1N5OX

Structural consequences of a cancer-causing brca1-brct missense mutation
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
207
Chain Sequence
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNRPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Breast cancer type 1 susceptibility protein
publication title Structural consequences of a cancer-causing BRCA1-BRCT missense mutation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 56
structure length 207
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1n5oX02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1n5oX01
2XNKA 2R1ZA 3T1NA 1JNXX 3HUFA 3T7IA 4Y2GA 4BMDA 1GZHB 2M2IA 1OQAA 2K6GA 3SHTA 3SZMA 3K05A 1IMOA 2VXBA 2COUA 1Y98A 1T2UA 5ECGC 2NTEA 3AL2A 3SHVA 3QVGA 3UENA 3PXCX 3K16A 1N5OX 3K0KA 1WF6A 3JVEA 2ETXA 4JLUA 4ID3A 3AL3A 2K7FA 2EBWA 1CDZA 4OFBA 4IGKA 4Y18A 3T7KA 3PXAA 3HUEA 3UEOA 3QVGB 3U3ZA 4XQ0A 3PC8A 4XPZA 1Z56C 3PXDA 3KTFA 3I0MA 3L46A 4N40A 2EP8A 2VXCA 2DUNA 2COKA 4IFIA 3PD7A 3K15A 4BMCA 3OLCX 4U4AA 1L0BA 1T15A 3PC8C 1IN1A 3PC6A 3FA2A 3COJA 2COEA 3PXEA 3SQDA 2HTFA 2JW5A 1T29A 1L7BA 1T2VA 3T7JA 3I0NA 2EBUA 3L41A 2L42A 3K0HA 2LE0A 3EF1A 2AZMA 2ADOA 3PXBA 3PA6A 3L40A 2XNHA 2WT8A 2INGX 3EF0A 3PC7A 4BU0A 2D8MA 3II6X 1KZYC 4BU1A 2E2WA
chains in the Genus database with same CATH superfamily
3CLUD 3KD2A 2P9YA 2ZT6A 3R0JA 3WBJA 1DIAA 1RJGA 2BMEA 2JHGA 4KOAA 4AF7A 4DR2B 3JQAD 4HADA 1C3JA 1NN1A 1NX6A 2H7CA 1PKXA 1TCVA 4B47A 4MS3A 4PHCA 4HBZA 3OQJA 4Z8YA 1G7CA 3AZPA 4N5NA 5LB2A 5IHPA 2I2BA 3MBOA 5K3BA 4I4TB 4EELA 4OQDA 3E3OA 3R1IA 3VPGA 1KWGA 1N1DA 4RY0A 4G5HA 1Z3CA 4H3HB 1N7JA 1MX9A 5C5EA 4G8CA 4YRDA 2HU8A 3PNQA 3GVPA 3R41A 1E69A 3MT8A 4P08A 3ITDA 3IMCA 2UYYA 1XQVA 5LMUB 4AN4A 4Q3NA 1EM6A 1XZAA 1KF0A 3DA8A 3MCTA 1SGWA 2QP3A 2WU4A 4O4LA 5T4EA 4ADSG 3G8BA 1W52X 1Z12A 2EBFX 3D7RA 3ANYB 4G8JA 2QL9A 1D09A 2HBQA 4LXUA 5IW8A 2DBZA 3BGDA 2Q4BA 4P5PA 5C18A 1O2DA 2R2GA 4XJTA 3ACCA 1OBFO 4MPRA 3B6IA 3DBHB 3M4ZA 1HT2E 3NHPA 2K7ZA 4PAQA 1MIOA 3UJDA 5DB4A 4DCUA 2ADMA 1A9XA 4E5NA 4ZKDA 2V7WA 4EWLA 2A35A 4XH9B 2HGZA 2VDMB 2QZSA 3IURA 4NCXA 4WACA 1BNCA 5FTKA 1H1LB 3EQ9A 4XSHA 2PS0A 3SKVA 1EA5A 3L5OA 1XXLA 3FKSD 4KKVA 4QG3A 3RS2A 2GPBA 2AZ4A 2Y0CA 3UWKA 4YVFA 3LO8A 1PBNA 3MOIA 3R7AA 4BRUA 2Z95A 1PYOA 3BSWA 3N6VA 5JJ5A 3HGQA 4ND3A 4FE4A 4GC9A 1QVAA 3PDUA 3MHPA 1DTWB 3PXDA 4GR4A 4M36A 4QPDA 4YJGA 1YFKA 2CDBA 2HCJB 3T9BA 4PGMA 4D44A 3VSAA 4L6CA 4RLQA 4U7PB 5EZ6B 2O0KA 1FVXA 1P2TA 4P9NA 3LGXA 4WOBA 3OQMA 5BQPA 3TXYA 1N3YA 3OU7A 4XZ3A 3LKVA 2H0AA 4L95C 4FXPA 5GP1A 1ZZEA 1U9IA 4F84A 4TXLA 4G2NA 3UVEA 2QZ4A 1E2JA 3AKYA 4JC0A 3RFTA 1V47A 1IOVA 2BFAA 2Q7XA 5A3JA 4A8JA 1JA0A 3FYCA 3ZBQA 3A06A 5KTNA 2XGJA 4YP9A 5I51A 4Z53A 2J9RA 3I5UA 3O3NB 3I9MA 1VP9A 2A3RA 1K3FA 1YIAA 3FCYA 1R10A 3SFZA 2O8BB 2AHOA 3L0PA 3JQCA 3TFWA 4WVFA 1VIMA 1ZD9A 2PMFA 3LK6A 4RIEA 1FY2A 3MILA 1QTRA 4DMCA 1VA5A 2XMZA 4GE0A 1KKLA 5CIYA 1NT2A 4JZKA 4KMMA 1A9RA 4Q1AA 4HDRA 5BV0A 2YHUA 4WZ6A 1QH8A 2FR0A 3TLJA 4OPMA 1ZK1A 3WTCA 4I99A 3WLNA 1KO8A 4R1LA 1AD2A 3GLIB 1ZSVA 3U61B 2H51A 1QS0B 1YK0A 1ONSA 2B5VA 3A9TA 2INGX 3K8ZA 4MVJE 5TT0A 2WJYA 3PJDA 1DBIA 3U7HB 2X6RA 5GZ3A 1EXNA 3C43A 2QTTA 1RHRA 4EUHA 1QDLB 3T3GA 4E30A 3CW2A 2OCYC 3O1HB 4DYHA 1NPDA 3C4JA 3WNBA 3DXYA 4BWFB 3I1IA 1FTSA 1NONA 2FMXA 4HH0A 3H9QA 5DLPA 5E8JA 4CU2A 4DNQA 4L08A 1S3GA 4HRXA 3A32A 3R5HA 4OB7A 4EKNB 3HFSA 4F7WA 3T1NA 2I6SA 3H5AA 1VLHA 5TJHA 4XI9A 4D5EA 1U7WA 4AJHA 3FI0A 1UAGA 4S1OA 3HJFA 1LJLA 2HCRA 2UZIR 4F92B 1SMKA 1ZD5A 2H8GA 2A78A 2QAIA 4BVHA 3FWPA 1XEXB 1QO7A 2PTHA 1SHJA 4MHOA 1FU8A 3FD8A 3G88A 1H5UA 1RFLA 3SZLA 3O2NA 4WOPA 3UUFA 1CIPA 2E7ZA 2ZRKA 1KYVA 4ZALA 3GLVA 5E6RB 3VR6A 4IEEA 1T36A 3X2SA 3OQIA 5I7WA 2C5FA 1OFUX 4D3SA 1NR5A 1E9BA 1H22A 2HHCA 3RWBA 5FAKA 1RI1A 2FPXA 3QEAZ 2YJNA 2A9VA 3LGSA 5GV8A 2GARA 2WYWA 4QXMA 2DQ4A 3AKDA 4OG2A 1T8TA 1E92A 3VAZA 3W3AD 3IIMA 3PF9A 1K88A 1F2UB 1NE7A 4WFQA 4R8KA 2AFHA 3QXCA 1QIMA 4TRNA 5A3RA 1TTPB 3FPGA 4ZI7A 5L8VA 3OZSA 4J0HA 2B8WA 1X8KA 2HBRA 2V8BA 2QRMA 4PANA 1WDMA 5GGYA 1E9CA 2XUZA 1JFSA 5ALQA 1MW8X 3WR5A 3KJHA 4O1HA 4ZHQA 1AGRA 3FWNA 4YRNA 1Y81A 1SVUA 4K03A 1JXAA 1YWGO 2W8BB 1UFKA 2ZTHA 3QBJA 3NHKA 4LJLA 3TOXA 2IHUA 4AZ0B 3PNPA 1Q22A 3N8KA 3R5XA 1NNSA 1ZAKA 2AXPA 1G6KA 3E3LA 3JU3A 1SKQA 4FUTA 3OD5A 4RS4A 4Y6RA 4XPZA 3BMNA 2CJYA 4B45A 5KHOC 1ZWKA 4FX5A 4KW7A 4FFPA 1IN7A 4LF9B 3VSEA 4RK0A 3SOPA 3T52A 2X1LA 1X0VA 2G09A 5G40A 1ZOIA 3TBKA 1GTL1 3UKDA 4YWJA 3K5WA 1ADJA 3NPMA 1G98A 3FNHA 5EWMA 3CFYA 3UAWA 5KKAA 2RGYA 1URPA 5EP1A 1UMCA 4RV4A 5LQJA 3L84A 1OT3A 4CQJA 2Q9AA 3KZOA 3M33A 2JGIA 4DLYA 2D7DA 1Q16A 1VB3A 1Z06A 2ZUBA 3OUUA 4O2BB 4DBLC 4OLBA 1FQJA 1RDFA 3K72B 4NJMA 4XB1A 2IHBA 1KEEB 3OCZA 3OX3A 2NYRA 1ETHA 2AEFA 2H5EA 4HX5A 1Y5LA 5F5XA 3UKJA 4A2PA 4BX0A 1T4MA 3S6JA 4EG1A 5ABPA 7MHTA 3IUNA 2VJKA 5EZYB 4DHEA 3OCYA 1OFTA 4PAGA 4N6GA 4Q34A 2GBCA 3HKCA 3VH4A 4CT0A 2RHLA 2XTNA 3PXUA 1MX3A 1G21A 1E8MA 4XWTA 4XDGA 3WWZA 1FTNA 1X7ZB 4WLNA 1W73A 3LD9A 1UDCA 5JQWA 2B78A 5HILA 4BQSA 5CK5A 4ND5A 5ALWA 1DC5A 3OIYA 4URFA 4WNCA 4EG5A 