1MMFB

Crystal structure of substrate free form of glycerol dehydratase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
181
structure length
181
Chain Sequence
FTLKTREGGVASADERADEVVIGVGPAFDKHQHHTLIDMPHGAILKELIAGVEEEGLHARVVRILRTSDVSFMAWDAANLSGSGIGIGIQSKGTTVIHQRDLLPLSNLELFSQAPLLTLETYRQIGKNAARYARKESPSPVPVVNDQMVRPKFMAKAALFHIKETKHVVQDAEPVTLHIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of substrate free form of glycerol dehydratase
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Lyase
molecule keywords glycerol dehydrase alpha subunit
total genus 56
structure length 181
sequence length 181
chains with identical sequence E
ec nomenclature ec 4.2.1.30: Glycerol dehydratase.
pdb deposition date 2002-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 1mmfB00
1IWPB 1UC5B 2D0OB 3AUJB 3WB2A 1NBWB 1EGMB 1DIOB 5D5PA 1IWBB 1EEXB 3WB0A 1UC4B 1EGVB 1MMFB 3BRCA 3WB1A 2D0PB 5D5QA
chains in the Genus database with same CATH superfamily
2CMDA 3EEFA 4QDZA 1Q1ZA 1NRJB 2OSVA 3NVKI 4LZZA 2Y0EA 3U4IA 1ACMA 3QPCA 4R8KA 4Z86A 2B4YA 4HD8A 3KJQA 4MR9B 2HHJA 4OHUA 3PNVA 4WN3A 1OW3B 3OX2A 4KQ1A 4RABA 4ARZB 4Z3OA 5AKEA 3VH4A 4KC0A 1ZIPA 1RTTA 1VG8A 2GF0A 2JCXA 2Q3MA 2RHCA 3EZ2A 1GG9A 3PFKA 4FILA 4JI1B 4WVLA 3H4IA 1Q1EA 1XQ1A 5AK6A 1DRWA 2V1XA 1NXWA 4YRJA 4P3KA 3VO2A 1OFIA 4FLEA 5TC4A 4JR2A 4UDOA 4HDSB 4AF6A 5IK2A 3PDIA 4B81A 1KMCA 4RESA 5C32A 5B30A 4DV1B 2O7QA 3TPCA 1FUKA 1G5QA 4R9SA 2R6DA 4GXQA 3K9FC 4IWYA 4RK6A 1NXQA 3P9KA 5AK4A 2LGJA 2X13A 1R0CA 2XQGA 5JIBA 2CMKA 4RJIA 1VHTA 1WW8A 2P65A 4AMUA 4TQAA 1TFRA 1JQKA 1TADA 2XNHA 4V0KA 5HOQA 3X3HA 3UYLA 1JHAA 3FKQA 3K09C 4UVGA 2DWCA 4G5XA 4FE3A 1B1CA 1GFSA 2O2JA 5CGQB 2H1LA 4DR4B 3HKDB 1W0CA 2ERYA 1LBHA 2Z8YM 2FKAA 3EXAA 1D04A 4HCJA 4ACBA 1JPUA 1NUTA 4HF7A 4K8RB 4U1RA 2OKCA 4H7IA 1Z6PA 1Z68A 3MGKA 2CDCA 3GFPA 4M4SA 4AKEA 1PR3A 2GFQA 1KH1A 3M9XA 4KXLA 4C0LA 4D3YA 3AJAA 1YTUA 1ISMA 4IOMA 4ARAA 4MR8B 3IDFA 5MHTA 2ZRQA 1JJVA 3IKJA 5H3LA 4D98A 3AHCA 2C7VA 3O8RA 3CRRA 4IIBA 3E35A 5CT9A 1HMPA 2PBZA 3B12A 3BRCA 5T41A 3TRDA 2I3AA 3G3EA 3EXHB 1E32A 5KTPA 3U19A 3RU7A 1E0AA 1GEGA 3K70C 5LQDA 2KE5A 1LDGA 2E5LB 4FDAA 4PQYA 4I9UA 4UNNA 2Z1NA 4O4LF 1J09A 1NVFA 1QSGA 1ZLYA 1I1QB 4Z2YA 2PUDA 4KTVE 5FV7A 5HW0A 2P41A 5H1YA 4BFYA 2Z5GA 5AW3A 2G9VA 2GASA 2QTGA 2RAPA 1HL3A 2XKAA 1PE0A 5G02A 3VH3A 3F90A 2VWPA 2XDQB 1RHQA 1XYVA 3HNRA 3BWVA 2NP6A 1AKNA 9LDTA 1NNEA 3INRA 3I09A 2BN4A 4EQZA 4D9GA 1IN8A 4WKPA 1W5AA 2FGJA 2GR9A 3O94A 1D2HA 4ZO6A 3W5BA 4NE2A 3M6FA 4OV6B 5FYQA 2BEVB 2FQXA 2O0KA 3OF2A 3ELUA 5SZJA 2Q49A 4S12A 1IWBB 1GLVA 1TK3A 3E5RA 3QEOA 1I2AA 4QTZA 2HY7A 1SHZA 2EARA 5TDHA 2JJ2A 3EQ9A 3GVCA 5CIYA 3WWZA 2AFRA 2ZBUA 1VCNA 1WLSA 4YWJA 1CY1A 1IHUA 2FEOA 2QDXA 2R4UA 2W2KB 1XBTA 4KXXA 3VJMA 4BLQA 2FSSA 3U7HB 1UEXC 2XQKA 2YXNA 1VG0B 2FQ1A 3AETB 3RIGA 1A4IA 3X1DA 2PL3A 3ODGA 5C2JB 1E1NA 2GCEA 1GA4A 1Y7HA 3PRJA 2QVBA 4AFNA 2VXBA 4YCLA 3D6AA 3WGLA 3QPBA 4MP8A 4MW1A 4JSYA 1N0UA 2I2FA 3H5AA 1JJFA 2ZQZA 3IVRA 1Z18A 3UK0A 1NASA 5F7XA 1K2WA 1RZ3A 1M75A 1QIMA 2ZYWX 1G5FA 3O3OB 3L4BA 1K7YA 5EIWA 5ICFA 2X1MA 5LYJB 4ER6A 2F3SA 5DTJA 3I5MA 4C0AC 4HLDA 2O19A 1CEXA 1RXCA 2WV7A 2Q62A 3MMXA 4E1BA 2X5NA 4PIMA 5CBPB 2BBSA 5HXAA 1PAUA 4E7PA 4QSMA 5JCJA 1RHRA 4D8TA 1KYZA 2I4TA 3GHHA 4B46A 3OQNA 1J20A 3MTJA 2WA1A 1KYYA 3FYUB 3GAMA 3L2OB 4IJ6A 1KR2A 1KQPA 2VZ8A 4BO0A 3BXFA 4CEJB 1ZGZA 1C4XA 3H7IA 3KJNA 3N9IA 2VSXA 2Z9BA 2HWXA 3C41J 3CUTA 3KQMA 3GJXC 2Q3EA 3P32A 1MLDA 1LSSA 4CMHA 1F2VA 1EFVB 1YVDA 2W71A 4LMAA 2CNOA 3A4LA 3UMJA 3CPHA 1PJAA 3ENNA 4ZP1A 2H54A 4DSAA 2I6SA 4TSKA 1FW6A 1T36A 1YZFA 4I5DA 5FFFA 5HDQA 4BBPA 4ZTZB 1B74A 2RC5A 1ZUIA 2WP0A 3IBFA 3R5XA 3ZXSA 4G1BA 1UKVY 1XVUA 5KCMA 3IVMA 4ONEA 3VZBA 1GRNA 1F60A 2N1BA 5FORA 2IF2A 4RDIA 4YCMA 1V26A 2F9FA 2OQ2A 4BX9A 1WM1A 2D0DA 2CXPA 1ZK1A 5DWQA 5KOJB 1JYFA 5C1OA 3GVIA 1OWPA 4GP7A 2HA2A 4DLYA 1G20E 2CK3A 1T8UA 2W4IA 3SQDA 3HACA 5FBHA 3EDRA 5EAIA 3RDPA 3R6GA 4UAUA 4D46A 2X19A 4I5GA 4QDTA 2OMKA 1GPAA 1OXUA 16PKA 2AMLA 4FYYA 2B1GA 1Y4DE 2PJDA 2Y76A 2P79A 3D5EA 1XXLA 1G7SA 4ZU3A 1RQNA 2C9CA 1IUOA 3NBFA 5F51A 2INGX 5AXAA 5EJFA 1QORA 2AZTA 3S2YA 4DMKA 5K0JA 4LIPD 5IH3A 1VIAA 1FEZA 2CWWA 1P4RA 2G1KA 4F0JA 4L7QA 1N92A 4PGGA 2PWBA 4X91A 3A3PA 2WHYA 1L5HA 1OTYA 1E5XA 4PYRA 4L78A 2HI0A 2GXSA 2XCQA 4FHFA 4BEWA 5FLKA 2AD5A 2OZKA 5J4KA 3ZPXA 4IIYA 4WKNA 4Q1DA 3B52X 1SD2A 3LM8A 3WGYA 2JKYA 2Z08A 3LCVB 5EKUA 4JDPA 2XBMA 2A9JA 1NW4A 4DARA 1A72A 1FRVA 2F3RA 4GOXA 3RIXA 2OV2A 1JSLA 5DTMA 3FHLA 4FFVA 4EKNB 3VHLB 3PQEA 1JG4A 4G86A 4UBIA 1NX9A 4CM6A 1XA3A 1L7EA 1ZIYA 3OE7A 2LKCA 3E8SA 3EXEB 3KSAC 4H4CA 3X1YA 2V8OA 3A2NA 5DHAA 3VZQA 2B5OA 1WHTA 3CLTD 1OQAA 1PJZA 3ADOA 5ALYA 3RG8A 4HAWA 3ETJA 3N58A 3RWBA 5L40A 4TZ0A 5CK5A 4Y6PA 1BDHA 4K9PA 1MO4A 2X7HA 3R44A 4WE3A 3T15A 3WK5A 2C0CA 2WFLB 1J2UA 1U9ZA 5TMPA 2JGLA 5AKKA 5JSYA 2AUTA 5LMUB 1ZXLA 4U2CA 5F5NA 3CQ9A 4FDMA 1XCGB 4J7XA 4NESA 2P27A 3CUSA 4MITA 3O03A 2O2IA 1JQ5A 1SG0A 2J5XA 2LCIA 3I2KA 4QDKA 5T8KC 1EHCA 1DKNA 3WMRA 1ODJA 2CEKA 2WJWA 2A35A 1DJNA 1JILA 3FSGA 1HLPA 1LTQA 3MB8A 4RA9A 5J2UB 