4TTSA

Crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (y200a) complex with 10-formyl-5,8-dideazafolate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
308
Chain Sequence
MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWRLKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAVRLIATGKAPRIKQPEEGATAECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGKSVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKMIPGSQYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the hydrolase domain of zebrafish 10-formyltetrahydrofolate dehydrogenase and its complexes reveal a complete set of key residues for hydrolysis and product inhibition
doi rcsb
source organism Danio rerio
molecule tags Oxidoreductase
molecule keywords 10-formyltetrahydrofolate dehydrogenase
total genus 87
structure length 308
sequence length 308
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 4ttsA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4ttsA01
1NJSA 4EW2A 1RBZA 1ZLYA 4ZZ0A 5J9FA 3NRBA 4TT8A 1JKXA 3KCQA 1GARA 1MENA 3AUFA 4EW1A 1FMTA 1RBYA 1MEJA 2YWRA 2CFIA 2BLNA 4IQFA 4ZYYA 1S3IA 4TS4A 4ZYZA 5J63A 3N0VA 1CDEA 1YRWA 1RBMA 1ZLXA 4ZZ2A 4S1NA 1ZGHA 4DS3A 4ZYXA 2BW0A 3DCJA 3LOUA 4NV1A 3GARA 1GRCA 4YFYA 4Q12A 4EW3A 3DA8A 4ZZ3A 1MEOA 1C2TA 5CJJA 4ZYVA 2GARA 4QPCA 3TQRA 3W7BA 4ZYTA 1CDDA 1RC1A 4YFVA 3R8XA 3O1LA 3AV3A 3TQQA 2FMTA 4PZUA 4TTSA 4ZYUA 4ZYWA 4ZZ1A 3Q0IA 4QPDA 1C3EA 4R8VA 3P9XA 3OBIA 1RBQA 1RC0A
chains in the Genus database with same CATH superfamily
2ZI3A 2A33A 4CXMA 5DNYB 4OJKA 4QVKA 2JFYA 5E6UA 3IPLA 4ER5A 4P3XA 1TO6A 3TIXB 4Z4GA 3WL4A 1WBJB 1Y1KE 2MSCB 2KYRA 3NGMA 3O8OB 4UCWA 5DTEA 3F9RA 4BAZA 4DIMA 4I8XA 5J4HA 1G0NA 3GY0A 4I1YA 1ZD3A 2UZ3A 3HP1A 5G1NA 1E2NA 1EXNA 1YCFA 2XWSA 4URFA 2BHTA 2Q6LA 1GNRA 2XTZA 3C7KA 1X2EA 4K9SA 4ZC8A 5TMDA 3B9PA 1JWBB 3SFZA 3W77A 4C08A 2RHRA 2Z3WA 3WJ1A 5IZ4A 3KYJB 1HDYA 4D46A 4A36A 3UA4A 3QX8A 2G7MC 4RTOA 2RKWA 2EW8A 3IBFA 1GNPA 2HV9A 3ELUA 5ILGA 3CVUA 2YHUA 1YB5A 4BLUA 2PJZA 3VPSA 4AF7A 1JFFB 4AZTA 4KTTE 3JZDA 2W11A 2CHFA 3WLTA 1Q77A 2II6A 3BCUA 1E3MA 2JIZD 2WD9A 3AQ4A 2WJYA 3DFZA 2QRPA 2F00A 1JEAA 5J4YA 2XDAA 3TLMA 3E1GA 3N2LA 1Z4KA 1O6ZA 4QYWA 5AKEA 3E84A 5D5HA 3REGA 2YWRA 1YSCA 3HDTA 4B33A 1XHFA 5AWFC 5GM1A 1DT5A 3WZ2A 1F9AA 1CUIA 1Q19A 2WSYB 4JASB 2ZXEA 3FFWA 1CDOA 5EIBD 4YT8A 3H5IA 1FTWA 3Q5GA 4ZZIA 2XWQA 3UPUA 4ALIA 4PAQA 2VT2A 3U13A 2H0RA 1T0UA 4HYYA 5SYAA 3QUSA 1T26A 4U7TB 4OKSA 2VXBA 4XWOA 2BWJA 1LNQA 4ATNA 2QDXA 1EDBA 2JAXA 5C2JB 1UMBB 1UOOA 1JR2A 3RAGA 4H17A 4JB8A 2HZ7A 1EVLA 1L1FA 4J2HA 5LLSA 4EMUA 3PHCA 2HT1A 5B3JC 2QNIA 3EK2A 2Q62A 1SQ0A 4OA8A 1ZK2A 2C42A 5T64A 3BXZA 3ANNA 4G1UC 3GGCA 3GCXA 4I7EA 1RXWA 2OFOA 1P77A 1T24A 1J33A 2YOFA 1ZGZA 3GX1A 4Z7NB 2PUFA 2BKUA 2H2FA 2QP3A 4Z2YA 3G1WA 1FLNA 3ANXA 4ZO6A 4ZIRA 1TK9A 2OCAA 1VTKA 2RMKA 1XXHA 4GL4A 3AEQA 3KSAC 4PICA 3K1AA 4MVJM 4OAQA 3ZJYA 1R0RE 4EQ6A 3ZI4A 4JC0A 4X1KA 2J59A 1N1DA 1XP5A 1F12A 1F8UA 2UYGA 4EAAA 2YIMA 1DAFA 4YO7A 5IDQA 1X7XA 2ET6A 3GHYA 2I4MA 2VA9A 3DCNA 2CZCA 4LCEA 4M37A 4V0ME 1HKUA 1L3BA 1L6RA 1C9JA 1XTSA 5SY6A 1SZPA 5C5EA 4IUYA 4JUBA 5JFGA 3EJWA 3TZCA 1IEQA 3AIKA 3BJMA 2R8ZA 2B61A 4BC1A 4XB2A 2DBVO 1Y1SA 1X3SA 4XWKA 4J0DA 4UTNA 1ZEJA 2OP0A 2PKQO 3CH7A 3T9CA 1F3LA 4GLLA 4EUSA 3I12A 4EDHA 2LKDA 3FYUA 1A4XA 3VR6D 3ZHRA 4B4VA 3IHLA 1FYDA 2BMAA 2XJ9A 1RMQA 2FN3A 5BSVA 3AVYA 1C3VA 1W0JD 2FR8C 2HQ1A 1S8AA 2HU5A 3MJDA 4NC9A 1DFHA 3QENA 4LJ4A 4EFKA 4LPSA 2GK3A 2JGLA 1E0DA 1WVGA 1UPBA 4MQ5A 1VOTA 2SNIE 1GZ3A 2XQVA 5A6SB 2J5RA 2MYUA 1SWVA 1W4AA 4L6CA 2E5FA 4QOFA 4LHWA 4P0QB 4RQUA 3KQQA 2UUOA 3AR3A 4G67A 3LQKA 1X7DA 3M6LA 3QBDA 1CZLA 2J67A 4B74A 4G1BA 2CV1A 3QG5A 2D5AA 4MVJH 1J8YF 4NOLA 3JQGA 2PJRA 3PEUA 3C3CA 1GPBA 1KVQA 2AZMA 1US8A 3PHLA 3U2QA 4MX8A 4WZAB 1N77A 2DR2A 4RTLA 2ZIGA 4U7DA 2NZUG 1NMYA 2PH5A 3ILYA 1QO7A 2H9YA 4LEIA 4WLNA 1NQOA 4PVCA 1GCGA 1NLMA 3IXLA 1FB5A 2DFVA 1CHDA 3S5JA 1CJCA 4LBZA 2XT6A 1F8YA 2AFHB 5HCNA 1Z4OA 1DTSA 2PTGA 3KEOA 3CN9A 3PUYA 4UUBA 4H6WA 3MTBA 2R5FA 5GGYA 2O8BB 1XEXB 2E4YA 1XB2A 1WB5A 3B1YA 1E2MA 2IEYA 1F7VA 2EBWA 2OC9A 3QPCA 2O50A 3MMSA 5AKKA 4D57A 1B8PA 1P0CA 1Z08A 2DUWA 4JR1A 4Q7EA 3CLSD 2PK3A 2QQGA 2YN2A 1BE0A 3DZCA 3EEYA 3GW8A 1X0XA 3LRXA 3MWFA 3PIDA 4G8DA 4UXHA 4XWAA 4ZJUA 4ZCQA 1SG9A 1UPUA 2JKYA 4G5RA 1J56A 3H7AA 3UKDA 1O03A 4O4LF 4ZGGA 3FPAA 3QFCA 3C1AA 4EF4A 1T36B 3PXDA 4JLAA 2BMDA 4RCYA 3V34A 2FSHA 1B93A 2IYXA 1S2IA 1GGNA 4I8IA 1Z18A 3KPVA 4RY9A 5BP7A 2DB3A 2KE5A 1OX6A 4BU1A 3PYMA 4RA9A 3EBOA 4BN4A 4ZYYA 4GRDA 3UVEA 3VU3A 4Q3KA 1KPGA 3UHJA 1I51A 1L5VA 1SGWA 2DUMA 3ZIAD 1EP9A 4B3XA 2H7YA 4F5WA 2OLJA 4AN1A 3P4YA 4L8YA 4KR2A 4RA6B 3BHIA 2F3UA 4KYUA 4M55A 4ALNA 4YQFA 5KI6A 1CSEE 5D6NA 4A5OA 5CITA 1P45A 2R2GA 2R25B 3EFOB 4V0OA 2Z2XA 4OUDA 5FADA 1RPAA 4IMJB 4E2WA 3OQJA 3UK6A 2HOQA 3BWYA 1U3FA 3FCAA 1R6AA 3K2EA 5I3ZA 2OG2A 1XDZA 1D4ZA 4HB3A 3WB1A 2EG9A 4E21A 5G0UA 4W7HA 1IZYA 1U90A 1NW6A 4LGCA 1Y3HA 1JA0A 3UMBA 4I50B 4LBWA 3ZXXA 5KAPA 4EHBA 2ZCUA 3PDIA 5AKHA 3UPDA 1PF7E 1KSGA 4Y98A 3IEVA 1D7OA 5AM0A 1PR9A 1YS7A 1D0IA 3K1ZA 3KOWA 2RHJA 1PSWA 