2FE4A 3LQFA 3OPYB 2CYBA 5HKBA 4E12A 4GPZA 2SKEA 3CF0A 5CB6A 4O25A 2H1WA 4UE2A 3MA0A 1NW5A 4PIVA 3OOWA 5H0IA 2AUNA 4ENTA 4TSKA 4G0UA 1U8FO 4K6GA 4F5WA 5IF9A 1YCFA 4E14A 2K87A 2XKBA 2H1SA 4FHFA 4MUNA 5FI3A 3M6FA 4XIGS 2YYZA 4QDKA 1Q0PA 5L9AA 3TRDA 3TVTA 2H7VA 1WKCA 1M76A 5EKTA 4E4RA 3BMCB 2HLPA 3L0SA 3SIWA 4JMLA 4M1MA 3I2YX 3VR2A 2P5SA 3W5IA 1R0WA 1C30B 2JB9A 4GOXA 2ISQA 3KVOA 3RJ5A 5IKMA 4ICIA 1PFQA 2V7PA 4TKVB 4YH1A 3KVRA 4PBTA 2VCHA 5K3EA 5ECGC 3GRZA 5LN1A 4CIBA 3D7LA 1DDIA 4LW8A 4C87A 4F4DA 3UO8B 2VPXA 3CSDA 1DT5A 1RQNA 4LWPA 4ECAA 2X1VA 5BORA 5C37A 1LPBB 2UUBB 1SFRA 1ZCFA 2CKMA 2PZAA 3DE5X 3RYFB 1WHSA 2NU8A 3CEJA 5FPQA 1JLHA 4Z0TA 1B6RA 4DBLE 2WTMA 3K92A 2QB5A 1XCJA 1LPMA 2EZTA 3U37A 4L51A 4CM9A 3QJYA 3PNVA 1YQGA 5E6UA 2I8LA 4KQMA 4E1BA 2OFFA 2Y27A 4JX8A 1SKUA 2GZRA 3ZLUA 2VSXA 2HZ7A 4TYNA 5KKCA 4RACA 3B6KA 3T9CA 1OASA 3FAKA 1O6FA 3E8MA 3EGXB 3O7WA 3KR9A 2ZREA 4B3RB 1K8RA 4FJ2A 4HC4A 4S2EA 1QOQB 4YP7A 1Z73A 3IAHA 1MJFA 2R8EA 4PX9A 2VP4A 3PEYA 2BZ0A 1Q6ZA 2LKDA 1M6VB 5IVHA 4MV0A 5FUWA 2KI5A 2OQVA 4AKGA 1Q0ZA 2HMVA 1SKYB 2NTJA 4QHYA 1MO3A 2O2YA 4BN0A 1ARZA 1MJHA 2FJ0A 4URYR 2EATA 5TS3A 3WICA 1T8SA 2IEBA 4FFBA 4MUJA 3BXXA 3FJ1A 4B48A 4EHAA 5E2AA 2B94A 1R37A 3R7WA 3O83A 1E61A 5HOEA 2BP7B 2JFOA 2QP9X 4P22A 3U81A 5EP3A 4KREA 5EUCA 2ZRIA 2CDAA 4LOKA 5DBIA 3F6YA 1L5KA 2QTBA 5DYNA 1PYDA 4U2GA 1JSRA 1RHMA 3ITNA 2G3YA 3VOTA 1L7BA 4JIGA 3BORA 1EHIA 4NAHA 3I42A 1B74A 1F8GA 1XD2A 5AVZA 3G0IA 3OM9A 4AIRA 1E2FA 3FKQA 3KWFA 3HXOA 2IS4A 2H1CA 3M6MD 5EWLA 5IF3A 1KKUA 2MOKA 1KARA 3RUIA 2R7AA 3IAAA 4MUGA 1B93A 4DJ5X 2OXCA 1YZTA 4FDLA 4DLAA 1B73A 2BI7A 5CLJA 3Q2KA 3ED1A 3AFMA 2HIHA 5CH8A 1XLUA 5BWLA 1HORA 4NG4A 2A84A 1WM1A 2H7YA 2WOJA 2RMKA 4DMFA 2O6HA 1KAMA 3INNA 2GK4A 3VC2A 3T99A 2D3TA 3H8JA 2NN3C 1L4LA 4JS0A 2PMEA 2CY0A 1GRCA 2AWOA 3WK8A 3ROGA 5C51B 2BKLA 5D6NA 5LIPA 4LJ7A 5J4HA 3TOCA 1QHXA 2NVBA 4KVFA 4P4UA 4TSFD 3I64A 4XGKA 3G7SA 4B4WA 3A05A 1K0FA 1OHHA 4O59O 1E89A 4O8ZA 4CLHA 3EIEA 3HE3A 4UHEA 1UINA 4KH1A 1U4SA 1M83A 2ABWA 1IL0A 1ZGHA 4RPGA 3HU2A 4J6FA 5IFLA 2BBTA 5KNCD 1CDDA 3LUGA 2W6JA 5J2TF 2JJMA 2JZCA 4MRMA 1UPTA 1BS1A 2VYVD 1U0JA 1DB3A 1M54A 1EKXA 2WIFA 1B41A 2QTMA 3D2CA 2WZQA 3A6JA 5FQNA 9ABPA 2X4GA 3DT8A 16PKA 4GVLA 2RE8A 1ZQ9A 3A3NA 2O8EA 3NBQA 2NV6A 2OO7A 4ZC8A 1CZRA 3SC3A 4Y1FA 4WY2A 2JLCA 1DG3A 2CYAA 5EGNA 3U31A 1TDJA 4AG3A 1C9MA 1ONOA 1JE1A 1Q1EA 2WF8A 1CJSA 3AETA 3JV7A 3LRPA 3M1YA 4O4IF 5COAA 4BNKA 1FX0B 4IFBA 2NSLA 3WGYA 4D98A 1T0BA 4ME6A 3JVEA 3VR0A 3ZG6A 3B53X 2OGWA 2ERCA 2FHPA 3F8TA 5KQGA 4KX3A 4GXTA 1IFXA 5JYBA 3VO2A 4Y0VA 4EW6A 2ANBA 5LKRA 1NDHA 2AN3A 3BMXA 2CNKA 4UBOA 1KJ9A 1QX4A 3VR6H 4LK2A 3A6PC 4NQZA 3TMAA 2I1LA 4CMGA 1E1RA 1ZUWA 3LHFA 3HZHA 2IUYA 3MUNA 2FDRA 4ZJYA 1NQOA 1HZJA 5EIFA 2R4UA 1X7GA 3A4VA 5LDHA 3IIKA 3MUEA 5JLAA 3ELWA 4R7ZA 3O2QB 2YV2A 2NWQA 2YMQA 2F1RA 3M3DA 3ZZ0A 4PYKA 4PO1A 3RVDA 4HJRA 1TLFA 1MNQA 1Y6ZA 2ZPAA 2GHIA 3DHVA 4GYYA 4UVGA 3U48A 3OMWA 5LLDA 1YZLA 3EVTA 4X1IB 3V32A 4BMZA 1U7XA 3B2NA 3OC6A 3QX9A 5IAAA 4YUXA 2CE2X 4L5JA 2PFGA 3AEKB 2MMCA 4M0CA 1TM1E 5CURA 2ODAA 5ETJA 3ZWKA 4QTTB 3ZE8A 4YRMA 3SQXA 3SYMA 1N2BA 1NVKA 3REQA 1IHUA 2HSGA 4HEQA 1RQXA 2B9VA 2C00A 2R6DA 4S12A 4ALIA 3WAKA 2XLBA 4U63A 5CA1F 4LGMA 4DMMA 2V7QD 4HATA 1Q91A 1GNPA 3DE6X 4FLEA 5GONB 4XGQA 3GDHA 5JROA 1HZZC 1TD1A 4L3OA 4R54A 3WLMA 1X8JA 3PC2A 4ZOBA 3W2TA 1N7IA 3JTEA 2FWJA 3FZYA 2JLZA 4EEKA 4URWR 5F7XA 3QWAA 2JGFA 3L0BA 5EIWA 4DSZA 5H1YA 1IZYA 1XZJA 3ZNNA 2ZUWA 2WV7A 3TBHA 4JFAA 5AW8A 3DVLA 2EW2A 1E5QA 2FZKA 4Q47A 3D6UA 1MOZA 1Z35A 1Q7RA 4JYBA 5G53C 3ZZMA 4BU0A 1ZGJA 1M5RA 4OB6A 3HVHA 1GA6A 2GM5A 3CZRA 1VFNA 3G68A 3QU5A 1F8YA 4NH4A 4CQLB 4Q9JA 1XYYA 2QLTA 3T3IA 4A3SA 4J91A 1R8SA 5DWQA 1ZRSA 4DSAA 4K9OA 1ZUHA 1RWQA 5J4LA 1NXOA 5JW6A 2P9EA 4J9UE 3B89A 2HZBA 3FOAA 3V4ZA 3EZ2A 3KL2A 5CDFA 5GJCA 4YMWA 5KJ6A 1AK2A 1Y4AE 2CHEA 3AIIA 3HCWA 3I04M 4XSGA 1LNSA 1RXUA 3NWOA 2COUA 3LBNA 1N6OA 2AOTB 2HB6A 3AGPA 1FK8A 1RJ9B 4M0MA 4UDOA 1Z47A 4Z5XA 5GIOE 2B21A 3B7WA 4CL0A 3ER8A 4JDPA 2VYFA 3EYWA 4JLNA 2RARA 2PNJA 1LPSA 4FZ5A 3TBFA 2ZJ5A 3TINA 4I50B 5MFPA 2OKGA 3KUKA 5LP1A 1EFLA 4GEKA 2Q2OA 1VYUA 2FP4A 1MX5A 1K4YA 2IEGA 2R47A 1RHKA 2UXCB 3EDQA 2AS0A 4FMDB 5DYIA 4A1OA 1CEYA 4IGIA 2XZPA 3PBKA 2ZTVA 3M6XA 2XE7A 3IB6A 1A2OA 4ARBA 2CV0A 3U1BA 2NZVG 2H9YA 4H35A 5CNKA 2FJUA 2GAAA 2YH2A 2A86A 3OWXA 1S96A 3AF3A 1HUQA 4PR3A 5B2ZA 1BMTA 1QVZA 2R96A 3KOXA 4FDMA 4HXEB 2C0PA 4D42A 3BHNA 3BFKA 3EGDB 1W4BA 5JE8A 2RK3A 3AUAA 5DGCA 1WXXA 3DXXA 5JPIA 4KPGA 4RF2A 4JOQA 5D3MB 3HUDA 3LT2A 4H31A 3AKEA 3GJQA 4Y9RA 4JASB 5FX2A 4HPXB 4YALA 1L4NA 2RDMA 5AW7A 1EGQA 3UT0A 3CW9A 3GK3A 4RMHA 1E5VA 4BFCA 1AMNA 3JD2A 2M32A 3BDVA 4QBFA 5E6SB 1JVBA 4I5EA 5DGTA 1UCFA 3IOMA 4C3VA 2IBSA 3WK5A 1N2EA 4HZUA 4YRAA 1JDSA 2J08A 3HJAA 3KSDO 4RUKA 1FRZA 4B1FA 1OWNA 3IKMB 5DTEA 2G9ZA 2HSWA 3HXPA 4DJEC 3OZBA 4ASUD 4N0MA 1A7KA 2W2KA 5KYKA 3UAVA 3IXMA 2ZCVA 4IJMA 3VZRA 2XTMA 1T9ZA 1Z4MA 1QQ7A 1OA0A 4YS6A 5HS4A 2O4UX 3Q2OA 2EF1A 4MYRA 4IRUB 3D3WA 3MBKA 5C3UA 4ZYWA 1XMVA 4ZEMA 4XM2A 4YCMA 4KXWA 4DTCA 5CBPA 1A97A 