA 4AZTA 3OIUA 4OQDA 3DM9B 3WLRA 1ZM3A 4GPEA 1XOIA 3ZTTA 4Y9DA 2OHJA 3J81k 4QG7A 2JIZD 2CK3A 4MS3A 5ALMA 3TOZA 2VHYA 5AM5A 3HI6A 2R00C 3I9JA 2D1FA 4LNAA 5DEIA 5FWAA 1MP0A 2XB4A 1U0RA 3B1VA 4IDAA 3QFRA 3GJYA 5F21A 2HXGA 1OFUA 2DWCA 1VKHA 4JBYA 4K9KA 1EJ0A 3LX6A 5AH0A 4KR3A 1Z0JA 2H3HA 3O8LA 4MWZA 3FTDA 1S7CA 1VI6A 3A3KA 4B6EA 4LI3X 2IS6A 1KKMA 4JMLA 2EZTA 2F8MA 3NWBA 1QDLB 4RMGA 2CDNA 1NW8A 3D7KA 1HC7A 1OI7A 3PXBA 4R2IA 4Q9JA 4D9BA 4QDUA 3VO8A 3IIKA 4RD3A 1TAGA 3QELA 4PX9A 4YO7A 2IHJA 4D8XA 3GEIA 5JNWA 2ROQA 3Q7SA 3HK2A 4HAUA 3HN6A 1NJFA 4KV9A 1YCGA 5SYNA 4YCDA 1KJ8A 2A6PA 5FWXA 3DE5X 3M3DA 1W5AA 2FWJA 3G2MA 2ZU0C 2L69A 4IJVA 2W2QA 4C6TB 4FEYA 2VHQA 3K35A 1B93A 4BO7A 3NFRA 2DR2A 2FWRA 2J6CA 1Z4LA 1P5HA 3PTLA 4GZ5A 3GVPA 4QUJA 2FWIA 1TM7E 3TCXB 1FRFS 2Q07A 4KQHA 3P0IA 1N2XA 4HLDA 4JSRA 1HTWA 3E8SA 1XQYA 2C7PA 2PJUA 4OXNA 4DV7B 4HNSA 2QRLA 1MBZA 2IPNA 1WMSA 4LUCA 4B31A 4QYIA 2CZGA 4I5FA 1F17A 1UXGA 3GLGB 3MIIA 5LL6P 3F0TA 3LBNA 1GEEA 4OHMA 4ROTA 1L8XA 1Q83A 3V4FA 1GZUA 3FHLA 2H4ZA 3O8OA 4WFIA 4KYVA 2Y9MB 3HYLA 5LA6B 3UJ7A 5CBKA 2EYUA 2IZ7A 2KLBA 4YAKA 9LDTA 3BH6A 2OP0A 3H2ZA 2IV2X 3ZW8A 4XEUA 4LHYA 2ZI5A 3IE0A 4WL0A 4MICA 4WBNA 3E9CA 5L8VA 5AW5A 4B3SB 1PEYA 2DPMA 4ND7A 4PQRA 5DBIA 4UDNA 2BGWA 1D03A 2C9MA 2Q29A 4MS1A 5FA6A 3KKQA 4MQEA 4P4NA 2JAPA 3V4SA 1M2FA 1MO2A 5ALVA 1NLZA 3E3LA 3JY6A 5KX5F 2XRYA 4LZOA 1Y1SA 2VH5R 1KO1A 4WNAA 1SUCA 2HXSA 3QE3A 3EOBI 3S68A 4BIIA 2WQ6A 3GLGE 3EY9A 4DY4A 3IAUA 3Q98A 3NUGA 4MVWA 4Z1MD 5EWLB 4TT3D 1SIUA 3RJ9A 4JKIA 1WUJS 4RHCA 2MMGA 3AESA 2GASA 5CX1A 4C0SA 1Y3HA 4BJ3A 1QQ5A 3R9XA 2JIPA 2P2SA 2WPNA 4JS0A 3WV5A 1BN7A 2ADMA 3RG8A 4YRBA 3WA6A 3IMEA 1ISMA 1RJWA 1OZ0A 4D6PA 4EMSA 2JC3A 3WHKA 1MORA 2PS0A 3KQOA 4L0MA 3OQ1A 1Z4KA 5EQTA 2A30A 3BWVA 3ZYCA 2OKGA 3QUBA 5AKEA 1U28C 5TS2A 4LC1A 3W7AA 2P5YA 2I87A 4N39A 1SXJB 2QLLA 4WESB 3RU3A 4YUXA 1DEXA 2B1IA 1R7RA 3NYIA 1E8NA 1ONPA 1E6EA 3WE7A 4F86A 2HNKA 1DBVO 1BGWA 1B8OA 2X23A 3FTQA 3IDFA 3QU7A 5CG1A 3UYLA 5AMXA 3L0PA 1NF8A 3OKPA 4DQVA 2CJPA 2C04A 4JI5B 2SICE 1NAIA 1IQ0A 1MTZA 2FNAA 5ENVA 4MUAA 3ZTYA 4YYZA 4C2BA 1N5IA 3DE1X 1QUEA 2YWRA 3ZBUA 1T2VA 3NI2A 3IUEA 1A9SA 4LS3A 2GKGA 4ZI7B 2KM1A 3NEPX 1GGFA 4UAGA 3IEUA 1BU5A 5CAEB 4A26A 4IDNA 1N8KA 3Q6IA 1U7DA 2FRXA 1V2HE 2H11A 4XCXA 1I14A 3V9PA 1LUAA 5K4GA 2V3WA 3VJLA 1IXKA 1LXCA 3WGYA 2BFCB 2F43B 3QXCA 4ZTZB 3F7NA 2B4RO 1YT5A 2P4EA 2PJDA 3IULA 4Q4AB 5LCXA 2D3TA 3O90A 1J56A 1N92A 1SXJE 2MR5A 3GO4A 3M7IA 3MRTA 1HM5A 2M1XA 1UP4A 3IUMA 3OLCX 3VPSA 4YMHA 4WUTA 2CT8A 2HA6A 2ZM5A 1NN5A 3GHHA 2VTBB 1ACMA 2OZLB 1NT4A 3GUUA 4EQ6A 1MJNA 2CHFA 1FP4B 4QU5A 1J42A 2WDPA 3PUJA 1QR2A 3K96A 5D8DA 2RKWA 3EQ8A 3EZ2A 2CV0A 4PC6A 1MVLA 2NO7A 3DFFA 1BOFA 5CCEA 3NHMA 4YV2A 4O6VA 4PR3A 3CNEA 1F9EA 2HSJA 2QTNA 5CNMA 4AAYA 3WYFA 3ZHVA 3MINB 1C30A 1M9NA 4X84A 4CJXA 3EMBA 3NT5A 5DCYA 3TMKA 1WDMA 2I3DA 4M22A 3A9TA 1U7UA 2ZRNA 3GDHA 4MYUA 1S6YA 4YRLA 2OD2A 2Y0CA 4HDAA 3R8XA 3RVNA 4LF8B 1LU9A 5KMGB 4FN4A 3FB4A 3IA7A 4QYXA 1R6AA 3N39C 3D02A 5H7XA 2V97A 4FFBA 3RQSA 3ZE9A 2X2OA 2EFJA 2WYWA 4HDSB 3ZU4A 1JHAA 5K8VA 2RSLA 4ZEOA 3PXXA 5FTNA 2C7QA 2AL7A 3WVNA 2XQJA 1C4XA 4UXJA 2J3MA 4G89A 2RH4A 2UXCB 1EP2B 2DE0X 2LCIA 3H9QA 5LQUA 4CE6A 1ULTA 5TGZA 3GFRA 3D2AA 1H0HA 2Q6TA 4XR4A 1GN8A 3NTUA 2I33A 3EULA 1HH4A 4WRRA 1F48A 5ALJA 4EW3A 2GCNA 4RPKA 2HCBA 2H65A 1CNMA 2XQGA 4Q21A 4FT4A 1ZSVA 2D5BA 2C9YA 2ZCJA 2CXQA 4TQUS 2Q2OA 4RK4A 1VDMA 3N05A 4ESHA 5DM4A 2IYRA 2AN1A 2VF4X 2WKPA 4FYVA 1G60A 1FRVA 2D5CA 2XYRA 4MINA 1C3XA 2V8BA 1V45E 2YNMA 1AV7A 1FVHA 3ICQB 3KEQA 4F7DA 3T5DA 5AXDA 4HQKA 1Q74A 2YDXA 4MDYA 4TVBA 1P19A 3KQVA 1FUKA 1NNSA 1FNDA 4PC3A 4II7A 5EMLA 5EJIA 5BW5A 5CDGA 2CWWA 3OBIA 4DEVA 1QBGA 8ADHA 3AJEA 4WASA 1J0EA 2PH3A 1SBYA 4U2GA 1SM4A 2FUEA 2WU8A 3H11B 1NG9A 3RUEA 3B2EA 5TQ0A 3WQSB 4DPKA 2A1UA 5IYZB 1DTWA 4R6XA 3OI7A 1OWNA 3CXUA 1E2LA 3OTHA 1PR2A 1JR3E 1JLHA 2I4NA 2QUKA 2PT5A 1XSEA 3CX8A 4G97A 1FVOA 2M6KA 5K8JB 4RTJA 5EWMA 4PLVA 3V9AA 1JLRA 1RM0A 4G1UC 4RGQA 4K7JA 3SR0A 4CMBA 4YCMA 4EB6B 4F93B 1KZ1A 1QRAA 2X1MA 2FZLA 4AXXA 4IHJF 4MIOA 1WD5A 2J3DA 5HE9A 1ICIA 4I8DA 4P4SA 5K99A 3NBUA 4A2PA 1XA0A 