1H2EA 1Y7TA 4LKRA 1TCBA 2P5YA 5CM2Z 3GL9A 5CBPA 3A4TA 1GPBA 3DSRA 4KJZA 3RSCA 2HA5A 3AI3A 4MCJA 4Y0NA 4YBRA 3P45A 4MQBA 1RRPA 3LWNA 3WKEA 1FMFA 3WYAA 2ZSKA 3WHLA 3LHKA 2WSSA 3LGAA 3UN1A 3KSRA 3TLGB 5AHXA 1IM8A 1SXJE 1T9GS 1L6IA 4IV8A 1R66A 3RVDA 1K8YB 4E2XA 2PCLA 2HF9A 3S5UA 3KB8A 3CBQA 1U1FA 4Q9NA 4B9EA 2GESA 4LRYA 3DXFA 5CMLA 1ZH2A 1ZM2A 4NCIA 4DL9A 2YR0A 2ZRBA 4X95A 1EFAA 5JUWA 1QFJA 1T1RA 4K86A 1K7EB 2OFWA 3D7KA 3T3GA 3ZGYA 5JECA 5DBIA 2IUSA 3LXUX 5D2CA 1Q16A 1QGZA 1ZRHA 4LYGA 4N3NA 4NJEB 3WK7A 1UWLA 4BFVA 3RYCA 4JL8A 3IHTA 4OXQA 4JR0A 3WB9A 4X1IA 4FIZA 4JBWA 3CONA 4YBZA 1LF5A 2ZRHA 1TA9A 2G83A 4KR0A 1PNVA 2GLUA 5FTNA 3VC2A 3ROXA 1Y3BE 4YO8A 4ZZ3A 1TRKA 3B5JA 1KH2A 1YJ5A 2WDPA 3LC0A 3HRIA 1CBUA 2G72A 2C03A 4HDAA 3ZHSA 4BC1A 5FDFA 4EK9A 4F9TA 4XIGS 2KI5A 1H5NA 5JAMA 1SKBA 2X6TA 3ROMA 1I0IA 4HQNA 3E84A 4AO7A 4OY3A 1XZKA 1YXMA 1VG1A 1EUCB 3A7EA 4Q3AA 1V3VA 1Z63A 1RC0A 4BWYA 1MORA 2COKA 1U8XX 3RFTA 4ZODA 1ATIA 2D5IA 1WZ2A 3ZWAA 5C8YA 2CJWB 3HJAA 1RWPA 7YASA 2XVYA 3OZAA 4JB8A 1U2DC 2FZWA 1RIFA 3SSNA 3NTXA 1YKSA 1H2FA 4BFZA 1TFUA 2BZ0A 1UBHS 4NPHA 1M7HA 1CUGA 1DAFA 1ORIA 1ECCA 5M34A 2WTEA 3EE6A 1EB9A 2YFQA 3FNBA 3QI7A 1ZI9A 1CDOA 2VCYA 3DWGA 4KQ6A 2AXNA 1XR3A 2NNWB 3HADA 1L5WA 3ZDZB 4U5QA 5EXSA 3IQIX 3NHFA 2VF2A 1A5ZA 1E9BA 1Y1KE 4A2QA 1W2WB 3GFVA 2IH5A 5SY4A 5EIOA 5JQGA 3F49S 3INYA 4BQIA 3VR4D 2QZ9A 2OILA 2QM8A 1U0RA 4YJFA 1KU0A 2JLWA 2Q6TA 5D85A 1AGYA 3IE1A 1Y89A 2VUIB 2WE7A 5A3SA 5F9FA 1YBFA 5LOVA 2Y68A 1CRPA 2C2HA 3DFZA 1QLJA 3MLAA 2YWEA 4M6WB 5DF1A 1SOWA 4MA4A 3R41A 4NMWA 3PLNA 2WPDA 3M6XA 2NSHA 3D5QA 3TDNA 3AP2A 4NBWA 1BNCA 4WA7A 2VT2A 5CVVA 1E1RD 4M8SA 5IX8A 1JF8A 1U7ZA 1U7WA 4G0QA 4IHAA 4IO1A 2ZIXB 4FFBA 4KRXA 3CNLA 1FX0A 3OVMA 4OU5A 4RA6B 2Q5OA 4JJAA 2I3BA 1YRAA 4DT1B 4ZCMA 1FBTA 3NBYC 1VDMA 5JVDB 1UBUS 3DVRX 1KMIY 3HCEA 4LDAA 5HCIA 2FRDA 2H2WA 3KOUA 3KZNA 4KLAA 5IC4A 3T0GA 3L6EA 1LLCA 2OP1A 1IMJA 4D9NA 2UXCB 2J5QA 4NENB 1PT8A 5EUQB 1XT6A 4IPTA 2PUHA 1B16A 3E9DA 2BW0A 2W8BB 3H9CA 3G2MA 3VC7A 2QLFA 4HN9A 3AF0A 2NG1A 3KSDO 1FVXA 1QGED 1FFDA 4ZGBA 1P80A 4DXAA 4R1SA 1IUNA 1NJ2A 4UXIA 4D79A 1AH2A 1T1GA 2CL5A 2RHLA 1EQAA 3Q11A 4ZCSA 1GQSA 1PJ2A 2NO1A 1SHTX 4P33A 3ESZA 2QJWA 3WLRA 2YN4A 1T3LA 2FEPA 4MPTA 4C0BA 3WB2A 2B3TA 2PU5A 3E7XA 3FNRA 2QN8A 3PX2A 4HAIA 1MW8X 3ZJVA 3GIDA 3KJEA 1MVLA 2ILVA 3EC7A 3L6CA 4J0DA 4TYQA 3TG8A 1GL7A 2J59A 1W5SA 3EIOA 4Q4CA 4DBLC 2ZJOA 3FCEA 1HEIA 5JYBA 3U5TA 1XTIA 1R8JA 2ZRFA 3FE2A 1AXEA 4O0LA 2RJNA 5EXTA 2BMJA 5DHPA 3TKLA 4EAQA 3C3MA 2ZWMA 1B93A 1WY7A 4XYEA 1YQTA 4M21A 3RJ9A 2NM0A 1Y42X 4A26A 1NM5A 1Q57A 1UK6A 4O1HA 1D7OA 3A4YA 5CJJA 1P2UA 4ZQCB 3SU8A 3T41A 3UT0A 2PGJA 4HT3B 1MTZA 1QKKA 2WKQA 3DYVA 4F60A 3CZMA 3STWA 3G0HA 1WNTA 2A2ZA 1CS0A 2B82A 2VT7A 3T99A 4I7EA 3ZVNA 2WOOA 3WGZA 1NC1A 2G7MC 2IEIA 2PR7A 1NUSA 3U3MA 3BSFA 2FCRA 5KVCA 3OZBA 3QELA 2CHQA 1YFKA 2R68A 4PSDA 5FTWA 1SVLA 3GLHE 1N2ZA 2SKCA 1UBCA 3K92A 2A9PA 2D2VA 4KRYA 3WMEA 4QJBA 4HSGA 3ZIAD 2IX9A 1Y8QB 3NHYA 3KPVA 1NY6A 3SY8A 1K97A 1M1NB 3HXPA 3ER9A 3RQSA 1R0YA 4DLVA 1CY4A 1RWQA 1V7PC 4D42A 1B14A 2V3VA 4B6OA 2Y0DA 4UTXA 1NJ1A 4R4JA 4OHZA 1KYQA 1V1MB 1C1HA 5JJLA 3C8UA 4FD3A 1QS0B 3ER6A 1OAKA 3LY8A 2QUZA 3BIFA 3B9QA 4KAFA 4M99A 1HTBA 2VA8A 1HQCA 3R3VA 2PNJA 4DW8A 4RS4A 1NV8A 3U0BA 1NVEA 5C8YB 4LS3A 3V8PA 4JLSA 2I6TA 3NWBA 3AUSA 4TRJA 4MQEB 4KHPB 1IN1A 4JU8A 3WGOA 2JLZA 1RZUA 1LQTA 4Q6BA 1JHVA 1DWOA 2FE1A 1CQWA 3H5NA 4FZVA 3ZYZA 1CZKA 1N1EA 2HXSA 3KXIA 2IU4A 4M1OA 4EUKA 4LQDA 5BVGB 2GCNA 4P36A 4WBNF 4MGZR 4FXOA 1BDJA 5FI5A 3A36A 4P93A 2ZEJA 1RD4A 2UXDB 1UM8A 4AZSA 2QIOA 5IMSA 4Y2JA 4W4TA 3W9UA 2GAJA 3MERA 1TK2A 1CXZA 5F33A 4C30A 2CKDA 4A27A 4EA7A 5JCOC 1NVTA 1P7VA 2CNWA 4RK0A 2XE4A 3T5BA 3VMFA 3AEUA 4YXWA 1NF3A 3QUSA 1AUXA 1AMUA 1L9XA 1JDUA 3PT5A 1CJKC 2FPPA 3F7NA 3N8DA 1DQRA 2BWJA 2R9VA 3IPRA 4P58A 2BRUA 2BFBA 1MB0A 3GJ5A 2UYGA 3R75A 4DGQA 2YIVX 3T9CA 1M2GA 2FAXA 4TZTA 1JVSA 2C2YA 3D0QA 4I55F 5H81A 2HW8A 4IG9A 2X1HA 1X0VA 3DO5A 5JBQA 1GQYA 3AKZA 3T5DA 1W85A 4HNQA 1JDBC 2G3YA 1N57A 1S3GA 3LO8A 4XSGA 3ZJTA 1HYHA 5F52A 1ZESA 5CT5A 4DT1A 2XUHA 1ZC3A 4E5DA 3VNRA 3WLNA 1QHHB 1E0JA 3SMQA 3OE7D 1Y6JA 4ZVUA 1NWCA 3DNMA 5M5BA 3KXKA 2FRVA 4LJ4A 3IPXA 2BH2A 2O8CA 2J09A 1HDEA 1NU6A 4GR4A 1QQ6A 1SVMA 3A10A 4ZJUA 1ZUWA 5JJKA 4JLDA 2V7WA 5BN5A 2XNJA 1JQ3A 4ZAXA 3CVOA 4X66B 4RKQA 5JMTA 3QVSA 1T2CA 2P1RA 3KR9A 4P7GA 1RRKA 5JI3E 1ZM3A 3AKYA 3L49A 3Q87B 3QPDA 1R16A 4RFSA 2CVFA 3RYIA 1IJBA 1APBA 3SC2A 3WO0A 3K4QA 1FYEA 3A3YA 5DOZA 4F91B 5JATA 3PKJA 5LKRA 2TMYA 1MEJA 2J9XB 3EDQA 4X1OA 4AT1A 2Z57A 3DBRA 3OQOA 4Q1CA 4A36A 1QTIA 3OOYA 2C04A 1L1QA 2OE2A 5DN6D 4IYRA 4S0ZA 1BS2A 4X54A 1RQPA 4MLPA 4KPUB 2DR2A 1SA0A 4KGVA 2HPVA 2CDNA 1E98A 1GZ3A 4YECA 2GSDA 1XCMA 1E99A 4BUCA 3BK7A 1QXSA 3VI3B 2FP4B 2TECE 4GUDA 5AJHA 1EQUA 2HOQA 4XD7A 3T7AA 3F5SA 3RARA 1R4NB 2GAAA 1W0KD 2OBLA 4OHCA 4AX4A 4Z4FA 1EBFA 2PXAA 3KBOA 3P2OA 4MR7B 3UH1A 3NCTA 3EA0A 4MQEA 3OF5A 1G9TA 4RY2A 1SUWA 3QIAA 1B43A 1M9NA 3HP7A 2H0AA 4GGOA 3JQ8B 2OB2A 4BAUA 2HMTA 1WEKA 4GPTA 1L4KA 3FSGD 4LI0A 1O3YA 1RWXA 4KITB 2ZDGA 4C0SA 3KXPA 5GV7A 