3HS3A

Crystal structure of periplasmic binding ribose operon repressor protein from lactobacillus acidophilus
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
264
structure length
264
Chain Sequence
KKSKMIGIIIPDLNNRFYAQIIDGIQEVIQKEGYTALISFSTNSDVKKYQNAIINFENNNVDGIITSAFTIPPNFHLNTPLVMYDSANINDDIVRIVSNNTKGGKESIKLLSKKIEKVLIQHWPLSLPTIRERIEAMTAEASKLKIDYLLEETPENNPYISAQSALNKSNQFDAIITVNDLYAAEIIKEAKRRNLKIPDDFQLVGYDNNILCGYTSPTISTIDQNPKLIGQTAAHRLLDLMSGNNSTRNSIIDVLPIKRDSTEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose operon repressor
publication title Crystal structure of periplasmic binding ribose operon repressor protein from Lactobacillus acidophilus
rcsb
source organism Lactobacillus acidophilus
molecule tags Transcription regulator
total genus 99
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hs3A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hs3A01
2MSKA 3HZHA 3QLUA 4M88A 4KPYA 4GPAA 2PE5A 4LDAA 3O2QB 2R4QA 3CU5A 4PYRA 3CNBA 3RVNA 1LK0A 1DP4A 4F3TA 1U2PA 3TO5A 4HNRA 4JB2A 5FWXB 4EVRA 3KS9A 4OLBA 5HQJA 5JS2A 2PUFA 1YS6A 5JNSA 1CEYA 1E6MA 3IDOA 4JASB 1TJYA 2X7XA 4MS4A 3D02A 4MLDA 4O1HA 3CRNA 4W5OA 2PKXA 1FFGA 1FQWA 4RXUA 2MSLA 4OATA 3KSMA 4ETNA 3EQ2A 4KFCA 3BRSA 3DGFC 5CNJA 1YVUA 3E3MA 1ABEA 1JL3A 4NCBA 1Z25A 1JF8A 3MIZA 1SXGA 3HXMA 5KC9A 1QPZA 3N0WA 2LIVA 3VNAA 3SAJA 4OBBA 3CTPA 2F8TA 4OLAA 3N0XA 3KYIB 2ZWMA 4G0PA 3JVIA 4MQFB 5IUKC 3KYJB 5TPWB 1QNLA 3QLUC 5F64A 1DBQA 1P2FA 3JY6A 5GQSA 3RVOA 4W5QA 2VUHB 2QVCA 1RXEA 5KQMA 3OM0A 2HQOA 5IBQA 3A10A 3CG4A 1QO0A 2M98A 3GL9A 4XXHA 5CHYA 5IULC 4Z4FA 4DADA 1Z12A 5TQ2A 3DLHA 4F11A 3H6GA 1GLGA 3OM1A 2MYPA 1SD5A 2HJ9A 3T38A 3HV2A 4QYWA 4KV7A 4Z4GA 4MS3B 1ZY2A 3KLOA 4Z0NA 3IP7A 3O2SB 1JFSA 5EWLB 4H3HB 3JS5A 3LUHA 1E2BA 2L19A 1P8AA 1QO0D 3LKVA 3G85A 1S8NA 3URMA 2HPHA 5T7BA 1NY5A 3F73A 3T8YA 1L5ZA 4ZJPA 4FE7A 2VUIB 4WWHA 3C97A 1QP4A 3N8IA 2IYNA 1GCAA 1ZGZA 1D1QA 1ZGGA 4B09A 1RNLA 4YCSA 2W42A 1NXVA 1OXKB 3KHTA 4IRXA 3ROFA 5IEJA 1JDPA 5DTEA 1PNRA 2FMHA 4YV7A 1EWTA 3BBLA 5JNWA 4MAAA 2XDYA 4MR9B 2E4UA 3GYBA 3D8UA 2FXIA 4O5AA 2GBPA 3SM9A 1QP7A 2CHFA 4TN5A 4L4UA 4RU1A 4Q7EA 2QVGA 3I09A 1YTUA 2V0NA 4MQEB 5ABPA 4MRMB 3LUCA 3O1HB 1FSPA 3NNNA 3OLVA 1BDHA 4YS6A 4W5NA 1CHNA 1AB6A 3IP9A 4P98A 3CLKA 3CG0A 3I5AA 1LJLA 3H6HA 4RKRA 3MQ4A 3BILA 1ISRA 3RVMA 3SY8A 1FFWA 3NHZA 1RPJA 2R48A 4YO7A 3KLNA 4RK1A 3OQMA 4LX8A 1U2QA 4NQRA 5ED4A 1PHRA 1DBWA 5C5CA 2CHEA 1NTRA 4WXEA 1E6LA 4MYRA 3FGZA 5DGCA 3H5LA 2ZAYA 4RK5A 1ZH4A 2RDMA 4MR8B 5KWSA 3KCNA 4D6XA 2QU7A 1TLFA 2VK2A 3OLWA 1APBA 3ROTA 1UDRA 1Z2EA 3L6UA 4HYEA 1A2OA 1DCKA 4UHKA 1U04A 1VRVA 5JNVA 4LDZA 4ETMA 4MS1B 2E4WA 2A9RA 1K66A 1VPWA 1MAVA 1DJMA 1DZ3A 4KMRA 5BQ3A 1ZVVA 3EDCA 4DQDA 3H1GA 3H1FA 2FLKA 2QZJA 4IMJB 3HVRA 6CHYA 3LOPA 2ID7A 4YR7A 1Z26A 4Z99A 2RJNA 3GRCA 3I42A 4QYMA 4E7OA 2PUBA 2QSJA 1YMUA 4G0OA 5FWYA 1USGA 3SNKA 2PUAA 1URPA 2LUOA 4CBVA 1P6QA 2J48A 2IPAB 3FFWA 4PZ0A 4LRQA 3SG0A 2PUEA 5BR1A 2FMFA 2IKSA 4HNSA 5JNUA 2CWDA 3H5OA 2LP4Y 1D4ZA 4MR7A 1BDJA 4YWHA 1LJUA 2FMIA 2FQXA 2FVYA 2WJWA 3Q15C 2O20A 2ID9A 2RGYA 3O75A 4TMYA 2WJAA 3EJWA 3O2JA 4RV5A 3H5VA 4Q6BA 1D2AA 3MF4A 3HJFA 3QELA 2JVKA 3S99A 4JB0A 4RK0A 4XAQA 4S05A 1EHCA 2HQBA 3GV0A 3I45A 3KTOA 1Z15A 3QEKA 5EWMA 1YK1A 1ISSA 1J56A 1T34A 1YS7A 1GUBA 3OMXA 4EYQA 4EYKA 1JWLA 2WWVD 5JNTA 3EAFA 1C4WA 2PUGA 2IPMA 1F51E 4YGXB 3OLYA 4LZLA 5EWJA 1KMIY 1NXOA 3IPCA 5BRJA 3NHMA 1GCGA 1DC7A 4RK6A 5T3YA 3EODA 2JBAA 5KI6A 1QQBA 4RDCA 3DGEC 3A0RB 2FKAA 5HSGA 3TMYA 3OQOA 5FWXA 1YK0A 5I4CA 4WZZA 2WMYA 2CD7A 4NICA 5TPZA 2BGGA 4IF4A 1JYFA 1KGSA 1SXIA 3UKJA 1DC8A 3QX9A 2RJOA 5E3JA 1BDIA 5JS1A 1DRKA 3RVPA 3NBMA 4EY3A 4NV3A 3HO1A 4JP1A 1DCFA 1QKKA 4PE5B 4KQ9A 1EAYA 3OLZA 4RY0A 1JH9A 2LBPA 1MIHA 3FMVA 5KQLA 1NXTA 2L2QA 4WXMA 3QEMB 4G86A 2JVJA 5TPZD 3GT7A 4RXMA 3HS3A 1NXPA 3CFYA 4GNRA 1PNTA 1PEAA 3GWGA 4MQFA 3DLBA 3M6MD 3LUJA 4XARA 5TPWA 8ABPA 1RXIA 5D2CA 4FE4A 4JA2A 4P1ZA 3FFTA 5BRAA 2QV0A 2GI4A 3CS3A 2GKGA 1BVHA 3O1JC 1MB0A 2L17A 2DRIA 3B2NA 2YHBA 3ILHA 4RK7A 1ZITA 4Z4HA 3C3WA 5TQ0B 1QQAA 3UK0A 3QX8A 3CZ5A 3H5IA 2E4XA 4Q6WA 4RK4A 4Z4CA 1M5UA 2JRLA 2I6FA 2OQRA 4MS3A 4LE0A 5CNIA 2NZVG 5EWLA 5TQJA 2QW1A 1Z18A 1LBHA 1XHFA 3N53A 2HSGA 3HSYA 9ABPA 2PL1A 2FTKE 1Z2DA 3HUUA 1L5YA 2JK1A 5KQPA 4RZSA 2QXYA 2AYZA 3TX6A 1LBIA 1H9CA 2FEWB 2L18A 3LUKA 3DBIA 2FSPA 4KK4A 4RSMA 4HNQA 3FFXA 4MS4B 5IC5A 5FBKA 2FEKA 2GWRA 4IMIB 4MLCA 1M5TA 4MR9A 4Z4EA 1C0EA 3H75A 3RH0A 1ZN2A 3CHYA 2IPNA 4UHJA 2FW0A 1R8JA 5KQGA 1A04A 3HUTA 4MQEA 3OO1A 4N47A 1JX6A 4MRMA 4RWEA 3LUFA 4QICA 1BAPA 1SXHA 1A0OA 2FEPA 1EFAA 4G0YA 4Y9TA 2WRZA 2A9QA 4N76A 2PUDA 4D6YA 2PUCA 4MPTA 2FQYA 1MVOA 2PAFA 3HDGA 4H60A 3GA5A 1YMVA 2IPLA 3M9XA 4PICA 3KG2A 2MYTA 3A0UA 5GOTA 1NXWA 3K9CA 1HEYA 4ETIA 1E6KA 3NNDA 3C3MA 5HKOA 4XLTA 1XHEA 5IUJC 3BREA 4EVQA 2F8SA 5TQ2B 7ABPA 1JDNA 4MR8A 3IPAA 2MSWA 1Z16A 2JBAB 3T95A 2JVIA 1D5WA 3TB6A 4F12A 5B3JA 1ZHHA 4S04A 1AB5A 1EWVA 4WT7A 4W5TA 2B1JA 1JLKA 2VYCA 3N0RA 3RVJA 3HM9A 3W9SA 3RVQA 1TVMA 3JVDA 1K68A 4G0XA 1Z13A 4MS1A 1JFTA 3OLXA 2WY2D 1U8TA 1KRXA 3EGCA 1DG9A 3N75A 4F8JA 3QK7A 