4TTSA

Crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (y200a) complex with 10-formyl-5,8-dideazafolate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
308
Chain Sequence
MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWRLKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAVRLIATGKAPRIKQPEEGATAECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGKSVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKMIPGSQYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title Structures of the hydrolase domain of zebrafish 10-formyltetrahydrofolate dehydrogenase and its complexes reveal a complete set of key residues for hydrolysis and product inhibition
doi rcsb
source organism Danio rerio
molecule tags Oxidoreductase
total genus 87
structure length 308
sequence length 308
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 4ttsA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4ttsA01
5CJJA 3O1LA 1MENA 4EW1A 1S3IA 3W7BA 3AV3A 1MEJA 4QPCA 3R8XA 4ZYZA 3TQQA 1RBQA 1MEOA 4ZYUA 2FMTA 1YRWA 1JKXA 1NJSA 4ZYYA 1CDDA 4ZYXA 4ZZ1A 1ZGHA 4TS4A 1C2TA 1GARA 4Q12A 1FMTA 2BW0A 5J9FA 2CFIA 1RBMA 4ZYTA 4R8VA 1RBYA 3P9XA 1CDEA 3KCQA 4EW2A 3GARA 1ZLXA 5J63A 2BLNA 4PZUA 4ZYWA 1C3EA 3OBIA 3DCJA 3TQRA 4NV1A 2GARA 3DA8A 3NRBA 4QPDA 3AUFA 2YWRA 3LOUA 1ZLYA 4ZYVA 4DS3A 3N0VA 4S1NA 4YFYA 1RBZA 3Q0IA 4TT8A 4YFVA 4ZZ0A 4ZZ3A 4EW3A 1RC1A 4TTSA 4ZZ2A 1RC0A 4IQFA 1GRCA
chains in the Genus database with same CATH superfamily
1NWCA 4AYXA 4A8JC 4O2LA 4FWTA 1V45E 4X94A 5CVUA 1MRZA 1XVVA 3L8DA 1AMNA 2BFBB 1TMGE 2QRMA 3LI2A 5HGJA 2WWYA 2M98A 1MAWA 3G7SA 3NIGB 1JR3D 1OOEA 1P1RA 4JZYA 4RANA 4GI3A 3STXA 4BNXA 1WIWA 2OB2A 5HTKA 2AZXA 1E5VA 4K9NA 3ENWA 4LRQA 1O9GA 1SU4A 3IPXA 1GEEA 2O7VA 3MT7A 4QA9A 5C8YB 3AXSA 2RHLA 3FCEA 4FI3C 4G86A 5IVIA 3JALB 2YNMA 1VJRA 3LIIA 2X8BA 3HWRA 4KLCA 4L3OA 5KYNA 2HD4A 1TA9A 1Z75A 2G5GX 5K8CA 4N5NA 1SO8A 1NLUA 4C03A 4MQUA 4JSTA 1G66A 1QHGA 3NWPA 4NV3A 4G1BA 3R6DA 4CIWA 1D03A 3BHIA 1Q44A 3CFYA 3FM9A 1FP2A 3CSSA 3SPXA 3VR4H 1ISIA 4HGYA 1GU1A 3OIWA 4IJUA 3HJFA 4A26A 3DE0X 2V97A 5GPBA 2YNMD 1JLMA 3H1PA 4HNSA 2X5OA 2CE7A 4MR7A 1OROA 1E1MA 1JSZA 4WN3A 5GJWC 1FC0A 2YRXA 4DCPA 2QVYX 1NLYA 4AP6A 4C20A 2ZAGA 2Q62A 3VJMA 4C0SA 1Q77A 4G8JA 1Y1PA 1OC4A 3A0RB 5TQ2B 2PO5A 4ZOLB 3G82C 1E0DA 4I46A 4PSDA 4JSYA 2JD1A 4K9OA 4C2TA 2H9YA 2QW0X 2RBGA 2W4QA 3OTWA 3SYRA 2F9FA 1UQTA 5ECGC 1P7ZA 4PANA 2L2QA 1X9GA 3K1AB 4X71A 1D2EA 1OAAA 1XJQA 2G80A 4D4GA 1J8FA 2GPBA 3ENNA 4IINA 1KSGA 4EBFA 5JS6A 3R3SA 2QN3A 2A1TR 4O4HF 1SU8A 3H2JA 4RHUA 1BXKA 4WFKA 3RVJA 4EEKA 2KW5A 2COEA 4E70A 2JJQA 1L4KA 5C9ZA 1OWMA 4HDAA 4ALNA 2AVDA 3KE8A 3VTKA 1PNRA 4PFJA 1NR1A 1W5AA 4MKGA 4W1RA 1XFAA 3ROEA 1HDZA 3PKJA 2V7WA 1PL8A 3MS2A 1VL5A 4MINA 1NQTA 2Y1OA 5LMNB 2LVBA 3NJ8A 4IIXA 1A8SA 5GOTA 4B8YA 1GPJA 5F33A 1U1FA 1AT1A 4G5RA 3EF0A 4YJDA 4P3NA 1T4CA 5AKZA 1PSZA 4K6CA 4BEJA 3WV5A 3UJ6A 2AMLA 3KZ1E 4HXEB 1EM8A 4S1VA 1IZ0A 2NZUG 4YAGA 4G01B 4Z1MA 5HYVA 1CUAA 4HLQB 4YCAA 3VOAA 4QUGA 3BE8A 4MOWA 2QAGB 3DO6A 4FFPA 4QQRA 1H3EA 2FQ1A 4QUKA 3N2KB 4MQFA 4MI9A 1U1EA 4RHEA 3DWFA 4M53A 4Q03A 1PQWA 3VC3A 1L7OA 1NRXA 2EZ9A 3QXGA 1QE0A 3DHVA 4TT3A 5IT4A 1QBGA 1XD2A 5CGQB 4DM7A 3CPSA 3LQRA 4XRGA 5JI2E 1QYVA 1PWXA 2IC5A 1QV9A 1Z25A 4KXVA 4JT4A 4YT8A 4Z1MD 1SMKA 6GPBA 4DQUA 1ISFA 3IIJA 4K0RA 4RETA 2DBQA 4AKTA 1E9DA 3G5AA 4D8YA 4EB3A 1LH0A 1WEHA 3WGGA 1CUVA 4KWIA 4TYWA 2ZSDA 5L3SA 4X6XA 3AM5A 3LQFA 2CNOA 3D0RA 4V0SA 3WMXA 2ZJ5A 2FUCA 1D4OA 1U2GC 5CEEA 1Y8RA 3U4GA 4DGSA 1JFTA 4RMHA 3EVNA 4TT3D 4LUCA 3ITNA 2JRLA 3BRCA 4AQDA 2QX8A 4QU5A 1T24A 5DT2A 3THXA 2A59A 4CLRA 5KVCA 1UJCA 3WLSA 2VA8A 5MHTA 3NH6A 1YC5A 2QA5A 1GPDG 4MWDA 1MTZA 3QW2A 3IMCA 1ECJA 4MUJA 5JXGA 1KMQA 3MUFA 1BJKA 5BURA 2BBTA 2OBLA 2C0CA 1UJ4A 3ZWDA 4C4XA 4E5DA 3BSFA 3HA7A 1TEZA 2NAPA 4Q4CA 1MB0A 1M33A 5JAZA 1RM0A 2QUAA 4QE3A 5JRJA 2ZI6A 3FVWA 3WFZA 1WJGA 1D2MA 1MA0A 1Z5ZA 2OHVA 1R7RA 4GKBA 4G2NA 5JYBA 1M2OA 1QCDA 3JX9A 4EQZA 2ZVJA 3GMDA 5ALSA 3PWZA 1U5BB 1L7VC 4PYQA 5B5SA 3DGEC 4N8DA 4O2BF 3IV9A 5D7NA 5HIJA 3DFFA 3CUUA 4HXFB 5KBYA 1AB6A 3D0QA 4PSKA 1L5WA 1SQSA 4EELA 4ER0A 1KETA 3BFPA 4URHA 2E2WA 1SRQA 2NO7A 4ITVA 4V1CB 5HZHA 1HM5A 3OM1A 4M9QA 4EITA 3TJZA 1EB9A 3EXHB 1XX6A 4HVAA 1EUCB 4YJKA 4ZAGA 5IYZF 4KYIB 3VDQA 1QHNA 7ADHA 4NRDA 1C3EA 3H05A 3O7MA 5DNVA 4N3BA 4R7ZA 1C14A 1G4UR 3GBSA 3OWOA 4HADA 4AQYB 2ZWMA 4BX0A 1HE5A 1L5SA 2YFYA 3V8EA 1SC6A 1MPTA 3SAJA 2D59A 3Q7TA 3LCRA 3V4VB 3DC7A 1OASA 4AJ1A 5CLIA 1GAQA 1UBCA 1VBNA 4LJRA 3R6WA 2OGZA 4L8FA 2WFMA 3K5IA 4DJEC 4FGUA 1W5EA 1Z2DA 3TO5A 1M83A 4H59A 3EZNA 3IDAA 3SC3A 3ROKA 3N6VA 3DOEA 4H27A 3V1YA 1U7DA 1B2RA 3QEMB 3L2OB 3T5PA 3HFJA 4NOKA 3CTPA 1AXRA 3M6WA 4FN5A 4HEA6 4PQYA 1Q0QA 3OFNA 3VR4D 3NDRA 3H18A 2E21A 3QPBA 1NBEA 4G5FA 3HCPA 3HKBB 5CHEA 1XTBA 1P2UA 3WL6A 3OTGA 3PYLA 4O2AF 5ALRA 2ODQA 1JEQA 4IBOA 3N2YA 1ZD5A 5A1TA 5CG2A 2EX4A 2LR0A 2QI9F 1SKYE 1V11A 3QVSA 4LV5B 1U28C 5SICE 1C0LA 1SXGA 4CEIB 1EWKA 2QTNA 3GROA 4KU4A 4R7TA 3IDOA 3ONEA 1EK5A 3OFND 2BBOA 3NG1A 5F2KA 3WY9A 3GOHA 5K05A 4E5MA 3UYLA 1USKA 2H57A 2RGAA 1M6VB 3CCCA 