2Q2QA

Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
250
Chain Sequence
b'TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-D-hydroxybutyrate dehydrogenase
publication title Cosubstrate-induced dynamics of D-3-hydroxybutyrate dehydrogenase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 91
structure length 250
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q2qA00
1YB1A 2C0CA 4CLOB 1W8DA 4AJIA 3CTMA 4UAGA 4PVDA 4BO9A 2GNAA 2OOSA 4R5MA 4KZPA 4QO8A 4E30A 2GLXA 5B4TA 4M55A 1YBVA 5DP2A 4MIYA 3JQ7A 1YS4A 3I4FA 2Q99A 1PZEA 3DHEA 1BDBA 4M86A 1KVSA 4R69A 3ONFA 2WTBA 4ESOA 4GX0A 3INRA 4FC6A 2G0TA 2YFQA 1GCOA 1VL8A 4FW8A 3RJ9A 1E7QA 3DQPA 4G5HA 1E5QA 1E92A 2HLPA 2NUAA 3PWSA 1DC4A 1H93A 4MIEA 5CEFA 3PLNA 1D7OA 1EFKA 1SPXA 4FR5A 3RUFA 1FXSA 4W82A 1M67A 4YJFB 3CKYA 1AHIA 1LQTA 3QWBA 3WDSA 2JHGA 1WNTA 4MVJM 3I83A 1P1JA 3D4OA 4EI2A 3JQ8A 4PZEA 4EEZA 3GY0A 3U4HA 2UVDA 2DTXA 3Q9UA 4UEOA 4RV9A 5GZ3A 5C7IO 3ZU3A 4BIIA 1NTOA 3V5NA 3M6IA 2PZLA 3E1KA 4FPXA 1YH3A 2BELA 3PYLA 1YOVA 4W9NC 5F1OA 3PJFA 4DPMA 4QT0A 1AUPA 1WPQA 4IS2A 5MGBA 4KP7A 4B7XA 1MLDA 2B4TO 2ZATA 3HG7A 4JQCA 4WE3A 2G1UA 4HNHA 1NASA 5G4LA 1SAYA 1QV6A 3CXRA 1HETA 2VRCD 1U7TA 2HU2A 2PA3A 4FFNA 1UZNA 4RF5A 3GGGA 1T1RA 2O2SA 1VJ1A 2EV9A 2VHVA 3NRCA 5TQVA 4GWKA 4NBTA 5DULA 5DBFA 4NBRA 4BNLA 4CM7A 1HF3A 1WP4A 2NU7A 4JN6B 4WLOA 4DBVO 1E6EA 2I76A 2B0JA 2O3TA 5JO9A 4PLFA 4A26A 5ICSA 4E31A 2GZ1A 1UZMA 1PEDA 1F14A 4FBGA 1C0LA 5IZ4A 3V1YA 2Z1MA 2YQ4A 2Z95A 1NAIA 3BIOA 1YDWA 4Q39A 3HADA 1G6KA 2ZJ1A 2HQ1A 4PLVA 2B35A 4Z0PA 1B7GO 3UAGA 4CLEA 2HK7A 1WAMA 2AA3A 2RH8A 2GD1O 1ULSA 3DTYA 3IKTA 2FP4A 1E3WA 4JJIA 3ON5A 1GPJA 4O6VA 4DA9A 3GR6A 4WASA 3AOEC 2W2KB 1GU7A 3NT2A 1OAAA 4RVHA 3WMWA 2Q1SA 5CG2A 3VPSA 3F5SA 4NFHA 3PI7A 4JK3A 1T2CA 2AQKA 2EERA 4JJGA 3SC6A 4WKGA 1GCUA 4KMSA 5IJZA 1V6AA 3TZCA 4CPDA 2X0IA 4R01A 5GZ1A 4BMNA 4ITUA 1HTBA 4WLVA 4J1QA 2P9CA 5CFZA 1FDSA 4YBZA 3QIVA 3AFNA 1DSSG 4E13A 1ONNA 2PFGA 4IMRA 3AOGA 1A4IA 3U09A 4BNXA 2AE1A 1CRWG 4HBGA 4OXKA 4WCFC 3LVFO 5DP1A 3EMKA 4Y6PA 4QEDA 2B4QA 4II2A 3RD5A 1S6YA 1TVEA 3FBGA 2VZ8A 3KXDA 4J4HA 4J1NA 3BYZA 1PS0A 3E03A 1U7HA 5DN9A 3PJDA 4P4NA 1UDBA 2I6TA 1QLJA 4YAKA 2HRBA 4WEOA 3R3JA 3OFSA 4MKXA 1R12A 5GY7A 3MJSA 1KETA 2PV7A 1Z73A 3CSDA 4BNZA 4C7KA 4EGFA 1NHWA 1WZIA 3JYLA 2VNAA 4BO7A 1SCUA 2X4GA 1NQTA 2NQTA 5CPBA 2QYSA 1HDYA 4L9RA 1HYEA 1UXJA 5T6BA 1JTVA 4DXHA 1PQUA 2EKQA 2GUGA 1MB4A 3NX4A 4J2HA 3ZN2A 2BGMA 1MGOA 3BMQA 4O59O 4Z6KA 3OM9A 1E1NA 1PIWA 2P5UA 1E7YA 5L7TA 3QA9A 3ZNNA 3WGTA 4W9NA 4O0LA 4ZGWA 1OI7A 1GDHA 5CEJA 4J49A 3QVWA 3KETA 2JD1A 4RL6A 4ZVVA 3ZWXA 1Z74A 2EXXA 4ZQHA 3C1AA 3U5TA 2BFPA 1XQ6A 5BNIA 4XCVA 4N18A 5IG2A 2PKQO 1DLJA 4C4OA 1PS8A 4KTTE 3DTTA 3QVSA 1BXGB 1ZSNA 4RZHA 3TNLA 4PN3A 5JAIA 2Y05A 4C7JA 1OFGA 2FOIA 4BB6A 1VI2A 5KVSA 5HWSA 1V0JA 5J23A 4PLWA 3PDJA 1BRMA 4BNIA 3JYNA 2OZPA 2AEMA 3AUSA 3DZGA 2GN9A 2NTVA 3MTJA 1ZUD1 2A9FA 1PTJA 3FNFA 3EVNA 3RUEA 1MC5A 4BQPA 5JCXA 4HNGA 3NUGA 3W4KA 5H81A 3KUXA 4GLLA 2YHUA 1ZH8A 4DIBA 5BSFA 3IIEA 1B16A 4P4LA 1G1AA 4MOWA 4BKOA 4YVFA 3D1LA 2VN8A 1UJMA 1PSDA 4PCVA 2NM0A 3M1LA 4BNYA 2VYND 4Y6RA 4D3FA 4I9UA 1TLTA 4N7RA 3OIDA 4I8XA 2W2KA 3H2SA 3JQGB 4LN1A 3AOEA 5T8KA 4FFMA 5G0WA 2YZ7A 3CMMA 2HCTA 3FF4A 4XYEA 3U4DA 4IZHA 2ZYDA 4RVGA 2B37A 3PQFA 2FR8A 5AXAA 3H5RA 4GL4A 1GV0A 5JMPA 2EHDA 1NHGA 4E33A 3B6ZA 1YL5A 2HMUA 3U9LA 5KJ6A 3H5AA 4IIUA 4WNIA 3HN7A 4YAGA 3TZHA 2FWMX 1PQWA 3ADOA 3GDGA 4A7PA 5I9LA 1ISJA 1N9GA 1PL8A 4FJ1A 1ISMA 5FI5A 4Z9FA 4PG8A 2NV6A 2J5RA 4BHTA 4WCFA 3KSZO 4BB5A 1M6HA 3UUWA 2Q2WA 3TFQA 3WFJA 4Q3NA 3A4VA 4TVBA 1ZW1A 1LI4A 5U1PA 3KLPX 3PHLA 3A28A 4GKVA 4MJLA 3Q2KA 2V7PA 1N2SA 3JQBC 5HS4A 2YHIA 1EBFA 3MOGA 1C1DA 4EJ0A 2P68A 5C5IA 3HNPA 2W98A 3I6QA 1IZ9A 4DBZA 3GEMA 4I5FA 3WIDA 4K28A 3GOHA 2DT5A 1VC2A 1D1TA 4N5NA 4CMGA 3JQEA 3GZNA 3ZWBA 4CMAA 1H2HA 3W8EA 3NTRA 1P1RA 1WVGA 4U7WA 2UDPA 1LDEA 2Z5LA 2D59A 3GT0A 3GRPA 1V9LA 4J2OA 3RU9A 3WGIA 1GAEO 3AM3A 3IJRA 3WR5A 1KVTA 5JCJA 4U6QA 2ZKLA 3AU9A 2C07A 4IDFA 2CZCA 4IS3A 4GMGA 4BKRA 1XQ1A 3TQHA 3H5NA 4HUJA 3NJ4A 4YAJA 4CM5A 2O7SA 3BHMA 1NM5A 4GWGA 2EW8A 4J4BA 3NYWA 5L3ZA 5JDIC 1GQ2A 4FFRA 2B5VA 4MPDA 3SEFA 1AXGA 4CLRB 1I8TA 1CIVA 3DAPA 1T4DA 3WMXA 1CF2O 3H9QA 1HDRA 3ZWAA 4IJVA 4B4VA 1B14A 3KB6A 1DJQA 4NU5A 5CP8A 3GN1A 3TZ6A 4GH5A 1PU2A 1U5AA 2VHYA 4CM9D 4DL9A 3KV3O 1DLIA 4YJHB 5KTKA 3MJCA 4E5MA 3U62A 4E2WA 4Y9DA 4E4YA 4B3IA 2H5LA 1ZCJA 1UP7A 2GF2A 2DU8A 4YTEA 1A9YA 2VQ3A 4FC7A 4OYRA 3EDMA 1R37A 1XU7A 4BL5A 4BKUA 6ADHA 1E3JA 4WLEA 1UXGA 5C7LO 1BXZA 3M2TA 1IPFA 2E6UX 2UYYA 1BXKA 3D4NA 3EGOA 2HMSA 3QW2A 4RQTA 2XXBA 5IDWA 3QVOA 3V2GA 3VH2A 4J6FA 3JYOA 3RSHA 4PLCA 2VHWA 4NJOA 3DBHB 4U0JA 3E6AA 4KDFA 4EZBA 2HRZA 2OP1A 1ZEMA 5T67A 1WZEA 3BHJA 1FK8A 4BO8A 5KKCA 2RH4A 4WCDA 2C5AA 3WWYA 3ZWYA 1AGNA 4KUEA 5TIIA 1SOWA 3BTSA 1XGKA 4BO6A 5I9MA 1ZXBA 5EJ2A 4MVJH 2HJSA 4DTIA 1HSZA 4OH1A 2YJZA 3DFUA 2OHXA 1K3TA 1U3UA 1HE3A 5FYDA 4R54A 1NQOA 1LRLA 2X5JO 3O38A 5ILOA 1LSOA 1LC3A 4HFNA 1DHTA 3JD1A 3PJEA 3PHJA 1W0CA 2NU6A 4XRGA 