1TMYA 5FBHA 1QP0A 2MYUA 1QMPA 4IILA 2AYXA 4NCAA 4W5RA 2IOYA 1DCMA 3OQNA 3K4HA 1TM2A 4TLMB 1YIOA 4KNYA 2R25B 4LE2A 5IUNC 4TLLB 1USKA 3M9WA 4WUTA 1NATA 5DLEA 4D74A 3F6CA 3QLVA 4JAVC 2H0AA 4QPJC 1CYEA 3G1WA 2B4AA 4KREA 3A3KA 5DKFA 3RVSA 3GBVA 4G0QA 2H3HA 3NNSA 4YLEA 1F4VA 1ZESA 3RVKA 3CKMA 4ZMRA 2FQWA 3SQNA 3OO0A 2Q5CA 3HK2A 3L49A 1PUXA 3O74A 4MGEA 4RKQA 2E4YA 3T6KA 1XWWA 3TD9A 4FB4A 5B3JC 3GBPA 2JCGA 3KKEA 2MYNA 5CNMA 4KZKA 4EVSA 4YRZA 2QR3A 4OG2A 5DCLA 1D1PA 2GX6A 5C5EA 1M2EA 4KQCA 3E61A 4L85A 5TE9A 2PJUA 4XFKA 1ZAYA 1BA2A 3BRQA 3CZCA 3LUDA 5HM6A 3IP5A 3LUGA 3R0JA 3P9YA 4ZMSA 3IP6A 2P4UA 2YHAA 3Q7RA 3HCWA 3MYYA 5CNKA 3ILYA 4IGAA 4JOQA 3LFTA 1USIA 3H5TA 5PNTA 1M2FA 1JFVA 4KK3A 1FFSA 2M1ZA 2TMYA 3HEBA 4N0PA 2WB4A 1PEYA 2R47A 4EGSA 2OENG 1KRWA 1WETA 1JHZA 2PL9A 2FN9A 3QLVC 3DZDA 2JB9A 3EQZA 5IX8A 4H3KB 1SRRA 3Q9SA 2N9UA 3VNBA 1EWKA 1IIBA 1JBEA 2E4VA 3OMWA 4KRFA 1W25A 4Z9BA 3RVLA 2A9OA 1DBPA 3HDVA 1NXXA 1DRJA 2P9HA 3JPYA 3MA0A 3QLTA 4ZPJA 1OXBB 4G0ZA 4G97A 4EYOA 4DN6A 1VKRA 1VLZA 3EULA 3O1IC 5KC8A 4XASA 1Y1LA 3C6QA 5FWYB 3C3KA 3JTEA 2A9PA 4EYGA 4KVFA 4E7PA 1Z17A 1MB3A 3FDFA 3Q7TA 6ABPA 1ZDMA 4ZYLA 1W9HA 1P6UA 3QEMA 2E4ZA 2NZUG 3LKBA 1GUDA 3LUAA 2PMCA 1I3CA 5JNRA 2FN8A 2NT3A 3LMKA 3MM4A 4MR7B 2NT4A 4N0QA 3MMNA 1RZRA 3F7NA 4RY8A 4N03A 2FMKA 4ML3A 4YP9A 3Q7SA 4RY9A 2LPMA 1JYEA 4F06A 2NUBA 3QELB 1U0SY 3Q41A 5IEBA 3JPWA 1B00A 3F6PA 2IDMA 2KYRA 3O21A 4Z9AA 2FLWA 3KJXA 4Z4IA 3RVRA 4LE1A 3UUGA 3H1EA 5EWMB 4EUKA 2PLNA 4RXTA 3LTEA 4G0MA 5TQ0A 4OTZA 1ZH2A 4PEVA 1RZRD 3H5WA 2HQRA 4RS3A 1NXSA 4N41A 3RQIA 5EWJB 1ABFA 4O1IA 3N6VA
chains in the Genus database with same CATH superfamily
3R6DA 5JPIA 4LWPA 2OCKA 3T3NA 2BFMA 5BW5A 2QBYA 4GPAA 2QWXA 1I6KA 2BFEA 2QR5A 3ANLA 1KQPA 2EL9A 2IF0A 2RGAA 3VMMA 4BNMA 1N7IA 4OI0A 2C2BA 4L5IA 1PJ3A 4G8DA 3VI3B 4NFSA 4P9NA 4QTTB 4BO7A 3FOFC 4LC0A 4W7SA 3RI3A 4M87A 2J9FA 3ZCXA 2VLIA 1MABA 2Z6UA 5SZJA 2JLWA 4Y2RA 2A1TR 2R8ZA 3IDOA 3L4BC 5BN4B 4JEIA 3TVTA 5A2QA 1SO8A 4QBGB 4N40A 1ZMBA 3PK0A 3FD8A 1U6IA 4D0GA 1ZI8A 2TMGA 4OFBA 4KFCA 4JFAA 3KFLA 3TK1A 4ZJYA 5IDXA 1V96A 4OU4A 4GZMA 1IY2A 1M34E 1ZBQA 2O05A 3CNLA 4L27A 3LT4A 3UAZA 3VR4H 4CV0A 2YIDA 4NENA 4G8CA 4ZAYA 3LYUA 2WKSA 3VH2A 2JHFA 1E6EA 4EF6A 4HGRA 1W88B 5EKTA 2CL6X 4AX4A 1IN7A 4EF5A 2C7QA 5ADUS 1KZHA 2Q9AA 3Q87B 1A2QA 2FE1A 3T3HA 4HAYA 3DF7A 1HE5A 3E9CA 5HQ3A 3WP0A 1P2VA 2I6XA 3QLUC 2Q7XA 3ED1A 4QQFA 4ESVA 4ZI5A 3GJTA 1P2SA 4ZYWA 3W2IA 2VYNA 2O8NA 3V32A 3ONWA 2DTDA 3A10A 1PL6A 1PL7A 2EGGA 2FMUA 2ILTA 3GL9A 3OJOA 5E1DA 3A1TA 4DT1A 1LDEA 1P4JA 4HWRA 5C34B 2YV2A 1R0ZA 3ENNA 4C6RA 4BTVA 2DXIA 1DTEA 4ERXA 2OCBA 1EA5A 1XAIA 4DG5A 4NYIR 3NALA 1OYOA 2HEGA 1MJFA 3GGOA 3CVJA 3LCRA 4PAQA 4RQTA 4L57A 3V46A 3ZS8A 3H84A 4C0WA 4EKYA 4Z0NA 2CV2A 1N4AA 1UWLA 1XU7A 1ZVQA 4RABA 4MRAA 1NUTA 1PR2A 3FVRA 3NIBA 2FWPA 4KDCA 5EY5B 4GL4A 3QKSB 3SJUA 1C29B 3URMA 1SB9A 3I39X 5EP2A 3FROA 4JROA 1G59A 5G2OA 1S5PA 1F8UA 1YRWA 4WWHA 3DO8A 4PWYA 4FCVA 4PIPA 2QM7A 2NUAA 4KWTA 1Z73A 2FR8A 4JJEA 2LDBA 3NUZA 5TS3A 2RC5A 4MAAA 2XSZA 3IE2A 3K9NA 3LQ1A 3M4NA 3PFWO 1NF8A 5COBA 3Q98A 2H2GA 3O8QB 3P0IA 1DLJA 3Q4GA 4KAAA 1YZHA 2AA3A 4CGYA 5FPHA 4XCVA 1ZIOA 3W1EA 4X7RA 4CTJA 1QYDA 1HQDA 1KMMA 1HLFA 2IHYA 3AY7A 3GLGB 4U7TB 5AHKA 4ZFNA 3EPRA 5BN1A 2AJLI 2BY4A 2G4CA 3DBVO 3MQ4A 3ESDA 3IALA 2VNKA 4U7DA 1SUBA 4DJ5X 1DAIA 5HWSA 2FI1A 1W0JD 1PJAA 4KYVA 4NZPA 4IFEA 4H6PA 2OXFA 4RLHA 6Q21A 1QF6A 4XGRA 1Q1ZA 3ONVA 1R0XA 5ED4A 2XE8A 5DGXA 3W9BA 4WL0A 3PF8A 2VQ3A 4YQZA 1KC1A 1O94C 2X15A 2H29A 5HF9A 5KTRA 1EXVA 4RHXA 2Z3VA 3TFOA 3JRNA 4JQCA 4RK5A 4II7A 2GJ4A 2L42A 5ECGC 3VU1A 1UC4B 2DY0A 3A25A 4HADA 4HAIA 3TLEA 1ZQ1A 3HC7A 2O2HA 1E3WB 3OLWA 3DVQX 2ZCVA 2QNIA 1YUBA 2CL7X 3PL1A 3U9TA 2C31A 1DWQA 1MNAA 1YZ3A 2NNWB 3QY9A 2P9GA 1NKSA 1LS6A 1UPTA 1TUBB 2P9QA 3L7LA 1F0YA 4FMPA 4K6CA 2P5SA 3ISJA 2WIAA 1N6LA 4W7HA 4ER5A 1Z4PX 3RFFA 4C08A 1G8FA 4R05A 3S2YA 4CPDA 3SF0A 2IXBA 1PFUA 3RYCB 2O0MA 1DQNA 4FDAA 1N33B 2CK3A 4TTTS 1Z82A 3H42B 3LDHA 5BV2P 3AWDA 1JEDA 4A0RA 3HO8A 3D7NA 1XQWA 1OI2A 4CQLB 3I3SR 1W4CA 2KJQA 1PFGA 1PEDA 3CXRA 4EL0A 3AIOA 4QYMA 4RA6A 2QRVA 3BAZA 3GEBA 1SUSA 4IDGA 4J0DA 4NS1A 2F1HA 5CLLA 1BZYA 1SUFA 2A9KA 4YMGA 3DV0B 4A26A 5JDIA 1IONA 2FFHA 3B1FA 4H6XA 4NKRA 3TQOA 4XB1A 1HLPA 3KKLA 4BQEA 2IGTA 1BHO1 5IDQA 2Q45A 2Q3DA 2RGGA 2WUDA 4QGAA 3R9XA 1DEAA 3C3CA 3JZIA 4IF6A 2BZGA 3SX2A 1NF2A 4F56A 1O0CA 1RKVA 2PRJA 2LP4Y 1I7LA 1X3SA 2PDAA 1P3Y1 3KCQA 3UT5A 3QFTA 1MB9A 2JATA 2XV1A 3CZPA 3DVRX 2D1FA 5IFLA 1ODSA 5JCZA 1HYQA 5KVAA 3DOFA 1Q6ZA 3H5VA 4DCCA 4YMLA 4EGAA 2FPXA 1K27A 4NESA 1E1QD 4R1PA 1JV2B 4JP2A 5JFTA 1TK9A 2P9CA 1R0YA 4OD0A 4WZBB 4Z0TA 3BMQB 4BTEA 2XA1A 3P26A 2HQBA 1YFZA 4TSFA 4O2RA 4EFKA 4WXYB 4RQBA 2JGEA 5DSXA 2OO5C 4BVLA 2XDQA 3SSOA 1NVAA 1WHTB 1V5EA 2A0XA 4OL9A 4P0TA 3BCHA 3MWEB 1CR1A 3EISA 2VXBA 1DELA 2VP5A 5K7SA 2YJNA 3KE8A 4LZLA 3FCCA 1NBMA 2LRHA 3ETCA 4IKOA 1LNQA 4QU0A 2GN0A 4ND4A 1DFGA 3NHMA 5GJCA 1T5TA 5T3YA 5BQXA 1DUSA 1TIPA 1T35A 1U2TA 4CKYA 3OZFA 5CDTA 1OLUA 3RS8A 2W58A 1LDNA 1QIGA 5I45A 2C94A 3TMYA 3GDGA 3LO8A 2P7IA 3W2GA 5E0KB 5G1OA 5LD2B 4G1CA 