1MMFB

Crystal structure of substrate free form of glycerol dehydratase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
181
structure length
181
Chain Sequence
b'FTLKTREGGVASADERADEVVIGVGPAFDKHQHHTLIDMPHGAILKELIAGVEEEGLHARVVRILRTSDVSFMAWDAANLSGSGIGIGIQSKGTTVIHQRDLLPLSNLELFSQAPLLTLETYRQIGKNAARYARKESPSPVPVVNDQMVRPKFMAKAALFHIKETKHVVQDAEPVTLHIDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glycerol dehydrase alpha subunit
publication title Crystal structure of substrate free form of glycerol dehydratase
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Lyase
total genus 56
structure length 181
sequence length 181
chains with identical sequence E
ec nomenclature ec 4.2.1.30: Glycerol dehydratase.
pdb deposition date 2002-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 1mmfB00
1IWPB 1MMFB 3WB0A 1EGVB 1IWBB 2D0PB 1DIOB 1NBWB 2D0OB 1UC5B 3WB1A 1EGMB 5D5QA 1EEXB 3AUJB 3BRCA 3WB2A 1UC4B 5D5PA
chains in the Genus database with same CATH superfamily
5AVRA 3GRUA 4BV8A 2X0DA 4LRYA 4QFDA 3LFUA 4DJ5X 1B2RA 1T0UA 5E6UA 1EZZA 1TCAA 3A3KA 3Q5EA 4PG5A 1RBYA 5EZYB 5K6AC 5TPWA 3QVXA 1JJ7A 1JYFA 2YV5A 1PGPA 4J0HA 1OREA 3DWIA 4MUKA 5JXIA 3TLKA 4EYSA 2GK4A 2H6EA 3ECSA 1F51E 4D8UA 3OIWA 4DIOA 2CXQA 2AWNA 3D4LA 1MZPA 3OIDA 4E5SA 1EGQA 1P39A 5CDFA 3SE7A 1VLHA 5F3WB 3ZDAA 1Q91A 1VMIA 2FU5C 3FDIA 4JSYA 2C7QA 4Z9BA 1ZH0A 2ZZNA 1E2KA 1P4AA 1QKIA 3H6HA 1DLJA 2GM9A 1MPXA 2YNMC 5LU9A 5JLJA 4WZZA 3MFQA 3U7HB 2B0CA 3GRRA 2D7DA 2V9CA 3ROTA 3PRYA 4WJLA 4B3XA 1PQYA 1D9XA 4WLNA 2HPHA 3DLCA 3MMZA 3F6BX 2QN8A 2QAIA 3KTOA 4MKGA 3WXMA 2P9ZA 1GDHA 2WDZA 5BT8A 3VX4A 2FEKA 2HHCA 1LH0A 1LUAA 4A7PA 4BFUA 1Q6YA 3KFLA 2F55A 3ODPA 4E12A 2EX1A 3VHRA 3PNQA 4P0QB 3WGZA 2VHQA 2YL2A 2PQ6A 1U7DA 4Z0NA 5DBEX 2I78A 2YXEA 3QYPA 4C76A 1OAOA 5TLSA 3TJRA 3OURA 1SU6A 3FR8A 2EFYA 3F97A 4AN1A 3W3ZB 1XEXA 4NTZA 4OI2A 2M1XA 5EJ7A 5IDWA 3NFYA 3MQFA 5A1JA 2IS2A 3V00A 2EFCB 4ESOA 1QMGA 2JFQA 2V4MA 5I9NA 2CV0A 2FFHA 4G3XA 4N4AA 4EEZA 4V2UA 4TTPA 4C6RA 4Y2HA 3DZJA 2CEAA 2J6BA 2XA9A 2V45A 4L0DA 4KYUA 3PUYA 1LFDB 1TZCA 2VPTA 1RD4A 1NXXA 3D3QA 3PJGA 2WVGA 1IBLB 2NU7A 5FHQA 3NIBA 1FU4A 3OECA 1QO0A 1XDDA 4QULA 4NICA 3F6PA 5LYJA 1MV5A 5H5JA 2OCLA 5AM2A 1AKVA 4WGGA 2A94A 3M6XA 2GBCA 1QV6A 1T4CA 3P96A 1UPBA 3L4BC 1PVDA 1SZCA 3MILA 3HA7A 4PYRA 2ZU0C 1XAIA 4CTNA 2GI4A 2UVPA 3KYCA 5F3RA 4OBBA 1BAPA 1AGNA 3IJEB 3LW7A 4HYEA 3RVNA 1PZGA 2HCRA 2IPNA 1AJEA 2VYCA 4UTXA 3K9HA 1H42A 4C7OB 2C58A 3N53A 1E3SA 2FV8A 1CP3A 2JCGA 2RCYA 2B9EA 2JFFA 3DEKA 4BRZA 2Q4DA 5JNVA 4E1VA 2KHZA 2ODQA 1EM6A 3CR8A 3LTEA 1X8JA 2HFJA 4G6ZA 4QXAA 3LXXA 4DCCA 1W4LA 5EHZA 5KOJB 5CD1A 4FP9A 4YWJA 1OBFO 1I3KA 2FG5A 1YUNA 5E0KB 3AEKB 4WOBA 2EV9A 1JEAA 2HSJA 3D2CA 3MJVA 3RK0A 4CUKA 1PCXA 3OZIA 1RXUA 1ISSA 2VF4X 3HL4A 4UOQA 4I2VA 4D92A 3A6FA 2GHIA 3UWSA 2O2YA 1N2SA 2ZAGA 2VBFA 4KLZA 1OH6A 1WG8A 3HCOA 3TLJA 2JGIA 2RGNC 4JI4B 4JWKA 1GGEA 2ZR7A 4D9CA 2HHJA 4UNNA 2IXAA 2XTMA 4Q1EA 4TSFD 1C9MA 4N47A 4EY3A 1UPFA 2PMBA 3GWGA 5E9WA 2GO1A 4O4LA 4PWYA 1Q74A 4WXRA 3QVGA 4K88A 4JNCA 3A10A 5ADHA 3KHUA 3E7XA 4OM7A 5IDQA 5K6AA 2WI8A 3KSZO 1G5TA 4B43A 2JCYA 2AI3A 1JAHA 3BE6A 2A1IA 2C00A 4LHEA 3OCXA 3RAGA 1QMPA 2VNAA 1PJ3A 4DQVA 5ULLA 2D2IA 4OH1A 3DB2A 2Z3VA 1DPFA 4BFWA 1NURA 1ORTA 4DLKA 3ORHA 4EYQA 1Q7TA 4EKNB 3Q88A 2HRRA 1UIRA 2GHRA 4AIRA 2YNMA 1XN1A 1G5PA 2CJWB 2KPOA 2C07A 2O06A 3D3WA 4FDUA 4KIWA 1S7GA 4DW8A 2HQRA 3A6GA 3W2TA 2ACWA 4GRIA 5LQSA 1C9DB 2N1MA 1R2QA 5C3MA 4RFSA 1FTGA 3TQHA 2EFDB 2OOKA 2PN1A 2X8LA 5EQJB 2NTYC 3HBLA 4OQPA 4BVKA 2VTBB 3QF4A 2EEPA 4F06A 4G8JA 2JHCA 3DMPA 1TYAE 2IC5A 2ET6A 2SECE 4YDSA 3G5TA 2HQ1A 1GV0A 1G7SA 1I4EB 2FZGA 4W6QA 3A6HA 3OVMA 4KQEA 3WGGA 3E82A 5JAIA 3FVWA 4FILA 3FCXA 3UGKA 3DBHA 1W9HA 1RYHA 2XWSA 3BX1A 4RORA 3M4NA 4YJHB 2X3UA 3BTSA 5DHTA 1HH4A 1KOGA 4RXMA 1A7KA 3ZC3A 1QP8A 1HDCA 1VJDA 3A9VA 3E84A 4RAQA 5FWAA 4C04A 5IG2A 2NZUG 2MINA 2N1BA 3E3NA 1YWGO 4OYHA 1ISMA 4B3GA 3BERA 2RHCA 5CH5A 3DFMA 4PSUA 5IS2A 3HJGA 1Q57A 4CQJA 4TYYA 2HJ9A 1U2GA 4NBVA 4PONA 5IYZA 3GRZA 2JL1A 1KZYC 2YOGA 3O2JA 4QAQA 3BA6A 3HVUA 3PTLA 4K1XA 3I6QA 3DXYA 3ZYCA 2VBGA 4RIGA 4M9SA 2PIDA 4J91A 1F48A 4U2KA 2ZIXA 3PPVA 4XGIA 3IBTA 1NSYA 3I1JA 3S2SA 2V58A 2AXEA 5GVRA 5DLYA 4AZ3B 1K6MA 2WTEA 4BNNA 4INJA 4CLOA 2BMJA 3URKA 3ZNNA 4GI2A 4AMBA 5A0TA 3X1XA 4WZAE 1S02A 4YRPA 1N3BA 1VKNA 1Z2AA 2DWUA 2WP0A 1XTKA 2AN5A 3RJZA 3E9RA 2PFGA 2XKBA 4OQYA 3AV0B 5DYTA 1A9RA 2P2YA 3Q98A 2YYZA 1V4NA 4JOCA 5M2QA 2HNAA 1G38A 1SUWA 4JK3A 2HUNA 4N01A 3PLRA 1NM5C 4JT8A 4N5DA 3UXMA 4UEWA 2Q8PA 3WO1A 4XR4A 4QNNA 2FOIA 3HLYA 4BX3A 1KEKA 4RESA 1JNYA 1MA3A 4BFXA 2G4VA 4OQFA 3E0QA 4ZQFA 3SE0A 4C0AC 3NJ8A 1IXZA 3O94A 1YR9A 1T43A 1YFKA 2RHBA 3DOHA 3QVMA 2VP0A 3D2AA 3JR3A 4G8BA 4LOIA 5D6OA 1CUWA 2IU4A 1IPEA 1U8AA 2YV4A 4QLBA 3A32A 2QSJA 2ACVA 4URHA 5KDLA 1XCOA 2YWRA 4ARIA 4UZEA 3CR7A 1B42A 1BHSA 4EY7A 1S5PA 4JL8A 1GKIA 1OLXA 3PNOA 3DPIA 4TMZA 2WWWA 3PKIA 3RE1A 3BRQA 2VPPA 3UV6A 1HURA 2ZS8A 5CB8A 4MRRA 3UWOA 3ABIA 4IQ0A 4B73A 1H66A 4G0ZA 3EVAA 1XNHA 1P8AA 3D5QA 3IB3A 2AW3A 1H8HD 1PBNA 3NIWA 4MS3A 3GNSA 5FP0A 