4TTSA

Crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (y200a) complex with 10-formyl-5,8-dideazafolate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
308
Chain Sequence
b'MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWRLKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAVRLIATGKAPRIKQPEEGATAECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGKSVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKMIPGSQYFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title Structures of the hydrolase domain of zebrafish 10-formyltetrahydrofolate dehydrogenase and its complexes reveal a complete set of key residues for hydrolysis and product inhibition
doi rcsb
source organism Danio rerio
molecule tags Oxidoreductase
total genus 87
structure length 308
sequence length 308
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 4ttsA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4ttsA01
4IQFA 1C3EA 3Q0IA 4QPCA 4ZYYA 3AUFA 5CJJA 4YFYA 4ZYTA 1CDDA 4ZZ3A 2GARA 1RC1A 2FMTA 4ZZ2A 1YRWA 4ZYZA 1MEJA 4ZYXA 4PZUA 4ZYUA 4ZZ0A 3DA8A 4EW1A 3W7BA 3LOUA 1ZLXA 4DS3A 4ZYWA 3P9XA 4EW3A 1RBMA 5J9FA 4TS4A 1ZGHA 1CDEA 1GRCA 2BW0A 1MENA 4R8VA 3TQRA 1RC0A 4ZZ1A 3AV3A 4QPDA 2YWRA 1RBQA 1ZLYA 2BLNA 1RBYA 3TQQA 1JKXA 4ZYVA 4TTSA 5J63A 3N0VA 1S3IA 3DCJA 2CFIA 1NJSA 1C2TA 4NV1A 4Q12A 4YFVA 3R8XA 4TT8A 3OBIA 3O1LA 1GARA 4EW2A 4S1NA 3NRBA 1FMTA 3GARA 1MEOA 3KCQA 1RBZA
chains in the Genus database with same CATH superfamily
4HNHA 1RYYA 5ALYA 2VVTA 2PYZA 1G4HA 3EFEA 3KV3O 3JPWA 1FU8A 1C3LA 5CURA 3RYTC 3PC4A 2HJGA 2VPQA 1NBHA 5KCZA 1VBKA 3DVRX 4X44A 1S4QA 2ZRQA 2Z8ZA 3ESQA 5BN4A 2KJQA 4G4JA 2OSVA 4IY1A 5G0UA 1P45A 3DV2A 3ORFA 2ZREA 4J2HA 1ZH0A 2CLEB 4W7SA 1LD3A 2JLZA 3RS2A 4MS4A 5JZSA 1HA3A 5ALEA 4TTVA 1ZKDA 2I4RA 1ZG3A 1Y3AA 2A9FA 1TYEB 3OKPA 3DF7A 5HQJA 3I6QA 4ZOEA 1I0LA 1I2AA 3HB9A 3SNHA 1EFHA 4DUYB 3U40A 1NXVA 1DQZA 2IYYA 4J6FA 1Z2DA 5CH5A 2IIVA 3HZZA 1E60A 1HNNA 2DZDA 4JJGA 2ZJYA 3W05A 2W2PA 3GT3A 4RZSA 3QEMB 2ZJ7A 1AQYA 1QRAA 3NWOA 4W7HA 2IU0A 3SC4A 2FN3A 3UJAA 2B61A 4P7FA 2WMNB 4RBNA 5EWMA 1LS6A 5DOVA 2H16A 2HMYB 1L5HB 4BLTA 4CR6A 1RQXA 1JHQA 1JLLA 1QO0A 1U4NA 2HRBA 5IARA 4QKQA 5FWNA 1U7OA 5EXSA 2IBMA 1P2BA 3MQFA 2X7JA 1NNUA 1TECE 3ONWA 4FHGA 5HKKA 4YRMA 4BU1A 1RJWA 3ILVA 5CUQA 3SOZA 3DDNA 3WLKX 2X0EA 3LK7A 3FFXA 4N5MA 2FPIB 1GPUA 2PGNA 1W94A 5FTLA 3UMBA 2C03A 2HLHA 1U3GA 2Y1CA 3AHHA 3QW2A 4K03A 1BWPA 3DFMA 3PJDA 4MI6A 4B0PA 1OH7A 5AUPB 4G4SO 4YMWA 5LYYA 3IP9A 4CM6A 5DNCA 2YWBA 5T57A 1CUGA 2OGUA 4WEQA 2GPTA 2RJNA 1WF3A 2EG5A 2W0MA 3W2FA 1JFSA 3AILA 2Z4RA 2GX6A 4YH1A 3WKBA 4ENQA 2X13A 3HZHA 4IGEA 4GXQA 2ODTX 3VYRB 2VSOA 3E84A 3K16A 4B45A 2R8PA 4B3IA 2QX9A 2JVKA 2XUPA 3T1TA 4B82A 2ZK7A 2W6ID 1PSWA 2FEXA 3DBHA 4DCNA 3TQRA 2OCXA 5F9FA 3ETHA 5ENDA 2WQZA 2H2FA 1W4AA 3EE6A 4HXGA 1R6AA 4O8CA 1AKVA 2I2XB 3RJ5A 1JJFA 3BMCB 5DDIP 4QLOA 4XWGA 1XZAA 1TTTA 5EWJB 1O4WA 4BEBA 5DWQA 4A23A 1U63A 3C8DA 2YIVX 1EBUA 1PFUA 2PV7A 1SWVA 4JP8A 3D6FA 1KU6A 1M66A 2BI7A 1Z37A 2H48A 3B9BA 3F4BA 5BRAA 4EOGA 4MIKA 2CL5A 1CU1A 3TMYA 2QQFA 2A6PA 2Z8XA 2P90A 2DR2A 5TARA 3UB2A 1Y8RA 4CKCA 2II6A 4CHGA 1KTVA 3LPLA 1Q0PA 2RBEA 4IFEA 1X7WB 3L07A 5FPPA 4E94A 5IYZB 4GO1A 1L7QA 1EK0A 3EZGA 3TSWA 3F73A 3IJEB 1OX4A 1EESA 2YYZA 1YVUA 4CW7A 2C8VA 2H1IA 1Y8CA 4M6WB 2TMDA 3PEYA 4UU0A 2WDPA 4I4NA 1GQQA 4TLDA 1PJ8A 1GCGA 1YVDA 2V55B 3PFHA 1A4XA 4CM3A 1N2EA 3OIWA 1K8XB 4BIMA 1AKTA 2OK8A 4UHDA 2OXEA 2YIMA 3ORQA 3NDRA 3VPXA 3OIGA 2BI4A 4Y6PA 3U5TA 2G5PA 3QE4A 3FPGA 2AUTA 2FP4A 5BN5B 5AW8A 2OWEA 4G5OA 2BM1A 2FPMA 3R5KA 3HKEB 3JTMA 2R751 5CJ2A 4ZO4A 4GYYA 4JGIA 4BEWA 2ZBFA 1E66A 4Z0TA 3UBMA 1NXPA 3V7NA 1A8QA 3ZHUA 4Q24A 2GFQA 1EP3B 3MJHA 3TM5A 4WFQA 4MYTA 3N05A 2P3SA 2J32A 4XGRA 3C48A 4UFOA 4MAFA 1FNSA 1HFKA 2WJJA 3G1WA 3D4NA 1HPLA 1CKEA 1YONA 5EVJA 3QVMA 4HPJB 2V9PA 2HJWA 4GSYA 4XH9B 3L41A 2JCGA 4O2RA 2O54A 5K20A 4EYGA 3CKMA 2PZJA 2WYVA 3KVYA 4MZDA 1D4OA 3PDJA 1NBMA 4P38A 2WIGA 4Q9DA 1PLJA 1NUPA 2ZB8A 3KB6A 3SZUA 4EFLA 3EVFA 5IF9A 1E1MA 2IGTA 3GDOA 4M99A 1QWOA 3ANMA 4RTNA 2ONYA 3U17A 3R7WB 2Y67A 3W7BA 4NP6A 1YMUA 1YR9A 3LDUA 5AVYA 4B4KA 2R62A 1Z2AA 2MSKA 4V2IA 2PT5A 4UM8B 3EZXA 4C06A 5BSKA 3UV3A 1KZ6A 4NAHA 1J33A 4GE0A 4CR8A 5JEEA 1H42A 1D03A 1AGXA 2XBUA 4URHA 2CZQA 2DUNA 2FFBA 4W7IA 4X1YB 4R0MA 3R5FA 1YCDA 1NLYA 2ROQA 1K3UB 5K05A 1L4HA 4UTNA 1CEEA 1LPNA 1CQXA 4IHAA 4KLAA 4BVFA 4L9SA 1QYDA 4LYJA 2P7HA 3PQ4A 1UPFA 4L9AA 3A3PA 1T9BA 4G8BA 3NC4A 4JBXA 4Y7CA 4YAFA 3TLGA 3PPXA 4OOFA 2JBAA 4D4GA 2YWHA 4O02B 3W8EA 5EPEA 3OZCA 1LI5A 4M54A 1HTWA 4LOHA 1HF3A 1L4FA 4H4CA 1HLGA 2GFHA 2TMYA 3NT4A 2XQJA 1W9MA 4U8GA 3NEAA 4D9FA 4O5AA 5LQUA 1CZUA 1G1MA 1UPUA 4G9BA 5DM4A 1JYFA 1CY7A 2BCJQ 5JEDA 4GC9A 1F06A 3AV3A 2QWXA 3J80A 3L0IB 3DZBA 3Q6IA 4JLVA 1B6GA 1JAIA 2FWPA 1QGYA 3ENQA 13PKA 3AJ9A 1WX1A 4DQXA 2PUBA 4ECAA 3TZ6A 3HLKA 4ZDWA 2D4HA 4IDPA 2JZOA 4TTTS 4ZGGA 4BLWA 3KYIB 5AI4A 5K2MA 2RB4A 3N8NA 1NJ8A 1P2GA 3AL0C 2WUGA 5BQXA 3QKRB 1GCUA 1T6YA 1BWSA 1YJQA 2KLBA 3BMOB 4KO2S 2B9VA 3ANSA 2FJ0A 3Q8LA 1H8ED 3L8ZA 2V7WA 2NUAB 1J7JA 5IDQA 1E2KA 1C2TA 