5KYVA 3A2KA 5DU2A 1M5RA 3WQHA 4YO8A 2ID7A 2RONA 1SUWA 1QAQA 1EU1A 4KXUA 3KJXA 1WCXA 4DDWA 5LKAA 2I6XA 5EGSA 3EA0A 4Z7OB 1PL0A 1A69A 4YV2A 1MTOA 1QVRA 1F6DA 2BGTA 1JPNA 2YJ3A 4CQNA 2ZYGA 1H3NA 7REQB 5K3CA 1QANA 4MMXB 4PLZA 4PLTA 2GLXA 2ZREA 1RQRA 2A4KA 2PT7A 1FFCA 2O2IA 2VP5A 5D3KA 3QE3A 2WVAA 1OA0A 3T5DA 2C83A 4HUQA 2RC5A 1Z16A 4LZZA 3Q0TA 3NPAA 3VX3A 2QLFA 1W8IA 3L1VA 3U17A 1PKEA 3RC1A 3GOQA 1PGNA 4NPCA 5IP5A 2PJUA 2PSEA 1QOZA 1KO1A 5JR3A 5LQDA 4JENA 5EZYB 2BFDB 3OPYI 4BO0A 3O5AA 4ZZ3A 4MVJG 2W2VA 4GBGA 2WLTA 3W0LB 2FFBA 4PINA 4QUBA 2O8DB 4TLCA 1V4VA 1GZVA 3RYTC 3T4UA 5F77A 4RF5A 4BNXA 1GDHA 1A8PA 4Y2PA 4PSDA 5ER6A 2XYVA 4C7OA 2IQIA 3F74A 1U1EA 2I6TA 1WEHA 2W9XA 4PU0A 1VPDA 4WT7A 3FI9A 3ZQJA 4L0DA 3JZMA 2XB2A 1NPDA 3ELWA 4HVTA 1D6JA 2YINC 2BL4A 2GBFA 2EQ5A 3PQ4A 4N5MA 1E2BA 4IYRA 4ZZ2A 3OM9A 1P2UA 4C76A 3AC0A 2CCJA 4HGZA 3FDZB 1LTKA 3D8NA 4HTFA 3LCVB 5EHZA 1XDGA 1YQWA 1MFPA 2PGXA 4KR0A 2GUGA 3N76A 3RRMA 3UBMA 4BUZA 5E9AA 3STVA 1UOPA 4FOSA 3UT5B 4TT3A 3WA6A 3W8DA 1KQ3A 3KVYA 1RWWA 1X7ZA 3WQSB 4EDFA 4IIHA 1R0WA 4LJYA 5TS2A 1PX0A 3PP8A 4X3PA 5FXMA 1MG5A 2MWMA 5F35A 1IUKA 3FDXA 1D3AA 3QPBA 5LOVB 4A2CA 4M9SA 4EYQA 3S2GA 1E2DA 1RYEA 3RV4A 3A06A 1E4YA 1GPMA 3HB9A 1UEXC 4GPTA 2AXQA 1UFVA 3RUHA 2PLFA 2Q29A 2RE8A 4HAIA 1NBME 1YS2X 2PCLA 1QG4A 2ACVA 3I5MA 3MBIA 4P3NA 4WBNF 5F33A 1YOVA 2FSFA 2PANA 1LPPA 1SK8A 2RGDA 2VUUA 4AVYA 5H4HA 2G63A 3LM8A 4IX1A 3QVGA 4MLDA 3ZWPA 4H0NA 3W5CA 4FLMA 5LYJF 1NC3A 1LI5A 5BWNA 4C88A 3HJUA 1VL2A 1A3CA 3WA7A 1LLDA 2FMUA 2C7GA 1F51E 2W90A 1CUCA 4GG1A 3EPJA 1YUMA 2HA5A 3HXTA 3ZK8A 1QBGA 2AVNA 2YV4A 4HDNB 4US0R 4MKZA 4ZOBA 5GIOE 4ID9A 4ZO9A 4WESB 4MS3A 1TJYA 3EXEA 1ODTC 4QBTA 4UQOA 2DPHA 2HCJB 3ROPA 3JWIA 4UASA 4MYRA 2YJ6A 3E2MA 4L8VA 2ZDQA 5JMPA 4D5GA 3W1EA 5HKOA 3EISA 4FONA 2JHGA 1WV1A 1NR5A 2WVGA 2WJWA 4FOTA 1FTQA 2CZGA 3EJ6A 4TYMA 4XWYA 1AUVA 5EN4A 3PQDA 2JLXA 2Q6TA 5JQGF 1IY9A 2JGJA 2QSYA 3HBFA 3FTEA 1SQSA 1YQGA 2BKXA 2VHUA 1JEOA 7AT1A 1BA3A 1CIJA 1HDIA 1Z68A 3R6DA 4J49A 4XX1A 5AVRA 2E21A 5KHAA 3FPKA 3H1FA 4MLCA 3LCJA 4EJ0A 2X0FA 5B57C 2NVBA 3ZVKA 4GI1A 4PPYA 5DNWA 4EGCB 1W5TA 3FLEA 3ZQUA 4YCNA 1F1JA 2G80A 1C8LA 1NSYA 3DEJA 3HP7A 3L9XA 4OXYA 3CT4A 5GZ6A 3T7AA 2HQBA 3GRPA 5JS1A 2PLWA 4A6DA 5EP3A 5A0TA 3BB4A 3F6RA 4BHTA 1YMUA 4CQMA 1IVSA 1LVUA 1U8CB 3VPCA 1II8B 1U0NA 2MSKA 1F17A 3TLZA 3UENA 5IYZB 1XTQA 5F7XA 2D6FA 5LBIA 2PRSA 2FHPA 2ZVJA 1P9NA 4GSLA 4OO3A 3IT3A 4QU5A 4Z0HO 1RXIA 4B1FA 2AW5A 4YPVA 2Z2KA 4GLJA 5K8VA 4CDGA 3N7TA 3O8QA 3G1UA 1KWKA 4RIFA 1U7WA 1BDMA 1YHZA 2PUEA 1SA0B 4KWIA 2JCXA 3O47A 4I5DA 2GCGA 4P84A 4I3FA 3UATA 4B44A 1SXJA 3DBHA 4XGRA 5CNMA 4BQFA 2B25A 1A8HA 1GTRA 4GT1A 4OREX 5EZ6B 2L42A 2P2GA 3OF5A 4UBMA 2P7IA 2AI2A 2O4UX 1AURA 2ZWVA 4J2TA 5A4AA 4ZVVA 3RGWS 3HO6A 4FSXA 4BGDA 4OYLA 1EZ4A 3KYCA 2X6TA 2V9ZA 5DRTA 4OLAA 1G7CA 1LLFA 1O94A 2JA2A 2W43A 3B5EA 4X41A 3WYEA 4E4RA 4EEZA 2IEZA 4LE2A 1CG6A 5I9TA 1FPQA 3CR7A 3DSRA 1U8EA 4P7JA 1HQYE 2DBYA 3W9SA 2H8GA 5KU7A 1O96B 1V7QA 3D4NA 3FKSD 3OM1A 4NX2A 3I2GA 1EFUA 2Q5LA 5KNCH 3NHMA 2HMTA 4MR8B 2J0QA 3MA0A 4HS4A 2BRUA 3OOSA 4KI0A 4BFZA 1K3UB 1MVLA 2W71A 3FDJA 2FFRA 3OMLA 5KVCA 1IY8A 1FVXA 4PQEA 1D09A 3AB7A 1KAQA 1GRVA 3R23A 2FMIA 5D1NA 3Q3JB 2BEVB 3L0BA 1XZIA 4E5DA 3NV7A 3EGWA 5BVHB 1K1EA 4M6WB 1SXJB 3DBHB 4JKIA 4S1PA 4RFVA 2QE6A 2NYAA 2B35A 2VBIA 1AS3A 5EP1A 4EKDA 3HJFA 3QVWA 3N7AA 1DXYA 5EKXA 3OP4A 4HWGA 4I6EA 5F12A 1UJNA 5FAXA 5TR9A 4WVLA 3PNLA 1M73E 4F3TA 4P4LA 2C2ZA 2GJ4A 1KETA 4XCVA 4YJFB 2QVYX 4FUQA 2HU2A 4L5IA 1ZC3A 2X2FA 1SKUA 4L7QA 2EOAA 4B83A 5DPMA 2BDEA 3JW8A 1EFAA 4EKYA 4PGHA 2R1ZA 4KIJA 1OFGA 2VJDA 4MOWA 1JYFA 5DBOA 4NBTA 1TIPA 1MX9A 5J63A 3CN7A 5IVKA 4Q48A 4FGLA 1J5XA 1ZLXA 1CJVC 3AXSA 1K0UA 1ODJA 1TA9A 3O3MB 4KKVA 4Y6SA 1QZZA 2Y77A 4TRJA 5EUQB 3NBUA 4X45A 4F6RA 3TFOA 2VFAA 2HRDA 1JGTA 3CSUA 2J8ZA 3G8YA 4JLOA 3T1OA 3PRYA 1SUAA 2Q1TA 1JHMA 1K89A 4HLCA 3OUZA 3GB9A 1ZHOA 1FFXB 2MSDB 4N0EA 1Z5WA 1WV0A 521PA 1EWTA 1JALA 5F76A 2SCUB 3UUWA 4BCDA 3VHRA 2CVOA 1VLHA 2CMDA 2XT9A 7ABPA 1R4NB 1EUDB 4M0DA 3GJRA 3KUCA 4US2R 5HYVA 1JT9A 3N1UA 2BIFA 2IYVA 1LC3A 2HY7A 2JL1A 2RHWA 4R8MA 3SLRA 3E3OA 3VQTA 3EVDA 1E5VA 4MKHA 2XE8A 4BKMA 2OM2A 3BRWD 4EKEA 3JVIA 2ZCJA 4NECA 3KB1A 2O8FB 3D54D 1NURA 1PFYA 4O0LA 1EKXA 3MFQA 5EPEA 4MKFA 4HUTA 4QUAA 3RSLA 2C1XA 1BROA 3F2VA 1J7JA 1EAMA 3F3SA 1VCOA 1XWIA 2MT9A 2NYUA 4JGGA 1KERA 1KK2A 4MQBA 2J41A 4Y0AA 5D7NA 3SDZA 4ZRNA 4E22A 3F6PA 4EUFA 3QLVA 5AVTA 3AZQA 3TQIA 1YS4A 4Q3DA 5FUWA 5H81A 4IXDA 1R8XA 2BY4A 4O4JF 1RCFA 4DIOA 1FFAA 2YJTD 3LQQA 3MILA 4GI2A 2O2EA 2XIJA 3DOIA 3GUYA 5CLGA 4E2YA 3INNA 5I8WA 2NPFA 2HJHA 2XITA 1JEYA 3JWGA 4XOIA 4YQZA 1FS4A 4DJDC 2CB9A 2ZBPA 3SXPA 5BMOA 4DR7B 5U1PA 3SD7A 1A76A 1AUPA 3ZDYB 5BOSB 1YFJA 2G76A 3PG5A 2QD5A 4FEEA 4W5TA 221PA 1T8TA 4LF4B 4RGBA 2XOKD 2VUTA 3FAZA 3RKRA 4B9EA 4O59O 2EU8A 2EF1A 1XZPA 5AUQA 4X8MA 4DV7B 4HQNA 1BGWA 2R4QA 3BH6A 3C3JA 1CD5A 1L4BA 1KH1A 1BTOA 2P9CA 2BVNA 2VCYA 4AD8A 2ZM6B 2NUPA 2DECA 1R3DA 1UT8A 4RKQA 4IIJB 3WYBA 4D9BA 4I19A 3U9LA 1K3FA 2YVQA 5EWLA 4J3NA 3JALA 4LDQA 4HB2A 6YASA 3K5HA 4ND7A 4MRSA 2GVNA 3D1JA 3NAZA 