1N5OX

Structural consequences of a cancer-causing brca1-brct missense mutation
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
207
Chain Sequence
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNRPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural consequences of a cancer-causing BRCA1-BRCT missense mutation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
molecule keywords Breast cancer type 1 susceptibility protein
total genus 56
structure length 207
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1n5oX02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1n5oX01
4BMCA 3K0HA 2EBUA 3T7JA 4BU0A 2NTEA 1T15A 4Y2GA 1KZYC 2XNHA 1L0BA 3KTFA 2COUA 1T2VA 4BU1A 3PXAA 3K15A 1Z56C 2COKA 1T2UA 3OLCX 3PD7A 2EBWA 3JVEA 3T1NA 3L40A 2DUNA 1L7BA 2XNKA 3PXBA 3SHTA 2L42A 1Y98A 3EF0A 4Y18A 2D8MA 2ADOA 4BMDA 2JW5A 2LE0A 3PXEA 3PC8C 2VXBA 2HTFA 3I0MA 4OFBA 5ECGC 3SQDA 1T29A 3HUEA 3AL3A 2AZMA 3PXCX 4XQ0A 2ETXA 3T7KA 1JNXX 3UEOA 3QVGA 3COJA 4XPZA 3T7IA 2R1ZA 1IN1A 3HUFA 3L41A 3QVGB 2EP8A 4IFIA 3I0NA 1N5OX 1CDZA 3PC8A 4U4AA 3SHVA 1OQAA 3K0KA 1GZHB 3L46A 2K6GA 3K05A 2M2IA 3II6X 2COEA 3UENA 2K7FA 3EF1A 2INGX 3SZMA 3U3ZA 1IMOA 4IGKA 4JLUA 2E2WA 3PA6A 1WF6A 3PC6A 3AL2A 2WT8A 3K16A 2VXCA 4ID3A 3FA2A 3PC7A 4N40A 3PXDA
chains in the Genus database with same CATH superfamily
1QGDA 1RWOA 3QWAA 2VYVD 2G1AA 5AIBA 4BYMA 1N1EA 4H3HB 2MOKA 4TWZA 1MFPA 3C8ZA 2BJVA 2FSPA 2Q50A 1MBZA 1QS0B 4DLRA 1LA2A 3TGWA 4MV9A 1V45E 2ZUVA 4DCNA 3NHWA 4EL5A 4DR6B 4YRRA 1P2GA 4L0DA 3GJSA 3S3TA 2NVOA 4FMPA 2ZE6A 4D43A 2G6BA 1G2IA 1FP4B 4H3KB 2DC1A 3L84A 3UZUA 3FKSA 3ZE7A 4DJDC 4F4HA 1T36B 2VC2B 3NG1A 2WWIA 1QJ4A 1UP6A 1IIRA 1L9XA 1P7PA 3U7QB 4N8SA 1P7ZA 1S02A 4XH9B 2AFHB 4ITRC 2QX4A 3IEVA 3NXSA 4EEXA 2WF5A 4EYQA 4AP5A 1A8IA 4JYBA 6PFKA 4IIYA 3UICA 4XD2A 4DSNA 3RIYA 2YL2A 3GUHA 1YR8A 6ADHA 3GFTA 5B1SA 2GDZA 3LZDA 2A9JA 3BHIA 4K6OA 3UAYA 5IC4A 1B23P 3ZZNA 1UBRS 1SZJG 3EDCA 4KGVA 4UMEA 3N9IA 2FPSA 1IVYA 5F78A 2PDAA 3E7FA 1JT9A 5AK5A 3TIFA 2PLRA 2WT9A 3MT8A 2E89A 3HV2A 3MMSA 3Q3CA 2NZVG 4WZAB 2K7FA 5B53A 4AZ0A 2I1WA 3AESB 1PJ3A 1A0OA 4TYMA 5JAOA 3PGJA 3U3KA 1E3TA 1PD0A 1XR3A 2JFQA 1T10A 4Z8YA 2QPAA 2RONA 2QAGC 3BCHA 4KNVA 3AHCA 4MK4A 4A2QA 5B7GA 5JMWA 3WL4A 2ZDGA 3DFIA 1JWBB 4M0PA 4DLXA 3DBOB 5HS4A 3HC7A 3RJ5A 4ILKA 1H8HA 3JQAD 3OCZA 1U2RA 2Q0SA 2ZPUA 1DKNA 1C0KA 4KQHA 1Z26A 3FMVA 3RBZA 1IPEA 3AHHA 3EMDA 4MEAA 4QARA 4EF6A 2D0DA 5CTAA 4US1R 2ZWIA 3HB9A 2ZIUB 3W5SA 3FMPB 3TMKA 8AT1A 3W05A 5DLYA 4B6EA 4FN4A 2FW1A 4WKBA 5TQJA 2DUJA 2BEJA 2FN7A 3DMGA 3O1IC 2L0XA 5LYJB 2H51A 3OCVA 2ONJA 3ABQB 1ZOIA 3USES 2AEMA 2BGMA 3E9MA 5A4FS 1JG3A 1PZGA 3QVTA 4PQGA 4GECA 2JGDA 5FQOA 3NHRA 3A3NA 3H6KA 3A2MA 2K5UA 3NC4A 3AP2A 5FUYA 3SU8A 4HAXA 5C1OA 5T4HA 3A1SA 5A9TA 1JJBA 5FR2A 1AV7A 1RZRD 4URYR 2NV6A 4GO1A 2W8BB 4PCAA 2XMQA 4Q39A 4XQGA 3I6IA 1OAOC 2HA6A 2HJHA 5T41A 5B64A 1QH8B 5A2QA 1N6IA 3CN9A 1EDBA 1W29A 2PQMA 1ZKMA 2RGDA 3HL4A 4ZYYA 2GHIA 4LZLA 2VAMA 2XHEA 2ENUA 4EQ6A 4MPTA 4TVBA 4ZZ0A 3TNYA 3TWOA 3NYQA 3ZBQA 4M7OA 2GRAA 3IUNA 1MOPA 3UAVA 1I5RA 2EKLA 1J2UA 1H4TA 1ZISA 3OFSA 1H66A 1QYVA 5AOCA 4Q19A 3LQYA 2ZM6B 2YJGA 2YYYA 1SXPA 5CM9C 2H5IA 3DFUA 4O4HA 1M1YA 3VAYA 2Q5CA 3PEYA 3E6AA 4LUCA 5U4XA 4HUTA 4ZEWA 2C92A 4P22A 3I6MA 5DIFA 4BMCA 4EK9A 2GN6A 2UUBB 2B34A 2VJNA 3FWZA 4FZ5A 3ZGVA 4OSOA 4CMAA 3L5OA 4MGIR 4ZO7A 5AOAA 4B2YA 1DQNA 4LWQA 1ENZA 4MDFA 2ZIGA 4CEIB 3BXXA 1XAHA 4AX8A 1CJVC 1GSHA 3FDIA 4UTPA 3FZEA 4ZP1A 1L5OA 1RWBA 4R84A 3GJRA 4HEHA 3W3ZB 3ZU2A 2OWDA 1MX9A 5IAGA 2NXNA 2AOXA 3CUVA 1QSGA 3KVRA 2GJAA 2ZYSA 4O2AF 1R9NA 2OV8A 5JSZA 1XXHE 1YB2A 3REOA 3VNRA 5AI8A 5DI3A 1VB5A 2GB4A 1CUDA 2NXJA 2Q29A 2XNKA 1WHTB 1UBOS 2J4DA 1PJRA 4GX1A 4NWIA 4ZAFA 4Y1EA 5LWHA 3HJAA 2X3YA 2BP7B 1ZK4A 4BNJA 1PR5A 1Y3IA 4M83A 1M2NA 2AFVA 3PVSA 2Y0BA 1RI2A 4PGFA 3WGJA 5HQ3A 2QZZA 5CG2A 2UZ3A 1RXCA 1Y6FA 1R88A 1LW7A 3E2PA 3KC2A 3Q6IA 1AG9A 4LNAA 4YQFA 3L0DA 2R4QA 5HZHA 3D9QX 5DRTA 1SUCA 4F4CA 1E3DA 2ZI6A 1AS2A 1E9FA 5IARA 1JA9A 1UBFA 2BFCB 2CLIB 2VXBA 3OEYA 1H1DA 1RBQA 3BGDA 2D0IA 5TRTA 4IRUB 3WLEA 3IMGA 3BEDA 5DNAA 5C34B 3TH5A 3SYLA 3SJ7A 3CNHA 2J08A 1BYUA 5T4FA 5C4IA 4JB8A 5LLDA 1ESZA 4AS2A 2O2SA 4UEJA 1GTRA 2EERA 3DV2A 4AK9A 3L6EA 3EBLA 3ROMA 1CRQA 4POOA 1GZ7A 3HN2A 4PWYA 2ZRHA 1GGNA 2GWHA 5GONA 2BBTA 1ZVJA 3CNEA 4NH0A 4C7BA 4EGSA 2WWVD 4I66A 1X8XA 4OQLA 4P36A 3EA4A 2IK8A 3FXAA 3T3OA 3H75A 1WM1A 3ST7A 5T3UA 1X7GA 2O4CA 4YV0A 1DIHA 1IY9A 4H4EA 3Q0TA 4DBVO 1IHXA 1XSEA 3QFTA 4ROSA 1KO8A 4C7KA 4EG5A 3ERCA 2VT2A 3BMXA 1KO5A 4PSUA 2BGTA 4TM8A 5CK5A 4M8KA 1E0DA 2Y1WA 2NYVA 3R40A 4UEOA 4DRZA 5TPZA 2OXEA 3KD2A 2ANCA 3QMWA 4FOPA 1IRIA 3EXHA 4II3A 4QFCA 3SF0A 2XVZA 4IDAA 2NPFA 1X74A 1ISGA 3BK1A 3CPJB 3CJQA 1GV1A 4HB4A 5CB4F 3ENVA 2G88A 3PQ2A 4WKNA 3KB8A 4K6KA 4F1KA 2DFPA 2B0JA 2V6FA 3I1FA 5F2OA 2YXLA 5L3QB 1UM9B 5HRCA 5FBHA 4IJVA 4YRBA 3KL4A 4YDHB 3ZU5A 3FBGA 1L7DA 3I4FA 1UC8A 2VDKB 3SIXA 4D57A 3G2KA 2NAFA 4G01B 5GOZA 2NU9B 4D3SA 1T0PA 3EDYA 2GD0A 1JE1A 1I9CA 1VE1A 3IEXA 2VBGA 4B3RB 4CU5A 3A9WA 4UZEA 5B3LA 1AZSC 1YK1A 4ZHSA 