1LU9A 3O90A 4Z0NA 3TW8A 3E7PA 3D6FA 4GO1A 1CSEE 1D7AA 1K2VN 2GA8A 3GOQA 1QFXA 2QE7A 5AVQA 1Y3HA 3O95A 5CD9A 1CF2O 1DBWA 2RCNA 3EMBA 1UQRA 4K2HA 1RYDA 2ZBRA 4FGZA 1T0HB 2B2CA 2W4QA 4HXYA 1NPTO 2OVFA 3T38A 4X8LA 5JS2A 3WGGA 3ZWQA 4RTOA 3CX7A 4XGNA 3H2JA 1FUYB 4Q7QA 5A4MS 1J4AA 1S02A 2HBZA 5I7RA 5ICSA 4ZDKA 1UZUA 4G6ZA 5JD5A 4UVDA 2P35A 5EMJA 4JU9A 5IUKC 3WS7A 3ZW7A 4RAQA 1SCIA 5BSGA 5DPMA 3Q7SA 1X1BA 4GYJA 2WQZA 4Q21A 3RYIB 3UOGA 4B76A 5CT9A 4EO7A 3IVGA 1MIHA 4A8TA 4BEWA 1LSSA 3I5AA 3MT0A 3KZNA 2PUFA 3C8HA 3PHCA 5AXBA 4RTSA 3FCSB 3SYNA 4AZTA 5LM3A 1RXIA 4CR6A 4KK4A 4Q02A 3DFIA 1K7YA 3KZCA 3VR6D 3EDMA 2RJOA 2X23A 3F2VA 2ZYDA 1LPPA 3I73A 4DVJA 2HO4A 4HFNA 3T15A 4MLDA 2CXRA 4BYMA 1C0IA 1DUVG 3WV5A 1I0LA 3AEYA 4P1ZA 5JH7F 2EZ8A 3DMGA 3FGNA 3D3KA 3PKJA 4DLNA 8ATCA 1R16A 1XRPA 3GT7A 1J1ZA 3UCFA 3T1QA 4RKQA 4EJFA 4AJEA 3VNVA 3IEKA 5F35A 1JG7A 5EJIA 4QYMA 3HVUA 3NYIA 4ZYZA 1JEYB 1M7BA 4DSOA 2ZE7A 2C3UA 2O0MA 2QR5A 1DEHA 4GQIA 2ENWA 1KMHB 5I5GA 3UH0A 2J6HA 3E82A 2HY7A 4QEKA 3KKZA 2GHRA 1XXHA 2CUZA 3LQ2A 4YIKA 3S2GA 4UMVA 4BBJA 2PGLA 1Q21A 3C15C 4RD3A 3ZD9A 4ZCPA 2J30A 4G2TA 2JI8A 1PJRA 1RJWA 3LC0A 3KSBC 1XA4A 3C7KA 2PX5A 2JCVA 4KODA 1SNYA 5IUJC 2ZJYA 5L3SB 5EHNA 1CY1A 2QI9C 2IU6A 3VR4H 1ZJWA 3JRNA 3CG0A 3CPSA 4QDXA 4LBWA 1SVLA 2ZXEA 4BRZA 4F56A 3I52A 2I4RA 4AJIA 4EF6A 3O9MA 3BGWA 4PPNA 4DWOA 7REQA 2E5LB 4AY2A 3JARA 2QEQA 3REFA 2DAPA 2QJWA 2G5CA 3L0YA 4HMOA 3LW7A 2BFFB 4PYNA 1Y1KE 1QK3A 2HYDA 4QEZA 1NUUA 4M0LA 2QU8A 4GOKA 2H48A 4JUDX 1IY0A 4GX2A 2PYIA 3OPMA 3UYLA 5F78A 4B4OA 4EUEA 1JHAA 1AVTA 1S2DA 4HN4B 4TZKA 5DRTA 1T15A 1NR7A 4JKOA 3OQVA 1T2FA 4ZT4A 5A03A 5FPKA 4WKGA 4XVQA 3TSZA 1C8LA 3KJXA 4LNUB 5D86A 3G2KA 5LR6A 5IDYA 3I62A 4D3XA 2DJ5A 3GVIA 3FVWA 1YRBA 5KU7A 5H82A 4X95A 2CNBA 1W5AA 3CTPA 4S0ZA 2XE6A 5JXGA 2KPOA 1V16A 1CUZA 1T2DA 3C7AA 3WGMA 3ZDFA 1I36A 5K8LA 3AVXA 4DCOA 5M5BA 3HDGA 1NW8A 2C3OA 3UHFA 5JBNA 4Z7NB 3KUXA 4R0MA 2G6BA 4KUEA 1E7MA 5EHQA 2IW3A 3DCNA 4LC9A 3OJLA 1KDRA 2FEOA 3U5TA 2C7PA 4G26A 1I10A 4DN6A 1H94A 1B76A 1QAMA 4LXGA 5CDYA 3EQ8A 1VBMA 4KP7A 3KOZA 4GWLA 1O95D 1JV2B 3H4TA 2PKCA 1GGNA 2C3PA 2PBZA 2X5OA 1Y1RA 3LY9A 3KKLA 1W59A 3H3FA 2Z2XA 5K8TA 5DRYA 3FNQA 1AH2A 5ES3A 1OH5A 5A6SA 5FB3A 2VUTA 2WF6A 4TV9F 3VR2D 3WOVA 1PS9A 4AMZA 4BLRA 4EPXA 5CB4F 5CAEA 5I8WA 1CLUA 3T1HB 1UZLA 2Y76A 1DP4A 3F3MA 2OHXA 3KWJA 3OF3A 4ND8B 4Q1CA 3CLRC 4DE5A 1QIFA 1U9CA 1N1EA 3I2JA 2ZIZA 4IDPA 5LQDA 3IV7A 5B4VA 1RADA 3Q9LA 3UXYA 4V3CA 3WAGA 2XMGA 1GNTA 4WL0A 4JXXA 3RK0A 1N2ZA 3O31A 4JZYA 2IWHA 4PNZA 5BVGB 5F98A 1JR6A 3FB1A 1UFOA 5B53A 3AEXA 4B3XA 4LJSA 4CM9D 3KALA 1CE8A 4L16A 1II9A 2JKVA 3B2EA 1XTZA 4AYXA 1DG1G 2X6TA 5BT9A 2XA9A 4HWTA 5E4FA 3NBMA 2AQIA 2Q5OA 3O8QB 1GHTA 1SUPA 3GRAA 4BP8A 2Y0EA 2WJ3A 5D01A 2P2SA 1KEWA 2L69A 4LOHA 2HQ1A 2ZZMA 4L4YA 5AW5A 1XTJA 5HGXA 3PIRA 3A14A 2R48A 1ESCA 1SQ0A 2ZJ1A 3EXFB 3L6UA 4MA0A 5JQGB 2H31A 1G8KA 1K63A 2XTZA 4FP9A 4QECA 4P54A 1DOAA 3DWIA 3D5TA 5EMKA 3ABRB 2N1BA 2HXGA 3BH6A 5BYJA 1BHSA 1K8ZB 1KYZA 3I0MA 4DCVA 4CM5A 2W2TA 1RMQA 1KR2A 3VPXA 3H4VA 3OFNA 3P0HA 4P6VF 5DX8A 1W36D 4MW6A 3UZUA 1RVDA 2QT0A 2DRIA 3VTAA 5AM3A 4RVGA 4JFRA 4OH1A 4L78A 1Y0BA 1DV2A 2WLSA 4EG6A 4RTPA 2I6GA 5EIXA 5FV7A 3Q8LA 3SS9X 4G81A 3OSZA 1OXBB 1JH8A 3E35A 4L6AA 1ENZA 1ONNA 1UXGA 2D54A 2OOKA 2BR5A 2XKKA 1YHNA 3G0CA 4PGHA 6ABPA 2JD2A 4DV1B 2XYQA 1JG4A 1Z6YA 1QFZA 1M1NB 2HTEA 1VKRA 4G0OA 3SQDA 4MR9A 2QL5A 1GDDA 1LDYA 2H2DA 5A4JA 4F04A 3P1JA 5CFMA 1FYWA 5JANA 3JWJA 3AJEA 4AY6A 4TMXA 1B26A 2KMLA 3C6MA 3MWJA 3Q9UA 5SY4A 1LBEA 3HDHA 5K3OA 3T4UA 4W5JA 3DM9B 1HBJA 3PQFA 3VU1A 4HLCA 1W6UA 1V11A 1WDLA 1Y9DA 2RBGA 3FPLA 3K9GA 4XW2A 5SYNA 2Q7OE 4AVYA 1ZXXA 4NQRA 2VSQA 4JQSA 4ZO6A 4HWPA 2DJIA 1CUAA 4ZOLB 4OBWA 3EVNA 3ZKWA 1ZH4A 1SC3A 3D7KA 2GAJA 3ADBA 1NF2A 2FMUA 2PWZA 2P6UA 3E5MA 4DNFA 1LZKA 4UXHA 2F48A 1VL6A 2QVBA 2OFXA 2WPNA 3B1FA 1GY8A 5T64A 4YRKA 3RI3A 5HJ7A 3QVXA 2W2VA 4H7JA 3HR8A 1LI5A 1B4DA 4IJUA 2YHIB 2ZFUA 5BUCA 5I3CA 1IYZA 2GCOB 3V8RA 1OYVA 2G7MC 4LV6A 3NYRA 4Y2UA 3ZYCA 4D92A 1GPYA 1MU0A 4X61A 1JI0A 5AVJA 1NQUA 4MVWA 4KN8A 3FLAA 3UV7A 2W6JD 1F2TA 4OGFA 3AB3A 4GQBA 5DX0A 2UDPA 2OZLA 3CXRA 2WT9A 3PRJA 5K0GA 2CE7A 3ND5A 4RGVA 3A2KA 4MGZR 1X1EA 2I4NA 1NTRA 3LA6A 3TVDA 2OKCA 3NH9A 4K05A 4IS2A 2C88A 3G85A 4YT4A 3VDMA 2WIBA 4BJHB 1EUCA 1MOSA 5T41A 5PGMA 2OO5A 1JLSA 1FTWA 1NQXA 1SU4A 1QWOA 2HI0A 3RSHA 3V42A 2P6RA 4FLFA 2DPXA 3HVIA 2FEXA 3BE5A 3JYHA 2WR8A 4OUDB 4PU0A 4WNIA 3FYUB 5DBEX 4V0RA 3RS5A 4JEUA 2ZB3A 3RTBA 3V1LA 5BPFA 2O59A 1L7OA 3D3JA 1QM5A 2HK6A 1GTRA 4X93A 4X6XA 3PE4A 1DIBA 3TECE 1N8KA 2IIQA 1YSCA 3ASVA 3C3AA 1XVAA 3NBAA 2GF9A 3A3PA 4XARA 1JR2A 1KBOA 1VJ5A 1WHTA 2XYGA 3RRBA 3WGLA 5LQUA 2AJDA 1C0LA 4LDAA 1EJ0A 1NQAO 3FF1A 3IXQA 2IOQA 3QVMA 3ZUGA 1BE1A 4PIMA 3NZEA 1PTJC 4Y2XA 1TAGA 3GGCA 3Q8WA 2V03A 3JQAB 5DN9A 2AMYA 4C89A 2QVCA 3AHGA 3FXAA 3T7KA 2LKCA 4M9ZA 1L7XA 1YRLA 1RPJA 2G5PA 5J2UB 1OKKA 3UK2A 5JCOC 1CDEA 3GP5A 3ZR4B 4N5DA 2GPJA 2SHKA 1YI1A 4OQEA 3P2YA 2XUFA 1JHDA 1Z4LA 3GNQA 4J49A 3RKSA 2R0QC 1HY3A 1JEJA 2Y0DA 1EZ1A 3SQNA 3VHXB 4J43A 3ZXUB 4FB4A 4A15A 