1B26A 3HWRA 4LVUA 4XIJA 5G2OA 4YDRA 4IMPA 3UFXA 1HEUA 2DUUA 3ENKA 4J0FA 1UP6A 1IULA 3HFGA 3ZW9A 4AJHA 5DCWA 3WQRA 1DC3A 3CZRA 3DZHA 2GR9A 1U9JA 2NVUB 2SCUA 3H7AA 1H0KA 2BKAA 3F47A 1EVZA 1ZJYA 3JQBA 3PXXA 2V65A 4OXYA 2WYWA 1KEWA 2CFCA 1NNUA 1ZK2A 1ZMTA 3LK7A 4RPHA 1NPTO 3RROA 1ZKMA 5AXDA 4CJXA 5EL0A 3DZKA 4Q9NA 3JV7A 3M2PA 1EK6A 2GCGA 4RPGA 1ISIA 3JQAB 2BH9A 1ZIDA 2O50A 1E5LA 1ID1A 2DBRA 4L8VA 4TZTA 4K9DA 3KTDA 1QG6A 2ZQZA 3OIFA 1A4UA 2X0RA 3AUUA 4CV2A 1ZK1A 3TF5A 3JD2A 1N1EA 3HDYA 3GH3A 2CDCA 2I67A 4YAIA 3MEQA 4ZQEA 2DVMA 1DC5A 1GD1O 3FD8A 1Y6JA 4FN4A 1PWZA 3AM4A 4W7IA 3DZIA 3EYWA 1V3TA 3H65A 3U4IA 4JBHA 4N5MA 4TKLA 1JLLA 3JQ7B 3S2EA 5TT1A 5ITVA 3CUKA 4JP3A 2OO5A 4I5GA 4IZIA 4A0SA 4B3HA 1XG5A 4FGWA 3NKLA 5JDIA 3T4XA 3ICCA 4A5OA 1H6AA 4LMPA 2I3AA 1PS9A 3NAQA 3TJRA 1YONA 3FNGA 1VSUA 3IP1A 1H6CA 3D3EA 3E82A 3EZYA 4NH4A 4TRRA 2Q45A 3W6ZA 3P2OA 3GUYA 4XA8A 3VPGA 2JAPA 2Q1UA 1DDOA 1P74A 5BSEA 1C0KA 1YDEA 2ET6A 5JW6A 3IAHA 3KYDA 2P9GA 1RM5A 3C7AA 4YYZA 5CHEA 2DFDA 3PRJA 4M54A 3GZ4A 4OKIA 4DREA 1IZ0A 4IXTA 2ZB4A 2Y1GA 4FSHA 4NU6A 1W6UA 2DQ4A 3ROQA 3HHPA 1I2ZA 2ZCUA 4GGPA 4XDYA 1ZSVA 3ASUA 1YQGA 5EESA 3FSRA 4F3YA 1XCBA 5FFFA 4CM4A 3UF0A 3DAGA 2PWZA 3G1TA 4IM7A 2FHSA 4BNHA 1YL7A 3CIFA 3ASVA 2B69A 2VNSA 4KTVE 4TZKA 2UV8A 2VWGA 3R3SA 2OUIA 2X58A 3RUDA 4EITA 1BTOA 1NP3A 2EJVA 3CE6A 5BT9A 5KJFA 1RWBA 5LDHA 4EUHA 2HUNA 1GZ6A 2NADA 1OC2A 2Q3EA 4YACA 4CLHA 1E7SA 4LISA 3GG9A 2ILTA 3L6OO 2Y0CA 4N5LA 4P4GA 2X23A 3U0BA 2H1SA 3F3SA 4G81A 2VT2A 3DO5A 4CMIA 3D4PA 1GUFA 1XEAA 4BGEA 3K5PA 3UW3A 3EAGA 3NT4A 3VDQA 3ANMA 3S2GA 1JWBB 1EVIA 2JKVA 4GSLA 3PYXA 3IUSA 5A06A 3UOGA 2IXAA 3GGPA 4DLAA 1LC0A 4IY1A 1HYHA 4IIVA 4MKZA 5DBIA 1LU9A 4JCOA 3K8ZA 3PZRA 3LSYA 1NFRA 4BV8A 5L4NA 2NVUA 1I3KA 4B7UA 3L9WA 4NK4A 2J5QA 1PGOA 4ALKA 1PGJA 2FMUA 5JAZA 3Q6IA 1E3WB 3HFSA 4M89A 4ZU3A 2P91A 3IC5A 3JQAA 4L4XA 1ZZEA 1Y8RA 5JCJD 2QRKA 4Q3CA 5KVQA 4F45A 5JPIA 4UVIA 2VYNA 4E5NA 1X7GA 3E9MA 1JAXA 3VZQA 2NQ8A 3IKVA 4RZIA 4YT5A 1O0SA 4D0RA 3WICA 2QIOA 2QX7A 2IE0A 3QSGA 2Y66A 4GX2A 5IDQA 1P77A 1TB4A 2QZ9A 3D64A 2X6TA 2YV3A 3NT5A 3DFZA 4FJ0A 4IBOA 1SEPA 1CETA 3EY4A 4W99A 1R4NA 2GPTA 3BMNA 4R16A 3O8QA 3OIGA 4AVYA 4BKQA 1R16A 2HK8A 4R1TA 1QR6A 1RKXA 2EJWA 5DBGA 3EVTA 5HRUA 1LDGA 4IDCA 2J5KA 3ZV4A 1BHSA 2EEZA 2YDYA 2PY6A 4H7PA 1R66A 2NTNA 3WIEA 3G79A 3I4CA 1K6JA 4NK5A 4Z3KA 4LW8A 2Q1WA 4UVGA 1VM6A 1JAYA 1LXCA 3MJTA 4UEJA 4AJPA 5BR7A 3TDKA 1H2BA 1P1FA 3HDHA 2QG4A 2E82A 3JQCA 3LT4A 1IHYA 2CD9A 2X9VA 3I9MA 3DHNA 4UEKA 4R41A 4RVUA 3S55A 7ADHA 5K6AA 4BO4A 1IL0A 4LMRA 4UVDA 5FWNA 4H15A 4R68A 4ND1A 2JHFA 4DC1A 4QTZA 3GHHA 4EJ6A 2EGHA 1PR3A 2CVOA 4UUNA 3R1IA 1O95A 4MVJI 2HDHA 5LC1A 3BMQB 2QYTA 1ZVMA 2XPCA 3WYBA 1PJ2A 4LCEA 2BRUA 3FTPA 4KOAA 1NWHA 2X5OA 3M1AA 3DR3A 5A9TA 1U4OA 4BUCA 3TFOA 3O4RA 1QMGA 4AJ4A 8LDHA 2D5AA 3L77A 2FN7A 2J3IA 4QFCA 4NNJA 1I10A 4BO1A 4OJNA 3L6EA 1GL3A 3ZWWA 1RM0A 3OEWA 1DIGA 1Y8QA 4BNKA 5ICMA 5I8ZA 1XWFA 4MO2A 4QO7A 3PWKA 2P4HX 3B1FA 1IHXA 1I2CA 3VH4A 3VTZA 1YVEI 1PZFA 1ZNQO 1KOLA 2VZ9A 4E2XA 3MJEA 3NDRA 3NGLA 3TOZA 2D0IA 3ZGYA 4ALIA 5CAEA 2DBQA 1A7KA 2PZKA 4HADA 3VTFA 3OJOA 3WBBA 4PIVA 4CMEC 4CM9A 3F9IA 1B2LA 5A05A 1U3VA 2YUTA 3DONA 1ZEJA 3BAZA 3FWZA 3FI9A 3KO8A 2NWQA 1R0LA 2Y1FA 2V6BA 2PLAA 1RPNA 2J3HA 4RGBA 1XU9A 2BMAA 4HP8A 3ZWMA 4RCVA 4F6LA 3MZ0A 1EBUA 1Q1NA 4J4TA 1EK5A 2PTGA 3L6DA 2ZTVA 1RJWA 1Z82A 2BI7A 3RBZA 3WGHA 4FGSA 2X9GA 2OFPA 3TSCA 4G65A 1I5RA 4NFSA 5K0ZA 2HJRA 1WLYA 3S1LA 1ML3A 1I3NA 1LTHR 5T8KC 2PD6A 1PGQA 1NPDA 1I33A 4BO3A 4ND4A 4IXWA 1NQ5A 3FPCA 4KUGA 2OBNA 1J5PA 1B8PA 4YA6A 2NNLD 2DTEA 4FFOA 4J1TA 1GY8A 3DBLB 2YFHA 3ZV5A 1B8VA 1PJ4A 2Q2QA 4HXYA 1AXEA 1QXSA 2BHLA 3E5RA 3IMFA 5IFLA 1ZBQA 3IL2A 3DL2A 3RAJA 3W4IA 3P7MA 1KC1A 1O9BA 2W4QA 3VPFA 4JX8A 1GQQA 2E49A 1EUDA 1X0VA 2VTDA 3AI3A 4Q3EA 2P5YA 2HKIA 1KS9A 1N9GB 4AG3A 1VJTA 5GMOA 1P0FA 3P19A 4OM8A 1I24A 4WCFB 1ADGA 3FR7A 4GSKA 4IINA 5A03A 5COBA 3ZWOA 1NQAO 2EWMA 5DCYA 4XR4A 4ID9A 2AQHA 3TOXA 4YRAA 4NJMA 2HMVA 4HWKA 1ARZA 2YHIB 2GYYA 5TX7A 5CEEA 1C1DB 4YT8A 3FNEA 2Y1DA 4OQYA 4YR9A 3KBOA 3H9JA 2FZWA 4DLLA 4IQ0A 5KJEA 3EHEA 3JQDA 5CDUA 4QFDA 3GZNB 1EFLA 3WLEA 3ITKA 1LDNA 1IE3A 3ZW8A 5DOVA 1UP4A 2H63A 2O48X 1D3AA 1GZ4A 2WE8A 5FEUA 4HFMA 3MCVA 2EP7A 4FIZA 1QYCA 4LCJA 1XR3A 3OJLA 1A71A 3AW9A 4TSKA 4X54A 3G17A 3ZWVA 3U49A 1RYDA 3GA0A 2G17A 4FOSA 4CQLA 4IJUA 3L9XA 3INTA 4F46A 3RBVA 1C1XB 4O5OA 3DMTC 4YJDA 4E2YA 4CMHA 1T1SA 3VVBA 4Y8VA 4XDZA 1VL0A 1I0ZA 4J0EA 1Z6ZA 3Q9NA 4Y67A 3UICA 5A4DA 3MJ4A 3V1UA 3BHIA 2POQX 2CUKA 3PJGA 2PH3A 2CDAA 4WGGA 5TT0A 3WQSB 1JDJA 5F5LA 3W6UA 1HWYA 3D7LA 5C3MA 1O6ZA 4ALNA 3FRJA 4GX1A 4ONEA 2NU8A 5COQA 4NZ9A 3HB5X 1HE5A 1FF9A 4MP6A 2HMWA 1HZZA 1VKNA 4K26A 5B37A 5IXYA 2JJYA 4JGBA 4D46A 1ENPA 4PRLA 3KEOA 2WD7A 3WTBA 1WMAA 2PKRA 4XKJA 3DXFA 4XQEA 3K92A 2I9PA 4INAA 4DIFA 3GG2A 3IP3A 3VPXA 1J0XO 1QV7A 2Y0EA 4YJGA 4CMEA 4FB5A 4WNCA 3F6YA 5ILGA 2ZCVA 4ALMA 4UVEA 4WPGA 4XR9A 3SXPA 4QECA 3NTOA 3HE3A 2XXJA 3RJ5A 3W8DA 3B20A 1ENZA 2D1YA 3C1OA 3JQAD 4QXMA 1LDBA 3WTCA 4RO0A 1UXHA 