4TQAA 2QVGA 3JVDA 3RTGA 1KO8A 4PZPA 2DPGA 2QAIA 1AG9A 1LC3A 3ASVA 3A27A 2PX5A 1TUBB 4C87A 4ND4A 4AZ0B 2IWHA 2QTVA 2VHCA 2FI1A 1FYFA 5EC8A 4ACAA 1K92A 4C4PA 5ITZA 3QSGA 4BDSA 1U04A 3OLVA 2WKWA 1MENA 4R0VA 4IILA 5JEDA 4ISBA 1MJ5A 2ZT5A 3L7LA 1NFQA 2CZGA 4CMIB 2PUAA 4DJ5X 4AJHA 1I1QB 3CRQA 5EHQA 4M3NA 1RRCA 1B2LA 3EA4A 3KR9A 3QY0A 2GD1O 1SBIA 5FBHA 4RMIA 2AD1A 2Y93A 3I8OA 4FOSA 4MQEA 3OUTA 3R3JA 2QYTA 4UBOA 2IUUA 1HE4A 4X1KA 3FCAA 4OLHA 3UJ8A 5ALPA 1RM5A 3HY6A 3HA5A 3TMYA 2ZJFA 3IO5A 1GP2A 3VUEA 2DY0A 2C99A 3CKKA 1D4FA 1I0IA 4AL4A 2I7XA 5I8PA 1E8NA 2VHQA 4MDHA 5AIAA 2C94A 1WCYA 1V7CA 3ZZTA 2JCGA 2P35A 5A05A 4ZI2A 5LU9A 4KN6A 2GETA 4DR6B 4E1AA 5KCMA 3FOFC 1M8KA 3FNBA 3SQLA 3TL6A 5CXQA 1XTJA 5KYWA 3V8NA 1PDWA 4YH1A 1TUGA 4OQLA 4BB6A 1PNTA 4CEHA 2N75A 4QEZA 5AI8A 3B60A 3CIOA 3I9OA 2AN5A 2PUDA 2A5FA 2MJLA 3DCIA 3EXIB 1P9LA 3WYNA 3AWDA 3GA0A 4CL3A 4LBWA 1OZ0A 4PLHA 5F12A 4N48A 3ZIUA 2X0KA 3LKDA 2HRZA 4L0CA 4NENB 1QFMA 4LXGA 3NBYC 3M1AA 2CMFA 2GEFA 3D0OA 1EFKA 3MWEB 2PUBA 1BRMA 2FPUA 1N0UA 3DE4X 2WEKA 2XUJA 3D2LA 1JALA 2WSIA 1TOAA 2FR8A 2VQSA 2BZGA 2NUBA 3Q3GE 4DIMA 1ZVJA 3RIYA 2G5CA 3UJ7A 2PKQO 1L8AA 1XZNA 4MR8B 2A6PA 3O95A 3JALA 4P83A 2GLTA 2NXCA 1PU2A 2W2OA 2R00C 3GUUA 4IVPA 4CGYA 1XK7A 5FHRA 2G0AA 4O4LF 1FDIA 1YJXA 2X4IA 2QTZA 4MP3A 3KTAA 5FLXA 3TZQA 2NNWB 4Y0AA 1T1IA 2QSJA 3G7NA 3NBMA 5E2AA 4CM8B 3DW1X 3O03A 1F0KA 3FDJA 5FKJA 2OKCA 5DTIA 1V3UA 4YQFA 4UUOA 1DT5A 1SD5A 4C88A 1S2OA 1GD1O 4QLAA 5EJ5A 2B1JA 2SKDA 2Q5HA 4LECA 4LI0A 1XP8A 4R54A 4U7WA 5ICEA 4AQ7A 3BXEA 5FYQA 2ZT7A 1TZBA 5DEOA 3KAJA 5HHTA 5CYGA 2A2ZA 2TMDA 4ZZ0A 5B3JC 1Q20A 3EZFA 4LTNA 4RCYA 3U13A 4GX0A 3ETHA 3CZ5A 3ILSA 3AUAA 5E38A 3FE2A 4CQJA 1JIIA 3FWHA 4IFTA 4Y2UA 1ZGGA 2UAGA 1XA0A 4MEAA 5HIIA 3VGPA 2C8JA 3WLTA 1OGIA 1S8NA 1GPKA 4MDYA 2R4QA 4ZOLA 4EGJA 4DDWA 2EX0A 3DEIA 4LYFA 5CT6A 1JXOA 2XCRB 3B20A 1YDEA 2YRWA 3RC3A 3AJEA 3UENA 3VR6H 4B3GA 1VJCA 4IPTA 4UCQA 3TXYA 2JI6A 3D3NA 5CYOA 2VUSA 4LF7B 1S5PA 3PA6A 3R5XA 3LECA 3D4PA 3MCZA 3GGGA 4HNVA 2XDWA 1KHHA 3N2LA 3ZWAA 2NU7A 1YULA 2RAUA 3VZDA 1LK7A 2XQJA 1G8SA 4IS3A 4DG9A 4DNPA 5HF9A 1PJTA 2VZ9A 3PE3A 2BI7A 4MKHA 1ZOIA 4WKGA 1EK0A 3QV2A 5HK8A 1YC2A 5EZ6B 2WQZA 3G13A 4P93A 5IJXA 2OFPA 4BRUA 3GR6A 4FFLA 1XQ6A 4ZOCA 4IIYA 2J0VA 1R9GA 3EZ2A 3WK7A 3D7LA 1JHAA 3KLOA 1RBQA 3D54D 1CZLA 1KY4A 4I50B 3EUFA 3GGCA 2DMRA 3IHWA 3RVPA 2UZ1B 5LP1A 3GBPA 4MITA 3T3NA 1CX9B 2QJTA 3AJDA 3ZY3A 1EKXA 2QV0A 2K87A 3OKPA 2FZEA 4XPIA 3A1TA 3LG2A 2O1XA 4E32A 2GAOA 2PUCA 2VXBA 3H2GA 4BU0A 5K0ZA 2I7CA 5JHGB 1UPTA 1BFKA 1E6MA 2WYWA 3B5IA 3QPVA 2R62A 4IO1A 4LC0A 4X0EA 1LSJA 2Z6UA 1V4BA 4X97A 1V35A 2ZI4A 4L27A 3A05A 2XX3A 2CBGA 2ZKIA 5D3MB 2WUWE 2AHRA 3FTCA 1UBJS 4FYHA 4WDRA 2C7VA 4KDRA 3OX2A 3RIXA 3D9QX 1H1TA 5LYJB 1EEHA 1H9BA 2BMWA 2OSVA 3LWZA 4GWLA 3TUIC 3C39A 1MKYA 3DWEX 4I1IA 4U2FA 3ACBA 2XWBF 2QR2A 2CSUA 2QNIA 2JA2A 1E3IA 3G0GA 3ZD9A 2O1WA 2W22A 2FW1A 4ERXA 1O8CA 2BELA 2QNBA 3WQBA 4ZT2A 1ATZA 1GU0A 4UHBA 2OXCA 3AIOA 2UYYA 2DUMA 2WWVD 1GAEO 1L6IA 4WKBA 4II3A 3TXXA 1NBOA 1OA0A 2VJQA 3HDQA 1CFJA 1OJLA 2CEAA 4N3NA 3TRIA 3R3VA 3IBCA 3BD9A 2GCNA 4R8LA 1NVXQ 5GTDA 4G0NA 5E4YA 1P62B 2HMTA 5JS2A 4ZEWA 1TM2A 4OQDA 3BCHA 3O4GA 4U8GA 2G1PA 1NVMB 2RIRA 3EBPA 3T7TA 4B0OA 4BE9A 3AJRA 7GPBA 1QP4A 4DHWA 4EQ6B 4O0LA 4PFKA 3SMQA 2PT5A 3LMKA 4L5AA 3OY7A 3QI2A 4HFMA 4BFSA 3CT4A 1B73A 1J5XA 3G2LA 4EW6A 3ORYA 4IDOA 1YS4A 5JSZA 1LWOA 2WTUA 1TVMA 2PQ0A 4FMPA 2NSJA 4XGRA 3F7MA 2IUFA 3GELA 3BMNA 4L28A 2EZ4A 4FD3A 2H9AA 1CUSA 4KWCA 4LBVA 4LVUA 5CVDA 3TCKA 1S02A 3OTHA 1V43A 3DAHA 3IBTA 5HWSA 1ZGCA 1YF3A 3IAM1 1GNPA 2YCLA 2V1XA 5LCXA 4DXHA 3KQNA 4ZV7A 4C29A 1FPQA 4OB7A 1II8B 3NVMB 3UBMA 4HDKB 4R7GA 4L73A 1ZK4A 4CL0A 2AB0A 4V1CA 1T4DA 1KSHA 3OP4A 5FBZA 5C1IA 3MRVA 3OJWA 4W9RA 5HRAA 4UEJA 3Q6NA 4QNNA 4ZKEA 2B82A 2D54A 3A2LA 4FMCF 4X8HA 1NKVA 2J08A 4ANFA 4DGQA 2PBZA 3BULA 1W4RA 4UAVA 3DVAB 3VNQA 2JZOA 4B44A 4DDTA 3S28A 1UP4A 3ABZA 2GXAA 3HYSA 4RGQA 3D6VA 1NG1A 4CLHA 3D81A 4ENVA 3P9SA 2Q9BA 2X2EA 4K1XA 1MX3A 4BO7A 2FQYA 5DCYA 4QUEA 2G70A 4O4JA 5ALMA 3SHFA 1K8RA 3GEPA 2R6CA 5T64A 3CKLA 5KTKA 5AK0A 1HE8B 3IQHX 4RV4A 1DIBA 5ALGA 4EPYA 2CHQA 5DNCA 2ZDQA 3QVKA 2VPWA 1UPUA 4PC6A 5AD1A 4LXXA 1X80A 1JI0A 4HL6A 4JJAA 3K20A 4HRAA 3UMGA 4HQ6A 2YOFA 1C4WA 3EWIA 1SURA 1FRFS 2H1FA 2ERYA 2RAFA 5J2UB 4AJKA 4C7OA 3BXHA 4TTJA 3K9BA 4HN2A 1GTSA 2GDZA 4F8JA 4Q34A 3KPJA 5CA1F 1XZBA 2R11A 3NOVA 5CBPB 4JLAA 2JBWA 3IEPA 1GV1A 2CCKA 1W2GA 4W8GA 1JT2A 3L04A 5F78A 3PGKA 1N4AA 1GPWB 1ZITA 3ICQB 4M0PA 2REBA 5ALYA 4ZVVA 4CMEA 1D6NA 1M6WA 1QJ4A 3TIIA 1CUUA 1S7CA 3PDIB 2XA1A 4DLWA 3T4EA 1EQ2A 1M6VA 5G4KB 5LD2C 2Y0PA 3TL3A 1W30A 4I55B 4K6FA 3ZNPA 4ETMA 4DCVA 3GEEA 2ECQA 1PUIA 2O0LA 1U2RA 1DOAA 3NNNA 1UK6A 4L0DA 4NBSA 4LOLA 1ZS9A 2AFHB 4QGGA 4UASA 1TIPA 3TVYA 1UBFA 1Z2EA 4AKEA 1AHHA 1CERA 4EMSA 4ENQA 5KNDA 4RKYA 3VKHA 1O97D 4TSKA 2R7MA 3DJYA 4OK3A 2GA9A 1GGFA 4FHDA 4K9KA 1Y5MA 4MVWA 4WESA 4FVTA 4ZODA 1U0LA 4CG0A 1QHXA 3M7IA 2NYAA 4BGVA 4ZI3A 1Z4IA 4ALLA 4EGSA 4QSHA 3OE7A 1L5NA 2P9TA 2R79A 3C6KA 1SKQA 2V6BA 2EBFX 1FOEB 1KDRA 4PVCA 4AMYA 1A9XA 2CLDX 4I4NA 4LOIA 