1DAHA 1SK8A 1Z33A 5FULA 1QK3A 4IH4A 1MP0A 1T0UA 3I9NA 4JUAA 4AY2A 1JHMA 4IYRA 5TPZA 2SNIE 1JPVA 2WHRA 1SXIA 3BH7A 4TOIA 1G9XA 4ZO6A 2J67A 3QSYA 3I52A 1E64A 2JFXA 1SCQA 2CMHA 4PQRA 4BJ3A 3TLZA 3TOVA 3ZDCA 2BLNA 3T1NA 1EAYA 2Z8YM 2AE2A 3EB9A 1PGOA 1VIVA 4RCZA 4U9UA 1N9ZA 2XMDA 4RZ2A 4C4YA 3FTFA 1QS0B 2XEXA 2JVJA 4KR0A 3EEBA 2JGJA 3KKMA 1L7XA 1PNTA 4MV5A 3C1TA 1JAYA 2OBBA 3NMUF 5IXJA 2PQMA 3LLMA 1QZTA 3KPYA 2OZPA 4CHGA 3KDAA 1GPLA 3NHLA 3RS5A 4EECA 5AW4A 2AFHA 1SVMA 2Z57A 4UBMA 4F7WA 5EA2A 1W36D 4FE4A 4FJ1A 1JMKC 2XNDD 1E5QA 3D4NA 2PKRA 2YL2A 5DP1A 1AKUA 4C76A 3ZVKA 1F9EA 1YJAA 4UHBA 4BQSA 3VOTA 2CVOA 4OL0A 4D56A 3M2PA 4HDCA 4DYHA 1S2LA 3PHCA 4YP1A 5T4BA 3GFTA 3WLMA 5KYWB 2VPZA 3C5VA 4Q6WA 2GEVA 1M5UA 2I6FA 3G5LA 4HC4A 4YP7A 3UJ3X 4F71A 2Y1CA 3N53A 4OYYA 2B30A 3A4VA 4TYPA 5CIWA 3OOSA 1NIJA 9ABPA 1J1UA 5DFAA 1EMDA 2C20A 3T94A 2WFLA 1ZI6A 3O7MA 3M33A 1G6HA 3Q6MA 4IS2A 3CT4A 4PAGA 4B7XA 1TRKA 2IHJA 4ND1A 3PUVA 4R40A 3QUCA 3RC3A 3SR3A 2PYDA 2X2EA 1VSVA 4ZP1A 3KUXA 2PX4A 1HDGO 1GZ5A 4HGNA 4TT3A 3U7EB 1LF0A 2P1RA 4AYWA 4ABTA 3EHEA 1U2SA 2WFMA 4YQEA 4NZOA 4LHYA 1NFQA 3LX4A 1JLMA 1GRVA 1Z07A 3Q0IA 3WBBA 4DNPA 1KZ4A 3LA6A 2Q6KA 4MJXA 5DMXA 4CKEB 1V7PC 1VBMA 1Z4NA 4EY4A 4MQEA 1E4OA 5FNZA 3D8BA 4RWEA 1FDRA 1SXHA 2VA8A 3IESA 3IUSA 2F4VB 1DJNA 1JXOA 3H2HA 5CW1A 4YAJA 2YXLA 3QBVA 2I7VA 2DHCA 4PXSA 3KOZA 2D06A 2WNHA 2DQYA 4D6YA 2J32A 1LJ8A 2WHXA 3QE2A 1CY2A 5EIXA 5C81A 2D0PB 1NJ5A 4K86A 3LW7A 5M7EA 2FRDC 1U7XA 4GX0A 1IY0A 4R8RA 3TLKA 1JVNA 1QM5A 2VQDA 3HI6A 4R2XA 2YFYA 3B6KA 4XLTA 4P8RA 1AUPA 3AKCA 3EUAA 4Y9RA 3SF8B 3BIJA 4QWMA 4XKJA 3UWKA 2YYSA 2C96A 1H94A 3GP8A 4JGIA 1E2HA 3PIIA 3CNEA 4Y2HA 3DTTA 2V54A 1QV6A 1R12A 3IODA 2JBAB 5AJUA 2HRQA 3T95A 1GGVA 3LSTA 2CE2X 1GRQA 1N2CE 3AJEA 5C8YF 1C1DA 2AXNA 4QVIA 3G89A 3BBPA 5ICCA 2Z58A 3WK5A 2RH8A 4P3KA 1NASA 3BGDA 5KCMA 3RVQA 2J5QA 4E0BA 5C35A 3FSGD 5EMHA 5CA1A 2H8KA 1SUWA 3JQ7B 3VYSB 2QHXA 5LLDA 3EVGA 2VKTA 1P31A 1V9CA 4MPRA 3ZNNA 3NIGB 3ZXXA 3DMNA 1K6JA 1H2YA 1PSWA 2XMPA 1X15A 4H18A 4QJIA 3MJHA 1WVGA 3R74A 1VA4A 5AP9A 3PKJA 5FOVA 4E14A 4F4CA 1RVDA 3G7UA 4FYPA 4X61A 1E6CA 2DC1A 3GCDA 1PK8A 5E9JA 3T5CA 3KZCA 2J6IA 2GSWA 3PLNA 1W96A 1OY1A 1XEAA 4KHZA 4R3WA 4R9RA 3OFSA 3CX4A 2V6JA 3MINB 5JXJA 5C7IO 2JFYA 3AKEA 3HABA 4G0QA 3HACA 4MCAA 3ND8A 5ALRA 2AN3A 2I2BA 2Y1WA 3AOGA 1HOTA 2PUTA 2VHWA 4HVCA 1XKLA 3OPVA 4E5PA 1T8UA 4L8LA 2RKWA 3GIDA 1ISPA 1JB9A 3NM4A 4E5KA 1IZ9A 3B1VA 1A1SA 2WSIA 4WCDA 1Q7CA 1TT5A 3LDAA 4CYMA 4P4TA 2H63A 4ZQCB 3PGMA 1Y3CE 3D7RA 5I4IA 4K6OA 1N1EA 5LQRA 4MKGA 3WGHA 4E6EA 2DSNA 2UYQA 4CI0B 1OLXA 2IDZA 3OF3A 5KQRA 5BSFA 2YCBA 2H1HA 3MWGA 5LZ8A 4F1JA 1N2EA 3TTUA 2F6RA 4ZMSA 1U8EA 5IKOA 2LCIA 4B82A 2RHTA 3HCWA 5F7JA 3BQ9A 3SEQA 4B8WA 3DDUA 5JMTA 2HSDA 1XP5A 4MWTA 3WA7A 1AA6A 1PTJA 4IGAA 3GLQA 4RCYA 1EVYA 2ID8A 2KB0A 4I55F 3G2PA 3S2FA 4AWAA 2WF8A 5JNLA 5BSTA 2CZGA 2X23A 1GKLA 2PH1A 1Z06A 3I83A 4GM0A 1KEEA 5AJHA 1E3EA 2BMAA 2N3ZA 2Y4NA 3BWMA 3JQGA 2W6MA 4GSKA 5TRTA 2CY0A 2JLXA 3Q40A 2O7QA 1EVIA 2BZ0A 1RM3A 1W48A 3DZDA 2IQIA 3QW2A 1QTRA 4HXEB 4ZOQI 1E1YA 1Q0QA 3Q9LA 7MDHA 2QM8A 1H2WA 4WCFC 1I4WA 2QAGA 4Q4JB 1WBDA 4LX0A 1OFHA 5FDFA 4GXTA 1S7GA 4IX1A 1UP6A 4DAOA 2DH5A 2GZMA 2VP0A 2V6IA 3KXIA 4GS5A 4G1EB 1OXUA 3HA3A 4BFUA 4DV0B 4KR7A 5KC8A 4WAUA 3C6QA 4B17A 4ILEA 1NI4A 3BDAA 3I8OA 1MA0A 4YRTA 1Q17A 1E1RA 4JGGA 4BB0A 3SIXA 5D8DA 1TU3A 2JPDA 4D8XA 2PRSA 4GP6A 3QKIA 1PJRA 5AW8A 2YZMA 1AQIA 4FHGA 4IO1A 2QN7A 2PWYA 2IU6A 3KPWA 1W35A 3ZIDA 2HGZA 4BJ6A 4YGYA 1JDBC 1QHHB 3CB2A 3RS4A 3DBOB 3HR8A 4MI1A 1GZUA 2WDPA 4B45A 4COKA 2VJPA 3R41A 1F38A 4WLFA 2A57A 2AWNA 2QPTA 3P8ZA 1CJBA 1M1UA 2Y2VA 1CR4A 3GIWA 3O21A 5C8YB 1QF9A 2JF0A 5FBWB 3OTWA 3P1JA 1D2RA 3FNGA 4YAWA 3ZTWA 4ZCIA 2R96A 2NU8A 5DK4A 1LK7A 3WLEA 3QU7A 5FI3A 4NFHA 4BVHA 4HSGA 3BTVA 3EPLA 3FCAA 4BQIA 3NX4A 2HY7A 2O0JA 3R7FA 4X6XA 4TLEA 2OZLB 4ZJZA 1PR6A 3GBSA 1KDTA 3DPSA 4I3FA 1QB8A 3GAFA 3L7OA 1QIHA 1TEXA 4XX0A 5HUQA 3F67A 1LBEA 1JDVA 4L8WB 1YB1A 1UIMA 1Z7EA 2YZGA 4HX2A 1E5LA 2PGIA 3OPYI 5KSPA 4EVRA 3N2YA 4GO1A 5IJ0B 3HJBA 1WY5A 4DCOA 5A5GA 3GB9A 1IBMB 5U4XA 3F74A 5J40A 5FUVA 1FUKA 1YASA 3AXTA 2XYPA 4BBZA 5ERYA 2GRAA 1F8XA 1WXXA 5ITWA 2H1LA 3KXDA 4QDKA 1LRJA 1J21A 4X1IB 4OBWA 1RRVA 1ONNA 5A4IS 2GAOA 3ND6A 4Q4HB 2XX3A 3RIEA 3ZCTA 1R8XA 1OVMA 1JDSA 2XQJA 1U2GC 4FD2A 1WEKA 2GXAA 3N3AC 4FHZA 2C4KA 2OVBA 2VHUA 2P30A 5L6MB 1ESZA 2XKKA 4EB0A 1HA3A 4UM7A 3TTXA 2ZULA 2ZRFA 3EEYA 4UJ5A 3UHFA 3VU9B 4TTPA 4RAOA 1ONOA 2OLEA 2QTMA 3DEIA 1Y6JA 1GUZA 3RRBA 3RR2A 2FEMA 4I55B 4BLUA 2R7KA 4OQ4A 5I5GA 4DG8A 2ZR8A 4GR5A 3ZHYA 3UMYA 3NTUA 2JI9A 4RMIA 1IHPA 5JBQA 1X9GA 3NIFB 3W5CA 1CR2A 1KS9A 5TQ2A 1SBNE 2Z2JA 1X70A 1GZVA 3LXMA 2OT3B 2WT8A 1CR6A 4WCVA 3OWHA 3FZGA 3TIXB 3VKWA 2HHHB 1J5EB 4OM7A 1Q16A 3IMEA 2A1TS 2OBFA 1N5LA 4AJPA 3VYUB 5ECWA 4C4TA 1V47A 1G60A 3GDHA 5AR1A 2O54A 4W99A 1ZUWA 1DV2A 2KM1A 2WHQA 5C2JB 2VZ9A 1RXYA 1G8YA 3O8RA 2FPLA 1JGTA 5L8VA 1JH8A 3ZWVA 3K9FC 2PM8A 4JT2A 4AJNA 3IOCA 1QKIA 4UZEA 4B09A 1GPBA 5EZQA 4F4FA 4M38A 2ID4A 3ROFA 3PBKA 4ZCLA 4B0PA 3DOOA 4AS2A 1QF7A 3A6DA 2C42A 3M6VA 3ZHCA 5C4MA 