4FDAA 2XOXA 5F1PA 4DQVA 4J16A 2Q2VA 2VWQA 1ZO8A 3SC4A 1DHRA 2NVBA 5EIOA 4IDAA 4ZHSA 1QSGA 3QWFA 4J9VA 1HDOA 4RPLA 4ILKA 5JAQA 1UXKA 4L73A 5A5FA 2FPPA 4CV0A 2DFVA 1RYEA 1L7EA 4LVCA 1EDZA 5TC4A 2IEDA 3EK2A 5EERA 5JMWA 1F8GA 3D5TA 3DBLA 4KQXA 4Z0TA 1I01A 4WJZA 3K31A 3WGYA 4OHUA 2IDZA 3VOSA 4XQCA 3GMDA 3OECA 3HDJA 2WMDA 3DC2A 3RC1A 3GLQA 3IUPA 1EQUA 2VWHA 4AJOA 2CF6A 3IS3A 3T7EA 5C7OO 4BNJA 3AWDA 1PX0A 1GEGA 3UXYA 2AQIA 2DKNA 1H5QA 4D43A 1DXYA 1PL6A 5I7FA 2PR2A 5A02A 3CH6A 3ZI0A 1LSUA 2BGLA 3DZFA 3ORFA 1AE1A 4J7XA 3DOJA 3GF4A 2Q50A 4CM6A 1HRDA 4N54A 1O94A 4UUOA 4P38A 4FFLA 4B7CA 3H3JA 1U28A 4CR7A 1MV8A 1ZK3A 3H9EO 3LZ6A 2W2LA 1V3VA 3KZVA 1PJCA 2O4UX 3W4JA 2Q49A 3ZU4A 2BGKA 3NDIA 3UCFA 2PGLA 1PR9A 4DUPA 3MOIA 4YRBA 4MVJG 1FJHA 1YGYA 3VKUA 5KCZA 2O3RA 4TKMA 5G0UA 1X7HA 3VH1A 2DC1A 1SNYA 2ZB8A 3VAZA 1BW9A 1C1XA 3OMLA 5IDXA 2QHXA 1UAYA 5ER9A 4UUPA 5F5NA 3TL2A 3DMTA 5CDSA 5MDHA 1X0XA 4TROA 4XEHA 5L95A 3A14A 3P2YA 1YXMA 5I7VA 2FRDA 4K6CA 3OQ1A 2AE2A 2FR0A 3W1VA 2C2XA 1KYQA 3AY3A 5JLAA 4IDDA 2E4AA 1KVQA 1GZ3A 5U9CA 1P1KA 4GGOA 1NXQA 4AJEA 1Q0HA 5F1KA 3KYDB 2YY7A 4E21A 1BMDA 2UUPA 1Q0QA 4H16A 1E6WA 4DQXA 1LA2A 1K0UA 1ZK0A 1ZMOA 3OF2A 5DT9A 3KM0A 3BMCB 1YKFA 1M6WA 4OMUA 4IJWA 3ZV6A 1NR7A 1PGPA 3ANLA 1E3SA 4PLHA 3DBVO 1MG0A 1HKUA 1NR1A 2C7GA 5TF4A 3MWDB 4NPCA 2D5CA 3LQFA 5COAA 2AMFA 3WBFA 2GASA 5B12A 4J7CA 4CM4B 5LDGA 1WDLA 1P1IA 5F3RA 1PJBA 1IUKA 2WSBA 3O9ZA 4WLNA 1FDVA 2PD3A 4J91A 5L9AA 3ZU5A 3NEPX 3OQ6A 5JNLA 4E3ZA 1M2WA 3UCXA 1DO8A 2BFAA 2JAHA 5ADHA 3JYPA 1DFGA 1E3IA 1E3LA 3V2HA 1U1IA 2DAPA 4XYGA 3ZWPA 2DLDA 3E9QA 3ADPA 1J49A 1LLQA 2X8LA 4LRSB 3IQDB 1LJ8A 2VUTA 4XGKA 1G0NA 1I36A 4XYBA 2ZYGA 4BQRA 5L53A 1IOLA 3TRIA 3RCBA 3ZNQA 4FJ2A 3F46A 4MVJA 2AQ8A 2B4RO 4CMIB 9LDTA 4NBWA 1LNQA 4Z3DA 4JJFA 1F06A 4NI5A 4RLSA 3H6KA 1KIFA 5JY1A 2Y68A 4CR6A 3KYCB 2Y93A 5A04A 4GQAA 4DPLA 3VPHA 1PJQA 3RBXA 3RC7A 1LQUA 3H4VA 5H83A 5GZ6A 5DF1A 1E0DA 1T24A 2P4QA 1IYZA 5B4UA 2O3JA 4GBJA 3WYEA 1PQPA 2FPGA 2J3JA 2FY8A 2O23A 4ND3A 5IAAA 1YBMA 4WOJA 4JLWA 4R3WA 1ADCA 4II3A 4LGVA 1C14A 1HLPA 3G3EA 1ADBA 2JFHA 4Z9YA 4B4OA 2JFFA 1SZJG 5A1TA 1C0IA 2X0JA 1ULUA 3F4LA 3K6JA 4ZRMA 1Y8RB 1R6DA 2IRWA 4E5PA 1RM3A 2LDBA 4J1SA 3KLMX 5T57A 4BNGA 3VHRA 1KY4A 1JWAB 4YT2A 1ZK4A 3WJ7A 4R9SA 3PEFA 4BNUA 4OSPA 2X22A 3LC7O 3RFVA 1EVYA 2WE7A 4MP3A 1ZSYA 2C29D 3ZWNA 4L0QA 2GERA 3ABIA 1RM4A 3S2IA 1GFSA 3N7UA 4R3NA 5HA5A 3EW7A 3ZHYA 1YRLA 3COSA 4AJJA 2X86A 4LRTB 4P22A 3OSUA 1R4NB 3BMNB 4B4WA 4A2CA 3VZSA 1XLTA 3O8QB 3HJAA 3K96A 4PRKA 3PYMA 4NFYA 3RC2A 4GLOA 4BGVA 5A5EA 3FCOA 3PWZA 3PTZA 3TZKA 3WSWA 2RHRA 1NVMB 1VPDA 4BNVA 3OA0A 1I3MA 4NHEA 1JU9A 1DOHA 3F1KA 4RDHA 2YV1A 1FMCA 1YO6A 2I3GA 1P9LA 1H9BA 2PGJA 1UDAA 2PZJA 1PZHA 3LLVA 3FPLA 4R1SA 2OBYA 2Y1CA 2PKQP 3CMCO 1A72A 4R1UA 2XAAA 3Q11A 5K6AC 2VTEA 3GFBA 3RASA 5B4VA 4URFA 4BNTA 4LSMA 4DIOA 4CM8A 4BMSA 1UDCA 3W8FA 3STHA 4L75A 2J3KA 1EZ4A 3GPDG 4I08A 3BMCA 1XHLA 1X7DA 3SLGA 5ES3A 1GR0A 3S2FA 3O03A 5THKA 2D2IA 5I7EA 1QP8A 3ICPA 3RI3A 3LT0A 3JD0A 3WS7A 4RORA 4NQZA 4GAEA 3ZHBA 3DOOA 1BSVA 2AG8A 2EKLA 1U2DA 4AJ2A 1J4AA 2G5CA 3V2UA 3GVPA 1OOEA 4D45A 1I30A 1ENOA 3BZUA 1H9AA 1HSOA 4QQRA 3RUCA 1QYWA 3C8MA 5KIAA 4OSOA 4UREA 6LDHA 1HXHA 1GYRA 3OA2A 4BV9A 1Y8QB 4CR8A 3F4BA 3H9GA 2WDZA 3WNVA 3HZZA 2O3SA 3DBRA 4W6ZA 4Z0HO 2PD4A 3PHIA 3ETEA 4XB2A 1VSVA 7MDHA 2AHRA 2BF7A 3U3XA 2YW9A 3I9JA 3RUHA 1PZGA 3WGOA 4NBVA 1KEPA 1QORA 3GQVA 2YDXA 4EUFA 1XYGA 3VDRA 5BSHA 5L4LA 3LF2A 3BTVA 4DWVA 3PPIA 3KYCA 1ONOA 5JY6A 3ZWCA 5HTOA 1U8FO 4AJ1A 1T26A 2ZJ0A 3UKOA 1B8UA 1PJSA 1BWSA 2VHZA 4ZICA 5TNXA 2EP5A 4YCAA 4ALJA 3GN2A 2HK9A 2W2LD 4XX0A 3C7CB 3RFXA 2ZTLA 4GKBA 4AJKA 1NFQA 3WGQA 3HDQA 4XYLA 1YBAA 3K2BA 3H2ZA 4RQUA 1P0CA 3L4BC 1K6IA 3WOHA 1S7CA 3PIIA 2NVWA 1A27A 1M76A 1MFZA 3F1LA 4ZRNA 4D0SA 1HL3A 4BGIA 3INGA 3Q3CA 5H82A 1A5ZA 2I66A 2O3UA 3ZV3A 4U8GA 5TJHA 5TS3A 1CDOA 2DTDA 4L4RA 1GADO 4GVXA 5TLSA 1DRVA 3IDSA 1P3DA 3P5SA 4XQGA 4BNMA 3JYQA 4OO3A 3QY9A 4BNFA 2C82A 1CJCA 1TEHA 5L45A 3H3FA 1Y9AA 3TWOA 1TI7A 3I1JA 3QV1A 1EUCA 2I99A 3WSVA 3H8VA 4DQUA 3ANNA 1PJTA 1N7HA 4W4TA 2EW2A 2O7QA 3RVDA 4OIMA 3TZQA 3TN7A 4E5KA 4U5QA 3I9OA 4HFJA 1XDWA 3A06A 1UUFA 3MTGA 4B8ZA 5C37A 1JN0A 1T4BA 3K9QO 4ND5A 5HBRA 1G0OA 2IEBA 3SLKA 1H6DA 1YL6A 4NJMB 2R6JA 2C59A 3CZMA 3KVOA 3UHAA 1GV1A 5G0SA 3RWBA 5CDGA 2AXQA 4BOYA 3CPSA 1L1FA 4CQMA 1HE2A 3ETDA 5B1YA 2AW5A 2O2YA 2DPHA 2X0NA 4LK3A 1C3VA 5JC8A 2X5KO 1LSJA 3L4SO 1LDMA 1EE2A 1GUYA 1P31A 2JCXA 3PFFA 1SOVA 1R0KA 4K1LA 2TMDA 4PVCA 1B3BA 5AYVA 3WB9A 3AI2A 4PGFA 4CQLB 2CY0A 1PGNA 4R9RA 4YB8A 4K6FA 2ZK7A 4IQGA 3OP4A 5EINA 1K6XA 1XELA 3FBTA 5DCUA 5JXWA 4TRJA 4MVJD 3WLFA 1SEVA 3I9NA 1HDCA 1DIAA 4GPD1 4UULA 2W8ZA 4E0BA 4RF4A 2GZ3A 3ROMA 5BNTA 3QQPA 5CG1A 2EIHA 3TL3A 3DZBA 3WWZA 2YYYA 3LT1A 1QKIA 2RCYA 4XGNA 4HY3A 4NDNE 2WD7B 4RDIA 3D0OA 3JQ9A 5ITWA 1BG6A 3E18A 3KSUA 5AXCA 4EJMA 3NGXA 4UVHA 4YJGB 1QYDA 1HDGO 1DAPA 1DC6A 1X14A 2R00C 2DPGA 1K2WA 3VC7A 1NWCA 5BNFA 3PQEA 1B0AA 2CF5A 1JKJA 4DMLA 2I65A 3Q0EA 1WDKA 3WYCA 3D3WA 1JVBA 4E6PA 1SMKA 