1N5OX

Structural consequences of a cancer-causing brca1-brct missense mutation
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
207
Chain Sequence
b'RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNRPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Breast cancer type 1 susceptibility protein
molecule tags Antitumor protein
source organism Homo sapiens
publication title Structural consequences of a cancer-causing BRCA1-BRCT missense mutation
pubmed doi rcsb
total genus 56
structure length 207
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1n5oX02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1n5oX01
3K15A 2ETXA 3KTFA 4XPZA 1T2UA 3PXCX 2WT8A 3JVEA 1JNXX 3OLCX 3PXAA 1T15A 1Z56C 5ECGC 1T29A 4BMDA 3PXEA 1L0BA 2EBWA 3AL3A 2M2IA 4BMCA 1CDZA 3K0HA 4ID3A 3HUFA 3QVGB 2COKA 3UENA 2INGX 3UEOA 1IMOA 3EF1A 1GZHB 2L42A 2VXCA 3T7JA 4OFBA 4XQ0A 2EP8A 3PC8C 2K7FA 3U3ZA 3PC8A 1L7BA 1T2VA 3II6X 4N40A 3PXDA 2K6GA 3HUEA 3PD7A 4BU1A 3AL2A 3FA2A 3EF0A 2COEA 1WF6A 3K05A 2JW5A 3T7KA 1IN1A 3SQDA 4Y2GA 2LE0A 3SZMA 3T7IA 3PA6A 3PC7A 2COUA 2ADOA 3L41A 1N5OX 2XNHA 1KZYC 2HTFA 2E2WA 2XNKA 3PXBA 3I0MA 2DUNA 4Y18A 2VXBA 3K16A 3SHTA 4JLUA 2NTEA 4U4AA 2R1ZA 4BU0A 3L46A 3K0KA 2AZMA 2D8MA 3L40A 3COJA 4IGKA 3SHVA 3QVGA 1OQAA 3PC6A 1Y98A 2EBUA 3T1NA 4IFIA 3I0NA
chains in the Genus database with same CATH superfamily
4XKJA 2Q2QA 5HS4A 4C0XA 3ESAA 1PYGA 3P97A 4J49A 1EESA 1R5JA 4KNYA 5IANA 4G25A 4WASA 4HYEA 4RZXA 5BSRA 4LHVA 3BQMB 4AJKA 4F93B 1E4EA 2WIKA 4QDKA 3FCXA 4P5EA 2MYNA 3HYNA 2YJ4A 3R5KA 4YUZA 1Y9EA 3BRCA 3UMFA 3U4MA 1EWKA 2PR2A 1N2IA 3LD9A 4IF6A 1KAHA 5TQ0B 4ALJA 1KBZA 1UINA 2I2FA 2XGGA 3MTDA 3OLWA 1C8LA 4MI1A 5IJWA 4JWKA 5KSPA 1QZXA 1PK7A 2H51A 3LTEA 3R0QA 3MRVA 2AXPA 3OF3A 4NS4A 2B4TO 4JJ7A 3UB4A 3DNPA 3QE0A 1WSBA 3DBHA 4YRBA 3FAZA 4KV9A 5LB2A 1WCIB 1JG2A 3H5AA 1PG0A 1PJ8A 1RAAA 3LHSA 3E9ZA 4G5HA 4N1AA 4A8JB 2CV0A 2CL6X 5H8WA 1Q0PA 2XHEA 2X41A 5KTNA 3EOZA 4Z54A 1M83A 5T6BA 4F85A 3QEMA 2FX5A 2WFLA 3GDGA 3WA7A 2J46A 3CWCA 1PT7A 3UK0A 1KHTA 1M2EA 2IYNA 3SZ3A 2R85A 4PGMA 4OQPA 2XZDA 2CVQA 5ERYA 2Q2VA 1ZN7A 3DF7A 1OJLA 2HB6A 5J4YA 2IYPA 3GFQA 1WPGA 1KVQA 4N40A 5AKZA 3OM1A 1NM5A 1WZNA 2ZTLA 3EXEA 3QVJA 1N3IA 1EZZA 4TV8B 4UHEA 3W5HA 1GYQA 1EK2A 3CN9A 4CL0A 4CM8A 3H2BA 4N5MA 3Q11A 2Z58A 3ZW9A 4A16A 4RCZA 4AICA 3G2IA 3H9BA 3L1UA 1TX4B 2G63A 1L8QA 2PEYA 4PIMA 1LKZA 1OBCA 1JHPA 4IX9A 4UDXX 4BB6A 1AQUA 4CM5A 4DR3B 2P5TB 4XVQA 5FO1A 2ECOA 2CCGA 4FYKA 4RANA 1J1ZA 1E9DA 2VG8A 4N0PA 1VSTA 1L4NA 3AUJB 2WRZA 4U5QA 1NIJA 4L16A 4RSRA 4CHGA 3I2HA 3URMA 1OB2A 5IM5A 3KHKA 2N1MA 2WINI 3HYTA 3K4PA 4KXXA 4ZQCB 4BQEA 5JYDA 2KQUA 4YJGA 3VAYA 1ISRA 4XYMA 1XJQA 3PKZA 1GZUA 1STOA 3WS7A 2HPAA 3KSDO 4HEA6 4XB1A 5FYDA 5THQA 3RYFB 1L4HA 5KTRA 3INYA 4JZKA 2FRVA 4NMXB 1IOZA 2D5IA 2YMPA 1TD1A 1Q3HA 4UMFA 3LY9A 3ZNPA 4ZTZB 2ZRNA 3E9QA 1GKIA 1X87A 4MHSA 1JVBA 5CJJA 3FPFA 4IBOA 3IDAA 2HZ7A 4P3KA 3QUAA 2QVXX 4LISA 1QFXA 2HA0A 4G0UA 3JWPA 1KH3A 1UKEA 2YYSA 3AP2A 3OZXA 2DP4E 5L4NA 1G21E 5COQA 1YKSA 2JFHA 4QGAA 4CIDA 1MJ5A 4MVXA 4G8JA 5H3CA 4S3MA 4CCAA 4BIIA 2BH9A 2VF7A 2W2XA 4M55A 1LLUA 4NCHA 3K15A 4TROA 5ALMA 4B7AA 2NSLA 4R9RA 5CX1A 5BVGB 5CA0F 4DJDC 4WFJA 2PE5A 1DJLA 3AILA 1BMQA 2H57A 3LUFA 4NX2A 4DJTA 3QSYA 4D9NA 4H1UA 3ELBA 4N6GA 3SX4A 4EL0A 1QIMA 4FMPA 1YBAA 3RF7A 2ZRBA 1ONNA 4RHEA 3RS0A 2CB9A 2L19A 2WHQA 5F1YA 5C7YA 1DKOA 3PJEA 4KQHA 1CQJB 4EHBA 1EM8A 4ITVA 1VYUA 3E03A 5FOWA 3IAAA 1RAFA 1PJ4A 4MV3A 4N41A 2N0SA 2VQEB 3RU9A 5ENDA 1Z4KA 3FSJX 3GLIE 1V71A 4F7DA 3KAPA 2GBPA 4R6WA 3AY3A 2ODTX 3G89A 4FJ0A 4ZKEA 3ZX4A 3Q3EA 4BFLA 1UDAA 1THTA 3OWXA 2NUAA 4HCJA 2NO9A 1ZM7A 2ZREA 4HJRA 3FLMA 1GPMA 2IZ5A 3PYXA 3WBJA 4MYRA 4CM4B 4YAEA 3UEOA 4EKNB 4RTJA 2PBFA 1YE3A 4KR7A 3U49A 5LP6C 3FJ1A 4AMZA 3M8KA 4N49A 2QP3A 1MOSA 3S28A 1RXIA 4MRRA 5EESA 3VR5H 3I0ZA 1GGMA 2ZAGA 3CBGA 4HTFA 3FNHA 4L4SA 2REBA 3JZFA 4XCXA 4E14A 4E5PA 3D7MA 3ZD7A 3LSTA 3C43A 4LVCA 1KFJB 1YB6A 4LOIA 5J4VA 1KQ3A 2JVJA 3B53X 4GHWA 3DZ8A 3Q3CA 5ALLA 4RO0A 3FY4A 1XALA 4J0DA 4M88A 2IUUA 1II9A 3ESXA 1TYEB 2F9LA 1YS4A 1AGYA 3GJQA 1T1SA 2YXPX 1SUEA 1UJ5A 1QE3A 1K89A 3C24A 3S0JA 3WNZA 4OB6A 4ARIA 1N2SA 1DCMA 3S99A 4RADA 4DPKA 3OOJA 5EMLA 2QE6A 1DX6A 3UVEA 1A4XA 3BTOA 1T1GA 4KUGA 5E7QA 3BUSA 3CNLA 1PG5A 1GFSA 3M6MD 4EHDA 4AKHA 1QHFA 2Z1MA 5DGIA 4MHTA 3PQ3A 4N8DA 2FSGA 2BBWA 4XARA 4L8LA 4MUBA 1LPBB 4NHOA 3LP8A 4ZK6A 1DNPA 2BEVA 3TSOA 1OLXB 1U4NA 3R5HA 2ZRPA 4PR0A 3W5CA 3M1LA 1HT2E 1NQ5A 1JHYA 1UQTA 2EWWA 3O03A 3L43A 3PYLA 1UPUA 4RE6A 5G40A 3LV8A 4INPA 1CTQA 4AU1A 4YP7A 4L3VA 4G5XA 3MWJA 1TO2E 2E7ZA 3LUHA 3NS7A 4MEJA 4CNBA 1QK4A 1TMKA 2Z57A 2G88A 3Q2KA 4TT3A 4A8JC 2J1LA 4RCYA 4U7JA 3W7AA 1HFWA 5C0OE 4ITRC 3WDKA 3CG4A 2CXQA 4N9QA 2YWJA 1T24A 3KJZA 3I45A 4O2BB 4JI2B 2AF4C 2R97A 5DNVA 3I9JA 4YV2A 3KP1A 1WXQA 4FFRA 4K1XA 1FEZA 1KY3A 1N2CB 2EX1A 3C3JA 3EMVA 3EULA 4GR9A 2IYXA 1M8FA 2IY7A 4R2KA 2MSEB 4KOEC 5B58C 4EG8A 2YWDA 4R2LA 3TFQA 1NC3A 1KR2A 1QYWA 3FOCA 3PWTA 1W0KA 2VPXA 4LKOA 3TCXB 5F2NA 1M6WA 4TRRA 1M74A 4YXFA 3ZVKA 2VLIA 3NOOA 5FUQA 1J8YF 1F6DA 