4TTSA

Crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (y200a) complex with 10-formyl-5,8-dideazafolate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
308
Chain Sequence
MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWRLKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAVRLIATGKAPRIKQPEEGATAECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGKSVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKMIPGSQYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title Structures of the hydrolase domain of zebrafish 10-formyltetrahydrofolate dehydrogenase and its complexes reveal a complete set of key residues for hydrolysis and product inhibition
doi rcsb
source organism Danio rerio
molecule tags Oxidoreductase
total genus 87
structure length 308
sequence length 308
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 4ttsA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4ttsA01
3O1LA 3W7BA 4EW1A 4ZYZA 2YWRA 1C2TA 4TT8A 2BLNA 1MEJA 1JKXA 4PZUA 4ZZ0A 4ZZ3A 4EW3A 2CFIA 2BW0A 1RBQA 5CJJA 4ZYYA 4ZYUA 3DCJA 3DA8A 4IQFA 3R8XA 1RBMA 1RBYA 4YFVA 4QPCA 1RC1A 4YFYA 4Q12A 1NJSA 1S3IA 1MENA 4QPDA 4TTSA 2GARA 1GRCA 3N0VA 4DS3A 3LOUA 1RC0A 4TS4A 4ZZ2A 3KCQA 4ZYVA 4EW2A 1CDEA 3AUFA 1CDDA 3P9XA 4ZYXA 1ZLXA 4R8VA 5J9FA 1YRWA 3TQQA 3Q0IA 1GARA 3AV3A 4ZYWA 4ZZ1A 1ZLYA 1FMTA 4S1NA 2FMTA 3TQRA 4NV1A 3NRBA 1RBZA 1ZGHA 3GARA 3OBIA 1C3EA 5J63A 1MEOA 4ZYTA
chains in the Genus database with same CATH superfamily
3L6EA 1GV0A 1Z62A 4EFMA 5IKMA 1VGVA 3ZWAA 3HJGA 1QH9A 2C29D 3CZMA 4Z9AA 3AHCA 3B7GA 2J48A 2N75A 3LP8A 4NPAA 1E0SA 3K20A 1OC4A 3C48A 4L5IA 2D1SA 3HYRA 4WERA 3OTWA 4MUJA 5HFJA 2P2DA 1Z0DA 3HZZA 3TLYA 3TFQA 4RFLA 3SZ3A 3OT1A 2ARKA 4HDKB 2C2YA 1BAPA 2G6TA 4UNSA 4LOIA 1B26A 1PNTA 1H1LB 2WR8A 4JJGA 4WPGA 4D45A 1DEXA 5F7XA 1QYVA 5LQCA 2I7TA 1JQEA 3E0QA 2PH7A 4RY8A 3GYGA 1T5OA 3G2HA 4NU6A 3EWAA 3PB3A 4P34A 3HTXA 4KRFA 1Z45A 5JCJD 1QH1A 1T5BA 1JHAA 1NUHA 4J0KA 4ZEOA 5B36A 3JAWA 3LCVB 1P1CA 1BE6A 4NICA 4YRMA 1ZG3A 2EXXA 2G9QA 4YAKA 5EMLA 3ZKWB 3OCWA 4KQKA 4HMOA 5JSHA 1HOXA 3A14A 3OQOA 2J0SA 1RLMA 5FNZA 5JMOA 3T5DA 4BTLA 3CYFA 3OLCX 4KE8A 3UW1A 5I7OA 3KO8A 1GTJ1 1O6ZA 1S2MA 2NYUA 4PIVA 3HUTA 4I3HA 3GRZA 3LHSA 1WHTB 2BEWB 3H2KA 1J21A 4IWYA 4QOIA 4DM7A 1QMPA 1SCBA 5EINA 4U6QA 3EIHA 5JCPA 1G2OA 2C7RA 3PFBA 4V02A 2VK8A 4AY5A 3O3MB 4H08A 3S1LA 1PL6A 1SKYB 1Z0KA 4Q48A 1PS0A 2PWZA 3BRCA 3G85A 3MUFA 4WMLA 2XCLA 2VK1A 4M0PA 5C7IO 2H1OA 1L6IA 4OQZA 1D2EA 3IFSA 4P3OA 2UXCB 4R41A 2H00A 1FFBA 3CX6A 3OOJA 5K5EA 1X7ZA 1O6FA 4KPEC 3OCYA 5CPBA 3F0TA 4OXIA 3RYTC 4W5NA 4Z4EA 2Y3IA 3L6CA 3L8FA 4TS4A 3VU3A 2EFGA 5IM4A 4NZYA 5AXAA 3D02A 3OTGA 3C1TA 4X95A 1FYFA 1CS0B 2QD2A 4INOA 3AH8A 2FMIA 2GEDA 4AJNA 4BX2A 4NCBA 4GLJA 2IYEA 2NUBA 3ER6A 3I09A 4CJXA 1QHHA 1XLTA 4YRTA 2ZXFA 4IFBA 5EHGA 4M8SA 2UUPA 2XF8A 3LCJA 4HN2A 4EAQA 2W71A 3PJEA 4MQUA 3AQIA 4RLHA 3K8QA 5C7YA 2RKBA 3MWKA 4MWDA 1JR3A 2D2IA 4ZOCA 5LP1A 4GBED 2Q1SA 2VUHB 3PC8C 3MAGA 1KNQA 3KR0A 1BQEA 3DV0A 4BO9A 4Q1AA 1DO0A 1XEXB 4Q6WA 3LNCA 3IIKA 3MPOA 4BWVA 1AKQA 3WO1A 4DZZA 2XUFA 3CF6R 1AKVA 3LUFA 3FLMA 1UOOA 5UKDA 3ASZA 3JQCA 3MTEA 3GMTA 3RS8A 4II7A 1VHQA 3SHOA 5EXTA 1GTG1 1ZL0A 1SR8A 4JB0A 3L9XA 1N6HA 4MGKR 8ABPA 3HUFA 4HR7A 3OH8A 4FCTA 1ZRMA 1YD7A 4W1SA 3RIEA 3V33A 4N5NA 5LP6C 2PEZA 2PKEA 1SIWA 3HKEB 1P0IA 2GJ9A 2WUFA 3BVPA 1AM4D 1RRPA 3BJIC 3OWHA 3R76A 3ULKA 3IR7A 1B6TA 3B1FA 4DAOA 1XQWA 2R7LA 3KQHA 4HDNB 1ZD1A 4NLLA 3GJYA 4GSYA 2B3TA 2H3HA 4OREX 2C5SA 3VZBA 2AV6A 1USIA 1U6KA 1MB0A 3DHYA 5FQOA 1UJ5A 5JQGB 4K3VA 3DFIA 4PZUA 2B1JA 3ZWVA 4E5PA 1Z08A 2Y68A 3GFOA 4DA8A 4CETA 2R1ZA 4YRPA 1YK1A 4B71A 3D7LA 3UJ6A 1N1EA 2J3HA 3CFYA 5TT0A 4YRDA 1MJNA 3C3JA 1Z56C 4WN3A 2VTEA 3OU7A 3INNA 4H1TA 1AV7A 2I03A 3EIQA 3EWIA 3VU9B 3KJGA 1JEOA 3QVSA 4LVUA 4JVLA 5IDVA 1VJRA 3LGXA 2AR9A 2ZJ4A 4DQKA 2JI8A 4KHZA 1C0KA 3PQ4A 4U7GA 1VCMA 3DVAB 3NTXA 2ZUVA 4B6OA 3S4YA 2NT3A 2XCIA 3G0BA 5T64A 3ZZ0A 4BAUA 4A5SA 1B6GA 2VSOA 1EWQA 1K3FA 5BN3A 5KKAA 2OHHA 4ZCQA 1N2ZA 1ZCAA 3OMWA 1BOFA 3FCUB 4QGFA 1R0WA 1HF3A 5ALTA 3TKLA 3N6VA 2HO4A 2ZIVB 1SC3A 4M0EA 5DLQC 5ITSA 3PQ8A 4DQVA 1EYZA 1PTKA 1OFGA 2X9QA 3HB9A 4XR4A 1YS2X 4KDCA 3VI3B 4C6TA 2AR7A 3EEQA 2I6FA 1DKPA 1GZSA 3H8VA 1D2CA 4L4XA 4PIMA 4INJA 1OLUB 5BWMA 3IPCA 4CTNA 4IKPA 3U9TA 1ZXLA 2BTOA 4HB4A 5CDHA 3IB6A 2XOXA 1UJ2A 1PZXA 1OXKB 4HLDA 7YASA 2EKLA 2YHSA 3GVIA 2ZIGA 1YU6A 4P93A 1E92A 1T2AA 3N0VA 4H3HB 4I4TB 3V3KA 4BMOB 3QA3E 3QTLA 5ENDA 1J33A 1PZNA 1QU3A 2FQQA 1I6KA 1P9RA 2IITA 2M6LA 2O8CA 3M9LA 1P2BA 4Q4DA 4ARBA 4IHJF 5AKEA 4PSAA 1IPHA 3IHTA 3C3WA 1RJ9A 5J4LA 3O82A 5C81A 1M1XB 3AP3A 4QQRA 1XU9A 1ZLXA 2PXAA 1A2BA 4G25A 2JS7A 2C04A 2WSYB 3HL0A 4D97A 3H5NA 2VK4A 4XB2A 4MYHA 3GT4A 4MINA 2GJ8A 2DULA 4D9HA 1JQBA 4YC7A 2F43A 3ZVNA 1RM5A 3NH6A 3G5MA 2GZRA 3EOZA 1ITZA 3OE7A 3QU9A 1A7AA 1U0EA 2P9GA 5K0SA 4WA7A 3R24A 3QI7A 4ZCMA 1N7GA 3PR2B 2JGDB 2J9YB 4M60A 4KR0A 5SZHB 3SSNA 1DAPA 4ZWNA 3GVHA 3T06B 3F5DA 1HDEA 1TPYA 3JALA 4FMCB 4BCCA 4X6UA 5BXYA 2GPWA 4OXNA 4QHYA 4QIHA 4GL4A 3QBEA 4PN7A 3R6TA 3CE6A 3GAFA 1I80A 2IS6A 3D8RA 1BD4A 1PS9A 