2Q2QA

Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
250
Chain Sequence
TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cosubstrate-induced dynamics of D-3-hydroxybutyrate dehydrogenase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords Beta-D-hydroxybutyrate dehydrogenase
total genus 91
structure length 250
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q2qA00
4A03A 1I10A 1OBFO 4NG5A 1UXGA 2NQ8A 1YBVA 2W2KA 3NDIA 4BNFA 1EFKA 1NHGA 2C20A 2NLOA 2QZ9A 1VRWA 4NZ9A 2A9FA 4NBTA 3K96A 4CR7A 1DHRA 5A06A 2UYYA 4U8GA 1ENYA 3ABIA 1GAEO 1PEDA 2YFHA 3GDGA 2CDCA 3ORFA 4QUKA 5DNAA 1HZZA 3ZU5A 1IL0A 3D3WA 4IDFA 1DAPA 3LQFA 3U49A 4U7WA 4Y6PA 1DRVA 3KO8A 3ZH2A 2P9EA 4E5NA 1ML3A 3WLEA 4BO0A 4ND5A 3WYCA 1U5CA 3KSUA 3PHLA 3JQCA 1E6UA 4UVIA 4JP2A 2FSSA 3NUGA 4KQXA 4KWHA 2O3UA 3UICA 3GR6A 1R0LA 2PK3A 4RF2A 5HWSA 5G0WA 3TZQA 4MVJE 1D1TA 4KWIA 2QYSA 2CVOA 2I3AA 3IAHA 4BVAA 1IPEA 3AY3A 3QWIA 2IXAA 5JW6A 3VZQA 4OJNA 2VN8A 2X9VA 4PLYA 3U4DA 1W4ZA 1FDWA 3ZZNA 1WP4A 2AW5A 2GPTA 5L9AA 1LRLA 3K9QO 5JDCC 4BO9A 3PZRA 2NU6A 4DPLA 3GG9A 4KOAA 1I30A 4RORA 1Y8RB 4RQTA 2YHIB 1V9LA 2ZTMA 3GUCA 3OETA 4GWKA 5F5NA 1VJ0A 1DEHA 3HADA 4ZA2A 4HBGA 2C2XA 3EVTA 2VHVA 3HDYA 3ZU3A 3SXPA 2Q49A 3QY9A 4YJGA 1SEVA 5BQFA 4U5QA 1I32A 3ZU2A 1V35A 1IZ0A 3DHEA 4D3FA 4YJDA 5AOVA 2CUKA 1RYEA 2IODA 4RQUA 3RUAA 3LU1A 1LDMA 4ROSA 1BHSA 1GUZA 4FBGA 5EN4A 3DBVO 1X0VA 2NU7A 1HTBA 5KVVA 3AM4A 1HLDA 1C1XA 4TMFA 3IKTA 4CMHA 4E0BA 1P31A 3PWKA 3EHEA 2QG4A 2DLDA 1NQOA 4MJLA 4LW8A 3H9UA 4EJ6A 1KBZA 1UDCA 1M6HA 1OOEA 2J3IA 3WOHA 3CPSA 3AI3A 1CQIA 3PWSA 1E6EA 3DBLA 1F14A 1E1MA 1BSVA 3GPDG 4GI2A 3GN1A 4OOEA 4TWRA 2YHUA 3GRKA 2G17A 1NFQA 1UAYA 2NACA 2OL4A 4WCDA 4NJMB 1DC3A 3F1LA 1G6KA 3OICA 4JBIA 1ZK3A 2NADA 4R1NA 2VNSA 1PL6A 1UAGA 1IYZA 2Q2WA 4OXYA 3DOOA 1ZZEA 1AHIA 4XZ3A 1ZEMA 4CLOA 4MVJF 3DBHA 3Q11A 2B36A 1EQ2A 1E5QA 4ILKA 1GEGA 1GPDG 4H15A 4Q3DA 4TSKA 2BFAA 4UEJA 4LVUA 2X1HA 3GG2A 2AEMA 2HK8A 4FSHA 1LBEA 2A35A 4KTVE 1ZSNA 3JQGB 1YJ8A 3RCBA 5IDXA 5EIOA 4GH5A 4ZQBA 3TFQA 5TIIA 3MJVA 4FW8A 4DTIA 3JQFC 2W90A 1TVEA 2BH9A 2FOIA 3VDRA 2FZWA 3MOIA 4I9NA 2PD4A 1LTHR 4HFMA 4BNMA 1XU9A 1ISHA 1JAYA 3CIFA 2WSBA 5L7YA 1LRKA 3WTCA 3S8MA 1ENZA 5JCJD 2OORA 4NFSA 2AQ8A 4AJPA 4OL9A 1D4FA 3ONDA 2VUUA 5BNIA 1HLPA 3Q6IA 3HQ4O 3RUIA 3OSUA 2Y66A 3DMYA 4RGBA 2QIOA 5B1YA 4K9DA 4CLDA 3MJ4A 1PS9A 2AG5A 9LDBA 4PLTA 3WXBA 3VH3A 1M2WA 3LT2A 3NEPX 2DKNA 4I5DA 4J2HA 1XHLA 2ZYGA 4LVCA 4CR8A 3GUYA 4ALIA 3EGOA 1V3TA 2X4GA 2VT2A 4E12A 1ISJA 1Y1PA 3T7EA 1FDVA 4IIVA 4EEZA 2E4AA 5I7SA 3ONEA 4CLRA 4JJGA 2CZCA 4GSLA 2DBQA 3QP9A 1LQTA 3FR7A 1IY8A 1ZH8A 4AICA 3ZWCA 1ZMTA 2VWPA 4W4TA 3UKOA 4Z9FA 4RF3A 1ZIDA 4P4LA 1YQDA 4CR6A 4ZD6A 1DIGA 1U5AA 1HF3A 1Z82A 3RC1A 1O9BA 2D1YA 4L76A 1WDLA 4CLXA 4TVBA 1HYGA 1EVYA 1NWHA 3CH6A 1FDTA 2GZ3A 1DIBA 2B35A 4DGSA 3KSZO 1P77A 2EERA 1ULSA 3A9WA 4NR0A 3TL2A 3HNPA 4YA6A 1JQBA 5A9RA 4M1QA 1BG6A 1YQGA 4TZTA 3NGXA 3BYZA 1BRMA 1H9BA 3FSRA 4OXNA 4WECA 5CAEA 2O50A 2W8ZA 4ZVVA 4MDHA 5G0UA 3TDKA 3ROMA 3ZW8A 2ZTLA 4LK3A 4Z9XA 1ENOA 5KVQA 5H82A 3GGOA 5DBFA 4PLVA 4GLOA 2EKLA 4HNGA 5EJ2A 1R15A 3WSVA 3FBTA 4XGNA 3K2BA 4PGFA 2B5WA 3BMOB 5ITVA 3MTJA 1U1IA 2GN6A 2EXXA 3GFBA 4DQXA 2YY7A 3ZV3A 4PLZA 5EQFA 2IEDA 3AK4A 3C8MA 5DP2A 4PFJA 3KEOA 3QWBA 2NSDA 4KMSA 3VOSA 1KOLA 4G2NA 5G0TA 3ETDA 2JFGA 1JVSA 4B8ZA 3AUAA 2Z5LA 3FWNA 3GZNB 2Y05A 4QEDA 1BGVA 2C82A 1OFGA 2ZKLA 3EK2A 4CUJA 2JD2A 4YB8A 1Q0LA 4L0QA 3CZRA 2EJWA 2B5VA 3IP1A 3GAFA 2BFPA 1PZGA 3SC4A 1BMDA 4CM9D 4EUEA 1AUPA 1Z73A 4RDIA 1EUCA 1HWYA 1P1HA 3ZNOA 2IRWA 2V6BA 2Y1EA 4R1SA 3NDJA 1O0SA 3JQAB 2I66A 1IZ9A 2W2KB 1I8TA 5L7TA 1JAXA 1XWFA 5JSFA 4NH4A 3AJRA 2WMDA 2ZTVA 1GPJA 1GEEA 1IE3A 3H2SA 2GGSA 2JFHA 5L40A 4BQRA 3I6IA 4Q39A 3QVWA 3E6AA 5TRTA 2Y99A 5IDWA 1HL3A 2QX7A 3DC2A 4CM3A 1WZEA 4K6FA 4ZRMA 1NVMB 2PD6A 1HDRA 3WGIA 2G76A 1YXMA 3E9NA 4JN6B 4J0EA 5FFFA 2GLXA 3IKVA 1FF9A 4KP7A 1QMGA 2GCGA 3DHYA 3PLNA 1QLHA 2Y1FA 4NFHA 4XDZA 4XQEA 5JNLA 3AOGA 1ZCJA 3ZW9A 3NX4A 4GKBA 4H16A 3NTOA 1JDJA 3ZNQA 1UDBA 2Q46A 5DCYA 4PG8A 1SOVA 2VOJA 4L4XA 3NAQA 3ZCXA 2RCYA 2QW8A 1ZK2A 2Q1UA 3PHGA 1GQQA 3UCEA 2QYTA 5FYDA 5ER6A 1MC4A 4IXTA 4WEOA 4MIOA 3Q0EA 3C7CB 1EVJA 2WD7B 2JD1A 3KYDA 1CETA 5ITWA 3RAJA 2POQX 3VVCA 5KJFA 4NK4A 3L4BC 4EZBA 3UF0A 2JHGA 2RH8A 4FFNA 3UXYA 1SCUA 3E5RA 1WDMA 3QIVA 4FCCA 3JQEA 3RJ5A 1X0XA 1MG5A 3H2ZA 1IHXA 4KZPA 4P8RA 4DC0A 4CLHA 4H3VA 1SC6A 5DF1A 3GVPA 2G5CA 3WFJA 4MVJM 3BMOA 3JQ6A 4RPLA 4A27A 3IDSA 4GX1A 3HWRA 5KJEA 4BNZA 3A4VA 1MV8A 2AG8A 2O3QA 4YYZA 2OBNA 3O8QA 3WMWA 2X58A 1WDKA 4U0KA 4M8SA 1LDGA 3RUFA 1ADGA 5GY7A 4ZICA 3AOEA 2P91A 4BMNA 9LDTA 1ZMOA 1DAOA 2HDHA 1A7KA 4J7CA 5T57A 3FNGA 3HFGA 5JCJA 1Q0HA 1PJ2A 3ZHXA 2VHYA 5HRUA 5FF9A 1X1TA 2NVWA 2PA3A 1HDZA 4E2XA 4R9RA 1U4OA 4QT0A 4OYRA 3CE6A 4B3IA 1EBUA 3D7LA 5B37A 4CM5A 3U5TA 2WJPA 3WIDA 2GERA 2YFQA 2RAFA 5F21A 1DOHA 1HDGO 4BO1A 4JBGA 1CEQA 4KTTE 4XKJA 4MKXA 3DONA 3RC2A 1T2DA 1H2BA 4QECA 1QP8A 1UJMA 1DSSG 1I33A 4M55A 1XLTA 4JX8A 4PLCA 3U62A 2CY0A 1JTVA 3QHAA 1PGQA 4JCOA 5KJ6A 3F9IA 