2BRUC 5KQSA 4PYIA 1U2TA 1YFKA 4U2CA 1C9DB 5DE3A 5C31A 2X1MA 3K2QA 2PD6A 5FYDA 3TSZA 2B37A 4BQRA 2I9KA 4Q4AA 2FQYA 3HVUA 4Q01A 2H92A 4F2HA 3AHFA 4UD6A 3GQVA 2SCUA 2YY5A 1SC6A 5FLYA 5JZOA 3CZMA 1PEDA 1PNRA 1CQPA 1PT5A 2OAGA 2KQUA 4E3WA 3R5FA 1SBCA 4N4AA 5EIHA 4GRDA 1IU9A 4HP8A 3ZDYB 1BJKA 5EJFA 1VCHA 3NM5A 2ATEA 1J21A 2P8SA 3LBYA 3NLLA 3H86A 4PS1A 2V7GA 4WASA 1Q20A 1E2IA 1WU8A 3IQEA 3KU1A 4D4MA 1M74A 4QRIA 3OQNA 2FWMX 1A2OA 3PK0A 3OFND 2BGWA 3R0IA 1Z3CA 3SHOA 1AQJA 1NLZA 4AICA 2GDJA 4Q3BA 3KUUA 1ST2A 3V1MA 1RKBA 4P0PB 5JSQA 4G23A 3RVOA 2AXEA 3EXFA 1IK4A 1KERA 5EKDA 4EY8A 5DHAA 3V8QA 1M66A 3V7WA 1T0HB 3NV7A 5AJYA 1NJFA 1WD5A 2E4VA 2QOEA 5C5IA 2D8MA 1N75A 4IH9A 4U8GA 1A1SA 1JDUA 1FRZA 3D1LA 2M6LA 1DJLA 4RK5A 3RTGA 3W34A 1VSVA 4DWOA 5C8YB 4YLGA 3DTVB 3O1JC 4RAQA 1T0JB 2EZUA 1W35A 3AVQA 5K3FA 5HKBA 3UANA 1VGVA 3WNBA 3NHJA 4GEKA 2GNPA 3TPFA 3D7RA 1EFDN 1QYDA 2JAOA 3T1VA 1HTBA 5KCMA 3BWXA 3L07A 3QPAA 2H4FA 1JWLA 3FDFA 1OI2A 3GFRA 1HQCA 1VHWA 3CXRA 4M4SA 1HSZA 1GPJA 3A6JA 4GLOA 1Q2UA 1M8JA 1OBFO 1PFKA 4C07A 2W2OA 5FEUA 1NVMB 3ZG6A 1ZOLA 3CTPA 1NAIA 1HQDA 4JFRA 2G8LA 4NECA 1H0HA 3UAGA 3MFQA 1IZ7A 3TTXA 5BPFA 5EP2A 1TKCA 4F4IA 4FEYA 5A4IS 1BGWA 5EGSA 1DKRA 1C3VA 1H9AA 4Y8VA 4PZZA 3PIIA 1A8QA 4KPEC 1JDPA 2QGNA 5HM8A 1Q7RA 4C88A 1FFSA 5AW0A 3IDSA 2JCGA 4ND8B 3S2FA 3LS2A 4MV1A 4ZO4A 4H7PA 1EP9A 2DR2A 1J49A 3ED1A 1JKIA 1L7VC 2JGEA 2QTBA 2B25A 3D7MA 4IIFA 3NIWA 3MTEA 4C43A 5IBQA 5BMVA 3U4QA 3F98A 4E70A 1DZ3A 2Z83A 4NAVA 2W11A 3F6CA 3IHKA 4TWIA 1HQKA 3PQ4A 3QF4A 4Z7QB 2CNWA 4RE5A 4RF2A 1PJ2A 1E79A 5C37A 5DTIA 3P2OA 1VLHA 1QRDA 2B78A 2ISSD 2GFQA 3ILXA 4BNZA 1PJSA 1LBEA 2WVGA 3PRJA 4FC6A 4DV7B 2O3JA 3TSCA 1JQ5A 5MF6A 2DLCX 1QNLA 2XWJI 4GQAA 4MW6A 1BQ3A 4P98A 1Z7YA 4XIYA 2FEOA 2Y1GA 3SQLA 3W3AA 4TL9A 1U31A 3IP9A 4ND2A 3VSEA 2YJ4A 4ARUA 1M34B 1FDRA 2FZEA 4P4UA 1CWUA 2CL5A 1NQTA 5J5VA 3FMFA 1C4OA 3RDPA 3WADA 1KR5A 2PZ8A 5IABA 3K5PA 2IYOA 3GL9A 1XRLA 1JEEA 3H1AA 3IEIA 4LVCA 5GONB 3FVRA 1YI8A 3DXYA 1OZFA 3JQPA 4RV5A 4I55B 1XRNA 2JRLA 2G7ZA 3ABSB 4OJTA 4QGGA 2ZZKA 3SFVA 3SYMA 3R5SA 1SN7A 1SU7A 5B55A 1V26A 1GL7A 4WMLA 4G1EB 3H87A 2YNMC 5I01A 3A14A 3AUJB 4RH1A 3ZHQA 1L8LA 1SRQA 2HAEA 1UZUA 2ZCUA 3K9BA 4PX9A 3HV0A 5IM5A 1WJGA 4E5VA 3I5YA 2WZQA 2Z5FA 3NP7A 4LY9A 3NXKA 3VSCA 4QRHA 1V8OA 3IIIA 4R0NA 4WESB 3LXMA 4XASA 2HXSA 1GKLA 3J7TA 3VNQA 4BO4A 1A69A 1ZN8A 2P2SA 3A3YA 4MUMA 5GZ6A 1ZOPA 4W7IA 1HYHA 5AHOA 2XWSA 2PKQP 1CR6A 3MCZA 4Q47A 5C5DA 2GOYA 2P4EA 4NMXB 3BX1A 2P9JA 1GTVA 1QLHA 2UZAA 4M1YA 4TWBA 1VBFA 3V46A 5I6DA 1HORA 1WVIA 3QXSA 2BKVA 3V2HA 1P4AA 1TVKB 1YH3A 1ZD5A 2JH3A 5AM0A 4FNOA 1PQPA 2QN7A 3TBKA 5K3AA 5AM3A 3GJ3A 2DWPA 4NK4A 1U28A 2Q7XA 4ETIA 5ADWA 4E2FA 5IZ4A 2RGXA 1G7TA 5J23A 4MVJI 3ABIA 2XIJA 3SDBA 4GX2A 3DBRB 1Q1EA 4OGLA 1ZZEA 2BWJA 3ETLA 3IHWA 3EWNA 3LC1O 5EJ6A 4RIGA 2HCRA 3DT8A 1FBNA 4ZOLA 1TD1A 4U2FA 3W4JA 3WWDA 3CVUA 2ZDHA 2C5LA 2VRCA 4OB6A 2JCSA 1QBKC 2GI4A 2RBGA 1SA0B 4MQ6A 4TRRA 4TVKA 2P9FA 2R6AA 1JLRA 4CLOB 3Q7QA 5EIFA 1SR8A 3DZIA 4GI1A 1VI6A 4WOCA 3AUYA 4H0CA 3X1MA 4L4XA 1B2RA 3QYFA 3UV6A 2GKSA 4BLVA 2FOXA 4AYXA 4A6PA 1E2UA 1NC1A 3DKVA 4PHGA 3LT1A 4R8LA 4YXWA 4MCHA 2CL7X 3A4TA 3O26A 5LZ2A 5HP4A 2DJIA 1DKQA 3EIQA 3WLNA 5E3HA 5DNUA 1KI7A 7MHTA 3B89A 5H02A 1ZJZA 2DCUA 2XMZA 1CDZA 3N05A 1J0DA 3O4GA 2HDWA 3I0ZA 2I4LA 4QAQA 5IDVA 4GBGA 5C1BA 1AGPA 1AMUA 2FZWA 2IGTA 1YVPA 1GSAA 4PTLA 2QTWB 3GEGA 4EYOA 4M1ZA 4EA6A 1WUIS 1UPTA 5CVUA 1EXDA 1YS9A 2L18A 2QKYA 5EIAA 1LUAA 1I7LA 4RMGA 4AKSA 4JI6B 3NZEA 2PYIA 3AEQB 2GFIA 2A0FA 1UQUA 3AR3A 3QELB 4A1OA 1Z4IA 3GZTB 2IBSA 5CYOA 2PMWB 4GZ3A 3I01M 1FRFS 4UHCA 5GOTA 3KQLA 4YECA 3WLIA 1XWFA 1FJGB 1X8JA 2J6CA 1BROA 1JPVA 4NCAA 1HDEA 1RADA 4NICA 4RD0A 1TLTA 2R86A 2QN2A 3AEQA 3QPBA 5DYIA 4B7CA 5KTOA 4XRGA 1Z3IX 5E2AA 4BTVA 2A7QA 4BGVA 2N42A 2B0CA 5A4MS 2IHUA 5HCUA 5HM6A 1F2UA 3EC1A 4CT0A 4PN7A 4ALLA 3TE6A 3P2MA 5E6SB 1OH6A 2HRRA 4DLAA 1MTOA 3KSRA 2K87A 2QP9X 3WRYC 5CBPB 5JMTA 4F2PA 5C18A 2GCOB 3ORYA 2ECFA 1VCNA 3C7TA 4F2WA 5K0GA 3BICA 3G1WA 1UFOA 1IH8A 1T5LA 1C81A 3JZDA 1NXTA 3VOBA 2EJWA 1ABEA 1GVNB 4BFYA 2Z5LA 2YH2A 1PQ4A 1NVDA 2D62A 1SWWA 3NYWA 2DG2A 3RYCA 1IE3A 1EH5A 3LAWA 5K7SA 3CKKA 5EL0A 4DA9A 4Z54A 1F06A 1Z5UA 1SC1A 1ZJ6A 2WINI 2WTXA 2NNWB 2PEYA 1E1YA 1B2LA 1PW7A 4JGGA 2IA5A 3MHTA 2PN1A 3EE6A 3WHPA 4AP9A 1AH2A 2VO1A 1GV0A 3T7RA 3B2EA 5ALYA 1M2VB 1XJCA 2ZE7A 5FPPA 2XB6A 3TDMA 4Z7OB 2VOEA 1K3UB 5LDGA 2O5RA 1G55A 2VT6A 3D0QA 1Z6AA 4P4GA 1SCAA 2AFHA 3NTXA 1G1MA 5ALHA 5IFLA 2YASA 5JW6A 2O8VA 5BMVF 3W7VA 1Q44A 2XZLA 3PFKA 2WAOA 1C2TA 3PJGA 3O3CA 1RI3A 1W25A 2ACVA 4ZEOA 2W2TA 4B3BA 4CM8B 3ZGZA 2WZCA 4PQEA 1E7MA 1GTG1 1S2GA 3ND6A 5AVWA 3ROZA 3UIEA 4KKXB 4IYRA 4E5YA 2W37A 3SHQA 3B5JA 3VZQA 1QQTA 1XZQA 3TQFA 3RHZA 2QZPA 1OREA 4F85A 1ZK3A 4MR7A 4FE3A 1X7HA 4BCBA 1CB0A 3N0WA 3IT3A 3MJEA 2VYNA 2Y67A 3QE0A 4K9DA 4URFA 1KE2A 1QIDA 1RM0A 4NBVA 5I8ZA 3TM4A 2I7TA 3DAHA 4PONA 4R9RA 4EHLA 1SG0A 1NLFA 1F38A 1OXXK 1A2BA 1TRKA 1V5EA 2PJDA 3IAM1 4FN5A 4IGFA 4PBRA 1AQIA 1U2DC 3LY8A 4F5WA 5JI2E 3U7FB 3IPYA 4D8VA 3ZCXA 4MWZA 2XNCA 1K7YA 5EXPA 4CLXA 