2Q2QA

Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
250
Chain Sequence
TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Beta-D-hydroxybutyrate dehydrogenase
publication title Cosubstrate-induced dynamics of D-3-hydroxybutyrate dehydrogenase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 91
structure length 250
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q2qA00
2CSUA 3ETGA 3R1IA 1Q0HA 2VYVD 2NVUB 4DC1A 2AEMA 3SEFA 4CMAA 3JQGA 1WXDA 2OO5A 2W2LD 3GMDA 3PHHA 1Y6JA 3DHYA 3A06A 2XXBA 3ZV4A 4ALKA 1ZK3A 1GZ6A 3U49A 3W1VA 3K5PA 2BF7A 1TXGA 4XD2A 3QWIA 1LDBA 3H2ZA 3H9JA 3GEGA 3O38A 4DTIA 4XGIA 1HZZA 3GVXA 2EKLA 4OJNA 4NG5A 3ZNNA 4GVLA 3U62A 1F17A 1ARZA 2JD0A 3PJDA 3MJEA 2X22A 4OM8A 4B4UA 3AFMA 5B12A 1NVMB 2VOJA 3JYNA 2W98A 4A27A 3ULKA 3KOUA 1GUZA 1WZIA 4GWGA 1F14A 1HZJA 3D3WB 4E12A 5JNLA 4JGBA 1L1FA 3GGGA 3EC7A 1R4MB 4CM5A 4XKJA 1CERA 4O59O 3TN7A 4OXKA 2X1HA 3FWNA 1D7OA 2P4QA 3MJTA 4ZQBA 3RASA 4CL3A 4PCVA 3E9QA 2H6EA 3NT5A 1CYDA 3VH4A 2DT5A 4BNLA 5DCYA 1QSGA 3SXPA 1P1IA 4W6ZA 2BFMA 2P5UA 1LLUA 4D41A 5I9MA 1KBZA 2DC1A 4GSLA 3CH6A 3UICA 5L4NA 2RIRA 3HFGA 3WFJA 3ITKA 3RCBA 4JXKA 3RBVA 5DCUA 1IHYA 1AUPA 4DL9A 3L9XA 1RM4A 4RLHA 5EQFA 4BNVA 2QHXA 1E5LA 1N9GB 2Q99A 1K6XA 1BGVA 1R6DA 2DPGA 2OORA 3DBLB 4FOSA 4WCFC 1RPNA 2X9GA 5AVOA 1OBFO 4EJMA 2HLPA 1EVZA 3BMNA 4WPGA 3G17A 4Z9XA 4P8RA 4TRRA 1AN9A 3JQAD 3TWOA 4BL5A 1OMOA 1BVRA 1B15A 3BIOA 2WYUA 3F6YA 4BO5A 1E6EA 3ROPA 3BAZA 3UXYA 4JJGA 1JTVA 3WIEA 5IZCC 3LT2A 1U28A 1YKFA 4D44A 5I9LA 2NM0A 4E5KA 4ONEA 2CF6A 4IY1A 3KTDA 2X0IA 3KSZO 5JC1A 4J1NA 4NZ9A 3S2FA 2ZTVA 4CODB 1ZMTA 2PV7A 5DDIP 3WQRA 3A14A 1KVSA 3IQDB 3S2GA 1H6AA 2VRCA 2CF5A 2J5RA 4TMFA 1ZEMA 4ALIA 4KTVE 1WDLA 3ROMA 3L6OO 1T1SA 4RCVA 3KYDA 1JKFA 3OECA 1ENPA 3F5QA 2HAEA 2I66A 1YOVA 3D4NA 1JU9A 3W4KA 6ADHA 2QRKA 2DKNA 3PZRA 1NPDA 3OSUA 3DOOA 2YV1A 3DAFA 3VZQA 1P44A 5TJ9A 2AW5A 3Q2KA 2YQ5A 1KVUA 4BHTA 3DMTC 1PGPA 3INTA 4J91A 4RVFA 1JW9B 3OIGA 4IDDA 1V8BA 3AOEA 2NQ8A 2E82A 3O26A 4AL4A 4Y98A 1NP3A 1P9LA 4FBGA 1P1KA 2AEJA 2JFFA 3OJOA 3LSYA 3VPXA 2ZCVA 3KUXA 3U9LA 1FMCA 3MOGA 3WICA 3S55A 2PGJA 2I6TA 1E3JA 3ONFA 1ZUD1 1E7WA 4ALNA 3JQ6A 4YPOA 4GMFA 1E1KA 5F1PA 1O8CA 3BZUA 1NPYA 4FFRA 5EERA 4CPDA 1BXGB 3AOGA 3ZU4A 3GT0A 1GY8A 1ZIDA 4OKIA 2XAAA 1EUCA 3B20A 4B7CA 1UDAA 2I9PA 4UVEA 2Y99A 1NNUA 3NUGA 8ADHA 3GG2A 2CDAA 1V3VA 4J1SA 3Q3CA 3UH1A 3O4RA 5ILOA 4IUYA 2ZJ0A 2EXXA 1V35A 1BWSA 1C14A 4K6CA 1TT5B 3ZWXA 4UUMA 3CXRA 1NFFA 3H7AA 3PIIA 4WGGA 1RJWA 2WMDA 4JQCA 5MGBA 1MFZA 3D7LA 3HQ4O 1DC6A 2E4AA 4QO8A 1PS9A 3VC7A 3GFBA 2IZ0A 1U8FO 2B37A 4JBHA 4M8SA 5DZSA 3DFZA 1JN0A 1XR3A 1HRDA 3WMWA 2PKRA 2Y0EA 1QP8A 3GVHA 1R4NB 2PZMA 5KWEA 4RF5A 4K1LA 4E13A 1MV8A 3KETA 2EJVA 3ZNOA 1B26A 1BVUA 2NU9A 3DC2A 4ZRNA 1YJQA 2FRDA 4CQLB 1EK5A 2CFCA 4IJUA 3JQBA 2GPTA 2FSSA 2GLXA 4PLGA 1X15A 3HNPA 1EQ2A 2FR0A 3NDIA 3LC1O 2OBNA 3GC6A 4B4VA 2EEZA 4EI2A 1Z7EA 4IDFA 4PLYA 2ZJ1A 2NTJA 1AGNA 2EERA 1OC4A 3OIDA 4UREA 4KDEA 4TRMA 5TT1A 1F06A 1YH3A 3GMSA 3WNVA 4R9SA 4BV8A 2EP7A 2FPGA 2P9CA 2F1KA 2X5KO 4PG4A 1UJMA 2HJRA 2Q2QA 3K6JA 1SC6A 1ZEJA 2DFVA 2GN4A 3PZBA 4J4HA 4OXYA 4BS9A 4E33A 5H82A 1IE3A 1IYZA 3ZWVA 4ALLA 3DZKA 3D5QA 3KLPX 3AOEC 1MG0A 1P31A 5A03A 1C3VA 3U5TA 4BNJA 5AXAA 4R16A 2GR9A 3FPLA 2V6FA 4PZEA 1HDXA 4M86A 4E6PA 5CG2A 4RQTA 1G0NA 4AJ4A 4CM6A 1YVEI 3DZHA 3TL3A 5I7SA 3X2FA 1O94A 3ENKA 2PNFA 1DB3A 4TRNA 3QP9A 1I3KA 2P4HX 2Q46A 3C8MA 4DLBA 4FFMA 4QT0A 4UVHA 4WUVA 4Y6SA 1RWBA 2Q1SA 1ISIA 5JY1A 1WP4A 4IGFA 1HETA 4YJDA 1T2DA 3FTPA 4JBGA 3S2IA 4M54A 1B8UA 3ZGYA 4YAKA 2R6JA 3DHNA 1IZ0A 4NU6A 3OFSA 3RI3A 1X7HA 2WE7A 4RPGA 4EJ6A 3PIDA 4C7KA 8LDHA 1XQ1A 2NVWA 2BGLA 1U1IA 3F3SA 1N8KA 1U3WA 1V9LA 3AW9A 4NBVA 3QA9A 1A4UA 1LSJA 2D2IA 1M76A 4NU5A 4PZCA 4J49A 1YONA 2HMUA 3CMCO 2C7VA 1K2WA 4F6CA 3N7UA 3HJAA 1T2AA 2WDZA 3QWFA 3WR5A 2ZB3A 5TX7A 1YL6A 2QG4A 1IB6A 3VPSA 1GAEO 4R54A 3JYPA 3WX0A 4IMRA 4P4LA 1VLLA 5DN9A 2A35A 1FDUA 4PLFA 4FD3A 2JFHA 5HS6A 4L76A 2O7SA 4BQRA 2AQ8A 1BW9A 4EZBA 4XJSA 1BDMA 1KYQA 2NACA 3DBHB 3GEDA 4BNNA 4D45A 5K0ZA 4RZIA 3PWSA 1GU7A 4FFNA 3RC7A 3CPSA 1NPTO 1MC4A 4N54A 4U5QA 5JSFA 1LC0A 5F5LA 3Q9NA 4WJZA 2HJSA 4BMSA 2G76A 4XRGA 1HTBA 5IDXA 1O5IA 1P3DA 1BXGA 3OP4A 1T1RA 2AQIA 3KVOA 4I9UA 1PL8A 4CV1A 1NBOA 5HTOA 1GDHA 4M1QA 2X7HA 4QX6A 4ZQHA 4OMUA 4HFNA 1O0SA 2OMEA 1LUAA 1GQYA 3U4DA 1ADCA 1F0YA 1HE2A 1K6IA 2DTDA 1TVEA 4OYRA 3UHAA 3H2SA 2PGLA 1ZJYA 3TZCA 3DR3A 4NHEA 2HK8A 4M87A 1Z73A 2B5VA 2Q4EA 5TC4A 4IDEA 4UEJA 3M2PA 4B3HA 1P1RA 2YHIA 4XYGA 1K5HA 1J4AA 4TVOA 2Z1MA 5L9AA 4F46A 3ZCXA 4Q3EA 1RM3A 1O6ZA 4YQYA 2EHDA 3VPGA 1QRRA 4WOJA 3TOZA 4QQRA 5A5EA 5BSGA 4AJLA 1DSSG 1DAPA 1SB9A 1ZJZA 3IIEA 4PGFA 2GUGA 4NFHA 1QLJA 1PR9A 3V8BA 1H2HA 1E3SA 2FP4A 4OQZA 1PJ2A 4GLOA 4ZRMA 2Z1NA 1UXHA 2TMDA 4YJHA 3NTQA 5G0SA 3DZIA 4BNIA 4O63O 2Q45A 3DBVO 3DDNA 2FR8A 4IBOA 2Y1FA 5L95A 1X7GA 5BNIA 3E18A 3JD1A 2PWZA 3HE3A 3ICCA 4DBVO 1V6AA 2VHYA 1BRMA 4I5FA 1H93A 4R4JA 3WJAA 4WCFB 1ZMOA 4WNIA 1U3UA 4K28A 4URFA 5JY6A 3BMCA 4TKMA 4DGSA 3NEPX 1VL6A 2B35A 3FF4A 