3TQTA 2FPWA 2JD0A 4TXHA 3ZCRA 4RNCA 3VC2A 4BP8A 5K3OA 2IJGX 4WCFB 4OATA 4BX2A 4OX9B 3SZUA 2ZRMA 3LHKA 1RP7A 3CKKA 1N3BA 5A9RA 1GNPA 1F6BA 2VLBA 5CDFA 1UMDB 2WMOB 4DLZA 2V7XA 3V6LA 1M7BA 2YWFA 3CLSC 3SX4A 2RC5A 3MD0A 1SC3A 2HR1A 2GYVA 3RVQA 2J0UA 3M6MD 4A03A 2XVZA 2A0UA 4P3PA 3N2LA 4KITB 3OF3A 3EBOA 4ZT5A 4AULA 3RBZA 4KAFA 5AVYA 4B0PA 2EBWA 2PYIA 1LWOA 1IE3A 1SC4A 3L4BC 3QPWA 1OBFO 1MHPA 2XYQA 4KPGA 2EKBA 1CP2A 1GTJ1 2X13A 3AUKA 4KPFC 2V65A 3UKDA 1YZNA 3OFVA 2D7DA 2NVUB 5ELMA 2M6LA 4UZFA 1GUYA 4UTOA 1WCXA 2AQHA 5KVQA 1N3IA 4E32A 2R84A 3TQQA 2W2VA 4BEBA 1ZOIA 2IYLD 1D1TA 3CC8A 3TPCA 5TV2A 3KP1A 4K9DA 2LIPA 1EFDN 3UO8B 2P91A 3U2QA 2KBEA 1SXQA 5DGCA 5L51A 4TUYA 4KWTA 2I29A 5JPIA 3U4CA 4ZOBA 1V6CA 2NWQA 4B74A 5C7LO 1LQTA 5JT1A 1X1BA 3NNNA 3QUTA 3ZZUA 2ZIXB 4LMBA 3OQJA 3QW2A 4BGDA 1KI7A 1TX4B 4F4UA 4Q4LA 4V2IA 2NM0A 5DNYB 5BNTA 1WULS 4EMBA 2A5LA 4EY8A 2EERA 3I2IA 2O2GA 1W5FA 4HYQA 4PRZA 1UJMA 2H4JA 4UCXA 4KI0A 4E30A 2O4UX 2OLJA 1A96A 4DCOA 3AIMA 3C1AA 3OO1A 1AK9A 4NJEA 1IMJA 4OCZA 5GVRA 1SBZA 3TZLA 3UJHA 2RHMA 4G5RA 5KQRA 1SKMA 3BSWA 1LRKA 4WX2B 4R83A 1IC6A 2GJ9A 3GELA 4WXRA 1ZD2P 4U02A 3X1WA 4DILA 1U2PA 3F8SA 2OO7A 5F1PA 4BUJA 4AUNA 4F4IA 4YLYA 3L6BA 4AKTA 2VZ0A 3ES9A 2AXNA 3PPYA 1NBHA 4GX2A 3F46A 2XECA 4YJ2F 3SNKA 4CNQA 2ZETA 4FLMA 5AK4A 5EMKA 4WBSA 1WMFA 2DSTA 4GWKA 4QPNA 4H3HB 3WTBA 2PUVA 3THOA 5J2TF 2FZKA 5FBLB 1FNBA 2GEJA 1HE5A 3IQFA 3ZEAA 3LXRA 5GGYA 2VJNA 1RABA 3CPHA 3OM8A 4DADA 1WE2A 1WS6A 1WMAA 3FZYA 4CQMB 3DTNA 3CG0A 1Y4UA 1JEEA 1NVTA 4P3NA 3ZGZA 3VOAA 1QU3A 1KAGA 3CB4A 1I6MA 3UC9A 4Z7QB 5KNBA 1XF9A 2P6OA 2IXEA 4M53A 3C5WP 3R7WB 4A1OA 2R6FA 4AK9A 2NO4A 4CLOB 5IZCC 1LTHR 2FX3A 3Q41A 4CUJA 1W4LA 4AS1A 4H35A 3RAEC 4WK2B 2HQOA 4B3HA 3SIXA 5C4IA 2NVWA 2HLPA 2JLYA 2A4KA 3LRTA 1RRGA 4BNVA 4FE7A 3CW9A 1ZVKA 1QYRA 3V3TA 3BKXA 3CRW1 2FQWA 2VDKB 2C2MA 3F5FA 2FFQA 1Z8FA 1JFFA 3OIVA 3SZOA 4NAVA 4IVNA 2I0FA 1JV2B 4RKEA 5JADA 3NVDA 4QTUB 3GNSA 4E1AA 4P3KA 2X40A 3DE0X 4AJ9A 2H92A 4QHSA 3F6CA 4GOOD 2FOXA 3GRCA 4BFLA 2POQX 3VZCA 4TOIA 4HLUC 1SHJA 2NZWA 4HH3C 1I8TA 3O03A 3CA8A 2W6CX 4I5GA 2YNMD 5LXTF 1JDPA 4H6PA 2PT7A 1KK1A 2MDTA 4G37A 4NCHA 3M9LA 5I7RA 3EMVA 2C1ZA 4F1KA 1JA0A 1HLFA 2JD1A 2OB1A 2PX3A 1QC5A 3C7CB 4YRFA 3WRYC 4EL0A 4B3TB 4CKEB 3FCOA 2X5XA 3QVGB 2NUAB 2R1TB 4DA4A 2PXCA 1T5HX 4RKQA 3V2IA 1ZCJA 1N0UA 3WQRA 4S35A 1BOOA 4WXEA 1ZZGA 2NO1A 1RBMA 4CM6A 3OEED 3KVRA 5ARBA 2G9RA 1K3TA 4N0EA 4BWYA 4LRQA 3REQA 1FRNA 3EVZA 4M1SA 2DWUA 4NEGA 4MWDA 1ZN9A 2C61A 3CQ9A 3ML1A 2ZRFA 4UARA 3V6MA 1KO4A 1W6UA 3K9GA 1OBVA 3KPYA 4RPCA 5K3EA 1XZBA 2AG8A 1DAFA 4GE0A 5AHXA 3V8VA 3HKCB 4XLZA 4LJSA 5CBPA 1QK3A 5KDDA 4DE5A 2LDXA 1HE4A 4Q4JB 2RGEA 3PDWA 1PVVA 3IKMB 1FBNA 1G8FA 1MQ8B 4EY6A 5BN3B 2WF5A 3WRVA 3KC2A 4AU1A 2HA5A 5C8DA 1E20A 1G38A 1UK7A 1ZMTA 3WB9A 1HQDA 2J0QA 1GWNA 2XCOA 2L0XA 4DDKA 2ZTSA 1K5GA 3OCWA 2IEYA 3IPLA 3V4LA 2X4DA 5AYVA 4JEMA 3K70B 1PRYA 2E5FA 3G2LA 3IPRA 1RQ7A 3AUYA 1L3CA 2WVAA 2Z1DA 5IAGA 3HJRA 4FYYA 4DKJA 3V48A 4GKJB 1ODFA 2H9YA 3IURA 2YHBA 2OBLA 1XQXA 4KDEA 1OAKA 2NO5A 3FYUA 1NPDA 2VWPA 1JEJA 1ADJA 1Z12A 2GR9A 3RGGA 1IN8A 2P9YA 2ZVDA 1A5ZA 4I55F 1GZ4A 1T9DA 1SOWA 1T9GS 3HE3A 3NTVA 3GG2A 4P81A 1RNLA 3LQFA 3CS3A 4QVGA 3CGGA 1RWMA 3AILA 1XELA 2O8CA 4PSUA 4DMHA 3C3MA 3SD7A 2OV2A 4IILA 4AN1A 3WFZA 1WKBA 3LJKA 4Q5IA 2C5GA 1JVBA 2H18A 4BMDA 3U44A 1V9LA 1N34B 2JANA 1DO0A 1G5PA 2J3IA 2XQVA 3UTCA 1PLJA 5IWAB 4WDQA 4XASA 1LBEA 3FHCB 2QSUA 1MEOA 2O6HA 4BVAA 5H59A 5KTMA 1E1MA 5LP6F 3LQRA 3IXMA 3GLUA 2UVPB 2PZJA 4W7IA 1XVAA 4JOQA 2RHJA 1EFPB 3FPFA 1ZU4A 4NYJR 4UEQA 2Q28A 4DCVA 5J2UF 1YS9A 1T9GR 3L9XA 4REMA 2X41A 2ZI9A 3DZKA 3K9HA 1P3JA 2BTQB 3FUWA 4CCWA 2O3JA 3CR7A 4JLWA 3I72A 3EGXB 3QYFA 4ENRA 4LJ9A 4O0MA 3AVTA 2IYUA 4YCBA 4W9MC 1G19A 1RKVA 3QLJA 4ZKDA 2JFQA 5ICMA 3I6ZA 2HJHA 2YCLA 1A82A 3DF9A 4U6SA 5J9FA 4CQLB 3W4KA 1KVRA 1IQRA 1J9ZA 3GD5A 4OL0A 3U7IA 2FQ1A 5BYBA 2B0CA 1TYDE 1Z38A 4W99A 4ZAVA 3AEQA 3HRHA 1F9AA 3QU9A 4BEVA 1T2UA 1H1DA 2CLKB 2GB4A 3E58A 4Z54A 4UNPA 4F4DA 4PANA 4ARAA 4ECAA 3EHEA 1WB5A 3AU9A 4IIJF 3NIFB 1N7GA 3NALA 4ALMA 3B9RA 4M37A 5EE9A 3FGNA 5DF1A 2C3PA 4EOGA 2Q2VA 