3KKKA

Y92c catalytic residue mutant of phosphoglycerate mutase from plasmodium falciparum
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
230
structure length
230
Chain Sequence
TTYTLVLLRHGESTWNKENKFTGWTDVPLSEKGEEEAIAAGKYLKEKNFKFDVVYTSVLKRAICTAWNVLKTADLLHVPVVKTWRLNERHCGSLQGLNKSETAKKYGEEQVKIWRRSYDIPPPKLDKEDNRWPGHNVVYKNVPKDALPFTECLKDTVERVLPFWFDHIAPDILANKKVMVAAHGNSLRGLVKHLDNLSEADVLELNIPTGVPLVYELDENLKPIKHYYLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a phosphoglycerate mutase from Plasmodium falciparum
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Isomerase
molecule keywords Phosphoglycerate mutase
total genus 77
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.1: Transferred entry: 5.4.2.11 and 5.4.2.12.
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3kkkA00
3DB1A 2P6MA 2P2YA 2H52A 2HPAA 2IKQA 1BQ4A 3FDZB 4AROA 3F2IA 5HR5A 3QPVA 3GP5A 5AJXA 4PZAA 1DKPA 1SK9A 3ZHCA 1ND5A 4FDTA 1ND6A 3BIFA 4FDUA 3K4QA 1IHPA 2P77A 2EOAA 1YFKA 3E9DA 3FJYA 2ENUA 1UJCA 1SK8A 2AXNA 1DKOA 3EZNA 1CVIA 2BIFA 5CX4A 1SKAA 4D4LA 1DKQA 2P9YA 5AK0A 4JODA 1DKNA 1UJBA 2P9ZA 5HTKA 1H2EA 4PGMA 4PZ9A 4D4KA 2H0QA 2P2ZA 1C7ZA 4ARUA 2ENWA 2DWOA 3NFYA 1H2FA 4TSRA 1YJXA 2P78A 2HIAA 3LNTA 2EKZA 2P79A 1E59A 3KKKA 1C81A 3D4IA 3O0TA 4HBZA 1XQ9A 4QIHA 4EO9A 3IT3A 3MXOA 3IT0A 2P9FA 1V37A 3QPUA 3D8HA 1FBTA 1NT4A 2RFLA 4GPIB 2PA0A 4JOCA 3LL4A 2H4ZA 4ARSA 4GPZA 2P75A 3DCYA 4ARVA 1C80A 2WNHA 2QNIA 2P6OA 1E58A 3QPWA 1QFXA 1DKLA 1BIFA 1QWOA 1RIIA 3GP3A 2OWEA 3E9EA 5AJWA 1K6MA 1QHFA 2GFIA 5PGMA 1BQ3A 3IT1A 1RPAA 2A6PA 2P30A 5AJZA 1RPTA 2DWPA 2YN2A 3MBKA 4E3WA 2I1VB 2YN0A 3R7AA 3NTLA 3EOZA 2WNIA 1FZTA 3E9CA 2WU0A 4D4JA 2F90A 3HJGA 1EBBA 4MA4A 5AJVB 1TIPA 5CU7A 3D6AA 4EMBA 3IT2A 4ODIA 3C7TA 2A9JA 2EKBA 5AJYA 5CDHA 3PGMA 4JOBA 2OWDA 1DKMA 3OI7A 3F3KA 3LG2A 3K4PA 3FDZA 3GW8A 4IJ6A 2HHJA 1V7QA 4IJ5A 2H4XA 4D4MA 1SKBA 1T8PA
chains in the Genus database with same CATH superfamily
2QZSA 1NXQA 1T9KA 2B0JA 1OIWA 2GKSA 2W98A 3EW9A 2QQ5A 4JP5A 1T0UA 2EZ4A 3VUEA 4V1CB 2O8EA 3I6IA 1SHZA 1VSBA 1S4MA 2O1XA 1N2CA 2VEDA 4C4PA 1A3CA 3OFVA 1PI3A 4S1PA 3TZCA 3GN2A 1PQWA 1E61A 3KC2A 4ZT3A 2CNLA 4BV3A 4RIHA 4YAUA 2O8VA 2QN6A 5ARDA 4JI6B 4ESHA 3TQTA 2FQWA 3KKPA 5IANA 2P6PA 4Y9TA 4BDTA 5EJGA 3F73A 3K94A 1TAQA 2FQYA 3RYCB 1VJ0A 1BDMA 2VOJA 2ZJ3A 1XEXA 3ZHYA 4CG2A 1UK6A 4TOIA 5HKAA 2JS7A 3LIPA 3AM5A 4RAOA 1ZCBA 2J07A 3O6VA 4YUWA 1OTHA 1L5VA 1KSHA 2W43A 2ZYHA 3AG5A 3PYLA 1Q7BA 2YTZA 3K16A 2WTXA 3EBOA 1XIVA 2AOXA 3PUJA 5KWJA 2YCLA 3MK31 4PLTA 1F12A 2WJJA 3CLHA 2GTPA 3HCWA 3QG5A 5I01A 1TQDA 3EH2A 1D6SA 1VJ5A 3VHRA 3GPLA 5DBEX 2H0AA 3O7WA 1DBPA 5JCJA 3C15C 4KYIB 1M1ZA 2WUWE 4HNUA 1GCGA 2GPAA 3F4KA 1AKNA 3B7GA 2B83A 3AEZA 3KNZA 4Y2YA 4B4OA 5CA0F 1Z82A 3DP9A 1DG9A 2ZRAA 3SFVA 3VXKA 2PT9A 2P9FA 2QM8A 3NTVA 1V37A 2MSNA 2D5IA 1D5CA 5DI3A 2FJUA 3VJKA 2H1HA 1J90A 1YC5A 1ORTA 2F4NA 1BXGA 2OHXA 1KJ9A 2PK3A 2WC1A 3P71T 4GPIB 3ZGVA 3VKGA 1KRWA 2VQEB 3P9XA 2ZB3A 1HOTA 1FS6A 5ALYA 5TT0A 4DLBA 2ES4A 4JWKA 2YV5A 1BDBA 4HUTA 3RYFB 2P9TA 3GLGB 2HPVA 5KX5B 4GC9A 1PTKA 1MPXA 1NRIA 2ZJAA 4OJKA 4RMJA 1PZEA 1VMDA 4A9AA 1RC8A 4Q4JA 3R5SA 4XGKA 5KTOA 2WMYA 4PHFA 4WESB 4TZ0A 1M2VB 1Z6PA 2MSCB 1R37A 5BNFA 1WQ4A 1G6Q1 2NQ2C 1DO0A 4O1IA 4UU0A 1ZI9A 2B9EA 2VDOB 4CV3A 1J2EA 5CAEA 3KZKA 2A6PA 2FPIA 4OQDA 4RWEA 5KNDA 1T9CA 1MJFA 4BY9E 1FFSA 2LD4A 4JP1A 2VP9A 1BE0A 2HLDA 2XUHA 3B20A 1GTMA 3GELA 2BAGA 1N2XA 3QNUA 1FSZA 1FDSA 2QV0A 2VP4A 1ZN7A 2R6FA 3IQHX 4GM1A 4Q9IA 4MV0A 3OKFA 1NQVA 4Q47A 4X0EA 5A5GA 4ESEA 1SXJD 2C5SA 4CIWA 3STHA 3LLUA 3I04M 1JJFA 1TU0A 3RFVA 5AW1A 4IIJA 4L50A 1GGKA 2O7VA 1STOA 4JOSA 1HEYA 4UHDA 4D0RA 2WYUA 3CH5A 1ZCZA 3L8MA 2PGLA 3P9SA 3NRBA 4I9FA 5EQTA 3WMEA 1U99A 5C4IA 5I7VA 2PLAA 1MEEA 3BDIA 4NMLA 5FTWA 1MFZA 3P2KA 3TMKA 2HK6A 3K8QA 2W93A 3FSGA 5A1TA 4B6FA 4RXTA 3S70A 1FDRA 2GF2A 1HZZA 2J33A 3U4CA 2X0DA 4G0UA 1Q15A 5JADA 1FUKA 2VPWA 4WHMA 1OFTA 1E3SA 1N5MA 3FD8A 2VDRB 2BF7A 4ND8B 1ODSA 2HU2A 4U2EA 4E11A 1CBUA 1AS2A 2WWWA 2OBYA 3BD6A 3F97A 2FN3A 3RVJA 4HADA 2DBRA 5C5EA 3DFZA 1E1NA 1SK9A 3ED1A 3KOUA 4LOKA 5I7FA 3U5ZB 1DJQA 1Z38A 2KJQA 1IQ0A 2VHUA 5H0IA 3KELA 4LWOA 1MZPA 1QIKA 1SVWA 2C4TA 4ZVMA 4PLWA 1QE5A 3CJTA 5BQOA 2AOWA 3G2LA 2PNJA 5CPBA 3HYTA 3UJ6A 1ITZA 4GNKA 2VTKA 5BPFA 3MTBA 4MPDA 1YAJA 3ACBA 4EO4A 1B0UA 3LDUA 4QHYA 1NZFA 2GYVA 4RCVA 3R44A 3HY6A 1B2LA 2QZ4A 1TKRA 3AV3A 4RHYA 4MYHA 1F38A 4JFAA 3DT9A 2QGFA 2P2ZA 3BFVA 4QG7A 3QWIA 3V8EA 1NVWQ 3IIEA 2B3DA 4NYJR 1JHDA 5EINA 5ICGA 4GXQA 4LEIA 4WZ6A 4AJIA 1MJGA 2J0UA 2WOOA 2XYHA 2YQ5A 2IDZA 5DYTA 3NAGA 1WO8A 3VU9A 3IQEA 3OZ7A 4BS9A 4HUJA 1LV8A 1Z5GA 5FV4A 5IMSA 1QHHA 1N5LA 1JSZA 2O0HA 3E9MA 4DPMA 4WGFA 5K03A 5ERYA 2Q4RA 4KO8A 3S7TA 2AG6A 2XTJA 2YW9A 2ASVA 3R7NA 1JBKA 4PRZA 3RSLA 1CJTC 4Z7NB 1P5JA 3K9BA 2DHRA 4L22A 2DPGA 2ZYVX 3OJWA 2X19A 4FK8A 3M82A 3H7IA 1A04A 4J3FA 4YCDA 3CW8X 2ZE5A 1NW8A 1GNQA 3FUTA 1N25A 3OEYA 4NWIA 3ZN2A 5AI4A 3DCYA 4C7JA 4DREA 4HDQB 1RS0A 1PTJA 3R7WB 2YFQA 4RDHA 1PGNA 2HWUA 3ZDZB 4JA0A 3IAUA 4XVHA 1LSSA 1B8OA 4OXXA 4XEUA 4LYEA 3WYEA 1IAQA 5BR4A 2JGIA 2GRUA 