3OSZA 3PUVA 3MWDA 2B4AA 5LZ7A 2YY5A 1QSGA 3JQ9A 3M9XA 4MVJP 1DBRA 1KHHA 2FRXA 3BORA 3OCWA 2OHHA 4BFCA 4C4TA 2XUOA 1K3TA 3Q0EA 1VKOA 2AI1A 4C0XA 4H1WA 2C94A 2R1VB 3JARA 2B4RO 4IMRA 4GE3A 1OGJA 1G60A 3AV0B 5HDQA 2Y92A 5H3CA 1MO3A 2DSTA 4C7JA 1V4BA 2X8BA 1AGXA 1TMGE 4CTMA 3CZCA 5DASA 3OQHA 4URWR 5FUYA 5JS7A 4FE4A 3HB1A 3ZW8A 4JP8A 2E37A 4RK0A 4YNBA 1NR7A 1LH0A 3ROXA 3N3AC 1L5KA 2BI7A 4D41A 4HQ6A 3FI0A 3WV5A 4C3VA 3O75A 3OJEA 4QGBA 3SIXA 2PIDA 5EXPA 4C1NA 4X1YB 3FROA 1CCWA 4OATA 4UUPA 3WYNA 1NSFA 1RJDA 1LFDB 5BV2P 3HYRA 2VHXA 4EG4A 3DT9A 2I3ZA 3G2IA 3N0VA 5KYUB 2R1VA 3JARB 3MC1A 3V8QA 1GTMA 4N3GA 1PYOA 3P4UA 4XDZA 5HF6A 4PBRA 3DE3X 2J3QA 4UHEA 5J5AA 2O2HA 2Z8ZA 4IV8A 4BX9A 4LHZA 1G3IA 1WW8A 1K6MA 1G0OA 1G1AA 2V6JA 1CY8A 1WX1A 1Z62A 2ZSBA 1WXWA 3I83A 3JQRA 3TDKA 1DJMA 2PVPA 1ULHA 2C2OA 2GZ1A 4GC9A 1TA4A 1OUMA 4TLDA 1DRJA 4U5QA 4CNQA 1IN7A 3HUEA 4V0SA 1DZ3A 2P1ZA 1E2QA 2R1TA 2RAVA 3OIUA 5AK3A 3DZ8A 5JXJA 2ZRAA 5IC4A 3LW7A 4AJNA 1AO0A 2PZFA 4JEUA 4U7HA 1CNFA 3BIXA 4M0UA 4G41A 1YR2A 2CUNA 4FOPA 4FHDA 4A91A 4Q9NA 4UUAA 1AV7A 1UXKA 3QEJA 1YQXA 1L7NA 2YBEA 4M99A 3D5QA 1N2GA 4FQ5A 3AF1A 4UTPA 5JCZA 1C81A 2Z5VA 4EG0A 1V8DA 2YZNA 2RG7A 3ZVNA 2I8LA 1G6KA 3ITEA 1KEEB 3RG8A 4IHKA 3ICEA 4KIGA 2BYTA 1IQPA 1CEEA 2AJCA 3OZWA 1NBIA 1Z06A 1ZD5A 2ZYHA 3NJ8A 4WXPA 1ONSA 2C07A 3K9CA 2QD2A 2WG2A 3I45A 1XMOB 2GLUA 2I67A 3J7AC 2YC2C 3HBLA 3KALA 5TGTA 3OOWA 3VC3A 1T43A 3IUYA 3ENVA 1TQ4A 4HF7A 1C0IA 1Y37A 3BWDD 5ALIA 4B87A 1ILEA 2ZE7A 4HSEA 3CGGA 3OVMA 3AFOA 3RSHA 4ZEMA 1I4OA 4LYEA 5B3KA 1YDEA 4N0PA 3GMDA 3DKKA 4JLWA 2O8FA 2J30A 5JPCA 2IV3A 4IEIA 3T3NA 1Y5LA 1BHQ1 1L8OA 1XZNA 2FRDC 3GNQA 4RIGA 5FHRA 3LE8A 3S2EA 5BNTA 5IC6A 3SXUA 1NNLA 3EXAA 5LXTA 5LA6F 4WN3A 4RVCA 3U3KA 1U3DA 4AN4A 1VLVA 4DXAA 2XOKA 1R16A 2NVUB 3SXJA 3LBYA 4LJ7A 3W5UA 1QQBA 2AQKA 4ZU3A 2JIOA 4UVEA 2HF7A 2ZRNA 3L1UA 1O8BA 2P6UA 1R27A 3PVSA 4N54A 1Y7PA 1T13A 3QF7A 5TRTA 5KYXA 1N2IA 3B7PA 3FB1A 1UDWA 3P2IA 1JHOA 2X14A 1TRKA 3IVCA 3NEPX 4N47A 4JQSA 2CSUA 4RPLA 3UMSA 3OZXA 5DV9A 3AFMA 4FE7A 2JGKA 3VDNB 4ETMA 3L4JA 1E32A 1GFWA 2AOXA 5GGXA 1L5FA 4NBLA 4K3VA 3A9VA 2W6ZA 1YBHA 3KQYA 3KRTA 3R76A 4ZJPA 1JG4A 5IJ0A 3OJLA 3KM0A 3VPXA 1SQGA 3D6HA 4CDMA 3IV9A 1AB6A 1JSRA 1IBCA 4MI6A 1L3IA 1NYQA 2PNJA 4IKPA 1JNXX 1VYVA 4QL3A 3VGPA 5I4CA 4PRYA 2YFYA 1YKSA 4QT0A 5T57A 2FUNB 1NJ1A 1JWLA 1NFFA 4F04A 1A72A 3IPCA 3NHWA 2Q4BA 1YBFA 3F6SA 1TAGA 3O2QB 3D02A 1L5OA 2G28A 5KS2A 2ZRKA 4ND1A 5JV5A 1LUAA 3THYB 1GZUA 2HEGA 3QJYA 2NIPA 1EXWA 4M21A 2LWIA 2VWPA 3QEKA 1YJ8A 1NRIA 3L77A 3DL4A 3H11B 3N2IA 2WP0A 4C89A 1TM1E 2PX2A 4OM8A 4QOSA 1OA1A 4PLYA 1WOYA 1NMQA 4N5DA 3LXXA 4MDHA 2AWOA 5BN5A 5BUQA 3TLEA 1AF7A 5TS3A 4KXFB 3V8VA 4ETNA 2Q5QA 4OP3A 1WXFA 2FSVA 2F1KA 2J5BA 2NADA 4GGPA 1OH8A 4PYIA 3WFIA 4L5AA 5CFRA 3AUUA 4L5CA 3EZLA 1XCBA 2E48A 1G2QA 1THTA 4BFVA 2WD8A 1RM4A 4H7JA 1XAJA 2YQ5A 3SF0A 1HX7A 1TMYA 4IJ6A 1Q50A 3A2NA 1YWGO 4XLZA 2OXEA 3H42B 4QU0A 5G4KA 1RKXA 1QF6A 1ZITA 3N5KA 2EHDA 4LJRA 4Q00A 5CVTA 3BIOA 3KKPA 1HTWA 1GUFA 1UODA 3C16C 1G1MA 2I1LA 3DWIA 2FRVA 4G97A 4B7XA 1C0LA 2O2GA 2J9FB 4OP1A 1UKYA 1WZCA 2GLTA 3ESRA 4JYMA 4DCMA 4YRBA 1VSQA 1XXHB 4BYMA 1DLJA 3ESYA 3M2TA 4JGIA 4OLHA 1TGYA 2CCGA 2H29A 2D7DA 2CHEA 1CR1A 3C15C 1EM6A 4JXXA 4RYDA 3R5TA 1WNTA 4O63O 1FFWA 2OORA 4QATA 3RK1A 2WSSD 3FSJX 3AJDA 3OE7D 1YA8A 2QMOA 5ALSA 4PNHA 1JHXA 4CVNA 3DVLA 4QICA 1MEOA 2W70A 5AJTA 3VAAA 4ZYVA 1ZPDA 4Y0NA 2ZSDA 2NTJA 1JR4A 4CN9A 5CEEA 2EJVA 3QLJA 3ZC3A 1NXQA 2ZYIA 3AERA 1IRXA 5J4KA 1GPNA 5IPFA 1ZSVA 2VZ8A 2CVPA 2VCEA 3ZNNA 1FUKA 4ZAYA 1Z6XA 4RM2A 3I0ZA 3AVUA 3GJQA 1FVFA 1I3MA 1UJ5A 1NU8A 5ARCA 1ZJZA 1EFCA 3NRBA 1DRVA 4AYXA 1CZNA 4K05A 2REOA 1EGHA 3O26A 2F8TA 4IXTA 1N6LA 1W581 2O7RA 1JQ3A 3HN2A 2CLFB 1ZJYA 3I1IA 5K01A 2OYSA 2IS2A 2NV2B 1O4WA 4HAXA 1UKEA 4OYHA 1ACMA 1JG2A 2AVDA 5EIHA 3UXYA 3SM3A 4MUFA 1YFLA 3V48A 2PSHA 1FYFA 1V3TA 1JV2B 2C61A 2ZI5A 4X0EA 2GR9A 1WXXA 1OT5A 3BRQA 1VI2A 3QU2A 5EMHA 4AMUA 2OV4A 3G2LA 3KU4A 3ODGA 4MB6A 4DG9A 5F9FA 3HKDB 2XXJA 4EG3A 6GPBA 3IELA 5JYCA 4R8VA 4YREA 4DJFC 1U7UA 2WF9A 1UIMA 3L5KA 2H4HA 4C5CA 1G291 2ESRA 1J2RA 1W47A 1WCIA 1HURA 3E4DA 3Q3VA 2JBAB 4P83A 5D87A 5FD8A 3M3DA 1VHJA 4QUEA 1A96A 1SURA 3T1NA 5LA6B 3G1TA 1MXFA 2DMRA 4IIVA 4HWPA 3RODA 1JVBA 3NYIA 4E11A 1IPFA 5A5DA 4RGQA 3UF0A 1TCCA 5ALDA 1DQYA 1DT3A 2C1ZA 3QEAZ 2Q4DA 4V0RA 2XLCA 1FJ2A 1P61B 3EC7A 3EVGA 3WHLA 2FY8A 2HA7A 5IAAA 1ZU4A 1IDN1 2ODPA 1K88A 1QYWA 2NUAA 4X66B 1J1UA 3HVUA 3G5LA 3LKDA 2QP4A 2W8ZA 5BUCA 6PFKA 2P11A 1I7DA 3C97A 1MA0A 3HCAA 1Q6YA 1CE8B 4M83A 3V33A 4DVJA 3NKLA 5I9NA 1V95A 4J0IA 3TBKA 1GQRA 2E18A 2LCFA 5GV7A 4DQ0A 4JAVC 4Q3NA 1E9AA 1QBKC 1TVEA 4N7MA 5DGCA 3OLWA 5CFQA 1DQSA 3NP9A 3WYFA 1ZG3A 4JVLA 3GDHA 4TMZA 4AL4A 4D5EA 4TYNA 1ZLYA 2G06A 3D7NA 2QAJA 4N76A 4FYKA 4GPEA 4Z1MD 1X7ZB 3W2HA 3HY4A 1YONA 5BSRA 1U4SA 2ZZNA 3ZIAA 5LKRA 1W2HA 3NUQA 2N46A 1K5DA 4JLSA 5C34B 2RCNA 3K6KA 4I66A 3GPIA 3LF1A 1UJMA 3O94A 2HSJA 3K73O 2B8WA 5GONB 4EATA 4YXFA 5KB3A 1T25A 2X9QA 3UMRA 4OHYA 1F3OA 2CFTA 3FMVA 2BFPA 5KOJA 1J2TA 2BGJA 4IXNA 1DV1A 2JIRA 1LC0A 2I6FA 4N01A 4LIPD 3FBGA 3I2YX 1FRNA 3AHFA 