3EVCA 4OHMA 1LC0A 3OF3A 1MA3A 1OKKA 3AM1A 1O5IA 3LNTA 5CH3A 3CLHA 3GQBB 3O03A 3EVTA 5EP3A 5LP6A 1HEYA 3VAYA 2DKFA 3QG5A 4REQA 5HFAA 2H4ZA 1CE8B 3CVJA 3CVOA 2Y0DA 3KKOA 1KU0A 4KV9A 4E12A 5LU9A 4OJKA 3BT7A 1EDDA 3WWPA 1PFKA 3A26A 1L3BA 1V5EA 2ZPUA 4XTCS 4XYBA 4ND1A 4GZLA 4ADSG 2VT2A 3OD1A 2GM3A 3IA7A 3RU9A 3WLNA 1MAVA 1ZMRA 2W5UA 3D9QX 5TRTA 3FVTA 3MFQA 2ZAYA 3NV7A 4FYIA 4MIEA 1XTUA 5GZ1A 3W8FA 2A9OA 3UMGA 1T3SA 5GY7A 1XTJA 2B1IA 5BOSA 1YZVA 2QR2A 4ZV9A 1U7ZA 5AVZA 3OKAA 4ZRMA 1JA9A 3CLVA 1RJFA 4C4XA 3KKLA 2YWFA 2J09A 4EGQA 2X9VA 1PAUA 4DR7B 2GDJA 3AHJA 3PE3A 2ZIWB 4FN5A 2PUTA 3D59A 3H0EA 3SKVA 4BJHB 5CLQA 1YFLA 2O8FA 3ZGVA 2AS0A 2HBZA 5DTIA 4DCCA 4HVCA 1KBZA 2BGNA 2EU8A 2WWFA 3PX3A 3EGIA 3JWJA 2BVNA 4MPDA 1RAIA 3NBUA 4ARZB 5KREA 3KYCA 2G67A 3JVUA 3L7MA 4ZO9A 4BWYA 1E2GA 1FTYA 4JNCA 3VM6A 4EPXA 4DLXA 2AF3C 4HDRB 1NP3A 1HTWA 1EDZA 4IW3B 2Q8NA 1E1LA 4V38A 2UZ1B 3GLFA 2PUBA 1AUVA 3DL4A 4BPBA 4MICA 2ZIEA 4K6CA 1FXWA 1UQRA 1CJBA 2YW2A 4I1RA 3I5YA 3QPBA 1R0BA 3S1AB 1RWPA 2W6OA 4MYSA 2AN9A 3OI7A 4BNLA 3CZRA 5EPOA 1DL5A 1SD2A 1H23A 2PJRA 1BH6A 4CT5A 6GPBA 2H18A 1O94C 1ZH8A 2QW1A 4PONA 5P21A 2F9MA 4F4HA 5BN1A 2CKDA 4WKOA 4Z2YA 2LW7A 1Z5GA 3M2TA 4XQGA 3HLYA 3OZAA 4UXIA 4EW2A 1KVTA 1MC5A 3QHAA 5KTOA 2XWPA 2QZJA 2P5YA 2FPMA 3KP1A 4H16A 4UBNA 2WJIA 4BX3A 2PKYX 4KH1A 3ZY4A 3I5UA 3V4PB 3UM9A 2JHGA 3UWKA 1GQQA 3H4VA 3EDRA 2WZDA 4YUYA 2XIQA 2ZIUB 4XDHA 2X76A 2OO5C 4JLVA 3P9CA 3CNLA 1QV9A 1W0JA 2WHRA 2O20A 4CQJA 1CQJB 1MUUA 3HB0A 2QY9A 1HE8B 4LE1A 1EM8B 3VMMA 3RUCA 4LC0A 1NA5A 4AKIA 3P9SA 3I0MA 2XB6A 3DOEA 1S02A 2QRHA 1NUSA 3BWVA 2BKUA 1D0IA 3LHFA 1DEHA 2GNPA 4HH0A 3UAXA 4BNDB 3SR0A 1Q0PA 1O89A 3DL7A 4JP5A 3RF7A 1H5QA 2GEUA 1EXWA 2F8SA 1TCAA 2EWVA 1CIVA 2Q3DA 2ZCJA 2WSSA 2J7PD 1I3OA 1QSGA 3RRNA 1CY8A 2F90A 3HKBA 4IXMA 4C7VA 4ZYTA 5LQAA 3A2LA 2FN8A 4JSTA 2ZYWX 1YB7A 1K7SN 2HQRA 1NJFA 3NBQA 4I99A 1YKGA 4KCGA 4B6QA 3VSAA 1DTSA 1KF0A 3GZJA 2C2MA 1X7WA 3TQFA 2R3SA 4KKVA 4C6HA 2DR2A 4YGYA 4P3YA 5HIMA 4NNPA 5AOAA 4JC4A 4YRBA 2PUEA 1A5TA 1QZUA 1V2HE 1GADO 1P9NA 2QRMA 4Z54A 4FYWA 5LA6F 3KYBA 4YPOA 3B6JA 2B1RA 3KXKA 4UUOA 2R6R1 1SH7A 2MIIA 1WDWB 2IHBA 1DXOA 1NNUA 3L0OA 4YP5A 1DUSA 1KY3A 1GJRA 4DCVA 1ZI9A 3H3FA 1YB2A 3W6OA 13PKA 2QTCA 3MAAC 3AI1A 4AP5A 2CFCA 4Q5IA 3TAHA 5A7FA 2D7JA 1XU4A 3ZTTA 5B7GA 4D4KA 1E32A 5JLJA 3RGGA 2AJCA 3WFZA 4TYQA 1MAWA 3PIDA 2R8EA 4BGVA 4LXUA 3OQHA 5DSXA 1LC3A 4HQFA 1I24A 3BRQA 3AM3A 3AY3A 2ZKIA 4L8YA 2HN9A 3W2GA 4G0VA 1TL7C 1RABA 3SP1A 3PNKA 4DUZB 2VQDA 4QGGA 3D8SA 3LCMA 1V1RA 1BFKA 4EHKA 3L7NA 2W8BB 2A2ZA 5DX1A 1CVLA 4U2DA 5K4AA 4CIBA 2PZJA 1RYBA 2P9TA 4S04A 1P1IA 2PL1A 4UKDA 5BSGA 3U40A 5I7EA 3NWEA 3DL2A 1X8JA 3ED1A 3FCYA 3TNFA 4AMZA 1E94E 1FIUA 2EEZA 2WM9B 1S3IA 5SYAA 1EFPA 1PX2A 1O7JA 3LDUA 2VDUE 3LOQA 3BF7A 4J07A 4PXAA 4R81A 5DM1A 4AM8A 2WUGA 3W3AA 4ZK2A 1M74A 3W4KA 3HDVA 3H5IA 4XGIA 1Z5WA 4F85A 4XLTA 5IFKA 1A98A 4DV4B 4FE7A 1OFVA 1VL8A 2Z8XA 4Q02A 4HPXB 2DKNA 5CLLA 3TAUA 1PZHA 4BO1A 4C4AA 4HWOA 4ALJA 3L6DA 4XYEA 1JZSA 2YZ7A 1VKNA 1XFDA 3UHFA 2RGXA 2VTVA 5FL7A 1SG6A 2NSJA 1G2PA 4A27A 1UWVA 4NAUA 1JEAA 4ATNA 3GBPA 3QMPA 1NQXA 4GOXA 1XRRA 5IK2A 3F7TA 1M8KA 4IJ5A 3JQGA 3LO5A 1AOXA 4M87A 3T9CA 1BVHA 4LG1A 2X5JO 4OBEA 4XWAA 3ETCA 5FBHA 5FJIA 4CMJA 3T5MA 2O8BB 3KDPA 4DNQA 4NBRA 2DR0A 3LQ4A 2QN7A 1B16A 3DE5X 4PC6A 5BY2A 3KKKA 4X1YB 5DISB 1CK4A 3P32A 1USWA 2QGZA 4QSHA 1Q0LA 2EJVA 4J2HA 1GPKA 2PA3A 4FD2A 3QXGA 4HZUB 3P0HA 4WI1A 5A4MS 2FE1A 5INTA 3U7JA 1QH8A 1W46A 3D7RA 5BOVA 5BMVF 3HI4A 1KQ3A 4AJKA 2G07A 3NR2A 1GTZA 4EZBA 5DX8A 5JBIA 2PH3A 3C6KA 1AO3A 3EOAI 4Q47A 5TNXA 5CXXA 3QLEA 2XBUA 1JFFB 2ODTX 2ZB8A 3N5CA 5BV8A 3I9NA 2H4HA 2QK4A 3NVDA 1CNEA 2FHSA 2Z6AA 3OPYA 3OCXA 1H65A 4YRGA 1BE8A 2HRQA 4DYHA 3HYSA 2XTZA 3BGOS 3BC1A 3QUCA 4E2FA 3BK7A 1YHZA 2I2AA 4N65A 4QBFA 4W8HA 4P86A 1PKEA 1YS1X 3D8TA 3O94A 1I7LA 1ZH0A 4G26A 4LJKA 5ALLA 4ZI7F 3AVUA 1JDPA 2NPFA 1C8VB 3HFRA 1U2DA 4IRMA 1ND6A 4IQ8A 5IC5A 2QKYA 3B38A 3TBFA 4DTCA 5LJLA 1E3MA 4U2CA 2R7NA 2PQMA 3O95A 2NYAA 2X5OA 1M6EX 4KU4A 1O58A 2UZ3A 3D3NA 1XDGA 3VJKA 2WU3A 1WSBA 1F1JA 2C2OA 2G5PA 2ZSJA 4C0JA 3T3IA 5KQGA 5D5HA 4UOZA 4JENA 4KPUA 4MW4A 3RS2A 4J75A 5IHXA 1X92A 1ZN8A 2JZCA 4IDAA 4IIHA 1QM5A 5DB4A 5HNKA 1OXVA 1A5SB 1Q12A 1UFKA 3HDYA 2C8JA 4L3OA 3TQIA 3CO5A 3WGYA 4ZHQA 3K9GA 5AI0A 1U2EA 1YXMA 5CVCA 5JEDA 5DVZA 2QE6A 4Z9YA 3PNSA 1JDZA 1DC5A 2PZMA 3JVIA 4RD6A 1UH5A 4C7OA 4OV6B 2JLCA 4ZRNA 3LY8A 2X6RA 2NU7B 3T4EA 3INRA 3M6UA 4RDXA 1V3VA 3P4UA 2DERA 1E0JA 4Q9KA 2BFCA 3DZ8A 1KJJA 4V3BA 5G53C 4P7BA 2DWQA 3AONB 2DB3A 4HUJA 1V9SA 2QSUA 4Q1VA 2V9CA 1CXZA 2PBZA 3IILA 3K2IA 3PRYA 3ZEAA 3K31A 1GPYA 1UFRA 2PBLA 2R8ZA 5I47A 2P4HX 4HPJB 4CKCA 3ZQKA 4Q4LA 4YJ2B 3R3UA 1KTIA 5C34B 4EO9A 1Y1PA 2OB2A 1T29A 2ZAGA 3I32A 3L7OA 3MOGA 4X00A 4AWAA 1E9CA 4QKQA 1X7XA 1K92A 3Q1KA 4I3GA 1D6MA 4N49A 3QZUA 3QLVA 2QMZA 4C3UA 2CV0A 3ND5A 2M32A 1IM8A 2HWUA 3OCZA 5AMXA 5E1OA 1Y5MA 5EE5B 4A2WA 3RB8A 5MDHA 1VDMA 2HDHA 1SBTA 3AERA 5LB4A 5CA0B 3OQMA 3IPYA 2ZTHA 4P7FA 3AR2A 3PWTA 4CUZA 1UM9B 3VC2A 1E61A 3NFYA 4D5EA 1XZFA 1PRYA 4FXOA 2R00C 4ENVA 4ND8B 5CMLA 4TSRA 3IBSA 