3CLUD 1WSBA 3OO1A 4JLKA 4C3ZA 2DHQA 4OJNA 4EYEA 3U1BA 2A57A 3ABZA 3TRKA 4MVJF 5ED4A 4CF7A 4BO4A 3HDVA 4PPYA 4UNNA 4O59O 3T9DA 3T94A 4ANFA 5TJ9A 3TKAA 4AQDA 3DE2X 1XZKA 3PP8A 3RSZA 1BW9A 1RZ3A 3FB1A 1AOXA 3DLTA 1ETHA 1QHEA 1UFKA 3MAGA 4IIFA 4MYDA 3JRNA 5DISB 3GQBB 2JDIA 3EQZA 1NXPA 1QH1A 3HEMA 4ZK2A 4RWZA 4HGPA 5FP0A 3RTGA 2AQ8A 2OZPA 4J6FA 3VDMA 1V11A 5CEEA 3G68A 3O4FA 1U0FA 4YRSA 1Z3CA 3K9QO 3IA7A 4LGYA 5AJHA 3ZY4A 5LPNA 2BJWA 9MHTA 4IJ6A 3THWA 1O96B 5INTA 5LBIA 1F60A 1CYDA 3ZD9A 2W58A 2GD1O 1JXOA 4Z9YA 3O1HB 2XZPA 4RQAA 4AAYA 5EZYA 1K8QA 1DJMA 4ZWNA 1D2HA 1CLUA 1R8SA 1QAOA 4NZ9A 3MS2A 2Y2VA 1E9SA 4V0MA 2RG7A 4OAQA 5FJIA 2QZ9A 2ZK7A 1WCXA 3KQVA 5G41A 1AA9A 2QM3A 3CF2A 5IHPA 4ZVSA 2A9FA 2PJRA 2O5CA 5HJ7A 3ZZTA 4HH3C 4JQCA 3AZOA 1WX1A 4GT1A 5EC8A 1LDNA 4BTVA 1OLXB 1GRQA 3HY4A 2PKCA 1H1LB 1AU9A 3WBBA 2JVJA 4J0FA 3AHGA 1ECFA 1YZYA 2JHAA 3FH0A 4AZTA 2BGIA 4ZCPA 4DV2B 2EWMA 1QRUA 3GLVA 3DLHA 4FDAA 3P7MA 1XTVA 1Z34A 2JIZA 3N8GA 4BAZA 3JR7A 3R09A 4IXMA 2IPLA 3CSDA 4O0LA 4OOFA 2D2VA 2QL5A 3CT4A 3KL2A 3D6NB 4OJTA 1GRRA 4AMZA 1IBKB 4YRMA 4PX2A 5FFNA 1KDRA 4G84A 2C77A 4RHCA 3G7SA 4N18A 4TZKA 2VTEA 3U40A 5H8WA 1IPFA 1T9ZA 4FPXA 1MEJA 2TYSB 1J33A 3I9JA 3UW1A 2ZUVA 3RC7A 3KVOA 2X4DA 7ABPA 1KZ4A 1LVGA 1NI3A 3TTVA 3BILA 3C4QA 5AOVA 4TTQA 3BUSA 1JHAA 2YC4C 3ZHQA 4X54A 3NTUA 4MROA 4F4UA 4GBJA 4A03A 1RM4A 4PIVA 1FBTA 1D2RA 2LWIA 2QU7A 3P96A 1KI1A 2ONJA 2JJ2D 2ZKIA 3QFRA 2CSUA 1XRRA 2WWHA 3CEMA 1VJGA 2QE7D 3IURA 1EFAA 1L5KA 4GVXA 2CK3A 1NKTA 2ADOA 2MMGA 2FU5C 4ZMSA 2YASA 5IZ4A 3ADCA 3DAYA 3HCEA 3N0VA 5FTNA 2D00A 3LY5A 3PSHA 2OCXA 5DM4A 4AY4A 4CEJA 1JR2A 1C0LA 1D2CA 4BKMA 2BFFA 3VC1A 2HSEA 3OFJA 3CKLA 2HXGA 2WV9A 3NDIA 1VIMA 2NOAA 2OESA 1H2HA 3NP9A 3QVJA 3GFFA 3AO0B 4IXTA 4MKZA 3QVGA 1UFVA 1FU7A 1E1DA 1ONNA 4KW7A 1WXXA 1L7RA 4MKIA 4NESA 4V0LA 2OGZA 3R0ZA 3FMFA 2L19A 1Z8FA 2JCXA 4IGKA 4B6GA 4TTVA 5CFZA 4ZU1X 4N41A 2AUMA 3B9RA 3J7AC 4WCFA 4KGZA 3LCUA 4JC0A 4NZZA 4W6QA 3HDYA 4LFAB 1K2VN 3SHWA 1JHRA 3LRTA 3H9QA 4DB2A 4E51A 1FDUA 3DXYA 1X7XA 1XRJA 3A9SA 3LC2O 2PUBA 4DCCA 3Q7QA 2R96A 4KXQA 4BMPB 5ICFA 4LTNA 2VHJA 1UK7A 3QVMA 4YIKA 1U7WA 3WOHA 1K97A 1QV6A 3NATA 4AT1A 1JA1A 2BUBA 5BW8A 4K0RA 1PWEA 3VPCA 1MAWA 3BJMA 6NULA 3NU1A 3RHSA 1DAHA 1TCVA 5E6UB 4BKQA 2VTVA 3H1TA 2E2WA 4I9GA 4KR3A 3LX8A 2XKAA 1EP1B 3LVFO 3RSQA 2EJUA 2P6MA 1HY3A 1TTHA 3BGSA 4MARA 2PNFA 4ALJA 4EP1A 5I9NA 4XGRA 2DQYA 4EYQA 1JKFA 3T4EA 1NW6A 4AROA 4WFQA 4TQUS 4Q3OA 4YA6A 4BLTA 3T7JA 3WQBA 2QU8A 4F1JA 3ISVA 3C3EA 1JHOA 2FE4A 3CLTD 4MW4A 4BWYA 4OLHA 4UOZA 5F21A 1XLTA 2PUAA 1IHPA 1TIBA 4XX1A 3ZHXA 2ZRDA 3CUVA 3LQQA 3NHZA 3PNLA 1N33B 3HYSA 1PV4A 3PJGA 4OAOA 2FEOA 1C4XA 2CVOA 4JOQA 4PZYA 2Q3CA 5E4YA 5HZMA 4KEAA 4R0MA 2IBSA 2LZ0A 2HFJA 3WS7A 4PSVA 4QA9A 2UUAB 1Z0UA 2OHJA 1E3QA 4F5YA 3MUNA 4WK4B 2XOEA 2J4DA 1Z6QA 2ZPUA 1CZOA 2FPXA 2JIOA 4D3ZA 2MR5A 4CCAA 1YKGA 1RT9A 3AJDA 3GBVA 4I99A 2P9CA 2I3BA 3ETHA 4KGDA 1FNDA 2G70A 4PHCA 4TWJA 4F1WA 5LMZA 2C4MA 4OU4A 2ESRA 2XRYA 2GNPA 5FL3A 4EB0A 3ZGXA 4D92A 1HQKA 2XNHA 4YECA 2X2PA 3ZGOA 4ILKA 3AUUA 4AIIA 4LJ9A 1LNZA 4F5WA 5JDIA 2PY6A 5AKYA 1U3GA 4O2BF 4CGZA 5ERXA 2R1VA 2WHEA 3ZWBA 1KJZA 3MRSA 2GJSA 2AFHA 3BXXA 4LQ4A 4REQB 1EUZA 1NMEA 2CMFA 2WM3A 1SUIA 3GFVA 3PC8A 5LQUA 4EYOA 1TYEB 3H2GA 3BJZA 2GASA 3U4IA 4ZOQI 1VGVA 5ALLA 4L8VA 3I6MA 3SBDA 1XVVA 1E58A 5LQAA 1SQ5A 2IDMA 1H5QA 1DV1A 1E1QA 2XSZD 1Y8CA 4QLBA 1OLSB 5C53B 3CX8A 2GM3A 4MQEB 3DKVA 5ES3A 2R00C 2QUKA 5FOTA 1BD4A 1NOJA 4B80A 5ITVA 4ZIRA 1TU3A 1EFRA 1JEYB 5J47A 1S8AA 4YRRA 4X95A 2OG1A 1BMDA 4OAPA 1ZNQO 2I4IA 3FX2A 2OILA 1AN9A 1RLJA 1U8AA 4IH4A 4P3YA 4RABA 2B2XA 5B3AA 3VV2A 2NSYA 4EPTA 3VTKA 2PUVA 4DDTA 2OK7A 2O52A 2PAFA 4XUEA 4HAIA 3SHOA 4BGVA 5AJVB 1I5RA 3LPCA 4K6KA 3W2EA 4E5DA 3JALB 2PS3A 2RC5A 1NLFA 1U7DA 3HKCB 1JG2A 3TOCA 4ZCLA 1IAVA 2XUPA 2G5CA 3V9AA 3EIFA 2W8ZA 2APJA 4GXNA 4ZVNA 4R7ZA 4H6XA 4FEYA 3LUBA 5DI3B 3ZI7A 3EZ7A 3IKJA 4G9BA 1I4TD 1PGJA 3CNLA 4MO9A 5AD1A 3Q3VA 2GFHA 1I7QB 5A3JA 3E81A 3FDZA 3G13A 1WXEA 4FX5A 3FUVA 1I4DD 1MF7A 3G8BA 3HU1A 1JHQA 2EKLA 3E70C 4MRPA 5ECGC 1WPQA 1KPGA 5FI3A 1SKBA 4HGNA 5LN1A 1NXVA 1KVQA 2C1ZA 1OGIA 2GYWA 2JKZA 3EBPA 3M4JA 4V0RA 1AGXA 1H8HD 1JYSA 4DDHA 4GE3A 5CNIA 4TMZA 1LNSA 4HTFA 1X39A 1TM1E 4QE3A 2YHAA 1Y80A 2Z3ZA 3MILA 1XZAA 1JHYA 4BCDA 1KFKB 1G7CA 1Q95A 1T1GA 3AQ4A 1P80A 1NV9A 2FW6A 1OAOA 2PS1A 3FCEA 1BSVA 3WSVA 1J39A 4E08A 2OD9A 5JBIA 1D2GA 2UV8A 1YXMA 4LGCA 1ULAA 2RBEA 2VJNA 4TUYF 3RSFA 1O77A 2GZ3A 3OU6A 2AMYA 3KWFA 4RD6A 1KK1A 4N0EA 1Z83A 4X7BA 4YBZA 5AHXA 3ULKA 3K0BA 2P27A 3AGPA 2ZUDA 4AG5A 3RV4A 5F7XA 4E2YA 4RH0A 3K30A 2P3SA 2D0DA 4DR1B 3PQ3A 1T0PA 2VNKA 4OGFA 3USZA 1V8DA 5A71A 2YYYA 3PPIA 2FZCA 1Y3DE 1NMSA 1TPZA 1RBMA 3PG5A 1ILEA 1I7SB 3C43A 3RASA 2H2AA 1TADA 2ZWOA 2YW2A 3B51X 4MV7A 5F9HA 1E1RA 3H11B 4RV5A 2PLNA 5JAPA 3ZBUA 1RZVA 1XD8A 2HXSA 3GARA 4WKCA 3EULA 2Z3VA 4GPBA 3SHTA 2PM8A 2YVAA 2XF8A 2Q2OA 3UGTA 3S1LA 2GEFA 2DSTA 2ORIA 2ZTLA 2KLBA 3ZVKA 4CEIB 2B37A 3DQPA 3FVRA 3ORSA 3AHEA 3F3YA 3QEMB 2JAXA 2ZR0A 5EOVA 5T4EA 1QRTA 3UENA 2HQ1A 1RWWA 3H4TA 4C0BA 1O6ZA 2I7TA 4MSUA 5JO0A 5KQPA 