3WDSA 3HADA 1CETA 2H5LA 4QFDA 2HDHA 2EW8A 3L9WA 4BO6A 3IDSA 1GEGA 3TZHA 5C3MA 5IDQA 3I9MA 3ZV5A 3ADOA 1NAIA 4O6VA 5CEEA 2RHCA 4W99A 2O23A 3JD0A 2JJYA 1TT7A 1WMBA 3ZWWA 3DAPA 5T8KA 4JX8A 3GZNA 4WK6A 4KUGA 1R0SA 3ETEA 3BHMA 1U4SA 4GVXA 1JQBA 3QJ5A 4PG8A 1U2DA 1C1DB 5LDGA 4CV3A 2BGMA 4EUFA 4U0JA 1ULUA 5EQDA 4PN3A 1Q0QA 3F4LA 4UEKA 1XYGA 5KJ6A 4XJTA 3KEQA 4ZQFA 2PFGA 3IJPA 2YFHA 4I5EA 3GHYA 5JO9A 2AG8A 2JFGA 3QV1A 5BNFA 1ONPA 3D4OA 1NWCA 2ZK7A 3JYQA 1VL0A 5JE8A 4D7AA 3GRPA 2Q2VA 3E1KA 1D1TA 4LK3A 3UFXA 2B4RO 2HMWA 3BHJA 4K6FA 5A05A 2OL4A 2VTEA 3SC4A 5AQ1A 3A28A 3IJRA 4OKNA 4ZICA 2PH3A 4Q3CA 1N7GA 3BA1A 4IXTA 2ZYAA 1YRLA 1ZW1A 1LSUA 1NFRA 2GO1A 3GUYA 3TZQA 3WGOA 2O3QA 4BNGA 5ICSA 3AU9A 3MZ0A 2X9NA 4G81A 1A7AA 4RL6A 1I2BA 3ON5A 1DJQA 1M2WA 2D8AA 4B7UA 3NGXA 3WWYA 4B7XA 4NQZA 1GR0A 4B4WA 4BNFA 4IGEA 2VUUA 1BXZA 2JKVA 4H15A 4D79A 1Y1PA 4DQVA 4C7JA 3EGOA 1MUUA 4YDRA 3I1JA 4TROA 4KWHA 2BKAA 3E8XA 3ZV6A 2CMDA 3ZWAA 1EMDA 1GYRA 5HWSA 1J49A 5ITVA 3WGHA 2EG9A 1NM5A 3PDJA 4BGUA 1B0AA 3ADPA 4FB5A 4JJFA 1PQWA 4XX0A 3ZHXA 2C82A 4BKRA 1KY4A 3ABIA 1JVSA 2IZ1A 2UAGA 4QEDA 3C3XA 5BSFA 4GH5A 2W2KB 2WEKA 1PTJA 1KEVA 4CR7A 1IL0A 3H3FA 5KOIA 5A02A 2EKPA 3V1YA 4F3YA 4PG5A 3ZWNA 5I8ZA 4BKQA 1SEPA 5KNLA 4XEHA 4D0SA 4WLNA 4CLHA 3EZLA 3ZU2A 2O3JA 3RFVA 1LSOA 2RH8A 5ICMA 2Y66A 3OETA 1CWUA 3IS3A 2G0TA 4LVCA 3ZWCA 3BYZA 1HWYA 3FI9A 4I9HA 1YO6A 4UUOA 4GPD1 3ROKA 1SNYA 3RUIA 4XWYA 2HMSA 3C7DB 3NT2A 1UP4A 4WKGA 2VYVA 4U0KA 4PLTA 3PYMA 2W2LA 3GK3A 1GCOA 4FFLA 2GCGA 1ML3A 3H6KA 2WD7A 4B4OA 3AUSA 3UVEA 2YJZA 2B4QA 3SJ7A 1VSUA 1WZEA 1PU2A 2HSDA 5CG1A 5JYDA 2CVZA 2YDYA 2YDXA 3UUWA 1D1SA 4QXMA 5A9SA 3FNHA 4AJKA 2JCVA 2BFAA 1Z82A 2EKQA 4X54A 1NVGA 3ZZNA 1O9BA 4MINA 1SBYA 4BNXA 1I2ZA 1DFGA 1VI2A 5DT9A 3UN1A 4CUJA 2WJPA 4CUKA 3CEAA 1I01A 4J0FA 4PLHA 5CPBA 4J7CA 4BGVA 4E30A 1W4ZA 1ZK1A 3GVPA 1TEHA 1K6JA 1ULSA 5G0WA 4B79A 3E9MA 3X2EA 4YB8A 4FJ1A 1PJTA 4MIYA 4NR0A 4EYEA 5GZ1A 4FDAA 4A7PA 3SC6A 3KYCB 4LGVA 3DONA 3JD2A 3UCFA 3RUFA 1XLTA 2H9IA 1U2GA 1YB5A 4YJGB 3BTSA 3HDQA 3PQFA 3EVTA 4IDBA 4MVJD 4EBFA 1CRWG 3FNEA 2VZ9A 2C29D 1ZSYA 1YDWA 4PIVA 3QVWA 2Q1WA 3IOYA 3KV3O 1WW8A 2PZLA 1JLLA 2HRZA 4J90A 4YBZA 4A5OA 4DBZA 3TQHA 1HL3A 1X1TA 2CY0A 2O4UX 4YRAA 1I5RA 3OM9A 4O0LA 3WWZA 5GMOA 4S1VA 1NWHA 1Q7GA 4XB1A 4FW8A 4R3WA 3ZNPA 3QVXA 3JYLA 3GNQA 4ILKA 4WNCA 1I33A 2I67A 4L73A 3D0OA 4IIVA 4CM4B 1T2FA 3GVIA 3KHUA 2FZWA 3DHEA 3STHA 1ISHA 2V6MA 4E2ZA 4YRDA 1BMDA 1EBFA 2YFQA 3WLEA 4AJ2A 2DBRA 1U3TA 3DFUA 1HDCA 3JQFA 4FN4A 4ND4A 2NTNA 4IQ0A 3AI1A 3LZ6A 5JW6A 1N1GA 3G0OA 3JV7A 4ZGWA 1LQUA 3BHIA 5BR7A 1LBEA 1LI4A 2E49A 2ZATA 3JQAA 4BGIA 1PZGA 4R1UA 1DRWA 3GPDG 2C59A 3KB6A 4UVGA 1D4FA 1LRKA 4YYZA 5JYEA 1D3AA 3DOJA 4WE3A 4J0EA 1OI7A 3JQ7B 1FDWA 4J1QA 1WMAA 4JCOA 3H4VA 1T4BA 3NAQA 3TPCA 4CMEC 5B4UA 5JAMA 2GDZA 2QQ5A 2OBYA 3KRTA 4LSMA 3LQFA 3I3OA 3OEWA 1PZHA 1R16A 3OA0A 3RBZA 4DMMA 2JHGA 1H2BA 1X0VA 2RBEA 1CEQA 1CDOA 1DFIA 1PWXA 4J3FA 3MCVA 4A26A 4Z6KA 1T2EA 2OGUA 5KVVA 1JAYA 3OHSX 3B1FA 4I1IA 2PKQP 2HRBA 5JAZA 1MGOA 5JCXA 5I7EA 2J3JA 4FR5A 3ENNA 3NGLA 4Q39A 3W4JA 5CFZA 3RUEA 2BI8A 5TJHA 3FPCA 4B8ZA 2GRAA 2I76A 3D5TA 1JWAB 2RAFA 2A94A 5ER9A 3TDKA 4EITA 2I3GA 1Z7BA 1XIVA 4QUKA 4NI5A 4ID9A 5TGDA 1T4DA 4BGEA 4DA9A 4IQ8A 1YBAA 1OFGA 2R00A 1N1EA 1TLTA 4FOOA 2DQ4A 2AE1A 2LDXA 3A4VA 3I9JA 5G4KB 3VPFA 5U4QA 4BB6A 1PJBA 1MA0A 4MDHA 4OOEA 3P19A 4DLAA 3FSRA 3GQVA 3DL2A 2E48A 2FMUA 1KIFA 2PA3A 5DBIA 4YJFB 1PGNA 4CMIB 4XR4A 4CM8A 1KVRA 1U9JA 5EINA 4J9UE 5IDYA 2OZPA 1KC1A 1C1XB 2Y1CA 1YS4A 3LYLA 3O03A 4J7XA 3FBGA 2VHZA 1ENYA 3W8EA 1GZ4A 3C1OA 4Q3AA 3PHJA 4ZQGA 4ZN6A 3HSKA 1GQQA 4JBIA 1XU9A 4QSMA 2JCXA 1YBVA 2IODA 3UCEA 1I10A 2FOIA 2V6BA 1FXSA 2PKQO 3UKOA 5MDHA 4R51A 5BNTA 2CZCA 3FHLA 4PG6A 3ZU3A 3IKTA 3JQFC 2OP0A 5L51A 1NVTA 3GVCA 1XWFA 1HDOA 2UUPA 2ZB8A 4RF4A 4OOFA 3DZGA 3L4SO 1HYHA 1W73A 2JAPA 5JLAA 3RAJA 1I3MA 1B8PA 2Q1UA 4LRTB 4IMPA 4JJIA 5C7LO 1HXHA 2BFOA 1IHXA 1LXCA 4C4OA 4BO8A 3EAGA 3AM4A 1HF3A 5BQFA 5BT9A 3JTMA 3AY3A 3TRIA 4EDFA 1YQGA 3ZHZA 2P9GA 5B37A 1YL7A 4Q3NA 1G1AA 4YAJA 3JQ8B 4XDZA 1EFLA 4EW6A 4DVJA 1M6HA 4DXHA 1DAOA 5IG2A 4GKBA 2G17A 4I9NA 3A1NA 3GGOA 4BB5A 2NVUA 4MIOA 3BMOB 1EDZA 4E5NA 4HFMA 2UUOA 1GUFA 3OJ0A 3OH8A 2Y68A 5KCZA 3QVOA 4CQMB 2O2YA 1XDWA 1YE3A 4IPTA 4NJMB 3LU1A 4YVFA 3RKUA 2I3AA 3H9GA 1UP6A 2B83A 3DBRB 1D8AA 3F1LA 3PJGA 4ALMA 5JXWA 5IN4A 2VRCD 3FR8A 1DPGA 1HDRA 1XHLA 5G0UA 4CMBA 3PHIA 2DBQA 3TL2A 4YAGA 2AXQA 3FTNA 5JMWA 5TLSA 4N7RA 5G0TA 1LJ8A 5JAQA 1GYPA 2NVBA 4TZTA 5EPOA 4ITUA 1UP7A 4B8WA 1ZO8A 3CTMA 2RHRA 4MVJI 1B8VA 1R0KA 3F1KA 3UCXA 3D3WA 2C7GA 3G1UA 4RF2A 4Z0HO 3NT4A 1HKUA 1JWBB 1M66A 1MX3A 2PD6A 2Y1DA 1R4MA 3AY6A 4N5NA 4YEDA 3KZVA 3WQSB 3WBFA 3C1AA 4F45A 4NK4A 3AUAA 1NQAO 2VT3A 2Y0DA 3WBBA 1PX0A 1FJHA 3WSWA 5J23A 3K92A 3Q9UA 4DQXA 3KXDA 1AXEA 2PY6A 3MTGA 4FC6A 4KP7A 2SCUA 1LDYA 1VC2A 1B2LA 1KC3A 2B0JA 1P1FA 3DAGA 4BO3A 5JS6A 1VJ1A 5HA5A 5CEJA 5L3ZA 4WEOA 3WGZA 2VWQA 2JL1A 3GGPA 5TIIA 1DJNA 1NQOA 1E7RA 4J4BA 4RPKA 1DLIA 2ET6A 3H9QA 5COQA 4W9NA 3RUAA 4EJ0A 3ZNQA 