1UBUS 2V54A 3OJEA 2G07A 2JFXA 3W1EA 1H23A 3MQ2A 3EQ7A 4AUMA 2B4TO 2QKYA 4RH0A 5TPWB 2NVUA 2GJ8A 2C2WA 2FA9A 4YLGA 3UHAA 2MHCA 3VC7A 2WQ6A 4UHBA 5IJZA 1CYEA 4ARSA 1K0UA 2XJ9A 3OT1A 4W1SA 4DMRA 2BISA 2A1TR 3FPKA 1CS0A 4AC9A 1G9TA 2K2QB 3KLBA 4EKYA 4PQRA 5FFNA 3K4HA 5JSQA 3SLRA 3ZNQA 4MYUA 5BSRA 3ABZA 2ARKA 3K0BA 4KQHA 2IUFA 1LD3A 3F0TA 1T6YA 5FADA 1ODJA 4ZJPA 1DO0A 5AYVA 3O91A 2VPPA 2J33A 3C85A 1ISHA 1U8UA 2GJSA 1PWXA 5KAMA 2WJHA 1RCFA 3VPCA 5GAJA 3PVZA 3VI3B 4JJEA 3FTDA 4HUQA 2IF0A 1PT6A 3GI1A 4PYRA 4AO8A 4Z51A 3QX3A 1G3MA 3AOEA 3FSEA 3WKAA 3GIWA 4Q66C 4JB0A 5FBZA 1Y4UA 2GA9A 3PGMA 3DLBA 3AF6A 1H8ED 3FTCA 5IZ4A 3AEUB 1KSJA 4J03A 3JWGA 2FN8A 5THXA 5J1SB 1YVPA 2A0XA 3OJCA 2PKWA 3ZTYA 3TTYA 4NFLA 1IXZA 1P73A 2V6BA 1PSWA 3P9YA 4TYWA 3EWNA 1IN6A 1CFZA 4CGZA 3ZHUA 1L5RA 5CW2A 2HNAA 1U2PA 2Q1YA 3QLVA 4GSYA 3AXTA 1NKTA 1YZUA 1BSVA 4PG5A 2AYZA 3LT5A 1EDDA 5AWFC 4J7UA 2JIQA 2XCOA 3H1TA 1IY9A 3ZS9A 4CU5A 4K0KB 3H9GA 4V38A 3BN3A 1X7YB 3ZWPA 4RJTA 5LDDC 2IYAA 1X7HA 3EFEA 4OQQA 4PTYA 3C14C 2YJ6A 3P4UA 2VF7A 2BEUA 2H11A 1V7PC 2G63A 3C1OA 3DXZA 4YASA 3IQXA 4AUKA 3T94A 4C4PA 4MQMA 1AQJA 2XWQA 1JWLA 4AZ3B 4YJ2B 4CMHA 9MHTA 2PO7A 1GCIA 4FQ7A 3G9QA 1RLTA 2XMQA 1II8B 1O6ZA 1J5PA 3RTGA 3WTBA 3VV3A 3WLSA 1W75A 2ECFA 4ALLA 4PPFA 5D1NA 2YXDA 4KTVE 1R9NA 4UOZA 4CHGA 2GPNA 4WW0A 4ZT7A 2NZXA 4MUXA 3AG5A 4L9WA 3OFSA 5EGSA 5FA8A 5IJWA 1GPLA 3NDPA 3G0GA 1CX9B 2FQYA 4IWNA 2O14A 1E79A 1ES9A 1P39A 3ZWYA 3BXGA 1ORIA 2Y93A 4BQQA 5BSKA 3LZ6A 4ID3A 5CTJA 1VHLA 3A11A 4EI7A 4MXDA 1EMDA 2H63A 2PBLA 2VN8A 2QTCA 4FXOA 4U9IS 5AKYA 5EMLA 3DPSA 2GD6A 3OTHA 4MP8A 5AJYA 3GFSA 1P5HA 2H2GA 1JH9A 2XCIA 1N32B 1UL1X 2F1JA 2RGWA 2PL3A 3FLBA 3LHIA 3MYYA 4QVIA 2YRXA 4KMOA 3X2FA 3PC8A 2BEVA 3T5PA 2G1AA 3CNNA 1T0UA 4GX1A 4FMCF 2EP8A 3UMGA 3DV0A 3AFIA 2UVPA 2VEOA 4NK5A 5E9WA 4QRHA 1T1GA 1ZPDA 4M9QA 5HKLA 2WDPA 4LZZA 3UFXB 4C7VA 3ZE2B 2PQ2A 4KG7A 3GX1A 2ZI9A 3ESBA 1V1RB 4TM7A 4UE3S 4BO8A 4EJ0A 1NF9A 4RIIA 4OHYA 1WNTA 2QY6A 3X2EA 3IT0A 2B1JA 3COJA 3ANXA 1W94A 2J9YB 4MIEA 3ZGVA 3EZNA 3SE7A 2QE7D 1T25A 3DT6A 2IH4A 1A9YA 1LX6A 3WO1A 2J6IA 1DIHA 5D3QA 1X1TA 3BTUA 4H1UA 3GMIA 2V7EA 3KHSA 2WOOA 1PEDA 1B8PA 1KSHA 1RTKA 1ZNYA 2Z4SA 4QG7A 3X1JA 4E51A 1C4XA 5I9NA 1UWKA 3FPCA 3MJ4A 3JVDA 2IC5A 1DKLA 2RAPA 4LTDA 5CFQA 2E48A 4RSGA 3UC9A 4QARA 1F1BA 3I37X 2YBEA 2W2NA 1E3WB 4K8OA 3PEVA 4DBVO 5DGIA 4MKRA 1J0XO 1RAHA 4TYPA 5E9QA 1Q2XA 2X0KA 1KI2A 4WWHA 4GBMA 3G23A 4I1RA 3STWA 1HOTA 1POWA 1XWFA 2H57A 1Z0DA 4K3VA 4PGGA 1FQKA 1I4DD 2VQ6A 2P62A 1AKVA 3IE2A 4DZTA 3GLHE 4U2DA 2VRBA 3WVNA 5D3ZA 1ZM3A 5ILQA 2ZK7A 4MUFA 1SK9A 4UD6A 3MRTA 4AS1A 4X7PA 2C2KA 3GQBA 3VAAA 2X0JA 5ALRA 3TN7A 2EOAA 1K8XB 4V03A 3SCZA 3OAAA 3UCXA 2AZTA 2I3ZA 1Z68A 1VKNA 4YBZA 5HUHA 1Y4SA 1X1AA 2RONA 5KVSA 1CUHA 3W5VA 3OQNA 4MGHA 2XE8A 2IS1A 3PTAA 1RXCA 2I2CA 4C0JA 1BH2A 2EFEB 1CEXA 4TTPA 4MEAA 2C7BA 3HZRA 2Q50A 1I80A 5TVGA 4IDFA 4QQRA 3ZX4A 3C87A 3RVJA 4R1MA 3T9DA 2WJ4A 3EXIA 1X39A 4OQPA 1V8ZA 2W71A 2H1FA 1J56A 2X42A 2PJZA 3P9SA 3VJKA 1GPKA 2WE8A 3IIIA 1IM8A 4HQKA 1RSZA 4E3ZA 2AF4C 4YHBA 3VVBA 2GASA 3L0IB 4EECA 2FPRA 1JFRA 3LLCA 5M04A 4ISBA 1XAHA 2IXDA 4TWRA 4V39A 4D9JA 4XEUA 1UMDA 4WOJA 2PS1A 4OHCA 2RGRA 2H06A 2J0VA 1LRLA 4JLPA 4HLQB 3NNNA 5D8DA 4BGDA 3PQ8A 4IEIA 3C48A 4DMGA 4KO2S 3WC4A 1OB2A 5JAMA 3KYCB 1G7TA 3ORYA 3R23A 4BO1A 4DCSA 1R12A 2IPAB 1DCKA 1I5OA 1KO4A 3QUBA 3R5SA 3DZCA 3RRFA 1YJBA 3SEZA 1CQPA 4EPVA 4Y18A 4JB2A 1GCOA 1QRTA 5ADVA 1ELOA 2H18A 2VYCA 3AC0A 2J59A 4YC7A 1B0ZA 1LXCA 1O5TA 4PZZA 2FOIA 4FS3A 4EGAA 3U39A 3E9NA 3M70A 3WBBA 4BO2A 2WEKA 3T0GA 2G83A 3UT5B 2E55A 1TCCA 4WNYA 3QOFA 5CIQA 1TCBA 4HAZA 4FONA 2IXFA 3L1HA 4F5EA 1DV1A 2UVQA 3A0UA 1TX4B 1YB1A 3PFWO 1JKJA 5AUQA 4OA8A 5K7SA 3QVOA 2O3UA 1BE6A 2LR0A 3QBTA 4RX1A 1ZIYA 1KZGB 1YMUA 4RHUA 2QSYA 1OH7A 1IDOA 2YFHA 2X4LA 1DAEA 1JYSA 5CR9A 3RUPA 4MV1A 1LVHA 4UARA 1E6UA 2RK4A 4JJ6A 5U1PA 3U60B 3T3NA 1ZI8A 3FLEA 1V6SA 1IPFA 3A4TA 1XVVA 3RS8A 3OY7A 1NUSA 1E7WA 4KRXA 5DM1A 4KXNA 4AJOA 1FTQA 1EEXB 2BY4A 3E7WA 4KN5A 2ZRGA 5A2QA 2O8BA 3OCVA 4DIKA 4R2HA 1J2JA 3TNFA 1EM8B 1IATA 2GI4A 1FFEA 1T5IA 1IZZA 1OBVA 1UBLS 2DQKA 4MITA 3RQSA 2PXXA 1SBHA 3CLTC 4JJ7A 5CDSA 3ZS8A 3QHQA 5F4ZA 2JIPA 5DF1A 2LPMA 5A7FA 3UUGA 2BM1A 3D3NA 2ZZKA 1DFGA 2JJ2A 1P91A 2P75A 1W1UA 4MYTA 4OKNA 4D97A 1DXHA 4D43A 1UBEA 2MR6A 2PUJA 1FOEB 1WMBA 5AW1A 4FR0A 3RJZA 5K6RA 1HEIA 2XWSA 4HGZA 4L8GA 4ZAVA 1IH8A 5LB4A 3CQ9A 3BJEA 1NXXA 1DQNA 3WQSB 1D07A 1EFUA 4EZIA 4N3GA 3U9TA 3A1VA 1E3SA 4MV4A 4G0YA 4H27A 5SZIA 3MJSA 3G2LA 5ED0A 2I22A 3SZUA 1Z5ZA 2FMTA 4XWOA 4ZEXA 4OHFA 1JF8A 3ETHA 4WKPA 5EHGA 2VWPA 2D4HA 2NU7B 1BH6A 1YUBA 1SHUX 2D8AA 2WWVD 1GPNA 1YZKA 3JQ8A 3KLNA 1WBBA 2DG2A 3QEJA 2A92A 2BHLA 4UPDA 4KXMA 5FFMA 2PYZA 3AERA 1YOVB 3WG9A 3THXB 1PUXA 2XNDA 1XMXA 1V4BA 2A67A 5HM8A 3R75A 1DC6A 1M1ZA 1W47A 3AFNA 4XIYA 5IEBA 3VH3A 2XKJE 3SX4A 3AHFA 2ONKA 5BUSA 3DKKA 1PSDA 1OXUA 3N2EA 1AMOA 3QVJA 1J07A 2J8ZA 2YFYA 1PNRA 4QT4A 2DBYA 4MYCA 5I47A 2DUUA 4EHNA 2AB0A 1NW3A 3L7NA 4CMEA 4DBZA 4NI5A 5JSZB 1AKNA 4G5XA 1DKPA 4J2HA 4Q3CA 2Y2UA 3K70C 1RKQA 1OLXB 