2P4SA 1TVEA 4JU9A 4P08A 4UAGA 1GQFA 3UIEA 4MVJD 2CFTA 5A3QA 3SKVA 2FE1A 4Y2RA 5FWYA 4CMAA 3NVAA 3CPHA 4KAAA 3VNVA 2NIPA 2VUSA 1PGOA 1AZSC 1HETA 3LPAA 2BRUA 3GZ4A 3WJ1A 1O5TA 2EKBA 3C4QA 1I3CA 2UUAB 1MOPA 3TMKA 1O8BA 1ORVA 3H84A 3AR2A 3WWDA 1BWQA 3D6TB 4WACA 2I3BA 3STUA 1J6UA 2JEOA 2PUWA 1EP2B 2V96A 5A04A 1SNYA 2AQ8A 3C15C 4WX2B 3NVMB 5CEFA 1WEKA 1M2OA 1WLSA 1W1IA 1YO6A 1EKXA 2M2IA 2NSJA 1JHZA 1J06A 1GADO 5K0GA 2NZJA 4EEKA 4KDCA 4Z3DA 2E1RA 2YVQA 4G0OA 2J0EA 4AKEA 3OTOB 4MDEA 4NBNA 1BJRE 1Q17A 1UBFA 4CU5A 1RZUA 2JLVA 4BE9A 3LXUX 2WSYB 3TLGB 3JRXA 2WJ6A 3VDQA 2ZRMA 4GKVA 2A9VA 4ZVRA 1A8HA 4Z7NB 1Y8CA 2JKZA 4LZPA 3IMGA 4NCNA 1LS6A 4LQCA 3ZBTA 1PTJC 5KOJA 2R8XA 3F8TA 5EIBC 3LQKA 2FZVA 4PAWA 3T94A 1W52X 2VRCA 4LAFA 5GMOA 3VDNB 4EPTA 3BH7A 1HDOA 3RS5A 5J2TB 1D9ZA 4GUDA 3GLKA 1PJSA 4H9GA 5G0UA 5C7LO 1BD3A 1I3MA 1C7RA 1UZAA 2ZT5A 1TJNA 3CPJB 1N0VC 2IUSA 3EZ9A 4XASA 5AJVB 5FBRB 1V47A 2X0RA 2QSJA 3GCWA 3SD7A 5LZ8A 3TQOA 5JD6A 1SKYB 2XWQA 3RC1A 1WM1A 3JD3A 3T54A 5J9FA 4LOJA 3IALA 2WIJA 2W83A 5EUBA 2QI9C 4OQNA 4Q39A 3ZHRA 2J08A 1MHTA 4PANA 1B6TA 4FDTA 2HCRA 3W4JA 4DIBA 4EHNA 2DUUA 3BJZA 2O5EA 3JD1A 1EVYA 1U6KA 2EWVA 1B6RA 3PC3A 4N65A 4UVDA 4ALMA 1JAHA 2HK8A 2NVUB 2RSLA 4HUTA 1ZU5A 2FWNA 1L7QA 5CHYA 5L6MB 2IA5A 1WP4A 2P2CA 2OLKA 1X3SA 5FDFA 5DNYB 4UUNA 1FJXA 1E0KA 5KOIA 1ZVMA 1QDEA 4HPXB 4JP1A 3LXMA 4DM7A 1F7VA 3GR6A 5M29A 1CUJA 1IZ0A 4FOLA 1R88A 3ZDCA 4L28A 2OAQ1 1VB3A 1KGSA 4OG2A 3ZVMA 2XBLA 1NOJA 4LK2A 4CG2A 2J09A 2PQ6A 4XUEA 1KP3A 2QY6A 2LBPA 1JFVA 2NU6B 4MUIA 4QULA 4UASA 3AI3A 5DGTA 3TOCA 4MS3A 4R7ZA 5JBNA 2H3HA 3I9LA 4RJTA 3RJ9A 4F6RA 4DUZB 4NCXA 3D1JA 3EXFA 1AX9A 3MMSA 4IDCA 4JBHA 5EMNA 2G9QA 1RC1A 2YXEA 4HUQA 1Q84A 1RLOA 3FOEC 1WDWB 2Z8ZA 4LHXA 4FFDA 1QGYA 1QGUA 1EDZA 1E58A 5HIAA 4EZIA 2VYVA 1R4AA 3P19A 3VYSB 4D4IA 2I2AA 5F35A 5JD4A 3WBBA 5BNIA 2VJYA 3M5CA 4KHPB 3RANA 3K5HA 4LEIA 4KN9S 2JGDB 1IXYA 4LFBB 5A4MS 3HVJA 2P9YA 4P38A 1AIPA 1R4MB 4RKRA 2DFTA 3C6QA 3UGTA 2VSQA 5AVXA 3A26A 3CX7A 4HX9A 4Q9LA 1QQAA 5AJUA 2NO4A 1ADCA 3F4BA 621PA 5TGZA 4QRDA 3LHFA 3GH3A 1T2NA 3MPUA 1NN1A 3QMWA 3LU1A 4EPXA 3DKPA 1EBUA 4JBYA 2JH8A 4QZVA 3K0AB 1V1MA 3GUYA 2GK3A 1VSUA 4DR2B 3WGOA 4X93A 4C7VA 4TM8A 2A84A 5AP9A 3S8YA 3RGGA 4XB6B 1JHOA 2DWPA 2CNOA 3D4BA 4ZICA 2DQKA 1V8DA 5GONB 2YVKA 1JHXA 2RHDA 1ZJZA 3TZLA 1E9FA 1KEPA 3BK7A 3OTQA 3FI0A 4RY0A 3QIAA 3WWYA 1S1MA 1LJLA 2ZSKA 3MUEA 1M1YA 3D3WA 4PFQA 2X5JO 5KNBH 5JSZA 5SZKB 5EXSA 3H4VA 3KZOA 4NBTA 3X1YA 1P3Y1 1XAJA 3KB8A 2PG3A 1E7WA 3CKLA 3OP4A 1V7QA 4OU5A 4ZHQA 4HEJA 1KP2A 4BPBA 3VR5A 1SGWA 5LP6B 1LSJA 1DIBA 1W6RA 2PZBA 3N05A 2ID8A 3DCYA 1NVWQ 4FONA 1DBSA 4MDHA 2OGUA 4QO8A 3H99A 5EE3A 2PRIA 2QMOA 1QH8A 3FZQA 4J7UA 1UBKS 3SQOA 1HI9A 2HAEA 3BZWA 4MLZA 2NQ2C 1AN9A 3KLMX 2K7ZA 3G5LA 3K71B 1VLHA 1ZIYA 2BZGA 3A2LA 2A14A 3AHCA 3EVGA 4CNQA 1WCWA 1OTXA 1ZNXA 3AONB 2HW8A 1RYZA 4KUHA 1W36B 4KQ9A 3PRKE 1EX9A 4X9XA 1LVUA 2B2CA 3AF5A 1NMQA 4NZYA 2CFSA 2EHDA 5LU8A 5BSTA 5BWCA 1WF3A 3GXBA 3IDSA 3QLUA 2BGNA 4OVKA 2EZ4A 4URZR 1N9GB 5C80A 5HGXA 5K0EA 1H94A 4FR2A 5DHQA 3BGDA 2ZPAA 3EBPA 4H77A 1YUNA 1XEXB 5BNWA 4DA0A 3WB2A 2O8CA 1A8UA 2M98A 1JP7A 4MR8A 2O2DA 4ZAWA 2JD1A 2NAPA 4G2NA 1C2TA 1Z0SA 2R44A 5BO5A 3LKVA 4KE7A 4HVCA 1V8ZA 5HX7A 3IILA 3IP9A 4FR0A 1A4IA 1QIKA 2RDMA 4EJ6A 5BWLA 3C41J 2XXBA 4HGRA 4MVJM 2DC1A 1V26A 3AR8A 3D2AA 1XU9A 5J63A 4AUNA 5LZ2A 1M5TA 2PMDA 4E7PA 1NUSA 4V39A 5BMOA 2EL7A 2JZOA 121PA 4MVYA 4DE5A 1WXXA 3JR7A 2Q41A 1VIMA 1DAFA 2A86A 2YW9A 3PJDA 1KP9A 2C4UA 5ALDA 4EA6A 2V54A 1ZMXA 1E6WA 2PLWA 2QM7A 4B3BA 4NOLA 4DLNA 4AN1A 4GZ3A 5LVAA 3QUTA 4KV7A 4E2XA 2H9AA 1D4FA 4ZGWA 2NADA 3F6CA 4TWJA 4WKBA 1B2LA 2GJAA 2WKSA 3W77A 5DRTA 2NUBA 3GVHA 3KJHA 4UEKA 1MO4A 1VSBA 1OZHA 1ZVKA 2Y71A 1V16A 2VQ6A 4JENA 2FUKA 1OLSA 2IPXA 2PYIA 3KNZA 4K9OA 2QN2A 2OFOA 3I39X 4YAIA 1Y4ZA 4M9QA 2FZGA 3CFYA 5HIMA 3WKAA 1A9OA 3D7LA 2VH1A 3ZK8A 2B1QA 2WJHA 1IM5A 3CGWA 4J0CA 4MWBA 5H59A 1YACA 1QP4A 4EHHA 2ZZMA 1DJPA 4UZEA 4JIGA 2QM8A 3NORA 4WAUA 3CMCO 4UE3S 2VKTA 2QLJA 3IP3A 2B6HA 3KLNA 5IAKA 4PSCA 4YJ3A 3ZGNA 4ER3A 1NWCA 4IAOA 4LF4B 3BMNB 3GFOA 3IAS6 5DT2A 1ZWLA 4FEYA 3G2LA 4TQAA 4AXBA 5HW0A 1H0HA 1OLOA 3IIJA 4TMKA 1UMDA 4JHXA 2IH2A 3E3OA 4TS9A 5JAHA 4DV1B 3NB0A 1X1QA 4PX2A 4B46A 2GO7A 1PWHA 2OAEA 5CMLA 3U80A 5J23A 3JQDA 5CAEA 1DTSA 4O4HB 5JSFA 2UZIR 4LNAA 1SUWA 4ZEVA 3ASZA 2QIPA 1DWPA 2YV3A 4NXMB 3PC8C 4C05A 2Z2IA 1OGJA 2A92A 4X71A 3M0EA 4LXHA 1JKJB 1LWNA 3N28A 1PT8A 3GJ6A 1VLLA 4WXMA 1T3TA 2A1TR 1WHTA 1YU9A 3SYMA 3AM4A 2BMVA 2PT6A 3V1LA 2P9HA 3G3EA 1XN1A 3T9AA 3QSGA 4UCWA 1VL6A 1ICIA 4MGKR 2NUAB 5HFJA 1YVUA 3P5SA 1OIWA 4KFCA 3LVBA 4NPHA 3DR5A 3LG2A 3P0HA 4WERA 2XUIA 5JVDA 1ZD1A 2ZSHA 2BKAA 1U1EA 5LQUA 5FLYA 4EUFA 3OO1A 4EUNA 1DZIA 2JB9A 1W2GA 1YA8A 1S0UA 2PGAA 4R1PA 3P2IA 3FG9A 1N5JA 1KDZA 5KTMA 1NG9A 1OX4A 4DGQA 4IJQA 5C4MA 3D2CA 2DECA 2V6FA 2FUNB 1S8FA 3FMGA 4GOMD 4HEA1 4NEGA 2GKOA 1E79D 3R5XA 2C61A 2YY5A 2EYUA 3LL7A 4M0PA 5AESA 4EPVA 4Z5XA 5HRAA 1ENYA 5JAPA 1CDOA 1RPNA 4R5HA 3ZXSA 1OH7A 2BEWA 5AOVA 2GWRA 3RAPR 4AKSA 4R4JA 3MNFA 2WF5A 3M6XA 3WJAA 2ZBVA 3E1KA 