4TTSA

Crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (y200a) complex with 10-formyl-5,8-dideazafolate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
308
Chain Sequence
MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWRLKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAVRLIATGKAPRIKQPEEGATAECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGKSVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKMIPGSQYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title Structures of the hydrolase domain of zebrafish 10-formyltetrahydrofolate dehydrogenase and its complexes reveal a complete set of key residues for hydrolysis and product inhibition
doi rcsb
source organism Danio rerio
total genus 87
structure length 308
sequence length 308
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 4ttsA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4ttsA01
4Q12A 1JKXA 2BW0A 1MENA 4ZZ0A 4ZYWA 4IQFA 3N0VA 1CDEA 4S1NA 1RC0A 1MEJA 1C3EA 3W7BA 1ZLXA 4R8VA 4NV1A 2FMTA 1GRCA 3P9XA 4YFYA 4ZYVA 4TTSA 2CFIA 3DA8A 1RBQA 1RBMA 4EW3A 1ZLYA 1C2TA 1ZGHA 1RBZA 1S3IA 4YFVA 4ZZ2A 3NRBA 3OBIA 3O1LA 4ZZ1A 4ZZ3A 3DCJA 1NJSA 3AUFA 3TQRA 3Q0IA 3LOUA 4EW2A 4ZYXA 4QPDA 1GARA 3KCQA 1FMTA 4PZUA 1MEOA 4QPCA 2GARA 3R8XA 1CDDA 5J9FA 4DS3A 3AV3A 4ZYTA 4EW1A 2BLNA 5J63A 4ZYZA 4TS4A 3GARA 1RC1A 1RBYA 4ZYUA 4ZYYA 2YWRA 5CJJA 3TQQA 4TT8A 1YRWA
chains in the Genus database with same CATH superfamily
3CNLA 1OXBB 3EEFA 1IUKA 5AT1A 5DSXA 4GLLA 4D56A 1V3QE 4F2PA 4U8GA 2D5BA 2VF4X 1M83A 4YJ2B 1CJVC 3W3AH 1Y4DE 1DFIA 1Q0LA 3Q8WA 5J5AA 1PTKA 2WHEA 1U2TA 3QE4A 4OYLA 1MX9A 3V8BA 3W3AD 2BF4A 5BN3B 5KJ1A 5L6MB 5EE1A 2BKXA 3CZMA 1X92A 4S35A 4NCAA 3QX8A 4B46A 1QS0B 2WVAA 1ZN8A 5FRDA 2X0DA 4BC1A 1FFWA 1EWYA 2DC1A 3P97A 4LJ9A 2NTNA 4C76A 3JR3A 4B2YA 1I3CA 3G1TA 3KBOA 3IOYA 5GZ3A 4KO1S 3E1GA 1GRRA 3D3NA 2C9OA 3QF4B 1GP2A 2UZ3A 4LY0A 3QJYA 3RYHB 4PTYA 1D4AA 3ZXYA 1T8YA 2Q5QA 3GJ8A 5I45A 3L1VA 1EHCA 1A5BB 2O0KA 2P0EA 3OFNA 1ZIOA 2UZAA 3OX2A 4BKOA 2P30A 4CI9A 3PHGA 3UPUA 3VPAA 4GPEA 2CN1A 1FFYA 4LYEA 1VPTA 2RSLA 4J7UA 5F1KA 3Q72A 3TSOA 2QU7A 2BP7B 4U7HA 1LTQA 5F7JA 2JI4A 3QV1A 2EEZA 4MVJI 5AW8A 1PJTA 1IUPA 4IDFA 1EBUA 2O0HA 2IYRA 1OZ0A 4FQ7A 3ZEIA 3OH8A 1CQIB 1YIAA 4U2KA 3UOGA 1IG3A 1L7NA 2BBTA 2W2LA 5GZ1A 5SY4A 5HK8A 5I7WA 3M5CA 3PKIA 3C3WA 3JAWB 2CFOA 2DQYA 1NBEA 4WSOA 3USES 3RS0A 1LLUA 2WYWA 2XUPA 4LIPD 3FW1A 5E6UB 4B2LA 4O4LF 5CXSA 5DLEA 5H02A 2CCJA 2JIZD 5REQB 3B8EA 5F4ZA 2DKFA 5AHKA 2LCIA 4GKBA 3X44A 4P82A 3ZHBA 4Y6RA 1CRPA 3BSSA 2X22A 2ZWVA 4ZICA 5CFQA 5FFNA 4H1TA 3OQNA 1BDJA 4IH4A 3QLTA 3V46A 3KALA 4FFDA 2XNSA 2I2FA 2GK3A 2OOKA 4BLTA 4B17A 4JIGA 2GAAA 4QDUA 3KVNA 2QG9A 2YOFA 5IZCC 3BWEA 4RFLA 1B14A 3A1FA 3LY9A 5FV7A 4Y7DA 3D1VA 3CCCA 3O4RA 1RFLA 2B37A 4GEKA 9ABPA 2ZSBA 4AZ3A 3SZUA 5BN1A 5EUQB 1YTUA 2RMKA 5FUMA 1SVIA 3RT7A 5AVXA 1YBMA 4Q00A 2GXUA 2A1TR 2O8FB 4RDCA 4ZYTA 1SEVA 3OC0A 4PZLA 1K7CA 4UQOA 1Y34E 1Z38A 4PC2A 5IJ0A 4OHPA 5J23A 4JSTA 4LZOA 1ZIXA 3QYJA 3DBHA 4HKTA 1EE9A 1TOAA 3C43A 4OMFG 3S70A 3Q2IA 1VCMA 4EYQA 2P41A 5EPEA 4B3IA 4EVQA 1GNLA 2YIDA 2XEXA 1F3LA 1OLOA 1N2CB 1ZDMA 2PGAA 1CIJA 1QLJA 2WKPA 2Y1CA 3PS9A 3GIDA 4PR0A 1CUJA 2JKVA 3P0IA 1A9OA 2F8TA 3AB7A 2R00A 2I91A 3V7UA 2HSEA 5BR7A 3IOMA 1RW4A 3PF8A 3AF5A 4GI1A 4HC4A 2M6KA 4FK8A 4BUCA 1CR6A 4B81A 3Q3HA 1CEEA 5ECGC 4F12A 4G0OA 3IUNA 4R3UC 4HX5A 3WLKX 3AVUA 4PIPA 3IJRA 3T9DA 2HPZA 5AUOB 1UJ5A 2SNIE 1SGWA 1LI7A 4GDFA 3G0HA 5HUJA 5AH0A 4AMGA 1QU3A 3LKDA 2BFBB 4UULA 2OENG 3E22B 4J8PA 4JU9A 3L0SA 5TT0A 3RPEA 3SJBA 1LB1B 4CLHA 4AF6A 4AU1A 1OREA 4DLTA 2XF2A 3AVPA 3QP9A 3X3HA 3ZW8A 5KNDA 3GP8A 3ZGZA 1OHHA 4BN0A 4QFDA 3N6VA 4P98A 1FS4A 2J7PA 4DZZA 3SJCA 2ZRHA 4E12A 3NWBA 5HZKA 2RHRA 3LRTA 1QYRA 1X3LA 1SN7A 3KKZA 3UMSA 3EODA 3EH1A 1YZKA 2H65A 1RYBA 1DU4A 2XT0A 1DXHA 2Q3CA 4IUDS 3UVEA 1ILWA 3IL2A 2KPOA 2P9YA 3RUPA 2HA4A 4D44A 3BD6A 2V4MA 2OCDA 3A70A 4Q6WA 4AVYA 1JLMA 4LRTB 4RGVA 3OUTA 3ETDA 1CUGA 2AWOA 2YZGA 4IICA 3ZWKA 1CD5A 3RU3A 2PAFA 1Q74A 2E6UX 3SIRA 1GPYA 2UYOA 1XU9A 4HNSA 4DLXA 3QOFA 1J7KA 4W6QA 1F4LA 4E1AA 1LJ8A 2D1QA 1NBIA 3A36A 3OTHA 4XLTA 3QE2A 3SJAA 4EUNA 1EM6A 3KQUA 1JFTA 5L3VA 4NPHA 1YRBA 2V1UA 1VYUA 1XKLA 1KFJB 4QUGA 1OWLA 1QHSA 4R8MA 4DLPA 3MRXA 2RG7A 3ROXA 4MUEA 3UG7A 2RBKA 3U3JA 4ARZB 2DFVA 4HATA 2TECE 3UKOA 4BO6A 4FCTA 4NK4A 3SR0A 3I39X 5M2QA 3O03A 1ZU5A 5AK6A 4D8WA 4J2OA 4RANA 3PF9A 4X1IB 3GFPA 3BE5A 2WJIA 1O7JA 2GI4A 5FT9A 1YCFA 5EIXA 1WSWA 3KWMA 4PNHA 1G3UA 2CL0X 2ORYA 3MOGA 4V0LA 2OZPA 2FXVA 4RULA 3GLIE 2JK0A 1L5WA 2VBGA 1VE1A 2A1TS 4TQUS 5LSAA 1PQUA 1U0OC 2CNKA 4R9NA 4C0KA 1V7CA 4EYGA 3LO5A 3DTYA 5LQJA 4KSBA 3DOUA 1XZEA 3PNLA 4RD3A 2NO6A 3LVQE 4XVRA 4HAZA 5LWHA 1B73A 1P18A 2QMEA 3EW9A 3NXSA 5J4VA 4LFBB 3BL8A 2REOA 4R2MA 4DNOA 3KM0A 5F9MA 5CDSA 3RBAA 4G1FA 3EMVA 5M3BA 3V1KA 1XVAA 4FGJA 3VX3A 3WGNA 3G13A 3K3PA 3M81A 3K5IA 4JBIA 2BBSA 5A05A 1IQ0A 3RHZA 1YKSA 2VHXA 2Y0DA 3OT1B 4CDMA 1FZTA 2MCFA 2XDQA 4P4GA 2WOOA 5KSYA 2H5LA 3DZJA 1Y4AE 3R76A 4Q5IA 5KTYA 1Z4QA 3QE0A 4PICA 5ALHA 5HM6A 2HHJA 2LV8A 2YXBA 3MUFA 5A6SA 3LCMA 1Z0DA 