1DUIA 5FQNA 2ZBDA 3TJRA 1W46A 2Q2OA 3L7NA 3OUUA 4K9NA 5EXSA 4HT3B 3MXOA 4DLBA 2EEPA 2XT0A 4NF2A 1Z74A 3I23A 4DRXB 4QOJA 5I7OA 1ZCJA 1GLNA 1XEFA 1ZI8A 3JS5A 5BW8A 1Z13A 1ZIPA 4IIJA 2H1FA 1Z34A 3PT9A 3ZUPA 4BVAA 1G20A 4HO1X 1G5HA 4LF8B 4Y6RA 1MIOA 4L6AA 3RWOA 4N5LA 1TLLA 2Z09A 4YRNA 1P0FA 3E8MA 2QGNA 2FW9A 3D6MA 3QVXA 1XRSB 1A5AB 1XT6A 2AXNA 4KVZA 2V7BA 2PX6A 4KXVA 4ESOA 2CLSA 3MERA 2V7VA 1TJPB 4MMYB 1LS6A 3TRHA 4D0SA 1EX9A 5TJHA 1Y5IA 2J3EA 3HU2A 4B80A 1LJ8A 3N39C 4I55A 4ENPA 3C41J 4KXMA 4RPKA 2AG0A 1SHZA 5L6MB 1FDTA 1U8AA 1DC8A 1SD2A 1RM3A 3CXUA 2BR5A 3RU2A 3NETA 4ZKDA 1KC1A 1O57A 3ICWA 5FBVB 2QZ9A 2OCBA 3LDAA 1L7DA 4NDNE 4JUAA 2VS1A 3L7MA 1FDWA 4B0PA 4YCSA 5ALZA 5G3ZA 1UWCA 4ZVMA 1ZINA 1O6BA 3PHHA 5EXXA 4U2BA 5GV8A 1A7JA 3AHHA 1LNSA 2PMWB 5CFNA 3CU5A 4MW5A 3C6BA 2YIVX 2ZKIA 1CNEA 1KO5A 1IWPB 1R4ZA 3F71A 2NSLA 4PONA 3F73A 2IOFA 1PD0A 2XAAA 1BFKA 4XSVA 3DDSA 4OUDB 1Z6PA 2ZB2A 1H4QA 3C1OA 3HRHA 4G4SP 4L5BA 2DR3A 5KWSA 3H16A 3HJHA 5DSTA 5HFNA 3WJAA 5ER9A 2FK7A 1ZMOA 4LX8A 3SJZA 1DAMA 2SHKA 3WADA 4EP1A 3KL2A 1MJFA 2YN0A 2VRBA 4P2BA 4CJXA 3AUYA 2O59A 4YRGA 4KUHA 1WKCA 2ZJ2A 1EJ0A 3E48A 2SCUA 3DKRA 3KQOA 3UUGA 4Q4AB 4CTOA 4YUAA 1T9GR 2CJFA 3C14C 4D44A 1LF5A 1RADA 4F12A 4Q66C 2PL3A 3H1EA 1U9ZA 1TEHA 1PGOA 2RH5A 3QX7A 4Q9IA 2B1GA 4AXXA 1HORA 2JFFA 5BMVB 2YMMA 3FKSA 4GVXA 3GNTA 4V02A 2ETVA 1BQEA 1TPZA 1UL1X 3AB3A 4HZUB 3UICA 1HE4A 4EHJA 5JDIC 3OI7A 4KMMA 4R8SA 3SK0A 4O4JB 2IXDA 1G8SA 1IXRC 5FBWB 4QDTA 4AO7A 3DNPA 3R44A 3A4NA 3B6KA 4NAHA 3MUOA 4RL6A 4YJFA 1IH8A 4BRZA 4WWHA 1MVNA 3N2GB 1M1UA 2JASA 4BU0A 2QL5A 2QQEA 1U2DC 5JWOA 2ASEA 5IASA 4ZFNA 2UUBB 2YY7A 1TX4B 1M5UA 5KHOC 2BCJQ 4JLBA 2YV3A 5LPNA 3V7FA 3QPUA 2A7QA 2NQTA 5EHQA 3TLGA 3UK1A 2UV8A 5JI2E 3AKZA 3HCEA 3AL0C 2GESA 3UB2A 3R8FA 1RWVA 1O0BA 2CNOA 2IXTA 2X5XA 3C1TA 3BM5A 3QKRA 2YXDA 2H17A 4P54A 2RD2A 1RLJA 2JG3A 1KYVA 1IU9A 4QJ3A 2VJQA 4W5JA 4WACA 2E85A 3T1TA 2VHWA 4EBFA 5E1OA 1FCJA 4JYCA 3JQGB 4PX3A 2IZ1A 1N4AA 4CMCA 3H4IA 2ZWPA 1XZMA 4XUEA 3ZHOA 4LF7B 3UGJA 1CY4A 3W9UA 4ED9A 1KDRA 1SG6A 1VE9A 2G04A 2GXUA 2H06A 1BX1A 3TO5A 3GL9A 4A0GA 2WU1A 4YXWA 1BMDA 2H0AA 3LLUA 1BOOA 1GZHB 1O87A 3HV2A 3IIEA 4AUMA 4AJ4A 3RRZA 1TLFA 2GCIA 2H52A 1DAPA 4QTUB 1F48A 3NTLA 2AG6A 1KE2A 3A9SA 4QBIA 3W7VA 1IBLB 3U7HB 5A3SA 4II3A 4TS1A 1UAGA 2CE7A 1RBQA 3UV6A 2X2EA 5ESRA 3OETA 2C5AA 5DKFA 3VH4A 1E79A 4EZIA 4R01A 1PGQA 4C0LA 4PZAA 4U2DA 5C52B 3PT5A 4FM9A 1KJNA 3PNSA 5F23A 2ZR8A 2JVJA 2JD1A 1FTNA 2H51A 4FDTA 3N3BC 4B3FX 4KQXA 2VUHB 2YJGA 2YY6A 3RADC 3NDBB 2B78A 4RYLA 2JFUA 2V98A 4OYYA 3PIRA 1CUYA 4QDOA 4RKWA 5DNUA 4BJHB 2R68A 4CM6A 1Y8CA 3C3XA 3EEBA 1KS2A 3PQ7A 1N5OX 4MKIA 4DLNA 1A8IA 2QORA 2PAFA 1V1MB 3UM9A 2JEYA 5FOTA 3G5TA 1NT4A 3HFRA 4Q3EA 3SYMA 4TRMA 1PDVA 4A23A 1VLLA 3A3KA 2Q1SA 3JWEA 3EGXA 3K5IA 5LFAA 3RUPA 3SHQA 5IT5A 2GHTA 4GM4A 2PYDA 3E0XA 3W3ZB 4POOA 1CJBA 2WKQA 4L6IA 2G8LA 2WA2A 2ZEJA 3FVTA 3HYSA 3NWPA 5BV7A 1H8HA 2FUG1 1C4WA 1E7QA 1IEVA 1PWZA 1UXOA 2QD4A 4JBNA 5AT1A 5SYNA 3HJRA 3S55A 4E09A 1L5RA 1VCMA 3ZBQA 3WY9A 2UZ1B 4YAJA 2IWHA 3KUXA 2VNIA 1Q15A 2UYQA 5CVDA 2J46A 4JBHA 1Z15A 2ACWA 1BXGB 1Y6FA 1LSUA 1UZMA 1O95C 3OZTA 4CM8A 1GDTA 1I1OA 4MDYA 2V5UA 2GJAA 2DQKA 3PQ2A 3SJAA 3LC7O 4KACA 4MJ3A 2YUIA 3JR7A 4GWLA 3GJ3A 3LXRA 4QXQA 2CT8A 2GCPA 3ADCA 1N6PA 1JDNA 3WIUA 4KZKA 3KWFA 3PX2A 1NVBA 1GTL1 4S1WA 3V9AA 1I4EB 3GJ8A 1QVWA 3IR6A 3D8HA 3UXEA 5DTQA 5I7AA 1VCIA 3AX6A 3U4QA 1U3WA 4B09A 1ESNA 3L7OA 3L7AA 4X97A 3ADBA 4Z5XA 1FZQA 3I6YA 1PQYA 3HQ4O 3O3NB 3VNQA 4DS3A 3WMFA 1V5WA 4BQNA 2GK6A 2B1IA 2P4QA 3PICA 4C03A 3A1SA 4WLEA 2E87A 4J1TC 2VC2B 5G2OA 5EE0A 1O1YA 3UJ9A 3V4SA 5BQ5A 1Y3CE 2YDXA 2YUTA 1CNMA 1LX7A 3K5WA 4LMBA 4B40A 4ABTA 4LYYA 5E1MA 2ZJYA 1A9PA 2FF5A 3F1KA 5A1TA 3X1ZA 5KJ6A 1NU6A 2AX3A 2VRCA 3QXGA 1LX6A 3L7JA 4XA8A 4QREA 1WAMA 2ZGVA 3L7KA 1WWKA 3Q7EA 2AS0A 3R3WA 3ZYCA 5ALOA 3ED1A 3QH4A 2P0AA 5IH3A 5I4IA 3WNVA 4CLDA 3SHTA 3VHLB 4BNHA 4ZN6A 1DO8A 2AYZA 3PWKA 4OBEA 1GD1O 4MITA 4BEBA 1KKMA 5LDHA 2GASA 5CD9A 2CN1A 1E9EA 2XYQA 1DC3A 4XCQA 5IAJA 1RPJA 2Y6UA 1KMHA 4MVJE 1KFJB 3V80A 3WZLA 1JPJA 2FFJA 3BIFA 2GRJA 1AUXA 2MSLA 2QYOA 3SSOA 3M89A 4G5GA 4B5KA 1AKMA 4B3JA 3K8QA 1Z38A 4WMLA 3OFVA 4KW7A 2OZKA 3BYZA 1RHUA 4PHCA 2C0CA 4XW2A 3WNBA 3FDZA 4PSUA 2ZAOA 5CJ2A 3TWOA 2VZEA 1SHKA 2Q2NA 3NQ41 3TRIA 2WMOB 4EMBA 1KYXA 3OIGA 5JECA 3FUUA 3N6VA 5JZBA 1DWQA 1MQSA 3FCUB 4X8HA 5ES4B 4ETIA 3EQ9A 3QMVA 2QB5A 4E7PA 1E4EA 1RRKA 3DAPA 4L9WA 4F8YA 4JI1B 5KYUA 2FCRA 1NYLA 3W78A 2ZANA 2OKCA 3BL8A 3NWBA 1XWWA 1JMKC 1SIBE 1V5FA 4LYDA 2V7WA 2QGZA 4RCVA 4B3RB 3OU6A 2H1LA 2JFGA 3JQEA 4IWXA 2F67A 1MTZA 3ICPA 1P0MA 2A30A 2I7TA 1JHAA 4AECA 2H48A 4XVRA 1DO2A 1T6YA 4B6RA 5CAEB 3DYBA 2QN1A 2PJDA 2XOXA 4DSZA 1F1BA 3MRVA 5KUTA 2ZW9A 3NVDA 4OJTA 1OZAA 1V71A 3C0KA 1Y6RA 5KQMA 4B6OA 3CVYA 2O7SA 4H9GA 4BP9A 2QN6A 1ISMA 4J9UE 5EY5B 1CRLA 3ZD7A 2Q4OA 4CIBA 1DOAA 1ZYUA 4FYMA 4NMWA 3IOEA 3MSXA 3U5TA 3D4PA 2CBGA 1YL7A 2O0JA 4US1R 3L8GA 5LQRA 3RVRA 2GK7A 2H2IA 1ZHFA 2VF2A 5C1BA 1HKHA 5JROA 4BJ6A 3T3EA 3VNUA 1UFOA 3L1IA 3LQRA 1Z56C 2DT8A 2P9ZA 2VCHA 4NV0A 4N1AA 3OEED 5BRJA 2DH6A 4DB4A 4J1SA 4D97A 