2GK6A 2FW6A 4YXFA 5AH0A 4CCAA 4V2IA 4QLBA 1GP2A 4NCIA 1D9ZA 3B1YA 3NKFA 1YOBA 1WSDA 3TIFA 3RTCA 1QNLA 2AD1A 3JQEA 3LUJA 5JBQA 2E5WA 3E5HA 3HB9A 4HQLA 4NULA 3P7MA 1NBOA 4LCJA 1VPWA 3KXPA 1R9GA 2H4WA 3OQBA 1AS3A 4CMBA 2DUJA 4ZJZA 4KITB 5KWEA 3R40A 1AXGA 1EJBA 2Y1CA 4CQNA 1R8YA 4MPJA 1HFWA 3EZFA 1IY8A 4GSLA 4Q5IA 1Z6PA 2UU9B 4Q12A 2OBFA 4I9NA 3KZVA 4G9BA 4LCEA 5EWJA 3OFND 1IXKA 3DO8A 4OX9B 1ZW6A 3VZDA 1IM5A 1W8DA 5AD1A 2PN1A 2WU8A 3OQOA 3LWZA 4DR5B 5CVUA 4I1YA 3F7TA 3B1WA 3FOZA 5CLGA 1E59A 5IP5A 4TSRA 3QPVA 5LQSA 1PZFA 3CLUC 4KUGA 2D59A 2IE0A 4XE5A 5B5SA 1NNLA 2GEKA 1KAHA 1JZSA 2O06A 3DEFA 2GK3A 2QRNA 2X8JB 3FVQA 5LL6P 2HMYB 1NV9A 1M2NA 1UKBA 3KPUA 4KPYA 3B5JA 5F3WB 3IEXA 1XC7A 1PJ3A 1R6TA 2AG8A 3EZ6A 5FOVA 1GT91 2ZBEA 5J63A 2DU8A 3ZV3A 3CO5A 3MJDA 2P91A 4I9GA 4OH7A 5FOQA 2C2OA 3DE1X 1BHO1 3QTTA 2XNJA 4XUDA 3O6VA 4G0MA 2BDTA 4BMPB 1JSCA 1AM4D 3CUUA 4E4TA 4RPIA 4DR6B 4WUVA 1JAHA 1H2RS 2IEAA 4PXSA 1XP8A 5I9TA 2B6NA 4BTEA 3PJFA 3T7JA 3PL5A 1M67A 5K4HA 3JTMA 4PZUA 2XUJA 3ECSA 4BLTA 1EXMA 2VKTA 2VUUA 4ZI3A 4YQZA 5JNTA 3ICWA 1FP4A 4JOBA 2ATIA 3HYTA 3DYVA 4L7QA 5CVJA 4RCVA 3V1MA 1SBIA 3DTVA 1N2CA 5BV1A 1IUKA 3I5YA 2FN4A 3AV0B 4O3FA 2M6KA 3SM9A 2P41A 3PNLA 2LCFA 5HJ2A 1P3JA 4CLXA 3SC2A 5E0KB 2WFLB 1JHPA 1RJFA 2SNIE 4M9SA 2HRBA 1UBKS 1XCBA 1S9DA 4CQMD 4ZYTA 5CYFA 3CV3A 1H0RA 4XCXA 1TTHA 4BVEA 2ZDGA 1TO1E 3S3TA 3UKOA 3IYLW 4HPJB 1H9CA 1Z25A 2HIGA 1JUDA 2PBFA 3DMRA 3MLBA 1V5GA 2OBNA 4RYDA 5BMVB 4QATA 1Y3IA 1E9EA 4JC5A 4JUAA 3TSCA 4MHTA 3JQRA 1Z0UA 1FU7A 2VH5R 4BQPA 1J21A 1PJ2A 1UQTA 2P0EA 2QTLA 2YVAA 3STVA 2OY0A 2QLBA 5C4GB 1KJZA 2FWIA 3PYXA 4GIBA 1NWHA 4II2A 4M88A 1I2BA 2G0TA 3DM5A 5DO9A 2DR3A 2Q6TA 2ZIGA 4ZVQA 4RVOA 3HSYA 2Q4OA 2XT6A 2J5BA 3DR5A 4X1OA 5BOVA 3U40A 2RGEA 3FGOA 1JDBC 4D41A 2ATEA 1GNLA 4FFSA 4KH0A 4EP1A 3IULA 3L6OO 3MK31 5J40A 2WYIA 5E0OA 3LKBA 3HABA 3CUSA 4N82A 2HYIC 1SQSA 1VL2A 2O3RA 2I55A 4TLCA 2EAUA 3RVQA 1FLNA 2NX2A 4MRVA 1RZ3A 2JPDA 4HLUA 4MS3B 4OYLA 1QE5A 1ZK0A 4XFJA 4JP5A 2AJLI 4XQCA 1A8SA 1U2GA 3A4NA 3EULA 4G24A 3SXPA 2WJJA 5JEDA 1ESMA 2GN8A 3A6FA 4J16A 5CHEA 1PO7A 5L6MB 3AUKA 1DWQA 2O2IA 4RC9A 2X77A 1SHLA 3BCUA 3OLXA 4L7VA 4UEOA 3HP4A 3KZXA 4UHHA 4K5QA 5C31A 4AJLA 4MYDA 4BWGA 1BG6A 2J32A 4UREA 1ZK2A 4KGDA 1CY8A 1XI2A 2ZBPA 3GZNB 3QPBA 3LUCA 2E49A 2HDOA 3ZVRA 4XUEA 1BHJA 3PX2A 3RFFA 1KQOA 1ZICA 3ZY3A 3H6HA 3NBUA 4RPHA 1PJBA 4Q93A 2LW7A 3D6HA 4TVOA 3KQNA 2ZIWB 1SC9A 3OMLA 1H4VB 2QRLA 3KB8A 3C3EA 2C3MA 2Z0MA 3RT7A 3VO9A 1APBA 4YRSA 1A9XB 4I7EA 2ODQA 3MUOA 2LDXA 2P2GA 3GVXA 4WK0B 4CG1A 3U1VA 1Z8FA 1OILA 3FNBA 5CM8B 3BF8A 4IOJA 2F9FA 3PWZA 4OREX 4MR7A 2RK6A 4HAIA 4K7JA 4KXLA 1M8GA 4MS4B 4XWYA 1X94A 1XQYA 2O5RA 4KK3A 1YL7A 4I1SA 4TKUB 1IONA 5EOVA 1QC5B 2NO5A 2R1UA 4CMIA 1I6KA 5JNVA 4CEJA 4ZVKA 3JVUA 2PZGA 2QPAA 4Y30A 1G8YA 3ONFA 1R4AA 5HCUA 1SUWA 2FW1A 4YJGB 4KIJA 1B1AA 3HJBA 3BB1A 7MDHA 4YP5A 1I5RA 1W5FA 1E9RA 2FZWA 3O3OB 3V4PB 3WWOA 4S05A 1YBMA 1XU4A 2H2IA 2NG1A 2OXIA 1EU1A 3ZZTA 4PN3A 1MMFB 1CVRA 1RM3A 2B8EA 3PITA 3QOWA 4GFDA 2BFDB 4WEQA 5HPYB 1YL5A 4G5GA 1EFKA 3ASUA 4RVCA 3GPBA 1EP1B 5E9AA 4PTZA 3KWMA 4K6CA 1N5DA 5LOVF 1TADA 2WZBA 4NPCA 3NHLA 1GKYA 4HDOB 3ZDQA 7GPBA 1Y3DE 3IP9A 1KXJA 3S5UA 3LC1O 3USCS 2NACA 3ORRA 3R9KA 4Q6BA 1KO1A 2Q6OA 2R751 4YPVA 1JLLB 3Q41A 4OM7A 2HLHA 1OAOC 4LEIA 4CKWA 4ZVPA 2FZLA 2RSLA 3PR2B 4MUIA 2GN0A 2CDCA 1ZD4A 2C4MA 4NE2A 4UUAA 5G0TA 4ZXFA 2WPDA 1EVKA 2OBXA 3IDFA 3Q6IA 2H00A 4GXQA 4KWCA 3Q6NA 2OD2A 4O33A 4UBIA 1VIAA 3QW2A 3UN1A 1AUOA 1QH8B 4BZZA 3OX4A 4IL5A 2G04A 5E4JA 3GGSA 3GJZA 4QOHA 4RJIA 4BNJA 1A8PA 1D4AA 1PFGA 1E1QA 2VATA 1XEWX 3QXGA 4GZ5A 4KDCA 3VHRA 3PHBE 2Q2VA 1U11A 2DT5A 2Q3CA 2RI0A 3IPXA 3LDUA 3OIFA 3AP3A 3PYMA 4OQMA 3G17A 4IG9A 4DDTA 1PDVA 4H7FA 4CRWB 2Q2QA 3C39A 2WI8A 5ADUS 3IBTA 5GJBA 4Q7LA 3GDGA 1X74A 4DFDA 1YONA 1USVA 3M6WA 1OFHA 2YY5A 1OWMA 5D1HA 3NV7A 4DIMA 2AZXA 4RH3A 3ESQA 1S01A 2IYPA 4AICA 2RHDA 4KHPB 1NQVA 2CNLA 1E4YA 3EVDA 4NCHA 5BNZA 2LIPA 1LPOA 3U5ZB 1M2HA 3PJGA 3A25A 2EBWA 1T36B 1YB6A 1FVOA 1MCZA 3OFKA 5FFFA 2WP8J 4L5YA 4U8GA 4YT5A 1T1RA 1WAMA 3O8BA 3LSTA 3NKLA 2HRCA 121PA 1DCFA 4M1KA 5FTWA 4RU1A 4WFKA 3BHIA 3VKGA 1HMPA 3QUAA 1EIZA 4H77A 2BFMA 1R0SA 2D0OB 2OPBA 3AM4A 1K8QA 3L01A 2P8SA 3KLOA 4XVHA 4XJXA 3BVPA 3FIUA 2YOFA 4KBFA 2AFHB 5LD2B 1OA1A 3AUXA 3M5PA 4D6PA 4F3CA 4ZI7B 3A04A 5ALXA 3MTJA 4ZVLA 4JLBA 2HSJA 3Q3CA 3WMGA 3K4PA 1E2HA 5F9FA 1RXYA 1VYHA 2VAXA 3DWEX 1C3EA 4FHCA 4ESHA 2QI9F 4ZHQB 2IXAA 1R66A 1G20A 1ISJA 3D4LA 1M8KA 3LQYA 4KWEA 1Z5NA 1C8BA 1J8QA 1UWVA 2YIVX 3BWXA 1H3NA 1QCDA 2N42A 1ZOLA 3LT0A 4FOTA 4HAXA 3T7EA 1PI3A 3JYQA 1P75A 4RE6A 3WSWA 1E77A 5E95A 5A6VA 4P3YA 4QTYA 3TG8A 1T0JB 5FBVB 1U5CA 2GCGA 3BMNB 1KC3A 1U6JA 4UTPA 4N5HX 2VH2A 3AVPA 4RK5A 2ZIAA 2F55A 1UBOS 5ESRA 1S8OA 4MQ5A 1M10A 3W5UA 2D06A 4W63A 5FNVA 5J5AA 4DJTA 1H8HA 1TM5E 3L8HA 2XNSA 1ENOA 3MAJA 4PW0A 5EWMB 4PC7A 3GEPA 1X2EA 3E5RA 4BYGA 2VOEA 4BB6A 1UMCB 4XQEA 3SQLA 2C8VA 3A1DA 1G66A 1RRFA 3EVGA 3KVVA 3LDGA 4FYXA 4QYWA 1U7ZA 2AC4A 3K9NA 3OJOA 1O57A 3GLSA 4LZPA 4NDZA 5CLQA 4YRFA 4N47A 3W0LB 3B36A 1XP5A 5TQVA 4A0FA 