1N5OX

Structural consequences of a cancer-causing brca1-brct missense mutation
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
207
Chain Sequence
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNRPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antitumor protein
molecule keywords Breast cancer type 1 susceptibility protein
publication title Structural consequences of a cancer-causing BRCA1-BRCT missense mutation
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 207
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1n5oX02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1n5oX01
2XNKA 4U4AA 2DUNA 2LE0A 3K0KA 2K6GA 3SHVA 3L40A 3FA2A 3PC7A 2HTFA 3T7JA 3AL3A 2VXBA 1T29A 3OLCX 3PA6A 3KTFA 4XPZA 2ADOA 2AZMA 3QVGA 3PXBA 4N40A 2VXCA 3PC6A 2M2IA 3L41A 3SZMA 2K7FA 2EBWA 3JVEA 3K15A 3T7IA 4ID3A 3PC8A 1L7BA 3UEOA 3T7KA 3K0HA 3UENA 3EF0A 1KZYC 3U3ZA 3SQDA 1GZHB 2E2WA 2COKA 3L46A 1T2UA 4Y2GA 2EP8A 3PXEA 3I0MA 2D8MA 2EBUA 1CDZA 4JLUA 1Z56C 2JW5A 3COJA 2COUA 1L0BA 1N5OX 3II6X 4BMCA 4OFBA 4BMDA 3PC8C 3I0NA 2XNHA 1JNXX 3EF1A 1IN1A 2R1ZA 2WT8A 3PD7A 5ECGC 3HUFA 2COEA 1T2VA 4IFIA 2L42A 3SHTA 2ETXA 3T1NA 4XQ0A 3K16A 3PXDA 4BU1A 3K05A 1WF6A 1OQAA 3PXCX 4BU0A 2NTEA 3QVGB 4Y18A 1Y98A 3AL2A 2INGX 4IGKA 3HUEA 1IMOA 3PXAA 1T15A
chains in the Genus database with same CATH superfamily
2RCNA 5LQRA 2VT7A 5IWAB 5B3JC 2XCRB 4H77A 2M6LA 4DY6A 2FZGA 1XDSA 3HEBA 3A4TA 4X00A 5CHEA 4RXTA 4RKQA 2CJWA 4DSAA 1P6XA 1Y1QA 2VDLB 3ZCTA 3ZDDA 5LZ7A 3I8OA 1K68A 1LZLA 5LDHA 1UIMA 3CEPB 3ISTA 2GAIA 3IJRA 1HYQA 1KI7A 2CXHA 4J49A 3CTMA 4JB3A 2RSLA 1EP9A 4LBYA 4P2BA 1Z2EA 4BUJA 3CR3C 4WNAA 4OA8A 1NJFA 1NKVA 4UTRA 5SZKB 3GAZA 4BMXA 5F7XA 1MBZA 4KODA 4RZSA 1R0KA 3PXXA 1XMVA 4KQWA 4MUKA 4C0BA 2A6PA 5CFLA 3U4AA 3BIWA 2W5UA 3JYQA 4C4TA 1OF1A 2Y1WA 1FP4A 4AF8A 1TYBE 5FQOA 2HK8A 1YIOA 1K6EA 3MUFA 3LBYA 2G17A 4BFXA 2ZB4A 5K51A 5ETJA 4KR3A 1XB2A 1S1CA 2H0AA 3HYLA 4KXWA 3T95A 4QXRA 3UAZA 4Q93A 4M9UA 4A10A 2DHRA 2IZZA 4WY5A 4C4PA 3HQ4O 3WRXA 5BOVA 3OLQA 3HDGA 2LNDA 4JI6B 1C2TA 2OOSA 3O84A 4JB0A 2VK8A 4S35A 3KZNA 1WSDA 2XUPA 3IP1A 1PFUA 3EGWA 1ABEA 3KCNA 3KX2A 3LHDA 2GD6A 5K6AA 1ZWLA 2H9YA 1TA0A 1NZDA 5AVWA 5E9JA 4K6CA 2AFVA 2WYHA 2ZB7A 1ZP6A 4U0KA 2PT5A 1VPVA 5ADUS 3UAYA 3UXYA 4GH5A 3RODA 3FWKA 3BAFA 3DCYA 4MVWA 1ZUNA 4WESB 1C9DB 3MN1A 3I76A 1LRKA 1Z35A 3CR8A 4B3MB 1A8HA 3AI1A 3E48A 2JIMA 2HIGA 3BBLA 1OI3A 3FR8A 5JFGA 4DV0B 1YQWA 5F12A 1SQSA 2FPLA 2X2EA 5KWIA 5DCYA 1DEHA 1DFIA 1L0BA 2MWMA 1A9RA 3F6CA 3PR2B 3WTBA 4BMCA 4F91B 4KXFB 4PCLA 2C07A 5FEUA 1XPOA 3NVKI 2CJWB 4HQOA 4JSTA 4GX2A 1QR6A 3ICEA 1JFFA 2E85A 4FKBA 3P9IA 2O3UA 1EJ2A 3E9MA 5I7VA 1D2CA 3K53A 3PUIA 1XCOA 3MPOA 4L51A 4OATA 4CMGA 2AZXA 4DOMA 3LDGA 4QRHA 1TKCA 2QW0X 5CURA 5IS2A 1OR8A 5FHQA 1SXHA 4ZTBA 2AWOA 3R3ZA 4J29A 1XBTA 3NIBA 4UQOA 4WNAB 4WIAA 3QXJA 1JALA 1JBKA 2PX5A 4OI4A 2ZBUA 5DBGA 4F3YA 3H4IA 3H5OA 4MRNA 3V00A 3TI9A 5IU6A 2FUEA 3HGTA 1YUNA 4DA4A 2R2AA 3QNMA 5KNBD 1FP4B 4I50A 1U8ZA 3QBVA 4TRJA 2OBYA 3V8NA 1YR1A 5JY6A 2B35A 3B3QA 4EYGA 3TLBA 3X1JA 4PHGA 3X1MA 1Q0HA 1WO8A 4W1SA 8ABPA 3DTNA 5FNZA 1TT5A 2R6AA 4ME6A 4W5RA 4BQEA 1GIAA 1H69A 3WJ7A 4JJFA 3I04A 4BYMA 3M4NA 2Q3FA 2P2ZA 5G40A 4HYYA 3G5LA 3R3JA 3DPUA 2Y2UA 1KDVA 3O3MB 4B0PA 2G1UA 5IFKA 3A4LA 1KZ7B 4IIYA 5IKOA 3VA7A 1W25A 1F3LA 4L8VA 5GY7A 2X0KA 4D0NA 3N0XA 1ULAA 2GN6A 4R68A 3NOVA 1V1RA 1S1MA 1DIGA 3N74A 1VA5A 1Y5LA 2OCDA 2PFKA 3IVAA 4KLZA 5KPDA 1QHEA 3QLVA 3RRZA 1XP8A 1YZFA 2WD9A 4ZOBA 2H7YA 3C14C 3EWAA 3SYNA 5IVPA 1F60A 2JD0A 4HWPA 3AL3A 1H9CA 1CUSA 4WMLA 2Z3ZA 3KOOA 3PEUA 3WGNA 3BDIA 1I51A 1SHTX 4WGGA 4XYEA 2VC2B 2D3TA 4LGVA 1EP3B 3CO0S 2PD6A 4QU0A 1U94A 4I1YA 1FBTA 2JCGA 3TMAA 2VJQA 4CMKA 2C95A 1G8AA 3O03A 5IZ4A 1QMPA 2JIQA 4X8OA 5AM4A 1JSLA 3LV8A 1FLDA 5ICEA 4N9QA 3RUIA 3T38A 4WK6A 3LWBA 3VPDA 2YW9A 1RQXA 1UM8A 2VDWA 5DKFA 5H81A 1DQZA 3VR6H 4HHEA 4GPTA 4KRYA 4ITUA 1WDMA 1RE1A 2X0NA 1QUFA 3EYWA 3VGPA 3DOCA 4D45A 1RZRA 1IBLB 4Z4EA 4LRSB 2ZRLA 5DHFA 1KY3A 4ZKEA 4OQFA 4RDXA 2BH2A 4U7WA 3NBYC 2NTYC 2OAGA 2UVQA 1PJLA 1QWSA 4G1MB 4LIPD 2P6MA 2NWQA 1MGOA 3PGA1 4YRSA 3WGIA 5LD2B 2CXUA 5E2IA 2CMDA 3H2ZA 2GETA 4DWWA 1FW8A 3GHYA 1GO2A 1NXSA 1TT5B 1SPBS 3I05A 4RULA 4R83A 1TKBA 4GEGA 1SKQA 1V41E 3DF7A 3RHTA 4I4TF 1YOVA 2FWIA 2FZKA 2WNIA 1FTQA 1GTL1 3AF0A 1HT3A 3ZNQA 1Z8DA 3KE8A 1ZEJA 2OV4A 2Z3VA 4UAJA 1B0UA 3GR6A 4N49A 4TZTA 1UBLS 3RK1A 3RC8A 6GPBA 4F3NA 1IUNA 2G8NA 1AN9A 1IPEA 1C8LA 1SC3A 1KMNA 1O08A 1SK9A 2OHGA 3DAHA 3R6GA 1V1RB 4KG7A 1U3VA 3JWPA 4D5EA 1V0JA 4TWJA 4EYSA 1O58A 5A4AA 5JSZA 3NNDA 2Y3IA 4HWGA 3AESA 3AR6A 1IBCA 5AOVA 2X6QA 1C4KA 4U7PB 5DNDA 4ZVMA 4CIYA 1EVQA 2Q0HA 4ZVRA 4JDUA 2QTWB 4AJNA 2Z08A 4MCJA 3U5TA 3NUGA 2I6UA 4C6SA 4EBBA 4PHTA 5IJAA 4IHJF 1R74A 1X1SA 3AP2A 4KO1S 3AF5A 4MKGA 3R7LA 3FFBA 3LA6A 1KKUA 1V3UA 4F72A 4TTPA 2H1HA 2GNOA 5FLKA 1WMBA 3RTAA 4EBFA 3IEKA 5DWDA 4IIEA 4L27A 2C1XA 1KFEB 4RLQA 1YMQA 3TQCA 2O48X 4TKUA 3ER9A 1IMJA 2J30A 1QDLB 2PBZA 4M89A 2VYVD 1V37A 1J25A 1A2KC 1L3CA 2C04A 3BRCA 3OF3A 2QLBA 3GYBA 2A5JA 2VJAA 1USWA 3GVIA 1BMFD 4N0QA 