5U4QA 3D6UA 4FFLA 1L4NA 5IDXA 3IYLW 1T2DA 1BXKA 1TMOA 4D9BA 3QELB 3TNLA 3JRWA 4ZZIA 3PXGA 421PA 2I4OA 2Y1CA 3OMXA 1L3BA 1KI8A 4OL9A 1QPGA 3VPSA 4BJ6A 4HGRA 2AR7A 2DPHA 4P32A 2CDRA 4YJ2F 4WASA 2QZ4A 2LIVA 1VDZA 3OO0A 4YUVA 4TS4A 1DG9A 2QN9A 2C8KA 3LC7O 4EKGA 4XWOA 2D6FA 2WJ6A 1V7CA 4R6XA 4QC2A 3TN7A 1ZC4A 1AZWA 3O8OA 5L7WA 1E6MA 1P75A 2NTVA 2AFHB 3CKYA 1ZK3A 4P9NA 1Q7RA 2WI8A 3M4XA 2VPZA 2HC9A 4G8JA 5AW9A 2LIPA 5FOUA 3TOVA 3D8HA 2EGHA 3BTUA 3W9BA 1X13A 3JWHA 3F6EX 1SOAA 2CB9A 4PTYA 2WIDA 5F5XA 2FOIA 3QENA 1KF0A 2GZ1A 1Z2PX 3CU5A 4LZPA 4RSMA 2GM4A 1SG6A 3QPWA 3P19A 3T7SA 2YZ7A 5E7QA 4PC7A 3P26A 4YRNA 5KB3A 4Y6SA 3CR7A 4HB0A 1ML3A 1I32A 3M2PA 2YRXA 2DGDA 5EIEA 1N4AA 2XJ9A 1R12A 3VKVA 2RDMA 3Q5EA 4P80A 4ZVRA 1ZJWA 3W6ZA 1D2MA 2ID9A 3WZLA 1LVUA 5L4LA 1NF2A 2JBWA 3BF7A 5LIPA 2Q9CA 4RVGA 4HEJA 3DAPA 4OP2A 5K8JB 3PEFA 3PCTA 3OKCA 3I3OA 4GYJA 4GZ6A 1A3CA 1XDSA 3RYTC 4BB5A 5LLTA 4NBTA 3OWHA 3U1TA 1EE1A 4UE2A 1VI5A 1T8TA 5DULA 3UIEA 4L4SA 2QUIA 3ENWA 4X6UA 2HR1A 1ZMBA 2OAEA 3T3DA 1UBSB 2QGZA 1E6KA 1Z6XA 3RJMA 3EHDA 3MF4A 3MINB 5EE9A 3VZSA 3I30X 4MVJI 2BE9A 3NEPX 4EI9A 2OO7A 3RC7A 3LKDA 1N1MA 3PBKA 1ST3A 3V3KA 3CUUA 1QKIA 5A62A 3ZD7A 2VF4X 3HCFA 1US8B 1G42A 4J49A 1TM2A 3EUFA 2FOXA 2XCOA 5LBIA 4HH4A 4V2IA 1INLA 1X15A 1P60A 2ZJ7A 4L4XA 3TTYA 5G2OA 1P4AA 4MAMA 2QQFA 3ZD8A 4PYJA 2WA2A 1L4FA 4J0HA 1E2LA 2ZSAA 3NM5A 2JIPA 1HE3A 2BFBB 3B1YA 1C0EA 2JCBA 1N9GB 4RGBA 1S8AA 4PYNA 4GRDA 1UKEA 2RGWA 1OBVA 1OFGA 2IYTA 5AJWA 1OILA 3LL7A 1ACLA 1EK2A 4MWGA 3BMOB 4Y2HA 2JHPA 5DH9A 3TLAA 4BAZA 3FTEA 2Q99A 4ZA2A 4EYOA 4TKVA 5CA1F 4V24A 4WADA 1GKYA 1IJKA 3O3CA 3C6KA 4P54A 1ZUHA 1M66A 1HZZC 4BKUA 5K4HA 2ZYAA 3O7WA 1QH9A 4I9NA 1K3FA 3QKRA 2EZ4A 4LDZA 4V02A 2QF7A 4OGFA 1CQJA 2PRSA 4GLJA 2CB0A 3TSZA 1RYYA 3AM3A 1VHJA 2J9GA 3ADPA 1NTOA 1VHDA 1NKTA 2XWBF 3LA6A 1EXVA 2H1FA 3U7IA 1GCOA 3I73A 3SN6A 4A1FA 3W3AA 5LMZA 5HQJA 3MCVA 2FFRA 4Z4GA 2CXXA 2YNMA 3GLGB 1YZUA 3WHKA 1RNLA 3QMPA 1ISRA 2AJLI 2PGAA 2W0SA 4I14A 3TSYA 2XMCA 3QE0A 3ZLBA 3H2BA 4LOAA 2G0AA 3GJZA 3QLJA 1KI4A 4IIHA 3PEUA 4C05A 1JSZA 1Y9EA 2JRLA 3GEEA 3H18A 5FA8A 3VVLA 2Q9UA 5DN9A 5ALNA 1IPFA 2YN0A 3DMTC 3KAJA 3C6BA 4FSXA 4NNPA 3QQ5A 3ANNA 5AOAA 3IEVA 2FPUA 4CIDA 1IXKA 4P92A 3OWOA 4ZC1A 5REQA 2P0YA 3R76A 3KTAA 1XOIA 4RVSA 3PICA 1EFDN 3QXSA 2Q5EA 1R0BA 4TM7A 1ISSA 1W19A 2H4XA 2I9PA 1IMOA 3A7DA 1NT4A 3QBEA 3NXKA 2GVNA 2OV3A 3GCZA 3NV7A 4CQMA 1B0AA 1ODCA 3OUZA 1KI7A 7AT1A 3VKWA 4GKVA 1NONA 1G5TA 2W6JD 3Q0IA 5FUQA 5K3EA 4ABTA 2GMWA 1W8DA 4FMCF 4J3NA 3VV3A 4I1SA 3Q8XB 4I0WB 3DPUA 3KV1A 2PKQO 4PBRA 2VQFB 2OGWA 5B3KA 1XK6A 2OHXA 1IH8A 1YDGA 4INAA 3L0BA 1H94A 2D7CA 2OZPA 3BE6A 1EJ6A 4PAOA 3LOQA 1V25A 4DG9A 5IWCA 1DFIA 2RHDA 2XYVA 1V5WA 5C35A 5BYAA 2XQIA 4NP6A 1XEXB 1YJXA 4AZWA 4KIGA 1ZL2A 3RVSA 1DUVG 4KLCA 2IY7A 3ZLVA 1UBTS 3ZZUA 4N18A 3GF4A 3ELYA 1P1JA 5LYYA 1SC1A 1UDWA 4HX9A 1C2YA 3WO1A 2QRZA 2A1TR 3WKBA 2HCFA 4TWBA 4YT5A 2B2XA 4UBLA 3HKEA 1CYDA 4IXNA 4RTKA 2ZUEA 4NQZA 4EGFA 2PUVA 2XEDA 1OUMA 1C29B 1L7XA 3B6KA 4DYDA 2MSCB 3PRHA 3BYZA 1HOTA 3O26A 5AHOA 4NU0A 4BWFB 2V7EA 4Q6WA 2WYHA 1XCPA 2B5VA 1IQ0A 1THMA 2KM1A 2EW8A 4II7A 4P5PA 4UE6A 5JV5A 4BQPA 2PX3A 4F4DA 1UMBB 3EXFB 1F5NA 1VJCA 1I4LD 4CFSA 2DJ5A 3K0KA 3LFUA 2XMRA 2QLNA 2D1SA 4OQ4A 1SKAA 4A73A 4J91A 3L4KA 1AKTA 3SAJA 1ZYUA 3HBLA 3SCZA 3JVIA 4NFHA 5I8PA 3AI1A 3N7UA 2JGMA 1RXSA 1FLDA 1VBMA 2O2ZA 1J33A 1S9HA 1MC4A 1ZJ5A 5FAXA 4DCCA 3H1BA 5E8JA 1G2IA 3TM5A 1NR1A 3ME5A 1SXPA 1AHIA 1CUCA 5AM3A 1UEJA 5BVHB 3E7WA 1N32B 4K9OA 2Y67A 4B7CA 3FDFA 1KK1A 3HRHA 4XCVA 2ZWAA 1QWSA 2DU8A 4KGZA 1LW6E 3X1XA 3GDHA 3KM0A 1D9XA 3DDWA 1OLOA 3L18A 4LSMA 4FP9A 3C6ZA 1FNNA 2I67A 4YTEA 2VPQA 5DASA 4V0RA 1P18A 5FL7A 1QQTA 4ALNA 2EOAA 4V0SA 2UKDA 3H8WA 4OLJA 4D80A 4DYHA 1RXVA 2QUAA 4QYWA 5GADl 1L7RA 2WT9A 3I8OA 3LX5A 1MUUA 2FMKA 3GLKA 2D8MA 3BZBA 3LUGA 3N7AA 4MINA 2W48A 4NDNE 3NOVA 1M83A 5CW2A 4AYXA 3NMUF 2NVOA 1RAIA 1W34A 3ZJUA 3UW1A 3ZTWA 3A04A 4LVOA 3MCZA 2PUBA 3HFJA 2GJAA 5JANA 2OXFA 1N9ZA 1P2SA 2VNSA 4Y30A 1KEEA 1ZM4A 1JVBA 3O1HB 4B3JA 3T5CA 4TXJA 4XGQA 3W04A 4A2CA 4CG3A 4N03A 4EA6A 1TAHA 4HVLA 5I9IA 3D31A 2VHYA 4OHVA 4R2XA 3KYCA 4L22A 5T4FA 2P77A 5H4GA 3DVAA 2WUWE 3PRKE 3VH1A 4UUMA 5K8CA 4O5AA 4NCBA 2QVLA 1GKKA 3PXBA 3Q3VA 4UCFA 1U7TA 1KYXA 1N6HA 4RD1A 3OBBA 2II6A 2M1ZA 4M38A 2X0FA 1N3LA 1Z2DA 3BGVA 3A9VA 2JFBA 1AN0A 2P2NA 1MGOA 2DP4E 2D1YA 3DB1A 2Y1GA 3I6QA 1K6IA 2BVNA 4ZT5A 3TSWA 5HWSA 5JMWA 1E3EA 3EVEA 2FFQA 3C70A 1C7EA 3FZNA 5E2IA 5FYDA 3ORSA 2R6ZA 3FW1A 3DWEX 1A2BA 3IO3A 4U2BA 4CMAA 3HMKA 3BRWA 3PXCX 3G1TA 4B1FA 1UPXA 4QJ4A 2H7CA 1A8PA 5K2MA 1KQNA 5H9WA 3QV1A 1VGQA 4S1VA 3NDRA 2O50A 3GUHA 1SC4A 1E79D 4R5MA 3NORA 3IIEA 4Z4EA 3HWWA 1CJTC 1EXDA 1EX6A 1PYOA 2DQZA 1DBIA 1JU4A 2ZS7A 2CN1A 3IP9A 3LX8A 1WZCA 3AC0A 4DOMA 2WKRA 1EVKA 2IVZA 1X77A 2B4AA 1L4MA 1MAWA 1V8OA 3Q41A 5FPYA 3ICEA 2WIKA 1HDXA 4YMSA 3K0CC 5G4LA 5BSWA 4JXXA 2YJNA 4WK6A 3HVRA 3B6JA 5BRNA 5HM8A 1JHXA 2A94A 2WQZA 3ED1A 3RC3A 2PMFA 1QQBA 4GE0A 1T1IA 3DTVD 3SJAA 1GTSA 1I4EB 4C0JA 1ILEA 2A9OA 1HYQA 1GKUB 3PITA 2OXRA 1B73A 4XB1A 2VDMB 4ZVKA 3RS4A 3RVKA 