2DJIA 2YMMA 4RFSA 3TLBA 2J5RA 3KOMA 3P4XA 2IHJA 1A95A 3K1TA 1QGOA 4GKBA 4WXPA 5HDBB 2GK3A 3SJUA 2WF6A 4I55F 1U94A 4WXHA 1K3TA 4QXMA 2WE8A 4E3ZA 1JXOA 2PJUA 3BIXA 1A9XA 3P96A 3MC1A 1WSWA 4RTOA 3LK7A 3TCNA 4OXXA 4PYIA 1NBWB 2EFEB 1UIMA 4EMBA 4IZHA 3RJMA 5A62A 4KUHA 4NCJA 1AMUA 4WNIA 3WRWA 4PHFA 4D3FA 2YZGA 2D8AA 1IHYA 4R84A 2XB4A 3FHJA 1OI4A 1W5EA 2BGMA 3CH7A 3WGZA 2OQRA 3FA2A 3DHWC 4A6PA 1BC5A 3NOOA 4ITVA 4EDFA 3OFNA 1ECFA 3DAOA 1YZKA 5FF9A 2QMQA 3T95A 2AFIA 4FC7A 4XGQA 3T5PA 2P6RA 2X5XA 1P5HA 1OZFA 4PLFA 5KPDA 2IH2A 3PUKA 1CFZA 1HKHA 4B45A 4DMUB 3TDMA 5HUHA 3N2NA 3MSCA 3ZE7A 3UXEA 2HD4A 1T9HA 2JH8A 3BXHA 4P38A 1OGYA 4EA6A 1RZRA 1JIKA 2VRBA 3K09A 2AOTA 3R0VA 4TQAA 4ZYZA 3OFVA 3TTSA 5EMHA 5T3UA 5F73A 1SQFA 1B2LA 1NXQA 1LNQA 2PKXA 2QAGB 4ITUA 5B2EA 5HFNA 2B25A 3BG5A 1B15A 1GRQA 4FDLA 4US2R 3IIJA 1QP0A 1JPVA 4Z8XA 2H2IA 5LQNA 1U2RA 1TZKA 2MR6A 3PNOA 4HZGA 1SC4A 2YVLA 1AGRA 3QWIA 1XGKA 2NZ8A 3E48A 1Q15A 4XVUA 1GZHB 1LJLA 1PNOA 3LFUA 4QU9A 1XK7A 5AESA 3VJRA 1E2MA 3VKWA 3E84A 2QN1A 3IVGA 4QPNA 4FMDB 1OROA 4UXHA 2A5DA 1FX0A 4NAHA 4IIUA 2Z2ZA 2H4WA 2PT6A 3HY4A 4ZT7A 4PAGA 1YCHA 2GO1A 1T4GA 1XRJA 3QW4B 4PLGA 3E7FA 1GPLA 4FR0A 4GLBA 4ZO7A 2A9JA 2W22A 2PYIA 3H9CA 1VPTA 2PS0A 1J9ZA 1KGSA 2B4AA 2TMGA 4OXRA 5KJEA 2JI4A 2VA8A 5ALYA 4EF4A 1L7PA 2QZZA 2V1XA 3RGWS 3WWCA 5I9TA 5CYPA 4BE4A 4DIBA 2K4MA 3A9WA 1VE5A 3ABRB 4LOJA 1MVNA 1JJ7A 4DWVA 4MW2A 5ALVA 4YXWA 3K4HA 1KMMA 4P36A 1O6BA 1JAYA 4LWPA 4F7DA 1SUPA 5DI3A 4DRYA 1R9GA 1Z22A 3MRTA 3P2MA 1T8TA 1T0IA 4AN4A 3QJGA 1FQOA 2QYHA 4OQNA 5KYWB 2EW8A 1IH8A 3B1XA 2R6DA 5I4CA 3VR5H 1QJCA 3C41J 1UPCA 3ZZMA 4B8YA 4BKOA 3SU8A 1JYFA 3VYUB 3ZZTA 1WHTA 3PYMA 4TL6A 2G5CA 4TV9A 5HCUA 5TQJA 3NVAA 3O4JA 4EGAA 1YVPA 1JU9A 5EERA 1I0ZA 2JCGA 1ELOA 1UJBA 5ICCA 4H4CA 2PGXA 4P0QB 5KU7A 4LRSB 2H63A 3H05A 4MMXB 3W3AD 2VWGA 5JAPA 3FCOA 1JSRA 2WDZA 4WKGA 3WHIA 3IE2A 2IXFA 3DLPX 4JI5B 1IN4A 4KNYA 1RXVA 3A4NA 4DG8A 3A6PC 5FL7D 1K68A 2B99A 4O5AA 4CTMA 5ALEA 1QZXA 3PPWA 3OP4A 2OO3A 2IXDA 3BKXA 1CEEA 2OHOA 4BKMA 5GWXA 1NMYA 3I2GA 3R23A 1EE9A 2AFVA 3QITA 4D9NA 4G5RA 2JLAA 3J80A 4TLMB 2AWNA 2Q3LA 3R3JA 4CM4A 2XCOA 1PFYA 2ZIZA 1T34A 3QFCA 4XCQA 3RSSA 3KCNA 1RRCA 2FY8A 2C42A 1FMCA 3UJPA 2N1MA 1SBYA 2POCA 3DVLA 4MV9A 3LF1A 4NSNA 4BTEA 5J2TB 1C8LA 1BXZA 5C8ZA 4MTCA 4MVJE 5K2MA 2O1SA 3V1MA 1ZGHA 1QHYA 2CD9A 4EL0A 3FPSA 5I8PA 1VLLA 1I6MA 1IXKA 2IU6A 2Q5QA 5FWNA 4P4SA 3ON5A 4NENB 3A1EA 1T6XA 3KB1A 1YQWA 4MGHA 3PPIA 3SQLA 4DSAA 4Z7NB 4ZI3A 2QUIA 5K3CA 1Q74A 2EP8A 4QU0A 5DULA 1ZD2P 1BEUB 3ETHA 4Z3DA 2WI8A 1KDZA 3HU1A 2GA8A 3T5BA 2YL2A 4ESHA 4BVFA 4FHZA 1M1ZA 4GMXA 4WADA 2GZHA 1U2GC 2JASA 3CIOA 2OHXA 3I2IA 4B09A 2W6CX 4LQ4A 2BTQB 3AUXA 3NHPA 1Z2AA 4M37A 5FX2A 3FFBA 3V7UA 4GYYA 4N1AA 1I6WA 2A57A 3RU3A 4BV8A 5L45A 1GZ5A 3WNVA 2ZIXA 1NDQA 3F6SA 1P33A 5K6AC 3D5TA 4JVMA 3ET4A 4EPVA 1FZQA 1LPNA 2Z9DA 3HVIA 4J2TA 4MVJM 4JVOA 3M4NA 4LF4B 4RQAA 4BLRA 1TMOA 2PL9A 4KO8A 2QTVB 3HYLA 2D1FA 5AI9A 4OGKA 4M1QA 2JCVA 4NZZA 1F0KA 1Y63A 1LEHA 3MB8A 3UHPA 5EWMB 4FB4A 1Z5NA 3ERCA 1I7DA 1U28C 3QF4A 1WU8A 3FNHA 3K4PA 1Z4JA 2YTZA 2XYVA 3GVCA 3GEIA 4IKEA 4RVFA 3IUEA 2X23A 4MJ3A 1LLUA 3BXXA 1BYUA 1SN7A 2P65A 3EXG1 1T9ZA 4PLHA 1ZOIA 2JFZA 2XGJA 3ZGOA 3HBJA 1O6CA 1E2IA 5K3BA 3GP3A 2MU1A 4XLLA 3X1WA 4W9MC 1UUFA 4AJPA 1X1DA 3DVAA 2ZTLA 1W2WB 1NFQA 4ENSA 3F8WA 2HMUA 5FPSA 3BJZA 3SPXA 4EK9A 5NLLA 3RKRA 1WWKA 3T9EA 221PA 2DHDA 3OPYI 5CX4A 2RGGA 3VZPA 5J2UA 3NX4A 1QORA 4ENRA 5MHTA 3V42A 4OXYA 3D6HA 3HCBA 4QRIA 2FW1A 3EA0A 4IMRA 1OH7A 4MXDA 4QYXA 4D4MA 3E82A 1A04A 1E4VA 3LUGA 4RF4A 5COAA 5FO1A 4OI4A 4ZVRA 1J25A 3MTIA 4Q4AA 5K3OA 4L0CA 2CUKA 4TLEA 5AHOA 5BSWA 4L50A 4KXXA 4FYYA 1BXRB 4G1CA 5BO5A 1H6CA 3OPMA 4ZREA 3R44A 3K0FB 3GEHA 3NT2A 1T9DA 4XUEA 3X1XA 3WBKA 1PT9A 2AKAB 2YFKA 3AIIA 1FLDA 1X87A 3PUHA 3WWYA 5J4HA 2FG7C 3EDCA 4G5OA 2C4VA 2XVXA 4PW0A 4X24A 3SC3A 2ESRA 4CQLA 1QFJA 4RQTA 2PX0A 2PGLA 5B6IA 1PUXA 1KI2A 1U0OC 1GFIA 4ZMBA 3R2JA 2H7CA 2O3RA 2WG2A 2XA1A 2IWHA 4EEZA 4DLZA 4QE3A 3TE7A 2BHLA 2F3QA 3WQHA 4PYQA 3BSWA 1N0HA 4EHNA 3QPVA 3EIXA 3E2PA 3QTBA 2WWIA 2XVZA 3M3PA 4EA7A 3U49A 1DAGA 1UKBA 4RADA 1FUUA 3IE1A 1JHOA 3N9IA 2FPIB 4FJ2A 4GU5A 5EAIA 1NXWA 3U0BA 4CTOA 1R5BA 1M75A 2KB0A 1M34E 4YMVA 4BEWA 3VH2A 2L69A 3EXEB 3A31A 3L8CA 2JARA 1FBNA 1GZ3A 2YJ5A 3CISA 3ILYA 3K6JA 4OP3A 4U63A 3H19A 2JGDA 4MROA 2F3PA 4EEKA 2FMUA 1QRRA 3H2HA 3OFND 5BYJA 2JK1A 3R7DA 2DH6A 2DF8A 3RROA 2QVLA 3T5TA 5D1NA 1OXUA 1ZCFA 4CDGA 1QVWA 2YDXA 4ER7A 2LP4Y 3KYDA 1O87A 3LQYA 1CDZA 3PQCA 3IX7A 4OGFA 3EZGA 4Z1MA 1WA5A 5GVSA 2X41A 2GN4A 3TBHA 5KTMA 4R1PA 5F5LA 2MSLA 3DR5A 1AZSC 3NOQA 1YZYA 4TWZA 1LVUA 1HO3A 2D0OB 2IYWA 1XXHE 1HL3A 1AY0A 1P7ZA 3LUPA 4OAPA 5M3BA 4GKJB 3BTSA 1L7EA 2HHLA 2CFIA 3WNQA 2R60A 3WLRA 3TFWA 1JZQA 4KLZA 3PCRB 2DFPA 4OSEA 2AC4A 1QMGA 3KSUA 3HJNA 1J23A 4QUGA 3HACA 3TD2A 1EFAA 1ZM3A 1CE8A 3DA8A 1KDOA 5A5DA 1G41A 2JGNA 3DLAA 2CBZA 3KV3O 4QYIA 2R8RA 3DP9A 3X2EA 2COEA 2QW8A 1K4YA 5FEUA 5JI2E 1TKCA 4P35A 2QN3A 1L3IA 2GXQA 4MJ7A 2EQAA 4LPSA 4HEA6 2GNAA 3V2IA 4NCIA 1NZJA 4MKXA 1KJ8A 4JZYA 3CR8A 4CV2A 1JR4A 1K8ZB 2PWAA 1TAUA 2BP7A 2FTKE 