4M54A 3O75A 5K2OA 2R00A 2AR7A 2O2DA 3ZOZA 4PM4A 1Y3BE 5JRZA 1SZCA 4Z9YA 1CY1A 4P5PA 4UHDA 4OIFA 1HV8A 1DJOA 1WIWA 3MWDB 4C4PA 3CTMA 4EABA 5LIRA 2ASVA 1QX3A 5IXSA 2H2DA 3F8WA 2OCLA 1R4AA 3B70A 1GCUA 5K3OA 2WKPA 4N1AA 1A97A 2X0JA 2H4HA 3D54D 4QHYA 2VQ3A 4C6SA 4D97A 1PVOA 4QUEA 5E95A 5DU2A 3AM4A 5HF9A 2YQZA 2PAAA 2H0QA 2JFNA 4K05A 3S4YA 4C0HA 3LYUA 2DUWA 1WULS 2I03A 3PIRA 5G0VA 3VYWA 1T9KA 4UTXA 4JQYA 4FDUA 1S8AA 2PSEA 4AWBA 2PJZA 5CXQA 3W2IA 2G63A 1VE3A 2EZTA 1JWAB 3HKDA 1E79D 4GHWA 2EDCA 1CW2B 2NIPA 3CM0A 4JLPA 1HDZA 3AKZA 1L9KA 2GO1A 3SXJA 5EEHA 2PLFA 1ORDA 4PO8A 4DNXA 1REQB 1FXUA 3OLWA 4RPKA 1Y9AA 1OXTA 3M1YA 2FMXA 4MUKA 2E18A 1T4BA 3RVLA 5J4HA 1Z35A 3FWKA 3MWLA 1X7XA 3LLUA 4C76A 1RRMA 1G6KA 5ESDA 1XZGA 4C04A 2QM0A 1RC1A 1DHTA 2YN0A 4ZKDA 3WK7A 1EX1A 4W82A 4LISA 2H48A 2ATXA 3F46A 4NARA 1XX6A 4HDSA 1OWNA 1USVA 3KEOA 3RTCA 5IK2D 3GY0A 3N8IA 4CYMA 4EPYA 1U1GA 4BS9A 3AY3A 4Z4HA 3ER9A 3ZI0A 2G07A 1INLA 1DOAA 5ALIA 4B46A 4N5IX 2HLHA 3U3JA 1R6VA 4E08A 3FPSA 5KJEA 3E9CA 1Y7PA 3PZRA 3K7EA 1L4NA 3MT7A 3GGCA 4CF5A 1DX9A 1IRXA 3CLTC 1NP3A 5L3RA 1WUTA 1G18A 2CJXA 4B75A 3PXBA 2DQKA 4IJ6A 4F7WA 4C9BA 2W2XA 3PUXA 4CM4A 2JI4A 2WUWE 4K86A 1Z6PA 1WF3A 1V7QA 3IH5A 4PS0A 3AI2A 4BMSA 4ZOQI 5JSZB 3DE4X 3HKBB 3CLSC 4WXMA 3U1VA 3UT5A 4CN8A 3MUEA 4FZ3A 1GTZA 4AN4A 2B9VA 1C8BA 2E3JA 1V37A 3DVAB 3QJGA 2BE7A 1PCXA 3MQFA 2BN4A 1EZZA 2ZU6A 4K9RA 1UWKA 5G4KB 4U2EA 1AS3A 5TMBA 1T35A 3V3KA 4BQSA 4WN9A 4FCTA 4DAEA 3AJEA 3AVWA 3NTQA 2XRYA 4IDHA 2C5FA 1TYDE 3OETA 2E0IA 3Q87B 1RAAA 1FU7A 4WA8A 2WBLC 4IDGA 4RPCA 1RDFA 4MHOA 2PR7A 4P84A 1FVFA 1LBSA 1XMXA 2PTHA 4QXPA 4L57A 4B6JA 3BWVA 5CW2A 4IUYA 5AWFC 1SXGA 2XF8A 2CF6A 4HYYA 2Z8XA 5HMLA 1PAUA 2EC5A 4BB0A 1OFUA 2PKEA 5JCPA 1T6BY 2VDWA 4DZRA 3ISVA 1BXGB 4E88A 3QNMA 2EQAA 2R2AA 4NE2A 2PFGA 5DTQA 1HX7A 3UMRA 2WHRA 4OMUA 1N7JA 2YFHA 4KWHA 4LVNA 4A03A 4WGGA 3IUJA 2WM9B 3GFBA 4ZT3A 3GLHE 1PGPA 5HEKA 4BX2A 4Z53A 4ZI3A 1YRAA 4ENRA 4ZHQB 3CVXA 4GDMA 1ZICA 4C4OA 3HB5X 1MJHA 3D4PA 4YMWA 1PX0A 1ZSVA 2QJOA 3AI1A 4KIJA 5F3RA 2VT3A 5CURA 4PIMA 2YICA 3KM0A 3H6HA 4IEFB 1IB0A 1R8JA 1GZHB 2Q99A 3S5JA 3UB4A 3ZUGA 4HWOA 1JTFA 5K0BA 2FPWA 3QX9A 4TL7A 2OXFA 2QQ5A 2QRMA 1PR3A 3NAGA 4QQRA 4L27A 5KOHA 3FJ1A 4JXJA 2ZZNA 2WTBA 4P4TA 3V34A 1ADGA 1E1NA 4CI9A 5JJBA 3Q3JB 1D2HA 5SZIA 4YT5A 3NBFA 5EC8A 2IYRA 3F5SA 4OHXA 1T25A 2HQOA 2VPXA 1UKZA 1DB3A 1OA0A 2GN9A 5IBPA 5C8ZA 1JJFA 5E7QA 5JJKA 2WD7A 3L92A 4BVFA 5CFPA 9GPBA 2PGXA 1ESMA 3LLMA 4URZR 5IAOA 1NJ6A 1SUFA 3DDNA 2BF4A 4HDMA 1KSGA 1QPZA 1QF7A 2BTQB 4ZYLA 5ICSA 1H6BA 4IXWA 2I3AA 1VPLA 2WIFA 3HCFA 3NHPA 4OB8A 2NPOA 2RGCA 4MVJA 1C1XB 1EK5A 1MQSA 3TTTA 4CIVA 4TQAA 2VTEA 3WX0A 4HG2A 1ZN9A 8MHTA 2JFVA 4GMDA 1EB9A 4J94A 5LIPA 3TX6A 1T15A 3UFXB 2V65A 3Q98A 3DPUA 1EX6A 3SZGA 3W5JA 5C8VA 3GFSA 3K72B 4X3OA 1BWSA 5ES3A 5KNBD 2J3EA 5GINE 1J00A 1M2HA 1L7EA 4KK3A 4J1NA 3CR8A 4DTCA 1FLNA 3RS0A 2E49A 3MTJA 3P4XA 3M1IA 3V3TA 5FWNA 2CV0A 4AL4A 3NEAA 4YLYA 2FZCA 4RSMA 4CTMA 1K98A 3ESBA 3WWCA 1GUDA 1KA9H 4LYJA 5DXFA 2QUIA 3I5AA 1NHGA 4DYHA 3RSGA 3EOBI 2WMOB 3IJ5A 5G40A 5CM2Z 3TLGB 2Q1TA 4RXMA 1G42A 5KC9A 3L01A 5HRUA 2VP9A 4TYPA 1SCIA 1GZDA 1JBKA 5GM1A 1UKVY 4LFAB 1ZC4A 4Y2XA 3AFOA 3HBMA 1X1DA 2RBEA 2RKBA 4JUBA 1XMIA 3O31A 4OKNA 1G8AA 1JQBA 4WAUA 5AUPB 3CLHA 3B8HA 4YAGA 2Y0DA 5LP6F 2JARA 4JVOA 4MHTA 3CH5A 3PXEA 1QOZA 4URXR 3A3PA 4XX0B 3AV0B 2AQ8A 3A2NA 3B51X 1MKYA 3CG0A 1SOAA 3IDOA 4KACA 4J0GA 3NIFB 2XTZA 2EHDA 5I7WA 2ISQA 3S1SA 2RHLA 5FBRB 4ZTZB 1L8AA 1Z6TA 4Q4CA 3BQNB 1M0WA 4NHOA 4UATA 2ZT5A 3UJBA 3D2CA 3UKJA 3X1XA 5KYWA 1HNWB 5MN6A 2XR1A 3LWNA 1DVRA 3R3UA 1IEQA 4LXGA 5FOQA 4M21A 4MP8A 2R1VB 5I4BA 2XUDA 5JD5A 3CRNA 2LCIA 3QVUA 4HDSB 2FZKA 5D3KA 4DRXB 2Q8PA 4TQUS 2XUQA 1E3WA 2WAYA 4RHTA 3COJA 1H2YA 3PF9A 3U4IA 2XB2A 4F3YA 1T5OA 5AK3A 3ROGA 5FADA 2EV9A 1QC5B 3GFGA 2OL4A 2P9HA 2SBTA 2XA2A 2FEXA 1D6JA 1JG6A 2YTZA 5K8VA 3ULKA 3G2OA 1OI4A 2Z57A 4MAMA 4B5LA 5CFNA 2D5CA 2N0SA 2Q2NA 2QZSA 4V03A 4AO8A 1B8UA 3THXA 4Q4LA 1CF9A 1HURA 3MIIA 5HRAA 3KT6A 4OQPA 5B1EA 3J81A 3MXOA 1EBFA 2B4RO 1KP9A 3ICVA 3DDZX 3PUZA 3VR0A 3IE0A 5C35A 3LO5A 1T4GA 2NZWA 2DHCA 4RGVA 1JEAA 1SKYE 5FWAA 3WQQA 1JIIA 1Y4SA 1T26A 3I1IA 2UYOA 3PX7A 5TVKA 3EBOA 2Z43A 5LD2C 2ZBEA 2QE7D 1P29A 1QRAA 1ZD1A 1ZI6A 2IGBA 2ZBDA 3KIPA 3OU6A 4OHPA 1OB2A 4X8OA 2OK7A 2YHBA 4PAQA 5ED4A 2ZYUX 2HDHA 1J1ZA 2NW6A 3SF8A 2KB0A 4I50A 1I4OA 4CT5A 4G56A 3MVEA 1NZFA 1WCIA 2OBYA 4KPGA 4ZO6A 5JANA 1JAIA 1YACA 3L6DA 3PITA 4EUEA 3WRXC 1P61B 4GI5A 4MPJA 7AT1A 4B3FX 5LQUA 1DCTA 4E7PA 1PL8A 3KHTA 3WRWA 2CBXA 4DA6A 2QIOA 3DWGA 1GRNA 5IS2A 1VXRA 3Q2IA 4XKJA 2A7XA 3CUSA 3DM5A 1YBAA 2JA2A 4YXFA 1VKZA 4LY3A 2QM8A 4FGWA 4H27A 4LX0A 3TN7A 4I9UA 3VQTA 2H08A 1NASA 2OPHA 3V00A 4YAEA 1TA4A 2IEZA 1IY8A 2WFMA 4WZAE 5HCNA 5TF4A 3SR3A 2NADA 2R8BA 5JXWA 3V1YA 5A3VA 1HDXA 4OATA 3C1TA 5AKIA 3ESYA 4L5YA 4EMTA 3PD7A 1KYWA 4GM4A 2PUAA 4X1YA 1C3LA 1FFGA 4COOA 4FFOA 4F4DA 4Z4QA 3Q7PA 1H5NA 1OFTA 3JYNA 1XBTA 2HXYA 3MJCA 3NHBA 4MQ5A 5EJIA 4KKVA 4HNUA 3GLFB 4CKCB 2F1RA 4GI2A 2HWUA 3ET4A 3M1AA 4G97A 2DGDA 3JWJA 2J09A 3P1JA 3VU9A 