1EX1A 4IIJB 1DZIA 5JD6A 2P2LA 5TGZA 4OYLA 2QJRA 3CRZA 2Q50A 2H2AA 4FKZA 4PRZA 3STTA 3V80A 2P68A 2VZ9A 4HVCA 4MP6A 1ZCBA 1QP8A 3AMVA 1EVIA 3RUEA 2ES4A 2PWAA 2ZYVX 4HX5A 2E9SA 2EZUA 4WWHA 2P90A 1EGAA 3QMWA 3GA5A 4BBJA 1YR2A 1BWRA 1FFXA 1SM4A 3OSUA 4H1HA 4K1XA 5BN5B 1DAPA 4PBTA 3GMIA 4KDEA 4RH0A 1EFCA 1X7YA 2FFBA 2R44A 3I2GA 4LCJA 5TB5A 4FDVA 1RE1A 3AG6A 5EINA 1DPFA 2FFJA 2ZIGA 3OCXA 1PCXA 4BLTA 3CSDA 4OXNA 3WRWA 5AI6A 2XT6A 1J2YA 4CKEB 4M22A 2X8JA 1X7WB 2VJBA 2Q2NA 2XT0A 4IJ5A 4AYTA 4ZDWA 5LNK6 4D44A 2PYZA 4NX2A 3V3TA 2EYQA 1E8NA 5F2KA 2UYOA 2J9RA 3AHDA 4LWPA 4PIPA 3FAKA 2ZSHA 2GI4A 3EXFA 1RC1A 4KLZA 4MQ5A 4XH9B 2G04A 1PDVA 1OR8A 4IFTA 4B32A 1A96A 3WL7A 2IH4A 3BJZA 5FV4A 5L3QB 4UM5A 4GW3A 4YV7A 2D06A 2QRLA 4HGYA 3O74A 1SBYA 4ZK6A 3VX3A 1VXOA 3H8VA 4BFUA 6REQB 1G21B 1DLJA 3HWSA 1FYDA 4R0NA 3LQ1A 1XDDA 4CMJA 4EFMA 4KNVA 2WWVD 5K6AA 1RHJA 5DJ5A 3DCIA 5CLLA 1P39A 2Q7DA 3KQHA 4NC9A 1YCFA 2ODQA 4NJOA 3RF7A 4RD2A 1P33A 2R6HA 2BY4A 1XMSA 4E15A 2PUFA 5CCXA 3PWZA 5JMPA 2B25A 4C4XA 3U2QA 3GUUA 4MV0A 5B1SA 5D6NA 2DFNA 1AHHA 4TT8A 4TQ9A 5L7YA 5IXJA 3TAHA 3LCUA 3MYYA 5DEOA 1DZ3A 3I6MA 2EX1A 2FX2A 2XI4A 3SC4A 2ZSIA 3PKZA 4XFDA 2WIFA 1XTPA 4MI3A 5TVGA 5AW7A 2WMYA 1XRPA 2YY6A 1VJDA 3UYKA 1U99A 3ZDEA 4CR7A 3HK2A 1DAGA 1C9JA 2ODAA 3EQZA 4MMZB 4CV0A 4R8MA 5K7SA 2KJQA 1RJWA 3IQFA 3DUFB 4RVFA 2CXSA 4ME6A 4BV2A 4Z0HO 3AF1A 2H57A 4GQAA 3VR5A 3DLAA 4DMHA 1F7VA 2BI7A 3H16A 2MYUA 4B87A 4GVLA 3ZN2A 1U6IA 3QWFA 1CKEA 4UEOA 5G3YA 2J6BA 4EMBA 2PTHA 1E7YA 4WT7A 3W4KA 2FLKA 1QH1B 3KZKA 2OB1A 5HFAA 1BW9B 1EINA 2ECKA 4BJ3A 4DG5A 2YKGA 4ZI7B 4FCCA 3PA6A 1XMJA 1LBIA 2DY1A 4PVDA 5A4DA 5EJGA 4LMPA 1MNQA 3JATA 3ANTA 2LRHA 3FWPA 4BNUA 1B6TA 2B69A 2G36A 2BYTA 4BCDA 3DMPA 1DRVA 2G4CA 2Q8QA 3K96A 1R6TA 3LQKA 4U6NA 4US1R 3KQQA 5B3JC 5FI3A 3KVOA 3OESA 2UZ3A 1EAMA 5H4HA 3H3XA 2FWMX 1VJTA 2QA5A 3GPIA 1NG1A 4B35A 3GLVA 1WTCA 1XTQA 4DV3B 1VLZA 3HGMA 4BNDB 1VRWA 4M8LA 3SQNA 3GJSA 4TVBA 3EEOA 4DRZA 1JZQA 2XCTB 1ZY2A 3A37A 2A0FA 3KB6A 4FZRA 3ZGVA 2FQWA 2V5UA 3D8UA 3IRVA 1DSSG 4C29A 1EG2A 1WF3A 3K6JA 2FN4A 1RRMA 2P11A 2AG5A 3JASA 2VXCA 2HZBA 1GSIA 2P2DA 3L93A 3NTVA 4PRYA 3IPCA 3VTAA 2K2QB 4BU1A 4CNBA 4DJAA 3AEQA 1RP1A 4H7FA 2G80A 4XR4A 1PVOA 2CNDA 3OZSA 3FA2A 4TTVA 2JGDA 1HE5A 3DT9A 4KN8A 3FKJA 1KY3A 1Q21A 4U2GA 5EI5A 1ESCA 1YZGA 2ZYHA 4H9GA 2Q45A 4GI5A 1TCUA 3FPLA 3NG1A 1L6RA 3QWHA 4JLVA 4E13A 1BFDA 3THYA 3PJEA 2YQ4A 2YNMD 2CCKA 1O5IA 4P83A 1NXTA 4UD2A 4BE7B 1XEAA 2XOKD 3JW8A 3NGXA 4TSFD 4AIIA 1F14A 1N0WA 3PL5A 3T4PA 1X3LA 3EVBA 3D1LA 3IE0A 1DHRA 3OH8A 4HWSA 2ZIZA 4LXXA 1ZCFA 4QU0A 4TV8A 4Q9IA 1AHPA 4OA8A 1PO7A 2ZBDA 4JMPA 1R2QA 2GM5A 5BSUA 3F8TA 4ZHQA 4JQSA 5KMGA 2GF9A 3EPRA 2VAWA 3OY2A 1QANA 4D81A 2Y8EA 1M76A 3RU9A 1QRTA 2IV2X 4QZVA 3QVGB 4LI3X 4FM9A 4G0ZA 2WUEA 3T3HA 2VP3A 4BHTA 1C7ZA 2PH7A 1U2GC 2O23A 5IKPA 3MIIA 4LHEA 5DBGA 4E32A 1QG4A 5H02A 1XPRA 4WPGA 1SN7A 2AEMA 2Z9CA 2R48A 3NTOA 5TQ0B 1H9CA 3W7AA 3DOEA 3BK1A 2OMEA 5HTOA 3HN6A 2QX6A 1IIRA 4GMKA 3WDKA 1UBGA 3M3PA 3U4QA 2WNHA 3CBGA 3FMFA 4MLDA 5IF9A 4GBED 5JVDA 1V6CA 2XTMA 4Q05A 1BU8A 5F1KA 3OLXA 3RYHA 1PLKA 2VPIA 4GMGA 1OYWA 1G7RA 3D0KA 4WNCA 3ZJYA 1QYVA 3U4CA 3PFBA 1FFCA 4PG5A 4M53A 5JEDA 2B2CA 4A10A 2VF8A 3CVYA 2QD4A 4G0OA 2AI2A 3LHIA 3A6KA 1A82A 1PR0A 3SZMA 1RZRD 3AZOA 5LZ5A 1EESA 1YGPA 4WBXC 3KG2A 3LCCA 3CW8X 2AG0A 4TMYA 3H8SA 1L5MA 1PYGA 4MI9A 3ZGNA 2WUDA 3ETGA 5LP6F 2G4VA 1STOA 4FINA 4Q5IA 1PS8A 4TMVA 4B4KA 5H3CA 3K0AA 4QL3A 4BRSA 2ID4A 3RK1A 1FP1D 2LD4A 4AWAA 2BTQB 4AP5A 2CJYA 3PWKA 4FDUA 5DNUA 4MVYA 2HLDA 3TZBA 1YQGA 5AVRA 2EQ5A 4NJMA 2AG1A 2VJLA 3A28A 5A2QA 1XZBA 1KZ7B 3ZR4B 1JHRA 3AIKA 4BPBA 1OJLA 3AFIA 1GD1O 2WTAA 4MGYR 4NK5A 2OK8A 1A9RA 4ND1A 3CX6A 1VIMA 3UAWA 1Q0QA 5EZ5A 4NCHA 3KZVA 2X5KO 3AV3A 3T9DA 4FW9A 4ARVA 5EL0A 1TPYA 1OI3A 2NXCA 3ZD6A 1YL6A 3C5VA 4PGMA 3ZEAA 5JALA 1CZHA 2AMVA 1C8BA 1ICEA 1P72A 1USGA 2OOKA 4FYHA 1P61B 3BX1A 4X85A 3R7DA 3ZZ1A 4PC2A 2Z3WA 2ZBPA 5A2GA 1L8AA 2REOA 1V47A 3ZBUA 1N0VC 1COWA 2VAMA 1U65A 1B0UA 4FB4A 3USZA 3ZX4A 1JEYA 1NFQA 2PMWB 1FMJA 1Z4LA 2QQGA 3NATA 2Q5HA 1HGXA 5HFJA 5CEFA 4BC0A 1PFUA 5TSDA 3RAGA 1H2AS 1RAFA 1A9YA 3VM6A 1QK3A 2Q4RA 7ABPA 4Q01A 1TJ5A 4RPIA 1CYEA 5J4VA 2GEFA 4YDHB 1JZTA 4AW9A 4F3CA 4R54A 1JQBA 4JEHA 3AB8A 3KLPX 4Q1FA 1VI2A 1ZG3A 3EC1A 4QBGB 3AIMA 2YS6A 3SHQA 3QA9A 1A4RA 4H6VA 3HU1A 4K87A 4ZAFA 1WUHS 4AU1A 4MUNA 1P1KA 3GBSA 4RH3A 2G6BA 4D9CA 3EX7C 2BM1A 1E4EB 1JFFA 4DLSA 1HTTA 1JS1X 1ZRSA 2PV7A 3FRJA 3TX6A 1I7DA 3E9QA 3HDGA 5GVSA 2PJUA 4I1VA 5D1NA 1SU8A 2JH9A 3UWMA 1CULC 3ESBA 1OHHA 2CLKB 4UARA 6Q21A 1Z8NA 3MJHA 3TNFA 3PHGA 3JATB 2E1RA 3PWSA 4AULA 1PGPA 3V48A 2Q5LA 1FSFA 3G89A 1RJ9A 3PC7A 5SYMA 3V7WA 2BGMA 3WKDA 3G5LA 3RYIB 4KNYA 1BQ3A 2XMQA 4JWTA 1YJAA 3TW8B 3WL8A 3CN9A 5FLYA 1MD9A 3P9ZA 3DE1X 1OH7A 3TAXA 2GN4A 2VQDA 2X5JO 2XGSA 1RW4A 1MDFA 4PN3A 2PZMA 1BVUA 3MMZA 4BEVA 1Q14A 4RVNA 3HXMA 3DBHB 4R84A 5F1PA 1KZ1A 2W6QA 1GPJA 1ZI8A 3R7AA 3USES 4BATA 3QBTA 3AJRA 3RRNA 1UXIA 5CUQA 4AL4A 2Z98A 1JLRA 4F56A 4F97A 3ADCA 1YZHA 2GFIA 2J9FA 5AW1A 2GQ0A 1IBKB 5B53A 5SICE 3UHPA 3HCPA 4QPJC 3TOCA 1FDSA 4ZQBA 