2BM0A 4YP5A 5EXSA 2C99A 2M1ZA 4MUMA 3JATA 3RKSA 3F74A 3KIPA 5J4YA 5F52A 2PU7A 3NHMA 1KS9A 3PA8A 4MPDA 4MPPA 2NZVG 3RQIA 5EJ7A 4Z4GA 4INZA 4OHYA 3I1FA 4KQEA 1TECE 4FEAA 5CLGA 3KKMA 4E11A 1JLLA 3MVEA 2W2OA 3DZIA 1A4RA 4RFVA 1X7ZA 4BAUA 4HAIA 5ELXA 4ZIRA 1E2BA 1TD1A 4IILA 4GYKA 4XQEA 2V7PA 4YCBA 1VKRA 3QVTA 1QZ3A 1G6KA 1ID8A 2JCXA 2NXCA 2ZSBA 1B42A 4OLHA 4Y7DA 1R64A 5CLIA 2RDMA 1U02A 5LQNA 5LB4A 1JHPA 1DEXA 3Q8MA 2H57A 2MT9A 4WOKA 8GPBA 4JODA 1QG6A 1R8QA 1YOVB 1ZSYA 4GT1A 4ZARA 3H2IA 4RSRA 1JDBC 1WBDA 3Q7SA 4UVEA 3TQHA 4BNFA 5ED0A 1GGFA 3SBEA 3O6VA 3V7UA 3C24A 4EJMA 4QVGA 4C7KA 4YIHA 2ORYA 3CB2A 3T1YB 5GAJA 3FYHA 3O4GA 1PVDA 2VVTA 3QVMA 2BKXA 3LOQA 5FI0B 3NJRA 4EI9A 2Q8QA 5IKMA 1Z7GA 1J2EA 1WCXA 2Q5FA 1IVNA 3C6ZA 1DQYA 1BCSA 3BJMA 3IBTA 1JR3E 4PTLA 3AESB 1VG1A 5CDFA 4BAZA 2WE8A 1KFBB 4HJRA 4FE4A 5KX5F 2HWWA 1PL6A 3PR1A 5SZIA 5TGZA 4ZQIA 5AVYA 5HRUA 3VKWA 1NW3A 4OHBA 4FI3C 1D2GA 3RFXA 4RVUA 5E1OA 2OFXA 2WMDA 3IC5A 1FF9A 2HIHA 4QDJA 2JF0A 3AXTA 1F1JA 1XNHA 2HQOA 4XD7D 1RD4A 4AXXA 3FWZA 2X1LA 4PSUA 4TKUB 4BECA 4E13A 1VLMA 3VI4B 5A4JA 2FQYA 4ZGWA 3OHPA 2QJWA 3DVLA 1E0AA 1HT0A 2ZJ1A 4JT9A 2Q8PA 2QW1A 5J2TA 1BD3A 2I87A 3CF0A 1GLVA 3DV0A 3P2YA 4W8GA 5DTEA 3JATB 1XZCA 1WE2A 2NT4A 5AKGA 4YT2A 3F6PA 2R8BA 3ZD6A 2KM1A 4EFLA 1LI5A 4W5TA 3FCUB 4YUAA 5ESRA 2IUSA 2NIPA 3L7DA 3ADPA 5ELLA 2DTEA 1OX5A 5D5HA 1R6XA 2ZI9A 1SCJA 2X1HA 4JHXA 4ZIRB 1J90A 3WE7A 1EFHA 3AHDA 1CS0A 2B94A 1G17A 3GUVA 1GL3A 3EDCA 4LHSA 4CI0B 1FQJA 2OCXA 1FFDA 4QT0A 2GEVA 2OHJA 4ERNA 3MIZA 4R31A 4Y6LA 1KR2A 2LGJA 4IFBA 1ILEA 1Y4ZA 5EKXA 5TC4A 3T7EA 4HR7A 2PVPA 1PJ3A 5CDUA 5JLJA 3ZU5A 1PZMA 1J97A 3V48A 4OQYA 3LGXA 3HI4A 2O2JA 1M2OB 4KGZA 1LGYA 2BF7A 4BP9A 1QGDA 4PX2A 3N07A 3ZCRA 5IDQA 3LWZA 1CETA 1Q84A 1Z88A 3W6NA 4E15A 4IDQA 5KTTA 4FB4A 2Z95A 4LVNA 3IDSA 2P41A 3OIUA 4R2MA 4W5JA 3WGYA 4AZ0A 2H52A 1SMKA 4OYRA 5GOZA 3GMIA 1BCSB 4HGRA 4POAA 4NTZA 5FWXA 4UFPA 1QRDA 1JEDA 2IPOA 1JN0A 3K9QO 2XUIA 1VHQA 3EVTA 1TEXA 5EUCA 5IAJA 3TZ6A 3ZU2A 1W34A 3DL0A 4AX8A 3NYIA 5FORA 3CH6A 3LQFA 1SOWA 4G2NA 4I9FA 5C4IA 2EW2A 4L28A 1GTSA 3ZX4A 3SOPA 3SOZA 1U63A 1I1OA 1V7PC 3O1JC 3T52A 2I76A 3N53A 4CKWA 3JW8A 3PFKA 2Q2QA 1RZUA 3F98A 3PUKA 1O5TA 1Y3FE 3QLUA 5J2TB 1W4ZA 3DV0B 3I39X 3R2JA 2PRJA 2NQ8A 5AIBA 1I7PA 4D9EA 2V74B 3VNVA 4LDAA 2O3TA 1CBUA 3RC3A 4I1VA 3KVNA 3Q5GA 2D5IA 4HF7A 4JSRA 2JJYA 4K86A 1C7QA 1KP3A 3L06A 4E1BA 1XZQA 3R7DA 2ZGVA 2G77B 3K35A 3EZYA 1OBOA 1ZI6A 2EZTA 3BWDD 3BRWA 2AI3A 1XZFA 4G23A 2C9MA 2DR0A 5BSGA 2H7VA 2O2EA 1CS0B 2GI4A 3HJRA 4K6HA 2ZRPA 2ASEA 4RDIA 3TPFA 2QD4A 2OHFA 1SKYB 1HLFA 2CY0A 2J09A 2OFPA 2YS7A 4NL4H 1Z5UA 3TQRA 3U4QB 4C0WA 2OC4A 1DWQA 3WAGA 2Q62A 2PMCA 4K2HA 4YROA 4ECEA 4ZI7A 2EGGA 4BGVA 1E4VA 3NVDA 1KARA 4J0QA 1QP8A 1ARZA 1CR6A 2PUTA 1HL7A 3P96A 1IB6A 2EW8A 4DA6A 5FWYA 1H6BA 5HUHA 4K0KB 3MNFA 3V2HA 2R62A 2XQVA 3GJSA 2IC5A 1JB1A 3UKDA 4FYPA 3NFRA 1BH2A 1ZR2A 4AZ0B 4HGQA 1RI3A 4QOIA 4S2EA 2QQEA 4DXDA 2DT5A 2EBUA 3AI3A 1EESA 4ARCA 2NTNA 3PF8A 3E7FA 2D0DA 4YP0A 3RRXA 5FWXB 1VCHA 2FWRA 5A3RA 3IQFA 2IZ1A 4BL5A 2K5UA 1UDBA 2PPLA 1GCAA 1W4RA 2D8AA 2OTCA 3KT0A 4M9SA 4RBNA 4TYPA 1JHOA 4L07A 2B36A 1THTA 3A7EA 4F3CA 2Z5VA 1BHJA 4DJJA 2FMFA 2BMJA 4PZUA 1SXQA 4ZRMA 4B5LA 2M9MA 3KC2A 4B44A 3EDOA 4CKWB 5DM2A 5CM2Z 2HHAA 3EPRA 1PZHA 1WZNA 4LY0A 4RADA 4WXEA 5ALGA 5E7MA 2WFZA 4CTNA 5HF8A 2YMLA 1IG3A 3WL5A 4WADA 5D3ZA 2Q7DA 1VJ1A 3SM3A 3JD0A 1TPZA 1YU9A 4GLLA 2X5XA 2O8BA 2C8LA 3DB2A 3U4HA 5A5FA 5K01A 5TY0A 3QHPA 2J45A 1E4OA 3ONFA 1KVUA 1LC0A 4BKPA 2GPJA 2AMYA 4QQ8A 2PX6A 1ZGCA 3ESYA 4B8YA 4FEYA 3DV9A 1MC4A 4G0NA 1IEXA 4WLFA 2DWCA 3OFJA 4YK7A 3P9RA 4W8HA 2QA5A 2QF7A 2XQIA 1MH1A 1QIJA 4Y6QA 1QR2A 2IVFA 2VAPA 3QUAA 5KAPA 3ADCA 3HN6A 3UWOA 2H85A 1GSIA 2VEOA 3KLNA 1CZUA 4IKEA 4ZI7B 3UGJA 4JUBA 4R98A 4FDMA 2XTZA 4UNSA 4QL3A 1J8MF 2Q0XA 1WUTA 3DA8A 1NXPA 2X4GA 2ZCVA 3I72A 1AQIA 2GMWA 1F4VA 1FU7A 2PJZA 5FWYB 1ZUHA 4JU9A 2B7CA 4HH1A 3TOCA 3DMDA 4YMLA 4RHTA 1QIFA 1YL6A 5FI5A 1C9KA 2D59A 1E2IA 1HEYA 2GF9A 2NO4A 2QNIA 3EDMA 2QYHA 1JQEA 3IOEA 3ITKA 1C3OB 5EJIA 5ARDA 3TMYA 1NQTA 3QUCA 5ES3A 1JXMA 4MVJA 1D03A 3E8MA 1ZA2A 4TWIA 4BV2A 1VYHA 4G5SA 5BT8A 1TTTA 4M21A 3MJTA 1ESZA 1MOQA 2B92A 2W6NA 1T4CA 3FYUC 3PGXA 4OAPA 3ZH9B 4V0LA 1NVVR 1SVKA 2JGEA 1QG0A 2WG1A 4GM4A 4M0KA 7YASA 2D4HA 4XI9A 5EJFA 1M1ZA 5DE3A 1JZSA 3TW8A 4JL5A 3G9ZA 4Q4DA 4G1VA 2UUPA 3LUBA 2AFIE 1YHYA 2ZDGA 3V4SA 2Y0CA 1V1MA 2WWRA 5I3ZA 4KGXA 3TLCA 3NRBA 1K6MA 3M1IA 4A8TA 2NGRA 4RD4A 1PBTA 4Q3LA 3OJFA 3UICA 1WLSA 3AB3A 1MQAA 4BQIA 4JA0A 5C46F 2XXJA 1SK8A 3NAGA 4V0RA 3RS5A 2J9ZB 3AEYA 1R8YA 3N8HA 1AIPA 1QYXA 2PSJA 4MQEB 2V7WA 4EG6A 2YYYA 4JAVC 4K6MA 3TJRA 1KNQA 2VPPA 5M29A 2AOUB 2FEWB 2WF6A 4HZGA 2W90A 2J67A 5AKIA 4IQGA 4JVNA 5K7SA 1JHYA 1OTYA 2O8BB 1MB4A 2WIAA 4LV8B 3KM0A 2QTGA 2Z2XA 3BCSA 4FCWA 1GQSA 2V54A 4DG8A 3D3NA 3MTGA 2VWPA 2WHPB 4IICA 4NI5A 1DQNA 3RVSA 2D7DA 5LWQA 3L6CA 1MX9A 1MZVA 3DMTA 3PBKA 4FYIA 4DSTA 1FCJA 4JXZA 2G63A 1XQVA 1JMYA 3CXRA 4HL6A 3T3DA 4LDQA 4EJ2A 3TM5A 5JH7B 3KSAC 2BEWA 3OZEA 5ECWA 4IO0A 1VE6A 2H2AA 1XDBA 4AWXA 1B26A 2ZIZA 4FWBA 2BYTA 