1CDDA 4YN3A 5BWLA 3UH1A 4GYYA 3MWJA 1QKKA 1B8NA 3QXHA 5BYJA 3S81A 1P4SA 2YRXA 1EVJA 1SB8A 4ER0A 4BIMA 1U63A 1QH9A 4YQYA 1QH1B 2O0LA 3VU9B 1DIGA 1DIOB 2I62A 2X9NA 5AJUA 4U8HA 3B5EA 3NHUA 3ZX4A 4Y6OA 3K9HA 5DM4A 2IXGA 4IW3B 2ZRCA 1UUFA 4IILA 4UVHA 2BE9A 3QTLA 4BKUA 3ASZA 3RUHA 1IJFA 1FRQA 4DV4B 2DBZA 4DR2B 1FFHA 3N39C 4X1IA 3HTXA 2A14A 1U5AA 2O8BB 5ALDA 4U7DA 4I1UA 3U3DA 4QNNA 3LVFO 1S2IA 2NG1A 3EZ6A 3FMGA 4EEZA 4Q1BA 1B8VA 2JATA 2ZWVA 4AJPA 4YHHB 2QRUA 1ZI8A 2KJQA 3I2GA 3WFZA 4A82A 3HR4A 3KOMA 2HU5A 4FINA 1JALA 4LYYA 3RTDA 3CSUA 3UPDA 3WMGA 1PJQA 1RBYA 1GZ6A 2A0KA 4AZ3A 5PGMA 4Z9FA 1ZEJA 4M9QA 1OLOA 3PD0A 3WB9A 2Q5JA 1YVEI 1U3TA 4PC3A 4TMTA 4R1LA 4TTAA 3CVWA 4D98A 4KDEA 3L93A 2NSDA 3I45A 5F76A 4LDPA 1QHYA 1ZXBA 5JAZA 2QROA 4GYWA 4F60A 1DS6A 4FS8A 4NC9A 4QM7A 3C39A 2COEA 4R3WA 8LDHA 4R2MA 2ZPTX 4AJJA 4RENA 3KAJA 3DD1A 3N2KB 2CV1A 5HQTA 3TKAA 3LA6A 4NZ9A 1D2GA 4KW7A 1IMOA 1GG8A 4XPIB 2J7PA 1OAKA 1UMKA 4ER3A 1UJNA 2FN9A 4MGYR 2GBLA 4BNYA 2I1LA 4XEUA 3ORFA 3PYLA 1Y63A 1JI0A 5F9HA 1XLUA 4KEAA 3DZBA 1EDOA 4L16A 2B4KA 2XX3A 3TLZA 1ABFA 3H9QA 1CPYA 3DL7A 2H9YA 1J8MF 2FPUA 2PX3A 1U94A 3DVSX 4RM2A 1LK7A 2TMYA 4TSRA 3H4IA 4GKAA 2HF2A 3DEJA 5AK4A 4D46A 4EUSA 2JG3A 4EKGA 2EJBA 2W2QA 4G41A 1T8PA 3BIXA 3EZNA 1Z28A 3BYZA 5FCDA 5FL3A 2A5FA 3PPXA 3HA3A 5D86A 1XZ8A 1E9DA 3HXOA 3PFBA 4GI7A 2G9ZA 2Q6OA 3E7DA 4NYIQ 3JZIA 2O1SA 4O4JB 1DRUA 4P08A 4BWGA 4BCDA 4KDFA 5KNBA 4P81A 1IC6A 5B2EA 1RI1A 4G8CA 2KLBA 4CM7A 1CUXA 3KZMA 4YT8A 4P2GA 5JJ5A 1VDZA 1HDRA 4E11A 2JFUA 3F3SA 3UTCA 3ZCVA 2XCIA 3X2FA 1O57A 1RJGA 3BA6A 4DY6A 4INJA 3SHTA 2C1EA 1WTAA 3A9SA 3CISA 1MW9X 5JQGF 1KZ9A 2YN2A 5KYKA 1H2RS 1TCAA 4UCWA 3FCXA 1YHZA 3MLBA 4GM1A 1BMDA 4BLPA 1QE0A 3N86A 1JLSA 2PT6A 2FW7A 2UAGA 3FVVA 3OTWA 3N8HA 2DBQA 1MG5A 1PTKA 1PIWA 4LBWA 3CZ9A 3O1LA 1U9CA 1JQDA 1TQ2A 3RLIA 3WYBA 5TX7A 4HPWA 3E3LA 4MR8B 5EGNA 1U7XA 3LGXA 2OFXA 3HZOA 4AWAA 2YVAA 3D3EA 4CMHA 1ZOOA 1BEEA 2P4SA 2CUZA 3DFFA 4JBHA 4OHUA 5LQAA 2QU8A 1SHKA 2RHTA 3B1JA 4LRSB 1I24A 1P1HA 1U5BB 2V6GA 4M1OA 4WFKA 1RE0A 1P33A 4YNBA 2W4QA 3S7TA 3SQMA 1PRYA 3B9RA 3UHOA 2OXTA 4ENWA 4D9BA 1IMJA 2XE8A 2MCFA 2ZB4A 4JBLA 1NY5A 4WACA 4UBIA 2Q5QA 2VZLA 1VIMA 2YDXA 4QUKA 5T4EA 1ZITA 1ZQ9A 5D7NA 4CETA 4RD3A 2WHPA 3HA5A 3N75A 4I5FA 4ENVA 3FD8A 5C80A 4QQKA 4KFUA 4Q1DA 4RMHA 5BV2P 3TDKA 1ZMXA 3DNPA 3DZ8A 2YIJA 2WABA 2XADA 3EVAA 3W5BA 4RF4A 3CEAA 2V4MA 1B8PA 2VHJA 4MX8A 3ESZA 1D2RA 2FMKA 3ZTTA 2XNDA 4DIKA 2ORWA 3LPNA 3ADCA 2MYUA 3CZPA 3O8NA 4U9HS 1SIUA 4Q3DA 2WY2D 2BEVB 3HLKA 1QONA 2X4IA 3H4VA 3IUSA 1RWKA 3MJVA 4U4AA 4S04A 1D2AA 1LV7A 1Q1ZA 1QF9A 1ULTA 2LCFA 2ZSUA 2FRVA 3AO0B 4R3UC 1G20E 4URHA 5FB3A 1KOLA 8ABPA 4RTPA 4PLZA 4AZWA 4OA5A 5B6IA 4QYIB 3K71B 2O0HA 5JJIA 4KIWA 5HA5A 1NBMD 4JI7B 1YHYA 3EEOA 3AI3A 4IOMA 5AJVB 4B83A 3GBVA 4CU2A 4Y0AA 3S70A 1GFIA 1H9CA 2XOKD 2XMDA 1I1HA 3F6YA 3L7IA 4M2LA 2F1KA 4CI0B 3PL5A 3H84A 3EH1A 9LDTA 5F3WB 4FOLA 2CJYA 5HUJA 4C3OB 1BE0A 4EHFA 4IY1A 5CVEA 1X3SA 2UDPA 5LZ5A 3V1KA 2B6NA 2UXCB 2B4YA 4GLFA 2XTMA 3BKXA 2OD2A 2C04A 2ZVPX 1F51E 4HXFB 5CDFE 3ZGLA 4FFMA 2OQVA 2PGLA 5JVDA 3FZYA 2DUUA 1SD5A 4JIGA 2A1UA 2AGVA 2Y8EA 3UT0A 1H6CA 3GPIA 3CVYA 4DV5B 5IDQA 9ABPA 1HDGO 5GV8A 2W6ZA 4LF9B 1M73E 4TXMA 5KKNB 1O97D 4PGGA 2WZDA 3IVAA 3KJEA 2XKJE 1PK9A 1T3GA 1UOOA 5E6UA 1L1FA 2OYRA 5CFQA 5IWAB 2UYCA 2QRZA 1YJ5A 1D8TA 2ZJ0A 3L06A 3QKWA 5EQTA 4F8JA 5FAKA 3LGSA 4XJSA 3H2GA 5HIMA 4N18A 4GFDA 3BIWA 2JAXA 2CB9A 1FVHA 1TCVA 3O7WA 1DKOA 2RARA 3MS2A 1XL1A 3CKLA 3LQFA 3QA9A 4PYKA 1T3LA 4A2PA 4C29A 4YRSA 2EX4A 2K2WA 1L5WA 3AM3A 2ZSJA 4JDUA 3P9QA 3ZY5A 1MQ9A 2NYUA 1P9WA 3AKEA 3GPDG 3EUEA 3VU0A 4QTXA 2YV4A 3ONFA 4ND6A 5A3RA 4DJTA 5ITWA 1E6MA 5LWQA 1QG4A 5E9WA 1T1JA 2JJYA 2VXOA 3MMPA 1K06A 1WRBA 3DWEX 1OI7A 2ZYVX 3I05A 5GVRA 3S1AA 3PYXA 4BNXA 1LQTA 1NOKA 1LRKA 2O1EA 4AVYA 1R10A 3MG9A 2GCPA 1U6KA 5THXA 3A0UA 4NCIA 5EMNA 1Y8AA 4L8YA 5JQGB 3EGCA 2QRPA 1PS8A 3H1TA 3VYSB 2PY6A 1UBUS 3BJMA 3O74A 1Z74A 2XKBA 3WYGA 1P80A 3MBIA 5A6SB 3KOOA 4X8LA 5JO9A 1KI4A 2VQEB 2CFTA 2WHXA 1X7XB 4LOLA 2BFMA 1EINA 4B6PA 2ZJOA 2ZUBA 2HPAA 1GQFA 2C4HA 5ITVA 4OP2A 1UFVA 1PZFA 2ADMA 1ORVA 2EF1A 3RVMA 2PBLA 3MCUA 2QNBA 4LHSA 1O54A 3P9IA 4F92B 2I1QA 1UMCA 2W43A 1GXSB 4QOGA 3HSSA 2QTLA 4JEHA 3V4OA 2H2GA 4CR7A 3DCYA 1QX4A 3ADPA 1LBHA 3MINA 4XVUA 4DV3B 4M0EA 2N9UA 3AEXA 2Q0HA 1ZUWA 3A6DA 1EJ6A 1YAJA 1KJZA 2X14A 4RKYA 2G1UA 2YC4C 3A10A 5G2OA 5HOQA 4INPA 3LUHA 3IEMA 3EGXB 3P52A 4D9FA 3RS3A 3N8GA 2BFPA 3TYXA 4DADA 5KKCA 1NKSA 1SRRA 2JJ2D 4HDNA 3OJFA 1I4EB 5KNDA 2OO5C 3GW8A 1KU6A 2OEPA 2ZS7A 4A8PA 1GL9B 1JAZA 1JFFB 1E20A 2R48A 3JRWA 4WK4B 1U2PA 1O7JA 3IMKA 1GTMA 4RF5A 3IEUA 2YWJA 5HIJA 5K3CA 4N9QA 2Z08A 4PPYA 3J7AC 1F8XA 1OX4A 3MUOA 4RCZA 1DTEA 3OY2A 3R41A 1MR3F 5EHNA 3SZMA 4F3RA 2J6HA 1UR5A 5JS7A 3WWYA 3UN1A 3RT1A 2BMEA 4TYYA 1YE8A 4I5IA 1GVHA 2HQRA 3R0JA 3HJGA 2YWXA 3QFFA 2FW6A 3HDQA 4GOOD 4RABA 1OX4B 1V35A 2ZSKA 3EYWA 4HLUC 5AK0A 5FUMA 2TRSB 3TNDA 4ESHA 5KYYA 2W2VA 4E5NA 4MW9A 4CKXA 1IWPB 3HI6A 4CDGA 3T7JA 3OWXA 5JBQA 5K0FA 5L40A 5DNYB 3USZA 2C2GA 4KGXA 1YS4A 4F3NA 3TG8A 1NUPA 4WGFA 