4EHBA 3W2EA 5ADUS 8MHTA 2UZIR 3D7KA 3JTMA 2COUA 2KS6A 1PJBA 3CZAA 2E0IA 4I4LA 3EDYA 1YJXA 1T5HX 1VCIA 1A7AA 2NZXA 4ZO8A 3RASA 3GL9A 3PNLA 3L8FA 4WSOA 3CNLA 2QQEA 3CZCA 1GSIA 4OQQA 1GTRA 1C3XA 1XDUA 1S2NA 3PA6A 2POQX 1RCFA 2G6BA 1A4XA 3K2BA 1PJQA 4OQZA 1X7WB 2BR5A 3DF7A 3EFOB 5MF6A 2EJTA 2BFBA 1Y48E 2P2DA 3FPCA 3S8YA 4YAOA 1KS2A 4Z1OA 1A5ZA 4YRLA 1QRAA 1Z4KA 4FEEA 2BN4A 2QIPA 3TKAA 1D3AA 1F1BA 3HKDA 3L2OB 2GSWA 1NRWA 2IEBA 4C6HA 3OY2A 2H7CA 4GECA 2EERA 4QBKA 2BEVB 4JBWA 1X1DA 4EPTA 3UG6A 2I3ZA 4P4TA 1JHPA 2FW0A 4MYDA 1EUZA 4LE2A 3SSOA 2AMYA 5IC4A 2D7CA 2OILA 1XTVA 7GPBA 3EZGA 5DRYA 4JXXA 1EFCA 2BEJA 1XFAA 1HOXA 3UW3A 3VVCA 1UBGA 5KMGB 1XRJA 3MWYW 5F3DA 2N3ZA 1BD4A 2CXPA 4MWZA 3TNDA 5K2OA 1CHDA 4UUMA 1U80A 2W2KA 1GCOA 4QTTB 4B84A 3QBEA 3CIFA 4ALMA 3F6RA 3DL0A 2UUCB 1SXQA 3IP8A 3NAQA 4QDUA 1QYXA 4NRDA 5KPJA 2R0QC 2G1PA 4JC4A 1U63A 1ODLA 1J0AA 1KH3A 1TJ5A 2A67A 2G9ZA 1WDLA 3CT4A 4QJ4A 1P2DA 4EHLA 2KE5A 2Y0EA 4UHJA 4NBRA 5TV2A 3V7NA 2VSOA 3RQSA 1LCIA 1S2OA 2ZRGA 3AH8A 1L5WA 3VH3A 4GM0A 4A8JA 2CCJA 3KQUA 1JLLB 2MT9A 1J6UA 2HSWA 2ID7A 3IKLA 5DULA 4RF3A 2K6GA 2WICA 3EC2A 1XCMA 2ECQA 1YDMA 1SM4A 2GESA 2IZ5A 2DQ4A 3HYCA 3GPIA 3CF4G 1V7ZA 3QX7A 4IM7A 3VO2A 3W2HA 3ZV5A 1L5OA 4B8WA 4R4JA 3JXEA 4BJHB 5FWNA 4KWIA 3FLAA 3HUTA 3VA7A 2CUTA 3GMSA 1AB6A 3OMLA 3R1IA 1CHNA 3BMNA 1NHWA 3OIFA 3RT7A 4YHBA 4FQ5A 3ZU6A 3IDOA 1ZWKA 3KFVA 2BF7A 3N5KA 1KI3A 2BFFA 1CS0A 3BXFA 4FXOA 3PFNA 5GONA 5EVJA 4D9FA 5DNUA 2FWRA 3KO8A 3PNPA 4CEHA 5CPBA 4Y9DA 3FY4A 4AB1A 4HLQB 4JCCA 2GSDA 3CTMA 3DF9A 3MAAC 1KL7A 1W4BA 2PZAA 3AP2A 4CXMA 1PLKA 4QRHA 1I1NA 5KHOC 1G16A 1TMOA 4K86A 4J7CA 3FMPB 4KIFA 1ADGA 4JROA 1CE8A 3T3GA 1CUDA 3H9CA 3IR7A 2FZLA 1QZUA 2O2IA 1O8CA 3CRQA 3I9FA 1YS9A 4RPKA 3WJ1A 3BN3A 4FHZA 3WK6A 2UAGA 4K6OA 3RDPA 4I5FA 3OQ1A 1E96A 2ATEA 4X91A 3W1VA 4N82A 4YMUA 3C7DB 3AJRA 3UAOA 3QFRA 3GUUA 5B1EA 4MWCA 1E60A 2ENWA 2VOJA 4BXOA 3ON5A 4IIXA 4AM8A 1JX6A 3PWKA 4UXHA 3FVRA 1E1CB 1P4HA 5DFAA 5J43A 3WB9A 2G9RA 4MVJA 4UD6A 3OE5A 3RS4A 2OV3A 2UYGA 2VPYA 3TTXA 2EZTA 4YN3A 3P52A 3PQ2A 3AVQA 3GLHB 2OCIA 2QRUA 2XVXA 1LEHA 4JJFA 2PK3A 1UDRA 2W2NA 3B1KA 4ALIA 3K4HA 2DQYA 3T1YB 4WBXC 3DULA 4G37A 2BZ0A 1RYFA 1Z22A 2JIPA 2ZUSA 1TJNA 3FCAA 3QXCA 2J7KA 2HA3A 4X94A 3SDSA 1YK1A 4TKMA 4AY4A 3NIDB 2FB9A 2XCIA 1LI5A 2O23A 4Q9HA 2XT0A 3MT8A 4UZSA 4ZYTA 4WEQA 4Z1MD 4P4NA 2H1OA 4WZAA 2Q2NA 2ZJYA 5HG0A 4R69A 3SJAA 4UNSA 4F5EA 2Q6KA 1Q1EA 3AR3A 5LBUA 1X7YA 2AOWA 5AKIA 1SK9A 4YV7A 5K0ZA 1PQPA 1EUDB 3E7WA 4MQ5A 3UFBA 5I48A 4BNWA 5CRIA 5EOVA 3ZWDA 4HDQB 3F74A 3AY7A 5GJCA 3C3JA 5LIPA 1G8KA 4E7OA 3ZLJA 2GN4A 1O2DA 4OL0A 4ZXFA 3U3JA 5D7BA 1PQUA 1KY2A 3P8ZA 5FUQA 4YJFB 4IIDA 1DAEA 5H70A 4X61A 4O5OA 3UK7A 2PX6A 7REQB 3EEQA 2O7RA 2ORED 5LDDC 4FOSA 5AJTA 2H52A 2HSEA 4PRLA 4DC1A 3T0FA 1H2EA 1DBQA 4Q7KA 1F4LA 1WXFA 3ND6A 3KQWA 4INOA 2CVHA 4KGXA 1Q5PA 2X2PA 3TIVA 4PLPA 4M9UA 4NS1A 3GY0A 3TR6A 3BG5A 3ZWKA 2PXAA 3OUTA 1PNQA 4UDYX 1DIAA 2V7QD 2WU0A 3NQ41 3UGTA 1XXHE 4R71A 3K0KA 1W1UA 2FX2A 4QOFA 4XGRA 3LBHA 3NW9A 1QQAA 3KWJA 1AUXA 3Q1KA 5FT9A 2JI4A 3U17A 3ONFA 2O5VA 5JXHA 1P9LA 2OHJA 1YCGA 2X7XA 5IP5A 4OAOA 4L6CA 1Y37A 4D9BA 5A71A 5IARA 3S68A 1U9ZA 4F86A 4RJKA 4Y1GA 3IA2A 4CE6A 4DV4B 1Z29A 2ZWPA 3KAKA 2XQFA 5IXJA 4G4GA 1M9NA 1CQJB 1IFXA 2JGMA 1IZZA 1NNUA 5DO9A 3A1NA 5CB4A 1GITA 1MU0A 5LQKA 1M1XB 1QHHB 4MS4B 2VDQB 1BD3A 3GZ4A 4Q4HA 4OMDA 4FFVA 4NEQA 3OZWA 1JA0A 4JFAA 4X6XA 4UULA 1F8FA 4MIYA 4R9NA 1E2HA 4ZXPA 5JDIA 4HVCA 3C45A 1IUKA 1MW9X 1HC7A 1VTKA 2AA3A 2WBLC 2WOJA 4FKMA 5AHXA 4AY3A 4MP8A 5AHKA 3V32A 3VR6D 4KQCA 3EXEA 4AG5A 3UM9A 1UMCA 3E7PA 2WAOA 4GP9A 5A05A 5ALVA 3K16A 4ID3A 2WWRA 2YJ4A 3Q8XB 1MHTA 1ULZA 4O4HF 2CLEB 2B92A 2IEYA 2X1VA 3C3MA 4OBXA 5D8DA 1QG2A 3FDJA 3JRNA 3IC5A 4HNSA 1QHXA 2R7AA 4K26A 4NR0A 4XI9A 1G18A 2IYTA 3O8BA 1F0KA 1CDDA 4KEAA 3LW8A 4IH9A 2REXB 4I66A 3SOZA 2X6QA 3F4BA 5M5BA 3NWPA 5HA5A 1G20A 3VJMA 2ZT7A 3KYJB 2BBTA 3V1UA 3JQRA 4R51A 3ENKA 3TUJC 1IM8A 4IRUB 1RDFA 4W5TA 1RWNA 1V8FA 3C8HA 1M1NB 1CFJA 2REBA 3EN0A 4GQBA 4FFSA 5KAMA 5KVAA 1UT6A 4ZVVA 4ZEVA 1JDPA 8ABPA 3MTEA 3O8NA 3Q1LA 4YUXA 4US1R 1V9CA 1QC5A 2GTIA 4LY3A 3JS5A 3Q12A 4KQMA 3T15A 3VI3B 3R3UA 4P32A 4TTTS 4PZ0A 2ZRPA 3I64A 1UKEA 1Z13A 4HCJA 4TSKA 4L4XA 4JI1B 1G0NA 2O2EA 2QUAA 2XSZD 3RC7A 2JI8A 2B0JA 4ZYUA 3ZPXA 5K99A 2WOOA 4ARCA 3KOOA 1AGPA 4G8CA 5KZMB 5FPKA 5UKDA 3UENA 1IRIA 1UZUA 4L0QA 2FUKA 1SCUB 3QVVA 1VPEA 2RGCA 5TMBA 3ZQUA 4BKQA 4CMIB 4Y30A 4PANA 3PGKA 3TO5A 4KK3A 5C7YA 2GN9A 2W4IA 4LDAA 3MAGA 4X8MA 3TTTA 5ITVA 3K70D 5KQGA 4G5XA 3AHFA 4RQUA 5J63A 1V5IA 3ZHRA 4MV8A 4M1TA 3CEMA 2BEUA 2D5CA 4F3CA 1EVEA 2EZ4A 4O8ZA 5CT5A 4C0HA 1J5EB 3MRVA 2J3HA 3BFJA 1QPBA 4EGSA 1HOTA 1M83A 2Q5JA 2BEWB 3EPRA 4K87A 4B75A 3DKVA 1GWNA 2QEQA 3QQPA 2FR8A 2ZRJA 4ND1A 3G7UA 2KWIA 3U7FB 2H06A 2Y3IA 3UK6A 4A27A 5ICGA 3IV9A 3L6DA 3JQCA 3AU9A 4E4TA 4YRZA 4YPVA 5TGZA 4FM9A 4QWWA 1GQQA 4NZZA 2Y71A 4D4IA 2SKDA 2VDLB 3OE7D 3W6OA 3FUVA 3C3XA 2H8KA 2O3TA 3QJ5A 3IUJA 1LXCA 4B6GA 4DCVA 1BW9B 1FMFA 5GWXA 4CM8A 4N39A 1DTWB 3HUUA 4CM7A 4YYEA 3NYRA 3Q3EA 2ZYRA 3CPHA 4JAVC 4L2IA 1JRLA 2VJPA 1A5SB 