1EFTA 2NO7A 2NU7A 4RVOA 2NN3C 4YS6A 4OAQA 2ZI6A 2VDKB 1LDBA 3B9PA 5KNDA 1O6BA 3OU2A 1UJ2A 2BJHA 4BNIA 5H3LA 4ZYTA 1JKIA 2GZMA 4QBIA 2XMZA 3RVQA 2P4QA 4K40A 5IRCD 1Y9ZA 1SEPA 1E64A 2X3FA 4NHOA 4R3NA 2GEUA 4FONA 1KZ4A 4BFYA 1XKTA 3QEOA 4R7GA 3GEHA 3VBCA 5AVXA 4JOSA 1NG9A 1EE2A 3C3JA 4TOIA 1K8YB 1IXKA 2EG9A 2UVPA 1A7JA 1L6RA 3PUWA 3L77A 4NU8X 3VPAA 4BFTA 3LH5A 3TGPA 1Z06A 1GDTA 1XIVA 1T4CB 1O9BA 1PKXA 1XD8A 3WRVA 3F3YA 3GFVA 3VO2A 4K0RA 1WXGA 2AKAB 3LZ6A 1VKOA 4A9AA 4E31A 2C2MA 3GARA 4YQZA 3EA0A 4FOTA 5AHRA 3TPCA 3IUEA 1V1MB 3ZU3A 4DLSA 2PNFA 4M86A 4DMUB 1LZKA 4TV9F 1SXJC 4I6EA 1KOJA 1EZ1A 2Q1SA 2NUAB 3NMUF 4IVPA 2L17A 4IIUA 4ROSA 3D3JA 2Z1DA 4U4AA 2WU3A 1LLQA 1GP2A 3C43A 4OLFA 1KI1A 3SMQA 3UV7A 3ENQA 4JEUA 4C76A 4M4SA 3ADDA 5TPWA 2CUTA 2YOGA 4O8CA 1WXHA 5BO5A 3H99A 3WMEA 3R24A 2J08A 1VHJA 1PG5A 4UUOA 3UW3A 1E3MA 3IPCA 1ILWA 3V1LA 2O2IA 4KQGA 2OPBA 2PJUA 3K0EA 2JBAB 3HSKA 1OD6A 3GN1A 4G1CA 4LOHA 3VOSA 3LBAA 4JVMA 2P2GA 1ZM9A 3WLAA 2BEWB 1IYZA 3C6BA 3VKGA 1ZCJA 3KZXA 3KWFA 2OECA 4FUQA 5AVJA 3SICE 4IP0A 2G4LA 2ZJ2A 2NU7B 2OGTA 3KZVA 3AR7A 3I01M 3ZV7A 4ENUA 4XWOA 3W2HA 2OHIA 2QLLA 3N0VA 3SEFA 4NFYA 4KZPA 4URWR 3K09C 5AM3A 2Q6IA 1U2ZA 4S1NA 1E79D 2J3HA 1XTZA 4M7RA 5AXDA 3VUFA 5DTIA 4ZYXA 3CRZA 3ZNOA 1NATA 4R0NA 4A8JA 4IDCA 3IKTA 5KYNA 3T61A 2UVPB 2XVMA 2EWWA 4PZPA 1Q19A 2WSMA 3DCJA 4S1WA 5G2OA 3R8XA 3RTCA 5K2OA 2FMHA 3MTEA 1F8GA 4QOJA 5CVTA 3HSSA 3HEMA 5CDGA 4D26A 1H8ED 2ID9A 4L72A 3D0RA 1Z62A 1I94B 5IKXA 4OUDA 3HA5A 5J40A 2I2BA 1MJGM 2O0LA 4YBZA 1YR7A 1V6SA 4TTJA 1U3WA 3JYHA 1TTPB 4QREA 2GAAA 4L02A 4ZANA 1YA6A 3ROZA 5BW5A 3TNJA 1VYTA 3G0GA 1BGVA 3LCUA 4KN9S 4MQBA 1QWOA 2JS7A 1YDGA 4B1FA 2O8EA 4JUCA 3I2GA 3ASVA 2QY6A 3IESA 5TPWB 3HB7A 3KDSE 3GC6A 1JP7A 2QN7A 2W6CX 1N4DA 4EB0A 1T9GR 2P2SA 3H0KA 3RSHA 2VJLA 4DV7B 3EQ6A 4OM7A 1GYQA 1KAOA 1SFRA 2A14A 2CYAA 1V4VA 4B7AA 3OY2A 4PX5A 2CZGA 5K2MA 1MKYA 5CGQB 1IQ0A 2XRFA 1O6FA 5EESA 4A0SA 2W6MA 2QM8A 4AYTA 1X7YA 4O2AA 1CYDA 2OP1A 4J94A 3EY9A 5E1MA 1Q20A 2IF2A 3B82A 4B8ZA 5JVDA 2KPOA 3ABOB 4UHKA 1HG1A 3KV1A 1IAQA 1GU7A 5KAMA 4MZDA 4UUAA 3TR6A 2BKEA 1U5AA 4GQIA 5A71A 4ZMBA 1CUJA 2QL6A 4BWYA 1KSFX 3PHLA 5B1IA 5H59A 5BQXA 5BSMA 5LZ4A 2EQ5A 3C7CB 5BWLA 4RY0A 5KYTA 1R0CA 2O6HA 3OJEA 1H93A 4YBRA 2XF8A 1JPJA 3CFYA 3PTZA 3JTEA 4QOFA 2M6KA 2PKCA 1AUQA 3VO1A 2FN4A 5C1BA 4A8JB 1VDMA 4HPWA 3HK2A 4KO3S 2ZULA 1U1FA 4GZMA 1O6GA 4N7BA 1GQ2A 1KPGA 4GSYA 3H0CA 4J2OA 1QU3A 1RVDA 1XA3A 3EUEA 4BKUA 4G4JA 2A0YA 2P67A 2JVKA 3A1SA 3PB3A 5CEFA 2GEDA 5JANA 4D4LA 1V71A 3OPMA 1OLOA 3BFPA 1Y82A 3VNUA 2YJ5A 3LCVB 3I6YA 2CUZA 4OUDB 2AN4A 1T29A 3RUEA 2VNAA 4MVYA 4CG1A 3SQWA 1BYIA 4ZI3A 1I3KA 1ST3A 1ZJ6A 2GUGA 4RWZA 4TN5A 1J2YA 1R5OA 4CUZA 5A5VA 4RH0A 5SY4A 4DQXA 3EARA 1XFDA 5AI6A 3IBFA 2NG1A 2OHOA 1VE1A 4IFTA 5JCOA 3WMFA 4ZYUA 1R0ZA 3RNLA 3HBMA 3WL8A 2R1VA 2QTHA 3IPYA 3LYUA 4YRAA 1ZK1A 2O8EB 5HGJA 3VPCA 3OM1A 3A2LA 4OLJA 1OBVA 1BDBA 5FNVA 2JFGA 4UE2A 1GQFA 5C34B 1DO0A 1QE5A 4EOGA 1IB0A 2OYRA 3RW9A 4ZFNA 5KJ6A 1R9GA 1H65A 1PR4A 1RM5A 3RWOA 2MSCB 4IZOA 2J3JA 3AKDA 2AC7A 1KSHA 2FW9A 3K2BA 3MILA 3MWDA 3OG9A 2PANA 2BM9A 4IGEA 5JSHA 4MINA 1MZPA 2JGJA 5LPNA 4EL0A 4RMNA 3CVXA 5JDCA 3CVVA 1B0PA 2OC9A 5GM2A 3ZE2B 4ZEXA 1VP3A 1ZD3A 4OBXA 2PYZA 4X7BA 1XKXA 2ONZA 1JKJA 4IOJA 4ZO7A 1P1BA 2QMEA 1XNRB 1X7YB 3IV6A 4O2AB 4OF4A 5FJIA 1AZWA 1SIWA 2OZPA 5BYJA 4BCCA 1O54A 1QYWA 1SRQA 5EIHA 4EGCB 5KWSA 3S2YA 5B55A 5JVDB 2BF4A 3GZTB 1O96A 3PRHA 1Y7PA 3ZX5A 1A8UA 2CF6A 2RHRA 1OU0A 5KPJA 1OBHA 4MWDA 3MSCA 3TECE 2C5LA 1E98A 3V4RA 2WYWA 2Z8ZA 1BN7A 4C08A 3V2GA 3D4OA 4AKIA 1MXFA 2YMPA 1F4LA 3ICWA 1V5EA 1MEJA 3KYCA 5A4KA 1LPNA 4YRLA 1KRWA 1FSSA 1ZY2A 1G5PA 1ATIA 2H1SA 4DDMA 3I3OA 1BROA 1EVEA 1L4GA 4CIVA 4QM7A 4RQTA 4Y67A 1BMDA 3OX3A 5DX8A 5JALA 4L5YA 1Y7TA 1D1TA 1WQ3A 2H07A 2YRXA 2ZTMA 4ZREA 5F7JA 3SR3A 3PD0A 4C9BA 3HDTA 2OQ2A 1KDYA 3UT6A 3LTNC 2O6LA 3U7QB 4DLNA 1EPUA 1Z36A 3KG2A 2A33A 1F17A 2RGCA 2EX0A 2WF7A 1FZQA 2PUFA 2EL9A 1WQ4A 2FK7A 3QLTA 1L5KA 1ZCAA 4BZQA 4XH9B 1VSVA 2C54A 1T5LA 2IYSA 1Z6XA 3K31A 3LKDA 3MBKA 3PNLA 1O6ZA 4M22A 1LTHR 3NB0A 1VGRA 2DT8A 4PNEA 5BN1A 2ZXUA 2X76A 3PKZA 1Z15A 5I7FA 4EK9A 1FDTA 1OTHA 1Z18A 2CMGA 1TZKA 2R1VB 2WZBA 3HMQA 1IDN1 3FKQA 4P3OA 4P33A 4E12A 1RNLA 3EH1A 1PL8A 2XOKA 4JC5A 2PZMA 2PUCA 5FNVB 5K1ZA 1UPAA 1LBIA 1PZGA 2V6IA 3QPUA 4WZZA 4DQUA 1RYEA 2OESA 3MB5A 3S8MA 3MWDB 1QZUA 1DRUA 3HUEA 1AUPA 2CHFA 4HDKA 3JQBC 4LDJA 1IHYA 3FPCA 2Z83A 1JKJB 5BMVA 3WL4A 2IJGX 2DKOA 2GJAA 1CUUA 2WNHA 3H7IA 3AEQA 3OOHA 4GI5A 1NYTA 3WK5A 1PFYA 1QOQB 3M4YA 3N6XA 1AGYA 3GEBA 1REQB 2O8FA 5FV7A 1JJ7A 1MPXA 3G88A 3K6RA 3WLEA 1EUZA 1QAMA 2BL4A 1O96B 5JROA 4A6DA 1KP9A 2A5GA 1MG5A 1ICEA 2X0IA 2XA9A 3IOYA 2I1VB 4GVXA 3FAZA 5AKHA 1L8OA 4RA9B 1EE9A 3ZHZA 2C31A 3EA4A 1WULS 3K9WA 1AHIA 3I9JA 3MFQA 1SA0B 1FJGB 5E95A 4CWAA 1LNQA 1BEZA 2QZ4A 3KYCB 1VIAA 4XR4A 2XWPA 4DR3B 4AY3A 1T3HA 3L6EA 3AUFA 4FYYA 5A4DA 2ADOA 3RK0A 3CURA 3H8SA 1UDRA 2W6IA 3O8BA 2Z5GA 2WT9A 4RDHA 3AU8A 4BEBA 5FUQA 3K5HA 1VGQA 4UBKA 3RFCA 2GPAA 4ZCIA 5GIPE 1YRQA 2PMWB 3ZH2A 3PCXA 3S5JA 5I45A 2B8NA 5TB5A 2Z0MA 