1L7BA 3UKOA 1S2NA 2J30A 4XAQA 4XCQA 3A2NA 2NX2A 3CYFA 5B55A 5MGBA 1HWYA 3OQMA 1UBUS 2OM2A 4U2KA 3GZJA 2P2CA 2XJ9A 1YJ8A 4ZYLA 1N6IA 3OJ0A 1OI3A 4R3WA 2Q0HA 3NONA 4Z2AA 3GG9A 1Y5LA 5FWXA 2ZZMA 2VSFA 1Z6ZA 2FPKA 3LYLA 4FD2A 1J1ZA 1VG0B 4ME6A 3OE7D 3P2OA 3I64A 1O08A 3UAGA 1GAWA 3AFNA 2BGLA 4PZ0A 1L7EA 1W73A 1CE8B 1A5SB 3L8CA 4GBMA 2BF7A 1JBKA 2XB6A 2FUG6 3SVZA 4JVOA 4ENTA 3NVDA 3UJCA 2PUWA 3F6CA 2ZJ4A 2HJSA 1ZR4A 1C9DB 2HPHA 4ARZA 3QOYA 2QJFA 3OTQA 1EINA 2RC6A 1VPDA 1U98A 1UBHS 1ZMBA 3BXGA 4B3CA 1LJLA 4MWTA 4N5IX 2QMOA 3R3HA 2J32A 4MMZB 2Q49A 3TQCA 1XZDA 3LCMA 3DMHA 3W0LB 3MWEA 1JPJA 2CD9A 3LNTA 3QE4A 4QOIA 3VAAA 2BFMA 1MRNA 2PIDA 3K0CA 2J9ZB 4FIZA 1H4QA 1VL6A 3USZA 1XVTA 4BGDA 3G9UA 3S2SA 3WZ2A 2AR7A 5KYXB 1I36A 2EFHB 2P8SA 1IN4A 1Q83A 1H9AA 3SC6A 1NU8A 1P0CA 1K7SN 1QYIA 4F4JA 3PGJA 1PFWA 2BEKA 1ADJA 3IE1A 3V7UA 4A0FA 5JECA 3H3FA 2FPWA 2VTVA 4LNAA 4GXQA 5G2OA 4MVJE 5KQGA 3IEIA 4PIVA 4F3YA 5HUJA 1LDMA 2FUEA 3A26A 5KKNB 1K75A 1G4HA 1NNEA 2OO3A 1RJEA 1RU3A 2IHNA 2Z3VA 3IUJA 1HNNA 1YNOA 4ZVKA 3ZGXA 2BOVA 4QBHA 1KI9A 3KL2A 4FGZA 2O5VA 3OY2A 4EDFA 4MVJA 1F0YA 3CZ4A 4FOOA 3IT2A 2OM6A 4CCYA 1J42A 1QE5A 5IARA 5IX8A 4XGNA 4G5YA 4G6ZA 3LTNC 2R6R1 3JSXA 2C5EA 1O7JA 2NU8B 5G53C 5LLDA 1Q14A 1QOPB 4RS4A 4O8ZA 3UJ9A 4R6XA 4TS4A 4QO7A 5E8RA 1Z4KA 4CKWB 1BN6A 1M66A 2WA2A 4HJRA 5FOXA 1LLQA 4RCZA 2H0RA 4KK4A 3V33A 4CLOB 4BEBA 3NYRA 3DM5A 4DNFA 3DQZA 4IDCA 5CX4A 3U3OA 1KEEB 3O75A 1YRLA 1MO5A 4H0FA 4IVRA 4MVJD 1Z63A 1VYUA 2EP7A 2EBUA 1YRQA 1E9VA 2XUFA 4S24A 1Q3HA 3L8YA 4YAWA 3W6ZA 3IVXA 2JGDA 3KEQA 4MV3A 1A1VA 4PTLA 3MTDA 1T4GA 3AT1A 1LBQA 1XZCA 5CDTA 1P1JA 1DOZA 4V38A 3TZKA 2X7HA 3C8UA 2OV3A 3B6KA 3ET4A 5BXQC 2FRDA 3NHUA 4CQNA 3RANA 1NI4A 2I8AA 3PEVA 4G84A 3P94A 1DBPA 4IIUA 1ZAKA 3M6MD 2HMAA 4GP6A 4COOA 4RGYA 4DA6A 5C4MA 3TAXA 3MT9A 4TRJA 3MHTA 1PIWA 1JDTA 1MVOA 2NO9A 3IUPA 4KQXA 1MFPA 3QPAA 4QEDA 4BMOB 1H05A 2IYFA 3PRKE 2XBLA 1CYDA 1ULHA 1WSWA 2WJJA 4GH5A 4GYKA 4BX3A 2G09A 1TZMA 2QAJA 3IB3A 4XJTA 5DLPA 3H4TA 3D1LA 3GRAA 4UNIA 3RABA 2HFJA 4CM1A 5BWOA 2SBTA 1OH6A 4MGHA 1Q91A 1LK0A 5CM9C 1E7SA 4F2GA 4BNNA 2C7BA 1UDXA 4HNGA 1MGPA 1F3LA 2WIFA 2HM7A 3A1CA 3AJ9A 1UKVY 4KCGA 4V1CI 3K2IA 4EX6A 3ZJVA 1R37A 2WWRA 3JSAA 3JR7A 2KBFA 2XE7A 2GK6A 4M1YA 5HW0A 6ABPA 1SKBA 1YT5A 3QKSA 3LGSA 1YZFA 4FXPA 4OO3A 1IEXA 4DCTA 3TTUA 3ADDA 4KR0A 2D7JA 2EWWA 2P3SA 4KV7A 3FSEA 4QTXA 3KB6A 2GEUA 4F3NA 4H3HB 2P91A 4POOA 5AKYA 4PG7A 1RAAA 2IU4A 1JR4A 1KMHA 4HX5A 2IPNA 3BIXA 3WHIA 3RGWS 4IX9A 3V1MA 4YMUA 1M2EA 2VHEA 1O03A 1IZYA 2GCEA 3FF4A 3P0IA 4QOSA 3VYVA 1L1QA 3CLTC 1ZNYA 3R5FA 4BXOB 3MBOA 5CJPA 2ZYGA 1CSEE 1MQ9A 2ZJ7A 1ORVA 4WCFC 3ZHVA 4BZWA 4E14A 3M70A 3EMDA 2AWOA 4X63A 3H2HA 3HXKA 1L1FA 1NA5A 3D6MA 4OMCA 2X7JA 4FZ3A 2RI0A 1JEOA 4IDEA 3LA6A 3H84A 3SHOA 3UJDA 5IVPA 2JI9A 2QRVB 2JAHA 3FUCA 2Z0MA 3NC1C 3EZ9A 2HGZA 1ZDMA 4JYCA 5ILOA 1N9ZA 1UT5A 1KL7A 2G1KA 4PHCA 4V0RA 4AYTA 3WDKA 1Y1TA 1YI0A 2JK1A 3MLAA 3MAAC 2WHXA 5DTQA 3RF7A 3EDYA 3ESAA 4BCDA 1F0NA 4IDFA 1ZGZA 4DA9A 3L8ZA 5PGMA 2PSFA 4J6EA 4HWTA 4AKSA 4TV8A 2ES4A 1EFUA 2LZ0A 1XDBA 4R1MA 4RSMA 1GCGA 5E9JA 3VZSA 1ETHA 5IAKA 4EQ6A 2GXQA 4PHFA 4CKEB 4OIMA 3MTQA 1CJBA 4U7JA 3SR4A 1QQAA 1SUAA 4YJ2B 4Z3KA 3ORSA 3JR3A 4YAUA 1QMPA 2DKOA 1N8TA 5HMLA 1OGJA 2ZUFA 4N76A 1IJKA 1LY1A 4LQ4A 1Y1LA 2XYPA 4O02B 4ZT5A 4BO0A 3ONNA 1OMOA 5C34B 1E69A 1B6GA 2OHHA 4HDNB 2JFYA 4J0CA 3JYHA 3DWGA 3FHJA 1FYWA 2P9JA 2XYQA 3RJ9A 1XTZA 4YASA 1R8JA 1T3TA 3GYGA 5D1HA 1WQ1R 4HDKA 5FAKA 1C0PA 1TMKA 1FMLA 2VDWB 3EZ6A 4Z7JA 1LTQA 4PNEA 3DMRA 4WXRA 3DD1A 2B4RO 3VYTB 4WBNB 3BGWA 1UMDA 4YP5A 4ENSA 1EWTA 2HUNA 2JH8A 5HBGA 4E22A 5DNUA 1TO6A 3F7TA 4DNXA 1L5QA 1XJ5A 4FX5A 1DCMA 3ZIAA 4A0HA 2HB6A 3OZFA 1YUMA 1WMEA 2H1WA 1KY2A 5TB5A 2P5SA 1E20A 1ZK0A 4XYBA 4IOMA 3G0OA 4I7EA 4YP7A 5KTTA 5E6UA 3F4KA 4F1JA 4E6EA 3KLBA 3TAHA 1OX4B 4L5CA 1RYZA 2ZBVA 3R2JA 2YL2A 1E94E 2G88A 4E7OA 3IUSA 2K7ZA 3ZNOA 1GO2A 1EXVA 4JOSA 1CULC 4MIYA 1R18A 3LVQE 1MW8X 3A4LA 2Q3JA 4XW2A 3OQVA 2AKAB 1VGVA 3S5UA 1I3KA 3ZIAD 4LWOA 3TKYA 1G9SA 2ODAA 3H16A 3HKDB 1PJAA 3SZMA 4D4HA 3AR2A 1ULBA 4P5DA 3MGAA 4YT4A 1T5BA 4X8LA 2O2YA 4HLNA 4AN4A 4Z9AA 3BGSA 5JZOA 2DBRA 1NR7A 1QMGA 1GADO 1DJMA 3HCDA 2C2YA 1NF8A 1U8ZA 1J07A 4S0XA 3OIGA 5L95A 1OAKA 3ETLA 4MS3B 2G1JA 5F2EA 3PU6A 4NFYA 2O3QA 2D06A 2HZ7A 2ZGVA 3WK9A 3NC4A 3WGQA 5B57C 2CEKA 1ULAA 4Q19A 3OO0A 4TLMB 2VJCA 3PDIA 3AEUA 2QW1A 1X7DA 4FHZA 3MMSA 4N18A 4NWIA 3TLGB 2XRFA 1IQRA 3R24A 3ZH9B 7MDHA 3C1UA 5HS4A 5C5DA 1V4VA 3M3HA 3ZWQA 3V2IA 5DPMA 5A3RA 1QKJA 2OGSA 4R1UA 5AVOA 3RRYA 3QW4B 3JAWB 2PYDA 5K9ZA 3U7QA 2X5JO 4AZWA 2GPAA 4YRQA 1N6OA 2VS1A 4DQXA 4KXFB 3A6FA 5HCUA 1U0GA 1XCBA 5A4KA 1B8PA 4L72A 3N7TA 4QM6A 2X9GA 3B2EA 3GCGA 1L6RA 5E6RB 1EE9A 3TX6A 5BP7A 3FVTA 4MVJI 1T9GR 3JQ7B 3D1JA 1EBUA 2HPZA 1FUEA 3OCJA 3KOUA 4I9UA 5C5EA 4MQMA 4GL2A 1BVRA 3SFVA 4D8TA 3EMKA 2C1XA 3I61A 1UBRS 1PQUA 3PS9A 4PPNA 1DAEA 4D97A 4Z0NA 1SXQA 3M6IA 4Y2QA 1VA4A 4NE7A 3NETA 2IPLA 4LHZA 4G1VA 1ESMA 4TLBA 4NCJA 2VTDA 5G3YA 3PBKA 4N40A 3UVEA 1XBTA 4JXJA 3A58B 4PRZA 4WEOA 4K88A 1J20A 2PWBA 2E49A 3M5DA 5ERYA 5MGNA 1R0CA 1UR5A 5SYAA 2FMTA 