3AY7A 3BMOB 4A27A 1T2FA 2PH5A 3PDUA 4PG4A 3ZU2A 4YQZA 4YWJA 3VZRA 1MP0A 2VCYA 2H9IA 4I5EA 1SB8A 1FDUA 3RKUA 4BO0A 5AQ1A 1KEVA 4M8SA 4R5HA 4YQYA 1IY8A 2WD8A 1E7MA 4RVFA 4E12A 1DAOA 1GYQA 1OZAA 1OC4A 3L4BA 1A7AA 1GUZA 5IDYA 1YJ8A 5KNLA 3KEQA 1B15A 1YQDA 4MKRA 3T7CA 5EPOA 1E7RA 3DHYA 4CLDA 1EQ2A 4AFNA 3N58A 5ENVA 3OHSX 1MC4A 4CMCA 1VKOA 1B3RA 3LDHA 4MVJF 1GQYA 2WJPA 4PLTA 5DOZA 2ZQYA 1ZFNA 3DDNA 1W4ZA 4CV3A 4YT4A 2GZ2A 1Y81A 4MVJP 2EGGA 4HKTA 4IUYA 1I32A 4W7HA 4R51A 2VT3A 1GEEA 1KVRA 1CYDA 2FSVA 3EC7A 2BLLA 4Q3DA 1H94A 4DLBA 1HDXA 2HMTA 3ROPA 2GSDA 2IODA 1ENYA 2OORA 2A92A 4FOOA 1DIRA 3SJ7A 4CLOA 1JA9A 4Y6SA 3I9KA 1Q7CA 2VWPA 4PZCA 5JYDA 1CQIA 2CVQA 5KWEA 3PK0A 5IN4A 2A94A 2WEKA 3RFTA 3GVCA 4NIMA 1P45A 4GI2A 5CPFA 3RC9A 1DRWA 1TA4A 2Q46A 1EE9A 4YRDA 4AJLA 4GX5A 2BI8A 3HUDA 1V35A 2C20A 3I6IA 3OH8A 1MFPA 1TT7A 1OBFO 3OQBA 4PZDA 4TRMA 2C54A 2JCVA 1XIVA 4FD3A 1NYTA 3LLSA 3DOCA 3JQFC 4XIYA 1AHHA 2V6GA 4L74A 2X9NA 3GNQA 5I7SA 2VYVA 3GRKA 3QE3A 4HFRA 1Q7BA 1R0SA 2F00A 2RAFA 4FFPA 2NTJA 3D5QA 5IN5A 3VZPA 4Q3AA 2IZ1A 4YJFA 5AVOA 1D4FA 3B1KA 1FDWA 1BW9B 2VOEA 3Q2IA 4BGUA 1CQJA 3V8BA 4BKPA 3AI1A 3NTQA 1V3UA 1BGVA 3PLRA 4L76A 1NVGA 1U5CA 2VHXA 2NSDA 3WQQA 2YQ5A 5JFOA 1VL6A 1CERA 3I23A 3E8XA 2IZ0A 4RVDA 2B5WA 3OBBA 5ER6A 4A73A 3GAZA 2Q4EA 2JD2A 4WLUA 3RKRA 4BNNA 4ZN6A 2EG9A 3O26A 3UGKA 5A3VA 1NBOA 1U4SA 3GVHA 4OOFA 5JDCC 5TSDA 1LLUA 3AUAA 4IGFA 4U0KA 1Y1PA 4TVOA 3VH3A 4A03A 2Q1TA 1U3TA 1Z45A 4CMKA 3KOUA 5CDTA 5IZCC 1GYPA 2JCYA 3OJFA 3A9WA 2PZMA 4IJKA 3SJUA 4BNWA 4D3DA 1LDYA 1HT0A 2I5PO 1Q7GA 3ONDA 2R00A 3ZHXA 3FTNA 2PNFA 3HN2A 1O8CA 2ZIZA 4ND2A 3LF1A 4S1VA 3OJEA 2B83A 3BMOA 1MXHA 2BFMA 1UAGA 2VRBA 4IQ8A 5JE8A 1A9ZA 1IB6A 4RJTA 3PHGA 1LEHA 1DPGA 2QW8A 3K2EA 2A4KA 3ITDA 2UUOA 1EVJA 2CSUA 4I9NA 3SX2A 4BO5A 1W73A 2LDXA 2ZTMA 4U6SA 5DZSA 3BTUA 2B36A 4O1MA 2P2SA 3JSAA 1P1HA 2NU9A 2X1HA 3MJVA 3UCEA 2JFGA 1FDTA 2GDZA 1DFHA 3FR8A 2HAEA 4FQ8A 4CM3A 5IF3A 1R4MB 1N1GA 4TRNA 5JO0A 2W90A 1NFFA 4XYMA 3I52A 3PGXA 4JXKA 4XD2A 5L7WA 2AG5A 2Y99A 3I3OA 4Z9XA 4LSWA 1N7GA 5LCXA 1E6UA 3DZJA 4P8RA 2O4CA 1K89A 4QUKA 4MDHA 4ZJUA 5BQFA 4F6CA 1KEUA 2CNBA 4KQWA 1CEQA 3K30A 1E7WA 1Y9EA 1LBEA 4CQMD 2C7VA 1X1EA 2IYPA 1KVUA 4FCCA 2OXIA 1Y5RA 4D7AA 3LC1O 4WECA 2A35A 4YAEA 3GVXA 4CLXA 2H6EA 5I8WA 3G1UA 4EYEA 1O5IA 3WXBA 3WG9A 5JC1A 4ZD6A 4JROA 5G0VA 3ZH2A 4PG7A 4I1IA 5L4SA 2Y67A 4WUVA 5T64A 4E5YA 3E48A 5I9NA 4WLFA 4BMVA 4B79A 1ISGA 3GPIA 1YQXA 2XF8A 1QYVA 1UR5A 4HX5A 1QRRA 1D1SA 1EUZA 1ISFA 4TMFA 5G4KB 3RIHA 2OL4A 1PWXA 1JKFA 1H6BA 1YB5A 4J43A 4JP2A 4Q3BA 3A1NA 4ZQFA 5KOIA 3JQFA 3QWAA 3OICA 4WOKA 5K9ZA 3DAFA 1SC6A 1GPDG 1XA0A 1LUAA 2FPIA 4RPKA 1Y7TA 4OXNA 4CUZA 5JSFA 2CMDA 4E32A 3RU7A 3ZZNA 2J6IA 1ZJZA 4B3JA 3AJRA 3JQ6A 3G49A 4JBIA 4JBGA 4I5DA 3RUAA 3B1JA 5L7YA 1EMDA 5DNAA 4TQGA 5A3JA 3R0IA 3FNHA 3QRWA 4OQZA 4AICA 4EBFA 2CDBA 3PIDA 1Y5MA 2PGDA 2Y1EA 2EKPA 3BA1A 3PFWO 4XB1A 4BVAA 3AM5A 3KHUA 1JW9B 3ZHZA 4Y98A 3C7DB 4EW6A 5JDCA 1YJQA 1HZJA 3GAFA 1I2BA 3JD3A 5KKAA 3WGZA 3WGGA 4KDEA 1HE4A 4PFJA 1E1KA 5G0TA 4S3MA 5FI3A 1K5HA 4CUJA 1JVSA 1N92A 1UZLA 1R15A 4CM8B 4E2ZA 3FWNA 5IZCA 5A9SB 1VE9A 5KJ1A 3VVCA 2FZEA 1JKIA 1P44A 3NJ8A 1BXGA 4IDGA 3ZDFA 3CINA 1DEHA 4RF3A 4XGIA 3GUCA 5HS6A 5JBIA 5EQDA 3EUWA 3GFGA 3QWIA 3T4EA 4DRYA 2UAGA 3F5QA 2WWRA 4DPKA 1NX6A 4PLZA 3GK3A 1XKQA 2DUWA 5KVVA 3HSKA 3K73O 1DIBA 1E77A 5ENDA 4WK6A 1Q0LA 1U8XX 2IYOA 4OAQA 1F17A 4G2NA 1IPEA 4ZQBA 4WEQA 3DWFA 1YWGO 5DDIP 2R2GA 2ZB7A 3NDJA 4PG5A 1HYGA 3IOYA 1T25A 2WM3A 4EUEA 1VRWA 4TWRA 3UVEA 1CWUA 1KY5A 3X2FA 4BO2A 1U3WA 2J8ZA 3C3XA 1LRKA 3GEDA 4ALLA 3ST7A 5CDYA 4XRRA 2AEFA 1SO8A 3E5MA 2F1KA 3ROKA 3DBRB 1R4MA 2WYUA 1TXGA 4O63O 4DMMA 4OGWA 4R1NA 3DEYX 5EN4A 5F21A 1ORRA 3CEAA 3GEGA 4R4JA 4CUKA 3JQGA 3L0DA 2GN8A 5L40A 1ONPA 1Z7BA 4RPJA 5KVCA 1X15A 4YXFA 3SVTA 2GGSA 1DJNA 4KWHA 1C0PA 2WYVA 1E1MA 3FN4A 3X2EA 1EDOA 4J90A 1Q2XA 2BD0A 1ADFA 3ETGA 1LLCA 1DFIA 2GRAA 1PJLA 3RQSA 1MXFA 1DRUA 2JL1A 4FS3A 5EMHA 3DMYA 4ZA2A 2VRCA 1TT5B 1QLHA 3WX0A 2C5EA 3KYBA 4B8WA 1BVRA 2C2YA 1L7DA 2V6MA 3LT2A 1X13A 3FHLA 1UXIA 4PLGA 1F0YA 1E3EA 2VYVD 3PQDA 3HQ4O 4J9UE 2ZTUA 1JQBA 5TGDA 1NPYA 5G4KA 5THQA 1AN9A 3ENNA 3PHHA 1WW8A 2QZZA 4KWIA 3ZCXA 3JTMA 5JYEA 3QLJA 3GVIA 4MP8A 4D41A 4HV4A 4NBUA 4RF2A 1T2DA 3C1TA 4MINA 4XQ9A 4D42A 5L51A 2D4AA 1BDMA 5TJ9A 2IXBA 2X7HA 2VZ0A 2QRJA 3E9NA 3S8MA 3I5MA 3ZNOA 4DYDA 1DIHA 3GDOA 4IDBA 1WWKA 3KSDO 4AJNA 2BFOA 1M66A 2GN4A 3L07A 5AOVA 1Z7EA 2VOJA 1LSSA 3GHYA 4PLPA 5TRTA 3QP9A 3NV9A 4A10A 5HM8A 4MIOA 1VJ0A 5U4QA 3BXXA 1EEHA 4MVJE 2HO5A 3LYLA 1LLDA 3VKVA 1LRJA 3PP8A 4M1QA 4M87A 1T2AA 4L4SA 2FSSA 2O3QA 4I9HA 3EZLA 3C24A 5EQFA 3IJPA 4CQMB 4KUHA 2CVZA 2PK3A 1DBVO 1WDMA 1Z75A 4NMHA 3TPCA 3ULKA 3QVXA 1D8AA 4CLRA 2AEJA 3KRTA 4GVLA 5A9SA 2G82A 3R6DA 1V8BA 1YB4A 1VLLA 4XJTA 5JS6A 3Q1LA 1DB3A 4CM1A 4EDFA 4D3SA 4YEDA 3ZNPA 4OKNA 2VUUA 1QYXA 3C85A 2E37A 4XJSA 4YJHA 4EEXA 1ISHA 5JAMA 2Q4BA 1M75A 4H3VA 2OGUA 3PZBA 4QSMA 4IDEA 1LX6A 2DBVO 2DBZA 2IZZA 1HDZA 3AY6A 4NG5A 3QWHA 3MWEB 4D44A 2YV2A 1PJ3A 2NLOA 1MG5A 1PL7A 