2ZT6A 3N2EA 3PB3A 1GZVA 1HQYE 1U3GA 3TD6A 3W9BA 3ZTTA 3ZUPA 1N2EA 2EVWX 3STXA 1M1UA 3DQQA 2FHSA 1MX3A 1OUMA 2Y99A 1U9YA 2DUMA 1GUYA 2CNNA 2I8CA 3HWRA 3H2JA 3QLVA 2G9UA 3LCCA 5GINE 1OT3A 1O4WA 1T6XA 4YBRA 2VKQA 3NDBB 1XB2A 3N8NA 2FPGB 5EFOA 4R1OA 4KBYA 4GQIA 2GBLC 2D1FA 1TJYA 3JQ9C 2WY2D 5ADWA 1NSFA 2X2EA 4ZAGA 3A70A 2DQKA 2OAGA 1ZNWA 2VK4A 3UQYS 3SMVA 4H3VA 4TYNA 3BORA 1J0EA 3OP1A 3BREA 4FUTA 3DMTC 3MMSA 5HFAA 4G0VA 4JI8B 1X7XA 1L4KA 2NZVG 4WCDA 1NT2A 2P6UA 5LA6B 1OYWA 2QNIA 3BOSA 4ZGGA 4FNMA 4FZJA 4CFSA 3QYAA 1V5EA 1ZK0A 5F1KA 2FPIA 3EMBA 3MWJA 4IYJA 1U0TA 3CC8A 4ZAZA 5BUSA 2DU8A 2ZSKA 1L5SA 1U7HA 4J07A 3EVNA 4XWYA 2HIAA 1XCJA 2GZRA 3WRYA 4DUPA 3UMSA 2XBMA 5IABA 4HYQA 3X1KA 1L7NA 3W2IA 2BGKA 2L82A 3M6FA 4DLUA 4MTCA 4YJ2B 5G2OA 4CMBA 1XTPA 2IXEA 2W8ZA 3O4RA 4G1EB 1N6IA 5CFPA 2VP5A 4NS4A 3GAMA 1I36A 4FCCA 2J5BA 4F93B 5HZMA 4RTOA 4B0PA 4C2TA 1R16A 1XXHA 4IJVA 4QYTA 2CFIA 3MB5A 3SC6A 1JFLA 3WGIA 4RKEA 1IXKA 2JA1A 1X80B 1NE2A 3VDXA 4B34A 5A6SA 3C43A 9ATCA 2QR3A 2E18A 4FZRA 1LV8A 1ICIA 2PX8A 3R09A 4GGPA 2CBZA 1EP9A 4IKEA 5FB3A 1JEEA 5BO5A 2DKFA 4HDRB 1F2TB 1XF1A 4X8OA 1YDHA 1HA3A 4HWPA 5AHOA 2OGSA 5C1IA 3ZI4A 5KSZA 1WXEA 1UAYA 2Z1MA 1MEOA 2MHCA 3BMQB 3L0DA 3PNVA 4L5BA 2NYUA 4PLCA 4F11A 5DF1A 4XYBA 4L9WA 2Z2XA 1OVGA 2A9QA 5ADVA 5LQCA 2D74A 1UAAA 1PVVA 2Y4NA 4I4TF 1P2GA 5AKKA 5HDQA 3WWDA 5L4NA 3G2QA 4JJGA 1CT9A 3LNCA 1L4FA 1DXHA 1JTVA 4M7OA 2WZBA 4TLLB 3UUWA 3BB3A 3COWA 4BO6A 3SSNA 2P1DA 3B70A 3OETA 4UE6A 1KJJA 4KNVA 4MUIA 1ZHOA 1IDOA 3EVTA 1WDWB 5LUAA 5LQAA 3CLVA 4IXWA 4M6WA 1DC4A 4LPSA 4WZBB 4PTZA 4CNBA 1ZG3A 2WYHA 4FBGA 3C3EA 1O96A 1ZYUA 2NUPB 4CF7A 1BGVA 4OCZA 4F46A 4NATA 4XB1A 2GN1A 1E99A 1A7UA 1Q1GA 2CHFA 2O05A 4LBYA 4OK5A 2OCKA 4EOGA 3VYVA 1U9CA 2CVZA 4V38A 5BVGA 2H2FA 3QI2A 3GRCA 5ALKA 2ZXUA 1DJPA 5IVKA 1P3Y1 2Z6VA 1MOSA 3TM4A 3JQ8B 1SVMA 2QTCA 4Q4DA 3P26A 3STYA 5DOVA 3I5AA 5HKAA 3HV0A 1SUAA 2QTLA 2OL4A 5BV0A 2VDMB 4QOIA 1YL6A 1YHNA 3DNPA 4G0MA 3AESB 3OTGA 3G2MA 4MWOA 3IB6A 2GF2A 2YWGA 3C1UA 4HPWA 2XHZA 4MI9A 1QRDA 1ODSA 4HI0E 1YOBA 2VCHA 3DKPA 4YJ3F 4MZDA 4AZWA 3OIGA 1RWBA 2G80A 2ZGVA 2ZIZA 3X1ZA 1MH1A 2GPWA 1DT3A 5DLQC 4OU4A 4B80A 3Q7RA 4PW0A 2B1QA 2UKDA 4JODA 1UFOA 3MUFA 2I91A 2ZR0A 1WUYA 1K66A 1IN7A 4AJ9A 2D8MA 3W5BA 3TRKA 1Z45A 2PKCA 3B8HA 3LFTA 2C3PA 2XE7A 4H16A 2WV7A 3UT5B 4KFCA 1QYWA 1CG6A 3DV2A 5ARCA 2DJIA 2Z8YA 5F52A 2IOYA 5JY1A 1AVTA 2XECA 3FYCA 4M8NE 1SKQA 3BJEA 5IX8A 3NBKA 2CV1A 2P6MA 3VJRA 3GFVA 3VOTA 3TI9A 3AINA 4KUGA 1E2EA 2PUJA 4GKKB 4QAJA 3E05A 3BJMA 4AJNA 4ZQGA 2GJ8A 1AKWA 2WE8A 5IKXA 5GMOA 4G09A 2P35A 2SHKA 4Z7OB 2I1QA 3SK0A 4HT3B 2F9LA 1OD6A 3HUDA 4XIJA 1KOJA 3U13A 3OX3A 4OXQA 5JECA 2HRBA 4QOGA 3EIEA 1VRWA 2Q2OA 1KR5A 2A57A 4I9GA 1WMSA 3AF0A 3G7SA 4BQSA 3GQBB 1NJ8A 2X41A 4KR2A 4WVFA 5D3KA 2CZCA 3TNFA 5CVEA 1MX1A 5FTKA 2VF2A 5A06A 3ZR4B 3JYHA 4ZOLA 1LK5A 3NH9A 3U7QB 1G21B 3U9LA 1XYYA 3VSBA 1NL3A 3AGPA 3IAM1 1KFEB 1N5MA 5FFMA 4BUCA 3DZGA 3F7TA 1E3LA 2P1ZA 5CNIA 3G9UA 3RSOA 1FDSA 4PQEA 1VI6A 3AM3A 5E9JA 4F1WA 2FW9A 1Z06A 1ADBA 1J23A 1OTXA 1FRQA 2LV8A 2I34A 2YHUA 1X9IA 2ZWIA 4YJKA 2HMSA 3RVSA 3A4NA 2PS9A 4QBTA 4JJAA 1NDQA 1GZ6A 1LTKA 2LCQA 2C0PA 2NP6A 1HL3A 3B1XA 2XHEA 1LC0A 1BYIA 1NMSA 1QXSA 3CUKA 1I4LD 4LC1A 5EHIA 1YR2A 3G1UA 3PJEA 3C16C 1KVQA 3AF3A 4BLRA 4CIWA 5HRCA 1T3HA 3UWKA 4HRYA 3AF2A 1MDFA 2Q45A 2UYYA 2X5NA 3ZIAD 4EW1A 1RM5A 1JDSA 5A3VA 4C4OA 1PEAA 5KNCD 4LRUA 1GZ7A 2EQBA 3PICA 1TQ4A 2DVMA 5F5XA 1F8GA 5C31A 1JVSA 2OT3B 1U0HC 4FE3A 1IULA 3JQGA 2IUEA 2XYVA 4DLAA 1DCFA 3SQMA 2WSSD 1G3UA 1R6XA 3GT4A 5TPZD 4ID9A 3M9XA 4LFCB 3MQ2A 5K0TA 3K09A 4Q24A 5C32A 5AW7A 5C8YA 1WOMA 2XE6A 4TRJA 3RYHB 1BEUB 3HGMA 4HZGA 4OM8A 5IRCD 3EZ9A 4S04A 2VUIB 5FNVA 3W6UA 1SXJC 3NHSA 4FDLA 5DYWA 1KQFA 13PKA 1J7KA 3WV4A 4GBGA 4YECA 1M75A 4Q12A 3TVYA 1L7QA 3J81k 5ERXA 2F8SA 3O0TA 4ER3A 1T9ZA 5J4KA 3GPDG 2IYFA 3INTA 3L77A 1UWLA 4CBVA 3C3WA 4JC5A 4OI4A 5AUPB 1JT2A 1RYBA 1VMEA 2JLAA 3WA6A 1BEEA 3G82C 3GGCA 4FU0A 3L8DA 1K5PA 1ZUNB 2QMEA 1EWYA 2WJHA 3QYFA 3LOUA 3MINB 1N92A 2V8OA 2YVLA 5FBLB 5LOVB 5I47A 5LLTA 5F98A 2G36A 1U7XA 4RCVA 1FNSA 1TD9A 4KN9S 3WYFA 4FMCB 2QT9A 3IO5A 2OV8A 2XNSA 3GEGA 5BWLA 3A4VA 4IHJF 2HOQA 1WY7A 2YBDA 2WMNB 3GROA 4ZD6A 1RNLA 5BSHA 4HN4B 3GV0A 4H0FA 1NJGA 4WKOA 5BN4B 1EFLA 1ZA1A 1EP3B 1T91A 2OR3A 4PGGA 3IOCA 3F4KA 4XUCA 4KOEC 2HLDD 5KYKA 4ONEA 3HVJA 1TRKA 5AO9A 2FPLA 4U6NA 4R2MA 3WYGA 2QZJA 3QPBA 2ATCA 1G1MA 1C3JA 4IOJA 4JQSA 4PGAA 4UXIA 1SG9A 5BRNA 5CYPA 4ZC8A 1FJ2A 2FVXA 4ECEA 2I03A 2NXWA 3IVRA 2OK7A 3K94A 2A5GA 5CXXA 3BK2A 4CV1A 4O29A 5EJIA 2PSJA 1DJLA 3FNGA 4Z9FA 5HE9A 2OQIA 2AR7A 2W6IA 2H31A 2H16A 4OGGA 2WU8A 4X00A 4GOLD 3LX4A 4PHCA 3YASA 3A31A 4CZ2A 1R4NB 4TL6A 3LLVA 4GOOD 3PNKA 3WAJA 1ID8A 1R12A 3VR5H 2DPXA 2FP4B 3ZD9A 1GPNA 4D4JA 3GUCA 5J2UF 4IS3A 3TOZA 3AVVA 2A1UA 2NXJA 1DBPA 1SCKA 3C8ZA 3BFXA 2C3OA 4MV0A 5I9SA 3RRYA 2CSXA 3HWSA 3JWJA 3AUJB 4NK4A 1LBHA 3WLJA 1ZGJA 1CUIA 5EZQA 4OSOA 3HBFA 4E6EA 3JAWB 4WBNB 3PXAA 1LLQA 3HLTA 3QOFA 3IOEA 4Y2TA 4OI1A 2Q9BA 4LCEA 1JFRA 3NANA 4MVXA 4F9EA 2BHNA 2JFUA 3Q87B 4XJXA 1SH7A 1V8OA 3SDBA 1ZN8A 2RB5A 