1N5OX

Structural consequences of a cancer-causing brca1-brct missense mutation
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
207
Chain Sequence
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNRPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural consequences of a cancer-causing BRCA1-BRCT missense mutation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
molecule keywords Breast cancer type 1 susceptibility protein
total genus 56
structure length 207
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1n5oX02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1n5oX01
1T2UA 3COJA 4BU0A 2ADOA 3JVEA 3K15A 1L7BA 3PA6A 2LE0A 3PC7A 1T15A 2K7FA 2R1ZA 2L42A 3HUFA 3OLCX 3PD7A 2COKA 3II6X 2XNKA 2DUNA 3PXAA 3PXBA 3SHTA 4BU1A 3U3ZA 2ETXA 1N5OX 2K6GA 2EBUA 1T29A 1KZYC 3QVGB 3KTFA 3L41A 4OFBA 4Y2GA 3AL2A 2EP8A 4U4AA 1GZHB 3PXDA 4IFIA 3SQDA 3PXCX 1WF6A 4Y18A 3QVGA 2AZMA 2XNHA 1OQAA 3K0HA 3T7KA 1T2VA 1JNXX 2INGX 1Y98A 4ID3A 3T1NA 4XQ0A 3K05A 1IMOA 2M2IA 3AL3A 3FA2A 4N40A 2HTFA 2VXCA 2WT8A 2COEA 3EF0A 1L0BA 3T7IA 1CDZA 4JLUA 3I0NA 3SZMA 1IN1A 3K16A 3EF1A 2EBWA 2D8MA 2NTEA 3L40A 2COUA 2VXBA 3I0MA 3UEOA 4IGKA 3PXEA 4XPZA 3UENA 5ECGC 4BMCA 3L46A 3PC6A 2JW5A 3T7JA 3PC8C 3PC8A 3HUEA 3SHVA 2E2WA 3K0KA 4BMDA 1Z56C
chains in the Genus database with same CATH superfamily
2BTOA 4KPFC 2XITA 3DZCA 5BMVF 4FS8A 1RYFA 2PU5A 2V97A 4B75A 3HVJA 4H7EA 4RIFA 4TLAA 5AKIA 2WKSA 5CFNA 2YV4A 5GVSA 3EYAA 3PC7A 2EEZA 3C5CA 5E4FA 2NNLD 3LP5A 4AY6A 3KX2A 1MBZA 4RW0A 4PVCA 1MO4A 4Y6PA 4N9WA 3V00A 2WKWA 3NIWA 1II0A 3ED1A 5JIBA 2F9MA 1Z37A 3AVQA 4WOBA 2ZYWX 3ZHQA 1L1RA 2REXB 1EVLA 4N5NA 1JJIA 1KEEB 1A9XB 4FXOA 2V9PA 1IH8A 4HYQA 4JJAA 5AJYA 1CR6A 3M3PA 4FMDF 4UCWA 2WHQA 2VRCA 1YDHA 4CQLA 4L16A 1SN7A 1BW9A 3DHWC 1ZIOA 2R48A 3RSSA 3G0OA 4IIHA 4OJTA 4LQCA 4F3TA 2OV4A 1I9GA 4QUJA 4MQFB 3VR3D 3N70A 4YT5A 2JFHA 5K01A 2FZ4A 1N6LA 2JFFA 2JFGA 2I3DA 5GV7A 3WBBA 2DXIA 3L0DA 4KDRA 4DC0A 2I66A 2W6ID 4LF9B 4LJRA 2AJBA 2O5VA 2HA4A 2I2DA 2XAAA 2XWQA 3GNTA 4H16A 3TRIA 1PJAA 3M89A 5HSGA 1JB1A 3AFOA 4UD6A 5FWYB 5IAEA 1PV2A 4URHA 1HA3A 1T9AA 3LPNA 1VE9A 3BK1A 2X5OA 1F5SA 1PFYA 2R8XA 2CCKA 4GPIB 3U3RA 5BMVB 3PXGA 1XCGB 4FQ7A 2QMOA 3ZHXA 3JATB 1GYPA 1Q0HA 1YRLA 5KYYA 1DC3A 1NXWA 3WIEA 3KQVA 4LHSA 3CLUD 2C0PA 5DBHX 3U4AA 3L93A 2LR0A 4P35A 2VXCA 4YAWA 1S2DA 2Q07A 3CEAA 5EMLA 5FR2A 2PKQP 2COEA 4DUYB 1VG1A 1YRBA 5GPBA 5JECA 3D4NA 1GNQA 3TMKA 4MVCA 1O6BA 1C4OA 1UC9A 3R3YA 3L6DA 2GVZC 4Q9JA 1KBZA 4NY1A 3ZN2A 1O95A 4EBBA 3IE0A 1YAHA 5A4IS 2WJWA 3CF4G 5KTPA 4CV2A 1B3BA 3D2LA 3TFQA 1WXDA 3J81A 4YGXB 3CFYA 3L6RA 3M5PA 5IMSA 5HF5A 2PO7A 1P7CA 4AMGA 4PYJA 3CNNA 3UNXA 4CCAA 1OFTA 4WBNA 2A5YB 2WE8A 1FXWA 2YQ5A 1V4VA 5CT5A 4YAIA 4OVKA 1L7AA 3C7DB 1N2EA 2GZMA 1QORA 3F6BX 1K06A 1GSAA 4LI3X 4DLYA 1QFMA 1QWOA 2ODQA 3FYUA 1NF9A 4OHMA 3UEOA 5LJIA 1BQ3A 4RSGA 5DZSA 3WFZA 3IEVA 1ISFA 1KYQA 1IZ9A 2ZB2A 1BXZA 4FT2A 1VJGA 1QZXA 1RXEA 2CUZA 2O8NA 4OLBA 4RKQA 3JALB 4LV6A 4Y1GA 4CQMA 1TO1E 2EZUA 4JMPA 1D2MA 1U7UA 4GRIA 4GNKA 1DC4A 2QW1A 1QB8A 3QNUA 1HT0A 1ZXLA 2FSUA 2WW8A 1NQ5A 2BFDA 3FYHA 4CMIB 5ESDA 4EJMA 2X42A 3I9OA 1JAIA 2X7XA 4G0MA 4CRWB 4YH1A 5G53C 4LI0A 1N75A 3IBSA 3JWEA 3X0DA 3SCZA 3TPCA 4NG5A 4JA0A 4JXZA 2Y0PA 3T0GA 4EVQA 4XCXA 1FUKA 4MULA 4ZQGA 1RS0A 3PSAA 4NHEA 1IOWA 4R05A 5EZYB 5A4AA 3CR8A 1PT7A 1XK6A 2AJCA 2VRBA 2WILA 1QDUA 2GBFA 3OE7D 1PR6A 5EZQA 3D0OA 1LDNA 2QSZA 1E3DA 2I7VA 4KYIB 2Q3HA 4YLGA 5LBUA 1BROA 2RBKA 3LTEA 3QLVC 3S6JA 2GJ8A 3KJFA 4RF4A 2QU8A 4QHYA 4R2WA 3OOHA 5DV9A 5TEVA 1T35A 2HHCA 1Y4AE 1EVEA 4B48A 3HJHA 3ILXA 2HGSA 3AGPA 2XTNA 5DTQA 4ND3A 4UC0A 2I6SA 1FSZA 3C8MA 1XPRA 5LMNB 1Z22A 4M1SA 5DTMA 2HW8A 1XZKA 4NEHB 3ZV5A 1FJGB 1YL6A 2LP4Y 3ECCA 2DSTA 1LPBB 3BWDD 3HXPA 4QASA 2W2XA 4YAFA 3OM0A 3G2JA 3F74A 1ZS9A 3P9XA 4H15A 3ZDQA 3QV1A 1ADJA 1TVKA 2X2EA 1ZOSA 3ELDA 4KTVE 1ST3A 1E1NA 4DT1A 5LD2C 1WUHS 4D3FA 5IDYA 2IW3A 2W4IA 3ESBA 3IAAA 2C42A 5CB4A 1ZO8A 2JFYA 1QQBA 3O2NA 4J3JA 1TAQA 4ZQHA 4EYSA 3JTMA 4U7FA 3KKNA 5JC8A 2F48A 1NNEA 4B84A 2PK3A 2AWOA 3FWPA 4LX0A 3ELYA 1GZ3A 2HA7A 3M3HA 3HG7A 2G9NA 1HDRA 5HJ7A 4WOKA 2B3DA 2PLWA 4ZAFA 1F20A 2QUHA 4EKYA 5U9CA 2IPOA 4CMHA 5KSPA 4L2IB 2I22A 4I3GA 2XGGA 5E3JA 3B1KA 3RGGA 5KC8A 1AGXA 1OA1A 3LE8A 5HFAA 3P2IA 2PGNA 4HQKA 3E2IA 3KZVA 2DY1A 5ADWA 2OV6A 3FOZA 3EGDA 1QHHA 4MMZB 2WV9A 3F7TA 4FFVA 3OCXA 3GI1A 4XFKA 4ZVUA 3WOVA 2A0FA 4XD7D 3EBPA 4JR0A 5G4KA 1OJLA 1OVMA 3TMYA 2A5JA 3UK2A 4F3NA 5DHAA 4ZCMA 4LDNA 5EMJA 1JDSA 2IUEA 2RE8A 4UASA 2B34A 3S40A 4ZN6A 3WK6A 1U0BB 2I55A 3WSTA 2Y4NA 5B7NA 4DRXA 5A03A 4TM8A 1VLQA 2G67A 5H3LA 3UT0A 5FOSA 2X0JA 2C77A 2ZRCA 2H0AA 3PK0A 5DXJA 5LNK6 1GNTA 4KN6A 2FPRA 4AXXA 4E2FA 3J7AC 2F3SA 1QYVA 4H1TA 4OM8A 2BFDB 1E32A 5IS2A 4C7BA 1C8LA 1M5TA 4S1TA 1Y3HA 2GAFA 3FB4A 1EVJA 5F2OA 1L5HA 2YIVX 4ND2A 2QDKA 4R51A 5AIBA 4RDXA 2C3MA 2V45A 3BCUA 4X84A 3DQQA 2WV7A 3QMPA 4UUPA 2PWBA 1BXGA 2J6IA 1CLEA 4H4EA 2E4UA 3SWWA 4EG4A 4DQKA 1L5NA 3ED5A 2XQVA 2NPIA 5F7OA 3VZDA 3CX6A 3NANA 1N7HA 3D1VA 4J90A 1E9EA 3RI3A 1ORTA 4FXPA 3GZTB 3PNPA 1KJYA 2DOKA 