3GNSA 3JQ8B 4M49A 2P9EA 2G76A 1KC3A 2NACA 2QQ5A 3DB2A 4CODB 3B70A 4ROSA 2DM6A 1KERA 2RIRA 2Z1NA 4DC0A 1NAHA 3AU8A 2GN6A 2OP0A 3GC6A 3QVTA 1N5DA 4D79A 4XZ3A 4QX6A 1F12A 1WMBA 1YOVB 3JQ9C 1U2GA 1NVTA 3DBHA 1O89A 2RBEA 2GO1A 3BTOA 1SB9A 1HLDA 3RUIA 9LDBA 1BVUA 1WXDA 2D8AA 2ZB3A 3SBOA 2RHCA 3WJAA 4CV1A 4B4UA 5IXSA 5FF9A 4OOEA 1OMOA 2D3TA 1N8KA 3JCZA 4GMFA 3U4CA 4J3FA 2EF1A 4RLHA 3WFIA 1T2EA 3GNTA 3D3WB 2VUSA 2OMEA 4DYVA 3H9UA 2JD0A 1KBZA 3AK4A 3JD4A 3GDFA 3N74A 3QHAA 2V6FA 1TT5A 3AUTA 4NR0A 2ZYAA 3PGJA 4BS9A 3OJ0A 4PG6A 4J7UA 3PVZA 4RVSA 4CL8A 2QRLA 1F8FA 4JNKA 2Y1OA 1MA0A 4CMBA 1MUUA 2TMGA 3LU1A 4ZQGA 3HB4X 1YE3A 1X1TA 1ZXLA 3LC2O 3OETA 1XSEA 1SBYA 4AL4A 3UH1A 1P33A 2HSDA 3G0OA 3GMSA 3I9LA 4XWYA 3OEYA 1E1LA 3V1TC 3WNQA 1J6UA 2FR1A 2Y0DA 3GGOA 4UUMA 1MX3A 3UN1A 3AFMA 2E48A 4CL3A 4IGEA 1UH5A 3QJ5A 5AXBA 5T5QA 4OL9A 5KJCA 4DVJA 3ONEA 4IPTA 4YPOA 5A9RA 8ADHA 1GTMA 5BSGA 4PLYA 1I3LA 4DGSA 4CMJA 4JIGA
chains in the Genus database with same CATH superfamily
1XCPA 4MUGA 2IHTA 2B1GA 1TUBB 4CCWA 3KWMA 4CLOB 5A3QA 5JZOA 4KR0A 2MINA 5AW6A 2WFLA 4UAGA 2VP5A 2GZMA 1AKWA 1P18A 4Z51A 4LZOA 4RHFA 3UWMA 5CX1A 2OBMA 1Z6YA 4EW3A 3E9RA 3O74A 3JQ7A 1PZXA 3RDPA 1XXHA 3H5WA 1KVSA 4R69A 4C06A 1HT1E 1S9HA 4MA4A 5E8JA 3TTWA 2FZLA 3Q3JB 3WJ2A 4QDZA 1OGYA 5DGXA 3B1XA 3RAEC 4GO1A 3MW8A 2YFQA 2ZDHA 4LXIA 2Z6VA 1AZLA 4L9SA 2V54A 4F93B 4ZK6A 5M5BA 1MAVA 1RMTA 1PNOA 1E7QA 3L40A 4WKCA 3BIJA 2B3DA 3D0KA 2D2VA 4IMIB 4XGQA 4B09A 5KREA 2UYCA 4TV8F 2BFCA 1H93A 5CEFA 1G7TA 5EJGA 2YNMD 2UYGA 3PLNA 4Q34A 1CR6A 2RSLA 1SPBS 1OTYA 1RLIA 2XE4A 3MJRA 3EF0A 1E9BA 1M67A 4DUGA 1PBTA 2AX3A 5C8YF 2VHUA 1AHIA 4PAWA 4F2WA 1AKTA 5DISB 2JLZA 2JHGA 2G9UA 5IEJA 1WNTA 2XE6A 4HATA 2F90A 2ZI9A 4GDMA 5CLJA 4Q9KA 2QL5A 2ZRJA 4WNAA 5C1IA 4ZVKA 2PXHA 3GY0A 4HRXA 1JIXA 4UEQA 2JLVA 4KB5A 3BSFA 4UEOA 4EHDA 4FYPA 4RV9A 1BA2A 1TAQA 2AMVA 1TDJA 3H2JA 3VTKA 1NTOA 3K2IA 4U2KA 2AEEA 1YZ3A 3M6IA 1NVXQ 2D00A 3TSAA 3PC8A 5F1OA 4DE5A 3I30X 2YMMA 4QT0A 1AUPA 3CU5A 2QS9A 3FCUB 3FKSD 3IAEA 3VJLA 4C20A 4B7XA 1HFKA 2V3CC 4X7RA 1TCCA 4WE3A 3WXMA 1JPJA 1QJ4A 1SUIA 1COWA 2PS1A 1HV8A 3I1YA 5CB4A 3MGBA 5G4LA 4XJXA 4YJ2F 5E9AA 5CA1F 1C0EA 3CONA 1HETA 4GOXA 4BFYA 1RRVA 3V48A 4RVCA 1KGSA 1UMCA 5IT9A 2HU2A 3GOQA 2DFLA 1WF6A 3BA6A 2PA3A 3IFSA 1Z4KA 1REQA 3ANXA 3IMEA 3LTEA 1U11A 4L51A 4P2GA 4RF5A 3RRYA 3FTFA 3T12A 1EFAA 1HT3A 3BM5A 4OXRA 2ZLBA 1NJ6A 2EV9A 3C6MA 5TQVA 3WOVA 4TV9B 4CDMA 4ER3A 4DJTA 4GWKA 1A1SA 2C3UA 5DBFA 4BNLA 5FA6A 2WQ6A 2HX1A 3NWBA 4OLBA 4GPEA 2NU7A 1WHTA 2I76A 4FMCB 1XXHE 4M0MA 1GZDA 4HAYA 2O3TA 4IUDS 1UC9A 3FTDA 5GVSA 3G23A 4HYTA 2WMYA 4E31A 1CEEA 3KAJA 1V7QA 1W52X 3E9EA 1RWNA 5DX8A 1HGXA 2FJPA 5HG0A 1RCFA 2ICAA 4KO8A 4GR4A 4RY9A 2XQKA 1NAIA 3BIOA 4QGBA 1SBTA 1VMDA 1CY4A 3P0RA 4Q39A 4OHCA 3HADA 2NP6A 4FB4A 4OLJA 1FY2A 3RRZA 3D7KA 1J7JA 2VDWA 2B35A 3UAGA 4CLEA 1D0SA 2WSMA 5C5DA 1AURA 1KNXA 4K3VA 4L6CA 1ULSA 3DTYA 2GPWA 2WC1A 4JS0A 3QMMA 4O2AF 5J59A 4DJAA 1GPJA 3UMFA 1VPVA 4I50B 2X77A 3GR6A 4M1OA 4PPGA 2YVLA 1S89A 1GLNA 1HMPA 4IWNA 1OAAA 3WMWA 3I2HA 2Q1SA 3RS8A 1A76A 5K3CA 2RARA 1ODCA 4FKZA 3ZGNA 3ZZ1A 4NFHA 4JK3A 3ENVA 1T2CA 2EERA 3CC8A 5IK2D 4LJLA 4LNUA 3EC1A 5H9VA 1V6AA 3TZCA 3IALA 4D92A 4CPDA 4CGYA 5GZ1A 2MR5A 4PPYA 1HTBA 1AV7A 1OASA 4J1QA 3IUNA 3Q98A 4M8LA 5AW2A 2OBFA 5KQSA 2OCDA 2QTBA 2QLNA 1T29A 1DKPA 1FRFS 3NNNA 1ONNA 1CVIA 2PFGA 4Y2YA 3SC3A 3TTUA 4MUKA 3ZHUA 4YR7A 3U09A 2NX2A 2AE1A 4GI3A 4BNXA 5BPHA 2BHRA 2JCBA 4HH0A 1VE7A 3NVAA 4GS5A 2ON6A 4HBGA 1U2TA 2JH9A 2ZYRA 1WCV1 5DHQA 2J9GA 1C50A 2DP4E 3IPAA 5IUKC 3ICQB 3N3BC 3EMKA 4Y6PA 2B4QA 3LAWA 4II2A 4MRMA 2CZQA 1N2ZA 2F8LA 2JS7A 2IFTA 1IC6A 2VDJA 3BDVA 4TGLA 1WXFA 1QGDA 3IIMA 3IDQA 1KRXA 2DWUA 4LNAA 3PVSA 1EJBA 4OGLA 3WHKA 5KTTA 1X94A 1KI9A 4P4NA 1DNPA 2I6TA 4YAKA 3QF4B 4WY5A 1UDRA 2EQ5A 2HRBA 1XRMA 2PXCA 4WDQA 4B40A 2O2CA 3MJSA 2PV7A 3CSDA 3IYLW 4BNZA 1I2AA 1ODKA 3DV2A 4E7OA 1GLGA 2JFWA 3LJKA 3TTYA 4NLLA 1UBFA 1FX1A 1E2GA 1Y3CE 2RH5A 1MHTA 3PNYA 4IIJB 4L9RA 2EC5A 1JYFA 1QU2A 1XRSB 3P45A 2H29A 4BX9A 4OF4A 1DX6A 2W71A 2YMQA 3B36A 2EKQA 3PCXA 4GRAA 3AG6A 5AT1A 3FMPB 3OUUA 5LB4A 1SUPA 2IY8A 1KH2A 3BSWA 1CHDA 5C31A 3R7AA 3BMQA 1J90A 3DVQX 1VDMA 1B6GA 1D2AA 2CE2X 2HJHA 3E61A 3EF1A 2A9JA 3ELYA 4LWZA 4N47A 5J4YA 1K9VF 3QA9A 2HEGA 5L7TA 2GILA 2FX3A 4W5RA 1B73A 2YL2A 4O0LA 1BZYA 5CEJA 4RULA 1LX7A 5I9IA 3KETA 2IF0A 2FG7C 4MYHA 4RL6A 2XE7A 5EMNA 5JV5A 4ZQHA 3BD6A 1HK7A 4LF5B 3L1VA 3U5TA 3URMA 1U63A 4GSYA 3HCOA 2XYQA 3PXAA 1B4DA 1Z2NX 2TMKA 2VYCA 1UMBA 2RDMA 2IY7A 4BQNA 1ZSNA 2C4KA 3ELDA 3TNLA 3EY9A 1VLQA 3ZY3A 4M98A 2BONA 1P2FA 3DEFA 1QJCA 3OY2A 1V0JA 2GQ0A 4YREA 4BN5A 3RIYA 4EEKA 1OVMA 2CJPA 1R4ZA 2MT9A 3M9WA 1F1JA 2V96A 4FHFA 4EENA 1E62A 2O2GA 1XCJA 4S0XA 3JYNA 2BSQA 2OZPA 4B2PA 4LIPD 3AUSA 3W79A 4TPKA 3WLSA 3MTJA 4D1YA 3WB1A 1NURA 4OY3A 1RAEA 1PP4A 3V3KA 5HMMA 3FNFA 3RUEA 4ZCIA 1SURA 4NU0A 4AKHA 1NXOA 5GP1A 3MB8A 4HNGA 2YNMC 2D5LA 3W4KA 3JX9A 5LQCA 2D13A 3NIFB 5DYYA 1LS6A 1AH2A 1ZH8A 1ISSA 4DIBA 4CL2A 4M7OA 4AMYA 4Z86A 4RKWA 2O2XA 1DINA 