1I80A 4PWYA 1XF9A 4GMKA 4O6VA 5E95A 3OQOA 3OT4A 2EVWX 1NVAA 2WJYA 5DWVA 2UV8A 3S2EA 1Y3CE 5JECA 3GUZA 4TS3A 1NI4A 3L7KA 1NURA 3QE3A 3W9BA 1T9AA 1V2HE 2ZPTX 3DOIA 2XKAA 1P2BA 3NM6B 3J81A 1FXWA 1NYRA 1S01A 3HL4A 4PEVA 4R1NA 3QX7A 1VPVA 4L0MA 5H80A 2Q99A 2IOYA 2X5NA 4FBLA 3M83A 4MDHA 4RDXA 3IVGA 4FFVA 4C03A 4MYTA 1GCGA 3REQA 1VLHA 1O87A 3OCUA 4IGFA 2PQ6A 3J7TA 3AP3A 4HO1X 1Q1EA 3N2GA 5L53A 1VPDA 3ZKWA 4MA5A 4ZI2A 1VECA 3IO5A 2B4TO 3L6EA 3IPRA 3L93A 4AP6A 4I9NA 2XYRA 3UWOA 2NVOA 3JASA 3WNBA 2J8ZA 3WSWA 4LI3X 5IDYA 1H1LB 4G5OA 2NP7A 3NTQA 1NU6A 4S2EA 1JZTA 3RRNA 4W8GA 1J00A 4ONEA 5CHYA 4CCYA 1R6AA 3I6YA 3ITKA 3RF6A 1IZ9A 3CLUD 3KVVA 2HHAA 2IEBA 1ZSNA 1NGSA 2QZJA 3WGYA 2AK3A 1K08A 2JJ8A 3EIFA 4D02A 4CM6A 4GOKA 2FX3A 3PQCA 4G2NA 4EB6B 1IHUA 2QPTA 1PR4A 1T5SA 1YJAA 4KGVA 3E5MA 4QX6A 4RWZA 4M1TA 4E88A 4YMVA 1U5BB 5FWXB 2HF7A 4YS6A 2HDNB 3PPIA 3LGAA 3REGA 2X1VA 1F8YA 3GRKA 5FNVB 4L8YA 1EB9A 2O2XA 3RIXA 3LK7A 4G6ZA 2EWWA 1JR4A 2X7JA 2XAUA 3Q6MA 1WU7A 4RGQA 4CYMA 2FWJA 1FE8A 1QVAA 4Q3KA 721PA 2X8LA 2V5AA 1B3RA 1JIVA 4PYLA 3R75A 3MJFA 4BNZA 3WWYA 3NTRA 3U6BA 1TU3A 1PWYE 1FJ2A 1PDWA 1V8ZA 3MJHA 1G63A 1HDOA 3MMPA 2H51A 1TVEA 3L1JA 3P9KA 4AIIA 2P79A 4UTRA 3PJDA 3LT4A 2R96A 2QRJA 5DSZA 4KZPA 2NIPA 4ZJUA 1Y4SA 1UEJA 1YHNA 4ZPJA 4YWJA 5L7YA 1XRMA 2FU5C 5BW8A 5HPYB 2P3QA 3B1ZA 3ZD8A 2OQRA 1YS6A 5JI3E 5JEDA 3P20A 4BVEA 1TF2A 4DJAA 5LC1A 1M6NA 1NPYA 4DC9A 3HCRA 2EDCA 1K3TA 1ZH6A 3KT6A 1R4ZA 4FFRA 4EW1A 4MLDA 3K9FC 3RNOA 1NE7A 1V5FA 2ZBFA 4M36A 4CEHA 5B64A 1KTVA 3LQYA 4BNDA 4R51A 1CK4A 3QF7A 2P2SA 1U5CA 2AN9A 4LHXA 1TB4A 2W7TA 3ILSA 1XKTA 3UMYA 1I3OA 1DBIA 5EJAA 1H1DA 5MF6A 1XI2A 1IM8A 1ZY2A 2C4WA 2DAPA 2H8GA 3QPVA 1AQUA 1NZDA 2HA6A 2W90A 3GUCA 4HT3B 5IAAA 2R4QA 4TXMA 3FDJA 3OLWA 1TADA 4LC1A 2XB2A 3GGJA 1SU7A 4FHZA 2J9FA 3Q9LA 3VQTA 2CC2A 4JYCA 1P4GA 3P19A 4FYHA 4YRBA 2LBPA 1U0HC 4MQFA 2YWEA 4W6ZA 3QY9A 5KQSA 2EFHB 2VQ3A 4P4NA 2YJZA 3EVCA 3PDUA 4BFCA 3UN1A 4HWSA 4L16A 4XM0A 1VJ1A 1PYOA 1OIXA 1XRRA 1KA9H 3WK5A 5B3LA 4NZZA 1HFJA 4IUYA 5AHRA 5F5NA 5C81A 3U4QA 3H3FA 4PRZA 4R7TA 3I76A 5KSZA 3H9CA 4ZP1A 3DPUA 4DMHA 3OI7A 1YE5A 3RWOA 1PFUA 4KFUA 4WI1A 1WD5A 4YRZA 1PJSA 4F5YA 1SVOA 2AJLI 1W5EA 1VB5A 4U2GA 2H1CA 1TKBA 2JFBA 3FPBA 1W581 3K9QO 2P0YA 3HCPA 1CQJB 5CBKA 4KAAA 3U9SA 3GZNB 2G63A 3KELA 2PO5A 3HM2A 1FNCA 3WKEA 4P31A 1XDGA 1Z8NA 2VNJA 1KRXA 1MNAA 2AZMA 3BWMA 3SE0A 4KWEA 1N2BA 1P81A 5JVDB 3EA0A 3UUWA 3VTFA 4ZCMA 4YHHB 5ALDA 3BHIA 1YR3A 2YWCA 4IJ5A 5K8VA 5KWEA 2FFAA 3F8SA 3WK9A 3KBBA 2IIBA 3ZY3A 2NG1A 4MIEA 2C1ZA 2EERA 1PZXA 1MJGM 4MVWA 1DAMA 2QJOA 2X4IA 4L75A 3CH7A 4YP1A 2YJTD 3K5PA 3QBDA 4KXQA 4BO1A 1QHXA 3AUUA 3INTA 3TTTA 3R77A 1EFAA 2DR3A 4BNWA 2UDPA 3CA8A 2ZIZA 1FRNA 1JUDA 3CR8A 3P8ZA 2O8VA 4HYYA 4P32A 3TOVA 3WFIA 4F7DA 4MDYA 1KRHA 3TM4A 4Z7OB 4KHZA 4GPD1 3O8DA 2D3TA 4M4SA 4TWBA 1QOZA 2O3SA 1OLUA 4JLMA 4EY5A 4JX8A 4LYHA 2ZI7A 1N6OA 3ETGA 2J5RA 3U4IA 3H5VA 4UNNA 1BCSA 2RG1A 3AP1A 3DT6A 3OQIA 1ZL0A 4KNVA 3C8ZA 5KYVA 4WMLA 1TO2E 3WLJA 1YNOA 4RFSB 3ZDEA 1RHRA 4JL6A 2F1RA 2WU8A 4FYIA 1PR0A 4XUGB 4N5IX 4BNMA 5LMCA 4KWIA 3RRYA 1N6NA 3G7NA 3VTZA 4RPLA 3VOAA 5ITWA 1FS6A 2J3IA 4DTCA 2PSFA 1SBCA 3UHFA 5EFZA 3HI4A 5I3ZA 3VA7A 4JAVC 2VP4A 1GNPA 1AK9A 3DJFA 2D1SA 1L5QA 1TCAA 3A3KA 1PZNA 4RTSA 4L6AA 3W8EA 1U2GC 2DR0A 3FTDA 2GN2A 2XBUA 1DCMA 1QVZA 4XYEA 1U2EA 4IVQA 1OA1A 2PGLA 2ES4A 4ND8A 1N92A 4NTZA 2Z8XA 1KDVA 4V24A 5F7ZA 5BWNA 1EM8A 1JH8A 1D1PA 1RPTA 1ZKMA 2ZCUA 4IW3B 1W2GA 3IA7A 1EX9A 1JQLB 2G0TA 4N7JA 2OFXA 3VPDA 1TUBB 3KQSA 1N6LA 1S2IA 1ZN9A 1MJ5A 3DNMA 3MA0A 3OCJA 4BO2A 1RZRA 3H2GA 4V0QA 2OE2A 2HWUA 2XMZA 1H1TA 5AOBA 1H05A 2FW0A 3PICA 3ZE8A 2RHGB 5FTKA 1B26A 2ST1A 2I6SA 3IAM1 4CEIA 5FPSA 2I78A 1TVCA 3RFCA 5JRZA 1WDWB 2ZE7A 2GRAA 4FZRA 1VJ5A 4DLKA 3O8NA 2E82A 1L3BA 2M98A 1I1HA 1XEXA 5SZHB 5EHGA 1Z6PA 4E09A 3A4MA 1CNFA 4L9SA 4F6RB 5IWAB 3F4BA 2B1JA 4FCCA 3C45A 4PYRA 4BVLA 1Q1BA 5BSMA 2L2QA 3PRKE 3HN6A 1QXSA 1KVSA 1RCFA 2SCUB 3CG0A 4AXBA 1MU0A 1E1NA 1U0TA 5LA6F 1YI8A 2XOKD 4FKZA 3EGXA 4FSXA 2O1WA 3DKPA 1F12A 3OZDA 5KYWA 5BXYA 2ZRGA 1E7RA 4MUMA 5J4HA 4QDKA 1YB6A 4RIFA 7YASA 1L9KA 4D99A 4EGAA 5GWXA 3B60A 5ESWA 3I30X 3DBLB 4RKYA 1YRYE 3FRIA 4DA9A 3TR0A 5E9JA 1ZA1A 2YIJA 4IRUB 4LRYA 1ZNQO 2QSUA 2HYIC 2JGMA 1VG8A 1JDSA 4AWAA 2XQKA 3H3JA 2J9YB 4XWAA 4UD2A 8OHMA 1H9BA 3T6KA 3N70A 2HC9A 2Y1WA 4QO7A 4JYMA 1Q1NA 2QW0X 1ZINA 3LUPA 3GLUA 3RS4A 1K92A 1QTQA 1LU9A 3LQQA 4PO8A 3GFSA 1SC4A 2QK4A 1EJBA 1US8B 1WKCA 1UJCA 4YPVA 4EDFA 1N78A 4JELA 5E4JA 4OFWA 4CETA 4Z4QA 4NKRA 2DERA 1WUKS 3QG5A 5FBZA 1I2ZA 1VE5A 2P9TA 3LQ2A 4EITA 1B8VA 2VUUA 3C5WP 4HEA1 2CLLB 4L57A 4G5HA 1I13A 3ABQB 2DM6A 4GZ6A 5F51A 4A8TA 3OU7A 3ISJA 1J22A 3JX9A 5IAEA 5M29A 1Q19A 2WM8A 4U5QA 3U4HA 1NRWA 1M6WA 3BJZA 3C15C 4WUTA 1TQDA 2ECQA 4BNVA 4V03A 4YP6A 3WHIA 2JASA 5IKMA 4MYDA 2IEDA 4X24A 4JA0A 2EFCB 1E20A 1F8FA 2GNAA 3EC7A 4GOLD 3V80A 2GEFA 3EZFA 3VHRA 3W1EA 3GJSA 1MDBA 4FVTA 3KTAB 4QULA 3D4BA 4REOA 5IW8A 3FCYA 5FOUA 1VSQA 1MQ8B 4C4SA 3TEFA 3K4PA 5K6AA 3TZHA 4N39A 2B2CA 2WYHA 4WBNA 1P1KA 2ATEA 5FADA 4RCZA 3TUIC 2CXOA 1NMSA 4XLLA 1PTJC 3O8QA 1YDWA 