1XIVA 4JK3A 4EYEA 2NTJA 4Z3KA 1LX6A 3OJEA 4ESOA 1PJSA 2H5LA 2WWRA 4UUPA 2DBVO 1P33A 3JQAD 2WM3A 1GL3A 5A3VA 5TGDA 4LGVA 2CDBA 3UFXA 5JC1A 5CDUA 2OGUA 4IUYA 5BNTA 1B16A 5IN5A 2X22A 5JMPA 5A5FA 2ZB7A 5EL0A 5JDIC 3SVTA 4RV9A 4WCFB 1T4BA 1XQ6A 3JD4A 3NGLA 3QVOA 4HXYA 4J1SA 3RBVA 1ENPA 3I5MA 5TJ9A 4BNUA 4BNHA 3PLRA 3VH2A 1IOLA 5BSGA 5THKA 3M2PA 3JD2A 2RHCA 4I5FA 4DIFA 2X6TA 1UP6A 2VNAA 3WGHA 4EEXA 1W0CA 5F3RA 5GZ1A 1LLCA 1UR5A 2X7HA 4TROA 1OI7A 1QRRA 3H65A 4DBVO 2J5RA 4B4WA 4KQWA 4PVDA 4CUZA 1ADFA 4A5OA 1PIWA 4D0RA 4E2YA 3ADPA 5JS6A 3PWZA 1PR3A 2VWHA 3H9QA 5B4TA 1J4AA 1XEAA 5CPBA 1PX0A 2CF5A 2D2IA 3WJAA 1PJCA 3ZWVA 3FNFA 2CD9A 5EPOA 2E37A 3VKUA 2DAPA 1ZXLA 3JSAA 4NU5A 1GZ6A 3F6YA 4B7XA 4RJTA 1Z7BA 4IIUA 1DB3A 4HFJA 4NBWA 5CDSA 5L3ZA 4FIZA 3PVZA 1U8FO 4BNGA 3LYLA 3WGYA 3LF1A 3N7UA 5CG2A 2WYUA 5TS3A 3ZV5A 4DLAA 4PLHA 4BNVA 3UAGA 3PDJA 5U4QA 1QXSA 2BGMA 3TZKA 4IZHA 1LDEA 1DO8A 2V6MA 1UUFA 5T64A 2CF6A 2X0IA 3GVHA 2PKQP 2NTNA 3WYBA 4OOFA 1VL6A 2HRZA 2EWMA 4U0JA 4DBZA 1KVRA 2O7SA 3NJ4A 4MO2A 1SEPA 1RWBA 3HJAA 4FGSA 4J1QA 4XYBA 5I7EA 3RFXA 4XJSA 1WXDA 4EGFA 5JXWA 4WKGA 3MTGA 2DFVA 4JNKA 1NAHA 1YWGO 1HZJA 3FPLA 4YACA 4BKPA 5ES3A 1VI2A 3SJ7A 1MLDA 1NQ5A 4WJZA 1S7CA 4ZQHA 2PZLA 3HDHA 3KVOA 3MOGA 3W4JA 3DHNA 3E48A 3BMNB 4Y6RA 1HDXA 1O5IA 4L74A 1YKFA 4NNJA 1ZSYA 3GNTA 5EMHA 5BSHA 1GQ2A 4CLEA 4D45A 3OIDA 2P2SA 1JW9B 3BTSA 4FGWA 4Z0PA 1B3BA 4Y98A 1ISFA 3S1LA 1YOVB 4R01A 2C5AA 1A4IA 2JAPA 4AJEA 2NTVA 4YDRA 2Z1MA 3C1OA 1GR0A 5CEJA 2Y1GA 4GMGA 1C0LA 3AWDA 5IZCC 4YXFA 4D79A 2O3TA 1ZSVA 4XIJA 2FPPA 4BL5A 1YE3A 4GBJA 3HSKA 3GGGA 3KSDO 2B83A 4L75A 1VL0A 1MXHA 1UZLA 4HV4A 4C4OA 3ASVA 1RM0A 3A28A 1FDSA 4YPOA 1LXCA 1MFPA 3RUDA 1GUFA 4DVJA 4RPJA 4RVUA 2BRUA 4IDBA 4CMKA 3ITKA 3EDMA 1T26A 3H9GA 3RKUA 1UXHA 4DIOA 3SX2A 4TVOA 3K30A 4BO2A 4ZQGA 4C7JA 3BIOA 3VHRA 4I1IA 2W4QA 2I6TA 1MX3A 4DMMA 3NYWA 1N1GA 5LCXA 4BNKA 5JLAA 1F8FA 1R4NA 4TKMA 3QWAA 2AA3A 1LQUA 3NTQA 1IUKA 4CM4B 3OQ6A 3GZNA 4O1MA 4URFA 1CRWG 3WG9A 5I9NA 2VYND 3VDQA 1B15A 4NIMA 3KBOA 1NVTA 2D59A 4FJ2A 4YAKA 4AVYA 3RASA 1ZW1A 3ZHYA 5HM8A 1WAMA 2VWQA 1MB4A 1V8BA 2YV1A 1DC5A 3JYPA 4J49A 3GHHA 2VUTA 1PL7A 3FR8A 5COBA 2ZATA 2BELA 3LC7O 3U4IA 4PG6A 3BHMA 2PD3A 3RFVA 1ZVMA 3KYBA 5G0SA 1TI7A 3WMXA 3I83A 2G1UA 3AM5A 2ZQYA 4ND3A 5JE8A 3O9ZA 3ANMA 4JJFA 4XQ9A 1ONOA 4IJVA 4YT4A 1Y5RA 2Q2VA 3FD8A 4ONEA 2HJSA 4W9NA 1CERA 4QTZA 4R69A 2FWMX 1PS8A 3DOJA 3JQ9C 3Q2KA 4D0SA 3OFSA 3FCOA 4BNLA 4CPDA 1B7GO 3C24A 4WPGA 3BTOA 1R4MA 3L6EA 2Z1NA 5AXDA 2VCYA 4CQMD 5JMWA 1Y8QA 3QRWA 4BGEA 3G3EA 2VZ9A 3MJTA 1BWSA 3FNHA 1T1SA 3IIEA 4B7UA 1Q0QA 1NQAO 4GMFA 2AQKA 3NKLA 3NT5A 4XJTA 1HYEA 4GGPA 5BSFA 3DO5A 1AGNA 1GY8A 3BMQA 3JQGA 5CFZA 4DUPA 2QZZA 5A02A 4RZIA 4HP8A 4XB1A 1LA2A 1WZIA 1BW9B 2CDAA 4F6CA 1JKJA 3BXXA 4J0FA 5GMOA 4TRNA 2AEFA 3TJRA 3DFZA 3FTNA 3P5SA 4LSWA 4QX6A 3UW3A 1ZJZA 1HXHA 2BLLA 1K6XA 2VT3A 1JN0A 1I01A 1X1EA 4EJMA 5JAMA 2FP4A 2Y1OA 3KETA 1KVSA 5F5LA 2JKVA 1U9JA 3KYCA 4YQZA 2GRAA 1ZK1A 3NT4A 1T2CA 3DZJA 1N8KA 5DN9A 1BXZA 4EITA 1PZFA 4WCFC 4AL4A 3WSWA 2OO5A 5KJCA 1D1SA 1GTMA 1XR3A 2X0JA 4NK5A 4PVCA 3Q3CA 1C1XB 1LRJA 3I9MA 2X5OA 3NV9A 3TPCA 4II3A 3EC7A 5T5QA 3DR3A 1H9AA 3LF2A 2PZKA 4XGIA 3H9JA 3V8BA 3DMTA 2Q4BA 4MP6A 1UZMA 1GZ3A 4IMPA 2CMDA 3TSCA 3BZUA 4IINA 3DTYA 2J3KA 1KC3A 3ASUA 3D3EA 3PJFA 1MUUA 3JQ9A 4KUEA 4W9NC 3GQVA 2DBZA 5L51A 3BTVA 2PH3A 1Q2XA 3L6DA 1TEHA 2LDXA 4ZN6A 3KZVA 5KKCA 4P22A 1CDOA 4NQZA 3KYDB 3DEYX 4LN1A 2I3GA 2WD7A 3I6QA 5JAIA 3BAZA 4PZCA 5DZSA 1NAIA 2GZ1A 3PHHA 1TT7A 2NV6A 3H6KA 3SJUA 1JKFA 4JGBA 4BGVA 1WW8A 4G65A 4I5GA 3VZRA 4CV3A 3SLGA 4WOJA 2HMTA 4AJ4A 2DTDA 3WR5A 1DRUA 1LI4A 1N7HA 1U3UA 2AMFA 1BXGA 1U7HA 3GK3A 4E3ZA 4IGEA 1A71A 1YO6A 2HCTA 2VHXA 1VLLA 2EF1A 3FWZA 3KLMX 4EW6A 2PR2A 5JCXA 5KTKA 3RBXA 5EQDA 3GY0A 2PH5A 3P7MA 3AI2A 1NP3A 1B2LA 2CNBA 4YVFA 3ZWMA 3I9NA 3WYEA 2WDZA 3V2GA 1HE4A 2HMSA 1EFLA 3ZWWA 2BD0A 4JP3A 2H63A 5LC1A 3EVNA 3O38A 2OP0A 3JYLA 1H6DA 3BA1A 4BV8A 4U6SA 3LVFO 3ENNA 3W8EA 1P0FA 5A9SA 1I5RA 3IL2A 4BNTA 4BQPA 3WNVA 1KVUA 4E32A 4QFDA 3JCZA 2IEBA 3E8XA 5CPFA 3JQAA 5DT9A 1YGYA 1Q1NA 4N54A 2YW9A 5FEUA 3OMLA 3COSA 4IQ0A 4XYMA 1K89A 5L45A 4MVJH 1DFGA 1KVTA 1N9GA 2AE1A 5F1PA 3QSGA 2O3JA 4WLFA 3H3JA 2UVDA 3W1VA 4YR9A 3DZFA 4K26A 3L77A 3OJFA 3W4KA 4C7KA 2NNLD 4B4VA 1GUYA 1SBYA 4HKTA 3RU9A 1RPNA 4BB6A 3PIIA 4MVJA 1LSUA 5H83A 2E48A 1EVZA 3JD3A 1NM5A 4J43A 5I7FA 5L4SA 2A94A 1DFIA 2R00A 3B1KA 4AJNA 3JQ7A 4YJHB 3WFIA 1P74A 5FWNA 1MA0A 4CV1A 3ROKA 1Y7TA 1GZ4A 3GHYA 3INGA 2ZJ1A 3E9MA 3F5QA 3WGQA 5THQA 1VJ1A 1FJHA 3WS7A 3DZHA 2B69A 5I8ZA 5TSDA 1DRWA 4QQRA 2WE8A 1XKQA 4MOWA 1W6UA 1LU9A 1QYCA 5I9LA 3D3WB 3DAPA 4J9VA 1M6WA 1CYDA 1DPGA 2J8ZA 3HE3A 4JLWA 2J6IA 1E3IA 5AXCA 4M54A 1YBAA 1H93A 2C54A 1I3LA 5K6AC 1I3MA 1E7QA 3IP3A 3B20A 1MC5A 2Q3EA 1N92A 1LDNA 1SAYA 4GVXA 4J1TA 3OQBA 4E5MA 4ZU3A 4R5HA 1YDWA 5IFLA 1HE2A 1NASA 4IDGA 1L7EA 3N74A 5B4VA 3V1YA 1C14A 4WLNA 5TF4A 5CG1A 3LSYA 3B70A 1YJQA 3LT0A 2V6FA 2Y0DA 1AE1A 3NT2A 4R3NA 1YL6A 1Z7EA 3DBRA 1QYWA 3KUXA 2GF2A 5LDHA 4FC6A 4R68A 