4P4LA 3V3TA 5CB6A 2CB0A 1O87A 1U6JA 3DDHA 2ZUUA 3VU8A 5I5EA 1BN7A 3B1VA 4OQEA 4EHBA 4UTVA 3E7XA 2VP0A 4UM8B 3EFOB 4X6LA 1VFPA 2NM0A 2R6HA 3CX6A 1JFRA 1FJXA 1JG6A 3M1LA 1RPJA 4Y6RA 4CT5A 4K1XA 2WLSA 4YP5A 3EXFA 3KQYA 2TRSB 2W2KA 1J2JA 1RKUA 2A9VA 2C4TA 1JPUA 2CHEA 3EAFA 4M60A 5ADVA 5KPJA 2R5FA 3AOEA 3HY3A 4K7JA 4TSRA 4ZCQA 5A6VA 1JJVA 2AOTB 1CIPA 4P84A 1NNEA 3DEHA 1QVAA 2HCTA 2PL1A 3FF4A 4XYEA 3U1TA 1XV5A 5CT6A 1PL0A 3W8RA 2GEBA 4LZWA 2I54A 2B21A 2ID9A 3H5RA 4GL4A 4LOJA 4RKRA 4ETWA 2XQGA 1XEWX 1SUFA 2VIIA 3M34A 5G40A 3ZZMA 4Y2TA 1C4XA 2ZTHA 4E33A 2HMUA 1LF0A 1UOQA 1U0JA 4QVKA 1A96A 1AA6A 1B0ZA 3MQ4A 2G4CA 1GA1A 1G5QA 3HN7A 4YAGA 1MNAA 1PQWA 1FMLA 4A7PA 3FWKA 3ZC3A 1CXZA 1A8IA 4FJ1A 1M0EA 1MJ5A 1YR8A 3GP5A 3MBIA 5B3JC 1Y6QA 4RACA 4PG8A 2WTXA 1T8PA 1H0HA 3AT1A 4WCFA 5KBYA 2QN2A 2G36A 4LV8B 5F64A 5IEBA 5AM5A 5K4AA 1H8EA 4II7A 4M1MA 1KL7A 1WTAA 3OIVA 5EVJA 4M99A 3BRWA 1PR0A 4WKBA 3F7MA 1NMXA 3SHFA 1ZUNA 1R10A 3KLPX 1E8MA 3Q2KA 4W6ZA 4FI3F 1N2SA 4UXJA 1MB0A 1W96A 4O4LB 4OQQA 5D5PA 3WRYC 1OGJA 2XTJA 5JHHB 3THWA 1V9CA 4DV6B 3EGWA 4LK2A 3A1DA 4DV0B 3P9YA 3HNPA 2W98A 1GZ7A 3I8XA 2QE6A 2QGZA 2XZTA 4I5FA 3P5BA 3HP1A 3UV6A 4DY4A 2Y0PA 3T3HA 3BL8A 3CNLA 5BW6B 3JQEA 3OBIA 1K08A 2OQVA 3UTCA 5AKKA 3ETJA 2W4IA 4ZVUA 3KEFA 1Z4LA 5CB0A 4J29A 4EBBA 2FFHA 3OPXA 5AVZA 2VQEB 1WVGA 2HSGA 2UDPA 1XMVA 4HQNA 1DQRA 3FKQA 5AKYA 4YI3A 2H1IA 1H1DA 4MV0A 5EJFA 1GAEO 3ANTA 1B1AA 4KMMA 3CJTA 4REMA 3DV0A 3IRUA 3QLUC 2GXUA 4Z2YA 3RRNA 4ZT5A 3F3MA 4U6QA 1T0PA 5JCJA 1OH7A 1KU0A 2C07A 3G02A 2H1FA 4GMGA 4CBVA 2DETA 3UAOA 1XCOA 1WB5A 2AL7A 1XQ1A 3TQHA 3H5NA 2X40A 3OPQA 1XB2A 3NJ4A 4PHTA 3VFDA 2G72A 4FYHA 1Z33A 3TUJC 1WEHA 4AZ3B 1NN3A 2EW8A 3ZXUB 2PGIA 5HUJA 5LP1A 1KWKA 5EKUA 5L3ZA 2PRYA 5JDIC 3L8HA 4MPDA 2B5VA 4U7PB 4DR6B 1MT3A 1J06A 4AF6A 1NUSA 4TLCA 1P7PA 2PEYA 1I8TA 4H7IA 1T4DA 2FK7A 5G41A 3N39C 5E4FA 2PIAA 1U31A 5A0VA 3ZWAA 4IJVA 2QJTA 2GCIA 4OXQA 3VUFA 3B7PA 3FVVA 3TZ6A 3DD5A 1O03A 1U5AA 2VHYA 4CM9D 1H0SA 3NO4A 1LI7A 1G20B 1E0JA 3SDBA 1DLIA 2VQSA 3F90A 3SZUA 3ERCA 2QUAA 2WAXA 1QMPA 2NUPB 2YMLA 1MGPA 4MW7A 5ELMA 3R7WB 3PNVA 3CB4A 2H17A 3LM8A 1SCBA 2VHEA 3D54D 3CSSA 1ZCJA 4DMRA 1RJGA 2ATEA 3DZCA 3ZHVA 1XMIA 2GF2A 4ZO8A 1W25A 1EGVB 5CXQA 1GT91 5CXSA 2BFEB 3E22A 3EDMA 3EZNA 4OYRA 1AM4D 1ZIPA 4UJ3A 1N4AA 5B7NA 3P9CA 4B6JA 1YCDA 4JV5B 1ESDA 2ZUBA 3ETCA 2J4CA 3ORYA 4GPTA 1RQPA 5E2BA 3KALA 1O1YA 1W46A 3EGOA 4Q7QA 3WL6A 1BWPA 5ABPA 3RYCB 2XXBA 3TB4A 4CIXA 3VH2A 4MK4A 3MBOA 1F6BA 4J6FA 5IM4F 2QGFA 3QVGA 3RSHA 4ZVRA 4EP1A 4NJOA 4PFKA 3RTCA 2CJWA 2J6BA 1CF4A 5HXAA 4KDFA 1O6CA 5IBQA 5T6MA 4FT4A 5M04A 2Y1KA 1QGYA 4X9XA 1A0OA 1I6LA 4UTZA 2NZ8A 3QLEA 5KYVA 2OWEA 4BO8A 3OUTA 1RZRA 1C8LA 2ZZKA 3WWYA 1FUKA 1AGNA 3PQ3A 4KE6A 5TIIA 3EYAA 2NXEA 4IEIA 3BTSA 4KMOA 4NQRA 3BQ9A 1Q17A 2JHAA 1Q11A 1ZXBA 2C5FA 2HJSA 3K9GA 3A4NA 3W06A 1S8FA 3AEKB 4R98A 4MX8A 2OHXA 1K3TA 3M1IA 3WK6A 1Z17A 2O8BA 1HE3A 4MJ3A 3NWEA 4AMBA 4MYCA 3K94A 2OBXA 3O38A 5B55A 1EAYA 3PI6A 1XZEA 1UAAA 1LC3A 1PLJA 2IH4A 4IO1A 3PJEA 1OXBB 2HSZA 3AVXA 4QYXA 4QYSA 3TIIA 4XRGA 2QVGA 3LQQA 3AUXA 4XIJA 4HN9A 2A14A 4DQDA 2ASVA 1MO5A 4UAJA 3PUVA 3UFXA 1WNFA 3ZW9A 4AJHA 4L9WA 4M0DA 3I6YA 3SFVA 4Z4CA 2JIQA 1Z8NA 4KR7A 2GR9A 2I91A 1KP2A 1R9NA 1U9JA 1QKJA 2VH5R 3F3KA 1IM8A 1X9IA 3WL8A 3ZLBA 3H7AA 3H8WA 4YRSA 1H0KA 1E0SA 1FVXA 1L5NA 3HXLA 5DTQA 1SXJD 4OBXA 4UATA 3JQBA 4AUEA 3KJIA 4ZTZB 3PC3A 2V65A 2CDRA 3AJAA 2ZUCA 4RPHA 3OLVA 1UPCA 4L08A 4RZQA 3S99A 4MHOA 3NC0C 3MCWA 3DZKA 3SEZA 1KAHA 2ENWA 1EK6A 3JV7A 4RPGA 5DHUA 3RVQA 4DCNA 2C3YA 4HC4A 2P3LA 5IARA 4Q1VA 1Z4QA 2DBRA 4L8VA 1VPTA 2FEAA 2ZBQA 4EGCB 3QEOA 1WL8A 3OIFA 1H85A 5CCBA 1A4UA 3AUUA 4G9GA 5DMXA 1CUWA 1TKCA 2LIPA 1PFVA 4RJIA 4RA6B 4UXIA 4V02A 1J9GA 1FS4A 2DH6A 3HDYA 1FXUA 2QOEA 4MS1B 4NZMA 2LTAA 3GH3A 5EP4A 4B3CA 3BT7A 1E8NA 2I67A 3IKJA 3CVJA 4QXRA 1PDWA 1CSEE 3MEQA 2H4WA 2DVMA 4ZQEA 1VBKA 3SNHA 3AF6A 1Y6JA 5T4EA 1A97A 1BNCA 2MINB 1QR2A 2EJUA 2WFLB 3CG4A 4FN4A 4YROA 4EJSC 4PSVA 1JJBA 4W7IA 4Y7DA 1QKKA 3EYWA 4N3AA 4OYHA 3CLKA 4OQ4A 4D5GA 4EI7A 3H65A 3NAMA 3U4IA 1T10A 2OG1A 5BV8A 5CX1B 2HGSA 4GM0A 1JLLA 2OQIA 3F6RA 3JQ7B 1HYQA 1KOJA 1XXHB 5TT1A 3FGOA 1I3CA 4I5GA 3RVKA 3K0SA 3FIUA 4FGWA 2X7JA 2PZFA 4A5OA 4C3OB 1U2SA 5LZ8A 1PS9A 4ZI7F 3EA0A 3KLOA 1YONA 4IDOA 5LMNB 3EOAI 1G38A 3TI9A 3M6XA 3D3EA 3E82A 4OK6A 1D07A 5DSXA 3EZYA 1W88B 1ZJ5A 4H1UA 2M6RA 4IXNA 5AVKA 4TRRA 2Q45A 1N3LA 2F3TA 3GUYA 2YRFA 3P2OA 2JAPA 2VBFA 4R8VA 4RENA 2Q1UA 4Y2RA 4UXHA 2QGNA 3UA4A 1P74A 2BFCB 3P0FA 3QNUA 1C0KA 3V42A 5BSEA 5GADl 3CRNA 3IAHA 1EP1B 3AW8A 1C29B 2QQEA 2RHWA 2YV4A 3C7AA 3A3OA 1CS0A 3DKIA 3FFXA 5BT8A 2FRVA 3O8OA 3LD9A 4A6DA 5LU9A 3PRJA 1K9SA 1ZQ1A 4LWPA 4C76A 4O4IB 2JGNA 1IZ0A 3IDOA 3MYRA 3M6MD 4FSHA 3H1FA 3IB6A 2DQ4A 3NTUA 3HHPA 2FUNB 4WNAB 1EZZA 3T34A 4XDYA 3U6BA 1ZSVA 2KQUA 1G63A 5EESA 1VXRA 4KZKA 3ZK7A 3FSRA 5BRNA 1YKGA 3FI0A 4Q1AA 4F3YA 1GZSA 2P4UA 4CM4A 2ZXEA 3OQVA 5FFMA 1DRJA 3DAGA 2YVQA 4UCQA 4YUYA 3L04A 3G1TA 3NC4A 4KU4A 1Z2CA 2JLUA 4B3TB 4PX3A 4DLYA 4BNHA 2XUKA 4FHEA 5CVTA 