3T4EA 4Q3DA 3UGKA 4QFCA 1XQ6A 2BGKA 1X1EA 3C7AA 4OSPA 1N9GA 2CDBA 3DBLA 4CLOB 5B4TA 1LX6A 3RJ5A 3PJEA 2DTEA 1ZCJA 3ZDFA 2ZCUA 5CDGA 5LDHA 1PIWA 1EK6A 1FK8A 2W90A 5ENDA 4F6LA 4M55A 2HKIA 2X6TA 1NX6A 1PJCA 2BI7A 4FS3A 5AOVA 3VKUA 1KY5A 4BKUA 3KLMX 2ZYGA 4W4TA 3VH1A 3I4FA 3CMMA 5G0VA 1QYDA 4W82A 3RFTA 4BOYA 3PQEA 1E1NA 5AYVA 3OICA 2B69A 1U7HA 2VYND 4QECA 2NLOA 4HKTA 4LCJA 2ZIZA 2ZTMA 3FNFA 1UAYA 1W0CA 1XGKA 4DPLA 3ONDA 1VRWA 1QR6A 3OMLA 1YQDA 1SEVA 2FHSA 3QLJA 4CLRB 1LLCA 3RU7A 4GGOA 1RKXA 2POQX 1LDMA 3DTYA 4AJOA 3TOXA 2VWHA 4YXFA 1DIAA 5IN5A 3CKYA 4BO9A 1K3TA 1A7KA 1Z45A 2J8ZA 3WTBA 1IPFA 5TT0A 3E48A 2P9EA 1DRVA 1E3WB 1YB1A 1LDEA 1Q7BA 2Z5LA 4PLWA 5I7VA 4XRRA 2PZJA 4ND1A 4U8GA 1HEUA 4CMGA 3QHAA 3ANMA 3WYCA 3OQ1A 5L7TA 4CMJA 4MKZA 1YWGO 2QZ9A 4RPLA 3PHGA 2C20A 2HCTA 5EJ2A 4RLSA 1H6BA 2A9FA 4II2A 1UDBA 1P1HA 3E5RA 4CM9A 3WJ7A 3ZWYA 3FNGA 3C85A 3NYWA 4R5HA 3VHRA 1S7CA 3JQBC 2FY8A 2P2SA 3LLSA 4FIZA 1ZKMA 3NX4A 3ORFA 3WQQA 1JKIA 4RDHA 5EMHA 4L75A 1A71A 3E82A 3VH2A 1UXGA 2WM3A 4M49A 1XA0A 5CDSA 2QZZA 2QIOA 1ADBA 5KJCA 3PPIA 2ZQZA 3K73O 3OQ6A 3DTTA 4AJNA 5CPFA 2A4KA 4R1TA 1A5ZA 3L4BA 4RJTA 4AVYA 5CEFA 1X0XA 2VUSA 4A2CA 5KJ1A 3TF5A 5JDIA 4JNKA 4L8VA 3NKLA 1EEHA 1Y9AA 4TZKA 1VSVA 4P4GA 1ENOA 4OIMA 3EUWA 3AWDA 5C7OO 1TT5A 1MC5A 1NHWA 3PFWO 5IJZA 5FYDA 3W6ZA 3RJ9A 3JCZA 1S6YA 1E77A 3O8QB 4YA6A 4KUEA 1GZ3A 4RVHA 1GCUA 3GH3A 3WGQA 1ZXBA 3WNQA 3U0BA 1E6WA 3IP3A 4ND3A 3ZN2A 2GN8A 1PZEA 4Q9NA 3LVFO 4KUHA 2WSBA 3B70A 3JD3A 5F1KA 3ST7A 4CMKA 5TS3A 1R4NA 1QKIA 1MP0A 4FGWA 3BMQB 1A9YA 1RM0A 1Y8QB 2VOEA 1MFPA 4ZHSA 4AG3A 2NADA 1Q2XA 3I9KA 4YT8A 4WLOA 1Q1NA 1SAYA 4RQUA 2RH4A 5CDTA 5IXSA 3VVCA 4AJJA 4CQLA 4ZA2A 1E92A 4FFOA 1ISGA 3JQEA 4RORA 3LF2A 2W8ZA 1HE3A 4D42A 2PH5A 4DYDA 3F46A 1I8TA 1Y8RB 2B5WA 2R2GA 2XF8A 5ENVA 4TSKA 2CD9A 5I8WA 3PQDA 1AHIA 3EMKA 1PJQA 4IJVA 4AJIA 2BHLA 2HK7A 2O2SA 2BRUA 3ZU5A 4CQMD 1E3IA 2HO5A 1ADFA 4BNZA 4RO0A 1PJLA 1U4OA 3L0DA 3W4IA 5A1TA 4Y6RA 3H65A 5GZ6A 1A4IA 3I9OA 3MJVA 5B4VA 2J3HA 4BO0A 5I9NA 3GR6A 1R15A 4DIBA 1UZLA 1GV0A 4R41A 5CAEA 3G3EA 2YZ7A 2JCYA 4A03A 3VVBA 1JVBA 1N5DA 3V2HA 3WXBA 3C1TA 4I5DA 1DC4A 3WTCA 2C2YA 1I3LA 2D4AA 3ZW8A 3RIHA 4AFNA 3H5AA 3ZH2A 2GN6A 2WTBA 3NDJA 4RV9A 4HADA 1BTOA 3JQGB 1TB4A 1VJ0A 4YR9A 3WSVA 4GWKA 4NFYA 1EZ4A 4NIMA 3I5MA 2I5PO 4L0QA 5L45A 4YACA 3V5NA 2W4QA 5JDIC 3GDGA 4MJLA 4UVDA 3RU9A 3RBXA 4R1NA 3WIDA 1B14A 2OHXA 3L77A 4MPDA 2UV8A 3GDFA 4NNJA 4U6QA 1IPEA 4FJ2A 5JCJA 3QSGA 1FF9A 1QORA 4RZHA 1ZFNA 4KDFA 5T67A 3COSA 2OFPA 1NASA 4BNMA 1UUFA 3ZW9A 1DO8A 3SVTA 2YW9A 2FN7A 1H5QA 2V6GA 1X14A 1CQJA 4E2WA 2NSDA 2Y1GA 3DEYX 1K0UA 1NQ5A 3TSCA 1GEEA 3I23A 3HZZA 1ZH8A 4XR9A 1JAXA 3GN1A 4RVDA 4MKRA 4P38A 3PVZA 1XSEA 3W6UA 1A72A 1SZJG 3GRKA 2ZKLA 2GZ3A 1Y5RA 5T57A 3PGXA 3PFFA 3WYBA 1HE5A 5A5FA 3DBHA 2IEDA 1YXMA 2NTVA 5KIAA 3WGYA 3BTUA 4ESOA 1DXYA 3JD4A 1UAGA 4K26A 4BIIA 4RGBA 3LT0A 4HFJA 1HYEA 3N74A 5JMPA 4MKXA 4NBWA 3MEQA 2C07A 5C5IA 2Q50A 3EVNA 9LDBA 1ZVMA 3HDJA 1EVIA 4BMNA 3GA0A 2WYWA 2BH9A 4ALJA 3QVSA 3JQCA 5HS4A 4IZHA 1LA2A 5A9TA 5BSHA 1J5PA 2CVOA 3M1LA 4E21A 2ZQYA 3BMNB 2QRJA 4TRJA 1HT0A 4BUCA 3ZWOA 1BDBA 3LT4A 4R68A 1QYXA 4WEQA 4QO7A 5CDUA 2DAPA 4MVJA 2C54A 3PJFA 1XELA 4WCDA 5JPIA 2VZ8A 1UXIA 3MWEB 2DBZA 1UZNA 4LRSB 3FCOA 4BVAA 2IYPA 2FZEA 4OH1A 5ADHA 3QRWA 1NHGA 4OAQA 5T8KC 2VHVA 1DLJA 2WD8A 2BLLA 3JYOA 4XIJA 4FC7A 5T6BA 3K2BA 2AMFA 2O3RA 1L7DA 3DXFA 5FF9A 2Y1EA 2GGSA 3WGTA 3D3EA 1TI7A 2GYYA 1BHSA 1LLQA 2JAHA 2GZ1A 4L9RA 5DP2A 4DUPA 3H5NA 4XCVA 3KYDB 2X86A 1HDZA 4EGFA 4YT4A 4IDAA 3WS7A 3RSHA 1YOVB 2AQHA 1BSVA 3IMFA 4YCAA 1NYTA 4RPHA 1PGOA 3MOIA 2Z95A 2DUUA 1OAAA 4PG7A 4NFSA 4YRBA 3WOHA 1E7SA 4DPMA 1N2SA 4XB2A 4GKVA 4WASA 1ISFA 1EE2A 1I36A 4Y6PA 2HUNA 4U7WA 1ZK0A 4XYLA 1XU7A 3RVDA 3PWZA 2CUKA 2YY7A 3GN2A 1VPDA 4WCFA 2Q1TA 1GQ2A 5COAA 2OOSA 3VOSA 4MVJE 4CV0A 1E1LA 4J2HA 4OL9A 1PQPA 2G1UA 1K89A 2FPPA 2J6IA 4J6FA 2BD0A 4XYEA 1ZSNA 2D0IA 1H9AA 1IY8A 3PXXA 4WECA 1M75A 2X8LA 2ILTA 3H8VA 3UW3A 1PSDA 1QYVA 3F5SA 4K9DA 1ZBQA 2PGDA 3TNLA 4P4NA 1ISMA 1JA9A 3B6ZA 4TKLA 3T7CA 2HMVA 4LVUA 1GV1A 4CM7A 1H0KA 4A0SA 2X4GA 4EUEA 3AM3A 3D1LA 3QWHA 1I2CA 1WVGA 3RC2A 5IZCA 4LMRA 2D5AA 5KTKA 1ZNQO 1JDJA 5C7IO 3AU8A 1YQXA 5IDWA 1R12A 1C1DA 3VZRA 4NBTA 1HSOA 2QYTA 1E0DA 2PLAA 2J5KA 4IS3A 2Y0CA 4OO3A 3RUHA 2A92A 1Y7TA 4Z3KA 3QVTA 2P68A 3ANNA 2E37A 1UXKA 3P7MA 3WGGA 4N5LA 3K30A 1KOLA 5FI3A 3FBTA 3WFIA 4CLXA 3B1KA 4E4YA 1PJSA 2VHXA 3A9WA 3OEYA 3ZHYA 4AICA 1VKOA 1J6UA 4HY3A 4BV9A 2O4CA 4NK5A 2Q4BA 4IM7A 3DZJA 4BO7A 3L6EA 3PGJA 3DMTA 1Q7CA 4LCEA 1QYWA 2NNLD 4J4TA 1NXQA 1KS9A 4RDIA 2YV3A 3GZ4A 3MJSA 4IDCA 2IE0A 2ZTLA 3P5SA 2VUTA 1LLDA 3IKVA 4ROSA 3K31A 2JD1A 1HYGA 5EIOA 3V2UA 1W6UA 1WNTA 1XCBA 4BNYA 5HRUA 1N92A 4D3SA 3MTJA 1E3LA 3WG9A 4BNWA 4D3FA 3TZ6A 2DBVO 4OGWA 2DFDA 5U9CA 2O3SA 5DULA 3FRJA 1P0FA 9LDTA 2UVDA 4M89A 5TNXA 2QX7A 1EVJA 2FWMX 4BNTA 4JN6B 1YB4A 4O1MA 3DWFA 5DNAA 2H63A 1QG6A 2V65A 3HWRA 1NTOA 3IAHA 1GFSA 2W2KA 5L40A 5IF3A 2HMTA 1ISJA 5JBIA 3I9LA 1DC3A 3F47A 5F21A 4W7IA 4MIEA 3NTOA 1T26A 3M2TA 