1O95A 2TMDA 1BXGB 4WLUA 3ONFA 1DC6A 3PTZA 4IQGA 1XQ1A 4XQCA 1LSSA 3ROQA 3ZGYA 3KRTA 1TA4A 2YDYA 3EMKA 2VYVD 3K31A 4XDYA 1E7MA 4FJ0A 1H2HA 2JAHA 1QR6A 2DQ4A 4R54A 3S2EA 3ANLA 4ZJUA 4HFNA 4OQYA 2O4CA 3FHLA 3Q9UA 1E7WA 1R6DA 2V7PA 3PJEA 4NBVA 3RUHA 2PLAA 4D44A 4DRYA 4BGUA 1E3WA 3FRJA 4DXHA 2D0IA 3EYWA 1DIHA 1G1AA 4G81A 4OMUA 2C07A 5A03A 2D4AA 3AM3A 2BF7A 3ICPA 4Y67A 3A06A 3O4RA 2Q45A 1NBOA 4L73A 4PLGA 5BNFA 4YAJA 1H5QA 1U2GA 4OAQA 1T4DA 3VH1A 3C85A 3FI9A 1E3SA 4IS3A 4DQUA 2CFCA 4XWYA 4NBUA 4RPGA 3M1AA 1DIRA 1E92A 1BDMA 1QORA 4G5HA 4O63O 3TFOA 2I9PA 3AY7A 3JD1A 3I9LA 1EE9A 4W82A 1PTJA 4AJJA 2EV9A 3GEMA 3TL3A 3U0BA 3CTMA 1RM3A 2HU2A 1LSJA 5JYDA 1A27A 5K0ZA 3GH3A 5ADHA 3SC6A 3PYXA 4D41A 2C2YA 3Q9NA 2PGLA 1PQPA 3OHSX 3GPIA 1E0DA 5JC8A 1PSDA 1ZO8A 4N5NA 4R1TA 4R9SA 5ICMA 4WLVA 4CMJA 2Y67A 3PI7A 4XCVA 4AJKA 2NU9A 1U3VA 4MVJD 1K5HA 5JYEA 1LLQA 2ZYAA 2J5QA 2OHXA 4K6CA 5COAA 2HMVA 1W73A 2VRCA 4WNCA 4D42A 1YB4A 3V2HA 3OQ1A 1IB6A 3X2EA 1L1FA 5G4LA 3S2IA 1NFRA 2QHXA 4RPHA 4IJKA 4MVJP 3UN1A 4J7XA 1RKXA 1SO8A 2GSDA 4RPKA 3JQFA 3GNQA 3ROPA 4BNNA 4WOKA 1XYGA 2OUIA 1ISMA 3AFNA 3OA2A 4IQ8A 4AFNA 4MPDA 3L9XA 4BV9A 2Y1DA 5U9CA 3R1IA 1PJ3A 3RD5A 3T4EA 4BS9A 4IMRA 1A5ZA 4HWKA 3UGKA 1UZNA 4UUMA 4UVDA 2VHWA 4GGOA 3L0DA 4Q3CA 5J23A 4ND2A 4DPMA 2PKQO 1P1FA 2Y0EA 3JQDA 3U09A 4YT5A 4R4JA 3A1NA 2X23A 4YJFA 1X13A 3TOXA 5TT0A 4ZGWA 2FSVA 1KEWA 4Y8VA 1M76A 1K6JA 2GN9A 3GN2A 4GVLA 4K28A 4KDFA 4ALLA 5JO0A 2FRDA 1C1DB 1NPTO 1F17A 1PJQA 5TNXA 2C29D 3PJGA 2RH4A 3PDUA 1HKUA 2OBYA 3D4OA 3B6ZA 5BT9A 3ETGA 4NMHA 4DMLA 5GZ6A 1B3RA 1H6BA 1PQUA 2EGHA 4CV2A 1QV6A 3WICA 3L4BA 1YONA 3DTTA 4HNHA 4J7UA 4UAGA 5IN4A 4PG7A 4CM4A 3L07A 1NNUA 3AFMA 1GD1O 4BO4A 3L4SO 5L53A 2CVZA 1R4NB 1VJTA 2HMWA 3PYLA 2HLPA 3WGOA 3DZKA 3WNQA 1J6UA 3QVXA 1Y6JA 2GO1A 3Q2IA 4PLWA 3U4HA 3ZWXA 2I65A 3GFGA 2O48X 1Z6ZA 4ZQEA 5K9ZA 1D8AA 3G49A 4CQLA 2RIRA 4QXMA 3ZU4A 2X0NA 2HQ1A 1HEUA 2VQ3A 2V65A 4DYVA 1B8PA 4Q3BA 2VWGA 4CV0A 4MVJI 1XA0A 4J90A 2A92A 5KWEA 3GOHA 3HN7A 2J3HA 4E5KA 4UUOA 4YCAA 3ST7A 3WWZA 1UDAA 1B0AA 4RVHA 5AXBA 1YQXA 4H7PA 1Z45A 2RBEA 4ID9A 4ZQFA 4UVEA 5K6AA 2HMUA 4NJMA 3ZV4A 3D4PA 5IDYA 3OECA 1O94A 2X9GA 3PHIA 3UCFA 2IXBA 2FPIA 4R51A 2WD8A 4DLLA 4UEOA 2UDPA 1EK6A 1LC0A 3QVSA 1RM5A 4M89A 4UUNA 3EZYA 3IUPA 1KVQA 3G1UA 4CMEA 1WWKA 1U4SA 4UULA 1X7DA 5TQVA 4FJ1A 4GKVA 4YRDA 4LISA 4O59O 3WBBA 2JCVA 2WE7A 4NBRA 4GX2A 5KKAA 1XELA 2GUGA 4PLFA 3RWBA 1YVEI 3INTA 2FY8A 4WGGA 5CEEA 1I2CA 2VHZA 2ZYDA 1JVBA 2R00C 4Q3NA 3PXXA 5A4DA 2GR9A 2OOSA 3HDJA 3PQDA 3CSDA 1H6CA 3I4FA 3TZHA 1T2EA 1VC2A 1B26A 3R0IA 1WLYA 3E5MA 5U1PA 3VTZA 4YQYA 5IAAA 4LCJA 3EAGA 1N7GA 1XCBA 3AUSA 4FD3A 3BTUA 4E33A 3ZWBA 2DUWA 3M6IA 1DDOA 4NU6A 4CMAA 3OP4A 3OH8A 4HFRA 1GQYA 1QYVA 4IDCA 2BHLA 1NPDA 4WK6A 4E2ZA 3I9JA 1AXEA 1O6ZA 4K1LA 1HDCA 1KETA 5CP8A 3MZ0A 3RVDA 4BB5A 4XR9A 1ARZA 4I5EA 4MIYA 1NHWA 3W6UA 4BNIA 4ALJA 1HRDA 4OGWA 2EHDA 1QYXA 1YOVA 4OHUA 5TLSA 5GZ3A 2IYOA 3R3JA 3JQBC 4GX5A 2ZCVA 2PV7A 4JROA 1EQUA 1IPFA 3FPCA 3B1FA 1QV7A 4LCEA 1E6WA 4BO7A 4AJOA 1ISIA 4FOOA 1VSVA 4FOSA 3W8DA 1G0OA 3LT4A 2EW8A 4Y9DA 3TQHA 4WASA 3KB6A 3F47A 2AE2A 3GGPA 1PGNA 3I3OA 3ENKA 3V5NA 1XG5A 2EEZA 3GMSA 4GQAA 4WLEA 3MJEA 3GMDA 2HK7A 2NQTA 1CF2O 2ZB4A 4WE3A 1GFSA 4TZKA 2HAEA 1PGPA 4FPXA 2SCUA 4PG4A 3SEFA 2D8AA 3CXRA 2X0RA 3RUEA 1A72A 5CEFA 4BKRA 3E03A 4ALKA 4OSPA 1NFFA 1KEVA 4FFPA 4QO7A 1PJTA 1FDUA 3DL2A 5DBGA 2JCYA 5A3JA 1P0CA 4BMVA 3PQFA 1ONPA 4F6LA 1KY4A 1P3DA 2AHRA 4XIYA 4WLOA 4NJOA 2P9CA 3H5RA 1PZEA 3LLSA 1JLLA 2W2LD 1T24A 3VH4A 3RQSA 4MINA 2OXIA 2VOEA 1NR7A 1VE9A 4W99A 2PZMA 4YWJA 2ZTUA 4WCFA 1TT5A 1ZUD1 2ZK7A 4AJHA 4CM9A 2D3TA 4BKOA 1Z75A 4HADA 2DTXA 2O7QA 2EW2A 2P4HX 6LDHA 1AN9A 3PZBA 3CINA 3O26A 1OC2A 3GVCA 5A04A 3BMQB 4NI5A 5G4KA 1C0PA 4DYDA 3D1LA 2PGJA 3K92A 1H6AA 5DBIA 3OBBA 3E82A 4Z0HO 3DWFA 4D46A 2NUAA 1KC1A 4I08A 1GYRA 4M49A 4GAEA 4ITUA 3PGXA 1X15A 5EINA 3HB5X 4ND4A 4FFLA 4IS2A 3K73O 4B79A 2JJYA 3H5NA 1SZJG 1WVGA 5DOVA 3TWOA 1Y81A 5BSEA 5KVCA 4B4OA 2DPHA 4N18A 3D0OA 1YB1A 4BIIA 3RFTA 1H94A 3AW9A 3OJOA 2O2SA 1RJWA 3ICCA 3IC5A 4Z6KA 3WGTA 1YBMA 5TJHA 1NX6A 5CDYA 3RKRA 5IZ4A 4LRTB 4D3SA 2AEJA 1ADBA 2IDZA 4PLPA 4Q9NA 3ANNA 3F4LA 1N5DA 4A26A 2FN7A 3RROA 2UV8A 4BOYA 2D5AA 4DA9A 2Y68A 2CSUA 1LNQA 5C5IA 5L4NA 2Y0CA 3AUTA 3F5SA 4RDHA 5G4KB 5MGBA 3GRPA 4BNWA 4BO6A 5G0VA 3OA0A 2Q1SA 2QRLA 4GSKA 4Y6SA 5ILOA 4PCVA 1JA9A 3UHAA 2ZIZA 1YDEA 3H9EO 3WIEA 4D3DA 1R0KA 2WEKA 3IS3A 3RJ9A 4E30A 1DXYA 2C0CA 1WPQA 3O8QB 5JAQA 2BFMA 4LSMA 3I4CA 3ZI0A 4OO3A 4B3HA 5AYVA 1GCOA 2JL1A 4NDNE 2IYPA 3VPSA 2ZCUA 3STHA 3GAZA 1A9ZA 4PRKA 1E7RA 3DBRB 1C0KA 1LUAA 1UP4A 2WYWA 3DBHB 4E21A 1PR9A 1U8XX 5COQA 3UVEA 3LZ6A 4TRRA 2FHSA 4AJ2A 4YAEA 2Y1CA 4XYGA 4MP3A 3E1KA 3WQRA 2VTDA 3S2FA 2XPCA 3QWHA 4R5MA 1UXKA 3QWFA 3VZPA 3TOZA 1QYDA 4LRSB 5KOIA 3F46A 3EY4A 1I36A 3N58A 1E5LA 5CDTA 3QV1A 1N2SA 3A14A 1BXKA 5DCWA 2C7VA 3JQBA 2BGLA 4CMCA 4TKLA 2VZ8A 2PWZA 4DPKA 1LLDA 4HY3A 3IMFA 2VYVA 4BHTA 4AJ1A 1I3NA 1HT0A 4D7AA 3HDQA 1VPDA 2P5YA 1CIVA 4RLSA 2Q2QA 4MKRA 2B37A 3GVIA 3KEQA 