2XQFA 4K9NA 1BDJA 1KI6B 1MN6A 2B61A 1M34A 2HLDD 1EWTA 3NCHA 3O95A 4KPUA 4MRVA 4S1NA 5DX0A 5TMBA 3M5CA 2OEPA 3GFOA 3LXUX 2J9RA 4MPRA 4FLFA 3S40A 4UEKA 5KS2A 3WNDA 2E87A 4DEYA 3WFIA 2CB9A 1QZTA 1V7PC 4LJ4A 2AIRA 4K2AA 2DBYA 1X9GA 2EARA 3B60A 1MGOA 3ND7A 2B92A 3DT6A 1WTCA 3MS4A 4R98A 3TH5A 4B84A 1Y8RB 4NH4A 5JALA 1YH3A 4LHSA 1BKDR 4HT3B 4IG4A 3ZE2B 1UMCA 4QFMA 4FMCB 4TN5A 2GM3A 3DJFA 4ALNA 1NHGA 1E79D 2YFQA 4KXXA 1UDBA 4YMTA 1E8MA 2Z8XA 3EZ7A 3GJRA 5T8KA 1KY5A 5AHRA 5AXBA 4EPYA 2QAGC 4L0CA 3UK7A 1VLMA 2ZUFA 2B9EA 3O4FA 2PUAA 3ZDAA 3H1GA 5A0VA 2EEZA 3A4IA 3QEOA 1F5NA 1M1NA 1MC4A 4QNRA 3HTXA 1GKLA 3I1JA 3STVA 3A31A 4BZZA 1FSZA 3WLFA 3WL5A 3H7AA 4WLOA 4YRQA 1TVKB 2WZQA 2O2YA 3CPEA 2VT6A 3EVGA 3G0DA 3OCVA 3RDPA 4KWHA 5CLHA 1J06A 2WABA 2P5TB 1NR1A 3LP6A 4OMDA 1M1YB 4CMIA 1AA9A 1FNNA 4L85A 1YCHA 5ITSA 1GPMA 5JW6A 4WIAA 1KYYA 4F96A 2RG1A 3FPSA 1S1CA 2AI3A 1XMPA 4F9EA 1Y5LA 1JFVA 1UP6A 2PKQO 1KBOA 1MRZA 3G2QA 3O38A 2PGDA 2Z8YM 3H83A 4YMIA 1UK9A 3RASA 3OLYA 5JAMA 4DCMA 1FDWA 2HSDA 4IUCS 1YVUA 1TUBA 2XOXA 4MCHA 3TXXA 4PHFA 1XDZA 1GL9B 3QEMA 2OYCA 3CVXA 1X38A 5AW9A 5L95A 1EZ4A 2W4MA 3F2VA 3N3BC 1NV9A 1KZHA 3PFBA 3UUGA 2ECOA 1OE0A 4MVCA 1WABA 3SJZA 1SXPA 1P7YA 2BFEA 1T8WA 2BM9A 3WWCA 4MUBA 4OHVA 3T54A 4BO9A 4D4GA 4YIHA 1D5CA 2BGLA 1EJ6A 1I0IA 1PWZA 5DH9A 1X94A 1TAUA 1LBQA 1OWPA 5TJ9A 4F2HA 3KETA 4NFHA 4XWGA 3RYTC 3K6SA 3HKBA 2CV1A 4OP1A 1PR4A 2GVDC 2WWTA 3H75A 3M2TA 1O96A 2L18A 4Q15A 1FDIA 4H7FA 3CCBA 2BMEA 1WMDA 1B4DA 4TYYA 3PFFA 2ZUWA 4CIXA 3FSGA 1EFLA 4DBZA 1X1DA 2FPKA 4TV8B 5B3JA 2VAXA 1SGWA 5JJBA 3HJAA 1GLVA 1AUVA 3I2HA 1PZGA 2E82A 4C5AA 3K9BA 2YRXA 1UXHA 2PLRA 2X2FA 3ELWA 3AVXA 1TZCA 3LUFA 3JZFA 4PG6A 2BDTA 1TO1E 1EUCB 1ULZA 2BR3A 1VE5A 2OGTA 4HYTA 1VJ0A 3TRHA 2AA3A 2BY4A 2OCKA 4HXGA 4U0JA 5F2EA 3RU9A 1SOMA 3OAAA 4GKBA 1P8JA 4W5HA 2JGFA 2NUPA 1S4QA 1P2FA 2RGYA 1XJ5A 1AZSC 3AB8A 3DPSA 2PD3A 1XXLA 3N6XA 2FW8A 4HS9A 2XT9A 3T0IA 4BDTA 3V7WA 1J33A 3JW8A 5KDLA 3ESAA 5K1ZA 3ZNQA 4Z3KA 4MLCA 2ZRLA 2QYHA 2Q1UA 3HL0A 3KDAA 1YUNA 1H2HA 2DPXA 3TZKA 5FUWA 3KB2A 2QX8A 4YP5A 4TZ0A 4EHHA 2V7UA 2ZBPA 3U13A 1B23P 5IVHA 1NOKA 2X4LA 2W4IA 2PS3A 3MJCA 4AJKA 1E3SA 1JE1A 3OHSX 3RG2A 4NOJA 4URHA 1Z68A 2CFRA 4IIFA 2P4SA 5BUZA 2HJWA 2I6FA 4ZVUA 1B00A 2BFOA 4BV8A 5KQGA 4GC9A 2RHLA 1G7TA 1WDKA 2C31A 3G7UA 4HY3A 1NW7A 1SHUX 4CM7A 5JXHA 1FQKA 1V71A 1YV9A 1PG0A 1Q0LA 2JIQA 3P1JA 1E3WB 1P4GA 4K9QA 1YRHA 1GZ3A 3KE9A 3PUYA 5IEBA 4CF4A 5EMHA 1XHLA 4EUSA 3O1JC 4G5OA 2O3QA 3VPGA 2IXGA 3G9QA 3GCZA 5TRTA 2DVMA 3SMQA 3JVDA 4TPKA 4PZEA 2HB6A 2R4UA 3ISJA 4QGHA 1X87A 3DZDA 4AUEA 4WK6A 2MSCB 3E5HA 3WWDA 4I2NA 3GD7A 3CVYA 4G2TA 1Z45A 1ABBA 2V7EA 4OQNA 4J16A 1WZEA 3L7KA 3BXPA 1BMQA 4R5MA 3EVTA 3QLEA 3J81A 2A2ZA 2Z4RA 3Q8MA 1H0RA 4L5AA 4NU6A 1X7GA 13PKA 4L0DA 4B4DA 1O89A 4JENA 3G2IA 4JBWA 3WMRA 5KTKA 4F21A 5JASA 1DBRA 3GK3A 3QHPA 2Z2IA 3KSUA 3NBXX 4POAA 5ELXA 1WVMA 2Q3LA 4MV5A 1BE0A 1P4SA 3H1FA 4FE4A 1EP9A 3BRSA 4A5SA 1VIAA 5GINE 5IN5A 4D79A 2G70A 3HM9A 4UULA 4FIZA 4H7PA 4MVJE 4A2CA 1QHYA 2G72A 4WKBA 1YCFA 2I62A 3ZDCA 1RHKA 1CDOA 4D9GA 2M98A 4NEHB 1USVA 3LXXA 4RXUA 1MQSA 3E81A 4TTIA 4OK5A 5TT1A 3DZHA 3BORA 2H1CA 3BSYA 1GHTA 4RFVA 2OA0A 5HDQA 4QARA 2IUTA 2J45A 3GLRA 3IKVA 3LT0A 2CLSA 3VR5D 4EPVA 1J0CA 1ODKA 2O7VA 3WWYA 1PBTA 1UM9A 2DCMA 4DGSA 1YONA 5TLSA 2O7NA 1QHNA 4LFCB 3VHXA 3VR5H 3TAUA 3IEMA 2CF5A 4C0KA 3A2NA 1V4VA 1RM3A 1XAHA 2N42A 2XQKA 3S0JA 3UJ8A 3U7FB 1E1CB 4UAUA 4QT4A 2O06A 1NKVA 3I58A 1QGUA 3WZLA 3ZK7A 1H8HA 3C0KA 1PJAA 4E03A 3H1TA 1B1CA 3JWPA 5C7OO 2M2IA 1FY2A 1VMAA 2GA9A 1DOHA 3VVLA 1ZCFA 1E63A 2B0JA 3HXKA 1N9GB 1OLSB 1U9ZA 4XWOA 5IF3A 5JRDS 1R5JA 3QVUA 3M6XA 5JYEA 3PJEA 5ULLA 4CEHB 4RADA 1GAXA 4CKCA 2GF9A 1QCYA 4AN4A 2C2WA 1ESEA 1Q0UA 2OWDA 5TXGA 3DYVA 1UDAA 4PLTA 2I4MA 3H2SA 1TM3E 3M49A 4P53A 4RZXA 2DCUA 3V55A 2IZ1A 2XAUA 4XJTA 1OPRA 4EEZA 3U9TA 3W5BA 3OZVA 2QSYA 5K2OA 2VWHA 4MW2A 1XCMA 1P7VA 2GLXA 3MJSA 4ISCA 3RRFA 1MO4A 4AY2A 1DAKA 1F4LA 3LKBA 1WKCA 2PEYA 3D3WA 4E09A 5B3LA 1LSOA 1QF9A 3BWMA 1RSZA 2UU9B 2OORA 1X7ZA 4KE7A 5LUAA 3PV0A 1QP8A 2G67A 3AHDA 2HU8A 3HL4A 1XXHA 3PXAA 2VOEA 4GX5A 3TE7A 4B79A 5AESA 4YQYA 