4OSOA 3DOCA 4NBRA 2VNAA 5G2OA 3AUTA 2Q49A 1U8XX 3L07A 3RC9A 1ZSVA 3JSAA 1AE1A 4KMSA 3PLNA 3Q0EA 1ONNA 4FCCA 3ONEA 4YWJA 3TJRA 4II3A 1VE9A 5KJFA 3V1TC 4BNUA 2D1YA 1HSZA 1GUYA 1UZMA 3PYLA 4GBJA 1VL8A 1C0PA 2YHUA 1DEHA 3Q6IA 1A27A 3NJ8A 1J0XO 4UAGA 3B1JA 4ND2A 1QLHA 4LMPA 4HX5A 1DIRA 2X23A 1KERA 1PGQA 2QRLA 3AI3A 7ADHA 4MOWA 3UAGA 4GMGA 4E2XA 1PQUA 1YGYA 2EGHA 1WPQA 4DYVA 3U3XA 4G2NA 4WLVA 3GAFA 1U5AA 2DPHA 3QY9A 2FPIA 1GL3A 2ZB4A 2GASA 4CMCA 3FWZA 4QTZA 4D0RA 1I24A 4IS2A 3ZV3A 2IXAA 1G6KA 1ZXLA 2E6UX 4HNHA 3OBBA 2X5JO 1OC2A 2CNBA 4XQCA 1V3UA 1I32A 2VZ0A 1ZZEA 2IXBA 2OUIA 3OQBA 1V3TA 1Q0LA 4GQAA 2DLDA 4S3MA 1EUDA 4WLUA 2VWGA 1EBUA 3E5MA 4XZ3A 1PL6A 3KYCA 3CZRA 4DWVA 1Y5MA 4TQGA 5FI5A 1KEUA 3ZWBA 4YJGA 2IDZA 4YT5A 1ZK2A 4OQYA 3T4XA 4GLLA 3PK0A 1BG6A 1BW9B 1PJ4A 4HUJA 4IJKA 4LW8A 4IQGA 3ROQA 3ASUA 2HQ1A 1PZFA 5EESA 1B16A 1Y81A 1NFQA 1A9ZA 3U4CA 1CJCA 2AE2A 5L4SA 3GLQA 5IXYA 1C0KA 1UH5A 1WDKA 1KVTA 3HFSA 3R3JA 3GNSA 3IUPA 5KJEA 2EV9A 2DVMA 1DDOA 5L4LA 2Q3EA 4NJOA 3KM0A 3DQPA 4BO1A 1YJ8A 4CM4A 1KEWA 2R00C 5AXBA 2AA3A 2JHFA 3NDRA 4XQEA 4BMVA 4PLZA 4DIOA 3NJ4A 1LU9A 3ZWPA 1V0JA 2FR1A 2PK3A 4NDNE 5CHEA 3C24A 1SMKA 1RYEA 2VTDA 5ES3A 5I7FA 4ND5A 1ORRA 4R69A 4R9RA 4J16A 2PD3A 3DB2A 4FSHA 1E1MA 5K6AA 1P0CA 1BXKA 4JROA 4D43A 1E5QA 3RD5A 4E5PA 1EFKA 3JQ7A 1YDEA 1HLDA 5CP8A 3LC2O 4GX1A 4CR8A 3MJCA 1WDMA 4BO2A 2YHIB 3DZFA 2VYNA 3KYBA 4L4XA 4UVIA 5EL0A 2XXJA 4R1SA 3GY0A 4CL8A 1LEHA 2X0NA 4XGNA 4D46A 5A06A 3NRCA 4HP8A 4YTEA 3F4BA 3RC1A 2D3TA 4PFJA 4XIYA 2IEBA 4HXYA 3H5RA 1O95A 3VZPA 2H1SA 2P91A 4DRYA 3GHHA 5IZ4A 1AXGA 1NAHA 1GADO 1GYQA 2YQ4A 3W8DA 4GX2A 2QYSA 1SOVA 4O5OA 3AM5A 3GEMA 4AJ1A 1P77A 3I52A 1DBVO 3P2OA 5T5QA 3UOGA 1EVYA 5JAIA 4XQGA 4YJHB 5TQVA 1OZAA 3ZHBA 1C0IA 2YV2A 1E7MA 3EZYA 3WB9A 3ICPA 1KETA 4XDYA 4JP3A 1DFHA 5KVQA 4HWKA 3INGA 1LDGA 3DMYA 1PS0A 4KTTE 4KZPA 2I65A 5F5NA 5L7YA 1F8GA 3AJRA 4NH4A 3LK7A 1RYDA 1SCUA 2C2XA 4Y67A 1OOEA 5H81A 3VZSA 4RVUA 5G4KA 2HK9A 3BMCB 2UDPA 2NU7A 1B7GO 1CQIA 1YBMA 4KWIA 4Z0TA 3RQSA 2Y93A 3IL2A 1HLPA 4WLFA 5COBA 3RROA 5THKA 4XQ9A 2BMAA 3SLGA 4GSKA 1DC5A 4YJFA 3PI7A 2OP1A 4CMIA 2ZYDA 1T24A 1DOHA 4KOAA 4E5YA 3Q11A 1L7EA 1EUZA 4MVJP 2I99A 3L6DA 5TSDA 3GPIA 3AK4A 3GZNB 1C1XA 3QIVA 3RWBA 2Q2WA 3PWKA 3LLVA 4CMHA 5A04A 3OJEA 3V2GA 1T25A 3KSUA 4DC0A 4Z3DA 3M1AA 1SB8A 4E5MA 4J9VA 2V7PA 3S8MA 2DUWA 3OJLA 3LT1A 4PLVA 1SOWA 4CV2A 1U3VA 1YL5A 2CDCA 2X0JA 2PD4A 1I0ZA 3V1UA 3KBOA 3R3SA 4L4RA 3G49A 2GERA 4PLPA 4AJPA 3U09A 4P22A 2ZTUA 2EP5A 4R01A 1LSSA 3VTFA 3PRJA 4UEOA 5JFOA 7MDHA 5KVSA 1ADGA 3JQ9A 3Q2IA 3EHEA 4PLCA 1C0LA 3JQDA 4BKPA 4CLDA 5FEUA 1VM6A 4BNHA 5K6AC 3AY7A 3D64A 4E3ZA 4CLEA 3RFXA 3VTZA 1W8DA 1B3RA 3KEOA 4R5MA 3H9UA 3WYEA 4N18A 5ILGA 4BQPA 4TWRA 1RM5A 2EF1A 2EWMA 2G82A 2O48X 2LDBA 1U5CA 1LC3A 1NQTA 4XYMA 2DM6A 4ZD6A 2DTXA 3JQ8A 5LC1A 4DLLA 1Y9EA 1P45A 1T2CA 2ZB7A 5IAAA 4B3JA 3HDHA 5THQA 3WMXA 1E3EA 2CVQA 2PZKA 2WWRA 1B3BA 1DHRA 1E7QA 3BMOA 4W9NC 4EUHA 2AG5A 3I4CA 4MP8A 5K9ZA 4IIUA 4CQMA 1H94A 4NJMA 5A9RA 3HUDA 1WLYA 2NUAA 3KSDO 3QQPA 4KQWA 3SJUA 4DQUA 1GPJA 2F00A 1PWZA 3VKVA 3DBRA 4HV4A 2C5EA 2EIHA 4GL4A 2AQKA 3NTRA 3CZMA 5U1PA 1QXSA 2YUTA 1Z74A 3OF2A 3DZBA 1F8FA 4A73A 4CM3A 3K96A 4JP2A 4XGKA 4Q3BA 3G1TA 2WYVA 3PLRA 5EN4A 3ITDA 1IOLA 4MVJH 1LQTA 5DOZA 4MVJG 1FDVA 3U4IA 4JIGA 4JK3A 1PJ3A 3VPHA 3I6QA 1DIBA 5G4LA 1CIVA 3H9EO 3ZI0A 4Y8VA 1IZ9A 1HDYA 1UDCA 2VT2A 4IXWA 1DIHA 1E7YA 1FDTA 2IRWA 5DF1A 4WOKA 5A9SB 4FGSA 1DIGA 4PVDA 5F3RA 4OHUA 4GX0A 2X58A 4J2OA 4W7HA 1QV7A 1LRLA 3F9IA 4E0BA 4JLWA 3S1LA 5A3JA 2O3TA 3FN4A 3HN2A 4J1TA 1LRJA 4CM9D 2QW8A 4MVJM 5FFFA 5L7WA 1MG5A 2WD7B 3BTOA 5HM8A 3LDHA 3EDMA 3S2EA 3VDQA 3PDUA 1LTHR 1PL7A 2WE8A 4E32A 3GFGA 1WWKA 3AI2A 4HNGA 3RUCA 2TMGA 4PRKA 3T7EA 1LNQA 3CINA 1Z6ZA 3W8FA 3EYWA 4IZIA 1PS8A 5JDCA 3AUUA 2VQ3A 1VJTA 2GZ2A 3WGIA 1UR5A 2X9VA 2BELA 3NV9A 1HE4A 1EQUA 3GNTA 3HHPA 3PTZA 3PP8A 3CE6A 2O3UA 3H3JA 4HFRA 5GY7A 3JQ9C 5ITWA 3GF4A 2J3KA 3DO5A 2UYYA 4J7UA 5CDYA 3R0IA 1DHTA 4CLOA 1QV6A 2VRBA 4UUPA 5F1OA 1NR1A 4RPJA 2D5CA 3E6AA 1SPXA 5GZ3A 1PEDA 2NU6A 4TVBA 1M6WA 4MVJF 3WLFA 2X0RA 4XYBA 3UF0A 5KVCA 2NWQA 5DP1A 1LDNA 4FFPA 5JC8A 3HB5X 1HDGO 4INAA 1IULA 5ER6A 3PYXA 6LDHA 4ZU3A 3MJ4A 1QMGA 1X13A 3INRA 2Y67A 2VN8A 4BKOA 2EW2A 3VAZA 2VHWA 3E03A 3QW2A 4FJ0A 4IINA 1ZK4A 4D3DA 3L4BC 1GTMA 2G5CA 3HN7A 4LN1A 4NMHA 2J3IA 2AHRA 1TA4A 5BSEA 4HBGA 1MXFA 1I30A 1R66A 4YT2A 4I08A 4BO4A 4AJHA 4UUNA 4CLRA 4OXNA 3M6IA 2EJWA 3BTVA 1SO8A 4YAIA 1MLDA 1H9BA 3IUSA 5DBFA 1P33A 4IDGA 3SLKA 3KO8A 2B4TO 2RCYA 4G5HA 1XG5A 3QE3A 4DIFA 4H16A 1E3WA 1ONOA 4NBUA 3GDOA 1P74A 3D4PA 2GNAA 3JQAB 5DCWA 4I8XA 1N7HA 1FDSA 3MWDB 4DPKA 5L53A 3GAZA 3QWBA 1KEPA 3Q1LA 4J43A 2VNSA 4L4SA 4RVGA 1XKQA 3CSDA 1XEAA 2X5OA 2DU8A 4G65A 5JO0A 4I5GA 3FR7A 2O50A 2XOXA 1EDOA 3U4HA 4DREA 1ID1A 3PHLA 1MXHA 3RKRA 2YYYA 3OJFA 4CM1A 3TFQA 4B3IA 4FPXA 2FSVA 1CF2O 5T64A 4U6SA 3R6DA 3HB4X 4YAEA 4KQXA 3I6IA 4Z9FA 4A10A 2XPCA 4UULA 5JDCC 1EE9A 2P5YA 3GOHA 4GI2A 1GPDG 4CUZA 5FWNA 4H3VA 2O7QA 1R37A 5C37A 1R0LA 2AEFA 3TFOA 3ASVA 