4HV4A 1IY1A 3DZHA 2QT0A 4PZZA 4U5XA 4CNBA 1ESCA 3DCNA 1HT1E 2NXCA 2X0JA 1ZJJA 2PX3A 1G2IA 2NW6A 2BMFA 3CH5A 3OZFA 4HAXA 3IDFA 4JEUA 4MI1A 4P3PA 3DWEX 3RYIA 4YV7A 3HSYA 2FFQA 5T4EA 5EZQA 4DDKA 4IHQA 2QX8A 4EJFA 3K1AA 4QHSA 1N0IA 2OKGA 1M2OB 2YS6A 4DLTA 4CTKA 1ZJZA 3OHPA 2BTOA 2GJ9A 4E2XA 2OHIA 5EN4A 2O48X 1JHAA 3TLZA 2C99A 4US2R 3G5TA 1CG6A 2FUNB 2I6SA 1MOPA 2LR0A 3GCZA 4LKOA 4Y9TA 4MW4A 2HSJA 3C7AA 4D9BA 2ETVA 4ESEA 1IOVA 1D2HA 4NZZA 1JXAA 3GZ4A 3PNKA 5JDCA 2XMQA 2HHCA 4XUCA 5K0ZA 3IVAA 2RC6A 3OFKA 5LKRA 3K0SA 3T1QA 2QL7A 1J9EA 3NBMA 1Z36A 1R9NA 1VECA 4RK6A 2QAGB 2BGNA 2ZI4A 3MT8A 4W6QA 1KYIA 3F8SA 1RAGA 1E79D 2CKMA 5GPBA 2WWGA 1WMAA 3GY0A 3TR0A 5DNYB 1CD5A 3TEFA 3TRDA 1RJEA 1X80A 1QRTA 2X2PA 1CNFA 3LWDA 5JROA 1X74A 2ZJOA 4H1VA 5AI9A 3PX3A 3DDCA 5BT8A 4JVOA 3HDHA 4LBWA 1OXMA 1UAAA 2OG2A 4K2AA 1Q15A 3RGWS 3ZX4A 5ES4B 1CFJA 3DXZA 4RK7A 4EY5A 3B7GA 4HGQA 4UHBA 2PS0A 5JIBA 2VJYA 2PWZA 4MO2A 1OYWA 2IS6A 4K0KB 2I6GA 4N5DA 4FOSA 3RFUA 4I5DA 1TO6A 1ZJ6A 3GLRA 1UZNA 3PLNA 1L5LA 2FTKE 2ODNA 1Z0AA 2WMYA 1V16A 1P33A 4LDNA 1BO6A 4RSRA 4XJVA 3RVSA 1OXSC 3OQNA 4YP6A 3SC6A 3KKLA 3IPCA 2OAP1 2ZUDA 5C1OA 4KO1S 4JA2A 3U3DA 1NVKA 2FKNA 4R2LA 4ZAGA 2GNAA 3EQZA 2GO1A 3JCZA 2C94A 1XTRA 1RYHA 2L69A 2FW0A 2VNKA 2X14A 1WUYA 1EJBA 2IF0A 2VJOA 2X1HA 1V3QE 3I30X 3IOYA 4EA8A 2RMKA 4TKVA 4DYHA 1FMCA 1IBRA 2Y2VA 5JNLA 3U19A 3GH3A 3O95A 5BMOA 2WIFA 1DG1G 4HVAA 3VU3A 3WLLA 2IXTA 5LD2B 3D43A 3EZFA 3GCDA 5G41A 2YNMC 4GMKA 2HUNA 2DWQA 3W8DA 1GNLA 2C4UA 4FJ0A 3B5IA 2EWWA 2LD4A 4WXEA 4IVNA 1I94B 4FB5A 1XJCA 1GNRA 1WV0A 2DFDA 3ZCPA 1ENZA 4PIVA 1DC7A 3A4VA 1QV7A 2Q9AA 1PQ4A 2CDRA 2BHSA 2GM3A 5DMHA 4JB3A 3NYQA 2UZ4A 3C7CB 2EERA 4Z4EA 1MDFA 3ZWQA 4RHCA 4MPDA 1DLJA 3ISTA 4LVUA 2C7OA 1EHIA 4U2DA 2ZETA 3WIDA 4C3OB 1TF5A 3OU2A 4P4SB 2BLNA 4AF7A 2R2GA 5I7EA 4Y1RA 2R1TB 4ZALA 2OECA 1PVVA 3HADA 3QMVA 4LQDA 1A82A 1VLZA 5E4JA 3WY9A 2Z3WA 3RS4A 2XUJA 4EAAA 3S55A 1EIWA 3DYIA 4YCSA 1IN5A 1XMXA 1TM7E 4B6QA 3OBBA 3Q5GA 1J09A 5CVCA 4R0VA 3WNZA 2VP2A 4PG6A 2QT9A 1CERA 3DUFB 2ECPA 4QFCA 2WICA 1W0KD 4EG8A 1W4CA 3O1LA 5H4GA 4S1NA 3R7AA 4E5KA 4HAIA 2AFHA 3UXHA 4K6GA 1OZFA 1CF9A 4WI1A 3KQYA 3FMFA 4GH5A 5ALQA 1U0OC 2OY0A 3NH6A 5BVGA 4KFSA 2ENUA 1M5UA 2PWAA 3LX4A 1VG0B 2H1WA 1I30A 2XUFA 3K32A 3Q7IA 2VUUA 4IFIA 5DI3B 1S8NA 4PV7A 2JAHA 3MTJA 3J81A 4L28A 3IAHA 5D85A 2QTZA 1ZD4A 2C5BA 2F48A 2C31A 4I4TF 3U13A 3L1HA 3QX9A 1QLHA 1MQAA 1YQDA 3RSQA 1P5ZB 3W06A 4KZPA 3N9IA 3H9BA 1IMOA 3DS8A 3MMXA 4QWMA 5DHRA 3UHAA 3PDUA 3TTSA 2O4UX 2IHTA 4R71A 7REQB 1VI2A 1B2RA 5CBPA 3DZKA 2BGLA 4AMGA 3RPEA 2X86A 2I2CA 2J7KA 3F7NA 5K99A 4X66B 1UBGA 5EPUA 2G1PA 5HKOA 4RULA 2G71A 3GLGE 4KQJA 1ISIA 1KFJB 1WDWB 2QUHA 4BLVA 3RM3A 2ZRHA 4AUMA 4BX9A 5K8LA 3HM9A 1SQGA 3CUEF 2QDXA 4PQEA 4RDHA 1Z4JA 1G7TA 1E0DA 4QD3A 4DV6B 3RHTA 1O4VA 2A3RA 3S99A 4JDPA 5CVTA 3ZVKA 4B6OA 4HDSB 1VM6A 1KSGA 1KJIA 5FL7A 4EPVA 4G0WA 1ILEA 5HW0A 4Y6LA 2C98A 3IVGA 4AI6A 5LBTA 2GT1A 3OETA 1QUEA 1ZLXA 4TWJA 1K63A 2REBA 2MR6A 1H69A 4XZ3A 5I8ZA 1CUWA 5EIWA 4DBLE 1ZQ1A 1HLDA 2BM0A 4DLSA 4LTMA 4IXWA 2GCGA 1PEDA 5JAZA 3GD7A 3M3HA 4MS1A 3CLUC 2O8VA 3QJYA 1XTIA 1N0WA 5G0VA 1SXQA 1T2CA 2E6KA 1LSSA 2FRDC 4YAKA 1W87A 3ZI7A 2A1UA 1RI4A 1ZL0A 2WNIA 2IS4A 1EM8B 1FSFA 1RPTA 2DR3A 4BNLA 3G85A 4C7OA 2QRPA 1SNYA 5ALDA 2C29D 3I34X 3K6SB 1V7PC 2PHZA 1OPRA 1W19A 4N7MA 4EFKA 5EIHA 1KFCB 2INGX 3G6WA 1U80A 2VJBA 3A2LA 3VZBA 3HRHA 2NNWB 3DZDA 1HYQA 3GQVA 4GI2A 3I3OA 4UBKA 3UMYA 1ZP6A 3RI3A 3QG5A 5LWQA 3F49S 4MR9B 3CQ9A 4Q39A 4XARA 4DLWA 5ABPA 3DH0A 1A9PA 1KP2A 3PQDA 3I2KA 3PNVA 1G8HA 4HL6A 4XM1A 5J5AA 4JUDX 3PWKA 4UEJA 5ESDA 2XF8A 1TKCA 4FLEA 1GTMA 2B7CA 2BV3A 3PRKE 1GKUB 4M46A 5ESWA 3TD9A 3UCEA 4CF7A 5TIIA 2V6FA 5JJIA 3KHUA 1RJFA 4JH0A 3FDZA 4LV8B 1SHUX 3KEFA 4R2WA 5LBUA 2PUFA 4AZWA 1QZZA 4KSYA 1O6GA 3V8VA 3CX6A 4PLYA 2OB1A 1KJ8A 1NW9B 1DE0A 1V2GA 4KDFA 1NDUA 4MJXA 3T0FA 5I8WA 1HEIA 4KQCA 3G82C 5FKJA 2CDNA 4MUEA 2QRNA 2HRZA 3E81A 5BR1A 5I7SA 1JHXA 3J7TA 4GG1A 2FWIA 1T29A 1PDWA 1ADJA 1QIHA 2IUSA 2Q0HA 2Q5IA 4QAQA 3RVMA 3F6BX 2G04A 3GEIA 4JXJA 3VSDA 2HRCA 2OO7A 4MQ4A 2RHCA 4G3XA 4GPD1 5I5GA 2FSFA 4XD7A 4CTOA 4YJ3B 1ZD2P 4RIIA 1U7HA 4RX1A 3O8BA 5E95A 3R9KA 1QB8A 2I78A 2J46A 4O25A 4REQA 5EHZA 1XMPA 3VJMA 2W9XA 4OIFA 4FI3F 5KOJB 2AF3C 3JD4A 5EP2A 5CT5A 2UKDA 1G8YA 3LX6A 5AVJA 4ARZB 3BL5A 5TXGA 1QYWA 4U63A 4C3UA 4WY5A 4UEQA 3VDQA 1ZCJA 4BO6A 3JATA 5I4KA 2GZ3A 5IS2A 3N2NA 4B8ZA 1QFYA 2F2TA 5EUCA 2H59A 4H0FA 3IP3A 1AKEA 3NOOA 3UC9A 4WGFA 2NQ2C 1B8VA 3Q2OA 3NONA 4NU0A 4MULA 3BE4A 4EB6B 2OOKA 1BQ4A 3WAGA 2W98A 4PNPA 2DT8A 4H59A 5F9MA 1Y6FA 2Q6LA 4MA0A 5F3RA 4ESHA 1FYXA 4L50A 2X0NA 3ZS9A 1MA3A 3V4RA 2ATEA 2C2YA 3KWJA 1S2NA 1FYWA 1XZIA 4I1RA 4YPVA 1TRKA 1XNGA 2ADMA 4I50F 4Q48A 4ZYXA 4CETA 3L02A 1QGUB 3G2NA 1V9SA 3GLQA 2HNBA 4M9UA 2HEIA 2V3VA 1XTVA 3NB0A 1FW6A 2GNOA 3W6PA 2AWNA 4DWOA 1K9SA 3RUCA 3O3CA 2JGDB 3IC5A 4PAWA 1C9JA 1JDBB 2MIIA 4HD8A 1UP7A 4KX5A 4I4TB 1FUKA 4HLQB 5FPYA 3U2QA 3D8HA 3OJFA 4GQBA 5HJ2A 2CJFA 2NX2A 4EW3A 3AUXA 4RAQA 3VHQA 1CUVA 3WYAA 4DHWA 1O6ZA 1NLMA 3CXUA 2JIRA 4KDCA 4EB0A 2LZ0A 1XX6A 2P1ZA 4WH0A 1BCRB 3WYGA 