1E98A 3I2FA 3AZQA 4NJMB 4UAJA 2XZTA 2OBMA 2ZJ6A 3D2LA 2QVYX 2ATCA 3D8RA 3EF0A 4JP2A 2KM1A 2IH2A 3AVYA 4N7JA 4ZCTA 3R9XA 4LXXA 4DV0B 4H0CA 4YI5A 3RVPA 2BFWA 4POOA 1QYXA 3DEKA 2GX6A 1ZLXA 3R2JA 2CYCA 3OLZA 1CLEA 3HKCB 3BXOA 4XWWA 5DZSA 2PBRA 5DGHA 5H3LA 2HF9A 1G21B 1O89A 1XZEA 1LCIA 1L4HA 1X9IA 2ERYA 3LC2O 1TU0A 4C06A 4RVUA 1Z2CA 4Q1BA 5IYZA 1XKLA 2X40A 5B7GA 5EJEA 3WLRA 1WPRA 3MFQA 4WLUA 2WKQA 5AVWA 1E2KA 2R8RA 3NJRA 4GMXA 2GD1O 2VPYA 4A8HA 1Y3CE 1P9OA 1HE8B 4MB2A 4UKDA 3KFLA 1PR1A 3OICA 4PLWA 1AKUA 1L7QA 4LYAA 2TMDA 2HU5A 4DZRA 1J7KA 4NWIA 2C8LA 3TCXB 4BO7A 4F38A 3ISJA 5HQ3A 1N5IA 2HPAA 3O4RA 1NT4A 1L7RA 3JD1A 4TZTA 1XDWA 2GEUA 1KC1A 4JXZA 2CLFB 2YV1A 3FB4A 2DKNA 2WYUA 1QP7A 4NMHA 4EB6A 2XMCA 3BHMA 4DV6B 5FWXA 2ECQA 3EZYA 4A73A 4ESOA 2ACKA 3BD6A 1PJTA 5CCDA 1PZMA 2JFVA 1QGAA 4F5ZA 3SDSA 4U0KA 4B2IA 3S1LA 3MTBA 1T4BA 1WQ1R 4CV2A 4RL6A 1QZTA 3PHHA 1F51E 2EC5A 3DCYA 3DZKA 2I4TA 5JWRA 1SZCA 2AG0A 4LRTB 4B71A 4Z3KA 3TLCA 4NS1A 4ZIRA 5FBHA 3GW8A 5HX7A 1KERA 2QQEA 5KYNA 5FQOA 4C4XA 1J0BA 3D7SA 3DDUA 3N8NA 1WHSB 2OK8A 3DP7A 3UAGA 5HKOA 1I4OA 1NJ5A 2R60A 5BQ3A 1DIGA 1U0FA 2VJBA 1GAJA 2XYVA 1Z88A 1XDUA 4LA4A 1VE1A 3WL7A 1UJ2A 4ZVSA 3N86A 4XYLA 3DNPA 3QBVA 4Q7EA 1F06A 5BWMA 1I2AA 1FJXA 3SM3A 4QOEA 2CFTA 4OA5A 3FAZA 5LWHA 1Z08A 2P78A 4YN3A 2FSFA 2PIAA 2WF5A 3N9IA 4TMZA 4OI1A 3M9XA 3TIXB 2HEIA 1JW9B 3MS7A 4ZVMA 3TX2A 2AR7A 4B3IA 3NRBA 4PC1A 5EVJA 1CB7A 3H05A 1UXKA 4L27A 3WJ1A 5K3AA 2HQSA 4N8SA 3ZQ6A 4NU0A 1TZJA 4NFSA 3SLGA 4AU1A 2XDAA 3KAPA 4WK2B 4F72A 5ELXA 1GKIA 1GCUA 1DRUA 2JJ2D 2O7SA 1PFWA 4MWBA 3GJTA 5F76A 1WV1A 3HJTA 5TB5A 1QV6A 3P2MA 4WXHA 4KBGA 3NS7A 2FEPA 3HKBB 1E6WA 1GG8A 3O8DA 1KGDA 5U4QA 3PHIA 4IV0A 2QENA 1FJHA 4FFBB 2B4YA 2XHEA 2D5IA 1NQ5A 4X92A 4HSEA 4K8RB 5SV2A 4RDHA 1KIMA 3R7WB 4DCMA 1JEAA 3VNUA 3LLSA 1KHTA 3C8ZA 3RV3A 3DMTC 1G55A 4TS4A 5PNTA 3NETA 3HWRA 3X1XA 4AY3A 3IOYA 1OR8A 3NKVA 3LPMA 4MQFA 1W19A 4OSEA 5DOVA 1T5TA 3HZZA 1OH6A 3NWPA 1BKDR 3L7YA 4YA6A 3DLAA 2RGNA 4JNKA 1TA9A 4AX8A 1F5NA 1HRDA 1M66A 3RJ9A 2VR1A 4UUPA 3LX8A 5HZMA 2XNDD 1NRXA 1MGOA 1VTKA 3M4XA 2C59A 3Q3HA 3ZX5A 5BV7A 2X1HA 1CZOA 1JS1X 1L3BA 3ETEA 1XU7A 4WAUA 3U13A 2YY6A 5BW5A 3DMNA 2WM2A 4D5GA 4ENPA 1VB5A 2OSBA 4AKTA 1WDKA 3OHPA 4H7IA 1J06A 3L0ZA 1NLYA 4LZOA 4WBSA 2IYVA 1XTUA 3COSA 3OTIA 4V1CI 2YZ2A 3ZDBA 2Y1KA 3ZXIA 2VLBA 1GPWB 3KJNA 3M3HA 1RM0A 3A9CA 3BTOA 3FGPA 1PJLA 2OXRA 3CISA 3CRQA 4IJKA 4X8HA 1Y98A 4CL8A 4DLVA 4JCOA 4Y1GA 4GKVA 4Y6SA 3KSUA 4X3CA 3VJMA 2HHHB 3B1JA 2Q7DA 1WE2A 2G8NA 3HKDA 3KKKA 1UDAA 4JJKA 4BV8A 1BJTA 1TW3A 4OP1A 5CJJA 2DWCA 3CLKA 2HPZA 4IX1A 2IQ5A 3VGPA 4UDYX 2HGSA 2J41A 1ZG3A 4I3GA 4WOCA 3OLYA 1C7EA 4KDRA 2WIKA 3QG1A 4XQGA 5K8IA 1SUEA 3V97A 3IIJA 3DDWA 1ZI6A 4NMXB 4I1OA 3ABOB 3CURA 5ALPA 2ZJ3A 1PR2A 1TVEA 2BSAA 4RF5A 1MFZA 4MRMB 4MRPA 1GITA 2VAVA 4Q3AA 3S8MA 4DRXA 3K9HA 2BOVA 1P33A 2VHTA 4W8OA 3GUHA 4LHSA 5A05A 1DAKA 5EJGA 4MUYA 4TV8A 1PGQA 2RIRA 1QVWA 3CKLA 2PQ6A 3ZDYB 2ASVA 3W06A 2O8EB 1IG3A 2A0KA 4MKFA 5CFOA 1KEZA 1T24A 1Z62A 4MV9A 2MDTA 2FK8A 2JFWA 4IAOA 1ZHHA 2X2FA 1JIVA 4IH1A 4RMIA 4MV8A 4D9HA 3WYFA 1U28A 1ZK3A 2W6MA 5LLTA 1IM2A 2ZXFA 2FR8C 5CEEA 1DXQA 2XQIA 3C24A 2H52A 5JAPA 4JJ4A 3LNCA 2EYQA 4WDQA 2NZUG 4TKUA 3E70C 1IXRC 2Z1MA 1C2TA 4KXXA 4HL6A 4BQNA 4UVHA 1SCBA 4KN6A 3S44A 3DUWA 4PRKA 1PCXA 4LAFA 1VMEA 4AQDA 2DPHA 4MVJM 5ALNA 5B7PA 4I50F 3DONA 2IIBA 3IUYA 2YQ4A 1TRHA 3EQ2A 1RLIA 4FMDF 3NGXA 1AV6A 3IEIA 5AUNB 3FDJA 2J3DA 1A5ZA 1WQ4A 1VG8A 2JL1A 5AVOA 1H0HA 3DTVD 2NTYC 4BO4A 4DB2A 4I14A 1DHRA 4HYYA 3IR6A 2ADFA 5KX5F 3A1FA 4BFYA 2E4UA 4JR0A 3WQRA 3N8HA 3K1TA 3QTBA 2GEBA 5IJ9A 1S8AA 1SXIA 3CIOA 5DLEA 1NF3A 2XIQA 2QVXX 3W2FA 1W2HA 4EQ6B 2D5BA 4TWZA 5B1DA 1WB5A 4Z8XA 3QFFA 3BK2A 4R8MA 1NNUA 2VJPA 4DIOA 1IJKA 1GEEA 2I1QA 3HLTA 3WGTA 3ED5A 4RQTA 2UZ1A 3E1KA 5DU2A 2XCLA 4B35A 3GFBA 4MQEA 3DEHA 4Z7JA 3H0KA 4H1VA 5CVEA 3RS3A 4UJ5A 4JN6B 4EB6B 3AIOA 4C2TA 1RWMA 2JASA 3W6NA 1RLJA 4OXXA 5KOHA 5KPJA 1U9IC 1YXMA 5IMSA 3DMPA 4J1QA 5FTLA 2OLEA 2YWHA 2HCTA 3BICA 3GLUA 3JYLA 4NCAA 1VKHA 4HXGA 3RF7A 4A8JC 3WMWA 2BTQA 3ESDA 3EPRA 4AD8A 2GOYA 4RIHA 1EDOA 4G67A 4KQXA 4PG7A 1KZ9A 1JIJA 2UZAA 4YRGA 1G60A 3GHYA 5DWVA 5LYYA 4CYMA 1SCJA 1O58A 3GP3A 2PD6A 4LE2A 1ZBDA 4RZQA 3WFJA 3TPCA 3QVGA 3TPZA 3CF4A 3T6KA 3VPHA 1T4CB 2NSYA 3QKSA 2ZJ8A 4O4HA 3GRPA 1S3FA 4R2IA 2HA0A 1HYHA 5B6JA 2XADA 1IIBA 1QFMA 1ULHA 2YKGA 2A1TS 4ZU3A 3FTNA 2C7GA 2QW8A 4Z99A 2FCRA 5HIMA 4YYEA 2CB0A 4ZOCA 3DHWC 2X5NA 2D3WA 1DUIA 3BILA 2W42A 1FS4A 4QQKA 3BRSA 1AS0A 3JZFA 2HA7A 1U2DA 3ZY4A 1FFSA 1F3OA 1LTHR 3B51X 4XIFA 1NY6A 4L9RA 2XCSB 4PYQA 4ZAYA 1CUXA 2WU3A 2P77A 4DXHA 3D02A 3EGVA 3IDSA 2HA2A 5D51S 1J42A 5AKJA 2VK2A 3GBSA 5EJAA 2KE5A 1JDUA 3ROZA 4LBVA 3H5OA 3U3ZA 2R87A 1DT3A 4JR2A 1CQJA 2I7TA 3NHRA 4Y1RA 2FSUA 2QAGC 1HLFA 4Z2AA 5L3QA 1RWKA 4GMHA 2FP4B 2J3HA 4OIFA 2B8NA 4WJZA 3UK0A 3ERCA 4Z7QB 1TJYA 5C1PA 3C6XA 1MR3F 4FWTA 1SM4A 2ZWPA 4QYXA 1FMCA 2C82A 3KO8A 3SS7X 4RY9A 4EVQA 2VDNB 2VJYA 1RXEA 3TR5A 4E5SA 5KMGA 3VDXA 1HMYA 1GRQA 4INPA 3Q8MA 3V4LA 3UWOA 3RK1A 3B1KA 3OE1A 1P9LA 1CUIA 3T3OA 4I4TA 5JIBA 