4YO7A 4Z3KA 4OK3A 2QNIA 3THXB 1EDZA 1SY7A 3T7SA 3VHXA 1KVSA 3K20A 4YQEA 3U60B 1C3EA 3OPYB 1CFJA 1SCUB 2QD5A 3IO5A 3FWKA 1B8UA 3HRKA 4WZAB 3RKSA 3KWFA 3AF6A 1E9CA 4Q1BA 4QPCA 3KQLA 3ZE1B 2DC1A 2BZ1A 2W2LA 1M1UA 2XEDA 4RVSA 1PZNA 3GBPA 5B1YA 3QYJA 1YR2A 5GONF 2A1TR 5CK5A 3FI9A 3QW4B 3RSCA 1XTPA 3DCNA 5CCXA 3NVDA 4S24A 4RTLA 2C9DA 4QC2A 3SBDA 4EI8A 2NG1A 3ELWA 5F35A 4ZU3A 4AP6A 5LN1A 1XRMA 3P8ZA 1L6RA 1PFVA 2QZZA 2I62A 3CLRD 5JAMA 1PK9A 2VF7A 2KQUA 2YHSA 4TTJA 4Q9IA 4C4RA 3UQYS 1N5KA 3JSXA 3BXXA 4RJKA 1I4OA 1KJJA 3NH6A 3SFVA 5TIIA 4OK5A 1DIOB 1BXRA 2Z3VA 1G4AE 2EJVA 2J5RA 3EQ9A 3TRFA 5DMXA 1ZU5A 2J45A 4J07A 2H1OA 1V8BA 2XUJA 4C07A 5KYKA 1C8VB 1D07A 1XZNA 3DF7A 4FYMA 2GZDA 3I5MA 3MQ4A 3OA2A 2AW3A 2O0LA 4PQGA 3X1KA 4CPDA 4KG7A 3UA4A 3ZV3A 3GF4A 4C2UA 1SA0A 1FEZA 2BFCB 4OGGA 1E3IA 1YQGA 2AEEA 2R6GA 2QTMA 4BQIA 4YRBA 2KBEA 2EGHA 2FA9A 3L05A 1OAKA 3LUDA 4JVSB 3HKCB 1ML4A 3JQEA 3TEFA 3E05A 4US2R 3THYA 1X7DA 4UTZA 5K0SA 3L8GA 3QG1A 4IM7A 4I5GA 1O5IA 3TOVA 4ZQEA 1YNSA 3E7WA 3H19A 4JD5A 1KEEA 2WNSA 4WEQA 1TM2A 4FT4A 1KOJA 2ISCA 2Z4RA 3C74A 3FDZA 3PVZA 1M54A 1PE0A 4W8HA 3B52X 4AJHA 3KWJA 2BTEA 1ZL0A 4NFHA 1VYHA 2GZ1A 5KSWB 2G70A 4R3WA 4ZOCA 1RXSA 1O2DA 2HN9A 4NAVA 4Q3AA 1IY1A 2ZRIA 1RYHA 2FK8A 3WRWA 1ZISA 1TJ4A 4HDMB 1CPYA 3INGA 3KL4A 1Y7TA 3DW3X 3AJAA 1M2EA 4H7KA 1C7FA 4RC9A 2MOKA 4QJ3A 1ETUA 2ZJ0A 1FVOA 1M1NA 1RVDA 1DEAA 1R0LA 2NTNA 1IZ8A 3PGKA 4II2A 4IIJA 3ZUGA 3H1GA 2HNAA 3VA7A 2V3CC 5KUTA 1QHEA 4EGAA 3WLIA 3QOWA 2Y0DA 2VNHA 2APJA 2HY7A 2R86A 3D7RA 4FTWA 4CTOA 4P08A 1ECBA 1R3UA 2BEWB 4N3BA 3KC2A 3ZDEA 1OU0A 1G8GA 3QUSA 4CLEA 2QN9A 1PHPA 2R8YA 2FUG6 3R5JA 4QBFA 5ECWA 3SF8B 2VHYA 5GP1A 3WDSA 1L1FA 3WMRA 4BB5A 3F4BA 2HHLA 3L46A 2KLHA 2N0SA 1KS2A 3F4LA 3R9KA 5EKSA 4X7MA 1ESDA 3U6BA 4P3KA 4CM1A 4J1TC 2BIFA 1IXSB 2V3WA 3GFFA 1RRKA 4ZZIA 2XMSA 5DHQA 3LW8A 1GO2A 3VTAA 1ND5A 4D43A 2GF2A 1UKBA 1CQJB 1KA9H 2YS6A 3AW8A 3A9SA 3QE4A 5KWIA 3WLHA 4C14A 3COPA 2ADOA 4OKIA 1RP7A 5H0IA 2E89A 3PRKE 4IWYA 1YR6A 4AUNA 4XEUA 4GLLA 1I3LA 3RABA 3V1KA 1IN7A 4E30A 4UAVA 3GFPA 1DPGA 2CVHA 2QM3A 2FRDA 2YVLA 1P1BA 2ZBUA 2REOA 4E2WA 3WMFA 5CIWA 3ICWA 2L42A 3D3WA 4DS3A 4QYSA 4RM3A 2VSOA 1DJNA 3HUFA 4LC0A 5FNZA 3OZXA 5H3HA 4FW9A 5KNDD 3GDOA 2I4NA 1E3LA 2YWDA 2ONYA 4L0QA 3PUXA 3A1SA 3A6JA 5LYJF 1SCAA 3CEPB 3H9UA 4CLRA 4IUCS 4MHOA 3ZDZB 2FSGA 1KZ4A 1PWYE 3JD4A 2Y1GA 3DZHA 2BRUC 1W4CA 4CW7A 4IHQA 5KTTA 4G4GA 5HKOA 4MPRA 1U0NA 3T9AA 2GM5A 3JYQA 2BGMA 1TGYA 4MV5A 1LCIA 4LHZA 3CUEF 2VJOA 3R6LA 3W8NA 3L8DA 3PUWA 2NXCA 1FS5A 1GXSB 1J2TA 1I14A 1K2VN 2ZU6A 3QKSB 1WXGA 2I29A 4QARA 3OEHA 1FZQA 4A15A 2HMYB 3I2FA 1M76A 4OUKX 4EHLA 3HNRA 3ORRA 4E11A 1XTQA 2I6UA 2WJ6A 1COWA 3WRYA 5EXDA 5JI3E 5DNYB 1DCKA 3DXYA 1K86A 3H1BA 4D4KA 1K8YB 1Y6ZA 3C1OA 3I0ZA 1NRWA 3LOPA 1KI6B 1IEVA 2AD1A 4I8XA 1FB5A 5ICSA 3FTFA 3GCDA 5ENVA 1KY3A 4CQNA 4GOMD 3GN2A 4YEDA 5B1HA 4BMZA 1WKCA 1UQTA 2BP7B 1LLDA 1IK4A 1RP1A 2HEIA 2HCFA 4FEYA 1J09A 2CMKA 2IUYA 2V8BA 4KIJA 4ETWA 4LXHA 3WGQA 5LWHA 4WX2B 3EIQA 1FQWA 5BT8A 4OK6A 5FOXA 2JLXA 2NVWA 1X3SA 4WN9B 1VZ2A 2X9LA 4B3CA 2ZIWB 5DLYA 3W6ZA 1Y8QA 1C7JA 5IX8A 3VDXA 1MW9X 1B2LA 3KJNA 1H2EA 4ZGGA 9LDTA 3I32A 1A1VA 1V1JA 4B6FA 1ADBA 1UT5A 1QXSA 2H65A 3S2ZA 1WBBA 1SBTA 2YYZA 4B46A 4G56A 4O25A 1CEYA 3T5CA 4JKOA 1CQIA 3UB3A 3TZ6A 1N34B 5AQEA 3IILA 4INOA 2IDJA 1YBAA 4GLFA 3V97A 1GAXA 2P2NA 4RH3A 4DA8A 2NO6A 3IBCA 1KY5A 2A3RA 4EHNA 4YRGA 1XZGA 2HX1A 1KORA 1RD4A 3MT7A 4YP7A 1NJ5A 1N6OA 1VCHA 2FX3A 3DL0A 2YW9A 4A92A 1T0UA 4TLBA 1HX7A 1BCSB 1ZOLA 2X9VA 5K3EA 2AI1A 3IKMB 2OO5A 3JQAA 4DLKA 5ISMA 1ZJJA 2R84A 3FOFC 2RC6A 2PMEA 3EZ7A 3QU5A 2B1IA 4RH1A 1VE7A 1ZA1A 3TBKA 2J0QA 3RYHB 3ETLA 4IIUA 5JT1A 2ACVA 1OUMA 1TTQB 5CFOA 3W2GA 3OJFA 3OPVA 4R6XA 2BGKA 1CIPA 1J0BA 1HZZC 1VIVA 2VT2A 1A9PA 2V8OA 3H8SA 4U7JA 5ALNA 3NS7A 4OKSA 1JLLB 1GPYA 1E1DA 2F8MA 2OAEA 2EIHA 1TQ6A 1UKYA 4DYDA 1RZVA 4M22A 2NWQA 2AKAB 4M8IA 1U3FA 1GKYA 1ELOA 2HSZA 4UMVA 3A27A 4GHWA 2QTHA 4BXOB 5BNIA 4RF2A 4F85A 2CLFB 1JDPA 3PR2B 4H0CA 3SF0A 4EVSA 4MLPA 5EMNA 2OCAA 3E22A 5ITWA 2PWYA 1OYWA 1FA9A 1Z35A 1FCJA 1DEXA 4KVFA 4XIJA 3DNMA 3FXAA 2VHXA 4MR7A 5EAIA 1AXGA 3OPYA 4AKTA 3QEAZ 3HXTA 1QR2A 3M6WA 4UAUA 4GZ3A 4KSBA 2X8WA 1GFWA 3GRCA 3UTCA 3BIXA 4AP5A 4YIHA 3IV6A 3U80A 3FMGA 5EYPB 1Q1ZA 2JJ1A 4MS3A 2GUGA 4PGGA 1DJPA 2ZPTX 3H16A 4NENA 2H31A 4WOCA 4GGOA 3E9MA 2OGWA 3Q7RA 4Q4HA 3KHTA 4KZPA 4GL2A 1QLHA 4HADA 3TH5A 4C4XA 2HO5A 3H84A 4MKXA 3PEEA 2CJPA 3PXDA 2Q99A 3THOA 1SXJB 1ZEJA 4KH1A 1P1RA 4LY3A 1T24A 2UV8A 4C2BA 2IY9A 2RGAA 3C3KA 5CVVA 1P1IA 3TTXA 5E7MA 3D3JA 1P74A 2ZWIA 3KKMA 1W2WB 1OHHD 1Q0PA 1YCDA 1UOQA 2B83A 4ND1A 5T8KC 4BFYA 3KKZA 2RG1A 4QUGA 5JS1A 3G5UA 1J5PA 1O96A 4I1IA 1DAOA 1FMLA 1I24A 1ZBQA 4D57A 2O2GA 3HFJA 2FJPA 2GVDC 3FJOA 3MGBA 3UWMA 3TIVA 4BKMA 3S99A 3RARA 4FKMA 2VL7A 4E4TA 4QU8A 3CNEA 1V3TA 2AQHA 1LA2A 3AF4A 3H5IA 4NWIA 5DN6A 2PUVA 1P80A 2H5IA 5EIBD 2I1QA 4IIEA 4WJKB 4JKIA 4AECA 1DMRA 2DHEA 1JR3A 4WVLA 4B6EA 3L4BA 4EHHA 3V48A 4EHFA 1NZJA 3CUWA 3G7NA 3Q41A 4OM7A 4TWZA 3HLTA 1FS6A 2JBAB 2ZTLA 2GETA 1DZ3A 3DUWA 3QK7A 5I9NA 2DECA 1O94A 