1Y8AA 3ML1A 3WNBA 2EHDA 4DLXA 1BEEA 2WILA 4RF2A 5AHWA 1E6LA 2H9IA 1SUPA 5DN9A 5H83A 3ERCA 1PP4A 3MILA 4URFA 3D7MA 2W37A 4FUQA 1NN3A 3OT1B 3O8OB 2Q2VA 5EWMB 2AG8A 2WM8A 3Q5DA 3DYIA 3QVMA 4EJSA 3M6XA 2JA1A 2IXTA 1BS9A 1XRNA 3KT3A 4OK5A 3GRFA 4PO9A 1GZHB 3LUCA 3LFUA 1ZHHA 5CURA 3CEJA 2Y71A 2IE0A 3LIPA 4DT1A 1YR7A 3SF8A 4OGGA 3TK1A 4UOEA 1E1QA 2C3MA 1EUYA 2BDTA 3D8NA 4FLMA 2BFOA 4GKAA 4IICA 3RB8A 3AM1A 2NU6A 4AKHA 1Z47A 2Q3FA 4XR9A 2OCAA 1X7ZB 5EZ5A 5LIRA 2HV8A 1PEKE 2OA0A 2QQ5A 1G291 1XZJA 3KX2A 4WUTA 4PZAA 3N58A 4X7MA 4A0SA 1D8AA 1DKRA 4DNOA 4F9FA 1O0SA 3JQFC 5JCPA 1ZI9A 4Q4DA 4R2HA 2A14A 2VT3A 4LGVA 3KFXA 5EGSA 1DRKA 4E12A 3G02A 1ISJA 2VXCA 3N2EA 4ZAFA 4KPUA 4B75A 1E1QD 1YQWA 4TL6A 4Y1GA 1JHXA 5ALLA 1E1RA 1TYDE 4PG6A 4X1IA 1LBEA 3PUIA 4C4YA 1XXHE 3DEAA 8ABPA 4Q1BA 1IIBA 5JEEA 4UREA 5GM1A 4FEYA 2EYUA 4YPVA 1WV1A 3D2AA 4DLSA 5SV2A 5KWVA 1NSTA 5AVKA 4ZZIA 3VNUA 5EEGA 1XXHA 1R15A 3GGJA 2OXIA 2XVAA 2W0MA 3SGLA 4FR0A 1PVDA 4G4GA 4LQDA 1S8AA 3V42A 1E1RD 3G0BA 5J1SB 4JC0A 1IY8A 4HGQA 2ZRPA 3SOZA 5CVCA 5FTLA 3PUWA 4WXHA 3UGKA 1MU0A 4L5YA 4ZT3A 3V2GA 5K01A 4JLPA 1EUDA 2EHJA 5KDOA 1EZ1A 1E3JA 3ZU5A 4GIBA 2AFRA 4F2WA 4HQOA 4JOCA 2DE0X 4D98A 4II2A 1KJQA 4JQCA 1Q1GA 4YMSA 3VJRA 1HE1C 2AQIA 1RHKA 1NVDA 2CXSA 2R7NA 1P4SA 3EC7A 3NHYA 3ZV6A 2GM9A 3FPJA 1Y98A 1UZUA 1SWWA 2PZEA 3RUPA 3PCTA 4RF3A 3WGUA 1CUDA 5BXYA 5FI1B 5C3MA 2BHRA 1PD0A 1CZOA 1KZGB 5IJ9A 2HY7A 4OHBA 2I6QA 4ZJPA 5I7FA 4N7BA 5GJBA 2X9VA 3PDJA 4P2GA 4BQOA 1YOVB 4D9NA 1QG2A 2HHJA 5CH3A 5IT5A 3GVCA 4HI0E 5ALUA 1KZ9A 4MIKA 1BFUA 1Z07A 3K9WA 1PD1A 3PUYA 4KBGA 5ALWA 4DSNA 1B41A 1X14A 4GC5A 1FLVA 5FTWA 1M1XB 3VJLA 1GHTA 3PXUA 3A6KA 1XLTA 2OO5C 1TK9A 3B1XA 3U4QB 3IA7A 2JATA 3WLEA 2VQDA 4TKUA 1E3TA 4RULA 3AI2A 1QYWA 2X9QA 2F2TA 2PS1A 3OQHA 4QAJA 5DHPA 4GZLA 1NHWA 3BERA 4MW2A 2P2DA 4B3MB 4GYWA 1UWKA 4X64B 1FW6A 2RKWA 5JT1A 4KQ6A 1K5GA 1VCOA 1EAYA 3CEAA 3RG8A 4EO4A 3QHPA 5JJKA 2FWAA 4RACA 3VH3A 4JI7B 1GNQA 1F4VA 3MQ4A 1DJLA 1HK7A 2Y0EA 1KJZA 2WNSA 3T3OA 2O8CA 3O21A 3V8MA 1AQLA 4IV8A 4I6JA 3OFKA 1EFTA 1TLLA 3GRUA 2NT4A 1Y48E 1XP5A 2YVAA 4D4MA 5I6DA 1KARA 3PICA 2HDNB 5A5FA 4X61A 5FWNA 5I9NA 3GT3A 2PMKA 4FN4A 5TGTA 3FNRA 4JJIA 3WJ7A 4XVCA 1HT2E 4U7HA 5GGXA 3RS2A 3HSSA 3KKKA 1FS5A 5L6LB 1I7SB 4BN0A 5ITWA 3IP5A 3EX7C 2N46A 3JRNA 3M6UA 5K3DA 1F4PA 2G06A 4BAGA 3PQCA 5M04A 4J7UA 3WKBA 3LFTA 2JFBA 3TKAA 3ZI4A 3R5HA 2IY7A 2W90A 1IG3A 3D7KA 3JD2A 3UWKA 1MGOA 1W34A 3B6ZA 3JD3A 1Y9JA 5J63A 2ZYAA 1M1YB 3G3EA 4LF5B 3EIFA 1JNXX 1QPBA 4IDAA 4MXDA 1H8EA 2AK3A 1V5FA 4Q9DA 1TCCA 4YK7A 1XCJA 2GBGA 3I30X 3VNBA 4RH1A 1N2IA 3WMFA 1VB3A 3CUEF 2C9CA 1IEWA 1J9EA 4JP3A 5JY6A 1HDGO 2C2MA 2FR0A 1E99A 3AR7A 3BTVA 3OKFA 1X39A 4XCXA 2FK8A 1RXCA 3E9CA 2QL9A 1OU0A 1QO0A 4EA6A 1FFYA 4IGFA 3AKDA 5F9MA 2B36A 3T95A 1O4VA 3I1YA 3WOVA 1E7YA 1QZZA 2DWUA 4RIIA 1YJBA 2C8VA 3OJEA 3RS7A 1H8ED 2XQFA 4KAAA 1Z6PA 3OJXA 3DO5A 4YJ2A 3T7CA 2E87A 2WB2A 2HMYB 3BZUA 2YJ6A 1WB4A 3GUZA 2BDEA 4X9XA 3L4KA 1RBZA 1SQ0A 2XUDA 4JBLA 2JVIA 4BV2A 4HDNA 2IYEA 3X3HA 3R7WA 5KAPA 4Y1RB 2XKKA 1QO0D 3ZDFA 1KK3A 4DWOA 1TMOA 2Y2UA 1M5RA 2FZCA 3TG8A 4GBED 1XEWY 3KKZA 3OQIB 3PXBA 4KR2A 1XV5A 3EIEA 2ZUCA 4WBNA 2JJ8A 1P4RA 3HSKA 2BGTA 2JFHA 1VCMA 3PTZA 1H2ZA 1W52X 2KS6A 5EKUA 3TSCA 2R6AA 5DBIA 2WTMA 3CBGA 3DDUA 1OTXA 5B12A 1XROA 4X92A 2NPOA 4BX9A 2DT5A 4BKMA 4IDDA 4TMFA 1NRWA 4J2TA 3ZLJA 1U3DA 4MYHA 4WZAB 3TR0A 4ITRC 1BA2A 1H1DA 2ZK7A 1P73A 2M1XA 4L22A 4IM7A 4RDHA 2GD2A 5DNWA 3QKIA 3VGJA 2BBSA 2HA2A 2QN7A 4XLLA 5FPSA 3TOZA 3LY9A 2O2SA 3CLHA 4ZQBA 4A4DA 1Y37A 3LCVB 1IZZA 4YHHB 3VNVA 2RMKA 5HKKA 1I14A 2ZRDA 5JDCA 3HZOA 3NUGA 1K6XA 3GDWA 4PINA 3RBXA 2WICA 3VBCA 3P2KA 5FWAA 3CKYA 4PO3X 4ALIA 3ADOA 2OTCA 3PTLA 1RQXA 1LBIA 2C4HA 4U3JB 2AK2A 4Q4LA 4GVXA 4AG5A 1B6RA 4FQ7A 1BGXT 3R3XA 4KAXA 2VDKB 4QICA 4P4UA 4GLJA 3E22B 1CUZA 1SBCA 3KT0A 2ZAOA 4HRVA 2LCIA 4OGFA 2VPIA 2EIHA 1J23A 2J9FA 3TLGA 3ZX4A 3OLZA 3UOAB 3BWXA 2Z4RA 3FUWA 3UJBA 5K2OA 1DXYA 5KQMA 1KDTA 2OD9A 3NEJA 3UA4A 5D6NA 2GO1A 2PRJA 4FZRA 1Q7TA 2PJDA 3DB1A 2QL5A 3B2QA 2P5TB 3AM3A 4UPEA 1HC7A 1W2WB 1IB0A 1KU0A 2VYFA 2II6A 2C2GA 2JS7A 5L45A 2Q0XA 2G9RA 2HJHA 3C3AA 3EGEA 1G42A 2ZRNA 2R8OA 3BB4A 3MGBA 3ZBQA 3ZX5A 1QU2A 1F1BA 4JU9A 4D43A 4R71A 1PTKA 4L74A 3NANA 3R3UA 2A1UA 4IZOA 4RVNA 3A14A 3M2TA 3VV3A 1AV6A 1SM4A 4CTNA 4O1HA 2A9VA 4J0EA 3OIUA 3K31A 1T8WA 3PNLA 4R0NA 2GNPA 2QI9C 4FGJA 1YRHA 3PHBE 3H5NA 1EVZA 2PT7A 1DXQA 4NJEB 3UH1A 4RFVA 4EHIA 3QFRA 4X7BA 3IP1A 2VWPA 3F3SA 1OI2A 5G0WA 2P9EA 2W58A 3TSAA 4K9PA 1JDUA 4LQLA 4QTZA 3AUFA 4YO8A 4E3ZA 5FQNA 2AQ8A 4G1MB 1XAIA 5JUWA 4FMDB 2CJXA 2J3EA 4RENA 2GK4A 1JPNA 1F1JA 4N9QA 2YIMA 3OT1A 2ZJAA 4S1NA 5EXSA 2BGNA 4X3PA 1K6MA 5GV8A 3B9PA 2E89A 4LYYA 4FYPA 1Y80A 4ZOEA 3Q9UA 3MUNA 2ZYUX 3WWYA 1N25A 1M6HA 3B2NA 4S2UA 4ZQFA 3RAFC 2RGGA 2F59A 1N57A 3KQKA 4AMZA 3SQWA 3M34A 2HOQA 2I6XA 1XYYA 2WKPA 4QC2A 2JH3A 2QF7A 4DMRA 3E6AA 2C7QA 1AS3A 1X7ZA 2FP3A 4EF5A 2AV6A 2QORA 4E30A 2PVCA 2Q8PA 3GRYA 1QCYA 3CV3A 4RZIA 3QOXA 3VI4B 2B6NA 3COSA 3ZE1B 4YQYA 4I4TB 1EFLA 4BMXA 2KI5A 3F49S 4KRYA 1CCWA 1RRVA 2OBYA 3CCFA 5A5GA 4II7A 5JXWA 5KQRA 2GN6A 