2XZDA 1ML4A 5HDQA 5FWXB 3NEPX 3KR2A 2G6BA 4GPZA 2P75A 4MK4A 5T67A 4DYDA 1NYRA 3HA2A 4ZKDA 2WK1A 4EHAA 1WOYA 2C4KA 3D7RA 1XRMA 1GAEO 3HN2A 3IUQA 2JGAA 3T7TA 1LW6E 1DKLA 4URHA 3JZAA 3LW7A 4OXKA 1RZRA 3B9BA 2XE7A 5JYCA 5AJWA 1SKYB 5HS6A 4MCHA 1IEWA 1L1EA 3GN1A 5TPWA 3T5BA 1WQ3A 4PRLA 2XE4A 1JI0A 4U7JA 4QVGA 1T43A 3ONWA 4YLGA 3OIGA 1I3OA 2BMJA 3G8CA 3UWSA 4YUZA 1DCMA 4XYLA 2EBUA 3GMDA 3PUXA 3TI7A 2IA5A 1UBMS 3PEEA 2FQQA 4H16A 3H18A 1B0ZA 4MGKR 3VH2A 4WJKB 4D4JA 5I7OA 5EIXA 2J3HA 2J6CA 1PJSA 1IMOA 3PLAE 1M9NA 1GPKA 2BMEA 2OZKA 2QMUA 4O1MA 4PPNA 3UHFA 4DEVA 2AI3A 3PE4A 4MS3A 1M1UA 1QIJA 2C8VA 3JQFA 4GR9A 3S6JA 3TTTA 4W1RA 5IT4A 3BRWD 3BXOA 3T6KA 1UCFA 4N01A 2HHHB 4CNQA 4BC0A 2IUYA 5EJIA 2B7BA 2Q1WA 2ZETA 2ZGVA 5A7GA 2GVDC 1KDYA 3UJCA 3EIUA 3TZKA 2J3EA 4XEHA 4D82A 1Z2DA 4TKUB 2JFVA 2CL7X 3PDIA 1NBHA 3KTFA 4HAWA 4DJTA 4H27A 2A59A 3KB1A 1XBTA 2H3EA 4G8BA 3SJAA 3O8CA 4INOA 1A5ZA 1WOMA 4CQMB 1LEHA 4N3CA 2AD5A 2AG1A 1IK4A 2QLBA 4MI1A 4Y6RA 4ZPXA 3V4RA 5AW3A 3G8DA 3QJYA 3P2EA 5A0TA 3RS5A 2CXNA 3GEHA 2I2XB 5BV0A 2G9NA 5L3QB 4BNLA 4TRJA 2WJWA 3VKWA 3ZE1B 2C9DA 5ENZA 1RADA 2OKCA 4Y6QA 3WHKA 4BB0A 2ZJYA 1HT2E 1UMDA 1E69A 3W3AD 2V3CC 3AESB 2I4TA 1H9AA 1FIUA 1QE0A 5CDSA 3BAFA 1H5NA 1JXQA 3WX0A 1KVTA 4B3DA 3TR6A 2IIPA 4B46A 3NHKA 2WU3A 4Z0TA 4ISBA 3WLAA 3CRVA 2TMGA 5B1IA 5BXQC 1DKQA 1HDCA 1UFRA 2EF0A 4UE3S 4TVSA 4ZZ3A 2P91A 3AC0A 3GWZA 3AESA 3TD6A 3EY9A 5DNYB 2BEVA 2OQIA 3CCCA 1D4OA 4X61A 4PFKA 5C5CA 3CH7A 1USGA 2WAXA 3DLAA 3JQAD 4NIMA 3DAPA 4MUFA 1ISHA 4R3WA 1JIKA 1BVRA 5EN4A 4LBWA 1L8OA 6ABPA 2JCGA 3TKLA 3KKKA 3IILA 2JFNA 3LKVA 4LVOA 2NU7B 1JR3A 4IEFB 2O0JA 3IMFA 1U0GA 4Z86A 2DPHA 3UICA 2IS4A 1CUUA 2I65A 3I1JA 2XMDA 4IQ4A 5AKXA 1Q50A 5JJ5A 3PFIA 4C4TA 1KOFA 1B6TA 3KCQA 4KDEA 4M7WA 1NVKA 4R9RA 5F64A 4BYGA 1C5KA 5KTTA 1FW6A 2CSXA 4K6MA 2A5FA 4ENQA 3DF9A 4MA0A 3KQYA 2VG8A 2OO5A 1XLTC 2ZAOA 2CXHA 5FL7A 1S3SA 2HEIA 2CD7A 1JAYA 2WU8A 1NHGA 3RYTC 4BVHA 5KKAA 1P2GA 5LNK1 4K9DA 1NPYA 2IU0A 3JV7A 3UK0A 4PPQA 4N0DA 1S9DA 1D6JA 3M2TA 3D1LA 1V7CA 1AGPA 3MCUA 4P0TA 4LXXA 3C8MA 2PSSA 1PLJA 2ADFA 3OWXA 5C18A 3DDWA 4EB8A 3C3BA 4YP6A 2ZRJA 3F90A 2R25B 3AP2A 1QGUA 1HL3A 2C2YA 1ZVQA 5MFPA 1G6OA 3VNSA 2AJTA 4JSYA 1OB5A 5JWRA 3ETNA 4FNAA 1PJCA 4BX0A 3V2GA 1TJNA 3F1LA 3QNWA 4Y9RA 4E03A 2OD7A 3BSFA 2I2FA 4IDBA 3R3ZA 4CKEB 4HWOA 4H60A 5T4FA 3SC4A 1HE8B 3IMCA 2PUFA 4YMUA 5IUNC 4BVKA 4Z9XA 3X1WA 4BVBA 3L8EA 2BBWA 2ZVQX 1TTTA 1CUAA 1C7QA 1DQZA 4C1NA 3WWDA 1T2VA 4BDSA 1I32A 1G41A 4K9SA 3S2GA 1Z7EA 1WUKS 4AJ2A 3WLSA 3DAGA 2QLMA 3KU4A 3NT2A 3VV3A 1Z36A 5AK6A 4RDXA 5J43A 4ZO8A 2C82A 4P3KA 2Q5HA 3RJ9A 4IDPA 3B5EA 3TJRA 3NM5A 1EBUA 5JAQA 2GF0A 3F2IA 3RPEA 4D8YA 2CJPA 3ZE2B 3D2LA 1UQRA 4L0QA 5EIWA 1V2HE 3VSDA 3PR2B 2Z2YA 3GL9A 4E2WA 5AVKA 4ZYZA 3H5AA 5H81A 1M6WA 4OI0A 1R3DA 3LUHA 2BR4A 5KAPA 3A10A 1GTJ1 2A0FA 1W2GA 4CMHA 4ZEMA 3RQIA 5ISMA 3AF3A 3ND5A 4KQIA 1UOOA 2MU1A 4L8FA 4LRTB 4MX8A 4MI6A 2FR8A 2YWJA 4ASUD 2MIIA 3HM9A 1KGSA 4INJA 2FV8A 4D02A 3LHFA 3QOFA 5DHFA 1VHDA 2A5LA 3ASUA 4N3BA 4DC0A 4N7RA 4X7PA 4JP2A 4G0OA 1CF4A 4DYHA 1Q92A 4KG7A 1NC1A 4DQDA 2XYRA 4ALKA 5GPBA 4DXAA 2P41A 2G7MC 2HA4A 3LDFA 1G1AA 3QE4A 5G3YA 3JWGA 5A03A 1SUEA 2JJ1D 1YR6A 3HB7A 5CDFA 1P74A 1DKRA 4CDMA 5KQRA 1MEOA 4GMFA 3E3OA 4MS4B 5AT1A 2CYCA 1BHJA 1SCKA 2XCQA 3L0CA 4P8RA 3L0BA 1Y0BA 3NBZC 3SCZA 2RJNA 5J2UA 3IT0A 3M6AA 1T4DA 3MF4A 3WGIA 1S0UA 3TSOA 2QX6A 4U3JA 1W5EA 4QVIA 3EVEA 1W0KA 4W1SA 4HNTA 5HILA 1JEAA 2WJPA 3HNRA 4HPXB 2ZYTX 1WZIA 2WKPA 5C7OO 4GKKB 2R79A 4JENA 3KE8A 1N6RA 1QBGA 1ZK0A 2VLBA 3K72B 3M89A 1NU6A 4G5HA 4TV9A 5CM2Z 1W5TA 2Y27A 3TRFA 1Q11A 3L7AA 4I50F 4LDQA 2UZ1A 4D81A 3MGAA 2B7LA 4L3VA 2CV1A 4KPYA 4PV7A 2VT2A 5AVTA 4Z7QB 1Y5RA 2V4UA 4KRYA 4DZRA 4N0PA 2GK4A 4CI0B 1M1YB 1PLKA 3MSXA 2QMOA 2DCUA 2XYVA 5IKPA 2ZAMA 4KLCA 1MGOA 4UNQA 4LJ6A 5K0TA 3PL1A 1XU9A 3L77A 5CH5A 4QPCA 3T3IA 3VNQA 3WWCA 4K8RB 4HEA1 4P35A 2EFJA 2IPOA 3MGKA 1YR8A 3OE7A 3KM0A 4MV4A 4RV4A 5EWLA 4AJKA 3W3ZB 4CFZA 5CB8A 1YDHA 4TUYB 3GAMA 4JBXA 3BICA 3L6UA 3RWOA 5BVHA 5DTMA 4R0NA 1RXYA 3NIFB 3GROA 4YJ3F 4Y98A 4LMRA 5LXTF 1LB1B 2ZDQA 3KQPA 5DWDA 4URXR 2PX6A 3NRCA 2OG2A 4H6PA 5IX8A 2OKGA 4LKRA 3OTHA 1RWVA 2Q6LA 3BIXA 1RWXA 1ZMBA 2OLJA 1IOVA 3A04A 3WA7A 1Z73A 2I1WA 4M1TA 2HLPA 4BNUA 5CD9A 5A7FA 3FYUB 4N03A 4TYQA 5A4AA 1IL0A 2WVJA 1XA3A 4BAUA 4AXBA 3FSRA 4FT2A 3K0AB 4EHFA 2EP7A 2OBBA 1JSRA 1C4WA 4BNKA 4K6HA 3Q8WA 1T9GR 3EXHC 5E7QA 4TMTA 3U19A 2W2PA 4I9NA 4NULA 5G40A 4E13A 2VUIB 2NO9A 2YXLA 2WRZA 3E9ZA 2DFKB 1KEEB 3K1AA 5FUYA 1RCTE 2RD2A 1N2JA 3LM8A 4JWTA 1U4OA 4MWZA 5KJEA 2HOQA 1UJ2A 2VRNA 3AUYA 4E6EA 4YPVA 1UM9B 1N9KA 2C58A 3MIZA 3QOYA 2BHNA 4LJ4A 1OBHA 5TJHA 2WVHA 3LW8A 1UOPA 3AR2A 1LX7A 2GYUA 2NM0A 3M7IA 1USKA 3UFXA 1TJ4A 2J09A 5FPYA 4OHBA 1CQIB 1W96A 2J3LA 3CRRA 4B45A 5FOSA 3NHLA 3AM1A 5C8YB 3BRQA 2VZEA 3M4ZA 1NN3A 2CV0A 3K92A 1GLGA 3AM3A 2FZGA 2GWRA 2UZIR 3EGDA 1CX9B 3BL8A 2EKDA 4TWRA 1M5UA 4B8YA 4F72A 4KXYA 3EDYA 3WIUA 1CR2A 2VK4A 3I5YA 2YHIA 1I1NA 4FFBB 2CXTA 4HQKA 5EWMB 4HX2A 2XUOA 4M9ZA 5I8ZA 2O2ZA 1U65A 3E1GA 3WLPA 5FADA 3FRJA 4N0MA 2IWRA 1JT2A 1UMCA 4BLSA 2VSYA 