6PFKA 3VMFA 3HFGA 5FPTA 2AJLI 3GCZA 4IHKA 4CTJA 3HUDA 4P58A 3FSJX 4HAXA 4H1HA 3CVUA 4NULA 3KL4A 4LX8A 4EHKA 2CXRA 4JOBA 4QATA 2A92A 1NZJA 3CPJB 1M1NA 1RADA 4EB6A 3HDJA 3BX1A 4JVOA 1XWWA 4EB8A 3LRTA 3HEAA 3EB9A 3A04A 4WOBA 4AS2A 1FYXA 4EHIA 5BW6B 1MO5A 2BEUA 1YASA 2IYYA 4OIMA 4B3CA 3UANA 1LX7A 3PT9A 1Z3IX 3DWEX 3HJAA 5EE3A 2PQMA 1PZNA 1WMDA 2QIOA 3WVNA 2JKVA 1E9AA 4HDKB 4YRPA 1ODJA 3GJ0A 3AQ4A 5IVDA 1QCDA 3U17A 4J3FA 1BX0A 4FFWA 4K9MA 1LKZA 4HGYA 4RVSA 3DLCA 4KO8A 5AH0A 4PPFA 2QORA 4F7DA 5BMVB 2RE8A 3AEQB 3IVXA 2YV2A 1LPOA 2H2DA 4MW2A 3PYMA 4QE3A 4P4UA 5EQJB 3NBQA 4CMBA 2O8FB 1G6Q1 1NOIA 2H2WA 4RY8A 2C7OA 3LUFA 2N3ZA 4C05A 3N0WA 4ZQHA 2W6OA 2A3NA 3QPAA 3TWOA 5BUSA 3KKOA 5MN5A 5HKLA 4OL9A 2CE7A 5BV0A 1H1TA 5ER6A 3Q6IA 2GILA 4R9UC 1U8EA 1A76A 1NYQA 1OROA 4BU1A 9ABPA 3DGEC 1A1SA 4R8RA 4CF5A 1PAUA 1XG5A 2W2TA 1UBJS 2QP3A 2Z4SA 1OUMA 4JI2B 1TW3A 1Y6GA 1NBME 3EZ6A 3KU1A 4HNSA 3MBOA 4IXDA 2WAXA 4CQMA 2VPXA 4MUFA 1X7WB 1J0EA 5M04A 1T2DA 2VJDA 2JHAA 3ZZ0A 1G6HA 4WK0B 1R66A 2GZSA 4MQMA 1P29A 1K92A 2HF2A 4MW4A 5JAQA 1M6YA 1NM5A 5IM4A 2CV2A 4MYCA 1FFYA 2DERA 3QXCA 3TQTA 1XVIA 1ZOSA 1PIWA 2B5WA 3NWOA 2NV0A 2R6JA 2C20A 3I0ZA 3KJIA 4JASB 4C04A 4G0OA 4RZXA 1NV9A 4US2R 5CBPA 1Y5MA 1E6CA 1XYGA 1VZ3A 2BCJQ 5HCNA 2JGMA 3HXLA 2QW8A 5LSAA 1L8LA 1QGZA 5IT0A 1JZQA 4KK4A 1B8NA 1M75A 2AN9A 4PGHA 3FF1A 4US1R 1NU8A 1Y9JA 1KAEA 3ZR4B 4A3SA 4EB6B 2VH5R 4GPIB 1JTVA 1NTRA 3PUZA 4KRFA 4GUDA 3KVVA 1HKUA 1RHRA 1WAMA 2WINI 4I8XA 3KQUA 2ZCUA 3BFKA 1U8AA 2HK7A 2J1LA 2QR3A 1K75A 2BEUB 1IEVA 3OWHA 3UJBA 1P8AA 2Z8YM 3BXPA 3TXAA 4UPDA 1ZZGA 2O8VA 3H1AA 4B4DA 2LP4Y 4PO8A 1OA1A 2ZRDA 2BGJA 2HA6A 2AB0A 3AJ8A 2AQHA 5CA1F 4S1PA 5FTWA 1XV5A 2NVOA 4IINA 1T8WA 2H4YA 5ALJA 1J23A 3KVYA 4PRZA 1ADJA 3ZWNA 1G21E 1XJCA 2E18A 2GK7A 1UBMS 3RTGA 3ZLUA 3T06B 2KJQA 2QRJA 3HU1A 3VR1A 3WDLA 4BLVA 3R76A 1RHJA 3DZBA 3RLIA 1XLTA 5LMUB 4NZYA 3O91A 5B1YA 3BEDA 4H31A 5KTMA 3HU5A 1YK1A 2WSSA 2A5LA 4YAJA 1LPPA 3ZCPA 2AHOA 4L76A 5AOCA 5JT1A 1OLSB 2FA9A 2OV6A 1RSZA 3ETDA 3FBGA 4UZEA 4X61A 1M1YA 2IPNA 1JUDA 3BMCA 3IA2A 4JBNA 4P6VF 4PAGA 4V39A 5FT9A 2R7LA 4A1OA 3WBFA 4Q3AA 3DT6A 3R7WB 3CC8A 3U19A 3K9HA 5DSXA 1C4WA 3PJDA 1I32A 5F73A 4HLCA 2HKIA 1QHFA 5AO9A 4A0GA 1BDJA 3E2MA 2OGWA 4JIGA 3EVFA 4CQMB 4Z1MD 3O3OB 2VTBA 1PR1A 4R2IA 1MU0A 2YOHA 3BGIA 4GM0A 4KQKA 2V6JA 4ALMA 1SKBA 1E1KA 1K8QA 1HORA 2R8OA 4XE5A 3T8YA 1YRWA 3MGCA 2BMEA 5UKDA 3DTTA 4RIIA 1PSWA 1QF7A 1SXJD 1ORRA 2IWRA 2FPIA 4Q39A 3ZCQA 1XRMA 2B21A 2PTHA 1DS6A 5CBPB 1R00A 2YY6A 1AM4D 1SIUA 3CX8A 3BQMB 4MRMA 4BIIA 3FLBA 4CQLA 4DNXA 4DA0A 4RUKA 5DGTA 1OAAA 5FI3A 3GFBA 2FZWA 4IVNA 2VJBA 2YDXA 4Y9TA 1CF2O 3LP8A 3S2FA 3TRDA 2HXYA 3A4VA 3UT5A 3WK7A 2HYIC 5HZHA 2A9OA 3VR0A 4AICA 3MCAA 3LMKA 1U2DC 3IRVA 3R4CA 4R2HA 1P2UA 3CMMA 4GMDA 3WRYC 3WWCA 5HS4A 3R5TA 1U28A 2FG6C 4ZVUA 2VDQB 2B7LA 2R25B 1SD5A 4F9TA 3QE4A 2RCYA 1T1JA 3F5MA 4NZOA 2PKRA 3PXDA 1ZD4A 1QNFA 4PLHA 5HKOA 3KT6A 1UJCA 1SU7A 1OQAA 3EJ6A 4EFDA 5E0OA 4YY3B 4H9GA 4D02A 1I01A 2YXEA 2GFQA 1N2EA 1JLRA 1R6BX 2OCKA 2YZ7A 2RHGB 5HEKA 4D9IA 4P3KA 1IQPA 3BGVA 4HDRA 1J49A 3P0FA 4H18A 2OV2A 4JLWA 4EO7A 3R7FA 1VIVA 5FBVB 4J7XA 1GRVA 3ZTTA 5HPYB 1EU1A 2NT3A 1SO8A 1VBKA 4B6OA 3GFRA 3H2KA 3M82A 4F5YA 1SAYA 1MRZA 4BKRA 4KL8S 3WL7A 4S04A 4UAUA 4JC0A 5J5VA 3QNUA 2K6GA 1JIIA 4FDLA 4PSVA 1M1YB 3BMCB 4F1WA 4YCLA 1PFKA 3EHEA 4CZ2A 1YCDA 1OHHD 3WXBA 1F6WA 1KO4A 3DAGA 2WZQA 4QARA 1E5QA 1KYIA 1ACLA 3CNQS 1GRCA 1XTRA 3QPDA 4NF2A 7MDHA 3BHNA 1GG5A 4EX7A 3O9ZA 4Y1FA 3GT3A 3ZJVA 4RIEA 1VHWA 5CXSA 1FYEA 3AETA 4QIHA 5ALRA 3E1GA 2PD4A 3IAHA 2YV4A 5B7GA 7ABPA 3TSYA 2VFAA 1GTG1 1A9SA 3THRA 1T9GS 1P5ZB 4MHTA 1O8CA 1IK4A 2CXXA 2VWHA 2FPIB 4UTZA 3LUDA 3EMBA 4RF3A 4CQLB 6REQB 3O9MA 4MRMB 1OLXA 4ND5A 521PA 1P31A 1LS1A 3BXOA 2VJNA 4BVLA 1EM6A 1R0YA 5SY9A 1NXTA 2HU2A 2I78A 1I6WA 4ZZ0A 1RMYA 3D7RA 3OCCA 3UVEA 4YUYA 4K8RB 2PKXA 2YVUA 4U8HA 3BKXA 2H7CA 1EGVB 4B4WA 1MJNA 4UHJA 3FHCB 3LUKA 2ZM6B 5A4IS 3VC1A 1IWBB 1V5WA 1SVUA 4KE8A 1WA5A 4MW0A 1L9KA 4DMFA 3KB8A 2O1EA 1DXYA 2QSZA 4O0MA 3QMWA 3AW8A 2WJVA 3B8HA 4PZCA 1ZOLA 4RMGA 4XJSA 1GUDA 2FLWA 4URZR 5I8ZA 1ODCA 1L5FA 1UOOA 2FZCA 3ZGLA 2YIJA 4GQAA 4H6PA 1K63A 2YVKA 4YQFA 2Y76A 4HDRB 3KEOA 5A05A 3C3EA 4TL7A 3TAUA 1UK9A 4F93B 2XUAA 4ND2A 2IUFA 3BSYA 4U2BA 4FYXA 2UZ3A 3FJYA 1KAMA 3S1LA 4Z7OB 1TLLA 2P4EA 4R9VA 2VJYA 1PUXA 3LDFA 4FZJA 4G5YA 4L4RA 2FN7A 2HRQA 4WVLA 4G09A 2P2CA 4DGQA 1YD7A 1PO7A 3ZUPA 1RFLA 1VPDA 5BSEA 2XSZD 2P4UA 1Y3DE 4MEBA 2C4MA 2YNMA 3BM5A 2BJVA 3IQZA 4LXTA 1FTWA 1YR8A 3ZWWA 3MOGA 1SVOA 3NU1A 1DRJA 1GA4A 2PN1A 4Y1EA 5L51A 2X2PA 2IF0A 3DXZA 2P6OA 2VTEA 3U7IA 5HJ2A 4EAAA 4MPTA 3CZQA 2O06A 1R8SA 5F2NA 2F90A 4XWKA 4F6LA 4UDOA 1CUGA 3AETB 1XU9A 1XPUA 3HE3A 4PYOA 3C7TA 3OU6A 2X42A 1K27A 1F8UA 1SBCA 4UCQA 2PZEA 4XOUA 3CWZA 4AMUA 1D2EA 1CY4A 1J8DA 1A7KA 1RAAA 1Y1SA 4C5BA 5A5DA 4MPJA 2C96A 4ZHQF 2WNSA 1V7CA 2JAUA 2PZLA 3RVLA 3W2FA 3WRWA 4AT1A 4HD8A 3K70D 1OLXB 3CLRC 4IJMA 3BD6A 3LCMA 4BZXA 3G5MA 5CYGA 3MJEA 4FBMA 4NV0A 4AJ4A 4L8GA 2R7NA 2HTEA 3JQRA 3OZXA 2AC4A 4IGKA 4KN6A 4R1NA 5DM4A 3MRXA 4B09A 1WUYA 3F6EX 