2HFJA 4I4TB 5INTA 1J8DA 1TOAA 2QRJA 4FOOA 1U9ZA 2ID7A 3UJ7A 2BI4A 4ETNA 2H9AA 1DE0A 2DSTA 2NO1A 3ZDAA 2ADFA 2J45A 2NP6A 5KQLA 1UZNA 2H63A 2MINA 3WIEA 1FEZA 4M76B 3RYHA 1V7PC 3IJRA 2OAEA 1CQJB 3RAEC 3ENQA 5FPSA 1O0BA 4JEMA 3ENWA 4HO1X 2Q4BA 3HBAA 3EPLA 3EVNA 3UPUA 3CV3A 1MB2A 1OFUX 4DT1B 5ABPA 4NPHA 2HMYB 1NMEA 4GIBA 4Q3CA 4ALMA 1JG4A 4BYGA 1A9XB 2FR1A 5C8YA 1CZHA 2YOFA 5CYPA 2RIRA 3NHSA 5TE9A 2H0RA 2IIPA 2IZOA 1BZYA 1V11A 1Z4QA 4BC1A 4A0FA 1Q1NA 4YWHA 1RXEA 1BIFA 3GCDA 2Z3WA 2V58A 1OZAA 4YYZA 5I9NA 2BGJA 5KQRA 1RP7A 3MBOA 5H4HA 4AJOA 3ZNNA 1D4OA 2IS2A 4KU4A 1HO3A 1U5BA 2M9MA 4MP6A 5G0TA 2C2OA 1Z5PA 1JHOA 1F17A 1PZNA 1C3EA 2R7KA 3DUWA 1E3IA 2JIZA 2BHNA 2AXNA 4AWXA 2FUCA 3EXEB 2VSYA 4AG3A 3DA8A 2IV7A 2IS4A 3KR9A 1IEWA 2F1OA 4EG4A 5CDYA 2YNMA 1E5DA 1KRHA 1SVMA 3O3NB 1M6WA 2HREA 3G17A 4PYLA 2ZJ8A 3BH0A 5IEJA 1ZVQA 4KAFA 4L5CA 1T34A 1CUVA 2HBQA 3DV0B 4UBKA 2JPDA 3W04A 1P0FA 3TW8A 5FORA 1DJNA 4C0QC 4WZ6A 3MD9A 1U1DA 3OI7A 1BXZA 5AVJA 3EZ2A 4UBMA 1EWTA 2BEVA 2Y1OA 3DZDA 3GROA 3VR6H 5CXUA 1PW5A 3KYCB 4M55A 1L5NA 1TM5E 1YA4A 4U2BA 4L22A 4Q4DA 1RQ7A 1RYHA 4FE7A 1KI2A 3BD9A 1MA3A 2SICE 4MWTA 5AKZA 3NTOA 4NIMA 4IIVA 3HRIA 2IZ1A 3EVBA 2YIVX 3R6GA 4PYQA 4QUJA 3WLHA 1RWWA 3WLJA 4D82A 5I7OA 3I8XA 5K2MA 4TV9F 1W73A 3KQPA 1QV6A 5LYJA 2MSWA 3RF6A 4D0LB 2IH5A 2ZU0C 3NVMB 5HILA 3LW8A 3NBQA 1O95C 2I4OA 1CUFA 5DBFA 1H4QA 4HN2A 1DRKA 3T1YB 1LPPA 2VRCD 5EE0A 4C0KA 1JA1A 5FL7A 1A2KC 1ISHA 2OO3A 3HA2A 3UCXA 3SBEA 2P5YA 1K8XB 4LE2A 4YK7A 4ND4A 3GN1A 1B42A 3JQ9A 4IDFA 3EEBA 2QRQA 1ZC3A 1FS5A 4HWGA 1KO4A 1P5JA 3I4LA 4M1KA 1L3CA 2JFXA 3TFWA 3LMKA 5F7JA 4ENTA 4FXOA 3U6BA 3BGOS 2B92A 5FTJA 2A8YA 4EHBA 4CV2A 4HD8A 3SD7A 2P3LA 4LRUA 1JMYA 3UNXA 1ENYA 1N2ZA 4IKEA 2CXSA 1JEQB 2DOKA 1Z0UA 2BZ0A 3ABRB 3I12A 3I5UA 2XQGA 3OF5A 3U3MA 3ZCUA 3EW7A 5P8WA 3BC1A 3UA3A 2ZK7A 4BKRA 2BM8A 3TPCA 1XCJA 4MEBA 3KSDO 2VI5A 3R4CA 4EPXA 4F12A 4X3CA 2EFCB 3PVCA 3ABZA 4HMQA 2OR3A 1USGA 2ZWPA 1NW6A 3IOBA 4HAIA 3IPRA 3ZCQA 4B6RA 5JBIA 3PCXA 2C0PA 5KIAA 3A2LA 4K9LA 4PCLA 3EPRA 3TOXA 3DFZA 3DMTA 3KYCA 3L7LA 1R9JA 4V2IA 1SU6A 2Y27A 4DQ0A 3NGLA 3WRXA 3DLBA 4AURA 1P3JA 1PBTA 1JXQA 1KJNA 2IITA 2PRSA 2YOGA 3SYNA 3HKBA 3QYAA 4MARA 3UT5B 1YT5A 3UG7A 1YIAA 2FPKA 1O9GA 4B4UA 4BC0A 4E5DA 3FHJA 1CNFA 3R09A 1G7SA 1XA3A 2C84A 1K89A 2DU8A 1ONNA 3HUUA 4OD0A 3TEFA 2PO7A 3HRHA 3PQ7A 4IHAA 1BEUB 1Q21A 5EJEA 1ETHA 2OC9A 2P75A 2ZYTX 1CY2A 2WG0A 3BEOA 3GRFA 1HEIA 1DMSA 1DX6A 1XZAA 3IAAA 3R7WA 2O2YA 2BP7A 3D6NB 1WW8A 4MGZR 3RWBA 2WDZA 2Q3EA 3H5VA 3DEZA 4TKVA 1RZUA 4ZAGA 2H6EA 1J7KA 4HDMB 3EGWA 2BLNA 2DKOA 5CNIA 1J5XA 2DLDA 3DVAA 1L4YA 3I3OA 4HH4A 4L9RA 1JFTA 1P91A 1SUPA 2LZ0A 1M3SA 3SEQA 2ERYA 4KDRA 3ISTA 3MGKA 1TC1A 3LT4A 5BT8A 1MXHA 2R7AA 3U4DA 5JMOA 1Y6JA 4IV8A 5ALJA 5IH3A 3NDJA 1ZR2A 1NNI1 4D9JA 5J4LA 4ZCIA 2A88A 4PC1A 3R20A 1ZUHA 1E2LA 2MMGA 3O38A 1E61A 2R8OA 1J0XO 1EFCA 1QVAA 1VSBA 4KFTA 4I8DA 2YQ4A 3DHVA 4BWFB 1V8FA 1E2QA 1KKUA 2HSGA 1YZ3A 1L2TA 1J6UA 4FB4A 1PKXA 2R4TA 2PKXA 3BREA 1GEGA 4G36A 4GOJA 4QSHA 4QFDA 1NJ8A 3EWSA 2MINB 1RYMA 3KZKA 1NSYA 2I8LA 3QBTA 2RHDA 5IVDA 3TQQA 3PNVA 3QE9Y 1O0CA 2X15A 3BFPA 4AMYA 3MCVA 5TT1A 1J07A 2POQX 1D7OA 4LE0A 4GD3Q 2YWBA 3W90A 3N3BC 1KTVA 4AG6A 3FYUC 3FLAA 1JHDA 1Z2EA 2Q0XA 2R6R1 3KEGA 3U3OA 1PEYA 1OYOA 2HA2A 2V6BA 1A9XA 1G6OA 4MV7A 1TAHA 4GMGA 3U49A 3QV2A 4R0VA 1I9GA 2GBFA 2OC4A 1R0WA 3PI7A 5KAPA 4AJLA 1WETA 4AZ3B 4LNUA 4O4HF 4QDKA 5CVVA 5DM0A 3WISA 1MV5A 1XFDA 2UZIR 1HT2E 1P4RA 3G5MA 5DTRA 4AS3A 1F7UA 5E4FA 1YFZA 1DEXA 3W78A 2HWKA 4R51A 3SICE 4KO3S 3G0IA 4DBLC 3LF2A 16PKA 1GQSA 3FIJA 4G0NA 4QWWA 4D9IA 1MRSA 1CE8A 4AC9A 4RFSA 4RFLA 4WCFB 4J43A 1WCYA 2YJTD 5K0LA 2EEZA 4U00A 4IMPA 2ENWA 4EY5A 2V7PA 2V55B 4WN9B 5FV7A 3BXZA 1J24A 5IJ9B 5D3QA 4OGWA 1YZYA 4QO7A 1DWUA 3GO4A 2GFHA 5F12A 2V4UA 4JUCA 4MR9A 3UMYA 1Z34A 4ZU1X 5L7YA 5GAJA 2DPHA 3WYEA 3QPCA 2QY9A 4H77A 1JP7A 4JEUA 1F2VA 2I7XA 4G4JA 1O6BA 1QRUA 3FPHA 2FKAA 3SZ3A 3WHLA 3AG5A 2NSJA 4MWEA 4AFNA 3U16A 1U9JA 3L7MA 2WF7A 1PSWA 3QEMB 3O9VA 1N4DA 5KOJB 3COVA 4LF6B 2QLLA 3EODA 4UXJA 1PJBA 4FKBA 4Q9HA 2A6PA 2JZNA 3GOHA 1ND6A 5HBRA 1OLUB 3D8UA 3Q3HA 3RARA 1XTUA 3IOMA 4OHOA 3K8OE 4QPPA 5F1OA 4S1PA 4OI2A 4F7DA 1IUNA 1CF4A 2ZAMA 1E2DA 1SCKA 4BFXA 3UMJA 2AMJA 3TZHA 1EUCB 2IL1A 2OCBA 3MWEA 4QTYA 4E07A 5K8IA 4LHEA 4P4LA 3CRW1 2D1QA 3IQIX 3RS8A 3NWEA 4Y9RA 2CJWB 1RWXA 2E82A 1C0PA 1CUUA 2LDBA 4JKOA 5HIIA 1SO8A 5LXTF 4AJ1A 4BKMA 2DETA 3H2ZA 3V8VA 5JCZA 4KGDA 4HOYA 1PJTA 3FJOA 1M2OA 5BN1A 1XCPA 1JZQA 2EARA 1W581 4LJ5A 4TMVA 4C4RA 3HQ4O 3FMOB 1H42A 1NXQA 1WXQA 2JA1A 2WILA 1XV5A 1M2OB 4K6FA 2ID8A 4OFBA 2ZYGA 1T2DA 3E8MA 4RSGA 1QGOA 1ES9A 1KBZA 2N75A 1XTTA 2PD4A 3B1KA 2PMBA 4IUCS 3ZJVA 3AOEA 4XWTA 1W30A 1WMFA 3ANMA 4EFDA 3OUZA 4FFDA 1V9CA 2HSZA 3RROA 4C4XA 3MSXA 1T6NA 4JNKA 4MRSA 4G0XA 4LI3X 4Q4AB 2Q6LA 4U3JB 1G5HA 3TCNA 5HKKD 4Z4EA 1KRXA 1E7RA 3UFXA 3NTVA 4K1XA 2MJLA 4YRCA 4EIWA 1A88A 3PHJA 2FWJA 2FVXA 5HOEA 1HE3A 1QMGA 1OTYA 1NLYA 2WHPB 4PYNA 4TV8A 3JPYA 4FZRA 1MC8A 3N5KA 3JALA 2JFHA 4QOSA 5K6AC 1BXRB 2WAXA 3BTOA 4LJAA 1TAQA 2HMSA 4CCSA 1CIPA 2FUG1 