1YHZA 2J30A 2FFRA 2VJCA 3BQNB 1MBZA 2QN6A 3HN7A 4YRBA 1ESEA 4QFBA 2PUGA 1JQDA 2R00A 3OUZA 2YXBA 1Y8QA 5JIBA 2KLBA 1KQOA 1YBMA 3KEFA 4DGQA 1ZIXA 1XRLA 1ZVQA 2PL3A 5HM6A 5EG5A 4ALJA 1YRQA 1IZ7A 1R9JA 4MQUA 1NBWB 1THTA 3G17A 3SEAA 2QIOA 3ZV4A 3EXG2 4MRMA 1NKTA 1WB6A 3PGA1 1JEYA 3JV7A 5TNXA 3DCYA 1T9GS 1JHDA 3INRA 1YRLA 1JG4A 3E5NA 4FE7A 3WLKX 3G89A 1JS1X 1SVSA 4RY9A 2GPTA 3K1AA 4XM0A 1Q3HA 2VXBA 4BAZA 5KSYA 1NYRA 3LVBA 5BYKA 1BDJA 3I9LA 3MZ0A 4RXUA 3LT1A 2ZAOA 1D4FA 2ZSJA 3G0CA 1TQ8A 3KIPA 1R5JA 1ZFNA 2VJNA 4KPGA 4MGEA 3UAYA 2H51A 2DSNA 1SOUA 3BAZA 4YJ2F 3LDAA 1YONA 4Z1MA 5LJLA 1SPBS 2B4AA 2RFLA 1JDZA 2WZCA 3F5FA 3V1NA 4EAQA 3UMVA 1L4HA 3LS2A 3IMGA 3AHGA 4IZIA 1M8FA 4O4JB 3HZRA 1M8GA 4GICA 4IV5A 4AKHA 1GZ4A 4S3MA 3R8CA 2WSLA 3E9MA 1QHGA 4UD2A 3B36A 4E31A 4RZUA 3LA6A 4C5AA 1WHSA 4KPFC 4ICIA 1PF7E 4HAVA 3EBPA 3HJFA 1CUXA 1TOAA 5KIAA 3DDOA 2WEKA 1VG1A 5EWLA 1KPHA 3NRBA 1CU1A 2DHDA 4JT2A 1KEVA 4MMYB 3K70C 3A4LA 3L40A 4GXTA 3JZDA 1QR2A 1SNYA 3OZDA 5A5VA 3ZE2B 2EGUA 1FEZA 3C3YA 2I71A 2SCUA 1UJ4A 3THSA 4Z7NB 4OO3A 1KXZA 1W44A 4HDKA 1CY6A 1YCFA 4I9HA 5CT8A 5DYNA 4BFCA 1C50A 3EOBI 4Q1FA 1F8XA 3GCDA 1GPBA 4JLNA 2H1RA 4OFBA 1KQNA 3ANLA 3M9LA 5TARA 2V7QA 1OAAA 2Q28A 3OE1A 4EPXA 2JGLA 3UOWA 1PS9A 2BOVA 3RIEA 2FVYA 3I2HA 2TECE 3N2NA 4IBOA 2FWNA 2ZTSA 3IRUA 4JJ7A 3H11B 4KSBA 1UC4B 3FTQA 4TTVA 2OCBA 3BXEA 1NVMB 2YFQA 4L3OA 5I9MA 1ESDA 4ZT3A 4D3ZA 3MF4A 4R2XA 1KAOA 1YZUA 5IASA 5B58T 5DNEA 1XPRA 2PUBA 1KS9A 3ORRA 4PN7A 4MW5A 4F45A 1VE1A 2JK1A 3A9RA 1Q3KA 2BTOA 4YMIA 3RUFA 2R1TA 1L9KA 1DAOA 3CUWA 1SVKA 4G0NA 2G4CA 2ZT8A 4OB8A 2HYDA 2GZSA 1GNVA 3OZAA 1R0CA 4Q19A 3WYAA 1FIUA 1X8LA 1LBQA 2NYAA 3HUEA 3OSZA 2GUGA 2GNOA 4GAEA 4KAJA 2WQ6A 1QGUB 2J07A 3RTAA 5HKKA 3BCHA 2JIMA 2GKGA 1Q0PA 3B6KA 2GD0A 1O95A 4B4WA 3BFPA 4CV2A 1JAIA 4OKNA 5JG7A 3ZV6A 4EB6A 1SG6A 3G8DA 4W9NC 4RK7A 1HI9A 3K9WA 3RBVA 2F48A 2WKQA 4NH0A 4TKUA 5HS4A 1O9GA 1K2VN 4RZHA 4LNUA 5CA0B 2R66A 4A92A 1C0LA 2D2XA 3E3AA 3E5RA 4JEMA 3ZWVA 4CMAA 4CHTA 5E6RB 1H9CA 1ZLYA 3AKEA 2P9FA 3WA7A 2WD9A 1N6PA 1QZTA 3NC1C 4J6EA 4P34A 3VXKA 5KYYB 1BZYA 2IHYA 1G4HA 2G72A 3UPTA 3DLTA 4H0CA 3NHWA 1LBEA 1VOTA 1W35A 1XRRA 1Z56C 3FYUC 3HKCB 5AVJA 5AJXA 5JNRA 5K8CA 5JT1A 2K4MA 5JH7A 2FPRA 3UAVA 1NRXA 1ML4A 2XZDA 4LZLA 4QX6A 2ZJ6A 3CJQA 1DG1G 1QIKA 2IU6A 1LPSA 4W7IA 3BTUA 2HPVA 2Q46A 4A0HA 1K27A 4EFDA 4OQ4A 4F9TA 1Y8ZA 4DLXA 1RZRD 2JJ1A 3GA7A 4O2BB 1QUFA 2WWVD 4KTVE 3ZWMA 4DQXA 1FDRA 2BP7B 4RA6B 5KJCA 2JAHA 4X3CA 3H65A 1XDWA 4ZCSA 5HNKA 2B5OA 2GEJA 2HJSA 5JS1A 3SG0A 4DLSA 1TM1E 2BONA 4TLAA 1XU7A 4LE1A 4COOA 3DV9A 2IEDA 2VAPA 2F3SA 5AOVA 1O97C 2QVXX 3LQKA 5BXQC 1BXRA 1TVKB 3WLTA 5KNBA 1DWQA 5EMLA 3SYTA 3B3FA 4DVGA 3FOWA 2XCUA 2VYFA 5IZ4A 3KHKA 3NUQA 2J5RA 3QEKA 3UWPA 1YRHA 3W5UA 2Q29A 3H05A 5I4IA 1W87A 1PUIA 1YBVA 1S1CA 2OBBA 4M9ZA 2MYTA 2XZOA 1SC4A 4LQLA 2AEEA 2E87A 3UH1A 4TN5A 1UEJA 4XQ0A 1P3JA 4CU2A 5JMTA 3UMMA 4C1BA 1N2JA 4UU1A 1OIWA 2I4OA 3R2JA 5FYDA 3QVOA 2WYIA 1FP4A 2ZJ3A 2AJTA 221PA 1QIEA 4MVJI 3T3OA 1XV5A 1I3CA 1G9XA 1F4VA 3C74A 3R3ZA 1GPKA 3HXMA 2EJVA 2QNRA 3PC6A 2FWAA 5IAEA 2VHJA 2YIMA 5K20A 1EVJA 1PJ8A 4U7GA 4TWZA 3QM1A 2CXNA 1UAGA 4M76B 3PD1A 3WAKA 3N59A 2W6MA 1S4MA 3AF1A 2J9YB 2ZJAA 3KSMA 4GP6A 4FD2A 3ZBPA 4D6PA 4D8WA 4CIYA 2VQFB 4WOCA 3EZ2A 1HNXB 5CLHA 1NOJA 3G2PA 5K3FA 1KKMA 3MYRA 1NUQA 1PEKE 2F2TA 3DHYA 3LGSA 4BIMA 1HT1E 2X0KA 1LPBB 2ZZMA 1H0RA 2E4UA 2HEIA 4K05A 4TX1A 4B48A 3COZA 1P91A 1GLNA 2CXUA 2JBAA 1JR2A 3MSCA 4TLDA 4Y6RA 2OYRA 4ZPJA 1OZAA 2JH8A 1KEEA 1GZUA 1ZAKA 3CEAA 3IE0A 5FYQA 1GCIA 2P5SA 3LFHA 3U5TA 1JHRA 2V96A 1IBCA 3IQZA 4LGMA 4WD3A 4KL8S 1RCUA 1ZVJA 3BXOA 2WUDA 4EO9A 1N36B 1GT6A 2PD3A 2R1VA 1XZPA 3IAHA 4PZPA 2XT6A 3ICPA 3RRNA 1Z0SA 3M2TA 3JYOA 4PYLA 3DE3X 3PWTA 3OCJA 4E5MA 1E1NA 4RJIA 5AR1A 1M34E 1GAJA 5LLDA 1M6VB 2PAFA 2VVTA 1UODA 3G02A 1VLLA 5AI5A 4Q4JB 3MG9A 2HPZA 4JQOA 3A9TA 4O3FA 3DE4X 3CN7A 3K8ZA 1R27A 1UL1X 2DFPA 5EWMB 1YTLA 3I45A 1WD5A 1G3IA 2ZXEA 4EHNA 1T5IA 1I3LA 4UMFA 3C2QA 3ICQB 1V8DA 3DOOA 3HBAA 1JDTA 2X3YA 4KUHA 2TMYA 4N0QA 2Z08A 3ER6A 5EXTA 4MYTA 2B82A 4PINA 1EWKA 3TOCA 4RHUA 4RIFA 4ALNA 1C41A 2DZDA 2J08A 3FTNA 4WASA 4FNAA 4M9XA 1WPQA 2AMJA 4I8XA 5DTEA 3RFVA 3F3SA 4KE8A 5TF0A 1DIRA 2ZITA 4JJEA 4MH0R 4KH1A 5C46F 2C92A 4EA7A 5LPNA 5L7WA 4PFKA 1FFCA 4V39A 2DRIA 2IYOA 2QPOA 2SKEA 2ZBEA 3KSUA 3PFCA 4HQFA 2G40A 2WC1A 4MVJM 1E4OA 1L3CA 3M70A 4RF4A 1GN9A 2VXOA 1DL5A 1SVOA 1WSBA 4XDGA 5HIIA 1NXTA 3V8MA 4EB0A 3HVIA 5HCIA 4DY4A 1YVDA 2BKUA 4K3UA 1Q1AA 2PO5A 5AHWA 1KKUA 1A2BA 2ENUA 3OOHA 3GCWA 4K9KA 4D02A 4DR2B 1FTYA 3FYHA 4NBUA 4C22A 4KO4S 1K4MA 1N6NA 2W0SA 1V3VA 2FGKA 2J45A 3GG9A 3I9V1 3OJXA 4A0FA 4BMSA 5KX5B 2B78A 5K3SA 1K08A 1QFMA 2I2FA 3PGMA 1M2VB 5K0LA 3E2IA 1R6BX 5HCNA 4YIKA 3SKVA 2ETXA 2G70A 4FGZA 2A3RA 5CTJA 5EYPA 4X7PA 2IWRA 3GNTA 2FFQA 4S2EA 1E7MA 1LSJA 3H9QA 2NAFA 4US0R 2C31A 2HA5A 3QPCA 1M66A 1PJAA 3O2QB 4J3NA 3AVWA 1ZW1A 1U1DA 5IJWA 1W48A 2WWHA 4KLRA 2OVFA 5FPHA 4Y9TA 1CUAA 4D96A 3MRSA 4TKVA 1V6AA 3NEYA 2IS1A 5A9SA 5FBKA 3SF0A 3BHJA 5L3ZA 1JI0A 2JGRA 1R4AA 4DJEC 3OP4A 3DSRA 3QEMA 1UC5B 3R6LA 4RTKA 1NG9A 