3ZIDA 2BONA 1H2WA 1XHEA 1QVWA 2Z1MA 4BO3A 5AM1A 4YRMA 2XKBA 1Q0QA 3FXAA 3H1EA 4J3FA 1KOLA 4PN3A 3KQLA 2RE8A 3ZWKA 3COJA 2QUZA 1WBDA 2I2AA 3N8NA 1N2HA 2RARA 2ZB3A 2DC1A 2V7GA 4DLTA 3IXQA 1EE9A 3WNBA 1DRVA 3LKVA 4B2YA 5B4UA 1ZJJA 4J1SA 4IIXA 1OVGA 1ADFA 4Z4QA 4KX3A 2Y1WA 1W5TA 2WFMA 3DFIA 5B2EA 4GP7A 1TQ4A 3PLNA 2WAMA 5JDIC 1UJ4A 1RHRA 5JAZA 3IVXA 1IMOA 3K2QA 4JQOA 3L7OA 1HGXA 2CLLB 3I0NA 3TTSA 2C8VA 2XGGA 3KEOA 4LQLA 4LXYA 4S1PA 3GFVA 4MUIA 3FNFA 3EASA 5KJCA 3C6KA 2C9CA 2E4AA 4WZBA 4IMIB 3VDQA 2DLNA 1L1FA 4DV6B 3F6SA 4YUYA 4HQLA 4EY7A 1UMBB 4U6NA 4J1TA 3U61B 2Q3MA 4MQ4A 4MI9A 3S2GA 2P30A 5HPYB 4XIFA 5LQNA 5ALWA 5LYJF 1JQJC 1KZYC 2GHIA 1RHJA 4Z8YA 3SKYA 5EJ9A 3CG4A 3G8AA 2GO1A 4KQ6A 1G7SA 1Y5IA 4IJQA 5IUNC 4TS9A 1SHZA 2VAPA 3E8MA 3QOXA 3KR9A 4KQCA 1LSUA 3WYEA 3OTOB 3I1YA 2V9PA 5H02A 4ARVA 1F2TA 2FPXA 4TQ9A 1W5BA 3AGPA 2B20A 3A1TA 1U6JA 1VL6A 2QRHA 3VKUA 1OIWA 2PX5A 1RACA 2GQ0A 4L9RA 3V1UA 3DDWA 3V8BA 4BLRA 2VYCA 1W1IA 4JUAA 3EG9A 4DLSA 5MN4A 3I6YA 4M1OA 2PX0A 1ZD5A 1ZO8A 3QENA 4N49A 4UBIA 2F90A 4NCNA 5FIUA 2XHEA 3I6QA 4ACBA 4NBVA 2ECFA 3THYB 3LPAA 2YYZA 5AP9A 1XTBA 2RI0A 3SF0A 3X1KA 5E1DA 1RM5A 2Z5GA 1YRWA 2BKLA 1W8DA 2X0KA 3USCS 1K6EA 2VTDA 3PVCA 4QGGA 1RXWA 3UJ6A 3TXAA 1Y1RA 2V7WA 5L3RA 3W6UA 1WX1A 2PGXA 3O31A 3T1TA 1PGOA 1I3LA 1AF4A 1E2DA 3P0JA 2WMYA 2HRZA 1PJLA 3JQAA 4G01B 5HE8A 1BE6A 1T2FA 1NXOA 3E35A 4NYMR 1ZK0A 2FSUA 1A4RA 1AQUA 1NMYA 3EWAA 3GH1A 1U04A 1G63A 2ATXA 2O2SA 3TX2A 4ATNA 4RD6A 1XBTA 3A9CA 2ZB7A 1RWQA 4LBZA 3ISTA 4B82A 4I99A 1OYWA 3RQIA 1Y80A 5AOAA 4RY9A 4NOMA 1T2NA 1O94C 2BI7A 1DDOA 1V37A 1D2NA 4MRPA 1M0EA 1T0JB 5DM0A 1G8MA 1KI4A 2F1HA 1IM5A 4QC2A 4O4LB 4R1TA 2EP8A 5WRFA 4YRGA 3OQIB 2F55A 3B52X 1M54A 3AY6A 3HH8A 2RGWA 3L0OA 5EZ5A 1MV8A 4JC4A 2EX0A 5KYXB 3FA2A 4TKMA 2O2ZA 2HIGA 4QNNA 3T7EA 1QV6A 1XLTC 2R25B 5F3RA 3D8SA 2E7ZA 4IHQA 3AHIA 5KTOA 5JQGA 4MO2A 3WIOA 5DBGA 2H4YA 2IF0A 1KI3A 4ON9A 3A05A 3SHVA 2TMKA 3QU4A 1BU8A 4ZZ3A 4LC0A 4AG3A 2F4VB 2BRUA 3LBIA 4IFEA 4EYOA 4QJBA 4UBJA 4HEJA 4B83A 1SR8A 4G1EB 3RFVA 3BPSA 1A72A 1ZNZA 1FIUA 2RIRA 3BZWA 3I5MA 4RIGA 2EP7A 5DO9A 1JZQA 4JFAA 1L9KA 4Q9KA 4G1BA 3LLSA 3LQ1A 3GJXC 2ZT7A 1PS9A 1ISJA 4G25A 1JSCA 1TA0A 4HAOA 1A71A 3D6AA 1A9OA 1CQJB 4YJ3B 3O83A 6REQA 2DMRA 3DT9A 3MUOA 3QXHA 1GPH1 1OFIA 2HPVA 1MB9A 3EAFA 3HA7A 3KUXA 2AMVA 5CW2A 3HXMA 2W6MA 3WLOA 2AUTA 1J97A 4O3FA 3UMJA 4DSNA 2Q45A 2PO7A 1XD2A 3BJEA 1U3WA 5TPZD 4EJ6A 1O8BA 2OC9A 3HJNA 1UJBA 4EECA 4LHEA 2JJ1A 2QRPA 3LCMA 2F2TA 4NBWA 1GUZA 1N5LA 3MGBA 5BQFA 2D4AA 1KSFX 1FA9A 4QODA 4DB4A 1YFJA 1CLUA 3MFQA 4FX5A 1Q2UA 2OCYC 1P74A 2D1YA 3K09A 3PB3A 2ZTLA 3FKSA 4H0CA 2AOVA 4Q4HB 2Q8NA 3K32A 1XA4A 1BRTA 3ZR4B 4PU0A 1TT5B 2XF8A 3EVAA 3AM5A 4UJ3A 3FFTA 1U8UA 3IEXA 4CTJA 5CXUA 5FWYA 2LPMA 3PHLA 3WKCA 3ZWPA 4GYKA 3OA0A 2FPMA 5F3DA 1B43A 3DKKA 4N5HX 1DKPA 5CT5A 5EHIA 4BXOA 2C97A 3A27A 3Q8LA 3BULA 1WHSA 3JQGB 4FGLA 4HNAB 1MJHA 4B46A 2D1QA 5CRIA 4R9UC 1N9ZA 2GN8A 2QTTA 3LSTA 5K3BA 3ZVKA 3GMSA 4G8JA 4YDRA 1GVHA 1MRNA 4DA6A 3BXGA 3ZIAA 2I1VB 2QD5A 3LQQA 4CF3A 3OJXA 1MT0A 2AV6A 4ID9A 4UREA 4X00A 3STHA 3SVZA 4FMPA 2HSGA 1DIAA 4N82A 1KL7A 2VDPB 3NP9A 2H2AA 1BEUB 3NVAA 1R4AA 3DONA 2DH5A 4G23A 1QX4A 8LDHA 1CR6A 4E3WA 2F9MA 1EE1A 5HILA 2FZ5A 3T4UA 1WU8A 2OD9A 2UZ0A 2XXBA 5C3UA 4XKJA 1VLQA 1EUYA 1BNCA 1K98A 3IC5A 4MW0A 6ABPA 4BN5A 2H31A 2Q3EA 5I51A 1ZIYA 2PLNA 1GQQA 1A76A 2OM6A 1IRXA 1CUZA 4YDSA 5FOUA 3VR3D 4PZ9A 4RJTA 1Q0RA 3PHCA 3SZRA 3OY7A 2IX3A 5LUBA 2FFAA 1NBWB 4HADA 4CDGA 4BWVA 1J49A 2HK8A 2PZBA 3USES 4YBRA 3O2NA 2XRFA 3ADDA 1Z4NA 5TPWB 2ZQZA 3FDJA 3WHPA 2FJ0A 2PD4A 2ZWIA 3WNZA 1J00A 2VXOA 2XA9A 3AEXA 3NU1A 4FQ7A 1KMCA 2TSYB 2WYVA 2ZBEA 5REQB 4CIYA 2HQRA 1H6AA 3G1UA 3UHAA 2AX4A 1WSDA 2Q3DA 4N18A 4YPVA 5JJLA 1WUIS 3KR1A 3O92A 5KYTA 1Z4JA 1LLQA 2Z8ZA 4I4TA 2QAGB 1Y6ZA 1FPQA 1TYBE 3H65A 3E82A 1D09A 4ZARA 1Q0ZA 3MTAA 4M98A 5BPHA 5F2NA 1CRPA 1G20A 4CPDA 3O4IA 5IVPA 2ASVA 4NU0A 4UHEA 3WL7A 2ZSUA 4TKUB 1SXJD 5A3RA 1J5PA 2K5UA 5ITVA 2HD4A 3E18A 2YRWA 3KZXA 2FR8A 1CQWA 3H99A 2OMEA 5DGTA 5B53A 1ZMRA 3V46A 4IJWA 4YXFA 2YWDA 2JAOA 3ED5A 1Y6QA 4BBJA 2GZ2A 2CDAA 2J7PD 1AS0A 2GXUA 4QEDA 