1LA2A 4WA7A 4EIWA 3F9IA 1EVQA 3GD5A 1LX7A 2H00A 5JZ9A 3CSUA 4HDNB 4POAA 2IY9A 3WIUA 1H42A 4MVJM 1GZSA 1YTUA 4FHCA 1M6VA 3JSAA 3UB3A 4MRMB 3K1YA 3V4LA 5LN1A 4BPBA 4RL6A 3EZGA 1G5HA 1IULA 2ECOA 1P7VA 1HZZA 2Y99A 4LPKA 1AB6A 1ZMXA 1J23A 2ZJ1A 5BNTA 1UKEA 1WWKA 5HF6A 5T4EA 1U0FA 2J41A 3H6HA 2FSUA 2VN8A 3ONEA 4M1OA 4GI1A 4WINA 5K0NA 3NH6A 3MCAA 2OAGA 4PIVA 1N3BA 1P61B 1P0CA 4L95C 3HCRA 1NLMA 1QXSA 1UXHA 1I3MA 4FMCF 4YASA 1D1SA 5FA6A 5K0GA 1UAYA 3AM1A 4UU1A 2A3NA 4MUYA 3P9KA 5AM0A 4D0LB 4TMFA 1UBKS 1AKMA 3ORHA 2FQQA 2IPOA 4YCLA 4IEFB 4U9IS 1CZUA 1UBMS 4DCGA 1ZNYA 3LW8A 5CVVA 2ZAYA 4D02A 4S35A 1A9QA 4NYJR 4X5OA 3ADBA 3CGWA 2ZDHA 2OL4A 4K0RA 3IMFA 3W5AA 1TLFA 3R3YA 4MI6A 1U0JA 4D3ZA 4UEQA 4XWKA 4DSNA 4ZGWA 2C1ZA 3G79A 4CXMA 3E3AA 5BPFA 3NHSA 2I67A 3JD1A 4JUDX 4AMGA 1FU4A 4ND8B 1E2PA 2HRZA 5EJMA 1Y48E 3IAFA 3HQ4O 3QEOA 1PL0A 1RXCA 2QP3A 2WAAA 2VK4A 3KR0A 3ZHVA 2EFJA 4EB3A 2B4QA 4CQJA 5E6RB 5CFNA 5A9TA 3JAWB 1I9CA 3DNPA 3H1GA 2WT4A 5BVGB 3QGMA 3EVEA 3HMKA 4QOIA 1QX3A 2BISA 2RFLA 1FUUA 3U26A 2C4TA 1ZZEA 4YUWA 1XD9A 3EF3A 3KKPA 1Z8DA 1USGA 1JJIA 2V5UA 4GR9A 5CLJA 2Q4DA 3GFSA 1SQ0A 1CY6A 3VKGA 4JT9A 4ZEXA 5AOCA 1GG9A 5H4HA 1N2BA 3GJ8A 5A7GA 1N6KA 1L4HA 4XJTA 1XLTA 4P7FA 3T3DA 1TJNA 2HO5A 2PVPA 5FA5A 3UXYA 3V2UA 1H8HD 5KKCA 1YMQA 1M2JA 2VXCA 3DULA 3GT3A 4LXHA 4WXHA 3D6VA 5K8UA 2ZKIA 2FFJA 3HA2A 2RHWA 1F1BA 1KJZA 4JD5A 1T6YA 5LB2A 2I33A 1RI5A 3AM3A 1IBLB 1GILA 1QQ6A 3W79A 4MW4A 3VBEA 3O8OA 4KLNA 2A0FA 4RF5A 2V4ZA 1M2VB 1P9LA 3RS3A 5KMGA 4LKRA 1CETA 4O4JB 4Y9UA 2JLQA 1VL6A 4U00A 1G9SA 3HZZA 4EG0A 2ISSD 1JIUA 3VU3A 4F7DA 3UAVA 4UUNA 1T29A 3SSNA 4CUKA 3PWTA 2REQB 3P9CA 2P11A 4AP5A 2AQ8A 1CIVA 2Q2QA 4S1NA 4V1CA 1S2OA 1OH6A 2YOHA 1KDOA 1L1RA 1L7AA 2R84A 4JJ7A 3MQ2A 4C0XA 3F98A 3FZYA 3HKCA 1ZN7A 1YDGA 2C1EA 2PD6A 3Q3JB 4KLAA 1OHHD 4PYIA 5AVZA 2I6QA 1EZZA 4NAUA 5LVAA 1R74A 1J25A 3DE3X 3ZHOA 3OH8A 2AT1A 2VAWA 1L5MA 2E21A 4EENA 4IGEA 1YR6A 5A3JA 1SU7A 2W4IA 4U7WA 5B2ZA 1NRWA 2O2CA 1L9KA 4HGQA 3WP1B 4K28A 1IZ8A 4DE5A 3KSUA 1G98A 3CVOA 4KPGA 5JMWA 3FN4A 3FUVA 5AOBA 4K88A 4E22A 4KR3A 4Y6PA 4JC4A 3NR2A 5HYVA 2UXBB 5BPHA 2DLNA 4MQ4A 3EDRA 1XZ8A 2BONA 2P2YA 2MR6A 4L4RA 4WFQA 3N2ZB 2R1TA 5TB5A 3SJCA 1QDEA 2ZVDA 5HFJA 4EY3A 4MVJD 2F4NA 3SIPA 1BTOA 3O0DA 5IFKA 2PEYA 1R6DA 4FMCB 3L3BA 2Z5GA 2H2FA 1HNXB 1UC8A 3M3HA 3Q85A 2VK8A 2ZWAA 4FSXA 8OHMA 2G80A 3PPIA 1DKOA 4MVJI 4KUEA 5GV8A 5BW8A 1XPRA 5FWAA 3WYDA 1EWRA 5HVNA 1BU8A 1XD2A 2YICA 4E1VA 3IRUA 4C5AA 3V9AA 4DY6A 2HQ1A 4B76A 1Y7LA 1BS9A 3U4DA 1VE7A 4K03A 3CO0S 1QQ5A 4HVTA 4B3XA 3PUZA 1RIIA 2A7QA 2A78A 3Q3IA 1H22A 3P7MA 4H7HA 4MUAA 4UXIA 3COWA 4XOUA 3HWSA 5JCJA 4F2PA 1BVHA 2I54A 1DHTA 2GHRA 4K40A 4Q03A 3FMPB 5FV4A 2BELA 5KNCD 5F3WB 3LCJA 4JI8B 2F48A 1CUJA 1ZITA 4WX2B 4LHZA 1L3IA 2O8BB 2BIFA 4QOJA 5BT8A 1Y6GA 2WSYB 3BORA 3ZHSA 4DXHA 2RH9B 3FOAA 3ER8A 2BKXA 1M8PA 4M6WA 1Z5NA 1YBMA 3Q5EA 1T3TA 2VDNB 2OQRA 4Z4CA 1HF3A 2JBHA 5IT9A 2QKYA 5AYVA 1T8RA 4Z0PA 2QW1A 4BNUA 4Y1FA 2GM4A 3HXPA 1XJCA 1XQXA 2M6SA 1JAHA 1U3GA 3B5EA 3OZXA 3U7IA 3AR9A 1R8QA 3TI9A 3GLRA 1AK1A 1M2OA 2C84A 2NVWA 5H70A 3DQQA 4BRUA 3K0CC 3QPWA 4H4CA 1DG1G 1KBZA 2EFGA 5J4KA 1KK2A 4Z53A 4JJ8A 3V7YA 4N5DA 1LVGA 3JWHA 4WJZA 4EHIA 1VMAA 4N5IX 2RARA 3WNQA 2YUIA 1E9VA 1HL3A 1MX3A 3QWBA 1REQB 3ZHQA 4LHSA 2P90A 2ZT6A 2ODNA 3PNYA 2P69A 4Q7KA 1XDSA 2SKEA 3RSSA 3TTSA 1LFDB 3K3PA 5K99A 4JI7B 2Z95A 2FEPA 2JFWA 4IHJF 1YDMA 4TKZA 4IBOA 1OC2A 4LQCA 4MITA 5ESWA 3WIDA 5E8RA 1DFHA 1VSQA 3D6NB 1JE1A 5CT4A 3LWZA 1K4YA 2R44A 3TR6A 2QT1A 4HMPA 2ZU0C 2NXCA 4ED9A 1LWOA 2PQ2A 4LRXA 1GNTA 1RQXA 3MAJA 4PGHA 5ALOA 5H16A 5B57C 4UARA 2ZS9A 1ZO8A 3EIUA 1JS1X 3QHQA 4KXVA 4R9UC 5EMKA 3ROEA 1IHDA 4BNTA 5BURA 2G6BA 3UH0A 1CRQA 4Q3DA 4LHXA 3TLMA 1V5GA 2MSWA 1O3YA 1H69A 7AT1A 3INRA 3WHKA 2I8CA 3DMTC 4G01B 1KVTA 5G41A 2MSEB 1VMDA 3MAAC 4JODA 1MPTA 3M49A 4JP3A 1EFLA 2DPMA 4QJBA 1GL3A 2VUUA 5JATA 3ORSA 4E09A 1E6UA 1U3DA 3SKXA 2XVXA 1RM5A 2FRXA 2WYWA 2VWHA 5DLPA 2AVNA 3TECE 3VTKA 3JTMA 1M1XB 3FUUA 3N59A 3OLXA 3WOVA 1D07A 4CIXA 1W85A 2X6RA 4YPFA 4D25A 5DN9A 2BR3A 4EJSC 3PXEA 4P86A 4NU5A 3QK7A 1T6XA 4RPCA 2H4JA 3G2IA 3MGCA 1W36B 1GO2A 3D0RA 5FCDA 3JWGA 4FEAA 1WO8A 4YRSA 1ZHOA 3TDNA 3V1LA 4B48A 4DKXA 1F2TA 4OQLA 3PG5A 1MO4A 1NULA 1WAMA 3MJ4A 4FLEA 4TLLB 1CK4A 1K2WA 3WNVA 4DL9A 4MDHA 5TDHA 3U7JA 4ER3A 5BOVA 3RHFA 3U16A 1MVLA 4UBNA 1MORA 5IAEA 4RHEA 2XCQA 4R41A 4MUMA 5CP8A 4YLEA 2WE8A 1GL7A 2WD7A 1QU2A 3HB1A 2Q5CA 4MKFA 1PYGA 5LQMA 2XCUA 4FB4A 4C6TA 4IGIA 2VSQA 1F6BA 4HUQB 2AFIA 4KZKA 1TF5A 3T3EA 2A86A 4CUZA 2C00A 3LPDA 3IOEA 2IP4A 2VTDA 3N9IA 3SCZA 1KYXA 2HOQA 3R3HA 2BZ1A 2SKCA 1UZUA 5TE9A 3CCFA 1FC0A 1YBAA 4LQDA 3I6QA 5HM6A 3IP5A 3LUGA 2IBTA 3OPMA 3Q3HA 3B9PA 5CPBA 3PNPA 1IIRA 1JU4A 1AKYA 1Q20A 4WI1A 3I01M 5C8VA 3ZEAA 2XVAA 4QAJA 1USIA 4LFCB 4E32A 4CT4B 1HKUA 2PO5A 1BXKA 1ZD5A 4GOND 2TMYA 3HEBA 4IXTA 2FA9A 2VDWA 3LPCA 3MWJA 3VPAA 4EFDA 1T4BA 2C57A 5IBPA 3GLIE 4QSHA 4JLDA 3CZ4A 3VH1A 3HDHA 4GWKA 4HZIA 5SYNA 2HQSA 4J3JA 1Q0PA 4PS1A 3T4EA 5FTLA 1RYMA 3CUUA 3QLVC 1UFVA 2FPPA 4KXMA 5HHTA 1LI5A 1SRRA 2JD2A 2EJUA 2NUPA 4FFVA 1WRBA 3BRWD 2ZU6A 3F6BX 