1K7SN 5A3QA 4OHUA 4EZEA 3IBYA 3DT9A 4ZDIA 4BX9A 2PUDA 4DDHA 4I7EA 2ACKA 4PHHA 5G4KA 3KKPA 3DAGA 3GP3A 4MR9B 1W76A 2YHAA 3ANYB 3JALA 4REMA 5DHPA 5FI3A 1CDOA 1J09A 1CB7A 4MJXA 3W8EA 5JVDB 3NVKI 4PS1A 1KPGA 5E8JA 4EY5A 5H81A 1LSUA 4RKFA 2JVKA 1D07A 2B83A 3GK3A 4TGLA 4TLCA 3PR2B 1Z3CA 2ID9A 1PX0A 3DZBA 3LRXA 4IIGA 1EVZA 4IGIA 1U0SY 4DSTA 3H4TA 3DKRA 4PLFA 2J3DA 5LZ7A 3ZWQA 1X0XA 3JARB 5IC5A 4BNDB 3JAKB 3M1YA 1PI3A 5MN5A 3ZWPA 1JJVA 2AOUB 1LF5A 2OO3A 5EWJB 3WOVA 1VLJA 1AG9A 1BE8A 2RGGA 1XA3A 4XYGA 3R75A 3E81A 3IMKA 1IPFA 3VC3A 3B1FA 1HRDA 1T10A 1TUBB 1AZLA 4BATA 3I58A 5HS6A 4BUJA 2LR0A 2YW9A 3KSRA 3PDCA 1H8ED 1W0JD 3T3DA 3H9BA 2XVYA 3F8WA 3I42A 1RW4A 1MAWA 4EG8A 1RJWA 5KYNA 4LJKA 4J8PA 1Z82A 4ZCMA 4AO7A 1JGTA 2ZJ5A 1RWOA 1DCKA 3GVIA 4BMPB 3KFXA 1P4JA 3HFJA 4ZTBA 1DJNA 1K92A 4TROA 5AK4A 5CFQA 3AL2A 1YZQA 5JDCC 4FMDF 4ZANA 4LDNA 4PVDA 5DPMA 3QVTA 1QU3A 1OMOA 2W0MA 1I30A 3GFOA 3G2LA 1L5KA 3E5HA 1Z34A 2AYZA 3CZ5A 5JSKA 4C3UA 5HKOA 1MP0A 5DGHA 4MGHA 1KU6A 1P2FA 4JWTA 1NXWA 2NO4A 1CBUA 2RHRA 2XD4A 1FYWA 4MIOA 4WLOA 5KTNA 1T6ZA 4CEIA 2C7GA 4HPJB 4R1PA 2HFKA 1CUBA 1IL0A 3HDTA 4ARSA 3IX7A 1JLKA 1MO5A 5DEOA 5F2NA 2L0XA 4RLFA 1YS6A 3J7AC 1DAKA 4DDVA 4W5WA 5DW3A 1Q95A 5IMSA 2LUOA 4BMZA 2CLSA 4R01A 3SMQA 3ANSA 4IO0A 4Q3KA 4RD2A 2GN8A 3LT2A 5B3KA 4NBSA 1EHCA 2CL0X 3GMDA 4HQRA 2J4FA 2XCOA 1FSFA 4PG6A 5E7QA 1T8UA 1H94A 3RARA 3OFKA 3OJ0A 1XRNA 3DBLB 2ODBA 2YASA 3RSGA 2B8NA 1KMHB 4WINA 1SB8A 3RUEA 2BBWA 3O38A 2DTEA 5B1SA 5DNCA 1YF3A 4JJZA 5FKJA 3FFAA 4QXPA 1L7PA 2JGDA 3A37A 3OC0A 4YK7A 4RULA 5TY0A 3RUHA 1G2PA 2DE0X 3KYDB 1DEHA 4EB8A 5I7HA 1X7ZB 5TRTA 1L5GB 3G9TA 2G0NA 4MUEA 4P98A 4E88A 2WTXA 3M3HA 4BP1A 4OHWA 3ZJVA 1YVPA 2BYTA 3H8VA 2HKIA 1OFUX 2HU2A 4AN4A 5BQ5A 4C4SA 4G4JA 3KOWA 3CEHA 2P9TA 3W2FA 4J1QA 1D4OA 4YV0A 2YV1A 2ZRHA 3C6ZA 2VP3A 1NJSA 3F0TA 4NJMA 3F3KA 4U5QA 5KQMA 5DM70 5BN5A 1M34A 2FZWA 2XWPA 3IAXA 3MCVA 3O90A 3QU5A 4RPLA 5BR1A 3RVKA 3EULA 4UFPA 1KEZA 2D0IA 4N9QA 3ZIAA 2GJKA 3ZW9A 3AXTA 4GPTA 4KLAA 2WF9A 1CTQA 3UMGA 1LI4A 1TYZA 2ZJFA 1B41A 2NV0A 2AFIE 5KNCA 2VT7A 4NENA 5LMUB 1FLAA 1OJ7A 1UF9A 1KQ3A 1Q44A 1RMTA 3DFFA 1BN7A 5ARBA 2XB8A 1ORDA 5E6SB 2J5KA 2WSSA 1DZ3A 2LCFA 2UVQA 2X8WA 4FMPA 2QL9A 5TPZA 1G3QA 3FE2A 3NHFA 1X94A 5HEKA 5KYXA 1SBQA 3KEMA 4TV9F 5JD5A 5L45A 1NF2A 5BMVB 2BTQB 1KNQA 1QBGA 1SEVA 4U7TB 1CZNA 4TT3A 3QENA 3SP1A 1N7IA 2DHEA 4LS3A 1DAMA 1PGQA 3R7BA 5K45A 3N2ZB 4PCVA 4V1CI 2IP2A 1IOVA 1U5BB 5A4IS 5KNDD 4C7OA 3L0YA 4TTJA 2UXCB 3IMFA 1HE5A 5CLIA 3C41J 3MJDA 1GAQA 1RWQA 4G5OA 2I4TA 4PYQA 4L78A 5HBRA 3B1YA 1EWQA 3DJYA 3UPUA 2BELA 2J6HA 2NU6B 3FCUB 1COWA 5KHLB 1GILA 5I7EA 4BWGA 2H1LA 3L0OA 3RODA 1ZHHA 2WDPA 1QV9A 3S1SA 3DDSA 2A0UA 2Q21A 2DHRA 2NVBA 4LSWA 4RD1A 5JRZA 2R44A 2ODNA 4EGQA 4J0DA 2FJPA 2VHZA 2ZRBA 4UQOA 1O58A 3IT2A 4NNPA 2FPSA 3BMXA 2OMEA 5FADA 1ZOIA 2PIAA 2PJRA 1H3FA 1L3BA 1JIIA 2VYQA 1JAYA 4KCGA 1RAFA 5B55A 3DB1A 4QJ3A 3G0OA 3QZUA 3AJ8A 3EWNA 2VJKA 1AS2A 1LFAA 1SELA 2BFCB 3LY9A 4KC0A 1AGXA 4X1KA 2ERCA 3CS3A 3F5QA 3GBVA 3TZLA 1UMDA 4UVDA 2BMWA 3CISA 4B1FA 1U6IA 1NN0A 2GEFA 1K3FA 2PWPA 3L5KA 5LNK6 3HNOA 4Q7MB 4LSGA 1XEWY 2UVDA 3BDIA 4DXAA 3ENNA 1LU9A 3PRHA 2QTZA 1SC6A 1FFAA 5COAA 1H2AS 2JIRA 1IOZA 3OWOA 1L3IA 3GCZA 3RYIA 1EUYA 1DDGA 3NHKA 2CMDA 2BDUA 3KJEA 2VQDA 4QUBA 5DOZA 4QJIA 5EN4A 3WKBA 7YASA 1RWKA 2P77A 4MB2A 2NUTA 3KZVA 1KP3A 4CLRB 2XOEA 4MW9A 2GD6A 2E82A 4EF6A 3EIQA 1OA0A 2CL6X 4EG7A 2XW6A 4NOJA 1N32B 4XPIB 3O84A 5HJ2A 3UKDA 3W9YA 2ORIA 3PUVA 2EQ5A 1TLFA 3DL7A 5KTPA 3ADDA 5KWIA 1QHIA 4Q34A 1NF8A 1Y1RA 4F1JA 5F1YA 2WJVA 3HJAA 3DWEX 3INYA 3QKIA 1O03A 3UKOA 2VS1A 2Z3ZA 3K1TA 1WDTA 3OLWA 5FI5A 5DI3A 3BGDA 4RGBA 3GLIE 1YDWA 4F60A 4Z3OA 1BROA 1OH5A 3I6BA 4MUMA 4ZV7A 5JHGB 1JKFA 4MAFA 3ZZTA 3I23A 1Y33E 3KQPA 4S35A 3THXA 2QLTA 4KSCA 3I5MA 3I72A 3IAAA 4FLFA 1QQBA 1I8TA 5KTSA 5FEUA 4YRJA 3SYRA 3IBCA 4EA6A 1JEQA 2GB4A 4RIHA 1GUFA 3R3WA 2RGUA 2HA0A 2HWKA 2VL7A 4U2BA 1LD3A 1JBKA 3A6EA 4JEIA 2VDJA 2Z2JA 4TV8B 3STWA 3TQRA 2Q3FA 2OD7A 1Q1BA 3A27A 5ECWA 2AMVA 5BUZA 1KOFA 2W83A 4JXKA 4QHSA 5B57C 2JLSA 3P2EA 4R9RA 4AZ3A 2VPIA 4WOPA 4IFIA 2JIZD 4TVKA 4F96A 1NC3A 1UMKA 1TNDA 3EPPA 1DO8A 3T1NA 1KSHA 1XPJA 5DGCA 2DCMA 5J40A 3VOAA 3HDQA 4H18A 4D41A 3PFBA 4BLVA 2UZAA 4RTPA 2P0EA 4K0KB 1F0NA 3E22B 3R7WB 4C4XA 4E1AA 1ORRA 4B2IA 3HCEA 1YQUA 1OWOA 4XVQA 3MCTA 4RD0A 2Q4TA 5FUBA 4HX5A 4LGCA 3F2VA 1Z83A 1E0DA 3IV7A 2HV9A 3GEPA 4JDPA 4M9CA 4IMPA 4A91A 2DH6A 1J2JA 2ZBGA 1T9HA 1WB5A 4FS8A 3IQEA 3CJTA 3JQBA 4RY2A 5EQFA 4E5KA 3GLGE 1KO5A 5MDHA 1PO7A 3DDUA 1PU2A 3DR5A 2Y2UA 3PDHA 1MC4A 1XZDA 4E07A 1UBMS 4ZT6A 4RZ3A 3ZYZA 2EJCA 4HBZA 4AJ2A 1XG5A 5JWRA 1YCDA 2EG5A 2YTZA 3AETB 4GUDA 3TZ6A 4HEJA 4DMUB 1GKKA 1UKBA 3HADA 4C7KA 1FVXA 3A4YA 4HFJA 5AMXA 3ZE8A 1SIUA 3CWQA 1LNZA 5FPQA 5B6JA 1E3EA 5JPDA 2ZAIA 4IHQA 4EPRA 3EF3A 4GSYA 1JSXA 3LL7A 4YC7A 4MXDA 1QRSA 1ABEA 4MKIA 2J7PD 1EFUA 1CUYA 4IQFA 3S1LA 3V34A 4DREA 2PJZA 5BR4A 4G1CA 3L1VA 1RTKA 5IAJA 2CNLA 1EFVA 3A3OA 1RLMA 3BIXA 4IIFA 3K8YA 1M2WA 4HH0A 1H2YA 2C9MA 1C8VB 5CT4A 3A05A 3GFPA 1LLCA 3H75A 3OWXA 3N2KA 1BXGA 5BV8A 3A0RB 3FSJX 2H1CA 1I6KA 