4CKXA 4XIJA 4TKZA 4RLQA 4A0SA 4KQKA 1PT6A 2B4YA 4KSBA 4XWKA 2PSSA 3JU3A 5DCUA 1E96A 2C58A 4LDPA 3KNZA 3RBXA 4AJHA 1N75A 1RJ9B 1O5TA 3QXXA 4DN6A 2PXHA 3H18A 4ES6A 2Y1LA 3SOZA 1PIWA 3UK2A 3OQ6A 1J99A 4EHIA 1TKRA 2YMLA 4BHTA 4GPD1 2ZPAA 3EW7A 3RRJA 1SH7A 1FJ2A 4LF6B 3A8TA 3UJDA 2UKDA 3DQPA 3WISA 4O5AA 4FNGA 2KMLA 2XCTB 3AR6A 1E4VA 3CR8A 4Q19A 3WGIA 3VYUB 3DLHA 3PX7A 4FGSA 1E0JA 3C6YA 3I9V1 2EHJA 5HCIA 2A0FA 4D57A 3P96A 1GP2A 3N74A 4H15A 3V2UA 4GPIB 5DRYA 2QR2A 5JAPA 4OMUA 2J3JA 1DUIA 2OZEA 4C4XA 4G1MB 4G63A 4GIBA 4JLOA 1T4BA 3OJWA 3BJIC 4WKGA 3EZFA 1A7AA 2OCXA 4I6GA 4MPDA 3SXPA 2Q5IA 3FBGA 3EIUA 3ND6A 2WWFA 4G09A 3G5AA 3MFYA 5ETJA 2ZJYA 1RMTA 1KORA 2JI4A 1SAYA 2ZI6A 3GEGA 4X8LA 4ALJA 1Q1GA 1Y9ZA 2WHPB 4K81B 3C3KA 1YHZA 1E1QA 3FCXA 1SCKA 3FW1A 3QEKA 4NENA 4TWAA 5FUVA 2IP4A 5MGNA 1YL7A 1QVRA 4EPRA 1XEXA 2O54A 1TM2A 2I6UA 2X9NA 3PJDA 3OFND 2G4CA 2QMZA 3FYSA 1GY8A 4L6IA 5JNTA 5FA5A 2PBRA 3L7YA 1K0FA 3L0BA 4PHGA 2V55B 2DZDA 2OZVA 1UH5A 1QHXA 2BFFB 2KB0A 4PCVA 3SC2B 4FNMA 2Z4TA 2XVAA 4UBKA 4KRFA 2IS1A 2XMBA 1RLUA 3GYGA 4HLNA 1QF6A 4WLFA 1GFWA 3EC1A 1CIVA 1R0WA 3I37X 1WVIA 3L82B 1NVVQ 1P1BA 1VG0B 3CJTA 3DTVA 2G8NA 4P4UA 4TXMA 4UXIA 5I7SA 4RF3A 1J22A 1ZDMA 3UAYA 3QKWA 1I4LD 2OFXA 2DR0A 4E46A 2M9MA 4X7BA 1YHYA 3V8PA 4DLRA 4YRSA 1JR3D 3AGQA 1P60A 2IT1A 3HCWA 3FCYA 3TLGB 5LP1A 2PWAA 2V59A 2ZS7A 3U7HB 2OECA 2GFHA 5KYKA 2BGRA 1R5OA 4ENVA 4WWHA 2PZKA 1NW6A 3B7PA 1HUQA 2ZJAA 3BXXA 1C1XA 4YRIA 1CE8A 4B3FX 4CWAA 5KPJA 4IKEA 3FNIA 3BMOB 2MINA 2ZSKA 4O4HA 3EEYA 1CRWG 2XTJA 3JVIA 3WLKX 5IF9A 1TQ6A 2R7MA 4LYYA 5IC6A 1Q0PA 1Z3CA 2O1SA 2QMUA 4GYYA 1T9CA 4RBNA 1R88A 2HIAA 2W2NA 4YRRA 1KDVA 4B2IA 2D1TA 3NC1C 1DKNA 4FBLA 3ZIAD 5B36A 3JATB 3HDQA 5SYAA 3ROFA 2JK1A 5ICSA 4PO3X 1TF7A 4OP2A 1CUWA 4N40A 4U2KA 1QDEA 2FG6C 5JZ9A 3AOGA 3N8DA 2YHUA 2G5PA 2JAXA 4WBNF 5KU1A 4OI0A 3VJRA 5FL7D 2YFHA 3WWPA 2IYPA 1Z5VA 4BNIA 1NXPA 3D8RA 5K0BA 1RYDA 1UKZA 2FPGA 2VLIA 3M4YA 3T4XA 5C8VA 4RDCA 4UAVA 1YMUA 2G5TA 2O2XA 2GKSA 1UEIA 3LYUA 4JJKA 4AJ1A 1TZBA 1DGQA 4P36A 4WE3A 3OQOA 3T3HA 2BSXA 4MB6A 1PQ4A 3W34A 1QAMA 4EIWA 1JHOA 2X7XA 3GIDA 2CHQA 2AKAB 4Q03A 3KB1A 5K4HA 2WIKA 1U63A 1CUUA 1ZK3A 2CVPA 4TGLA 5EJAA 4ZZ1A 4NCAA 4Z9AA 2CLIB 3JQRA 4RJIA 1QF7A 3T1OA 1E2MA 3ONFA 2ZOSA 4DSZA 3SIPA 4K46A 4J4TA 2PA0A 2ZIUB 1NJ2A 3PKIA 4KXYA 2VATA 4Q1FA 5CP8A 3I92A 4Q9AA 1LW7A 1NM5C 5FTWA 1Y34E 2IPLA 4B6GA 1RLTA 1V16A 2COEA 2UYGA 2ZIEA 2PVPA 1R9JA 3D7RA 4R41A 4PIVA 1IEXA 3WSTA 3CUWA 1Q44A 4MYHA 1MCZA 5DIFA 2FZEA 2IW1A 4INJA 4KO1S 4KODA 1JEYA 5F7OA 2EFEB 2QUJA 4HXEB 3UT5B 3VPFA 3OJEA 4CODB 3HUUA 1HT1E 1Q7BA 3EXFA 4Q3OA 4EA6A 1BWQA 5FAKA 5ES3A 2XCRB 1NDUA 1FLNA 3E7WA 3QLVC 5JWRA 3HB0A 1J90A 3GRUA 4AM8A 3IAS6 2J08A 3KLMX 3PPWA 5KTTA 5AUQA 5F4BA 4X1YB 1DWQA 2QE7A 1JPVA 3AH8A 1VLVA 3TZEA 1HL7A 1KOJA 4PNPA 4UFNA 1O9GA 3J80A 4ARZA 5KYYB 2QRKA 2P3OA 3QVXA 2WWVD 2XNDA 1ZQ1A 4JN6B 2ZB8A 1KZ9A 4RZUA 3NONA 4TLAA 4UM7A 1VC2A 3V7UA 1USIA 2X5OA 3DAOA 3HGQA 3IQXA 2WYUA 3A9UA 3CRNA 4LBVA 2ZM6B 2XYGA 4LNUA 1YACA 2ZRHA 4US0R 3O7WA 4GPBA 4CIVA 4FB4A 1WBBA 3DHEA 4M9UA 1T9HA 4OX9Y 5MGBA 1V7ZA 1DKQA 1PS0A 3S44A 1PSZA 2DUUA 2ODEA 3V4RA 1XDGA 3BMQB 3CWZA 3KK0A 4BRZA 1KO5A 2GETA 1PZFA 2O2IA 4W1SA 1SBQA 2A67A 4QRIA 1PJRA 5KPDA 1LV7A 3TZ6A 1I4DD 4KR6A 2WZCA 1TGYA 3PR1A 4BQNA 1UPBA 1JIQA 1XE3A 4FOTA 2CDBA 1PR0A 2KSQA 3LE8A 4KUHA 3ZD8A 4IW3B 1O6CA 2R2AA 4O2BA 2W83A 1VE3A 1DTEA 4D3FA 3L41A 2YZ2A 3O94A 4AL4A 3CWCA 4JJ7A 4XJXA 1XNRB 1VZ3A 2PGAA 2W6ID 2ZBGA 3K1TA 4QXPA 2X0EA 3T41A 2CCGA 4IL5A 1DKLA 2CNWA 3VI3B 1SVOA 2ZU6A 2NSDA 2VHEA 2XADA 3AR7A 3FMGA 3GQVA 4GKAA 4HAZA 4PHTA 4WK0B 4CQMD 4LGVA 1SKUA 1Z37A 3CVOA 1GAQA 1DX9A 4MQBA 2OAGA 4M9CA 4OTZA 4CG1A 3EC2A 2GJKA 3G6KA 3HO8A 5ED0A 1ZVVA 2WIDA 3GRZA 3ESXA 4WI1A 1LLDA 1ISRA 1BVUA 4NABA 3Q8KA 1MJ5A 1DHTA 3FFBA 4Q18A 5JEDA 1YJQA 5DSTA 2XZTA 2JA2A 1HMYA 1UBSB 1YBFA 3PDUA 1U2TA 4D5GA 1RYBA 5E2IA 3PR3A 2Q5EA 4WY5A 1XK7A 3NHFA 3WWOA 5E6UA 4BFCA 5IXSA 4LCEA 4TL9A 3SFTA 4J8PA 1IVNA 3GRKA 2R8EA 2AZDA 2R7AA 1H0SA 2JLZA 3UTDA 4N5NA 3I8OA 3USZA 2OO5A 2EZ9A 2QTVB 4DDWA 1JI0A 3RVMA 2YJ3A 1JWAB 3D0QA 1SVIA 4S0XA 4IJ5A 5IUKC 1L1EA 4K2HA 