2FSVC 2QS9A 4G84A 5DK6A 2Y6VA 2P0YA 3PT9A 4C5CA 3GCGA 4ZAVA 1WHTB 1Z26A 2O2EA 2ZBFA 2UUBB 5LU9A 2OZVA 5BYJA 4ILEA 1E7QA 2I2XB 1KRHA 3H9BA 4GG1A 2VSXA 1NFRA 1CS4C 3C5HA 4OP2A 1E9RA 4XGIA 3RGWS 4DBVO 4JB0A 1Q77A 2CVOA 2PX5A 2V58A 4NPHA 2IOFA 5BV7A 2JB9A 3LZ6A 2J3JA 2QTBA 4FFWA 2POCA 1BKYA 2WD8A 3JZDA 1G8KA 3NO4A 3ORHA 3Q11A 4H7HA 4NICA 5H83A 4C3VA 4GBED 4RK6A 4M9QA 2FSPA 1KS9A 5IXSA 1JIVA 4JHLA 1QK3A 1CNMA 3DOIA 4FYPA 4G5RA 1K6JA 1TQ4A 4MA5A 5J47A 2J5QA 2ZR9A 1P9NA 3LUGA 1QC5B 1G8JA 1XDSA 2ZTMA 3OIFA 3PQ8A 4NMMA 4ZOLB 2AT1A 5BYAA 2GESA 3F98A 3P27A 2HJRA 1JSLA 2V5AA 3UJDA 1OFIA 5ITZB 4L08A 4KWHA 3MK31 2NU7B 2RI0A 3E3AA 3R3WA 5J3JA 3DP9A 2VJYA 4PNZA 4Q1AA 4GLBA 3UWDA 3NDBB 4Q9KA 3NETA 2ZM5A 3VSEA 1SD2A 1CBUA 2EWMA 2PCLA 3KU4A 4BUJA 3OQMA 2WG1A 5FWXA 5AOCA 5I5GA 5BPHA 3IMGA 4HATA 2OUIA 4K6HA 2HZ7A 2PZKA 1GNLA 2E82A 1FRQA 3EXG1 2PG3A 3OHMA 1ZMBA 4V0NA 4PAMA 2C4NA 4ZO6A 1XL0A 1RHKA 2G0NA 521PA 4CM3A 1BJTA 4QHSA 4XOUA 1DBVO 1YJQA 1JIJA 4AW9A 4HQRA 2FMUA 1REQB 1R8YA 3TSAA 3U2QA 2IS2A 4F04A 3IT0A 4DLAA 3V8NA 4LRUA 2I7XA 3GDFA 2ZWPA 4TS1A 1YRYE 3DDSA 3K0CC 5DYWA 1JG7A 3ENQA 1EFHA 1SPBS 3A3NA 3FYDA 1R4MA 4BP8A 4QGFA 1NRJB 5K0GA 2HT1A 3GWGA 2Z1MA 5EHGA 4KUHA 5TPWA 1TOAA 2FPXA 4O4JA 4BNLA 1K3FA 1W76A 3N8DA 1U5CA 4L7VA 4IOMA 5J5VA 1M1YB 2ZAYA 5A6SA 1R0YA 4DV4B 3GEDA 2QZSA 4FCTA 1E6EA 1MG5A 3W8FA 3RVQA 4ZAGA 5EC8A 3K5IA 1ESMA 3RS5A 1PJTA 3IP5A 3FZEA 4YS6A 4F7DA 5KTMA 3MVEA 1K27A 3QV2A 1YT5A 5I9IA 3K9QO 1NG9A 4AJJA 1EX1A 1ZK1A 3KP1A 1ZICA 4AJ2A 1K98A 4QOIA 1KO1A 1KEZA 3P9ZA 5B7QA 2AW5A 3CRMA 1QH1A 3MTDA 2BZSA 1AUOA 1FZTA 3LCCA 4K9KA 1BDJA 1JR6A 1M2NA 3R41A 3ZQ6A 2E4XA 1KSHA 2BFOA 1JLKA 4DR7B 1X87A 2J8ZA 3I6MA 3GFGA 4ISBA 1E9VA 5CVEA 5J43A 1MPXA 1TK2A 3GXBA 3WGGA 3AR6A 1A7UA 4RCZA 4S1OA 1PV4A 4GQBA 4M37A 2Q4TA 4MB0A 2FDXA 2E4ZA 4O2AF 3WYCA 5AUOB 621PA 4I9HA 4D7AA 1NBMA 2CLDX 4JNCA 4Y9UA 2JHPA 3NYQA 1B8VA 4N5DA 1IXRC 1P9RA 4JROA 3HDQA 3NOQA 2JVIA 4BLQA 4UTPA 2JJYA 1U8AA 1ZD9A 4HZGA 3TKYA 2LGJA 4EB6A 3CRVA 4YROA 3LMKA 5BSMA 2FXVA 3OJLA 2XD9A 4C4YA 4BY9E 3HCPA 4QPJC 2XUAA 1EXDA 4OREX 2G6BA 2ZYRA 3DE6X 1PS9A 1UAGA 5GY7A 2LZ0A 1GUFA 1N6IA 3PPYA 3SQLA 4AQDA 4PC7A 1AKVA 1Z13A 1T5SA 3AV0B 4Q4DA 5KEIA 1I2BA 1U3DA 3T4EA 4QM6A 2FEXA 5P8WA 3ZLTA 4NBNA 3I9FA 3HFGA 2CMDA 5FNVA 1J8FA 4OAOA 4TXHA 5IH3A 4EM6A 3PCRB 3QVWA 2O8EA 3NYIA 5FPYA 4UFNA 4PEVA 2CLOB 2H1LA 5JCOA 3TSZA 4F71A 1XDUA 3ISJA 4URZR 1UPCA 1W4BA 2WDPA 3HN2A 3MRVA 3O47A 5A05A 5KOYA 2AFHE 1P6QA 4NV0A 1XWFA 2UZ1A 4XA8A 5DGTA 5I5EA 4MUKA 5E6UB 5REQA 3V42A 3EFHA 4HLUC 4OHWA 1EE9A 4DQUA 1R64A 4QDUA 1N9GB 2C2GA 4BPBA 2XWSA 2RGBA 1J7KA 4MR9B 5LMZA 2JGDB 1XCPA 2FH5B 4FE3A 4YTEA 4AWAA 4Z6KA 4AJ9A 3IDFA 3LQKA 2R9VA 3O38A 4O4LF 1E6UA 4UHCA 2HWXA 1V2HE 5EJ8A 1V4BA 721PA 2C2HA 2PFKA 4CE6A 3MC1A 3L8CA 3ZHSA 1EBFA 4Q3KA 2P2ZA 2C1EA 3CMMA 3H2YA 4J75A 4Q66C 4XIIA 3V46A 5MFPA 3LO5A 4R1QA 4YRZA 3DOHA 3LOQA 1RJEA 1AB5A 4L8FA 5AJVB 4U0JA 4PZ9A 2IYVA 2UZ0A 3X43A 4YC7A 5TMPA 4L5CA 5CLIA 1THZA 1U9JA 5E0OA 1XVUA 2GUWA 4C1NA 4TZKA 2A0WA 3C85A 4RY9A 1ST2A 3L92A 1K7SN 2IYNA 3D1JA 1JT2A 3CBGA 3CR7A 3ZK7A 1ILEA 3PE3A 4KR6A 2IL1A 2F00A 3CS3A 2W98A 5NLLA 3IP7A 3BGSA 4UVHA 1ZCAA 3HCRA 1QF7A 1KQNA 5L6MB 1U31A 2QP9X 2RDMA 4QLBA 5THKA 2ONJA 3PI6A 4B6JA 2OGSA 2QUAA 2CXUA 4QBKA 2AZMA 2P4EA 1T3GA 2P1ZA 2XOEA 3LT2A 2C5EA 4OL0A 4NBUA 4TTSA 4ERNA 1Z83A 4D82A 1CP3A 1ZHFA 1DLJA 2WM2A 3NJRA 3GMSA 3JZFA 4NBWA 1E4YA 2AMVA 3HU1A 1U2TA 3R3VA 4X8OA 3VJLA 2Q3MA 4O33A 1XEAA 4PF1A 1FP7A 1UBFA 4E5UA 3N2GA 1K6MA 4W9MC 2C7GA 3ZTTA 4LDJA 1AHPA 2XE4A 5JD6A 3EX7C 1RTTA 3WFIA 3L1KA 3URMA 3T1HB 3HY6A 1IBLB 1DUSA 2RAPA 3DEFA 1HYHA 2ZIVB 3CUSA 4I1UA 2OBLA 1O9HA 3RBAA 3AW9A 2ROQA 1Z74A 5ELMA 1RFGE 4LTDA 1NLMA 4LBWA 1GZ7A 1RLIA 1MHPA 1POXA 1VRVA 1E1YA 3HB1A 5LQNA 3E8MA 1ZPDA 3PCXA 1OXXK 2I76A 3ANMA 5EE3A 2GR9A 3X1ZA 1ZSVA 2GPJA 4M8NE 4PO9A 4XPIA 5KSYA 3TNFA 4Q5IA 1GYQA 1O08A 3HJCA 3WK4A 5CFZA 1PEKE 1QAMA 3DE0X 1BN7A 3J81k 1OFUA 4DVGA 1XMQB 1HQDA 3EB9A 4DDWA 4JLVA 4K9RA 3K09C 3PJRA 3IAUA 1BG6A 2X0KA 3GEHA 4P33A 1MLDA 2OZLA 5AW8A 5K8JB 1Y1LA 5JXJA 4INJA 1IY2A 4LZZA 3VPGA 3BMNA 3IUBA 2PAFA 2X0EA 4EG5A 1NUHA 2JJMA 1E61A 3DBOB 3JQQA 2WFZA 3UW1A 1CNEA 1MF7A 1QPBA 3LX5A 4C7MA 3T1VA 3MIIA 4HGQA 2JI9A 4LOLA 3ZWOA 4E70A 4BVBA 4MVJH 1TFUA 2CMFA 5TQ0A 1KI8A 1OFUX 3ORSA 3GCZA 3QNMA 4V0ME 3WOHA 2C7RA 4EJFA 1C0IA 2A5DA 4JL5A 5JQGB 1SJ9A 3IR5A 2P3OA 4E7OA 2AGVA 5KNDH 4XWAA 4W99A 3FGPA 5B36A 1H5QA 3WLAA 4PSAA 3OX3A 3DA8A 3GLGB 4OF4A 1G20A 3AOGA 1HYEA 5I45A 4KJXA 5CDFA 1MB3A 5HR5A 1W19A 1YJ5A 2B99A 2IYLD 5HE9A 2I2AA 1RQXA 5ALEA 4UU8A 5EIBC 2FPIB 2PX8A 3UMGA 2G8NA 2W6QA 2JAUA 4JXJA 3UMFA 2YV2A 2WSLA 2WDZA 1U02A 2AMYA 2PEZA 3NWBA 2PSJA 3QRWA 1B14A 5AI8A 2FKAA 3NHMA 2WINI 2CFRA 5LZ9A 2GKGA 1JPVA 2XKBA 3AVWA 3IT2A 4DA9A 2VHUA 2YZGA 2HD4A 1IAVA 2Q5LA 3VR6A 3ZVLA 1UJ2A 5H7XA 4G23A 4RL6A 3E53A 1RPNA 4I4IA 4GVXA 3SR4A 5JJLA 2JIMA 4NH4A 2HMSA 1JT9A 1AGYA 4MVJD 1L4UA 1FPMA 3HCAA 2BGWA 4Q12A 5FWYA 3G8YA 5B12A 2QZPA 3L4EA 2JA1A 1JEYA 1XFAA 2ZRHA 2QLBA 3USES 3JSAA 2ZAIA 3PDIA 3BWXA 1F12A 5P21A 5FR1A 1NDHA 