2VT3A 3JATA 4JITA 4TM8A 1YE3A 4FFNA 3R9KA 3MXTA 3SHFA 1RRFA 3N28A 3RYCA 4ID3A 1R74A 2H57A 1NKVA 4D8WA 4LHVA 1UIRA 3VGPA 3K0CC 2VSYA 3H84A 5JW6A 2XUAA 3LYUA 2NUTB 2Z4RA 2O0HA 3MHPA 1UMBB 1BHO1 3ZHQA 1R3UA 5BVGB 3H99A 3WLAA 2RSLA 2WU4A 3ZXSA 3MRSA 2DRIA 3BDAA 3A6GA 4MK4A 1XMOB 5JRDS 2XXAB 1MNAA 3DKIA 5JSUA 1BKYA 4M2LA 1Y3CE 4B5LA 3S8EA 1S2IA 1H94A 2RKWA 3C87A 3N6XA 1K7EB 4KFSA 4FIZA 4HSEA 1AQJA 4EI2A 1YVEI 1Y3HA 2OORC 4LVOA 3IKJA 1NI4B 3EDYA 4PO3X 1D5CA 1EVIA 2GCNA 2ZUWA 3FDZA 1XVUA 1G5RA 2F8LA 3QXHA 5FI3A 2PKQP 4ZYXA 5L8VA 1AH2A 5IJWA 3OWOA 4KGXA 4Q9NA 1EDBA 3I39X 1H0HA 2FW6A 5CDFE 3AEKA 2BCJQ 2Y76A 3NHUA 3R77A 4BEVA 2PN1A 4CKXA 3BD9A 3IEIA 1P1HA 2MR5A 4BO6A 1RVV1 4BEJA 3CNNA 2QVGA 2OGSA 4N5DA 3FYSA 2R6ZA 3QELA 3NXKA 3PIIA 4N6OA 4Z49A 4S1NA 5E3IA 2Z43A 1A4RA 1CY1A 2CDRA 3LLUA 4R6WA 3TTWA 3HYCA 4LI3X 4Y18A 5DOZA 3G82C 1GNPA 3H0CA 1VHWA 2DYKA 2XRZA 4M7RA 3IUPA 4KIJA 4JIGA 5B12A 2WTEA 1VL5A 3FDIA 3PZBA 2HPZA 1KJZA 1XCGB 2XRMA 3K53A 1EJ2A 2YFQA 2ZOSA 5KVVA 3CINA 1Y8ZA 4J16C 1E20A 2VP6A 2WV7A 4KMSA 4EHIA 1FYWA 1I4EB 1NJGA 3RAFC 5ITWA 3JYHA 3DULA 4FS3A 1L4BA 1YDWA 2KJQA 4QODA 3ZNOA 4GPIB 2C00A 2HFJA 4BMVA 3U44B 4AMVA 3ZKAA 4FHGA 4MS4B 1H3EA 1NQVA 2OZEA 4WQMA 1QU2A 1KJIA 2I80A 2ERXA 2JAOA 2NM0A 2Q7OE 4BNDA 1YZQA 4OYHA 1QE5A 5ALGA 3RV3A 3ABOB 1YFZA 4YJ3A 2X0KA 5AW7A 2WQZA 3ANXA 4Y1FA 1C3OB 5DGDA 3VTKA 3ZDFA 4DLSA 1RI3A 2QTGA 3MBIA 4ZCPA 5AHKA 4ZCSA 4D0RA 1J2EA 5JVDB 2YZ2A 4AJ4A 4ZGWA 1IPEA 2GWRA 2HJHA 4R7GA 2RJ3A 2XZPA 4Y6PA 3T38A 3TS1A 4Y9TA 1A76A 1OGJA 3UQZA 4R1TA 4WY8A 1XZGA 4DC9A 3KG2A 2HIGA 3K15A 4JOCA 2GRJA 2FN3A 2ENWA 2OBBA 5JRJA 3DV2A 9LDBA 4ZVQA 3LKDA 2B6NA 3CRNA 3PHCA 4QUBA 1ZNXA 1QHIA 3AFGA 1VB3A 4U02A 2IYUA 2VOEA 4RYDA 1ZW1A 2BCGY 2KWIA 3FBGA 5TX7A 1VL6A 4F3YA 2O23A 3RU2A 5B5SA 4P7KA 4JLKA 2C2WA 3NFRA 4RY0A 4F9TA 1U2TA 4HT3B 3CPJB 4QEKA 3MXOA 5I8WA 1NC1A 3AL3A 2JCSA 2XYHA 4EOGA 1TZCA 2IHTA 1AK1A 3JQ9C 4BPRA 2UAGA 1KS9A 4YDQA 1KJYA 2C5FA 3D4PA 3VPFA 2LRHA 1F0NA 1DQSA 2V6JA 2Y1LA 1C4XA 1SBZA 5AO9A 2OCAA 4V0MA 4BMCA 4Q3DA 3M33A 1Q95A 5AHRA 2K2WA 3A3YA 3SCZA 3A58B 2C94A 3DVQX 4JHLA 2BEJA 4D8TA 2JDIA 1QHGA 4RD1A 2FOXA 1VJGA 4QXAA 3R7FA 5K0CA 2RD2A 3IEUA 4MWGA 4HNUA 4CKEA 3AHFA 1MENA 4ZK6A 4AXBA 1WQ3A 5LYJA 5HJ5A 4B85A 2Y93A 2YNMA 4NBLA 3TG2A 2X8AA 1WBDA 4Z4FA 4CWAA 4BC0A 1H2AS 3PDUA 4C4OA 1W36B 3O8CA 5HBGA 1JMKC 4AG3A 3Q0EA 1G16A 1HLPA 2HR1A 2ZCUA 3S2IA 3V4RA 3JWEA 4X91A 2GK4A 1MFZA 3KQKA 3HEMA 2J8ZA 3B6EA 1W0KA 2Q3CA 5HPYB 3H5TA 4CCSA 4F5WA 2Q46A 4BZWA 4B1FA 1L7MA 2QRKA 3AUYA 4MR8A 3GJXC 2OFWA 3TPCA 1XF9A 1GZVA 2EAUA 4K6KA 2QJTA 3K05A 5FBZA 2UZIR 4RCZA 1NUTA 2QROA 5CFLA 3DZFA 5KYGA 5DHSA 2OBFA 3GROA 4ND5A 1GCIA 5BPHA 5IAAA 5BWLA 5TF4A 2DCMA 3P26A 4XWGA 4RM3A 2VXYA 3GLVA 3WNBA 3O4IA 1BU5A 5LPNA 3JR3A 1BJKA 2OAEA 5IJ9A 2MJLA 5HCNA 1XO1A 1Q1NA 2J3JA 2ZWVA 1O9BA 4LZPA 5CB6A 1P9LA 3WP1B 1SHLA 2W6ZA 3VR0A 5JXIA 5JARA 3HU3A 1MZVA 3RK1A 4UHJA 5JYCA 3P2YA 1WBJB 3VKUA 1ICEA 1VBKA 4LTMA 1YQQA 3DZDA 4F06A 2DTEA 5AM1A 3R7WA 1ODTC 4HWPA 4HFJA 2DBZA 2WJZB 4DR2B 3ELDA 4UCQA 1UAYA 4ZANA 4KRGA 3RVNA 4GPD1 3NTQA 3DO8A 5TIIA 1QFXA 2ISSD 1M73E 3VDRA 2QPLA 3ZWNA 1Z25A 3QEMB 5KOJA 1HSZA 1PWHA 2NSDA 2XUHA 3GLIE 5H8WA 1V4NA 4HV4A 1EFVA 4QGAA 4BFYA 3KE9A 3HCEA 2SKCA 3CT6A 1VHTA 3K4QA 4DLAA 1U2SA 4UPDA 5LMUB 1J2UA 4MUFA 2B92A 1PNRA 2C8LA 3O9VA 1OLSA 4ARCA 1TQ8A 2V03A 4FWIB 4I6EA 3GH1A 3O91A 4UHKA 4X93A 3VO8A 1SUAA 1SVSA 3I3SR 2QAGC 10MHA 1V1MA 4KSYA 4HQKA 4P54A 4PC2A 3RIGA 4RTRA 3K0SA 2BJVA 2C2BA 3NHFA 1DJMA 3D8UA 4GM1A 1N78A 1YRLA 3TK1A 4RORA 3QKIA 1KYWA 4LYDA 1IZ7A 4ENUA 3NIDB 4NK5A 2CNWA 4HDOB 5G0WA 5CR9A 1DDOA 4TQGA 1H85A 5COQA 5A9SB 4CMHA 1JB9A 2FSFA 2QTRA 4G9EA 2MYNA 4YP1A 4DUGA 3DL0A 2BMJA 2Y1DA 1EWKA 1JHVA 1NLUA 4XARA 1DCMA 5JI3E 4O8CA 2V65A 3L4KA 4O6VA 1IZ8A 1GG8A 4JL6A 2VTBB 5B7NA 2GB4A 4B7CA 4Y2TA 3RKSA 2BR4A 2COUA 2B30A 3QWHA 5I7VA 1J2JA 4J1NA 2V4ZA 1NBEA 1IG3A 1UK7A 2JVJA 3LH5A 1V7QA 1NZFA 4PFQA 5DDIP 3I9V6 4HRAA 2WV9A 1QGUB 4P2GA 4LSZA 1IOZA 3V8PA 1US8B 4RJ2A 6ABPA 1DVRA 1PK7A 1BEZA 1X13A 4IZIA 1APBA 4UBJA 1VQ1A 4AICA 3UA4A 1KZYC 2ZJ8A 3QBJA 2UVPA 1Z4OA 4I2VA 4RJKA 4BMSA 4YR9A 1NNSA 1XTIA 5KSWB 5I5GA 1P1BA 3HKDB 3PL1A 3KJXA 4CF4A 1XNJA 2YUIA 2P9CA 4JB8A 5IP5A 4MS1B 5C80A 2VAXA 3EXIB 2O59A 4MUKA 5IJZA 2CCJA 4WVLA 2W2MA 1ZUNB 1G7RA 2JIOA 2XCSB 2H7XA 3KYJB 5ESXA 3Q88A 1U7TA 4C5CA 1NBHA 2FHPA 4ID9A 5H1YA 4KAXA 3SDSA 4GQIA 5CA0F 2C4HA 4FGJA 3HRIA 4NZPA 4GVPA 2WLSA 4OUKX 4REOA 1N8TA 1RWQA 4WDQA 1PLJA 3RS9A 3U37A 1EKXA 1Q22A 1JA1A 3TZBA 4E5SA 1J24A 2FRDC 3SEFA 1QB8A 1JEQB 4L75A 2BN4A 1RW4A 4XKJA 5G02A 1M2EA 2W6QA 4ALLA 3OX1A 3Q8KA 3PITA 3R0ZA 4EFNA 2RI1A 1KHTA 2XOKD 1N36B 2HADA 3V7WA 4M53A 2R68A 1B3BA 2ZI7A 1R4MB 3LLCA 3MCVA 5ECDA 1JZTA 3RKUA 5F9FA 3DXYA 1NXXA 1L1QA 5JY6A 2G7MC 2D2EA 1LQTA 2W83A 3K5WA 3LXXA 4LJ8A 5GZ6A 2ZITA 4B76A 5MFZA 1F6BA 4QFBA 1KOGA 2BF7A 4ESEA 5DYGA 2X0FA 5JASA 5CDTA 4EKEA 1SQ5A 1SKAA 4OHCA 3GARA 4EB8A 5I4KA 3OLQA 1CRPA 3NEPX 4JBWA 2HWYA 4XX0A 3WR5A 2ZBRA 3LHKA 5IASA 2WTNA 3IOEA 4IHJB 4OFZA 1DMRA 2QE7A 3D8HA 4DMKA 1D07A 1Z17A 3O83A 4JLWA 2BGIA 4E46A 3FOAA 4EPTA 2FMXA 