2OSVA 2RB4A 3QVSA 4L9AA 5I7OA 2D8AA 1K89A 3OPQA 2XQGA 4GWLA 3CMCO 1EDBA 2EHJA 3ZVRA 4ZWNA 4IGAA 5G0UA 4PBTA 1GAEO 2C42A 4UBIA 3NAZA 3VDNB 2F1KA 2PZLA 2J1LA 5IU6A 3D8TA 4TPKA 3S1AA 1NPDA 3I76A 2MYPA 2V7PA 2PUAA 1I0LA 2RHOA 4GKJB 4BNVA 4ZZ0A 4WX2B 5A0FA 3ZWWA 2BEVA 5JNTA 3KSDO 4UU0A 1EFAA 1XKQA 3U48A 3GH1A 3A2MA 3WGVA 4A6PA 4YUVA 4ASUA 3ADOA 2H48A 2EKBA 3JRXA 1FQWA 4J16C 2Y1KA 4OIMA 1GUDA 2FR0A 2RHLA 1UBFA 4BJ3A 3K6SA 2QD3A 1DC7A 4NCXA 2X19A 3IA7A 1EU1A 4JU8A 2C83A 1NP7A 3EZ6A 2GLXA 2WT4A 5BORA 4CM1A 3R9WA 5IH7A 4MPTA 1WOYA 1FS6A 3K2EA 5C53B 3AV3A 3KR2A 1VECA 1CJTC 1AK9A 1W5AA 4AQYB 3ZWOA 1TJ3A 2B1RA 4XWWA 1W581 4XR9A 3JQFA 2A5LA 3LRTA 4ZRMA 4EVQA 3CLHA 2BGWA 2GEUA 5D87A 3KUCA 4F1KA 4P9NA 4KIJA 1MXHA 3S6JA 1DJOA 1CIVA 4LBZA 3CXUA 3LSTA 3BA1A 4IIUA 2QLFA 1MHPA 3HKBA 1MC8A 4JVSB 4OMCA 1FSPA 3E2PA 4IJKA 1TX4B 2I3AA 3D02A 3WGYA 3U44B 4H31A 1OU4A 5AKGA 1NVVR 1YMUA 5E9QA 4NXMB 4TZ0A 2CE2X 1HFWA 1O1YA 5LC1A 1TAUA 7AT1A 4HZUA 1RZRA 1PR5A 3DLBA 4HTFA 2QRZA 3Q9NA 4AECA 1OH7A 3F67A 2TMKA 3BGIA 4JI6B 3BD7A 1WVGA 4RDHA 3U3RA 1BU5A 4YBZA 4QBHA 4MDHA 5F77A 1UOQA 4OHXA 4WXHA 3TMKA 2IY7A 2PRYA 1HDGO 2I33A 1IN4A 1E4EB 3QKWA 5LM3A 1WMBA 1JFVA 2O8CB 3SN6A 4CDRA 1UFKA 8ATCA 5JALA 1ZMXA 2NO9A 3UJBA 4AZ0B 4I6EA 4P83A 3RIGA 3WI7A 5THQA 3N9IA 4YDQA 1AT1A 4PYNA 4TMXA 2NZ8A 4BMNA 2BFWA 4DR7B 3U31A 2ZYSA 4B33A 4AKTA 4UUOA 4R5MA 4IZ6A 1N5OX 3B3QA 3N7UA 4Y7DA 3TL6A 1OV6A 4UDOA 1Z47A 1A9ZA 1X8XA 3M1IA 2VHCA 2C61A 2XX3A 2ZTVA 4U8HA 2B5VA 3PQ4A 3O1LA 2GYUA 5FOSA 3S0JA 4I1SA 1MAVA 4L5IA 2XIQA 3JQPA 2B2NA 1SEPA 4EJSB 1GGFA 2JG3A 1OE0A 2VQ6A 3PUJA 1YDFA 4H60A 3VZQA 4WJZA 4EI2A 4EHJA 3WAGA 1Z2CA 3NTLA 4HB0A 4BRSA 3LM8A 4JLBA 1UJ5A 2ANBA 4HPXB 4QZVA 4N76A 1TTQB 4CU5A 2ZUVA 3H4IA 2B98A 4TRNA 5D86A 3EEBA 3KOXA 3SF8B 2WFMA 4D8TA 4E3ZA 4XAQA 4D98A 3OZRA 4FN4A 3LUAA 2IX9A 4HF7A 3W5IA 1Y4DE 3N70A 1XUOA 3OZEA 5IJAA 2Q99A 1T3LA 5G40A 4MVWA 2JATA 2CFSA 4JGIA 2V59A 5CIQA 4BZQA 4CKWB 3NEPX 2PWYA 4A4DA 5IM5A 2JJQA 5AICA 3HCAA 3TDNA 3PS9A 4LWPA 1SURA 4NBWA 1WLSA 2XGMA 3DO5A 1Q22A 1HPLA 1GUAA 3D1JA 1Y6GA 1VJTA 4BN5A 4F3YA 3VDRA 2UYQA 1FY2A 5SZKB 4PNEA 2GPSA 4Z4CA 3DA8A 1I6MA 2QTVA 4UUAA 5DLEA 1PNOA 4FWTA 4A15A 4Q3EA 3PNMA 3IHWA 4PYIA 4YH1A 5LIRA 5G02A 3HNPA 2NQTA 5FFFA 1K9VF 2XVAA 2Q41A 4RM2A 1QOPB 4NYJR 3CGWA 1S0UA 5CVCA 3UJ8A 1SQ5A 4MQBA 1M1YA 1PNRA 4AQDA 3CEJA 4IWNA 3WC4A 1B6GA 5HKLA 2GBPA 3JQ7A 3ITEA 2P2CA 4NEHB 2HWUA 4W82A 1IB6A 1TQ2A 4I0WB 4DPMA 3MGBA 2JIDA 1Z15A 3EG9A 1G8SA 2IGBA 3K9GA 1AUQA 5FPPA 3NJRA 5G0WA 4Z2AA 3LDGA 3SC2B 2P5TB 1IAQA 1TADA 2IOHA 1B26A 3LIPA 1M6HA 3LD9A 4Y1FA 5D5HA 5BOVA 1L5LA 3GLGA 2B2CA 3B9RA 4GKAA 2Z2YA 4M60A 1C4WA 1FUYB 1WD7A 2W2MA 3B1ZA 4RHXA 2RGDA 5BV1A 4C0KA 4TMYA 4DUGD 6YASA 1GZHB 3B6ZA 3RAPR 2IH5A 4ESEA 4GZ6A 3OTWA 2JI7A 4D0NA 1YB6A 2GMWA 1T9AA 5BSWA 4GE3A 1QE5A 2F3UA 2HTFA 2J32A 1G59A 2AE1A 2WZDA 4CI0B 3EQ9A 3C6MA 4A2WA 1V47A 4MP6A 3H9GA 1S96A 3MRTA 4UPVA 1LW7A 4PO3X 4U2FA 1Y1LA 4DNXA 1E7SA 4YPFA 3LYLA 4M4SA 4LDQA 1RSZA 1YD7A 1NTRA 3CLUD 4XYMA 4JC0A 5AHRA 3W6NA 2ZPAA 3TTSA 1Q1ZA 1P33A 4HB4A 1UJBA 5KJEA 4F6CA 5AVQA 3TAUA 3DAOA 1RJDA 1V8BA 4WFJA 3ZJYA 4CKXA 2V7GA 2Q8QA 3QMMA 3AVYA 4GPEA 4Y0VA 1AF4A 4XH9B 3TZCA 4YV1A 4CDMA 3DD5A 5A4DA 1R6VA 4NCIA 3DCNA 1FLVA 4CLEA 2JI6A 4IH4A 1I32A 1WB4A 2FCRA 3R4CA 4G5HA 4JLMA 2H2HA 1RPJA 2IBTA 4RJJA 2IOFA 3D7LA 2D5BA 4JJ8A 3GBPA 1RM4A 3D6TB 1AO3A 3E9NA 5BQFA 5IDYA 3L46A 3CSSA 2ZVPX 1MB2A 5JRDS 1FNCA 2NU9B 3R76A 4M53A 1B76A 2QAGC 1MVLA 3NBAA 4HUQB 3AUXA 2F59A 1GEGA 2FMFA 1F2VA 1EWVA 1TF2A 4XFJA 4C3VA 2XUOA 4L76A 4X65B 1S6YA 4B7CA 4GZ3A 5SZHB 1VJ1A 1J8VA 3Q0EA 1PTJC 1NA5A 3VGPA 2H5IA 1T8SA 5IAGA 3G9ZA 2V7BA 1R0SA 1ZI8A 4AC9A 1F14A 1NBIA 2OORA 3FLEA 4R3WA 3N05A 1X19A 2DGDA 3JD3A 1A2KC 3ORQA 2HJVA 2V97A 3HQ4O 3QWHA 3WXBA 1D2RA 3UATA 2LCIA 10MHA 1KI9A 1TA0A 1WEHA 2EZ8A 3EFBA 4LISA 1ZL0A 1LZKA 1OLSB 2GARA 3EH2A 4LPKA 4R8SA 4EHDA 3H1BA 5JR3A 4IDBA 1A4UA 3VU8A 4EA8A 4BQFA 2B3TA 7ADHA 3D31A 4PAMA 4GMFA 4HEQA 3STVA 3QLUA 3JVUA 4PLGA 2WUVA 1ZH2A 2Y9MB 3MT9A 3PQCA 2GZ1A 2WJIA 4I1PA 2YV2A 2EKPA 1VHDA 5T4EA 2ONKA 5DX8A 3DD1A 3U7JA 4DIKA 5CK4A 5BW8A 1NQAO 3GNQA 2ZQ5A 4HDMA 1VFPA 1JTEA 2ZBFA 4J4BA 3N87A 4RVFA 4L0MA 4V0OA 5HQ3A 3ZE9A 1PSDA 3AJEA 5FBZA 5JQGA 1IZ8A 3MEQA 2E5WA 3FHCB 4FNGA 2QRKA 1W0JA 1JDJA 3L8EA 1A95A 3DAYA 3X2EA 3CO0S 2FEPA 4KBGA 1W2HA 2PS3A 2WIBA 1CQIB 3CNEA 4CM5A 5LQNA 4IR7A 1MO4A 1TAGA 4EHFA 2OXRA 4PICA 3GVXA 3OLCX 1N0HA 2G1UA 4PCAA 4D8YA 3IVCA 1HGXA 3I9OA 3PXDA 4BUZA 4URXR 2HW8A 2A0FA 2G4LA 5JNSA 3QH4A 1ZD3A 1W93A 4M0DA 4MARA 4LJYA 5DJ5A 5EXXA 1L5HB 3AHDA 3G8AA 1OKKD 5KOHB 1HE2A 2XMCA 2JFVA 5HKBA 4ATNA 1TZ2A 3KZNA 2QN1A 1QP4A 1SU4A 2B6HA 1DTEA 2GS9A 5C7IO 2O1WA 3P4XA 3GX1A 5L6MB 3T94A 2O4UX 2X42A 3E61A 2XADA 3FNRA 1WUIS 2WKPA 5HIKA 1LC3A 5KYGA 1JA1A 1HE8B 4OJQA 1SU8A 4KO8A 4L5CA 2H08A 1NWHA 2H9YA 1CR6A 1ZITA 2BEWA 1U94A 1E3WA 2V0CA 5H9VA 4L1KA 2RH8A 1VLZA 2FP3A 3OLYA 4YI5A 1AKEA 2BVNA 5AM0A 1XLTC 3O1IC 2N75A 4ABYA 5K05A 5A6VA 4WY2A 3W05A 1YQEA 4YB8A 4LYEA 1U3UA 1V6SA 8AT1A 4A6EA 3WRXA 1RP1A 1OCEA 1F2UB 2ZSAA 4F8JA 5LD2C 1PWZA 4F2PA 3PC3A 