2W0SA 3HB5X 1ZSYA 2PKWA 4GEKA 4LA4A 4LECA 1AO0A 2B35A 2Y27A 1Z4PX 1PTKA 4C78A 3QVGA 5KDOA 1HYGA 1UBMS 1D04A 4KUGA 1Z33A 1HFWA 2HLPA 1ZVKA 2KX7A 3DLHA 4KLZA 1U1DA 4WE3A 3A2KA 5I9BA 1M10A 1R0BA 4H1UA 2BCGY 5EUQB 1J8MF 2NPOA 1EA7A 3OMXA 5CVTA 1SQ6A 2LTAA 1JJBA 5HMLA 1T9ZA 5HCNA 2FR1A 3CRZA 1HOTA 1SUBA 2VAVA 3CSSA 2GS9A 4REMA 4OJMX 5IBPA 4TS4A 1QRRA 4YRIA 4R9NA 3OA0A 3EPKA 3AR8A 2J4FA 3QUBA 2AS0A 1OB2A 1EX7A 2XWPA 1NN5A 1VSQA 3MOGA 4IHJF 3U44B 2B4QA 2ECPA 3WLFA 1TVMA 1QVVA 1V1RA 3KVNA 4HD8A 5FCDA 4HUTA 1WDLA 3JQRA 5ALSA 2AN9A 4Z2YA 1V43A 2PGLA 1SZCA 4B31A 2G4LA 3E61A 3AKDA 1JXQA 4L8YA 1N2OA 5B64A 4HX9A 1W1WA 5PNTA 5KO2A 1JKJB 1XP5A 1OGJA 2FAXA 2VC2B 5DIZA 2B6HA 2GN4A 2J9FB 1U2GC 4IGKA 1Z47A 2XTAA 4LSGA 4II3A 1U2EA 3AVOA 3IODA 4RANA 1QDLB 3JQ6A 4OFWA 1Z73A 2QTGA 2B1RA 3BERA 1TUBB 4G07A 2H48A 4P4GA 3OE5A 2QX7A 3RFXA 2W22A 3PDJA 3GNSA 1FRNA 2JW5A 2FV8A 3PRJA 2QI9F 1SZDA 1W0KD 5SICE 4CEIA 3ND8A 4TL6A 1NULA 3NHBA 1TXGA 3HPQA 5I7AA 3RTAA 5KOIA 1CUZA 2HUNA 5DO9A 5HRUA 5FJJA 2B5WA 5CFLA 2JIZD 3LL7A 4C2AA 1OWOA 4H7PA 4M1EA 3AILA 4K7JA 3I5XA 1Q15A 4H35A 1VKOA 1EK1A 4BIMA 3M6IA 4ZV4A 2WAOA 1GVHA 4QXRA 3FRJA 4RJ2A 5LMUB 3U7HB 5A04A 1RPZA 2Q27A 1Z5VA 2CZGA 3KR0A 1CCWA 2DERA 4GPZA 2W58A 1RRMA 4W63A 4EG8A 2OYSA 1F6DA 2BZ0A 1LSOA 1CJMA 2Y68A 3E27A 2C82A 3CH5A 3EHEA 3GUCA 3KB8A 3W3AH 4CM4A 3H87A 3OZEA 2WZBA 4QHTA 3G82C 3R7NA 1TZCA 4LBYA 2DT5A 2R751 2RGDA 3IP3A 5DGCA 5JU6A 1QU3A 4QXAA 3W79A 1ZONA 2IEZA 4NMXB 1U0JA 2J30A 1A5SB 4WVFA 3LQQA 4K05A 4D8YA 5ALZA 3MCTA 4B6QA 4MHSA 3TB6A 3IX7A 4TV9B 2PX0A 1G5IA 1H2WA 1NZDA 2CYBA 4PZAA 5JCZA 3IESA 2NM0A 3F9CA 3ZDFA 2QLMA 1EJBA 1JHVA 2QG6A 1I6KA 4MUNA 2W00A 1F51E 3AIOA 4HLQB 4U4AA 1X1CA 3SXPA 4RK7A 4YV1A 2VWGA 3IIIA 5DULA 3U7FB 4DLPA 3EOAI 4FVTA 2HIAA 4WKPA 4ECAA 3SNKA 2QGNA 2EDAA 3OIYA 4JX9A 1DO8A 5U4QA 1S1CA 4GI3A 1VKNA 1TU0A 1CRQA 2A7QA 4HFNA 4L4XA 1XAJA 4MEBA 4KSCA 5TX7A 4RKWA 1TCVA 1N92A 1R9NA 1JJFA 1P6XA 4P5EA 4FE4A 4GAEA 1G3RA 3FHLA 3I5UA 5CA1B 3DR5A 1FDOA 1S3GA 2PGXA 1GL9B 3EPRA 2NUTB 3Q4GA 2WU0A 4BUCA 2FEKA 1ZGCA 3HEAA 5AVUA 3F90A 3TWOA 2XIQA 2NXJA 2FMIA 5ALDA 2QX8A 3FIUA 1HDCA 4Q03A 4B82A 4X1YA 1WL8A 1N1DA 3RFTA 2HJ9A 5FYDA 4UFPA 4GD3Q 2GH1A 1PJRA 3QVOA 3K71B 1E59A 4RFVA 4DANA 4EDHA 5HTOA 3KUKA 2W2MA 2ZQYA 2XLCA 2ZQ5A 1RI1A 3CT6A 2CBZA 3WSWA 3N2YA 1WU8A 2I3AA 2QSUA 4JR2A 1VJRA 2C4KA 4NEGA 2ZT7A 5A6SB 3REFA 3V1LA 4KVGA 3L8HA 4EKDA 3U5ZB 3MPOA 4H59A 2QRVA 2YXEA 4YDSA 5JR3A 2IXEA 3B1JA 3VNAA 3JRNA 2GLTA 1N2BA 5B6JA 2HQBA 2Y1KA 3QXHA 4TTRA 4R2IA 3GLGE 2JD1A 4D9NA 3AYZB 3ZCTA 2JZNA 3VR6H 3BKWA 3LRPA 4ID9A 1C7QA 3UENA 4F46A 5KYXA 3LXXA 2IHYA 4UHEA 3LKVA 1H05A 4MUAA 4TZTA 4YUWA 5ES4B 1FDVA 1ZWKA 4P83A 1E0SA 5G1NA 4NYJQ 1GFIA 1E2PA 3CONA 3IP6A 2IXBA 5B4VA 2XNDA 2ZUVA 3MW8A 3V4OA 2HIMA 3JVVA 2UVDA 3BH6A 2ZJYA 5CFQA 1ZINA 4QRIA 5E6SA 4XWTA 1TCUA 5C51B 4IWXA 1QP7A 4P0PB 2ZXEA 2D1SA 4MS4B 2I91A 3AF0A 1PGOA 4O2RA 3N2LA 2JC3A 4UTOA 2YWBA 1SKAA 1TAHA 3K2QA 1XF1A 4XWOA 4ENRA 3NJ4A 5LD2B 3PJEA 1K4KA 3CF2A 2PMBA 4BZPA 3DXZA 5KNDA 1EP3B 1JDUA 4GBMA 4GI7A 4PHTA 1L3IA 4ZAYA 3AP2A 1ZNZA 4CV1A 4DDKA 1NW6A 4IHJA 4RSRA 4B2LA 1Z7YA 3ZNQA 1HH4A 3IAFA 5CEFA 2WI8A 1AZLA 3T9BA 3W6PA 1OWLA 1NXOA 1G6HA 1WMAA 2P3LA 4U00A 2ZLBA 2XKAA 2XR1A 2R66A 2J3EA 1SGWA 3EFEA 3OT1A 3SEZA 3WHPA 2FFHA 2XXJA 2AKEA 1CRLA 3EZFA 3FNIA 3HEMA 1YR7A 4RHFA 1EGHA 2JBWA 3IBTA 1C9YA 1PL6A 2D1YA 3AM5A 3IVCA 4DWVA 2O8DB 4IIJF 1LJLA 1MJGM 1K97A 1W29A 1BJRE 4M6WB 1T2AA 4X93A 4KDEA 5JTTA 4AL4A 3UHAA 1RDFA 1LBQA 1WW3A 1WCIA 2QJRA 3E7PA 2Z9DA 3G1WA 3QSGA 2EFGA 4LYAA 4U2DA 3B7PA 4I6JA 5EIEA 3FPHA 4RSMA 1N32B 4ARZA 4R98A 2Z56A 4FD2A 3ZZMA 3AL2A 3QTLA 2L18A 2K87A 5EXSA 5U1PA 1HFKA 3U0BA 3VGJA 3ZBPA 1UP7A 4BX0A 3ZTWA 1NVMB 2QE7D 1HEUA 3I9LA 2XMGA 3QWBA 2WHXA 2WU8A 1X86B 1EH5A 2IZ1A 3KU1A 1YONA 3P2MA 3TI9A 1W4LA 3ZTYA 2FPKA 5BWCA 1R6DA 2C2ZA 2FE1A 1MMFB 2H9AA 2Q2VA 4X63A 3D6MA 3OHSX 5A3RA 1HDGO 3UA3A 3O1LA 5CX1A 5ITVA 4GI1A 4D8TA 1C3XA 2WWRA 3L5OA 5EKTA 1GGMA 2FHSA 3WV4A 2R47A 2FPWA 4GOOD 3FYSA 4KNVA 4UTVA 4RTRA 1GQQA 1UM8A 2VEDA 1FUUA 4KWTA 3UG6A 1USKA 2PAAA 3FF1A 4A03A 2H7XA 2ZBDA 2GNOA 3Q7SA 1ZJWA 5B2EA 4BWYA 3MXOA 1Z8DA 3L0ZA 3PE4A 2XZPA 5IASA 4F11A 1DJQA 1CZKA 3B7GA 3CXRA 3TLKA 5EL0A 2A9OA 4JQYA 4AO6A 3KFVA 1N1GA 1TLTA 2CEAA 3AFHA 3JASB 3Q8XB 3QXXA 3WI7A 4D0LB 1Y4DE 1DAKA 5K3AA 4E88A 3Q5EA 3GEIA 4HDKA 1SXJC 1JL3A 1Q1AA 2VP3A 1TM7E 3R7LA 2TMYA 4WRRA 4X00A 2ZT5A 2YJTD 2A94A 2XUZA 1L9XA 4G41A 2OK7A 4CLXA 1KO7A 1QYXA 3VPHA 5ICGA 5ALKA 5F33A 1E4VA 2YL2A 1M83A 3AJ8A 4ZO4A 3RQIA 2EKBA 3H9QA 4OHUA 2ZE6A 4NDZA 3RTDA 3T7DA 3ICQB 2W2VA 1LBTA 3AB3A 1FRFS 4NX2A 4B4VA 1XAIA 2VSNA 1LW6E 3V4VB 1B6SA 1HT2E 4WY5A 2DHDA 4ZGWA 3H2KA 2XZLA 4YMSA 3AI7A 5KCZA 1K7FB 4E21A 2P2LA 3ZJYA 4BNDA 4ZHQB 5BVHA 5B2ZA 1I3KA 2JS7A 1DHRA 4YACA 1U6IA 5FLEX 1TKAA 2O3JA 2JIBA 2GHTA 1Y8QB 1XC7A 2P9ZA 2JAOA 2SHKA 2WAYA 2ZR7A 2GM3A 3C6MA 4WH0A 1J2YA 3G02A 1YL7A 1ADFA 2HGZA 3KSBC 2IV7A 2GN2A 3NMUF 1RQ2A 4H3HB 4DDUA 4RK0A 2VTDA 2Z9CA 1I0ZA 2PKEA 3MFYA 4YVFA 1T9KA 2WKRA 2D1RA 3CX8A 1KYVA 1RRCA 2C4UA 3S0JA 2XT9A 1NKSA 1TRHA 1ZL2A 