4M46A 1AVTA 3QPAA 2VT6A 3OECA 4H4DA 4EK9A 2C4KA 2E49A 1P4AA 5FO1A 4H2DA 2FPMA 2XUQA 1UZNA 1YH3A 4H7FA 3UAZA 2EFDB 2WZCA 3AY6A 3H1GA 2VDLB 2X7HA 1MOSA 2I76A 2REQB 3H2GA 4PPFA 1T9CA 4DA7A 5KYKA 1ICIA 2H11A 5B6PA 1NXVA 2WNHA 5ITZB 3EFOA 1FJXA 1P6XA 2PKYX 3GAAA 3U5ZB 5F3RA 3LLVA 4IV5A 3WHPA 2MSNA 4KXQA 1OASA 3TQRA 3ILVA 2L0XA 1QXSA 1QJ4A 1NPYA 3BEOA 1OE0A 4L57A 4CMAA 2P41A 2F6RA 3T99A 5AUPB 2WAAA 4NI5A 2C3MA 2HBYA 3U7GA 1YJAA 4DR3B 2YWXA 3B3QA 5AKGA 5A4IS 3HJTA 4QBFA 3LC2O 3LX4A 1HDZA 1K63A 4GIBA 1QGZA 3KV3O 1E2JA 1ZDMA 2X1MA 1CUUA 1N5KA 2A67A 1EFRD 4XARA 4F38A 1N36B 3DLTA 3MJ4A 1RLTA 2ZS9A 3NTOA 4MRRA 4NEHB 4C5AA 2HPAA 3A37A 4DA8A 3ADKA 5TC4A 3K2BA 2Q8PA 3CW8X 3RE1A 3UJ8A 3OU2A 4QQ8A 4UMVA 5TQVA 3T4PA 4RNDB 4WQMA 2BTEA 4J3JA 4OU5A 4YH1A 1N7JA 3I64A 2J0SA 1EUDA 5FOWA 1FDVA 2HUNA 1U3TA 4U6QA 4KR6A 4JQYA 4C05A 4Q7LA 2VP6A 4GYJA 5L3RA 3WKCA 1YO6A 4PCUA 1K5PA 3OZIA 2GX6A 2I34A 3AOEC 1FL9A 1W9MA 2YX1A 3D4BA 3ZE1B 3EIUA 4UOEA 5KVSA 4KR9A 1LXCA 4JWKA 1KDPA 1XRPA 3U3XA 5FAKA 3O8CA 3COJA 2GQ0A 1G7SA 2GF0A 2L19A 4YB8A 2OYRA 4E2FA 4DR6B 2O8BA 3ONNA 2PKWA 1V6CA 2VSYA 2PH7A 5EJFA 3QKWA 3TLBA 1BHSA 2WIAA 3C4QA 4M1KA 4ZICA 3EIXA 2VH1A 1M0WA 2WE8A 4DUYB 3WNDA 1M34E 2P6PA 1OX4B 3AO0B 5KC8A 5LQAA 1BCRB 2W6JD 4MVXA 3BJIC 2G1AA 3GJ5A 3M0EA 4WDQA 1YJQA 3JQ7B 3KSZO 3IBTA 1Y1RA 3ESDA 3PUWA 4S0ZA 1WUIS 4OUKX 3OA2A 1AQYA 1UPFA 2JLQA 1Z4LA 3OX3A 5BSUA 2FZLA 3AXTA 4EO7A 1VBKA 5CDHA 1FDSA 3D9QX 1HLGA 1JXOA 3T9DA 5IVHA 1GYPA 4PFQA 3GEMA 4RTJA 2QUBA 2QV0A 4NPHA 1MA3A 3CNHA 3JQBC 3RRXA 3NB0A 4TWJA 5BR1A 1EP1B 4HNAA 2VRNA 4IIEA 4LYFA 3M1LA 1X7WB 3EB9A 5HKLA 3G89A 1EHYA 5EZSA 2EJCA 4CL8A 4E08A 2H08A 1EVYA 1XFAA 1FFBA 4D9CA 4XQEA 1JB1A 4X44A 3PFCA 3FWZA 3FTPA 5FI1B 3EDRA 1A5SB 5K3SA 5JVDF 3EGEA 4E15A 3I92A 2YOHA 4NMXB 4R69A 1L8QA 3DL0A 3S7TA 1NE2A 4ZYTA 1P3Y1 3Q12A 3H2JA 2ETXA 1MP0A 3PFFA 4OK5A 1BDIA 3QU4A 5AVQA 1FX1A 4N9QA 3QSYA 2FN9A 3DLCA 4GMKA 2FCAA 1LTHR 4IMIB 4QBGB 5A05A 1WBBA 1G8JA 1PNVA 1S4MA 3CZMA 1IZ8A 4PRKA 2X5OA 2AFHE 4Q18A 5CVEA 5LUBA 5B58C 5CDYA 1HDRA 3GVCA 1OWMA 2IYTA 3OCZA 3KE9A 3M1AA 4W4TA 3U9TA 3UMGA 3QUAA 3ROMA 5EKDA 2XF8A 4S35A 4AI6A 3G2MA 3ZG6A 4RD1A 1ZICA 1J5EB 1OI3A 2OXIA 5CFPA 1W35A 2YJ4A 3FHCB 2HO4A 4EEXA 3BVPA 4RMJA 3K1JA 4W9RA 4RPGA 1ZXLA 3VR4A 3ZI7A 1Z5OA 3GRCA 2Z6UA 3BE6A 1K97A 1ZK4A 2E3JA 4BKOA 2PA0A 1XRQA 2Z5LA 4KV7A 3K96A 4MNTA 5LZ5A 1N9GA 1XVUA 4ZIRB 3FNEA 3FF4A 4LFCB 5HOEA 3HSSA 1R6XA 4K6OA 4N3NA 5JTUA 1LLQA 2CXSA 3TLXA 3EUAA 1LPAB 3TSWA 5AI6A 1FIUA 1EZ1A 5IYZA 4FU0A 2HU8A 5DT2A 2CXPA 4XTCS 4QU9A 3B1JA 2YVAA 1OYVA 3U3OA 1MRSA 1LDMA 3C43A 3PCRB 3VKWA 3WIBA 1ECBA 2PCJA 4OQEA 1AS0A 2BM8A 1D4AA 2WJZB 1P4GA 3F90A 1ZL0A 3NGLA 3QVUA 4I9FA 4IIDA 4K5QA 4RWEA 2JDIA 4AG5A 1ZAYA 1D2HA 2EKZA 1J9ZA 3KR9A 3K0CC 3PWSA 1TVKB 4M7WA 1I14A 4QJ4A 2OY0A 2XKJE 5KQPA 2JCBA 1XHLA 3V1MA 4HDQB 1N1MA 3PS9A 2QAGC 3HB5X 4Q4AA 3ANSA 1KI7A 1OYYA 2Y0PA 2GYUA 1UC5B 2HJSA 3HC7A 4M22A 3VTZA 3NT4A 1OLUB 2I3GA 4ZI5A 3T3HA 3UB4A 5AW8A 4IOLA 2VVTA 4L02A 4X6YA 4YT2A 1Z12A 1NW8A 4FIDA 2J3JA 3VSEA 4KK4A 5LP6A 4F5DA 4K8OA 4MPTA 5CB4A 1C4XA 4B75A 4UM9B 1V0JA 4X6LA 2FF7A 1XA4A 4X6XA 4OTZA 1COWD 1M0TA 2QN7A 3B36A 2VAXA 4HRAA 4DLPA 5CCXA 4KDRA 5B3AA 3EXEB 4ZQBA 1UPAA 2NSHA 1MW9X 2YYSA 4NE9A 3WL8A 3ZY5A 4EGJA 2ZSIA 1MAHA 3EZYA 3I04M 3CUKA 1EM8B 2ZT6A 4M0KA 4JT9A 1EJBA 1K66A 2WU4A 2YC4C 4NOMA 3V8PA 2DERA 4N65A 1LW6E 3GQBB 1Y9JA 3IUMA 1W25A 2AN9A 2QJFA 4YYZA 5KDDA 2PWZA 5IAOA 2Z83A 2FLWA 4FILA 4JX8A 4XGQA 5J40A 2B8JA 3DFMA 3E3NA 3I3SR 2XCOA 1J8DA 4AUEA 4YBRA 1M2JA 4D9KA 3HY6A 3QMMA 3T0IA 1NBAA 4LXIA 1GQ2A 2CDRA 4LJ6A 2DRIA 2DTDA 2FYTA 3WGUA 4NWIA 3RDPA 3EFHA 5DI9A 3NVKI 1R7RA 1YOVB 4DQXA 1LDNA 1RT9A 1UDCA 3HCWA 2JLVA 3OIDA 2RGYA 2C31A 1P73A 4MWBA 3GJSA 4XDYA 3VC7A 5EL0A 2GZ3A 4MUEA 3PGVA 4RKEA 3ST7A 2IPMA 1NY6A 4UD6A 3BL5A 1J39A 1S2NA 3BE8A 2UXBB 1MJ5A 3BRCA 5CVUA 2Z5GA 1YR8A 4HNTA 1UK8A 1G20B 4YECA 4NMMA 1C1XA 1BX0A 4G25A 1MJGM 2XQGA 1XRMA 3NC4A 4N3BA 3G8DA 1OTHA 2PGLA 4UEWA 1B7GO 3OX1A 5DLYA 1Y3AA 3A9CA 1MHTA 5BQPA 3LY8A 1T1EA 1G4AE 1WY5A 3KXIA 3RQIA 1JIVA 4ZT4A 4MRPA 2FX3A 4ZP1A 3LBIA 3WRXC 3MJTA 1CP2A 1I3OA 2Q6IA 2VK2A 4IZIA 3RVQA 5AOAA 3WYAA 3B6MA 3W79A 2ZE5A 4F91B 2GZMA 4TLBA 3SFVA 1N2EA 1ZI6A 3IKJA 3R09A 4I46A 3DOUA 2B4TO 1Z2CA 3B52X 3C98A 3L79A 4HDSB 2EEZA 2ZZKA 3CNLA 2JAUA 1XA3A 2QF7A 2EJUA 1N5RA 2IUUA 10MHA 1UJBA 1RTKA 1NRWA 3NM6B 3LC0A 1YNSA 1Q7TA 3DE4X 5FTNA 1WSAA 4PLPA 4V24A 2C0QA 3LHKA 1Q12A 2XQIA 4EJFA 2N47A 5ES3A 1J2UA 3L0IB 5JC1A 1PFWA 4H0CA 1Q17A 2JVKA 5KWIA 4O2AA 2QK4A 2VBCA 3NBYC 1B2RA 4UNRA 4RPIA 2F62A 1YRYE 5EE9A 2E1RA 3DZHA 3WLPA 4EBBA 4Z4EA 4NAUA 3NJ4A 1U0TA 5L3SB 5I4BA 3IH5A 4INJA 1N2HA 5BYBA 2PZBA 1WY7A 3NC0C 3JWPA 4LMRA 1M2EA 1XTRA 5A02A 1B6RA 1NQXA 1XUOA 4GR5A 3OZRA 5THKA 4QSHA 5E4TA 3IE0A 2PU7A 1GCAA 3G7UA 5L53A 3U7JA 5BWCA 4KDFA 1NMEA 2YNMC 2EJBA 5GP1A 4RZHA 3ROEA 2I6UA 4CN8A 5BV1A 1KL7A 2VWQA 3JQDA 3B1ZA 4RIHA 1RRMA 4ZKEA 4UZEA 3SC2B 2VHVA 3PDIB 3VZCA 3A6LA 3CUSA 3DV0A 1GO2A 3IAXA 2JH9A 3GGJA 1ETHA 4HDRA 3NAGA 3D4LA 4OK6A 2BGWA 2VHZA 4FGJA 4CKXA 3WLLA 3IALA 4IX9A 1QZUA 5KSZA 1HFEL 3HEBA 1KHTA 2P2ZA 