4CL2A 2VNHA 4B9EA 3UYKA 1H5NA 3THYA 1RXSA 4YMIA 4C5BA 4ZZIA 2QT1A 3GLHB 5HW0A 3NP9A 4EY3A 1Q3KA 2O6LA 1WR8A 4S1WA 1QXSA 4D3FA 4RZ3A 4ND1A 2VZ8A 4UBMA 4C6TA 1S3SA 2AX3A 3KVYA 1J8VA 5EIHA 2PL9A 3IQGX 4RS3A 4R51A 4EUSA 1O77A 2WM8A 1ETUA 1WKBA 2I62A 3RIMA 1W25A 3VC1A 2ZRMA 1E1CA 4TTIA 5BMOA 1ZIXA 2WVHA 4MKIA 1L5QA 1R6DA 2W2KB 3D9QX 2DHCA 3KS9A 4URUR 1DRWA 1RYFA 3C3PA 3K0SA 2O52A 3NONA 1SUCA 4X1YA 1KZHA 3TRKA 1R0ZA 2EIXA 1ENYA 2A57A 3QYAA 5AM4A 1E2NA 1H1LA 1GWNA 1Z2NX 2HA3A 3D3WB 3HLYA 2N9UA 3MGKA 2Q3MA 2BC9A 3ZW9A 2HHAA 1HEUA 5CBPB 3TW8B 3V7FA 3FUVA 2GN1A 4GPD1 4JI8B 1X70A 3OOSA 1LQUA 2WPDD 4E21A 3L7CA 1K2WA 2R7MA 3JQPA 3KK0A 2PU5A 1ZH0A 3IP1A 1XIVA 4R41A 4OU4A 4G07A 2MU1A 1OBCA 2QX7A 4X7MA 5COQA 1L5ZA 3KOOA 1W1IA 1CPYA 5CCEA 4UZFA 2C1ZA 3AQIA 4LZWA 1J70A 4DXAA 5JNUA 2BSXA 1O54A 1UK9A 1RPNA 5IT5A 1E1QD 4QPJC 5DSZA 5BT8A 3GLFE 2OUKA 3RHTA 1JJ7A 3LCUA 4RFVA 1REQA 4KQ1A 1UPAA 5FD8A 2FPIA 4LBYA 2G1PA 1Y9AA 4P3NA 4D4HA 4W5RA 1KS9A 2Q3LA 4DQUA 4HNRA 1M7HA 1OX6A 4WI1A 1V3VA 5SY6A 4CM3A 4G09A 4GD3Q 1CY0A 2I6XA 2R85A 3K31A 3L6CA 3SD7A 1WJGA 4AJKA 1Q2UA 4L9AA 5DCYA 3ZWOA 3QYPA 5E7MA 2BM9A 2FK7A 3G0BA 2QZJA 4O5OA 1PU2A 3EVAA 2I9PA 1QH0A 3IP8A 4ND4A 3HO8A 5IAEA 3TE6A 3RVOA 3PKZA 4FNGA 4CJXA 4DA7A 1UC9A 2KHZA 4HDQB 4NLLA 2VQ3A 4QXAA 4W8HA 3W90A 1Y1PA 1NLFA 2ZI3A 5KYTA 3RLIA 1T5LA 3U3JA 1O7JA 1PL8A 4HMQA 4NARA 1P81A 4Z9XA 1OWPA 5EUMA 5JJCA 2W8ZA 2I2WA 1E2DA 2WBLC 1IUOA 1JFLA 4RD6A 1ESDA 1D6MA 3E9MA 1C14A 3EZXA 2FEWB 5ALUA 1HDYA 1EK6A 4HEHA 1C80A 5L3RA 3CW8X 3INGA 3PSHA 1O95C 3CE9A 3C1TA 1QS0A 3KPJA 2IYFA 4DJFC 4EJSA 2C4TA 1FRVA 1J9ZA 3LA8A 4KR0A 4WXEA 1CUEA 2EJUA 5DI3B 4EKDA 1QKJA 5CVVA 5FJJA 2F3QA 1KXZA 1K6JA 3PT5A 3A9VA 1QGED 4QELA 3HKEA 4LHYA 4YDSA 1XXHB 3GRYA 1Y5RA 4KAAA 3HB7A 4A03A 4MW9A 5JVDB 2IYYA 1T1SA 2ZJ2A 4DUZB 1IN5A 1ZNZA 1ODFA 3NBYC 5BN1A 1I8TA 1D7OA 4UQOA 3X43A 1KRHA 4OATA 3BD8A 1Z6QA 3JQFA 2QR2A 3TDMA 4LNAA 1TKCA 4N3BA 4PQEA 4YCCA 4KQWA 5ARBA 1JKXA 1C1HA 1HX7A 2XTAA 2IGBA 3AH8A 4QRDA 2LBPA 2DHEA 1VE6A 2BT4A 5JEEA 4N8EA 1BEUB 1XEXA 2A5LA 5B58T 2COEA 4A23A 3PC3A 2AJTA 3O5AA 3G3EA 1PJAA 1G8HA 2RGCA 3ZBTA 5DIFA 2R7NA 2XA2A 7REQB 3JARB 1WETA 5E6RA 4RTLA 4JBHA 1U7PA 3TTVA 1WW8A 1H8HD 5BV2P 4XB2A 4KCGA 1IWBB 1NRIA 2JHAA 1XGKA 4BHTA 2HF2A 5D85A 3MEQA 4B5LA 2X5KO 1UC5B 4IV8A 4NICA 2JVKA 3VVCA 3CEMA 4HV4A 4WCFC 4TLLB 3JWIA 3ZU6A 1QUEA 1WV0A 4UCQA 1VDMA 4RW0A 3UAXA 4YMGA 3TQTA 3GN1A 2D0DA 2DQSA 1LK7A 2CB9A 1IQUA 3LX5A 4IXMA 5JQGF 3TB6A 4FJ1A 3AI1A 5A0TA 1P19A 3P26A 3D31A 3A4YA 4FZ3A 4I9UA 2AEEA 3TQOA 3EPLA 3GGGA 1N8SA 4W7IA 3DF9A 4NEQA 2JARA 3CGGA 3HCFA 3NOVA 4NU5A 1V16B 4O08A 4CE6A 5M29A 3CKYA 1S2NA 4TL9A 4AZ0A 3RARA 5LNK6 1MQ8B 1HPLA 4AN1A 1DC4A 2WHPA 3K94A 4B8YA 4YLYA 3O1LA 3CN7A 3ZLBA 1OFGA 1KFJB 1RD4A 1RHJA 3GUUA 3KVNA 4PEVA 5AM1A 1FLAA 5HGJA 4MWOA 3TQQA 5AFSA 3PX3A 1W36C 1DX6A 1MB4A 3KZMA 3T3EA 4IDOA 1TEHA 4XYBA 4UBJA 2VP5A 4YPOA 4J3JA 5A1JA 2HJGA 3TPFA 2D2VA 3A9WA 3PUKA 1A9QA 1GV1A 1VM6A 4FYIA 3N6RA 1XJ5A 2CSXA 1TFRA 1UBTS 1ATZA 3VPFA 1SHKA 1FW6A 3I12A 1SXJD 1WZIA 2F64A 2FFHA 3MINA 3FN4A 2ZR8A 3PEEA 3RRJA 3P9CA 3RLFA 5KTPA 3KQYA 1Q84A 2JCGA 3TLGB 5LU8A 1KVQA 1U8YA 3GF4A 1Y7TA 1SC4A 3WHLA 1SVIA 2W5UA 2AN4A 1P1BA 2OUIA 2WP0A 4UE6A 2QS9A 1Z28A 4MJXA 3HJUA 5HF8A 4G37A 3L1KA 4J6EA 3OCXA 3K73O 4O2BA 3LLMA 3QYFA 4JEHA 4DC0A 2VT7A 4F45A 5BXYA 3FLMA 2L2QA 5CAEB 1J90A 1N9GB 1X1DA 3D6TB 5G3YA 5K3SA 1UOPA 3WSVA 3LHKA 2PUVA 5KJCA 3IOBA 3SSMA 3FCAA 4ETNA 5EZYA 1TT5B 3NORA 3OM1A 1R15A 4C05A 3U7RA 1FE8A 1E6MA 1GSAA 1GU1A 4TMTA 4Y0NA 2Y2VA 5G3ZA 4EBFA 2IHTA 3KLMX 4HQOA 3DLCA 4IHJA 3UXEA 1QP4A 5E1BA 3G2JA 3CZCA 1G63A 5I7EA 1SXPA 2R4QA 1USKA 3R7NA 1Z0AA 1WG8A 5FP0A 4ZGWA 1PLKA 2Q27A 3G1TA 3NM4A 1RXWA 1CE8B 4BNVA 1K5DA 1YB7A 3THWA 4PYLA 3OCUA 1C50A 1V1MA 2F2TA 1YAHA 4TXHA 2O2DA 5KC9A 3ZNPA 4DABA 2JDIA 4UMDA 2A2ZA 3CLVA 2DUNA 1W6RA 3LUHA 4KSBA 1U0SY 2GRUA 3IPAA 5F33A 3PGVA 4BBZA 2FWBA 1UUFA 4L8LA 4NCNA 4RTJA 1YUNA 4D9NA 3IBGA 1G42A 1YA6A 5C81A 5AHKA 3C3CA 4BB5A 3KE9A 1LDEA 3R7FA 1YS1X 3QUTA 3DNFA 2NT4A 4P7KA 1H2HA 3EGWA 2V8OA 2WTBA 3AV3A 5LA6A 1C9JA 3WYBA 3WI7A 3OP4A 1H4QA 3GGPA 3QWBA 1E2IA 3QTLA 3R0QA 1GPMA 3VNBA 1BX0A 2KB0A 1LDMA 1CHNA 4IINA 3RC9A 4NCKA 4PLFA 1E20A 2ZWAA 3QIVA 5KB3A 1Q7BA 3V6LA 2WWYA 2PTGA 5LQNA 3FRHA 3CR8A 2AZMA 2ILVA 2FFAA 3N3AC 3ZE1B 3H2YA 1TC2A 4YRLA 5A71A 3R0ZA 1UBFA 3R5JA 5B1YA 4QOIA 2JC3A 2OWDA 4MR9B 5IG2A 1NI5A 4YHHB 1YS4A 3D0RA 3FJYA 2RHOA 1J49A 3V8BA 2B9EA 2EGHA 1IXSB 4MI9A 4N3AA 4RSRA 1JSZA 3AONB 4D46A 1JE0A 2ONYA 4FYYA 1V11B 4LSZA 4MRAA 3RTAA 2UKDA 3GEDA 4F9EA 1EQAA 3ZU5A 4G1BA 4JLMA 2K2WA 4HR7A 4NL4H 5KYVA 2B98A 5EXPA 5FPSA 3VQTA 3ZI0A 3ZKWB 2HWYA 5DCUA 4UQLA 1Z38A 1MA0A 2VF5X 3P0EA 3TG2A 1BW9A 4OSPA 4DLSA 1LQTA 3FNEA 1UDBA 1WPXA 2ZSIA 4P4TA 2FRVA 1C9YA 5EI5A 5F52A 2ZG6A 1N0VC 5BN4A 5CFRA 2BP7A 4FK8A 3ZUPA 3ZPXA 3A9RA 3DF7A 4KIGA 2IWRA 1R6XA 1VJCA 1WOYA 4KNWA 1BX3A 4OV6B 4QICA 4LXYA 1EUQA 1FUKA 2DC1A 2QRKA 2R1VA 1Q50A 4MAMA 2V5UA 3MJEA 2JIZA 3IEMA 1COWA 1TLLA 4C3ZA 3QY0A 3UJBA 1PE0A 2O05A 1AHPA 4ER7A 3GJYA 1ECGA 1F2TB 2VUSA 2YXEA 3H83A 