2W71A 3PG5A 5BSGA 3L43A 3AUUA 4OUDA 4ZT7A 3N07A 2CDRA 3TZCA 4G0OA 1DRKA 3P2JA 4BNUA 1KDPA 5AKGA 2AC7A 3FUCA 1U3CA 4BJ1A 1CNFA 4S35A 4LG1A 3RSGA 2ZW9A 4YMLA 3NWEA 2CCGA 1XALA 5DTJA 3OJWA 4BB0A 3FGNA 3ORFA 1E20A 4UBNA 2R60A 1GTVA 1KVUA 3FCSB 2X9NA 4JT9A 4GX5A 5B7PA 4HDKB 2VQFB 3G17A 2OVBA 3E2PA 2VJCA 1SPXA 2FN8A 3PGJA 2SICE 4M8KA 4RU1A 2F2TA 4FI3C 3REGA 1QP0A 3ML1A 4G5FA 4BFWA 1AKEA 4ETNA 1K9VF 1PUJA 1OHHA 3NUGA 1XTVA 1E2EA 1XLTA 2PGIA 4ZFNA 4J1QA 2EF1A 4CKEB 3E4CA 5CHEA 2E6UX 1V6AA 5CHYA 1HM5A 1QF9A 3TO5A 3QELB 1IXKA 1ZKMA 1UF9A 1IPFA 3TXXA 4IDPA 4GF5A 2IWHA 4HX5A 3ZU2A 5JDIC 4S05A 3CR3C 1UBTS 4EW1A 3E7FA 1K66A 2DLDA 1NPTO 2EAUA 1EINA 2QN8A 3OY2A 2C5FA 1KOFA 4ID3A 4JELA 3HA2A 3LLMA 4HC4A 4V1CB 3E48A 2F59A 3CVVA 4K8OA 3ZDCA 2DR3A 5HKBA 3DCIA 3FFAA 1MNAA 1P5ZB 1G5TA 5CIQA 4AZ0A 1TA9A 4QOGA 4ZOEA 1U7DA 4BQSA 4RH0A 3LBIA 4C20A 1E7SA 1WUYA 3O2JA 2HJWA 1YE3A 5IAOA 4FD3A 2HCRA 2FCRA 1KOGA 1CDZA 4OB7A 5H68A 5SZHB 4CIDA 1PQYA 3QKRA 2MSDB 4X7RA 5HE8A 5K20A 3J7TA 4MAAA 3DJFA 1Q16A 3U4DA 1GQYA 4R2MA 4TQAA 3WO0A 4FC6A 3EXAA 5IUNC 1GG8A 5AHOA 4EF6A 1G291 2PVPA 3L40A 4PE5B 1CULC 3VPAA 1ZK4A 2P75A 2OGZA 4CU2A 1NXPA 2QYTA 2B4TO 4HDOB 4LNHA 3SF8A 4ZI2A 2FKNA 2F17A 4OQFA 4ZK2A 1XJ5A 2BL4A 3AK4A 5IJAA 1IC6A 1QX4A 4ZJPA 4IH1A 4AZVA 2GLUA 5SY4A 4FYHA 2E37A 3JAWB 5BP7A 1V3UA 3LXRA 1P31A 3DT6A 2YYSA 2FWPA 5KYXB 1ZR4A 1M0EA 1YB4A 1NTRA 2VG8A 3FUWA 4HEJA 4OHCA 1W5FA 1T8SA 3SHVA 2G1PA 1TZBA 2Q4BA 3TTSA 5JAOA 3D31A 2AC2A 4BYMA 5B3LA 4TGLA 1U9CA 4Y2QA 4U2GA 3P2YA 1K6XA 2J67A 3FWZA 4OGFA 5ERXA 4XWKA 2ZPUA 2BMVA 3OUTA 1P44A 3CLUC 3FN4A 4U2BA 5JROA 1YVRA 2PKRA 4G0UA 4CFZA 5JD5A 1ZNQO 1S8AA 3EZXA 3FTCA 2RIRA 1UMBA 1NIPA 2A33A 1QG0A 1J8VA 2LE0A 4P7GA 4PZPA 1ZKDA 4M99A 4H08A 4R8SA 3X1JA 4EHKA 4MKFA 3U62A 4N5LA 2YN2A 4MLCA 2ZJZA 1Y7PA 2NGRA 1UZAA 4UOEA 3NBAA 2WTBA 3LHFA 2IPMA 3L1UA 3M83A 3VSBA 1WCYA 2DVMA 2ZROA 2D62A 2IHJA 3CRRA 3E8XA 4NYMQ 1V5EA 3ANLA 3EAFA 3NTLA 1R66A 4QUKA 4G1CA 3H2ZA 1US8A 4KN8A 4N0EA 3O4JA 1CJUC 1G4UR 3DT9A 3U39A 5BYKA 5JLJA 1QPZA 3NWPA 2YVKA 4K86A 3TOCA 3VOBA 5LNK1 2P90A 4CL3A 3ZW9A 3AVTA 1TEHA 3K9HA 1X8LA 1HR0B 1AURA 1N4DA 1JTEA 4ZCSA 4RTOA 5KCMA 3E9QA 1AV7A 1JQDA 1KZYC 4JP2A 3RVDA 4YAGA 1N6PA 4S0XA 1KKMA 1O9GA 4F9EA 1TJNA 1PVVA 1LDEA 1OSNA 1QJCA 4X85A 4E5MA 1TGVA 1OH8A 4G9GA 1NIJA 1Y6RA 4B1FA 3HU3A 5DRTA 4G4IA 3VU8A 4HNVA 1M8JA 3T1YB 4UE3S 2BHRA 2QHXA 2LBPA 5GGXA 1KETA 1JSCA 1YJAA 3GD5A 4J7XA 5IKEA 2O59A 1YQWA 1XZHA 3D7MA 2PO5A 2CVFA 5T3UA 3BMCA 3RUIA 3CT4A 1SULA 4PCAA 1UINA 4YJDA 1NU6A 3TRJA 2P1DA 2CD7A 4DBZA 1GNSA 4MZDA 2PU7A 3KYCB 4OXRA 3SOPA 4J6EA 1O97D 3DE1X 5JNSA 3X1DA 1T9BA 4TV8A 2KYRA 5JDCA 3PDHA 2OB1A 4WBNB 2D2FA 2Z5VA 4R2LA 4F45A 3P20A 3QBTA 3SDSA 1THTA 2XA9A 4BRWA 4H3VA 1Y5LA 3BCSA 4X1KA 4D9IA 3DAOA 3IALA 4L8GA 4ND5A 4YJ2B 4D9BA 1UJ4A 3UGTA 1EEXB 5EHXA 1A2BA 1G2QA 1PNTA 4PTZA 1D9XA 3F3KA 5AW3A 1DP4A 3WO1A 3SQWA 4Z4CA 5J5CA 3STUA 3R0XA 1PV1A 3IQHX 1A8QA 3SBOA 3TSCA 2JZCA 3BPSA 2VT6A 3EVCA 3E9EA 2GI4A 1A4IA 3QKSA 5AR1A 2FE4A 3MMXA 1ZG3A 4UE2A 4KPYA 2CHFA 2C2YA 4DA6A 2PLFA 5L6LB 1XZEA 5H9WA 3H2HA 3RS8A 4IDBA 5TDHA 5JXIA 1QGAA 4QJ4A 2PYDA 2XUFA 3CUKA 1HSZA 2ZVQX 6Q21A 4YLYA 3IRVA 4ZMSA 4XUCA 3OJXA 1JHAA 1ULHA 4WHMA 4MRMA 1JTVA 4OXYA 2VAWA 2YVQA 4ZARA 5DBIA 5T5QA 4DM4A 3QVTA 4J03A 2EFDB 3S5UA 3RRJA 2IP2A 1XTRA 3USCS 4F4HA 4YCLA 4LJ8A 1VPTA 1YHYA 2JGAA 4PSUA 1FX0A 5DBEX 2XYVA 3PFCA 2J9RA 1MA3A 3FBGA 4GMDA 5HUHA 1YJBA 3ZWYA 4DJFC 5JD4A 3AG6A 1RHJA 4BO7A 1P2GA 1ZVMA 1UMKA 2ZS9A 2VH2A 2B7BA 3SKVA 1Q20A 4G01B 5L40A 3B1VA 2A3NA 3OX1A 3T1TA 1C14A 4BB6A 4XLTA 3EXHA 1R8JA 5T41A 2E4YA 3MBOA 4FNMA 3PFWO 4DHWA 4FJ2A 1XDGA 4YWJA 5FTNA 4MX8A 4EY3A 1T34A 2CL6X 1NXQA 2XSZA 2P62A 4PHGA 1M8KA 5CRIA 3V2GA 4AIIA 5HM8A 2PNFA 5JXHA 2PUAA 5EE1A 3AINA 5FXMA 3ZLBA 2I4TA 2FEMA 2O6LA 3Q9NA 3EQ8A 4BE7B 3ADDA 2BMFA 2QE6A 2OWEA 2J48A 3A06A 1L6IA 3DO8A 1OLSA 3CPHA 4J2HA 2VQEB 4TSFD 5FPPA 3EISA 3GLKA 3IULA 1XRJA 2E6KA 3LFUA 4L51A 4BFXA 4P81A 3IVGA 3JW8A 3SHTA 1Y3CE 4QNRA 1NLUA 1DC5A 3MM4A 5JD3A 1T5HX 1YR1A 2AN1A 1TMYA 5GWXA 1J25A 1CVLA 1TZJA 4Z7JA 2UZ1B 2XRMA 4CKWB 1MX5A 2SBTA 3PPVA 5DM4A 2H2IA 1X7XA 1OAOA 1E18A 2QVCA 3KTFA 3Q2OA 4LE2A 5B58T 3IOYA 1TB4A 3R1IA 1OTYA 4J2OA 4XM0A 4HN9A 3BJMA 4Y2GA 1PK8A 1LF5A 3RRFA 1Q50A 2CLCX 1W9MA 4RKEA 3M3DA 1J5XA 1TMGE 3INNA 3HNPA 3B9BA 3OPNA 5BSHA 3FNHA 2VPZA 4HTFA 2UYCA 1FRVA 3P9PA 1FYXA 5HIAA 2Q9BA 4LW8A 3Q7EA 4KI7A 2FW0A 1I2DA 2WFMA 3I39X 4DQVA 2Q6IA 2NYRA 2HJSA 2PA3A 4M4SA 2M32A 1A2KC 4PTYA 4RZ3A 3AM1A 4GYJA 3NAGA 4P3XA 3L0YA 1GTJ1 2Y92A 4Z9BA 1W7AA 3AQ4A 4PS0A 3W78A 2BGRA 3DTYA 2QRJA 4FJ1A 3SAJA 1OC4A 2Z04A 5A4DA 2IYOA 1G55A 1PT8A 4F5ZA 5AW0A 1G5FA 1SURA 2I99A 3RB8A 2YDXA 1MAUA 4PG8A 4F4JA 3MJFA 4FMCF 3E2MA 2HCBA 4LKOA 4C0SA 1DO2A 1QFJA 4GR5A 5JYDA 1S5PA 4ZVSA 1OBCA 4IMPA 2VZ8A 1FF9A 1WXWA 4NZYA 2XGJA 4Y1RB 5FL7D 6PFKA 5FULA 4TL8A 1KSGA 3QTBA 6NULA 2ZS7A 4NZPA 3QOXA 4DC9A 3PGA1 2ZS8A 1IJKA 1NBAA 1W4ZA 2FRDC 2NTEA 4TV8F 4KZKA 3SLGA 1G3UA 4QUHA 1W6RA 2NT4A 3EQ2A 5KINB 5HMMA 4D98A 5JCXA 4DJTA 3EXIA 3IHLA 4N3NA 3CTMA 3T3IA 2W6NA 3HRIA 3FVQA 