1UAGA 3IT1A 1SD1A 2G88A 1JV2B 3JW8A 3R3HA 4FYXA 5E3IA 3E8SA 4HUQB 1ND6A 2AMFA 4BO0A 5HQ3B 1R8QA 2JHAA 2ZJOA 2XB4A 1QH0A 4L50A 3TSCA 1RCUA 4PZ0A 1ZM2A 2P1RA 3VC1A 1F8XA 3WLRA 3T7DA 3UJ8A 4RQTA 1V25A 4YLGA 1JLKA 3BCSA 1VKJA 4AX8A 5JZOA 3OLZA 1X14A 2XE6A 1QX3A 2FLVA 2QVCA 2WWYA 3TOXA 4M0DA 5JHHB 1WXWA 1O94A 4PU0A 3TW4A 2C5EA 1IOZA 3DUFB 4C7JA 5KSOA 2BMJA 4DIKA 3K2IA 4C0XA 2CLCX 1PX2A 2PGXA 1WEHA 1V1MB 1Z3IX 2RDMA 2WSIA 3OE5A 4FGZA 4WZAB 4DBLE 4DJDC 3V1LA 5KC8A 3R9XA 1CZNA 2EARA 3KIPA 1L5OA 4TTVA 3W7AA 2VP3A 4KGXA 4WOKA 2NUBA 1L5MA 2BTQA 1LTKA 3E4DA 3TLJA 4GZLA 3VU0A 2YMQA 2JA1A 2HRQA 4L15A 4YMGA 4JB8A 1YMVA 3R6DA 5DM70 1IPHA 3DHEA 3WIBA 2CXRA 1CW2B 2BSXA 1C1DB 1R12A 1VBFA 3ND5A 4UFOA 1Q83A 1R9NA 5D84A 3U7JA 3E1SA 5EHZA 1CERA 1SIBE 1XCOA 2HI0A 2GB4A 3GYGA 4WVLA 3UMRA 1KEEA 4X1YA 3EG5A 4NZOA 2QBYB 4FEYA 4LA4A 3TRHA 4D6YA 1AGPA 1S9DA 1Z82A 4FE7A 1A9XA 2QQ0A 1TPZA 2OFPA 3PPWA 4W5QA 1IM2A 4G8JA 2J32A 1NMXA 2V9PA 1E1CA 2VJMA 3Q0TA 2K7ZA 2FZWA 2YS7A 4OVKA 5JNTA 3C3BA 1M34A 1SCBA 3IQFA 1XJQA 2VJYA 3MLAA 3HWX1 4P92A 1R4NA 2YV4A 2QAGA 5T67A 3CZCA 2F1IA 4PC7A 3DL2A 5G3ZA 3GMTA 2G0AA 1Q7RA 1NV8A 2AKYA 1P6QA 2WSBA 1L1FA 2CHQA 4JH0A 1KJNA 1WQ1R 1YFZA 3DPIA 4S1VA 4LDRA 4AULA 4RVFA 4EY4A 3NNDA 5ED0A 4G24A 4JY7A 4UM5A 4G0VA 4LJ7A 3EBOA 1ZD1A 3DDOA 2CNDA 4FFLA 4BDSA 4DR2B 5TS2A 3W4IA 1U65A 3E8XA 3NBXX 2PNJA 3W6OA 2I67A 3M5WA 1ZOPA 1R0SA 2ZCVA 2W0SA 4R01A 1B8NA 2FUKA 3RTBA 2KQUA 4I1YA 5EJIA 2BFWA 3IRVA 4MWSA 5AVKA 3TQSA 1DLJA 1JSLA 3QUSA 2BFDA 3N2LA 3GX1A 4ALMA 4F3KA 1C41A 1HE4A 1M1YB 2VOEA 1ZN2A 3R5HA 3SM9A 5JHGB 4C07A 2PJZA 2VPWA 3HSKA 4YCJA 2YYYA 2PHZA 4J1TC 2EZTA 1O95A 4ZZ3A 4JKOA 5EN4A 1SZPA 4AX4A 1LPOA 1COZA 1AKNA 1Z7YA 2LD4A 3FUVA 1W8DA 4P3KA 2VRNA 3F6BX 3AI7A 2VJOA 3QXSA 1N0VC 4FIDA 4GMDA 4UBOA 1A98A 3HYTA 1K97A 1Y5LA 3D6FA 3GNSA 4B5KA 3FXAA 1GYRA 3HDJA 1PO7A 3GVPA 4QGFA 1MEOA 3WQSB 1QCDA 2H59A 3L7CA 5DWQA 3NHZA 1Z7BA 2W2XA 4PZPA 4RTLA 1AX9A 1G5QA 4NBRA 1MABB 3R8XA 5DNYB 1V9LA 4WCDA 2ZB3A 3EG9A 3U0VA 1QO7A 1TZMA 3DLPX 4WCFA 2BGGA 1U8XX 3F7MA 4R16A 3F5QA 4YMWA 3S40A 1XQVA 4HVCA 4M0KA 1QR2A 2JEZA 1MO2A 3HBLA 3PPXA 3TXXA 4JHXA 1KHHA 1UKBA 4X41A 2IYLD 2JBAB 1U2ZA 3KEGA 3P32A 1REQA 4YLYA 3H9EO 3SOPA 4UCFA 4RXUA 4XTCS 2QRQA 2GLXA 3AR2A 1AXEA 2F17A 2YWGA 3DYBA 1J33A 3MS2A 4KQXA 5EGSA 3HLYA 3M2PA 3OIUA 5CB8A 2WIKA 5JDIC 1E3SA 1QHHB 4DZTA 3D2AA 3CVXA 4CM4A 4E5UA 1U5AA 5F9HA 2Y71A 4IIXA 2QQEA 1PR9A 2CVOA 2D13A 1J07A 1J09A 3AJEA 1F0YA 3WV4A 4D0NA 1HETA 3E2IA 4F21A 1P4RA 3GU3A 1A7KA 5EYPB 4PC1A 1ABEA 5FF9A 3A2LA 2PRSA 5J2TF 4YRGA 1IN1A 4K6GA 5I48A 4BVBA 1NFFA 4TT3D 1XCMA 2VXOA 1LV8A 2YNMA 1DOZA 3QX9A 4KE8A 4OM7A 4UHEA 1C0EA 4E5SA 3RYIA 3ZBPA 1NX9A 1RR6A 3CURA 1ZH4A 5CLLA 5GPBA 4N8EA 4D3YA 2LCFA 1T6BY 3BWXA 5FYDA 3WWPA 3WXMA 4II7A 1RNLA 1YOBA 3H1EA 3QYAA 4Q3LA 4PX3A 4ER5A 4PN3A 3NCHA 5AUNB 5IM4A 1D0IA 1N2XA 3U7FB 2FQYA 3FAZA 3G0OA 2GPSA 5CLFA 4HNAA 1AUQA 3OOSA 2J48A 3BEOA 4LX0A 5TQJA 3PENA 1DDOA 3I09A 3TD2A 3MCTA 2JJ1D 4IFIA 3JQ8A 4R8SA 1JHXA 3O2JA 2O5EA 3I1FA 4R71A 5B2EA 5CA1F 3GZ4A 2DOKA 4ZEWA 3BHNA 2GYVA 3R3VA 4F8YA 1GUFA 4I5FA 2ZRMA 4Y2QA 1XPRA 1D6NA 1KI4A 1HEYA 4UDNA 4CXMA 1L7QA 1FLNA 2R8PA 3NTLA 2WKWA 3NOVA 5E6SA 2OHHA 2QD2A 1KJYA 2F1KA 3QPWA 2VZ8A 4IMIB 4LVUA 4BBZA 5G4KA 4TWRA 2DUMA 2Z5LA 1ULUA 1IBKB 3WRXC 1FNNA 3G7SA 2V9ZA 1VSVA 4IFBA 3GJQA 4HDAA 4EPWA 2PTHA 2EAUA 3EFHA 4DSTA 3SSAA 4GQAA 3RBXA 2GPAA 2RB5A 4AUKA 1NXVA 3NDJA 3QVKA 3DXZA 2FI1A 3OZUA 3AETB 3C87A 4HRAA 1HO3A 1YIOA 4PQFA 2JG3A 2Q21A 4X1KA 3H2JA 2X4GA 5HJ5A 3ZXXA 1OXVA 3CC8A 3L6UA 2XVAA 3M7IA 3V3TA 3SVLA 1JIQA 1S89A 2J87A 3OJWA 3WIDA 3V4LA 5JQGA 3L2OB 5TQ0A 3UJ7A 1M8FA 4G8BA 4JASB 4RABA 1ODLA 2J6HA 4MGIR 3TW6A 1U4OA 1YMUA 3MUNA 1HSZA 1J0CA 3Q85A 5CNJA 4H7FA 5FO0A 2G0NA 5G53C 2P27A 3N07A 4RPCA 1DIHA 4AECA 1MP0A 2BV3A 5HS6A 1P5RA 4UQLA 2G36A 1CS0A 4MUBA 3ZH9B 3LWNA 3EVGA 3NBAA 5CXUA 1U6IA 1VP3A 1KR2A 4LE0A 2MWMA 2GARA 1N0UA 1DC7A 1U31A 1KI2A 1UUFA 1D1SA 4Y2RA 4O4HA 4FX5A 5ICMA 4E03A 3DV0A 4ED9A 3VO9A 4TM7A 2GCOB 1QHNA 4A1FA 3O47A 4FX2A 1OX5A 3BZBA 4AQDA 3RAPR 3WWCA 4YR7A 1RWKA 2Y67A 1N2EA 3C4JA 3GLGE 1QVRA 2Y3IA 2JAHA 1COWA 3R09A 1CUZA 3G59A 5KNBA 4GMHA 3DOJA 2H2DA 2DJIA 1UM9A 2GN4A 3ZV7A 2ODBA 3JYLA 4D3FA 2DBVO 2EKBA 2ERYA 1M2VB 4LHYA 4NFHA 1II8B 1QB7A 2IHVA 2A4MA 1NW5A 2F90A 3AHEA 3IMFA 3NHRA 4MRVA 1PR6A 1HMYA 4MUKA 2O0LA 3U5TA 3WE7A 4INAA 3C1TA 4Q0MA 1VKZA 1XRLA 5EIOA 1UADA 4BQPA 1QP8A 4HQOA 4JMPA 2MSKA 1P74A 4X92A 2C54A 3FYCA 2B0JA 4K86A 5IPFA 3TFOA 3T94A 3PJRA 4O0LA 2C7BA 1KY4A 2C2MA 3C1OA 2ILVA 3SDSA 5I01A 4V3CA 2V97A 1PGOA 4J0HA 1R6BX 2B61A 2PX5A 1NASA 2XCIA 2YRXA 4UBNA 1QIDA 1Y5IA 4AG3A 3IUSA 1MMFB 2N75A 1P6XA 2RHOA 2QZ9A 2YHIA 4LXQA 4JS0A 5BVHB 4KYVA 4DLVA 1U8EA 3I28A 5CCXA 4N0MA 3TL6A 1ZK3A 2RI0A 4NYMQ 3MPOA 3WRYC 5AESA 4FJ0A 2O8DB 1P3DA 4K0RA 2KSQA 1E8NA 4FOPA 2C3OA 1PD0A 3QKSB 3AESA 4GHWA 1XRPA 4YCDA 5E0OA 2H54A 1YACA 5DRYA 5JMOA 2BMEA 2CMKA 2Y8EA 5DN6D 2GPJA 1YR8A 3OLQA 1TJYA 1G4UR 3I3SR 2UZ4A 2ZAMA 3S44A 2AFIB 2Y2UA 4G4JA 1DBWA 1YAJA 2ZULA 3QVGB 5EWJB 5FAXA 3WL7A 1U63A 2HD4A 4EF4A 1PU2A 2PBZA 2JI9A 2WFAA 3F5DA 4P5PA 