3OZFA 4RENA 2BE9A 5JH7A 3VNVA 5IJXA 4BJ1A 3QITA 1QRDA 5JC8A 1DX9A 2BN4A 2EATA 2PBLA 3F6PA 5BR7A 3RG2A 3KQTA 2YR0A 1EJ2A 1EFLA 2FPKA 5L9AA 4WY2A 1PFUA 2KW5A 2FPPB 3IHKA 3M8KA 1OXUA 4JKIA 4R5MA 2HUPA 2BEWA 3DTTA 1I80A 4X92A 5TGTA 1M7GA 5CVUA 3MT8A 3SC3A 1N4AA 3L40A 4NU0A 3WLQA 3ZIAA 3MJRA 4CL2A 4PHTA 1NFQA 1K5PA 5J23A 2VF2A 1N6LA 3IUSA 2I7DA 1AVTA 1NMQA 5D51S 1Q3KA 1B8PA 4LSZA 4E31A 1ZQ9A 2C1XA 1XAHA 3QF7A 3VBCA 3ZU2A 3PA6A 5L95A 3Q3GE 4AB1A 3QPAA 1DVRA 2MSEB 3PJRA 4OQZA 1MB0A 1QWOA 5K6AA 3GLIA 4CL3A 1GTZA 1V3TA 3MNFA 3GVCA 1DJOA 4F71A 1BXZA 1DPFA 3MWFA 3HSSA 4GZMA 3L0IB 2FLVA 2GHTA 1QM5A 2X8JA 1RJFA 2QUJA 1CY8A 3A4MA 4GLLA 4WE3A 3S5UA 1MD9A 4BV2A 1VPEA 3ZXSA 2OBFA 5DYNA 4PQEA 1B73A 3AZPA 3WHLA 2V7UA 3E3NA 3UJAA 3SJCA 2ZRBA 3PBKA 3CRMA 3AONB 1X8LA 2XQVA 3HI6A 4M8SA 1C0PA 5GIPE 3K0CC 2GBCA 4G9GA 1FA9A 3JQFC 2WWIA 4HVAA 3FRHA 4A6EA 4CM8B 8ABPA 1UC9A 4JLBA 3SG0A 2Z83A 4ZT7A 5CH8A 2DC1A 3SYLA 3CUYA 4PX9A 3SZLA 4AP9A 3I04A 5BN5A 1E9VA 1DAFA 3SJBA 1TJ5A 4HWSA 3DBOB 4MVJH 1JJBA 2IXAA 1V5FA 3GNSA 3DOOA 1WZEA 3QVTA 4MP8A 4ND7A 5AH0A 2R48A 3UXHA 3ZK8A 5BV8A 4QQKA 2QAGA 1L7EA 3F47A 3QYPA 4MLDA 3T7IA 4WOBA 2G07A 4FM9A 1DE0A 1ZM7A 3KXDA 2A1IA 3ODGA 4YO8A 1YVDA 1GEGA 2R2AA 4IRXA 3TGLA 3DB1A 3VR4D 1M8GA 1KI3A 1SJ9A 4ZJYA 4IHKA 4V39A 5FBZA 4LRUA 4NJMB 1LPAB 4IZ6A 3BFXA 1OBVA 1LX6A 1KQ3A 2KM1A 2Z08A 4OD0A 2O8EB 2X3UA 2HUNA 4UE6A 1DLJA 1X8XA 1SUAA 1K68A 4BO2A 2G08A 2Q7OE 3DLPX 1BKSB 2IPMA 3CUWA 4LJRA 3DV9A 1IZYA 1VHTA 1UFQA 3C14C 2A9RA 2GJ4A 3CIOA 2G67A 2FWPA 3RIHA 4E12A 4BEVA 1TIKA 1B0AA 3R2JA 1ETUA 1TD1A 4RCZA 3RROA 4ZYXA 4IDQA 1OLUA 3T9BA 3U7EB 3R6GA 4PLCA 1P62B 1C3XA 2EL7A 4YCMA 1FFBA 1KFCB 1NE2A 4GOKA 1G8JA 4L75A 3RC9A 1BCRA 2B99A 3WNDA 3AERB 4N48A 4QUEA 1SOMA 4KXWA 4KR6A 4HH0A 1CS0A 4IDFA 4QQRA 3SXUB 3T4XA 2AR7A 2VVTA 1OQAA 1QGYA 3L7DA 5FOVA 4QFCA 4OUDB 3DWEX 1RXCA 3UH0A 3AETA 3LDGA 3JWJA 1AKRA 2QSZA 1NLMA 1PDWA 1ODIA 4F0JA 3BX1A 3O0TA 1JR3E 1F2TB 5E3IA 3RT1A 3T99A 3WWZA 1UADA 4HJXA 4FHZA 1O95C 4CQJA 3KSBC 2BM8A 2ANCA 3KOYA 3CV3A 3C3AA 3CB4A 4BN4A 3W6UA 2J5KA 4BO0A 5ALZA 4R3NA 1FFXB 1F2TA 4KIUA 4P3XA 4DR5B 3IQZA 4R2MA 4XTCS 4A7PA 2JASA 1EFVA 1E60A 1ADCA 3IQIX 5GTDA 4F3TA 5IBPA 2D5LA 1TF2A 1Y9DA 1OPXA 2FMIA 3KL4A 4UTZA 5LVAA 1KZ9A 3DMYA 1Z56C 3K0HA 4MWTA 4OJQA 5TB5A 2QRGA 1KYZA 3QK7A 4O8ZA 2AWOA 1ZJ6A 2JFHA 4JT9A 2GPWA 1FLNA 2QMZA 4DCPA 3TQIA 1ISGA 2JH3A 3DZGA 3KPUA 4YRQA 4JX9A 1JFTA 1RWQA 2NUPA 1XHFA 4NENA 4DIOA 3IQFA 3LVQE 4TLEA 3ONFA 5IDVA 3OQBA 4KZPA 5F78A 1DRJA 3SYKA 2P1ZA 1TUBB 1QPBA 1R10A 2V5AA 1WPXA 3MOIA 4L27A 4X6UA 3AT1A 4JNKA 3VYWA 5IC6A 2G9ZA 4MWBA 4WKBA 3U4HA 5C5IA 4CT5A 3PIRA 1UKCA 3IUBA 5FHQA 3T3GA 3FB4A 3UHJA 2IYQA 3V5NA 1EUDA 3ZEIA 4Z2AA 4N8DA 5L8VA 3HN7A 3RDPA 1JILA 2I80A 3IDSA 2D7CA 2R66A 1G8YA 1ESEA 4HB3A 3BAZA 3ROZA 4QXPA 3C6QA 3ER6A 3NCTA 4NK4A 4OM8A 1KIMA 5J40A 3WYCA 4EI2A 2GBLC 3TEFA 3P45A 4IMPA 5FCDA 3GZNB 1QHNA 2WD7A 2F3PA 3IPCA 4FP9A 5DEOA 3ADPA 1OLOA 4CDNA 3I61A 3RVOA 2YC2C 4QJBA 1Z4PX 1X1CA 1B41A 2VDMB 3R3HA 1BA3A 3EXG1 3ZCSA 1SELA 3G1UA 1N92A 4S1OA 3UPUA 4WJLA 3DTNA 1W73A 3A6GA 5GMOA 1K63A 3BN3A 4M1KA 3EOBI 1YZFA 1YFZA 4CEHA 5L45A 3MA0A 4X8OA 3C3CA 1Z4OA 2RHBA 5K4HA 1KKUA 2VAWA 3EVCA 2A0XA 3A1NA 3EDOA 1P2SA 2NU8B 4B84A 4BFVA 1WRBA 2QSYA 4Z8XA 4GGMX 1A2BA 3A2MA 1QQ5A 3L8CA 2H08A 2JA1A 2BUAA 4DA9A 4AMGA 2JLBA 6ADHA 5J1SB 3VZDA 2E4XA 1CP3A 1SHLA 3R3VA 2JGEA 3N3BC 1J09A 4D9GA 2Q3JA 5FUXA 4C1BA 1ACMA 1MAAA 2WJ4A 2J5BA 4E4YA 3I45A 4I2NA 2YY7A 4HUQB 2NXWA 3OU2A 4J0JA 1HK7A 3ETCA 2XHEA 5BSKA 4XGQA 2Q45A 3UV6A 4Z6KA 3PUWA 5J4HA 4CV0A 3JQCA 5FPKA 3CYFA 5LFAA 3W5CA 1Z6GA 4BVFA 1KMNA 2YMMA 3WAJA 3DPUA 2R5WA 1TW3A 4BLRA 3JQ8A 2O3RA 2C4HA 3INRA 3V00A 1PS9A 3K6JA 3R3UA 4QUKA 4ZV7A 4GS5A 4JXKA 2C96A 1YE8A 2QJOA 1WUJS 1Y9AA 2ILTA 2VA8A 4NH0A 2F00A 4ZAWA 1DL5A 3DWGA 1EFCA 2V03A 1XSEA 4ZVKA 3ZD6A 2GAAA 3A4TA 4IZHA 1P73A 3LT4A 2K5UA 3DMDA 2AA3A 3D1VA 3FTFA 2H5IA 2Z2JA 2Q28A 3BULA 1ZBDA 1JX6A 3EXEB 1IN4A 1XCGB 1PJZA 1TK9A 4K87A 1U90A 4LWZA 5CT5A 2I62A 4Q02A 3PHHA 3LL7A 4REOA 2QUHA 4RY9A 4PCLA 3BZBA 3GJZA 3GLGE 1NBIA 5C46F 2AKEA 2IEIA 3CJRA 3K0KA 1FVOA 3RFXA 4F7WA 3PR1A 121PA 4JMPA 2QW8A 3IP5A 4RVHA 3B2NA 3H9BA 4KDRA 1KMHB 3Q8XB 5AJZA 1B8VA 1JDBC 1RPTA 4IWYA 3T5PA 1Z4JA 1PFQA 2VHTA 4MRMA 4IS3A 1XKQA 4NXNB 1YS6A 4POOA 4DR6B 2G9UA 5EG5A 4IO0A 2CNDA 4JEMA 3RNOA 4B40A 3RRZA 4DNOA 1U3WA 3P0IA 1WAMA 4AO6A 1QYXA 1N32B 2R7MA 3R23A 2UUBB 2Y2UA 3FUXA 2A7QA 3UV3A 3UXYA 1GCIA 4R2JA 1F8FA 1RVDA 5JD4A 4E09A 4EX6A 1ZIXA 2KWIA 4WT7A 4F6RB 3TUIC 1O6GA 3PC6A 2KSQA 4CLRB 2OFXA 3IUNA 4UFOA 3B1XA 5IASA 2NZWA 1U0BB 1S7GA 3MLBA 4P34A 1HQDA 1DQPA 3K4PA 1FFCA 2JG3A 3N28A 2IYEA 2RGGA 3G88A 1Z4MA 3MN1A 3W5UA 3IAS6 2JFZA 1RLIA 3K1JA 2QR3A 3AI1A 3MPUA 3OE1A 1G66A 4YRDA 3KKEA 2QPTA 1JJVA 3AF2A 2I5PO 4G85A 1OSNA 1OX5A 2I7XA 4I14A 5HPYB 4S1NA 1TXGA 3CTPA 4QBGB 1F4VA 1SR8A 3V1MA 1LS1A 3AOEC 2ZCJA 3ANYB 2BMAA 3MC1A 4RVCA 3L0YA 1KK0A 1O0BA 3O9MA 4HF7A 4OJYA 3OC6A 5I9LA 2BTQA 2O2CA 3G17A 2IEYA 4C6TA 4B6RA 5G4LA 5GZ3A 3L6EA 5A0VA 5CNKA 2FPMA 3GT3A 2I9KA 3AG6A 2D4HA 2C4VA 4LIPD 3B82A 7ADHA 1R9GA 3RLIA 