5LCXA 3GG9A 1GD1O 1VKNA 3I83A 4YQZA 3VDRA 4E2YA 2C5AA 2EGGA 1PGJA 1I3NA 1MB4A 2PTGA 4RF3A 4LSWA 5B1YA 3FD8A 2J5QA 1JKJA 2Y1OA 3CIFA 2JD2A 4GX5A 2HU2A 1O89A 3ANLA 3K8ZA 3O8QA 4L74A 3SX2A 3LC7O 4PVCA 5KKAA 4NPCA 4GAEA 2GF2A 2GN9A 3C7CB 4EEXA 2B36A 3P2YA 1H6CA 1PR3A 2NQTA 4N5MA 5JCJD 1UXJA 4CM8B 3BMQA 1Y8QA 5DOVA 4CMEA 3G79A 2GSDA 3ETDA 4ZVVA 2VWPA 1AHHA 4MP3A 3LF1A 2GD1O 1H6DA 2D59A 4ZJUA 4BNKA 3RUDA 4IJWA 4PRLA 2IZZA 1Z75A 5DBGA 2NU8A 5A4DA 3K9QO 4E31A 3PEFA 5KKCA 3K2EA 1X7DA 5HBRA 2NV6A 2BFPA 1Y8RA 3EY4A 5IFLA 3HDYA 3I9NA 4PZDA 1M67A 1F12A 1ENZA 1IUKA 3N58A 2IYOA 3IC5A 4MP6A 4XA8A 4FQ8A 4Z0PA 1G0OA 1P1JA 3E9NA 4R3NA 3SBOA 3BXXA 5H83A 3IP1A 4GGPA 3OA2A 4LISA 4RVSA 1KVQA 1NR7A 1QYCA 2PR2A 4H7PA 4EEZA 4WLEA 3QWAA 3AFNA 2Y05A 4DMLA 3CUKA 1DRUA 5AXDA 4MO2A 5TRTA 4CR6A 3TZKA 3HG7A 4Y9DA 3EK2A 3EW7A 3GUCA 4CJXA 3O9ZA 5AXCA 5A3VA 1U7TA 1WAMA 5TF4A 2OXIA 4AJEA 3OIFA 2VCYA 1E6UA 4ZQEA 4Z9YA 3VH3A 3ZWMA 2C0CA
chains in the Genus database with same CATH superfamily
3ETGA 1QH9A 3R1IA 4BRSA 1HG0A 2ZAMA 3LWDA 5BW8A 2DWUA 3QZUA 4L08A 1SXGA 4KR6A 2NVUB 4DC1A 3DAOA 3NR2A 4CMAA 3JQGA 3L06A 1AF7A 3BIFA 2H92A 3GMDA 2H4WA 1QFMA 2BM8A 1RWXA 3PHHA 4FMDB 3A06A 4FYYA 5UKDA 1AQJA 4ALKA 4Y6LA 3WGJA 4EKNB 4TKVA 4COOA 2BF7A 4XD2A 3GPCA 3WYDA 4V03A 2DMRA 2ZRHA 1QV9A 1ZOSA 4EHAA 2QJFA 3GEGA 2W6QA 3KAKA 4E08A 4YNBA 2YWBA 3FOWA 2EKLA 1ICIA 3CT6A 4TV9F 3DOHA 3ZNNA 2ONCA 2YKGA 4LF4B 2BFDA 1ARZA 1J25A 4HEA1 4KVAA 1NJ6A 5E0KB 3GFTA 4D9CA 2A1UB 3PQ4A 5IVHA 4J6EA 2P3QA 2QRNA 3H6HA 4LWZA 2E89A 5LQMA 3NONA 2A57A 2GEDA 3KOUA 1QK5A 1UBTS 1GUZA 3L04A 2JGKA 2QPAA 1GZDA 3QTTA 4HUQB 3ZZ1A 3D3WB 3USES 5BV2P 1LPBB 2P9BA 1RTTA 3P32A 4OLFA 5JNLA 4JGBA 3T3OA 1H1LB 5A2QA 2IPMA 3EC7A 2ZTSA 2YN4A 4OI4A 3DF7A 1CERA 5HZKA 1N6RA 1XNGA 3F0TA 4PANA 5IKEA 2ZUBA 3TN7A 4REMA 2JG3A 1EWTA 3K0CA 3NHBA 3U7QB 2HHCA 3R9XB 5JATA 3FZQA 3FWNA 1T3LA 2P3SA 5KC9A 4AWAA 4R05A 4UDXX 3OKAA 2SCUB 3RASA 4X85A 3WXMA 3PGKA 4YMLA 1LNZA 5D5PA 3NT5A 1H1DA 3CNBA 3IX7A 2QK4A 4RD0A 1BN7A 3WP0A 1J70A 4CCAA 1M1NB 1L5HA 1P1IA 1CZHA 3QVGB 4W6ZA 5ERXA 1DG1G 1W4CA 1N8TA 1VG1A 3NIBA 1LLUA 2ZSHA 5E7JA 1FPQA 3MW8A 4K81B 5I9MA 4O1IA 4NJEB 3SS9X 4FCVA 3GRZA 4AKHA 3OZEA 3AB8A 1FOEB 3ZKAA 3WFJA 1XXHB 1Z0DA 1FX0B 3IAXA 2R3SA 1XEWX 4JXKA 3RBVA 4RXTA 3SR4A 2DKOA 2XWJI 1E9AA 4DL9A 4GL2A 3OZGA 4RLHA 1RM4A 2I91A 3PXEA 5DGDA 1N9GB 3ICOA 2LCQA 2WICA 4RQBA 2NGRA 2ZRFA 4AIIA 2WHQA 2CHUA 2F59A 1JHDA 1RPNA 2XWPA 1OBFO 4MZDA 2HLPA 2NAFA 2NO0A 1V7PC 2W5UA 5G41A 2YC2C 3U7EB 1YT5A 2HOQA 2C7RA 1SU4A 4D9GA 3IESA 1EVZA 3ZVMA 4PZUA 2A5LA 5LXTA 1PZXA 1BVRA 1JYEA 1VCNA 4I66A 4KN6A 2Q3MA 1NZFA 1W2WB 2F8LA 2ZGVA 2ZT7A 1JXOA 3BIOA 4HDSB 4QDKA 1EVQA 1NRJB 2H4HA 1PL0A 2WYUA 4MLPA 1FE8A 3WK9A 1NJFA 4UDNA 2HBRA 3WIEA 1CT9A 1XQYA 1TC2A 2VDUE 1U9YA 1SHJA 2W22A 4QAJA 1YKFA 1YRHA 5I9LA 1PR2A 1KQNA 1J9ZA 4E5KA 3E9YA 3L5OA 2F67A 1UJ6A 1NVUQ 4RSHA 1EFHA 2HCFA 3ONWA 4E4RA 3P0IA 4OHOA 2D0PB 2PH1A 3KSZO 1P29A 1TKRA 1UWVA 2B8TA 3PPYA 5K2MA 3WO1A 4ER5A 4F1WA 4FGUA 4LOAA 3GJRA 2OCGA 2AWOA 1H6AA 3O82A 2CF5A 4I2NA 4JGIA 4TMFA 1EXDA 5D8DA 3SS7X 4IJ6A 1SUAA 2PANA 4HATA 3OECA 4AC9A 1ENPA 1SXQA 5CB4F 3F5QA 2HAEA 2O54A 2I66A 4FS8A 1SKYB 3RSOA 4N1AA 3D4NA 5JXJA 1HURA 1JU9A 5CLGA 2DKFA 6ADHA 2QRKA 421PA 1W49A 2OGWA 4MUHA 5DIZA 1ADJA 1MEJA 4OGGA 3DAFA 5FFMA 1P44A 1R27A 5TJ9A 3JASB 3JU3A 2Z9DA 3Q2KA 3A6JA 2OG1A 3QLUC 4BFXA 5ALDA 1P6UA 1SRRA 2JEZA 3DMTC 2PSJA 3RR2A 1IQPA 2DSNA 1AH2A 2IYVA 3I30X 1JW9B 2YN0A 1N8NA 4IDDA 3O26A 4B7AA 5A0TA 4QVKA 5HIAA 4OATA 3K09A 3N2ZB 5CVDA 1UBMS 3T5AA 3PC7A 4F8YA 1Q20A 2J4DA 4IVQA 3GJ0A 2P7HA 3I5YA 2JFFA 3DE0X 5FUYA 5EUMA 3MOGA 2FZ4A 2LGJA 2P6NA 1VGRA 3RYHA 3T95A 4BJ5A 5JNUA 3MRSA 5KDLA 1J21A 2PGJA 1ZUD1 3FMPB 1WSWA 3OT1A 3KWMA 4JR2A 5F1PA 1O8CA 5CM8B 2WAXA 3BZUA 1Q1BA 4KN9S 4TVKA 3W3AA 5KQPA 2JIRA 5ECDA 5AVTA 2OV4A 4HLDA 3HVIA 4K8OA 2OC9A 2ZJ7A 5F52A 4KR0A 3RV3A 1UDAA 1EZZA 3THXB 4UVEA 1KPIA 1C8VB 3GJQA 1NNUA 5KYWA 1JSZA 8ADHA 1V1MA 3DUFA 1SU6A 2CDAA 1GPYA 3Q3CA 3UZUA 5EEHA 3O4RA 1OT3A 4RL4A 3DPUA 4ZZ2A 4JLDA 4EHFA 1U0JA 3R40A 3UWMA 3JARB 2OZLB 2J9YB 5HFJA 3WKAA 5E3HA 1GGEA 3PIIA 1SUWA 1WHTB 4O02B 3MMZA 5IBCA 5MGBA 6AT1A 2E4AA 3K1YA 4DM4A 5F76A 1LPSA 3GFBA 3AB7A 1OZHA 1CYEA 3G8BA 1NBEA 4M8SA 1ZAYA 1SHUX 2ECKA 5K3CA 3DFZA 1XR3A 7AT1A 2NYVA 3EJWA 3F7MA 1QP8A 4O29A 3M9XA 1GAJA 4P5EA 2ZYVX 1E9SA 4WKCA 2WV7A 4OHPA 5IM4F 3TK1A 5KWEA 4E13A 2UUAB 3MB8A 5JD3A 3KETA 4EG4A 5INTA 4LNUA 3CB2A 1G8AA 1BVUA 1CB7A 3TVTA 3K70C 4ZYWA 3OPXA 4FE3A 2ZPTX 5D3ZA 3H99A 4S1TA 4RACA 2QYHA 1E6CA 3O9VA 4HO1X 3HNPA 4R1PA 3M33A 4QHYA 3M4JA 1Y4UA 5E8RA 3AVOA 4CTNA 2OBNA 3GC6A 4AY2A 3G8AA 4FNGA 3BWYA 4G0MA 5AJXA 3EUFA 5CNMA 1NW5A 2NTJA 1AGNA 1ZESA 2JFPA 3M5CA 1ZH4A 1VKJA 3KU1A 5F2EA 1H69A 4F3CA 5TT1A 5CFNA 2V5VA 1TF2A 3EMDA 2ZT6A 2VPWA 3GMSA 1XD2A 1JDNA 4A8JB 1SKMA 2WF9A 4L0CA 4KFSA 3UJ3X 1CZRA 2FPGA 2P9CA 3V2IA 1HORA 5JNVA 3OEHA 4PG4A 2P4SA 2Q2QA 1G8SA 5LUAA 2F3TA 3PZBA 2BEJA 2GN4A 2WHEA 1KYIA 4FLEA 5DPMA 4FNOA 5I01A 2QF7A 2R4TA 4QQFA 4AQYB 2JS7A 5FUBA 2PT7A 3BREA 