3MYRA 1MO5A 1N3IA 1YB7A 1TFUA 3HGTA 1OFUX 1V8DA 5EC8A 4NICA 1RJWA 2GAOA 4OQEA 5AVSA 5HIAA 2EIXA 2O8EB 1ETUA 3RIMA 2O8CB 2P0AA 1WCXA 2FMIA 5K6RA 4HH4A 4PZEA 5TPZD 4ACAA 2HIMA 3KEFA 4KN5A 4EM6A 2QYOA 1HORA 3UHJA 2VNIA 1AXRA 1P9LA 1X1EA 4QAQA 1T5LA 4KPEC 4MIOA 4V0KA 1SOWA 4DIDA 1FUUA 4JK3A 4EA9A 3MIZA 1V5WA 1JHZA 3VPHA 3X0DA 1S2OA 3QFSA 3ZY2A 4CQLA 5A5GA 3CNNA 2XUHA 1JU9A 4FEEA 5EEGA 1BS2A 2NZXA 1GLGA 2W22A 3AEQB 1SOAA 1KZ6A 1B6TA 1IXZA 3GJ5A 4ILEA 5EWMA 5H7XA 5JE8A 4F5DA 4FWTA 4YHBA 5B12A 4LJLA 1XTSA 3DZIA 3JQ9A 1EVZA 3O1IC 4M9UA 1EWKA 4I46A 3MJDA 3CH5A 2IY8A 3WDLA 3H7AA 1IOVA 1RQ7A 3MBIA 1CJCA 2I65A 4EY7A 4CMIA 4DIEA 2O06A 4ZT6A 3DOFA 1HE8B 4CE6A 4OL9A 2Z5VA 1JPVA 1MGPA 4IHJF 4B3HA 1TK3A 4RELA 1G5IA 4AJ4A 4NENA 4YT4A 4PONA 1NF9A 3JQAB 5E8JA 3GN2A 6PFKA 4OTZA 2BGTA 2P3OA 3F71A 3K0CA 3MWGA 3I12A 5ALOA 1CT9A 3LPCA 3VDQA 5CYPA 4I4IA 5EXTA 1PHPA 5I6DA 1U0LA 3HPRA 1VE7A 4PFKA 4M6WA 5DCYA 4ZI7A 1HUQA 1U4NA 1KY3A 1MOQA 2WIBA 4GLJA 5DFAA 2PSEA 2K5UA 3QBTA 4RIHA 4OSEA 3CSDA 1QJ4A 1LRLA 4R69A 2I3DA 3EGDA 3KQWA 5JH7B 1QQTA 1L4YA 1QH9A 2FZLA 3ONNA 1R4MA 1X42A 5A4MS 1U2RA 4IIJA 5IM5A 2VPZA 2HEGA 1UZNA 4JGIA 4PGHA 3SLRA 1QK5A 3OM1A 1VLLA 2WOJA 4QHSA 3HSSA 3OURA 2XCTB 3FGNA 2O4UX 1G4HA 3V2GA 2WU1A 2WINI 2IYSA 2ILTA 2ZK7A 4JP1A 3FOAA 4POOA 5IAOA 3FTEA 2XKJE 3BF7A 3BSWA 3T4EA 1YZTA 3GOQA 1EGAA 2R1UA 2RHTA 3QWFA 1IXYA 1EINA 3G85A 1ZL2A 2YWBA 2PLWA 4UARA 1ZNWA 2FZKA 3T9AA 5KTNA 1M75A 3F2IA 2PMBA 2H2GA 3F9CA 3TKLA 3TCXB 2R86A 1JP7A 3GRUA 3EDCA 4HLNA 2F00A 1ID8A 1EX1A 4LBYA 3FBGA 2IUTA 5BSEA 4NQZA 3PL5A 4G4IA 4HGZA 3VKWA 4JYBA 4QUDA 4ZT4A 2QAIA 2QX8A 2W2KB 3QX3A 1EK5A 4H3KB 4KG7A 2IZ0A 3IRUA 4EA6A 2YFQA 2FDXA 4G1EB 1VLZA 3ES9A 5IKPA 1O5OA 2CNNA 1OI7A 3CX8A 2NVBA 2YMLA 3O38A 3UJCA 2C8VA 3DLAA 2Q3FA 3O93A 4DCVA 4X20B 5COAA 1XO1A 2EKPA 3OAAA 4JT2A 1SCIA 3MGKA 4EHAA 2CE2X 2HV9A 2BUBA 3DAYA 1C14A 2VHJA 3E81A 2YXLA 4NJEA 2FOIA 2NYUA 2FZGA 1WF6A 1WZEA 4DYVA 3HRKA 1KJZA 4G1UC 3KOZA 4TTJA 1CQPA 1ZNZA 4ZCPA 3VR6A 4WTOA 4ZI5A 3TLGA 2ZUUA 2VLBA 4BFZA 5EZYF 4MLPA 5FB3A 1P3Y1 5AVYA 4QBHA 4M7RA 1VHLA 1WAMA 5B7NA 1EG7A 1T3LA 3I2JA 1K8ZB 3MS4A 5E2IA 4C6TB 4YV1A 4QJ3A 2ZVDA 4L2IB 3RSCA 3WFZA 2F8MA 1YBVA 4Z0TA 4FWBA 4LPKA 3D59A 5DF1A 1B42A 2FX2A 2CVZA 2I2AA 4P33A 3IUMA 1MZVA 4S0XA 1WO8A 4QM7A 1DX9A 2ZI6A 4HNTA 1KEPA 4IGIA 3NO4A 1BH6A 2NO1A 4LNUB 4JUBA 4TM8A 4CM8A 1PR1A 4ZZ1A 3F98A 5MN5A 4TRJA 2NZJA 2PWBA 3RGWS 1I01A 4PV7A 2I2BA 4L73A 1PIWA 3DYIA 3QFHA 4RD6A 1A27A 1HDGO 2W6ZA 2ACEA 4J75A 3FCAA 4KGDA 4M89A 1CJMA 4RV5A 3CLTD 2G40A 2DH6A 1NR1A 4ZAWA 3O8BA 4FUTA 3OJ0A 2FPUA 3NI2A 3LWDA 4WLVA 3G2KA 3FOZA 1XZBA 5J9FA 3ZBUA 2EBWA 1OWOA 1JPUA 4UHBA 5KUTA 4GG1A 3F5SA 4LDNA 5AI5A 1TYZA 2FRVA 1ST2A 2RHCA 3HRHA 1VSBA 1AO0A 1WA5A 1XDUA 1GQYA 3LUJA 4EP1A 3IAS6 5J4KA 1X8XA 4YQFA 1X7WB 1R6UA 3N0TA 2KE5A 1XRSB 2ZIXA 4N5DA 4BATA 2CLMB 3DPSA 3SFZA 3URKA 1JA0A 3AHGA 4PRYA 4BMDA 3JCZA 4RHXA 2NQTA 2C5BA 4O1HA 4QQ8A 2AZXA 1ACJA 4BN5A 2WB2A 3RUAA 4FOOA 2O57A 1MHTA 3IT0A 5E1DA 1UPXA 2I2DA 5TPWB 3TZBA 3ILVA 2PPVA 4FC6A 4HTAA 4INJA 5FEMA 3UIEA 1SZCA 2VSNA 4ND1A 4OP3A 4IQ0A 1QFXA 4E2ZA 1XIVA 1NSYA 4KEAA 1OXSC 3NEYA 3ONWA 4I55F 4OBBA 3G9ZA 2VTDA 2EG9A 2YZ2A 5JC8A 2PX2A 1N9GA 1ZEMA 2PSSA 1TVKB 3FPSA 2RHHA 4Q4AA 2QOEA 4TUYF 4QSHA 5L95A 4MX8A 1ZMBA 2WD7A 2F43A 1OTHA 2CD7A 5JOQA 2E4ZA 4GP9A 1ESNA 1SVUA 3DOHA 1KDRA 2JH3A 2JRLA 3ER6A 3EXIB 3ZHVA 3JD4A 5U9CA 2E18A 3MZ0A 1LK5A 3BFPA 1CFJA 3A3OA 1E1QD 3O0TA 2XQVA 2V96A 1SKQA 1QGUA 4GGMX 4NBTA 1SULA 4Q3BA 4AM8A 1NV9A 4TZ6A 3AC0A 3JRWA 3FNBA 3D0QA 3DSRA 2V5UA 4BNYA 1EFRD 2PKQP 1HQYE 1EUQA 1Y9ZA 3L9XA 5CT5A 1DXOA 2JFHA 2E85A 4K05A 4BEJA 1FIUA 4EEKA 4YJFA 3H5WA 5EMMA 4ZJZA 4U6QA 2ZJ1A 1P9WA 3G17A 3TOZA 1OR8A 1WPXA 4N5NA 2FMTA 2Z56A 5IZCA 5JWOA 2B5VA 4DN6A 4Q1DA 1E62A 1RIIA 2GN8A 5KYXB 2EP7A 2GFIA 1OI3A 4JI7B 1Z5VA 2AF3C 2J7KA 1LZKA 2RHWA 3H4TA 3HO6A 4XPZA 4C0JA 4AZ0A 2NNLD 1XP5A 2BKAA 4KQIA 2C20A 2BDUA 5MFZA 3L5OA 3ZWVA 4WEOA 4DA0A 2YVUA 2P6NA 4FTWA 1QYDA 1GZDA 2ZQYA 2TS1A 1T6ZA 1AA9A 4IH1A 4RHFA 5D6NA 1SCUB 2IZZA 1ZIDA 1SXHA 2FJ0A 4MWOA 1FDRA 3OZGA 4J1SA 2XD9A 1N25A 1QQBA 4CF6A 5JFOA 1YVEI 1JR3A 4M22A 2DR2A 3E05A 2XRMA 4J0CA 5M5BA 1PV1A 3DQZA 3W77A 3RIEA 1GGHA 3RUDA 3CRNA 1JHPA 1AZTA 3NBFA 1THMA 2JGJA 3A3PA 4K9NA 5JCJD 3C6MA 2HA2A 2YOHA 3MT9A 4I1UA 1B6GA 1X8LA 2NU8A 2FPXA 3SEFA 1LJLA 1SVMA 1NONA 4PZUA 1EFPB 4LV8B 5FBWB 4ZVNA 3FIJA 5EG5A 3T1NA 4CG2A 1JEQA 4Y1RB 5J5CA 4ETNA 1DAKA 3DF9A 2O07A 2OZLB 1YRHA 2XMQA 3IR5A 1QH1A 3NHUA 3O92A 4KH0A 5TEWA 3ZNQA 3VSEA 3IP5A 1X19A 1ZM3A 2GVDC 4H77A 3WO1A 3ZVLA 3BBLA 5E9QA 3H8WA 3ZZ0A 3SQXA 3QW2A 1BWPA 3UFXA 1VRWA 2N1MA 3HDYA 4M1KA 4KVZA 4RSRA 2FW9A 5LM3A 2WZQA 4IS2A 2XYGA 3ZOZA 1W2WB 1WPQA 2ZUSA 3SD7A 5IRCD 3DWIA 4IDPA 1O6BA 1N5IA 4DYDA 3AL2A 2OCKA 3D3WB 4JODA 4WE3A 2G6BA 4DCCA 5AI8A 4BE4A 3ZWYA 3GP5A 4MR7A 1GL7A 3S1AA 4L8GA 1KOLA 2SKDA 3JVIA 2W9XA 3G2LA 4RA6A 2X0FA 4KXFB 4DLZA 3WA6A 1L7BA 5IEJA 3OLCX 4NCHA 1QG0A 4EKYA 3PV0A 1GR1A 4Z54A 1YV9A 2F8LA 2JLRA 3CU5A 5JG7A 1T8UA 4W4TA 3ZLUA 4MRMA 5FQNA 2C2ZA 2DQZA 2JEYA 2BF7A 3NPMA 3CLUC 3D0KA 3H5TA 5CVJA 3N2NA 3V8VA 