4PG8A 3THXA 1V48A 4OA5A 2Y0DA 3H5OA 3VH4A 2QD5A 3RV3A 4X1IA 1K7XB 2VFAA 2FR0A 3EAGA 4L5CA 4MMXB 4Q19A 4F4IA 3GK3A 1SKAA 4BNFA 4GOMD 3WBJA 1YO6A 4MW0A 5BNIA 1I3CA 1Z0IA 3UWDA 2CMGA 3KP1A 2HA3A 2H9IA 4WWHA 4EI9A 2P4QA 2GKGA 1Y3BE 3OCJA 4ES6A 4OMCA 1ULBA 2Q8PA 3JWIA 4H0NA 2VK8A 4KXLA 4D4KA 5DTRA 3DGEC 4BJHB 1H5UA 2P9BA 4LN1A 2HHAA 1HDXA 3MTAA 3TX2A 2AFHE 3CEJA 1QJCA 1LPOA 3FPLA 1GNPA 4GL4A 1S96A 1U28A 4IP0A 4IHQA 2HI0A 4L9RA 2O6HA 1UM8A 3O8BA 3WV5A 1WBBA 5L3SA 3T3DA 5BSVA 4Q6BA 1OH6A 4KOEC 1E0KA 1ZVKA 2ZWAA 1NI5A 3DZJA 3CX3A 4IGEA 4UBNA 5EMHA 3SYMA 3FSGD 5JNVA 2BKVA 2CJWA 4TMXA 3BM5A 1IN1A 2WEKA 5K4GA 1P0MA 1XZMA 1N6HA 2ZSAA 5SYAA 4NCAA 3Q7PA 3QFFA 3K2EA 2GCPA 2P5TB 2MDTA 1IONA 5L3SB 2XF2A 1G5PA 1SFRA 2PN1A 3PQEA 4DCMA 1LY1A 3FZEA 3W8DA 3R8XA 5CIWA 1XMVA 1XFDA 1YCDA 3DKRA 3UJHA 2P6OA 2P2SA 4LRXA 5F4BA 2ZBUA 4O4JA 2HQRA 4YGYA 1PWZA 4F93B 2X5NA 3D7NA 5KI6A 4BTEA 4M8LA 3WRVA 3Q2OA 4E70A 4MW7A 1II8B 2YIMA 4TTIA 2Y1XA 1YZGA 1JTFA 1JA0A 1HE3A 4A8JB 4QECA 3WDLA 3LQKA 1X77A 2I22A 4LDRA 4Y2VA 1MX3A 3D5EA 2WQ6A 1W581 4RV9A 4J0CA 2LCFA 3R7AA 1ORWA 3PQ7A 3JQPA 3BL6A 3O2QB 4RK4A 1CQXA 2FPWA 3KXIA 4ZOLF 4KQ1A 1I2MA 2FFHA 1NNSA 1RACA 3BFJA 4JJKA 4HLQB 3AHDA 3SS8A 4W5TA 2G25A 3I2IA 4QTXA 4F1KA 4LNUB 3KOOA 2PQMA 3ND6A 3EWNA 2UDPA 2W2VA 3H4VA 3WLEA 3UK1A 3JQAB 1Z74A 5JE8A 4YH1A 5CDHA 5JFOA 4B48A 1IXRC 3G8YA 2CFIA 4YRZA 5KWEA 5BSGA 4GKVA 2W6IA 3OT1B 5THQA 3WGNA 4RXMA 5J2UF 3FKJA 4URFA 3OUTA 1R6DA 2II6A 5E3HA 2XMSA 3DOUA 1T6NA 2VF8A 4FC7A 1E7MA 1P1CA 5GV8A 1ZGZA 1MOPA 1QGDA 1PR9A 1E66A 1JDZA 4D4GA 5I7EA 1H2EA 4F9EA 4R2IA 3BE6A 3Q7SA 5F3DA 1L1RA 2JZCA 1DS6A 4YWHA 3VZPA 1C3OA 4MA5A 2OTCA 5A2GA 1PGOA 1NT2A 3LF1A 2AQHA 1PS8A 4JYMA 4B81A 1J9EA 2I6GA 4BVJA 4D9CA 4ZYTA 5DCLA 3PHGA 4KITB 2ORYA 4KXXA 3AI3A 3VR5A 3E23A 3K9HA 3BVPA 3PU6A 3TQQA 1OASA 2PVPA 3A3KA 4B6JA 1GZ4A 3ZJYA 1I0LA 3ZWDA 3K4QA 4CR6A 4EHIA 5IKMA 2YRWA 2OCIA 3STVA 3FA2A 1I1QB 3ZNPA 1E94E 3G0HA 4DGSA 3AF0A 5ALQA 3RS7A 5B1EA 2ATIA 3KALA 1G0NA 3I30X 1XD2B 5AKZA 4CL0A 4QDOA 5U9CA 4DBLC 3KG2A 5BQ3A 3ZWCA 5H9WA 3O4HA 2HQSA 1KF0A 3IP1A 1UEIA 2IU6A 3GDOA 1O5OA 5J5CA 2R7KA 3OEED 3CX7A 1ZKMA 1DT3A 4W5JA 2BHLA 3ZDCA 1XP5A 1XQ1A 2RGWA 5TVKA 1DCFA 5D1HA 1I8TA 1T2AA 2ZPAA 2R1TB 4G0NA 3SZOA 2JD0A 1HO3A 5JS6A 1JFFA 2HJSA 2R4QA 1E5DA 3HB4X 4O4LB 4YJFB 2HSWA 3NB0A 3TEJA 4HLCA 4C2AA 3I2FA 5L4SA 3DBHA 1L4NA 5EKUA 3FPBA 2OENG 2Q0XA 1RWKA 3DMGA 4FN5A 1MRSA 2P2DA 3N58A 3B60A 3VHXB 3Q7EA 2CYAA 3E2IA 1CV2A 4AJHA 4K9PA 1O0CA 1M2HA 4RK7A 1KYTA 3RVQA 2EVWX 3STTA 2UYHA 2NT4A 4JB2A 4MGIR 4Y6SA 1OZFA 3URKA 3QH4A 3CJQA 1RJDA 2QVGA 1HYBA 1PFWA 2V7GA 2WU4A 1JPVA 3K5WA 2V4MA 2C5HA 4MW2A 5E7JA 1CERA 1UBSB 1ENYA 2I7VA 4KQXA 5CLJA 3FCAA 1L5YA 3QUCA 4PQGA 5FI1B 4DL9A 1TD9A 3LF2A 4DKXA 4L4ZA 3L1HA 5KSPA 5KVCA 1UEXC 1YRHA 3A6ZA 3VYRB 3H84A 4R81A 2B20A 5BSMA 1D07A 5JALA 2VRCA 3EXHA 3KR1A 4CKWA 2OV6A 4MJXA 5H02A 1OW3B 3LUPA 1FU4A 1Z22A 4F45A 1YKSA 2IGBA 2BGWA 2C98A 4QOFA 4QQNA 3NETA 5ALHA 1NI4B 2ZBDA 4IY1A 1BN6A 1QK4A 3EQ2A 4URZR 1AUVA 4CM1A 3C6YA 3W8RA 3U7JA 3EYWA 3HXKA 3ZWMA 2IZZA 1YONA 1Z7GA 3AI7A 5I7AA 2ZJ1A 4NXMB 2X0KA 5KQMA 1YQQA 3BWYA 1EFHA 3OQ6A 2HZBA 1J23A 4YK7A 4IS2A 2PHZA 3FCUB 4UFNA 3UYKA 2CLEB 3H1PA 5JECA 2JFPA 1W94A 4Q3BA 1O4WA 1E2PA 1XF9A 2V6IA 4I50B 1CZHA 3C70A 3SSAA 3NDBB 2CXOA 1UPBA 4MCIA 4PAMA 3RSOA 1YQ9A 3QMVA 4URYR 2IY8A 5CIQA 5JZBA 1H9CA 5FUVA 4CEJB 5LLDA 1JPJA 2Q21A 4G07A 3DW1X 4FYJA 3HYNA 3KYDB 4GI1A 5FNVA 5JAMA 4DJ5X 8MHTA 2JJ2A 1W25A 2MYNA 4HN4B 3H2SA 5FPPA 3AFHA 1NJ1A 3VNRA 4AS3A 5DM60 4QDJA 2VS1A 5DTQA 2NQTA 1PT8A 1JHZA 1ZZGA 2M6SA 2QE7A 3ET4A 1F14A 4BP1A 5JWOA 2G1AA 3WXBA 2FMTA 1XTSA 3FR7A 3GP5A 5K0EA 2C4WA 2Y0PA 1JN0A 4YJ3B 3MT9A 5LXTB 4Y3UA 4LPSA 1YJ5A 4D6PA 4PFSA 3PLRA 1UJ6A 2P4HX 5CGQB 5SICE 2OB1A 3WB2A 1NRWA 1LI4A 2FQXA 4RSHA 5KS2A 4DV0B 4TVBA 1TJ3A 2XT0A 2NYUA 1J07A 5TPWB 4DHWA 8GPBA 4FCCA 2WIDA 4U7DA 3H86A 4AKTA 1FDIA 1TU4A 4GSKA 4DCOA 1H22A 2GN2A 5DYIA 1UKBA 2QX9A 4TL7A 4ZMRA 3EA5A 2WQZA 3C3MA 1ANKA 1SRQA 1T3LA 1W5SA 3KPYA 3LU1A 3QU2A 3V4OA 4ZK6A 2NO5A 1FFYA 1M3SA 1K7YA 4P38A 3R3WA 5FAKA 2H0RA 2F9LA 2JW5A 1DKNA 2X8LA 2NN3C 2Y1WA 4PGMA 2XBLA 5G1PA 1KEWA 2AHRA 2Z1NA 1NY6A 2BCGY 2MJLA 3U9SA 1GTL1 2CNNA 4FB4A 1HKUA 5TGDA 5HZKA 3H2YA 5KQSA 2H4JA 3JAKA 1UZAA 2BGGA 5CT6A 1JR4A 1Q0LA 4CJXA 2I33A 4HBZA 4WAUA 3P27A 3O3CA 4JDPA 1YUNA 4TS1A 1MORA 1BE8A 3GRFA 3PVSA 1E1YA 2PH1A 4GLJA 5IBQA 1OREA 3F6YA 5BSRA 3SIXA 2IUTA 4M38A 1OXSC 2D1FA 4MQ5A 3FBTA 1KAMA 1LJUA 3DZKA 4O4IB 1JSXA 1ZUD1 4ZQGA 2Z4TA 1VE7A 5FWXA 3UPDA 2YKGA 3OD1A 1ZC4A 3D02A 4LZWA 4CHTA 1MO6A 4RQBA 1BEUB 1SBYA 3UHPA 5TQVA 4KMMA 2UVPA 2YHUA 5LUBA 5AM1A 2QG9A 3ADKA 4YQEA 2PTHA 1KI6B 1JEOA 4AZVA 4TLLB 3A1SA 3KZMA 4FEAA 1B15A 2C4NA 3LKBA 4G4JA 3KJIA 1RLTA 3SBXA 1KOJA 5JCOC 4B3RB 3H7AA 1MVLA 1RTKA 4GIBA 4PZZA 4ZCMA 1PV1A 1WA5A 1OB2A 4E5UA 4C20A 1OHHA 5FI5A 1X7GA 4G81A 2BMWA 5CM9C 3TW4A 5JD6A 2NV2B 4B71A 4Y2HA 2C61A 1RPNA 1AMNA 1X1BA 3WLIA 1GZ5A 1GL9B 1U0TA 2A0WA 5L3QA 2FOXA 4F12A 4QOGA 1XKTA 2PV0A 3PF9A 2A33A 2ISSD 3CZMA 5ICMA 3GJ6A 2C57A 4DSTA 3LQ4A 1FNNA 3RYFA 4G5YA 2TRSB 4P32A 2WE8A 1RHMA 