3TLEA 1C4KA 3JQRA 1RRCA 4ITVA 4YUAA 2UV8A 5LM3A 4HSEA 5CB4B 2VWGA 1MNQA 4I3FA 2GCEA 2OUIA 1JZQA 3NBYC 4YLEA 5EE5B 3SVLA 4J3NA 4EHFA 1FW6A 5E1DA 1UMCB 1SQFA 1UJNA 1E2KA 2WNIA 5KJFA 4JSYA 3ZXYA 1REQB 2D3WA 3P26A 3FX2A 1KJZA 2PUBA 4FLFA 2YX1A 2ATVA 1XMXA 2Q3EA 3NC1C 4YACA 1YZNA 4J0QA 4CLHA 5I3ZA 3GG9A 4LZAA 2ILTA 5DIFA 5KDOA 3CVXA 3UNXA 2J85A 2ZSKA 4S1PA 1WHTB 1Z0ZA 1EE1A 2G5TA 3D4PA 3DO5A 3W9BA 4DSZA 3UW3A 3EVBA 3ANMA 5KVAA 2JKVA 4GSLA 1RYFA 2JW5A 2FP3A 3M81A 1T5DX 2LRHA 1EHCA 3PNOA 2J0UA 5TARA 1KKMA 2IXAA 4P35A 4LX8A 2FPKA 3CUYA 3UMBA 1LC0A 2GAOA 3F8TA 2XGJA 4MKZA 4KREA 3MERA 1ZX1A 3K8ZA 3LQ2A 4JCOA 3W2IA 3SQDA 3U7JA 2Y1XA 1MEOA 1S0UA 1G3IA 1SCIA 1Q7TA 3C7KA 4QLOA 3UG7A 4Q37A 2VDWB 4BWGA 4TYPA 1VYTA 1QCCA 3L9WA 4MUFA 4PINA 1UFVA 3O90A 1HA3A 2ZANA 1N25A 4ALKA 1YUMA 1P8AA 5JAZA 1E2DA 1PEKE 5ESDA 3HFSA 4G0VA 1F5NA 5IULC 1MOPA 3A6GA 2FMKA 4EHLA 1ZVJA 5IVDA 4DLNA 1ZZEA 3W90A 1GGNA 4MCIA 4S0ZA 3L49A 2I6QA 2SKDA 3BAFA 4PO3X 1S02A 4UVIA 1WY5A 4X91A 2GBFA 2B6HA 4LNUB 5EXEA 2HCBA 3IKVA 3F67A 4UM5A 2NVOA 2P40A 3A9UA 2JIBA 1W2WB 3D4BA 3A4MA 2WY2D 1PJZA 1KGDA 2NZYA 2QLMA 3PE6A 2R7NA 3EQ8A 5IDQA 1WX1A 1MOZA 3DFZA 4FJ0A 4K9NA 4P36A 3IPXA 2JJMA 2XNDA 1C8BA 3U4AA 3DE6X 3D3JA 3EY4A 2I8LA 3N2NA 2C9CA 2W6IA 1GQOA 2CFTA 2WKRA 3H75A 3TDNA 4AVYA 5DHFA 3L7MA 1R16A 3AFIA 2HK8A 1X1QA 4AMUA 5HRCA 2ACVA 5HRUA 1Y1QA 4MRMB 2AWOA 2WWGA 3B89A 1QQTA 3VNSA 3TECE 1P73A 1R1DA 3KJZA 4ZI5A 2VNKA 3HBLA 3IIJA 3ZDYB 1OFVA 1AQ6A 2NTNA 2N9UA 4NVRA 3GRCA 4MQLA 2ZE6A 2W6MA 3GGDA 5JJIA 2Q1WA 3HUEA 2XKKA 1SY7A 2QVYX 4FKMA 4RXUA 2A9QA 1H2BA 3COVA 5A4IS 2QG4A 2AR0A 1XTUA 2Z56A 5SY9A 5K03A 3GGSA 5JSUA 4UE3S 5CVEA 4BRZA 2N46A 4JLMA 1NW6A 3KXIA 4AU1A 5ALIA 1SXJC 1XMJA 2IW3A 1GPLA 1IQUA 3DDWA 4CETA 5K6AA 3FUXA 4UVDA 4ZZ3A 4IGKA 2ZAGA 2MSLA 4R68A 1B41A 4C07A 3QITA 1R27A 1MB9A 4MAFA 3JZFA 5DLPA 1RR6A 1AGPA 1I4DD 3AIOA 5A1JA 2WTUA 3QF7A 1U8TA 4KXWA 4EGJA 2EGHA 2OGZA 4WY8A 3NJRA 5CFQA 3OQJA 3T99A 1O95A 3OZCA 3HYRA 4W5NA 2BHNA 3BMQB 5I7RA 2DSTA 1YR6A 5DTEA 4C4XA 1OX4A 1W36C 3DCIA 5KOHA 4LHXA 3FTPA 4LPSA 5JNTA 1V48A 4DZRA 4KOAA 1NWHA 1ZGZA 3GV0A 4EPYA 4ABYA 3DR3A 4QOEA 3ZLTA 3TFOA 1JR2A 3O4RA 4KXQA 2PL9A 4HQ0A 1TEVA 1T0UA 1QMGA 1PNVA 3UAZA 2VJQA 2OKGA 3L77A 2FN7A 2J3IA 2UXBB 1A9OA 1XTQA 2P4EA 4I7EA 5AW5A 2WHQA 4X20A 1SWVA 1R4AA 3VDNB 2P79A 4XWWA 1UMBB 1N7JA 3HCNA 1RM0A 1JR3A 2QYOA 3AVWA 4QO7A 1L5LA 2MDTA 3PWKA 3A2NA 4Y7CA 2OGSA 2L82A 4CYMA 1JZTA 3TJZA 3B1FA 5K0FA 1RC0A 1ZNQO 1HDIA 4E2XA 1BVYF 4DV4B 2WAAA 3TOZA 4U2FA 4ZEMA 1TFRA 1WU7A 4GBGA 5HIMA 4XASA 2M2IA 4PO9A 1MZVA 1UT6A 2EBHX 1A7KA 4HADA 4FDUA 4MW4A 3OJOA 5KOYA 2ZJYA 4CMEC 5IWAB 1B74A 5LD2C 1L0BA 2V59A 1P7VA 2GAJA 3FCSB 3MVEA 4JT9A 4OH7A 4H6XA 1B2LA 2VSXA 3HJHA 1BC5A 1QAMA 1U99A 2NZVG 4TUYA 5FT9A 5A05A 3U9TA 4KRFA 3LQ1A 3HN6A 5DLQC 1D2EA 3W5UA 1X8JA 4YO7A 2SICE 1NXWA 3PFKA 5BNIA 3ZWMA 3OE7D 2HWYA 3PDWA 4G4SO 4RCZA 4TTRA 4RCVA 5L3QB 4F6LA 1UK6A 3C6KA 1OF1A 1Q1NA 2TYSB 4IFIA 3U7QA 4G5SA 4GR9A 3KSMA 2BI7A 3OF3A 5E6SA 3MRXA 3M5DA 3ODGA 2X9GA 4UTOA 1FP4A 1TJNA 1L4UA 3H1BA 2Q5JA 3LOQA 3RAGA 1Q5PA 2Q9CA 5ALOA 3EXFB 3E2MA 4G9EA 1G60A 5FOSA 3NCHA 2ZPTX 1ZP6A 2FA9A 3MGKA 4GMHA 4NNPA 3U44A 5K51A 4MH0R 1YR1A 2VF2A 4K81B 4LHEA 2BBTA 5AR1A 1NQ5A 5AIAA 4WBXC 3HDGA 2FR8C 4XWKA 1WCWA 2IC5A 5EXSA 2AC7A 2DTEA 3E1GA 3OHMA 4FFOA 4MRSA 4BDTA 3WISA 3DBLB 5C1OA 1NNI1 3T3PB 1HQKA 1PJ4A 1CZOA 2A7XA 3TMKA 3AF3A 3IL2A 1GNVA 2YXBA 3AEQA 2W4QA 1T4CB 2H57A 2GPBA 1P7YA 3NM5A 4GW3A 2NYUA 4K86A 3AI3A 1J8MF 1H2EA 1NI5A 1NP7A 1XQVA 4GQBA 3GJYA 3UB2A 4AG3A 5LXTA 3KQKA 3UWKA 5JWRA 4DV5B 2JJ2A 4WCFB 4QUIA 1ADGA 2C57A 4BATA 3FUUA 4UBJA 4ZVQA 4BVKA 4E2FA 1JR3E 3AC0A 3SZMA 4QJ4A 1NQAO 3CURA 1JAIA 2ODQA 1LK0A 3K2QA 3A3NA 4L6IA 4MEBA 3M89A 5DCYA 1ZUNB 1HT2E 1KRWA 4D3ZA 1SUBA 2AQHA 2PMDA 1GGHA 2JASA 3TOXA 5DJ5A 1JFVA 2JI7A 1USKA 4NJMA 4P3XA 3ML1A 3THWB 1AKQA 2GYYA 1O94C 3OF5A 1PR1A 1X39A 1BMFD 4YT8A 3NYIA 4OQYA 5DI9A 3FMFA 4TQUS 4DLLA 1CRQA 3QVLA 3EHEA 4DA0A 4UQPA 1JRLA 3PGVA 3SSAA 3U7EB 4OUDB 4G26A 4M0LA 5J2TF 2JAOA 3NYQA 4B80A 1XTBA 3WLEA 3ITKA 2JVIA 1YUNA 2M32A 3AX6A 3TBHA 1UP4A 4L2IA 3WA7A 3GLIE 2O48X 4TTAA 1KMCA 4FZJA 1CHNA 1F5SA 1R0CA 4JUIA 3AR2A 3UMCA 3VR5A 4ZYXA 5FEUA 4UBOA 1U6KA 5KYTA 1XR3A 1ZHOA 1A71A 3T5TA 3AW9A 2RGAA 3W5DA 4P3YA 5B1SA 3ZWVA 5ENZA 2G17A 3IT2A 4HZUB 5EUCA 1CFJA 1JBQA 1JIJA 3GJTA 2AV6A 3E7PA 3INTA 3L9XA 3VJRA 3KX2A 1RBQA 1KFKB 3O73A 4G25A 4RHEA 4E2YA 1TM2A 4ENQA 3BQNB 4Y8VA 4GP9A 5FTNA 1VL0A 1P0IA 3ORRA 1Z6ZA 2DJIA 2MYTA 3HUFA 4J0EA 2QLJA 5FLXA 4H9GA 4RGVA 3V1UA 1FSSA 1SCJA 2RG1A 5EAIA 1CUAA 3RPEA 1RI1A 2RHLA 1VHWA 2VJYA 4PNEA 1PRYA 1O6ZA 1MKYA 4ALNA 1RC8A 4BTLA 2O8NA 3A10A 5CNIA 1VFNA 4ONEA 2XCRB 5B1DA 4DCPA 1FF9A 1N2CA 3DXXA 5JZBA 1RAIA 2IXFA 4K26A 4BU1A 1ZM9A 5IXYA 4DR5B 1UT5A 3R7BA 4AY6A 5SY4A 4LYAA 4D46A 5BQOA 1NATA 3DEIA 1DXOA 5H8WA 1OH8A 2DF8A 3HKDA 1N2EA 1WMAA 3HPRA 1V16B 3NVMB 1N5RA 1TZ2A 3K92A 3NI2A 4KDRA 4INAA 1N8TA 2WV9A 4JLNA 4WZZA 1J0XO 4DIFA 1ZGBA 4L5CA 1FVFA 2HQSA 1Z3CA 1QV7A 4R9VA 1NC1A 3RW9A 4TMXA 2DR0A 2ZT6A 