3DZKA 3AOEC 5A03A 1B43A 1C3VA 1WMDA 3VR6A 5AXAA 1ESNA 3M3PA 3WOVA 2V6FA 5CAEB 4FYJA 1LBTA 2WJ4A 4M86A 4MB6A 4E6PA 4JP8A 4RQTA 3VA7A 3ZZUA 5BSKA 3GZTB 4D96A 3ZY5A 4EMUA 5AKGA 3K5HA 1XRMA 1XB2A 3O3MB 3X2FA 3I9FA 4RK1A 2ZTHA 1H05A 2AVDA 2PNFA 5K1ZA 4GDMA 5JNWA 2KHZA 2VSXA 4Q9IA 4TRNA 3I62A 4FFWA 1I3KA 2P4HX 3ZDZB 2CWDA 4DLBA 3O2QB 1I14A 4QT0A 4QULA 4P7FA 4WUVA 3ICEA 1C3OB 3QF4A 5JY1A 4FIDA 1GZUA 1FYXA 1HETA 1IBSA 2PU5A 4EY5A 4YP6A 3THOA 4NBKA 3GU3A 3GLIB 1B8UA 2I80A 3UIEA 1JIKA 3ZGYA 2Q41A 3OC0A 1Z17A 4UAUA 3DHNA 2CFTA 2H85A 3JAWA 3G0BA 2XGJA 1UT6A 3RADC 4EJ6A 2E5FA 3GP3A 2NUBA 1MIOA 3PIDA 1M7HA 2YRWA 2ZSFA 2MSEB 3BSSA 2JAQA 2NZ8A 3L7YA 1G9TA 5LPNA 1BFDA 4ARZB 3ZVNA 2NZWA 3OI7A 3F3SA 3OFJA 1U3WA 2H2HA 4TTRA 1A4UA 1M3SA 2D2IA 1UBLS 1F2UA 1WTAA 1YS9A 4ILEA 1VPTA 4KH0A 1RJFA 2Z8XA 4YDHB 1DAKA 5D86A 3MB5A 4GOKA 5EXTA 2HMUA 1OGJA 4BJ1A 3BL5A 1K2WA 2R87A 4Q1FA 2HRQA 2WDZA 2X8AA 1RWMA 1ZOPA 2BFEA 2WKRA 3HLTA 4HWSA 3LKBA 1GG5A 1YS2X 4LJSA 4NCJA 1DUIA 5TX7A 2OSVA 3VPSA 3WX0A 4IMRA 3BXHA 4P4LA 4GP9A 4C2UA 1CQJB 1F7UA 2A35A 3MG9A 1XCGB 3SSMA 4MPRA 1DAGA 1LV8A 1RKVA 1I3CA 2JGLA 3M49A 4LJ7A 4LOIA 5HS6A 2O7SA 2RI0A 3KZXA 4FGJA 5CDFE 3ONVA 2AQ8A 2GAJA 3NM6B 1WF6A 2B30A 2HQOA 4X1OA 3R7NA 2PMCA 3IAAA 1THTA 4L4ZA 4OPMA 4D97A 1LTKA 3THYB 3KOYA 4URHA 3IIIA 4F12A 4POOA 2RK3A 4IJQA 2XRYA 2YS7A 4CYMA 3E5NA 1G6OA 1RYBA 1N4AA 4QUJA 4U5QA 3RC7A 2VQFB 1NXXA 3F90A 3PKIA 1T35A 1IVSA 5BR8B 2F2TA 1PW7A 1UMDB 2AC4A 2HJSA 1BN6A 3CPEA 3FDIA 4WJZA 3VDNB 4NOKA 1NUPA 1VBKA 3W1WA 2E7ZA 3SNHA 1PNTA 4DARA 2C96A 4XRGA 2VSOA 3L7KA 4H4EA 1EA7A 1XDBA 1WB4A 3MTEA 2QG6A 1DU4A 1TQ8A 3OP4A 2REQB 4OFBA 3R2JA 1KE2A 1KU6A 2F6RA 1Z2NX 4FR2A 5KDDA 3C5WP 4AF8A 4UM9B 3NVMB 1X1CA 1NBOA 2FLVA 5JI2E 4PNEA 4WNYA 1QCDA 4ZQHA 3ZY2A 5ICEA 3TEJA 2IX3A 4HFNA 4CDNA 1IOZA 3EOAI 2ODNA 3U4DA 3VRHA 1UFKA 3KEFA 4OYRA 1K6IA 3UHAA 1N6PA 1ZD3A 2O1EA 3QEMA 4B4KA 3L0PA 2R751 6GPBA 2F55A 2C5GA 4EY7A 4XWOA 2PGLA 1XUOA 4BNDB 4PS0A 1RACA 1ZJYA 3H1AA 3LPCA 3PC2A 2P75A 3R4VA 2CYBA 4NHEA 4WJKB 4DXAA 1H4VB 1L1RA 2AI1A 1Z73A 2B5VA 2FQXA 2GM4A 3LFTA 4P34A 5HQTA 3CWZA 3GAMA 2D1TA 3M2PA 2X19A 4MLZA 3MT0A 1P1RA 3PQ3A 4BMZA 4MQEB 4OUKX 3O4VA 1K5HA 4NYIR 1J4AA 4V1CI 4F46A 3ZCXA 2F9FA 1DAFA 3BRSA 2JBAB 1RJ9B 1BCSB 1GU1A 1RM3A 1XKXA 2C2GA 3L0YA 4L2IB 5I9BA 5JRZA 4WOJA 3BK1A 2V9ZA 5HTKA 1XCJA 2ON6A 4RWZA 3CZ5A 1W19A 3KKNA 3BQMB 1DSSG 1C4OA 1V1RB 3E8SA 3I2FA 4RFSB 3ZD9A 1YUMA 1HV8A 1OJLA 1YQWA 3IIEA 5AVZA 2FQQA 4HQFA 4TUYB 4GI5A 4H1TA 1QLJA 1PR9A 3G0IA 5DHAA 3W5JA 1E3SA 1SELA 1UMBA 4OQZA 4RK4A 1L0BA 4RA9A 1T36B 1UXHA 2VATA 3OT4A 4YJHA 3GH1A 1ZD9A 3NTQA 4R6WA 3AC0A 1HQCA 3RB8A 1H8ED 2HLHA 2H8KA 4DM7A 2VBFA 5FORA 1OFHA 4NNPA 3DDNA 1Q0RA 2GM9A 3EZXA 1WF3A 5DRTA 4EPVA 5KNCD 1FNSA 2I6FA 3GGSA 4IBOA 3ZLUA 3OCJA 2Y1FA 1CLEA 1TCVA 1A9PA 1E79A 1X7GA 1S2LA 3RHFA 3WA6A 1L4LA 1XTRA 2PWZA 3ZCRA 2PGOA 1OTYA 3OESA 1I7LA 1JJ7A 1V6AA 4IAOA 4KLZA 1G20E 3S1SA 1EWKA 4R4JA 2QW1A 4WNIA 3OCWA 2CFSA 2ODEA 4UQPA 1ZNXA 4G8CA 5LB4A 4MI1A 3LUHA 3RODA 5JWHA 4EMBA 5CB6A 4AX8A 1ORHA 3NEPX 4MWSA 2CHVA 3KT8A 5FRDA 4IRUB 2FPPB 3RHSA 4CEIA 1SD1A 3HADA 4L7QA 4QUBA 5G3YA 4XTCS 4BO6A 5KTMA 1WMSA 4ZU1X 1N6KA 2MIIA 4EUSA 1W4RA 3I9MA 4B6JA 2ZWVA 3FPAA 4KIGA 3TR0A 1YFLA 2GJSA 1UBSB 4YJ2A 2PL5A 3B60A 5CJ2A 5H80A 4AG5A 3UPTA 3EH1A 3E3MA 3K20A 5FPTA 4EJSA 5HUQA 3VYRB 1TT7A 2X2PA 4JX8A 1J0CA 2JH9A 4H7DA 4ROTA 3WBKA 2ASVA 1C1DB 5DM0A 2L2QA 2J0EA 4ACBA 1OW3B 2YX1A 1I2MA 1YU6A 1RAIA 3N2KB 5ALFA 2A9QA 2JGAA 2VJDA 2YHSA 4DYHA 1QIGA 1RSZA 4B76A 4UJ3A 3VDXA 3CJRA 2W42A 1DQPA 2UYGA 3B6KA 3IR6A 3WB0A 5KJ6A 2WFMA 1QX3A 4HNAB 3KEQA 3B5IA 4ZQFA 3SXUB 5HOEA 3IKLA 4KMRA 1OV6A 2VHTA 5JO9A 2JBWA 1Y1KE 3GJ4A 3QFFA 2JGIA 5BR4A 5AHXA 2ISQA 1EVLA 1Q14A 4AF6A 3D4OA 4NSNA 4Y3UA 4ER7A 1AN0A 1HNWB 3ZGZA 3UHFA 4O4IB 4LKOA 4D99A 2C9BA 2ZK7A 1DCKA 1GR1A 3JYQA 5DYWA 5TQJA 1E2GA 2HLDA 3UFXA 4KK4A 5TS2A 1DX9A 1MRSA 3H75A 2YCLA 3EODA 4KAFA 5BV0A 1E2LA 3IRUA 1XTJA 4NE2A 2VTEA 5TPZA 2JIDA 3FUVA 3SC4A 4N6NA 2CV2A 4YCJA 4EG5A 2GPJA 2YQZA 3C48A 2FETA 2ZE6A 1FP2A 5A4KA 3FVVA 5GOTA 1ZW1A 3OURA 1KH2A 1AV7A 4AQ7A 5HF6A 4OEHA 3VC3A 3BD7A 1IG0A 4F0JA 2VJAA 5ESDA 5ICSA 4M1YA 3IT3A 2IZ7A 3EZ2A 3FNQA 4RL6A 3HM9A 4LV5B 3Q12A 1DJQA 4F4JA 5GONA 1M1YB 1RCTE 1RQRA 2D8AA 2OHOA 2DUJA 3KOOA 1XHEA 4NQZA 1GR0A 3N8IA 3G2LA 3L02A 4FM9A 4Z49A 1O96A 4HDMB 5ERGB 2JKVA 5CNKA 5HF5A 4ZYUA 1PKXA 2VAXA 4YJ3B 5IULC 2PQ2A 4RCYA 3I1JA 4E5VA 2OHHA 3DDCA 4KWHA 1HX7A 1I6KA 2ANBA 2CMDA 3L8FA 3FOBA 1EMDA 1GYRA 2O57A 4B74A 2Q5OA 2VAPA 3FMVA 1JHZA 1M33A 1RKQA 2FUKA 2KBEA 2PMFA 4N9QA 3ADPA 1FUIA 4Y2XA 4JJFA 1PQWA 1X19A 4I0WB 4TS1A 4XX0A 4EQZA 5LMZA 3ZWQA 4JXZA 2ZAIA 4WA7A 3ABIA 1ODLA 5M34A 2IZ1A 4QEDA 3C3XA 2Z8YA 4MICA 2WEKA 4W63A 1PTJA 4WFQA 1TUEA 3WRWA 3K9NA 1N2CB 3H3FA 3LHIA 2IX9A 1OLUA 2ATIA 4DR4B 4F3YA 2YNMA 4DMCA 3OLXA 5HCIA 3ZWNA 1XMSA 2PZBA 5I8ZA 5KNLA 4IR7A 4XEHA 1K88A 3N8GA 4YO7A 3ZU2A 4EFKA 1IBRA 1QB8A 5FULA 3EEOA 2AR0A 2JIMA 3X1YA 5LU9A 1M1XB 1IOWA 2Z6UA 2QN3A 1LSOA 2RH8A 3MXOA 5IEJA 5FWDA 4TMTA 1Z62A 5KS2A 