1DBWA 4UD6A 2OAGA 2OO5C 2PZJA 4Y98A 1P9LA 4M1QA 1VLQA 4ZHQB 1GXSA 3ESYA 4M49A 2EJVA 2QTVB 4MAAA 3DAFA 3FGNA 5IVDA 2G25A 4ND4A 2IF2A 1PSDA 4DDWA 2XUZA 3L6BA 4FINA 4PWZA 1TAHA 2IX3A 1L5MA 1R9JA 4MPDA 2MMGA 4YI5A 3PRJA 2PX3A 3GEBA 5LOVA 3U9SA 2NZWA 3DQZA 2IPNA 2MHCA 4LRTB 5I8ZA 5C35A 3DH0A 5LYJA 4HVAA 3KE8A 3GJYA 4N7RA 1QGOA 1R6AA 5FTNA 2J3LA 2OFWA 1Z4IA 3BGIA 3X2FA 2ODQA 4ZMBA 2QXUA 1A8QA 2WW8A 1KPIA 3D3NA 3D8TA 4J29A 3FYCA 3BDAA 1S8NA 1BYIA 3DT9A 4JDUA 1QB8A 2D8AA 4LWQA 5F2EA 3T5TA 4BNZA 1TADA 3C1TA 2PZKA 1DVRA 1F8GA 3ACDA 5J40A 3OT4A 1ZP6A 4KLRA 1T3LA 2HCFA 4KIUA 4AZTA 3OPQA 5GWXA 1GZSA 2BONA 2FX2A 3FCUB 1KF0A 3FSEA 4FHGA 4WL0A 3GN2A 1K0UA 1GVHA 4HNVA 1ECCA 1MO3A 3SCZA 4L50A 3PIRA 4P4LA 1FFAA 1L7OA 4R1TA 2C2BA 3FHCB 4V0SA 2HH9A 1II8B 1DFHA 1WMSA 5TPZA 3DC7A 5BNZA 1P4RA 3GVCA 5DEIA 1EK0A 3JASA 4MINA 4ZEOA 3RD5A 5DHPA 2HK6A 1DEAA 2FCAA 1LBSA 2XAAA 4MPTA 3KOYA 1VGRA 4Q4HB 3SJUA 3R6GA 5B36A 1RRKA 1H4SA 2Z6QA 2Q1YA 1K66A 4GRDA 4PZUA 3TLKA 5AKYA 1VGVA 4XX0A 1CRWG 1MO2A 3F7OA 5EZYB 2HLDD 4CMIB 3TEJA 2IHYA 4QEZA 5LP6A 1KYQA 4YJ3B 5BQ5A 3IEMA 4C0AC 4YO7A 2QRQA 4J0HA 1MNAA 2P1RA 5D86A 4B2IA 3ODPA 1D6MA 3WYEA 5KQPA 1R6UA 1YRQA 3Q5GA 1YONA 2QORA 1RPTA 1NP3A 3DDCA 3GA0A 4LJYA 2WTMA 4OL0A 3ACBA 4PHGA 4CE6A 3FR8A 3AEXA 3Q98A 3JVDA 4IWXA 4F0JA 3K9LA 1RADA 3NQ41 3AYXB 5AHXA 3FBTA 3AFGA 2VQFB 3T35A 3BL5A 3AKEA 2D5LA 2EDAA 4J6FA 2RAUA 1XZFA 5EG5A 4QVGA 3G23A 4IDPA 3SR3A 5I4IA 3ZWBA 3MCZA 4BNTA 2I55A 2DJIA 4JC0A 3MWDA 1GFWA 3SQDA 2N46A 2VAVA 2MIIA 3LI2A 1MZVA 4U7HA 3W3AD 1NW4A 3FDZA 2A3RA 3NOXA 3VSBA 2GBLC 4D42A 4IH9A 3U9TA 1EG7A 2W6OA 3CX3A 4N3CA 3LUJA 1KJWA 3HVIA 1B1AA 5DGHA 3WY9A 1TPYA 6GPBA 1NSYA 2YCBA 4GT1A 5K45A 4JUFA 2GXUA 1QLHA 2EKLA 1YAHA 5AVYA 4IMJB 5K51A 1XTVA 3A6ZA 4PU0A 2Q62A 2HA7A 3ZS8A 3PUVA 5JBQA 5KSYA 4FHCA 3O8RA 3W6ZA 2QAJA 5CDTA 4UXIA 4E2ZA 3HJBA 1B8NA 1UKYA 1WKVA 5BYJA 4AS2A 5AVZA 5TS2A 4DA8A 4JYPA 1E3SA 2RI1A 5EUQB 1NVMB 4K1LA 3GJ8A 4GBGA 5KKAA 3G0CA 3WTBA 4CQMD 3TBHA 4ILEA 3C5WP 5CUQA 5H9VA 4KPUA 1LY1A 2HSZA 5JCPA 1JDUA 1W5EA 4OJMX 3ZJ4A 1D2RA 2KJQA 2D0OB 2GX6A 4NCIA 2WSIA 4GWLA 4UTPA 4GOOD 4N9WA 2YHAA 5F7XA 1HQCA 4RVHA 1GZ6A 3ENVA 5TJ9A 3RNLA 4BCBA 5H80A 5F1PA 2J33A 3IYLW 4DSOA 3F5SA 5DPMA 4V0OA 2NX2A 1OYYA 1Y89A 3KYIB 4CQNA 4DLYA 1SURA 4BP1A 3ZU6A 4F72A 4L95C 3JQRA 3QTLA 3IPYA 1J5EB 4NTZA 2HCBA 2A0YA 3VYTB 1DWOA 4HNHA 2Q5OA 4JT4A 2AL7A 3GRUA 4KO2S 2HREA 1GSHA 3U7QB 4KITB 1HLGA 3L01A 3DE1X 4BUZA 5L4SA 2VPYA 4L22A 3RSCA 1NP6A 3JVEA 3T3MB 4MUJA 3JAKA 5E9JA 4CT0A 5BSKA 3ICQB 3H0CA 2X5OA 4CTOA 1A2BA 1G8HA 3EB9A 1ODIA 1Q83A 5FD8A 3GH1A 2XODA 4U39A 2FOLA 1A4RA 3O4FA 4N8EA 4Q12A 2HQBA 2ZSUA 4F9EA 1FS4A 1P7WA 4RMHA 1FJHA 3IAEA 3EPKA 1OROA 1KJ8A 4B6EA 4L5CA 5ALRA 2OLJA 3FGOA 4IHAA 3EGIA 1LF0A 4LDRA 4C20A 1IEXA 4PQFA 1KEWA 2OBFA 4D8YA 5A5EA 1KIFA 1P5JA 1ULZA 4YRMA 2A9PA 3A8TA 3UWMA 2O7NA 2R6JA 1HE2A 3KWJA 5AQ1A 1RI3A 3P96A 5LA6B 3VZQA 2CXHA 1IAVA 2ZS9A 3KYBA 1PSWA 2H1LA 1O9HA 5DP1A 2R1TA 4FYWA 3WI7A 4KUEA 1TGYA 2B94A 3IOYA 5BWOA 2QT1A 4MQEB 2DQZA 3H2IA 1S2LA 3TKAA 3ZQ6A 3MWFA 1TL7C 1QM5A 2A67A 3KU1A 4P2GA 2H4XA 1K88A 2OQRA 3QEOA 4H7FA 3ZHTA 9GPBA 4DWVA 1H93A 1GNQA 1HFEL 4OBXA 3BTSA 2Q0XA 1EFPA 1I3LA 4D8VA 2WQ7A 3WLQA 4FSDA 1U3UA 5FQNA 5FTKA 1EVZA 1RYYA 3RRYA 1YJCA 3SZLA 4LRYA 2A7XA 4B9EA 5KKCA 1SXJB 2H17A 4Y9SA 2Z6UA 1M6VA 4CCWA 5D1NA 3K8ZA 4D9JA 1HE5A 1A5AB 3RYTC 4AM8A 1Z34A 1C4WA 2AFVA 3H2GA 3F46A 3GHHA 3NASA 3DUFA 3IP8A 1YI8A 1ZVQA 1UXGA 3COZA 1RQNA 3U4HA 1IN1A 2AOUB 5DVZA 3A27A 3FI9A 1M34B 2FSVC 2XX3A 1MGOA 5CLJA 1QFMA 4JP5A 5D1HA 1DAMA 3ZZNA 1GPJA 2RD2A 3DDWA 2NXJA 3MTIA 4LMAA 3K70B 2C7GA 1QP7A 3EG9A 3JQGB 3PLNA 2IZ6A 5IZCA 2CYBA 4MKRA 3VZDA 2C1ZA 3BKWA 1MGPA 1DAEA 2GXQA 4YLGA 3KDSE 1ESCA 4NFLA 2D0DA 2OOKA 3NW9A 5FIUA 3V8BA 4EUSA 2Q4TA 1MAUA 2YH2A 3H9EO 3OZCA 3UJ3X 1L4BA 3CVOA 3EFBA 1GU0A 5I47A 4DS3A 2YZGA 3GNQA 5K3FB 2VYVD 1FZTA 2QRZA 3B51X 4XD7D 1GO2A 2EW1A 2IS6A 3NHYA 1G7RA 3RYHA 2PMCA 3VYRB 2AFIE 3SNKA 3WRXC 2VDJA 3ZKWA 1V6SA 1L4KA 1KC3A 3CO0S 3JWIA 4FGWA 4G1CA 3GQBA 1HRKA 1TZCA 1V5FA 4MNTA 5EUMA 1DKNA 2OBBA 1XNJA 4G24A 4J1TC 4L5YA 1U8EA 5DX0A 3AKZA 2YNMC 2FW7A 3QITA 4NU8X 3ZDYB 3MGGA 1RS0A 4BTLA 4GS5A 1C3OA 1LRJA 4QTZA 8AT1A 4L6CA 1J97A 1QZTA 2JCSA 3KEFA 4ZCLA 4TXLA 4FKMA 2KLHA 1GITA 2R4QA 3IT0A 4QJ3A 3SBEA 2ZJ6A 1GGJA 4E6PA 3O74A 3QIVA 3OH8A 4NV1A 4BLQA 4YXWD 1NVAA 3NTXA 3MJSA 2PKEA 4E5SA 4KWCA 1VQ1A 2JFBA 3EH1A 1I6WA 2Z30A 4NE2A 2Q7OE 1Z29A 3WNVA 1JJ7A 4E7OA 4IIBA 4M9RA 4IUCS 1SIOA 1VHTA 2Q27A 2G83A 3INTA 1W88B 4X45A 9LDBA 2KBEA 1CRPA 2QJFA 1ACJA 5KI6A 3WWPA 3CY6A 3ZLUA 3RF6A 4B73A 1GL6A 2RGYA 5CLIA 1OSNA 2TMKA 1GDHA 1I7PA 3QY9A 4ZCPA 4BYMA 2QYOA 5MF6A 1MTOA 1THZA 3FNIA 4QIHA 1Q50A 3DDUA 4BV9A 4MYHA 4BFWA 4OSEA 1U1GA 3W2GA 3IO5A 4ZP1A 4W5RA 2ECKA 1FFSA 2F7SA 1NPYA 3ERCA 4AAYA 1QH9A 2WI8A 1U2GC 3LT4A 1KMNA 5JQWA 5LMUB 4CIYA 2DQSA 1ELOA 2EARA 4N82A 3H6KA 3VJLA 4LZOA 1BOFA 1IK6A 4V0RA 2Y4OA 4K7JA 1DI0A 1YBFA 3QEMB 4MV7A 3UJCA 5JZOA 3LPDA 1O96A 1RWBA 5BV2P 1SC6A 2IYFA 2O8BA 1OC2A 4EYOA 1V37A 3SICE 1FC0A 2YXNA 5THXA 4I6JA 1SZPA 2MSDB 2OZLA 1EVQA 2PANA 