1P0PA 1E2MA 1S8OA 3L0ZA 221PA 4P98A 2WJVA 1JDPA 4IIXA 3JQGA 1U2SA 3E4CA 1NMSA 2EQAA 3BMQA 1QNFA 5GY7A 3QKWA 1GNLA 4EYSA 3M2TA 5TQ0A 5IU6A 1IXRC 1SWWA 2JHAA 3FUXA 1XAGA 3T9EA 4YAUA 2OQIA 3JTEA 1TM5E 1RM5A 2DUWA 1TQ2A 2IW3A 5IAGA 2Q0SA 2HWUA 2EFHB 2Q0XA 4UTZA 1FK8A 3QVOA 1Q5PA 5K99A 3DP9A 3MB5A 4YYZA 1BE0A 2FWNA 1T2EA 3PQ4A 4MGIR 2J46A 1WIWA 3KKNA 2MR5A 1MAHA 4L4YA 3KSMA 2C0QA 4RKYA 2V1UA 1VL2A 1E79A 2P9QA 3B3GA 3IKLA 2W70A 3U31A 3WK4A 2PS3A 5AVUA 3UXHA 5ALWA 4OGGA 3SHTA 2H5EA 1E7MA 2YOHA 3H1AA 3S0JA 3U44A 2W6ZA 2OCGA 3NTLA 3TQTA 4NNOA 2O3QA 3D3NA 4LHXA 3SC2B 2XOXA 3QQPA 1OBHA 1XMOB 5CLFA 2E49A 2VAXA 5T3YA 5DLDA 3RYFA 2DQKA 2C95A 1T35A 3IBYA 5FUBA 3ZWOA 3UVEA 3OICA 4NV0A 2V7UA 2PX5A 3VPAA 3ZDXB 2H31A 4OB8A 3EFEA 4FBMA 1L5FA 3IP6A 3VTFA 3IAM6 4CF3A 4LF5B 2XD4A 2YBDA 3V4RA 1EK6A 3LUPA 5CH8A 2GPYA 4E6EA 4ZCLA 2JZCA 3KYBA 4WLEA 3UHFA 1V45E 5BOSB 3E15A 2I6XA 4R3UC 1Y81A 2IXTA 3GMSA 4UTNA 2BE7A 1V8ZA 1HDCA 4KQ2A 2E2WA 2SICE 1W88B 2B4KA 2BFDA 2HJ9A 2X3YA 4OFXA 3PDIB 4WFIA 3J81A 2VA9A 1JG7A 3PQ2A 5AM0A 3TINA 5HG0A 1Z8HA 4PFQA 3CLVA 1UFRA 1DDOA 1OKKA 3B6MA 1PR4A 4EKDA 4V2UA 5JRDS 1U81A 3D7RA 4JI8B 1RJ9B 4LHYA 2ZQYA 2ZRPA 3T7JA 5BW5A 4MVCA 3GFGA 1GTVA 3CT4A 2JI6A 2MTBA 3V1MA 1RKQA 1Z5NA 2H3EA 2PZEA 4RMGA 4BAGA 1CFZA 1BC5A 1H9AA 3DC7A 4HAVA 3L41A 5E3IA 2IYOA 2XD9A 3MPOA 4MB6A 5AIAA 1XQXA 4R7ZA 4E11A 1Q1NA 5J2TF 3I9FA 1ONBA 2IPNA 1SQ5A 3ESRA 4ZOLA 3A0RB 3GC6A 3DVQX 3MT9A 1JIQA 5ADVA 1RZRA 3G2LA 4XW2A 4XUGB 2XCUA 3L0YA 4Q7MB 1L1RA 3TOSA 3GAZA 1YJQA 1X80A 2WF9A 4FFPA 1YDWA 2C9DA 4R1OA 4FOOA 1QUFA 2K2WA 2QNBA 3X1JA 4KQFA 5AUOB 1X7GA 3CPEA 1HFWA 4KZPA 1V9LA 2XB2A 3RH0A 3V6MA 2AJ8A 3AF5A 2CVOA 1H65A 1G7TA 1QE5A 4YRSA 1UC9A 1BN6A 1ZA2A 4FQ8A 5D6OA 2BCGY 4RADA 2XA2A 1XJQA 4PS1A 4JMLA 4JLUA 1PZXA 2E3JA 4TTQA 2XB9A 1L5QA 2OG1A 4F1JA 4F6RB 3U7JA 1RWWA 1AA9A 3CX7A 1KYIA 1Y48E 1ZH0A 4PSAA 1RPNA 4QE3A 2FG5A 1NMZA 1MF7A 1OYVA 2HTEA 4U7GA 1JALA 2HYDA 4NU6A 5IJWA 2AXQA 1XDBA 3DTYA 1YFJA 4KR6A 3AFHA 3ZQ6A 4XUCA 5AJVB 4WCFA 5IFLA 3JY6A 4EA8A 1C7JA 1BSVA 1RYEA 1XU9A 5C5EA 4EARA 4GOOD 4ETNA 1ABFA 3A2MA 1D4FA 1TZCA 2HMSA 3W3AH 2O1EA 1PSDA 1GO2A 3HHPA 3PVZA 2GBGA 4FGUA 2GF2A 1M5TA 2VSYA 1U7HA 5J23A 2FUG1 5THQA 2HPHA 3EWIA 2AE1A 4K9DA 3RT9A 1N6IA 5JPCA 2D13A 1F38A 1VSVA 2RFLA 2B35A 5DNYB 3JALB 1ODLA 4FXPA 1ZLXA 2ZR8A 5DBFA 2PHZA 1SHJA 1U11A 2JJ1A 2JLCA 2CMHA 2GZ3A 2REQB 1SKMA 2XMSA 3AV0B 1XQYA 1NE2A 2V8BA 3DE4X 1N6LA 3DEFA 4MQ4A 2OYRA 2R6JA 3O8DA 1KGDA 4ANFA 1S0UA 3VOAA 2SCUB 1N5JA 3ZV3A 1QQ5A 1YCDA 1VE6A 4Y2QA 1JG3A 3HYLA 3ROEA 3RVPA 4B7XA 2NO0A 1QMGA 2YHIA 5A0VA 4DLTA 1HNZB 4TV9F 2YVLA 2EJUA 5H5JA 2NIPA 1G38A 1EVZA 2FEXA 2TMGA 4P3PA 5FA6A 4R7TA 4Q0MA 2VSOA 3HKCB 1Z4KA 4URYR 2CJFA 1D03A 1WD5A 2HRDA 5LQRA 2F55A 1XNRB 2GJSA 1A5BB 2I8CA 2XYQA 3L07A 3PSAA 5E1MA 3VU3A 1TXGA 5MGBA 3VXKA 4CIVA 4GS5A 4M7PA 2ZUUA 4UUQA 3PNYA 1R15A 2HSZA 1MFPA 2GNOA 2Z5VA 3CCCA 1SXJA 1CUHA 3HB9A 4AUNA 4D9JA 1ADFA 4XWWA 1KI9A 1KDOA 2HIHA 3R5FA 4IJKA 4PPNA 2DR3A 1CQZA 4CKZA 4QUGA 3ZWDA 2C98A 1M2VA 1ND6A 1M2FA 3N53A 3KEGA 4L7VA 5G0WA 5BQXA 3GMDA 3RFUA 3M1YA 2C0PA 1C0IA 1LI7A 1SULA 2ZS9A 4JKOA 1W4LA 4YCCA 4IOJA 3PXAA 121PA 3O3MB 3OI7A 3R77A 1IHXA 1XLWA 2YJ5A 5K3DA 3UV3A 2LTAA 4Z5XA 5IKOA 2R1TB 1F51E 5AM1A 1M2JA 3ILYA 5K5EA 3HMQA 1FFYA 5DVZA 5E1BA 5BQFA 2ZU6A 2E82A 3CE6A 1U8FO 2IZZA 1I7PA 4GPIB 5ISMA 2RHTA 3DH0A 3GFBA 1NLFA 2RARA 2CLHB 4IRXA 4AF8A 4OQLA 3MT7A 2VDVE 1K75A 1N6NA 2PZBA 1CX9B 3RFCA 1JIIA 2A1IA 2FMHA 3QKSB 3SE0A 3GDWA 4RLQA 4PAGA 1T9GR 4GT1A 3WOVA 1SBZA 3LBYA 4HNAB 1KS2A 1VP3A 3ET5A 1Y5MA 3HB1A 4M98A 4Q18A 5K6TA 3IBCA 2ADMA 4YACA 1J8YF 1DU4A 1I6KA 5CXSA 5AM4A 1FW8A 5C52B 1VPDA 1GPLA 3SOZA 4UULA 2PBFA 1FE8A 1M6YA 4FJ2A 2BIFA 1NFRA 3TTTA 4BL5A 1OWLA 2WAYA 3LZCA 3GVXA 1PQUA 4P4GA 2PANA 3ZE1B 2EJVA 3DQPA 5DSTA 2I3ZA 4LSWA 5TF4A 4NS1A 2WAAA 4PPFA 4JQYA 4GP6A 2PR2A 1KFJB 2NZJA 3LT0A 4CMGA 3NXSA 4J94A 4P22A 5SZIA 5IBPA 4R40A 1NVDA 3RTGA 3ZWYA 4EHFA 3EF3A 4ZARA 2H48A 4F5EA 4CZ2A 3AFGA 4IQ4A 2AC7A 4L6IA 5FADA 3TPZA 4AJ9A 4E1AA 3FNIA 3IQGX 4Y7CA 2VEOA 2EVWX 3QOWA 5DHFA 5KSOA 1M1NA 2YWCA 3DPSA 4LBVA 5A9SA 4E70A 3E2PA 2Q6IA 1YQEA 1H1DA 1YS6A 4WUTA 3JASB 3U3XA 5CH5A 3TAUA 1YZYA 4OOEA 2AJBA 2CFOA 1HSZA 1NBHA 5KTTA 2AWOA 3AEQB 5CA0F 2ACEA 4C2TA 4I55A 4Q47A 3C6YA 2BCJQ 2I4NA 4TVSA 5CRIA 4J43A 1D6SA 4Q39A 2OHOA 3CIFA 4M9CA 2G70A 1V11B 2Z8XA 1R5BA 1AK1A 1I10A 2PBLA 1XX6A 3CNOA 3R3JA 521PA 4F3NA 5BRJA 4CEIB 5DRYA 2V3WA 1CB7A 1FP2A 2JVJA 1WCV1 2VC2B 3GEPA 1NM5C 3I1FA 3SQXA 1R9MA 2VZ0A 2CHFA 2WV9A 4KX3A 3RFFA 3TIVA 3S55A 3UCXA 4RUKA 3TKAA 1BKYA 4C3UA 4ZGWA 1CY7A 2DHCA 4TMKA 3L43A 2VP0A 4ML3A 2XMPA 3DT8A 3ONWA 1AHNA 1DJLA 1L3IA 3QK7A 1KVSA 2RKOA 3LIIA 1M5RA 5L9AA 3MOGA 2HQ1A 1SBHA 2VHVA 3B7WA 3Q3EA 1YKGA 3NDIA 3LSYA 4G36A 4GYKA 3OOEA 1KE2A 4AYWA 5IJ9A 4DIBA 3TFOA 4DUYB 2C84A 3CCFA 3GJYA 3B1WA 3K32A 3S68A 3HEMA 1TJNA 3SLRA 4B9AA 2ZU0C 2VBIA 3QU9A 4PHHA 1PWHA 2W2NA 4G09A 4K28A 1T5SA 3MILA 2IHZA 5FPKA 4M9ZA 2HLNA 3FZYA 1D2GA 1KEUA 2LUOA 4I8DA 4JB3A 3HJHA 5BSMA 4QYXA 3FBTA 4GMHA 2P30A 2P6MA 1IY0A 4AJIA 4HQLA 4DWVA 3BOSA 2J6IA 2C2OA 4AJOA 