4LF6B 2WIGA 4F7WA 4GW3A 4AY6A 3H9UA 4YT2A 2XQGA 4YRIA 2I6QA 1MNQA 5KDDA 1GZ5A 4DB4A 1WZ2A 1C7FA 5F35A 1N5OX 3VH3A 2QTMA 1E9EA 2HNKA 3R0ZA 2BEUB 3GPIA 2ZYWX 221PA 4U1RA 1O9HA 4YAEA 4RLQA 4YJDA 3ZDQA 4ENQA 3ZVRA 1AV6A 1YRLA 4DG9A 2FFHA 4YALA 4DNQA 4ZYWA 3D1JA 2Q5JA 4D9IA 3GB9A 3FFWA 3WFJA 5K0CA 4JV5B 1S2DA 2CBXA 2O23A 5FO1A 3DTVA 4DWJA 1ZQ1A 3EC2A 5L40A 3ELBA 1N5MA 1KH3A 3F0TA 3D81A 1W9HA 4JLVA 1LW6E 2QTRA 1WTAA 2AN5A 1JHMA 2VH5R 4KN8A 1MRNA 5LVAA 1K8XB 3QHAA 2VHEA 3ROFA 1G41A 4PC3A 3R6GA 2I2WA 1TCVA 3PI6A 3RC2A 2IVFA 2ISQA 4GI7A 1TM5E 3CIFA 3P0JA 4NBVA 5LYYA 1GDDA 1KBZA 2CNWA 2HSZA 3K73O 1QH8B 2FF7A 2WHXA 2ZT7A 2HQSA 5CLJA 3L8DA 4M1YA 1UJNA 5FYQA 5IAGA 4DMGA 1DKQA 1T1GA 2E4VA 3FYHA 3EXEB 1ATIA 1PFYA 1NBOA 4A0FA 3HJCA 3L0OA 1XVIA 3IJPA 3IV9A 1WF3A 1LKZA 5SY6A 3QIVA 5CGZA 5FPQA 3TBHA 3LOQA 4IZ6A 3ZCTA 3PYLA 1ARZA 4XKJA 3UQZA 3MD0A 4MAFA 1B0PA 1QE5A 5H3HA 3VJRA 3UJPA 3CVWA 1NJ6A 2Z9DA 1E96A 2VO1A 2ZKLA 1PJRA 1W0CA 3JZIA 1K3UB 1AZLA 4ZT3A 3T5PA 1XG5A 2XE4A 2OQ2A 1FDTA 1JAIA 5BNFA 4N5LA 3TG2A 1LS1A 5HGJA 3TLXA 4E5MA 1YZYA 3DO8A 1XJ0A 1ZGJA 1JXQA 2J3EA 4OQYA 4IJQA 4NX2A 4YJ3F 4IIDA 5E9AA 3MFQA 1WMDA 3PXDA 1Q17A 2HXSA 3FAKA 3TTVA 2D0DA 4BWFB 2Q4TA 2CDAA 3QITA 4DIOA 4J2TA 4DM7A 1KSGA 2IZOA 3GQBA 4PF1A 1X38A 3FGOA 4ZGBA 1J5EB 4YCNA 1EHIA 2V3WA 1WSDA 2C57A 4NBKA 4P54A 1UBLS 4AI6A 1X7DA 4IJKA 2CSXA 3ICOA 1DRVA 3R6LA 1T1JA 2YUTA 3E7WA 3Q87B 4JLKA 2IPLA 2R25B 3LCCA 3KOWA 1HLFA 1OJLA 2RONA 4OEHA 3T5BA 9ATCA 4OJYA 4GGOA 2CDRA 4DVGA 4L22A 4H9GA 1K0UA 1NQOA 2Q41A 3KJIA 3R3WA 5IABA 3FMIA 2PUBA 3R0XA 1HM5A 3DCNA 4QUHA 5KVVA 4BBAA 3N8IA 4Z53A 3AI2A 5H0IA 5CA1B 5K03A 1KTIA 1SXIA 1IUNA 2H2IA 1OBVA 2KWIA 1NDUA 1WHSB 2AOTA 1G21A 3I8OA 4Q7LA 4QT0A 5CD1A 3WLHA 1W87A 1J9EA 4DREA 1N5JA 4ERNA 1YA8A 2JCVA 3DMRA 5ALZA 4M8KA 4MPRA 2C4TA 1Q0HA 2KJQA 4QYTA 5K7SA 3X1ZA 1KI9A 2YCBA 1BHJA 3UC5A 3H75A 3M89A 3R6TA 1G1MA 1JDTA 2VWHA 4YYEA 4C87A 3O5AA 5IXYA 4XWKA 2CCGA 2ZBEA 3MGBA 2FQ1A 5CB6A 1R37A 5FD8A 3FKSD 3UUGA 5CW2A 1IQRA 1CUHA 4E31A 4WH0A 4ZRDA 2FPPA 3JSXA 2B5OA 2E3JA 2YZ7A 3LBFA 5KI6A 1ZHOA 2NUPA 4RL6A 4BEVA 1TYBE 4YJ2F 2EJWA 4HVLA 4IF6A 4TWAA 1APBA 5EGNA 1U2QA 2RH4A 4ZDJA 4UU1A 3F47A 5F98A 1QORA 3UICA 1UAYA 2CCKA 5FWYB 3VR4D 1JBEA 1GG2A 4HRXA 5FPYA 1TYEB 2H5EA 2ZUCA 3CEMA 4HLDA 4KLCA 5K0JA 5E3JA 2VP9A 2PUJA 1GTZA 1HYGA 4CLDA 1U28C 3VR2A 1JYEA 1XCJA 3OA2A 1LRJA 1E3QA 4F4JA 1NUQA 3VSAA 4C21A 1J9GA 3E2MA 2IV3A 4A1OA 4LF5B 4CODB 3OZFA 4HWGA 4B76A 3G9QA 1KAEA 3GLSA 1ES9A 1JQKA 1U3UA 4QARA 2RAUA 2OKCA 3OEHA 4Q34A 1SXJD 1JECA 1SJ9A 2IUFA 2N1BA 4EA7A 2IYUA 3D6JA 3G0BA 9LDTA 4DQXA 1P1IA 2AFHB 2F3QA 1VHJA 4WLNA 2GR9A 4Y0NA 1MFPA 2GK7A 3BRQA 3CCBA 3I37X 4E14A 4KR2A 3KL2A 3ZDRA 3LY5A 4KX3A 5E1BA 3RUEA 2BR5A 4UEKA 2DFLA 1BS1A 2PT7A 2WR8A 3DW3X 3TQRA 1D6SA 1I3LA 1Y3AA 3E9DA 1B4DA 1LCIA 2C3MA 3PNPA 1PJLA 3CUTA 4I8DA 2X0RA 2ZIAA 4MW5A 4E5YA 1EA5A 2ONYA 1W4LA 4XD7D 1EKXA 4I66A 4X7RA 3ENVA 3UEOA 2DFTA 3H5IA 4BRZA 1IXSB 4LK2A 1YS7A 4PFQA 3JTMA 3M6FA 4NARA 4KI7A 1KETA 3QNMA 1NOJA 2A1UA 2VT2A 3GJZA 2G5TA 5IYZB 1H2WA 1FTGA 1O5TA 2Z3WA 2EKZA 3FTNA 2H8KA 2CMGA 5BWCA 1IULA 1E6WA 2A9FA 3LY8A 1F4PA 4NP6A 2CKDA 3H5OA 5AR1A 3ZEAA 5CPBA 4B34A 2YBDA 4FLFA 4W1QA 1YE3A 2PTGA 4RNCA 2ATXA 1N5RA 2HSDA 4TSFA 5BV1A 1NZFA 1UPAA 3JWGA 3LUCA 1JHOA 2J0EA 2REBA 3MRSA 3AQIA 3OCYA 3OPNA 4PLTA 3WGMA 5L9AA 2XNJA 1RVV1 1T1SA 1BHSA 2A58A 3F67A 4N6OA 1VE9A 4KSYA 1ZW6A 3WGQA 1C7IA 4EI8A 2PMDA 2AKAB 2P8SA 5CNKA 4N41A 2FFQA 4G81A 4H16A 4ZOQI 2JH9A 3FKQA 1Q2XA 2C2YA 3EPRA 4M1MA 2DTDA 3R7BA 2HCRA 1GAWA 5LQDA 4ASUD 3PDIB 1MO6A 1N2JA 4OFBA 3SLKA 3ZUPA 4C6RA 2XZDA 1NLUA 1MX1A 3QU2A 2XUDA 2HRRA 4C2UA 1H5NA 4I4NA 1LD3A 3MAGA 1NQTA 5ULLA 2P2CA 2ZS8A 2V6IA 3A9WA 3GJ7A 3IQGX 4O8ZA 4X0EA 1Y9DA 5B7PA 1MJHA 4Q9IA 1A8UA 1GKKA 3B6IA 4ZU1X 2WNSA 4U2CA 5EERA 1W93A 3U44B 1M7HA 2WT9A 4JB0A 4MI3A 5CYFA 3SIPA 4RF3A 3CB4A 2IHZA 3TFQA 1JFLA 3EXFA 4L72A 2B82A 3FWYA 3AHIA 3MQ4A 2V7XA 4HB3A 2GO1A 5FBQB 3V32A 1LDMA 1X1QA 2AX4A 2WBLC 4AKTA 1ZR2A 5LWQA 4H1UA 1N1DA 2YDYA 5AI6A 5BW6B 1XD9A 2ZKIA 1A4UA 1MEJA 3RGGA 2G1JA 4QTZA 3ROPA 4FI3C 3Q5DA 2IYNA 2UUOA 2ZROA 4DMCA 1ZO8A 5B37A 2TSYB 4EZEA 2B4YA 2HN9A 5IDWA 1CEYA 4DEYA 2I7TA 5T4FA 3B3JA 3GBVA 5JAQA 2Z58A 1CZRA 1PCXA 4TKZA 3U3MA 4EUFA 1ZNXA 2YWFA 2I33A 2BR3A 1XTBA 4L5BA 3KAJA 1V96A 5AKKA 1U2GA 3N9IA 4PRLA 4JP2A 3K2EA 1T8WA 2EX0A 4Q3NA 4BMXA 3B85A 4HB0A 1GTL1 2CWWA 3AF2A 2Q4RA 1VG1A 2YTZA 2DEUA 4LK3A 3DOCA 3W5UA 4JQSA 1OAAA 1PJBA 3HFRA 2R60A 3BD9A 4HPXB 4HAOA 4RXMA 4JJKA 1BWRA 3SF8A 3FSGD 3K5WA 1NP3A 5C1BA 2ASEA 1FP7A 1W48A 4XI9A 4IG9A 2B1IA 3B9RA 4FDAA 4U9UA 3CGWA 2R47A 1P33A 3VR4H 1U9IC 4RVOA 2FLWA 1GITA 4F2WA 5IMSA 1KXJA 3FPLA 2JLBA 1PNRA 2VK2A 4B6JA 4D26A 1CYDA 4YJHB 4H3HB 1K4YA 3GFTA 5LQMA 1R0LA 2IPAB 3FMOB 4MP3A 4NCKA 3GBPA 4DLYA 5AKZA 5DIFA 1IK6A 2AX3A 5FOSA 2YJ5A 4NZPA 4CKWB 4CIAA 5I47A 3ORQA 1HE5A 2B8EA 5B2ZA 2ATIA 1ZCZA 2COUA 4TN1A 3R74A 3B7PA 1LH0A 1NAHA 2V7TA 1HTBA 3SXUA 1VSTA 3I05A 1YMQA 2WP8J 5F12A 4WK0B 2DFKB 3GZTB 4YV0A 4BFTA 5HDBB 1XEWY 3SC2A 1RWXA 1KFKB 3FMGA 6YASA 1I6LA 1FLAA 1WRBA 1CVIA 2CFTA 5KTTA 1USVA 4RSMA 3DBIA 