1MRNA 1WZUA 2W11A 3C5CA 5IAEA 1JR2A 3S2EA 2AG1A 2LE0A 3RK4A 2FB9A 1E60A 1FYVA 1TT5A 3HC7A 4EG5A 1B14A 4P83A 4XSHA 2VI5A 1G21A 1BMDA 4EABA 1X3SA 2C4UA 1ZGZA 1NPTO 3L8MA 5KX5A 4JJ7A 1V5WA 4WASA 4N76A 3QEAZ 2Y0PA 1FYXA 4PTYA 4L9AA 4Y2SA 4A8PA 3N87A 3REOA 3QUBA 4N0QA 4EYSA 5JSZB 2CSXA 4PLPA 4HEA1 1VMAA 2GBLC 1JMYA 4CGZA 1QC5B 3ONNA 5LQMA 1PI3A 3MTQA 4P81A 1HE5A 1RQPA 5DYIA 1FTSA 3RJ9A 4DL9A 4UE3S 2RHMA 4JGGA 3SVLA 1YZNA 2F8MA 1T1RA 3AY6A 4EB6B 1JP7A 2GT1A 4O2BA 3ZLVA 2PWBA 1XTSA 4ZT3A 1CEQA 4AL4A 5IXYA 3GLKA 4KQJA 1H8HA 3L4BA 3QX8A 5SZJA 3K71B 3OG9A 1I2ZA 2FZEA 3I92A 4B83A 5CXQA 4PCAA 1GP2A 3GNQA 4JXZA 1X3LA 4R2LA 4EM6A 3UKJA 2XUIA 1L4KA 3GGGA 3H2JA 4O2AA 4X8LA 5EEGA 1QAQA 2GXAA 3Q85A 2BFFB 2HLPA 3PV0A 3WK6A 1NTOA 2YXDA 4EJ6A 5A1JA 1AO0A 4RTMA 3G0HA 4QVKA 3DOIA 1OH8A 1VLJA 5C8DA 3U3KA 3UOWA 3KR2A 5F5NA 4BKPA 1ANKA 2GYYA 5A7GA 3HJRA 4HAOA 3ZI7A 5BV2P 3RSZA 3ZGNA 1CJVC 3FTCA 3KVYA 1W2GA 4ZVPA 3ROQA 2WIGA 4HLQB 5IXSA 1JLRA 1FQKA 3M5PA 3QYAA 1AUXA 4WWHA 3WLSA 3FYCA 5AJYA 2IOQA 2JFXA 3HABA 3QXCA 3MCZA 3GJ3A 1GGJA 4WGFA 1AG9A 3AX6A 3LDGA 4X3OA 5C5IA 5GIOE 1BRMA 1F4PA 2IIPA 2LV8A 4F8JA 3ADDA 1NY5A 1T4BA 3MM4A 3TNYA 5LLDA 2PL3A 1V35A 2ZS7A 3PXDA 4D4JA 2IOYA 3UGJA 2OEPA 4NATA 2W70A 4QM6A 3TNDA 2G9UA 3ORYA 4BWFB 3FOWA 5BNIA 1DARA 3RR2A 5BYKA 1JQDA 3E81A 4YCDA 1N2SA 5FUWA 2W8ZA 1Q1EA 4JKIA 4EGJA 3WYNA 3DLTA 1QFZA 4TWIA 5CBKA 3K35A 2C8KA 3D2LA 1NVEA 1Z2DA 2Q9UA 3DUFA 4HX2A 4NZMA 2E6UX 4MGIR 2O06A 3JQBC 4HN4B 4U6SA 1FYEA 4QC2A 5DTRA 5ADWA 4RULA 1B8VA 1SHZA 3FW1A 3STWA 1H2EA 1SD5A 1WUHS 1YRWA 3I58A 1GAEO 2GGSA 3HYTA 3QU7A 4YAWA 1DIBA 5DN6A 1OAOC 6AT1A 4BX0A 1E4EB 1DQPA 3E5HA 3HS3A 4RPHA 5IUJC 1W0KD 1Q3KA 3OP1A 3WZ2A 4EATA 2ZSFA 1GPAA 4AWXA 2B5OA 4GR5A 1BTOA 3FGOA 1HG1A 5EKUA 1FMTA 4WSOA 2H65A 4PHCA 4CCYA 3ZJ5A 2VP3A 1KA9H 1W85B 1VYVA 3SS9X 3NRBA 4AY4A 4EYQA 3RRMA 1O77A 4V1CB 3UPTA 1XJ0A 4S1VA 2HZBA 1QR2A 3ML1A 4LJRA 4FBMA 2R44A 2GVNA 5EE1A 1VDZA 3CU5A 2NVUA 5C8YA 3RS3A 4C0HA 1GUFA 4B4DA 4L15A 4QYSA 1N4AA 3VISA 5C46F 2ZRDA 3E2IA 3FCEA 3NASA 1EU1A 5LNK6 4Q3AA 1H2WA 2HT6A 4WVFA 1OXTA 3WB9A 1UQUA 2X0DA 4AZWA 2ZYGA 4D0NA 4ZEVA 2P41A 1L7NA 4HB0A 4ERNA 4CM7A 4FSDA 3ABQB 4ND7A 4X20B 4ZYLA 3LT5A 4X65B 2AFRA 2BMAA 1XP5A 4OHRA 2PCLA 2WPNA 1VPWA 1JKXA 5FPHA 3A1WA 2I3GA 4C9BA 4EYEA 2IYXA 2FGKA 4RD2A 1PO7A 1O1YA 3HXQA 2JJ1A 4B32A 3IIEA 1DG3A 1XSEA 1FYDA 4FFDA 3ZIDA 3C0KA 5K8CA 3OKFA 2EJUA 2C20A 1C1YA 3COVA 5JNSA 5IT0A 3ZUGA 3PUXA 3M1YA 3G2MA 3H9BA 2VH2A 1UMCB 4XCVA 1M83A 2YWEA 3CWCA 3ND8A 5TMPA 4IP0A 1FSSA 4EB0A 3A06A 1D4AA 3EXHA 4H7PA 5JDCC 1E2KA 4J94A 1AVTA 4TXMA 1KEPA 1R0ZA 1UOEA 3KLPX 3QXSA 1JKJA 4FEAA 3ZDCA 2XMSA 3AMVA 1RCUA 3IHWA 4JLBA 3C7KA 3RS5A 4KXWA 3OBBA 4O4IF 4UTRA 2CE7A 1QO7A 2D54A 1NG1A 3CXUA 4FIDA 3VBCA 2CK3D 4LX0A 2E5FA 3FNFA 1X39A 2OYSA 1WNFA 5ED0A 2OXIA 3QVOA 5LA6B 2VJKA 4XOUA 3LT1A 5FBQB 4AF6A 4DBLC 4ITRC 6PFKA 1EIWA 3E2MA 1GPBA 2PTHA 4IOMA 4JGIA 2XMDA 1LI5A 2PH5A 3KXIA 1EFLA 2WZBA 5FWYA 4FOLA 3K9BA 5A0FA 2M1XA 2ODQA 3TNLA 4DIMA 1EVKA 2BWJA 5DHAA 2BFOA 2VZ0A 1O96B 4FQ8A 4H4EA 1E96A 4MV4A 1GRCA 1N5DA 2F59A 4H59A 4BVEA 3LPNA 5L7YA 4YUWA 3DKKA 2JKVA 3EGDA 1HQYE 4L7VA 3EGVA 3TD6A 3JVVA 2BI4A 3HXMA 1EUDA 3G1TA 1E7QA 2RHWA 1WXHA 2CUTA 3PNMA 4Q1DA 1SU4A 4CXMA 3OMLA 3JQEA 1Q19A 2QUHA 4Q4JB 2BGJA 5EWJB 3TQTA 3L6UA 1V11A 3G7UA 4TN1A 3MRVA 3X1ZA 4BJ5A 3DW1X 1BJTA 2JJYA 1RACA 2GPYA 2JCYA 4HBZA 2B78A 4L72A 3UMMA 4J91A 1GGHA 3OX3A 3KR9A 4H31A 4MQ6A 4TLBA 3ZU5A 2CZGA 3QX9A 1Y6GA 1GSOA 2YW9A 3DZHA 2ENUA 4FC6A 4C0AC 3UUWA 4RQBA 4JUIA 1TCCA 3O3OB 4PG7A 1TOAA 4QXRA 2J5KA 3HJCA 2X4IA 1N6OA 2H07A 1S2NA 1IL0A 4PBTA 3K92A 4PPQA 4TLDA 1NSYA 4NV1A 3BL6A 3SZOA 3TNJA 4JI2B 1A2QA 3IP1A 4BB9A 2Y05A 3OX2A 4G07A 3PNQA 4Z5XA 2G3YA 1JIQA 3IAM6 1K8XB 5G0TA 3USES 3NC1C 1ZSVA 2YR0A 1E9BA 1MF7A 3OQIA 4NQZA 3WLJA 1M72A 2FZCA 4KXFB 4MLZA 2GI4A 4Q7LA 3URKA 3W3AH 2YN4A 4IGIA 4JH0A 1SXHA 4FFBA 4RHXA 5EQFA 1RHRA 5A1TA 1B76A 4N01A 1YOBA 4KV7A 3JQRA 3HJUA 2FWPA 2PSJA 2WNHA 4QLBA 2EG5A 3VSDA 2HLNA 3UWDA 1ORIA 2Q1YA 1ZP6A 4L3WA 3B60A 2GBGA 4NR0A 4WZBB 1BS1A 1XZ8A 2A9KA 5KQPA 1POXA 1A5AB 3D54D 3NYRA 1HMYA 1R2QA 4FK8A 1R0SA 2YOGA 2PEYA 1UKVY 1S5PA 2OXEA 3C5EA 4EQ6B 5JJBA 2ZJ3A 2QRVB 2PVPA 4PXYA 1E3SA 1JYSA 1SRRA 2ZRJA 4TMVA 5AD1A 4Z53A 2X40A 4ZYYA 1KSHA 1ISFA 3NDIA 3H75A 1L8OA 2ZUUA 1RCFA 2XCUA 5KKCA 2VPQA 5EJ9A 4UCWA 3OJWA 2FMFA 3BFXA 1CUXA 3I9V1 5DGXA 3LPAA 2Q99A 3ISTA 1SCIA 2F1HA 4OU4A 5LQJA 4EHJA 2AJBA 2VRNA 1JLKA 1FVFA 5C37A 1FBTA 2J6BA 3I9FA 5SZKB 2QPOA 5FA5A 2IY8A 3PQ3A 4G9GA 3TQOA 1H8HD 1I5EA 1TTPB 3BXOA 3LIPA 3PPYA 1NXTA 1PT6A 1Z0UA 2L82A 4ZEWA 4KQGA 4H0CA 5LQDA 4OXQA 1I3NA 1X0XA 4HADA 4MRMB 3MK31 4YECA 1E9FA 4ENTA 2AEFA 1Z0IA 3SZRA 5I45A 1TK9A 2Z5FA 2BMVA 1GLGA 1MGPA 2IXAA 1CYDA 2HHCA 1CUEA 5FT9A 2F8TA 1JG3A 1PJ3A 4LDNA 2GZ3A 1RLJA 3E1GA 3MSXA 4KDFA 4K81B 1C3JA 2UYOA 1CS4C 3IEKA 2C3YA 3RRFA 3QEKA 5CAEA 3RANA 2R6JA 4F72A 2HCFA 1E58A 3KKQA 4N9QA 4EHBA 4XM2A 2IZZA 4FGUA 1MN6A 4QVIA 1XR3A 3WRVA 2GEKA 2ZUFA 1IHOA 1KZ4A 1NZDA 2JLXA 3G5LA 3O4RA 4ZCIA 4QOFA 4KWTA 1XPOA 4LQLA 4OMFG 1N3IA 4EW6A 5K3FB 3HNPA 1UMBA 1W36C 1U65A 2XOEA 