2Z6AA 1A8QA 1WHTB 1NVUQ 2Q5IA 1UK8A 4OMDA 3WB1A 3GX1A 3IQXA 4CKWA 3LVBA 4LY9A 4UUOA 1ZUD1 4H31A 3EGCA 4M46A 3KUCA 1C4KA 3H5WA 1YUNA 4MV5A 3MAJA 4JJ4A 2F1KA 4KPUA 5BN3B 2X0EA 1O4WA 1Z74A 2KHZA 2O59A 1B6GA 3KR1A 3GXBA 2AOVA 3EN0A 1BWSA 4J2TA 5EWMB 3CINA 3FSJX 4DY6A 4OHBA 3RS3A 3AZPA 1G1MA 1N2JA 3L8MA 5FWNA 5C53B 3D2AA 3VNVA 1PG0A 2QSJA 2W2VA 3D3JA 1QFYA 1H1TA 2BTOA 1OFVA 2HF7A 3FPCA 4L16A 4F84A 3UUEA 2A57A 1DAMA 3OKPA 4R2MA 5CDGA 1XCLA 3EFHA 5EC8A 1ORWA 3G5TA 3GLSA 3H5VA 3MD9A 3C3DA 3WP0A 2I7CA 2E18A 1YONA 3EH1A 4LY0A 1DKMA 4EGAA 5NULA 2JK0A 2FZKA 4HDRA 4ETMA 1AF7A 1KJIA 3LC2O 5H83A 2IZ6A 3AINA 4HWPA 3TCXB 5HUQA 2FJPA 4NFLA 3KJFA 5B7NA 4YRZA 4JZYA 1NJ5A 2ICAA 5CFMA 5IJZA 3P2JA 6LDHA 2GUGA 4BNJA 3I04M 1ZM9A 3SI7A 1OSNA 2YRFA 3I1JA 4W9RA 3PGJA 5IVDA 3DKIA 1UQUA 3MSCA 4YAFA 2QU7A 4B8YA 1SCAA 2I03A 3LECA 4HDNA 1X70A 1YMVA 1JEAA 2JARA 3AR7A 3N2GA 1D6MA 3B8EA 3E61A 4IAOA 4R9VA 3RQIA 2C9YA 3AP1A 2K7FA 5CLHA 2JI9A 3OFKA 4AJLA 5KC9A 1X1CA 3OZ7A 3JVEA 3FGOA 1BQEA 3RT1A 3O4HA 2WILA 3EIUA 1P91A 4LZNA 2YHBA 2FSUA 4TXHA 1ULZA 4TS1A 3UJPA 4EJSA 5ITVA 1R8XA 1OB2A 3GDOA 1DMRA 1XYYA 5KVVA 1RBZA 5EHNA 1Z2OX 3CJQA 3G79A 5BPHA 5BR4A 2NT4A 3Q6IA 2BMDA 1OTXA 1RAEA 2BHRA 4Z3DA 1U2RA 1A5TA 2Z56A 3OCVA 4HZIA 4L73A 3D6MA 1I6MA 3ZY4A 5DLPA 5AKJA 2CFTA 2VDRB 4S2UA 2X58A 3HNOA 3O9VA 1VCHA 2JHCA 3DTNA 3BWDD 1BE1A 4YP6A 5HTKA 3WQHA 1GILA 2IHBA 3QF4B 1GRRA 4KN5A 1SPXA 4RH1A 3C48A 3K8OE 4LXQA 2TS1A 4V1CA 3FRHA 4OQQA 4A0RA 1NJFA 3FTFA 3ZHXA 1JHZA 4CQMD 3RC2A 2V03A 3HCDA 5IKMA 2FSVC 1T0IA 1SHUX 5KYKA 1LB1B 1QH0A 1PT6A 3G8DA 3AY3A 4OAOA 4HXEB 1W73A 4PG6A 5JCPA 2PX8A 1AVTA 4DB2A 3PLAE 3IOBA 5LZ7A 4X65B 3NIWA 2XE6A 2NOAA 3FKSA 3IAUA 3WV5A 4LE1A 1VCOA 4K6FA 5CVJA 1VBFA 4XUEA 4OQYA 1VE9A 4FGKA 3D4NA 2K6GA 4PYLA 3DUFA 1H3NA 4XB6B 1S8FA 3TF5A 5A0FA 2ADOA 2IU0A 4M0CA 3ZBPA 5AVSA 3E0XA 3IAS6 4P53A 2LVBA 4Z0PA 4MRRA 3GGPA 5LP6B 4QLOA 5E7IA 2F9LA 1G8PA 1LBSA 5DISB 1OPRA 4BMYA 1AS0A 4CM8B 3BWEA 4GSLA 5G41A 6GPBA 5J5CA 1LFAA 3TMAA 4OU4A 1PGNA 1X1QA 3NEAA 4MWDA 4YJ3A 1W35A 1RDFA 3OLYA 1GAWA 4LJ9A 3SXUB 2QTMA 3K8YA 2BEVA 3OJ0A 3ENKA 3MTDA 4LHVA 4QUAA 2HLHA 1DADA 3LPAA 4NDZA 4AN0A 1TQ4A 3C3WA 1WPQA 2IBTA 4G0VA 2YASA 4Q4JB 1X9GA 1K27A 3PEEA 4D0SA 2GK6A 4FUQA 4G37A 4HATA 3B1VA 4XDGA 2DH5A 1TKAA 2R87A 3PXDA 1RRGA 4GOMD 1EJ0A 3BMCB 3NM6B 3SZUA 1P8JA 4H7KA 2QM0A 5I4KA 1XDGA 2WVGA 3L4SO 1DT3A 3JQCA 4YYEA 1Z38A 4OF4A 4AVYA 1EK0A 4YQFA 5BWBA 4Y18A 3J80A 4M9RA 3W7BA 1H6BA 1C9MA 5BSTA 4Z1OA 2D74A 2BLNA 5FBKA 1H22A 2RH5A 2JIBA 3L9XA 3MJEA 4U0JA 2ZXUA 2H1HA 3BJEA 3LPDA 4XOUA 5LYJA 1XFDA 2Y1EA 3H11A 1K5HA 1Y8CA 4KAXA 5GVRA 4K7JA 5HIMA 2A9VA 4N3AA 1SUCA 1KPGA 3FUUA 2FLVA 4CKEA 1TA4A 2BEKA 2C5BA 5LBTA 2ZYSA 4K2AA 4WOKA 1N5RA 1V9CA 3LQ2A 1P29A 2B6NA 4ZAWA 4KQMA 4I4TB 1GJRA 9ATCA 4C04A 1UKCA 4D1YA 3TFWA 1G16A 4MI1A 4P3NA 1XZGA 5AW5A 1G6Q1 1I7LA 2EG9A 2HLPA 2GZAA 1DAHA 2P78A 2QRKA 1VKJA 2QXYA 1W93A 2Z4SA 5L3QA 1TJ4A 3RRMA 4BJHB 4HSEA 2ZRCA 2PG3A 2P62A 4HDCA 4MULA 1FJHA 2O2GA 2HA6A 1VSQA 3EW7A 4UBJA 3V8BA 4C7JA 5BW8A 3NVDA 3QUAA 5DNWA 1CF4A 5IDVA 4CKXA 1XEFA 1J2EA 3AGPA 4L07A 1Z0IA 2R1VA 4JI2B 4FGLA 1QYWA 5MFPA 1C80A 2WU3A 4RNDB 5CXXA 4DLPA 5HS6A 4UPVA 2B98A 3GAAA 3MPUA 5IXSA 2VJKA 4H2DA 2IHNA 3AUTA 1RLJA 3GEIA 3CGGA 1WUTA 4S04A 3COYA 5D5PA 1A8UA 4UEWA 4ITUA 4D0LB 1JEDA 4BGEA 2BOVA 1R0KA 1EGHA 3O73A 3DKKA 4TL6A 2DAPA 5B1HA 3RVMA 1KI3A 4LV5B 2G5GX 3O38A 2GDZA 3BK2A 3SDSA 4ZDIA 2V6FA 4X1KA 3F9IA 2H18A 2VYND 5CXQA 1NF8A 1E6CA 1NY5A 3M4ZA 3B5IA 4FFDA 4P84A 4RLHA 3TIFA 4E2WA 1LK7A 2FFAA 4AICA 3AOEC 1HM5A 1LRKA 5PNTA 2AN5A 2AXEA 1IHOA 4YQZA 3QF4A 3PNMA 2A0XA 3CWCA 4MX8A 4JB0A 4QPCA 4R8SA 4DYVA 3IL2A 1CEQA 2F9MA 3AUKA 1K6EA 2HIGA 4MQUA 3AY7A 5KX5A 2XF8A 2ZUTA 1Q83A 1SCIA 4EJ6A 1NVMB 3TTUA 4B0OA 4FOTA 4RJ2A 2C88A 4JYPA 2YJ3A 3USCS 1NW3A 4PRLA 1MAUA 4NZYA 5B7PA 3R7WB 2P0AA 3JQAD 1ZSYA 1RYNA 4HNHA 4HUQB 2O54A 4FU0A 3RGWS 4IO0A 2VT6A 4OB7A 1D0SA 4ZEVA 1T6XA 2UUOA 2V0CA 1ZP6A 4BLOA 3ZWWA 1QHHA 1T9HA 5JH7A 2JB9A 1EDEA 2HHCA 4EHLA 1K8QA 3N2YA 1O1YA 4BV3A 4F4IA 3C15C 3NHRA 4DXDA 1BCRA 3GFRA 1YRHA 1MBZA 3CUYA 2OFFA 3RRYA 3VR4A 4YDQA 4PX3A 2HA3A 5KUTA 2JFVA 1Q12A 5HQ3B 1VPWA 2OP0A 3CZPA 3KTDA 3N75A 1RYBA 4UM8B 4EJMA 5J2TB 3K70D 1Z5UA 1M1YA 1SUPA 1U4NA 4MQFB 1PT9A 4RFSB 5HFNA 3UAOA 1UJBA 3U48A 5KNLA 4XRRA 1SOUA 2YYAA 3BD9A 1K7CA 4ZEWA 1KEPA 4Q48A 4KI0A 4BO8A 5E95A 3A25A 4M1ZA 1M0WA 2TRSB 3K0AB 4NBNA 3MBKA 5KYWA 2ZKIA 5J2UA 3DOOA 2PH1A 3B70A 1E2HA 3GEGA 3TE6A 5LXTF 3T61A 3EB9A 3D43A 2L18A 4JC4A 4NJMB 1SXJC 4CRWB 5KQSA 3F7TA 1ESEA 4X62B 3HXQA 4JP5A 3EIQA 3KDPA 1RI2A 4CLHA 1VE3A 3IB3A 1MU0A 4BFWA 5WRFA 2HCTA 3OLVA 1N8KA 1JTEA 2BM8A 3SWWA 1ZJYA 3AI2A 2Q8PA 1QFXA 2VJPA 3QU2A 5CYFA 1DQPA 1DNPA 1MJFA 4O4LA 4UJ5A 4EJ2A 2GARA 2VJCA 4MPPA 4Z0TA 3B78A 3F47A 2VL7A 1Z33A 1AZLA 3EGEA 2G77B 3MJRA 1QTQA 5K3FA 4EITA 3K05A 4A23A 4BQOA 2JW5A 4B6GA 2XDAA 1MGPA 3E7FA 3DB2A 3LW8A 1O6FA 2IEGA 4M9SA 1ONOA 4N6GA 3F4LA 1G20A 4M0EA 5EA2A 3COJA 3D2CA 3HLKA 2C2ZA 4N0EA 1SUSA 4QNMA 5KYTA 1EDZA 1BA3A 2IZ5A 4RQTA 1HYEA 4GG1A 2P91A 4KXVA 2QL9A 4HS4A 3NHZA 2WJHA 2C5AA 4LJ6A 