4BNTA 3SJUA 1M7BA 4YASA 4BLPA 4HMPA 2MSLA 4C08A 1GTRA 2O20A 1E3LA 4R2XA 4OUDB 4W5WA 3P2MA 3F3KA 4CNQA 3UWKA 3BREA 4GBED 4E08A 4LQCA 3RYFA 1QRDA 3EN0A 2H7VA 2C78A 1KS2A 2QTCA 4E70A 2Y1EA 4N0EA 1BQEA 3F78A 1BDIA 2R8YA 1L5YA 1DRUA 2X5XA 2QPAA 4BB5A 3A1UA 2OBNA 1IHXA 4EKNB 4G5GA 1I4DD 1WZNA 3C0KA 4BQFA 5HUHA 2CJYA 1VL2A 2FX5A 5KOHA 3IERA 5B1YA 1M6HA 1JDBC 5DYWA 2QY9A 4IXMA 1Z68A 1A4RA 4EI2A 2A67A 4QJ4A 4U2DA 2OPBA 4BJ5A 1XXLA 4X44A 5C1DA 4CU5A 4GMXA 3NYIA 5JUWA 4PHTA 2QUHA 5BNWA 4JI8B 4V0RA 3QEMB 4Z4HA 2VHYA 3Q7PA 3L04A 1LI5A 3RJMA 4P3PA 2YXDA 3KKEA 1UBEA 3R23A 1YA4A 3PBKA 4HH3C 3WGVA 5LMNB 3ECSA 3HXTA 3RVDA 3TRDA 3GG2A 1E5TA 1O6GA 2ZRDA 2WM3A 1CJUC 3Q6IA 4HN2A 3VDNB 5GIPE 3ADDA 2Q6LA 2VF2A 2QX9A 3PLAE 2JCBA 3EWNA 4TLDA 2AEEA 1H8ED 1MXFA 3KQTA 1PJ4A 2VTKA 3LVFO 4H18A 5B1HA 4BKMA 3HH8A 2VP2A 4Q1VA 4BLUA 1FUYB 3IAXA 1WCV1 2OV3A 3TZ6A 1VJ0A 3A1VA 4D5EA 1R0KA 2IPMA 1ISJA 3HWSA 4R9SA 3JYOA 4XDGA 2X1MA 1JEDA 2FWAA 5ALNA 1PTJA 2WHRA 1DADA 1JHQA 1UANA 3U7EB 1GPKA 1UPTA 3NVMB 1ZXLA 1AB6A 4QTXA 5GAJA 1SVWA 1ZOSA 3H4VA 2X19A 4D42A 1DHRA 4IX9A 4W5RA 4E4TA 1I7SB 4OHCA 3KEQA 2AUNA 3NRCA 4RTMA 1ZOLA 4UEOA 1MV5A 3IBTA 5G02A 1J1UA 2DSTA 2M2IA 3EF1A 1T2CA 1TYCA 2RIRA 3DB1A 1Z2PX 2HBZA 4KPUB 2O7QA 5BVGA 3DLHA 5LB4A 3HKDB 4QPZA 1DMRA 4U02A 4Y9SA 2XTZA 1ADBA 1PNTA 1WMSA 3M6UA 3DE5X 3VR3A 1G60A 4AL4A 4JKYA 1E3MA 5J1TB 2BD0A 2PRJA 3COPA 4GDMA 4W8OA 1C1XB 1UDAA 5GJWC 1RU3A 3ZHZA 3IVXA 5F1OA 2WZBA 2OFFA 2ZZKA 3CZ4A 2R1TA 4PTLA 3BMCB 2G09A 3L8GA 4HAXA 3V4ZA 1I7PA 5AI9A 3K53A 5CURA 3CRZA 1A7AA 5LP6C 1UODA 1ZBQA 4YGXB 2D4AA 4GSYA 3QWIA 1M6VA 4IINA 4RJKA 1C9DB 2HU2A 2Q1YA 4GYYA 4AZVA 2G07A 1JBKA 2HCBA 1YDEA 1V5IA 3CUVA 3PD1A 1JTFA 2VPYA 3IXQA 5G0UA 3TQTA 3DNFA 3HB1A 1NWCA 3ACDA 4ZEMA 3KXIA 2A5FA 1IN4A 3OF3A 3L06A 4D6PA 3N39C 1TK2A 2KI5A 2WILA 1KYZA 4GOXA 4TLMB 4EKGA 1SBZA 3I64A 2ZWIA 3FMVA 1EDBA 3JPYA 3R0IA 4YO7A 1DZIA 4AJLA 1N2OA 4TTIA 4AMYA 1WXGA 1ZVJA 3F90A 3IS3A 3UK1A 3ADCA 4JI2B 2PQ2A 1DQPA 4DGSA 1ACMA 1MA3A 4YAKA 4JLDA 2HL6A 3ABIA 1PP4A 4Y6QA 3NDIA 1QWOA 1DI0A 2ENUA 3EDQA 2Y77A 4QEDA 3H6KA 3QELB 4RKQA 2CVHA 5F7OA 3TMKA 4KBYA 2JFXA 3DBOB 3N8KA 2BKUA 2J9GA 5C8DA 1P2UA 3W34A 4GKJB 4QLBA 5TMBA 5JXJA 3OIFA 5HCUA 2FW8A 2YY5A 3LYAA 2HBRA 1IBSA 1PJCA 3KKOA 3VZDA 2ZTVA 2WJJA 4EYEA 1MORA 1HDCA 5HFAA 5TIIA 2M9MA 4H4EA 4V02A 4BQQA 5BSWA 5KOJB 1TEZA 5EHIA 4BDTA 1BMQA 1NRJB 4BQRA 3PA6A 5C53B 1OZGA 1J56A 3M70A 2OC9A 2JIDA 4O4JA 1LSSA 1PS8A 4YI3A 4AZSA 3TOCA 3LUAA 4J4HA 1VM6A 1IJFA 2CMHA 1D2NA 2I54A 3O83A 4DQVA 1AQNA 4QELA 3A1EA 3LA8A 1LPSA 1Y1LA 5EP3A 1OFVA 3SMVA 1DFHA 1GRNA 3C8DA 3N76A 1OXKB 1PLKA 1PG0A 3ILYA 4LRXA 4WQMA 4A16A 3G5TA 3O2QB 1CY6A 1MAVA 1BYUA 2DZDA 4GAEA 3NDPA 3TK1A 3AVQA 1R6XA 3DMTA 2PJDA 3AO0B 4JN6B 5EA2A 3RRJA 1GNSA 4EI9A 3GEEA 4OX9Y 4MRPA 1EHYA 2H4HA 5JV5A 3DEFA 3BGSA 1DINA 1N7GA 2HIAA 1KJ9A 4NFSA 1RXCA 1IJKA 4W5OA 3ZWWA 3T41A 4J1TA 3H83A 3B3QA 5FUVA 1O58A 4UVDA 3CUEF 4G4GA 5KHLB 4YRTA 3OCXA 2C4UA 4C6SA 3DC7A 2C1EA 3UMCA 1WB5A 3HNRA 3WLNA 4IIGA 2GM5A 2C9CA 3OE7D 1F6BA 1KERA 1U0SY 2ZB7A 3WKDA 4C14A 4REQA 1I1OA 4DJJA 2J0QA 1L3CA 1M0SA 1OGYA 1GGMA 2NWQA 5DYGA 4D81A 2PS9A 1WD7A 1F60A 2PZFA 2CNBA 3AGPA 5FR1A 5E7JA 3ZV4A 1UPFA 2EZ9A 3IV7A 4FDUA 5TQVA 3NWOA 2O59A 4F72A 5T4EA 4YRNA 5CDTA 2Z6QA 1EGHA 2GT1A 3VISA 4BZXA 3EPKA 1R7RA 2WVJA 3ZG6A 5LOVB 2EBHX 5JVDF 2WIFA 4LTDA 1G5FA 5AYVA 4EHFA 3MINB 1FXSA 4ZXFA 2Y1OA 3H2KA 2R68A 2C9BA 4O0MA 3JQFC 3AERB 1QYWA 2D2XA 2NV2B 5AMXA 4FNAA 2AR0A 1G2OA 2V8OA 5FTMA 1S9HA 1D9ZA 4HGRA 3TB4A 4YAIA 5JDIA 1JEYB 2VSOA 1Z4MA 2A5YB 3PXAA 2TMYA 4V0OA 4AMUA 2CUNA 3CRQA 1ZGZA 3D0RA 3ZHXA 1KQGA 2CXNA 3U9TA 1G7SA 1DEXA 4KFRA 4GXRA 3R5XA 4RO0A 1UK9A 5B1SA 2P62A 1FYEA 3PNMA 3C5HA 1LNQA 5H82A 3W6ZA 3HXQA 3GLIA 2RHDA 5LYJA 5T3UA 3C7AA 2OXCA 4Y0VA 3CF6R 4YIHA 1BX3A 4NMXB 5FTNA 5DHRA 4BASA 3VBCA 3K9WA 1FVHA 1WPGA 3UC9A 2ZIVB 3MTEA 3IUQA 2HA7A 4C2BA 3AF6A 1Y5NA 4FZVA 3FYUC 2CXXA 1L4UA 1SXJE 3CX3A 3QA3E 4ZIRB 1R9GA 1A5TA 2G9UA 2LP4Y 3ITEA 2ZWMA 2GZHA 1V4BA 3TG8A 4I5IA 4MYUA 4DLBA 2JLWA 4QGHA 2PT5A 4TLCA 3Q7QA 1PV4A 1OH5A 4TV9B 1O1YA 3TRIA 4JDPA 3VSDA 1DO2A 1Y63A 4I3HA 2QXTA 4FCVA 2R79A 1KHTA 2ZR7A 3IA2A 3NJRA 4U7WA 5B6IA 1BXGA 1NSFA 1VOTA 2EW1A 4IDCA 4YAUA 2POQX 4ZARA 1XTIA 4F91B 2ZDQA 3QSYA 5CITA 5IJXA 4BHTA 4GX1A 3QV2A 3KSDO 4IDOA 1YS4A 3INYA 3R7NA 3KYCA 4JSYA 3ED5A 3NS7A 4RUKA 2I7XA 1T0JB 2PR2A 4E11A 2PLFA 1PL8A 2VWQA 1A2BA 3AU9A 3H0CA 4OJTA 1D2MA 3MJVA 4HZUA 2HA0A 2EYQA 3MOSA 3OOEA 1QBGA 1UP4A 3GDOA 4IRXA 3GLHA 2FMFA 4W5HA 3UOAB 3B5EA 1IJBA 1V71A 2FQWA 3OOWA 2HNBA 1T0BA 3IDOA 4UW9A 1VZ2A 1RJ9A 4AROA 4BMCA 3LH5A 4Q1AA 3UXHA 3Q3GE 4EUKA 3ZV3A 3DG9A 3OIYA 3U1VA 5CFRA 3EWSA 4NYIR 1ILEA 3UAZA 1UFQA 2HK9A 3PQ4A 4LJ4A 3K6SA 3LLSA 2WJVA 4RQAA 2ECPA 3D6AA 3KJGA 4AN1A 3D7RA 4OAPA 5J59A 3K9GA 1P60A 2G1PA 3IGFA 3T7IA 3TTUA 3DCIA 4JP3A 1IK4A 5DHQA 2XR1A 5FOVA 1N32B 5K0ZA 3M4NA 2ISCA 2NYAA 1BE1A 3SC4A 3VGJA 4BFWA 4BIIA 4F04A 1FY2A 4D4LA 4ALIA 1R6DA 1XTJA 4V39A 1UBSB 1QANA 1CHNA 1SC6A 1M8PA 2IYZA 3IODA 1O94D 2OM2A 1POXA 1DJOA 4Z51A 2C4MA 3BMNB 3UB2A 1BFDA 2H48A 1AE1A 3O2NA 4AXXA 5B5SA 3RU7A 