3QLVA 5IJAA 1PHPA 4FB5A 1U3FA 3F6YA 3K7EA 5ILGA 5L8VA 2ZCVA 3AHDA 3HDTA 4KIWA 3IIKA 2ONYA 3JVUA 4UVEA 3ELUA 3K1TA 4XR9A 3WLQA 3SXPA 2UZ0A 4QECA 4DIEA 1YQWA 3NTOA 1G7RA 1A9XA 3OZDA 3VTAA 2GJAA 3JQAD 4XUCA 4Z49A 4D4JA 4RO0A 4A8JB 2P9ZA 3SZOA 3TI7A 4F4UA 3A1WA 2X2FA 3QVGB 2AIRA 4DQVA 1GN8A 4KR9A 1THMA 2CJWB 3WL3A 2CNWD 3LUGA 2EZ9A 5JANA 2QZSA 3SKVA 1IN1A 1ZO8A 5AHXA 1XWWA 1TKRA 2BJHA 5EIOA 3SSNA 1NRWA 2VFAA 2YXLA 2ZE8A 3LX8A 1JHPA 3QWFA 2RJNA 3TINA 3KAKA 1HDOA 3EA5A 4QAJA 4RPLA 3NBAA 5JAQA 4FU0A 1FFXB 1UXKA 4L73A 4NATA 4Q66C 4M76B 4QRDA 4LVCA 1L7EA 1PWYE 5BN5B 3RREA 1WV0A 4FNGA 1RPZA 1C3XA 1VYVA 2G67A 5EERA 3FPEA 4PGHA 1F8GA 1T8YA 2B7BA 1VCHA 3K8OE 1KP3A 5FI0B 4Z0TA 3UJ8A 4FFWA 2O8BB 2UZAA 4BVEA 5J58A 4OHUA 5JD3A 4TXHA 1E6CA 1JB1A 4MS3A 4LC0A 2VJBA 1TYZA 4L4UA 3DMHA 4W1QA 5ALHA 4GYJA 4YJGB 3HDJA 3C6QA 3RC1A 2AC2A 3GLQA 1DJLA 1P5FA 3ZKAA 1EQUA 2XWJI 4FTWA 2ZULA 4Y9RA 1FUUA 4Q5IA 2KX7A 3QYJA 3UFXB 2R7LA 1GARA 3NHWA 3AWDA 2JIDA 2A6PA 4MGZR 1LPSA 1WB6A 3CYFA 4DEVA 2C7BA 4FWTA 1XPJA 4XX1A 5B1IA 1FU7A 4QWMA 4D43A 1QHIA 2PR2A 3IB3A 2IDJA 4YIKA 4XUGB 2IYAA 2HSEA 4KG7A 3WKEA 1LSUA 1Z4MA 2BGLA 2CJFA 3HCPA 3HDVA 2OOKA 4LJAA 3IA7A 5CAEB 1AE1A 4J7XA 2Q50A 3THRA 2FSGA 3OX3A 4LJ8A 3O83A 4O33A 4EY8A 3I5XA 1XLWA 4AUMA 1N32B 4CR7A 4B7CA 2CNLA 3HACA 1NYLA 1TJPB 2OGTA 2PLRA 3B60A 2X1MA 1ZIOA 4JVNA 2XA1A 4UM7A 4BGEA 1JVNA 1XP8A 3RSCA 4B3FX 2XT0A 2HIMA 2W2LA 5GJVC 1PJCA 4D74A 1XMSA 5DASA 2ZYHA 3W4JA 2Q49A 3ZU4A 2BGKA 2XUOA 4X3OA 3NDIA 1JSRA 3UXMA 2ZIEA 2PGLA 4MKIA 1G8YA 4PAMA 3U26A 2K87A 3KFLA 5HJ2A 5DVZA 3TD6A 2YJGA 1D5CA 3A6EA 4TWBA 1W4BA 3I12A 1OWMA 4KQ2A 4ZARA 3I9FA 3ORSA 2O3RA 5B6JA 4IX1A 1Z4NA 4XWTA 1XZBA 2DC1A 3BH7A 3L7BA 1SNYA 4BX3A 1MRNA 2PZEA 3GCXA 2HA0A 1KYXA 1JYSA 1XLTC 2Y2UA 3AF2A 4HTFB 1C1XA 3RVNA 2V45A 5IDXA 2QHXA 1UAYA 2ZB2A 1G5RA 1CP3A 1M33A 1JLLB 1JDBC 1L9KA 3EIFA 4U9HS 4UUPA 5BUQA 2RHJA 3DMTA 5CDSA 1SUCA 4YXWD 2ZR7A 1X0XA 1ZA1A 1XAGA 2D2EA 2JFBA 1WJGA 3ESYA 3LLMA 3TCXB 2V6JA 3W3ZB 5LP6B 3USCS 2R68A 3L5KA 4IIBA 1EK2A 2H9AA 1YXMA 5JWHA 4XVQA 1LPBB 1R3DA 4PQRA 5ITZB 5HNKA 3EIOA 3W1VA 2H1WA 2JIOA 1KYQA 3RU2A 2ATCA 2AI1A 4IDDA 1L5YA 3HEMA 4F6RA 5BWOA 3WL7A 1MC1A 4TKZA 3UXEA 5CTAA 3Q12A 4ZOLF 4Q3OA 5BORA 4BXOA 4LBZA 2BDEA 3LHFA 4XIFA 1P5JA 5F1KA 1R64A 2C2MA 2CJYA 1G41A 1JIUA 1A98A 2UUPA 1CS0B 1K97A 2BM9A 2HO4A 3HCRA 4HN2A 3DPUA 4HEQA 1ZCAA 1K0UA 1ZMOA 4NICA 3SQNA 4CDGA 5AHKA 1DWQA 4C9BA 5CA0F 3U61B 1IUPA 2QAJA 4JUFA 5ELXA 4OBBA 1SUEA 3BMCB 3UGQA 1V4NA 4RADA 4H4EA 4A1OA 3FYSA 1MEJA 1Z13A 2CLFB 1XNJA 2QTRA 1SK9A 4NABA 3FOAA 1MG0A 1NR1A 1SM4A 2YV5A 4BUZA 5B5SA 2WUWE 4G5GA 2LCIA 4YAUA 3R6TA 4Q00A 3LQFA 4UPEA 5B12A 3L43A 4CM4B 3AKDA 3GPCA 4H1HA 4WLNA 1JAHA 1EX1A 2B7LA 1AX9A 4DCMA 5C8VA 5JQGB 2FSFA 3ZU5A 3NEPX 3OEED 4IG4A 1Z5NA 1M2WA 2JLQA 2PA0A 1FW8A 4BDSA 3N8IA 2BFAA 1DO8A 1ZN7A 4UDOA 5CXUA 3F97A 3U3OA 2CL6X 3ZJ4A 3V2HA 1U1IA 3P27A 4Z1MD 1Z4OA 1LGYA 3E9QA 4LHYA 2F1IA 3ADPA 4BC1A 3ZDRA 5FNVF 2BCEA 3IQDB 2LKDA 3OT1A 4L72A 1BKDR 4WXPA 1I36A 2XVXA 2MU1A 4MGHA 4LF9B 3IVGA 1OWNA 1M2EA 3HKBA 3IAS1 3LIIA 3TRIA 3VO1A 2C9DA 3F46A 3LXMA 3ZCQA 1CDDA 2GAIA 2B4RO 3PQ8A 1RC1A 2XZDA 4AWXA 1H42A 5E9JA 9LDTA 4NBWA 1LNQA 1LQ2A 2D2FA 4Z3DA 4F1JA 5HIKA 3DPSA 1CNFA 4IQFA 2BEWA 4RLSA 2CXQA 1KDRA 1KIFA 2RKWA 4IYRA 4IOKA 3TS1A 2ZUEA 2Y93A 2J0UB 2E55A 1TK9A 2GEDA 3GT7A 4GQAA 4DPLA 3VPHA 4DG9A 3FNIA 2RC5A 4JFRA 5GZ6A 1E0DA 4IAOA 5TR9A 1IYZA 5B4UA 2Z3ZA 2O3JA 3DFMA 5AM3A 2QUJA 1SHUX 3AP2A 4XIIA 1ADJA 2FPGA 1SU7A 3C3AA 2X3YA 2XYHA 4QTYA 2QNRA 3SJCA 2GBLC 2AG0A 3H2BA 4LYDA 5FTLA 1ADCA 3SR4A 2DR3A 3ZQ6A 5C52B 1MOQA 4ARIA 2HLDA 4I1UA 2A86A 1NUQA 2EFDB 4GKAA 3VNBA 1TMYA 4BYMA 2JFHA 4Z9YA 2ZUVA 1EFCA 2ZJ4A 2UKDA 4QODA 2E21A 3AEXA 4DDMA 3A4LA 3KU4A 2X0JA 3ZGOA 1BE0A 1SKUA 4ZRMA 1JKXA 1R6DA 2I22A 1TMOA 2IRWA 1AUOA 2QYHA 3GAAA 1O57A 2X13A 2LDBA 3KK0A 1JX6A 1PZMA 3KLMX 3MFQA 3PNKA 3VKGA 2IOYA 2XQJA 1JWAB 4YT2A 3SE0A 3WJ7A 4R9SA 4CKBA 2J4DA 3RFVA 4JP8A 2W22A 1RFLA 1YZYA 2YZMA 3ZWNA 2VVTA 2CCJA 4L0QA 4C1BA 3IOEA 3WK5A 5DW0A 3ABIA 1G3QA 3PFGA 2AOVA 3S2IA 3N7UA 1TCBA 4RZUA 4QUGA 5HA5A 5DXJA 4HNTA 3EW7A 4PHFA 2EJBA 4AJJA 1W75A 3OSUA 2CL5A 4B4WA 3M3PA 3ESBA 4LG1A 4S1TA 5TB5A 2XCQA 1XNQB 3HJAA 3K96A 4C87A 4JYZA 4D0GA 4ECAA 4U9IS 3DHVA 5AW8A 2DUJA 3WIOA 1USWA 1XT6A 2YR0A 1QTIA 4QBIA 4A5SA 2PQ0A 1IZYA 3GXBA 3KIPA 1ATIA 1DJOA 1DKNA 2E3JA 3AJ9A 1IJBA 4MV4A 2RHRA 4EKNB 4BNVA 2GKOA 1VDZA 1OH6A 4DJEC 2D0OB 1DOHA 3F8WA 4WESA 4OMDA 1UKEA 2YV1A 1FMCA 3OKPA 5C8ZA 3DM5A 3KAPA 5A4KA 2XUGA 2PZJA 3UGJA 3U13A 2JFZA 3KYJB 1DBPA 2CN1A 4ZJZA 3CMCO 4DIDA 4CIYA 3Q11A 5KYUA 2PM8A 1OYOA 4OFBA 2Y8EA 1ORWA 4F3RA 4G5FA 4QG3A 2O05A 4LSMA 4YRQA 1KEZA 3A8TA 2DLCX 1UDCA 2IYFA 2Q5CA 3STHA 2XMBA 3K9HA 4CE6A 1R8JA 3WNBA 2W4MA 3GPDG 2GVDC 3LNCA 2YJ5A 4I08A 1X7DA 3TLGA 5JISA 4MGIR 1ODSA 3O03A 4EH1A 4DMHA 1O4VA 1QP8A 3LFTA 4UNNA 3RI3A 1OT5A 1RXCA 5ALRA 4AJ9A 2QSJA 3FXAA 3CBGA 2P75A 2QJOA 2HNKA 3N0TA 1OX4B 1MH1A 2ZDGA 4NQZA 4YAFA 5KOHB 3DOOA 1VB3A 3FCAA 1BSVA 3MLBA 4WRRA 3DMRA 2AG8A 4R0NA 1U2DA 3ZXSA 4BE4A