2ZPTX 4WOJA 3VHXA 1EVJA 4KWEA 5EE0A 3VR2A 3HXTA 3SN6A 2YY6A 3OQBA 2CLOB 1JVSA 4ZQHA 3K6JA 1SBTA 2G1KA 2QBYB 1E2NA 1S3GA 2XCUA 3QW4B 1JR3A 1JH9A 1JF8A 2NXNA 2V4UA 3INGA 2DB3A 1TCAA 1U5BB 1Z5VA 2VVTA 4ENRA 4ZODA 1QSGA 2H08A 1NW8A 1W48A 1KNQA 2P5UA 1XFDA 4TTTS 4ZZIA 3FMOB 1UMKA 4YHHB 3VXKA 2ZQZA 4FTWA 1YE8A 1LLQA 4RBNA 5ALEA 1JWBB 4WKGA 5F7OA 2X0JA 1PNQA 4I8IA 3BRQA 1UL1X 5DHTA 3QLEA 2IOQA 2QXYA 3R41A 1O9BA 2C2ZA 1DDIA 1VA4A 4NG5A 5JCOC 1JAYA 3A14A 3ESDA 2P0YA 5EMHA 4G2TA 3FPCA 2WEKA 1DAPA 1XYVA 3G1TA 3HVUA 4OP2A 2P79A 4RZ2A 5DHFA 2Z04A 5AIBA 2ALJA 2H7XA 4TYPA 4B85A 1H5UA 4IGEA 3UT5A 2DU8A 2NG1A 2QAIA 3CZAA 3KXIA 1W96A 5TT1A 1DP4A 1EX7A 2O2JA 2FUEA 1FLNA 1CP3A 2GZMA 1WSWA 2H31A 2NV2B 3CF4G 3LY5A 4OJYA 4ENUA 1GSOA 4B6OA 1AC5A 4Z9YA 1WXGA 2BZ1A 2IE0A 3NOQA 1DKMA 1Z6PA 2NT3A 1H2XA 4Z99A 2F90A 2XGJA 2X3YA 4OGFA 3HYCA 4LWOA 4KR3A 1R6VA 3V9AA 1RMYA 1H2AS 3CLSC 3OVMA 4K6FA 3DNFA 1QS0A 2OXFA 2P4QA 4KX3A 1UDCA 5KVQA 5EY5B 1O6CA 3DAHA 1XEWX 3TOSA 3CVYA 1OV6A 3RHSA 2RFLA 1GG2A 3JYNA 2AZTA 5ALWA 4ZDWA 2N42A 1P61B 2FXIA 3TBKA 5DLDA 4CL3A 4L4UA 1T8SA 2OQ2A 1O08A 1M2OB 4IF4A 2WV9A 4HDRA 3T1NA 2GN9A 2I76A 3H6GA 5BN1A 4ZV4A 1UCFA 4J1NA 5FJIA 3H8SA 3BE5A 2WWTA 4QXMA 2VK2A 1OGYA 1XTQA 3O4JA 3FIJA 1RHRA 3H18A 3KK0A 4IW3B 5BQFA 2OY0A 4QD3A 1N5KA 5K05A 1L7VC 2PUVA 4WCFB 3UK6A 3UJAA 1LDGA 4R54A 1NURA 1SJ9A 3I28A 5FWDA 1BXZA 5FYQA 1W85B 2EQBA 2RHJA 3GNLA 3AF6A 1C14A 1OWPA 1TLTA 4O4IF 1BMFA 5EINA 2B7BA 4YFVA 3TR6A 1UC8A 4Z49A 1ADFA 2IC5A 1VZ2A 4KR0A 4YBRA 4QU9A 3WQHA 3KO8A 4DMLA 1P8AA 4KZKA 4URXR 3ENZA 5A9TA 4JVNA 2MJLA 4NEQA 1NV9A 1TLLA 2X1MA 1A9YA 1CUCA 3EPPA 3OLQA 4LECA 5AKIA 1IYZA 3RJTA 4FOSA 5DTEA 1ZN9A 4CIAA 1OFHA 1F51E 2PGNA 1JQDA 4QDUA 1NW5A 1P73A 2HCTA 2X76A 3HFGA 1IY8A 4AMGA 2E5LB 2NTYC 1M2KA 1MB2A 1M2HA 3CBQA 4KTVE 1SKUA 5CT5A 4EHJA 1LSUA 1U2TA 4LZJA 2BMJA 5I7VA 1VCNA 1X9GA 4QPDA 3FNBA 4O0MA 2H2HA 3C8MA 4YEDA 4C4XA 4F12A 1YJ8A 2BEUB 2R8BA 1VE5A 3CW2A 3IE0A 3SOZA 2NP7A 2Q2OA 1T1JA 1GG5A 4RK5A 2YKGA 4KIWA 3DGFC 4TOIA 5KNCD 4OQLA 3PJFA 4DXDA 5BR8B 1YFLA 2PUFA 5MFZA 5CDGA 4LY6A 3FTEA 1ILEA 2HBYA 3GRVA 4PSAA 1C8KA 4O4LA 3S5UA 3CZ5A 4ALLA 3JZMA 3CUYA 5JSQA 4GW3A 3HFSA 4Y2HA 1JVNA 1RJ9A 3FDJA 4NENB 3WFIA 2P91A 1HEYA 1LJUA 1MA3A 5DH9A 4EW2A 3QELB 2ZDQA 3F7TA 3S8EA 2WYWA 4PFKA 2VC2B 1RHQA 1RM0A 2B83A 4DDMA 2VN8A 3KM0A 1JJVA 2DT8A 2FN9A 4Q1CA 1P5RA 3S2GA 3UAXA 1SUBA 3G0GA 1T6ZA 2WE7A 2ZI7A 3X1ZA 1OBHA 4KGZA 2VHXA 2OHFA 2PS0A 3A1VA 3TW4A 2CJFA 1MQAA 3KALA 4URYR 2ONJA 3KETA 1YB5A 3OZRA 5JR3A 4YRZA 3E22B 2BBOA 4LJAA 4KQEA 1KH2A 3N9IA 4R8LA 4C06A 1FL9A 3Q85A 3WFZA 4AY5A 3W9BA 4AJHA 2XDAA 3PC4A 2JC3A 4S2UA 1WPRA 2QMHA 1JH8A 2I9KA 5J43A 4P4GA 2NOAA 2XUPA 2G0AA 4C0JA 5KREA 1ZD9A 4XYEA 1BG6A 2HUPA 5G3YA 2QR2A 4Q66C 3FDZB 1X7YA 3I34X 4FDUA 4MUGA 2J3IA 4QUJA 2M6SA 2VDKB 2BR4A 1VOTA 2BFDA 3AR7A 3NAMA 4ZZ0A 1KS9A 7MDHA 2PAFA 1EEHA 4NARA 1A9TA 2VHWA 5ICCA 1DMRA 1CEXA 1UJ2A 4OHVA 1KARA 4XW2A 1ENPA 4CHTA 4AKGA 3SX0A 1T34A 2PD4A 2O9JA 4RS3A 2QLLA 4WN9B 2H7VA 1H4TA 4P0PB 4GRAA 5FB3A 2ZCVA 2IS1A 4L8YA 5ICFA 1X13A 4G56A 2CEKA 1A9PA 2I6TA 3KVRA 1TO6A 5GPBA 5BUZA 5KVAA 1T4BA 1P77A 3GG2A 3PXCX 3HO6A 1M1UA 2MSCB 4RLFA 3MWEB 3NHMA 1JNXX 5C5IA 2GD2A 3JYLA 1WP9A 4Q03A 2PWPA 4ZT7A 3ZE2B 2WZQA 4BMDA 4WBNF 2BELA 2FMFA 4QG7A 5TMBA 3AVXA 1BHO1 4GPTA 4AWAA 2PX0A 1E77A 3LDHA 2P2NA 1WY5A 4N03A 2A4MA 5LPNA 1DUSA 1EVLA 3TIFA 2FP4A 5EZ5A 3U3XA 3ZLBA 1WKBA 1UXOA 5KPDA 1PUJA 1C3XA 2HIGA 2FSSA 2B7CA 2VCYA 3E7FA 5TQ2A 1CY4A 5CEJA 1G64A 1Z9BA 2YZNA 4H6WA 3WGKA 1NRWA 3I4LA 4IKEA 3SQNA 1D07A 1J2JA 1V4BA 2VPTA 1B3RA 1OFGA 3LC1O 1FNNA 1XLUA 1DINA 2V1UA 1H8EA 1CEEA 1G5FA 1CJBA 1S4MA 1IAQA 5DK6A 2LCFA 1A97A 3HV2A 3L5KA 4HDKA 4MW6A 5C1IA 5AKJA 2FKNA 3ZI7A 4BYGA 2LIPA 1G55A 4QPPA 4NBVA 2RBEA 1HXHA 4Q34A 3VPFA 3UICA 1LEHA 1NZJA 1ZCJA 1K3FA 2FSUA 1NSFA 2JAUA 5IXSA 1XNQB 4Y9DA 4AP9A 1FX1A 4PPFA 1EI9A 4EW1A 4Z4FA 3JD0A 5KYUA 2G72A 4NY1A 3ISJA 3PF9A 2OP0A 2O3JA 3VZCA 1D0IA 1Q2UA 4MQMA 2BEUA 4XFDA 4FQ5A 3AXTA 3HBNA 4OBWA 1EQAA 5JXJA 3C3KA 1BX0A 1ZZGA 3L7BA 5EWMA 1GG8A 3AW9A 2R8ZA 2IEIA 4FLMA 3FGPA 1PNVA 2GCIA 1FBTA 1KVUA 1LQUA 3WL4A 4ALKA 2G7MC 3FCEA 3WIDA 2AC4A 3AP3A 3IVXA 1TJPB 2PRJA 1A88A 3NJRA 4CMKA 4KNWA 4WJKB 4BJ6A 4TMVA 4ZYLA 5AHKA 1BC5A 1BN7A 1HE1C 3V8PA 3FYUB 3D6NB 3S1LA 3KFLA 1UWLA 3NDBB 1IHYA 2XQKA 5D6NA 4V1CB 3B36A 4B3DA 3T4EA 4PZZA 4C0LA 3DUFB 3ZH2A 4F8EA 3QXCA 3RTBA 2Z2YA 1E6UA 1BCSA 4OXYA 1YJXA 2GZAA 3AB3A 5ESWA 2XYHA 3ONNA 4NHEA 2JGEA 2YS7A 4L02A 4EG1A 1KKMA 1RJFA 1FQKA 2GILA 3L8FA 5LZ4A 1II0A 2IDZA 5GY7A 2J5XA 2G08A 3CWQA 3DE7X 3PB3A 4HAUA 2B82A 1J70A 1NVVR 1BS9A 4GM0A 2B1RA 1FP6A 1UKCA 3COVA 2G9RA 1J42A 4FCVA 1DB3A 1Z2AA 3NM5A 4BNVA 3L9WA 2R87A 2EFYA 2FQ1A 1IONA 1LBHA 3C7KA 3FSGD 1P5HA 5E6RA 5IP5A 3UHFA 4TQGA 5IUKC 1EXWA 5EC8A 1NHWA 1WWKA 3NONA 2WE8A 3GBPA 2I54A 5JPDA 4GKKB 3MGCA 4Q7QA 3IIIA 5GZ6A 2WJ4A 5JHGB 2WT8A 4TKVA 2EC5A 3TTXA 5IG2A 2CHVA 3GAMA 3CTMA 5B37A 3K1JA 4WXHA 4YAWA 1QDLB 1M0SA 2OV2A 1ZD3A 3Q15C 4QYMA 1XD2A 5ULLA 5KMGB 5HEKA 3TQCA 1G20B 2R2GA 2GLXA 2FDCA 3G8YA 1VLVA 3OCUA 2AG5A 1UJMA 2OSVA 1TQ2A 