3KLPX 4I8DA 3NBXX 3LT0A 4IHJB 5ALVA 3PC3A 1RCUA 2P9JA 1JR3E 2QRLA 2Y1GA 4IM7A 4QASA 3QLTA 1LDMA 1NOJA 3EF1A 3SI7A 3W78A 4BTLA 5HKKD 4DV5B 2QQGA 1PJQA 2HMYB 3DEJA 3GW8A 3OZAA 2NZXA 4XASA 3T4UA 5KNDD 1K7FB 2PL3A 4IIJF 2FPRA 5EMLA 3PQ6A 1FTQA 2W4QA 3C6BA 3B9RA 1KAQA 3R76A 4EJ2A 3OEED 2O8DB 4XUCA 1G3MA 4ZIRA 1MB3A 2EW8A 1TEZA 1GWNA 1I4LD 1L1EA 1Q14A 4UNPA 4GP9A 3OOHA 1X1EA 2TMKA 2XUFA 1CZNA 3LIPA 2NZUG 4N12A 4LFAB 2BI8A 3MB8A 4MQUA 1G8JA 4M3NA 3WS7A 1ZJYA 3G5AA 4H17A 4Q3CA 4CM3A 3O03A 4BJHB 4TLBA 5CDGA 5IS2A 2QZ9A 3THXA 1VJGA 3CT6A 4MPDA 3V4SA 1GNSA 2NSLA 3GJ6A 1G7TA 4N0EA 4H7JA 4YP9A 3SQDA 5I51A 5CVTA 1U5AA 3IE0A 3KAKA 1SZCA 3F6PA 1QFYA 1G0OA 1PQ4A 3HYRA 4TRNA 1LFAA 3MMXA 4AZVA 2J1LA 4KX3A 4BNVA 4DARA 2H18A 4UU8A 1KMQA 3UUGA 5KYUB 2IYUA 2VWPA 3IYLW 2PLNA 5TQ0A 1Z88A 4G41A 2KI5A 3V4OA 3FPHA 3WMGA 4B9EA 2XCIA 4Y2QA 2XF8A 1XQVA 2VXYA 3TUJC 3RQIA 1SELA 1NBIA 2NO9A 1FSSA 1U0TA 3ACCA 4M8LA 1THTA 1XXHE 5E6UB 4D9NA 1WLYA 2Z30A 5J5AA 2R9VA 3CF6R 1Q0LA 3AF1A 3KL2A 2HA6A 3NVAA 3PEWA 3NKVA 1N8TA 3FUTA 4NEQA 3KSBC 3C5WP 4QREA 3R4VA 5F5LA 5C8DA 4C7MA 1KHTA 3R7AA 3RT1A 2PJDA 3LC2O 4OKNA 4HEJA 4U5QA 5K0SA 3JWEA 5JI3E 1U6KA 5NLLA 2I3DA 3AI3A 4QT4A 2WA2A 2IP2A 2WTXA 3VDRA 1SOAA 1IJKA 2GK3A 5CB4A 1RTTA 4AKEA 4LSWA 4FS8A 1SIBE 1FFGA 1FDTA 2AI1A 4JQOA 4ETNA 3QOXA 2CSXA 3DOHA 4JWKA 2G9RA 1V26A 1UBOS 3H9QA 2EBWA 3EGEA 5IHXA 1JF8A 2GJ9A 1ZLYA 1JKJA 2PWAA 2C9OA 2WHPB 3EG5A 3MIZA 3QKWA 4N0MA 1YOVA 4XVUA 3KQLA 3HXMA 2AL7A 1GNRA 1NYRA 2X9QA 2X76A 3R44A 4MH0R 3JQDA 1Q1GA 1N2XA 4LJ7A 1V6SA 3BXZA 3JAKB 3KYIB 1YRQA 3P0EA 3TR5A 3GFGA 4KYIB 3ZVRA 1C80A 3UB2A 3A2LA 1NC3A 1SVKA 1DBQA 3HBNA 2XA9A 4N9WA 3PFIA 1CLUA 2JA1A 3CONA 4YJHA 1IEXA 5D5PA 2RKOA 1RXEA 2WJIA 3CBQA 4MLZA 4EARA 1Z4OA 3A11A 5K6RA 3KQQA 3NTXA 1TLLA 4CR6A 1EM8A 3SD7A 4GMGA 1SWVA 2GZHA 4LWZA 3DE5X 1CT9A 5J63A 1PIWA 3SF8A 2AZXA 1M8JA 1NW7A 1PG0A 4NCHA 5AVKA 1XF9A 1E1LA 4YP0A 3OM1A 1QX4A 2WWFA 1UOPA 4F1WA 1GTL1 2TECE 4U63A 1LVUA 2Y77A 3R5XA 5KWEA 2WSSA 3GRFA 2KPOA 3AVWA 5DH9A 1E62A 3MAGA 4XIJA 5LP6C 3AUKA 1C9EA 2XTJA 1WW3A 3O2NA 4DDHA 5AVRA 5JYBA 3DJFA 2I55A 4BNDB 5K8VA 1S8NA 1NDUA 3FOBA 4IDFA 3VRHA 5J43A 1DEXA 4WOJA 5K0LA 5HNKA 4S2UA 1O97D 4IIJB 4O4LF 4W6QA 4FE7A 4G0WA 4MNTA 3GLUA 1VJ5A 4PWZA 4ZVTA 3SOPA 4IRXA 3K6JA 1DVRA 2QL5A 2VHZA 4HLUA 4U2FA 3OX1A 2GEUA 1VP3A 3WVNA 4C0HA 1DXHA 1DXOA 1QH8B 3UVEA 3MD9A 2B61A 2J45A 2B7CA 3HY4A 4TRJA 5CH8A 4AJJA 2PYIA 3GJ7A 3HPQA 3N2LA 1JKFA 1X7ZB 1E2QA 2IRWA 5DGIA 4Z8YA 1U1EA 2X9VA 5AKHA 1QONA 1OU0A 3NNNA 3Q7QA 1QG2A 5HJ5A 1VBNA 3R5SA 1JEYA 1RS0A 4U3JA 3AFNA 1ZRHA 4FGUA 4QTZA 2FKNA 5FJJA 1I5EA 1L5GB 5B1SA 1YOBA 3CJQA 5GGXA 3OPYB 2QLNA 3VR5D 4ZOBA 1T8SA 2EBFX 3KELA 3B2EA 2POCA 3FRJA 3GLFE 4HEA1 3RREA 3GNSA 2XE4A 1A7JA 1FRZA 2NVOA 3QXXA 1IEWA 2J6BA 3C5EA 4YH1A 2YJGA 1QIKA 4LMRA 2HXYA 1D6JA 1V5IA 1FYWA 1NWCA 4XFDA 3VZDA 5CGZA 2YDXA 4L9AA 2D74A 4Q15A 3T5DA 1BGVA 4F72A 4OBXA 3AI7A 1D2EA 1ZH4A 2W2LD 4PYNA 4UBJA 4FQ5A 4XIGS 2BFBA 4RAQA 5EIBD 1TCBA 4D9HA 3AIIA 1BDMA 5LL6P 3IT0A 3TQFA 1P4HA 4DA6A 4B4UA 5GIOE 2HA3A 1JI3A 1Q84A 1GAWA 2FOXA 2WU4A 4WFIA 5AVYA 4TVBA 3L6OO 1DO2A 1HYHA 5LDGA 2NU7B 4EB8A 1L6IA 3MQFA 1RCFA 2JCBA 4AZWA 2HDOA 2QGNA 4CTOA 4EWLA 1I3NA 3BMXA 4INAA 1I2MA 3DZ8A 1A8PA 5B12A 1YH3A 5CVUA 3FOZA 3DUWA 2ZUDA 4OSEA 3OHSX 2I22A 5KYYA 1C7JA 1Y3FE 1HQCA 2BFCA 1T1IA 4INPA 3UOGA 3WO0A 3QXCA 1MAVA 3EUWA 4MUIA 3FXAA 2DFPA 2NSHA 4P82A 3SSMA 5BQ3A 1Y1KE 1SXJA 2FLKA 3I2KA 4HFRA 2Q4TA 1SKAA 1U8YA 4KZPA 3L4EA 5K5EA 2E48A 1Z26A 3L7BA 3JXEA 2GYUA 4FBMA 1PS9A 1WXEA 4RVUA 1Z62A 2VH1A 1TXGA 4ZVMA 4BLPA 1OFTA 1PR4A 4QXPA 3TLGB 5AW7A 2QDKA 5DX1A 2FPIB 2GHQA 3GGGA 1KJ8A 1O7JA 2R6DA 4TWIA 2SCUB 2OCGA 5JQWA 4NZZA 1GPJA 2NO1A 4WV3A 3MMZA 2CWDA 3H5OA 1RJDA 2CLIB 2HF2A 2OCPA 4YJ3F 2E4AA 4XWYA 3REFA 1GKYA 2DR0A 1EBBA 3NYRA 1KR2A 3SLKA 3UYKA 3ZV4A 3AVXA 2C3MA 3K72B 2ORIA 3NLLA 3SQOA 4A4DA 1QC5A 3MWFA 3Q15C 2XWBF 2I65A 3F4BA 1E9BA 1TYCA 4KV9A 4OGFA 5ICFA 2Q7OE 3LFUA 4AJ9A 4AXBA 3EJWA 4BNYA 5JYDA 3JWPA 4OHBA 4QO8A 4DDUA 2N1BA 2WU8A 3QELA 1KDPA 4MVJP 4P5PA 1TI7A 1UODA 4ROTA 1YD7A 3FH0A 2O8FA 1OAAA 3GCXA 3AEUB 3BAFA 1KOJA 3EXAA 3I76A 3I8XA 3PQDA 5E9AA 2EKZA 2HV9A 3WWDA 1I3KA 2ZBQA 3BK7A 2BE9A 1Y9AA 3BIXA 3O3NB 1JDUA 3S1SA 2YJZA 5LB4A 4O4LB 1R9GA 1E3DA 1R6VA 1UEJA 1ENZA 3FI9A 2WWVD 4YXWD 1A98A 3NCHA 5BVHA 3ZWYA 3P2OA 4JL6A 1Z29A 3W6NA 4Z1OA 1WZIA 5EWJA 4QU8A 3UK6A 1NJGA 2HCFA 2FFRA 2X22A 3QF4A 4DRZA 3E7FA 2JJMA 3L4SO 1X80A 1C7EA 2Q1UA 2FH5B 5LU9A 2Z2KA 4YT8A 1Y3IA 1GLVA 1R5BA 1PUIA 2HJVA 3LO5A 3U5TA 1N3YA 1C1YA 2BEUA 1VA5A 2B4TO 2BEVB 2J08A 1WP9A 1KYQA 1NUAA 3BX1A 4MVJF 3A36A 5E7JA 1W93A 3FHLA 5JAPA 4N7JA 3N2NA 3BWEA 2HBQA 4XQ0A 4BU0A 2V4MA 5IM4A 2ZRAA 2FX2A 4KOEC 2BSQA 5TLSA 2OR3A 5AIAA 4GNKA 4A8JA 1UMBB 5MF6A 4W5OA 4GZ3A 1ICIA 2NXJA 4KYUA 3NBMA 1SBIA 3T4PA 3RK1A 4FM9A 4WEQA 4I4NA 4PN3A 1IZ0A 4JP1A 1QKKA 4BMOB 3UGKA 1US8A 2IHNA 1Q7RA 2I03A 1GCOA 5G02A 3C70A 3OT1A 3INGA 5KSWB 5DLYA 1AJEA 1Y34E 1EK1A 4DRXA 1L3BA 5A2GA 3CMMA 5A3VA 4YYZA 2CFCA 1O8BA 1HOXA 3WGNA 2QPOA 2GPSA 3PA8A 2NXNA 4BGUA 3G2QA 3M9LA 1GIAA 1WD5A 3GRKA 1EFVB 3KR1A 4XARA 4YI5A 