2X23A 2QKYA 4E1AA 1T1JA 3KLMX 1SC4A 4W4TA 2UUPA 3REGA 3VC7A 3E9QA 4P7GA 3R41A 1ZY2A 3ZIUA 2IH5A 4LY9A 2KHZA 1VJCA 2YCBA 4XM2A 2C9ZA 2N46A 1G5TA 2KLHA 3FI0A 1P7CA 1QIFA 4YT2A 2AFRA 2ATVA 2ZTVA 3BK1A 4XASA 1W5FA 5LWQA 3DVLA 5F3RA 2QP9X 2H07A 1CEQA 3Q8MA 1SC3A 4RVSA 1T8WA 2HKIA 2WHRA 1YJCA 2A88A 3T3HA 3TLMA 4UTRA 1GPWB 3DE3X 2GOYA 5LOVA 4PC6A 1L7OA 1QGOA 2VJLA 4OUDA 3QPVA 4Q12A 1JSLA 4AZSA 2XSZA 1E1QD 1N1MA 2C3PA 1KBZA 3ME5A 1PYGA 2QRZA 5FUWA 3RIMA 4AN4A 3I39X 3KB8A 1SUFA 1P0FA 4G1MB 2QRJA 5DW0A 4MR8A 5IT5A 1KC1A 2I8AA 3WYNA 4UTPA 4F4CA 3BBLA 2ENUA 4U2KA 4K3UA 3GRCA 5TMDA 3GPCA 1W46A 4PSAA 1Z75A 3WL7A 5J1TB 5JPDA 4EG7A 3DUWA 3DBRA 3G6WA 2R87A 1GPAA 1E1LA 1J1UA 4GW3A 2QORA 5IKXA 1Z13A 2W6MA 5JJIA 1UJNA 1JP7A 3JD0A 3AM4A 5DTEA 2HQBA 3FHJA 3KLBA 1G291 2H3HA 2FF7A 2ZJ2A 1EUQA 4S1WA 2C2ZA 4CMIB 1AZTA 4YB8A 5ED0A 4DIFA 1O94D 1X80A 1SZCA 2JHPA 2X40A 1FE8A 4EBFA 3GVIA 1BFDA 4Y18A 1D1TA 3AF4A 3NHFA 3R7BA 2J8ZA 1YRYE 3ZD8A 2DBYA 2CZQA 3GA0A 3VR1A 3AY7A 1FDVA 4KPUA 1R1DA 3OZXA 5JEDA 3A6PC 5HF8A 1Y1RA 4Y6LA 5JQWA 5CDFE 1LPNA 1J2YA 2J30A 4ALIA 5ADVA 2YJNA 3ESDA 4OHWA 1N8NA 3IIMA 2OAQ1 3LL4A 3AJ9A 1W85A 3V7UA 2PEYA 4PIPA 1H4TA 3AVOA 2PZMA 1A5AB 4IOKA 1F0PA 3EG9A 2B61A 1GFZA 5HK9A 2VTBB 3QWHA 1PJLA 2H7VA 5CVEA 1D0IA 1S3FA 4UHJA 4UUQA 4C5BA 1YRQA 3N05A 3DHWC 4K1XA 1T3HA 5E1MA 1N2SA 4IX1A 3RAJA 2ZB4A 13PKA 3E2MA 4NZOA 4C4OA 4FS3A 1U2RA 5A3QA 3P0JA 3BWDD 2R0QC 3OF5A 3SKXA 4D26A 4C88A 1I1HA 1YI1A 5MGNA 1DQNA 1M8JA 1Q77A 2VP0A 4WL0A 1OOEA 3GCWA 4RETA 2WJZB 3PKJA 3PIDA 4U00A 3W8NA 5JS1A 3WLRA 1E6UA 5IVPA 1P7WA 2FWJA 3LK7A 1ZGHA 2YWHA 4PFJA 5ITZA 4LHZA 1E4YA 1MTZA 1E98A 1N2CE 3QFHA 4IWXA 1YKFA 3GGJA 3S2IA 5JPCA 4GWLA 4V0QA 1MN6A 4KB5A 4KXMA 2QTFA 3CX4A 1XQWA 3V6LA 5AQ1A 5HIMA 5A9RA 1FXWA 1HNWB 1XEWX 4MUJA 1DXHA 3HA5A 1U81A 2FSIA 4KKXB 1GYRA 3LG2A 2RSLA 5CLGA 3QEKA 2FX5A 3RJZA 5FBVB 1M0WA 2WG0A 1XTIA 3AJEA 2XHZA 4BZWA 3KSUA 4B47A 1RRCA 1NG1A 2BCJQ 4CUZA 4ZI7B 3KT0A 4D96A 4X65B 3PRYA 4LE1A 4C01A 3LT2A 1ESMA 3D0KA 3KZVA 4UMEA 2WY2D 2NU6A 4RMIA 3BHJA 3HYRA 3IQGX 1O9HA 3ZH2A 2RHGB 3UUEA 2V54A 1UIMA 3E4CA 4F9FA 3SWWA 2RONA 3ST7A 3EGWA 2WMNB 2XD9A 1POXA 4JGBA 4JLVA 1SVIA 3CWQA 1N7IA 1S2GA 5DRYA 4X24A 1DADA 1CEXA 3UT5B 1Q2XA 1ST3A 2H8KA 3AX6A 3A4YA 3DE0X 4QOSA 2AH5A 2B6NA 3QVVA 4EHHA 1S2LA 4B7CA 4MULA 2VWGA 5B7GA 2HHCA 1ZN9A 4P82A 1L4GA 3ZX4A 3WISA 2V55B 3R7SA 4HQFA 2I2WA 2VF5X 2BDUA 4WZBA 2XGOA 1K7SN 3RU2A 1IY0A 1OFGA 1THZA 3F9RA 3GT7A 4HL6A 5EKDA 3WYFA 4HR7A 5CX4A 3BHNA 3ROXA 1ZVJA 1XTKA 2VHXA 3NG1A 3NKLA 4G1FA 1DGQA 3KETA 1B2RA 2VXOA 4FCTA 4PHGA 1KAHA 2WTUA 2A1TR 5B57C 1LS6A 2YXBA 4EPWA 3OM1A 3OA0A 1K1EA 3OX2A 4B3CA 4FFRA 2Y67A 1Z88A 1M6VB 4QSHA 1A9OA 4ZDKA 5IH3A 1QZXA 1A8UA 2PSEA 5JAIA 1EDZA 4OHOA 1VHJA 2C9OA 4U2DA 2OCYC 5FA5A 4JUCA 2WWFA 2P78A 3U0VA 5CVVA 4F60A 5A06A 4DQVA 4QWWA 2O8FA 1ICIA 3DVAA 4EKDA 3U81A 2IPXA 3RVPA 4XQ9A 5DM2A 5LA6B 3NAMA 3T0IA 4Q15A 3JTMA 1D9XA 4HPJB 2LR0A 3EHEA 5JWHA 3WB1A 4OYLA 4YR9A 1GAXA 1H0KA 1M34B 2FRDA 4HS4A 1KQOA 4X71A 2EAUA 4CBVA 1L6RA 3AW8A 2EZ9A 4KK4A 1EESA 1T15A 2X1VA 4DV6B 1U8TA 4M0LA 1P7PA 3B3QA 4UMVA 3V4VB 3H2BA 2OP1A 2X3FA 1YR2A 1D0SA 3U7IA 2PLRA 3O8LA 1HSOA 2BDEA 4K9LA 3V6MA 1FMLA 5GADl 3FTQA 5EE5B 2XCTB 2NAPA 2O8CB 3OLQA 4G09A 4NFHA 1QVZA 3G49A 5LYYA 5JANA 3M6VA 1QCYA 2CZCA 2WYHA 2HCJB 2JAPA 3FLMA 3Q0IA 3M5CA 1DJLA 1CUHA 1SULA 2JBAA 1NQWA 4LBZA 1PS0A 3H04A 3W3AA 2VHYA 2EW2A 1GR0A 4GICA 3P4XA 2YFKA 3GD7A 4CM3A 2IOFK 1XDWA 3QBJA 3VISA 3K70C 4N5NA 4OJMX 4EMTA 3U61B 1A2KC 1AM4D 4MGZR 1A9QA 4H4DA 3EVZA 5AIAA 1NAHA 1R0LA 3CG4A 4W1PA 1W2WB 2YMLA 4LSGA 4XUCA 1ZITA 1QHIA 4QUHA 3CPEA 2H31A 2Z8YA 1I5EA 4B6SA 5KJ1A 5BV2P 2M6RA 2A5JA 4CM6A 2XDWA 4OQXA 1E6LA 1VSUA 2OT3B 3EXAA 3ZCQA 4FR0A 4D3SA 1UQUA 2JFYA 4DLLA 3HLTA 2VPTA 1C9EA 1RPZA 1CUJA 2CNBA 2HCBA 3I76A 5EHQA 1DKMA 4EQ6A 1CJVC 1WKBA 1PYOA 4HXYA 1RFLA 2VKTA 2R85A 3ASVA 3Q40A 2YYZA 4LQDA 5BP7A 1R0YA 4RVGA 1H1TA 2FZEA 1AO0A 4AECA 3QKIA 2BGKA 5DF1A 4I08A 4LRWA 4PCUA 3GLSA 4P7KA 5AHRA 3R9WA 1OZGA 1ECLA 2MOKA 3V1KA 4OIMA 4DSUA 1YRLA 4BVEA 1DAMA 4Q1VA 2BI7A 4PCVA 1XXHA 1AK1A 3BORA 5JS8A 1NATA 5FL7D 3QE9Y 4XR4A 2PXCA 4EL5A 4J7XA 2Z43A 4I4IA 4O4IF 4C03A 7REQB 1RWBA 4IIHA 1EDEA 1YMQA 3E84A 1THGA 1M33A 3FCOA 4OFZA 4OY3A 3PLNA 2B1QA 5T64A 3SS7X 3TAUA 5LC1A 5JQGA 2FG6C 5LB2A 3H0EA 3ZCRA 1JEDA 1PDVA 2FWNA 1AZLA 1JTEA 1LRKA 1QV9A 3BGIA 3MB8A 5BSUA 5ITSA 5ERGB 3D4NA 3FWPA 1WKCA 3T1VA 1SBNE 2I6SA 5JVDB 3ZWPA 4C3VA 1T2NA 5JROA 2W9XA 4MYCA 1U7XA 2DWQA 2IITA 3HU2A 4J4BA 4PHHA 1GTSA 4QQFA 4QEDA 5KTRA 1T2DA 1X3SA 3HFJA 3VU0A 4CKCA 1AF7A 1J2JA 2PMBA 2OCDA 3M9WA 3X43A 1U5CA 3WGJA 4TWBA 3RK1A 4DY6A 1V95A 5BR1A 3FAZA 2QJRA 2A9QA 4COKA 1RI1A 5FPSA 3QE3A 1GNRA 4D6XA 3QFTA 5CYPA 2F3QA 2BISA 3L0DA 1NAIA 3NAZA 1P4AA 2CHQA 1VG9B 1QS0B 1BMQA 1OY1A 4D9MA 3UOAB 5GIOE 2IP2A 2Y1KA 1FMCA 3T12A 4NPAA 3ZS8A 3T3PB 1X2EA 4DQKA 1U8XX 1LFDB 1UR5A 3ETJA 3JR3A 3RVLA 5E6SB 4PNPA 2HD4A 3IR7A 4FZRA 1GT6A 1X1TA 3WB9A 4OX9Y 2FVYA 1UJ4A 4D8WA 4FDLA 4XJXA 4LNUA 3C8DA 5BWLA 1QVVA 3PNMA 2B3TA 4TT3D 2BFCB 3SJZA 1N8KA 1EVYA 1USUA 2CMKA 2GQ0A 4GECA 1QFXA 3DE1X 