4K1LA 3PXEA 2PFGA 4NZZA 1Q12A 2NUAB 3RD5A 2X7HA 3F9RA 2W2PA 5BVGB 2EFCB 4MVJP 2D0DA 3VSDA 5ETJA 1G2OA 3U1BA 2P9JA 3FTNA 4LJYA 4P53A 5EIOA 5DCLA 3IBGA 5IM5A 1UBJS 10MHA 2JJ1D 1TQ2A 1ZGBA 5IKOA 1MORA 4MRRA 3E9NA 4S1NA 5JS2A 1CDEA 5FBWB 2IPNA 5I8WA 1JIIA 2VDLB 1T9DA 2P69A 4RZIA 4B0OA 1NASA 1FU8A 1MJHA 3RYIA 3UCEA 4F56A 1PQWA 1WPRA 2C5HA 1M34A 3QJGA 2BE9A 4D4MA 2WZDA 3EARA 3NNDA 3THWB 1HORA 3BXGA 1KZGB 3WK7A 1C81A 4OGWA 2QTCA 2JDIA 4FFBB 4A8JA 3EE6A 3MMSA 4TL7A 1BEZA 1JDBC 3O94A 1QGYA 1QHFA 3SJBA 2ZRPA 3HY4A 3QH4A 4N54A 4XGNA 1PNVA 1S02A 1ZUD1 2A5LA 4A0QA 2QVLA 2Q21A 3ZXSA 2HDHA 2BY4A 1EVKA 4I6GA 3LFTA 3MUOA 3G2MA 2QMQA 2E5WA 5A3QA 1K5HA 1FW8A 3ICOA 2CNBA 1JG2A 1YWGO 1AF4A 2D4AA 3KB2A 3NOXA 4KAJA 2ZR8A 4MRSA 1H3NA 3I4FA 3RWMB 1KVRA 4N03A 1GITA 3DE2X 3FYUB 3KOMA 2W37A 3L3BA 3P5SA 1R8QA 3C15C 1JH8A 2BBOA 3QQ5A 4NTZA 3ZNPA 2IBSA 3FMPB 3M6AA 5LP6C 2AG8A 1XRLA 5T3YA 2ZR0A 4OB8A 1YACA 1KJZA 2WJHA 1TT5B 4DKXA 2X58A 1CUAA 2RONA 4LHWA 1JHYA 1OA0A 4MYUA 4YDRA 5A5FA 4E5KA 5ER6A 1JV2B 3M1IA 2QNRA 3FCEA 1HDIA 1LZLA 3NHZA 5A02A 1SQSA 4M46A 1P73A 2LIVA 3FIJA 3LBFA 4ZMBA 1AD2A 3OFVA 1G21B 5B1EA 4CM8B 2DCUA 3KZMA 3OQ6A 5JDCC 1NF2A 1E2DA 2ID7A 1E2HA 3M6VA 3CRQA 5IVDA 1KI1A 2FEAA 4K40A 3FBTA 3ZWAA 1C4WA 1P9OA 4HHEA 1FP4B 1PRYA 5IDXA 2GBPA 2R6R1 1QJ4A 3L8FA 4OQQA 2RGCA 3JAKA 4TMXA 2EV9A 1DEOA 2AB0A 4MS1B 4D2IA 3ZDBA 3WFJA 3MJTA 4OJQA 3IPYA 1FFYA 1YS4A 2BGNA 3WNZA 5T4BA 1BHJA 4LJ7A 1B4DA 5FPHA 1KYWA 4BO1A 1CF2O 3CZCA 1KO4A 4M89A 1ZM9A 3OZUA 2NU7A 1H6CA 1E8MA 1I1OA 4MQEB 2VDQB 2NX2A 3K0SA 1X1AA 4NNOA 3ET4A 4EFLA 4HTAA 3D0QA 4W7HA 5HQ3A 4BQNA 1YRHA 4AVYA 4L0CA 1TK3A 3IPCA 3PWSA 4HAXA 4PCVA 4PNPA 4LY6A 1NVAA 4NBKA 1L8QA 1GFSA 2ODTX 3HS3A 1Z18A 4Q4JA 4TRRA 5CA0A 3TEMA 1EP9A 5LIRA 4Q1CA 4L28A 4ZOQI 4BVAA 4UOQA 3L7JA 6AT1A 3A1EA 1H2AS 2WUEA 3D8TA 2C61A 4AU1A 3F6SA 1V96A 3B12A 2G1AA 1PL7A 3WL5A 3UAVA 1A9ZA 3GJ0A 4IQ4A 4I9GA 1G8MA 2Z43A 4Q4JB 5CA0B 1F0YA 2Q8QA 1NC1A 2ZIFA 3INYA 2OBYA 4R1NA 1OAOC 4B7UA 5JXWA 3V8MA 2CW5A 3V55A 3RM3A 1COWD 1DX4A 2GA9A 1ULSA 1DKQA 3BXFA 2W6OA 3D5QA 3HWSA 4M76B 4U9UA 5JBIA 2GYYA 4TYNA 4GPBA 3FHCB 1XZPA 3VJRA 4ARCA 2B25A 2R62A 2C2OA 3D2BA 2VK4A 1VM6A 4Y0VA 3SM9A 3E9DA 4HDAA 2CB0A 4IVRA 5TNXA 1UUFA 4KMOA 4MYCA 1ZOOA 3RBVA 3KZCA 2P5TB 3NI2A 4FGJA 4BFUA 4J3NA 1SRRA 1BDMA 4JHXA 3IEMA 2ZRMA 1S96A 1V16B 1SVUA 2GKSA 3CJRA 1KR2A 3JAKB 2BPOA 3LDGA 4JL8A 4N3AA 3ES9A 4R8VA 4TUYA 1MCZA 3GYGA 1UWVA 4W5HA 5JLAA 2BHSA 3N8KA 4XYBA 1G98A 2IP4A 4D25A 1TYAE 4LUCA 8GPBA 2NIPA 1AOXA 2RCYA 4Z7OB 1WETA 5LMCA 3RFVA 2R2GA 1YFJA 1T8RA 5FLXA 4AI6A 3CB4A 4Z0HO 1WY5A 3BJRA 1E98A 2YHUA 3G2LA 3Q15C 3DV0B 3V8RA 3CGWA 2DT8A 4CMEA 5E7IA 1HTBA 1C5KA 4Q3NA 4LWQA 4UPEA 1BYUA 3IUNA 3M5CA 2HYIC 3G8DA 3I2GA 3IOCA 2KLBA 2BKVA 2DBZA 2KHZA 3GEBA 4PICA 4F2WA 2PJRA 1BE1A 3D8SA 1ZK3A 1JEEA 3C5WP 3JD0A 5D6OA 4ND8B 1Z5ZA 2B8TA 3RS2A 3T3PB 3Q3EA 1QHGA 1TE2A 4FIDA 1RYNA 1CR0A 2VHEA 3ZXXA 1Y5NA 4O5OA 1DDIA 1M1YA 1DQRA 1LF0A 3ST7A 3JQAD 2V6GA 4QBGB 4FFSA 3GAMA 2XUPA 2D2EA 3JQ8A 3C4JA 3R6TA 4KPUB 5HTKA 2HT6A 2DLCX 3GFRA 4W1SA 4TYMA 1L5VA 3B13B 4FDMA 1U7HA 4ZI3A 4GLOA 5K5EA 3LRTA 1E3TA 4LV5B 3WIDA 5K0ZA 1RBZA 1Y4ZA 2HRBA 4IQ0A 3ANYB 3DUFA 3AR4A 5AW7A 2QN2A 3JQGA 4BAZA 4EMUA 4TQUS 1FVHA 3KR2A 3A1VA 1TM5E 3CCFA 3I23A 5JEDA 4J1SA 4RZ2A 1N2IA 1PEDA 1W1UA 3MZ0A 3UXHA 1HDEA 1V16A 3E8SA 3P9YA 2J6HA 3NNSA 1HURA 4FEEA 4L7QA 5DLEA 3SPXA 4D5EA 4JI3B 2C2MA 4C4TA 1Z4LA 4LHXA 3UBTA 3OEED 1D6JA 1KFJB 4EI7A 4YX9A 3EF1A 4DV1B 4F8JA 3EIEA 4TLEA 1FJHA 3KE9A 1RJFA 4G09A 4UZSA 1NW9B 5JQGF 2BH9A 1M2FA 2Q2NA 5K4AA 2IYUA 3AC0A 4BFLA 1N57A 3I61A 5IAAA 5CYFA 2AVNA 2RHLA 4FYYA 5D00A 1LD3A 1TKRA 1FNCA 2ECOA 3CNLA 3G2OA 4R54A 4MI6A 5TC4A 4BN0A 1PCXA 1ZRHA 1RYDA 1BE8A 1Y1PA 5EVJA 1A5BB 2YZNA 4YCDA 5H3CA 1ZM4A 4MEAA 1CC1S 3TRKA 4B09A 5JRJA 1KQGA 4HXFB 3OO0A 4MWDA 4Q24A 4XB6B 3AZOA 5ALPA 3PUJA 5BMOA 1MTZA 1K89A 1UJNA 2FEOA 3PC8A 2XB4A 4YP6A 4EJSC 4CDRA 2XAUA 2PT9A 2VUTA 4QOJA 1QTIA 2QQ5A 3SY8A 1EESA 1B3RA 3HWX1 4YR9A 2O8FB 4UBLA 1NJGA 2VTEA 4C05A 3DMPA 3RJTA 4YPFA 3ZVKA 2F3RA 3EGIA 1OI4A 2HSWA 2FW7A 4M9CA 2V6IA 4HDCA 3VXKA 3WGJA 1F8UA 1RPTA 3EMKA 3GMDA 4GECA 4LCJA 5ALLA 1FXUA 3Q9LA 1ESNA 3SYNA 3SLKA 1RPAA 1T4DA 1NE7A 1L8AA 5DHTA 5LQSA 3TKLA 2BI7A 2I7DA 5FORA 1WPXA 3B82A 3G0DA 4EYEA 1XZJA 1Y33E 1E4OA 1Q5PA 3JVUA 2IUUA 2BGGA 4LSMA 3ZIAD 3EZ6A 3HFSA 1VKJA 5IAJA 2XE7A 5H81A 4Z49A 3MF4A 5C7IO 2GHQA 4B5LA 3MCVA 1C3VA 4J4HA 1E4EA 5COQA 3MTQA 4NBLA 4PIPA 3UPDA 3JWGA 1WRBA 1QOZA 3FFXA 2XCIA 4HNQA 3NVMB 3V1MA 4BL5A 2MHCA 3HYSA 4KDFA 4ENSA 4RZUA 3N9IA 2I33A 4OQZA 4X6UA 4JBHA 3TW6A 4A1OA 2FZVA 1U3GA 2RK3A 5EPEA 3OU6A 4DIKA 3SSOA 3HBLA 1HTTA 1ORRA 2QRZA 4YV0A 1PHRA 3NTRA 1P1JA 3Q72A 4V39A 3UO8B 1PAUA 2DUJA 1NP6A 2CY0A 1ZGAA 1C9MA 3KZOA 3A6HA 3FSJX 5I6DA 1LPSA 2NU6A 2QDXA 1FTWA 3O92A 2VP6A 1PEYA 1FP1D 1KKLA 3FTQA 1NATA 3H3JA 4FBMA 4M1TA 3WQHA 4C0WA 1RR6A 4QYWA 1LFAA 1T5LA 1KPHA 1Z29A 3PZRA 5GJBA 3DFIA 5HQJA 1JAHA 2ILVA 5DT9A 4BNXA 4RACA 3C45A 4E15A 3TZQA 4DF3A 4ZCRA 1F7UA 1M6VB 3O8OB 2WEKA 3NM5A 2JL1A 3CPEA 3LUCA 1UWKA 1L2TA 2CXPA 3F73A 1KDVA 4Y0NA 