4B83A 1WUTA 2G9RA 1Z2OX 1NJGA 4L3WA 3ZCUA 1ZUIA 2FWNA 4RKYA 1CDEA 3GYGA 1U7UA 3F5SA 4RF4A 1T3SA 1Z18A 2IEZA 2KSQA 3G9QA 4EQ6B 1MIOA 4I9HA 3B53X 2QQ5A 5C2JB 4BPBA 3VKWA 1CHNA 1KDOA 1PE0A 2V6JA 3KPYA 2W2TA 3E5HA 2X7HA 4J0JA 4F3CA 1J0DA 1KXJA 3W3AA 5HBRA 1AKMA 1OXXK 1T2NA 1V5FA 3ETCA 5AK3A 1X8KA 5IXYA 1IJBA 1D4AA 3DLIA 3ZDCA 2I9KA 1X1DA 2HBYA 5BV2P 1VB5A 3EEYA 2JLWA 4MV3A 4ZEOA 1Z0JA 4MVWA 1M1YA 2WG2A 3RVKA 1ZOPA 5JTUA 4EMBA 1D6NA 5LOVB 5IK2A 4DR6B 3EF1A 4D98A 4ERNA 2A1IA 1GITA 2HRRA 2VZ0A 3QVTA 3KJFA 1E4YA 4OFXA 3FSRA 5CDHA 3AB7A 3OZXA 4RABA 1QHIA 3A9WA 3OSZA 1PR9A 4IGKA 4LPKA 4J1QA 4MI9A 2EWVA 3MSXA 5B7PA 3LI2A 4LYYA 1AN9A 1ZCAA 1XD2B 4QYSA 2FQ1A 3ET4A 1AKRA 3HO8A 3LFTA 4HN9A 3ZQKA 1R4AA 1MG5A 1U6JA 3KJIA 1SKBA 2V3WA 4JLUA 3RIMA 1GQYA 5GZ1A 4KAAA 4YFVA 4D0RA 1LDYA 4GM4A 2Q41A 3NXKA 4EATA 5DGHA 3O0DA 1WKVA 3JTEA 5FEMA 4EENA 1Y80A 2JLXA 3ZYZA 2Q1UA 5TJHA 1LV7A 2CEAA 5KKCA 2OD7A 2Y3IA 1VDZA 2ZTMA 5HJ5A 3DQQA 2P6NA 1Q92A 2HK6A 4UHHA 1J25A 2QD3A 4QQFA 1FTYA 2PSEA 2H92A 3ANLA 3PCRB 3OU6A 4UBMA 1JNXX 3E3LA 4EL0A 1GUFA 4AYXA 1ZCZA 2BEVA 1EP2B 3HJAA 1KQGA 4BJ6A 3LUKA 3DUWA 4GEGA 1KMMA 3X1XA 1U8EA 5BSMA 5GMOA 3OM1A 4IHJF 3MT7A 3TNJA 3ZZNA 4X93A 2PKQP 1E2FA 1K5DA 1OLXA 3IAEA 3URMA 1ZKMA 4IQ4A 5KQSA 1YQEA 2ZSUA 5J58A 4BKOA 3GRPA 5L45A 1K7EB 1F5SA 2J87A 1W46A 1GTG1 3WB0A 2GARA 3L6RA 1UKVY 5HFAA 5F4ZA 4Z9AA 2HA2A 1GO2A 5LP6B 5ECYA 1NJ6A 4ZFNA 3ER8A 3TUZC 4JN6B 3TWOA 1E2BA 4DVJA 1LV8A 2OFOA 2F3QA 4UUAA 1CUEA 4RZHA 5CK5A 5IM5A 3WXBA 1Z63A 2L17A 3H87A 5BN1A 3STVA 4AAYA 4YMHA 1XMSA 2D1QA 4A6XA 1CUUA 3M1AA 1KVUA 4R1MA 3F6YA 3HU2A 3BK1A 2AC2A 2XCQA 4NOMA 3WGHA 2VUSA 3HKCB 4CM4B 3TW6A 2M2IA 1KY2A 4IXDA 4J0KA 5JOQA 1RRVA 4FDLA 3FMOB 4KXWA 3AVOA 2VHJA 1IBMB 1UFVA 2X1MA 3P9XA 4L0MA 2JVJA 1FDUA 4S35A 1ZJ4A 4JJFA 3DAPA 3ND5A 4B5LA 3TLMA 4OQYA 1R9GA 5AM4A 5B7QA 4K9NA 4BB0A 1NSTA 5LQRA 1PCXA 2J30A 5BVHB 3L0ZA 2GBFA 5KWVA 5A5EA 1GR0A 4NDZA 2HCTA 1PX2A 5LZ2A 3H9EO 2D5BA 2B37A 2UYYA 4P82A 1VSQA 2CMHA 5EE5B 3L77A 1KVTA 1UC5B 5BWOA 3L7OA 2KS6A 4HQLA 3CVOA 3SQDA 4NF2A 3OP4A 3KT6A 4K8RB 4EM6A 5AI8A 3T41A 5AVUA 1RXWA 3L4BA 1TL7C 4BMZA 1SVUA 1PR4A 4FQ5A 1Y63A 3OO1A 1M8PA 2OCBA 4RLSA 4O1IA 1CJUC 4AROA 2O3RA 2JHCA 5DTIA 3I6ZA 3ABRB 3KQPA 4G5RA 3KB1A 4POOA 4KXVA 3CMMA 3H1FA 4JEIA 3RK1A 4X0EA 1H4TA 5C46F 1TFRA 4RIFA 1DKOA 1AVTA 3H5OA 1OZ0A 1U04A 2WWTA 3DWFA 4HS4A 3Q88A 4O5OA 3N39C 1BW9B 2PLRA 1LCIA 1XZJA 1KO1A 2BEWA 3IUQA 2E4VA 1KXZA 2G9NA 2XR1A 1OV4A 3HFRA 3ANTA 1ZN8A 1NY6A 3T34A 4WZAE 5HBGA 4LX0A 1K9VF 3ZVRA 1JR3D 1CUFA 1D2AA 4U7TB 1I3MA 3DMTA 3R24A 4E5PA 4O4LA 3BF8A 3DE1X 4PLCA 3S40A 4NHOA 1HLFA 3ZE9A 1PD0A 4DTCA 1ZWLA 3KSRA 1P6XA 2EFEB 2RE8A 3S0JA 2XCOA 4GEKA 4MQFB 3STYA 3RK0A 5DV9A 5I9MA 2YHSA 2NQTA 1GV1A 3M6XA 4FLFA 5JDCC 5KJEA 1I01A 4P08A 1H6CA 3L1KA 2VF8A 2P2DA 1FFEA 2G0NA 3SQNA 1WCIA 3A4YA 4PYKA 1DDGA 3R5HA 2FW6A 1N9ZA 1V3UA 4X1KB 3NH9A 2GPYA 3FCSB 4URZR 4BRUA 4OXYA 2Q7DA 1JQ3A 4BKUA 1BIFA 1N8SA 3B6KA 4TV9F 4BVLA 4EWLA 4OFBA 5KX5F 4KCGA 2CSUA 3SSMA 1RKVA 4BMDA 3CPJB 2ZPUA 4WRRA 2J0UB 5CDYA 2OCKA 2IBSA 1EXNA 2DQ4A 2OUIA 5FNVA 2X0FA 4QXOA 5TGZA 5FYQA 1R6BX 2CLLB 2ZAYA 4RS4A 4CJXA 2KQUA 1WZNA 1OB5A 5CJPA 5AJWA 2DFPA 3KKQA 2R6HA 5DN9A 1T3GA 1XU9A 4D4JA 1IB0A 5BV0A 4GZ6A 2H1OA 1PFYA 1XT6A 3OFNA 1F8YA 3A2NA 4II2A 3TBFA 4PPGA 5BXYA 5KTMA 1EIZA 1YWGO 3GEMA 4N5HX 2O2XA 1P9NA 3G0CA 2ETXA 3O73A 4M9CA 2WV7A 2VS1A 3SHOA 4TL6A 3TQCA 5KTSA 4DMMA 1D9XA 2PIDA 1QIGA 1XKQA 1WXWA 1S02A 2CFOA 1FFXB 2UZ3A 2XD9A 1SA0B 3NVDA 3C0KA 4UDNA 2D1TA 2XMGA 1ZU4A 4L2IA 5JYCA 2DFKB 2BEJA 2VYFA 5JV5A 1ZVVA 3OG9A 2H1LA 5J47A 2HX1A 4WGGA 1G63A 4NEGA 1R50A 2P11A 2I7DA 4LWZA 2JS7A 4IHJB 4HEJA 5FUVA 3SMQA 3T1NA 2A88A 2D5IA 5E6SB 3EW7A 1UQRA 3N2IA 4WE3A 2ZBGA 3BZBA 1SUEA 1KDVA 1AC5A 3V2GA 2BKVA 4MB2A 3OVMA 3E2PA 4TX1A 1L7MA 1HDZA 1IBSA 5FWXB 4D8VA 4CM5A 3B48A 4OVKA 5A6SB 3V5NA 3F5FA 4CLEA 4YXFA 3UG7A 3OM0A 2P5SA 2IHVA 5D3QA 4CU5A 3DE6X 4RV4A 3STXA 1MUUA 4J6EA 1I8TA 1HGXA 3KT8A 5B53A 3HVIA 4EEXA 3CNBA 3MHPA 4Q9KA 4NBNA 1OVMA 5CLGA 5G0TA 4AYWA 2ZT7A 3G2HA 1ZXLA 3MAJA 4BE4A 2V58A 3KFLA 5EZYB 1JI0A 1WXIA 1AZLA 1OMOA 1XB2A 2ZCUA 3WL7A 4BO7A 1EA5A 1VIMA 1F8GA 2QMQA 1JG7A 1JLRA 3SZOA 4DLLA 5IKXA 3EG9A 4G2TA 4RPLA 4B47A 3MFQA 1R4NA 1KRHA 4GIBA 3WTCA 1E7RA 3DSRA 1IIRA 5HIIA 4EVRA 4IJKA 2R8ZA 4XKJA 3GK3A 1A5AB 2GQ0A 2QTHA 3PIRA 5CLJA 1A96A 4WXYB 2O7VA 2BHRA 3UMCA 3L0BA 1EFTA 1KE2A 4KWIA 1IZYA 3I4FA 4I4LA 1NVFA 1BXGB 3EEBA 1NSFA 3PTZA 3VI3B 2JJ1A 3O91A 2W4QA 3B6MA 1RLMA 1ZA1A 3NUZA 2EKZA 4NFHA 3ZE7A 5B30A 2QV0A 1M7HA 2GZ2A 4KQGA 4YRGA 2WKQA 3FOAA 4F45A 1J0AA 3N7UA 3HN2A 4HQRA 4L57A 1T13A 4MJ3A 3TSOA 4AMVA 4BFYA 3I2FA 2I7TA 2J3LA 1I4DD 2H3HA 4NAUA 1ZN9A 4P31A 1KVQA 2P9ZA 2QL6A 4R7TA 2NUTA 5FWYA 2WQ7A 4EGCB 1UDBA 4K28A 1W44A 4KR2A 4GYWA 2HDHA 5AW5A 4KIFA 2ECQA 5DIFA 4D4LA 5L7TA 2O59A 5AI0A 2GM5A 3TSAA 5E6UA 1YTUA 1F2UB 3LC0A 2OYRA 5CB0A 3ONFA 1GPAA 1VHTA 5C3UA 2PUAA 3UQYS 3O7WA 3U4CA 3TO5A 1G20B 3K0CA 1PG5A 1LDMA 4MS3B 1JVNA 5GIOE 1SM4A 4KEAA 1BA2A 2AD5A 5DXAA 2V4ZA 1R16A 1TYCA 4DMLA 2UXCB 4ZEXA 1KOGA 4HUQB 1WSAA 2G17A 3KUCA 4K6MA 1AF7A 3OQMA 3BK2A 1BS9A 1ZSNA 