4B81A 4RPLA 3MJSA 3C1OA 2ZIVB 5GJCA 2AXPA 2IU0A 3F8WA 2X6TA 1U3GA 3FYCA 2BN4A 2SKEA 3IQXA 1C7QA 2GCIA 3H5IA 4XQEA 4HATA 2Q8NA 1RAGA 2GOYA 3E27A 3DEZA 2QG6A 1VE9A 2EKPA 1T0BA 4JJ6A 5A9SB 3GLFA 2YWXA 4DCMA 4MUHA 3KPYA 3FI0A 2J59A 3HV0A 1IEQA 4TTPA 3K09A 4F2PA 1SIBE 2XRZA 4DDVA 1LPOA 4TUYA 3RASA 1RLOA 1OPXA 1XZPA 5ELXA 4G4SO 1M6YA 1N6NA 2FZVA 2PANA 3AEKA 4QFBA 4RZQA 2OP0A 3E23A 1Z08A 5JMTA 4GR4A 3OCZA 4P3YA 2I4OA 5F1OA 1I1HA 4CLEA 2PMWB 1XMSA 4MRPA 2RK4A 1HKHA 4IXMA 1C7ZA 3F47A 1YRWA 4DBVO 2JGEA 4R1PA 2O20A 4M1MA 3ZWPA 1BDIA 2XF8A 3EW7A 2GTHA 2J8ZA 3ZV4A 1A9TA 3CNHA 2PXCA 4RHXA 2UZAA 3PFHA 1SHZA 5FAXA 2GN0A 3T5BA 2OENG 1DCFA 4B6QA 4EPTA 4FHFA 1RDFA 5KTNA 3FHLA 3N8KA 4F4UA 2JCVA 3QBEA 2PXXA 1ZK1A 3II6X 3WP0A 4ZJYA 4AX8A 3RPEA 1QYXA 3CZ9A 4IIJF 4W5JA 4AYWA 1UPFA 4HPWA 2GJAA 3QUQA 3CPJB 5IXSA 1XFDA 3H9JA 1W19A 1JFFA 2Q4OA 2QRNA 5C53B 1M2FA 4A6DA 1HURA 2IEGA 3D02A 2W6ID 4R8VA 1DVRA 4KH1A 2X19A 3H0CA 4GPEA 4KSBA 1M1NA 1JEEA 1X74A 3GLHB 1YOVA 3QKTA 5CW1A 4MP8A 5E9QA 1E6WA 4UBKA 5LU8A 1SXIA 3DBVO 2RBKA 4YLEA 4G1EB 1Y5NA 3CUKA 1NUHA 4L8WB 4M1KA 5BYBA 2DZDA 1U7HA 4HFJA 5JRDS 1T1GA 4AZSA 3A4MA 4U9HS 3LLUA 3NKFA 3QKWA 3RUHA 4ALMA 4CGZA 1YVUA 4C05A 2DHCA 4ZO9A 5LOVA 3U4QA 2QN9A 5FULA 3X1YA 3HBMA 1LEHA 4OQXA 2EFYA 2XMZA 3H86A 1LBTA 1QLWA 1QF7A 2HK7A 3ESBA 4ZVOA 4D7AA 2DC1A 5JCZA 1L7PA 3N8DA 3TNLA 4ZCMA 5T6MA 1GRQA 1NXVA 3QUCA 3DLHA 4OY3A 4K8RB 1VKNA 1ZWLA 5A2GA 4UEOA 2ZRCA 4RTMA 5CCXA 3SE7A 3AVVA 2VHJA 2PUGA 1YXMA 3P0RA 5BRAA 3OOHA 1TM4E 4KSCA 5I48A 3ZCXA 4OM8A 2WC1A 2E3JA 2IQ5A 1PS8A 2IK8A 1BC5A 3A9CA 3PVSA 4IJMA 1Z7EA 3WJ1A 4YRTA 4E1VA 4KBFA 3OEYA 3U7JA 4XVUA 4RYLA 2SKCA 1ZU5A 2ZBGA 5BYAA 4P4SA 4D44A 5BSEA 2X86A 2VHXA 4D25A 1BCRB 1JG7A 1N6HA 1RI4A 3MOSA 2WSMA 4TN5A 4BN4A 1WHTB 3F5QA 4KDFA 5D6OA 1FRNA 3T4PA 1GRRA 5IDVA 4BRSA 3KV3O 4JZKA 4D5EA 5C8XA 2NUPA 3MAJA 1BH2A 4EW3A 4HLCA 4J3NA 3Q1LA 3TNYA 1M8PA 4M0FA 1EK6A 1WDKA 2N42A 2PD3A 3I04M 5KSWB 3OZSA 1UEIA 3WX0A 2GJ8A 3EA5A 4MKRA 1KJNA 2I1WA 1KMMA 4EPWA 3SYLA 1FL9A 3CB2A 2ZE5A 2ARKA 3IT0A 1AB5A 3DOFA 3L49A 3LT0A 3V3KA 2CYAA 2X3YA 4K81B 2HN9A 2F3RA 2P11A 5EUQB 4MUIA 2CMGA 1E0SA 1P60A 1TU0A 4LDJA 1GEGA 1YDHA 3CPEA 3GN1A 2J0QA 3BWBA 4JASB 1P81A 3RE1A 4AD8A 4QDTA 3H8SA 2C5HA 3QWIA 2F3QA 1YRYE 3DDZX 1OE0A 2JD2A 3KSBC 1IFXA 5EJ2A 2NW6A 3K53A 4OH7A 4FYXA 4B4DA 1BCSB 5AUNB 1PEDA 3FDIA 2XNJA 2Y8EA 2APJA 4JHXA 3U49A 5BUSA 1EXDA 4MUFA 4YRDA 1Y7PA 1X2BA 1NQVA 2PRKA 2B78A 2DVMA 2X4GA 2PAFA 2N47A 2HWKA 3IR5A 5E0KB 4BUZA 1S9DA 3BTUA 4RFSA 2W6JA 2YYZA 2LIPA 3BHMA 5E3IA 4B71A 4MV9A 4P54A 1ZD1A 2FFQA 4OJQA 3QY9A 4WASA 5BORA 2HSDA 3IHKA 4OHFA 2BFWA 4ZCSA 2QTWB 2RK3A 3PSHA 2J5XA 3E0XA 4CMBA 4UOQA 1BSVA 1I6LA 2XUAA 3ISTA 5JWHA 4EATA 3OQIA 1NVVR 1DI0A 3PZRA 3IUEA 4U7FA 3GO4A 3G68A 2FF7A 2I33A 3DSRA 2DPYA 2A5YB 4F46A 3COVA 1OFTA 2IKSA 4WZAE 4RTPA 2W6JD 1SUIA 1G9TA 4ZANA 3UJAA 3F6RA 3LRXA 5DI3A 3G2KA 5KOJB 2OGWA 1N2EA 3KQQA 3QZUA 1QIJA 3JQDA 2D1YA 3NXKA 1G3RA 4QYMA 1X7HA 3V48A 1Z17A 4HEJA 3IMFA 1DKOA 4WZAA 4ZAZA 1NAIA 2OHXA 4OA5A 4EVQA 2OQVA 3KQOA 1P61B 1UFOA 3NTXA 5BSHA 4QBKA 5A6SB 3T1HB 2W4IA 4YJFB 3DBHB 5HGXA 5JWOA 4B3IA 1QANA 1E3WB 1P44A 2YYYA 1R8QA 2EJWA 1SWVA 4J0QA 2UUAB 2ZB2A 4AO8A 4MMYB 3LYUA 2ZIWB 4EFNA 4UZEA 4I5GA 4HZUB 2OZVA 4U3JA 2PCJA 2WYOA 3JQAA 1X70A 3OZGA 3CF0A 4KX3A 1NVVQ 4HLUA 2IDKA 3K0KA 4TTVA 4RKEA 1QIMA 3ELYA 3QBDA 3DFMA 1EX7A 1W4AA 3G85A 2C20A 1PS9A 1T3ZA 2BSQA 2WJ6A 4NH4A 1AKQA 4IIFA 5CB8A 1I5EA 1CUGA 4X8OA 1Y5RA 2BJWA 3UT0A 2H7XA 2I3GA 4QDUA 4C04A 1BE6A 2W6ZA 1BMDA 4OTZA 5B1SA 3DHNA 3HCOA 1DS6A 1A1SA 1H8HA 1Y89A 3JZAA 3DCYA 3R0QA 4L5BA 4YRLA 2YX1A 3LTEA 5AKJA 5ALQA 2ASEA 2UUPA 3JQAD 3WFIA 9MHTA 4RVDA 3KU1A 3PFFA 4MWBA 5EP1A 4IDGA 4W5HA 1SJ9A 2A33A 4PW0A 2PL9A 4KPFC 5JD4A 3IAS6 4OA8A 5BSGA 2B37A 2Q6TA 1WXDA 2J0EA 3N76A 1BQ4A 1IRXA 3GC6A 4MARA 4RXTA 5JXJA 4F5DA 1KBQA 4EKGA 2ZT6A 1FP1D 2ZPAA 3FCXA 4XUDA 1W5FA 1XU9A 3MD9A 4BEWA 5ETJA 5L3RA 3PTAA 1EGAA 1H8HD 4GX1A 4QQ8A 1X86B 1PR1A 3I34X 2NZ8A 1KIMA 3CH6A 4Q9IA 4HRXA 2YXLA 4YYEA 2O5CA 3GLGE 2NG1A 1N8SA 3CIFA 3VNAA 4IFBA 2XZOA 1FBTA 4EJ2A 3D8RA 1ND6A 4UCXA 4M36A 5D8DA 3HPRA 4H7HA 4NJEA 2NYUA 5ALFA 3V5NA 4Y30A 4UBMA 3VC1A 1NVFA 3W7BA 1DEAA 5TQ0A 1U0JA 4JCCA 1RCTE 1ZCAA 3GLGA 1D9XA 2DB3A 1P2SA 2DRIA 1RQNA 2FVXA 3AOEA 3Q1KA 1DQPA 1LPBB 4C21A 4P86A 1VI6A 2P6OA 3F6BX 4MUGA 5G0TA 4AKGA 2D1TA 5IZ4A 1Y8CA 1J4AA 1TEHA 4PR0A 4P58A 3K0HA 2ATEA 2CHEA 3ETGA 2H1RA 2XZPA 3THOA 3L40A 2C4TA 5LDDC 4FS3A 4MDFA 1I6MA 5AJYA 5DHUA 2OCYC 3TFWA 2JIMA 3BIJA 4I36A 3BS4A 3E8MA 1RSZA 3F8TA 2IOFA 2O1EA 3G0DA 5JAHA 1XRRA 3PP8A 3GUCA 3T3PB 4BZPA 4ATNA 2O0JA 4CUZA 5JALA 2O0HA 4PE5B 1Y6RA 4DBLE 2DFTA 4X3CA 4BFZA 1VA5A 4CDGA 5CW2A 3DZBA 4PNPA 2ATCA 1A96A 2JRCA 1Q1BA 4AP5A 3W2FA 3N8NA 1DHRA 2KLBA 1UM9A 4WLVA 3G2IA 2X8AA 4TRRA 2GZDA 4XR4A 4DR7B 4D81A 5EXPA 2WM9B 4YIHA 1NYQA 4WNAA 5B1YA 3NT5A 3DOJA 4FSXA 1Z4PX 1SK9A 2MYTA 4XIIA 1WXQA 2VDNB 1ZY2A 4CMEC 4E5VA 2H5IA 4KUHA 1F8GA 5LA6F 3RU9A 1NNLA 1WNTA 4OMDA 4QHYA 1FUUA 4AJ4A 2VATA 1T1JA 4CIDA 2POCA 4PYJA 5GP1A 1IQPA 2O14A 4XLZA 4NEQA 1NF3A 1PT8A 1V4NA 1TYAE 3QXJA 1UBGA 3ORQA 3PGVA 