3UJ9A 3VA7A 2ATCA 2MJLA 1WCV1 4ILKA 2HMSA 3Q7RA 3VJMA 1XTSA 5JSUA 2HCFA 4V0OA 2WAAA 4R16A 5LP6C 4MLZA 1MH9A 3FZEA 1ARZA 1MO3A 4BCDA 1L5KA 4KE9A 4MGIR 3MQFA 4ZYTA 1FMJA 2JGAA 4L8WB 4NBTA 4QRHA 5DNAA 4JI4B 1QP7A 2EL7A 2WF6A 3PDIA 3DBRA 3ZLJA 3EZ9A 1TYZA 2RB4A 3AB7A 6GPBA 1LH0A 1X1QA 1EXNA 3UXEA 4IH9A 4BO6A 1SHLA 1R50A 3H3FA 1GADO 1WRBA 1O6GA 5GY7A 2XYHA 2J48A 2B21A 2WWRA 3QE2A 1PTJC 2G63A 3EXEA 1NVDA 1OLUB 3H04A 3UK6A 1SC6A 4HG2A 3HBNA 2GTIA 2YFYA 3L7IA 1NUTA 4QJIA 4R8RA 2JCXA 1L7VC 4EUKA 1G2QA 5JXGA 3RYHB 1ZYUA 2QWXA 1BFDA 1RAIA 3CUKA 3EUEA 1OT3A 3HPRA 1K2VN 3GF4A 3O4GA 3SU8A 2B3TA 4TSFD 1KZGB 1G41A 4GZ6A 3GDOA 3SJAA 1AUOA 1TIKA 1YIOA 5FLEX 5BXQC 3TNLA 4XOUA 2H16A 1C7JA 3O21A 4FVTA 1WL8A 4QXOA 4G4GA 4S1TA 4XQ9A 5C35A 1L5HB 2YJ5A 4F2PA 5F1KA 1QTQA 3LQYA 5M04A 3FTEA 1G64A 2VNSA 1XVVA 4NCJA 4UUPA 2VDRB 4RIFA 3FH0A 2YRFA 4BVHA 4DCGA 4GEKA 2RBKA 1EGVB 2FSPA 4QOSA 3DAFA 3TTUA 3W6PA 3ZGXA 5AD1A 1JHMA 3K70D 2ZKLA 5ER9A 1O03A 1T5SA 1W5SA 1PF7E 2HTFA 2WT8A 3EZYA 1U94A 1XB2A 4R1QA 2J0EA 3RUCA 1XZGA 2QRVB 3KYDA 3MA0A 4FOOA 4PLZA 4QE3A 3P45A 3PSHA 1K92A 4UE2A 1DJLA 4IM7A 1YFLA 2EG9A 5JZMA 3ETGA 3OZTA 4TMYA 3F47A 4Y2TA 1ABEA 1XZ8A 1BJKA 3DV9A 1AUQA 4ENQA 1VXRA 4R3NA 1VJCA 1IFXA 4H1UA 2NU6A 4JLNA 2KHZA 4V3CA 5M29A 3QPCA 3FUCA 4FZVA 1E7MA 5ICCA 2QJTA 2P4UA 3AY3A 4MGHA 5CA1F 4UMDA 3NMUF 1W49A 1Q21A 2ZYIA 3MSCA 1IBRA 3IUNA 1CZHA 1D4FA 4J29A 4RL4A 1PNRA 5AOVA 1NBIA 2BEJA 2IV3A 2BDEA 3DGFC 5K3FA 2HWUA 1JKIA 4A16A 4E1BA 5KX5B 2DEUA 2HWYA 1HDRA 4TTRA 1XLVA 2Q5HA 4TQAA 4U9HS 2QE7D 3IHLA 4DG9A 1D2CA 3BCUA 1UC4B 1Q11A 2I7TA 4RZQA 1CIJA 4CLRB 2B4AA 5CYGA 1U98A 3K8OE 2YIDA 4B32A 2GZHA 2XNDD 2GN0A 4KGVA 2FDXA 2WHXA 4B81A 1QQ6A 5A5FA 2ZK7A 3SVLA 2XODA 4GLOA 2CXSA 3QIVA 4B43A 5FPPA 2JLUA 2G17A 3U4IA 1MX3A 2V7PA 4H1VA 1XZKA 4AY4A 2XA2A 2DKOA 5IH3A 3C87A 5A06A 1AB5A 1WSAA 3P20A 3TVTA 2ZJZA 1R74A 2DBRA 4ZOEA 3UCXA 1RHMA 4H0FA 4EENA 3DE2X 1ZJ5A 2G4LA 3R09A 1NVBA 2HPZA 4MV4A 1MA3A 4JSTA 2E48A 5E1BA 3B5IA 1X80A 4Y2UA 1E4YA 1XK6A 2IDMA 5J1TB 4DEXA 4GG1A 1T1SA 5E2AA 5HCUA 3AZQA 2GS9A 2ZT6A 3UWKA 3FAKA 3K1YA 3VVMA 3RC9A 1BYUA 3VR6A 4Q7MB 1NXTA 2PG3A 3HB4X 2O2JA 2HNAA 4Z8XA 3HGTA 1QS0B 3HWWA 4ML3A 1E9FA 1FZQA 1KSHA 1UFQA 1Z7WA 5CK4A 5ALTA 2CVOA 2D5IA 4I9GA 5GTDA 2WU1A 5GIOE 1Z0DA 4PLHA 4RF4A 3SXUA 5HW0A 1OH5A 3EDQA 4NY1A 2BM8A 3RYCA 1M1ZA 2WA2A 3AETA 3OM1A 1F3OA 2OV4A 3ZJTA 4NICA 8ABPA 1EVLA 3GQBA 2VP9A 3GV0A 2V6FA 2WJ6A 4JASB 4YAOA 4ZALA 4AJEA 4K9LA 4GS5A 4YS6A 3FMVA 3B6EA 4EKEA 3A4YA 1KMIY 4UTZA 4IIEA 5G1OA 1V1RB 3KYCA 2MSDB 4WDRA 4CZ2A 1LZLA 3AJAA 2VSQA 2N1BA 1Z47A 1EB8A 1ATZA 3D1VA 3GZJA 2VPQA 5E9AA 4L5CA 3WGUA 3GBSA 2I8LA 1Y0BA 1KA9H 5ADVA 1LPMA 2FZCA 4MR9B 2YWXA 3BZBA 3C14C 5HBGA 1NVUQ 1UBTS 4JCOA 4MUJA 4PBSA 1KNXA 4D1YA 3GT0A 1A95A 2GAFA 4H31A 1NJ8A 1XU4A 1LX6A 1G2IA 4WFJA 5CB4B 3TIXB 4HNTA 1Y98A 4OSPA 3VKGA 3J7AC 2J85A 3HFGA 4X91A 2GM4A 2REQB 2EZ4A 3VAYA 2GSWA 4TTPA 2ZDHA 1WXDA 1GPKA 1R0SA 4LWOA 2E3JA 1EWVA 1NXSA 3BS4A 4RORA 5BR7A 5GOTA 3ZY6A 4ARSA 2XMGA 4JL6A 1D2GA 1YASA 2R86A 5MN6A 1UPTA 2NIPA 3WDMA 1LCIA 3KX2A 4OHRA 1FQJA 4ZT7A 4YECA 4DCNA 4CDRA 4PW0A 4JXXA 1BQ4A 3E3NA 3T7DA 4AYXA 4IJ6A 5J5VA 4QL3A 3NM4A 4Y9RA 1FYVA 5A4IS 3DDSA 1X19A 2ARKA 2ECKA 5DBFA 2V1UA 4QDOA 1G3RA 4YJDA 4N54A 1FC0A 2YJ6A 3W3AA 5G4LA 1EWYA 4KR2A 4JUDX 1P1KA 4X54A 3PC7A 4MV0A 5J43A 1Y6JA 2YUIA 3IDOA 1CUGA 3UOGA 1CVLA 4FINA 3PHGA 1I33A 4CV1A 4TMFA 4EZEA 2VP5A 2FH5B 3B7WA 3CGWA 3QH4A 4AWXA 3KDSE 1DFHA 1DRUA 3U6BA 5FNVA 2KLHA 4JFRA 4HNGA 3GNLA 3LF1A 1I6LA 4PYJA 2FSVC 1JHZA 1CEEA 2GBIA 2VK4A 1U3DA 1J8YF 2FEXA 2D0DA 4KO3S 4Y2JA 4KQXA 1HO3A 2H1IA 3UWPA 1HURA 1PJZA 3H9CA 4WQMA 4JXKA 3EXIA 1C9EA 3UEOA 4RSRA 3ILHA 3WNCA 2OXRA 3SLGA 3LV8A 3VAZA 1JJAA 5KYNA 4CETA 1LPPA 1O3YA 2PLAA 4AD8A 5BVHB 2YR0A 4MTCA 4JOSA 2AN4A 4A0QA 2BGKA 4TTAA 1ZR4A 3ABQB 1DIRA 1CF4A 2FZGA 2ZVJA 4N7JA 1S2LA 2CKMA 2JRCA 2QTMA 5DYWA 5IP5A 4ZMRA 1NQOA 4HPWA 1KH1A 1VSVA 4LOIA 4J7XA 3MLEA 1JHXA 4P1ZA 1T8RA 3DLIA 2V9CA 4LJ6A 1FFDA 3ASUA 3TCKA 4NATA 5FOQA 1TW3A 5GGXA 2PMEA 4CQJA 3C6MA 4F71A 3LUPA 3K9QO 2ZBQA 2DBVO 3EIWA 1C0IA 1E62A 4L78A 2HYIC 2WUGA 3FN4A 3PI7A 1VIDA 