2IYRA 3PPXA 4RCVA 5JJ5A 3DPSA 3LQ2A 4OATA 3RVJA 5I7UA 2ZBDA 1H8ED 4DB2A 4LGVA 3VX4A 3F5QA 4UTXA 1O87A 2AGVA 4P32A 2J6IA 4HAOA 2ZRGA 1XLTA 4PR3A 2WWGA 5WRFA 1AKTA 3DZFA 3BORA 1G291 1W581 1MEEA 4QGFA 4YAUA 1JQBA 2R1VA 1ZJJA 3KKOA 1K6EA 1SH7A 3BWMA 4IRXA 4NJMA 2Y2UA 1QYDA 3ND5A 4O2AF 5AO9A 4QU0A 3VZBA 1WBBA 5H4HA 3W5AA 4I8DA 4C78A 2JA2A 4DZTA 3CLHA 5GJVC 2OENG 3C6BA 1CKEA 4HQRA 1S2IA 2Z6AA 1JDTA 3JTEA 2P0AA 2PCJA 2WYUA 2HWYA 2VDQB 2NT4A 2WP8J 1PWEA 3ASUA 2D1SA 2PYDA 3OJCA 5E0OA 4AFNA 4LXGA 5HM6A 1CYEA 3DBLB 5IJ0A 1IBLB 1BW9A 3A36A 3GFTA 4JFAA 2CFIA 3CW9A 3CLSD 1MT0A 2DWCA 3R23A 2F4VB 3SI7A 1M2VA 3DW1X 1QYIA 1VG1A 1O0SA 1IQUA 1Z7GA 5SYAA 3K05A 2MOKA 3HJGA 2XY4A 3BIOA 1OIXA 2XGSA 3OD1A 4HMPA 3GZNB 2FUG6 1Q7TA 4UM7A 4G0YA 3UAVA 2GPBA 1Q7CA 2AVNA 4MPJA 1VCOA 4OQYA 3A3KA 3CLRD 4RAQA 3W90A 3ZDZB 4PXYA 2XUDA 2HA6A 2IBMA 2A30A 2ADOA 5DXJA 1ZH8A 3NWOA 1V4NA 1JIKA 5H9WA 4CM6A 4ADSG 5KYTA 4MHOA 4N5NA 1KBQA 5JNTA 2FW9A 1EP1B 1DU4A 1UDWA 1XV5A 3EA4A 1OT5A 1BSVA 1G2QA 3HJNA 1Z33A 4JSTA 4CDGA 2X2EA 2JK0A 2CXNA 4GRIA 2II6A 1CUWA 4NJEA 4CEJB 1XNRB 1V5WA 3AVUA 2O8CB 3PUJA 3KJGA 5TB5A 1JHQA 4QQNA 4WY2A 4IMIB 4BJ3A 3HBAA 2V7WA 3DE5X 1E9BA 2O0KA 4TXNA 1MJGA 3ME5A 3AUSA 3F49S 2AN3A 3WGQA 1GYPA 4F9TA 1SQ0A 1T1EA 1CY8A 5HOEA 4OHOA 1KMIY 1WB6A 1MJGM 2D3WA 2ONCA 2XMSA 3H3JA 3ZN2A 1HEUA 2DERA 2HLHA 2JBAA 1G9XA 1FZQA 4MGIR 3RI3A 4ACBA 1OE0A 3CB4A 1GQ2A 3OTIA 1E3DA 4X3OA 4UARA 2O2ZA 1QDUA 4WQMA 3K1AA 1M6HA 5D51S 2OO5A 2CXXA 4I1SA 2FPOA 1QQ6A 1K8YB 1TA9A 3LM8A 2WMYA 3IUNA 1A71A 3NALA 3RLIA 4BGEA 5BN4A 4MMXB 4G09A 3KPJA 3FVRA 2CDRA 3VJRA 4KXLA 4Z1OA 1HPLA 3R4VA 1XAIA 4PZLA 3ZE8A 4ER0A 5LQCA 4D9BA 2C3UA 4EI7A 1CT9A 2ZIXA 1NT4A 2DR3A 2VXYA 3DXYA 5FF9A 3DCIA 3ZCQA 3ZY6A 1AO3A 3H2YA 4HB4A 1MW9X 4RL6A 1O94C 3KPWA 1LBTA 3Q6NA 3P2YA 4C0BA 2NZ2A 5IFLA 1Y5IA 1V43A 3IIEA 3IQIX 5ALVA 2PGXA 4MKHA 3P94A 4JEUA 2EGHA 3G8CA 3L1JA 1MXFA 1Q7EA 1ZNWA 2OFXA 4AZSA 1YT5A 3ICPA 4HLUC 4JUDX 1ZK4A 1SC4A 3LX5A 4V02A 4A8PA 2JHFA 1JBEA 1UMDB 2EJWA 2WABA 1XDBA 5IKPA 3EYWA 4MDYA 4Y2SA 3T15A 1I6LA 1YI0A 2WT9A 2I6UA 3B9BA 4AS1A 1QCCA 3IA2A 4OY3A 3O3MB 4MW4A 2JL1A 4M4SA 4ZGBA 1ABBA 2VXOA 4J94A 3ZHXA 3UUEA 4QKQA 2VCHA 1Q77A 3KWFA 5KNLA 2XXAA 2I62A 3BHIA 3E9CA 4PNPA 1NE7A 4I66A 3TKLA 4U6NA 1EXMA 4NBLA 1JTVA 3L49A 3TTWA 5LYJB 5GJBA 1M1NB 2BGLA 2QGNA 4GYWA 4PINA 4CKYA 2JIZA 2C5GA 2IYLD 3DYIA 2HBZA 1RE0A 4KH1A 4KAFA 5FA5A 4XX1A 1KI8A 2BFMA 1UOEA 1VL5A 2OSBA 3FOWA 1P19A 5KVSA 1PAUA 2Z08A 1JIQA 3FLEA 1KETA 1F9EA 2EYQA 1XVTA 5CDFA 3RWOA 1G4AE 3KUCA 1NXXA 2CHGA 4ID9A 3CT6A 4NATA 4XX0B 2VT7A 1NRJB 3BXOA 4HBZA 3RS9A 3SZMA 2TMDA 6ADHA 4JC8A 1G0NA 1NULA 1CQIA 3LLCA 3EDQA 4UHKA 3OPVA 1Y4AE 3PXGA 3H4TA 1E3LA 4AP5A 3ADBA 1PL8A 3HJUA 4FP9A 5FAKA 3EE6A 3PTZA 5LJIA 4TTJA 2HF2A 4C0HA 3ANYB 1Z5OA 4CKZA 3S7ZA 2C7OA 2QD2A 5T8KA 3QWAA 1IY2A 2YMLA 4R8SA 3JAWA 3V8EA 5FWNA 2IZZA 4PICA 3TE6A 2ZYHA 1NY6A 1QG0A 2BC9A 2JIDA 2NV0A 3CZ4A 1C7QA 1HY3A 2VKQA 3HNRA 4UM9B 5KBYA 1TEXA 3I62A 2Y0EA 2QPTA 3BF8A 3I3OA 2QVZX 3L7NA 3QJGA 2KX7A 5IJAA 3EXG2 5IT0A 3R7WA 2BHNA 4ZVLA 2GN4A 3QELA 5BYAA 2JFUA 1RLMA 4L08A 1WMDA 4HZUA 3CR7A 2PFGA 4URUR 3V1TC 5C8DA 2MCFA 4IHQA 2C3PA 3GVIA 3OQ6A 1RRGA 1OXBB 2V74B 3A3OA 3C2QA 4AMBA 3THWA 2P0EA 2QF7A 5K6TA 1WB5A 3KQPA 5D3ZA 4RF2A 1CZKA 4MGZR 3PL1A 5EL0A 5F9FA 5TS3A 1N7GA 3OCWA 5IASA 2LD4A 3UCEA 2O1XA 2ZE5A 4AUKA 4BEVA 2WAMA 4NFHA 5IW8A 3HLKA 3Q6IA 4OP1A 3SEAA 2HIAA 2E4VA 2GAAA 1IPFA 2Z1NA 4F86A 4ZAVA 3KTFA 4AJEA 2H07A 1E3QA 1OFUX 1SWVA 1HFKA 4M0LA 2AUTA 4X61A 4D0LB 3HR4A 4EJSB 5A03A 1QG2A 2IOYA 4FE7A 4UMVA 3U61B 1HL7A 1G8FA 2Z5LA 3INRA 3NEPX 1P5ZB 2AEFA 3KLPX 3WYBA 3QP9A 1RZRA 2W4IA 1T15A 2C1XA 5CT6A 2NPIA 2WJPA 1CR6A 2OECA 1BQEA 2DPYA 3IAUA 2FCRA 1ZIDA 2MYTA 2RJNA 4NCJA 3F47A 3NAZA 1EUDB 4ND8A 3VR2D 4PCLA 4QDZA 1SXJC 5F51A 1PN3A 1G63A 4LYJA 2EJTA 3FZGA 3E1GA 3LCVB 4HMQA 1P2FA 5CYFA 4JXKA 2PMWB 3AU8A 3GEPA 3EGWA 3OZSA 1PG2A 3BMQA 1T9KA 3QKWA 1K7YA 3OFKA 5A9RA 3PD1A 1B15A 1EVIA 1SCQA 4DJAA 3BSWA 4LIPD 4ISBA 1H2FA 3L79A 3U16A 1Y8ZA 4LMBA 5HQTA 2VP2A 5CB0A 3EDOA 1DHRA 2QOEA 1AKWA 3L92A 1L6RA 2B9VA 2OV8A 1ACLA 3LBNA 4IVPA 4M8LA 1N6LA 2GZ2A 3R9KA 4DCCA 4D4HA 2MMCA 2Q4RA 1W0JD 1XZHA 1E6EA 3ZEIA 1QU3A 4LJSA 1ECPA 2PS9A 5AVRA 2P2SA 2ZIAA 1Y33E 3QJ5A 3GB9A 2BTOA 3OZEA 3T0GA 1UJBA 2ZXFA 4LPKA 1MOQA 2EFJA 3FPBA 2GUGA 2BFFA 3R3HA 1C8BA 1HZJA 4M8SA 3HBMA 4CBVA 1C3VA 5DGCA 4EFNA 5IEJA 4B2PA 3D8RA 3FLAA 4QUHA 4EG0A 4DC1A 1T2EA 3VU0A 4A23A 1JQEA 4GLBA 3MGKA 1X1AA 5FAXA 3GLIB 3SIXA 3WJ2A 3ZYCA 3NTVA 1XXHA 3C3PA 1XWWA 2NNLD 1G6HA 4JNKA 5KSOA 4MEAA 4L6AA 5BRNA 3O4VA 3O95A 2W6PA 5DLPA 2IWHA 3B3FA 2J0QA 3MLAA 4B48A 4MAFA 5LA6F 1AXGA 4DADA 2XUGA 2IS2A 3GGCA 2IEDA 1RVDA 2OXEA 3E8MA 4CN9A 3DZHA 1ZUWA 2UUOA 3KU4A 3K9GA 1CVRA 1CETA 2G06A 2V3WA 4MVJE 4OA8A 4PO1A 3VAAA 1R0SA 1YTUA 4NDAA 3OJFA 2ZIFA 4I3HA 4DOMA 1E61A 5B30A 4IIJF 1XTSA 2OP1A 1L4LA 4FD3A 1U9JA 1J23A 2EDCA 4B3GA 2QMUA 3OUZA 1UC9A 1PQWA 2PXHA 4A1OA 1R0WA 1RHJA 3LT0A 4ZYUA 1YRHA 4Y6QA 5E6SB 4XD7A 4KTTE 4TYYA 1K6JA 3GJ3A 5DNDA 3PD0A 4HWPA 5E38A 3H83A 1FTWA 2WUWE 2XCQA 3E0XA 1OLSB 4M9ZA 