3PJGA 4LZOA 5AO9A 2IV7A 4G0OA 1CS0A 3K73O 1C1XB 3OECA 1FYXA 2ZYTX 6LDHA 2PUFA 4ND7A 1Q92A 2WUFA 5KDLA 1X8LA 2VYVA 2V5VA 3OCYA 3OX3A 3VC7A 1JN0A 5AW0A 3RJMA 2BM8A 1XYVA 2X76A 3H8VA 1CJUC 2G0NA 2IEZA 2PLNA 4PYIA 4AZ3B 4GI2A 2IHVA 1JKJB 2DQSA 3GB9A 1R66A 1LDNA 2CLOB 4BWGA 4V3BA 4BTEA 5DNAA 4MRMB 4PEVA 1P7PA 3JZDA 3M5WA 4XWGA 2C7RA 2LRHA 4HTFA 1JZSA 4YMVA 4FB5A 1NATA 3IEKA 2VYVD 2ZUEA 1YUNA 2F17A 4HNRA 5TT1A 3RI3A 3RYTC 2FR1A 2EKLA 1SVIA 2FAXA 2WHEA 3FR8A 3ILYA 5CFOA 1IBKB 3LUJA 5TX7A 5AVQA 2CHGA 1NDQA 1T5SA 2ZBUA 2XA2A 4V0NA 3VKGA 4M8KA 3U7RA 3IS3A 3DDWA 1H42A 2Q7XA 4QPZA 4UUMA 4DQ0A 2Q1TA 1AK9A 2EG5A 2VDLB 4MR9A 3SI7A 2V6IA 3QU4A 4WA7A 4M0EA 4YUYA 3CZCA 4WN9B 5CT9A 2OWEA 3T9DA 2R87A 4AMUA 1WVMA 3E9EA 4YR9A 4Y2HA 3Q9SA 1P7WA 4P3PA 1H65A 3J7AC 4TS3A 1WCIA 4XQ9A 4OMUA 1CD5A 5EXTA 4ZU6X 1N5DA 2X3UA 4Z4HA 2A5GA 1SCKA 1P2GA 1URPA 3BDAA 3FUUA 4TXHA 4YV2A 2WIKA 1HE2A 4W1PA 2OK7A 4BP3A 1JJIA 3SBEA 4OP2A 3JQCA 1TI7A 3O3MB 2IEIA 1WW8A 1NDUA 3UPDA 4CIAA 5HM8A 5EJAA 3AJAA 3TMKA 1J8YF 5CDUA 3WAJA 2FRXA 3JRWA 4L4YA 2MCFA 4AG3A 4BQIA 1Y6ZA 2QZPA 2C4WA 4JVNA 1Q22A 3UHPA 3E3OA 4G36A 4PAGA 1WLSA 2ZDHA 4BGEA 4NNJA 1KDOA 2XVYA 3B78A 2PYIA 2BYTA 5HZGA 3OICA 2AEMA 3TLZA 5AFSA 1UJ5A 1DJQA 2C9YA 5IEBA 3PL1A 4MWEA 4D80A 1VLZA 1SC3A 3OCWA 1M2KA 3SSNA 5TGDA 4Q4AB 4ROSA 4ZPXA 2I6GA 3F2VA 5H0IA 1KH2A 1YVEI 3GFRA 4PO1A 4PO8A 4NH0A 4FJ1A 3C8MA 4FSHA 4BS9A 2VT2A 2FN3A 2HDOA 4G0ZA 2BSXA 1GYRA 2RGEA 3PXEA 1JE1A 1J09A 3GFFA 4JLBA 1E3EA 1GTJ1 4IWXA 1R8YA 4L1KA 3VOTA 1BCRA 2WM3A 4DV4B 4HGZA 5DWVA 3W4KA 1X77A 1WHTA 4CF5A 3C15C 1GPLA 3OIVA 4GMDA 5BR7A 4LXHA 1PHRA 3LY7A 1LSSA 1B1AA 4DLKA 1KQGA 4NZPA 3MWYW 1P7VA 3H3JA 4EF6A 2HYIC 3RAGA 3VX4A 2C4MA 3QVGA 5GONB 1C9KA 3O90A 4EKIA 1ZESA 1HSZA 1E3LA 2IIVA 1D2AA 4ARBA 1QIIA 3G6KA 4H60A 4DJFC 2WD9A 4FCCA 3WL7A 3ZN2A 4X91A 2HSEA 3K0FA 4CLDA 4YJHB 1S7GA 1RM3A 1Z5WA 5LMCA 4IVNA 3EMBA 1ZUNB 2RHTA 5DDIP 1QUFA 1O94A 3ANTA 1TIKA 1FRVA 3K8QA 4A10A 2WFLB 2FPOA 4RVCA 1TQ6A 4FYJA 1EZ4A 3AR6A 3BMCA 1U1GA 4PLGA 4DRZA 3SXJA 4ZDIA 3TIGA 3H2SA 3FYHA 1SG6A 4A82A 5HF8A 5C7YA 3JVEA 6REQB 4YBRA 1VE5A 2C4KA 4HC4A 3VHQA 4EA7A 5DGXA 3DDOA 3HUUA 4ASUA 4I66A 3LKZA 2YVUA 5FR2A 4WNYA 1O94D 2UUBB 3QWFA 4D45A 1LPNA 1OLSB 3FNQA 1FX1A 1NQXA 1T25A 3CH4B 4GKVA 2CK3A 4MLDA 4NU0A 4YECA 2QMQA 3PNSA 4ZU1X 4ALKA 5KWIA 1DX4A 1JG2A 2BCEA 4EBBA 3ELDA 1BHO1 1Z29A 3OM8A 5AI5A 3UPTA 1OYYA 2YWJA 4FYKA 2ZJ1A 5AKXA 1PO7A 4HQKA 1VG9B 4B6EA 2HFKA 4ZOLF 1YVRA 5J23A 1KS9A 2QMYA 1U7XA 4ASUD 4JJ7A 2A9QA 1VXRA 5NLLA 1KOJA 4EABA 2BE7A 4LRSB 3GZNB 3BZWA 5B1EA 2CK3D 4NAUA 4AW9A 3HCCA 2D0PB 4KLNA 4H7IA 4K6KA 3PHHA 2AR0A 5IW8A 2BKUA 2JG3A 1Z6QA 2EDAA 5EHIA 4J0FA 5DCLA 5F9FA 2XDQA 4EY6A 5A6SA 3B8EA 4XX0B 3SD7A 1EH5A 1KC3A 2PFGA 2FOXA 5C1OA 1PKXA 1W36C 4LNHA 3BBLA 4JLKA 4O1IA 2P2SA 4QFCA 3SSOA 1KP2A 1DTSA 2FVYA 3ZEAA 1NVGA 4UEQA 2YXPX 1PJCA 3OBBA 3EWSA 2BZ0A 1AUVA 5A4AA 2ZUUA 1U7WA 2YVKA 1QQ5A 5AHKA 4DMGA 3C16C 5C7OO 4GRIA 3FYSA 1CY6A 4FCWA 5JSQA 3LP5A 5I5EA 1AUPA 2IIQA 2V03A 3CLVA 3HLYA 2NYRA 3QK7A 4HP8A 3YASA 4EMTA 2HRCA 5CT5A 2EFJA 1WDMA 1E9CA 1V8BA 4HAXA 3JYPA 3LBFA 4KN8A 3W6PA 3R9XB 4ZT7A 5FD8A 4M4SA 4CQMA 2F67A 3L8GA 1BMTA 2IHUA 2W43A 2PD4A 3GGDA 1IY9A 3Q2OA 4MA0A 5F76A 2L17A 1C3VA 2D7DA 2P6RA 2WMNB 1XHLA 3QJGA 4YMHA 3URMA 1Y6GA 1J2EA 5KO2A 1R6BX 2WJYA 1OBVA 1T0HB 2Q9AA 4KKXB 1K8ZB 3ANNA 4MYUA 1H3FA 4N3AA 1I51A 4BVAA 1K4MA 1V5WA 2O8VA 4JLSA 4ND5A 3UTCA 1A5ZA 5ELMA 4EB6A 1F2UB 1PJRA 4PLTA 1IG0A 4TX1A 3BIOA 5CP8A 3X44A 1DO0A 4G4SP 1JPUA 2YY6A 1HI9A 3HVKA 2IXAA 2ECKA 4J90A 4FK8A 2VTBB 4TMKA 4NTZA 5HZMA 4G89A 4Z4GA 4JKIA 5JWRA 1KE1A 3KAPA 4D6XA 4WCDA 3R7SA 4OLAA 2WUGA 1EVIA 3JQ9C 1N3BA 1Z45A 3PHGA 4DM3A 2C2XA 3TGLA 1MUUA 2PAAA 4BFYA 5F7XA 5EWMA 3VYUB 4IXNA 3PHCA 1YQGA 1ZXBA 2CLCX 2M6RA 1B15A 2O1SA 1KBZA 4QTUB 4I9HA 1T9HA 4W8OA 4AJNA 4C6HA 4DR2B 2R66A 1MVLA 1CNMA 4GX5A 4GYYA 5LC1A 1DKUA 3K9FC 1FFDA 2JCSA 3DXZA 2YDYA 2W6PA 3L82B 4UULA 2C3PA 2RJNA 4EVIA 3ZPXA 2GZAA 1YQ9A 2ZR7A 4P4LA 1EWQA 3AIKA 1GFWA 2RHDA 2YHIA 4M7RA 5BO5A 1G6HA 3PGXA 3N0RA 4JHLA 1TA0A 4D3ZA 3THWA 4WFQA 4Y2SA 3HTXA 3H99A 1N7HA 2DFLA 4WCVA 2UYGA 4WBXC 1JAXA 5LDHA 4TLEA 4DPKA 4RY0A 3FYTA 2FPIB 2TECE 3FYDA 3PC8A 1E96A 2HUPA 3FTQA 3T94A 4RTSA 2XHEA 3F3KA 5AR1A 2BR3A 3KYBA 5B6JA 1R9NA 2FSGA 4OGLA 5IYZB 2ZI9A 2EWMA 3UAOA 4PQEA 4TMYA 4E08A 3ROPA 3W2GA 1KGSA 1CUXA 1LRKA 2DSTA 3FDFA 5A7FA 1P39A 2OAEA 2WF5A 5C52B 2HK6A 4RWEA 3ZVLA 3G2OA 2XMPA 1QRRA 2HJWA 3LHKA 5AKGA 3DT8A 3IT1A 3BTSA 1EWYA 2ID4A 1PNQA 3FYUC 3I01M 3PQ4A 5PNTA 5SY9A 1H2HA 3CS3A 3L77A 3WMEA 5BN5B 2VRCA 1JZQA 4CEJB 2VYQA 4A0QA 3WIUA 4AZ3A 1JKJA 2HTFA 1NLZA 2MOKA 2AX3A 3AFIA 3HJCA 1KEKA 2R5FA 1WUHS 4KQKA 1RQ7A 1N9GB 5EKDA 1EG7A 3HEBA 2WVJA 1KVQA 4W7SA 5A7GA 1BIFA 3W3AA 4O2AB 3RAPR 2EJCA 4F4DA 4FFBB 1X7WA 4Z4QA 1A97A 3KB8A 3KKPA 1JEYB 1XTPA 3LYAA 1ATIA 3FPHA 3OQ6A 2FLWA 2J33A 3INGA 2VRCD 5K5EA 3VSAA 3CG0A 4MJLA 3VFDA 1G8MA 3R7LA 2HXGA 1QVRA 3GJTA 3E7WA 3F6EX 3TJMA 1KOLA 1V2HE 2W11A 3D31A 1GARA 4LDNA 3SY8A 3W3AD 3VU1A 1QPZA 2XDYA 2B8EA 2HKIA 4WN9A 3OJLA 3MWGA 4KAJA 4D46A 5JFTA 3B8HA 1G3MA 2J3DA 4WMLA 2ILTA 2NVBA 5H5JA 