2Q2OA 3BGOS 4O1MA 3SJZA 3CCFA 3CEHA 1RXYA 4MIKA 4PLPA 2XT9A 4WLEA 4W5OA 3BXHA 2FDCA 3Q0EA 5LU8A 1RQLA 1MDBA 2DUJA 1WZEA 2V03A 2BPOA 2J3IA 2F62A 2B78A 5IM5A 1U4SA 2IU0A 4CM9D 5JHHB 1DO2A 1L1EA 3AUAA 4KK3A 4MCIA 4RFSB 1DXQA 3OQHA 4EUSA 3PPWA 1CD5A 1YAJA 5DNVA 5T4FA 4CMIA 1WPQA 3ZVNA 5DLQC 4FDAA 3PCTA 4IUYA 1GCIA 4QFBA 4UASA 5IF9A 4Y1RA 3RANA 1NVBA 2X8LA 1Q12A 1ZD5A 3MTBA 2HWKA 3QVUA 4LTDA 5AJWA 1WBBA 4WACA 1DT3A 4JMPA 5JH7F 2WVJA 4GSKA 4YJ2F 4F5DA 5HSGA 4DFDA 1J8VA 4F6RA 3W4JA 2VR1A 5ALPA 3RBVA 1HZZC 1N6KA 1Q6ZA 2A5DA 2VXCA 2ZSIA 4Y9SA 1FQKA 1OFTA 2BTQA 5CDYA 2ZITA 5H3HA 4XSHA 3GJ7A 4RMJA 2O2ZA 3DR5A 2FPUA 1U9IA 4LZNA 2XA1A 5FUXA 4WEQA 1UPBA 3CIFA 3CRVA 4B75A 3FNBA 4D3DA 2GZRA 1P80A 4XGQA 5EPEA 3OPYA 4ZD6A 3OH8A 1E94E 3DDWA 3SU8A 4LHVA 2UYOA 1W36D 4KIGA 4O1IA 1U2TA 4EEZA 4D9GA 1RLUA 4E5SA 1OJLA 1S5PA 2O14A 9GPBA 4DWJA 4AUKA 1TRHA 4LF4B 1YS6A 5HCUA 5CA0F 4AI6A 2ACKA 3L49A 1OMOA 1UP6A 2ADMA 3R4VA 4K3VA 4GL4A 4F4CA 3PE3A 5JE8A 1EX6A 5FPKA 1FVXA 2IHBA 5C7LO 4WLOA 4C0XA 1J2TA 3OIFA 1A8IA 3SQXA 2Q9CA 4L0QA 3OOYA 1ODTC 2CFIA 2MSEB 3PYLA 3SDSA 4RV9A 3S6JA 1ZJ4A 4OHMA 3CPSA 3K4PA 2CF5A 5FR2A 2IEZA 3AWIA 1CQJB 4PBSA 4DEYA 2GARA 2CNOA 4J0GA 2JW5A 3WIUA 1XEWY 2MTBA 1M8KA 3QK7A 2B69A 4D81A 3LXUX 5FJJA 5JUWA 4H4CA 4JQZA 2E5WA 3IBGA 4GKAA 2O20A 5GV8A 1R88A 2ICAA 1IN5A 4RWEA 3VH2A 1IZ9A 3W8EA 4EMSA 4KAFA 4LJAA 5KNBA 1M8GA 1S2OA 1YNSA 5TS3A 2BY4A 2HU7A 4LJ5A 4G63A 3ACDA 3OURA 1OW3B 4CMIB 4LTMA 2NSHA 3AI2A 4BZZA 2H2IA 4QZVA 2A9FA 5EMKA 2X4IA 4Y1RB 2Y67A 3P9QA 3A1NA 3PU6A 4YHHB 3GB9A 3JV7A 3WNVA 3D4LA 5AKYA 3U1VA 2YBEA 1VLZA 2BFFA 2PH7A 2HU8A 2WFLA 1JJAA 3NKLA 4RGVA 3C85A 3TBKA 3MS7A 4NBLA 4HUTA 1W5AA 1IM5A 2ZRCA 2ONKA 3BE4A 3RRMA 2C2GA 4W1PA 1E1RA 2VDJA 5A2QA 4GYJA 3A4NA 3DMGA 3OTOB 1P1FA 2GO1A 4DSOA 3ZXSA 4F6RB 3ZE6A 1C0LA 2DRIA 3E5RA 3JD4A 2VKTA 1DO8A 1NQXA 1FSZA 4R3UC 4RH1A 2PJRA 4OP1A 2BTQB 4LZOA 1WUHS 5C8YA 1XWFA 1Y1TA 3O2SB 5H68A 3GP3A 1U1CA 5CG2A 4XB2A 3UOAB 2XMSA 4ZO4A 3OPYB 3OOWA 3PRJA 2JBHA 4BOYA 4ES6A 5D3MA 4BKOA 5I48A 1Y3CE 1FLAA 2E4UA 4E94A 2CD9A 3DLAA 4OI1A 4GL2A 3MTQA 3CB4A 4AMBA 2CLIB 3ILYA 4ER0A 4U7DA 3PL5A 4N5DA 3AOEA 1VL5A 3C74A 4G5GA 4KQIA 4DW8A 1KWGA 4LF5B 3TB6A 2QAIA 4PSCA 3DDCA 5CDHA 4ENVA 2P9JA 1D2NA 1E5LA 2N75A 1PUIA 3LFUA 3QQ5A 4LSMA 1ZRNA 1STOA 3DVAA 2X7HA 3LC2O 2BGLA 1NJ8A 1TQDA 3UWMA 4ID9A 5K3SA 4Z49A 2C77A 2FW7A 5DTMA 2NYRA 2R97A 1ORDA 1W8DA 2XWJI 1NW7A 4G07A 4HLUA 5BSHA 2Z2YA 2IV3A 1X74A 5DULA 1XD9A 4UOZA 2DWPA 3FOBA 2WOJA 1A9TA 4PBRA 5EZYB 3D8HA 2QTNA 4J1TC 1A9XA 3VSCA 1KC3A 3JQAA 3HLYA 4C30A 3OD1A 5LUBA 1E66A 1Z47A 4XM0A 2BBTA 2Q6VA 5AKEA 3NEAA 3GFSA 2ZE7A 4TWBA 3PPYA 3F6RA 5EFOA 4OCZA 4CR6A 5B3LA 1A5TA 1CQIA 4LHZA 2A35A 1XMOB 1U8CB 3V3TA 3ZE9A 4UD6A 2KE5A 1BD4A 2B2NA 2BFFB 3L6UA 1KJ9A 2C88A 5KYVA 4J0IA 3ND5A 1FC0A 2R7KA 5JWOA 1PR2A 1DMRA 1NTOA 2PRSA 3E53A 4IGAA 1TVKA 4AK9A 2XB2A 1F5NA 1E5VA 3O0TA 4YGYA 5KDDA 1UJ4A 1Q0UA 5A9RA 4P0QB 5EQDA 4EHJA 1FTSA 2OM6A 3ZWDA 2GHTA 3GMSA 4D9CA 1Q1NA 5NULA 2OILA 3O26A 5C8YB 1RXVA 4M9QA 5BVHB 3QYFA 4Q3KA 4ZOLA 4ZTUB 2ZDQA 4EA7A 4L50A 4BO1A 3MJHA 3TO5A 4MCAA 3R6WA 4AN1A 1T4MA 3GJ4A 4L4SA 3EQ2A 2X4DA 5TJ9A 2ZW9A 3TQSA 3TIFA 2ZQ5A 4OUKX 4PGMA 4PYKA 4OI0A 2GTIA 1XZDA 4CDMA 5IWCA 1AKRA 3L0YA 1IOVA 5FYDA 1AHNA 2II6A 2FW6A 4XIJA 4G41A 5FUWA 1QFMA 1XC7A 3AG5A 3DEYX 4M8SA 4PW0A 5D3QA 2GFHA 5D8DA 4ZQBA 1RWXA 4FR0A 2VYVA 4KYIB 1IN1A 1F48A 1XKLA 2ETVA 2EVWX 2VRWA 1NQUA 3HCOA 3STYA 1A4IA 1M54A 1X0XA 4MRVA 4UPEA 1HNZB 2I6QA 2VCYA 4CR8A 3TR0A 2X58A 3DVAB 5FTJA 1D2RA 3WKBA 5F9FA 2DM6A 3IEUA 5TRTA 3DTVD 4A23A 4B79A 2X9NA 1RIIA 1E2NA 1NN3A 3I92A 4NR0A 2UXDB 1EDOA 5JZOA 3W6OA 1F5SA 3M6LA 4NK4A 3PS9A 2YJ6A 3OOJA 4D6XA 1MDFA 3H9UA 2I4LA 1T2NA 4B3RB 1T24A 2RG7A 4HB0A 2AMJA 2B9VA 3HFSA 2QMOA 3LFTA 1A9XB 2BFMA 1JDTA 3VZDA 4TYQA 4C4XA 2CT8A 3X1WA 2EJUA 1NOKA 2PL5A 3P97A 4BWFB 5BQFA 5BNWA 3DOEA 5HBRA 3UYKA 5HJ5A 1T43A 4LOIA 4QD3A 2LXNA 1SUPA 1RKVA 2HBYA 4YJHA 4YJGB 3QTLA 2DY0A 2EAUA 2OBXA 5JNSA 1SB8A 2GN9A 3FNIA 2JIZD 4C29A 5EJ9A 5HKAA 2GEKA 4EPVA 4MYRA 2ZBRA 4EY4A 1Y3HA 1U7ZA 2BRUC 2A30A 3TSZA 2PZGA 4G0XA 1ZFNA 2FDRA 1GSHA 1JR4A 3D3QA 3PFIA 5CT9A 4QA9A 4C1NA 3ZDBA 1TVKB 4P22A 1F2VA 3QLEA 1SCDA 3ZWVA 1XMQB 1TKAA 2IYAA 4O08A 3COPA 3A28A 1N25A 2HL6A 3CRQA 1DAHA 4NNOA 2AMVA 3IT2A 1SZPA 4DMGA 4HDAA 1LQUA 3L8HA 4WFJA 2PCJA 4DLYA 1KY4A 4JI3B 4ND4A 5A1TA 2ZAIA 2ZRBA 1CJTC 4L95C 4NE9A 2GKGA 3ILVA 4KLAA 3ZZNA 4LBWA 3MXOA 4FFNA 1WZ2A 3U7FB 1RKUA 3HYCA 4JQOA 2FMUA 5JO0A 1M66A 1CVLA 3TG2A 3TRJA 1BFKA 5I9BA 2AG1A 3CUYA 4NOMA 1K0FA 3OI7A 3L8MA 3FOZA 3AC0A 4TSFD 2Y66A 2RH8A 3OKPA 2YJ4A 4A82A 2QE7D 3E9ZA 4B34A 1TO2E 1XRRA 4XD7A 3ZIUA 5IKEA 3BD7A 2EKPA 1P39A 4LZZA 3UTDA 1WD7A 1I3MA 3R8CA 5IT4A 1J39A 5E2BA 1Y37A 4WCFA 3EIFA 1EB9A 1ZCZA 2AG8A 2WIFA 5AK0A 2IHNA 1PTKA 2KB0A 1SNYA 3T99A 4IV8A 3L1JA 4OOEA 4C06A 1BE8A 4C78A 4RAOA 2I54A 3GQBA 2J4CA 1U5CA 4CLXA 4O4LA 5D6OA 5HQ3A 2PD3A 1LF0A 4LS3A 2PGXA 5JWRA 1SU4A 4D4KA 2Y6VA 3LIPA 4JWTA 2HO4A 1PL7A 3KQPA 3H9EO 1V8OA 2QRUA 3NGXA 3TBFA 4DE5A 5ELMA 2COKA 1ECPA 2NYUA 2C00A 4KMSA 4MV7A 4PSDA 4BX8A 5EJEA 