1Z28A 3IAS6 5T67A 3U4MA 3G7SA 4KXMA 1RQLA 2NO5A 2P2LA 3P9XA 1SAYA 2OOKA 3HA7A 4IF6A 3T0FA 4CM5A 1N7HA 3V7NA 1AS0A 2XODA 2GM4A 4OH1A 3HHEA 4HNSA 3ZHTA 2ZJ1A 3OCCA 4KHPB 2ZJ6A 2JRLA 1Z16A 2YIVX 4QBTA 2NO1A 3NM6B 1NMEA 1R4AA 1XZJA 3C74A 4JSYA 1JDNA 1MJ5A 3MVEA 3MWYW 1BGXT 3JQPA 2OV6A 2YKGA 1FNDA 4AC9A 4Q3EA 2GF9A 5E4TA 2DLDA 3NDRA 4WOBA 4NS1A 1PJ2A 2FH5B 3ZGYA 3N7TA 1J8YF 3QBTA 3R1IA 4W9NC 4GE0A 4I36A 4ER5A 4M4SA 2HSJA 5LIPA 2CMGA 3M9WA 5EIBC 1SOVA 1TFRA 2PBFA 4RELA 4LXIA 3SIXA 1P61B 5IAOA 4DR6B 4QL3A 1CW2B 4DQLA 4EMUA 5ELXA 2ZIAA 4F21A 2VHTA 4GM0A 2N42A 3D7SA 4HYQA 4X1KA 4X71A 1M1YA 3ZTWA 3MT8A 4MQEA 5EVCA 2AFHA 2FJPA 4EUHA 1QCZA 4W7IA 1ZITA 3UYKA 1A9TA 3RASA 1QX3A 2IHUA 3MGAA 2ZVDA 2CKMA 1RYZA 4XJTA 4OQLA 5C4GB 3RYHB 5K9ZA 2IU3A 4KE7A 4QUJA 2F48A 2AKYA 2OV1A 1R8SA 4J03A 1YMUA 4KC0A 3R7SA 4H2DA 2ZBUA 3LAWA 4NYMQ 4CMEA 2CNBA 3K9FC 2R62A 4DC0A 1SVUA 1JHYA 3DVRX 4JU9A 3RW9A 5I9IA 3ZVKA 4CPDA 1SFRA 1RRKA 2JLBA 1YVRA 4NYMR 3A4TA 3AP1A 4KB5A 4PEVA 3WGJA 1OT3A 5FNVF 4OB7A 5B53A 4PTZA 4ZQHA 2R5FA 1OWMA 3MS2A 2QD1A 2K7ZA 3DLCA 4OU5A 2DFNA 4UE2A 4E5YA 1BDHA 3FFTA 2JBWA 3C4JA 4K9KA 1DRUA 2XUJA 3GVPA 5AVJA 4RAOA 4RK0A 5C18A 5G41A 3ACBA 1HLDA 4G4GA 3TPZA 4D9FA 3GGCA 2G4LA 4H6WA 4H9GA 1DC8A 4K9PA 3TIXB 2ZRPA 1ACMA 1XT6A 3L79A 3KSDO 1TPZA 2XUPA 3KAKA 1XMQB 4DYDA 3C3BA 3K9NA 3WGVA 2EV9A 5J5VA 4WLNA 2Q4RA 1NU6A 2CMHA 3DB1A 5EKSA 1RC1A 3IE0A 3IODA 4YONB 4DG9A 5EY5B 1LLFA 1Y8RB 2QT9A 4J3NA 3A6KA 3V4FA 5KYYB 3RC8A 1D04A 1KY5A 1AD2A 2Z1NA 3DE1X 3EG9A 2NUPA 4GECA 3RC1A 2PZEA 3OZFA 3DAFA 1I1HA 3E1SA 1SVIA 3ZWKA 1SZJG 2J4CA 1Y9AA 4HNTA 1U5BA 3HB4X 3N2LA 1Y3AA 3A6HA 4F71A 5HMMA 4B17A 5DWVA 2H1FA 3I76A 1R3DA 1NT2A 5FORA 4CTKA 4II3A 4QPPA 4PXSA 3U3JA 1GZUA 1JDJA 1HYGA 5TPZA 2Z2IA 2HU5A 1OTXA 2J9ZB 1JU3A 3CSDA 3FBWA 4WNAA 4YRIA 2OUIA 5JAMA 3ZDRA 2A9VA 2FWMX 2PUFA 4MARA 5THQA 3HJHA 4HH3C 1XD2A 2Z5VA 4I5GA 5EIAA 4LF8B 2GN9A 1J0AA 3ZU3A 5K0GA 3EGXA 2PIAA 3B9BA 4LYFA 3JR7A 3RABA 3BA6A 4JQCA 3PEEA 3CX8A 2SCUA 1NOJA 4HYTA 3HU5A 3QNWA 4L8FA 3BMXA 1C9KA 4BMPB 3PQFA 3N2KA 3FXAA 4TMYA 2R4TA 3CW8X 4MPPA 5FBKA 2OTCA 3TSOA 1N2JA 3EVAA 5K0FA 2ATIA 2AN4A 3U3ZA 3K5IA 1OAKA 3EWNA 1E2QA 1TM7E 2VT7A 4MUGA 5A5EA 3TL6A 1R9NA 4KSCA 3K3PA 3R3YA 4OLJA 1T6ZA 2KMLA 1N0UA 3JQ8B 1Z73A 3KQWA 2PX4A 3L46A 3A7DA 3CB4A 4NMLA 4YRLA 3HNRA 3TSZA 3CWQA 4AZ3A 4BEBA 4FS8A 3SY8A 5KJCA 3NG1A 3D31A 1SB8A 2NTYC 3GGSA 3OFJA 3QJ5A 3QPCA 2VP5A 1BO6A 1XTQA 1QRDA 3EQ7A 3ADCA 2NPOA 3X2SA 1KK1A 1C1XA 2WUEA 3WB0A 1QLWA 5IM4F 5GINE 1OX5A 4KR7A 1NR7A 2C9OA 3PF9A 1TMYA 5TGTA 2V3VA 5L3QB 1C8BA 4ARSA 1SVNA 5IABA 4QUHA 1CWUA 4GOMD 4EQZA 5F1YA 4YAIA 5KIAA 4G4SO 4IZ6A 1U8CB 1GKUB 2P5TB 3HDQA 4AU1A 2G8LA 4HSGA 1K06A 3SHVA 3THWB 1GU1A 2ZCVA 1JHPA 3G8BA 1DMSA 2BRUA 1B00A 2J30A 1P1KA 2C92A 3ETLA 5FJJA 3ZIUA 5AVVA 3SFVA 4MO9A 2Z5GA 3UMBA 3OZBA 5AK4A 5DM0A 4KQFA 4UU8A 3SJAA 4ZGBA 3WIVA 4FFRA 3HWSA 3D6FA 5EIFA 1HDXA 5CURA 4MTLA 3M6IA 1Q57A 4DSOA 1I36A 1OYVA 1V5GA 1ZVKA 4G1MB 5IC6A 1JTFA 4U7FA 4RIGA 2C03A 1MRSA 4DXDA 3U9SA 5EEHA 4IJKA 4BLUA 4HS9A 3EVFA 4UUAA 3TX2A 3NCTA 3OM8A 1JVSA 2A0FA 5ALKA 2FWIA 3S8YA 4GOJA 3EGEA 3Q1LA 4QULA 3D7KA 2CF5A 3A2KA 3PTAA 1JR6A 1W76A 4C0BA 2NO9A 3FVRA 3HA3A 1T9BA 5EHIA 1ISMA 4MSUA 1PEDA 2C0CA 1MJGA 3P27A 1X14A 3U17A 2QM3A 3LRPA 4NJMB 1NRXA 1EFTA 2VYCA 1OLXB 1KMIY 1NBMA 2WFLB 2ZB7A 4IUDS 1AGXA 3AW8A 3WGOA 3EFEA 1L4NA 1RTTA 1T3ZA 5A03A 3B70A 1G8SA 3ZCQA 1HG0A 1YZ3A 2I6UA 3CVUA 3VNUA 5EZYF 1EK0A 3DMHA 3AETB 3KUXA 1J8VA 5AJWA 4JLDA 4MCHA 5FFMA 4F38A 5ILQA 1KFBB 4WESB 4B2PA 4AS1A 2RH9B 4F6RA 1DP4A 5AM5A 4Z3OA 1KVQA 4RKFA 3E22A 5ALFA 5T57A 3RHSA 1AKRA 3NP7A 3EOBI 3OU6A 4QEZA 3IMFA 1L5KA 4YAEA 5JCZA 4DR3B 1JLSA 4B3IA 1M2OB 4FZ5A 3AOGA 4H77A 1QYCA 1L3CA 3MJ4A 3OT5A 3VGJA 1H5NA 1NXVA 3JW8A 3VPGA 4ZGGA 1WSAA 3Q6NA 1XZQA 2WNIA 2XGGA 4TUYB 3ZZNA 1MXFA 1PJZA 1TKRA 1QHFA 1Z8NA 3GGDA 3W79A 4ZARA 2OQVA 2YQ5A 1H0SA 5G1PA 3AIOA 5TE9A 3TOVA 2ECQA 1TUIA 1QHNA 3CF0A 4BFVA 4Q19A 4AAYA 1KZ9A 2HA2A 2RFLA 1HKUA 2GHQA 3FSJX 3QKSB 4DQUA 2YV3A 4AJLA 2BFEB 3O4HA 5A7HA 1KI3A 2ANBA 1I7QB 1GL6A 3ZWMA 1U7PA 1WB5A 4I5DA 2YFHA 5DNVA 1CUYA 2L42A 4AZSA 1E7MA 5CDGA 2MYTA 4YRQA 2WT4A 4HDMA 3RD5A 2J5XA 3DPSA 3CX7A 3LDFA 1KYTA 3AESA 2FSVA 3U9LA 1A7UA 2AOWA 1QRTA 1I3CA 4JKOA 4OD0A 3KSBC 4OI0A 2YICA 2FAXA 1WUTA 2WKPA 1WHSB 2FJ0A 3R3ZA 4IH9A 4ZJZA 1M0EA 1N5OX 1JNYA 4OI1A 1HURA 5B3KA 1RPAA 3ZV6A 3OM9A 4F1JA 2CYAA 3N86A 1K5HA 4Q18A 3EXAA 4RZQA 1Q91A 2J0UA 4X3PA 1A9OA 4IWXA 3LRXA 1ZK1A 4BVKA 3EZNA 1F0PA 3ZV5A 5JZBA 2ZTMA 1Z83A 2JFGA 1U8TA 3H9UA 3HPQA 2BFNA 3NORA 4R68A 1T5TA 2JIZD 3E3NA 3GMIA 3BMOB 3PXEA 1K5PA 1G8GA 1XRSB 2HDNB 2OZLA 4ZMSA 3CVXA 1DZ3A 4LXYA 1A9PA 2AQIA 3Q9UA 4YJFB 5ITZA 2ZZNA 4HFRA 3V2UA 2WY2D 1PJ8A 2DUJA 3PYXA 4QOEA 3VPXA 2HJ9A 1RKXA 2CZQA 2IKQA 3JD2A 3KXPA 4TROA 3ROTA 4EEXA 3EDQA 2FX2A 3F3KA 2VYQA 1C4WA 3SYMA 1ECCA 4G56A 3EC2A 5IT4A 1QWOA 4IDPA 3V4OA 2AI3A 1RIFA 2JJQA 2Y0CA 3L06A 2IDMA 3DOUA 1H66A 3PNLA 5F35A 4E5UA 5CB8A 4DR4B 4HAWA 2RHRA 2YJGA 4B2LA 1THGA 5DNAA 3HUUA 3HPRA 1OUMA 4G0XA 4U2EA 4Z9FA 5JSZA 2F6RA 4G65A 2QHXA 1S8OA 1IXSB 3R8XA 3L0IB 1PCXA 2ALJA 3QE3A 4DNOA 