1Y9EA 3QWIA 2QS9A 4FFPA 1KDYA 3DMGA 3ZW9A 4LDZA 4D25A 3WLNA 1KFJB 1WF3A 4Z0NA 4G07A 1P2SA 5IPFA 5JNLA 3NHAA 4KNVA 4RQBA 1XAIA 2VUTA 4RA9A 7REQA 2XEDA 3TAXA 3LDGA 2VDMB 3BBPA 4XLLA 1Z5UA 4KIWA 3M2PA 4W82A 3SQDA 3L8EA 4IHJB 1K7YA 1BX3A 5AQ1A 4WA8A 1M7GA 4JBGA 5J40A 2IHTA 4LRSB 2EW2A 1TIPA 2IITA 2DWQA 3EVEA 3TFQA 3TTXA 4L76A 2GARA 2TECE 2R6R1 4P9NA 3W8RA 3ZX5A 1JG1A 2QQFA 3G1TA 4MAMA 3GAMA 1NSTA 5AHWA 3UWOA 5A4DA 3P0RA 5KHOC 5CA0A 1WP4A 2DY1A 1TMYA 4RMHA 3LZCA 1VQ1A 4B80A 1C7FA 1GSIA 3P9YA 1PS8A 4FB5A 3AEUB 2Q5QA 1KPHA 4GNKA 3RYFB 5BRNA 2NSHA 1IHYA 1FW6A 2XR1A 4RHYA 1ZC4A 5K3DA 1E9VA 4ZCRA 4FHEA 3FNQA 3L8DA 4K6GA 4QD3A 2W7TA 4E08A 1DJPA 2X2EA 2ZE7A 3G5LA 2NQ2C 3TR5A 3GLIE 4OIMA 1W36C 1JDUA 2ZFUA 2P3SA 2H51A 1FP1D 1V8DA 1JVNA 4JQSA 1DI0A 1KEKA 1O6FA 3C45A 3EPHA 1Z63A 4NL4H 4E2YA 4KN9S 4OQFA 5FT9A 4RIEA 3PNBA 1Y1PA 5IUJC 2HMVA 4WA7A 1QIHA 2R96A 3MGKA 5EJMA 1BDHA 3FPBA 3QMWA 1RMQA 5CR9A 2KWIA 3OH8A 1JXOA 1HZZA 1OY1A 2C2ZA 1VI5A 1J07A 2Y8EA 4LF7B 1J2RA 1X92A 5KHLB 3W1WA 4F5ZA 4IDGA 1QKIA 3EG5A 5G0UA 1EGQA 3GJ0A 2IHYA 4LRXA 5DBHX 4Q3LA 4N76A 1MXFA 3N0XA 1QH1B 2B1GA 3E22A 3O26A 4FI3F 4FIDA 3ANSA 3EMDA 1YQQA 3LIIA 4GGMX 4P2BA 5KWSA 4DABA 3DMDA 5ICGA 3QBDA 4U7TB 1U2RA 2BFMA 3MMXA 1FMTA 1QRUA 3PUXA 5LQMA 1TVCA 4RDXA 2WU4A 3O5AA 1B2LA 4GSYA 2F7SA 2QDKA 3WXMA 3PVSA 5EGSA 1RC1A 1JB9A 2X9LA 1W85B 4U8GA 3ZZ0A 4ZIRB 2P2LA 1JFTA 1EUDA 2XXJA 3DCNA 3H5OA 2NO6A 1YI1A 5FPHA 4L8VA 1ILEA 4QA9A 4BE4A 4DA7A 1RE0A 4KCGA 3E5NA 4UPEA 1N6PA 2JGRA 3NZEA 2NTVA 2Q3JA 3L9WA 2RGCA 2NN3C 4HQFA 4YJ2B 4CT0A 2AB0A 1C7IA 4BO8A 4CM8B 3JV7A 3T9CA 3FDIA 5EAIA 3I8XA 5J2TB 3ERCA 2FLKA 1UFVA 5BQOA 3ZNOA 3AHEA 4HQOA 1GXSA 3UICA 1NJ6A 4BOYA 4EHKA 3W2EA 2HSEA 2L2QA 2QEQA 1G0OA 1XNGA 4LA4A 3WLQA 2O14A 1NATA 1M74A 1P9RA 1VKNA 2XWQA 2HMAA 1IHXA 1USGA 2Q3CA 3C74A 4MKIA 3CLSD 4MPJA 3ZHCA 4BN0A 4BVEA 2O8DB 2P5SA 4PRYA 2GH1A 3TMAA 2QMQA 3T7RA 4OGGA 2A9PA 1V11A 2VZ9A 5LD2C 4IGEA 5CB6A 1LI7A 1IWOA 4XFKA 2JIMA 3QBEA 3WTCA 3FLMA 1BE1A 1NZFA 2A86A 3VU3A 2HJVA 1V25A 3ETJA 3O74A 2OXFA 3TLAA 1Y8CA 4AZ3A 4YALA 5GQSA 3N76A 3BXEA 4N01A 1XROA 3W2HA 2VSFA 1YU6A 2WBLC 3RRZA 1N6NA 2TS1A 4C0BA 5ITZB 4CM4A 2K7FA 3QF4B 1MQAA 2W6PA 3MIZA 3SHWA 4Z51A 4RW0A 5C32A 1FJGB 4FFLA 4M83A 1ZOSA 2VAMA 2XUIA 2P9FA 2XTAA 3GJTA 4GM4A 5FI5A 2KX7A 1N7JA 1QOPB 2VYFA 2W2KA 2CBZA 3F71A 2C9DA 2CHUA 3IOCA 4BNDA 1IHOA 3LUKA 1NOJA 1VFNA 3KJQA 1S9DA 1RI2A 2K87A 4X65B 2I76A 2IHBA 5AICA 2NZYA 4RGYA 3WGGA 5DWQA 2EKPA 3V8RA 4WN3A 4R2WA 1ECLA 4MKRA 4NXMB 2QT0A 4G5FA 3BJRA 4A8TA 4A2WA 4P31A 3GLQA 3QUCA 2NPOA 2C2GA 1PVDA 2X15A 2YJ4A 1ODJA 4LXHA 1A8HA 3BFPA 2EL9A 2HBYA 4XSGA 2ZEJA 3WQHA 2BM1A 3E3AA 1NF3A 3LNTA 5JNRA 3D7SA 3HCCA 2K7ZA 2XDYA 3OZEA 4NWIA 2J32A 3RS4A 5LDDC 3S81A 4TMVA 1WSBA 1AKYA 4JI0B 4G6ZA 2C4MA 2EFDB 3UMYA 2J1LA 1XJ0A 5HQJA 5BV8A 4RCZA 3T7IA 1USWA 3M3PA 1T4CA 1X3SA 3TTVA 4BZQA 5H3LA 2JIBA 3P2OA 1SWWA 3CJRA 2VJMA 4Y9UA 2NMVA 3UMBA 3WG9A 1O9BA 3D8HA 1UBCA 1WLSA 3O9MA 2B4TO 3PIDA 3NHKA 3NTLA 3FWKA 4HDRB 4I4LA 1U0SY 4ZJPA 1A9TA 1PGQA 5ECWA 3DEZA 2AD5A 2WWIA 4BO0A 2Y1GA 3JD1A 3ZDXB 3AO0B 4G4SO 1U5AA 5ESRA 5HUQA 2A9JA 1W34A 3E27A 2FXIA 1LDMA 1A9RA 2JGDB 1EQAA 3CRMA 5EQJB 3F3KA 3E7DA 3N28A 5FO1A 3RIGA 4F92B 4KXWA 3ESBA 1NKSA 3E7FA 1O0SA 1IN1A 1AGPA 4I55B 3WKDA 1QH0A 3MOGA 3OVMA 4H7KA 4MIYA 1FDOA 1XKTA 1U65A 3SKXA 2O6LA 6YASA 1I7LA 3EQZA 5IS2A 4CKYA 4UHFA 1GTRA 1Z4PX 4P6VF 4A23A 2WU0A 3RTGA 1CDEA 2BBSA 4X90A 2Y1DA 3TIFA 4AMUA 1I4TD 4E4YA 3KR2A 3MWEA 3FYCA 1NASA 2AOUB 2RAUA 4ZV7A 3SE7A 1EFHA 4JJAA 1DELA 1LF0A 2GD2A 3MXTA 5EZSA 3UB2A 2P9GA 4X62B 1DZ3A 4YUZA 1I3OA 1GFSA 3ANLA 2PUHA 5LMCA 4BKRA 5LP6B 4EATA 1NKTA 4RPHA 521PA 3TZBA 1DARA 4JUCA 4ENSA 4AQ7A 2P6RA 2VDWA 1V3QE 3R75A 3VGPA 1E3MA 4YROA 3I61A 5JS8A 3B38A 3MLAA 3TOCA 1J1UA 2QLJA 3Q5EA 4TWJA 4P3YA 2UYYA 4HGPA 3CT4A 4MCAA 3T1QA 3L1KA 4BFYA 3QNUA 1PDWA 4TV9B 4CV0A 1JEQA 2QMYA 2DKNA 3KT8A 2HMWA 1W8IA 3KG2A 4HDMB 4HGOA 4HI0E 3IEKA 4C3VA 4DJJA 5HQ3B 2VNJA 4XUCA 4MXDA 1CY6A 3K3PA 3O82A 1FMFA 1W96A 4V0QA 5BQ3A 1V5FA 3T1NA 4EZBA 1UKCA 5EJ5A 3LP5A 5IULC 3ESYA 4AMZA 3CSDA 4CNBA 2B4KA 4B09A 1XWFA 1IIRA 4MQUA 5FBQB 5LQCA 