3PUWA 3QLEA 2BFBA 3UM9A 2C5FA 3ZU6A 2VKTA 3IS3A 2G0TA 1TUBB 3EXIB 5HFNA 1SJ9A 4JL6A 3ROKA 5LM3A 5CLFA 4HNUA 1JFRA 1N0HA 1SNYA 3RJMA 2ZYWX 1L6IA 3F5MA 2POCA 4WKGA 1BEEA 4ZWNA 4WFJA 3A4LA 1QP0A 2HU7A 2ZSEA 1F4VA 1SVNA 2W2LA 4LHWA 1II8B 4XASA 4TL7A 3THWA 1ML3A 2WPDD 2QD4A 4M1EA 3UVEA 3ANTA 4D0GA 5JYCA 1VSUA 1FTSA 1WZEA 2HSDA 1ZRNA 3Q3JB 1U2QA 4NBSA 2CVZA 2V6IA 5D7NA 5JYDA 1EDBA 1NXWA 3FUUA 2W6ZA 2YXDA 4QXMA 4EI7A 4CT4B 1U7ZA 1NMXA 3ZZNA 2WG2A 4MINA 2ZZNA 1Z47A 4IMJB 4BNXA 4D98A 2FK8A 2NSHA 3UN1A 4RNDB 4K05A 2WWWA 4X6XA 3ZJ5A 2BSAA 2J7PD 3CEAA 4YAFA 2XYPA 3QVVA 4FZRA 3CLRD 2XMZA 4PLHA 2V9PA 2WW8A 3AYZB 1YA4A 1ZK1A 2QXYA 4G4GA 4RAQA 1SC9A 4NYMQ 2MYNA 3OZTA 3KUKA 4BMYA 4BXOA 2VNHA 2QUJA 1K86A 1RT9A 2G4LA 3ASZA 3SM3A 2C2MA 4NR0A 4DWJA 3MS2A 3KVRA 3R5KA 2PFKA 1E5VA 1HNNA 2Z6VA 1HEYA 3UCFA 3W6PA 1XLTA 3H42B 3LG2A 3K9FC 2YW2A 3KJZA 1NBAA 4MVJD 1VLHA 5FYQA 2BY4A 2C29D 2PM8A 1DTSA 1YDWA 2GKSA 5AOBA 3CNHA 4GMDA 1EDDA 4YPFA 4CTJA 1O7JA 4EHNA 4EVIA 1JLLA 3DH0A 4TPKA 5J2TA 1NJSA 3A6LA 2UUCB 4TZ6A 3C3EA 5EHGA 2O4UX 3L84A 2FDXA 2ERCA 3WWZA 1P8JA 4P3PA 4S1VA 3V4PB 1F7VA 2VK8A 3KBBA 2XQKA 2XYRA 1H1TA 5ALHA 5IAOA 1WG8A 2H65A 5AK3A 5BYAA 4G0PA 5G1OA 4GECA 1JIUA 1VLMA 1XHFA 2B8EA 3QUQA 4X6YA 3KHUA 4EZEA 4N48A 4JMLA 1PSWA 3JX9A 5BUZA 1Q1GA 4XUDA 1EK1A 1K7XB 2I3BA 1VBFA 1HDCA 1P75A 2Q21A 3JQFA 3DBIA 2NTNA 5HZHA 2AL7A 2MU1A 2Z2YA 3AI1A 3CUWA 1U0RA 3LZ6A 3OCUA 1N1GA 1WCIA 4PTLA 4D81A 5JW6A 1B0PA 4MA0A 1LQUA 3BHIA 4ETMA 1LBEA 2V7TA 3HMKA 3QSYA 2ZATA 3JQAA 4YREA 1PZGA 3SIXA 2FF7A 1K9VF 1W9HA 2VPZA 3GPDG 3QX8A 2B1RA 1JHUA 1QTIA 2I2BA 4LX8A 4UVGA 3CCFA 5LU8A 5TARA 1UKZA 5B7NA 3NORA 3R7BA 1D3AA 4JI3B 1Q5PA 1EU1A 2GD2A 4J0EA 1OI7A 2KM1A 3JQ7B 1GZ7A 1FDWA 4J1QA 3TPCA 1TMYA 3NAQA 1X8JA 3L8ZA 3CVXA 4ACAA 3K0HA 4PEVA 2Q3JA 3KRTA 4BQEA 3MILA 3SYTA 5IYZB 2JHAA 1A96A 3U4MA 3LY8A 1WPXA 2EFJA 1JILA 1C50A 1Q7RA 4FILA 3HP4A 4ZAZA 1T2EA 2OGUA 1NIPA 1ND5A 3B1FA 5BW4A 1EI9A 2PKQP 2PDAA 4HGYA 1G66A 4L15A 3WIUA 5JCXA 2RARA 5I7EA 3NGLA 4JL8A 4RY8A 1L5LA 1FXUA 5IK2A 4PM4A 1J2YA 4KK3A 3CVOA 1UL1X 3V4RA 1TYAE 3IP7A 4U8HA 2A0WA 5EIAA 4A16A 2I76A 4RZ2A 4JX9A 3DP7A 2AR7A 5ER9A 3TDKA 3VNAA 1KWGA 2I3GA 1TNDA 3O83A 1WQ3A 1TC1A 4U2DA 2ESRA 1T4DA 4JLJA 4UNNA 5TGDA 3UMGA 1BMTA 4D26A 3NBMA 3N0WA 2HHJA 2R00A 1N1EA 1TTPB 1CFJA 1TLTA 3D2LA 3IUNA 3KIPA 3W04A 2JGJA 3IKJA 2IH5A 3OLYA 3K2QA 2WZCA 5DSTA 2LDXA 3AUXA 4MGIR 4F72A 3QH4A 3KB8A 3LZDA 1N9ZA 4HRVA 3VPFA 5K8VA 1PJBA 1MA0A 2ASEA 1C81A 3P19A 2PKYX 2DHCA 2WJZB 3ZIUA 3BXOA 4DLAA 3MXTA 3DL2A 4A92A 4UUQA 4ENVA 2ZI9A 4H1WA 1XTBA 1RVDA 1Z15A 2D2XA 4LHVA 1TGVA 4NCAA 1Y7LA 3JPWA 3EWAA 4Q4LA 2VHEA 1YDGA 4UTZA 1H4SA 2IT1A 5GVRA 1KVRA 1L5MA 1U9JA 2FN9A 2I2CA 3FLBA 5CTJA 4AZ3A 5B64A 5IDYA 3H4MA 4UDOA 5FPHA 3O03A 4M1MA 3DD1A 3IAEA 3MMNA 3RRMA 4ASUD 5FT9A 3PHJA 2ODAA 4KXLA 1RWOA 1I7SB 3P9ZA 2XCSB 4GXRA 2R4UA 1XU9A 1H2WA 1I1HA 4QSMA 4L5CA 3RVOA 3ILYA 4EUKA 5CX4A 2YVLA 4ZPXA 1YBVA 2IODA 1KY2A 4JC4A 2C2BA 2R6FA 4CE6A 3NAGA 2DB3A 1DELA 5MDHA 3OY2A 3KAQA 4X9XA 3M8KA 3CE9A 2QE7D 3WGLA 2CFIA 4DMRA 2PG3A 1B0ZA 2BYTA 4P7GA 4G5YA 5B1SA 4MZXA 4DB4A 1KK1A 4K9RA 2P2GA 2M6KA 1DWQA 1NI4A 4UHFA 2IHNA 1XZJA 1W73A 3HEAA 2Q1UA 2VQDA 2P30A 1PX2A 2VDNB 3ABRB 4NLLA 2YZNA 1IHXA 1KJ9A 4C4OA 2RI1A 1QOZA 4H4DA 1GKIA 5BY2A 5B57C 3SR0A 10MHA 4LJRA 1P0PA 1R64A 3FWKA 2HWUA 4ISBA 4EDFA 1YQGA 3I2KA 1PUJA 3D6AA 4PC6A 5IASA 4MPJA 1JYSA 1YUNA 3RS9A 4OI1A 3DMDA 3M89A 1JDZA 3F5DA 4P53A 1OFUA 3JQ8B 4XDZA 3E35A 2GX6A 3VR0A 3VZDA 3DXXA 5D51S 1Y42X 4FK8A 4P82A 3CISA 3DAHA 1M6HA 4MA4A 5DEOA 5KNDH 3FTQA 1DAOA 3JWEA 3STXA 2QV0A 3NNDA 5JALA 1OH7A 1L4BA 4GKBA 2G17A 2FI1A 3REQA 3VSAA 3W5BA 4LPKA 4YONB 2QBYB 3HU1A 3OWXA 3EH2A 4KACA 2JI7A 3UWKA 2NVUA 4BB5A 2C7QA 1EDZA 1X1RA 1TU0A 2DFLA 2KE5A 4HFMA 1QHNA 4LZZA 3TSYA 3EOZA 3ANSA 2HWYA 5KSZA 3OH8A 2XNDA 1RWNA 2Y68A 3QVOA 2JFQA 3ZE1B 1X7YB 2J3QA 5I7UA 1UBGA 3DT6A 4Q4HB 1XZLA 4YVFA 4QXAA 1UP6A 1H2XA 2DLNA 2N0SA 1H8HD 4IX9A 3PLAE 3F1LA 3OZ7A 4GQBA 3A6GA 4QC2A 1DPGA 1HDRA 1VCHA 4CNBA 3EIHA 4GRIA 3PEVA 4IDNA 1XHLA 5CTAA 5G0UA 3VGJA 2HA6A 4WY2A 5ICCA 3O8LA 4HC4A 5G0TA 4MS3B 2A1UA 5EPOA 3KDSE 4KEAA 4ITUA 2AYYA 1UP7A 1C8KA 2WWXA 3H1BA 2W6JD 1M10A 1UBJS 3FNIA 4B8WA 4EWLA 3BB4A 2WB2A 1B8VA 3SE0A 2QYOA 4HUQA 3D3WA 3OOYA 3G1UA 4RF2A 3O4FA 1W34A 5ULLA 1H1LA 4QTYA 4Z0HO 1R4ZA 3KUCA 4YUYA 1HKUA 2PD6A 4N5NA 5I7RA 5JI3E 1Z22A 3QYAA 2F3UA 1V4BA 3M6UA 2C9OA 3MNFA 3DL7A 3QVJA 4NK4A 4QJ4A 3V32A 4BVEA 5CK4A 2I1VB 3M4XA 5LQSA 1HT2E 1L7OA 3U7QA 1Q2UA 1R6TA 1XX6A 5LSAA 4R1LA 4F91B 3FB1A 3B1ZA 4PAWA 3ZHVA 3LCCA 4CIYA 2PY6A 4EAAA 3U19A 2SCUA 1NUHA 1W5EA 1VC2A 3B3JA 3KCQA 1FW6A 4CKEA 2GVDC 2KJQA 3AFGA 5JJBA 1U11A 4KJZA 5L3ZA 1KK0A 1M1NA 4IXNA 5JSKA 3QVGA 3H2JA 3GGPA 3LBYA 2ZBPA 1NQOA 3NUZA 2ZB2A 5BWCA 1E7RA 2VDWB 4JITA 4RPKA 4F3TA 2ET6A 2EL9A 2ODWA 4NJEA 3CUUA 5COQA 5IARA 1GTG1 4AZVA 3ZNQA 3T4EA 1U8ZA 4JOCA 3CGGA 4OBWA 2VUHB 3FGNA 1XXHA 1FX0A 4M0DA 5CM2Z 3BHNA 4H60A 5L3QB 1ULZA 3R9KA 1CUAA 1N9GA 2J6HA 1HOTA 5FTWA 3KU4A 4LZNA 4BU1A 2ZT8A 3PJEA 3LHFA 1ZCJA 2QX8A 