1NA5A 2DULA 1C8BA 4ZYVA 5JCXA 5JPIA 3UYLA 3HCCA 3KQNA 3IQIX 1DS6A 1ZCJA 3LW8A 3FTFA 3JS5A 5SY9A 2DETA 1K4MA 5FBKA 4BOYA 2HBYA 4PXSA 3WNDA 3ZGXA 5DOVA 1XWFA 1TO6A 3TVTA 4AURA 1EFHA 1P0CA 4DUGA 2PWPA 2DWCA 3D0OA 3JVUA 5GONB 7AT1A 1G8AA 3MWLA 3OPQA 3SSMA 5JRJA 4YV2A 2QTTA 4IFTA 1ZH0A 2CFRA 4OHKA 3T99A 1RC8A 5K4HA 2GXQA 1AN9A 1Z29A 4YREA 5KQGA 2PV0A 4IBOA 2O7NA 4UM9B 2IW1A 1ZW1A 3T0FA 2GTPA 4OHUA 4CKEB 2IZ6A 1TW3A 2YHBA 4PQRA 5K1ZA 4YUYA 2VTBA 3W2TA 1OYOA 1NNSA 3R0QA 4E2XA 3QQ5A 2JPDA 4XQGA 5IJAA 2VTVA 4LFCB 5K09A 3F74A 5IMBA 3CT6A 4FYMA 3R44A 3ZWAA 3LUDA 4QYMA 5E6RB 5I7AA 3FY4A 3HKCA 1YUBA 3Q2OA 5BYJA 4DLAA 3WKCA 3B7WA 3VMMA 1IQUA 3EVEA 5T8KC 4WZ6A 4NWIA 4RCVA 5ALJA 4I9GA 4UOEA 1KYQA 3CUYA 5EJ7A 1V9CA 1W88B 4I2NA 1V16B 1IN8A 5ENDA 4BMZA 1PI3A 5AW3A 5KX5B 3NEJA 4LZZA 2R1VA 4N0DA 5F77A 4EBFA 4JA2A 1KR5A 2WTXA 2C4NA 3O4JA 3RJTA 1AS3A 3N0WA 5U4QA 4A6PA 4B3FX 3RVKA 3C24A 4ZCSA 4H35A 1NPTO 1Z7GA 4BFSA 4WINA 1K6MA 4N4AA 4ARCA 1N57A 1T2DA 2PN1A 3EZ6A 2XE8A 4WKCA 2JGIA 4INPA 3RARA 5HOQA 3DWFA 4AJ2A 3GF4A 3CN7A 3BGOS 4QOSA 4HBGA 3ZTWA 3GD5A 4PGAA 2GEJA 3PIRA 1E69A 3TQOA 1T9ZA 4HPJB 2Q4BA 1WLSA 3ENWA 5LBUA 2OY0A 2UZ1A 2ZIUB 4PCUA 4QDZA 3MWKA 1QK3A 3AUKA 1ZAYA 2Q0XA 4PYMA 1W36D 4HDRA 2EW2A 2AXQA 3IHTA 1O95D 4K1LA 4LSMA 4FILA 4CV2A 5A0TA 2VH2A 1DRKA 3SLGA 2ZTLA 4JVLA 1FUKA 4HTFA 3ZV5A 1M7GA 1QVVA 1KP9A 2C8KA 3L0IB 1FRVA 1JQAA 4A8JC 4MGKR 1MBZA 4UBIA 1BA2A 4D45A 4IEIA 3RSHA 2GEUA 1Z4JA 3HKBA 1QQ7A 2GKSA 3ITDA 2E6KA 3EVTA 5D1HA 1L5KA 3TLMA 4CKBB 1DJMA 1WY5A 4O4LB 1JLLB 1BJTA 1C0PA 5AKLA 4ECAA 1KY5A 4HMOA 3KJHA 3WSTA 1B23P 3GGGA 4H7KA 1NF8A 2OD2A 4ZVPA 1A1SA 2DQKA 5ARBA 1WVGA 2Z83A 3IUBA 1QRUA 1I2BA 3IIIA 4Q1EA 2ZATA 4G86A 1TTPB 2BE7A 2BHTA 3ANTA 2A0YA 4OBWA 2VYVD 4H59A 3HJHA 1F8UA 2YMMA 1Q6ZA 3C74A 1CP2A 5IT9A 3C8MA 3TKYA 4MJ3A 3H9GA 1E32A 3GMDA 1CUYA 2G08A 1ESEA 1GUAA 4FKBA 3CJQA 3OSUA 4DQKA 2X7XA 4J9VA 3M0EA 1PT9A 3HA7A 5IF3A 4IJWA 2H1SA 3G7UA 3MEQA 4J91A 3EDMA 4LHWA 4WKBA 1R1DA 5IC6A 4COOA 4GSKA 1JQ3A 1RM5A 2VATA 4HX9A 4J1NA 3WR5A 2P77A 1T34A 2QB5A 3C97A 4ZT2A 4B3DA 1XAJA 1EVIA 2QJWA 5B1DA 1T0UA 1C4OA 2CKMA 4YPFA 2V0GA 3U60B 3UMBA 3ZV6A 4P22A 1QQAA 1ZOOA 2B4AA 4NIMA 5L3ZA 1BEUB 4WJKB 4BXOB 1EFUA 5FPHA 1ORVA 1G20E 2POCA 3ONVA 4YO8A 4AP5A 1H93A 2AOVA 2Y9MB 3N7AA 2CF5A 4D92A 2QQ5A 2NU9A 5J5VA 3JALA 1S3IA 1M76A 2MSCB 3FVWA 1NOKA 1XD2B 1JLSA 3L7NA 2YMPA 1QRSA 4L8FA 4L9RA 1HRDA 2EFEB 2ZJ7A 2ZTSA 3HYCA 3O4GA 4JR1A 1ZCBA 2BGLA 4HUTA 1D2EA 621PA 3LQFA 2O5RA 2MYTA 4NULA 1KI6A 3LUHA 1QO9A 2XIQA 4N48A 4HNHA 3FPFA 5DLDA 1D2AA 4Q3DA 4NABA 3WLEA 3PNKA 3WHKA 2M6SA 4B8WA 2IF2A 4EIWA 1RHMA 1XJWA 1HLPA 1DCFA 1RPNA 2ZIEA 1JE1A 1E99A 2BOVA 3W79A 2EKDA 1G19A 1LJUA 4Y9UA 4H7JA 3NASA 4TS9A 1XMIA 5CDYA 3P2JA 4ZPXA 1C3OB 1QF9A 4QYWA 2E5LB 3KS9A 1I9CA 2O2EA 2BTEA 2B9EA 3E3MA 3DV9A 2ZBPA 3ND7A 2GS9A 4IR7A 1WDMA 1E2IA 3Q3CA 5LUBA 5E4TA 1PSDA 1E7MA 2Z43A 1FYDA 2GFQA 5CIQA 5IAJA 4M9RA 3TQCA 1IVNA 2F59A 2R6GA 5D3MB 1Y8AA 3S29A 3PUWA 4CFYA 4UNPA 2VZLA 5EP2A 3EUAA 2G04A 2JIZA 4G2TA 2P9FA 3AOGA 1VIYA 3UK2A 1W36C 2AW5A 1J8YF 3TLZA 2ZI5A 1MVOA 3Q7EA 3C41J 1E0KA 1YFKA 4C4TA 3OQ6A 4C2TA 2IDMA 4MEAA 2G4CA 5CJJA 1GU7A 4GKAA 5K3OA 1PGJA 3B6ZA 3JAKA 5ILOA 1JX6A 3CG4A 4H0FA 2O9JA 4NNJA 5A1JA 3JWIA 4Z3DA 2DUUA 1NJ1A 3WB2A 3OTOB 1ORIA 2RK6A 5LDHA 3NJ4A 2P9JA 4L07A 1W59A 3DO5A 4NI5A 4KUGA 3TW0A 1OT5A 3GP3A 1NVTA 1Y0BA 4NOMA 5DTRA 4UUOA 5IJ9B 4GOMD 3FSEA 1BAPA 3PQFA 3Q5EA 2BPOA 3PCXA 1Y6ZA 4BNGA 4Q19A 1F6WA 2ODPA 3AFNA 3GLRA 5LZ5A 3SYMA 2WICA 4WOPA 5CK4A 1QKIA 1N3YA 2X5KO 3LA6A 1WCIB 5AWFC 2AEMA 1UR5A 1VG9B 3FE2A 1EP3B 4RWEA 4ALLA 4F2GA 4PLFA 1PGPA 3NDRA 3OMXA 5JPCA 2CDNA 1V95A 3OJFA 2FFJA 4UUAA 1TAGA 2WJAA 3PGA1 1E9VA 3FWNA 1OCEA 4MW4A 1LRKA 2G6TA 4I5EA 3EVBA 3NW9A 4WLFA 5I7EA 5CEEA 3BXFA 4J1QA 2AUTA 2JFOA 4U7TB 3RVMA 1OI4A 4NEHB 3VAYA 2MJLA 1DXQA 3CVYA 3ZUGA 3S99A 4RVUA 2NU7A 4P6VF 1B3BA 1HYBA 1TA0A 3Q7TA 1KZHA 1YNSA 3LQKA 2JI7A 3T7CA 3PWKA 4KQEA 4E3ZA 4UOQA 4OKNA 4UPDA 5ELLA 2PV7A 5IT4A 1TYAE 4HS9A 1B41A 1EB8A 4HP8A 2ZVQX 4GYKA 4NATA 3HDQA 4Q39A 3OE4A 3IQHX 3OHSX 1Z7EA 2GDJA 1AKTA 2YJ6A 1AQ6A 4FT4A 4YGYA 2WVHA 1GUBA 1IN5A 2Z98A 4PHGA 3ST7A 3NTUA 4AAYA 4AZ3B 1L4KA 3WWDA 2FR8C 1MD9A 4MQEA 2GX6A 3AUFA 3JWPA 4MSUA 4LHZA 4P7KA 1AK2A 5DJ5A 3LNCA 5HIJA 5KHAA 1NVWQ 2Q7DA 3UMJA 2QMOA 4D0LB 3O1HB 3GJXC 2ZQZA 4NMLA 3NIDB 1WX1A 5CHEA 3PGJA 4G01B 3A32A 4YUAA 3B5JA 2Q2NA 5EINA 5THXA 2CD9A 3DBHB 4M9CA 5TARA 5YASA 5A62A 4S1TA 1NF2A 4IZIA 3V00A 1NBAA 3T3OA 5IASA 3H0EA 4K28A 5IWCA 5JYCA 3OPMA 1E3TA 2LXNA 2XVYA 3FZNA 4QUJA 5CDHA 3S2FA 1GT91 2P9GA 3FD8A 4RIEA 1GQSA 5EP1A 1NNUA 9MHTA 2HF2A 4B71A 3I4CA 1OXTA 4DDMA 1JILA 1AM4D 4OO3A 2Q8NA 3I9NA 2VWPA 4OMDA 2XWPA 3IMGA 3RVNA 3WGJA 3I72A 4AJ9A 3NU1A 4YRKA 5CEJA 2QL5A 4GOOD 3L8FA 3T61A 2WHPA 4AKGA 3MN1A 4NEQA 1VBKA 3HP1A 1YRQA 4Q6BA 3JRXA 1L7AA 3ZXSA 4BVKA 4P4SA 4M8LA 2J59A 3VNSA 4H31A 3HZZA 3PFIA 1A3CA 1JYFA 2VK8A 2ENWA 4RADA 5TJ9A 3IKVA 1SHKA 1Z47A 2FXIA 2IOFA 3RT1A 1CUEA 2HJRA 3MTGA 2JFUA 4Q9NA 1MRSA 3RCBA 1PD1A 3CCFA 3ZK9A 2WF9A 3GN1A 4XIJA 1TJ5A 3JVDA 2PD6A 5JYDA 2RC6A 3WP1B 5EIAA 4MV9A 1DUVG 1XDDA 