1H4QA 1S2IA 5TPWA 1AS2A 1JR3D 1KFEB 1RI2A 3I9V6 2WM3A 1L7EA 3OOEA 3QU5A 4UPDA 3RVDA 1IN1A 1YFLA 4P1ZA 4HQRA 2QMZA 5DZSA 1XTKA 2GI4A 5E4TA 2XGGA 1C7IA 3T5BA 4LZZA 2GBCA 2P5YA 3RKRA 4CI9A 2O4CA 2YHBA 5DM0A 2CZCA 2Y1KA 2GCPA 2OFXA 2XUJA 4AQDA 2B20A 2O2SA 4M98A 1EQ2A 3BT7A 3DBRA 5K1ZA 4CL2A 2HNBA 2P4EA 2PL5A 3A9CA 3B20A 3MJDA 4FFOA 4CMCA 2CF5A 4Z2YA 1VKZA 5THXA 3FFBA 4NFLA 2PMEA 1NLZA 4ZYTA 4ZT7A 5H9WA 1VYHA 1VJDA 4UE2A 3DUFB 3D7MA 3GZJA 4GPZA 3TG2A 1VL1A 1NV9A 1Z18A 1LBHA 2CXQA 2DHQA 1XUOA 3VNSA 4DJTA 1M83A 1ENYA 1LKZA 2JLVA 2GN6A 3DEAA 3GCZA 1NQUA 3OQIB 4RD1A 4X20A 4GRAA 3EASA 4K6FA 3TIVA 3V8EA 5C1OA 1FDVA 1DIGA 4JDUA 1L8QA 2AMFA 2WI8A 4XX1A 4URZR 2WAMA 3HDYA 3TX6A 5I9LA 2G25A 4NOKA 1U5CA 2V8OA 2UZ1B 2X1LA 3KNZA 4PAWA 2D2EA 3AVTA 4YJ3B 4ZAVA 3VHXB 2BGTA 2GJKA 1PTJC 1IVSA 3F5QA 4XUGB 1Z8FA 4PYQA 4AQYB 3CUSA 1OXMA 2H57A 1BQEA 3ZDYB 4N47A 5FLXA 3SC6A 1WVIA 3OCVA 3CPHA 4IEIA 4BMDA 3RWOA 4MK4A 4GMXA 1M54A 1EVKA 2OP0A 3DZFA 4I3GA 5J47A 1CJKC 1DKUA 1EUCB 1VKNA 2OV8A 1SMKA 4R9SA 3REQB 2FFAA 4PQFA 3RRNA 1GUFA 3PC2A 2HSZA 2QAGC 4QLOA 3KJGA 4DXAA 1VG1A 2W71A 3GA5A 4MROA 2CUZA 1ZONA 3G1TA 1QHIA 2BE7A 4YT5A 4OHVA 3R7LA 3E27A 1HEYA 5DO9A 2C7OA 1FRVA 1PGQA 5AVQA 1USUA 4YTEA 1MBZA 3NPAA 1CZLA 3ZDBA 2A1UA 1WPRA 2X2OA 4E5SA 1P1RA 4YMWA 1QKJA 2BGKA 3BREA 3PE6A 2QJTA 2D1TA 2J9GA 2PJRA 4IPTA 1JA1A 1DTWB 4C7OA 3IRVA 4RPJA 2GF9A 3DBLA 3I0MA 2GCIA 3VOAA 4YRKA 3ZU2A 2Q5LA 2EKPA 3GZTB 3I5MA 3PITA 4AYTA 4YLGA 3GPLA 2R8OA 4PN7A 5B6JA 4ND2A 1NQAO 4YPOA 2AB0A 4LW8A 2K6GA 2F17A 1Z13A 3E1SA 2BMJA 5GJWC 2RBGA 4FN4A 3OEYA 1KERA 1AF7A 3OOWA 2IHBA 3BSYA 3HCCA 1B3RA 1OX4B 4R51A 1KR5A 3ITEA 3UMVA 4X92A 4B3FX 1C8BA 2IOYA 1B73A 2R3SA 4CIBA 4RTKA 5AT1A 5AUPB 1YIOA 2VH5R 2GCOB 5JARA 1TU0A 5J2UA 3OIVA 4M9XA 3I62A 2R4TA 5EJ8A 5CYFA 5KYGA 4OBEA 2QQFA 2RI0A 4KJXA 3WDLA 1JQ3A 3IQIX 3HNOA 1PHPA 1P2TA 2BMEA 2B6NA 3BTOA 3I5YA 1ZBDA 2O8FB 3ZTYA 5KOYA 1WY7A 5CCDA 1F4VA 1BQ3A 4MI9A 3RVKA 2DWCA 4CODB 1QP8A 5KEIA 4KX5A 3ESYA 1PUXA 2ZJZA 4V2UA 4AQ7A 2BFDB 3H5AA 1HI9A 1Q83A 2G5CA 2IUUA 1B1AA 3QIVA 2ATIA 1TIBA 2ORVA 2V3VA 3N8NA 4FFLA 3OETA 2OUKA 2CLCX 3CPEA 1P5RA 1MQAA 5K4HA 4OJNA 3UB4A 2CCJA 1ELOA 4BP1A 4I4TF 3SIRA 3WK7A 5KKAA 4EY7A 4BZPA 3BJEA 3DP9A 3I3OA 1MB2A 2XMBA 3CRZA 3ZXUB 5CBPB 3AFHA 3GG2A 3DMYA 3E2PA 5HOEA 3FOEC 4FYIA 1KVQA 4PCAA 1SVOA 5PNTA 4KK3A 2M1ZA 1W4BA 2FYTA 3GELA 4Q7QA 2PT5A 2PZ8A 2XUIA 4D9FA 1FNNA 2OENG 4MZDA 2KW5A 4AS3A 2BEKA 3HJHA 4BFCA 1WETA 2ATXA 4Y9DA 4XGIA 1FFDA 4J29A 2A5DA 1BXRB 5CYPA 1MT3A 3QRWA 3QXHA 4DA4A 1DT3A 3P0HA 1ODFA 2D6FA 3DCIA 1ZMRA 4XTRA 1L5LA 4ANFA 3OX3A 4JBXA 4ZVUA 4AICA 2V7VA 2Y1LA 3HDVA 5EJ9A 3FNRA 2PGOA 1UK8A 1ZKDA 1G7CA 1GZDA 2QUIA 4G97A 3ZD8A 4QRHA 4AMVA 2C7VA 3OCYA 4S24A 5FXMA 3U13A 4MWEA 3W34A 3STWA 4Z8XA 3RAGA 3WGMA 1E0JA 5TVKA 3JYHA 4RF4A 2CYCA 4BAZA 4WN9B 5A6SB 3UK2A 1D0IA 3AB7A 4ISCA 5I4BA 1H1LB 1U81A 3HXLA 5CJJA 1V35A 4BB9A 4PZZA 3OU6A 4Q39A 2X42A 4EABA 5A7FA 2J9RA 2VDRB 2G1PA 3HFRA 2EDCA 4D98A 2F3PA 3G0IA 2ABWA 3OKAA 4RD2A 2FMKA 3MCWA 5I9MA 1AHPA 2CHGA 1XCOA 2NXEA 3P96A 4OGGA 5CFOA 4TSKA 4BNJA 4TMTA 2ZK7A 4F06A 1LX6A 4QLBA 5AQ1A 2IX3A 3WL5A 1TQ8A 2B5OA 1FMCA 4HXGA 4DIDA 1F9AA 1SOUA 5FBQB 1C3EA 1KP2A 1N2IA 4DRYA 4D9EA 4ESOA 1V2GA 8AT1A 2WIFA 1GPUA 2V7UA 2R7LA 3MLEA 1SUEA 4Z9XA 2FR1A 5E6SB 2OYRA 4U9HS 1L4BA 3S6JA 4L4SA 3MXOA 3WFZA 1HZZC 1N2OA 2BUCA 3B52X 2XVZA 4DXDA 4B34A 3O1LA 3NI2A 2XWJI 4B6RA 4TKVA 2IX9A 2Z4SA 1CY7A 3SJAA 1DEHA 3ZW7A 5JQGA 1M0EA 1BX3A 1Z22A 1E20A 4QNRA 2EEPA 2VAMA 2V58A 4Q82A 3CU5A 1J8QA 1FX1A 1GSIA 2PX0A 4UZFA 4AW9A 2GASA 5FHQA 3CNBA 5GTDA 2HR1A 3A9SA 4AN1A 2Q8PA 4EG5A 2VJOA 2XW6A 1JWAB 1GNLA 2B4RO 4EQ6B 2PUFA 2JGLA 1VRCA 2OP1A 1E6MA 2ZW9A 4NK5A 4X71A 5IK2D 3DE4X 4O2BF 3U5ZB 2DTEA 2VPYA 1K8ZB 1UJCA 3EDQA 3MGAA 4KSCA 4C3VA 1V11B 2PKXA 2QZ4A 5LXTA 1TD1A 2PVCA 4F5EA 1UMDA 2JFZA 3A1CA 2QJRA 1TYAE 1WZNA 1ORVA 3TINA 2ONYA 1QYXA 3DYVA 2A0WA 2A5YB 1PCXA 4O4HF 3ZC3A 4F4UA 4RVCA 4NCBA 3JWIA 4BX3A 3MS4A 5CA0A 2J09A 4LG1A 1KI6B 1OZ0A 2R00A 2BFAA 2OBYA 1G0NA 3I6YA 3R3WA 2F1IA 4I4TB 4JJAA 3OZDA 3RHTA 5CFPA 3CTPA 5ITZA 2HHCA 4OLAA 4QU5A 3IOYA 2J31A 3LUBA 3MN1A 1M1YE 3AKDA 1JKXA 2D0DA 1P2FA 2X4GA 3ZKWA 3H65A 3KQTA 1RLJA 3KUCA 5FTJA 1HR0B 4LGYA 1ZIDA 1ZK1A 2QVCA 3UA3A 4TV8F 8MHTA 4W6ZA 2PH7A 2V55B 4BFVA 2QQEA 1F0PA 4XXHA 4RH1A 1QIMA 3OZTA 4WBSA 3LECA 4NYMR 3DJYA 2XPCA 2FSGA 5JAQA 1Z12A 3KJNA 4NCKA 1XLTC 1GPAA 2R86A 4DLBA 1CUGA 1T2FA 1SD5A 5E4JA 3G8AA 5IBCA 2XTAA 4IDEA 5DISB 5FLYA 3K0HA 1NDHA 1XROA 1E1DA 1L5FA 3WYEA 5IPFA 1GAJA 3IC5A 4I9HA 4L74A 4FNAA 5JPDA 4LJSA 5T7BA 2EDAA 2P2NA 3EZ6A 3KV3O 1U65A 4XWWA 2VWQA 3AG6A 4HDMB 1SXPA 3ECAA 3FYUC 4OK3A 2QTTA 2YCLA 2X9NA 3N8IA 2CL0X 2QY9A 2DQSA 3IJPA 1L7DA 4I9GA 2PWPA 4KBGA 2NTYC 1A4UA 4JI6B 3RYHB 3B1KA 4FPXA 4PS0A 3BA1A 4RENA 3RUEA 4JLMA 3UT0A 1Z6TA 5SYAA 2WT9A 1U2ZA 3OZRA 2VRCD 3RS0A 1IZ7A 1J2EA 3QJ5A 5AICA 4B75A 1N77A 3G59A 1YRAA 2FXIA 3DEYX 1KORA 3MC1A 3A7EA 1Q3TA 3K2EA 1I4OA 4BECA 3BB1A 1G5QA 2QVGA 1A9SA 4HT3B 1T1SA 3L79A 3ET4A 4D46A 5C52B 5L3SB 5ENDA 4Q16A 3RHSA 2EJTA 1O97C 3O83A 4AY5A 5CCBA 4RTOA 2ZZKA 2B3DA 1C0LA 4P98A 3DXFA 