3W8FA 1F0YA 4XRGA 1MG0A 2H6EA 4Z9YA 2C59A 1SNYA 4XRRA 1E1NA 3OF2A 4YJHA 5A1TA 1EMDA 1JWAB 1I2ZA 3JQ7B 3PHJA 1E3JA 1E77A 1U28A 2JHFA 4IDEA 3VPGA 3C1TA 1PGOA 5DCUA 1E1LA 1M67A 3GNSA 4B3JA 3IJPA 3BMNA 4RVDA 1A9YA 1QSGA 8LDHA 4NFYA 2VYNA 1S6YA 3KV3O 4M86A 2GN8A 3KXDA 2IZ1A 3I9KA 2YJZA 3BMCA 2HK9A 1ZK4A 2QRJA 2Z95A 3I52A 4F46A 4FB5A 4L4SA 5TC4A 1HSOA 5IZCA 3F1KA 4I8XA 3M2TA 4IDAA 5KJ1A 2AXQA 1DLIA 2X9NA 2D5CA 1FK8A 3LT1A 3RC9A 4CM8B 1A4UA 4RVFA 4CUKA 5AVOA 2J5KA 4J4HA 4BKQA 2I99A 4RLHA 4CM8A 3TNLA 1TB4A 3W4IA 3CMMA 4OXKA 1C3VA 5T8KC 1LDYA 2I67A 4CMEC 2HRBA 4E13A 5IJZA 4MP8A 4JIGA 5KNLA 3BMCB 3DFUA 4GL4A 4E6PA 1E3LA 2DT5A 3IQDB 2F1KA 3QVTA 1D3AA 4IPTA 4YBZA 3P2OA 3I1JA 3WGZA 3ZV6A 4YAGA 1L7DA 2O3RA 2YQ5A 3B1JA 3SLKA 2FZEA 2G82A 1RM4A 3BHJA 3WJ7A 5C37A 1EVIA 2X8LA 1ZKMA 3MJCA 1GYQA 3ZWAA 4UEKA 1ZFNA 1NQTA 4R16A 4E2WA 1LLUA 2V6GA 1OMOA 2JD0A 3RUCA 2Q50A 1XGKA 5I8WA 2BMAA 3H4VA 2VTEA 1MGOA 1SB8A 1PJ4A 2G0TA 2P9GA 4DLBA 4L4RA 2FR0A 4RVSA 4IBOA 1MXFA 3DDNA 1R16A 1PWXA 2XF8A 7ADHA 3Q1LA 4O6VA 4P4NA 3OEWA 4PZEA 1NR1A 3DAGA 4INAA 4TRMA 1WNTA 5I9MA 5A9SB 5F1KA 1DFHA 4BO3A 4XGKA 2NVUA 3V1UA 1NXQA 4A10A 1NWCA 4JQCA 2LDBA 1BW9A 3EUWA 4FS3A 1F8GA 3ADOA 3U4CA 1P44A 2W2LA 1VM6A 3QA9A 3RBZA 4WUVA 4EI2A 1EUZA 4W7HA 3X2FA 1O8CA 4KUHA 3WTBA 1P1IA 2B4TO 5AQ1A 1J0XO 2FR1A 4PG5A 4CLRB 1U3WA 3OEYA 2VRCD 3E9QA 3G1TA 2Q99A 2PZJA 2ZB3A 4XA8A 1LEHA 4GX0A 2EG9A 2FPGA 4IZIA 3F4BA 3GT0A 2Q4EA 2YUTA 1ZNQO 2I76A 1Q7CA 2O3SA 3MWDB 8ADHA 3D5QA 2XXBA 1X14A 3VPXA 1TT5B 4AJLA 1T2FA 3JQ8B 4XD2A 4CQMB 2X5JO 1P9LA 4F45A 1M66A 4OIMA 1BVUA 5JDIA 4TQGA 4A2CA 2XAAA 4CODB 1B14A 4DREA 3PYMA 2HSDA 2YQ4A 3DOCA 3NTRA 1CJCA 2FR8A 4X54A 4XQGA 1Y9EA 3G79A 3M1LA 2A4KA 2FMUA 1NPYA 3O03A 1HETA 2O4UX 2WYVA 4TRJA 1VKOA 4XYLA 4E5YA 1O89A 3DQPA 4BO5A 1KERA 3L9WA 1K0UA 2Q1WA 1RYDA 3NJ8A 3D5TA 3S2GA 2IE0A 3IJRA 5L4LA 3C1AA 2VRBA 4OH1A 1CWUA 3BHIA 4GWGA 4R3WA 1I24A 5JO9A 4LMPA 1K2WA 5IDQA 4L9RA 1IHYA 1VL8A 1PQWA 4KUGA 6ADHA 1ID1A 2W98A 1A7AA 3KYCB 2I5PO 1R4MB 3OJLA 5LDGA 1K3TA 4FN4A 5FI3A 3T7CA 1LJ8A 2X5KO 3C3XA 5JFOA 3PIDA 5T67A 1ZK0A 4CM1A 4XEHA 3KM0A 2PGDA 3P19A 3GDFA 1HDOA 2YZ7A 5CHEA 1QG6A 3WB9A 1I2BA 1PWZA 5L7WA 3QQPA 4N7RA 4CLOB 2NM0A 3FN4A 4XYEA 3PGJA 1T1RA 3GVXA 4IGFA 5JY1A 1GCUA 1ULUA 3DZBA 2DU8A 1DBVO 4I9UA 4R41A 1JKIA 1HE5A 3AOEC 5ICSA 4O0LA 1V3UA 3DAFA 1HDYA 1KEUA 2H9IA 1X7HA 1HE3A 1NTOA 2IZZA 4J6FA 4FR5A 2EKQA 3ZWYA 4HX5A 4B4UA 1DC4A 3DXFA 4XR4A 3WWYA 1M75A 5DOZA 1Y9AA 4BKUA 4HUJA 3AI1A 5ENDA 2ILTA 5HA5A 5JY6A 4CL8A 1H0KA 1C0IA 4M87A 4RVGA 5IXSA 4NPCA 2EJVA 3CKYA 3ON5A 4IJUA 2HKIA 1PZHA 1ZJYA 3U9LA 1BVRA 4RF4A 1SPXA 3K2EA 5DDIP 4YJGB 4CMBA 1V0JA 1R12A 2BFOA 5DULA 2BI8A 3TN7A 1R37A 3EZLA 4YRAA 4WNIA 2GYYA 2YHIA 4YAIA 2PY6A 1HSZA 3CZMA 4MVJG 4ALNA 2Y93A 1I3KA 3AY6A 3DBLB 3HB4X 1R0SA 4FDAA 4QSMA 1JWBB 2B4QA 1K6IA 1SMKA 1U2DA 1YH3A 1PJLA 2EIHA 1SB9A 3W6ZA 4EJ0A 4FFRA 2QRKA 1U7TA 4CQMA 1G0NA 4QFCA 2JCXA 3FBGA 3MJSA 4QO8A 1Y8RA 1YL5A 1MP0A 2B0JA 4IM7A 2PKRA 3U3XA 3AU8A 1E1KA 1CQJA 4JJIA 1DJNA 5C7IO 1VSUA 3R6DA 2P4QA 3PPIA 2CVQA 2EGGA 2YV2A 4ALMA 3F3SA 1OC4A 3WQSB 4J4BA 4BNYA 1UH5A 5ENVA 4EBFA 4JXKA 5B12A 1PL8A 2F00A 1N1EA 3PRJA 4W7IA 4P4GA 4Q3EA 3GEDA 5C3MA 3CEAA 5CDGA 5JBIA 5T8KA 3RIHA 4EUHA 4I9HA 1J49A 3L6OO 4RCVA 1FXSA 1KS9A 1BDBA 3OJ0A 1PGJA 1ZBQA 3K8ZA 1YS4A 3KOUA 4PZDA 1XU7A 4CQLB 5T6BA 1NYTA 1HYHA 4R1UA 3ZNNA 1OAAA 2DPGA 5HS6A 2ET6A 2GD1O 3ZWOA 3WLFA 4D43A 2E82A 2OZPA 3UCXA 3PFWO 4UVGA 3SBOA 2DUUA 3GDOA 3C7DB 5JPIA 4N5MA 1GADO 1UXJA 1Q7BA 4A73A 4RZHA 3OIFA 3ZHZA 3WBFA 3PQEA 3TZCA 4JBHA 2PFGA 1WMBA 1GV0A 4E31A 3LK7A 3V1TC 2ZQZA 4DC1A 3I9OA 2B4RO 3ZN2A 3PEFA 3WDSA 4GPD1 2HUNA 1PS0A 3GF4A 5MDHA 4OSOA 4OQZA 5A9TA 5HBRA 1ONNA 3UOGA 1AXGA 4ZRNA 2ZJ0A 3VPFA 1DHTA 4CM6A 4Z0TA 1GDHA 4N5LA 5C7OO 3UH1A 3T4XA 1NVGA 3RI3A 4YJFB 4CMIB 4E5PA 5ILGA 4PN3A 1W8DA 3DB2A 1N9GB 1EDOA 2AQHA 2R6JA 4CJXA 2QQ5A 5EERA 4DIBA 5JAZA 1AHHA 1F06A 3DZIA 3KTDA 5KVSA 1Q7GA 2X86A 2IZ0A 1GV1A 2C7GA 3QW2A 3HFSA 4RF5A 4OKIA 4CL3A 3MCVA 4YTEA 1EZ4A 4B8WA 3AU9A 3NRCA 5F1OA 3EW7A 4II2A 4OKNA 3ZDFA 3S55A 5B4UA 3LDHA 1FMCA 3UUWA 3WQQA 1YL7A 4J2OA 5L95A 3INRA 3PJDA 4FQ8A 5I7VA 2TMGA 5ER9A 4DL9A 3JYOA 4E4YA 2DFDA 1UP7A 3HHPA 4P38A 3JYNA 2AQIA 3TZ6A 4KDEA 1PJBA 1TLTA 2NVBA 3JQ8A 4IY1A 5HTOA 2PNFA 1T25A 2C5EA 1EUDA 3FTPA 2EP5A 3TF5A 3MWEB 1MFZA 4YT2A 1C1DA 4PIVA 5H81A 1KY5A 4A0SA 3JV7A 3G17A 3OIGA 3HN2A 2GN4A 5IF3A 3GZ4A 3LC2O 4J9UE 1P1JA 2DVMA 2VZ0A 2GDZA 2PTGA 1E7YA 3DMTC 3VAZA 4BUCA 3QLJA 3GLQA 2HO5A 3V2UA 1LSOA 3JYQA 3JTMA 3LLVA 3ETEA 3G0OA 3VPHA 2E49A 3VZSA 3ZNPA 1E7SA 4RO0A 1P1KA 3CUKA 3H3FA 1TXGA 4MKZA 3VKVA 1IULA 2GZ2A 2EP7A 2P5UA 4NHEA 4BMSA 1YRLA 4ND1A 5EESA 1LC3A 1EEHA 1ADCA 4BNXA 3PFFA 4XX0A 1GYPA 1P45A 4FFMA 5A05A 5KCZA 3AUUA 2UUPA 2XXJA 4YEDA 1ZXBA 4J1NA 2NWQA 1I0ZA 4S3MA 2J3JA 3GA0A 5IXYA 1D7OA 1B8UA 1KYQA 3ZHBA 2DBRA 4UREA 3HUDA 2NU8A 1QLJA 1PU2A 1EE2A 5HS4A 4BNJA 4Q3AA 4J3FA 4MIEA 4OM8A 1Y5MA 3GEGA 3QJ5A 4IJWA 4RL6A 3FNEA 2XOXA 4LMRA 1F12A 2UUOA 2BKAA 4S1VA 3VC7A 4ZHSA 4EUFA 1KEPA 2JFFA 