1YU9A 3JD4A 4QASA 1PR2A 4CCSA 3FWZA 1EHIA 4U7PB 5KCZA 3E9DA 3T1VA 4ENRA 2Z6AA 3ZJTA 1UMBA 1WVMA 4PAWA 3QMWA 4FFPA 2O3RA 3PJRA 3IDSA 3JD1A 3M5CA 1A2QA 3AFIA 5TPWB 1I7DA 1WVIA 3CT6A 1PQWA 4HQNA 4B3FX 4DYHA 3L84A 5CGQB 2I4MA 1AA6A 1L7EA 2WD7A 3GJ7A 3WLRA 4Q9IA 3ETCA 3N2LA 3Q7PA 2JLZA 2FWBA 4OJNA 4PSAA 2CBXA 2YWFA 4G36A 3TKYA 2E3JA 1QNFA 4QJBA 3HY3A 1DKQA 3V55A 1CYDA 4BQRA 2P9BA 3GYGA 1RLOA 4LDZA 2J0SA 4EG1A 1U2DA 1W5SA 2I2DA 3CFYA 1KBOA 1TO2E 2NNLD 1QYDA 1QZZA 2J3IA 2TRSB 3AY6A 3NG1A 4ND6A 4XGNA 2IX3A 3U4QA 1M6WA 4ZK6A 5HHTA 4ZA2A 5FV4A 2WUWE 5E0OA 1FCJA 1TDJA 3CJRA 3WKAA 2NTJA 3G0HA 2QTAA 4UM5A 5FOVA 4JUFA 2JVIA 4LXUA 3RFUA 3ILVA 5FL3A 1E98A 1JPJA 1V95A 2EATA 1UWVA 3T5MA 3R5JA 1UT8A 3KU1A 3DFKA 5EY5B 1LRKA 2CXHA 3OCUA 2CDRA 1S8AA 1KJQA 1UH5A 2PFKA 1JZQA 4L4UA 2ZRCA 3RU9A 1RQGA 3V1LA 1XEXB 2QGFA 1T9KA 1NU6A 3D3JA 3DMFA 4RMJA 1W0CA 2J6IA 4ZHQA 3GPLA 2BGLA 2X9QA 3T5CA 3LH5A 2BW0A 1YKFA 1ZZGA 2CLCX 1MAHA 1SKYB 2EGGA 4HWOA 1N2IA 4NV0A 5E1BA 3SXUB 4DA7A 3NNNA 4F6RB 2FYTA 2P6RA 1KK1A 4Q3NA 2AOTA 2QRMA 3N5CA 3PQEA 4HL6A 4ZYVA 4KQ6A 3IVMA 4AF6A 1XJCA 4ZO9A 4EGJA 4KR0A 1PHRA 3OQBA 5KX5F 2L17A 4LI3X 2HI0A 4YMGA 4JU9A 5J23A 5A4KA 2II6A 5AJYA 4WN9A 4HDRA 2R8RA 5LFAA 2NU7B 1SUBA 3CSDA 4WY5A 1IHUA 3F6EX 4II3A 3WNCA 1F12A 1H4VB 4TYMA 1AQNA 1WV0A 4ZCQA 5LYJB 1PT7A 2XGJA 2ID8A 2MR6A 1USWA 3RJMA 2BCEA 4U5XA 1FSZA 1T4CB 2BUBA 4UEOA 4MJLA 4GL4A 3EEOA 1U31A 1XQWA 2UVPB 2CVQA 3KYCB 3B3AA 5FCDA 3EGXA 3G88A 4ZO4A 3HJUA 3NRJA 2ZRMA 3QE0A 4M54A 3AL0C 2FLVA 4Q18A 1ENYA 4KI7A 2KSQA 5ELMA 3QX9A 4ZVOA 5B53A 3TDMA 5DASA 1I24A 1PR1A 1K7FB 1PJTA 2P65A 3HDYA 1WY5A 2V6GA 4PHTA 5ALLA 4DNPA 5B3JC 1WDMA 5DGXA 5H82A 3V6LA 1NVBA 2HY7A 1E2DA 2WSIA 3MOIA 4RF2A 3RBXA 3W5DA 3OEHD 3S2UA 5JI3E 1XI2A 4LOHA 1P1RA 1QQ6A 3EOZA 3OHMA 2A5JA 3H13A 4QARA 4I6GA 4WKPA 5K0BA 1C80A 3DT6A 3HPQA 1PLJA 3EF0A 3OF2A 3PC2A 4DYVA 3Q6IA 4JBYA 4D6XA 1C4OA 3NDIA 3F3MA 5EC8A 1U0OC 3FRHA 4OLHA 1OWPA 3VH4A 1H9BA 1K68A 3RK4A 1FNNA 1Y6RA 2OZKA 3OO1A 1OYVA 5AKHA 4PR0A 2WKWA 3HSYA 3AESA 1K06A 1NX9A 3MJRA 2A35A 1I5RA 3QVGB 4GXNA 4K7JA 3GLKA 4O4LB 2YVUA 4J90A 2X4GA 3EGCA 3KQKA 3KB1A 4AKEA 2XWQA 1BE6A 2YUIA 2OKGA 4G4SP 1YGPA 4DLZA 4IMJB 3CW2A 3COYA 3ZS8A 1A1VA 1T5SA 1VSTA 3QXHA 4N8EA 1D2GA 3UJNA 1DFIA 1MB4A 4POAA 1OXXK 4I2NA 2GPJA 4ARVA 3ILYA 1WZCA 1VPTA 3WJ7A 2DETA 3V4FA 1K7XB 2QX9A 1BQ4A 1UPUA 4QEDA 4RZ2A 2D0PB 1O4VA 1S2GA 3MOSA 1I6LA 3D3WB 4G9EA 1LDMA 5TF4A 3SGLA 4JASB 1U28C 3UVEA 1R0LA 1ZNYA 2CDBA 1XHEA 4PX3A 4RFSB 2JRCA 4B74A 5AVYA 4BBJA 4D3XA 2ZR9A 2BHLA 2IDJA 4CETA 1I9GA 2WG1A 3U1BA 4CKBA 3BWVA 1VYTA 1CC1S 1T4DA 2HJHA 1EZ4A 4PXSA 3RUDA 1L2TA 5FOXA 3ZV3A 1WTAA 2JIZA 3BPSA 3HLKA 4OHMA 4V24A 3H1FA 4U7DA 4QATA 4XD7D 3DBHB 3QEBZ 4MWEA 4QYIB 5AQEA 2IY9A 4A9AA 3HXQA 2W2XA 2GFHA 2GM5A 3DOJA 4H35A 5EIBD 4C29A 5J5CA 2ISQA 4RGQA 3HR4A 4RCZA 5DVZA 5LKRA 1E18A 1JF8A 2HM7A 2Q3MA 4Y0AA 4JC8A 3R0ZA 2IIBA 1GL3A 2CFCA 4JJ4A 2BR3A 2XRZA 3C15C 4K5QA 2HCFA 2BE9A 2DPLA 2OB2A 5JBNA 1N2ZA 3LJKA 3N75A 4MHOA 621PA 1JB9A 1D0IA 4G24A 3A25A 2EBWA 2XUGA 3M5DA 3EODA 4ZAYA 1OBVA 1POWA 2Z5LA 4RAOA 3GT7A 1XZQA 4JHXA 1BXKA 1KZGB 2ZIXB 2C4WA 2EWWA 3OLVA 3WSWA 3ZU3A 2H7YA 1XTTA 5JSZA 2Z6QA 4CLOB 3AI2A 4FHEA 4F5ZA 2WWIA 2NYVA 2ZRKA 1L5VA 2D00A 2QJFA 3F96A 4K28A 2V3WA 2ILTA 2GZMA 4YV2A 1T3SA 1G5HA 4J0JA 3IP7A 1EFDN 3HDJA 3QUCA 4C0QC 3MWFA 2WNSA 3QWFA 5EIEA 5DV9A 2PS1A 3SSAA 2R68A 3L18A 4PO9A 2VBIA 5KO2A 2FRDA 4IXTA 3LI2A 3DE0X 5ES3A 2BGUA 3A1UA 3KELA 3DZFA 1JHVA 5E3JA 1WCV1 1Y6FA 1T8RA 4P0TA 1THZA 1Q2UA 3LLUA 2FPXA 2FRVA 4EYEA 2HWXA 2JAXA 4FYWA 3ZDFA 5I9IA 4BAGA 3PTAA 1IHXA 1ACMA 3R3JA 5AXBA 2A8YA 3EWSA 2Q6IA 5IN5A 3SJBA 1NMYA 4HJXA 3UHPA 2DTXA 3L1JA 5NLLA 4W5QA 2UYHA 2PS0A 2UV8A 4LHSA 4RWEA 5CHEA 3ELYA 5CCXA 4ZZIA 5CBPA 4EKEA 3BICA 4FBLA 1K7CA 1N2HA 1K5GA 3KHTA 3L9XA 1EAYA 4NVRA 4D5EA 2R8XA 2GZHA 1FVOA 1OLXB 1A27A 4NYMR 5E3IA 1U7OA 5BNZA 2LRHA 5CW1A 2PUFA 2NVUA 3UFXB 2VRNA 3VR4A 3JVEA 1T1IA 3W7VA 1UXGA 3CKLA 9ABPA 3G2NA 2W11A 4MYHA 4PC1A 4I5DA 3BXPA 3PXXA 3E6AA 3PNSA 4MS3B 5KQLA 1S89A 1THGA 3AFMA 1OSNA 2CLLB 2VJMA 4NOLA 5TJHA 3B8EA 2Q6TA 1U3WA 1EWRA 3CG0A 1HLPA 4PO8A 1SZPA 3FNFA 3G8BA 3LOPA 4LZNA 3UF0A 5AVSA 5L3QA 5ITZA 1TECE 4EYKA 2X40A 4C07A 3P5SA 3VOSA 1JHOA 4LHXA 3VPXA 1V8ZA 4IV8A 5CDTA 4RVHA 2P91A 3P32A 4BKMA 1N8NA 1N5JA 2DQZA 1EUQA 1GU1A 3D1VA 3U37A 4G1VA 3FSGD 2V4UA 4TLBA 5DX0A 4B6QA 2BFBB 2JFPA 4L8GA 4MTLA 2M6RA 4HO1X 4AWXA 2D13A 1JW9B 3K5HA 4DT1A 1Q0TA 1PBTA 3ACDA 1YJ8A 3ZNQA 1YZYA 2OV4A 4LXQA 2RH4A 3JWPA 3HKDB 1CJUC 4LQDA 1W59A 2VSXA 4MV7A 5ABPA 4XEHA 2W2QA 3K4QA 1QR6A 3E15A 1P4GA 1NMEA 3TW6A 4EABA 1QBKC 1J06A 5DNYB 5CEJA 1EVIA 1Z6XA 2F3TA 3QELA 3BXHA 2P6PA 5BVHA 3VOBA 1CJKC 4NG5A 4KHPB 5DZSA 2IK8A 1E66A 1NG1A 4IL5A 1Q3TA 1NLYA 1A2OA 3VYTB 3P2JA 4V0RA 4NYIQ 4Y2XA 4IDHA 4YXWA 3T7IA 2P3LA 2Q0XA 1ZWLA 1SCDA 1CF4A 1YDGA 4P0PB 4HNVA 2EFHB 2G0TA 4KWEA 1WCXA 2H2WA 3U3ZA 1T1SA 4F4IA 1AXRA 2PRKA 3K9NA 4J49A 5HUHA 3C7CB 1P1FA 1S8NA 2Q4BA 3I73A 5F5NA 5JWOA 1L8LA 3SR3A 3BDAA 2QV7A 3FZYA 3MBOA 2F6RA 1K6JA 4C1NA 4E2YA 3KPUA 2CT8A 3HCWA 2VKTA 3PFFA 4EPWA 1YO6A 2DXIA 1NKVA 