3CV3A 1QQTA 4EUEA 5ALUA 2WB4A 4YN3A 3FB1A 3G3EA 1V35A 1GG9A 1USIA 2FPWA 3GA0A 1C50A 4UM9B 2G9NA 4EPTA 5KQSA 2P27A 4YJHB 1RAGA 4RZQA 2Q3JA 5HXAA 1XOIA 4HPXB 5KYWA 4TLMB 4IWYA 5CVUA 5E7QA 2GBLA 4RHXA 5K03A 2C9DA 3E8SA 3DKVA 4Q4LA 5L3QA 3V55A 4LWQA 1CVRA 1J1IA 3JCZA 3RBZA 3ROPA 2RH4A 1ZGZA 3A70A 1WPGA 1QVZA 1RQNA 5IJZA 3IKJA 4PO1A 1C9NA 1GOTA 5LDDC 2FFRA 4NXMB 3VYRB 1R12A 4FPXA 4JLMA 3OJXA 2C3PA 4X64B 4R9NA 4CKBA 3AY3A 2J41A 3UMVA 1Q7TA 2RFLA 4P53A 3T3HA 3OPXA 2R5WA 5CR9A 3RU7A 4QYMA 3UMCA 4BQNA 1YQGA 1MR3F 2WYIA 3OZSA 3BQNB 3QWBA 3EG5A 4NBKA 3FVWA 1H9AA 4P7BA 4NYIQ 1PR9A 2XKKA 1JDJA 5LC1A 1I2ZA 1DIRA 1VPWA 3EJWA 3MTJA 4LF9B 2QJTA 3F1KA 4WCFB 2FOXA 1T9AA 3LPDA 4ZRDA 4I3HA 3NJ8A 1DBPA 4RCVA 1NP6A 3ZDFA 1XAJA 4OQ4A 1KDPA 2K87A 3G23A 4QEKA 1GADO 5DISB 3O47A 5HQTA 3SN6A 4EI7A 2ZR8A 3DMHA 4D82A 1G2PA 4O4LB 5HQ3B 1A50B 1Z0SA 5EAIA 5BXQC 5JCZA 3DLBA 2HHLA 2B82A 1OV6A 1RJFA 1SCBA 2PHZA 4A03A 4JJAA 3AJ9A 3L8CA 5JPCA 2HDWA 2MYPA 3C70A 4KR2A 2ERYA 5K5EA 3G9QA 3LHFA 2QNBA 2GAJA 3PT5A 3KPJA 2PLWA 3OCZA 5FL7D 4ER6A 5C3MA 5JRDS 1K2WA 4MNTA 3EZLA 4HUQA 2DMRA 3UCFA 3D9QX 3R41A 2CXNA 2WD7A 1ULZA 3OKFA 1GUYA 4O4HA 1AQUA 3NYQA 1TTHA 1TYCA 1W59A 1WOMA 3WZ2A 3IEMA 1YRYE 3GG2A 1AK2A 3C5HA 4RS4A 1TAUA 1IBMB 1OXVA 3LC1O 3DVRX 2AQIA 4K6OA 4QASA 2EX4A 1F0KA 4XASA 1KEWA 3UOGA 4Q1AA 5L3QB 2FGJA 1H3NA 3EGXA 4H7JA 5FULA 3H5TA 5LKRA 3JWJA 3FRJA 4TZKA 5T57A 3SXUA 1IXRC 3GIWA 4QTYA 5FX2A 1P9NA 1Y6JA 2OAQ1 4MQLA 2PLAA 1D0IA 1MN6A 2H4XA 2ECPA 3F96A 3F6BX 3NHKA 4HQNA 4Q47A 3VNBA 1SIBE 4CKBB 1F7UA 2HB6A 4A27A 3SG0A 1B0AA 1N1GA 1U2GC 1V8BA 2O7VA 4LF7B 2FHPA 1C8KA 3AUYA 1KBOA 3D8UA 1V3QE 2CDBA 4A0FA 4KQXA 4MLCA 1TMGE 5B3JA 5BY2A 4E33A 5ARCA 3CYFA 4ZMRA 1E9BA 1GN8A 1YBHA 4WBNA 3D2LA 2ECFA 1QS0A 1BGXT 5CXXA 1NF8A 4ZI5A 2XX3A 2DFPA 3CLRD 3IELA 4QWMA 1TKRA 2WJPA 3G1UA 5ALHA 4B2LA 4PLTA 3B13B 4TTRA 4HLNA 4KAJA 1IXYA 2HDOA 3MQ4A 1R27A 2QVCA 3WRXC 4EY7A 2V0NA 5B5SA 2EXXA 4JKIA 2GSDA 3VHXA 1ECCA 2Q5QA 1I3LA 3RLFA 1EDZA 1FYFA 3A6EA 5DSZA 4YWHA 2V3CC 1N9ZA 3C5WP 3DCIA 3H6GA 3KAPA 3KP1A 1VE3A 3DDZX 2H3EA 2WWWA 1UAAA 5KIAA 1PW7A 3H7AA 3HN2A 2IXTA 1OXBB 4LHXA 3TRFA 4D9JA 1N0IA 1PQYA 1VG0B 2ZE6A 1Q7BA 3L8ZA 2FMTA 2J7KA 4IH4A 4PHCA 1YVPA 3ZHRA 1P4RA 1DEOA 1QVRA 3LP6A 3K0CA 3V4FA 1YJBA 1L5ZA 1SXIA 1XZMA 4JWKA 1QIKA 4EF5A 1AK9A 2OD9A 4O4HB 3VSBA 3U61B 1H4VB 3SPXA 4XQCA 4BRZA 2OXRA 2YWEA 3CSDA 3VRHA 2MSNA 2DLDA 2RKWA 3KPVA 4OQLA 3RK4A 2QSYA 1AQLA 2WMYA 3IBCA 4ZGBA 4A15A 1O94C 4BLTA 4R54A 1TYZA 2VHTA 1VXOA 1EA7A 1RRFA 1KFKB 2QTTA 3CN9A 3EGXB 1D5WA 1RWNA 4DGSA 4X3OA 4ZCRA 4CGZA 5JTTA 4M7OA 4CMCA 1DU4A 3SVZA 1CR0A 3FBWA 4LE1A 2GKOA 4CEHA 1MP0A 2FRXA 1CQWA 2WAAA 3N2IA 3A9TA 4NFSA 2C59A 1P7PA 1KJQA 3Q5EA 2NU6A 3GLHA 4Z0TA 2XIJA 1D4FA 4R1QA 3CH5A 1QYVA 4I1IA 5ANRB 1Y81A 3EXHA 1T5DX 2W42A 4IRUB 2GFIA 2EF1A 4BE4A 2CDNA 1ZL2A 4I5FA 1A5BB 2XYPA 3I73A 4BXOA 3K94A 2NW6A 4ND6A 4WBNB 5DHRA 2QTZA 1R6UA 4YPFA 4O4JF 2XPCA 4MKHA 4ARBA 1ZIOA 3MM4A 1VCOA 1AKNA 1DIBA 1DPFA 3O8RA 3FVRA 2HV8A 1S3SA 2QV7A 4CTMA 3BF8A 2G5TA 5FTNA 3A2MA 1NR5A 4CU5A 1Z63A 5DGIA 3DP7A 1I3NA 2HMTA 4YXWA 3VHXB 4EMBA 5BPFA 2FV8A 4E30A 4UTXA 3PLAE 1PSDA 1GR0A 5FOUA 3WKCA 4JLPA 3EA5A 3TRHA 1FUYB 1Q1ZA 2Q1TA 3C98A 4ARUA 3CMCO 1IJEA 1G5QA 2IU3A 1KMIY 2YHSA 3BC1A 1V43A 1XEWX 1ULTA 2A0FA 2PS1A 3QLVC 4X8HA 1IFXA 3GCXA 4DCVA 5B36A 2ZWMA 3LF2A 3S44A 3G6KA 1JJVA 4W5NA 2UYCA 2A88A 4ABYA 1RBMA 3UGKA 3HR7A 2Z30A 2KS6A 3GCGA 3QPVA 5C8ZA 2ZSUA 4AXBA 1EK0A 3HJHA 1QOPB 4LYGA 2H2GA 2YJTD 4BVEA 5LOVF 3WGLA 4GP7A 3B5EA 3LZDA 4V2IA 3EZXA 4OXQA 4ILEA 1G2IA 1U98A 4BLSA 5HKBA 1YUBA 3ZTYA 5CFRA 4HOYA 5J1TB 5LL6P 3C8HA 2ORVA 4V2UA 1KJJA 1YZLA 4YUZA 2JFVA 5DGCA 2LCIA 1NC3A 3KAJA 6CHYA 2FN9A 5A1JA 3R44A 3RSFA 2D2VA 2Z9CA 3GJZA 3GLHB 3P0HA 3DOJA 4H0CA 3G0BA 3UHJA 1WJGA 4D9NA 4IDDA 2P2YA 4WXMA 4G4SO 1XCLA 1RXCA 4GKVA 2Z2JA 3ZIAA 3EZ7A 1IIRA 5JBNA 2NP6A 2WHXA 5TE9A 4GRAA 3RAPR 1N2ZA 1QFSA 4BXOB 4CI9A 3NBFA 4YJFA 2XI4A 3LCJA 2A67A 1D6NA 3S2UA 3ZCXA 2JGDA 1RQPA 1GEGA 1B8PA 1W0KD 4EZIA 1WBJB 4HX2A 4PZ9A 2GAFA 3P4XA 2QVLA 3VU9A 4LA4A 3WGGA 4O63O 2JZCA 1V8FA 3ABZA 2WJHA 5E4JA 2B6HA 2WJYA 3GFTA 4EMUA 4U6NA 4YONB 3IA7A 1PRYA 1UM9A 3EIQA 4AN4A 2OHVA 2OO5C 2PMDA 5DWVA 3KHUA 4PFSA 3BWEA 3U1BA 2UYYA 5CFOA 3VNAA 3IVMA 3OETA 3ET5A 3OOEA 4NMXB 5KVAA 2C9ZA 4UZSA 1G0OA 4U0JA 2ES4A 2ESRA 4RKFA 3V8MA 1R18A 1GG2A 3INTA 2D7CA 2XBMA 1XO1A 1LBSA 5DX1A 5JWHA 5AW5A 1M72A 3EDRA 3UT0A 5HJ7A 5JFOA 1YL5A 3ASUA 5GGYA 1AQ6A 3KOWA 2WIBA 2LW7A 2AUMA 1E59A 5I4CA 1BW9A 2IYQA 2C4WA 1AZLA 2XUQA 1HETA 4TYWA 1RKQA 3O95A 3H13A 2B4YA 1B7GO 1NZFA 2J31A 3A8TA 2R8ZA 4IHAA 4P8RA 4TS4A 3W3AH 5CNJA 5I9MA 5U1PA 5JSUA 3HB1A 3IUSA 1KPIA 2OBBA 4UXJA 3RS4A 4O4IA 2OKCA 3H9BA 4MWSA 3WLPA 4KVZA 5EA2A 5JZMA 1CUFA 4QNRA 4KPUA 1IAVA 4MLDA 3T0GA 1E79A 1PYGA 2I7VA 3C6MA 4HVTA 5GADl 1P4SA 1K66A 1Y0BA 2EC5A 2I71A 2Q4TA 1BXKA 1DBQA 2DH6A 2QD5A 2CEKA 1DCFA 4YJ3B 3S99A 1KXZA 2I4NA 2RHWA 3FHLA 3MAJA 3X3HA 4N7JA 3M1AA 4R1PA 3FKSD 3FMPB 1W6RA 3OT4A 2HF8A 1PJBA 4KE6A 3A05A 5DI9A 2Q2NA 3E4DA 4A2CA 3WO0A 1N7HA 1ND6A 3N0TA 4YJFB 3QV1A 2ODPA 3P2OA 