3KAQA 5EP1A 1Z39A 3UIEA 4H7DA 4HNUA 1BSVA 4JA0A 1BMTA 4ICIA 4ZVQA 3VISA 3WTCA 3DKPA 3EVZA 3SYTA 1ISRA 3ZCUA 2P77A 3G7NA 3R3ZA 1UDWA 2WV7A 4XDHA 3R8XA 1RPJA 3MFQA 3FHOA 5B58T 2HGSA 1TGVA 3O9VA 2ADMA 2OXCA 5LDDC 2I34A 1HSZA 1NQTA 2WIBA 4OXQA 1SU6A 5E2IA 6ADHA 4PV7A 4XZ3A 2WKRA 3IVAA 4M9RA 5EJ5A 1K89A 5A71A 2BM8A 1RWKA 2VNJA 4YV0A 2X19A 3V5NA 1OLSA 1I10A 1I2BA 1QZUA 2OAP1 1NP6A 2PN1A 3E8MA 4NJMB 3SZGA 1MHPA 3ELWA 3O82A 3ZJVA 2AJDA 2X6TA 3EIQA 3K5PA 1QUEA 1ZN9A 2AOUB 3JZMA 4LDRA 4MTCA 4ZVPA 3A2MA 5IAGA 4P3NA 1G19A 4HYEA 2V9CA 4PZLA 4R69A 2BOVA 2ZRKA 5CEJA 1XNGA 3IKTA 3BXOA 1U04A 4CF6A 2B4KA 3GH1A 3GWZA 4AZTA 4O2BB 1RMTA 3BGWA 4C87A 4LBVA 3GLHE 3UFXA 1EFPA 2G3YA 3G2KA 5CH5A 1GNPA 2VCYA 3E22B 1FYXA 3UC9A 2DUNA 2QZZA 2GTPA 2E4WA 5THKA 3E23A 2QYOA 3VZQA 4LY9A 2GYWA 4O4HB 1VPDA 1DZ3A 3W4IA 5BMVB 3RRXA 4RH3A 2WWIA 4IDHA 2JCYA 2HPZA 2ZTUA 4B31A 4DQDA 1EE9A 4NC9A 1BD4A 2F64A 5EIBC 4CR7A 5CDYA 5IKPA 3MRTA 2JCVA 2J3DA 4G0OA 3L7JA 3SNKA 2J3JA 1G5PA 2MTBA 3EZLA 4YONB 5C32A 2JLUA 4K9LA 4QDTA 3FLAA 4P22A 4A5OA 1YXMA 3OAAA 4R5HA 5BR1A 4KW7A 4TV8B 1E96A 4KN8A 5K3EA 1EJ6A 3LKDA 3HBFA 3STYA 3QU4A 4UULA 4Z2AA 1EX9A 2EQ5A 4Y3UA 1Z7GA 5KTSA 1ZM9A 2HPAA 1RE1A 5B7PA 2F2TA 4LF6B 5EJIA 2CJWB 5JH7A 3BRCA 1ORHA 5KS2A 3H18A 1FE8A 2J3LA 4BP3A 1XN4A 4I99A 5BWCA 3OI7A 4EK9A 3SPXA 1NE7A 1D9ZA 1K6MA 1NL3A 3AO0B 1KA9H 3MF4A 1G2PA 2XE6A 3K92A 3PYLA 1QYWA 4HDRB 5T57A 1GQRA 1BRTA 3PUHA 5IDVA 5K4AA 4NE7A 2PSHA 1NYQA 1Z0FA 2XHZA 4HPWA 4MHOA 1Z38A 5TS2A 3MTJA 3LX6A 3T7IA 4EUFA 3EVDA 1CC1S 1TAQA 1XMPA 1QIDA 2XITA 4G56A 5JD4A 5L4SA 10MHA 1YIDA 4GSYA 3VPBA 4PANA 1SHUX 3FPBA 3HRIA 1QH1A 3O93A 4L8FA 2DP4E 2YFHA 5EPUA 1MO2A 1GGFA 3RUAA 4AKHA 4DC0A 1U11A 4C06A 1TMGE 1DRWA 1VIMA 4L08A 4ETWA 1XPOA 3EGWA 3C45A 2XBMA 3TW8B 2AG1A 4MGKR 2CC2A 3H8VA 3GCGA 2IXGA 4PFKA 3M83A 4DEVA 3EXHA 2XHEA 3LF2A 5FUYA 5JUWA 5LNK6 2VYND 5I4CA 2BFPA 4MARA 1FFXB 3EWIA 1D1TA 4GDMA 2E6KA 1H1TA 4HF7A 4OKIA 4PX5A 3WLTA 1KTIA 1BDIA 1RXVA 1PBTA 1ECPA 3AW8A 3GVIA 4ZZIA 3ZWMA 5BSRA 1AKNA 3I58A 4WESB 2EFDB 4PU0A 5IH3A 3BFXA 5H81A 4Y6OA 1JHPA 3WYGA 4YMHA 4INZA 1GAEO 1IBCA 4XH9B 3JATA 4YRMA 1UUFA 1NXPA 1YACA 4Y6QA 3DCNA 3R7NA 1PV2A 4MUEA 1ND6A 2I7XA 4OSOA 2D3WA 1L1QA 2P62A 2O23A 2PNJA 4AN4A 4A2WA 1SZDA 2BGNA 3C3PA 4W9RA 1IY9A 1WUHS 4FUTA 1W7AA 4J16A 5K3CA 1ODJA 4ID3A 3EYWA 3I6ZA 2BKAA 1FXWF 3CKYA 2GVNA 2SHKA 2FX5A 3D6JA 5EIEA 2GBFA 4E07A 2E2WA 4GQAA 4URHA 1MPXA 1Q3KA 4I9NA 3Q12A 3V1YA 2DTXA 2NYVA 4YBRA 4BVAA 3VGPA 1R4ZA 2GZRA 2VLBA 4PCUA 2V5VA 3KJZA 3U61B 1L9XA 1CEQA 5ECYA 3B6JA 4REQB 2B5VA 4AZ0A 3PEVA 1LLCA 3ZE9A 4HGOA 3A27A 1J9EA 5K03A 3QNUA 2QT0A 2QLFA 3G9ZA 1JEAA 1RQ2A 4KXYA 3FR7A 3R0XA 3Q3CA 1N9KA 4Q3BA 4ESHA 4BE9A 2WPDA 4XPIB 3P97A 5DRYA 3G49A 1Z2DA 3RS2A 2X4IA 4B6QA 1F2VA 1KRHA 1K5PA 1W44A 5IT4A 4RNDB 4AUEA 5C1IA 1RC0A 1EX1A 2IYYA 4PG7A 2R5FA 5EZYF 4ZOLF 5FADA 2EF1A 1N9GA 2IH5A 4ITVA 9ATCA 4RHFA 1MQ8B 4HNQA 4MV1A 2E55A 3R6TA 4QGHA 2GWRA 3AU9A 1G2QA 4JFRA 4MR9A 4QQRA 4UBLA 3HYCA 3ERCA 2VF7A 2GPNA 1U28A 3CHYA 1N8KA 4ND7A 1X74A 1EVEA 1QRSA 2KBFA 4H1UA 4ARZB 1W1IA 2X13A 1R8JA 2QN6A 4CF5A 4A9AA 3ELBA 3OFND 4XYEA 1EP9A 4AAYA 1W87A 3YASA 1IBKB 1BAPA 2IP1A 1FJHA 3IUQA 2ZXUA 4C4OA 4G0YA 1J24A 3KXLA 1UBCA 1W5FA 2A9QA 2YWEA 3OVMA 4DV4B 4RTMA 3QNMA 2ZRLA 3W3AA 4BWFB 3LRXA 1M8FA 1GOTA 3C1AA 1J0XO 4MKIA 1KK3A 4FNGA 1YMVA 5CM9C 4J0IA 5J2TA 2JIZA 1BWQA 3KG2A 3D2LA 3TOSA 1TIKA 5JSUA 2E1PA 2YWHA 3HYLA 5EUQB 5L40A 1RJ9A 2FW8A 2FWIA 2F3SA 5JMPA 1XHEA 4TN1A 4J91A 1KETA 4FKMA 1RQNA 3CKLA 1G4AE 4YRAA 3PXBA 4HQOA 2Y1XA 5G4KB 3VFDA 5HA5A 3TDMA 3HZOA 4A6XA 2VTBB 1IQRA 3S7ZA 3PEEA 1LD3A 5BNZA 1YJBA 3F96A 6NULA 2ZUVA 1ZHHA 2I7DA 4F2DA 4LF9B 4ZYYA 1SURA 1RI3A 2JCSA 3F3SA 1W2GA 2VSNA 3ABQB 1GTZA 4FFNA 1FFHA 1DOZA 1R7RA 1BKYA 2YQ5A 3WLKX 4NPHA 4HTAA 4TM7A 4ZU6X 4EMTA 1M3SA 3C14C 1ADYA 3TLAA 3I34X 3G9XA 1QBGA 2H07A 4JSYA 5EXEA 5HF8A 2IS1A 2AN1A 4C2UA 3LIIA 1JG3A 2QTZA 4ZO8A 4B6EA 1U3VA 1INLA 3D59A 4BRSA 1RWOA 5ER9A 4LJ8A 1UJBA 1TM2A 4IXMA 2DWQA 1E92A 4ZJUA 2G28A 2R25B 5DBEX 3X1DA 4II3A 4M9QA 4BLRA 2I7CA 3HKEB 4UC0A 3M9WA 1KJQA 1I51A 4BO2A 1ZM4A 3ZQ6A 4UEWA 1I6LA 3KR9A 3G1WA 3TOZA 1K1EA 2IXTA 2ZSFA 4G5HA 4V3CA 2W70A 1XZMA 4JHLA 3HFGA 5IM5A 3ZZ0A 4FXOA 5T8KA 1FX0A 2AUTA 4BVFA 4FMBB 3OJEA 2NUTB 4MGEA 4A0FA 3M34A 3ZDFA 2B99A 5MHTA 1L6RA 3D1JA 2ONCA 5FBLB 2BBOA 1G21E 4UUOA 3SLGA 1WMEA 4JI2B 2FUNB 2GPJA 1EQAA 3QUSA 4QKQA 5IZ4A 3U44B 4XD7D 1ZK2A 1U5BB 3C7CB 1YBFA 3EA0A 4ZOEA 3T3OA 3TUIC 3GFRA 1DAOA 1B26A 3S2SA 5ALTA 4MB2A 4JMPA 1T8TA 4HB4A 1Z6AA 1U4OA 1Y8RB 2ZETA 4JOQA 2C5FA 3IXMA 4PONA 4JJ4A 5JXIA 2WVAA 4MVWA 1EHYA 1FP2A 1JJ7A 3PYXA 1NJ6A 4N0PA 5EZYB 5FUWA 3IUMA 3CPSA 3I9MA 1EJ0A 4R2IA 1V9SA 3IBFA 2O07A 2Z9CA 3EGXB 5JSZA 1IM2A 4NH4A 2ZRIA 1T4DA 1YVEI 3KOMA 3ZCQA 1SD1A 1AQLA 5EEGA 4GX2A 4MPJA 4X7MA 3BUSA 3E9MA 3Q1LA 1JG1A 3AI1A 2F59A 3HGMA 1R6UA 3OP4A 1QGUA 2NO7A 2JLRA 3R24A 3HA5A 3VNBA 1GYRA 2H5LA 3L8CA 5TEVA 3IKVA 4OMUA 1RKBA 3KDPA 1NVKA 2QR2A 1NXXA 2WAXA 3EAGA 1T9BA 2WV9A 1UP7A 3FPLA 3O8NA 1Y63A 3FWKA 5EJ6A 3BM5A 1F60A 1T1RA 1IJEA 3H5RA 2OBNA 1E3TA 1ZR4A 2PPLA 5EKXA 1WSDA 4AJEA 1SUAA 