3PHBE 1VKJA 5ALNA 2A0XA 3FPSA 1NXSA 1M1NA 2CYAA 2VHTA 3KJHA 2ZBEA 4R2MA 2JFBA 5JSFA 4G1VA 1NP7A 1D1PA 4HPWA 4L6AA 3IRUA 3L5KA 4MYDA 4BNUA 2JFYA 3O38A 2ZUVA 4MUHA 3HDYA 3U3RA 4KQWA 2EZ9A 1CQJB 4TV9B 5J2UA 3JARB 4ZC1A 2WP8J 3AFNA 3HY4A 4RPKA 1JP7A 5ALPA 1O89A 4ALKA 2F64A 2JFPA 3W4JA 3BXHA 3SWWA 3O4GA 5THXA 3V2UA 1WULS 2GSWA 5AHWA 3H3XA 4BUCA 1TCUA 1YZYA 2F1KA 2HCJB 2R96A 3ZIUA 1ULTA 2JGNA 4MKXA 5TVKA 1BJKA 1G5IA 1PFVA 2H7YA 2VOEA 1KDZA 3FSEA 3C5HA 1Q77A 5JXHA 4XSGA 2VPZA 4JELA 1R5NA 4JA0A 5TR9A 1UKCA 1Q3TA 3LHSA 3QPCA 4HYTA 5EMKA 3SKYA 4E2YA 4IVQA 4DLPA 2LCQA 5KU7A 3ABSB 2JLCA 3PF9A 3C3PA 2GRJA 3IX7A 4P81A 3DBIA 4PSUA 4F8JA 4PHHA 5I7RA 3LQQA 3D3NA 5DHFA 4DEXA 3PGJA 1L3BA 2WU4A 3CZ4A 4FHZA 4G5XA 4YQYA 3S1LA 3WKCA 4PX3A 1CUAA 3W2TA 1QP0A 1W36B 1RDFA 2CXSA 1RQPA 1ZVQA 3HXLA 3L8GA 4OH1A 3O4IA 3OICA 3ROMA 4EB8A 4XE5A 4ZMSA 2VRCA 1DTEA 1ODFA 4C4YA 2QAJA 1M33A 1JAYA 1YR2A 4S2EA 4EYKA 3WGNA 3L8HA 1CY0A 4OHVA 4P4GA 4P1ZA 5KVVA 1ULUA 4QUIA 4U39A 4P4UA 2OILA 4G9EA 4YGYA 4ND7A 2G9UA 5LQMA 2Z6UA 4QU8A 1CR0A 1LSUA 1LVGA 1XEWY 3IV9A 1MFZA 3G7UA 5CDUA 1YR6A 3KT3A 1JKIA 1NI5A 3ECAA 4KQ2A 4D4IA 4CM9A 2QTLA 4J0GA 1JEDA 4AZSA 4DRXA 2X5OA 5IWAB 1Z7EA 3H13A 2D8AA 3ZD7A 1G21B 3BD9A 4NBLA 1U5AA 2EVWX 4E5YA 2HU7A 3KTAB 3ZHQA 4MOWA 1KHHA 3B8HA 3L04A 1WQ4A 2C7PA 1RTTA 3T9FA 1OJ7A 1Q0TA 2G08A 2H5JA 3EZ7A 1WHTA 4LOIA 5GZ6A 2R7NA 1FU4A 1CPYA 3NTLA 2X2FA 2UUPA 1ABEA 3ZU4A 4Q7QA 1OBCA 3IAAA 2ZIEA 1N3LA 1B1CA 3BDVA 1JQEA 4A16A 2IS2A 5DTQA 1TDJA 4KYTA 2RHLA 2JDID 4QXQA 4F46A 3I52A 5H02A 4AG5A 1WHSA 4N12A 4UUNA 4V1CI 3T1YB 1MB4A 2JIZD 3B51X 4R68A 2IOQA 3U7JA 4D0LB 1YL6A 2FMUA 1IIBA 3MTQA 4NU6A 4L78A 1E1LA 3WDMA 3JS5A 2GEDA 4AZ3A 4DMCA 2AWOA 4AW9A 3QA9A 4I1PA 1I7NA 2G28A 5H5JA 4PR3A 3SEAA 1ZITA 4HMOA 3RJMA 5C8YF 2YFYA 5KSYA 1EXVA 2D2EA 3DC2A 2OFXA 2BJWA 3H5VA 2I6XA 3N0TA 1H2FA 3NHSA 3FI0A 1Z15A 2Q5QA 4RVGA 1U8YA 4XUDA 5ES3A 4E22A 1QGOA 4MRPA 3DA8A 2J5XA 1PWYE 3MMNA 3ZJ5A 2GM9A 4BZPA 3LL7A 4EYSA 2JI7A 2W22A 4JJAA 1E99A 4KPGA 3W9UA 1ADBA 2NOAA 3JX9A 3Q5EA 2CD7A 2HFJA 1DFHA 4A73A 2UUAB 4N3CA 5JQGF 5TQ2B 3QWHA 1G6KA 4K9KA 1XTTA 1JR3E 4MWZA 3TKLA 5H4HA 2GF9A 1XEXB 4M8LA 3TNFA 4Q4HA 2IPOA 3IIEA 1TRHA 2OVBA 4UTPA 1IG3A 4PZLA 4WKCA 3G1TA 1QFMA 3KQNA 1L5ZA 5AWFC 1E2DA 2XJ4A 3LCVB 4X60A 3VYUB 2FG7C 1UK9A 4JP3A 2P69A 1GN8A 3TOZA 2WKSA 2P4EA 2R44A 4ZQFA 2OQVA 4AYTA 1JH9A 3K5WA 4RHEA 2CMKA 2F43B 1UOQA 3MGKA 2WB4A 1JHRA 1ECGA 3IQEA 3SU8A 1KAEA 2BR4A 2BZGA 1X15A 3F97A 3G89A 4IO1A 2B8TA 2R84A 4QUDA 1YS6A 1KSJA 5EZSA 2O6HA 4XB6B 1YAJA 4QDKA 5H9WA 1TA9A 2PT7A 4RH3A 3U1BA 4KXFB 2HQOA 1O03A 2DFTA 2FEPA 3CGGA 2AE2A 2R4UA 3L7LA 4UAJA 1IN7A 2B94A 4XLZA 5A71A 3UM9A 2RK4A 5GTDA 1J2EA 5DNAA 2UYOA 4US1R 1YB1A 2F8MA 4QATA 1AK1A 4WA7A 5GY7A 3SR0A 3GLGA 5TEVA 4ME6A 4JSRA 4UBIA 1Z8DA 2H18A 1BDBA 3SEQA 3GJYA 3HP4A 3SC2B 3M6AA 3L2OB 2VKTA 3HLTA 3SFVA 3DR5A 1E1QD 1DX6A 2ACVA 1GJRA 3CLRD 1C7ZA 5KSPA 1ACLA 2WIBA 2WJWA 4QTTB 3BBLA 4DV3B 2R6JA 3Q87B 1GKYA 4I4CA 1HDXA 2OCAA 4MW2A 3EBOA 3PQCA 2ZCJA 4MP8A 1L5MA 1NKTA 1TCVA 3HJBA 4RFSB 2HK8A 1T1GA 4EEZA 1URPA 5K6RA 1U90A 2GHTA 1D5CA 2WJHA 3BIJA 2V8BA 4L16A 3MRSA 2L42A 5LJLA 5B6PA 3P20A 2CUZA 5CA1F 1FUUA 1PEYA 2I6TA 1VMIA 3LLMA 4TUYB 1RM4A 3K05A 1ZNZA 3RKUA 4WIAA 3ABOB 1GQSA 2PBRA 2H4ZA 1CJCA 1FSZA 1JFFB 2Z1NA 3PD7A 1P29A 1R74A 2ZG6A 3IEPA 1N8TA 2QM3A 2VP5A 4KK4A 4TKMA 3H11B 1NSYA 1DKPA 1U0RA 3A1VA 5E3JA 2R47A 2YJGA 2A5LA 4KQ1A 1RPJA 1FFAA 2ZRAA 5HMMA 4P86A 4A2WA 5IT5A 3D5EA 3PXXA 4JFAA 4G97A 2HSEA 3HYLA 5CB8A 3MIZA 3PXEA 3I4CA 5LJIA 5HK8A 2W2KB 3BCSA 3TKAA 4YJDA 3B20A 3ODPA 1EUDB 1U11A 4IFTA 3RWMB 3OJ0A 4QUHA 3WJ1A 1OUMA 3PGXA 4QREA 3VR4H 1PZXA 4NH4A 4Y2HA 4V3CA 3TPZA 4BBPA 4BLSA 1PVOA 4NQZA 1ZK1A 4XGIA 1II9A 4IJMA 5JSYA 2PXCA 1R0WA 2Z2ZA 2PKRA 5CP8A 3GL9A 1XCPA 2H08A 3LDAA 4F97A 2W6PA 4DZRA 3IDSA 5C1IA 1H65A 1YQWA 3P9QA 4EMUA 1NPYA 3CRZA 1F5NA 4NFLA 3L8YA 1JA9A 1J06A 1TJ5A 2AKYA 3O3MB 3OQJA 4PLVA 2W90A 1TZJA 3MBKA 3KZKA 4F9TA 4INZA 2GXQA 3WOVA 4TV8A 3H5LA 3QA3E 1V25A 3E9YA 1PO7A 1PT6A 3D2AA 4WESB 5M04A 2VXBA 1YCGA 1AURA 1G5TA 2B78A 4BNHA 2FUEA 1Z26A 4RA6A 3L4BC 3U9TA 2IHUA 4BU0A 1PSZA 4KREA 3H5RA 4K40A 5C8YB 1PT9A 3HDTA 4ZJYA 2J31A 4FHFA 3QZUA 5TPWB 5EJ8A 2WD7B 3IAM6 3I5XA 4K88A 2GHIA 1VJCA 4DANA 4WY8A 2QLFA 3V80A 1W5AA 4HEQA 4RTQA 4NS1A 1OC4A 3ZN2A 2C7VA 4ISBA 1IOLA 1JPNA 3CUKA 1WXGA 1E7MA 1ECCA 3UB4A 1R9MA 1GWNA 1O5TA 1ZINA 2FQYA 3FYUB 1UBLS 2O50A 5JQGB 2NPFA 1I3OA 1Q1EA 2CFSA 4TTAA 1QR2A 4DOMA 1TT5A 1U3VA 4RPIA 2UXDB 2Q28A 2X6QA 3B1XA 3PBKA 5DGIA 1A7JA 4CCAA 1NQXA 1XQ1A 3N8IA 2ADOA 1PFKA 3AYXB 3FDJA 1JPUA 4N01A 3THOA 3LX5A 4RK1A 1MC8A 1OGIA 5TMBA 4C07A 4NYMQ 2B4RO 2VRBA 4YMIA 1YUBA 2VK2A 5IASA 3HJGA 4M1EA 3BGSA 3C3BA 3CTPA 1B8UA 3HA7A 5ESXA 2Q29A 1KEUA 5J63A 3TOVA 4BLOA 3LLVA 2ONJA 4OUDA 4HN2A 1JJVA 2ZSHA 1Y33E 2NYRA 5E1OA 3JU3A 2BGJA 3ACDA 1H8EA 4R2KA 4TM7A 5SYNA 4MUKA 2RHHA 3LF1A 4GVPA 3C98A 3TPCA 2I8AA 4RY8A 1DTSA 4DC9A 4DWJA 2NG1A 1OTXA 1WDTA 4ZHQF 1SXHA 2ZPAA 2JJQA 4JSYA 5JBQA 2HREA 4UU8A 1IB6A 3FPFA 1T8TA 5BMVA 1DUVG 1CEYA 1XMIA 3T95A 1A9QA 4I6GA 1KO4A 2D00A 1O5IA 2BIFA 2XDQB 4RWZA 5HR5A 