1C5KA 2IKQA 1M33A 3BFVA 1ICEA 4LV6A 1AM4D 1ISFA 5KC8A 2C99A 1E2JA 1WHTA 2C2XA 3D8HA 1PG2A 4ARVA 2L82A 2I8CA 3TZCA 4C3VA 2Q8NA 3CGGA 1ZFNA 3H13A 3UAWA 3HHEA 1N5IA 2P35A 4BZXA 1XN4A 1ATIA 4FDVA 2XT9A 5IUJC 4V1CA 1L7RA 2C7QA 4Z0NA 1F8YA 5CDGA 2I6XA 1WR8A 2QENA 1IM5A 1QTIA 2A1IA 2VQSA 4TKVB 5HFAA 4HVCA 3BRWA 2QAGB 1A9QA 2YY7A 1P5HA 3LW7A 3DL0A 2MSKA 4MICA 1SK9A 3ELUA 5KDOA 2UYGA 2DF8A 3WKAA 3NDIA 2WP8J 3D3JA 1WCIB 4ER7A 5IPFA 3VNBA 3VR1A 1X2EA 1IWBB 1XI2A 2X3UA 3CNBA 1C7FA 4IQ0A 3Q40A 4JA0A 3ZZ1A 2B69A 2Q0QA 3LYLA 4FWBA 1XYYA 1RSZA 4FZJA 3VNUA 2JEYA 3DE1X 3M83A 3FCSB 3E0QA 1AQ6A 5DGDA 1RXUA 1PUIA 4G63A 3HVKA 3DOJA 1H8HD 4QQNA 3K0HA 4LDNA 4R31A 3OG9A 3NW9A 4AP6A 5EWMA 4MRVA 2A9QA 4UXIA 1JXMA 1SXJC 1IZYA 3IIEA 3GGOA 3V1TC 2GBIA 3WGYA 1OSNA 2CWDA 2ZI3A 2REXB 3GEPA 4RZSA 2B4AA 1MO5A 1B6RA 1F3OA 1VP3A 5JY1A 3KO8A 3BD6A 4CMCA 1SMKA 1C7EA 4TZ0A 2A0WA 1WW2A 2JGLA 2PKWA 2I2WA 1RJ9A 4PAGA 3W8NA 3QU7A 1H0KA 2A3NA 3ZDCA 2OMKA 5EHXA 3K8QA 1Z75A 3HSYA 4F3KA 4ZJUA 2GXQA 1T4CB 2V5UA 4GF5A 1ADJA 4NU6A 4P6VF 4UJ3A 3RAGA 3FCUB 3SQXA 1U1CA 1J5PA 1PG5A 3WGTA 3L0IB 3GUUA 4HAOA 2O2JA 5KQMA 1PS9A 3IB3A 4ZVRA 1TQ8A 3IX7A 4BFVA 1GHTA 3FYHA 5T3YA 1Z63A 3A9RA 3KK0A 1OC4A 3R44A 2FWRA 1CLEA 1U7ZA 2G1JA 2IYWA 4V1CB 3MRSA 2P6RA 1UC9A 1POWA 3E9RA 3GZNA 1NDQA 4AJIA 2WA1A 3FH0A 1U2GA 1YOBA 3LTNC 3MTQA 4FS3A 1IHDA 2PZJA 3B3FA 4BFCA 4ECEA 3CX6A 3DE7X 1VKRA 4KYVA 5DO9A 3M2PA 4P1ZA 2YNMD 1E6WA 3LQ4A 1Q1GA 3M34A 2IYZA 3ZJTA 1MZVA 1VCIA 1XMPA 2PH1A 1B0PA 1B74A 2Q62A 3TLCA 3LCCA 4KWCA 4ACAA 2KHZA 3FRIA 3KKQA 3OZFA 3LY9A 1D1PA 3B8EA 1UBNA 4TGLA 5GWXA 5HTKA 3SEFA 3OESA 3WJ1A 3PDWA 5KWEA 4TYWA 4MV4A 2OK8A 2V45A 3T7EA 1NUAA 1R6XA 2GNOA 1IZ0A 2WOOA 3L82B 4ZCMA 3VI3B 3N0XA 3OU2A 2Q9BA 1UWCA 2GRJA 1RKVA 4NEHB 1IHUA 3SP1A 2O2EA 5EXEA 2Y93A 3PNYA 1K75A 4ZHQA 1KFJB 4R2JA 2DKNA 4EB6B 1AKYA 4O4JA 1G41A 5C2JB 1V6AA 5MHTA 1RCUA 1NPYA 2PFKA 3B6MA 3RB8A 5JOQA 3ZHRA 1V5WA 1N2HA 4MDYA 4MQEB 4OKIA 3U4AA 3A6HA 3EISA 4WESA 1XQVA 5KOHB 4W99A 1X13A 2AG1A 1G4AE 4H35A 3O0TA 5H3HA 2Y4OA 2J4CA 4AZSA 5JNRA 3NANA 2D2FA 1GZVA 3R2JA 4NPCA 3W5VA 4BBZA 1X86B 2PXXA 1V8DA 3IAM6 1WNTA 3ICCA 3W8FA 4D3DA 4RIHA 4YRTA 3IP6A 5C4GB 4BMPB 2CDBA 1OHHD 3AZOA 2IEIA 4L50A 3WICA 3AR5A 4LJ9A 4NONA 4KLCA 3B9PA 3RVSA 1QV9A 1RAEA 5M3BA 3UENA 3I83A 4PLPA 5A06A 1M75A 5IYZF 4FE4A 3OOJA 4M99A 3M4YA 3CUYA 1JI3A 5BWMA 1W96A 1ZIDA 1LZKA 4TLDA 4Y1RB 1TA0A 3PHHA 3F78A 3TF5A 3O8BA 3QGMA 5BNIA 3Q7IA 2ZAGA 3UCEA 3KOZA 2Q3MA 3N2KA 1HZZC 1YBVA 3CWCA 2Q9UA 2Y1LA 3RREA 4JI4B 1RAFA 2WWRA 2XDAA 1ESDA 1HKHA 1TL7C 1T9BA 3GDWA 4RV9A 1WZNA 3UQYS 3UMMA 2PUCA 1BTOA 1LPNA 3DP9A 4EAAA 1P8AA 3H9UA 1FVXA 2ZJZA 5BOVA 2W2LA 4DDWA 2O8EB 2XMGA 4XR4A 1VIYA 5LP6A 4YASA 1GPYA 4IF6A 3NMUF 1O6ZA 3DPIA 3TW0A 3H11A 3S7ZA 3U7JA 2P40A 2FI1A 2QRNA 2RGAA 4HX2A 5H4GA 3GVPA 3GFQA 4PO3X 4N47A 3KKNA 5G3ZA 3GHYA 4EW6A 3EZYA 1ZMTA 1EUQA 3IE1A 4G81A 4HXGA 1I2MA 4MYHA 4R40A 3OSZA 1ZL0A 3VBCA 5D2CA 4AD8A 2ZBQA 2P41A 3EMVA 3KWJA 4DV6B 3LM8A 3FSGA 1DCKA 4N41A 4M0FA 3PP8A 4HEA1 4ZOLF 2F3RA 2A78A 4XM2A 3H9JA 4FKZA 2HA0A 1BVRA 1LLCA 3UVEA 4BEJA 3OLXA 3HO6A 1MQAA 3OJEA 4MIYA 2B1JA 4Q1AA 3ZC3A 5E1BA 5JNLA 1D7AA 4Q3NA 4C89A 1FTNA 2O3RA 4FNAA 1T1GA 4C30A 3JVVA 3A6LA 5DP1A 1GARA 4KXQA 2WWXA 1OBVA 3AUAA 3UGTA 1SC4A 1D03A 2H7CA 2B61A 1EM6A 4FSHA 3OZWA 4M9ZA 1AN0A 5LNK1 3E03A 1KJIA 2XAAA 5IM4A 3INGA 3MT9A 4GXRA 1O0SA 2I87A 2ODEA 4FSDA 1HZZA 2QZJA 4MAAA 2Q2QA 3ZWNA 1DAMA 1KBQA 1Z2NX 4LJLA 4QC2A 1E6EA 1JQ3A 1R4NB 3K1ZA 3P71T 3TKYA 2WJ4A 4JQCA 1GU0A 4B9AA 4QKQA 2BY4A 1XJ0A 3A25A 4HR7A 1JKXA 4KQ2A 4OYLA 1C29B 5JD4A 4MH0R 2BMVA 1AHPA 1JQKA 3CSSA 1M2FA 2P8JA 5EVJA 3SSMA 3WIUA 4KPUB 4GSKA 3F90A 3I92A 1G3QA 3G8CA 1E77A 1LD3A 4IIDA 1LXCA 2GTIA 2FU5C 4K2AA 1I3OA 2REBA 3ZCPA 3U40A 3ONWA 5CLGA 3K1JA 1T5SA 1OBOA 3B2NA 3JPWA 4I36A 4QHTA 4IUDS 4TRNA 1CDOA 4EMUA 1AN9A 2R47A 3ZE1B 1QLJA 3N2IA 1DAFA 1F0PA 3F6RA 3K0KA 3VR3D 4DV2B 4XB1A 2G1PA 2D8AA 4NP6A 3ZV6A 3SX4A 3U9LA 3OJLA 3WB0A 4O0MA 3ZWXA 1FFYA 1SC9A 2Q5OA 3FE2A 1A4UA 1E1RD 5KSYA 3QIVA 1UEXC 3NHKA 3C3JA 1J0CA 2RCNA 3OF2A 1ZXXA 4P86A 3S2SA 3KV1A 1X8LA 2E4UA 1R6TA 3EXG2 3PQDA 3JATB 2PT7A 1TEZA 3ICEA 3EK2A 1XTPA 1LDBA 2XQKA 4G4IA 4DLTA 1WPQA 4B80A 4EJ2A 2YYZA 3TLBA 4N7BA 1G8MA 4RLQA 2YUTA 1JHZA 3HCOA 1PZEA 4EYGA 3AB7A 4LYAA 4Y67A 1M5TA 3T52A 2OFWA 5TB5A 1X1SA 5K3FB 1JN0A 3MJHA 4LYDA 4QXQA 5REQA 4BMOB 1FFAA 3ANLA 5BNWA 2Y2VA 3GLQA 1XT6A 3KXIA 4F0JA 3B1WA 3W4IA 5FHRA 2PLAA 2WT8A 3Q15C 5FPTA 5IZCA 1QIIA 1VLZA 4O2RA 1E1MA 4RLHA 1WAMA 2VN8A 3OLQA 3OIGA 4JT2A 1ISMA 4ND3A 1UPCA 4W6QA 1DIAA 4FX2A 4BFWA 2AG5A 2GJ8A 3S0JA 2AOUA 5GJVC 1OXKB 2P79A 3W8RA 1C8VB 4QOIA 5K09A 3DYIA 5HK9A 3O4HA 4N82A 4DCCA 4IDEA 2A1UB 4J7CA 5BV1A 3DBLA 1JIUA 2PL1A 4HFJA 4IH1A 2VSFA 3LVBA 1Z0FA 5KWSA 2XYGA 3OOEA 4LQDA 4NZMA 4O5OA 4ARSA 2J0QA 3PQ8A 4GP6A 5DGXA 3KTOA 4X24A 1SHJA 2DR0A 4F84A 2WB2A 1U8UA 5HKLA 1SXQA 2QD2A 4QREA 3I58A 4WJZA 2GVDC 4W63A 5E1OA 3OPYA 3UKOA 4BNUA 4ZK6A 1U7TA 3LUCA 2QN1A 5FRDA 3KOYA 2HH9A 2M6SA 1CIJA 4S1OA 2JEZA 2VDRB 1GOTA 4YAFA 4DYVA 5GZ1A 3K35A 4I7EA 3ID6C 4OF4A 1Y98A 1IQ0A 1SHLA 