3A37A 3PB3A 2OZLB 1FTGA 4KYVA 5KIAA 5KOYA 2QYSA 4HTAA 5JWOA 3BFPA 2PXCA 3C6YA 3MSCA 4JHXA 1MXHA 2B82A 1EGAA 3PPVA 4R05A 3U7EB 3BFVA 4M21A 5FAXA 5C8ZA 2KX7A 2CV2A 2ZWMA 1VHTA 4BO5A 4MK4A 5ALFA 3OWHA 4Z0PA 3GRVA 4QDOA 1YVEI 2Z2ZA 1KAGA 4KLAA 4OFWA 5HDBB 5ALDA 3TD6A 4X90A 1LPAB 8ADHA 1UKCA 2G77B 3IE0A 3UOAB 1BFUA 2OV2A 4J0IA 4EFLA 4FYHA 5LMNB 2YYAA 4OQYA 2OZPA 4M87A 5LYJA 1IBSA 2ZAOA 3NAQA 1FDVA 1MRZA 4MGEA 2FAXA 4MUHA 5KNDA 1JQJC 1CRZA 1H2ZA 3LRXA 5DISB 1R1DA 1EYZA 1WHTB 3MGBA 3RHSA 2F4NA 2H2AA 4MROA 4LZNA 1NYTA 1T2NA 3VKWA 4L76A 2F1HA 1EDEA 1I4WA 3O26A 2FFQA 1N6NA 2IPXA 1D03A 1CERA 2GVNA 1J0DA 4D79A 5KTOA 4LZJA 4RD2A 2DUWA 4TT8A 1SU8A 2ZCJA 4YROA 2GRJA 3T0IA 1ORWA 2OAEA 3HR7A 1F12A 1QBGA 1XMIA 3Q3GE 1DI0A 3WP0A 4Z4GA 3Q12A 3HM2A 1VJDA 1ZAYA 1YD7A 4KVGA 4MQLA 4CG2A 3GXOA 3R3ZA 4C1BA 3UV3A 3TWOA 4U7FA 4BAUA 3L4EA 1QR2A 3C3DA 4LOLA 1VLLA 2I8AA 4FKBA 3KV3O 2OHHA 4MDHA 4TGLA 2DKFA 3X1ZA 4M9CA 2R1TA 3KHUA 3D5EA 1U9JA 4HNTA 1N8NA 4RQAA 4IQ4A 1FXWA 1Y6JA 5AR1A 5K3CA 2CL0X 4YGYA 3WRYA 5LXTF 1Y63A 3RBZA 1FYDA 2PZFA 4G85A 1N2IA 1SD1A 4CMAA 4CDMA 3FVVA 2PSEA 3GUZA 4QUKA 3PFHA 4IUYA 1S2LA 4H7PA 1T8RA 4CWAA 3OT1B 5IBCA 5H4HA 1VHQA 2QJTA 5JZOA 2QX4A 1FNCA 1TJ5A 4AP6A 1AS2A 1OLOA 2D4AA 3KXDA 5B36A 1NMZA 4BQEA 4MAAA 1SH7A 5EMHA 5KQRA 3KJEA 1VSUA 3ENNA 3PNOA 4JP3A 4UMFA 1TU3A 3TI9A 3CJTA 4JQOA 2WVGA 5JAHA 1X42A 3UB2A 1PS8A 2I3AA 1UJBA 1U1GA 2C5GA 4Y9SA 4WXYB 3K5HA 3R4VA 4DUYB 2AR0A 1ZSNA 1M8FA 2CLIB 5IH3A 5J43A 4KXQA 3LL7A 3OZGA 4RMGA 4LC0A 4P33A 4J1SA 2FETA 2PSHA 2ZVQX 5T6MA 4Z7OB 2I91A 4DMHA 3AOGA 3G9UA 1Y8CA 5F3RA 4F4HA 4MIOA 5K2OA 3MCVA 2I0FA 1KJYA 1E60A 4Q9NA 4DPLA 5HIJA 3SC4A 5TEWA 5A7GA 1XB2A 4IHQA 3VSCA 3DOEA 1EWKA 4L8FA 6PFKA 2UVDA 1GTG1 4D4GA 4LNHA 1XNJA 1XAGA 3IEUA 1SIUA 3A6EA 3H2HA 1MC4A 1M6YA 1Y5IA 5I8ZA 1T6BY 4BPRA 1J8DA 3PEUA 5FYQA 1C7IA 2F1IA 3ZGOA 2BAGA 4FPXA 1IDN1 4A6EA 4YREA 3P2OA 5DGXA 1ZOSA 2QD3A 2IP2A 2W6NA 1WZNA 1XVTA 1WUTA 3DT9A 4GRDA 4RABA 4EB0A 1Q0QA 2ZE5A 3Q0TA 4M86A 2QROA 4KO8A 5AKZA 1KDYA 2QBYB 1PFKA 2P27A 2YRFA 1IHXA 2C2XA 1MH1A 1MDBA 3QE0A 3GCZA 3QHAA 5GONA 4DG9A 4E13A 2HRRA 2E87A 4R83A 1TKRA 2BEUB 3X1MA 2HUPA 1LTQA 2JGMA 2JLBA 5L51A 1ILEA 3S8EA 3RVBA 3ZJTA 3SY8A 3B6ZA 3C3YA 4YY3B 4C6RA 3LV8A 5IAKA 1OB5A 1ZGCA 2IXTA 1UPUA 2A94A 2XGOA 4IR7A 1K8YB 3WISA 5CB8A 5JI3E 2XR1A 3MWEA 2QV0A 5CGQB 4HMPA 2QDKA 3AY7A 3PR3A 1QYCA 1YR7A 4C21A 3DFZA 1D2HA 4CQLA 2YV3A 5TGZA 2ZDHA 3C8DA 1DZIA 2AX4A 4H4EA 3SJCA 4W1QA 1S0UA 5JZSA 5FUBA 3VPAA 2BTEA 1A3CA 3DL7A 5JDIC 2V9PA 1V5EA 3AWDA 4EAQA 4YMHA 2DFNA 2RHJA 5IVKA 3MFYA 2NSJA 2RKBA 3IAUA 2YS6A 4M22A 1O0CA 3L04A 4CEHA 1A1SA 2P9ZA 4ZCQA 1DMRA 1A8HA 3KXLA 4B3SB 1EAMA 1VMDA 3M49A 4N0QA 1VQ1A 3C1UA 4RPCA 5ALKA 3FSRA 5EY5B 3KUDA 4IIVA 4ETWA 3KQUA 2NP7A 3ANTA 1XTQA 2AOTA 2DVMA 2G40A 2G72A 4QFMA 2BEVB 2FKNA 2P4UA 3OZAA 2X4DA 2IITA 4YO8A 1B6SA 3WLPA 3HA5A 1L7PA 2Q28A 5ISMA 3P2JA 1BQ4A 2PLAA 1IE3A 3QPAA 3KXKA 2UVPB 4KE6A 3PU6A 4M46A 1Z7YA 3VUFA 2HADA 3F90A 1SD2A 2BKVA 3PGKA 4P31A 5A5VA 5JS8A 1E58A 4AQYB 3TH5A 4D0SA 2VSNA 4HGQA 1I7QB 1Z4PX 4EVSA 3GP8A 3UT6A 4C0AC 1I2DA 3FOFC 3LS2A 1A4RA 1JTEA 5DP2A 2Z3VA 3G0HA 4JV5B 4FZJA 2ZPUA 2V7XA 4U2FA 3E8XA 2IUSA 5BWOA 3CX8A 2DULA 4BZWA 3OBIA 3AIKA 3PXGA 1CEEA 4Q9IA 2JGRA 3EGDA 2NMVA 4FFNA 5DN6A 5EJ4A 3T3MB 1DJNA 3ISTA 3JQGA 2GPAA 3V2GA 1FYEA 2PMCA 1BZYA 1TXGA 1H1DA 2WF7A 5DBFA 4XDHA 3ASZA 5EMMA 5HG0A 4B4KA 3SJBA 4GG1A 4FHZA 1MVLA 1SZPA 2EU8A 3SYTA 5CXUA 2O8DB 1U0NA 2Z08A 4OFZA 4TTAA 2RD2A 2VRCA 1X14A 5M7EA 2QV7A 5ECWA 1IVYA 1VRCA 2WMOB 1X9GA 5H3CA 3UF0A 5KHLB 4JB3A 4GPIB 2UXBB 2CDRA 1EFRA 1L4GA 3PPXA 3LFTA 1KYWA 5BNTA 1JI3A 4BGVA 1JFTA 2PU7A 3AI3A 4EHBA 1TAUA 2CUNA 5A5DA 1QU2A 4DLWA 3C0KA 3OZIA 4K26A 2JZNA 3R6WA 5BN3B 3GQBB 5BQ5A 5JAZA 2XYPA 2R97A 2ZJAA 3EFBA 1YBHA 1Z9BA 3M5WA 4CCYB 4N54A 5K0FA 2GBGA 3QHPA 4QUAA 3RSCA 1T6XA 4YUAA 1GA1A 4OLAA 5NULA 4JC8A 4LF8B 1FFHA 3EEQA 2H0QA 2ZR0A 3MYRA 1VGQA 2GXAA 2ZITA 3Q3JB 3X1KA 4L4RA 4XUCA 4B4VA 1SHTX 1GU0A 3IC5A 1Q11A 4ILEA 1U8ZA 3LM8A 4EGJA 2GK7A 3JCZA 4IRMA 4XB6B 5CDGA 3LWDA 2V96A 3FSGA 3AG6A 1AUQA 3EXIB 1C4KA 3ZGXA 1GD1O 3GEGA 4Q48A 4LF7B 2AK3A 3Q87B 5C34B 4ARZA 4NF2A 4IGKA 1PZHA 2QSZA 4KXVA 2XYHA 4MJLA 4R6WA 2R8ZA 4QJ5A 3WMRA 1ZI9A 3N5KA 1JLMA 4ISCA 2XXAA 1RWPA 3NEPX 2I2DA 4JENA 4XA8A 1WDTA 3UW3A 3W5SA 4LZLA 1OYOA 1JT9A 1UMDB 1UODA 3PK0A 1ISMA 4QOSA 2NOAA 1P80A 1RPTA 1SG6A 1T8YA 3L1JA 3CVOA 1DRJA 3H19A 1XEWY 3HCCA 3N2IA 3O4VA 1D4ZA 2VZ0A 3WB2A 5DBGA 2W2LA 1N33B 1NVGA 3LWBA 1W5BA 5BVHB 5DHQA 1ODTC 4PONA 4L5AA 5JECA 3EISA 4IHAA 4K9MA 2QTVA 5DYYA 2APJA 1N3IA 2OLJA 1XPRA 4FCWA 1HI9A 2Q0HA 3DB1A 5J5VA 1XQ6A 1JECA 2QLJA 1EQUA 1CKEA 4CF5A 3QSYA 4OGLA 1O96B 1CNFA 4MGYR 3D4BA 2FWNA 4DQKA 5KNDH 1JEYA 2XB6A 4JSRA 4YX9A 5DM0A 2HPHA 1P2DA 3NHJA 3OLVA 3KR2A 3VTZA 3PLAE 1TTTA 4ENQA 1NVXQ 4DNPA 1XL1A 1KI6A 2CEAA 3C3WA 1XU9A 5AJXA 4ZYLA 3TRIA 1QU3A 4RGYA 4HWSA 5DJ5A 1X9HA 1JIKA 3U7JA 4HQNA 3UAYA 3ZBUA 1R4ZA 4N6NA 4YV1A 5JI2E 5K6TA 2ZT7A 3L93A 1U2ZA 2HX1A 1GQYA 4FFRA 5KCMA 5DE3A 4XSVA 4ZEWA 3QV1A 1TMOA 1YJXA 1WA5A 4RHEA 4Q3OA 3HB5X 1A5SB 1VLMA 3NM6B