4XB2A 2BI7A 3ZWPA 3P2YA 1ZEJA 2O2YA 1T2AA 2GASA 3D4NA 3PP8A 1XSEA 1P1RA 3H8VA 1V6AA 1JU9A 2DC1A 4AG3A 4IXWA 4DQVA 4U6QA 2YDXA 4YT8A 1KIFA 4FFOA 3R3SA 3WGGA 3H5AA 3KHUA 1BTOA 2R2GA 2DTEA 4A7PA 2P68A 3C7AA 1Z74A 1DLJA 1UXIA 3TRIA 3K6JA 4UVHA 1VKNA 5C7LO 4IDDA 3VTFA 3GC6A 4L8VA 3E18A 3CMCO 3IUSA 5DP1A 4CM7A 2VUSA 1X7GA 2GNAA 3ITDA 3WX0A 3IOYA 2Q1TA 1LDBA 2WTBA 2OMEA 4BGIA 4O5OA 3VVBA 2YYYA 1YB5A 3ULKA 3LC1O 1EBFA 2OP1A 3RSHA 2YV3A 3MEQA 4YRBA 2EKPA 1Y8QB 1E3WB 3H7AA 1XDWA 4B7CA 4Z3DA 4BO8A 2O23A 2H1SA 3HG7A 3K5PA 4W6ZA 1U3TA 4J16A 3PK0A 5AXAA 3FF4A 2HJRA 5IG2A 1QKIA 1R66A 4AJIA 1ISGA 1GU7A 1DJQA 3OM9A 5BR7A 4J4TA 3D64A 3QE3A 5FI5A 1DIAA 4CMIA 3DZGA 3ZWNA 2BGKA 3RU7A 7MDHA 1E3EA 1J5PA 4DWVA 5TX7A 3NDRA 4CMGA 3KLPX 4WEQA 4EDFA 5JDCA 1WMAA 4PRLA 2OFPA 1B8VA 3JD0A 2UAGA 5A5EA 2DM6A 5G2OA 1V3VA 4J91A 2NVUB 2E6UX 3I23A 2RHRA 1EDZA 1ORRA 5TT1A 1OZAA 4FC7A 4GLLA 1EK5A 4F3YA 5KIAA 2ZB8A 1SOWA 3HZZA 3RC7A
chains in the Genus database with same CATH superfamily
2A1TS 1I4TD 1VPLA 2RONA 4H1TA 4NATA 1I10A 1QGYA 2ZI7A 1UXGA 4L5JA 2G83A 4QDTA 1EFKA 3FYCA 2QZ9A 3BWMA 2HYIC 1S0UA 2AK2A 2JFUA 3IUQA 4X3OA 5DNWA 3LDFA 5FADA 4CR7A 1B2RA 1E5DA 1ZD1A 1M34B 2PKWA 1QZ3A 2A7QA 3D59A 3T3IA 4U8GA 3ZZUA 2AOVA 4AMGA 1GAEO 1PEDA 1UKBA 4G4SO 1VJGA 3VVLA 4DMFA 4MGZR 1G4AE 1HZZA 5FTJA 1IL0A 3HB7A 3SZLA 3IUYA 3ZU5A 2VF7A 4IDFA 1DAPA 3OE7D 2QJWA 4UM8B 4R8LA 3E15A 3IESA 5CIQA 3CLRC 1X92A 2P3SA 1OD6A 3W5JA 3IULA 4FZ3A 4ND5A 5B7PA 4TVSA 3URKA 1DCFA 3PCRB 1L7PA 3KSUA 3JQCA 3TL6A 3HUFA 1DT3A 4KWHA 1HE8B 1IEQA 5GGXA 3GR6A 4MWCA 5I7RA 1R0LA 1AKVA 2OGWA 5DHTA 4QBGB 4RF2A 3UAZA 1TTTA 3TZQA 2I9KA 4KQEA 3W6NA 1A8HA 1C3JA 1UC4B 3EZNA 4BTVA 3USES 3LW8A 1M5RA 2QUIA 3UPTA 2CHUA 5EOVA 3ICEA 2EFJA 4HGOA 5JW6A 4PYJA 4KDRA 4OJNA 2IOFK 5HG0A 3QF7A 2NMVA 1PQ4A 3IIMA 3A3YA 5AW7A 1W4ZA 1FDWA 4PICA 4RTSA 3EVBA 1V96A 3GJSA 3MYRA 1I94B 1M2EA 1NVWQ 3UUEA 1X38A 4D4HA 5J59A 2NU6A 2CWWA 1RXWA 1I30A 3I8SA 2K2QB 4L0CA 4JITA 1Y8RB 4A2QA 3ILVA 4HG2A 1P1CA 2YHIB 3GUCA 4XVHA 3SD7A 5KNDA 3CJRA 1GGHA 5IK2A 4L1KA 3KQNA 1NE7A 3BFKA 3HADA 1XD2A 1LW7A 3BRSA 2GAFA 2VHVA 2F9FA 2AUMA 3SXPA 1EQAA 3V6LA 1O2DA 3LY9A 4AB1A 4D97A 1EP3B 1HTTA 3OTQA 4LXIA 3ZU2A 1U63A 3HNRA 4GQBA 4GGMX 5BUQA 2QB5A 3HDVA 2OFXA 4GYYA 1PI3A 1Q0SA 2K87A 5K0FA 4TLBA 4F3RA 1KWKA 3F8WA 3GLTA 1XP8A 5IJ0B 1PJAA 4JEUA 5A62A 2FEWB 4TQ9A 3AEUB 3ONNA 4I6EA 3O9VA 1XNRB 1BHSA 2QG9A 4LHXA 1KI4A 4OHCA 1VJCA 3CWQA 4QVGA 2ETVA 3MMNA 4HVCA 4F56A 2ORYA 3IKTA 4J0DA 4LY0A 3PWKA 4ZIRB 2QMUA 4NAUA 3NYIA 2QG4A 4GR5A 4LECA 5P21A 1XLVA 1RRFA 3OMWA 4AU1A 4D9FA 3BBPA 2KWIA 4IRUB 3H9UA 3UG6A 1W88B 2WF6A 3QEOA 3CUSA 4TLCA 3NH9A 1ADJA 1YU9A 2XGOA 4PSVA 1JR3D 4CKBA 3CPSA 4NE9A 1R74A 4OQMA 3PWSA 3TB6A 1Z4KA 3WBJA 1EH5A 3GPDG 1RR6A 2DYKA 2IF0A 2JJMA 3GA7A 1HQKA 1H2YA 4ZDKA 1Q7TA 5LQCA 1NFQA 1UAYA 2VIIA 3HR7A 4IDNA 1PV2A 4K9RA 4DCGA 4JBIA 2IPOA 3OICA 1ZK3A 4OU5A 2VNSA 4R1NA 1R8YA 3BCHA 1IBCA 4OXYA 4S0XA 1BEEA 5B1DA 3L4KA 3KZXA 3URMA 3L0OA 3OUUA 3EF0A 5ELLA 4MVJF 5DSXA 1CEYA 3MHPA 1W85A 1E5QA 4IH1A 2GMWA 5G40A 5IBPA 3RARA 2FFHA 3VU9A 5NLLA 2LD4A 3N53A 1LV7A 3WYNA 4ZV7A 3NU1A 4G3XA 4LVUA 2X1HA 3NVKI 3KNZA 1CCWA 1G63A 5DGDA 3E1GA 2A35A 3OVMA 3U44B 5LZ7A 2AD5A 3JSXA 2JCSA 4OJQA 4DNQA 1BZYA 3N8IA 4ZQBA 3STUA 5TIIA 2J07A 1EGVB 4JT9A 1XLWA 4B6RA 4DTIA 1II0A 3JQFC 3RSCA 1TVEA 1ECGA 2A9JA 3LECA 3LVRE 3QI2A 2IDJA 4F86A 3U44A 1YD7A 1U7WA 2QV7A 3E22B 4HFMA 4QTXA 5BYAA 7AT1A 1JAYA 3W6PA 5L7YA 1A0OA 5FWXA 1JA1A 1RMQA 2FEPA 3VYRB 3F5FA 3ONDA 4V0QA 1V9CA 3OOEA 5E6SA 3PQ4A 3CPEA 3U4AA 4WK0B 3RR2A 3UC5A 2COKA 3HQ4O 1KSGA 1HMPA 1ZCAA 3RUIA 2Y66A 4RGBA 3MWEA 4EGCB 2QIOA 4C5CA 1PS9A 4I6JA 1O5TA 1VHTA 4HXFB 4D9NA 1KRWA 4WKBA 3VH3A 3FZGA 2Z1DA 3PNLA 2X0EA 2DKNA 1EWYA 1KI1A 1XHLA 1RYNA 4LV6A 4PIMA 4LVCA 5AOBA 3D54D 3W7VA 3GUYA 2DH6A 3ZHSA 1HEIA 1M1UA 4L27A 5FBWB 3EGOA 1ZVQA 2X4GA 1PWYE 1ISJA 1Y1PA 2VBIA 3IBSA 4LHZA 4KRFA 4DG9A 3OWOA 2C31A 3X2SA 1XTUA 4IFTA 4N3CA 2HNKA 4CDNA 4EEZA 1IY2A 1Q6ZA 4JJGA 3LX8A 4GSLA 2O8CB 3NHSA 4NAVA 2RD2A 1Q1ZA 2C58A 2POCA 2XYQA 4F1KA 1G5RA 4L8YA 4AICA 1KMCA 1A9XB 1AZWA 2VWPA 3D0KA 3UKOA 2VS1A 3RFCA 1TKAA 1Y9DA 4D9IA 1GA1A 1YQDA 1WW3A 2VAVA 4ZD6A 4ZYYA 7GPBA 3T95A 1HF3A 2FSHA 3T3DA 4EAAA 1O9BA 2FEAA 4TUYA 4G89A 3GELA 1EG7A 1WDLA 4CLXA 4BATA 4C22A 4IF4A 1HYGA 4MEAA 3H8SA 2RGXA 3HS3A 1NWHA 2WMNB 3CH6A 1FDTA 4OQEA 4B31A 4BZQA 1TMYA 3GJ7A 3WIOA 4HWSA 1KXZA 1T8PA 4NENB 3DKRA 4ZOBA 3UTCA 3D2AA 1ELOA 1E3QA 3HO8A 1YQGA 2YWDA 4KO1S 1IH8A 3NHRA 1R3DA 4I4TA 3ISTA 5KTYA 1H9BA 3FSRA 4B32A 1E9FA 2J6BA 1QWOA 3UZUA 1X1QA 3ZW8A 5K0TA 1SC9A 3NGMA 5G0UA 3RU3A 3ICWA 4A8TA 1KQOA 2F8TA 2W6NA 2P9JA 4BLVA 1HR0B 1MQAA 4J75A 3EDCA 5DIFA 3PCTA 5DBFA 5LB2A 1QVWA 2OCAA 3ABRB 4QG7A 1N5LA 5FWDA 3OQPA 4HNGA 3NBYC 1R15A 2AX4A 4M9RA 5LQJA 4QDOA 2VBGA 3FBTA 4XGNA 5LQRA 2FPUA 1MN6A 5ITVA 3KYIB 1L7NA 3ZYZA 1VYHA 3LI2A 3BIFA 3OT1B 3MTJA 4RADA 2QMYA 2Q5FA 3AMVA 2GN6A 1MU0A 2WK1A 4M6WA 4DQXA 4HGRA 4Q5IA 3ZV3A 5JNSA 1C2YA 2HD4A 3UPUA 4YC7A 5EQFA 3AEQB 3AK4A 3C8MA 4K9LA 4ZJZA 1F7VA 3C3PA 