5FPQA 3BL6A 2ABWA 4RVHA 4EG6A 1I2ZA 4WLVA 2FH5B 5BSEA 2AZXA 2G25A 4LX8A 4EG7A 1KA9H 1A5AB 3BULA 4GE3A 4K9NA 4W1PA 4Y1EA 5GWXA 4ESOA 4KE7A 4YRTA 5LU9A 4X7RA 1RJGA 2HV8A 4Y6RA 4PC1A 5CVTA 1LNQA 1OREA 5JR3A 2O2EA 1Z4MA 5HKBA 1E7SA 3MJSA 2O5CA 3G0GA 3DGEC 4HWGA 2FY8A 2Q4OA 2RCNA 3SZ3A 3UAZA 1GNTA 4QQFA 1QGOA 1TJYA 1TT5B 2CFCA 4JP3A 4F3RA 1RIIA 1U3FA 1KPIA 4JELA 2NP7A 1VBNA 4H17A 1YV9A 3OIDA 1UFQA 3C14C 4EDHA 4CFYA 4M55A 2G4LA 1YL7A 5FNVF 3V2HA 1CY6A 3FFBA 3CT6A 4UHFA 3CS3A 1QF9A 3GRCA 4X64B 4L4UA 4F2GA 1SRQA 3V1NA 5C9ZA 2XKKA 1FYWA 1I3NA 4D26A 1Z12A 3P2YA 2QTNA 3LCRA 4U39A 3QNWA 5F78A 3TRFA 2JAOA 2R4TA 2E6UX 1C8KA 5HEKA 4BNLA 1FJXA 2HUPA 1MRZA 1KFBB 4XCQA 3RNOA 3CRVA 1BHSA 4IDFA 2F48A 5IUJC 4EKYA 3OP1A 5DXFA 3MTGA 5EYPB 2J3LA 4PYOA 4YAJA 4X63A 3V7FA 2R6R1 2WYIA 3GWGA 5JW6A 4N41A 4HGQA 5CLQA 3DMDA 5IDWA 3BGIA 4IX9A 2QXUA 3E9YA 3OIVA 5ERYA 2Q2VA 4L4ZA 1N36B 3GGJA 1U2QA 2H2GA 3WYBA 5JSUA 2CC2A 3K94A 1QO0A 3D4OA 5CITA 1ID8A 1DTWB 4QDUA 2ATVA 4LVCA 1SVWA 2XE8A 3ICPA 4RGVA 1M1UA 5T4HA 1K8RA 1HDYA 1G0NA 2YZGA 1V6AA 2Y2VA 5KWVA 2C9BA 4ND8B 1LSOA 1WY5A 1WP4A 1TD9A 1ZOOA 4D8VA 3G2KA 2BSAA 4MYDA 4RD0A 5FLXA 1D4ZA 3EPLA 3BHNA 3V4PB 3VTKA 1KFKB 1QR6A 3E48A 2I6FA 3LP8A 3R5JA 2IU3A 2LWIA 5GV8A 2Y0BA 1S7CA 2Y9PB 2IYYA 2O52A 4W5RA 2A30A 3MQ4A 4WZAB 5AHKA 5EJIA 1G2PA 4MQLA 1MXFA 2V5VA 3N70A 4EECA 2WJYA 1RADA 3THWB 1OBFO 3T3MB 4DA0A 1DXYA 4H7DA 4B3BA 1KQGA 4Y2RA 2YWDA 4FI3C 2Q3DA 2NTNA 3WIUA 1TZMA 5DCYA 5TR9A 1JH9A 4IIDA 5LCXA 1Y3FE 4TL9A 2DHDA 3R20A 1CDEA 4ZMRA 2KS6A 3VU9B 3KLNA 4XVRA 3PUZA 4JLOA 1CUSA 2QU8A 1Q7CA 2JVIA 3IJRA 3LZDA 2P2GA 5IRCD 2GEUA 1N75A 3DE2X 3RI3A 3OPYI 3G2HA 3ZU3A 4CDRA 4G26A 4RKEA 1KKMA 3F46A 3AETA 3DAHA 4MVJA 3G8CA 3KV3O 2FTKE 1Y37A 1DPGA 1NI5A 3FDXA 2C4MA 3N2ZB 4JUIA 1EWQA 1U3VA 1MVOA 4ESHA 1RAHA 1P73A 2ZSEA 4P4UA 3RWMB 3BCUA 4C5BA 3ZHTA 3S27A 1JXQA 4DCPA 3ANMA 5ED0A 1XZFA 3B3AA 1F2DA 2QRVB 2IYWA 3L7BA 1L5NA 2PGOA 4AMZA 1LQ2A 2EL9A 4YK7A 1J9GA 3T7KA 1O8BA 3IELA 4CHGA 1W48A 1NKSA 4WLUA 1A69A 1CZLA 2ZTVA 3VOSA 5DW0A 2ODNA 4A4DA 3EPPA 1OYYA 1K86A 3MMNA 1F2TB 4J07A 2DSNA 1MB4A 2Z0MA 2PMEA 2WTBA 3WA7A 1HLFA 1HT2E 3AL0C 4ZC8A 1WE2A 1DIRA 1WP9A 2NUTA 4DCNA 4LNUA 5FIUA 3HG7A 2VH1A 4TT3D 5FBWB 3GA7A 4JJIA 1XZHA 4ROSA 5JCXA 2DTEA 2EW2A 1M73E 3OMWA 1RHKA 5ICMA 4PZLA 3GEBA 4NR0A 3NAGA 3C7CB 3E53A 2FPRA 3BEOA 1RQLA 4B17A 5E38A 2AZDA 4KMRA 1YQXA 1XPJA 2ZDQA 4Q3OA 5DBHX 1N6OA 1YBVA 3ABOB 4QXMA 4KPEC 1XTBA 2H4FA 3F7OA 3JYNA 2PE5A 4OI4A 4URUR 3SJUA 4RFVA 5C8YF 1DP4A 1CZRA 1YR9A 2AQKA 2G8NA 2I7XA 1SOMA 2O7SA 2G6TA 3AVPA 3ORRA 3Q7TA 3QVKA 4JS0A 5DNAA 3ZLUA 4H08A 3DV9A 4MK4A 3Q8KA 1IVSA 3W5VA 2QKYA 4UTRA 1PW5A 4FCTA 3JZDA 3PXEA 4O4HA 4R1PA 4P08A 4AJKA 5JXJA 4LYJA 4CIYA 4RDXA 3DM9B 2I4MA 2FJ0A 5HIKA 1TYEB 4ROTA 4NG4A 2IS4A 2IHYA 4LRUA 5DHQA 1CDZA 5JY6A 3Q7IA 3CMCO 1X80B 3DYIA 2JJQA 3WWPA 3KOYA 1YF3A 3M0EA 1Y9DA 3TQOA 1FFWA 1K7XB 4D9KA 2J5KA 3VJRA 1NJGA 4ZOEA 1AKYA 5REQB 1C7IA 4DMLA 4I2VA 2ZR9A 3ZX5A 1MX3A 2EXXA 2GH1A 2P4UA 3GD5A 2FETA 4TL7A 4N3BA 2J0SA 4O29A 4BOYA 2M1XA 4EGQA 4FHZA 2LE0A 2VBCA 3DCNA 3HJRA 3ICCA 1JEQA 4OSPA 4U3JB 5C0OE 4ARBA 1JR4A 2O3RA 1AMOA 3FWKA 4DZZA 1IWOA 5F5LA 2I7VA 3I9JA 1QTNA 2Q9AA 5CT6A 9GPBA 2XWPA 1YI8A 2EFYA 1ZAYA 3QG5A 2NU8A 1N2CB 4OQZA 3F71A 4M88A 5IP5A 3EODA 3K1AA 3PENA 4OA5A 2BJVA 2VBFA 4AMVA 5E7MA 3N76A 4O8ZA 3QWBA 5L95A 4DSTA 4ZU1X 2IXBA 4BO3A 2E5WA 3IXQA 4KNWA 4X1YB 3STUA 3E5MA 4DF3A 4KMMA 4LWQA 2ST1A 4ZCPA 4B85A 1YKFA 4OTZA 1MCZA 2XADA 2RIRA 3OPYA 1WKBA 4QYIA 1UOQA 4XIYA 4BZPA 5C7IO 2EJTA 1JDNA 1UJ2A 1DVRA 4KI7A 4L27A 4FHEA 3UPTA 1P17A 1F4VA 1HDRA 1X1TA 3CPSA 5EHQA 2X0JA 1J9ZA 3PWTA 4JASB 5IM4F 4HAUA 1WDLA 4JQCA 3R74A 2JLSA 1EFUA 2NU7B 2WNIA 1C3OB 2YXEA 2W6CX 3L46A 4ECAA 2SCUA 1NUPA 2V7PA 1IQRA 3CLHA 4FHGA 4IVNA 1R88A 4IXWA 3S2UA 1T6NA 4QNNA 3O90A 1R6BX 5DM70 2YHIB 1NOJA 4PLWA 4TWAA 2GNPA 2VP4A 1RPAA 2ZI7A 5SY6A 4YMWA 1JLLA 2CVZA 4ZYTA 2PZJA 2IXAA 4QIHA 4GU5A 3AJ9A 5JI2E 3G9UA 4PZ9A 2XB4A 2ISQA 1HDGO 4UHJA 4O2AB 1UXJA 3MTEA 4UBMA 1C4WA 4EELA 4EB3A 3DW1X 4MNTA 3RTCA 3T3EA 4ZALA 1FTYA 3E22B 4JGGA 4TM8A 1ZR4A 3OOWA 5IYZF 2OENG 3ZTTA 4WA8A 5ES3A 3B9RA 1B8UA 1WPGA 3C5EA 3PUHA 3GLHB 5U4XA 4TYPA 2D1RA 3FH0A 3EIWA 3JQPA 2B30A 2OCLA 5DPMA 4HZUA 3GR6A 1EZ1A 4MGHA 3RVNA 4Z7JA 1DBWA 2P9GA 4RHUA 1C81A 1E62A 3SDZA 1I2DA 1N8TA 2L69A 3O0DA 4QQKA 3BCSA 3ZIDA 4BLWA 2HHLA 1O89A 2H07A 3A6GA 5G53C 5L45A 2MSKA 2ZSUA 4RSRA 1DWUA 3LXXA 4Q4HB 3MQ2A 2BD0A 2PK3A 3I9LA 2YYZA 5J5AA 1EBUA 2QRVA 2RJ3A 4MWOA 5F7OA 2UDPA 4N5DA 1JR3A 4HK4A 1K4YA 5KKAA 4Y1RB 4W8HA 4HGOA 4D9MA 5LQCA 4BE4A 5AVZA 1F0NA 1VHLA 2XCLA 3K4PA 1MIOB 2J67A 3NNDA 4DIFA 4IDNA 4DLXA 2UYCA 1UWCA 4N4AA 2V3CC 3EOZA 4WZBA 1TVKB 3ZS9A 1O6ZA 1PRYA 2GYWA 1J4AA 1GR1A 4A5SA 5FPHA 3IMFA 2XWQA 2YC4C 3EQ2A 2G82A 4L72A 3GT7A 2N46A 1KQFA 1EDDA 3ENZA 4YMGA 2Z2IA 3PUWA 3ML1A 3KKQA 2ZM5A 1C9KA 2PRYA 1EFHA 3CH4B 3VUFA 1U9CA 3SR4A 1TIKA 3AK4A 1PJ4A 1T43A 4QA9A 4CL0A 1GGMA 1HEYA 2XYHA 3OTOB 2PUGA 3WG9A 2Z58A 2HJGA 4INZA 5LBUA 1ZD5A 1UMDB 1AQ6A 1PUIA 4MEAA 5JCOA 3SXJA 2HFJA 3KKOA 2PZKA 3K3PA 1QE3A 5KHAA 3DOFA 2B4QA 3ZNPA 5EZSA 