1QF7A 3PCXA 4O4HB 4OVKA 4M49A 1WNTA 3I0ZA 5H02A 4A8JB 1LW6E 2GCNA 1G55A 3IULA 3IEKA 3CUUA 5ENZA 3R7SA 3OFNA 3GJ3A 2ZRAA 5EPOA 4HGRA 3U4CA 3HRIA 1NC1A 1UOEA 3HR7A 3K9CA 5I7VA 1M0EA 1CZHA 2IZ0A 1UDCA 2V6IA 4HVAA 2PHZA 1V2GA 1U02A 1P18A 1E2BA 1ZNZA 4MR7A 3WHIA 3ASVA 3H6GA 3GN2A 4L28A 3VISA 3TGWA 2IU3A 1CUGA 2IVFA 2OXCA 3BMNB 3MT0A 3O9ZA 4MVYA 3KLPX 4KDRA 3PLAE 3BYZA 4ZREA 5L4SA 5ILGA 4C14A 2BFFB 1CS0B 1V45E 1XROA 1S8OA 1OXUA 1Z39A 2HCTA 3K5PA 3QGMA 3VR2A 2AD1A 5C9ZA 3KRTA 5DIFA 2O8EA 1ZH6A 4G26A 1NW8A 3WMFA 2W98A 1NYTA 1G41A 3WNQA 3VAYA 4RPHA 1H1LA 1JG7A 2CVFA 1FMJA 5D3ZA 4K6FA 3UO8B 2JKZA 2HR1A 4FEGA 4BB0A 4QODA 3MUNA 3VNVA 1CE8B 1PJZA 1XJWA 4E94A 2W4MA 3H9EO 3LMKA 3PITA 3NTOA 4MZXA 4CT5A 3SZLA 3OKPA 4NCHA 3EXHC 4WLFA 4XPZA 3TNJA 3CTPA 4Q9JA 3UHFA 4EIWA 4BU1A 1JXQA 1FS4A 4EF5A 4R2WA 1KRXA 1II8A 5FUMA 5ALXA 3EPHA 1YNOA 3D8SA 5AUNB 3O0DA 4LV8B 4F72A 1YK0A 3D43A 4LHZA 3RRMA 1Y6JA 5BN3B 1T2AA 1PR3A 1IEXA 1R9GA 3HSSA 3R0XA 5CX1A 3AVXA 1YRWA 4NXNB 3C6BA 3TBKA 4J0IA 1MB0A 3RJ5A 3FBTA 3LO8A 1YVUA 5FXMA 1PFGA 1KWKA 1FDVA 1WZ2A 3IPXA 2GVNA 1M2HA 2WF6A 2WW8A 1X2BA 3D3EA 1G7RA 2J87A 3AYZB 3FFTA 3HJTA 3QKUA 4ZN6A 5IJ0B 1XVUA 3WBBA 3ZGLA 4GWKA 1NW4A 1L4MA 5EJEA 1L0BA 3DYIA 1D1QA 1UWCA 4BS9A 3W4JA 3DBVO 5IZCA 3FWNA 3TLCA 3AEYA 3MD0A 5CVVA 2PBRA 3DNMA 4BP3A 4DUGA 1T0BA 1DAGA 3JQDA 3PPXA 1XTJA 3BD9A 4M9QA 3JQAB 4TWIA 4GM1A 3N07A 1MQAA 5CG2A 3BB4A 2IYRA 4GM4A 4WZAB 1RPAA 2CDCA 4PRYA 2DWPA 1G291 2RIPA 3SQNA 1RRCA 1X7YB 4L02A 4P3OA 4QUKA 3W1WA 3USZA 1VMKA 5ALRA 1U5AA 2VJOA 3JWHA 3OZ7A 1P2BA 4ZARA 5AT1A 5IHPA 2FPOA 4NAHA 5KYVA 1JIJA 1YIOA 1HDOA 2BV3A 1KJZA 3AI3A 2I1VB 3EJ6A 1G63A 1XGKA 4FQ8A 1X1AA 2DC1A 1MLDA 2M2IA 4DCJA 2I54A 2OFOA 2VN8A 1E9CA 3WY9A 1W5EA 4CW7A 2VWGA 4FQ7A 3ZCQA 3RC3A 1XD2A 1QGZA 3GEDA 4YAFA 3FMVA 421PA 4ZO6A 3CVVA 4KQ2A 1N57A 4GZ5A 1ZRNA 2IVZA 2RG7A 4ERNA 1QO9A 1S2IA 4QU5A 5K03A 5HRUA 4DR5B 1KBZA 4NE2A 1RKVA 3OZUA 1OI4A 1XZFA 1N4DA 1QGUA 4PAQA 4KO3S 3UJHA 1MDBA 3ONDA 1I7NA 2WVHA 4ND2A 3RTGA 2VRWA 3FRJA 4ND3A 2FUEA 4JZYA 3UCXA 3SX0A 3VV3A 1JECA 3BKXA 4CIXA 4ROSA 3B9QA 4JP2A 4ZP1A 3VPSA 4ER6A 4XIIA 3CBGA 1IUPA 1O6GA 2YUTA 3CH4B 2CL5A 1QK4A 2E9SA 3E48A 4GD3Q 1UP7A 4YAUA 2C9CA 1CERA 3AZOA 1II0A 4ZQEA 4KRFA 3S40A 1FZQA 3FKQA 4JLPA 5AVTA 1JYEA 2E48A 1A4RA 2H0QA 3HG7A 3JPYA 4JX9A 4XDYA 2WB2A 2WAMA 3B1VA 2JD2A 4COKA 2GJ4A 3IIEA 3KLNA 1DBSA 1SUDA 1YS7A 1KP2A 4K9RA 4PC2A 2NSDA 4QUIA 3UC5A 3NT4A 2GN2A 1WUTA 3VO1A 2XA2A 3ZD6A 2QMHA 1S2LA 1PQ4A 1RHQA 4A03A 5CB4B 1D2EA 2YOHA 1UFRA 2V5VA 2FETA 1DRVA 1J20A 1GLVA 1Y3HA 1LLFA 3H5OA 2DSTA 2GEDA 4NHEA 3RU2A 4Q4HB 4ZALA 3IDFA 1JMYA 1VKZA 3Q11A 5TGTA 1T35A 4NHOA 4KMMA 3SS7X 2WPDD 3EEFA 5E1OA 2O8FA 4N03A 2A0XA 2WJJA 1MV8A 1NX6A 1AY0A 1I4DD 2VJLA 2XE4A 5BRAA 4B3MB 4NFLA 3W77A 4XCXA 4MI6A 3IELA 4HSEA 1WZIA 2BP7A 3EXHA 2QQFA 1WZUA 1G98A 1I2AA 4QGFA 3EXEB 1ECPA 4FZ5A 4BFTA 1P0IA 1UMCB 2W2LD 2PMDA 2LIPA 3OAAD 4C05A 2XYPA 2FN8A 3CVJA 3EVZA 3IAM6 4I4TB 2HGSA 1Q15A 3A36A 1EZ1A 1JHQA 1I3MA 2W7TA 1UPAA 4IPTA 1IQRA 2IJGX 5JBQA 1K0UA 3P20A 5CFLA 5K0EA 1R5OA 4OSEA 4LTNA 3VC7A 1R4ZA 1XKXA 5TQ0A 1WPGA 2YFKA 4OGLA 5TDHA 4WWHA 2GPYA 2XJ4A 3KXKA 4KDEA 1YUBA 4Q48A 3CA8A 2OY0A 4FIZA 4F6LA 5EINA 1WM1A 4J0QA 4R05A 4CFZA 2PT7A 1G20B 4JR0A 5JXWA 1KJYA 1YMQA 1WPRA 3L1HA 4REOA 1DJMA 4J03A 1LLDA 1MVOA 1QAQA 1QH1B 1SZJG 1ZD2P 3UBTA 1ZC4A 2IUYA 4HRVA 2P4EA 1VKOA 3BRWD 3R3YA 1YZFA 1BHJA 2AN3A 3GEBA 3LUBA 1HDZA 2IYXA 2GK3A 1GFIA 5T8KC 1BEZA 2X7JA 2R96A 3GXOA 3KCQA 4RQBA 1JQKA 1QYVA 2WIJA 3AFGA 3CUEF 1QC5B 4XVCA 5JNWA 4EKDA 1RRPA 4IS2A 2HMAA 5F1PA 2HDNB 1JJFA 1N0UA 3ICEA 4P4UA 1SR8A 4KQ1A 4DCOA 4BNZA 3U7RA 1HG1A 4YJ3B 5PNTA 4TVBA 4AZVA 1JFTA 1KPIA 2J3LA 2HJGA 4JDUA 1WMAA 3IAFA 4DEYA 4CEJB 3AQIA 4PAOA 3QI7A 4CTMA 1SUPA 3SM3A 5GP1A 4KFRA 4AQ7A 1M2OB 3IMEA 1CK4A 4X8HA 1A8SA 1PAUA 2C3MA 5FEMA 1EE1A 1U8ZA 1C30A 2PWAA 4OATA 5I9LA 3SWWA 4X7BA 1S9DA 5DYGA 3SX2A 3MMNA 2HXGA 1M67A 1PW5A 3L0ZA 3ZW7A 2BEUB 1YR1A 2JGKA 1T9BA 3T5BA 1SXIA 2Z43A 1IM2A 1OBOA 2QUIA 3THWA 1F2DA 5AI8A 4LECA 3MJCA 3TWOA 1KK0A 4XZ3A 4LAFA 4Q4JA 2ZANA 4JKIA 4EJ6A 5A1TA 3H1AA 2EL9A 1ZOOA 1GP2A 2HDOA 2MMCA 3H5VA 1WS6A 3NETA 3QFTA 4HXYA 4EX6A 5HRAA 2WG2A 4EF4A 4TYWA 3L05A 4XOIA 2V9ZA 5TC4A 1BO6A 1BJTA 5ITSA 3I04A 3PNBA 3ZXXA 1Z12A 4JI5B 5C8VA 1SD5A 3KB6A 3KJZA 3SBDA 2A30A 2OAQ1 3E2MA 3FMFA 4QG7A 4EARA 1Z2NX 4CM8B 2XB2A 3Q6MA 3KJGA 1Y7PA 3PHIA 2D6FA 4UTOA 2NWQA 4UQPA 1XNJA 3AUFA 4JVMA 2ZAYA 4L2IB 4EP1A 2WD8A 1ZH8A 2I7CA 4JI3B 3TI7A 2PSDA 3SBEA 1XZKA 2L42A 2HU8A 2I2BA 3OQNA 1Y1KE 4QPPA 5BN1A 4Y8VA 1I7LA 2XB9A 1LQUA 2AJDA 2PMCA 1VP9A 1CR2A 4RK0A 3R7DA 3OUUA 4RKYA 3Q8WA 2C84A 1JJAA 2E21A 3P0RA 4RVDA 3CVXA 3P5BA 4M7RA 3U3DA 5AUOB 4GU5A 4FT2A 2H4FA 5EIAA 5B3LA 3ERCA 3LL4A 4KQKA 5K3CA 1FK8A 3TZHA 5C51B 3ZQ4A 1WR8A 4ND7A 3SYLA 4HFNA 1G60A 2ASEA 1W2WB 1KZ9A 2FEMA 4BB5A 5LU8A 2P30A 1DNPA 4LRQA 3U49A 4HHEA 3ZLBA 3PE4A 3WQHA 2FPIB 1OX5A 2OE2A 4EVRA 4YRTA 1MJGA 3F9RA 3I39X 4Q05A 4X1YB 4BASA 3FCSB 4FFBA 2GYYA 1P2TA 3RAJA 2O54A 2W2TA 2BH2A 2GQ0A 3ABZA 4DCPA 1L8AA 1X14A 1ANKA 2YWEA 3CZQA 3EGVA 3NCHA 4KV9A 4QPZA 5CR9A 5DP2A