4MOWA 4K05A 4WNYA 3P0JA 5ETJA 4EB6A 2YXLA 4JU8A 3IHKA 3EEYA 2P4SA 4C4YA 4WZAB 1Q6ZA 1OVGA 1QGYA 3BKWA 4HFMA 2QVZX 4CIDA 4M1TA 2R47A 1Y1QA 2GD2A 4Q37A 3U26A 2GX6A 2XHZA 1FY2A 2IY9A 2F17A 1G9XA 3DZJA 3ZBUA 3UGTA 1DADA 1UMDB 2AOXA 3VR4D 5FUVA 4ZO6A 4UMDA 2WA1A 3IALA 5AXBA 3LGAA 2RAPA 3WK8A 3V2GA 3WNCA 1J1IA 4D82A 4D25A 3X3HA 4DCGA 3SBDA 1TKAA 2PLFA 2X8JA 3LFHA 2ET6A 3HP7A 4G84A 3VVBA 5I01A 4Y6GB 5HIIA 3TLGB 1OCEA 3C85A 3STXA 4CQMA 4JA0A 2P35A 1MABB 4TYPA 1F5NA 2PYDA 2TS1A 5CIQA 5KTRA 3LUHA 1SK9A 4HGPA 1DKUA 5TQ0B 4HF7A 1QYIA 1OB5A 1VG0B 1CZNA 3KM0A 4JP2A 5EUMA 4F6CA 1V2GA 5M34A 5G40A 3EPKA 3LBIA 4WKNA 4CKZA 2PRZA 1XEAA 4IX9A 1T5LA 1MO6A 3OVMA 4WHMA 5AI8A 3ZW7A 4EH1A 4R8VA 4MRVA 3UXYA 1QDLB 1X74A 3MTAA 3NTOA 4CL8A 2ZRGA 3IP7A 4B9EA 1ZU5A 3AV3A 4JCOA 1U7HA 3UK6A 5KTSA 1JU4A 1FXWF 4LC9A 4Q3OA 4WAUA 1T9CA 1U8YA 3OF2A 5CPFA 1QQ6A 1W36D 2VRCD 1KK3A 4IDNA 2Q1TA 4BO4A 2VO1A 3DZBA 4OQFA 1D3AA 3EHDA 3O7MA 5G4LA 4B6SA 3OIYA 1JLLB 3OA0A 3RV4A 4TLAA 721PA 1JG2A 1IQUA 3IQEA 1WZNA 3D0QA 3GCDA 3M0EA 3UWPA 3W34A 3HR4A 3GDHA 5KHLB 5DI9A 2GJAA 3U7FB 4ZJPA 1S1CA 5HJ7A 3BXEA 1IUOA 4HX5A 4C21A 4DSTA 1THMA 4J0DA 3TE6A 1SXJB 2F1IA 2YFYA 3H42B 2AD5A 2C8VA 1NQWA 2ZR8A 3AUJB 3JY6A 4JNKA 5FPPA 5G1OA 3SHWA 1N5KA 4CRWB 1E77A 2VDNB 3L3BA 2BKVA 4BFWA 3ZDEA 2CXQA 2GAOA 1ISGA 2AN5A 1PEYA 4GDMA 3WL5A 4ZJUA 2VNKA 1PK9A 4HAVA 1WAMA 4M8IA 4WCFA 1UXIA 3BTVA 4K6HA 5ALHA 3ZQUA 5EIBD 4DM3A 1OX4B 5AOBA 1C7EA 1V7ZA 5DYYA 2HBRA 1EDEA 2QYTA 5EVJA 1OF1A 5B55A 3PXGA 1WEKA 2E0IA 4GKVA 2QN8A 5DHQA 3VA7A 4NEHB 1MX9A 1RXYA 4A8JB 3UMJA 2PGIA 4GNRA 4KFRA 2Y27A 3VO1A 1T26A 3NAMA 5ALRA 3UJCA 2IUEA 4FGKA 3TZLA 2WWRA 1SVMA 2WBLC 5DCWA 4DCMA 3H4MA 3ABIA 1IONA 3F3YA 5IPFA 1L8QA 2P0YA 2C4WA 1TAHA 4LFCB 5JEEA 1L4EA 5TB5A 5LBUA 2I62A 3ZI0A 5LYYA 3AHHA 1KGDA 1LSSA 1BKDR 4UU0A 4DXAA 3PPXA 5B2FA 3DYIA 2P1RA 4KR3A 1V47A 1W96A 1CR1A 4R9VA 1JDSA 1DC4A 1P8AA 4V0KA 5A0VA 3H1PA 2REQB 3ZE6A 1UMCA 1XZDA 3BL8A 1E6CA 3W8NA 4F60A 4GWKA 1QG0A 2BCEA 3ZDAA 2VDWA 2ODAA 2P8JA 3H0KA 4BYMA 3WQRA 4KO2S 1O03A 2BL4A 2CMDA 5B4UA 1E2FA 521PA 2ZVJA 3H11B 3UMRA 5LJIA 1RYHA 4NI5A 2ODBA 2ZUDA 3RRJA 1G20B 1QIHA 3GUHA 4ZOBA 1FU8A 1VI6A 3BB3A 5H70A 1TM4E 2Q5CA 4I50A 4HC4A 3IUQA 3ZWWA 2LCIA 3LQ1A 4D81A 4J6FA 4UD6A 4BNIA 1E1CA 2PZGA 3OQVA 4F46A 2LPMA 2YV4A 3BRWA 3ZHVA 4JI6B 2G6BA 5FA8A 4B6JA 2Y2UA 4WOKA 5BNFA 1AKYA 4X62B 1TFUA 4JX9A 3A6DA 5FOVA 3RT7A 2AQHA 1KJNA 1YO6A 4B3BA 2R1VB 4R9NA 1QB7A 2JI9A 3IOMA 3IT3A 4MJXA 2IKSA 1E98A 4RKRA 4MP8A 3SD7A 2RBEA 5KOYA 2EZUA 1G8MA 1R0RE 3DEIA 1BHSA 3A28A 4OFXA 3DXFA 4C0SA 3S28A 1P17A 3GRAA 4ABYA 1R4NB 3N8DA 1VCIA 3M1LA 2ZJZA 3EY4A 3ZHSA 2JFWA 2L18A 2JLUA 3K8YA 2OT3B 3LGSA 4QICA 4UU1A 3V34A 3CVWA 4OLAA 2BGKA 3RSQA 1I1OA 3D1JA 2O05A 3O5AA 4O4HA 2IUTA 4BN4A 4D0SA 1P74A 2HV9A 4DIKA 3BA1A 1E9DA 2B4TO 1PW7A 4FSHA 4P3XA 4RXMA 3SEQA 3L0CA 3P20A 4PHHA 1SQ6A 3A1SA 1AGPA 4PZ0A 1CUZA 1MEEA 1PNVA 2QAIA 3ZBTA 2A94A 2V6BA 1JSCA 2FEAA 1E6WA 5HRAA 5EHNA 1CUSA 4IR7A 4WXYB 2F1KA 1WMEA 3HBLA 4QAQA 4B3TB 3KLMX 5K7SA 3W78A 2OD7A 3T1OA 4WBNB 2A1UB 1O6GA 2XI4A 2HW8A 2ZR9A 4M0LA 5BSFA 1U31A 5JTTA 4RVCA 3TECE 2CVHA 1ZJJA 2HRBA 3C7AA 3IBFA 3TF5A 1YZGA 3Q41A 5C1PA 2EF0A 5HZGA 1WCXA 4YJHA 3KTFA 2GTIA 3HI6A 2X0EA 2PT9A 3GEBA 4H7HA 1I5OA 1YT5A 3BMQA 4P9NA 4B2YA 5BMOA 4TXHA 5KQLA 1XRQA 3DPIA 1VKZA 1TVMA 2Q1XA 3CVVA 3P2JA 1ISPA 2QYSA 3THOA 5TMBA 2B7CA 3MINB 1XZMA 2ZBEA 3KAJA 5JPCA 3TUZC 3L7JA 3ZWPA 5B58T 1XKXA 3ROMA 5EP2A 5JNUA 5AKXA 4RA9B 1X8KA 1E6LA 4FOPA 4WFJA 1PWZA 2YXEA 4GX5A 4MI6A 1RFGE 2XADA 2ZAMA 4R3UC 4ZVSA 4RVDA 5BT9A 1SVLA 1ZSNA 4BMZA 3TOCA 1IAQA 4W7SA 4PGMA 2BBOA 4ZV4A 1M7GA 3RFVA 1W48A 2OCPA 2YRFA 3RWOA 5BMVA 4EY5A 5JY1A 3L7BA 1R5NA 2QYOA 1GNVA 2PGNA 3P2IA 2IPXA 1UINA 4NZNA 5AFSA 1ZFNA 2C1ZA 5LXTA 1UC5B 3B9RA 3SZGA 3LUBA 3O21A 3C1OA 2VHXA 2CJYA 1KL7A 1KQPA 4J8PA 1YCGA 1Z0ZA 3K6RA 3LYLA 4R05A 1SMKA 4NL4H 3NH9A 4TN5A 3UB2A 3ZE8A 1ZM2A 3ESDA 3NHYA 2ZRIA 3QIVA 1K4MA 2FDRA 3AVPA 2G76A 4CDNA 2CXUA 1T2CA 1F06A 3DW3X 3OPXA 4DANA 2JG3A 2ZE7A 2HKIA 5JC1A 3GLHB 1AZTA 3WYDA 1MORA 1U7UA 4ZI7A 5AVOA 3GL9A 4RZSA 1RR6A 4WNCA 1L9XA 3KQYA 1SBIA 3E0XA 1P77A 1Y3IA 4EUFA 3ONEA 4GD3Q 1T3LA 1RWVA 4MW0A 3SM3A 3EISA 1U0FA 1DKLA 1K6XA 3F7MA 2QMOA 1TAQA 3HP1A 1Z6TA 4JDUA 3QUAA 4LYAA 2AOVA 4ZV7A 3TOXA 4EUEA 5JOQA 4LOHA 1N9GA 3KKPA 3AUFA 2GPJA 3LI2A 2HBQA 1WKCA 3D3JA 3LC0A 4MRPA 1A0OA 3DXZA 1NJ6A 1NBAA 3QVGA 3JRNA 4ZVUA 2CC2A 3KEMA 2A88A 3SZMA 4UNQA 4XIIA 5H9WA 2GLUA 4Q7KA 2CJXA 1KPIA 1UKZA 4U2GA 1CR0A 1PFQA 2D13A 5JO9A 4HYYA 4EDHA 1F8GA 1X1QA 1F2TA 4ZVOA 1CDOA 1N6KA 3W5JA 3OJ0A 1LRKA 4PPGA 1IK4A 1YONA 3SR3A 5CK5A 3VTFA 4OHKA 1R6VA 4XIGS 5EP4A 4CMCA 4EZEA 3WYCA 3VH4A 4AUMA 3FE2A 2AVDA 4ROTA 1M6YA 5DBIA 3UMFA 4ZIRA 3OTOB 3C4QA 2JI6A 3QU2A 1F3OA 4E14A 1EPUA 2NU9A 3IQXA 2H4XA 2X2FA 5AW3A 1M1NA 5GM2A 1YGPA 4NJEB 5JH7A 1YNOA 3JQFA 4UM9B 2W93A 4Q9JA 4BAGA 3OE4A 2DXIA 1FU4A 2B4KA 5CTAA 4UUPA 2WJWA 4GF5A 4XUGB 1IJFA 3D7NA 3D81A 3RVJA 1J2TA 4UULA 1L5HA 3VNSA 4B5KA 2B8TA 1CZKA 1YR1A 2JAQA 4IMJB 4XW2A 5U4XA 1T2DA 1WUYA 4PCLA 4UBLA 4F56A 4I1IA 3ADBA 3ZI4A 2F4NA 2FU5C 1GCAA 3BIWA 5KNDD 1O97C 