1CUVA 3A05A 4QZVA 2FSHA 4PVDA 4RS3A 5COAA 5HCIA 1MJ5A 2WJAA 1NYQA 3OQVA 3WIBA 1SURA 2QVZX 3OPNA 4GC5A 4V03A 5CFPA 2H1IA 3RRYA 4PWZA 1J5XA 3B3JA 2GFIA 3NWJA 5BUQA 4JSTA 5BWBA 2CYBA 1J8MF 1V6CA 3ON5A 4GHWA 4NHOA 1SXGA 3DV2A 1HE4A 4D5EA 1ZAKA 4LZLA 4XE5A 1VBKA 2J9GA 3FMIA 3P9YA 3ABSB 4B83A 1C3OB 3ITDA 3FKQA 1U94A 4IDCA 7MDHA 1TL7C 4HLUC 1A4XA 2NZVG 3GJRA 4LXUA 4U3JB 4U6SA 3I5AA 4WBNB 4XR9A 1TECE 1MMFB 2QMHA 4EECA 2A9JA 3WL3A 4BFXA 4M1EA 2AC2A 4OP1A 4RZ2A 4EYKA 2GVZC 2JJ1A 2H1OA 4HLUA 2O5VA 3H0CA 3W79A 3GZ4A 3E03A 4PTYA 3WK6A 1IOWA 2GETA 3KO8A 1TUIA 4Q82A 1VJ1A 4F9GA 4J1TC 1AQUA 1KPIA 2CLMB 3O84A 3OVMA 3O3NB 3WMGA 3BHMA 1PL7A 5EVJA 2C95A 4P1ZA 5KSZA 5EPEA 1MIHA 2EHDA 4Q05A 4ZO4A 1PLLA 4DUZB 1ID8A 3ZHZA 1R4AA 5KOYA 4EKNB 5LJIA 2R47A 3B7PA 1P1HA 2RGEA 4E07A 1RYDA 2QN7A 1OWOA 4NJMA 2HMWA 5KB3A 1ISJA 1B7GO 5AVVA 3UMSA 1N8SA 2C78A 2GEBA 1Z4KA 3LCMA 1BMTA 2EX1A 2QT9A 3I9V1 3OLVA 2RGRA 3NOVA 1FFWA 1EM6A 1KR2A 2IIQA 3N2YA 1QFMA 3P9KA 2WWXA 5EHXA 1AUOA 4O2BB 1KZHA 3BSYA 3D6MA 4MMYB 4OHKA 3SC6A 1R27A 2FB9A 4YRGA 2Y77A 2GTIA 4LW8A 2A67A 2HV8A 1XKLA 4G41A 5IBCA 3M6WA 2OCGA 3HO6A 4ZZ0A 1P91A 1US8A 2HBZA 4BFTA 2H1LA 4TM8A 5JZVA 4DV7B 2C5BA 2BSAA 2GZMA 3AEQB 3AERA 3K0AA 4JODA 4ERNA 2FG7C 3C6MA 1EE2A 3LLMA 4HTFB 4PLYA 2ZE7A 2WF7A 1Q1ZA 1EH5A 1ODFA 5TR9A 3KQNA 4I6EA 2PCLA 4RGYA 3C4JA 3Q2KA 4O4JB 4P3PA 1PWYE 3OUZA 3N7UA 4R16A 2GXAA 4J2TA 5EJ9A 3ZYCA 5KC9A 1TUEA 1S2OA 2XUKA 3LUJA 3DNFA 4D8TA 2WF9A 2BEKA 1X7WB 2PMKA 4ZVUA 4I4TB 3JALA 1ZU5A 4I81A 1SBHA 1ECPA 1NVXQ 1XRNA 2X6QA 5EJ2A 1O5TA 3SS9X 4IH9A 4RORA 1GA1A 4FX2A 3ZV7A 1ZK4A 3HUUA 4NCNA 4DC9A 3SE7A 2HQOA 2ATXA 4AUMA 4TRRA 5IF3A 2VWPA 3DC2A 1C80A 1CIPA 1NW5A 1NXOA 4FHDA 5GONF 3FCYA 1I9CA 3DLIA 4DIMA 3MHTA 3NH9A 2ZJZA 3UMMA 3EUFA 3UWMA 1E2GA 2G83A 3I12A 2PA3A 4CFYA 4NHEA 4R1NA 2J32A 1KO8A 3CLSD 3IIKA 5LZ4A 4EUEA 2J6HA 1LLDA 1ZR2A 2O0MA 2YHSA 1NW9B 2MSKA 4TXNA 2D1QA 3MQFA 2R86A 3TTYA 4J2OA 4XD7D 3V46A 4YLYA 1A2QA 4M1YA 2HA0A 1X7YA 4M3NA 2R6GA 1PT5A 4N5MA 4II2A 1JAZA 1G4UR 2DWPA 5D3MB 3DVRX 3W5DA 2YN0A 1VFPA 1H3EA 4C04A 1FVHA 3C7AA 2WINI 3QM1A 1HPLA 1CHNA 2GAFA 4MZXA 3C3JA 4P53A 5ECWA 3TM5A 3UK2A 5CP8A 4EAAA 2RGNA 3IERA 2VF4X 1FXUA 1E7WA 2Q1UA 5LQKA 1APBA 3N39C 3E0QA 4H18A 4KPUB 3OOYA 1SG9A 3ADBA 3WGUA 1NW7A 1C0IA 4D8VA 4LX8A 1R0BA 2BHSA 3QPBA 4H4EA 3R8FA 3BRSA 1PBNA 4KQGA 4TL6A 4WN9B 3QY9A 5G02A 3FNRA 2V3VA 1KBOA 1ENPA 4OXRA 1JQ3A 2N47A 2Q2QA 3DCJA 4BRWA 4F21A 2QVYX 5AK3A 1CS4C 4LRSB 4EGSA 4B3SB 2P90A 1YVRA 4PS0A 4WV3A 1THTA 4CVNA 3LQFA 1OH7A 1KORA 1Y1LA 2AEEA 3IO5A 4IOJA 5AK4A 1F20A 4DNQA 2Q5JA 4NCJA 1SCQA 4NNPA 3QEOA 1SH7A 3JQ9A 1P9OA 3JQ8B 4JNCA 1DTWA 2WDPA 4U9IS 3ZJVA 4O63O 4S35A 4U7HA 1RYHA 1SXHA 3PKIA 1E4EB 3K0CA 4WDRA 3MINB 5CH3A 4Q66C 3FSJX 2X2OA 1OI2A 2GB4A 2CXQA 2OEPA 2DULA 3KIPA 4ENSA 2VAVA 2VDUE 1L8AA 3GLFB 2VP6A 3WE7A 5HRUA 2C2GA 1IPHA 4AL4A 1B00A 1GOTA 1P9LA 2GHIA 2Q1TA 3M5DA 1WG8A 3RJTA 4CG0A 3WL4A 1H4SA 3FDXA 1OC2A 4JU8A 4ZKEA 2BBOA 1SU6A 2P4EA 4FLMA 3SOZA 4D80A 1HWYA 2XT6A 3OZWA 5SY6A 3LDHA 5K6AC 3MUOA 5JJKA 1GG5A 1QK3A 1XHLA 2X76A 3AR8A 1I10A 3CPSA 1JYFA 3QLUC 4H3VA 5DGDA 1K9SA 4BFSA 1ICEA 2VDQB 3BZWA 4G25A 1E7YA 5EE1A 1HE5A 3IOCA 2O3TA 4KBFA 1HLDA 3ZU6A 5KX5A 3R0IA 1F2UA 1VECA 5BQXA 1GCAA 2AOTA 2W2NA 2W6JD 4M2LA 5JT1A 4BATA 3ABIA 1AB5A 4A0GA 2PRIA 3G5UA 1KZ1A 4LC9A 1YTUA 1E20A 5K9ZA 1JLKA 1FC0A 1XQVA 2DY1A 3G2NA 4OIFA 2Q3BA 3QEBZ 1T9HA 1E59A 1E32A 2FUNB 1WU7A 1KZ7B 3P9ZA 3ELWA 3K8YA 1P8JA 1ZRHA 1E96A 2Q5IA 2XGGA 3Q1LA 4JLPA 4JJ6A 4TN1A 3O91A 2Y68A 2PMCA 3Q5DA 3A6JA 5H70A 3VGPA 5EIOA 4CDGA 1WDTA 2NPIA 2QRKA 3FRIA 4BB6A 2BFEA 3DDNA 4NYMR 3P32A 2X8BA 3GJ3A 1XWIA 1X1AA 3OIDA 1GAQA 1HF3A 1TCUA 1U2GA 2VO1A 2BONA 1M0TA 2YBEA 3AR5A 1OAKA 3DOEA 3JCZA 3OSUA 3EJWA 4IIGA 3SDBA 2BJHA 2ZB2A 3NHYA 3RS4A 3NOOA 1W93A 1IXSB 1NQ5A 1CS0B 4GQBA 2BFFB 1A72A 3OX3A 3U62A 1QTQA 5CT9A 2O3UA 4RY0A 4DLUA 2O0LA 5IAOA 1P31A 2FPRA 1V2GA 3EISA 3HRKA 4Y9UA 4C7MA 2G09A 2NTEA 4L4UA 5A3VA 1ZUNA 2P2GA 3PFNA 3QI2A 1X1QA 2PLFA 2IYOA 2XUFA 4GM4A 4L2IB 3MBKA 1ZUIA 3EDMA 4LG1A 1X9GA 5LDGA 2BKXA 2CF5A 3ITKA 1DC5A 3MWGA 4BBPA 1SZPA 4HMQA 4IFIA 4EKEA 3HJBA 4KX5A 4D3DA 5EY5B 5EP2A 2I2BA 2VJKA 2DQZA 2NNWB 5CLFA 2QVXX 2RHOA 3T1TA 2FPLA 3IP9A 4UATA 4J94A 4NNJA 4YLEA 2G0AA 2HJRA 4N39A 3WRWA 5A6VA 4NJEB 4ECEA 3RYHA 1J5PA 2NT3A 3QVWA 1UOEA 2WIKA 1EFVB 4BGEA 1P9WA 1E6MA 4CCSA 3ICWA 3IYLW 4Q48A 2XVXA 5TQ0B 1XDZA 1V7QA 3EF1A 4ZQCB 1RXSA 1M7BA 2H4XA 2CN1A 5BPHA 2HRQA 2O2HA 4C21A 1WU8A 5I4CA 4ESVA 1NNLA 1P72A 1VE1A 1OIVA 1QVAA 4J6EA 4CLHA 1YZVA 2J9RA 1QIMA 4EIWA 4WADA 1DOAA 2WAYA 2BM0A 2AN3A 4JVOA 1L7BA 2WBLC 3NV7A 4MB2A 1UXGA 1IXYA 3OTWA 2PSJA 3EZXA 5G0UA 1H0HA 1R18A 1LBHA 4DDMA 3PWTA 4EPVA 2C5AA 4QHSA 1KKMA 1HE1C 1G3UA 4GSYA 3HWX1 4JAVC 4LOAA 2CNKA 3A9WA 1P2BA 1O57A 2P62A 1P33A 4QICA 1GQFA 1QGED 2HDWA 2ZJ0A 3ZTYA 2X58A 3G82C 3LBAA 4KYVA 4MUIA 1FX0B 4JD5A 3IODA 2R44A 5HFNA 4EHNA 4OHVA 2JGJA 2PQ2A 4HGQA 4OEHA 2PZFA 5F76A 2CBGA 1H8EA 3N5KA 3VBEA 2NUAB 5JMTA 1KJQA 1IWOA 1Z12A 2WKSA 1QTIA 4A1FA 4FGWA 4OK5A 2X5JO 1V47A 4UBJA 3X44A 5I8PA 4S0ZA 3WMWA 2GLTA 1JB9A 2VJYA 2XCLA 5CEJA 