4BS9A 2I0FA 4OQMA 2JI6A 2B3TA 5IAGA 4R68A 1WV1A 1I4WA 1T0PA 1NWHA 4XQCA 3I62A 5BURA 1SH7A 1BCRB 1MO2A 4A5SA 1IN5A 4IUYA 5DTRA 2CFCA 2XTJA 3CZQA 3DWGA 2Y66A 4ME6A 3ZV6A 1T2FA 1VCMA 2WWTA 3I9NA 1CRWG 3PWZA 2JEZA 4YA6A 3UJ3X 1JJAA 1P8JA 3W9SA 5CGQB 1YS6A 3OFSA 5KYGA 1A96A 2WU4A 4QGHA 4XH9B 4Z0PA 2DQSA 1H4SA 3FW1A 1ILWA 1EK2A 1ORHA 5JAZA 3KZ1E 1OVGA 4IFTA 2C0QA 2Q1XA 1E63A 3ZWWA 4FR0A 2F1IA 4WIAA 5FLKA 5KWJA 1PJ8A 1A5ZA 1XN1A 1WCV1 1GM5A 1XVAA 4D4GA 1EDEA 1XMJA 1E2GA 1VHJA 2YXDA 3B53X 3GT4A 4H6WA 1NYLA 2VP0A 4WZAE 1GR1A 2O2YA 1A9TA 3JVIA 3ZLVA 2Z6UA 1Z25A 3C6ZA 4M60A 5T4EA 3W4KA 3AM3A 1VCNA 5ENDA 1JE1A 2FQ1A 2JASA 3UYLA 5E3HA 4U1RA 1CSEE 3STXA 4QICA 4TQ9A 5KDDA 2R00A 1L4HA 4KBFA 2WHEA 4PO3X 1ZRNA 2OHFA 2ZZKA 3AHJA 4J29A 3BTVA 4NSNA 3DW1X 2CHEA 4KXVA 3BZWA 3FYCA 5KMGB 1N0WA 1SBIA 2HK9A 5BNWA 1WX1A 2MYUA 3LPCA 4JT8A 5AW1A 4OQNA 4RAQA 3RSLA 3WGYA 3FPBA 5CVJA 4OQEA 5FFNA 4DLRA 1G5RA 5DYNA 4RA6A 4AUKA 4Y1RA 2PZJA 1Z36A 3E81A 3OD5A 3UJNA 3LKZA 1S8OA 1VSVA 3IC5A 3MD0A 4Z4HA 1R37A 1XAHA 3FE2A 4G5HA 3O8RA 3RRZA 3QOYA 3UN1A 3Q6IA 4HEHA 3V4PB 1Z5WA 5JAHA 5LQKA 1QOQB 3FSEA 2PLNA 2HQRA 5EOVA 3SS7X 4GC5A 4IH9A 1OH7A 2O50A 3TM4A 1ZHOA 4R7TA 3RVMA 1BDIA 1PR0A 1QS0A 4XKJA 3AR7A 5K0TA 1OE0A 4D4LA 1D4OA 3VYTB 1WAMA 4BWVA 4ND8A 4X1OA 1S8FA 2G8LA 2J7PD 2XDYA 5CVDA 4KIUA 1U9IC 1W48A 3LT5A 1SFRA 5F1OA 1R5JA 5K8VA 3WWCA 1BC5A 2I8LA 4MGHA 4HPWA 1YKGA 2BEVB 1QFYA 1X1TA 2YUIA 1NC3A 1KAQA 4KX5A 3F78A 3X1WA 5C7LO 2H52A 1U8TA 5HQ3B 1R0XA 1E1QD 4WKNA 2LD4A 3LCJA 3OU2A 3P9RA 4PYQA 3BB3A 3FKQA 5EFZA 5EXPA 3L7MA 2IYFA 4EJSA 3ZC3A 4I55B 4RK1A 3GEEA 3IJ5A 2EHDA 5BSRA 4NCXA 3ZWPA 2BJHA 4J7CA 2OE2A 5AI9A 1AQUA 3DPIA 3GT7A 4ZQCB 2EZ9A 1MRNA 2GO1A 5DYTA 4QM7A 4F0JA 1NNI1 4Q7JB 4L27A 4O2BB 1GQSA 3D54D 3GLHA 4WMLA 2BFWA 4Z3OA 2VK2A 3EF0A 3Q5GA 3S27A 4HVCA 4KFCA 5AW4A 3OECA 1QO9A 1ULBA 2PGJA 2ODBA 2VNSA 3N05A 3QVUA 1O96B 5DVZA 4ER0A 1U3WA 4OV6B 2WG0A 4YCMA 5D6NA 3T94A 2WQZA 4F6RA 2UVPB 4DGQA 1L9KA 1JPJA 5TPZA 1JWBB 4OBBA 2QMHA 1M73E 4X8LA 2A59A 3CM0A 2PMCA 5AHWA 1MEOA 4PZZA 4BLOA 2WZCA 4WCDA 1WPGA 3A70A 4EGFA 1YRQA 4LK2A 2XADA 3FCYA 5DYGA 1E1CA 4J0QA 2JFWA 4PIMA 2WF8A 4AAYA 4GC9A 4B74A 4H9GA 4F86A 1BSVA 3ZCQA 4FSHA 3WYAA 1G5HA 5E6RB 4I55F 2GTPA 3LT4A 4RCYA 4Q19A 1FFGA 4J3FA 3TQOA 4F4FA 5IZCA 3UC5A 1XQ1A 2GZHA 3R5FA 4JC0A 3UJ8A 2AUNA 4BBAA 5I4IA 3ICEA 3ZD9A 2H1IA 4I1RA 3RVSA 5EQTA 5JMTA 5J4YA 3TQCA 5DTEA 4XAQA 1B0AA 4JX8A 1E3SA 3W7AA 2IHNA 3DB1A 4ND7A 4ND4A 4CGZA 1R10A 4FN5A 3U4CA 2JCGA 3O8DA 5ELLA 4Y2VA 2HHJA 3GJ6A 4LOHA 4YY3B 3HV2A 2O48X 1LSJA 4UJ5A 4HDRA 4EW6A 2O20A 1C3OB 3LVBA 2G40A 2PVSA 3A1FA 4FB5A 1OZFA 4BZXA 5K45A 1Z07A 1PR5A 3PIDA 4WXEA 5KQRA 4HDMA 4M8SA 2OV3A 3MSCA 1TMOA 5D1NA 2PJUA 1U0RA 2AJDA 5FHRA 2OWDA 2XB8A 4C3OB 4BVGA 4AUEA 4L9WA 3WLPA 3L04A 1G9SA 1YB6A 3EG9B 2H07A 1WLSA 1WSDA 2D5AA 3BN3A 3CA8A 3OLCX 1TAGA 5JVDB 1RRVA 4B3XA 4EWLA 2BEWA 3OFKA 1PG5A 4JV5B 2AN3A 2UUPA 4A2WA 1OCEA 5DNUA 3WWPA 1DHTA 1PQUA 4H2DA 3ZV7A 4XWWA 2PUCA 1AU9A 4DCSA 5C37A 3QHQA 2XDAA 4KO4S 5EQDA 2QRHA 4EY5A 3QJYA 5CPBA 4O4IA 3RC3A 1TF5A 3MBIA 1JFTA 4EA7A 4WXPA 3BH0A 3L7OA 1RWWA 5ESWA 1T8WA 5EWJB 3RIMA 3ILHA 5JG7A 3PHHA 2J0VA 4XUEA 4IDGA 1LNSA 4QPNA 5AYVA 3OCYA 5HVNA 3ZDAA 1T91A 1OI7A 3JD2A 1Y8ZA 1U2DA 1XV5A 4WJLA 5I01A 2EDCA 1CJTC 3LWNA 1E58A 3CW2A 2JGNA 1WZUA 3BSYA 3KVOA 2OYCA 1IBMB 5F1KA 1UBSB 1X15A 2HZBA 3EFOA 1EVZA 3KCQA 4Q4LA 1QIFA 4W6QA 4TV9A 4R71A 2QRNA 3G0CA 3R0IA 4D8UA 5MGNA 4CM9D 4V03A 3DE7X 3ZJ5A 2C5LA 3PFBA 1KYYA 1R5NA 3LNCA 1HLDA 4MKZA 2I6QA 4IMJB 4EFNA 3OKCA 2K5UA 4X1IB 1E0KA 4XYMA 2CJFA 4G5XA 1XQ6A 1PLLA 2AXPA 1US8B 2XNDD 3WISA 4E7PA 4DMRA 3W9UA 1NNLA 1K4YA 5JYBA 1VJ5A 2C95A 1NMQA 3G5TA 3NHAA 2GWRA 5G0UA 4KL8S 2O8BA 1PX2A 5DDIP 3PBKA 3U6KA 1EFCA 1CUGA 2REQA 2E85A 3HN6A 4JJIA 4CR7A 3VYVA 1PUXA 4X1IA 3NT5A 1KI3A 4BBZA 1ZY2A 1HK7A 3DEYX 2WT4A 2FN9A 4WBXC 2YWGA 4GH5A 3F5QA 3TQSA 1BHQ1 3GCWA 2ZM6B 1ZOIA 3I1IA 4OSEA 3B5IA 4WTOA 5MN4A 1YB2A 5E7QA 1ZR2A 3VSAA 1SAYA 3FDJA 1WKBA 1KYXA 1W49A 3B6KA 3EBOA 3IOMA 3PCTA 2AG5A 2Q9CA 4XASA 4ZVQA 5AWFC 2WJJA 4QJ5A 1ODKA 2J3MA 4TYWA 4CT0A 2AYXA 2I03A 3NORA 1PF7E 1GEGA 2YINC 3I8XA 7AT1A 4DXDA 1DQSA 1XEXB 2GBLA 3B9QA 4F2GA 1RKUA 2WK1A 7GPBA 1PT6A 2ZSFA 3ZHBA 4BB9A 2X1LA 2XTZA 2VA8A 3TLCA 1GUBA 4DSOA 1KPIA 3FWHA 3DD1A 2GYVA 2ZIGA 5ECGC 5ALMA 1P0FA 1AK1A 3C87A 4H1WA 1SG6A 2R5NA 5BQFA 1B6GA 1P2DA 2YWRA 2EW1A 3JZAA 1KTIA 3DJYA 3NUQA 3HR4A 3C70A 4J7UA 3FWYA 4L6IA 4LZPA 4KYUA 4XWGA 4LF8B 4FBGA 4LKRA 2HAEA 4Q39A 3N5KA 1PJ2A 4D4HA 1QTRA 1N3BA 4U7GA 4UZEA 1DUVG 1DINA 2JHFA 1TYZA 2ZT6A 2R8BA 1YDGA 3C48A 3DL2A 1CUVA 2OPHA 3REQB 1Z6GA 2VBGA 3K15A 3IAXA 3CWZA 4J0DA 4PGAA 3IELA 1XE3A 4DCJA 3GGCA 4XYLA 5IHXA 1NNSA 2ERCA 3BWYA 5ALYA 3HZZA 5ENZA 5TARA 5THQA 9GPBA 2JLAA 2V4UA 3GJYA 1XLWA 1DKOA 1OBVA 3UIEA 1VHDA 4M7RA 5CX4A 1SXJE 5D7NA 3OX2A 4EF4A 1J7JA 1T0JB 4IJQA 1H0KA 3GQVA 5LUBA 1FYFA 4HYYA 4OHRA 1NUUA 2GK3A 2NVBA 5AJXA 2X13A 1MR3F 5DOVA 6CHYA 2NU6B 2RK6A 2JAPA 1RWVA 2DWQA 3AUFA 4KXLA 1EK6A 4QPPA 1X8KA 5LBIA 2MSEB 3VU9A 1NF3A 4US0R 2BUAA 4NBRA 1GILA 3L8YA 1SG9A 3WGMA 5C2JB 