3ER6A 3KTOA 3SS9X 4ZO6A 1GZDA 4FLEA 2OCPA 4Y6PA 3CNEA 1GUZA 3FVVA 5IM4F 3D0RA 2HD4A 1FDVA 2DEUA 1NJ1A 4CEIA 2AN4A 4YASA 1XYYA 3RSSA 4G0ZA 2GK4A 5IUNC 4OK3A 1ZMTA 3E23A 1D2CA 2FMIA 4ES6A 3D5EA 4LVOA 4BNJA 1DELA 2JHGA 4KOAA 1E3JA 4ZDKA 2PYZA 1WPQA 4OB7A 1KK0A 1TTHA 1L4EA 4JLWA 3W4KA 2IUYA 2Y1XA 3QNWA 4QPNA 2Q49A 4TL6A 5HMLA 1KJYA 1MP0A 2X9QA 4KREA 1BCSB 1H1LA 5AKGA 4J7AA 3TGWA 3JAWB 1K75A 3N2YA 4IIYA 4JI4B 2V7QD 3N8KA 4WGGA 4XDHA 1FFDA 2A9FA 5ADWA 1ST3A 1CUBA 1Y3AA 1KQOA 2PMKA 2X0IA 4PCAA 2ID4A 3D1LA 3HMQA 1V7ZA 5LZ5A 3QEKA 5PNTA 3UMJA 2WSLA 3VI3B 3KQHA 1FDUA 1YZKA 3Q7IA 4B35A 4EYEA 3RIGA 1S4QA 4ED9A 3UJ6A 3OP1A 2EEZA 1W4CA 1VG8A 3L8EA 3B1XA 5FPQA 4F5EA 3JQ8B 1JU4A 3NNNA 1EXVA 3NHUA 3VSEA 3U44B 4A82A 2Q1TA 3ZDFA 1XTJA 5CT8A 5AJHA 4FJ2A 1K5HA 2X86A 3FWPA 3E18A 1A2OA 1L5HB 1OYVA 3FUVA 4PQYA 1XU7A 1C1DA 2BCJQ 3U4DA 5F2OA 1KVSA 4F06A 3H04A 2CV2A 1UFKA 2AK3A 1U0BB 3WLNA 2C5BA 3T8YA 2QQGA 4DIKA 1N36B 4XQ0A 5DTRA 5JZ9A 4TSKA 4R8RA 2XV1A 5A4KA 2AXEA 4BVHA 3UK7A 2VK4A 3OZFA 1E2JA 1KK3A 1R10A 1YR3A 3A1SA 4R7TA 3AESA 4WCVA 4C6HA 3HUTA 2NUPA 4RS4A 1BEZA 4BZZA 4JJEA 2W2KB 4WNCA 1F4LA 1N5IA 1IG0A 1WOMA 4BVEA 1DAOA 1Y3CE 4DIUA 3ETHA 3EIXA 4EO7A 1BGVA 1CBUA 3DO6A 3JQQA 5DMXA 3MQ2A 4MVCA 3GA7A 1DAIA 2V0CA 5JJCA 2ZBFA 1CF2O 2GK6A 2JGJA 3PUZA 4BCDA 1PGPA 2V9PA 5FR1A 1GILA 1YIOA 3K7EA 5JG7A 3T38A 1MRSA 2IX9A 2KPOA 4OAOA 5H82A 5TF0A 4HDOB 1I2DA 1ZD4A 16PKA 4Y2GA 3DEHA 2GD0A 1EGQA 2BM9A 5K03A 4RA9B 4O1HA 1H3NA 2HFKA 3PT9A 3RVLA 5EJ7A 1B1CA 4HLQB 3WK7A 3NPMA 5LN1A 1E1LA 1EFDN 2RARA 3BSSA 2W7TA 4W82A 4BZQA 1C9MA 5H83A 2O3UA 2JHAA 2GCPA 1Z08A 2AYZA 1ZI6A 3CO5A 4E3ZA 4UUBA 5BV7A 5CIWA 3U6BA 3CVUA 1NW7A 4HX2A 4NKRA 1QOQB 2AS0A 4I5IA 4K9PA 3K6SA 2LDXA 4GWKA 4IEIA 4CQJA 3THXB 1BO6A 1DKUA 3B8EA 5D7BA 4I14A 1Q0SA 4K86A 3D3KA 1Q16A 4CV3A 2H4FA 2QE7A 4NMMA 4DLTA 4XYBA 1ZN8A 4OH1A 5ERXA 4FFMA 1Z17A 4L07A 4X1OA 3RRJA 1SCAA 2GGSA 3LKDA 3WGVA 4DLRA 5KQGA 5HXAA 3L4EA 4L76A 4EPWA 1QRAA 1TJYA 2C4WA 3LPCA 1CZOA 1V3TA 4QUKA 4QODA 1Y7TA 3UV6A 3I2IA 1XTZA 1JQ3A 1ZOPA 4CCYA 2FWRA 3OMWA 2HHJA 4DLAA 3ILVA 1P1HA 2FFHA 2EERA 1VG0B 4B8ZA 2J67A 5HOQA 4MUEA 5JAUA 1I1HA 2AKYA 3PHCA 3RT9A 2R8EA 3BJRA 3AEYA 4TUYF 3VJMA 5ES4B 3AVPA 2O50A 4I99A 2CYAA 3MF4A 2X0EA 1OZ0A 1X1DA 1HT0A 1U2DA 3LK6A 1V5GA 2F3PA 1KXZA 1Y9JA 5BMVF 1I2BA 2G1JA 1L1RA 2FV8A 3ZE9A 2XITA 3HI4A 3IBTA 5TQ0A 2VLBA 3H1EA 1T4MA 1TT5A 3Q3GE 4MZXA 5AJZA 1SCDA 4IRUB 2GZSA 2NW6A 3UKOA 5JDIC 3CRNA 3HB5X 1BQ4A 3GNSA 4HP8A 3PGKA 5KHAA 5AHWA 1X80A 5LQDA 4XVCA 1KE1A 2ZUFA 4H1VA 2IZ7A 3OCXA 4GE0A 3QM1A 4HTAA 4AROA 2O2XA 1XCJA 3VA7A 2C2OA 2HIHA 2XT0A 3VSDA 1MW8X 5JAOA 3PPVA 3LYLA 4BNDB 3IQDB 4NNPA 1C5KA 2FPSA 1YMQA 2IL1A 3PHLA 1OMOA 5FX2A 3I5YA 1WUKS 2ADMA 1Z6YA 2VDOB 3SC2A 4CEIB 3U4IA 2AFRA 2B2XA 5FV4A 4JJ4A 5AI5A 3O47A 1RJ9B 4NENA 3A2MA 5EHIA 3KSZO 3R5JA 3YASA 4DV5B 5K3BA 1MORA 1NQVA 4QHSA 2E9SA 4P4UA 3R7BA 5I51A 2B3DA 4OHCA 1IRIA 3JR3A 5DSXA 2K2WA 4Q3NA 3BILA 3OCJA 5KAMA 3R6TA 3I1FA 1WU8A 3VDMA 5BRAA 1EQUA 1NNI1 4OHUA 2CVHA 3O93A 4LRSB 4RGQA 1AA6A 2K6GA 2PIAA 1DAKA 3BK1A 2XE8A 1NR7A 3EVAA 1ULUA 3JPYA 4FC7A 5KYGA 2WWWA 3TJZA 3A6PC 4KQIA 3BGVA 4L6IA 5IWCA 1RAIA 5EIOA 3BFJA 4KU4A 4MR7B 4TQ9A 3B1ZA 2IE8A 2X8LA 3ENQA 5IPFA 2EKPA 2X22A 5A4AA 3HNOA 2ZSDA 3TAUA 4JWTA 4U6SA 1C7FA 1P6XA 3M9XA 3O84A 2PK3A 1T91A 2JLUA 3ETGA 5ALFA 3ROQA 1WNTA 3D0KA 2GTIA 3O4IA 2ET6A 2YFKA 3ORRA 3LT2A 4DUPA 4WN9A 2FFBA 4W7IA 3CNBA 4IQ8A 3OJXA 3V1YA 4BLUA 4G36A 1H0RA 4S05A 2P62A 3SHTA 4HWTA 4JLUA 3QUBA 2YV2A 1NR5A 3PFKA 1U2PA 4MW0A 1YI1A 4CFYA 4ZVNA 3B1FA 4BFYA 3RJ5A 4D80A 4JK3A 3C8ZA 3D8HA 2ZGVA 4OHWA 4B32A 5A2QA 5AVKA 2A94A 3CYFA 3GLRA 4GVLA 4JOSA 5AOAA 1L5FA 4AYXA 5ITZA 1RRCA 1XVAA 2J0VA 4EFDA 1DEOA 1MPXA 5BOSB 4EZBA 3NHWA 1RYMA 1VE1A 4G5OA 2BI7A 2HMUA 2XD9A 3R6LA 8ATCA 3OHSX 1PW7A 3EVCA 3PJGA 2I87A 4H1HA 1W59A 5JWHA 5DHRA 2D6FA 1VJ0A 2YIJA 1ZCBA 1H1LB 3HADA 4BY9E 1BDBA 4QTXA 4B1FA 4MWDA 2P8JA 3PRHA 2FP4B 5IF3A 3RS3A 2R7LA 1V7PC 5LA6A 5AW3A 2CY0A 2BTQB 5LZ7A 3WLHA 4IZIA 1NU6A 1F12A 3A7EA 1X1RA 1U0JA 2Q0HA 4GF5A 2EKZA 4TS3A 4EABA 1JR4A 3ROZA 4HXEB 1XN4A 3GFGA 3AR3A 5CCEA 5LWHA 2HF9A 1L1FA 5DIFA 4BLOA 1BDJA 2MSKA 2VFAA 2J9XB 2Y4NA 2QTGA 4YQEA 4TZTA 5LQKA 1A9RA 1IN6A 4F3NA 3GJSA 4MS4A 3THSA 3UW3A 1IC6A 1ZH4A 3LNCA 4Y9RA 3AUTA 2Z8YA 1XQ6A 2W00A 4HXGA 5L53A 1J7KA 3QBEA 4G9BA 1FTGA 1KYYA 2NSDA 2DYKA 2Z8YM 3ED1A 3G2OA 3IURA 4M46A 1W9MA 5ALYA 4O25A 3ANLA 4XXHA 4E4YA 1ZMBA 3ZE6A 2DCUA 3CISA 5AVUA 3BDVA 3HABA 3CQ9A 3MYYA 2FPXA 3CB2A 1EX1A 3OLZA 1LPPA 2B0JA 3TJMA 2GEKA 1K7SN 3U3JA 2QAGC 4D43A 3NLLA 4HDQB 5GVRA 4JYZA 3AVYA 4D9KA 2XMQA 5CH3A 3WB0A 3T5GA 2BFPA 2WF6A 1UMCB 4JKIA 4AG6A 4JH0A 3GCXA 2JANA 2I34A 1LTQA 1P2TA 2VDLB 5JMOA 1B00A 3M33A 2GBCA 2AHOA 3A0UA 1D4AA 1Z0FA 4HDMB 2CF5A 4O0LA 1COZA 3TQQA 4LSMA 3ZHVA 2FI1A 4OHPA 1JXOA 3S2UA 4CV0A 4UBNA 1KOFA 2OCIA 5H3HA 2A1UB 4B8WA 4E0BA 5L95A 1PSZA 4UPVA 5FR2A 4PC7A 4RVNA 5JXIA 5AHOA 1T26A 3QU7A 3QI7A 3BICA 1ORWA 3DOJA 3MXOA 1OU0A 2XNJA 3EVZA 1ZN2A 1V1JA 1C0PA 3O1HB 3FHOA 1YOBA 2QSYA 4PLPA 4QPJC 1TAGA 4B34A 1QK5A 3RYIA 2R2AA 1Y0BA 2AF3C 2IXBA 