2MR5A 2CXXA 3TD6A 4B5KA 4M0MA 2QPAA 4GF5A 3ZDXB 1A27A 2RCYA 2ZRQA 1XLWA 1YZNA 4MEBA 5A9TA 3TECE 1BDHA 4GR5A 1KYXA 2GF9A 2ZSJA 4I8DA 1XCLA 1DAHA 2A7XA 3QLVA 4O5OA 1Q12A 4EW2A 3O3CA 1U7TA 4MGZR 5KSYA 3EXFB 1FSFA 3RC8A 4PZUA 2ONKA 3U60B 5IHXA 3LZDA 4YI5A 3RAJA 3O2NA 4C0AC 5KSPA 1MNQA 4HXYA 2E7ZA 4JGIA 1U2TA 1B8UA 4QGFA 3K4HA 1LQUA 3AH8A 3HN2A 3L1VA 5DHQA 2IIPA 5TS2A 5HM6A 3O1IC 4P34A 3NS7A 4D9MA 4E2ZA 3JQ6A 4UC0A 4JJ4A 5H16A 5LBTA 5JROA 4Q4AA 2WSLA 4EUFA 4OATA 1PS0A 2M1ZA 3KB2A 3C8HA 3EYAA 4IWNA 8LDHA 1G59A 1TAQA 2UZIR 5L6MB 4LY6A 1AA9A 3NWEA 1PVVA 1NF9A 3JYNA 1TIBA 1VSVA 2L42A 2VNHA 3IMKA 1RD4A 5REQA 1D7OA 3W5VA 1KYQA 2CJYA 4TWZA 4OAOA 2YWHA 4CM6A 1CRLA 2HO5A 1QHFA 3E9MA 1R6DA 1W85B 4RZUA 1ZPDA 3HA3A 4L2IB 4QU9A 2JBAA 2VPTA 5FX2A 3O3NB 2O4CA 1UL1X 3PD0A 3QX8A 4MW4A 1BVYF 1LS6A 2IZOA 4O0MA 5DO9A 5IANA 3WNZA 1XRSB 1Z13A 3Q12A 1ZVKA 5IUJC 1UUFA 1P6QA 3ZGZA 4MW6A 2QXYA 1O54A 2HRBA 4H1TA 4OD0A 4EARA 1QAQA 1FQWA 5A02A 3PCXA 4WKNA 4A0GA 1DLIA 4ZRMA 4AT1A 5IUKC 5P21A 1KAQA 3L8MA 2GM4A 1ODIA 4GS5A 2RHHA 3OC6A 3N3BC 1HTBA 3UAZA 4B2IA 3BL6A 2ADOA 4IQFA 1MH9A 2GZHA 2PCLA 3L43A 4YAFA 4C7VA 4EFDA 5L3QA 5KSZA 1M8FA 2SICE 4KQHA 3WK8A 2G6BA 4O4LB 2B34A 4LZWA 1MAAA 5GQSA 1T9BA 3ZHYA 5FBLB 1NMXA 4EY7A 2GRJA 3NBAA 2AI3A 2HIGA 3D3WA 4GMGA 1QDLB 3LUAA 4FP9A 3RVBA 4R8SA 2I4TA 1GGEA 3NIDB 4MVJF 2RARA 2BGJA 3IC5A 1LVUA 1J9ZA 5EIWA 3RHSA 3OJOA 1ODFA 2DPHA 2HLDD 4Q4JA 3AB3A 4YXFA 1DQYA 4M21A 4HX9A 4MHTA 2CDCA 2CLIB 5L51A 3JARB 5EA2A 3B6IA 1POXA 2IOFK 3K16A 2Z3WA 3L46A 4CMKA 3HM2A 4KXMA 5KTYA 3Q98A 3NPAA 3EOAI 1FJ2A 3BOSA 1KZ1A 2LKDA 5BN1A 1K6IA 1H6DA 1SU7A 3OPYB 4U2GA 2W83A 2IUTA 4B09A 5C7LO 3BB1A 3FVRA 1SOAA 2ADFA 3K2EA 4FZ5A 4RH3A 2COKA 3GZNA 1XG5A 4HXGA 2QZZA 3UK1A 3KPWA 3VHRA 2I71A 3LT1A 5A3SA 1GGHA 3KO8A 3I09A 1WG8A 1RQPA 3NHWA 1KI6A 3HVIA 4BE7B 5DSZA 1L9KA 4HDRB 1J8VA 1RTTA 4IQ0A 4OH1A 1R6TA 3C7KA 3KV1A 5FA8A 3ANLA 3NHKA 2HIHA 1KWGA 1RQLA 3DH0A 1UQUA 2HEIA 1T36A 1JMKC 4R05A 2FZGA 3U3DA 2L0XA 1ZEJA 1RZ3A 1R64A 3UM9A 1TFRA 3LBIA 3DLBA 1CPYA 1KNXA 1N3IA 2BFAA 1C8VB 3DMPA 3I2YX 4I3FA 1UJNA 4NBUA 3CVVA 5I7RA 3HJHA 3ZQKA 2HU8A 4AECA 1TAHA 5EQJB 2VSXA 2X8JB 2Z08A 1WDTA 3PC7A 5EINA 3H5TA 3BXPA 1YBHA 1R4MA 1RQ2A 3C3CA 3F3MA 2I2BA 4YUVA 1NURA 4HUQB 5BT8A 2AKYA 2YYSA 1VKJA 2ZBFA 3DTNA 3KXLA 3SKVA 2YTZA 4KLRA 5DTEA 3IP9A 3UTDA 2GZ2A 1QGAA 3ELBA 4PQFA 2C2WA 2W98A 3C24A 1RWNA 3L18A 3WWDA 1N5LA 1EFVA 1G60A 3UV6A 2A5DA 1N2GA 3Q3HA 2W42A 1S3FA 1QH1A 1PR2A 4G4JA 4KO1S 1IH8A 3TQTA 3PXCX 5KDDA 3O9VA 2QX4A 2BTQA 1UBSB 4MRVA 4Q1EA 4EX7A 2X0FA 4NESA 3GFSA 4L95C 1ZL2A 1SCUA 1X1AA 1QLHA 2CMHA 4WKPA 3I2HA 3UMVA 4R69A 4B79A 4ZHQB 2BMVA 2F1RA 3ER9A 5LYJF 4E31A 1TA4A 1J5EB 1PQ4A 2WTXA 1RI1A 4JVLA 1DWPA 4LJ6A 3MTBA 1GAJA 3B13B 4MB2A 2I6FA 5J5AA 4E2WA 4ES6A 4PZ9A 1PQYA 2C04A 3EVDA 4MULA 1ECCA 2GH1A 2FLVA 1QH8B 2YY5A 1PZXA 3DZGA 3E15A 2EZTA 3GY0A 5C37A 5JVDA 2DQYA 4C6SA 1QF9A 1I01A 4L9AA 2DFPA 3TINA 1IY1A 1VMDA 3DDNA 3PWSA 4LHWA 3WKAA 1BJTA 3I9V1 1GPUA 3WIVA 4ZCPA 2HHAA 2V7QA 3SWWA 3P9YA 2FGKA 1E2IA 2ZR9A 4KOEC 1X19A 2O23A 4Y9UA 5FCDA 5DH9A 3V2UA 1K63A 4C5AA 5DBGA 3GAAA 1UKCA 1ZMOA 4BQNA 5KU7A 1AO0A 4X20A 3LL7A 2Z98A 4J3FA 3J81A 2F8SA 4HGNA 1JDBC 2AMJA 5FBKA 3E2IA 1XI2A 1LV8A 2ON6A 2BKVA 3IPLA 1VYVA 3I2IA 4TV8F 4XSHA 2M6LA 2V7EA 1VMIA 2ID9A 3TWOA 3EPLA 3SU8A 1NRJB 5LP6A 3UY4A 4F9TA 4OMFG 3O2SB 3REQB 1RPZA 2FSVA 2BISA 1NQAO 2O2IA 2V7QD 4L02A 2I03A 3EARA 1TEXA 4GICA 2BZ1A 1Z5GA 3LGAA 4GM0A 3IODA 4JC4A 4BNJA 2J0UA 3MIIA 4TKMA 4Q16A 2JLBA 2HQ1A 3VSDA 3CGWA 5FUWA 3JQ8B 4KVFA 2QRZA 4DCOA 1NHGA 3QQPA 4WUVA 4YQEA 1R50A 1HT1E 2FPGB 3H2KA 1WXWA 1JDPA 3EDMA 3QLEA 4DUZB 2N1BA 3WIOA 2GPSA 1GQSA 1VSUA 3C4VA 2PKXA 3IPAA 4TGLA 4Y9TA 5D5HA 4DXAA 5LMZA 1KRWA 3WLPA 1P3DA 4AJEA 2XVZA 4YRCA 4AO6A 2ANBA 1QP0A 4FMCB 1X7YB 4GM4A 3ZVRA 5E1MA 2CYBA 3DZIA 1NVEA 5F64A 4K9SA 2AZDA 1FSSA 2Q2NA 2R25B 1E92A 2VWGA 1ONOA 1ORHA 2ZRJA 1NJ8A 4HQRA 4U0KA 2C9OA 4ZQIA 3CVXA 5CLGA 3OEHA 4UQPA 3TI7A 4EAAA 1ENZA 1UP7A 3L0YA 2B8WA 4REOA 2Z9CA 3I23A 1M2GA 5DZSA 2WG0A 4BVKA 2Q29A 5DHSA 4RYDA 3RFFA 4LFBB 4DDKA 3K7EA 4GMXA 2RH4A 2YJ3A 4OGWA 4S05A 5GVSA 1WU8A 3PPVA 4BVFA 3M81A 5B7PA 4V03A 4HAYA 5I7UA 4V0LA 1SCAA 4H1UA 3V4LA 4R2KA 5B2ZA 2IXEA 3NGLA 3OEHD 2CJWB 4TL7A 2FDCA 3KS9A 3V9PA 5BNIA 3JYOA 2GAAA 3EQ7A 3HP7A 4RV5A 3E4CA 2YASA 4EB8A 4ENUA 1IONA 1CQJB 1GU7A 1SK8A 3GLTA 3HH8A 4YCDA 1V95A 2CL0X 5H02A 2PBLA 4MGEA 4JI4B 4FYWA 3PL5A 3Q7SA 4MA5A 3HBLA 4UMEA 4BQQA 1JLSA 2ORYA 2WIAA 1IN8A 1GL7A 2GZ3A 1VFNA 3DWIA 4XH9B 1DHTA 1V1RA 2QJOA 1Z82A 1PLLA 4JLMA 1TB4A 3I1JA 3LOPA 1A9OA 3P45A 1PDOA 3IEUA 3ITKA 4M1WA 4RK7A 4UQOA 2QUJA 4Z4EA 3MGCA 1PR3A 1I1OA 4JYBA 1X1SA 5EP4A 5C31A 1U2SA 2QTBA 2YFKA 3WSVA 5KQSA 4S12A 1T9DA 1M34B 3DEHA 4KO8A 4QPJC 4ROTA 2V54A 1FTQA 3HY4A 1IJEA 3LM8A 2Z8ZA 3CRRA 1JDVA 3RVLA 3GLIB 2C07A 1MC1A 2DG2A 5JSHA 1QTNA 1FPMA 3EH1A 3KQSA 4OBEA 5FNVB 1ZNQO 2XQVA 1GSHA 1PR6A 2ZWPA 3S55A 4BMYA 3K94A 5IKMA 5KTMA 2DPMA 4K8OA 1TF5A 2BJVA 4DA8A 1UPXA 4OFXA 3ESXA 1ETUA 3U9SA 4F12A 2ALJA 5KAMA 1RHJA 4GW3A 1W2HA 3ZXIA 3GGPA 1TTPB 2ORWA 4REQB 4A6XA 1ZX1A 2P2LA 3WLIA 2K2WA 4EG7A 