2QK4A 5GJCA 3FTFA 6Q21A 3D5QA 4XIGS 5AXAA 4EMTA 4LJ7A 3ICVA 4LV5B 4EG3A 4W5HA 2YMQA 1DARA 2XTNA 3P0IA 4E03A 3SSMA 4CL2A 3QPWA 1HEUA 1JF8A 3U3ZA 3ELBA 1DAEA 2WILA 3I53A 1UM9B 2WI8A 1VHDA 4BX2A 5DK6A 4OXNA 2YXBA 4BBAA 3HJGA 4WZBA 5KI6A 2DR2A 1R16A 4ZRNA 3L0PA 2FG5A 4G85A 4LYEA 5FF9A 5JSQA 1L4MA 1Z6TA 3HDVA 3VOTA 3GI1A 4ZJYA 4DV4B 2XNDA 2ZDHA 1HLGA 1P9LA 2HIAA 2I1WA 3EC1A 4MVXA 4F45A 4MQFB 1EWVA 4M54A 4HCJA 5AOBA 3PX2A 4I4NA 1GGEA 1KI8A 2V7EA 5COBA 3KOZA 1BW9B 4CXMA 2XCUA 4H6WA 2AUNA 1ORWA 1YE8A 4GRIA 5I9NA 1COWD 4LE0A 3ONNA 2CDAA 2XA2A 1DG9A 2GLTA 2JZOA 3LUAA 1KDOA 1B93A 1B6RA 1LSUA 3PNSA 2VP4A 3V8EA 5D2CA 3CISA 1X9HA 5CB4A 1UKZA 4O4IB 1HDGO 4ZVKA 4ETWA 2HA0A 3DZFA 1TUBA 4YCCA 4LZWA 1S3FA 4Q5IA 4CKYA 5LNK6 3ZWAA 3FPSA 4YCMA 2G5GX 2IYTA 2QGZA 5LCXA 1OYYA 4NH0A 3ZZMA 3BE5A 1M2JA 2KX7A 3IAAA 4RO0A 2QP4A 3G59A 4C89A 3L8EA 4LCJA 3RU3A 1YQEA 1JEEA 2W2LD 1QCYA 3AB7A 4DQDA 3I2JA 2HPVA 4KH0A 3T3GA 1GA1A 1Y89A 4IXWA 1OIVA 1XAGA 2Z6UA 3K9BA 1DJNA 1G2OA 2GZ1A 1PWEA 3NHJA 4JB8A 1OZHA 1BJRE 1OU4A 2OZVA 4KXYA 4BFVA 4EDHA 2JFPA 1YA8A 4LDNA 2ZAOA 4EELA 3G0IA 2DPYA 2R60A 2YYZA 2ZQZA 2XZPA 3GAMA 4LHWA 4MMXB 3ITEA 4J1NA 5KTNA 5H3CA 1RKXA 4QXQA 2AZTA 3K0KA 2QM3A 3LHKA 1OH7A 1HQYE 1D09A 3ISVA 3QFCA 4QUEA 4J91A 2XGGA 4RAQA 3X0DA 1E6EA 3B36A 5HUJA 1Z13A 2ILTA 1YI1A 2E89A 2QD2A 1I2MA 4UEJA 3CX3A 4ZEOA 2RGRA 5GINE 3KVOA 3LHIA 4WZBB 2FU5C 3BMNA 1PJ2A 3VZBA 3AFGA 4EY5A 3ZOZA 1NSYA 1X92A 3KQKA 3HYRA 3VHLB 1VCMA 3CVJA 4NPAA 2ORIA 1FU8A 2FRVA 4FMBB 3O21A 2XHZA 1YSCA 2C2KA 2JLYA 2WM9B 2XT0A 3QM1A 4DV2B 3KB2A 3LT1A 4NCAA 4R1LA 3QI7A 1WZUA 2HJSA 4MROA 1ZICA 1U9CA 1E9SA 4B3FX 2N0SA 5EHZA 3GJ5A 4GAEA 3NM4A 4OYLA 2C98A 5C5IA 5CTJA 2Y1CA 1D1QA 1OFHA 2PBRA 1IK6A 1M2EA 4YDQA 4EFMA 1EBUA 5B58T 3ERCA 1A2OA 1FP7A 3FRHA 4AG3A 5CB4B 1UBHS 4XFKA 4KRXA 4WNCA 1H4TA 4WUVA 4HEHA 1Y34E 3QLUC 2X22A 2REQA 4FW9A 3E27A 1UEXC 3FPAA 3RIXA 5JD4A 1Q77A 2WM3A 3X1KA 4OXYA 1V9SA 3H5NA 1NUUA 1PV2A 1B8OA 4HDMA 3PZRA 3T6KA 4YMGA 4NNJA 3DGFC 4X8LA 4GICA 2QU8A 3VYWA 3I4FA 4Q4JA 1TUGA 4FHDA 1BXZA 3DLTA 1XXLA 4IDAA 4CIDA 2OG2A 1GLGA 3OQVA 4D1YA 5JZ9A 2VN8A 3F1LA 4XEHA 1E96A 1VTKA 1Z4OA 3TZBA 4UNRA 1E4YA 1QBKC 2FEAA 4NBRA 3SS9X 4BLUA 2NUBA 2B2XA 1NVWQ 2P0EA 4HC4A 4YLEA 3RGGA 4G0VA 4HS4A 4CM7A 1GRRA 4DLLA 2X40A 5D01A 2Y27A 5J1SB 3UHOA 4KWHA 4YT4A 4DBLC 1L7QA 5HHTA 2YV5A 5GJWC 3HUUA 2HJGA 2V6GA 3G2HA 5EP3A 1L3IA 3CNNA 1F8FA 5MGNA 3T5PA 5C1OA 2X5KO 3HXKA 3AWDA 3ZQ4A 3E5NA 2DUWA 5G1OA 3BMNB 4I50F 4YH1A 4Z99A 1J7JA 1W35A 3MGAA 1V7ZA 1KEUA 3LLSA 5GJVC 2ZIAA 1HSOA 3SF0A 4E4RA 5JY1A 2UAGA 3A6GA 3QOWA 4DABA 1DINA 1Q7CA 1XPJA 1VB5A 5H02A 2C0PA 2ILVA 3H1FA 3OZWA 3UA4A 3LO5A 1MT0A 3KQTA 3ZBQA 4EW3A 4RIFA 4ZVLA 1N5LA 1H5QA 1JG6A 1TMKA 1XJ5A 2FE1A 3MJFA 5DU2A 2AOXA 3LFHA 3A1FA 1CJMA 3D1JA 2OCLA 3V4VB 4C6TA 3C39A 4WVFA 3VR2D 1C1XA 2YHIA 3FUXA 3JQEA 3OTIA 4P4SA 3JD3A 5DIZA 5KYYA 4Y2RA 1FE8A 2JGFA 2QIPA 3QWHA 3U39A 3WDMA 3NBXX 4CR7A 1N77A 1Z4QA 5FLYA 5AKKA 4R9RA 4F8EA 2REQB 4JLSA 2AH5A 4L16A 3EEYA 3JRNA 3HDHA 3M3PA 1G59A 4MUJA 4XWAA 1KO7A 3O5AA 5M34A 1T5SA 4HDMB 1OXTA 2UXBB 5KSYA 2J5QA 4IDFA 3SZOA 4RTJA 5KJCA 2BP7A 1LU9A 5DYYA 3Q12A 2ZWOA 4DLAA 1CERA 1YQQA 3LTEA 1MB2A 2FI1A 1H0HA 3N6VA 2R87A 2HA7A 1GUFA 3PQ2A 4RHCA 2O23A 3DEIA 4DMMA 4Q3CA 2FPPA 1RJWA 1FFSA 3AEUA 3MELA 3QYPA 2WVGA 3H65A 3ZOKA 4WPGA 3TJMA 4DIOA 1JHQA 2VK1A 3QKWA 2FEKA 4MK4A 1CF4A 2VO1A 5EMJA 4KI0A 3Q9UA 1JIXA 4M0PA 1HQDA 1O95C 2ZK7A 4TMKA 1AE1A 4UHEA 2OLKA 4AURA 3URKA 2W8ZA 4B17A 5JMWA 1Q95A 5HFAA 4B84A 2FP4B 1IZ7A 2QAJA 3REFA 1JV2B 5U4XA 1USGA 4K9RA 2ZIGA 3P5SA 4V0MA 1B8UA 2C78A 2HLDA 3L0IB 1YXMA 3RG8A 5AVUA 4GR5A 1E3QA 1QGYA 1TC2A 5ECYA 3QOXA 1J4AA 1TB4A 3LECA 2GH1A 4BHTA 4XIYA 2JG3A 1NE7A 4HNAA 2D5CA 3BJZA 3BWBA 5FB3A 1NBWB 2YASA 3Q7IA 1AMUA 5CD1A 2G72A 3VBEA 3DC2A 4DNOA 4WJKB 1XVTA 1G291 4ZOQI 1E3DA 1JSCA 5KUTA 2XKJE 5LIRA 2GN1A 4A1FA 2HRCA 3KD2A 3LCRA 1A4XA 1QHXA 4F85A 4UQLA 1ZD8A 2G08A 4Z7NB 4XVCA 2VSYA 1IXZA 5H4HA 4BEJA 2VJCA 4QPCA 5DHQA 1G60A 5G0TA 5ITZA 1O94D 1K4MA 2WKQA 4C6TB 6REQA 4LXIA 4G5OA 5IG2A 2YHIB 1NX9A 5GONA 3SXJA 4P4SB 4HWSA 1ACMA 5KYYB 1DBRA 2HSWA 1T2EA 1Q3TA 4MS3A 1SVSA 2QTLA 1A97A 2GR9A 2FW1A 4BJ5A 1JSRA 2YXPX 2EYQA 3EVEA 4G25A 3V7WA 1JIJA 2F6RA 3PNPA 1ZGGA 4R2JA 5F3RA 1UBEA 2NUTB 1OKKD 4I08A 2BP7B 4QT4A 3OA0A 1ULHA 1OWPA 3EE6A 3LPLA 3WADA 1W49A 4B40A 2R7MA 2UZ4A 3HKEA 3RT9A 4Q19A 1P0CA 2FPPB 2ZJZA 4XYMA 3DMTC 2G1PA 4KIUA 3CE9A 1K6JA 2O5VA 3K5PA 2WG0A 2V6MA 2XDWA 5LBTA 4HV4A 1Z6YA 3A1VA 1XAHA 2A94A 1X3LA 4MX8A 4NCXA 2FUKA 5DBEX 1FXSA 2VPTA 3GCDA 4MRRA 1RDFA 2FB9A 1AS3A 2VT3A 3K7EA 4ZT7A 1R2QA 4AY4A 3NRJA 3IIKA 3MFYA 4S0XA 1QLHA 4XUDA 1U7PA 1ESCA 1JQAA 1PEDA 3GGGA 5BYAA 4X90A 1IC6A 2OAEA 2XDAA 2ZYIA 2CJPA 2OLEA 3REGA 4AS3A 5DEOA 4E3WA 4C7OB 2FXIA 3NJ4A 5JJIA 3RFTA 2G7MC 1JSZA 1WDWB 3JU3A 2QYTA 1PFGA 2V96A 4HNAB 5HZGA 1AV6A 1NP7A 3DE5X 5AQ1A 4TZ0A 1QAOA 1MC1A 4TL9A 4BVHA 3SZLA 5IDVA 1ATZA 1ZC3A 3DMRA 3S3TA 1MQ8B 4L5CA 1R1DA 1ZIXA 1T3LA 1ZN8A 2ONCA 2IT1A 3CLUD 3H4TA 4NDNE 2CXTA 4WLNA 4A91A 1W75A 3A37A 4Q37A 3ZW7A 1G4UR 2W0SA 3Q2KA 4FGUA 5E4FA 3VVCA 