1TMKA 4Q3LA 4N6NA 3PFIA 4R8KA 2CD7A 3KBOA 3NALA 2C84A 5AVTA 2ZU6A 5A02A 1IHUA 3WGHA 1ZVVA 1P0QA 3IUYA 1D2NA 3ROKA 4DDWA 4YCSA 5KAPA 4CT0A 1VECA 1XDWA 1SK8A 2NOAA 5DXAA 2CB9A 1D2GA 2O0LA 4B81A 4YRKA 3PJDA 2V0NA 3OIGA 2ID4A 3Q7TA 4FDVA 3WYBA 1ZNZA 3KSZO 1KJQA 2A67A 5FI1B 4I55A 5IARA 1MTOA 5CEJA 5HWSA 3Q7RA 3FAKA 2XKJE 1CVIA 2HJRA 5CHEA 4EFLA 1EA5A 3PX2A 4JLNA 3WL8A 1P0MA 1QBKC 3FX2A 5CX1A 3V6MA 5ICMA 2ZYTX 1XRPA 4XIYA 1JHQA 2PT5A 1GYQA 3JS5A 5JFTA 1ZJWA 1TYAE 1R9JA 1FSGA 2PMEA 1OPXA 3ORHA 3KB8A 2V7QA 4IMIB 3C7DB 4UFPA 5BPFA 1ICIA 4EI9A 1IAVA 1V9LA 3DBRA 4KG7A 2ZUTA 1U9ZA 3RYFA 1VCNA 1FFXB 1DIRA 4IS3A 1IYZA 2GEFA 5D3MA 1QWSA 1H4TA 1ODIA 5CRIA 4LXXA 5E1BA 1YQDA 1IN6A 1ULSA 2FQWA 4HXEB 4LRUA 4TS1A 4IDQA 4IJ6A 2YJ3A 4AB1A 3ILXA 2ZGVA 3AKCA 4YI5A 5LOVF 2YS6A 4L07A 3TL2A 3KHSA 3CNHA 3UT5B 2GJKA 3OHPA 1E5TA 1V6AA 2V7TA 4I81A 2H08A 4YMLA 2WZCA 3VXKA 1P4SA 421PA 4MI9A 4URVR 5AVWA 4AN0A 3KWJA 3TH5A 4X1OA 4I5IA 4RVUA 1MOSA 1OR8A 2P75A 3F46A 5EMJA 3UNXA 5LWQA 1N5JA 4D99A 4J0GA 5EFZA 3IDSA 5KTTA 4RGYA 2VL7A 2NVOA 3W2EA 2PIDA 5IBPA 1L7VC 1VJDA 1YL6A 4MWTA 3WOHA 3BULA 2BYTA 3BRWD 3VHXA 4XDGA 1E1KA 4JS0A 2ZRFA 1AKNA 1OYOA 4PZZA 3SZUA 1Z68A 4IJWA 4GW3A 3QV2A 1FDWA 4KAJA 2H11A 3EG5A 2OBMA 4LHWA 4Y6RA 1ORWA 3DXXA 3Q0IA 2OFOA 4RH3A 4A26A 4X61A 4MW7A 5ALPA 1TQHA 3OURA 3UAVA 1PTJC 1Z6PA 2BEKA 3CZCA 2O8NA 4DBZA 2ICAA 3Q3VA 4OQMA 2BEUA 5T41A 1UOQA 2EF1A 5HKOA 2KW5A 2W2OA 3KOOA 5JJCA 4F4CA 4TPKA 5H4HA 1Z82A 1E6KA 1KMHB 5EL0A 3GXBA 4ACBA 3L4EA 1P18A 4Z0PA 3P0IA 3E3MA 3B3JA 4GMDA 4MH0R 1RXWA 3RBAA 1CRQA 1P3DA 3M83A 3Q7EA 1Z8DA 4C14A 3KEQA 3MA0A 2PLWA 3MCUA 4TTVA 1NURA 4OKNA 2WEKA 1H8ED 1AGYA 1RQRA 4IG9A 1O5TA 2H0AA 5BQPA 1YOVB 2X6TA 1QIMA 1B1AA 2EKQA 3OZEA 4RPCA 3TQHA 3WTBA 1ISHA 2GHRA 4BY9E 4RTJA 2A1TR 2BGWA 3IQWA 4XUCA 1IN5A 5BYBA 4EPRA 3BMCB 2J3KA 1V9CA 2AA3A 2DOKA 2JEYA 2YJNA 1E2NA 3QP9A 4B84A 4GYWA 5HQTA 5H02A 3MOSA 4YMGA 1G6KA 3FZYA 2GFQA 2GCOB 4PR3A 4AMUA 4E07A 5CJJA 3V6LA 1HDCA 1UPFA 2AMYA 2P9EA 1TJ3A 2VDKB 3DYBA 4PG5A 1QLJA 4LZOA 4QASA 1EJ0A 1JG1A 3MN1A 4KAFA 5DLYA 1LK0A 1VJCA 4YRNA 4KN9S 3WI7A 4WX2B 2W2KA 3CMMA 1TYCA 2ZT5A 2WYIA 3G1WA 3B85A 3H18A 3K0EA 1ODFA 2CYBA 1QDUA 4UVEA 2NG1A 4D41A 5KWEA 1I14A 2Z9CA 5K8LA 5LC1A 3ZDQA 4GBJA 3VR2D 2FX5A 3TLCA 1AUOA 3IERA 3I12A 2JF0A 1G0OA 3FKQA 3OESA 1Q0TA 3ANNA 1YJAA 4MQBA 3SC2B 4DA6A 1A4XA 3Q3CA 1PL0A 1UEIA 1RHQA 1NE2A 1XAJA 2JVIA 3GFBA 4OOFA 3RAGA 2Y1CA 4J4HA 5JXJA 2GN6A 3DQPA 4MWEA 2X1VA 5KHAA 4AT1A 3LKVA 4OUDA 5JAHA 3L4JA 1JFTA 3R6GA 3LY7A 1SU7A 3P8ZA 4KPGA 3CXRA 1QUFA 1Q2UA 2VNAA 2ZULA 1KH1A 1G2QA 4OQDA 3A2NA 4Q3BA 3QKRA 4AI6A 1E6MA 2OAP1 4KLNA 4AMBA 4H1UA 1HE3A 3CA8A 1OA1A 4KQXA 4YQEA 2ZRLA 4LF9B 1V8PA 2VJBA 3QI2A 2Y0BA 4M46A 1RM0A 4RTPA 2I4RA 4QAJA 9MHTA 3DBLB 1J70A 5FWXB 3M6FA 4XJSA 4D5GA 4W5TA 4ZOQI 4Z99A 3UJHA 3KU4A 1N2CB 3VV3A 3L0YA 1B73A 2IOHA 1FCJA 3DKPA 4R1LA 4O4IB 1NVXQ 4P98A 2WJVA 1M2VB 4IG4A 4ZVKA 4D3YA 2FUNB 3BSFA 1DOAA 5TMDA 3UVEA 1B3RA 1JEYA 5GGXA 5JDIC 1TK2A 2YHIB 3PUVA 4KZKA 1K66A 2J07A 5CVUA 1O4WA 3KZCA 3VH1A 2UU9B 5J2UF 1DTWB 3O4VA 1Z6AA 3IL2A 2BBWA 3H9EO 3K72B 3S5JA 3FB1A 1YIDA 3GLGB 1GVHA 1J42A 1X1EA 4ZTUB 1DRWA 2F3SA 5IAGA 1GR1A 1JJVA 1OASA 1RYDA 1RAGA 4I4CA 4PO1A 4U3JA 3QYFA 1DE0A 1JBEA 2E4XA 2TYSB 4NARA 4QHSA 4XX1A 2R5WA 2X1HA 1PKXA 2HSWA 3IAEA 3O8QA 3GRKA 3PE4A 4QHTA 5EJMA 2FPWA 3WMEA 2AZXA 2MYPA 4C5AA 4EIWA 1VKRA 1JQ5A 2A14A 1U8ZA 1CLEA 2JJ8A 3VSBA 2BLLA 1EGMB 5DK4A 1IHPA 4HQNA 4CL3A 1WR8A 4DPKA 4PHGA 1GUYA 4BU1A 2G40A 3C6BA 3ZY5A 1EGVB 2IUYA 3OIDA 3UMSA 4PO8A 1HTTA 4BUJA 4DSUA 4BXOA 3UPUA 4ALMA 1FXSA 3E3OA 4KQEA 4LZNA 3KPWA 2P4QA 5D6OA 2F3TA 2O3SA 3L4SO 4DWOA 2C7OA 2C5HA 1SXJC 5DT9A 4AO8A 2DT5A 4Y1EA 1ADGA 2IYFA 1XD8A 2TRSB 5EHZA 1WW3A 4CMKA 4L6CA 1PR3A 4H60A 4N0EA 4RQUA 3DJFA 5IZCC 3NDPA 2G88A 1B0ZA 1XL1A 3DTVB 2OGWA 1VIVA 2ZTUA 3C98A 3GJ7A 1EK2A 4NEGA 3RVDA 3WO0A 4A16A 3U7RA 4D74A 2KM1A 2R1UA 3R09A 3OZVA 4QG7A 2WKSA 5BSRA 3BBLA 2FOIA 1PWYE 1KEZA 4R1QA 1CB7A 2PD4A 3PRHA 4MVJG 3FGZA 1NWCA 2RARA 3BCRA 1OZGA 1XELA 3NIGB 3O1IC 3C6YA 4KMRA 1KQNA 3TYXA 3FOCA 1RD4A 1KO4A 2XB8A 4OOEA 4A8JC 2DAPA 5HXAA 3OFSA 3T41A 1GKKA 2KBEA 3U4QB 3ZOKA 5K3DA 2QD4A 1P5ZB 1RI5A 3LQFA 1D1SA 5T5QA 4E1VA 4YX9A 3B1ZA 1TEZA 2VBIA 3OAAA 1DIAA 2ERYA 5E4FA 3VYSB 1ZGJA 4MWSA 3AOEC 1TTHA 3QV1A 1Q6YA 1U99A 1WDTA 3LC7O 3TR6A 5BUQA 1A5BB 2QLMA 3BZUA 3NEYA 1T8YA 4RVGA 4RH0A 3KB2A 1AIPA 1URPA 3MIIA 1XOIA 2WKRA 1ESMA 1KPGA 4PX9A 1M2FA 1HNNA 3FRHA 4HDSA 5BN5B 1E1MA 4PC3A 5MGNA 4EO7A 3DAHA 1NFFA 1R6XA 3H87A 3VHQA 3V32A 4WY2A 1XA0A 1XHFA 2VHVA 4CLOA 3PRKE 4CN9A 3JQQA 3Q40A 2CDBA 1USUA 1TGYA 1Y33E 2E9SA 1L8AA 2Q1UA 1DRJA 3GFGA 1WPQA 5KCMA 3TTTA 1SBQA 2Q2OA 2XZOA 4D6YA 4Q15A 4DE5A 3P19A 4B87A 4BRUA 4DREA 7ADHA 2Q6KA 3L1HA 5AUQA 4BQIA 2WF8A 3EXFB 2YVAA 5AVKA 1NR1A 5I9SA 2EDAA 4ETNA 2C98A 4B0PA 1H6DA 4UTVA 3II6X 3B3AA 4MAFA 4N0DA 1EAYA 1I4DD 4TZ0A 3IPXA 1SIBE 2HREA 2C0QA 5IN4A 1KEEB 5FYDA 1U0RA 2B21A 3OHMA 4B7ZA 1A8HA 3I1YA 3UATA 3FTPA 4WKCA 5HQ3B 5C2JB 1YA4A 4L5JA 4ND4A 1BW9B 5JLAA 4LYGA 5JS2A 4AG5A 5CG2A 4E5MA 2EP7A 3NWPA 1BFUA 3CQ9A 4UVHA 3FY4A 1JXMA 2P62A 5J23A<