4FDAA 1QAOA 4EVRA 3C3AA 4F92B 2CL7X 1T25A 1THMA 5C5EA 1EUCA 1O58A 3IKTA 3UQZA 1N5LA 3AOEA 1I5RA 2FVXA 1GTZA 3PHGA 1INLA 4IIXA 1FRZA 3IFSA 3U3OA 1Z5GA 2NO6A 1KI2A 3ZX5A 1OWOA 2DTEA 2PKYX 3KQVA 5AVJA 4YMTA 1CY6A 4JSRA 3OA2A 1ZW1A 2VHUA 2NTEA 4OM7A 2HA2A 3PIDA 2VDVE 4DL9A 3AR6A 2YN0A 3RRZA 4XJSA 2CJWB 4BNLA 4Z3KA 1W4RA 3IT1A 1OXKB 2JGRA 4J2TA 4QYWA 5GGYA 4DN6A 5E9QA 1LNQA 5CDYA 1HL3A 2FPGA 4O4LF 4DZZA 2CXSA 2AOTA 1VKZA 1DEHA 2NO1A 2X8WA 1LI4A 2X1HA 3OG9A 4P7JA 1Q57A 1PNOA 3LC7O 1QVWA 4CIVA 1DG9A 1E2DA 4CTKA 1CEYA 4YRKA 4H7EA 4OL9A 1Y7PA 1ZA2A 3CX6A 3HSKA 4C3VA 1G4HA 1EFVA 5EIXA 3WJ7A 2BUCA 1AMOA 2ZULA 4R31A 3GCDA 4PBSA 3SP1A 1IPHA 2P9JA 2BR5A 4X7RA 4ESVA 1QIHA 4CUKA 4GSLA 1NU8A 2YBEA 5FOXA 4Z0PA 1NRIA 4IUYA 4BRWA 2DKOA 1ZGJA 4WZAA 5DIZA 3U60B 1JR3E 1OYWA 1SBIA 3DULA 3TL2A 5IRCD 1NQAO 3FCAA 4LBVA 4N47A 3V7WA 3CF2A 4ETWA 2IPLA 3BD7A 2O59A 3TOXA 4MTCA 4NEHB 4A5OA 3NRCA 4ZOLA 2VYCA 3DFMA 5BSMA 1WL8A 1QQ5A 2R6FA 4NJOA 3CINA 3DA8A 3DMYA 4KQCA 2IS4A 2ORVA 2RI6A 2RCYA 3MD9A 4NBUA 4TX1A 1BTOA 3ETLA 1NF2A 3LUDA 2B6NA 2RHWA 3DBLA 3KL4A 2J30A 3NYQA 3OI7A 4RKYA 3HCPA 5C32A 3CVWA 4ETNA 3UAYA 5I7AA 2X15A 1JQ5A 2H1RA 4YJFB 1NMSA 4AL4A 4F4HA 1IHOA 1XTBA 1JIIA 2FZLA 1GGHA 2PX6A 3UGJA 3FNRA 4CV1A 1SG6A 2I7TA 3DTTA 4GVPA 4MGYR 1QC5B 5ESXA 2O8FA 5CB6A 2LV8A 2CXRA 2QRVA 4I55B 5CVCA 2BHSA 1M54A 4BE4A 4X97A 4RGYA 3O4HA 1T4CB 4XWAA 5IABA 1GQOA 3EEFA 3ZXUB 2EV9A 5FUMA 4GOLD 2ZIZA 3SG0A 4ESOA 5KC9A 2QTCA 1DRWA 2J4DA 1GXSB 5IDYA 5CCDA 2X8BA 4TSFD 4AZ3A 4BWYA 1ZBQA 1NM5C 2XECA 4P86A 1M8JA 2YJ6A 1RWVA 3EUWA 3WKBA 1VC2A 3DWFA 1G5QA 4B79A 5LBUA 4P5PA 4BO7A 1I51A 4LJ5A 4K9KA 3C3YA 1RD4A 3RGWS 1JFFB 2GERA 4GXNA 5ENVA 5G0TA 3WV5A 4QG3A 3ZGXA 3IBGA 3WRWA 4CW7A 1KI1A 4ND5A 7ADHA 1J5PA 1Y4DE 1XIVA 4TKVB 4RD0A 2ZEJA 4IYRA 2QD3A 3T7IA 4FNOA 4JLOA 4KO3S 4AP6A 4BNXA 4TTIA 3MWKA 4DXAA 5F52A 2D7DA 2WLTA 2OD9A 1G5HA 1GPWB 1X39A 2C42A 3HYSA 4FUTA 4UU0A 1WCIA 1TW3A 1KZ6A 3C8DA 3SPXA 1M0WA 5JISA 4L9SA 3LDGA 2OYCA 1B8OA 2AMYA 3QQPA 3LCRA 4YJ2A 5EKSA 4GOND 3CSSA 4MWCA 1UMCA 4P33A 4KFTA 1OCEA 3ECCA 4DHEA 1L8XA 1SA0A 1B26A 3N70A 2GDJA 3C8UA 3BIFA 3PG5A 2H2WA 2VNSA 3B20A 3QPVA 3UAGA 3VJKA 1JLLB 4AC9A 2NTNA 4X91A 1PFUA 3DEAA 4JJ8A 3RKRA 4CQMA 2XCLA 2Q28A 4D44A 3MWGA 4KIJA 4EYQA 1PHPA 3N2EA 2PRKA 5TQJA 2ZVJA 1ABEA 1Q74A 3H1BA 4BRUA 4KJXA 1RMTA 3CH4B 1PJCA 2JI8A 4OKIA 5IAGA 1GT6A 3ZXXA 4I7EA 5JDCA 2X1LA 4JZYA 1Z0IA 4AN4A 2ZI4A 4DG5A 3ID6C 3SKYA 3AF1A 3KV1A 2EBHX 4M7WA 3X1MA 3KFVA 1IULA 1C8VB 1JYEA 5E6UA 4G6ZA 3HRKA 5IDVA 3ZWWA 2QWXA 1XVLA 3OY2A 1KYTA 4OSPA 5J4HA 4FYJA 4Z2AA 3EZYA 1PJLA 3I3SR 1PZHA 3GO4A 2C95A 1HZZC 1UPTA 2WD9A 3F9CA 4Q3LA 5DBHX 3VX3A 5BVHA 4O2RA 2O52A 3CVXA 2Q5FA 1COWD 2W0SA 1Q0TA 4L4RA 4RSMA 3TEMA 4TT3D 1NPDA 1EM6A 2GYUA 2VA8A 3JQ7A 4HOYA 1QO9A 2OMKA 2YWEA 4J1TA 4PYOA 4RDXA 2E1PA 5A0TA 1BQ3A 4WKPA 3CUWA 1D1TA 3IVAA 4RACA 2UYHA 1YNSA 1Z3CA 4HDCA 2WJAA 3HP7A 4M9CA 1P0CA 2I71A 2HRBA 3INNA 4DMKA 4C4RA 1T0UA 2CW5A 4WT7A 2QLBA 2WF8A 5FNZA 3PK0A 4ENWA 3CUVA 1CUDA 2AI2A 2BBTA 1DKRA 3K0BA 4ATNA 4TLEA 4IZHA 1QGAA 8LDHA 2IHVA 2D59A 5H02A 3FGZA 1PFYA 1WBJB 1QYCA 1ZWKA 2FGKA 2WSMA 1W1UA 3GHYA 1Y6QA 4OP3A 2RGUA 5HNKA 4NYJR 1SCKA 3A0RB 4RK1A 1LLCA 4CIBA 4DCUA 2JD2A 1SVLA 4YS6A 2TECE 3K2IA 1F2TA 3NBQA 3A7DA 1G3RA 4IR7A 2DBZA 5KCZA 3GJRA 1MVNA 2PL5A 5D5HA 1NUQA 1X94A 4EY7A 2JHCA 1R3UA 4HFNA 4BS9A 2VJNA 5DCLA 5CLFA 2P1ZA 4FGSA 5JUWA 1E94E 2IIBA 5ER9A 3RFVA 5JD5A 3L7OA 1PQYA 2WBLC 3KBBA 2HU8A 5TVKA 4B31A 5ICSA 3U6KA 4ZOBA 2C5FA 3R76A 1AF7A 1AQIA 2FQYA 3PPIA 1JKIA 2CVOA 1PR6A 2GCGA 4G86A 4KXYA 1JHAA 4MV9A 1GWNA 4JBXA 4YBZA 1ZNZA 3EZ2A 1RQPA 4XIGS 3OZGA 2V8BA 1A1SA 5KHLB 1S02A 4JLPA 2YV4A 3SC4A 3GLFE 1Z2DA 3QE2A 4PW0A 1M67A 4RIFA 1JYFA 1K5PA 2OYSA 3FSGA 4WNIA 3X2EA 1KK1A 1KYWA 1P9NA 2PLAA 4WNAB 2XCIA 3T52A 2HDOA 4BFXA 3D59A 2ZYUX 3V55A 2HGSA 5KNBD 4Z53A 4CPDA 1TF7A 2XLBA 2CJWA 2OHOA 4L72A 4XGRA 1JDBC 3ZIAD 1HTWA 3QK7A 1Z7WA 1VKRA 2PS1A 5ICGA 3U1BA 3QNUA 2JGFA 2C83A 4IKOA 2IW3A 1L5NA 2YOHA 4JB0A 2Q9CA 3B52X 4G0VA 3FFWA 3BFKA 3G5TA 2J7PA 3PWKA 4JOBA 1QPBA 2IH5A 1E2UA 3PFGA 3DAPA 4MR7A 1AN0A 4WKNA 5FLEX 3SS7X 1KEEA 3IV9A 4TTRA 3AUFA 3O0DA 3DAOA 2ACVA 3ZY3A 3ZBUA 3BBLA 3DVQX 4C5AA 2PWZA 4UHJA 4EJFA 3E5HA 3G0OA 2PD3A 2RGAA 1GRRA 3V7UA 5A4JA 2IDJA 3HZOA 3PC6A 4MI9A 3ET4A 1N5RA 4KL8S 2OV4A 5HR5A 2CZCA 3I8XA 4N5LA 1VJ5A 3UG6A 2WU0A 2JIPA 2J48A 3HJRA 1CR0A 3NEYA 1WIWA 4NECA 4RV4A 5TIIA 2Y68A 4ENVA 3EA0A 1NJGA 4DSZA 2Q8PA 2ZRAA 4IINA 1PRYA 4FFSA 1OOEA 1UZNA 3T5DA 3NDJA 3BL8A 2A0KA 3RSLA 2PUJA 4F11A 1XDDA 1JWAB 3W5UA 2BSXA 2XDQA 2Z5FA 3L0PA 3G2JA 3GEGA 5EHXA 3KL2A 5DN6A 2CFOA 3KWMA 4DV4B 4IWNA 5JS6A 2WOJA 2AQKA 3RYCA 3OU6A 4RTKA 1J39A 2JG3A 3FOFC 3TB4A 1SBNE 3ENWA 1LNZA 1U6JA 1NT2A 1A7AA 1ZITA 2VHJA 4MUFA 2SHKA 3D2BA 1QHEA 1N6KA 2WB2A 2ZUTA 4G1MB 2JLCA 4QOJA 4DMGA 5KQRA 4BOYA 1G21B 4I50B 4UKDA 2E82A 5ITWA 4G89A 4E5YA 1CJMA 2EGGA 2I2XB 3NHBA 5TC4A 2WIDA 4QTUB 4MKXA 5DYIA 4Q7LA 3VMFA 1UK6A 3RS2A 3O90A 3NBMA 5CTJA 2M6RA 5IXJA 1H42A 4PGGA 1K97A 5BVHB 4FOPA 3A4MA 3MMNA 1YQUA 1L7BA 2GJKA 1W4ZA 2QQFA 4LX8A 1N2JA 2AFIB 4G9EA 5EWJB 