1T13A 4E51A 1QDLB 3NAZA 3H4TA 3PQ5A 2JZOA 2F9LA 3S68A 2BMWA 1X14A 3PIRA 3G68A 4DWJA 1RBMA 4B7AA 1NJ2A 3A8TA 1N1MA 2JZCA 2UYOA 2VNSA 4FNMA 1Y5LA 4EHDA 5K0EA 1TFRA 3LUAA 4FJ2A 4IH1A 4AM8A 5AVSA 3LU1A 3DH0A 1NT4A 2WWXA 3WMXA 1MAUA 3SIWA 4CCWA 1RE0A 4YJGA 5DIZA 4QJ3A 3L6EA 3P19A 621PA 5K3OA 2EFYA 2EZUA 3IAS6 4U8GA 1BEUB 3THRA 4IS3A 1CQPA 3MHPA 4I6JA 5AM2A 5A3RA 5AMXA 4TT3D 3JPWA 2W93A 5JISA 1NVFA 2Z5VA 1OPXA 4WZAB 4CQMA 2OC9A 4JLAA 2FLWA 4AY3A 2Q62A 4UQLA 4F4DA 4KEAA 2J3EA 1FBTA 5H5JA 4MMXB 1MV5A 2W2QA 3LZCA 4I50F 4PYMA 5BY2A 3E9RA 1I0IA 1IHUA 4Q21A 4QDXA 1TMKA 3VPFA 2QL9A 1QSGA 4BNLA 3TAXA 3L8EA 1TA4A 3TZ6A 4LJRA 2B82A 1A4RA 1XOIA 1IZYA 5DHPA 2I2WA 3WGGA 4QOEA 4ZV9A 3OLCX 3E1GA 2GXSA 3V2GA 3L8ZA 1FYEA 1IOWA 1L7BA 2UYYA 4XGKA 4GOMD 5JS2A 4EW2A 4RV9A 3DBHA 3K09C 5HKBA 2CHVA 2JJ8A 1NVWQ 4BNXA 1IPFA 2IXEA 2P4HX 1WZEA 2I2DA 1RXSA 2PZJA 1P60A 4IVNA 4NMLA 2OBXA 3DL0A 3RADC 4EZBA 1NY6A 2EJWA 3D7KA 2QMYA 3QPCA 1V3UA 1TKCA 3IDZA 4IY1A 1ABEA 2QG6A 1WPQA 4PHGA 4BUCA 3DL2A 2AI3A 4EVIA 2HMAA 5JR3A 4X7PA 1VB5A 5K6AC 1EGMB 2D4HA 5KC9A 2VPQA 1W5EA 1ZG3A 2ZIEA 3UYLA 3GLFB 1U0EA 4LCJA 5GM1A 2QAJA 1BCSA 4E5UA 4WKBA 3KYJB 4JR0A 3M3PA 3VNQA 2A0YA 2DVMA 2ZAOA 3HJCA 1RPNA 3JY6A 5GQSA 1UL1X 4J0JA 1GGJA 3TM5A 2VUHB 3AEXA 1I7SB 3A37A 1MXHA 1E1CB 1WHSB 3ONDA 3C6ZA 3DVSX 4TLCA 2P4QA 2GN9A 2ZI3A 4B9AA 4C0AC 4YR9A 2G0NA 3GN1A 1VIAA 1B3BA 1PUJA 4V02A 3U81A 3SFZA 4DADA 3KL4A 3NT4A 1Y89A 4N7BA 1FS4A 3HJRA 5BSMA 4KXLA 3WGLA 4UTOA 4F3RA 1PT7A 1V16A 4XB2A 5FO0A 3ZD9A 3U3ZA 4BUJA 3ZQKA 5HZMA 4IVQA 1HG0A 3ZGNA 3IP7A 5IXYA 3ON5A 5JI2E 4RFSB 3WIVA 2ON6A 3ZN2A 4B6JA 4U2EA 1BRMA 1W19A 4L50A 4BCBA 1UQUA 1C1XB 3IV7A 1KDYA 2ZTMA 4EZEA 1NURA 4C1NA 3TM4A 3WGUA 4HX9A 4F4HA 2ZE6A 5BR4A 3JQAD 4JSTA 3N0VA 4GXQA 3Q3VA 1B15A 1UF9A 4YWJA 3KQYA 2PBRA 1QR6A 4CETA 1DQPA 3L6BA 2Q3BA 4C04A 3E53A 1ZRNA 2XB6A 3E4DA 4QDOA 4QUEA 3BBLA 3CW8X 4M7WA 4X94A 3CX7A 2AR9A 4EHJA 4L73A 4CKBA 1RU3A 1TA9A 4CM9D 4O5AA 3IBSA 4ZHQA 1R0KA 1T26A 1ZZGA 4L4UA 5EXSA 1OA1A 2DSTA 2P67A 4HH1A 2YHSA 3PGLA 1CUXA 3D7LA 5MN6A 1NIPA 3AIMA 4E4RA 2VJCA 3OEHD 2O0HA 3PCTA 2QLTA 2PGNA 4MWZA 4H1WA 3AOEA 5JRJA 5ENZA 2E1RA 2YJTD 3HR4A 3OQJA 1PLKA 2BF7A 3JARA 4KIWA 4RTPA 1DDIA 2R6FA 1NM5C 4ENWA 4MWGA 3NETA 9MHTA 4HBZA 1K3UB 1FFWA 1XA0A 4FWTA 3QXGA 4I50B 2XYRA 1K7YA 4FOTA 2A5JA 2PSFA 1U2QA 2VJQA 4CKWA 4CG3A 1COWA 1ZRSA 4DLXA 3VHLB 3P9PA 4S1TA 1UBLS 4IQ4A 4WXEA 3Q8MA 2RH5A 4FIZA 2XUGA 1ZGBA 2UU9B 1R5OA 2GAIA 4OQFA 3SBDA 3WL7A 1VSTA 3EWNA 3QA3E 2C04A 4JENA 3PFBA 1YT5A 1Y80A 1DARA 4GKAA 1FU8A 1SG0A 1OV4A 1K5HA 1U3UA 1Z2EA 2O7NA 1H3NA 3JRWA 3L6UA 3LC0A 3C2QA 4KQMA 4MGZR 3PFKA 1MA3A 4NV0A 5GONA 3BFVA 4JLPA 5E7IA 3TTTA 2EARA 3PJGA 1O9HA 1LXCA 4NATA 4CFYA 1A5SB 1UEIA 2BDEA 3HVKA 4JL8A 4RMGA 1LSUA 4Y6GB 1XZGA 4MW6A 3C8DA 2JI6A 1O89A 2LD4A 3ESXA 1CQJB 5JZMA 2ZB7A 4ZOCA 3UAOA 4RPIA 1K66A 3AR7A 3TMKA 1CQXA 1QO9A 4KR6A 4FHFA 7YASA 2GEDA 3R9IA 1JEQA 2J0UB 3TSZA 1QHYA 1EH5A 3DAHA 1Q2UA 4N3GA 1MXFA 3UMBA 3AUXA 4GIBA 1N2SA 4V0ME 2ANBA 3BCSA 2WVJA 4KC0A 4RHYA 2XRZA 5DM70 1NNSA 2VSFA 2XLBA 5B1IA 4LV6A 1J5XA 1P9RA 2CLSA 1L5HA 3ZS9A 4JVLA 1G2OA 2HA4A 4A8PA 4Z6KA 1HRKA 2UZAA 5CM8B 1GRNA 2P6OA 1PW5A 3GHHA 1JFLA 1PNQA 4WA8A 3NTQA 4UVDA 2FSHA 2BFOA 3LHDA 3KB2A 2KMLA 3C1OA 2HB6A 2JANA 5BYBA 1FW8A 1KJYA 1VGRA 3I04A 1BDJA 4QBIA 5SY9A 1X8KA 1FUYB 2FQXA 1AN0A 4QYIB 1PWEA 4UM9D 4X8LA 5HR5A 1H3EA 1OIXA 4AWXA 1OUMA 4UEJA 1Y1SA 2B6HA 4KE7A 3E8XA 5A6VA 4LY0A 2XUQA 5D3MA 2XY4A 2ETVA 2NO5A 2XJ9A 4OEHA 1KI2A 4PGGA 4K81B 2BTQA 3DTVA 1FW6A 3CVXA 2W2MA 2P2DA 1JIXA 3N7AA 4XLLA 3WQHA 4N4AA 4D4JA 1C9MA 3CM0A 3OMXA 4WVFA 2P40A 1OU4A 1N4DA 2ARKA 3TQTA 1XG5A 4EFMA 2OPBA 1C3OA 2ZRCA 2QE7A 1PJ2A 1OT3A 3CZQA 4CVNA 3DDHA 1A7UA 6YASA 4ARUA 1Z5UA 3RT9A 1L5KA 1L7MA 4XVHA 4DMRA 3TUZC 4DUGD 1KI8A 3P4XA 5IC4A 4DNFA 3BA6A 1UH5A 1WB5A 1DDOA 1F5SA 1U7UA 1Y1TA 1U1IA 1VJTA 5HSGA 1Y7HA 2FJUA 5FWXA 3UCXA 3HLKA 2JIDA 1XTBA 1QFJA 3IP3A 4QXRA 4M7RA 3E1KA 4DGQA 4IF4A 5B3LA 2C4UA 3VOSA 4JI3B 3FKSD 4WNCA 4JSRA 4MA4A 3ZV5A 4CV1A 4X65B 2ZDGA 1Y5MA 3UC5A 16PKA 3OUZA 3QUBA 2D2IA 1W0KA 4OKSA 5DTJA 2Y8EA 1NPTO 3B7WA 3AL3A 2ZEJA 3N2GA 4JKYA 3ZK8A 2JAQA 3ZBQA 1KAOA 1JQKA 5EJ2A 2AH5A 2WZBA 4WXMA 2NYUA 1LF5A 4IJQA 1TO2E 4D8YA 1BX1A 3IAM6 4FX5A 1GRRA 1VL5A 1PDOA 2I2XB 2AUMA 2O5VA 1GFZA 1SBZA 2P27A 2EBUA 2K87A 2XJ4A 3PNBA 3S4YA 2HD4A 1JLLA 1N25A 4ZQFA 1FJGB 1CRPA 3X1YA 4FZ3A 3GUHA 4IOKA 4PSCA 1MC1A 1NBOA 2PXHA 2VPXA 1Z3CA 2BRUC 3VC7A 2GKGA 4E5NA 3S2EA 5DEIA 5KOIA 1MB0A 4BMSA 1VG8A 1U80A 3B2NA 2GYYA 1FXUA 1JQDA 3LNTA 5K3FA 2J4FA 2DQZA 3GQBA 4BNWA 4EG3A 1IOVA 4Y30A 2ZRQA 1RWQA 3H5IA 3SR4A 3LQYA 1C4KA 1K92A 5H68A 3G9QA 1S0UA 4UVEA 4PNZA 4P33A 3UV6A 1FDSA 2NZVG 2G8LA 4P36A 3H3XA 1KYTA 1ZRMA 5TQJA 3RAEC 4WK0B 3WYFA 1DOHA 1OWPA 2OK7A 3D0KA 4D3YA 2BFEB 4DQVA 4M0CA 2AD5A 1SOWA 1RAAA 4FLMA 5MN4A 4KACA 2H9YA 1L5YA 1RI1A 5KQPA 2YV4A 1WB6A 3ES9A 4I36A 1DBRA 2J9FB 1MABB 5ALEA 3INNA 4TUYF 5EC8A 1QE0A 1SU8A 3A1VA 3R9WA 5BV7A 3FBTA 4QJ4A 5DBIA 1JR6A 1EPUA 1SH7A 4EJFA 2RGNC 4UDXX 1ISGA 4FDVA 2J6CA 1TCUA 4EPVA 3GAZA 5T4HA 3W3AH 1JP7A 4HOYA 4UD2A 4AN0A 1EEXB 4QDUA 2O7SA