1D2RA 3TNYA 4D4HA 5LDHA 1O58A 2AKYA 1FK8A 2WTMA 2WUFA 2HM7A 1D9XA 4CTOA 4E1BA 2GKOA 2RG1A 4DLXA 2HKIA 3EGWA 3RS3A 3TW4A 2BI7A 1SHKA 1TO2E 3E8MA 3WNCA 2C3UA 2I2DA 3MWJA 2HB6A 1FP7A 1VP3A 3KEMA 4HDSA 1MF7A 4I1RA 4QOGA 1XVAA 3VH1A 4EGCB 5IM5A 4EPTA 1QYDA 4OJTA 3RFTA 4BOYA 2PMKA 2BGIA 4OJYA 1MZPA 3U80A 2XWBF 2H5EA 1PK7A 2IKQA 4RTRA 2C57A 4KQ9A 5ALTA 3LL4A 3SSNA 4DJAA 4DDWA 5AW7A 3WYGA 3A3KA 1ZN7A 3PR3A 4LCJA 3Q72A 1XZMA 4BP3A 5BMOA 1U9IC 4G89A 2AG6A 2V7QA 4DPLA 4YV1A 2ZJ4A 2YC4C 4LXIA 1FVXA 2O1SA 5L8VA 5F78A 4MV7A 3VX3A 1SEVA 2FWAA 1WZUA 2FHSA 1UFRA 3I6BA 3WY9A 4Z4IA 1ZA1A 3AR5A 1OIVA 1YCGA 1LLCA 1KEZA 4D4IA 1SKQA 2C9MA 1ODSA 1XK6A 1XPOA 2BDEA 4YXFA 5JWOA 3M6MD 1DIAA 5IN5A 1B42A 5CURA 4BO9A 4E6EA 4M6WB 3BWCA 1G5HA 1RHQA 3G5MA 1E3WB 1YAJA 2IY7A 4PLWA 1PF7E 1NG1A 1Q7BA 1Z0UA 3K32A 3SSOA 4MCIA 4FU0A 1XXHE 2HSZA 2EDAA 3QHAA 1CJTC 2CJFA 2GJ8A 1JB1A 3ANMA 4HL6A 4REQB 2JLYA 3JASA 1TECE 1NDHA 4MKZA 3ZCTA 3CRZA 1MRZA 4KU4A 3PHGA 4C1BA 1YB2A 1W36D 5EJ2A 1AKWA 1Z5GA 4YRIA 2VYFA 1TKBA 1H6BA 1JPNA 1XKLA 4HB0A 4BTEA 1E3MA 5FHQA 1I3OA 1OLOA 3IERA 3PE3A 5JZ9A 3ROTA 1XZGA 1HL7A 4M1SA 4X97A 1IXYA 2PUFA 2GBGA 4CM9A 3T9CA 5C53B 1OUMA 3IKMB 1BA2A 3O2SB 3JQBC 2P2SA 3LLSA 2TRSB 3EWSA 4FIZA 2PPLA 2QRGA 4I9GA 2PUGA 3ORYA 1NW8A 3SWWA 1C4KA 4TVSA 1YJAA 3FAZA 2FGJA 1Q3KA 1CDEA 4AKIA 1JJBA 2QIPA 2UUBB 3KALA 2HF9A 4EG6A 3KKKA 4L75A 4UCWA 4DT1B 5DWVA 5KPDA 2B2NA 2FN3A 3MWLA 3V7WA 3SVZA 1UXGA 3TOVA 3E9ZA 1L5VA 3IXQA 1AM4D 2K2WA 2ZSAA 2GPAA 3WRVA 2GK4A 1ZD8A 4IDHA 1O94D 3ZDRA 4YQFA 1ADBA 1C7EA 2HSJA 3BMXA 1VYHA 2FSIA 2ZRBA 2ZQZA 3K73O 3OQ6A 4KQ1A 521PA 2AXEA 2O8BB 3Q7QA 2EDCA 2A4KA 2WUEA 4R1TA 3ZKWB 3L4BA 3THXA 1PT5A 4RH3A 1DJOA 1Y3BE 1NMEA 2VUSA 2YWEA 2Z2IA 3O8DA 1KDRA 3OZAA 2XRZA 3NYQA 2FG5A 4L8VA 2OHFA 2PX3A 4IHJB 1XQWA 4PY2A 4P0PB 1FLVA 1Y48E 1SHZA 3WLPA 4B6QA 5C7OO 3JARA 1A8HA 1RQNA 2OZLA 4H1HA 2WJYA 1MC5A 2XR1A 3Q3IA 4M4SA 4NV0A 4YRRA 5FYDA 5SYMA 2V7UA 3RRZA 3UWSA 4MROA 1OH8A 4RJJA 1WHTA 4L8WB 3ZCUA 1S6YA 1E77A 1GRRA 3MQFA 1L4FA 3O8QB 2D7CA 3PGMA 4FZVA 2QTTA 4KUEA 4O3FA 4ENSA 3TXAA 3GH3A 2E87A 1E6WA 1LX7A 4AO7A 3ZN2A 3LYAA 4AJ9A 2G70A 3EXAA 4K46A 1U8CB 3LVFO 1PG5A 2WSBA 3ST7A 2QAGC 1RM0A 3TRDA 2QLJA 4ZHSA 1J8VA 3NC4A 2IWRA 3PXUA 2NADA 3EPRA 4DJJA 4BFTA 1PLJA 1Q1NA 1XZDA 4RQUA 3KKEA 5G1NA 3RIYA 5CDTA 5ALPA 2JB9A 3HGQA 1UMCB 2H0RA 4NL4H 2PH7A 2X3FA 3ZGOA 4F2WA 4MPPA 3HRHA 3NHLA 3VR1A 1QK4A 4YUVA 2VH2A 2W8ZA 1U80A 3A04A 2GTIA 3AW8A 1W88B 4LGMA 3NHKA 3F46A 3W2FA 5DHFA 3P45A 3Q4GA 4JOSA 1N2JA 3SFTA 1Z16A 1CNMA 1L4MA 2WV9A 3HCOA 1CZLA 4Q1CA 2HW8A 3PQDA 5HM6A 1PJQA 4UZFA 4MWGA 1NW9B 2HK7A 4ZRDA 4A8JA 2R65A 1VKRA 4A2PA 2BRUA 3ZU5A 2FK7A 1JDTA 2PUHA 3T1NA 1J07A 4UC0A 5EVJA 4AXXA 4RKRA 1VMDA 2A5GA 4E7OA 4C5BA 1U4OA 1WCV1 3VO8A 4PFKA 3GJ5A 4CF6A 5B4VA 1A4IA 3I9OA 2J85A 1WZNA 3MJVA 3WHPA 3IQXA 1FRVA 1QYIA 2IPOA 1AK1A 3N2NA 1I7DA 1WS6A 1XMVA 3GR6A 3CTPA 3L4KA 3QXGA 4DIBA 1HDEA 1UZLA 5ICFA 4ZTUB 4PO8A 5CAEA 4LZAA 2YZ7A 4P7JA 3GW8A 1DQRA 4PQYA 1WBJB 5EKTA 3VVBA 3V2HA 4A03A 3HV2A 1PHPA 5EMNA 1Q91A 1NBWB 4I5DA 4WL0A 1OFUX 1CJKC 3EC2A 4H17A 2HV9A 2H2AA 3QGMA 4DIEA 1FP4B 3SQWA 1I3LA 4FMCF 4BJHB 4EARA 3D02A 4L8FA 3ADCA 4QARA 3FSJX 5H7XA 3RIHA 4LWQA 2VNKA 2QMQA 2WTBA 1Q0TA 1C3OA 2W70A 5FD8A 2OXTA 1BTOA 4QOEA 4UNRA 3AIOA 3CX8A 2VK1A 5EJGA 5TGTA 4YX9A 3GLIA 5EXSA 4I46A 3MBOA 5ALNA 1E0AA 2H1RA 3EG9B 4GPIB 4JU9A 3LTEA 4URZR 4L0QA 4NFLA 1K0FA 2H52A 2W4QA 4O8CA 4E14A 1VLQA 4FEAA 1B14A 1KIAA 2ODQA 3EZ9A 1ECGA 4ARZA 4QG3A 1Z2CA 2Z5VA 4G4SO 5CA0B 2C58A 1WU7A 2IUSA 4MB2A 3GLHB 4LQ4A 1WB5A 4PCAA 2QN7A 1A9RA 1FVOA 3AJ9A 3QFSA 4RJKA 4FJ2A 2WWYA 2ZLBA 5EJ6A 1C4WA 1FF9A 4H9GA 5WRFA 2XUIA 5LQAA 1Y1LA 2FV8A 4H08A 5CB0A 2BMVA 2J32A 3HPRA 1S1MA 1IBLB 1QRSA 4DS3A 1P5RA 1PT9A 2OQ2A 2Y92A 3DFMA 4PHTA 3I04A 1GN9A 2XDYA 1UUFA 3FFBA 4X6LA 1DO8A 1B6SA 1LBHA 3WL5A 2G0AA 3ZW9A 4RTKA 4N3NA 3C6QA 2HQBA 2V6GA 3RVRA 1X14A 1CQJA 5C9ZA 3DEYX 2PKWA 1SVIA 3KPVA 4X1IB 4MHOA 4NOMA 3AF2A 3ETCA 3FHOA 3I23A 4HDRB 3LO8A 4MV3A 3RTGA 1X8LA 1ZD1A 3EXG1 3QKWA 3NEAA 1JI0A 4MKRA 1ZUIA 1XSEA 2VRNA 4FUTA 4JUCA 1SZJG 4S0ZA 3ABQB 5DYNA 3T7AA 4N65A 5K3FA 1HYQA 3PGXA 4P0TA 1GNPA 5IAJA 3THYA 1HE5A 3PA6A 4X60A 4R8KA 5A5FA 1XJCA 5J2TF 1QZTA 2YWRA 1HPLA 4W8GA 1JG3A 5CVUA 3MGCA 3V46A 3C0KA 1N2BA 2HA0A 3H8WA 1UMDA 3DD5A 1OZGA 2PTHA 2WIJA 4RJ2A 3GLIE 5CLIA 2V6JA 1UAGA 1TRHA 2FR8C 3NS7A 4K26A 4PXAA 4BIIA 3MMPA 1U7UA 4HFJA 5IT4A 5M04A 4QUGA 5JMPA 5C5IA 2C07A 5DI3B 4PYNA 3T8YA 2HCBA 1T9GR 3E0QA 1P39A 2REQA 3EVNA 1RXEA 3I58A 3NU1A 2AG0A 1ZVMA 2H7CA 4HI0E 4EG7A 1EVIA 4OF4A 4GOMD 5BNWA 1UKEA 2W0SA 5LQUA 5IH3A 3FYCA 5HS4A 4IZHA 1U8EA 4NP6A 1IK4A 1SK8A 4KE7A 3R9IA 3DLIA 3TIXB 4AKSA 1CHNA 2CHFA 2CVOA 2QE6A 4GYJA 1OX5A 2ZQYA 5F9FA 3I0ZA 1IDOA 4K6MA 4AZTA 2JFNA 4R68A 2E2WA 1BWPA 1EK0A 4MV5A 5JPIA 4BNDA 2B21A 3MWEB 3N86A 4RS3A 2DBZA 1VE6A 4B82A 4RIEA 5DHQA 4N41A 3EEQA 2IYPA 1M2VB 3HO1A 5ADHA 4BCDA 4RVDA 3W9YA 2L17A 1NHGA 4OAQA 5T8KC 1DLJA 1M2OB 1NKSA 3KQWA 4MQEA 1KJNA 2ZSKA 4XIJA 4CIDA 1WBBA 1UOEA 3U37A 4DMFA 1U2DC 1V4VA 1RJ9A 1BCSA