2PBFA 3KWLA 1FIUA 3JZIA 2MSEB 2V7TA 4IRXA 1EUCB 3Q7EA 1SUAA 5FJJA 3TLJA 4GX2A 1Z62A 4TROA 4HX9A 4LJLA 3INNA 4H31A 1KI4A 2CW5A 2FV8A 1P0FA 1P4GA 3BEOA 2R79A 3AP2A 2J3DA 1SU8A 2CN1A 2EBWA 4HDRA 4UM9D 5FUBA 2JBWA 5J23A 2CXXA 2FLWA 1PDOA 3LWBA 3HJRA 1DHTA 4QIHA 5DLPA 2Y99A 5DSZA 3T38A 4D80A 4ED9A 5HM6A 2HLDD 4U7DA 5KNBH 4P5EA 4Q7KA 1Q20A 4YIKA 1LPAB 3AKDA 2ZE5A 1EMDA 5GVRA 5EXPA 4YV0A 5AUNB 1CVRA 1ZN7A 1E79A 1HRKA 5DYTA 3IDQA 3K35A 1AK9A 3TD2A 1VKRA 2KM1A 4Q01A 5GOTA 2J0QA 3TRJA 1WXDA 3IOMA 5A1TA 5KDDA 3VU9B 4YP5A 5B2EA 3LUJA 1I3CA 3DO5A 3G2KA 3KYDB 3PXBA 2O2IA 3PZBA 4CMIA 1XWFA 4FJ1A 1ISFA 2IOFK 2E5FA 4ENTA 1NMZA 2JFWA 1TZCA 1KE1A 3JRWA 2SKEA 5FTKA 2O8EB 1NTOA 2K2QB 5LL6P 1O96B 1V3VA 5IT4A 2UZ1A 4YAEA 1NAHA 3R6DA 3NUGA 3GPLA 3Q3JB 1NFRA 1NBIA 1Q50A 1RHQA 4LZLA 5AJTA 3P0FA 4IIJB 4BRSA 3ED1A 1QRRA 1LFDB 1BN7A 2OBMA 2XAAA 5K4AA 4UQLA 3IKTA 1I3KA 1S5PA 1TZBA 2ZSBA 3CJRA 3QUBA 3ZCVA 4B5KA 4E2ZA 4ENPA 3D6HA 1MB9A 4TGLA 3HFGA 4WLVA 2ZJ5A 1GT6A 3VR4D 1P1FA 4UVGA 3HGQA 1EM6A 1ZGZA 1PZMA 2EEPA 3WL5A 2MINA 1KU0A 1WTCA 3JQ7A 4PCUA 5IXSA 5C4MA 3JR3A 1FVHA 1S01A 2HDNB 1YL7A 4GZMA 1WRBA 2G8LA 2WIAA 2WLTA 1G66A 1MORA 3MD0A 4KACA 4F21A 4HXFB 3KBBA 3L01A 3NANA 2BTQA 4A8JA 1YC2A 4E5NA 1T24A 3IT2A 4GP9A 4HNGA 1C7FA 5JSKA 1ZS9A 3FPJA 4ND3A 4OP1A 5HKBA 1HY3A 3QVGB 1DXHA 4Z0NA 4C5CA 2F3TA 4C43A 1KO7A 5FX2A 3BWXA 1JYEA 4UU7A 1F8XA 1QONA 1X3LA 4JLSA 3C87A 1SBIA 9MHTA 2QAIA 2DKOA 3M4YA 3FGPA 3H9QA 3L18A 3O8LA 1NTRA 2BMVA 3A1WA 5KEIA 1OILA 1UUFA 5CW1A 4N49A 1KQNA 4MB0A 4LF5B 1LTQA 4BFXA 4YFYA 2G8NA 2VG8A 5HA5A 1R27A 3DZFA 1E63A 1X13A 3C7KA 5LWHA 3CRNA 1JXOA 2P8JA 1HSOA 1BXZA 5KYUA 2IL1A 2LKCA 1EA7A 1CRZA 1SCQA 4RK0A 3PICA 1NT2A 2R1VA 2R6CA 4MPRA 2O07A 4PU0A 2D0IA 4OAPA 5AVVA 1W0KA 3GGGA 4CT5A 1XTPA 2AF4C 4FILA 3FTFA 2QNBA 4WK4B 1L3CA 3K0CC 4BMPB 1Z07A 2NP6A 2RH9B 2ZI6A 4X64B 2WZCA 2HV8A 2OHFA 1PZGA 5EYPB 2WG1A 4KV9A 1PZFA 4FHDA 3MRXA 2N3ZA 4EKEA 2BFDA 4QECA 1Z4LA 2PUTA 2BGMA 1I33A 2PXAA 4LXXA 4G0XA 3J7AC 3HMQA 1N57A 1RZUA 3CR8A 2VQEB 2VDPB 1Q74A 3R09A 4LXYA 4BV2A 5JH7B 2WUWE 4RTOA 2ZSJA 3WNDA 2I3DA 1DCKA 4OK5A 4BTVA 1N4AA 1SBQA 2I0FA 1W93A 3C7DB 3OE5A 3WLAA 2JHAA 4IYRA 3P9ZA 5HRAA 2EIXA 2P65A 3FCOA 1X6VA 1YS2X 1XCGB 2VDUE 4PTYA 4X8LA 3QLTA 4QJ5A 1QVZA 4JKOA 2XTMA 4MLZA 1GSOA 3R23A 4LC0A 3B2QA 4GYJA 1ZK0A 4URVR 4XAQA 4NONA 1BCSB 2I2BA 3LVBA 2ZJFA 5JAUA 4LWPA 3OLZA 1E8DA 3BQNB 3E9MA 2H57A 1I9CA 4WZAA 4JLDA 4D44A 4Q4CA 4MP6A 2F1OA 2WF6A 3H75A 1E3EA 3BDIA 2JAUA 4TXHA 1G1AA 3RQIA 3W78A 5KJ1A 2X41A 3TAHA 2ZR8A 2QK4A 1Y1RA 2P9QA 1WZUA 3D3WB 4E3ZA 2QX4A 4INAA 1QLJA 3BJMA 1HKHA 4Q7LA 4U1RA 4UXIA 2WWHA 3VI4B 5G4KA 3G5LA 5HJ7A 3DOEA 3CJQA 4OP3A 1SZDA 3A6GA 3ZU6A 5KNBD 2I3BA 3JD1A 3EXAA 2WM8A 1DBPA 2C5SA 1J56A 2HOQA 3DGFC 2VHXA 3ICWA 4N18A 4U5QA 4R9NA 1CB0A 4FS8A 3WIBA 2Q2WA 3EA5A 4BQEA 3K1ZA 3U44B 2PT6A 3KP1A 3ORRA 4G0PA 3K6JA 4IJ5A 2WUVA 5FQOA 3N70A 1I4LD 3EC2A 1NJFA 1C9MA 2VQ3A 3D9QX 3N2KB 1U1FA 2B92A 4IW3B 5DULA 5LZ8A 2CBXA 3FVQA 3IIIA 4HUTA 4XYBA 2XE8A 3TVDA 1QQAA 2XXAB 3U3JA 2O9JA 5HUHA 1U7XA 1UKEA 3NUQA 3GC6A 5H80A 3KUDA 4LMRA 1XXHB 2A94A 1E6WA 1EWYA 5DRYA 4OMFG 4Q3CA 1V11A 1Y5LA 1QGAA 4FOTA 1P2FA 1DQPA 2FN4A 3TM4A 2CY0A 1BGVA 3LO5A 2XMBA 3UYKA 1YQXA 1E98A 2OLJA 1XTSA 3G1UA 4L15A 4PPQA 5F5LA 4R2HA 4RD1A 3DAOA 1PRYA 2WJYA 3LF2A 1KSFX 3OKFA 4J2OA 4JBHA 1HOTA 3Q3EA 5LUBA 4DKJA 4TLLB 4EHLA 3QLVA 1EINA 2X8JB 5F2OA 4C0HA 3I1FA 2MSWA 2BGUA 3WRXA 3DLHA 2IODA 2IFTA 2Z04A 2CLIB 2Z0MA 3C1UA 5DSXA 3RSLA 4YRTA 2UVQA 3DHEA 3OWOA 4N03A 5GQSA 4WJLA 1J1ZA 4KIWA 1A9TA 1WMSA 2GZRA 2P5UA 4EHAA 4B3SB 1NE7A 1SOVA 1T1RA 3LSYA 4Q1FA 4FE4A 1TT7A 1UPCA 1PNVA 2JI6A 2VSQA 4AFNA 4DJFC 4JI0B 1D6MA 1UXOA 4XDYA 4DYVA 1K08A 4LDQA 4HPXB 4HWRA 3U3MA 1IXYA 4BVAA 1BQ3A 2X3YA 3FROA 2HJ9A 2JFUA 4ILEA 4O2BF 5I3CA 1BDMA 3OCWA 3BSYA 3K70B 4HQKA 2BFAA 1I2ZA 2EFHB 3IULA 1BVUA 3WWEA 2NIPA 4NI5A 1I7LA 1D2EA 4WN9B 1DUSA 1NJ5A 2IVZA 2OZPA 2WP0A 5FJIA 2X0DA 5EWLB 3AKEA 2QYSA 4REMA 3GRAA 4RGBA 2GLXA 3WGQA 1V0JA 1A9ZA 1ICIA 1PFGA 1PP4A 1K0UA 3BMQB 5DEOA 2HWKA 2BTEA 1RFGE 2P9BA 3MG9A 1CUJA 1U99A 4H4DA 2XYHA 2ZQYA 2FUKA 3PF8A 2RBGA 3RRJA 1AGRA 2VK1A 1YSCA 2HHJA 2XD4A 1HI9A 3QFRA 4PZ9A 1TTQB 4Z0PA 3PFNA 4Z2YA 3IAXA 3CA8A 3BZWA 5ICFA 2CHUA 5AXDA 2DPLA 4AZTA 3FVTA 4PXYA 2JD0A 3NAGA 1KI2A 4DG8A 4X00A 3NHFA 1J5XA 1OX6A 1I14A 1OXVA 3CC8A 2QM7A 3D6MA 3HVJA 3OI7A 5EXTA 3L4EA 5ECWA 5B2ZA 1RRKA 1NT4A 4MGEA 1IHXA 4NZNA 1ZX1A 1J8YF 1P75A 4I0WB 2K2WA 2ZEJA 3AVUA 4GOND 3UN1A 4BFUA 4DCPA 4UCFA 3O9VA 3JVVA 3FPCA 1JS1X 4RHTA 1JJ7A 1YVEI 3ZWCA 2H4HA 1W96A 2R11A 4L1KA 1J2UA 2GEKA 1GPWB 1CDOA 4NU8X 4RVSA 1PEKE 4FFPA 2YXDA 2GPJA 3I2HA 4J94A 1K5HA 4RE5A 1SPBS 1YJ5A 4TVOA 1K8ZB 4CG2A 3SS8A 4NMXB 1W34A 2C0CA 3EXFA 1X1TA 3HLYA 1KVSA 3OT5A 3UCXA 4F5WA 1PUJA 3LA8A 2IYNA 1KAGA 2NVWA 2P9YA 3BRCA 1PL7A 4QDZA 5BW4A 1FLNA 2SKDA 4XCQA 2A5FA 3CFYA 3PX7A 3AZQA 2PM8A 2X1VA 1Y5MA 1BROA 3N07A 3NR2A 5HCIA 3AJAA 2A9RA 4DBLC 1A2QA 1OASA 3FTEA 1DI0A 1MJGM 4IVRA 1U3CA 4I46A 3V33A 1LI7A 2C8LA 1XQYA 1JRLA 3JVIA 3E53A 3D8UA 4A26A 8ATCA 1IWOA 4N3GA 1JR6A 5A3QA 1TC1A 4IZHA 3R0JA 2A35A 1HYEA 1U3TA 1COZA 