3IBSA 3ONWA 4G0XA 2A1UA 2L2QA 1SIOA 4J29A 4D74A 4FD2A 3R7WB 4YJ2A 3HK2A 2ZU6A 2FOLA 3PPXA 4Q4DA 3AUTA 3ONDA 4C2TA 2ZATA 1FFDA 2CJWA 1SPXA 4P82A 1VJGA 2C2YA 1PZXA 3VR6H 4CM4A 2LR0A 1W87A 3NIFB 4OMDA 3TBHA 4CV0A 2VJYA 3OZBA 5JJCA 3PEWA 3I5AA 5C7YA 3OWHA 4H3VA 1S1MA 2ONKA 1T5HX 2IPOA 2VDJA 3IDSA 3R0JA 4RZSA 2NXCA 2UAGA 3CBGA 1UFQA 2TS1A 4REQA 1NNSA 4LF5B 2Q21A 4HPXB 2PS1A 4JQCA 4QFBA 4ETWA 3OQOA 1PG5A 5DHSA 3RUDA 1YKGA 2IH5A 3IEPA 4LDRA 1EP2B 4N8DA 1PVDA 3LDFA 1UINA 3S8MA 3EXHA 2IXBA 3RVPA 2QRLA 3DVAB 1HYQA 3UMFA 4DGQA 2VPTA 3DH0A 3NBZC 4FSDA 2GAJA 2QYTA 2VP3A 5FV4A 4Z9BA 3O2JA 2CEAA 1RWBA 1R5JA 3Q98A 5EIAA 5G02A 4A15A 3EUWA 4F92B 3KQUA 4YP6A 4YA6A 4L76A 3T94A 3REQA 3T5GA 1DRUA 3QU9A 4JJ7A 2H57A 3DMTA 4Z0TA 4YYEA 2JD2A 2GA8A 4RELA 4BB6A 5IWAB 1RZ3A 2P9TA 3FSGA 1I80A 2A3NA 2J0UB 1F0YA 3S2IA 4JI4B 4X1IA 3C3WA 2J4CA 2V65A 1JKIA 3MAJA 4ZHQA 4HTAA 1P5FA 1ZH4A 1TZKA 1WSDA 2NVWA 1C30B 1K8XB 2OK8A 2P2LA 2BW0A 2KM1A 2Q3CA 2X1VA 2YCBA 4BASA 2A9JA 4BRUA 3B2QA 3DM5A 3RS4A 1JIUA 1U81A 1PJ3A 5A1JA 2Y9PB 1U1IA 2CXOA 4U8GA 5FNVB 2BH9A 2GTHA 1MVOA 4UNPA 2NAFA 3FYHA 4IMPA 4W1RA 2Z6AA 1EFTA 2VZLA 5TPWB 3PEFA 4RZIA 1EXMA 2PUHA 3IO5A 4PLCA 2AEFA 2KHZA 2R87A 3CG0A 1M76A 2F1HA 3L04A 2QTHA 2QW1A 5B1SA 4AXBA 3HN6A 3QVOA 2Q9UA 3E2IA 2AW3A 2AKYA 3V4LA 3BHMA 5HQJA 3KC2A 4BNZA 3OESA 4JYZA 2WYUA 3QKUA 2I2XB 5KQRA 3SZMA 2VZ0A 2G7ZA 5C9ZA 1DVRA 2BSXA 3D2CA 3HA5A 3UOWA 2GBPA 3CO5A 4A5SA 5B2EA 2PD4A 3B7GA 3CISA 3FKJA 5H0IA 3JU3A 2PRIA 1E2IA 3FXAA 1QFZA 2RAFA 3LPMA 2CNDA 2YNMA 1RDFA 3D4OA 4NESA 2MMCA 4G4SO 1PCXA 4ARBA 4Y2HA 2EP5A 2ZULA 4LX0A 4PWZA 1OXVA 3H5TA 5FBLB 3VDMA 3UJBA 3TSZA 1KYIA 4HNQA 5FT9A 2JZOA 4BO6A 4UE2A 4B5LA 4URXR 1JDVA 1Q95A 3CVXA 3PEYA 3SKXA 1VLQA 5AVXA 3I62A 1S02A 3JQ7A 3JYHA 1UOEA 4KREA 2NZJA 4RLHA 3SZ3A 2JJMA 2OBBA 3CEHA 3I72A 3C7CB 1ZR4A 4OMUA 2GTPA 5LP6F 3TCNA 2KQUA 2PWBA 2OGZA 1R66A 3EVCA 3NPMA 2ZIUB 3AJ8A 2ZUCA 3DFKA 3FZQA 3PD7A 2G40A 3OO1A 5HOQA 4EQ6B 5C8DA 3K6RA 4X6UA 1TMKA 3H8WA 2WJVA 1UDBA 3EMBA 4CW7A 1S0UA 2RBKA 2IW1A 3R3XA 1X15A 3GDWA 2WU3A 5FV7A 1T9BA 2R7AA 2R96A 4LDAA 1RABA 3HU5A 4BP3A 1P9LA 1V3VA 4LK2A 3UA3A 5IFKA 4BAUA 2YVLA 4N6GA 4R8RA 4CI0B 2V0NA 4KYVA 4WY5A 4N48A 1MV8A 1XE3A 3CLKA 4P58A 4RKFA 2PRKA 3HM2A 2MHCA 1AZSC 3RSZA 4E2ZA 1TU0A 4NBUA 2CVQA 2DVMA 4UD2A 2AR9A 4FBLA 4J91A 5DP1A 2IX3A 3A6JA 1BDHA 3N7UA 5AXBA 2I0FA 3U4IA 2GCOA 1HG0A 1HT0A 2OCPA 3GNSA 3LSTA 3VO8A 3HBAA 3AR9A 4IGFA 4MICA 3THXA 4XRGA 1JECA 3DV2A 4AZVA 5KTRA 5KX5A 4GRAA 1H5UA 5E0OA 4B31A 4C4RA 4KR7A 1OH5A 1GV1A 2WA1A 3MWLA 4WEOA 1EB8A 1CKEA 5KC9A 1NLUA 3NDIA 4JL6A 4MUNA 2YL2A 3D0QA 2NUTB 3E9YA 1IXSB 5BN4B 3Q9LA 5JSKA 3N0XA 1OGYA 2LNDA 5KYNA 1MOPA 2HCRA 2REBA 3R24A 2XE6A 3VSCA 2QAGA 3INTA 1G7TA 3IL2A 3ENQA 4Z0NA 1BKYA 1WMDA 1UM9A 1D6NA 4F4CA 3ZW9A 1GFSA 1JKJA 4QIHA 5ICGA 4BMPB 5AW4A 3UGTA 1FF9A 2PDAA 2FEAA 4MYUA 3KKKA 4PAGA 1SM4A 5HZGA 4JI8B 5LWHA 1FSGA 4N5NA 2PL5A 1J6UA 3L6UA 1C8KA 2H1CA 3JV7A 5AI4A 5KSOA 5ALWA 4G8BA 4ENSA 1W52X 1PZNA 1VL5A 1LWNA 3AR2A 4H27A 4FQ8A 1FRVA 2ZBFA 3RS7A 2JGNA 4PXAA 4AB1A 4EO4A 3SM9A 3CRQA 1K27A 1SHUX 2X9GA 3D1VA 1ZA1A 1QFSA 2AE1A 1A2BA 4MCJA 3WE7A 1EGQA 2RC6A 2VK4A 2YBDA 3E5RA 3KZCA 4BLWA 4XYLA 1WEKA 3PKJA 1NN5A 1NVGA 1Q57A 1XRLA 1TQHA 5AKXA 4MUHA 5CYPA 2OD9A 5DCUA 5DK4A 3ELYA 5JD4A 2OTCA 1RD4A 1Y5RA 2HNAA 2XOEA 2CDAA 4NDZA 1QO0A 2VNSA 4H59A 2QX8A 1SO8A 4QUGA 2JIQA 2E82A 1RQ7A 2O3TA 2WILA 2QY6A 3HDGA 4OFBA 1R0LA 3C3DA 1QTIA 5DNVA 2GAAA 2HK6A 4PXSA 1YAHA 4XQGA 3DO8A 1ZBQA 3QE0A 2JH3A 2PFSA 1C3OB 2VDNB 3MFYA 1OC4A 5LLDA 5DIFA 3GR6A 4H3HB 1PJAA 3ZCRA 3WHKA 1G17A 1MX5A 4R1LA 2IBSA 4AJIA 2O0LA 4QGHA 4EHAA 5A3JA 2JI9A 2OSBA 4A8TA 4B2LA 3IULA 5HVNA 5DRYA 4OHVA 4F9FA 1VBFA 4G6ZA 3F4BA 3B48A 1IEXA 5DW3A 5MN6A 3B6JA 2RG1A 1WUHS 2PBZA 3GAFA 5D85A 3VVBA 5JLJA 3QXJA 2PH1A 4PO8A 3GOHA 3GVHA 4TKMA 4O0MA 3Q11A 4L9AA 5EWMA 4ZVPA 4DHEA 3FTNA 1BS2A 2BFFB 2N75A 2QD1A 1YNOA 3G2PA 3LVRE 3MWDB 4MWGA 2QAIA 1OZ0A 2WY2D 1KYZA 4Q6BA 3ND7A 4EARA 3U40A 4JJZA 5EWLB 2VPIA 4OQPA 3FLAA 4R6WA 1Z4MA 1UZAA 4O4HA 3AYXB 3QF4B 1GNLA 4KU4A 1AKUA 3VBCA 4PSVA 2PZLA 3B8EA 1CUZA 1KJIA 3IJ5A 2DX7A 5GONF 1SOWA 3N59A 4CKZA 5B6JA 1N4DA 2R8XA 1OH7A 1VL8A 1KY2A 1Y3FE 2ECOA 3L6OO 3N2KB 4KOAA 1KH2A 5LM3A 3IC5A 2ALJA 1EPUA 2K6GA 2QPTA 4Y8VA 1RZVA 5H68A 4ZTUB 3FMGA 2N0SA 5DX1A 3TIVA 1UM9B 4WXHA 2CL7X 1L4FA 4BVJA 1I7QB 4FLFA 3NUZA 5E1DA 1PWHA 1Q2XA 1C50A 1T5DX 2P78A 4FTWA 4TV8F 3PD1A 2WKPA 4U3JA 5ED0A 4E94A 4CU2A 3ZWDA 3OEEA 4MKGA 2P3OA 3AW9A 2M6SA 4X84A 4AUNA 4YR7A 2AJ8A 2NZWA 3N2EA 1XZFA 2DY0A 3JSAA 4YRKA 1XTPA 3CW2A 3PKZA 1YMQA 3GBVA 4WZAE 2PO7A 2CJXA 1E9DA 1XJQA 2JCYA 3OE5A 2V9CA 1BSVA 2VXYA 4H31A 3K9HA 1DELA 4PRZA 1K75A 2J32A 2HO5A 1H5QA 4LHYA 1GVHA 1J97A 1YZNA 4BVHA 4ENTA 1QTQA 4YJ2F 5KX5B 2BE7A 4HB0A 4K3UA 4PS1A 3TAXA 1Y1TA 5H70A 3PRHA 1JH9A 5CRIA 3TTXA 3BZUA 3KIPA 3P9QA 4CIDA 3FPSA 4LRQA 2Z56A 2ZBGA 5DYIA 3Q8KA 3K5PA 2QUIA 4BGUA 1P2TA 5DYYA 2ZYDA 1LTQA 3UJHA 5DM1A 4YV0A 5BUSA 1O9BA 2ZRBA 3GVXA 4G24A 4BMSA 4KGDA 3HVRA 3VKUA 2FSVC 5L7WA 1W0JA 1AGPA 2CYBA 4FYHA 4Q1CA 2G67A 3AUFA 3PJGA 1O97C 1CZHA 2BSAA 3BK7A 3KVNA 1K5GA 1G98A 2ZB7A 