4TM7A 5IF9A 4Q7LA 2JFGA 1JVSA 4JI3B 3AUAA 3T6KA 1K7SN 1NXWA 4B8ZA 4KXQA 4BPRA 4W7SA 5HOEA 1BGVA 3GAMA 4CUJA 4TXMA 4MXDA 3CJTA 3E3AA 4YB8A 2RJOA 2H2HA 4M9SA 3IB6A 4RY2A 1QIGA 4KL8S 2Q0QA 4L0QA 3OM1A 4MV1A 5AICA 3CZRA 5DK6A 1OFHA 5M3BA 2B5VA 3L8ZA 3AVYA 2GVNA 4LC0A 2J9FA 1TAUA 4EUEA 2VBFA 2C92A 4L85A 4ERXA 2FF7A 1XEXB 1NW4A 1TCVA 2IIVA 2FG5A 5KDOA 2NUPA 1O0SA 1S2LA 2HXYA 3FF1A 5C1DA 5JSFA 5F7OA 4ZT2A 2QQEA 2V7VA 3AJRA 1N2CB 4I14A 3MT8A 3TR5A 3OE4A 5I9IA 1H1TA 5CVEA 2OY0A 4C2TA 4PU0A 2GGSA 3C48A 3FBWA 3T7RA 1V25A 2JFHA 5KU7A 3TECE 2B2XA 3SYKA 1N0UA 5DNDA 4Q39A 4H4DA 1G21E 3CEJA 4GM1A 5FEMA 4EPYA 5K8JB 4B6FA 4CM3A 4LYEA 4KQKA 1NVMB 2PD6A 3N0TA 3UT6A 1G3MA 3S8YA 3CIOA 3WGIA 3W5BA 1O94C 4F91B 3AJAA 1ML4A 5FT9A 2QP4A 1MNAA 1T15A 3ZGVA 5EJ9A 2ACKA 3CO0S 1Q0TA 3IKVA 1M73E 4AMVA 5HKKD 2GPJA 1QMGA 3A9RA 4JNCA 3WK9A 4LE1A 5LP6B 2CHVA 3BGVA 3AOGA 5JNLA 5DV9A 3ZW9A 4YJKA 4IAOA 4GKBA 1E1CA 5FNVA 3BC1A 5CYFA 2ZJBA 4H16A 4KQFA 3ZNQA 4BGDA 2LV8A 1FXUA 1L7OA 4G37A 2IYVA 3DP7A 2FQXA 4URXR 1P2BA 3O4IA 4JBYA 1EHCA 2E3JA 2ZZKA 4L22A 1L5VA 3MT9A 4IYJA 3UCEA 3QNWA 4U7DA 1T9ZA 3A2KA 1WXGA 2XJ9A 3HY6A 2XRFA 2WWXA 4M9CA 5ER6A 3KXLA 2HDOA 4FZJA 4NZZA 4A5SA 2ONCA 4B5LA 2FJPA 3OKFA 4GP6A 4IG9A 1E0SA 2JCGA 2BFFB 2WD7B 1JZTA 2JD1A 2AFHB 3CSUA 3F6RA 4X63A 1ODIA 3E9EA 5WRFA 2H2WA 3RAJA 4JEMA 3VVCA 1Z5VA 4C07A 5CCEA 4NK4A 5AKYA 1T4MA 4EZBA 1QTRA 4UM9B 1O58A 2IYZA 1E9BA 2RH8A 5KOHA 1IXYA 1XVVA 3AF0A 3IAM6 1TQ6A 3KJGA 3K5IA 4MR7B 4RD6A 5IJ9A 1LNSA 1GU1A 3JQEA 4XUDA 3VSEA 1X0XA 3DWEX 2O8NA 2BTOA 1PYDA 1MG5A 3LLCA 1LGYA 4RU1A 1H23A 3EFEA 1IHXA 2JVIA 1G2QA 4LNUB 3CHYA 1YK1A 3PWTA 1QVRA 5HDQA 3R75A 4JXZA 3FGOA 2IE8A 3DFMA 5FIUA 2BWJA 4DLTA 1FLAA 4H3SA 2VTBB 5LBUA 4DMGA 2HT1A 3AQIA 1MC1A 1T1GA 2PZGA 3H11B 3HWRA 4G97A 4BXOA 1IOVA 2GD2A 1FSGA 1Y7LA 1D07A 2H48A 3DDWA 5E3JA 2B7CA 1LDGA 2JCBA 1EGHA 5E2AA 3MBKA 3RUFA 4ZICA 3AOEA 1GP2A 3PD7A 4BMNA 1CT9A 1H5NA 1EM8B 4EECA 9LDTA 5J4VA 4IOJA 3ZXXA 4E15A 3E8MA 1X7WB 1T5DX 2BBOA 2GZAA 1W4RA 2O0JA 2OC4A 2P3LA 2O8DB 1OTHA 1II9A 3BRCA 2ID4A 3O4FA 5HK9A 5KTMA 1OAKA 4DSAA 1Q2UA 4EKIA 3ENZA 2VHYA 5DWVA 5M5BA 5ALFA 3OPNA 1RDFA 5C8VA 4E2XA 1L5MA 2H17A 4QT0A 2YWFA 4FE4A 5J5AA 4AZWA 1EBUA 4CM5A 3FMPB 3U5TA 3S68A 2EZ4A 3H19A 1H22A 3WIDA 1D03A 2VJBA 3WJ1A 4TTAA 3TIFA 1GL6A 3COVA 4KR6A 1DOHA 2Q6LA 2EP8A 3FUTA 4HOYA 3T94A 3Q8KA 4YBRA 5LKRA 2YOFA 3QBEA 5LQDA 3FETA 2A0UA 1H2BA 3FWPA 3DMHA 3TCKA 1V16A 1QP8A 4QECA 3K09C 3OOHA 3VTKA 1M1YE 1ZHFA 2G36A 4EHHA 3DS8A 1EB9A 1GTSA 8AT1A 3KAJA 1JI0A 1YV9A 2CY0A 3CF2A 1Q95A 1OYVA 2BUAA 2GYUA 3OIUA 1XIVA 2PM8A 1G9XA 1QHGA 4D96A 4BFYA 1U3GA 5LQAA 5D3QA 3C6ZA 3I1YA 2NTJA 5JZVA 2IPMA 5FWAA 3G8DA 4LZAA 4UUPA 4AF8A 3IO5A 4IHJB 2P6OA 3NIDB 1PWEA 2DBVO 3IPRA 1K88A 4Y2XA 5DM4A 5F9MA 5TR9A 5A3VA 1GL3A 2FK7A 2C3PA 4EQZA 5EKXA 3ADDA 3ZE2B 1CY1A 1SY7A 3TUIC 5A5FA 5JDIC 5IYZB 5DTRA 3NGLA 1AK9A 4MWEA 4Z3OA 3OT4A 5FTMA 3HMQA 3I5MA 4BNUA 4DAOA 4RTMA 1NZJA 1WY5A 2BMVA 2AWNA 3IUEA 4Z2YA 3JPYA 4RX1A 3JZIA 4DT1B 1ST2A 5LOVB 4ESHA 4ZP1A 3JARA 4TV8B 1IOLA 5KUTA 1P2VA 4ZAYA 2QM0A 3QMPA 4CKCB 5K4AA 1KDZA 1U7PA 4ZAWA 3S1SA 2VL7A 1QOPB 2X7HA 2C2OA 3H65A 1KMHB 5BQ5A 5FAKA 1RBYA 1TMOA 3L46A 3FYUC 2E5WA 1CZHA 1N9ZA 2WWYA 1EP2B 3EVFA 4PVDA 1AQJA 3IPAA 4F2DA 1Z0JA 1NBAA 1SK8A 4FQ7A 2YS7A 4D0RA 2CLCX 5IH3A 2JATA 3NTLA 1JXMA 4KPFC 4DCTA 5EG5A 2QRMA 2VWHA 3H9QA 1A2BA 4UU8A 1J4AA 2QMZA 2YWJA 2FSUA 1NLMA 1TYEB 4JU9A 5ALSA 2IOYA 2WDPA 1BNCA 2O2ZA 3F74A 1UBJS 1W85B 4UHKA 5IKEA 4ZXFA 5IH7A 1AB5A 1P19A 1R0BA 3VKUA 3IEKA 3HVRA 4KPUA 4XM2A 4U2GA 4B7XA 4IIUA 5BUCA 1OV4A 5KU1A 4U3JA 2ZIXB 5ALOA 5SYMA 5FO0A 4FIZA 3S2ZA 3P8ZA 2A86A 2DR3A 3PVZA 4TSFA 3IE2A 3LYLA 3VHQA 4G4SP 4JBXA 3N7UA 1F2DA 2FZLA 2WYUA 3CH4B 4WKCA 5TS3A 3ZV5A 1DVRA 1FP4A 3A1CA 3KZNA 3PX3A 4OG2A 4QGAA 4YN3A 3UAGA 5U4QA 5ARBA 2P4UA 2BGMA 1JKJB 4ZVTA 3J7AC 1MABA 5EXSA 5BOSB 5T64A 4D25A 1X74A 1Z17A 3GVHA 2B92A 3NDBB 3FHJA 2PH1A 3TBFA 4N49A 3IDOA 3QEAZ 1KVRA 2O7SA 3NJ4A 1DO0A 4MO2A 3HTXA 3K9FC 1H2RS 1SEPA 3CF6R 2WM8A 2D0DA 2X19A 3HKCB 4G5OA 4W8HA 5C9ZA 2RHWA 4XYBA 3V1NA 2QTZA 4AXXA 5I7EA 2H52A 2SKDA 3I9V1 4FEAA 3AGQA 4HWTA 2AC4A 1QIMA 4XJSA 1WXDA 4EF4A 3MTGA 2DFVA 3BFJA 1P0IA 1QQ6A 3T5GA 5BQ3A 2W8BA 1E60A 4U2DA 1E4YA 3AY0A 4BKPA 5HIJA 5IAEA 4UHFA 2X8AA 3WYAA 4DLVA 4ER3A 5CYGA 4FN5A 1S7CA 2PZLA 3HDHA 3BWDD 3KVOA 3MOGA 3WLQA 1QWSA 3ZI4A 4EATA 3N2KB 3ZS8A 4P5PA 1YZNA 2VJMA 5JZSA 3K1AA 3M7IA 1XCPA 1YRAA 3VR3A 4UDOA 5GJCA 5E1BA 3WGLA 4D45A 4MV3A 1JW9B 1PD1A 1FPMA 2OCKA 3BTSA 4QG3A 1B3BA 2F9MA 13PKA 1CW2B 2FDXA 1A4IA 1D0SA 1Y3FE 3FPKA 4RSHA 1XB2A 3SP1A 1GQSA 1RAFA 1FTYA 3N2GB 2Z1MA 3PEUA 1GR0A 5CEJA 3KQUA 1C0LA 3AWDA 2WILA 1FSPA 2JH8A 1PKEA 4GT1A 4A8JB 4YXFA 3K6KA 4H7HA 2O3TA 4JVOA 1IN1A 4UUQA 1NL3A 2V4ZA 3V8MA 4W5TA 1DJMA 5D7NA 3GGGA 3KSDO 2YS6A 4G84A 2CZQA 4MV7A 2B83A 1ETUA 2X7JA 4RTOA 1MXHA 2ZWVA 1XJWA 4JSTA 3ROXA 4PGHA 1RM0A 1AMNA 2JKZA 3A28A 1TRHA 3FMFA 2OESA 3IQXA 3UV3A 1MFPA 2DWQA 2PUGA 3OESA 1JAIA 3LUPA 3BUSA 4RVUA 5D84A 4CMKA 3DGFC 3W7AA 1TX4B 3MJRA 3ZHYA 4Q02A 2DZDA 4MW5A 