3IAFA 1RCUA 1GFIA 3SZRA 1PLLA 5SY9A 4G5YA 2YHBA 3S2IA 3WG9A 1UPAA 1I4OA 3CURA 3NM5A 2B5OA 1VHQA 1KEEA 4MEBA 3LWZA 1L4LA 5IF3A 4JLBA 1ZZEA 3RRXA 1OROA 2OCDA 2ZSFA 4OQ4A 1PEAA 1VL0A 1N9KA 1NP6A 3MWYW 5KBYA 1BDIA 4LXQA 5I7WA 3IHLA 1JMVA 4EYEA 4XX1A 2NZ2A 3R0VA 2J0VA 4HNTA 4ZYYA 2AN5A 1E2NA 1TYDE 4P4TA 3EIXA 4YMVA 1QTRA 3IQHX 1MIHA 3AHIA 2WKPA 3U37A 3PEVA 1DARA 2OXTA 1KJNA 4ALNA 3N0WA 4HADA 1G5PA 1E1KA 1KI7A 1VGVA 4Q03A 4LA4A 2JB9A 2CJWA 121PA 1JDUA 2DP4E 4B3BA 1OFUX 2GUWA 5HTKA 1V8DA 1W6RA 1N9GB 3NALA 1AOXA 4PM4A 5LU8A 1C30A 1EHYA 2C2BA 3G0GA 1DS6A 3QU9A 3UJ6A 4KO8A 5KJFA 1E1CB 3MGAA 3PJEA 4OK6A 3WISA 3TIFA 4EG3A 1JKMA 2QQ0A 4V02A 4C0KA 3KR2A 4C7VA 1TK3A 5FHRA 5EAIA 2HLNA 2KHZA 4X71A 2QVLA 3O4HA 2GAAA 3MWGA 3U49A 4UTXA 4MLCA 3WIOA 4ADSG 2XZPA 3A1EA 4OLBA 4MCJA 1EFVB 4DCUA 1YQQA 5BR7A 4IIDA 1UFQA 2Z2KA 3K0AA 3WBFA 2X76A 3DD1A 3ORHA 1ECJA 5KYXB 4D3DA 4E13A 9ATCA 1WMDA 2BGWA 3K4HA 4PPYA 1GU0A 4UC0A 5GM2A 1EWVA 4O2LA 5ITVA 2C9MA 4O2BB 3WL3A 1YIAA 3SVZA 1DQNA 4GM1A 4AF6A 3TLXA 5D00A 3ZJVA 4DR5B 5E8JA 4FFRA 1W4LA 1ZI6A 2Q07A 2WTUA 1KQOA 2FRVA 1GLNA 1ZNWA 4G63A 4JC0A 4Q4JB 4QEZA 5G53C 3E2MA 3ESDA 4FFOA 4YAGA 3UJDA 5JTTA 2LVBA 2GN6A 5F33A 2NO1A 1O0BA 2CL0X 3HK2A 3WO0A 3HFSA 4E09A 1LC3A 3BA1A 4BB6A 5AW3A 1QE3A 5DM0A 3U39A 5AESA 4GL2A 2WUEA 1CR2A 3DF9A 1DSSG 1KDPA 3S1AA 3LZDA 4Z99A 1BD4A 1DRKA 5C8DA 2B1IA 5A9SB 4G0YA 4GWGA 3T6KA 2ZIWB 1K3TA 3VVBA 3PX2A 4RYDA 1FUIA 2AUMA 2XRYA 3GRFA 4JNKA 4O4HF 4IEIA 1PAUA 3WGYA 4BNZA 4BWVA 4ZDJA 4OX9B 2R7MA 1Q0SA 5IAEA 1J8QA 2XMRA 5TS2A 2OFWA 4OHBA 4C89A 4RA9A 4MV9A 4KQEA 5DM2A 3K9HA 3AM3A 1LBIA 2IP4A 4GKJB 4BFWA 5CTJA 3LDHA 1GXSB 3EWIA 4WW0A 3TBHA 3C3DA 1I51A 3P2YA 3IE1A 2C3UA 4V1CB 2ZI7A 2YHUA 4CVNA 4OLAA 2W8BA 1N6LA 5ALUA 3L4KA 4FWBA 2FYTA 3K9QO 1TVCA 2QN3A 1DDIA 3H4TA 3OPYB 4TZTA 3PSHA 2A9QA 4P2GA 1M6WA 2LIVA 1O97C 3IP8A 5CBPB 3NTQA 4Q12A 4X7PA 2RBKA 1EVYA 1N3YA 1VL6A 4Y67A 3ZV6A 1WZ2A 1F6DA 4CI0B 1M6YA 3D31A 3PWZA 4NK4A 3WYBA 421PA 5DX8A 4DMHA 3EXG2 4LGMA 3R5TA 5LM3A 4RF2A 1JR3A 4P32A 3M6VA 1PK8A 2PKXA 4OXIA 3RG2A 4F4UA 2XGSA 1T2AA 2NT3A 3FSJX 3PNYA 4OSEA 1BE6A 2ZIVB 2NXJA 3NRJA 1GY8A 4HH4A 1RHJA 5A4AA 1KK1A 4JX9A 3DJYA 4CG3A 3WGOA 2W43A 4RLQA 4ND8A 5ELXA 3A1UA 1OWOA 1BH2A 1HE1C 1QS0A 2Z95A 4J0EA 3EHEA 3GJ5A 5IEBA 1O9GA 3CVJA 5KOHB 1X0VA 5IM4A 4EVIA 3R40A 2XWPA 3I37X 4FFMA 3TFOA 2C4MA 3GLFA 1V5GA 2HTFA 2WW8A 2ZATA 4P92A 3UV6A 3WBJA 4EH1A 1WZIA 2XA2A 4HRVA 4KO4S 4OSPA 3V7FA 1M2KA 2EARA 4MS1B 4BJ5A 2O2EA 2Q46A 2SBTA 1R4MB 1JX6A 1I6KA 2PXXA 3B3FA 4GOLD 4KI0A 2XSZD 2ZSDA 3ZY2A 1QRDA 1HUQA 1P6QA 3CR7A 3FCAA 4RZQA 5FHQA 2BJVA 3N59A 4JZYA 5TQJA 3ZXSA 1XAGA 1Q19A 2PXHA 3BD8A 1NUQA 1SU7A 4UUMA 4ZYZA 1L1RA 1OFGA 2WYWA 1LVUA 2ECOA 3E15A 3NETA 4RNDB 3DL2A 1P2SA 3MJVA 1IUPA 1ZIPA 3PC8C 4G0NA 4PXSA 2NTNA 4GWKA 3WKDA 3ZXUB 4DSZA 3DP7A 1RJDA 3TI7A 3YASA 3RGGA 3B78A 4B35A 1XZFA 2H29A 1Y5RA 1NBOA 1OGJA 2PNJA 3RVPA 2QLNA 4KBFA 2BBWA 3RAEC 3UWPA 1NW4A 1S8FA 2JGRA 4R4JA 3A9RA 3PNBA 1IHYA 4J7AA 5JAQA 4ZYLA 4P3YA 1XNRB 1YZQA 2IZZA 3UK7A 3FDZB 5EFZA 1Z0ZA 4HNUA 2XZOA 4DR4B 5CDSA 1ACJA 2OV6A 3F3YA 3G2JA 2LGJA 3AIMA 4UE3S 3LU1A 3FOBA 3FPEA 5HXAA 3VNVA 1ICEA 2CCJA 3GT0A 3V1MA 2ZR7A 4AZVA 2GA9A 4AICA 4EBBA 2REQA 3OCUA 3ROPA 4JVMA 1UWCA 1BX1A 2PZFA 4R3UC 5JWHA 3RSFA 5CB4F 2XE6A 5ARCA 4A8JC 1G3QA 2X8BA 3D8TA 4GI7A 5LA6F 4EGAA 2OXRA 1Y1TA 2XGGA 3KUKA 1SCUB 3L6BA 4Q47A 1BD3A 4H1HA 4HX5A 2CBZA 1KQ3A 3KEQA 2HADA 2D4AA 2QU8A 4FUQA 4IMJB 3HXOA 3BKWA 2I22A 2A58A 4AO6A 4ZI7F 4DMFA 3THYB 4FGUA 2PZKA 4G4GA 1JW9B 4MUMA 5AKLA 4EHNA 5LXTB 1Q1NA 3OWHA 3JALA 1XFDA 3UANA 4OHCA 4BC0A 1DG3A 3HBFA 1QUFA 2GERA 3R6GA 4A6EA 2HY7A 3IIMA 4RDIA 5KIAA 1TLFA 5CG2A 2UYHA 3I04M 1II8A 1WO8A 4W1SA 3VKGA 4BNDA 3D5QA 1QFZA 3AG6A 1C1DA 1F8UA 2HIAA 1DMRA 4I2VA 1GL7A 1BSVA 2DPMA 3EEIA 3GJSA 4FFLA 5E8RA 5ADVA 4EYQA 1BN6A 5I9SA 4HUJA 4B9EA 5JARA 1FNCA 1F60A 1NAIA 1Z6XA 2EEZA 2VBGA 4MMYB 5COQA 1NF2A 1T2FA 1QPBA 2HPZA 3LP8A 1YKFA 4O4HB 2VCEA 4V0ME 1MRZA 1LGYA 2AOTA 2WSIA 1Q1BA 3NTRA 1TJNA 3ZHTA 3T52A 1FUEA 3DTVA 3PQ8A 3LBIA 1YJCA 2COKA 2XQFA 2XUZA 3M9LA 3E4DA 1LKZA 3L0PA 5F98A 3IBCA 4OM8A 3V7WA 2NZJA 4GGMX 1EKXA 1DOHA 2EP7A 3BB1A 3D1LA 3I39X 4K9RA 1QQ7A 5J2TF 1E6LA 1LBTA 1R1DA 2WABA 1YS1X 3AR7A 3WC4A 4F4JA 3GQBB 3H5AA 4ETWA 3OIYA 3K0FB 3WO1A 5A4KA 1O77A 4L8LA 4Y8VA 3JD0A 5F23A 3PTLA 1DHRA 1EK5A 1G3MA 1H2BA 1KVRA 1POWA 3PNPA 4PX2A 5CNKA 2E9SA 2VYCA 4CEJA 1DCFA 1DIRA 2BFCB 3AONB 4Q3NA 1CE8A 1IDOA 1GTVA 1KP3A 2QTCA 2VJLA 3CUYA 4CLRB 1ISRA 3AVXA 3NBUA 3RWOA 1E58A 8GPBA 2I7VA 3EIEA 4PC1A 3C3YA 1LQTA 2H06A 1JDTA 2Y9MB 5KMGB 1F0YA 2JCSA 1D2CA 1N4DA 2XA9A 3GGJA 3HM2A 4LF6B 5C52B 5SY6A 3IODA 3G17A 5JCPA 3CN7A 4WUVA 2O5CA 3ISVA 1B8NA 1RBMA 4K6KA 3VZRA 4OK3A 3AI2A 2VYQA 1DINA 4IKEA 2BGKA 4KL8S 3QKSA 4XQEA 2PS3A 1Y5IA 3FW1A 5BSUA 2O8CA 3ZU2A 1PTJA 2FCAA 1C5KA 4ZO9A 4JI5B 5KTTA 2IDMA 3U26A 3C5VA 4KXNA 2F6RA 2PCJA 1GM5A 3HBLA 2NU6A 4X97A 3MC1A 4NZYA 4HLNA 4L51A 2EL9A 2XECA 2JK0A 1QVRA 1X7XA 3LPMA 5ALKA 4M88A 1EHCA 4L76A 1VE5A 3SZLA 2BUCA 3FOCA 2G1JA 1R0CA 2WNSA 3PA6A 3KIPA 3X1KA 4Z1MD 1W36D 4MGIR 5C53B 1CZRA 4N5NA 4P53A 5T5QA 