4I6JA 1A8QA 1DEAA 3BM5A 4JD5A 3S2ZA 3TH5A 5ADWA 3C7CB 3F1KA 4E2WA 1IIRA 4KJXA 3KV3O 2GLTA 3CJTA 6NULA 3HXOA 4R2WA 1V8OA 4OSPA 1E5DA 1U11A 2Y05A 2C2WA 2PH7A 3AI3A 4S1WA 3SFVA 4FB5A 3RB8A 2BFFA 4QGAA 1DJNA 1AT1A 4RGYA 1WB4A 3FCUB 4YMHA 3COYA 3H9BA 1EFVB 1GAEO 3JYQA 5DH9A 1ZD8A 4EHIA 1I0LA 1N5KA 1O3YA 1V47A 2QS9A 4O1MA 2PKWA 2EP8A 3DTNA 2GCIA 3HA5A 4X63A 5MN4A 1XNRB 4GBJA 4QXRA 3UK7A 1K8YB 3CF4G 1EMDA 2IU6A 4MUGA 2GHQA 5LZ4A 1X94A 1MOZA 1C7JA 3VOSA 1DC4A 1TM1E 2IXAA 4E46A 3L3BA 1RADA 1P77A 4NE7A 5IDQA 1IY9A 3E6AA 3OZTA 1Z4NA 1PL0A 1UMKA 2WKSA 3DA8A 1CEXA 5IAKA 1AMNA 5K8JB 1LY1A 1JG3A 1GNQA 3A4TA 2E5WA 3ZCVA 2GK6A 2Q3MA 3EEYA 4R7ZA 3L1KA 1Z56C 1ZLYA 4JBXA 4D74A 4TTTS 5KTSA 3QU9A 3MWYW 4IWYA 4XFKA 2ZM5A 4RAOA 1QGOA 3L6DA 1P8AA 3RRBA 1PZFA 3BAFA 4LRWA 4PZ9A 3RDPA 1B0ZA 3IUEA 3OZRA 5K3BA 3ZNOA 3KLPX 4EJSB 5BQ3A 2W71A 4RHCA 1JRLA 1E2HA 3NIWA 3UGJA 4CIBA 4NL4H 3UWSA 4PYKA 4RPJA 3II6X 4TXNA 4DCJA 5EPOA 4IJVA 4JMLA 4ZAYA 2RCNA 1N2GA 4MVCA 3C85A 3CLHA 3GA7A 1S4MA 1DT5A 2QLJA 4Q4JA 4DDWA 5LQKA 4LXHA 3PQEA 5K8TA 4HLQB 3KK0A 3PHIA 4CKZA 3CPSA 4Q3CA 1VKRA 3A6PC 1OMOA 1OAOC 3BGDA 2HK7A 2OCXA 2P2DA 3CR7A 3NKLA 3NGMA 3QUCA 4N8SA 5HF5A 3SZOA 4YRFA 1MZPA 1ZMTA 2ZR8A 1BVUA 1X8KA 5A6SB 3U4CA 3V4PB 3WLOA 3R2JA 2Y0BA 3BRWD 3IYLW 1DWQA 3ZVNA 3MF4A 2R7LA 1QTIA 4V1CA 1FB5A 2SHKA 1I3KA 3GUUA 4S2UA 4E07A 4UFPA 1H66A 4R54A 5HIKA 1NJGA 4P81A 3GGDA 1NI4B 2Q7XA 3G2IA 3T7EA 1KC1A 1RQ2A 1IWOA 3DE3X 4BQEA 5CG1A 2JFWA 1X1TA 2OP1A 4Z4FA 2GEVA 4CMEA 3TZCA 1QP4A 1W4AA 5EY5B 3KDAA 1N3BA 4XX1A 4LJYA 3SU8A 1U3TA 1SXQA 3CRRA 3BH6A 3CIOA 3REQB 3COJA 2V03A 3GAZA 2M1XA 3NOXA 4HCJA 5JH7F 1G98A 1Z13A 2OV8A 3N2GB 4YCCA 3PTZA 4EHJA 4IGKA 3SQDA 5H3CA 3ZKWB 1ZZEA 2XOXA 3OP4A 1XMQB 2OHIA 1P1RA 3ZWDA 4OLFA 5F1PA 1X7ZA 3KJZA 3UBMA 3KPJA 2QM8A 3I42A 3O4HA 4PG5A 1GPH1 1UBGA 2C98A 2G9QA 2WZCA 3JASB 4EB3A 5K6TA 3DR5A 1F1BA 1KKUA 2QE6A 3F2VA 3NNNA 2AQIA 2QTZA 3DKKA 2CDCA 1UZUA 5F21A 2FPRA 2B6HA 1SKYE 3ND8A 2QL7A 5TS3A 3W4KA 4F0JA 3ZWQA 1P3JA 3HY4A 4LF9B 1VG0B 4M1ZA 4BWVA 4MP8A 1SURA 2Y1DA 1RYFA 3C8HA 1XEAA 3MS7A 4O3FA 4LCJA 1J21A 1RAHA 4OI1A 1SXJC 1ZK4A 1SU4A 3QH4A 4RZ2A 5ESXA 2ZRFA 1I4LD 2QGNA 3LCRA 3OX1A 1XQXA 4V0NA 4WECA 1I5OA 2REQA 2GERA 2BMAA 3L43A 2JD2A 4KVGA 3FCEA 3PP8A 4K88A 5HBGA 5K3FA 3RTAA 4OQQA 3RVSA 1C9YA 2H5JA 1EK6A 2GCGA 1DQSA 3HB5X 1AKRA 2OHGA 2ZYHA 1FSFA 4OJQA 2Q2WA 1QIJA 4OQPA 4WOBA 1H3FA 1T4CA 1NPDA 2ZJYA 5GM2A 1U1GA 3H2ZA 2ZI3A 4L76A 3EFEA 1DCTA 2OZVA 3GEMA 5KEIA 4I19A 3ZHYA 5L4NA 1E98A 2NT3A 4LYAA 3NGXA 3Q9NA 1ZPDA 2SICE 4QTUB 2A0FA 5DGTA 1PNVA 5DTMA 4CEJB 1EIZA 1T1RA 4MCHA 4WXYB 4HSGA 4OQ4A 4F4DA 1RJEA 1YK0A 2PZGA 4Q1CA 1NBMD 3G9XA 4MIKA 5FLXA 3O8LA 1RE0A 3DFFA 4QC2A 4B48A 3FVRA 4NVRA 1NNEA 1IRXA 3W5AA 5C4IA 3RK1A 3KB8A 3HA3A 2FHPA 4QAJA 1D2RA 2C1XA 1AXGA 1DC5A 5KTKA 3DFIA 3CM0A 4ZHQA 1NMYA 4M0FA 2PXXA 3HV2A 1H2ZA 3FLMA 1UL1X 3NIBA 4K9MA 5EEHA 4KWTA 3DVAA 4P7JA 2FE1A 1IY8A 1GSHA 3LOUA 4U4AA 1ZCFA 3TZLA 2ONCA 3L1HA 5LA6B 4DAEA 2YKGA 1Z88A 3URMA 2ZSIA 4CEHB 4Y2TA 4JOCA 4R6WA 1GPDG 2QD3A 2ZYDA 4BNDB 1E3WA 5AQ1A 4JIMA 4IIHA 4LVOA 1BJRE 2FSVC 4O2AF 4OP2A 3VO8A 1GRQA 4U39A 4JSRA 5KQMA 2WTAA 2EC5A 2X8BA 2GFHA 3IC5A 2OBLA 1G2QA 1YS1X 3U0BA 4FT2A 4GZ3A 1H2EA 2I4MA 4I1RA 2DYKA 4F71A 2J9FB 1YZUA 3ORYA 1UOQA 4W82A 4ZALA 4UPVA 5H83A 1OPRA 5BV7A 1ULSA 1Z6XA 1NC1A 1R64A 3H4MA 3IKLA 2PX3A 3VR1A 4EPVA 5CYGA 1WU8A 2OT3B 2IHTA 2WIDA 4OI0A 4HLUC 4BPBA 2YXEA 3U4QB 3R0JA 3AIMA 2PK3A 4DZRA 3GLGA 2FSIA 5TB5A 1BGVA 2JBHA 2WIJA 1JMKC 3RYCA 4YBZA 3X1DA 4LMAA 1OPXA 1EUCA 4PO9A 2JLSA 1MPXA 3IQZA 5EMHA 5E4FA 4B4WA 4PM4A 3D3KA 5D51S 3OFVA 1FYVA 3HB7A 3TBFA 3U40A 2FNAA 1B1AA 2G83A 5DSTA 1C9JA 1ND5A 3DEAA 5AI4A 3ACBA 4K26A 1GZ4A 3OPYA 4ITVA 4JC8A 1NP6A 1U28A 3LV8A 3NWPA 4Y1GA 5FEUA 2GTHA 1B16A 5KWSA 1T6YA 2I6XA 4EG1A 4GU5A 3CE6A 3ENZA 3GCZA 1CRWG 4MWZA 1YU9A 2C9ZA 3RLIA 1CBUA 1G42A 1X8JA 1VIVA 1WUJS 2A6PA 2J9ZB 2O14A 3TR5A 3WTCA 4G1VA 1TMYA 1I30A 2O2JA 1FW8A 2ZSEA 4K6OA 3W2FA 3SMQA 4AKEA 4DPMA 1C80A 3TD6A 1QV7A 1XJ5A 3EZYA 4OQZA 4YDHB 4DDVA 2FPOA 1Y5RA 1HBJA 4YCAA 1ZC4A 1JBQA 3CGGA 3G2QA 3AEYA 5EMJA 3WBFA 1U8CB 3G5UA 3LBNA 3UAVA 2PUTA 2XY4A 3LT5A 3RS8A 3LIPA 3FUWA 1I4OA 3C3CA 8ADHA 2I3GA 2RB4A 1YWGO 1P7CA 2B2NA 5JO0A 2CLFB 2AF4C 2FUG1 5DZSA 4J0JA 2UXDB 3GRAA 3NCTA 1OLUB 2ZM6B 4IYJA 1I6KA 2QDKA 2WAAA 2C2HA 2AVDA 3BB4A 4LDPA 1BVYF 2HQ1A 2LIVA 4P3NA 2RI6A 1TC2A 2NQ2C 3GUVA 1GOTA 1HGXA 1SD5A 2J4FA 5BN4A 1IE3A 3UUFA 2VWGA 2XOKA 4TMXA 1WXQA 2KLBA 3WAGA 5AVZA 3BIXA 3WGHA 2OLEA 1Q2UA 3WNVA 4C6HA 1KYIA 1KOJA 4G67A 4TV8A 4HDNA 2SKEA 3U49A 3L77A 2I0FA 1N0WA 4M9QA 4XSGA 3EVZA 4UXJA 3SHVA 3VH4A 4GT1A 1PWHA 4FJ1A 3S55A 3TYXA 2NZWA 2P7IA 5L8VA 2OXFA 4TRMA 2YV2A 1PJQA 4IOJA 4ZOLA 4NHOA 1Y8RA 3OCVA 3PFCA 2P8JA 3FWHA 3Q6NA 4AICA 2E49A 2G80A 4QUAA 1E2LA 3K9LA 3WOVA 5LBTA 5LDGA 4MB6A 2XZOA 1AQLA 1N5LA 2A78A 2AZTA 2CXHA 3BTUA 3ZQ6A 1DAIA 4MWCA 3TNLA 4DR4B 1EM8B 2P9HA 3CZQA 1E2KA 1NY5A 3K8OE 4PCVA 3UH0A 3WA7A 3OZ7A 1GPJA 2XGMA 4WNYA 5CCDA 3HS3A 3CH6A 4CL8A 1AIPA 3E58A 3FLEA 3N0XA 4QJBA 3VM6A 4ENTA 1KP2A 2EQBA 2VYQA 3TXAA 4MUHA 3WX0A 2VJAA 1B7GO 3GAFA 1BHQ1 2XU