2P4UA 4FIDA 3FFAA 4DCUA 1I30A 4BGIA 1D9ZA 1SB8A 3DOCA 1XALA 3PEFA 1JIXA 2GPWA 4KIWA 4HVLA 1Y9DA 1A7KA 3KJZA 3HU2A 4OPMA 3PNMA 4YWJA 3JYQA 2BGUA 3ME5A 1OXXK 1QIGA 2HK9A 2GF2A 3JWHA 3TSZA 1JIJA 3CJRA 3PUJA 4G56A 2R60A 2GUGA 2R9VA 3I5MA 1F8FA 1SBZA 5JCJA 3T99A 5AUPB 3NFRA 3AF2A 4R9UC 5AK6A 2I6UA 4DA0A 2RGWA 4WHMA 1IULA 1T2AA 2VH1A 5BQOA 5GINE 3JAMA 4MKXA 3VR5H 3DAOA 3HCBA 2DLDA 3B1YA 2BFFB 2QZSA 3LPAA 5B4UA 3KKNA 4ADSG 4RA6A 5TXGA 1GQRA 3VDNB 2ZIAA 2OXEA 1S8OA 3H0KA 5EMMA 2CLLB 1WWKA 3DC2A 4MNTA 5ALNA 4OU5A 4C01A 1SCDA 3TLKA 5J9FA 5JCJD 1BKSB 1RHUA 4EAQA 1G64A 3DP9A 2QQ0A 3MN1A 1O95A 2XI4A 2V4MA 4KNVA 2IP2A 3FKJA 3GDFA 2XE8A 1Q1QA 3KKEA 4QECA 3AYXB 5SZIA 3T12A 3KLPX 4LYGA 5COBA 3BWVA 2BEWB 2WJWA 4NZYA 1FIUA 1J2RA 2Q1XA 2VKQA 4QU8A 2CZQA 1QORA 2OD2A 2ISSD 4BNYA 1IXRC 4ZYWA 1RI3A 3PFCA 3I52A 2P75A 2FWBA 2W4MA 5IC5A 1A9YA 2IE8A 1Y6QA 1IOWA 1TJ4A 3L7CA 3Q9NA 4IYRA 4P08A 4DJDC 3E4DA 1QGDA 1O95D 5ENVA 5TNXA 4QWWA 2GGSA 3OOEA 4FW9A 3SHVA 2IZ7A 1TNDA 3V1UA 4KQIA 5JZVA 3W5BA 3SSMA 2HA4A 4A8JA 3RWBA 3ZDBA 2AE2A 3PQ2A 4QBIA 5C81A 2G4VA 4OJNA 3E7XA 4L8LA 4ZKDA 1OXSC 5JV5A 4DREA 4G0UA 1F51E 3H2IA 3P9IA 1UJMA 4GE3A 3O26A 1QTIA 4HFNA 3WNCA 2WSYB 4E4TA 1MHPA 2BC9A 3OPYA 4WA8A 3A3NA 4PNHA 3W1VA 4L0MA 3FCCA 4H6VA 2JCXA 1NE7A 3AB7A 4Q82A 5CVTA 1Y34E 4ITUA 4UATA 2BZSA 2P3LA 1J7KA 1I6KA 3MPOA 2PS9A 4Q1FA 1JTVA 1HNXB 3HB7A 1V9CA 3GFBA 3LUPA 1SH7A 3H04A 4MPJA 2XCQA 4V0OA 4XB6B 2H5JA 2J48A 2QRPA 2VYNA 3RR2A 2Z2JA 1Z6XA 3ZEIA 1UKZA 3ROMA 3QEKA 2ZUTA 2JFNA 3GLUA 4DOMA 4CN8A 1QU3A 2ZUWA 3LPDA 2BI4A 1FCJA 1QZUA 4HYTA 4MUEA 5IABA 4U9IS 5JISA 1QDUA 2XB8A 4EJ6A 1XMJA 5CG1A 4P4GA 2IHBA 4RTNA 2FW0A 3GQBB 1LC0A 2VWHA 3GJXC 4NLLA 3L9WA 1NN0A 2VYND 4LVOA 5IKOA 3FB1A 3OTOB 3ZD7A 3ZOKA 4KXYA 4OQMA 3CF4A 3RS5A 3RRFA 2B0JA 4X93A 5ECDA 1M2NA 5LQUA 4M46A 2LGJA 1GNVA 5I7WA 2GB4A 3NOQA 3STWA 3BFXA 5A06A 4C3VA 5SYMA 2ERCA 2OXFA 3SEZA 2B98A 3OZDA 4JNKA 1XMPA 3TG2A 4LJAA 4I2NA 1GFIA 3RG2A 3FLAA 2E4XA 4G0YA 3O4JA 4LZLA 3MWDB 4DARA 2NQ8A 5FUQA 4KE6A 2CLSA 1YK1A 2JIQA 2YS7A 4RIHA 2IHTA 4IEIA 4DV0B 3TIFA 3O92A 3OSUA 2C97A 3BCSA 4ZHQA 3UQYS 3DAPA 1ESCA 2ZRKA 3ODPA 1FMJA 2B69A 4H1HA 3TLEA 4BQRA 4DJTA 4DLLA 3IV6A 4PAWA 2O8BB 1J2JA 1NP6A 3IILA 3L93A 4EA9A 5KJCA 1E6UA 1I0LA 1KJ9A 3EG5A 4GSYA 4DRYA 5KOYA 4TYNA 2ZM5A 3D8UA 2MR6A 2WYIA 5CX1B 2WK1A 1R0YA 1U3TA 2D74A 4PX5A 3ZWYA 4EY8A 3WLJA 3B1VA 3LQQA 4C4SA 2QXTA 3MJHA 2O0KA 2DP4E 3A8TA 4GOLD 1NOIA 2NIPA 3KCQA 3R09A 1NJ5A 2OV1A 5BVHB 4DIOA 2DGDA 2I6TA 4ZT4A 4DTCA 3Q40A 1RAEA 3W3ZB 2OESA 4IZ6A 4Z9BA 2A1TS 1E6EA 1HDOA 3HL4A 2H11A 2E5FA 1GZSA 4HWGA 1VG8A 1DEOA 1XCGB 2JANA 5JC1A 1RKXA 3LA8A 1KZYC 1JV2B 3RUFA 4B87A 2ZI7A 4RQAA 4BV3A 3JQGA 4LZAA 4WLNA 3FFWA 1U9CA 1EK2A 4IAOA 1XNRB 2Q4DA 3REQA 4BZQA 5CK4A 4CE6A 5AW8A 3RROA 2LDXA 1H69A 4B5LA 4EYGA 1HV8A 4YJ2F 2CXHA 3T1NA 5FOQA 4LMBA 1P2FA 4CKBA 3HBAA 2H06A 1SBQA 3E9QA 2C31A 4FE4A 5JSUA 3RYIA 3ZQJA 5JO9A 1AS2A 5BUQA 3LHIA 3QWAA 3MWLA 2FPGA 3USCS 1F2TB 3AY3A 3CF6R 2XVMA 5AVRA 4D92A 4GZ6A 1ZKDA 3BD7A 1U2GA 3FH0A 4JB3A 3SEAA 3ICEA 2MU1A 4UCWA 4X45A 2IS2A 1Z5NA 1J8DA 3KLMX 4UTZA 2YCBA 3F74A 1J0CA 1BQEA 1P2TA 4HB2A 3BQMB 4WBNF 4TRMA 5D87A 1FFBA 4IH1A 2QUKA 4Y6OA 4LYEA 4R9SA 1HYGA 1C1DA 5F21A 5K0SA 3A7EA 4JP5A 2VHYA 3FI9A 3C3XA 3U1TA 1GKLA 4J76A 2FU5C 1D6SA 4KRGA 3KNZA 1DC7A 4FE7A 2WY2D 3MPUA 3WGOA 3HXQA 4OUKX 2ZQ5A 4GEKA 3A4IA 2XTAA 2O8BA 4Y8VA 3KQLA 5CAEA 4TLLB 4EG5A 1IM5A 1DUVG 4RU1A 3QFFA 3QFTA 1SBYA 2W2QA 4GPZA 4QJBA 5COAA 3AL0C 3JTEA 1LQTA 4KNYA 4UDNA 3OZ7A 3ZZMA 2XNHA 5JH7B 4MJXA 5KJFA 4I8XA 4JYMA 1PRYA 2GEDA 4AN0A 1TK3A 1H0KA 3H11A 1CRZA 1E98A 3PHLA 3W7VA 4Z54A 1UC8A 4E03A 4UAUA 5GIPE 4OI0A 2I76A 1CRPA 2MYNA 4R3UC 1Q7RA 2A58A 2GPYA 1LPPA 3B7GA 3WK5A 3R1IA 1NPYA 4JVMA 1SVUA 3C1TA 2OAQ1 4AM8A 2AQHA 2BDUA 4U7PB 4K5QA 5BN3B 5HDQA 2IODA 1BO6A 1SA0B 3I6QA 5HQ3A 1D0SA 1G7RA 5DGCA 3U4DA 2WAXA 3RTBA 1EP9A 1XCMA 2DUWA 1YS6A 2WSSD 2HCRA 2PXHA 1DAIA 1Y4DE 4D3YA 3HP4A 3AJ8A 4A2QA 1U0HC 5D01A 3P32A 1F6DA 3K70B 2ZCUA 2FLKA 3NHFA 1BXGB 2NVUA 3VXKA 1U3FA 5DOVA 3GLIE 1I3CA 1OV4A 5ED0A 3L0CA 1C2TA 4WGGA 3A3KA 3E53A 2YV3A 1Y9EA 2HJRA 2DUUA 4HWRA 4YREA 3VPGA 4IHQA 4WY2A 2FSFA 4DN6A 3FNHA 4UD6A 2R85A 2VHTA 4G0VA 3FZNA 4QUDA 1WSDA 1GAXA 2AEJA 3GLIA 1IQ0A 1L5HB 2VJMA 3DYVA 4PSCA 5JPIA 4AAYA 3CNBA 4RSHA 3HN7A 1OLXB 2XUPA 4J0HA 5FNVA 4OCZA 3UXYA 1YBMA 4WBSA 5ADHA 4FDAA 3OE1A 5F7JA 4OHXA 4Q02A 3QUBA 3I3OA 4CL8A 4FKBA 5IZCC 3PLAE 2FH5B 1DAFA 4EDHA 5A0FA 3L0PA 5DHTA 2QD4A 1A7JA 1A2QA 3DZKA 3P96A 5F4BA 4QWMA 5KYUB 4GXNA 1M7HA 1JQ5A 4B82A 3DE2X 2BLNA 2ZZNA 1U28A 1ABEA 2IIBA 4N49A 3ZCUA 5JDIC 1AH2A 1ZMTA 4BQFA 1F5NA 2PX3A 5BMVB 4K9RA 2E9SA 3EFHA 1FU8A 3ISJA 3SYMA 3ZU3A 1EDBA 4CETA 5J4KA 1SXJB 1WD7A 2O57A 3JAKA 3WA6A 5IFKA 4TVSA 1PBNA 3FUXA 3IB6A 2TRSB 3DLAA 3LBHA 5ARDA 3EXEB 4OM7A 3L0SA 2QTAA 4YACA 2X1MA 4FLEA 5SZKB 1RXUA 3A1UA 1BW9B 1X8KA 2GERA 5FL7A 3HYCA 4I9FA 3ZDRA 3C3YA 4D4KA 3NOOA 1GUFA 1K7XB 2XAAA 2O6HA 2HYDA 4I5FA 3UUWA 1CB7A 3P20A 2F00A 5ALHA 5K6AC 3LT4A 1KRHA 7AT1A 5KKCA 3ILXA 2R8YA 3AO0B 2BFFA 1A4UA 3SYTA 3ZU6A 4E6PA 2JCYA 2BCJQ 3H75A 4KPYA 3W8FA 4AMBA 1A2KC<