3RKUA 4RE6A 2OCGA 1UXHA 2HZBA 4QGGA 1XK7A 3K30A 2BFCA 1N2ZA 4UARA 1DBRA 1NBMD 1ZNYA 4I7EA 2K4MA 4ZQGA 3SPXA 2AV6A 2QWXA 2YMPA 4B83A 3I12A 3KTAB 4ZT4A 4PHCA 2PS0A 1N25A 2OSVA 2BZ0A 1E4EB 1CXZA 2H9AA 3OEED 1DX9A 2GPWA 4GR4A 1KJJA 4I4CA 5LCXA 5REQA 3WLTA 2CYBA 4K0KB 3QWAA 1LQUA 1JWLA 2W2QA 4BZZA 1CRQA 4KXVA 2P40A 1PQYA 4CM4B 3GZNA 4MQEA 3IDQA 2F4NA 2VYND 1QTIA 1UWCA 2H11A 4U8HA 4YNBA 4A8PA 4POOA 2D5BA 5HKBA 1EG2A 1NVTA 3DMNA 4WNYA 2I4LA 3L6CA 3LUFA 3R8FA 1SGWA 3LX4A 5FUYA 1QE0A 2FDCA 3E4DA 4CEJA 1EWKA 3KZ1E 5F2KA 5B30A 1VKHA 3DEAA 1V5IA 1T9AA 3ABZA 4QIHA 4G1FA 1AGRA 3OU7A 5CT9A 5BYBA 3HPRA 1TAQA 1ZXXA 3P9PA 3QUCA 4O02B 1U94A 1O96A 2UYOA 3BF8A 2JGRA 3GCZA 3L7BA 3LWZA 5GAJA 3T1YB 1G3UA 1V95A 2P35A 1VXOA 2VUTA 5COBA 3CW8X 4PE5B 1SZCA 4N5HX 4BFTA 4B84A 1DKRA 3LC7O 1A97A 4PRYA 4DV6B 2ATEA 3IBCA 3ZIAD 2JLQA 1FNCA 2DT8A 1QIJA 2NN3C 3T1QA 3FPEA 3ACBA 4JLKA 3AR6A 4JVNA 4YRSA 1JUDA 2ZQYA 1LBQA 3O9ZA 1XAJA 1ONOA 4IJVA 4N5IX 1RLJA 3HWWA 3TEJA 4EQ6A 2WHRA 2H3EA 3FD8A 4ONEA 2HJSA 3H13A 4W9NA 4QTZA 5A0TA 2D5IA 1EXNA 1PS8A 4L95C 4TXJA 5D6NA 4D0SA 1N78A 3OFSA 4UZSA 1WMFA 3MWDA 1W2GA 3N2LA 1B7GO 4RFVA 5DTEA 3SIPA 1LJUA 3D8TA 1K4MA 1YZGA 3EUFA 3L40A 4CIVA 4OBBA 1VLVA 3J81k 2VCYA 4CQMD 2XGSA 1Y8QA 4MPPA 1Z5UA 4KR2A 2TS1A 2PUHA 3CTPA 3G3EA 5E2IA 5E6UA 4PPQA 3TQFA 3S0JA 3DE4X 3ESZA 1Q0UA 4LQ4A 3TJZA 4NAHA 3UMSA 3L8EA 5CDHA 2OCPA 3AJDA 1QUFA 1AVTA 3O2NA 4H7DA 3SEAA 4FHFA 5HNKA 3GP3A 1IM2A 2ZSIA 1AGNA 3JQGA 4BU1A 3EEYA 3RH0A 5CFZA 3RVNA 4DUPA 2QZZA 5A02A 5EA2A 2V4UA 3GBSA 4YV1A 2DFPA 5KTRA 4RFLA 1UEJA 1A7JA 4XB1A 1LA2A 1WZIA 1BW9B 4OQDA 4RJJA 3OTHA 2BEKA 4CTJA 2WIGA 3EVZA 2RE8A 4LRUA 1DEXA 2IPAB 3EG9A 4OKSA 3K9NA 1TYDE 4TKUB 4UTZA 4O4HB 3TJRA 3D8RA 4F97A 3CVXA 2WTAA 2RGNA 3I0MA 3SFTA 1A2KC 3OPQA 2J33A 3OTIA 3NVAA 4LMAA 5AP9A 1CV2A 5DW3A 1Y1RA 1QB7A 4RNCA 1GTZA 4EYKA 2ATVA 2JFBA 4EJMA 1LBHA 2VH5R 4LC9A 1U2PA 2FP4A 4CIWA 1JH9A 3PT9A 2I4TA 3KETA 1KVSA 2IELA 3L7NA 4HUTA 3JAMA 2JKVA 4L3OA 4YQZA 5K1ZA 3VDMA 1QDUA 3M4XA 4WHMA 2PL9A 4DW8A 1S5PA 2IP2A 1WZCA 3AESA 3IQEA 1N8KA 2OBFA 2P77A 1G5PA 4WCFC 3B3GA 1IOZA 5JJLA 1D1SA 1GTMA 4DLZA 2JGMA 4PVCA 4BMYA 3Q3CA 1BA3A 2KJQA 4CCSA 2YXBA 3UJCA 3KC2A 3KQPA 2X5OA 4X1YB 3TPCA 4D74A 5C5EA 2NZVG 2AG0A 3SFZA 4ZI7B 1KBQA 1XRQA 3C6YA 4D9HA 3H6GA 4WXRA 1KEZA 1H9AA 5C51B 3LF2A 5EWJB 1RHKA 2RH5A 4MS3B 5AM1A 1GZ3A 4JELA 4DM7A 3MERA 5KJ6A 3GLIA 2QLTA 3VJLA 4IINA 1D1QA 1UBRS 1TZMA 1EWRA 3DTYA 3ASUA 1EINA 1QOQB 1T0HB 2Z9CA 3LE8A 4Y2QA 4WAUA 1OXUA 1Z2CA 1YACA 1I7LA 4W9NC 3GQVA 2DBZA 2RHBA 1XTZA 5L51A 1RVV1 3DAYA 2G63A 1E79A 2PH3A 4FNAA 3PQCA 3QFSA 1W5SA 3E2PA 4WXEA 5KKCA 3AR3A 1IBKB 5CYOA 1ABEA 1CDOA 3BE6A 1ECCA 1GFZA 3KYDB 4NQZA 4NZNA 2Z6VA 2ZUFA 3Q88A 3V4SA 5JAIA 4KO8A 2BN4A 1HE1C 2XGMA 3WWDA 3HB9A 1EUYA 3HU1A 3GNLA 4OP3A 2FA9A 5EIWA 2BKUA 2BY4A 2XNDD 1IFXA 4G5GA 2R7AA 3H6KA 4JT8A 1JKFA 2IU3A 2ZVQX 1E79D 4G65A 4LQLA 5EQTA 2WZCA 1O57A 1PG0A 5D7BA 3SLGA 4BJ5A 4Z8XA 1QPBA 4H18A 2VQ6A 3FGPA 3FI0A 1LI4A 3W2TA 5E6RA 4CTOA 4RTPA 1U3UA 1BXGA 1M1YA 1XQXA 4IGEA 4IRMA 1YO6A 2QD3A 4N6NA 4XJXA 1LPNA 3KLMX 3MCTA 4I50B 5F7ZA 3RRNA 2Y0PA 3HBFA 1N5OX 3BXEA 5IMBA 4B9AA 1WM1A 5E3HA 5FHRA 5CLIA 1T6ZA 1G8GA 3DE5X 4YVFA 5LU9A 2GAIA 2HWYA 2HEIA 3G6WA 1RWOA 3I9NA 1QDEA 3IRVA 3WYEA 2W4MA 3Q6MA 2CVFA 3GEIA 1ONBA 2BD0A 4RSGA 4ZTBA 1JG7A 3EVNA 3O38A 1QJ4A 1H6DA 2PXHA 2ZBGA 3LPNA 4W1RA 4BV8A 2DKFA 5AI8A 1XNQB 5PNTA 4BFCA 5A9SA 3AIIA 2ADMA 3HN6A 2CB0A 1VXRA 2HIAA 4NFLA 2VDMB 4YJ3B 3WNVA 3Q7PA 2LKCA 1JG2A 4BIMA 4N48A 3E8XA 3I0ZA 5CPFA 1QHHB 1YGYA 3W9YA 3PNMA 4D8WA 3OMLA 4PF1A 4XYMA 3UMGA 1C3LA 1OJLA 5F1PA 2AE1A 3R3HA 1DG9A 5BV0A 1P72A 3OEHD 4Y2YA 4N6OA 4WLFA 4CEJB 1F0NA 4CTKA 2UVDA 4YR9A 4RSMA 2NNLD 1XRMA 1GUYA 3R77A 4MYHA 4HKTA 2I1VB 5EMNA 3IPCA 5DI3B 5IKOA 3RU9A 5H3HA 4D81A 1HFKA 1A04A 3LYHA 4FR2A 1Z12A 3B3QA 4MVJA 1EVZA 5H83A 1N7JA 1QC5B 1ZM9A 2E1RA 3KJQA 5BXQC 5I7FA 5JNVA 2F43B 2N0SA 4BC0A 1XVLA 3LPMA 3EC1A 1RCFA 3JQ7A 1OXTA 1U9ZA 1WXIA 3B8EA 1P74A 3QLVA 4DMCA 5HZGA 4N40A 1FYWA 1Y7TA 1QNLA 1VRVA 1W25A 1FNDA 1QH1B 4B5KA 1BYUA 3GDWA 5CCBA 2ZJ1A 1QO0A 1YS1X 2XZPA 3V8QA 3WGQA 1PZXA 3E35A 3WS7A 1C9JA 1QG2A 4IVRA 3S3TA 4DS3A 2PGNA 4PGAA 3CNBA 2Q3HA 3KZCA 2XB4A 1MIHA 2GI4A 4NYJQ 1Y5LA 3O83A 2HGZA 5EKTA 3KPVA 2IUEA 1C9DB 2WAOA 1WO8A 3GJRA 4RYDA 3DAPA 4D3YA 1L4KA 3HE3A 3ESQA 4U9HS 2W2PA 1SC3A 1YBAA 1H93A 4QDKA 1GPUA 3EN0A 4LJ6A 4XLTA 1ZL0A 2YMMA 4IIJB 3UENA 5K6AC 1CVRA 1E7QA 1UPCA 3IOCA 4G5QA 3T7KA 5KWIA 3B20A 1MC5A 1DV2A 1OZ0A 2R6DA 3A36A 1JAZA 1Q19A 3ZWQA 5HZKA 2G4VA 1LDNA 3ONVA 5CBKA 1QX4A 3SZRA 4YP5A 3PIRA 2IQIA 3G2JA 2PIDA 5IFLA 1M1NB 1NASA 3FYHA 2FK8A 1P2TA 2ILVA 4DT1A 1KDOA 4FKMA 2YC4C 4CL0A 1IRIA 1RWPA 2QP3A 4GICA 3PV0A 1HT1E 1QNFA 3PXCX 4HMQA 1DQZA 4JR0A 1X8LA 4R3NA 1YL6A 1YTUA 1QYWA 3UA4A 2COEA 3ILSA 1B73A 1UT6A 1TTQB 4F38A 2V0CA 2GEKA 5ICCA 2TMDA 3BERA 5KYNA 1JU4A 3DD1A 4IQGA 3RQIA 1LSSA 1PAUA 3NTUA 5DI3A 5DNEA 3EOAI 2VYVD 4UM5A 3O90A 1KH1A 2JI7A 3NEYA 2CVPA 4IZ6A 2J09A 3IELA 2ECQA 4YRPA 1EFRD 1SUBA 2XODA 3FGNA 3D4LA 4FJ0A 2JAHA 4Q47A 