4OMFG 1EFVB 5AM1A 1GR0A 1SB9A 3K7EA 4XX0A 5KVAA 3AEUB 3VPDA 1JLHA 4DW8A 1GGKA 4Y6LA 4NCIA 3L7CA 5BV1A 3SVLA 1A4XA 1RQ7A 2OXEA 5A5EA 2EFEB 3U1VA 3RUPA 5K3FA 1T1GA 2IGBA 2X1VA 2HA3A 1SM4A 2Z5LA 4N01A 2ZYVX 4O2AB 1MO6A 1O4WA 2WZQA 4BJ5A 3M33A 5WRFA 4YT4A 3TI7A 3EGDB 3F2VA 5B2FA 3K0HA 1O5OA 3QPWA 4HJXA 3RROA 3NBFA 1RVV1 1V71A 2DHCA 5D5QA 4LNUA 2NZXA 4ZZ2A 4WDRA 5BUSA 2AXQA 5AKXA 1YV9A 1T3TA 4ED9A 2NT3A 2JIZA 1EUDA 3AY0A 3PEUA 2P4QA 4I2NA 4RPGA 2Q5QA 5K0LA 3SC2B 4GQIA 5KKCA 3OY7A 4H3KB 4YRQA 2R0QC 4JKYA 2AMLA 2NSHA 4I1OA 1CF4A 1CR2A 2YZKA 4UE6A 4S04A 3G7UA 3PNLA 1IN6A 1YTLA 4J9UE 2GPAA 3KAQA 2VIIA 3SQXA 1AQLA 3KQQA 4RGYA 4BP3A 2O8CA 4G26A 1O6FA 1SCNE 2QVBA 3IAM1 4MCIA 4ITRC 4CMCA 1QZTA 1NQXA 3I6ZA 2RB5A 3S2YA 2F1JA 3R6GA 5K6AA 2VWQA 1CHNA 3CSUA 2VRCD 2FLVA 4EUNA 2PS3A 1XPOA 1VTKA 5EUBA 4P4UA 1CUJA 2VYND 3AJDA 4LF5B 3W05A 3DE4X 4FYVA 1J6UA 3ZIUA 4ZICA 1W0JA 1IM5A 5DCWA 3VO9A 4LVUA 3GLQA 1DBIA 2V7VA 1F1BA 1J1ZA 1Z4NA 3NLLA 5IKMA 2ENWA 5DJ5A 4ZOAA 3C43A 2JLVA 1KAMA 2GJSA 4HSEA 3BL6A 2EL9A 2ZRKA 3J80A 3C97A 2C78A 1G59A 3DO5A 5BSUA 3GWZA 3I2KA 4W7SA 3T7JA 4D0SA 3Q40A 1EB8A 3CO0S 2O0JA 3K2BA 1BGXT 4FLFA 4HRXA 1GYRA 1MT0A 2VYVD 2R00C 2YMLA 1LQ2A 3OQBA 2GCOB 3IDZA 5IFLA 4PZYA 3NEJA 3U7EB 1Z0UA 4MKRA 1XD2A 2PUTA 3DBVO 4U5QA 1KYIA 2B94A 2QNBA 2VWHA 3L7DA 3PJDA 4L74A 1LW7A 4XJSA 4LXYA 3R7FA 3H4TA 1NFQA 3QWAA 3D2CA 4FFNA 3P4XA 4TTVA 2O54A 2DPXA 1V47A 2A0UA 2OFPA 1A82A 4KWCA 4RZSA 2ZIXA 3OLWA 1T5DX 1QUFA 1JQ3A 1O95D 1P1HA 3HWRA 1NONA 1GFZA 2IHVA 2VO1A 3DC7A 3ILYA 3DNFA 2LXNA 3FZYA 4J2TA 4PGMA 3X3HA 4N7BA 3K6KA 1R2QA 1XCOA 2PQ0A 3TIXB 3V1TC 1G7CA 1L7VC 1WP9A 1JEJA 4BQFA 1H4TA 1ZN9A 4UQPA 4ACAA 3FKJA 1LNQA 4DUGD 1YI1A 2G5TA 4KFSA 1K08A 2QD3A 4H3SA 4FHFA 1SEVA 1Y48E 2MR5A 5B57C 2VATA 4YALA 1SVNA 2PZ8A 4W1RA 1I51A 3ZIDA 1JR3E 4IXWA 2RKWA 1XCJA 2DBRA 4X71A 1M2OB 2F3TA 4ZYTA 4YFVA 3NNNA 3TM5A 3HTXA 3BTOA 2PBFA 3B8HA 3AXSA 2C5SA 4LOAA 4F4DA 1X7ZA 3EDOA 3HC7A 2OCXA 4DMHA 4HFRA 5EUMA 1MOZA 2HOQA 2Z30A 3LVFO 1SVSA 1KOLA 1T36A 3LUPA 3KE8A 3G9TA 4YJ3A 5AVXA 4X8MA 4NZMA 1O8BA 3JX9A 5EIWA 4BO9A 4B17A 3ETNA 3LCMA 5DX0A 1GPWB 1GQOA 3G1UA 4B79A 2PZGA 3H9GA 2QAJA 1FTYA 2JI4A 1RM3A 2VQDA 3LQRA 3H8WA 4ZXPA 1CZNA 3FDXA 8AT1A 4U39A 1RJ9A 2VVTA 3R3JA 3AWIA 4ZAXA 3RCBA 2LRHA 4EEZA 2BELA 4ZRDA 2AMJA 3EJWA 3U7JA 4BN5A 3L6CA 1T4CA 5AO9A 4RFSA 1BMTA 3A1TA 3R44A 3Q5DA 3X1XA 5CNMA 5K8LA 5LYJA 1X1QA 4O1HA 1JKJA 2XYQA 4JY7A 3A2MA 1LGYA 2GFHA 4KQKA 2J3QA 4YJGB 5FUMA 3PNKA 2IEAA 1EG2A 1Z0DA 4I4CA 4OGLA 4MWBA 2PUEA 3IMKA 4MQ6A 1GLGA 1HE1C 5HZKA 2ZCJA 3TR6A 3SZMA 1JBEA 1JSRA 2QJOA 3MD9A 4JU8A 4QQKA 3H5OA 2WF5A 3PDWA 2AFHB 4YO8A 2AG6A 4RMHA 3TW8A 3OPXA 3C3MA 4IQ8A 1NP3A 4D8XA 3EN0A 3P5BA 2B2CA 1ATZA 4DIOA 1F0KA 2GQ0A 3F1LA 4EKEA 4MV3A 4DCMA 1IG3A 3EPPA 2ZYDA 5EZYF 2P35A 3IJPA 1SHZA 1VG0B 1A71A 4PHHA 5CIYA 3UMVA 3A9TA 3F3YA 4RA9B 4XVQA 4L9SA 3OF5A 3Q87B 3AFGA 3AERB 2Y67A 4Z7NB 4PHCA 1R6BX 2PLRA 1HRKA 1PG2A 2H1FA 3GLHE 2GASA 5ESXA 5KKNB 4DG5A 3PHJA 2SCUA 4BEWA 13PKA 2JGKA 2JGDA 3BHJA 1NW3A 3LWZA 1E3EA 2BDTA 1Y82A 2GCPA 4I5DA 2FW6A 3PPWA 4X7PA 5CM8B 1FPQA 5EUCA 3WJ2A 4MUIA 5A7FA 1FDUA 2B5VA 1CJSA 4Y3UA 1PNRA 4D99A 1PTJA 2FETA 1WXHA 3L0SA 5IC6A 3PD0A 5KB3A 3R75A 3DQZA 5EMKA 1DAHA 2WP8J 3QTTA 3GLFE 3TGLA 2YJZA 2ZVPX 1TDJA 3W1VA 4K0KB 4REOA 1ZK2A 3WJAA 3HKDA 5L4NA 3M4NA 4XD7A 3V8PA 1E3MA 1I1NA 2FVXA 1QP4A 2IELA 2WC1A 2Y9PB 2X3UA 4GMKA 2JRCA 1Z39A 1MRSA 3NHLA 5JAIA 4XX1A 2RGUA 3FOEC 2RFLA 4MOWA 1TU3A 4CTJA 1DAGA 3S81A 1GZ6A 5IKPA 4D4IA 2R25B 3LPLA 2A9KA 1I3MA 5ELXA 1OYVA 2R8OA 5EESA 1JAXA 4CM8A 1L5OA 2JIRA 4N8EA 3ZD6A 3H05A 1JIUA 4NHOA 1C1DA 4KNWA 3ICPA 2IBMA 4PPFA 1GUAA 1DWPA 1ODIA 2PN1A 2WABA 2P7IA 3CLSC 3D02A 5I3CA 5JFOA 3QX8A 1XCBA 1U1GA 4QULA 3AEQB 4NYIR 3RPEA 4C4ZA 2IXDA 5EYPA 5BYBA 1RM5A 2WWFA 1GP2A 1GZHB 5G1PA 1E1QA 2IOHA 4CDNA 1R7RA 4Q3LA 1XHEA 3ROTA 1AN0A 4IGEA 3TLJA 4X6XA 3FOWA 3R5XA 4YLEA 3MEQA 1V1MA 4R0VA 4LAFA 4UCXA 1H2YA 4HAVA 4OI4A 1K63A 5LA6F 3G0HA 4TYYA 3HFRA 2EGGA 4EZEA 1JNXX 3OVMA 4O4LA 1UZNA 3AX6A 4CMJA 2ZATA 2QSJA 2YFYA 1NOJA 1SUAA 3ENKA 4G85A 5K99A 4I4TF 2H5JA 3PPXA 3PQ7A 1NR1A 4F2DA 1P5HA 1R6UA 4YP0A 1N2XA 1M72A 1YRAA 1QGUA 2IYSA 5C34B 5SZKB 4D9EA 2IS6A 1VHWA 2ID8A 2IEDA 1BWQA 1NN3A 2JK0A 3SOZA 1QYDA 4JQCA 3VNBA 4GI5A 4YYZA 1KK0A 1IBSA 1SQ5A 4FMCB 4QEDA 3PLAE 1VSUA 2R1VA 4KO2S 3ZNOA 3BAFA 3M6FA 1NFFA 5TPZD 5IT9A 3HXQA 4D8WA 1F4PA 1AQIA 4FR2A 2X8BA 2R7MA 2DU8A 4QIHA 4U7DA 3ITEA 1U0TA 2EQ5A 3EA5A 3SXJA 3GRVA 4J16A 4UTRA 4EIWA 2H1CA 4ZVOA 3P9SA 2IGTA 2H0RA 3DBIA 4JK3A 4FM9A 4FZRA 1UPAA 1RXCA 4UDYX 5DWVA 2ID4A 3CRNA 2P9HA 1QO0D 4E03A 2B9VA 5DASA 4GIBA 2ZTUA 4KQWA 4G2NA 4ZT5A 3GVXA 2XWJI 4YUVA 4ETIA 5I7EA 1D6MA 1EDOA 2NZVG 2D5BA 2P0AA 3O5AA 4R5MA 4Y9TA 3UAGA 1A04A 4M9UA 4KRGA 4RKRA 5D3ZA 2HB6A 1FVFA 1I80A 1VG8A 3T9EA 4GRAA 3L7LA 4HPJB 5KYUB 1FQOA 5JJ5A 1A5AB 1JALA 3A32A 5JALA 5LDGA 5ESRA 3ZW7A 2O7NA 3MMNA 4WSOA 5FRDA 5L3QA 1TNDA 3SC6A 2HPAA 4WN3A 3C7CB 4LV8B 4UU1A 1C0LA 3CCCA 3UT5A 1X94A 2ZWOA 2CVZA 1K7XB 2JANA 4A8JC 5J23A 3ETGA 3K1AB 5JZBA 3F6PA 1WUTA 3EY4A 1AUPA 1DI0A 3MT9A 3HKDB 4LYYA