2OHXA 2ZS9A 3CPHA 1G19A 2HXGA 3DTNA 3FNQA 1NF3A 3HI4A 3FUUA 4NYJQ 5A5DA 5EJMA 2IZ6A 4ZC8A 4I1VA 5BV0A 4KMRA 2RH8A 3FN4A 3IVGA 3X43A 4DLKA 4LTNA 3G9QA 1XTJA 5IKMA 5LXTA 4R5MA 5E2BA 3ZHUA 3PC8C 2JGNA 4Z2AA 4AY2A 5IMSA 1D1SA 1B1CA 4PNPA 4IO1A 4QLAA 4XR9A 5LNK6 1Z5VA 2AE1A 3A6ZA 3LCRA 3PHIA 4MKRA 3KAQA 5E8RA 3R7WB 5LQSA 2QLNA 1I33A 4DJ5X 4RBNA 4G0ZA 1Z17A 1NXOA 1A2QA 1CJTC 5A0TA 3T7TA 2ETXA 2C8JA 4ZREA 1JJ7A 3PFCA 1JLMA 4NBUA 1YMUA 4IDOA 4GICA 4JUFA 4O4IA 2ZITA 1XDUA 1TM7E 1OVGA 3EASA 2WYOA 4I55A 3IO5A 2VP6A 5BN5B 1ZQ1A 2WJIA 5K0CA 2BF7A 4B6OA 3U81A 1W6RA 4OO3A 2X8JB 3CLSD 1C41A 1ZX1A 2ZJ1A 4GUAA 4INAA 4E6PA 4V1CI 3O2NA 2W0SA 4IFIA 2IUTA 1GU7A 5E6UB 4DIMA 5IULC 4J6EA 1UMDB 1T43A 1LPAB 2WIAA 2X4GA 1M7GA 4EARA 4ZGWA 3X1YA 1ONBA 2YW9A 4Q66C 3LPCA 1ONOA 4URVR 1TC2A 4LYHA 3U7GA 1GTL1 1UBEA 3L79A 5JNVA 5IT9A 1YBHA 3NNSA 3DQQA 2PUDA 3BQMB 4A5SA 4D9GA 1AF4A 2YIMA 3AY7A 2JGJA 4IJUA 3F5FA 1T9GS 1V11B 3QKIA 2HNBA 4D5GA 1AKTA 4ALIA 1FTQA 2G9QA 4KHPB 4R05A 3GJ4A 4QEKA 4YI3A 3TMYA 2NSHA 3LUJA 5DBOA 1WKVA 4P7JA 1SCNE 1MPTA 3ELWA 5E38A 1JSXA 3RJMA 1F5SA 1UOEA 3LO8A 3LUKA 3MNFA 1J22A 5CT6A 2ODBA 5SYMA 3FOZA 1DUSA 5ETJA 1G4UR 2YVKA 4RVDA 2GBLC 1RYZA 4G4SP 1E5TA 1LFDB 3KZOA 4I2VA 3TRIA 4OIMA 3WWZA 4ATNA 4PVDA 1ZK2A 2VH5R 4XUCA 5IM4F 1IJEA 2PVPA 2YHIA 4RJTA 1YKGA 1KR2A 1Z0IA 3C3BA 3CVOA 5HJ5A 2ODNA 4O2AB 1KDRA 1YL7A 2GHTA 4G5XA 2PS3A 4OK5A 2ZDQA 1KIMA 4HB3A 2R87A 2AW5A 2YXDA 2FFRA 2G0AA 1KZYC 1JSCA 1RWMA 2GPWA 2YHIB 3EAFA 3GLTA 1Q95A 2I2DA 4JLBA 4OXKA 4WQMA 4ZVSA 2Q4DA 2HTEA 1NURA 1SOVA 3TVDA 1ZS9A 1QOQB 1POXA 3BXHA 3EVEA 5IRCD 3P32A 4HN4B 1VL1A 4Z8XA 1DJPA 4TWJA 4A0RA 1FP7A 2QMHA 1GTJ1 3EXAA 1K6XA 1LWNA 4JJ7A 3RT7A 4AJEA 3AEUB 2WNIA 1FXWA 1BN6A 3E9QA 4KXNA 4LWZA 4U7JA 4UHHA 1JDBB 1YJ8A 1KQGA 4NR0A 3S2YA 2ZB8A 1Z7EA 1X2BA 1HI9A 1ZK1A 2V98A 4HPJB 4QELA 4CV3A 1K92A 2DKFA 1ZVVA 5EIBD 4ARIA 3BB1A 4ZRNA 4AKTA 1W1UA 2AOVA 5CP8A 1XQXA 4LVUA 3SKVA 2PPLA 3T15A 2V7TA 2WMYA 1ISRA 1C4XA 1N4AA 3N1UA 1G6HA 4PWZA 2LE0A 4DJJA 1YZQA 2HIMA 3ZWDA 1YB6A 2Z2XA 2V1UA 1QQBA 4LXUA 3LP6A 3U39A 3FUWA 2FN4A 3KHUA 3F97A 1C8KA 2OGUA 1CUHA 4JJ6A 1LDNA 1K6MA 3E81A 3K6RA 4U7HA 2LDXA 1X7ZB 5B6JA 1RYDA 5AO9A 4NNOA 1PGOA 1RIIA 4CM1A 4P7GA 4MPDA 5BXYA 2AFIE 1FUIA 5IJ9A 5ENDA 1IY2A 1QV7A 3NATA 5JXHA 2G17A 4LHZA 2WYVA 3BIFA 2WM3A 4NYJR 4XJTA 2XUAA 2H00A 3SMQA 1V3TA 5GIOE 2ONYA 4DUGD 1LZLA 1A82A 1E4EB 3D6JA 2A30A 5TGZA 2XUFA 2XCOA 2NUTA 3T7IA 4DMUB 5B6PA 5EERA 4YYEA 4RTRA 1K3FA 2NUPB 2WUVA 2QTTA 1A9RA 2BFBB 3PKZA 2HGZA 1DFHA 4IV5A 3OQ6A 4MW7A 2IDKA 4YDRA 1YJCA 2H5EA 1ZCJA 1ZMRA 2FFJA 3B1VA 3I37X 1Y4UA 5AIAA 3O8CA 4M9SA 3GVHA 4UC0A 5FOTA 1FSSA 2F62A 2PUWA 3KZ1E 3MSCA 4C2BA 2JK1A 5HKAA 2JIRA 4KN9S 1YOVA 4BO1A 4KR3A 2JLQA 1ENPA 4BV3A 4CNBA 3MT0A 1CQJA 2P9CA 3LUGA 1FUYB 2XD9A 3H5LA 1CUEA 3KTDA 5H9VA 3VV2A 2G5GX 2F3PA 3D4IA 3TCXB 2LRHA 4M98A 5F7XA 5GTDA 5BSGA 3T3EA 3O4JA 3VPGA 4AKHA 4QFBA 1AUOA 3FY4A 3VC3A 1Y1TA 3F4BA 4PAOA 4MVCA 3VZPA 3KDAA 2EKBA 1F6BA 4HH1A 5FTNA 2XCUA 2AZXA 4HX5A 4L3VA 1TT7A 1EHIA 2CB0A 2QT9A 4M60A 3GLUA 3FGPA 4M0MA 2FOIA 1GYRA 1TYZA 4QT0A 5KU1A 5KYNA 1X19A 3BH6A 3TSYA 5AESA 5H82A 1VHLA 4JOSA 2P3OA 3VKHA 3GX1A 4RJKA 4YMSA 3JU3A 5LYJF 3NWBA 2BFNA 1V2HE 2QR5A 1XRMA 2BJWA 2IWHA 2J0SA 1L4FA 1JFRA 2Y9PB 5K3DA 4MR7B 1MH9A 1OY1A 3WK9A 3W6NA 2CLLB 3JQAA 3AILA 4MQ4A 1MIHA 4GZMA 3OZSA 4RW0A 4X6LA 5CJPA 2H4WA 3V4SA 4D02A 2EHJA 4CHTA 5UKDA 2E37A 2FEKA 2FUG6 3Q6NA 5AW8A 4PYOA 2XT0A 3G2QA 4K40A 3K0CA 4G0UA 1SD1A 3ICPA 4ZAYA 1R8YA 4E7OA 3TLYA 4JP2A 3K73O 4OQZA 4C22A 1QGUB 1ZUNB 3AHIA 3FI9A 3NV9A 4MGEA 3R76A 2I3DA 1P81A 3W79A 3JV7A 3UHFA 2DPLA 4ECAA 1HE1C 1N6KA 2CZCA 1JF8A 1RLUA 3FPBA 5I9BA 5DSZA 3W9YA 1LY1A 5ITZA 5JHHB 1TAGA 3EC7A 5T4BA 1L6IA 3DLCA 3UJCA 1JDJA 1WDTA 4KZPA 2KE5A 3CIOA 1H94A 2WTNA 3ES9A 1JQEA 2GF0A 4H6PA 4YCAA 5JH7A 5JPDA 1DKPA 1EDDA 1QRRA 4PSDA 4XVHA 5THKA 5DHQA 2UV8A 2VATA 1JILA 3GBPA 4HFRA 5CJJA 5IKEA 2DHDA 3DFMA 3H0KA 1KI6B 5TGDA 4MW0A 4C87A 4E46A 5IT0A 3OBBA 1PYDA 1A77A 1UANA 2GX6A 5JAIA 3AVVA 3D8BA 2B8JA 4JSYA 4RD2A 4LRWA 1VM6A 3KPVA 4X7RA 4IINA 4K9KA 1TM2A 1YI0A 3MOGA 3GNQA 3Q7TA 2YIDA 2C4TA 2A5JA 4KNYA 1N6HA 4LJYA 2CMKA 5ECGC 2FLWA 5AM5A 4KTVE 1K4YA 3O8OA 5AXDA 1SZDA 1W6UA 4KPFC 3SF8B 4EFMA 3TGLA 4PE5B 1WBBA 3CYFA 3K92A 1BS9A 3O3OB 3U1TA 3T7KA 2BUCA 3FWNA 1F7VA 3U4HA 1AZLA 3H1EA 5DKFA 3DXXA 1KVRA 4B3DA 3ZQKA 1XEFA 4I1SA 5BW6B 3JQFA 2E6UX 2D00A 2ES4A 2MSNA 3PFGA 5SYAA 3RASA 2IUEA 3BILA 1GSOA 3EJ6A 4JLDA 4EI2A 3FF4A 3G6KA 4BO5A 1UBLS 2BFDB 1H0SA 4YUZA 2FDXA 3DXFA 4G8BA 3R5KA 5KI6A 4YJFA 3ENNA 2E5FA 1CLUA 1Z6ZA 2EKQA 4KR0A 2Z5VA 3QHPA 5AW9A 1UBGA 2BKXA 4J0EA 3AVTA 4X61A 4GXNA 5ITZB 5IVPA 5BR8B 2RGNC 5IFKA 1HDCA 4ZYVA 2YJZA 1G9SA 2EZ4A 3D8RA 3PKIA 4CKZA 2Q7OE 2ZSBA 1PEAA 3AEKB 4UXHA 3CNLA 4WSOA 2X9LA 3LRTA 8ADHA 3NNNA 1UJ5A 1NUTA 3QBVA 3Q5EA 3JWHA 4FLMA 4WKGA 1X1TA 3U4CA 1AB6A 2OO5A 5KWVA 2E1RA 4E2XA 3VJKA 3VPCA 1RBZA 3MJTA 3IDZA 1ZD3A 1U0HC 1V16B 1QP8A 3QKSB 2FWBA 5CU7A 5JCOA 1OXMA 6REQA 1S8NA 2EJCA 3A6KA 1W36C 5DM2A 1FL9A 3NGMA 2F59A 4QXMA 3GZNB 3DMPA 5E3JA 1L7OA 3HN6A 1Y8QA 4Q1VA 