4LJ4A 3WDKA 4GPZA 4BE9A 1VJ0A 4YT2A 3ZY3A 3EPRA 1USKA 3VO1A 3VSAA 4KYVA 4F84A 1BWRA 3IL2A 3UMGA 2JH8A 2M98A 3IILA 4Q3BA 2RI0A 4P0TA 3ZWMA 1I24A 2ZYHA 1QVWA 2Z9CA 5EL0A 3QLVC 5FLKA 1Z6ZA 3HUTA 4DLNA 5BWLA 2BGRA 1L6RA 4BMOB 4DJJA 3OQVA 3RKSA 4UDYX 1NUHA 1UJ5A 4KB5A 3O1IC 3WRXC 3WR5A 4ZK2A 7GPBA 3CCBA 1RJ9A 4CLHA 2Z5FA 3C85A 5COBA 4JBLA 3VVLA 5CCBA 1SXJB 3F7MA 3QPWA 1SG0A 3ONNA 3SX2A 1EFPB 1SRRA 1YMQA 5JVDB 2G77B 1OH8A 4L8WB 4OQDA 2VSXA 4XVCA 1NE2A 4OJYA 1DKRA 4DXHA 1J97A 3PUXA 4A8HA 4C0QC 3REGA 5LA6B 1AQIA 1ISSA 2HB6A 2EW8A 3EIWA 4Q00A 1XNQB 3GRUA 3SC3A 3RUAA 1HDCA 1ZHOA 1GHTA 1SHKA 3GARA 2V4MA 3QVLA 4BIIA 1FP4A 1U0FA 3KRTA 3TDMA 1XI2A 5I47A 4ZI7B 3TTYA 2IQIA 1JR4A 1GPDG 4KX3A 1USGA 5IP5A 2ZROA 1FVXA 4G89A 4PX5A 2HK7A 1OFVA 1TYAE 1F20A 1KR2A 2EJCA 1MO3A 4NBSA 1KMHB 3EXHB 3P19A 1SVMA 4FMPA 1VJ1A 4KN8A 2GVDC 5KI6A 5GONF 2JLQA 3ZDYB 1NNEA 2OHHA 2JDIA 1E2LA 2ZTHA 1WLSA 4WZBB 4YMSA 2B2CA 3MCVA 1VPEA 4I1UA 2YVQA 2VDKB 2IYAA 3MCAA 1Y7IA 1RXCA 1TMOA 3Q7TA 1PF7E 4PAGA 2JIZA 5DHAA 1TLLA 4DLVA 5C7IO 3H9GA 2F1IA 4JBYA 3HS3A 1K0FA 4YJ2F 1IZ0A 3Q40A 2EZ8A 1D2RA 2WIKA 3EW9A 2QBYB 3ER9A 4F3RA 1MJGA 1KFBB 3BERA 3K30A 4URYR 4CKXA 1QRUA 2QA5A 2GBIA 2QIOA 3QEMA 3FG9A 1Y1PA 3G2OA 2MYPA 2W71A 3Q10A 4PZ0A 4MQEB 5JPCA 3VOAA 1NBEA 3AF2A 1L5HA 2CZGA 1Y42X 4O1MA 2Q3MA 3M33A 2A84A 4ZPJA 5EY5B 3SK0A 4CMEA 2HQBA 3OE1A 3OZBA 1NPDA 2XDWA 4DNPA 2KPOA 1HORA 1RE1A 3MCWA 4W8OA 1FLDA 5BPHA 1YVRA 2Z2XA 3BQ9A 1PBNA 4A0HA 3AVWA 3MQ2A 2PS9A 5DYWA 3VQTA 4AUNA 2BBOA 2AOXA 2FPIA 1CTQA 4PAOA 1XA3A 5JZ9A 5FUYA 4WOJA 3ND6A 5H3CA 5CT9A 5F12A 4UTVA 3OH8A 1BFUA 2ZJ3A 4I9NA 4JI6B 3A6HA 3TJRA 5I4BA 4B3TB 1HYBA 1GG8A 3V4OA 5IWCA 1AMOA 5EHQA 4YRIA 2OO5A 1I2BA 1QHFA 3LHFA 4AO7A 5K3AA 1FJHA 4GOMD 3ZHVA 1SKMA 1L5QA 4R2JA 4YRSA 1QANA 1GU7A 3UH1A 1XRRA 4PYRA 1N1MA 3PCTA 1X42A 4Z3DA 5IJZA 3C39A 1JHUA 3X0DA 4KPUB 2XUKA 1KYYA 3VNRA 3I5UA 2BYTA 3EOBI 3D0RA 3KYJB 4JNCA 4LMPA 1TTPB 4DIEA 1RIFA 4ESVA 1PTKA 1R0BA 1YU9A 1Z22A 3BMCA 1NNSA 3AR4A 1JLKA 4P7KA 5LLSA 4ARCA 3D4IA 5EWJA 2GCIA 2QR5A 1W76A 2MOKA 2NWQA 5G02A 5BWCA 1YDEA 1N2OA 2DBRA 3DHNA 3KD2A 1F17A 3M6WA 2ZYSA 5CDFA 3GJTA 1JKXA 5D3KA 5MN5A 1AUQA 1XALA 4ML3A 4PZEA 3WRVA 4W1QA 1YS4A 1SRQA 3AR3A 3NGMA 4JJEA 3S27A 5A4MS 1QZXA 4U0KA 4CFSA 1VE1A 2RHJA 1L2TA 2WC1A 3JVDA 1E6EA 3QX8A 4Q3OA 2AMJA 2NPIA 3CEJA 4UAGA 1X7WA 1E2JA 3W5VA 5IYZA 5JU6A 2YFKA 1GPJA 1E1QA 4DB2A 1S89A 1KY4A 5JJCA 1Z38A 1UT8A 4N0PA 4EX6A 4QDOA 4M6WA 2XY4A 4QPNA 4EFMA 1Z13A 1TQ2A 3L92A 2CHGA 4GBJA 7MDHA 3BHMA 2FN7A 2Q2QA 2GJ8A 4M36A 2C3OA 2HZ7A 2KWIA 2OPBA 3KVOA 5CFLA 4GMHA 3L4JA 1EVIA 2VQFB 1MTOA 1OT5A 5LNK6 3EHDA 3D54D 1VYHA 3GVIA 4QGSA 4OI2A 5JNRA 3C8ZA 5BN5A 1SC1A 3AUYA 2X2OA 2R00A 2P3QA 4TMVA 4ER0A 3FNRA 4HAVA 1GYQA 3HKEA 1EWKA 4QUEA 2NU7B 3LQFA 1RLJA 3PFBA 4L9RA 5DYIA 3E9RA 2NXWA 4DIMA 3B1FA 1TO1E 1S9HA 3BWEA 4KQKA 4JL6A 1ADGA 3QKIA 3I9OA 1NVMB 3ZUPA 2FOLA 4ZMRA 3EQ2A 1V9CA 2E2WA 3VU8A 5A7HA 3ZUGA 1GSIA 2WG0A 3WSWA 3ZE6A 3PR2B 2C1ZA 3L0SA 1SQ0A 221PA 4JYZA 3U3XA 4KBYA 2GN8A 3A6DA 5BW5A 4XDGA 1W5TA 2WIJA 4EPXA 3OE7D 1FP2A 1APBA 4DQVA 3ZH9B 1GZ6A 1VG9B 1SB8A 2Q5CA 5BYKA 5IG2A 2AS0A 4AD8A 5CNMA 4OGFA 4W5HA 2VAVA 3R7WA 1T5SA 3GVHA 5DCYA 5HSGA 5AHKA 4JT2A 4GUAA 1SBYA 1CUXA 1WOMA 3DGEC 3P9SA 4YS6A 4YYEA 4AWXA 4B33A 3WAJA 5D5PA 4ARIA 4N39A 1RQ7A 3UJ7A 2GLTA 3DLAA 5AKHA 3GCXA 3AZPA 5ER9A 4EO7A 4XPZA 1WG8A 3D6VA 4X1YA 2FWBA 4CF6A 2VZEA 3QV2A 3NIGB 4XGQA 5GONB 5EQJB 2IXBA 5C7OO 4C22A 2EBFX 2PT9A 3GUCA 3OIFA 4OHMA 1XQXA 3I9V6 1GTSA 5EG5A 3QHPA 3CLTD 4XI9A 4EJ0A 2PEZA 2HHHB 2P6UA 1IY8A 1C81A 4IZ6A 4JLNA 3UAWA 4MGZR 2IU4A 4DEVA 1ZH2A 5C80A 3HDGA 2BZ1A 1MO6A 3DOCA 5T3YA 4QUAA 3S2UA 2XVXA 1E4OA 1GR1A 4JJ4A 1R37A 5I7AA 4DMGA 3KJGA 4URWR 5JS1A 3HCEA 1G20E 3EPHA 1SVNA 2CLDX 2CLKB 1Z74A 5EE9A 4BJHB 1SXIA 2P40A 3FZNA 3ETLA 3LC2O 1JFTA 1NLFA 2G40A 1Z34A 2YJ5A 2H52A 2JH9A 5BSRA 1M75A 1CK4A 2G5GX 2ORVA 2FE4A 3GUHA 3OOWA 3PHHA 1T8WA 3IMGA 3CNNA 3VISA 3EDCA 4ZCIA 4CQMB 1Q12A 2JW5A 4W9NA 4HTFB 2Y9PB 1XVAA 7ADHA 5K8IA 1SPXA 1CYEA 1XLTA 1VIVA 4TWZA 2FA9A 4JI1B 3D0KA 2NU9B 3QKRA 4LF9B 1ZM4A 4TRJA 3BMOA 4ACBA 4AIIA 3ZKWB 1N5JA 1XPJA 3GOHA 5FB3A 4EMSA 2NUAA 1SVSA 4I9FA 2Z56A 4WK6A 1KWKA 2H1FA 1WE2A 4F4DA 1R8QA 3R8XA 1VHLA 4DUPA 3L0CA 3VAAA 2PX0A 3H05A 1MC1A 3ASZA 4CEIA 4NMWA 2APJA 1AV7A 3PYMA 4CBVA 4IH1A 1HG0A 2W5UA 2ZYDA 4B85A 1J8VA 3Q6MA 2VATA 1JQAA 4OJMX 1C4OA 4ZPXA 3AVPA 4ILKA 3WMWA 3SZMA 5KKNB 1B3RA 2Y2UA 1T0UA 2PMWB 4LOAA 5K03A 2Q1TA 2ENWA 1M2OA 1M2WA 3ZS8A 5B7NA 3S28A 1M5RA 3E9QA 1ZO8A 1TJPB 2IUEA 5KYTA 1VHDA 1KTIA 2OVFA 2XNCA 3ANXA 3SP1A 3VXKA 2C82A 5A62A 1ZMBA 2CWDA 2IIPA 1XF9A 1PV4A 3E7DA 3KKPA 3P9IA 5LQCA 2WAYA 1DRUA 3TZKA 4HZUB 5H16A 2ZVPX 3SF0A 5EIFA 4CLXA 1PSDA 2XHZA 5C7YA 1YRBA 1GGMA 5C1DA 5C37A 3WP1B 5KINB 3NNSA 3T7RA 2QAGA 2ZJAA 3GJQA 3NHLA 2XUHA 3F7TA 4J4TA 1OFIA 2E18A 2HLDA 1WMBA 5AW2A 3GLKA 3L5OA 4QQNA 4BTEA 4D3YA 5K4HA 2PG3A 4UTRA 4EG1A 4KN5A 2QPAA 4QRIA 4Q9HA 1I0IA 1EX7A 1OLSB 3I04A 4XW2A 3SQOA 1NWHA 4ALLA 1ZSVA 2HUPA 4CGYA 1Y4SA 1YZ3A 2FFRA 4R5MA 3QV1A 2HQSA 1JHVA 3UWMA 3E9DA 3K5HA 2F8LA 4KIGA 2BMEA 1XE3A 2TSYB 3BTSA 4PYMA 