4R05A 2H85A 5A7FA 3HYLA 2MYNA 1VKRA 4P86A 2NU6A 1BXZA 3I2KA 3TL3A 2R65A 4FFVA 2FNAA 4R2JA 2F4NA 1UFRA 1HEYA 4N4AA 3A9TA 1YIDA 2PNFA 3AGPA 5T6BA 1H2HA 4S1VA 3ZWOA 1NI4B 2H4XA 3VYTB 4YEDA 2AZDA 2A35A 2I7XA 4HQ0A 4JJEA 1PZMA 1WTCA 3ES9A 1Q3HA 3PBKA 4LUCA 4H1UA 3PF9A 3AWIA 2ISCA 4GR4A 3DZDA 4GVLA 4X92A 3VPFA 3IMCA 2GPYA 4CETA 2WWTA 1B8NA 5JRJA 1VLZA 2ZJZA 3DPIA 2WZBA 1TUGA 4LCJA 4MS4A 4EJSA 2J6IA 3B9RA 2A0XA 2XNKA 4TUYA 1E0JA 1JKMA 1T6XA 3L6EA 2DHQA 2H1OA 1X1QA 3AJEA 1QR6A 2RHOA 1U2EA 1NQVA 4GQIA 5IKMA 5KZMB 2XDWA 3GQVA 1TF7A 3ZE2B 1A9XA 2V7TA 1D0VA 2G1PA 2DCUA 3H3JA 2DBRA 1SXHA 3PTLA 4UE3S 3HUDA 5FI0B 3CG4A 2I62A 4J7CA 5BVHA 1YIOA 4KAXA 4RFSB 5H1YA 1Y8QB 1GSAA 3T35A 1YFKA 2FEPA 4RVFA 5LXTF 3TQSA 4M49A 4OHXA 5DXFA 3K0FB 5CB0A 4XVCA 1NBHA 2G8NA 1TPYA 2O6HA 3BKWA 3DDHA 3P9CA 4PEVA 4K88A 5A9RA 1QIHA 4Y2QA 4B7AA 2HK9A 1Q1GA 2W2NA 2BKAA 3MW8A 2BZSA 3LY9A 4PO1A 4PYLA 4DBLE 3S2SA 1S3IA 4DSOA 1J0AA 3JD2A 1BZYA 2TSYB 5EFOA 4Q03A 4RVUA 1JR3D 1W96A 2C5HA 4TMKA 3ROKA 3UGKA 5IX8A 2A58A 2QN9A 3IERA 3PNYA 4FFDA 3AK4A 3DA8A 4N3CA 5PNTA 3OKAA 3B9BA 1SXPA 3QWFA 1S3FA 2PX8A 3H9BA 2A7XA 5E2AA 1SKYB 1Z36A 4LKOA 1N0IA 3ADDA 2JLYA 1ZD9A 4I1VA 3DMDA 1J24A 4G37A 1VKHA 4OI2A 3SVTA 1S2OA 2Q50A 1H9AA 3IDQA 5H5JA 1SEPA 1P1KA 2FMFA 4AP9A 2PLNA 5JSZB 3KPUA 2WPNA 1WKBA 4EKNB 1U0JA 4ZTBA 2IOQA 1XEWX 3ICVA 3AM3A 3LF2A 1T9GS 1Y6GA 4C4SA 2ZIFA 4D26A 1VSBA 3WGTA 5DNDA 1O6CA 1KWGA 1IE3A 4JIGA 5ADUS 1Z83A 3W90A 4LY6A 1O58A 2Q5FA 2NZYA 1GPDG 1M1ZA 3IB6A 4GLBA 1EFLA 1II8A 3E3LA 4LGVA 1FMLA 2QUKA 4CV3A 4CQMB 5EIXA 4RSMA 4ZA2A 1JHPA 1YE8A 4FN4A 3EIHA 2DFKB 2I1VB 4ZT3A 4IKOA 4MRAA 3D64A 2GF9A 1PS9A 1PZHA 1V39A 1MPXA 2H63A 1H2XA 3TH5A 2A57A 4MHOA 4AKSA 5KBYA 5KWVA 5EJAA 4CBVA 2F59A 3FR7A 3W8FA 4C0JA 4ZVQA 3FJOA 2UVPB 1LBIA 3EQ6A 3FYUC 3LDGA 5AW5A 2L17A 5CW1A 3QA3E 4GC5A 5JAMA 1KIFA 3EXFB 1IJBA 5T8KA 1WDLA 1X38A 1PG2A 1HQCA 2DLDA 5A4MS 2AFVA 4RDHA 4HAVA 2JK1A 1YXMA 4JUCA 4E32A 4O08A 1Z0IA 1VYHA 4ACBA 1Z0JA 2BGRA 4BJ3A 3MJVA 3MT0A 1WHSA 3KLNA 1N8TA 2FPGB 1E0KA 1E61A 2HJVA 3NR2A 3O4RA 4TQ9A 4CMJA 4I1PA 1NN3A 3NW9A 5JTTA 4JROA 5KMGB 4QQRA 4IWNA 4UOQA 4BL5A 1U7DA 4EJSC 2WWVD 2VOJA 5HA5A 3WNZA 1NL3A 4AZ0B 4QTYA 3VSDA 2RH4A 4G0VA 3W3AD 1CUGA 2XDQB 4ZVUA 2H16A 3OLQA 4E5SA 1RBZA 4FB4A 4WJZA 3USES 5HW0A 1BIFA 3TFQA 1HDCA 3M6MD 4P08A 1FNDA 1DAOA 4X3CA 1T4CB 1UC9A 1HNWB 1OREA 1EEHA 5JWRA 2CKDA 4HRYA 2GT1A 3TMYA 4WCFC 5ELXA 2QOEA 4NJMA 1M8FA 1ISFA 1H9BA 1W30A 2RAUA 4HDOB 4PX2A 4PAOA 3T4XA 2C82A 2RK6A 2E5LB 5H9VA 5HTOA 1U2PA 4G0UA 2O8EA 2O2ZA 3KT8A 2G77B 1B26A 1ML4A 4WJKB 2OENG 3KFXA 3E82A 3LY5A 3U3RA 3PLNA 2SECE 1J8FA 3K2IA 3AUSA 1JAZA 1ZKDA 1T5OA 1QOQB 3LO5A 4L4XA 1RYFA 4IVQA 2PV0A 4S2UA 4TM8A 4DLAA 3OHSX 3C5WP 5G1OA 5T3YA 3HZZA 1IJEA 3BD9A 3ROTA 3TW6A 1W36D 1JIQA 2ZJ0A 4JT8A 3WI7A 2JLZA 3A7EA 1T0IA 2LCQA 1SC1A 1XAGA 2O9JA 3ND6A 1RBYA 3GLTA 4CUZA 2DOKA 2CWWA 1B42A 2DWOA 5JS2A 3X1XA 2AA3A 4D98A 2I3DA 4E70A 2XZOA 1GZ7A 1GM5A 1ISHA 1J9GA 1XX6A 2D2EA 4Q24A 2EIXA 4GZ6A 1IBSA 2EGUA 4HGRA 5BWLA 3SHOA 4ZAVA 1O2DA 2GARA 3C5VA 5DM4A 1X14A 4Z9AA 5D3QA 3RF6A 4C4XA 4BV8A 3CVWA 1CW2B 3KTOA 2JIPA 4RVNA 3NORA 3GEHA 2M1XA 1YACA 3MGAA 3SBXA 1JHDA 3RS3A 4M0EA 2IUTA 1U0BB 4UVHA 4CV1A 5BWOA 1ORTA 2HHCA 3T5PA 3X2FA 1ONPA 4CLOB 1NNEA 5GZ1A 1QYIA 5JXIA 1XD2B 2OGTA 2YASA 4V1CB 4G5HA 3WLHA 1ADBA 3RFXA 2IHKA 1VZ2A 4ZEVA 5J5CA 1C0EA 4MI1A 4NU5A 4TTAA 4XPIA 3PUZA 4JJKA 4OQQA 1OLSA 4OJMX 4Z6KA 4Y6QA 4QBHA 1KPIA 4HX5A 1CUVA 1RI1A 1HT1E 1A2QA 1DMRA 5LD2B 3DMGA 4K40A 1X80B 3VU8A 2XYGA 3P2MA 4FYIA 1EB9A 2DULA 5LOVF 2EDAA 3BGVA 5DLEA 4DIEA 3RTBA 1NUAA 5KO2A 1MB0A 1NONA 2UXDB 2V96A 3H6KA 1ODKA 4UEKA 3M4ZA 1LLCA 4IUCS 5FWXA 3W5SA 3FJ1A 4MPJA 4H0FA 4R2MA 4ZQCB 2XZLA 4QG3A 5B1EA 1TM5E 4PZPA 2D1FA 4ZCLA 3I01A 2PMCA 3GD7A 2GBIA 2WG1A 4X54A 1OLXA 4FW8A 4Y6PA 5IUNC 3GJXC 2V6IA 4ZI2A 1PRYA 2WM8A 2YVUA 1QV6A 4GD3Q 1CVLA 1FXSA 3GA7A 4Y2YA 3RAJA 2IP1A 3JAMA 2OWDA 1M6YA 4P92A 4XZ3A 3OPNA 1JMYA 2DFDA 3KZVA 1YVRA 4RHCA 5HQTA 3AJRA 3AYZB 4JR2A 4MB0A 5BVGB 3JVVA 5A5GA 5K0EA 4GUAA 2EATA 3AESA 2M2IA 1H8EA 4NTZA 2WHXA 1KI2A 3R8XA 3GQBA 2EKLA 2FOXA 4OY3A 4DMKA 4NZZA 1S96A 3DPUA 4HYQA 4BEWA 4FYXA 3LWDA 3DT6A 4BZWA 4DMRA 1BH6A 3VYVA 1NF8A 3CB4A 3ZK7A 4R2LA 3ZK9A 1HBJA 4DV2B 3QHPA 1IHPA 3E18A 2QG9A 4F4JA 4HLQB 1PLKA 3LOQA 2ZSAA 1RXCA 3FE2A 4D80A 2C2MA 1SIUA 2CLLB 3L92A 1P1JA 5GM2A 1BMTA 2QVLA 1VIAA 2YNMD 3KPJA 3BWCA 3EVBA 3QVMA 2H07A 2O20A 5CLIA 3JASA 5T4BA 3WGZA 3ZOKA 4COOA 4DHWA 2Q28A 2PBLA 1CUWA 3U7QB 1Z39A 1IMOA 3IYLW 1ZIOA 5EINA 1C0PA 4B35A 1XRRA 4LXTA 3ELBA 4P4NA 1C7FA 3ITDA 1KZYC 1YZVA 3ND9A 3QXCA 4HJRA 2BFEB 3A3PA 3EZ9A 4P34A 5HE8A 4TKUA 2QRKA 2PKCA 5CYFA 3QX9A 5AI5A 3THRA 1M75A 3GJ7A 2XNCA 1E3QA 1FBNA 2OFXA 1PQ4A 3D0OA 3RK4A 2PMEA 3V2UA 4UPEA 1XXLA 3VAYA 1N5LA 1HA3A 2Z2ZA 4UPVA 4LGYA 3NKFA 3RJ5A 2I6QA 1V8OA 1QH9A 4B8WA 3BF7A 1W1IA 1XTKA 3PE4A 4ZMBA 1EX1A 1QUEA 5BY2A 2YWFA 4HLNA 5IC5A 4EABA 3OZEA 3SS7X 3PQ8A 1CQIB 1QONA 5F1PA 1UQRA 2O3SA 4A2QA 2R8BA 5EG5A 4ICIA 1TQ8A 4ZO7A 3VZSA 4D9MA 4Y1RB 3VR4H 2VNKA 3TNYA 2HPZA 4C78A 1U6JA 2CB0A 4DJAA 4O8ZA 4O2AF 2JHPA 1BWPA 2Z3VA 1DP4A 4R7TA 4JP5A 