4UNPA 3JS5A 2Z4SA 3WV5A 4IHKA 1AHNA 2Y3IA 1QCYA 2VOJA 4DSTA 4E2ZA 2NTJA 4RIFA 3ASYA 3CXUA 4KL8S 1CZKA 4XYGA 1T2CA 2FXVA 1GNPA 3PNPA 2QQGA 4AY5A 3ET5A 1VFPA 3K5HA 3D3KA 3F1LA 3I28A 3WK4A 1BCRA 3U3RA 3ZR4B 4IJKA 3MM4A 1QF6A 1TF7A 2HI0A 2CL0X 2NVUA 4UE2A 4DAOA 1LDYA 4DMMA 3RANA 2PGIA 2VK1A 4XW2A 1DO0A 3T41A 1U04A 1XJQA 2CVOA 4JUAA 3V2UA 4C7MA 4AI6A 3A1CA 4NOMA 3MELA 2PX6A 4KMOA 1SZPA 5JTTA 1U6IA 4EUKA 2PU5A 1I6MA 2GAAA 3K0SA 1D4ZA 3IT1A 3LZ6A 4J1TA 5K01A 1SIWA 2FSVA 1GSIA 4BRUA 4UULA 2X5OA 1DAPA 4XWOA 3CMMA 3HKEB 4YC7A 1WZUA 3OE1A 3ZIDA 3NBAA 4EUNA 1Z4OA 2H4XA 1DRWA 1AKVA 1S0UA 3BZBA 3EEQA 3EZLA 1JXOA 1L4HA 1UC4B 3IO3A 3O03A 4FNMA 5IJZA 1L4GA 1DKUA 1RPJA 3M6IA 4WEQA 5ALUA 3K2IA 2QAIA 2C2WA 5DOVA 3AU8A 4BJHB 1N57A 1IXYA 2IYEA 5CA1F 5EG5A 2R8PA 1W94A 2IDZA 1XTVA 5CIYA 3KE8A 1CFJA 4HFNA 4F6RA 2JVJA 4N8EA 2VNIA 5DGCA 4FYKA 1XLTC 2IYYA 1LVGA 1UWVA 3CLUC 3ONVA 1WSWA 2W0MA 1G8FA 4TLAA 5KX5B 4ABYA 4IHQA 5A5GA 1YF3A 2WWWA 4KQ9A 1C1HA 4OQEA 2X7HA 2JLYA 2QM3A 4XE5A 3V6MA 1KXZA 2ZR0A 1K4MA 1O6FA 1QB8A 1SBTA 5DP2A 2V7QA 2UYYA 1KDYA 1MOQA 1I5OA 3RKRA 2WNSA 3CZAA 3U13A 4JYPA 1AMNA 3IV7A 4YLEA 4CG0A 4R1QA 2AEFA 1U8TA 3T3NA 5F7ZA 5AK6A 4YR7A 1HT3A 2E85A 3ZI4A 4OYRA 5LP6C 4D4JA 5BSWA 2XZPA 1MOZA 2YV2A 4KITB 2BR5A 3CT6A 3EPJA 4CL8A 4NFHA 3JALB 4JLMA 1BRTA 2ZWMA 4F8YA 3MAGA 4XQCA 2AUNA 1BA3A 4CRWB 3IESA 2Y0CA 3L1HA 4JLVA 5ALNA 3ML1A 2WPDD 4KQGA 2VL7A 3O3MB 4KV9A 4DB2A 1VMAA 4BXOB 1P1JA 4QM6A 3RSFA 2EP8A 4J07A 5FUQA 4DR3B 4FILA 5DLDA 5SZKB 2HUNA 1JL3A 4ZV4A 2G06A 3RU2A 2PA0A 4FHZA 2X5JO 5TPWB 5BRAA 4NMMA 1OD6A 1EG2A 1Y3HA 3ODPA 4JGBA 3EYAA 5EJ8A 3X2SA 1IN7A 1VJDA 4BLTA 2HU7A 4H3VA 3R8CA 3OE4A 1EWQA 3E48A 1K7FB 5A5VA 2ZWOA 3UMVA 3U61B 1OYVA 4CUJA 1ZRSA 2HADA 4KR7A 1NP6A 2GZRA 2HHJA 3K05A 4K1LA 4IGAA 4M9CA 2JI8A 2ZEJA 3OCWA 1BGVA 1G3UA 4KX5A 4P7KA 3QX7A 1T2FA 1EJBA 3TDNA 2G9UA 2C4KA 1OFHA 4GPIB 4QPDA 5ALQA 1WSBA 2FGJA 4UCFA 4EJFA 2X0EA 3WK8A 1ZBDA 3DEHA 3QLTA 3ZWKA 3KVOA 3TQSA 2OBFA 2JJQA 5KTPA 5JTUA 4UE6A 1Y9JA 1VE7A 1KAEA 1TYCA 3DOUA 1MNQA 3JQAB 4FU0A 4I5EA 1W44A 4R7GA 5I3ZA 2XXBA 4YMLA 2L17A 1FTGA 3K16A 3VSBA 1AXRA 4HSGA 3V7FA 3B52X 3ZGOA 3B9BA 4G84A 2AMVA 2XF2A 5EJ9A 2CY0A 4X1IB 2CMFA 3G0OA 4WERA 1JJVA 3M3PA 1OC2A 4WY5A 3KSMA 2BDTA 4PC2A 4MW2A 4U2DA 5I9SA 3M6VA 3R23A 5SY9A 2XCLA 1SKMA 3UCFA 4UUPA 5JYCA 4L78A 1UDRA 4ZI7F 3CLTD 2EOAA 4UZFA 1DADA 5LVAA 1CBUA 5K0NA 1A76A 1BX3A 1MX5A 1NSTA 3DZCA 3GJ8A 5G0UA 3RODA 1Y8CA 4J16C 4O4JF 4RC9A 4H7IA 3K15A 1OOEA 1UMBB 4OHFA 4TV8B 4OHZA 2G9NA 4AJ2A 4BP8A 3GFOA 1FK8A 4EGAA 1R3DA 4KHZA 5EWLA 4EKIA 4E1AA 3S8EA 2WSSD 3ABOB 1TT5A 3K1TA 3KBOA 2GKOA 2HSWA 2PZEA 2YZNA 4CODB 2HB6A 1LI5A 2XVMA 1QO9A 3M33A 2QTGA 2PXCA 2QA5A 4M53A 5G02A 5T8KA 3SVLA 5FLXA 1QP7A 4M6WA 3GNSA 3HWRA 3IQXA 3OFKA 4LQCA 4UAJA 5EPOA 1BFKA 3ECSA 4DJAA 4E6EA 3LBFA 3K1AB 4WUTA 4MA4A 4C7XA 5T67A 2WW8A 1V6CA 2Z2JA 5AXCA 1ZYUA 4J1SA 4XCXA 1C0LA 3AETA 2OCAA 3M5WA 1GZ3A 3IUEA 1FRVA 2JGRA 2ORVA 2ZWAA 4EM6A 2Q9CA 4RY2A 5C0OE 4BMVA 4AG5A 4HPXB 1MEOA 4A0HA 1N5JA 4DS3A 2RFLA 1YWGO 5HDQA 4R16A 3VH1A 3G2JA 2O8FA 1EJ2A 1A3CA 1FSFA 3GF4A 4RA6A 3K0EA 1X7DA 2HO4A 2RGNA 3OPVA 3D4BA 3K70C 1UL1X 1XAJA 3IKTA 1RTKA 3IELA 4CKYA 3VO1A 1QZZA 3C8MA 4L07A 4XCQA 1CETA 5EQFA 4TLLB 1A98A 1EFTA 1RMTA 1ECPA 5BNTA 4MWOA 5ECWA 2QL5A 1J8VA 3CO0S 1TEHA 5A05A 2R25B 2FPGB 2BHRA 3KSUA 1Z18A 4QATA 2QDXA 3LCVB 1HH4A 1OXVA 4G5SA 1Q0UA 4W1QA 1HY3A 5DTMA 1MFZA 1STOA 1T8SA 3AEYA 3LKVA 1K5DA 2XMRA 3WGUA 1J8YF 1YRHA 2REQB 2FZGA 1VRWA 3AR9A 3QP9A 1FF9A 1G64A 1LBTA 2IUSA 1CE8B 3ASUA 4LRTB 2YVUA 4LWPA 3A9CA 2CWWA 4QXOA 4C08A 1DEKA 2CXHA 4HC4A 4ZANA 5F35A 1H2BA 1N3YA 3DB1A 3FCAA 1QIGA 1OAAA 4H6XA 4D3FA 3OEED 2BFFA 2XYQA 1T8YA 2FMFA 4QVKA 4X5OA 2BCEA 4R9VA 3VU1A 2F48A 4IGKA 5L45A 2JS7A 4NCXA 3QVSA 1TYAE 3IQGX 1E7QA 1EVLA 1W4AA 4I6GA 2NVBA 1Y5LA 2FQQA 4TWRA 5A4KA 3AJAA 3KFLA 1RABA 2KS6A 3R6WA 5B4VA 2WG1A 2UXBB 3DM9B 4W5NA 2GWRA 2X7JA 2D5IA 1G3IA 2RB4A 5DEOA 4M8NE 1NNEA 1QGAA 4CTJA 4FGSA 4Q6WA 3P9SA 1MB3A 4NMWA 4O08A 1VJGA 1Y5IA 3ROXA 4HF7A 3ETHA 1FTYA 3KJFA 4LY0A 3U7EB 1HETA 3LOQA 4P32A 5J9FA 1U0GA 2Q1XA 4K03A 4B2IA 1DTSA 4NENB 3DAOA 2XE7A 3URKA 3PEWA 4HVAA 2NZJA 5K4GA 3P9NA 1D6SA 5F77A 4S1VA 4UOEA 1SQ6A 1SUBA 2YRWA 4E2WA 4GE3A 1G21E 5IU6A 3ZN2A 4FR0A 1E32A 4JQOA 5GIPE 1JLLB 4XTRA 2J9ZB 2A59A 1KVTA 3UTDA 4QYIA 1G16A 1OZGA 2M32A 3OQJA 3EXHB 1Q6ZA 2XTAA 2QBYB 1W9MA 1XL0A 4R7TA 2I78A 2IVFA 1RR6A 2HUPA 1K7SN 1KGDA 3ORQA 2CUTA 2IV2X 1CXZA 5E9JA 3NASA 4AMVA 4I4LA 4YXWD 5C4MA 4D0SA 1P17A 1VI5A 2FOLA 2WTEA 3JQ7B 3KOUA 3RIHA 5M04A 5DCYA 4AUEA 3U6KA 3EGDB 2QP3A 5AVTA 4QUDA 2HHHB 2Q5FA 4WX2B 1OT3A 4GR5A 1Z7GA 1GGFA 4MQFB 4BQFA 3BZWA 2NP7A 3VUEA 4EHHA 5IHXA 2V7VA 5M34A 2P0EA 1RLIA 4YROA 2I6SA 1OYYA 4N3GA 3ZX5A 2AKYA 3HBFA 4Q00A 3EGOA 2QN9A 3SX2A 4DSOA 2AK2A 2GJSA 2WUEA 3B3AA 3NIGB 1WBDA 3AQIA 3OFVA 3OZGA 3PGLA 1ZK0A 1U02A 2PA3A 1V3VA 3AZQA 3KWMA 4LXXA 5LA6B 4ON9A 3A4YA 5BWCA 4JV5B 2IF2A 3ZV3A 3MJRA 4BDSA 1NNUA 2O2XA 4FLEA 1B4DA 3B7WA 5EP4A 2QJRA 2O59A 4DGSA 3CEJA 4LOHA 2WNHA 3P97A 5CLIA 3CR3C 2ZIFA 3JASB 2QF7A 4V0SA 3RS4A 1Z5OA 2DULA