4F8EA 3GRCA 4DJAA 3FIUA 3O3NB 1WP9A 3FNEA 4LBZA 3ENNA 3T3DA 3UUEA 4XFKA 1HZJA 3M6MD 4TS1A 1IZ9A 3A7EA 2BM8A 2PSJA 4GXRA 1G21E 4LN1A 4NYMR 3FTPA 1LTHR 4HYEA 3OA2A 1NBWB 3DDHA 4O8ZA 1RCTE 4CV0A 3EG5A 1AM4D 2XX3A 4OKNA 4QOSA 1QHEA 4C5AA 4AJIA 1PYDA 5F2NA 1V3TA 1F0NA 3UPTA 2D2VA 4J16A 1XMVA 2B0CA 3P4XA 1I36A 2X9GA 4N6NA 4ENSA 1EE1A 1N75A 2OCPA 3CONA 5TC4A 2J7PD 3S2GA 3MNFA 1GRCA 2C4VA 2QJOA 1SGWA 4G0ZA 1CJMA 4CIYA 3MT0A 3WYEA 2IIBA 1O95C 2FQXA 5J43A 3PVSA 1Y8QB 4KMOA 2A67A 3CUUA 2PH7A 2O3QA 3PUVA 2E1RA 4R41A 1DL5A 2H51A 3BHIA 1A9YA 3EFHA 5K0FA 2Q5OA 4OB8A 4TSFD 4WLOA 5EEHA 2H5IA 4ZQIA 5LDHA 3GFVA 4IMIB 3ZR4B 1HDIA 5DFAA 3JWEA 3TTUA 3VR4A 5F52A 2Q6TA 2UVDA 1NVVQ 4IOKA 2P2CA 5DYYA 3V42A 4NSNA 3KQKA 3UV7A 4NOJA 3VNBA 1ZNQO 2C2WA 3PFCA 1JAHA 2PYIA 3DOFA 3KYCB 4BMNA 1XROA 2R8YA 3OT1B 1H4VB 3V8BA 4P4SA 2QL5A 4M7OA 4K2HA 3RC1A 2VDJA 4KUEA 1QKJA 2R1TA 2H8KA 1OAKA 3ITDA 2NV2B 3ROXA 3QWIA 4AT1A 4NCAA 4J7CA 2V54A 4G0QA 1R5OA 1SCDA 3JQDA 2Q6IA 3HJNA 4GR5A 2R6AA 2C3YA 3QPBA 1TXGA 1O57A 5DP1A 3W79A 2IZ1A 5DK6A 2RIRA 1YZVA 4DUGD 3B1VA 4RK4A 2O2SA 1VGRA 4S0XA 2HRQA 5BNTA 1EE9A 2XEXA 5AVRA 2COEA 3QQPA 1M2EA 1WL8A 3DUFA 2OV8A 5KYYB 1BKSB 2RKWA 3C16C 1DAGA 1XK6A 3UPDA 4S0ZA 2GHQA 4ER6A 5B12A 4BVGA 4ZGWA 1IHUA 3U5ZB 2XCRB 3AEYA 3CX4A 4JLKA 3MFYA 4HDAA 2Y0BA 1OAAA 4ICIA 4OGKA 5M29A 4KR6A 5JECA 3URKA 5KSZA 5DI3A 4OMUA 1KEKA 4JLAA 1U2ZA 3W0LB 3B1WA 3LP6A 3BILA 3ZHBA 1QH1B 3CZCA 1QMGA 3BCUA 4B48A 2Z4SA 2XQVA 1SBNE 3TB6A 3EBLA 1Y4AE 3E8XA 2FPGB 3T3IA 7REQA 1DAFA 3AESB 3V1UA 2L82A 2QPTA 1BMFD 3BFPA 2IY9A 2JAWA 2I03A 1IQUA 1E9CA 4YONB 4OMCA 4R9UC 2D2XA 3CBQA 2C5FA 1VA4A 4N8DA 5FI1B 4XFDA 1IM8A 1T5HX 1VCOA 3ZCQA 5C51B 3QEOA 821PA 1J21A 3IVRA 2IYZA 3WYDA 2QROA 4PAQA 4UJ5A 2BFNA 2OQ2A 2EC5A 3G0BA 5A05A 4B1FA 4HDSA 4OLHA 1Z2NX 2IW1A 5TLSA 1XXLA 3GELA 3OQ1A 4LDPA 3HGMA 1YOVB 2PGLA 3DZGA 4NCHA 4NCJA 2XRFA 3SLKA 4CMHA 2W48A 2AG1A 1U7TA 3CRMA 5HGJA 3DXYA 1SB9A 3WK4A 2W2MA 3IURA 1JFRA 2QMUA 3W5JA 1HDEA 1IY2A 3H9UA 5F21A 1X7ZB 1GPYA 3ZNNA 4W5JA 3DVSX 2NV6A 3GDWA 1T34A 3CKYA 1B41A 2Q0SA 3H16A 1BE0A 4QBIA 3SD7A 4H1UA 1G7RA 3GRVA 3DT9A 4FYJA 4LYHA 1OBOA 3ZDRA 4DIFA 4MWBA 2QSYA 3HKBB 4XYLA 4N47A 1DV1A 3HB5X 1MQ8B 4K1LA 3WLRA 1XZBA 5EGNA 1EM8A 1GPLA 4JI7B 2B3TA 5IDYA 4PNZA 4MVXA 4KJZA 5BW8A 2QLBA 5A0VA 3HEAA 4FIDA 4QYXA 2XWSA 2DY0A 3W5DA 3K6SA 2ZRDA 3ILYA 4MH0R 1AIPA 4QAJA 2ZJBA 3FIJA 1QG4A 4AX4A 5C5CA 4QL3A 4ZI2A 1M2GA 5IAOA 2NN3C 3KKZA 2CNBA 3V55A 4WXRA 4D82A 4J3NA 5AW4A 2IRWA 4S1OA 4TWIA 1Z0FA 4JB0A 4MR9A 4YP0A 2WHPB 4FEEA 5C35A 4LJAA 4GPBA 3PXAA 4B3HA 3EXEB 3NXSA 4HSEA 2CLOB 3ODGA 3ADBA 1B3BA 3KHTA 1QYXA 1W5EA 4G6ZA 3WK9A 1ZICA 5IVKA 5U1PA 3K0HA 1ADYA 2OXIA 4PSCA 2DFNA 1KBOA 4JJ6A 2Q3CA 3FLBA 1MB0A 3RS8A 5C8VA 5K9ZA 1Z6AA 4MVCA 1M7BA 4ZWNA 1ISMA 3HUUA 2AYYA 4FTWA 1ODJA 2FOXA 4GS5A 3BYZA 2PEYA 4D7AA 5JO0A 4Z3KA 4A8PA 1L5KA 4CL8A 5IC6A 3UY4A 3ASVA 4U2KA 2NP7A 1IVYA 4M1KA 4D4MA 3HVUA 4AKTA 1C9YA 1WA5A 3OBIA 2HEGA 4Z3OA 2XZDA 4KNYA 1HYGA 2IYUA 4UHCA 1YB5A 2HMWA 2VK4A 3G3EA 4YJ3A 4ALIA 5KVCA 3P7MA 2SKCA 4KC0A 2IZ6A 2IC5A 1P2UA 4GPTA 1ONPA 4IPTA 4BWFB 4DTIA 5KOJA 3GWZA 4LTDA 2I1VB 1BHSA 1F2TB 1KPHA 2QMYA 3DPSA 3PR1A 4P9NA 4ARZA 2HFKA 4GRAA 2ACEA 2AVNA 2WOOA 3QXJA 2P41A 1KI9A 1SG6A 1U3WA 4V0LA 1AB6A 5HS4A 1E9FA 5B6JA 3K70D 1H0HA 1H2HA 1N2JA 4LVOA 5G0WA 1U0EA 1NFQA 5DJ5A 5IVHA 1U0GA 1KEVA 1PT5A 3FNHA 2VBCA 4LHSA 4M60A 4XM2A 2GA8A 5FPTA 1C9NA 2GOYA 4RXUA 1TF2A 3PE4A 4K3VA 4X92A 2G9ZA 4QYWA 4EB6A 1XIVA 3CRQA 4W63A 3N0XA 2GJKA 2ZWOA 2AFVA 4IVPA 2GN2A 4KN6A 4EUHA 1G59A 1XDZA 4R1PA 1PL6A 4M1ZA 4J8PA 4UM7A 2VEDA 4MRSA 4NYJR 5CFQA 5HOQA 4QLAA 5JNUA 4N6GA 1IZZA 1VE3A 3RR2A 4EKNB 2FI1A 4G9GA 3ER6A 2CLSA 3CXRA 5FUXA 4H16A 2QM8A 1QGUA 1J24A 1DJLA 2YXBA 2LUOA 4XIFA 5JZVA 1K27A 1QZUA 1YGYA 1FXSA 5DXJA 2LDXA 1U0LA 1VZ2A 4ROSA 3GD5A 4JBGA 4RIEA 2JGDA 2QXUA 5FV7A 4MUJA 2R60A 3P2MA 1H4QA 1CUIA 2YXNA 4I4TA 4I1SA 5AICA 2ZS7A 3IV7A 4RKEA 4N76A 1DEHA 1V1MB 2OB2A 4HJXA 4U00A 1N5MA 4TLEA 3H1GA 3M4XA 4IUYA 1QP7A 4PWZA 4JASB 1YQ9A 4F56A 3TGWA 3CVWA 1BCRA 5IT9A 2OO5C 2BRUA 4F72A 3CH4B 1BGWA 3E7WA 4JMPA 4PSKA 1R5BA 1UJCA 5ULLA 2R85A 1G41A 1M8JA 4WHMA 1DVRA 3FUUA 4GDFA 3G2QA 4OJTA 1W29A 2J5KA 2ERXA 3HZOA 4EQ6A 1T9KA 2WRZA 2A59A 3JQ9A 4R3NA 3ZHSA 1VPTA 3BREA 4KSBA 2C5LA 4LZZA 5IDVA 4YAIA 2YQZA 2ZYWX 1PJRA 4XB1A 4BDTA 2VF4X 1TLTA 3HXTA 3UJPA 1TKBA 3E9ZA 2WKRA 3HNPA 3ZDDA 1D5WA 1VLJA 2LRHA 4QELA 1WBBA 2JHFA 5EHGA 4C6SA 1NFFA 2VSNA 1USVA 4WK2B 5LC1A 3IHKA 3LL4A 4RC9A 5LBIA 2Q5EA 4M1YA 3ERCA 4AK9A 5LOVA 1M74A 2BFMA 3KV1A 1X8JA 1B76A 3F6RA 4ZJPA 4H6XA 3INTA 1ATIA 4YIHA 5T6BA 5JWRA 3LCJA 2FFHA 4EQZA 4YASA 1Q7CA 3I2JA 3O2SB 1ISJA 3I0NA 5CEJA 1GQFA 2QRZA 1ZOLA 2VPPA 3CLRC 4IF4A 5EUQB 4WNCA 3VJKA 4WXPA 1T5DX 1KAOA 4UQPA 2Y77A 1XD2A 4AJPA 3NJ8A 4UM9B 2QQEA 2AT1A 2BUBA 4BKMA 3BH7A 2K7FA 1LF5A 3L82B 1GNPA 1H4SA 4JV5B 1QGED 3R20A 4EI2A 2B4QA 2R00C 3B36A 3WXMA 4YCJA 3RNLA 1AJEA 4E03A 4OXKA 1A1VA 4BFSA 1OFHA 1JDNA 2VTEA 3BXGA 3EDYA 4F3YA 1UEIA 3LTNC 4G85A 4EY4A 3OX1A 3HDVA 4DV5B 1E3QA 1N6RA 1UEJA 2CF5A 3QYFA 1DU4A 3AINA 3AKYA 2I4NA 3ZLVA 1Q7RA 3CF4G 1KZGB 5DTJA 4EFN