4XJXA 5H9VA 3NTVA 5GMOA 3QFHA 3RHSA 2IEDA 2HSZA 4TS1A 5GONB 3WLQA 4OV6B 1F6BA 3ROGA 3UAOA 1OB5A 1I9GA 2OXCA 4YRQA 3DYVA 3G8AA 4ITRC 1YGPA 3E15A 4LKOA 1DPGA 4UEOA 3UUWA 2YQZA 2E1PA 4TQGA 2UDPA 4AKHA 1SKYE 2YVAA 3TSWA 4E2FA 1RHUA 5ADWA 2P4SA 4KLRA 4F06A 4N40A 1KFCB 2L18A 3DBLB 4JP1A 5AYVA 3A25A 3VKFA 5K45A 1Z07A 3BCRA 3FYUB 5GZ3A 3AVXA 3BWMA 2JH3A 2DR3A 1MC8A 3LVRE 1T26A 5F33A 3ST7A 1P0MA 5A5EA 3HU2A 4Z1MA 2EBWA 2VP0A 4LK3A 2JAOA 4N3AA 1LI7A 3VISA 2QUZA 3W1VA 2OL4A 3ZWPA 3HKEB 3UEOA 3S8EA 2FSFA 1MJ5A 2RGXA 2R6FA 4GPZA 5HOEA 2F17A 4CUKA 1N2SA 1PQUA 4F71A 3DD1A 1DBVO 1BXRA 4UEQA 5J2TF 1LF5A 3AUUA 3ORHA 1ZN9A 5AHWA 1X1EA 1YI0A 3IP3A 2QI9C 2QUAA 3MJDA 5J5CA 3SNHA 4E1VA 2P30A 3NO4A 1JKFA 1QPZA 1Y8AA 3BJEA 2O54A 2HSGA 2C94A 3A6HA 2YV3A 3OQPA 1XMSA 1B6GA 2QSJA 4AJ2A 3QXHA 3B2NA 1FBNA 2CNKA 1I4LD 2OGSA 2V65A 3A31A 4OFXA 4JYZA 2YH2A 1NJ2A 5LJLA 3JRXA 3M6FA 3MS4A 4WA8A 1NDUA 2X5JO 2XUFA 4IQFA 5DXFA 4YP7A 2BOVA 4OOFA 4NEGA 4RJJA 4WD3A 2XQJA 1VMAA 1E1CA 2G88A 3NVMB 3ANYB 1CJUC 4KR7A 5TV2A 2CHGA 4A8JC 4NV3A 5EGSA 3QJYA 2NZWA 3C6QA 2I2AA 3TLJA 1Z22A 1QF9A 1P0FA 5FKJA 1UC8A 4E6PA 1L1QA 4NPHA 4LQCA 5LXTA 3M33A 2L82A 1LS6A 5T3UA 5AW1A 5JAOA 4XJTA 3FYTA 3QW4B 1KVRA 2AZDA 4YB8A 5TR9A 3DXYA 2ZSJA 3TD9A 3I9OA 5IHPA 1UPFA 3MWEA 3WBJA 3CVWA 4M87A 3FCAA 3TD2A 1CDEA 2JANA 2V9CA 1VLVA 4FS3A 2QYSA 4O25A 4D3ZA 4B3TB 2B99A 5IP5A 4MV5A 3NNSA 4D9FA 2JCVA 2JFFA 4NJMA 4PFQA 3AUTA 3HJFA 3JR7A 1Z4MA 1ZOOA 3RRNA 1ONPA 3LSTA 4Y0NA 2LZ0A 2J85A 2PEYA 4M76B 5AVOA 4YREA 3LT2A 3PTAA 9LDBA 2AKEA 1P2TA 2WC1A 1OHHA 3QE0A 4TKZA 2H51A 2QLJA 4U2DA 4HLDA 1ZOIA 2VG8A 3LX4A 3O2NA 4REOA 3S2EA 5EMHA 3N8IA 5AESA 5CX1A 1RM4A 2HEIA 4BNDB 5JQGA 4QOEA 2GN4A 2P78A 3AHEA 3L4KA 3WQSB 4PR0A 4R8SA 4DCUA 4RYLA 3N8NA 2Y77A 2ZYHA 4HQRA 2NPFA 4C2AA 1ZM2A 3SSOA 3UUFA 3AVQA 4BNLA 1SXJB 1YDMA 1Q16A 3M2TA 2XZTA 3QMMA 5TARA 2OFWA 4C88A 4DLZA 5ADVA 3W5AA 3M83A 5EP2A 3STWA 3MWKA 2P79A 2XYRA 1XTPA 4I1RA 3G82C 3W9SA 4QLOA 1JLHA 4DC0A 1IY9A 2F3PA 1GTMA 4K03A 3JQCA 4CM1A 2WTBA 1MX1A 3UATA 2JIDA 4BNVA 1NOJA 1D8TA 1QO9A 2PGIA 3FH0A 4FP9A 4LY6A 2Z9BA 5DM70 3ND9A 4P83A 4KC0A 4DMHA 1ODSA 1VJCA 3ABSB 2I03A 5DCWA 4AZWA 5F3WB 2G36A 1NAIA 3DQQA 1U11A 1UWVA 4ZI7F 1MOZA 2EF0A 4CHTA 3Q8LA 2BISA 3MT0A 1EHIA 4DIDA 3AR2A 3IB3A 2Q45A 1I9CA 4BWGA 1BMTA 3OJWA 3PC3A 2YWXA 1G5FA 4UEWA 3TL3A 3TSCA 2WYUA 2O4CA 4HH4A 1N4AA 4FHEA 3C3AA 3MWEB 3BWXA 3SHFA 1ZX1A 5LP6A 1WV0A 1Q92A 1P73A 2BBOA 2DLNA 4TVKA 4NJMB 1O9GA 3OVMA 1EXWA 3HKCA 1HDZA 3HCEA 1N5MA 1OZFA 1XWIA 1YKSA 2XMPA 1SCNE 3GK3A 2D2XA 4TL6A 2BR3A 4WINA 3ZHSA 3C1TA 2B37A 1LWOA 1Z4IA 2WR8A 2XSZA 3ZLTA 4YPVA 5HMMA 1G7RA 1N2CA 4U6SA 3UK2A 4DHWA 3IKVA 1K88A 4MRPA 5CB0A 4OU4A 4UHHA 4GZ6A 3QFTA 5CX1B 2GA8A 3H1TA 1NP3A 5JQGB 1TI7A 2YZNA 2ZB2A 3EBPA 5JDCC 1Y5IA 4WXRA 4HLQB 2FXVA 1PDVA 2X8JB 2EIHA 4N5MA 3R75A 4JJ6A 3JZMA 4BNJA 8OHMA 2R751 1HDEA 1R9NA 3GJ8A 5K0EA 3QSGA 3N5KA 5KB3A 4MVJE 4J43A 1JDZA 3N58A 4QM6A 3I9NA 4JUDX 4WWHA 3ENWA 2VYND 1O4WA 3A06A 2ZJ6A 3MD0A 4HGOA 4IIFA 5IVIA 3SZRA 1JHXA 1XALA 2J0UA 3G89A 3N1UA 3WJ1A 1EG2A 1AG9A 1TL7C 3GDFA 2AN1A 4RSGA 2HLPA 3V7FA 5CHYA 3OZUA 5IAKA 5DM0A 2R79A 3Q7QA 4MP8A 4RKEA 4LSGA 4B0OA 1UFOA 4RXUA 2IYWA 2YCLA 2V9PA 1S8NA 2YWJA 3V8BA 6NULA 4A0QA 2NO5A 3TN7A 1VMIA 3Q3IA 2R6R1 3GDGA 2ZTLA 5DCUA 4CL3A 3O75A 4O2BA 1RBQA 5T8KA 2WTMA 4RKYA 4NBSA 3GDOA 2VUIB 5DBIA 5T67A 4GPEA 4CM9A 2OCPA 4LG1A 3RM3A 2C57A 1JZTA 1R0RE 1HRKA 3QX3A 3WGUA 1NLFA 4P82A 4F4JA 2ZBPA 5D84A 4I3GA 2JI4A 2B1JA 1F2UA 2XCLA 2XKAA 3ZDAA 1O1YA 1FS4A 5AJZA 1RZRD 4YX9A 4L6AA 3GDHA 3L1KA 1A77A 2FMXA 3GU3A 3ROMA 1HX7A 4RW0A 2IEYA 5AVRA 2I67A 4P35A 4FFBA 3H6KA 3IMKA 5L3SA 1RRCA 3EPHA 3ELDA 1M2HA 2CFRA 4INOA 5F4ZA 2HXGA 4LY3A 3HKCB 1ZK0A 3FNHA 3GVCA 2YYAA 4N82A 4NFLA 4MVJF 4R1MA 3QU7A 5FV4A 3A3YA 4FHGA 4XJVA 5EMLA 4S12A 1X2EA 3U4MA 1XMXA 3B1YA 3R9WA 2C3YA 2C58A 4Z54A 1G7TA 1N2CB 4QYTA 3KLBA 3KQLA 2O59A 1TU0A 3OTWA 4YTEA 5DBOA 2J0EA 4R7ZA 1XK6A 4C6HA 1GUZA 1Z16A 2JB9A 3PA6A 2H4FA 1X13A 2QVGA 2QEQA 4NMHA 3V1NA 2IX3A 1J07A 4FOOA 1TIBA 1KBQA 2V7BA 4QO7A 3SEQA 1ZH0A 1TADA 3OHSX 3AZPA 4C7BA 2J6HA 2PWYA 4EQZA 5HVNA 5JAHA 4M88A 4BX0A 1YQUA 1GG8A 3VNRA 1HE4A 2JFHA 1N1MA 4Q9AA 5AHKA 2PKEA 3R5FA 3BGWA 3GXOA 5IASA 2AR0A 2YJZA 3OT5A 4QODA 5KTRA 3K70B 1S3GA 4US0R 5I8PA 2O3QA 2D5AA 3PC6A 3Q5DA 4YCDA 1PNTA 1L5OA 2J0UB 3JAKB 4IJ6A 2EEZA 3H16A 3EGVA 4F2HA 1XZLA 2BSAA 4WOCA 3OZGA 3WFIA 1J5EB 1QIIA 1KL7A 1GGNA 5LBUA 1XZEA 2JAXA 1ITZA 1NBOA 4N65A 3PDIA 1EINA 3OZCA 2F3SA 4QJIA 4Y9RA 1K8XB 4IDOA 4WZAE 1B6SA 4WSOA 5EVJA 4EPRA 4QQKA 5L8VA 5LQDA 4O2BB 3JQBA 2JI9A 1JEYA 3FSGD 1C4OA 1H05A 3ROEA 3B48A 3VDQA 2GM5A 1GU1A 4Q4HA 3S81A 2JD1A 1XZNA 2RMKA 2XVXA 1YJXA 1X86B 2XADA 3PNKA 3QZUA 4XTCS 1UANA 2GZ3A 5CBKA 3IAM6 3UC5A 4E21A 2WJWA 1YWGO 3VH4A 4Y7CA 4EHHA 1QLWA 2Y0EA 3RAJA 3S2GA 1F2UB 1E61A 2B8WA 1WDTA 3GLUA 3P2IA 1BKYA 2WPDD 4P08A 1U1GA 4RQAA 1U6IA 5D7NA 3CLHA 5EP4A 2CL5A 4BFUA 3V4OA 3JQFA 2NMVA 2VPQA 1IQUA 1SBIA 3D64A 3INNA 3KZMA 4FFBB 2VDVE 5L3SB 1VPLA 4C4RA 1T25A 1QTRA 1VRWA 2QX7A 3REOA 2ZUCA 1ZGJA 4RY2A 1SKMA 4UW9A 1IN4A 1HYHA 2V1XA