4C0WA 4JU9A 4E13A 5H1YA 3IBFA 1XVLA 2VPTA 1TZ2A 3I32A 3NHZA 1FP2A 4M46A 5BRAA 3NWPA 2J31A 3DTTA 1E2BA 2CYAA 1JXMA 2R6CA 2ZANA 4NNJA 4RHXA 3L6CA 2ZTMA 4CXMA 1D04A 2R48A 2ET6A 1ZAKA 3RIEA 3IV9A 3ZDRA 5A9TA 4E5UA 2O9JA 3V2GA 2NLOA 5AUNB 2WUEA 1G21A 3R0QA 2QSZA 2TYSB 3EH2A 3HLTA 3IOBA 4K0KB 3HDHA 1FLVA 4WXYB 4DF3A 4GZMA 5I4BA 4UZEA 3HWSA 4XSVA 3NWJA 5B5SA 3LVFO 1BKSB 4YJFA 2DAPA 1N1EA 4ZO9A 4GPZA 1ZPDA 1YDHA 4WD3A 4XVUA 2H1SA 3HM2A 2PZEA 4R8LA 3N2GA 2DWPA 1KJQA 1U4OA 3JQDA 1GYQA 3TR6A 1PUIA 1VPTA 2YYYA 5I9TA 1CS0A 4L3WA 5I3CA 2XEXA 3VR4D 2GHTA 3TL6A 3BGIA 2EQAA 2PGOA 3K16A 1D6JA 1Y8QB 3VR4H 2A0YA 2Y3IA 2PCLA 3FY4A 2CDCA 4F60A 2J4CA 4UC0A 4D43A 2OXCA 3HYNA 2LTAA 5DNVA 2D2VA 2XWPA 2YHIB 3AP1A 1EHYA 2XMCA 4G4IA 4O1HA 4V38A 1A2BA 1VJDA 1PJCA 3VBEA 3BC1A 5KOYA 2R1ZA 4BX0A 2QLBA 5CDSA 5ALEA 3AI3A 3L4SO 4GLFA 5L3ZA 4M0EA 2SNIE 4CCYA 2ODAA 4Y2SA 5ELLA 4DARA 5E6RB 1GG8A 4Z86A 3NM5A 5CIYA 1XWWA 1DX4A 1G3QA 4GAEA 5B4TA 6CHYA 1YNOA 4E21A 3GPBA 4P0PB 1UOEA 3H2IA 1N0IA 3T34A 1UDRA 5EXXA 3WJ2A 1QE0A 3FI0A 5BQPA 2ACKA 4UVDA 5ICFA 5JO9A 3I6IA 2UZ1B 4EL5A 4F3CA 1MAVA 3QOFA 4HAIA 3TOXA 3PNLA 1RI5A 3EXG1 5GV8A 2WUWE 3R6TA 4GL4A 4M6WB 4FFSA 4XARA 2MT9A 3GLHB 4AO7A 2QZZA 3EFEA 4MULA 1Z5WA 3NC4A 1XMJA 3ESRA 3OQNA 1N4AA 1XO1A 2Y05A 3F5MA 3NHLA 3PUHA 2OXEA 1EFTA 3AM3A 4FZRA 4Q9NA 4JODA 4J2TA 2JJ8A 1EZ1A 5E9WA 4IIYA 2NACA 4JJIA 4OXYA 4E5VA 1KMHA 1S2IA 2R5FA 1BS9A 1IRIA 1QG4A 3DBLB 4XX0A 2RONA 4D9FA 4EJMA 1OT5A 4XWYA 4BQFA 3D4PA 1T8UA 1JKXA 4UMVA 3GA5A 4EQZA 3DP9A 5G1PA 2DULA 3PQDA 4OFZA 4CLHA 5AM3A 4G0PA 4HTAA 4AJPA 2ZZMA 2FE4A 2P9EA 3OTIA 3PDHA 4M8SA 4NBKA 1HFKA 1T13A 3ANYB 4F3NA 1K4MA 3GJZA 5CVVA 3TQIA 2JNWA 5I9IA 1E2UA 1NMZA 3NGMA 5FWDA 4JBIA 2QPLA 4N5DA 2HF2A 4XDHA 2VJAA 5IFLA 1KEEA 1PJSA 1EMDA 2VL7A 4UQLA 1A27A 5G2OA 2FUG1 3TOVA 1CQZA 2HRQA 3GLHE 3M5PA 4JB8A 5BSKA 2JEOA 3MOSA 4LYHA 3UVEA 4NE7A 2ZIZA 2YTZA 2YWBA 4CEJA 4GXQA 4GM0A 3PNOA 4YMWA 3WL4A 2B1QA 1NNI1 5EQFA 1E59A 3C5CA 4V2UA 4BFUA 3L8HA 1LWNA 2J33A 2SCUA 1OAOA 1H4SA 5KYUA 2FMIA 3ZE1B 4D42A 2ESRA 3TW8B 4LX8A 4A27A 1CSEE 1U1DA 4FSHA 4LF4B 3JQ7B 4URVR 2JHGA 1J0DA 2Y93A 1P9NA 5K6AA 3AYZB 3JWGA 1MEJA 1TJ4A 1U31A 4OHWA 2RAFA 2V6JA 5ALYA 5FF9A 4MH0R 5HZGA 5CGQB 4EUNA 1AN9A 1YQWA 1NI3A 4PZLA 5EPEA 4EFMA 1JKFA 1CYDA 1WEKA 1WO8A 1FSPA 4LYFA 1NSFA 2JBAA 3O8QB 3PXGA 3RF7A 4MVJM 3W78A 2E85A 4F11A 1J9GA 3AF2A 4YUVA 3GG9A 4P54A 4ENUA 4D4MA 2D5AA 4C7VA 4I1PA 1VJGA 1PZMA 3WZ2A 3DNPA 3TRDA 3V2HA 4GP6A 2GPNA 1EJBA 4JI6B 2VDVE 2LE0A 3K0KA 9ATCA 2PU5A 1Q91A 2W48A 1JL3A 2QTCA 3TFWA 3QKSB 5JQGF 1JIKA 1VI2A 2Q3HA 2GI4A 4LZAA 3P9KA 4J0QA 5C37A 5TNXA 4K6KA 2R62A 2AI2A 4ER7A 1FRZA 2QTRA 5HR5A 1D2HA 1NGSA 1Z39A 4OGKA 1D6NA 2WG0A 4JGIA 4KK3A 4LZLA 4F06A 2JJQA 1ODCA 4PX2A 1PGPA 5HKLA 4NRDA 1W0KD 3QBVA 4C1BA 4CMJA 2Q2WA 3CTPA 4N5MA 2D74A 1NNEA 3UOWA 1Z0KA 2JHAA 2P6MA 4WSOA 1VPVA 4L15A 4MI3A 3TVDA 4TZKA 2F8SA 1FVXA 4JT8A 3PQ6A 4QRDA 3QV1A 3QITA 3A2LA 1HA3A 1S2OA 2PUEA 4H4EA 3G0BA 3THWB 4J6FA 1XU7A 2GO7A 5GJCA 2H9AA 2YQ5A 5JBNA 5MF6A 1YZYA 3N58A 3O0DA 4DRXB 4EG4A 5I7OA 4O3MA 2FWMX 3DUFB 1A9ZA 5CM8B 2HU5A 2ONYA 1K86A 1NT2A 3ORHA 3ZCUA 1L5WA 3ZWXA 5F12A 4I9FA 5TQ0B 3LM8A 3TUJC 4DJEC 5E9JA 1Z6AA 1RZRA 4EA9A 3FRIA 2B6HA 3ADKA 2XD9A 3OTWA 3OPYB 1NI4B 3KQYA 4J49A 2VBCA 4LDNA 1EVEA 2FZVA 5EXTA 3SYRA 3G49A 4RY0A 3IAS1 1FUYB 4RK5A 1IWBB 1QE5A 4L50A 4AUKA 1Y6GA 3LRPA 5C5EA 3PGA1 5K3SA 4ZK2A 1NXQA 4JL5A 3ZCQA 5F1OA 3N2KA 3ZBQA 4X61A 2RC6A 3QSGA 1N2ZA 2C00A 4KQEA 3S2IA 4AKSA 2XTMA 4RA6A 3KVYA 5CYPA 3S1AB 4EDHA 2QYOA 3FPGA 2BI4A 4IDEA 4LE0A 5I9MA 5TEWA 3MT0A 3C98A 1KU6A 1YRQA 5EXEA 1VB5A 1O6BA 4IVRA 1RRMA 2RD2A 1UFRA 3OPQA 2EJCA 4C30A 4KXUA 1Y1LA 1W36B 1DDIA 2JHCA 2NZJA 2VIIA 1XCGB 4FILA 4G0VA 4NI5A 4ICIA 3KRTA 1AM4D 4R2HA 2O07A 1HORA 2R5NA 3STXA 4B3MB 2WHRA 4X3CA 3IT1A 3GZ4A 4ZVQA 2B8WA 3ET4A 4X0EA 3UMFA 5JCJD 1C3EA 3ROXA 2Y99A 4A8PA 3ZS9A 1IY2A 2IOFK 3MCWA 3BE6A 4YPOA 3UJ3X 3ZUPA 4Z9BA 3FTPA 1TEVA 1NBAA 5ABPA 2OBFA 3CZRA 1UJNA 1BJTA 3ENVA 4GT1A 2ZSEA 3FNEA 4YP1A 3HI4A 4R8KA 3WLSA 1UCFA 1JAZA 1VPEA 3ZU2A 2P9HA 1SELA 1TPYA 3G85A 4C21A 3JAKB 2WTBA 3VYRB 1VP3A 4E2XA 1M6VB 2XCSB 4C5C