1EFRA 1ODTC 1QR6A 3QLUC 3EWNA 5GP1A 3S2EA 1V47A 2WUWE 3LRTA 1KK1A 4TMTA 3WKBA 3NASA 3H2BA 1KAQA 2X8BA 4FUTA 4OMCA 4QHYA 5EJ8A 1KIMA 2VP5A 4BRSA 1O6CA 4TUYF 1J06A 1I4OA 1VG1A 3RUHA 3A4IA 1T4CA 5TVKA 2C2GA 2PLAA 3ED1A 3CF4A 1E3WA 3FRJA 4RVOA 1POWA 2CMFA 3DAHA 1ZHOA 2XYGA 4PSAA 3OX1A 4OMUA 1FPQA 5BOSA 3QYPA 5I3CA 5KMGB 4NYJR 2WKQA 3QU7A 3RSFA 1FP2A 1UMCA 1H5QA 3M89A 3PR3A 4GXTA 2HV9A 3HCWA 1GNVA 4JLVA 3HFJA 3VH1A 1Z0ZA 3FI9A 4A0FA 1ZD5A 1QOZA 2CFCA 4MW6A 4NBUA 4FDTA 4RPGA 1XJQA 3E9DA 1INLA 2XWJI 2WZBA 1DIRA 1UCFA 1BDMA 3AJEA 1QORA 3WIBA 5F76A 3WL5A 2PWYA 3P9SA 1GGEA 1WA5A 4O08A 4DE5A 1L1RA 1QH0A 4ZEXA 2RGYA 3AY7A 5T3UA 3JD1A 3TFOA 4L78A 1EE9A 4V2IA 4W82A 5DTJA 3RT1A 4D98A 4AAYA 3OURA 3TL3A 4LIPD 2CLIB 1JX6A 1DTSA 2WUVA 1EPUA 4EHBA 4YRMA 1Y3HA 5ADVA 4E5VA 5AVVA 3E3MA 4JI7B 4FZ5A 1LSJA 4HL6A 1PUXA 1W5EA 5K0ZA 2VSYA 3GEEA 3RAEC 5KWSA 2WSIA 1AKTA 2ZRQA 2DERA 1N8SA 1W52X 3Q9NA 1T8UA 3CX4A 1QO0D 4HSEA 3RANA 5ICGA 2P75A 3G2LA 2Q27A 3LCRA 2BJVA 5DX1A 5JC8A 3ZWDA 3K1ZA 4WKPA 1OX5A 4JXJA 1JH8A 4KXLA 4A9AA 5ICMA 2B8JA 1S3GA 3W3AH 3SSNA 2X15A 3MAAC 1AMUA 2ATIA 3ZZMA 2R2AA 3CEMA 3H1AA 2R5WA 5JYBA 1YJ5A 2XDWA 4D9KA 3K09A 1U3VA 2AGVA 3FIUA 2UZAA 4MVJD 1YMVA 2H1VA 4WSOA 1C9EA 3T3PB 1VFPA 4CGYA 3HYSA 5JYEA 1LLQA 4QHTA 5D3ZA 1P2DA 4CKCA 2MYTA 4KK4A 3HJCA 4S1OA 5E1MA 3K9CA 4HQLA 2VRCA 4BQOA 4D42A 2P3QA 2YWHA 2ID7A 4D99A 1U0NA 3GUZA 4MJXA 1VE7A 4CEHA 4MS3A 3ASYA 2VQDA 3GGJA 1NFRA 2QHXA 5CLQA 3S2IA 4IJKA 4CE6A 4F04A 5CA1A 5AVWA 2J46A 3PLAE 2P1RA 4EGQA 3AUYA 3CKMA 1A77A 2GF9A 2JFYA 3JQFA 1T43A 3CLSD 3N8KA 3GOQA 4I3HA 4BNNA 2PS9A 4WOKA 4LHEA 4ZFNA 3OA2A 1ISMA 1UWVA 2I4RA 1KP3A 4D8YA 4AFNA 1RC0A 4MPDA 2DFLA 1RHMA 5LM3A 1H3FA 3OF5A 4BV9A 3HYLA 3F6PA 2Z5VA 3T4EA 1P60A 1PVVA 2WHYA 4HNVA 3UGKA 3QXJA 4UUMA 3T61A 3ZCRA 4GGOA 1T9BA 2I6FA 3HA7A 4ND2A 4Z4GA 1P1FA 1ZG3A 4UZFA 2FE4A 3LBHA 2EQ5A 2HI0A 4YT5A 4DLSA 3A1NA 1NA5A 4BMZA 1N0VC 1X13A 2P27A 1M0EA 3TOXA 3LOUA 3MCAA 1REQA 5TT0A 1T3TA 3DLCA 1AQ6A 4R6XA 2ZAMA 5U4XA 1JFFA 4MH0R 5AW5A 1XZDA 4NPHA 3U31A 3CLSC 4YLGA 2WLSA 4K28A 4DUGA 2SKEA 4ALLA 5ALLA 3O94A 2DJIA 2FRDA 1KSFX 1C1DB 1VL1A 3LG2A 4L3VA 4RK4A 3OG9A 1GCAA 1FX0A 5AI5A 3KVRA 2P9FA 4JEIA 1L5HA 1ND6A 5ALVA 4ND8A 2GVZC 3LP5A 3K70B 4QPPA 3A7EA 3HYNA 1JR4A 5T7BA 2QN6A 2TECE 2CLOB 4DDVA 1IOWA 3ETGA 3NKFA 5FORA 4Q6BA 5GZ6A 1IVNA 3HV2A 1Y37A 4OGFA 1KS2A 3EASA 3GJ8A 3C4JA 2IF2A 2KLBA 4B3BA 4CV2A 4XFJA 4ZC8A 1G2PA 2OGZA 2QX4A 3DTTA 3L4BA 4HNHA 1C7IA 1UKVY 1S2MA 4HNQA 4PG7A 4UAGA 1IVSA 4BO4A 3B7PA 2OO3A 1MW9X 2E2WA 3RVQA 4RWZA 2HMWA 4QWWA 1GCGA 3K3PA 4EKGA 3WAKA 3IVXA 1JHZA 3QVXA 4BUJA 3DT6A 3OLWA 3SN6A 4U7PB 4PTYA 3GFGA 4MVWA 5FDFA 1Z6ZA 3RS8A 4K81B 1N2XA 2QT1A 3MBOA 2AI3A 4QXMA 4U00A 5CVDA 2HQ1A 1R6TA 3WGMA 4W5RA 1WCWA 1XZCA 3IH5A 1B8PA 4JYPA 4Q3BA 2QNBA 5DNUA 1FU4A 4R0MA 5KAPA 4P3KA 2EKBA 1XA0A 2HPVA 3L8MA 4H08A 4HNSA 4J90A 5KWEA 1RRPA 3ANXA 1NVBA 3GOHA 3PX7A 2J3HA 3WWZA 2LCIA 3A37A 1UDAA 1IPHA 3Q2OA 1X2EA 4ID9A 1T8WA 3LHFA 1GHTA 1N2GA 4LQCA 1MD9A 1UODA 2JRCA 3ZV4A 3VX4A 3WJ2A 1JDBC 3S7TA 1PV4A 4GOKA 3OECA 4I81A 2G6TA 4Z7NB 1GTL1 1G20E 1I7NA 1RPAA 1VCOA 2FPIA 2WD8A 4H7FA 4UEOA 4DLLA 5IDVA 3U3MA 3LHDA 3KIPA 1EFAA 4M89A 2XZLA 4PY2A 3SJBA 1IZYA 3HRKA 3IMEA 1X7DA 1ZAKA 1U7XA 2PUTA 4GKVA 4LA4A 4NE7A 4NEGA 5AM0A 3TIVA 2YN2A 1Q1GA 3UM9A 1C9YA 2EJBA 1E5VA 2WP0A 1XDBA 4GX2A 1RC8A 3UHOA 3KKKA 4G1BA 3G8CA 3N6XA 1XZAA 4C87A 2IYSA 2VF4X 5KX5F 1I2CA 4DJAA 4ENRA 3RC3A 2BKEA 4IUBS 2E4VA 3GCWA 2R00C 2VAXA 3MILA 4Q3NA 3IX7A 1CDDA 3SX0A 1WB9A 1JLSA 5I48A 3ADBA 5A5DA 1NMQA 2GR9A 3A6KA 3DJFA 1JHMA 3PQDA 4PQGA 2WIDA 3I4FA 4Q3OA 4ENSA 4M21A 4IXMA 4OUDA 2PQ6A 4KX3A 3N07A 5DISB 3E5MA 2JJQA 3EIXA 5IAAA 1GUDA 2VNHA 5B58C 5CJPA 4NXNB 1T91A 1U0LA 2WJJA 2AJLI 1XCBA 2X2PA 2AFIE 2ZI6A 3ND7A 5BWBA 1M72A 4X6UA 5JZ9A 5D2CA 3RNOA 2GAOA 3AP1A 4BAGA 16PKA 4CMAA 4H60A 2VJCA 5EJ7A 3WRWA 2V3VA 2RB4A 1H8HA 3GRCA 2ZGVA 4ANFA 3UT5B 3U7IA 4E2ZA 2HHLA 3EXG1 2OV1A 3QSYA 3ZK7A 4OXQA 1AXEA 1OCEA 1RRCA 3VV3A 2W6CX 1EZZA 4RIGA 3QENA 1HDIA 3IPYA 4FZRA 3R7AA 2ZUCA 3MZ0A 1I13A 1QE5A 1RHJA 1V8DA 2HMAA 4EPXA 2YIDA 1U0OC 4EPVA 2ZAGA 3G2QA 3ZVMA 1DV1A 5JYCA 2XMDA 2ZWPA 4MJ3A 3W34A 3HEAA 1NVVR 4K1XA 4RZ2A 2QL6A 2YINC 4XTCS 5GZ3A 2MSDB 4PPGA 2G06A 2Z57A 5K3SA 1EQUA 1UEXC 2AFIA 3HLKA 1PHRA 3CWCA 5SZHB 1FP4B 3AJ8A 2VJMB 3KT0A 3B1FA 1DAIA 4LCEA 2H0RA 4PZLA 4MUMA 4XH9B 4PC2A 1ORHA 1RI4A 3BOSA 4FUQA 4GRDA 1DCKA 1E2HA 4FOSA 3R24A 5FOUA 4XWGA 2EW8A 2WIAA 1KYYA 4Y9DA 2OEPA 9ABPA 3L1JA 4G0PA 4KNVA 3ESCA 3KB6A 3NZEA 1PGNA 4X71A 2M6KA 4EBBA 3ENKA 3OTGA 5F73A 1XG5A 5IK2D 2GCEA 2EL9A 2N46A 3H0EA 4YV2A 4D6XA 4DZTA 2ZE7A 5F3DA 1MQSA 2NQTA 3KK0A 1JI3A 2D0OB 1L5RA 2Q6KA 3MM4A 5EWLB 4CNQA 4QGHA 2CB9A 3Q85A 3C5EA 2HAEA 4EY3A 2P69A 3B48A 4AF6A 1M2VA 2D8AA 2I2FA 5CEFA 1IHUA 3MS4A 4TPKA 4OHRA 4TV8A 3TKLA 1NFFA 4I1YA 3AUXA 3IVGA 1KEVA 4FFPA 4FYWA 1G98A 3N6VA 4QHSA 3RWMB 2ZU0C 1P7VA 3U60B 1D2CA 4O4JF 1K08A 5BMVA 1P4AA 1KY4A 4Q4HB 4DWWA 5KMGA 5KBYA 2FNAA 3ZDCA 5KCMA 4NJOA 2ZIXA 2PN1A 3EWSA 2JBAA 2XXAB 2HO4A 1EB8A 4GDMA 3DZCA 4DN6A