3D7SA 1VRVA 2OHIA 3GD7A 5BNFA 3KQNA 2HBZA 3L40A 1PD0A 2WUGA 1FLAA 1FRNA 3D6NB 4IF6A 2PN1A 4LKOA 4N9QA 4DMCA 2XZOA 4TRRA 1YQUA 3NRBA 1LBQA 1PIWA 3BGWA 1IK4A 3WL6A 1XWWA 2C3UA 3AKDA 4S1TA 3ETLA 4ZHSA 3FUTA 1JU9A 2I1WA 5P8WA 4YT8A 1DG3A 3OD5A 1A27A 2B9VA 3QFSA 4D8WA 1QRAA 1PUJA 1VL5A 2N1MA 3SQWA 2ZBEA 1NRXA 1IN5A 2X22A 4K1LA 3UXMA 2FSVA 2WPNA 3QEMB 5IAJA 4ZIRA 3BRWD 5AW2A 1UWKA 4ZAVA 1ZW1A 3LNTA 4PGHA 4XJSA 3A4MA 5TMBA 1O58A 2FDCA 4LE0A 4BDTA 1UKZA 1Q0PA 1NBEA 3I45A 3CY6A 1D1PA 1UIRA 2WM8A 5D51S 1NOIA 4WESA 2WIGA 5JRJA 3QSYA 1OX4A 1TUEA 2E21A 3C74A 3I01A 4UHDA 3REOA 1E59A 1JEEA 1YK1A 3DF7A 5AM5A 3SVZA 3RLFA 3C7TA 3RSQA 1E2DA 2H17A 3KPYA 1XWFA 4MKIA 4RPGA 4A15A 1GM5A 1KO1A 3MXTA 1V3QE 2NUBA 4MRSA 2SNIE 4RMJA 4X6XA 4WL0A 3FVQA 1L2TA 3AL2A 1NFFA 4P4TA 3TNYA 2NYRA 4EA9A 5E6RA 1G19A 3RRFA 2EX4A 4U9UA 1GRQA 4U9IS 1BH2A 2ZAIA 3GPCA 4M0DA 4AC9A 1WHSB 3D59A 5KQLA 1IDN1 3R0QA 4YJKA 1GYRA 2R1ZA 2R751 3KJHA 2V7QA 1SB9A 3R5KA 3HXKA 2DF8A 1CRWG 1O6GA 1RHMA 2JGEA 2C9OA 2ZPUA 4YP5A 4CR6A 1KP2A 1QVRA 3LKBA 1T8RA 3NQ41 3PK0A 4KO2S 1HQYE 1Y8RA 2X14A 1YMQA 4HQ0A 4RL4A 3RV3A 5JWHA 4YQYA 1G60A 1LXCA 2A3RA 4RDHA 1H5QA 4CMKA 5ES4B 2EFCB 4DG8A 3LTNC 1DX6A 1NVXQ 2AW5A 3NYQA 2K5UA 2P4SA 4FYKA 4QXPA 2IDZA 1W6UA 3DAYA 4JLAA 3WLPA 4HMPA 2Q6VA 1QK5A 3DE5X 2DG2A 4G81A 5BN1A 4KV9A 4LSZA 3EFBA 4IOKA 2PVSA 4EI2A 5A7FA 1M2KA 1HQKA 1V5IA 2DTDA 4QXQA 1RXUA 2PSSA 4E5SA 1JWBB 5JYEA 3X44A 2BDTA 1TM4E 2RBKA 5DI3B 3AGQA 5FOWA 1DXOA 5J2UF 1WSDA 2JJ1D 3HCWA 2WHRA 3TE7A 1F6DA 1Y9AA 2Q28A 3OO1A 4CT4B 2I29A 4UUNA 3T9BA 4DEXA 4G67A 1SGWA 2B99A 3NT2A 2ALJA 4F38A 1GL9B 5BR8B 2WHXA 2J3EA 3V8NA 1P2VA 3C3YA 4BBAA 2NZ2A 2V0GA 1VP9A 4NMMA 2HM7A 2QT0A 4I3GA 4Q16A 1X6VA 2FPIA 4XWAA 3CLRC 4QPNA 1LPSA 3JPYA 4GICA 4MIYA 3SHFA 3DMGA 4Y2SA 1DWPA 2OBFA 2YZKA 4DDUA 1H8EA 1U9IC 2FDXA 3WAJA 3KSZO 1GT6A 2EKQA 1CVLA 5EUBA 2DEUA 3QVGA 4IXMA 3OT5A 3Q3HA 2JAPA 2JLRA 2HWKA 5CAEB 1CSEE 2P9EA 3PIIA 1QLWA 2JFFA 4UAJA 1I5OA 1OA1A 1U7XA 3UEOA 4CTMA 1CE8A 1MQSA 2QL7A 3GNQA 4ILKA 3U4GA 2JFQA 4DXHA 1MQ9A 2A5YB 1NN1A 3TIIA 4XDHA 4GX1A 3HJGA 1OZGA 2XDYA 3G0BA 3W4JA 3NKLA 3GJ3A 2MINB 2NZWA 5EUMA 2JJ8A 4INJA 3H1FA 4B4OA 4GRAA 1GNPA 3W2IA 1ZU4A 3WKCA 4W63A 1QZUA 5EJ7A 1DCMA 1W52X 1MIHA 3MJTA 4G5RA 4IUBS 4DMMA 2X9LA 4XQCA 3AESA 3R6WA 1CUDA 1HWYA 4JJZA 5JSFA 2P6RA 4PTLA 3ES9A 3PGLA 1J21A 5GINE 3H1TA 1NKVA 3DHWC 1T0UA 3PU6A 4MJLA 4R31A 1EFRA 3FZQA 4LZLA 4L4RA 1BN7A 2G88A 2QMHA 1JJIA 5BO5A 5LP6C 3OAAA 4BMCA 1GNSA 1JNYA 1NSFA 1T1EA 4PQRA 4GRIA 4J7UA 1Y5NA 2JFZA 2ZBGA 4HEHA 4RGQA 4M49A 1HOXA 1N1DA 2I1QA 3BGOS 1SURA 2IEYA 3H99A 3JQFA 4HNRA 3DFMA 3FOZA 1T5OA 3KKKA 4REQA 1SXQA 3T34A 1KS9A 3MWDA 4YX9A 4MTCA 4URFA 2QZZA 4S1NA 3AB3A 3WI7A 3PC8C 3OT1B 4K6GA 4RF5A 1RQ2A 1YO6A 1KDYA 5LUBA 4MAAA 5KAMA 2B4RO 1D0VA 1DI0A 1G2QA 3KU4A 4FIDA 1XCOA 2NSYA 4ZO8A 3CZRA 4P8RA 4C1BA 1RCTE 1U8ZA 3OE4A 4MCHA 5JOQA 2G0TA 4UM7A 5CFLA 3KKPA 4FN5A 4PGFA 1KR5A 2CW5A 1GUAA 3PNQA 2DWPA 4CMCA 3ORHA 3ZOZA 4CT0A 2CLFB 1R4NA 3KDAA 4DJDC 2CBZA 4DR3B 4HFRA 5JSZA 3KXDA 3I4CA 5H8WA 3AEZA 4PNPA 1M8GA 2JI4A 4HNUA 2IK8A 2XTJA 8ATCA 3IKVA 4WLOA 3QY0A 5D86A 5JXGA 1BD3A 1RZVA 1Z0KA 1A9ZA 2ZI3A 2AKAB 4F85A 2PKQP 4WXRA 5FTLA 2I4RA 1NQAO 4CIWA 3U61B 2C3MA 3DKVA 1G66A 2QE6A 3M1AA 2POQX 4ALKA 3FZGA 3RVBA 1Z2NX 1G17A 3NCHA 1RRFA 1JSXA 2D1QA 1AS3A 4L5IA 2ORWA 4NU5A 4C89A 3BBLA 2JCYA 4LF8B 1FP6A 2VZLA 1IY1A 3S1LA 1ZO8A 3T1NA 2G1UA 4XWGA 1FP4B 3RS8A 4DV0B 3JYHA 4K3UA 4OLBA 2ZLBA 5AO9A 1RE0A 5FP0A 5KYYA 2VQSA 4RU1A 1CY8A 3I4LA 1MO2A 1GIAA 1QV7A 3HP4A 3OQBA 3Q40A 4RW0A 3VZCA 2OZVA 5IT4A 5JLJA 4JYZA 4HB3A 3S99A 1FTQA 4YO7A 5HJ5A 2PKXA 4ZO4A 4A8TA 1Y4SA 2NSLA 2PMCA 3BWXA 2GO7A 1TO1E 2FWBA 3HKCA 3I05A 5EMJA 2EX0A 1I6LA 3NFRA 3CRQA 1JR3E 3ZZTA 3KP1A 3ZXYA 4NBRA 5BQ3A 3R9XA 4E3WA 1RHUA 2EP8A 2Z4RA 4J3FA 1X38A 4JYCA 2MWMA 3GZTB 1TF2A 3F1KA 4WK2B 1GU0A 1PFYA 3CRNA 3UPDA 3QW2A 2IBMA 4LC1A 3L7AA 2O7VA 4P5DA 5DB4A 4CEHB 2DFTA 5CW1A 1P7WA 4F12A 1M0EA 3GRZA 4QFMA 2R60A 3GYGA 5F12A 3WHPA 1SVKA 1FYFA 3BD7A 4DEYA 2ZZNA 1PQ4A 1H3EA 4BNFA 3NANA 5AMXA 3ZY3A 1KBZA 3GNLA 4HUJA 1UDCA 2H11A 2VRWA 5DRTA 3CE9A 3N8HA 3F8SA 2DH6A 4G9EA 3C7KA 1YR8A 1XP5A 4NFYA 3H3JA 5B37A 3KHUA 1MX9A 3DUWA 1H1LA 4C07A 1JG1A 1KJQA 1VSTA 1L1FA 4EPYA 4P2BA 1W30A 1ORTA 3ORFA 3UMGA 2YXPX 4JA2A 5KKNB 3K1ZA 1QK4A 3Q2KA 1PI3A 3T1QA 3X43A 1ZD3A 3PHCA 2NYUA 3HWX1 4DY4A 4LHZA 3UJNA 4W99A 1P0FA 2SKEA 4KN6A 1EG7A 2AK2A 2VDWA 1ZBDA 1NG9A 2FJUA 4EFKA 1OAOC 3QYFA 4ZAGA 5EJ4A 1T2UA 4QXAA 4ED9A 3LDGA 4MW9A 2P0EA 5EJ9A 4X1KB 3MWYW 4ZVPA 1RJDA 4IIJA 1IB0A 4QUJA 4QEDA 1KFCB 2XUIA 1W4ZA 2VJYA 4ARIA 1Y3DE 3LQRA 3K7EA 2NU9A 3OJWA 3ABQB 4AK9A 3IVCA 2OFXA 4XYGA 4FN4A 1KAHA 3RGGA 1N2OA 3LLMA 1UCFA 2L0XA 2EJBA 1BH6A 4YDSA 5EP2A 5SYAA 1IQUA 4R1NA 4YCNA 5D87A 5E6UA 4AO6A 1DEAA 4GF5A 1N77A 2YJ6A 1GZ5A 5CVDA 4H7JA 3T4EA 3TFQA 4O8CA 5JPIA 1C3JA 3L77A 4GP9A 5H82A 4XIJA 1JKJB 3PJGA 3BMNA 4F72A 1LI4A 5I45A 5A5DA 2WW8A 1KL7A 2MSDB 4RTRA 4UMEA 1M2NA 4MICA 5CCBA 3A1UA 4TS3A 4GI3A 4ARUA 1A1VA 1UAGA 5J9FA 2J4FA 1M2OA 4DBVO 1AKQA 2JG3A 2RGBA 1NF9A 3O47A 2Z04A 3EULA 2PD3A 4NBLA 5GP1A 1KSJA