3WLSA 1P80A 1ZBDA 2QRMA 4QNMA 4WCDA 3CJQA 4L3OA 3RODA 1MH9A 1U2ZA 3FYUC 4DSNA 2A5DA 2VWQA 5T7BA 2GM3A 1NQTA 2C1EA 4KNVA 4U7PB 4AW9A 1O2DA 4P2BA 2YASA 1XRLA 4ESHA 4ENTA 1NIPA 3W0LB 4D3SA 3KWLA 4HB0A 3DCNA 3EVTA 2OV1A 1AKRA 1OTYA 4UJ3A 4Y1RA 3C0KA 4UTZA 4UHFA 1WAMA 5D8DA 3WE7A 2G3YA 3SJCA 2IKSA 3HB0A 3TCKA 3L41A 3Q88A 2FRXA 1ZMOA 3GAAA 4ZALA 2I3DA 3EIUA 2G77B 5GAJA 1U90A 5FP0A 3VH1A 4B3JA 1RLTA 2OFFA 4BVJA 1XZEA 4UUMA 3A4NA 3B38A 3FETA 1O97D 3N59A 1P4JA 1AQ6A 3HKCA 4UNIA 5E8JA 2VWHA 4NYMR 1PJQA 2P30A 1PUXA 4MP3A 5HRUA 5C8ZA 2WTEA 4PZCA 1XKLA 1SVOA 5A4FS 5F98A 3L07A 5LOVB 3K5WA 4XDYA 3C85A 4LA4A 4WLEA 5BR4A 2QVCA 2AMJA 3BE4A 2D06A 1EFTA 1U8TA 1FNBA 2WHXA 3BFPA 2H52A 2BGUA 1T5DX 4FE4A 2ICAA 4B4OA 5AR1A 3HXPA 3HLTA 4YI3A 5FORA 3WXMA 4U9UA 2NZUG 3QOYA 4AKIA 1S3IA 1D5CA 3TUZC 1GGNA 4F2DA 1VJDA 1USGA 3CXUA 3EMKA 3SEZA 1AF4A 2ODPA 1P2SA 1L8LA 4FYPA 3TE7A 5F3WB 4OM8A 2V6IA 1NLFA 1VCMA 2DUJA 2YVAA 4MMYB 1RZ3A 5A6SB 4RZIA 4OJKA 2VH2A 3TPCA 3MTQA 5EXTA 3V34A 5IAOA 2QD4A 5DCWA 3GLIA 2D7JA 2Y0BA 1XU4A 4DT1A 1M5RA 1HNXB 3ZGZA 3BF7A 3ZWYA 1YR1A 3PX2A 3GEMA 3M2PA 1IVYA 1VPEA 4RVCA 3VI4B 4EFKA 4EG6A 4KG7A 4CMJA 3A9VA 3RQIA 1E3WA 1YVDA 2ZLBA 2BFBA 3GWZA 2BGMA 4QASA 4W1QA 3TEFA 3QXGA 5BMVA 4CETA 2C7PA 1YH3A 3OCVA 3HKBA 3KR0A 3MOIA 3QKIA 4OJTA 1ZI9A 2IPAB 4BZPA 2WKRA 2FYTA 4M1MA 2WMOB 5KU7A 3PVZA 1YMVA 3OE1A 4N39A 4ECEA 5IKMA 2FR0A 4JXXA 1E0AA 1E9VA 1ZRMA 3RS7A 5AW2A 2YZKA 1BW9B 2I4IA 2TRSB 2HK9A 5EOVA 5KDLA 3N6RA 3PC2A 2F43A 2X8JB 2PT5A 3CNNA 1G5RA 1H3FA 4LNUB 3RIXA 4DILA 4NOKA 3T5BA 3GT0A 4FKBA 1KWKA 3G0HA 1PJRA 1L7NA 1QTIA 3ETJA 2WJIA 3P20A 3UMMA 2LPMA 4FJ1A 4YJHA 1SZDA 2YXBA 5JXHA 4MRMB 4UU8A 1OYOA 4YJKA 2E55A 1CIVA 1W93A 4GZMA 2HQOA 4MO9A 4L1KA 3D0QA 4OQDA 4KJZA 2Q5EA 1XZMA 3Q0IA 4GXTA 5IJZA 4NBKA 3WIBA 5ADVA 2I4LA 3VPDA 2A9RA 1F5NA 1JLHA 3B6ZA 3L6RA 3TRHA 2DXIA 1RKUA 4HFRA 4UBKA 3KSUA 1NDQA 5I7RA 1FU8A 4M22A 3STWA 4LXTA 3AF4A 1FUKA 4YAKA 5A5DA 2UAGA 4FMCB 1D0SA 3HCOA 3R0JA 4Q4AB 5K8UA 1IBKB 4WV3A 1YUMA 4MGEA 1TUEA 7REQA 1FIUA 2JGMA 5EZYF 2ZRKA 3ST7A 1CZHA 5D5PA 3QX9A 4H31A 1XXHB 4PYKA 4X0EA 2HHCA 2B4KA 3HXKA 3NTUA 3ZZ1A 2R4TA 5F2KA 1I5EA 2F9MA 2AG1A 2KI5A 3R7FA 1UK8A 1PFVA 1ZX1A 3BWBA 3R0VA 3BD9A 3HLYA 2COUA 4RJLA 2OEPA 2FWBA 4G3XA 4KDRA 4B6GA 3FNFA 3JPWA 5D3MB 2NAFA 1RZRD 2V6MA 4AIIA 3N1UA 4WDRA 4CLOA 4X1YA 5KOYA 3KKPA 4RORA 4Y9TA 4ZO7A 4X1IA 1XZBA 2ZOSA 3NG1A 3PXBA 4TTSA 1L8AA 5FPHA 2CB0A 3WICA 5HRCA 2PR7A 4V3BA 3IRVA 1DC5A 3R0ZA 4DV3B 5G0VA 4L8FA 3SQLA 3WGUA 3D8BA 3VDXA 2C7BA 1Z8NA 1AHIA 1SU8A 2B5VA 2CLMB 1ODCA 1UM9A 2XUQA 4QM6A 1F5SA 3OFJA 1ZJ4A 2QTAA 1QO0D 3QVXA 4H1TA 3PUWA 4MUAA 5GOTA 3ZWXA 2CJYA 4YP1A 3G7SA 4KP7A 4JVSB 1CY7A 4M1ZA 4FGLA 4PNHA 4CR8A 3CRW1 1MJHA 2R0QC 1OFVA 5K2MA 4HHEA 4E5NA 3IUYA 3V2IA 2C7QA 1M3SA 1JSLA 2PJUA 3AC0A 2OBXA 4B71A 2O3QA 3IHTA 4K6OA 4BO6A 1DBIA 2HU5A 3T3OA 1SQ6A 2XPCA 4DANA 1CS4C 5HBGA 1JHRA 4JD5A 2VR1A 5B55A 3CRVA 4YR9A 1PFQA 1V35A 3JQGA 3MUFA 3ITKA 3LUBA 5D2CA 3BFXA 1Y8RB 3O26A 4G1BA 5HKAA 3TN7A 4MA5A 1PDVA 1RWWA 2W2LA 3NU1A 2JLXA 1U8ZA 4LGYA 1KSGA 1Y5RA 4KC0A 1EDEA 5KOHB 4OO3A 1N5MA 4LYHA 1EH5A 4HQKA 2GBFA 4KAJA 4TM7A 5A6SA 5IVKA 1YA4A 1HG1A 3HL4A 4Q1EA 5GJWC 4ZXFA 3SWWA 4I0WB 1TCCA 3C97A 2AFHB 1JU3A 1MXHA 3GI1A 4DR1B 2I1VB 1SKQA 2ZB3A 3JQAA 1ABFA 4L73A 4RNCA 5AI0A 1TOAA 4DA7A 2JFOA 2A4KA 3L02A 1MD9A 2C2GA 1EWRA 2VATA 2BMFA 2XNSA 2GRJA 1BHJA 4O4HF 3Q8XB 4RGBA 4GL4A 3VZSA 2BM0A 1C81A 3HUFA 4FFWA 4RDHA 4TYWA 1E2FA 2YQ4A 2ESRA 3KZKA 1ZJ6A 4MXDA 3CRRA 2DE0X 3GV0A 3IHKA 4DCPA 1WB9A 4PX3A 4EB8A 1U5CA 1CIPA 3SF8B 5HQ3B 3B6MA 4R0VA 3W34A 1TYZA 1WMBA 1X0XA 2JFWA 2QTLA 5IULC 5K0ZA 4FWTA 4C08A 5DX8A 1DOAA 1Q91A 2WVJA 3I04A 4U2CA 1P8JA 3DEZA 3WKDA 4DLVA 5JC8A 5L3QA 5LLSA 3G0DA 2VAPA 1OKKD 3MRTA 3PITA 5KYVA 2DVMA 1AS2A 2PFKA 1YQ9A 3PNMA 2CDAA 3I04M 1JPJA 2OXTA 1EGHA 4X63A 5C8YA 4DMCA 1LDNA 2P6UA 4UULA 3WLLA 3LHIA 3DNMA 1LS1A 2A5GA 2ZSJA 4JT8A 4QICA 4QU8A 4YB8A 5EVJA 2X4GA 3C3BA 5KS2A 4RTLA 1QAMA 3PHJA 3LZCA 4RM2A 4WOCA 3SYNA 8ADHA 4F4CA 3M3DA 3DHYA 2F3UA 1P4AA 5AW6A 3JWJA 3MELA 5FJJA 3PA6A 5EHZA 4RA9A 1CY0A 4IQFA 2NPFA 4DBLE 1VXOA 1FNMA 3KZNA 2FB9A 2VP5A 4LVUA 4B81A 3IT2A 2E48A 3PCRB 3PNQA 3S4YA 4ASUD 3Q41A 2B1GA 3SJAA 4BKOA 5KPJA 2ORWA 4LSGA 1C29B 4FC6A 2JZNA 1S01A 5EN4A 2Y76A 1RM4A 2Q29A 1EWTA 4Q1FA 1JB1A 2A0FA 2PJRA 1ZSYA 1P4GA 5DX1A 4UUOA 2P41A 3WYAA 3AUYA 2WJ3A 1CE8B 2VXBA 2C5AA 4X95A 5JOQA 3F2VA 4LXUA 1JLSA 1JIJA 5AK4A 1UDRA 4DLXA 1FFEA 3B6KA 3ED5A 1YUBA 3OD5A 4NDZA 1U3FA 4ZYXA 4FDVA 4MUKA 5F3DA 2ILTA 3FN4A 1HYQA 4JX9A 3PQ2A 2X0DA 3V4PB 1RKQA 1VI5A 1AV6A 4WLFA 4UCQA 1KEKA 1YNOA 2ATEA 2P67A 2B34A 3AOEC 4LUCA 4RPGA 1J0CA 2ORIA 2AR7A 3CLTC 4UEOA 4CCYB 3DMRA 3TX6A 1RXYA 2YJZA 1KVTA 5H5JA 3VKVA 1DTWA 4JBIA 4N7MA 3N8HA 4B44A 2BCEA 4G5RA 5E9WA 3SYTA 1U1FA 5DNAA 2ENWA 4NOJA 3PEVA 4KZPA 4W1SA 2XCSB 4YDQA 4IGAA 4HT3B 1QHHB 5KSWB 1EPUA 2VOJA 4FCWA 2IH4A 1VRVA 4DDHA 1NC1A 2VNAA 1X8XA 5DLQC 3OBIA 2B2NA 3WOHA 1CV2A 3FWZA 4O3FA 2FZCA 3PSAA 1RR6A 5GV8A 4O3MA 2QYHA 1UP6A 2RHLA 4YQYA 1NUAA 5BYKA 5ITZB 3UH0A 5DULA 1BKYA 2ODEA 4IJMA 3MJCA 3OCYA 5LFAA