2YMLA 1OXBB 5LQUA 3EFEA 1N9KA 3TSCA 3T0GA 1C7QA 2HAEA 3LHSA 3N5CA 1C1DB 2C20A 3ZYZA 1POXA 1NAIA 2WI8A 5FP0A 3VC2A 3PVCA 1VIVA 3EZ2A 3DE1X 4ZT2A 1W4CA 4CF6A 4TUYF 2EL9A 3HCPA 4NEGA 2AGVA 2QZZA 1E5QA 1PT5A 3OZ7A 2HLPA 1HUQA 1E89A 3NTUA 1F06A 1QLWA 3R3SA 4QNRA 5COQA 4DR2B 2GEFA 1H22A 5DBIA 4D6XA 5CLHA 2HHHB 3FCSB 1Z5VA 1OV6A 4KO4S 1IY2A 4M9CA 4NOJA 1X39A 1JW9B 1PR2A 4O4LB 4BNVA 2PPLA 3TOVA 4EB6A 3EVTA 1GZSA 4A26A 1EA5A 4FC6A 4O3FA 5CDSA 2VNAA 3V2HA 1ENOA 5F78A 1QB8A 3B38A 5DHQA 2BUBA 4D8TA 4GP7A 2J08A 4M98A 4UUMA 3DLBA 5B7QA 3H11A 5FFNA 5AM1A 4UNNA 4AP5A 3K6SB 3RLFA 1HTBA 2EC5A 2JGFA 1JU9A 2ES4A 2OMKA 4MTCA 4TSKA 5IJXA 3ZXIA 4HLUC 3W6OA 1APBA 2Q1UA 2Q6VA 4O2BA 1U0LA 6LDHA 2ZYSA 1C9DB 1OYWA 1XQ1A 4YMVA 2AYXA 1J0CA 1GQOA 1CQJA 1TMOA 2G6BA 2GK4A 2XZTA 2AUMA 3DUFA 4OAPA 4UQPA 1H3EA 4KRGA 5EESA 3DQZA 3IVAA 3I4FA 4P0TA 3COSA 3WGHA 3CF4A 4J9VA 5FL7D 4JI2B 1XKTA 2FU5C 1BEUB 4HCJA 1Y4ZA 5ESXA 1ZC4A 3NWEA 2FZCA 4MVJA 1XFDA 4Q1VA 2BI4A 3OQPA 5IJ0B 3M4YA 4IJVA 1W5SA 4N7RA 3AJAA 3WBBA 3Q9UA 1W44A 2C77A 4UMDA 3RANA 1GR1A 4DY4A 5M2QA 3OTIA 3FOZA 5K5EA 1MW8X 2Q7DA 1NPTO 3D8SA 4YJ3F 4FB5A 5D51S 3ZJVA 5EI5A 2X0RA 3MJFA 4L0QA 2XQKA 4D43A 1U2GC 2CDNA 4CNBA 2FHSA 1TJ4A 1ECCA 3HA3A 3IEUA 5AVUA 3QFTA 5FL7A 2ZBVA 1FUEA 2X0JA 4EGQA 3ILHA 3FNRA 3OWXA 4QO7A 4FKZA 2X3YA 4LN1A 4G86A 3UK7A 3SU8A 2F4VB 4D4HA 1X8KA 4ZOLF 1MNQA 1PV2A 4PZEA 3PTZA 3BRSA 1E1KA 2GNOA 3B1KA 5DGXA 4CFZA 3HFJA 4FZRA 2ID9A 3I6MA 1P81A 4OH7A 5E8JA 4MB2A 3GO4A 5EIFA 5IM4F 2AWNA 1NW3A 3BWXA 1V35A 5EE5B 2XCLA 3PL5A 2X76A 1J0EA 5IN4A 1QYDA 3EY4A 4F5YA 3IUJA 1GGFA 1NIPA 5C8YB 2ZSFA 3LI2A 4I9HA 1EDEA 3C4VA 5AH0A 3ND5A 1G3QA 5A4DA 3DFFA 7MHTA 3JQ8B 3LVFO 3VGJA 1P80A 3KR2A 3DDUA 2UU9B 1SBTA 2PT9A 3I9V1 5D1HA 1E3LA 3PR2B 2Z2IA 1KJZA 1NXOA 2WAYA 3RBXA 3JQAA 4C2UA 2LE0A 4MROA 1KDTA 5FX2A 3TGLA 1QO0D 1EK5A 3GPCA 3IP6A 1S8OA 3L7LA 1ZUD1 3I6IA 2J45A 3KX2A 3NJRA 4O02B 4R68A 1FQKA 5EZQA 2QI9F 3V1TC 1YVDA 3TMKA 2L69A 1ZI9A 2O23A 4HMQA 3IP8A 5DWVA 1U63A 1UPXA 2FE4A 3N53A 1FRQA 4PFSA 2G09A 1TJNA 5AXDA 1SVOA 5I7WA 1NKVA 3ZGXA 4UHCA 4JIMA 3T41A 3I28A 3VHQA 1JRLA 3CX6A 1OFVA 3D3WA 4DXHA 5CBPB 1CUJA 3VNRA 3WVNA 5K0ZA 4RZ2A 4RLQA 4I3HA 3ZZ1A 3KETA 5LYYA 1O4VA 4HUJA 3KKQA 5EXDA 3TRFA 1ZFNA 3UCXA 2X3UA 3BB3A 2R1TB 4GKAA 4CTKA 1S6YA 4ZYUA 1CY2A 1FSPA 4N8SA 4IGKA 1P31A 5FOVA 3WHIA 3R40A 1I10A 3THOA 1M1YE 5ALTA 4D7AA 3DXZA 1FFSA 1E7YA 2OM6A 1JE0A 5DJ5A 4YRJA 5JZSA 1ZS9A 1CB0A 1KEKA 3SFTA 3B6IA 2SKDA 3Q1KA 3O31A 3TR6A 4PZYA 2PV7A 4PBTA 1J2YA 5KTPA 2JLBA 4RY8A 4B3IA 4LVCA 5CFZA 1D2CA 2DR0A 1QQ7A 1LRJA 1IUOA 2WF8A 1KJJA 3AG5A 1IN8A 2R8PA 4LXYA 5FBRB 4HH3C 4IGIA 4RL4A 2NW6A 3GCWA 4RKRA 3ZV6A 2Y1FA 1I7NA 4K9OA 3S2ZA 5B64A 4P4GA 1QZXA 1W5EA 1L7RA 2A1TR 2GD0A 2VA8A 2V5AA 3K16A 3KTAB 3LZ6A 3SE0A 2W48A 4BAGA 4GU5A 1ODLA 4U9UA 4CM3A 2QBYB 1QQAA 4ME6A 1FTSA 1I7LA 1GZ5A 1DAKA 2CL0X 1MB2A 2Q07A 2LVBA 3K35A 3L0OA 3TSYA 3ZIDA 4E5MA 4WECA 3GYGA 3NP7A 4NBVA 4IF6A 1XVVA 3V1UA 3TK1A 3IPXA 2AL7A 1MU0A 3N0WA 4KG7A 1JQBA 4S1TA 3VTAA 4WV3A 3H9EO 1YR3A 5AFSA 4YP1A 3GT0A 4DZZA 5KYWB 4NCAA 2HTEA 5AW6A 1QDEA 2NSJA 5IULC 5I7UA 4YASA 3CLVA 1PZEA 1Z75A 1YQDA 3F5SA 4F2DA 1G5FA 4Z4FA 2GD6A 1Z26A 1T6ZA 2Q3JA 2YIDA 2X13A 3ZS8A 4KCGA 4NIMA 3FPHA 1VYTA 2EFHB 3BQMB 3ROZA 3A1TA 5JY6A 1HL7A 2IF2A 3UN1A 2WKWA 1D8TA 4H6PA 4RAQA 3RBZA 4BNMA 3J81k 3A0RB 1O95D 3D3NA 1JQKA 3ABRB 5CK4A 2P1RA 1PEKE 4DC1A 3L84A 5E4YA 5KJEA 4ZVOA 1CY6A 2B7LA 2XA2A 4NNOA 2XZDA 3RS5A 3IKMB 3SCZA 4MW7A 1TF5A 4ZTZB 4MQEA 1W5FA 3WBKA 3RVSA 3HB0A 3OPVA 4H4CA 3MD9A 4D4IA 4YMHA 3AL2A 3IVRA 1HFKA 3RC7A 2NU7B 2XVXA 4QJ5A 4X7PA 4DWOA 4RX1A 4G1VA 4YCBA 5C5CA 4LOAA 4DV4B 1J20A 1WXIA 5EMLA 1YZQA 4AP6A 1ZK3A 3OHPA 2IZ0A 3QPWA 1GNTA 2R6R1 4F3KA 3F6BX 4ZHSA 2C8VA 1NVDA 2A0FA 2PR7A 3QLUC 1FOEB 1SFRA 2JFNA 4G36A 5FJIA 4AMGA 2UZ0A 2C5LA 1S2LA 5H3HA 1DJOA 1QKIA 2Y1CA 4PR0A 3T95A 3LH5A 3PGA1 2R0QC 4ADSG 5REQA 2FX2A 1UBTS 2P27A 3QMWA 4E5VA 1M2KA 1IK6A 4OJYA 2OVBA 4BNTA 3T5MA 4QEDA 4K9QA 5CYOA 3BXGA 4OX9Y 2CNBA 1B1CA 4PZUA 3EUEA 2H7XA 3X1JA 3K8YA 5IKXA 4BEJA 1R4NA 3OMWA 2UYCA 1ZO8A 4FHEA 1SUCA 3LL7A 3LNTA 5CIYA 3LLCA 2X4LA 3CWCA 3IA2A 4YJDA 4NOKA 4XFJA 4Z3OA 1XZLA 2H54A 4GMXA 3OQ6A 3NBQA 2NNLD 2FDXA 1YI0A 1JA9A 4HWKA 3SSAA 2I33A 4OIFA 5DTJA 2X5NA 1XJWA 1XTVA 1ZCAA 5EYPA 3GJ0A 5CBKA 4KP7A 1B3RA 1ZRSA 2BBSA 2O3QA 4N18A 3ZPXA 1QGYA 2XI4A 1YRWA 4LZAA 4ZU6X 1CUSA 1NTRA 1R8QA 4PC1A 5EJMA 4CLRB 4F56A 2F9MA 3SC3A 1V8BA 2V7GA 3VKFA 4LFAB 2G82A 2X7XA 2I1WA 1DBIA 4Z1MA 3KQKA 1OOEA 1CY7A 1GUZA 2JGAA 4AKIA 2BDTA 3BIWA 1LK0A 1GL3A 1A7KA 1S9DA 2FR0A 2CLIB 3QX3A 3KTFA 4BFTA 3UWDA 2DFTA 4J07A 5HSGA 4FCVA 3U81A 5BT8A 4BUJA 1NUQA 3WZMA 1I13A 4LHXA 1PZFA 1JBEA 3IDOA 4OHBA 3N05A 1FNMA 3VISA 1XKXA 1N3BA 4ND3A 1Z5NA 3W4KA 2AJDA 3L4EA 4E51A 5EMMA 1AM4D 1ECPA 4W9NA 1LKZA 2AMJA 3VTFA 1JHQA 1E3JA 3ZV3A 3URKA 3R3HA 2CHUA 3BCHA 1LLUA 3FAKA 3C39A 3U3JA 2EWMA 2OZVA 1CQWA 3TS1A 1U6IA 3PHGA 2JLWA 1T8WA 2FW1A 2D1QA 1PS0A 1FS5A 3U6BA 1A95A 3K0BA 3OZCA 3OOYA 4Y6GB 3KSUA 4K03A 3QOWA 3E22B 5FTWA 4IDGA 3NM5A 5AXAA 1Y5NA 1RWKA 1X87A 5HNKA 1JFTA 1G8AA 3L8HA 3H84A 3STYA 1ZOOA 1T4DA 1EH5A 1NVWQ