4PGGA 1DIGA 5EXPA 3ZDDA 3E61A 2HIMA 2OAEA 4AW9A 4BX9A 1MA0A 3EVFA 3DEZA 4CM5A 1WQ1R 4HDMA 2ZTSA 5F73A 4J9UE 1XCJA 5SZKB 2BP7A 2VQ3A 3SZUA 5IK2D 3RUAA 1Y9JA 1JBEA 2QLJA 2HBRA 4YPOA 2R7NA 5REQB 2POCA 1OBFO 2ZRMA 3AEUA 3KZ1E 4X85A 3T4UA 3VPHA 2JAOA 2BKAA 4CKEA 4JMLA 4NEQA 4NV1A 1EX1A 3DYIA 3UQZA 3VVMA 2PUCA 2G8NA 4HDNB 4WJZA 3RAGA 3C3XA 1KMMA 3ZZNA 4NOKA 3QJ5A 1T8YA 2ETXA 4F4DA 1CF9A 3OH8A 3QBTA 5CG1A 4GMHA 2PO5A 2W83A 3FGZA 1JE0A 1SCJA 2AG0A 3SZMA 3SXUA 2OOSA 4WZBB 4LXGA 2P7HA 1AX9A 2E49A 3NVMB 2ONCA 3HKDA 1PG5A 4G86A 4NS4A 2ZJOA 2Y1OA 4QXAA 1Y6GA 2EV9A 3WYDA 1XNGA 4OCZA 1DFHA 1EFTA 2DUWA 2BTEA 2CHEA 5JLJA 1B26A 2WLTA 4FYXA 4MPRA 2DXIA 4UVEA 4MA4A 2R00A 1H2YA 3ROMA 1C9KA 4TXMA 2X0FA 1O96A 3G2QA 3D3NA 1G19A 3D2AA 2W70A 3DZDA 4B32A 4FSXA 2XWPA 3H83A 3M6IA 4NCKA 2E9SA 3MRVA 2OWDA 4JBNA 4X1KA 5TS3A 1KJWA 4A6DA 1Q5PA 4JS0A 1AQJA 1PJ4A 4HDCA 1Q83A 4H6VA 1GFIA 1KY2A 2E48A 2B82A 3C5CA 2BFNA 2HNBA 4ZRNA 5CB4F 6GPBA 4AG3A 5AVWA 2XB4A 3D4OA 4GUDA 4YAOA 1S8OA 3TXYA 5C1BA 1CZKA 3OPYA 3VPAA 1KEKA 3LA6A 2A5DA 2WYIA 3UY4A 3V4PB 4DLSA 1PEAA 3FYUA 3NBAA 4PTLA 3MQ4A 2XTNA 1RXEA 2VZ9A 3M83A 4FD3A 5A1JA 4Q0MA 5KBYA 3MCVA 1NUAA 3OFND 4MLZA 5DV9A 1GSIA 1U1CA 2O7NA 3KB2A 4MV9A 4QEKA 4YEDA 3LHIA 3OPVA 4P4TA 1E4VA 2A0UA 3W78A 3MJFA 4LYHA 1E2LA 4MKHA 4YALA 3TOXA 1VLQA 2LW7A 4FDTA 3I9LA 4ZVTA 1W8IA 4NOJA 1Z6TA 5ECDA 2OAGA 2E4VA 5GZ6A 5GGXA 1F6WA 2ILVA 2X9GA 5B5SA 1KRHA 3E35A 3SXJA 5DNCA 3I58A 2P5SA 3Q0TA 4GR5A 3WTBA 1QHGA 5K8TA 2JKVA 1XD2A 4FOPA 4AUKA 4FBMA 3CF6R 3TTSA 4PLFA 5ICCA 2HO5A 4PZDA 3I01A 5G53C 3WRYC 2P9YA 3Q11A 1I2ZA 4HD8A 4HFJA 4DR2B 4UHHA 4MB6A 4OBWA 1F8XA 1Y34E 4HN9A 3TCKA 1Z18A 3SM9A 4LVNA 4E5VA 2V59A 4LZPA 5FWNA 1MG0A 2Z3WA 4KFCA 2WSYB 3WLMA 5C8DA 3K4HA 5H68A 1PJ3A 5BT9A 2BPOA 2C29D 1NQTA 2HIAA 2YV1A 4YDHB 5HQTA 2X0RA 2QRNA 3FYHA 4Q4AB 2C03A 3TLCA 1UXHA 2X8WA 1OH8A 3L0ZA 2OUKA 2EFDB 3OE5A 5J4YA 4FJ2A 4PG4A 5J5AA 2D1YA 4LFCB 1C3JA 1O58A 1FTWA 4A0FA 2QTZA 5A6SA 2FZ5A 4IDOA 4EFMA 3T1HB 2OMEA 3P0EA 2OFFA 2QM7A 1Y1PA 4O1HA 1DOHA 1CUDA 4RKFA 1E6EA 5AXAA 3T5TA 4UTNA 4MP3A 1EJ0A 1TLTA 4Q4AA 2F2TA 4ARSA 3K9GA 4M1QA 1ADGA 3ZY2A 4MIOA 5B30A 1PD1A 4FS8A 4Q16A 1XZPA 5FR2A 3VR6A 4WNAA 2I3AA 1G21E 3ELBA 5CFOA 4FINA 4FE3A 5IJWA 1XZLA 4GMKA 3ZE6A 4F2WA 3Q9NA 1XAGA 1M8PA 1XRSB 3CZCA 3DFKA 4GI3A 721PA 4KVGA 1VP3A 2Q6OA 1I3NA 5ALKA 1IZZA 1H3FA 1BE1A 2GZSA 2WTAA 5JFTA 1N2GA 1A69A 4HQNA 4M88A 3OX4A 1TZCA 4RFSA 2QIPA 4M0DA 3GUZA 1PG0A 1UM9A 2G8LA 2TMYA 1YOBA 3E22A 2WAAA 3H2HA 4ZAFA 3OO0A 1L8QA 2JGKA 3ZDFA 2PCJA 3D6VA 3OQPA 3TIFA 3UB4A 1EWTA 2CJWB 3DV0B 2P3OA 4J29A 4HSGA 2W6CX 2J5XA 3QYFA 2E37A 4P33A 4OH7A 1VCNA 1Z37A 3OJ0A 3RM3A 3THOA 1WM1A 4A27A 3W77A 4EA9A 3N0TA 4I8DA 3FROA 4E0BA 5A02A 1G21A 1CKEA 3MMXA 5K8LA 1N78A 1U63A 4RZUA 1V3QE 5TPZD 5EQFA 4M6WB 1N7HA 1V41E 4CLXA 1E2FA 2IL1A 3I52A 5C1IA 1G55A 2FETA 1WPGA 5ETJA 2ISQA 4YX9A 3FPFA 1XZ8A 1KOLA 4TYNA 1TRKA 1QP8A 4JZKA 2WB2A 3GP8A 3TAHA 1G21B 2P9HA 3WGKA 4MMZB 1XEAA 4OF4A 1M6EX 5FUBA 2AIRA 3L7NA 2AX4A 1PKXA 5JASA 2AYXA 1VM6A 4WA7A 3B13B 3EVDA 3CVYA 4QFBA 2DR2A 4GEKA 4F5EA 1I14A 1SPXA 2RIPA 3KBOA 3UA4A 4Y67A 2C7VA 1XI2A 4AZ0B 3BMNA 1ORIA 2XECA 4P92A 3RC3A 3W9UA 1SG6A 2QMEA 3DE7X 2PQ6A 4G5QA 3VNAA 4UHEA 4BGUA 4MDFA 1MC5A 2AXNA 1N0UA 2PD6A 3IUEA 3TL6A 2VHZA 1KQPA 2PH3A 2QMYA 1K4KA 1UT5A 3MWYW 4DAOA 3OZGA 5EFZA 5C3MA 1VRVA 5IFKA 1TKCA 1PWXA 3P26A 1SOWA 3ENNA 5FULA 3HUTA 3R20A 3HXPA 2IUEA 1TM3E 2RIRA 3E9NA 1OKKD 2ODWA 3OMLA 4IOMA 4S3MA 4Z9FA 1NDQA 2ECPA 4HNVA 4D9EA 1Q16A 2HRZA 3DA8A 3OCVA 4R7TA 3B1VA 1PAUA 3GLQA 4XDZA 1KY4A 4J3JA 3VZBA 4CMJA 4Z7OB 4A3SA 3K70B 4JV5B 4ETWA 1JEYA 4TWZA 1VBMA 5FO1A 1T5HX 3B1ZA 1W4RA 1UANA 5EYPA 5IT0A 4LYAA 5EGSA 3PXXA 1A9PA 1YC2A 1GPDG 2AUTA 3WNBA 4ER6A 1ZJJA 1X1DA 3N8DA 3KJHA 1XPOA 4ABTA 5CVDA 2OSVA 1HG0A 2QHXA 2XVAA 1GEEA 1UMBB 1WD7A 2J1LA 5KU1A 4ONEA 3GJXC 1PT9A 3LRPA 4C0HA 1I24A 1AHHA 2E0IA 4V3BA 5D3ZA 1PUIA 4KI7A 3G23A 2CZGA 4X1IB 3TW0A 2Q4EA 3PUKA 2D5CA 4LNAA 2AVNA 3WGYA 4MUMA 3PC7A 1VA4A 1WWKA 5KTMA 2AS0A 1W34A 1IG0A 2WFLB 3PENA 1G9SA 2XOXA 5D86A 5KVSA 1T34A 4G0WA 3MELA 5ALSA 5CB6A 2YZ2A 2B4QA 2OYSA 3OQ1A 4JLOA 1V16A 1FVFA 3OJEA 2QTMA 1T8RA 2OQVA 5JU6A 1O9GA 3PCTA 5KOJB 3ND9A 1QRAA 2XMQA 1IU9A 1HQYE 1JFFB 1G0OA 1GPLA 1RCFA 3IAM1 4IV8A 1IEVA 4OFBA 5FOXA 2FUKA 3W5IA 1T0IA 4P4SB 4J3NA 2C7PA 1GFSA 4L5BA 1B1CA 3R7DA 1KI7A 1E2MA 5IUKC 1ML3A 3ONDA 4CF3A 3GEGA 5CFQA 3EVBA 4ZHSA 1PNRA 1BOFA 3VR4H 4RPJA 2IPNA 3R5TA 3PXCX 5I4KA 2PWZA 1IB6A 3HN6A 2J87A 3C3YA 1GQOA 1YK0A 2P6UA 3A9TA 3TJZA 2PD3A 2PBFA 4CF4A 1PHPA 3IOEA 1SBZA 1TCBA 1Y4UA 3SF0A 1ADJA 3DFFA 2WSMA 4B9AA 4BE4A 5CXUA 4O29A 1II0A 2W2OA 3LBNA 4Z3DA 2ZBPA 3WB0A 3UOWA 4KGVA 3NYIA 5KOIA 1UT8A 2L0XA 1REQB 3NS7A 3QNMA 1YU9A 3TZQA 5M7EA 3ML1A 3DH0A 4OQYA 6AT1A 2H7XA 4H7KA 1W85B 1GRNA 1BJRE 3NGXA 3OQIA 1CVLA 3RBVA 4IXNA 4FBLA 1VTKA 3QBVA 4MGEA 4FB5A 3F6EX 5CW2A 1UBNA 1NUHA 2DLNA 1QG2A 4FSHA 3MWLA 1G5QA 1PU2A 2GZ2A 4XWGA 3BKWA 1ZPDA 3QJGA 3UMYA 2VT3A 1CB0A 3EFEA 2I67A 5DN9A 5CURA 2G4VA 4U7PB 4EUSA 4IIJF 3FNHA 2F8SA 1EVLA 4UPEA 3CPJB 1FRFS 1WLYA 1S02A 3PQFA 4YAKA 5F33A 2DH6A<