2Q2QA

Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
250
Chain Sequence
TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cosubstrate-induced dynamics of D-3-hydroxybutyrate dehydrogenase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords Beta-D-hydroxybutyrate dehydrogenase
total genus 91
structure length 250
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q2qA00
3H9GA 3GN1A 3OICA 3RVDA 4N5NA 4J2HA 5TNXA 4CLOA 4P38A 1KBZA 5JNLA 1HDXA 2G1UA 3CUKA 1P0CA 1ADFA 4TROA 4YXFA 2AEJA 3GRKA 4CUZA 5FWNA 1I10A 2ZB7A 4K1LA 3JQGB 4F3YA 4HNGA 4NFHA 1A9YA 3H5RA 3ZV4A 4KTVE 4QXMA 1EUZA 3RWBA 3UCXA 4D3SA 2VT3A 5K9ZA 3LF1A 1E3WA 2VOJA 1YOVB 1ISGA 2OO5A 4P8RA 4PVCA 4U7WA 4II2A 3WLEA 5IZCC 1UDCA 1O8CA 4JLWA 4DTIA 4KOAA 1RWBA 2VWQA 3WJ7A 3O8QA 1QLHA 3JQBA 1EBUA 2DBZA 2OXIA 1P31A 4U0KA 4WCFB 2VRCA 1LJ8A 4ALMA 5CP8A 1DJQA 4XX0A 3RUEA 4ND1A 2PWZA 1RKXA 1UXIA 4D0SA 2BELA 1R0KA 2BHLA 3I23A 2FR8A 1PZGA 1U28A 4ND5A 1JKIA 1QLJA 4XKJA 3Q1LA 3ZV6A 3EZYA 4U8GA 1E7MA 1LLQA 3GZ4A 3LLSA 2W8ZA 4PG6A 4PZCA 1ZW1A 4ZHSA 3KYDB 4OM8A 3DOCA 2NADA 4IXWA 3H8VA 2CDAA 4BNZA 1HRDA 4P22A 1MGOA 3TFOA 1SEVA 4G81A 2OUIA 4IDAA 5DZSA 1D3AA 4PVDA 4I5FA 1VKOA 1E92A 1BXKA 3AUSA 3WMWA 1ZSVA 2CMDA 4PG4A 3AOEC 1C1DB 2Q2VA 4XRRA 5B4TA 2Z1NA 1EUCA 2IE0A 2YV2A 3EW7A 4WLFA 1LRLA 4R1NA 4YACA 1YB5A 1RM3A 1C14A 1ZNQO 3BYZA 2I66A 4NR0A 4RPGA 4WGGA 5CDYA 1AXEA 1GUYA 3KV3O 4ZD6A 4FFLA 4LMPA 1YL6A 4CL3A 2Y93A 3HDYA 4FFNA 2A9FA 3NKLA 7MDHA 3AI1A 1HF3A 3V2GA 3VHRA 3DBHA 1E0DA 3TFQA 1NXQA 4CM9A 4LISA 2JFHA 1NVGA 1Z73A 2HJRA 4W7IA 3ZHYA 4LCJA 5JY6A 4E33A 4I5EA 3QLJA 4NFYA 4EW6A 2G5CA 4JBHA 3L9WA 3ULKA 4GMGA 1B2LA 1MX3A 4M49A 5AXBA 2RHRA 1YH3A 3WYBA 3JQEA 1MC5A 4L8VA 3RKUA 5ER9A 2HLPA 2HSDA 2HMVA 3S2GA 3DFZA 3KEQA 4GX2A 3F4BA 4CM5A 1HYGA 2Q45A 3RC7A 3A28A 4CV3A 1DRVA 4XQCA 1C0IA 4RO0A 3WQQA 2DTDA 3TZ6A 5KVSA 2P68A 3ETGA 4FJ0A 3C7DB 5DP1A 1IE3A 1Y5RA 4PLFA 2G0TA 1B8PA 1EVJA 4IJWA 3PTZA 3B1JA 5DBGA 3I6QA 1ZXBA 2C7VA 5JC8A 2PTGA 3FWZA 4FIZA 4WJZA 3DMTA 3H3JA 3VH4A 3L9XA 1QRRA 2VTEA 4BNGA 3U62A 3PRJA 5HS4A 4OO3A 2PV7A 3WWZA 1CRWG 5C7LO 1PQWA 3GNSA 5ILOA 4BNVA 3DHNA 3IP3A 3O8QB 2B69A 3TWOA 3S1LA 3CTMA 3RBXA 4W4TA 1JA9A 3UKOA 2AG8A 2Y68A 1Z6ZA 5A9TA 5JAIA 1ADGA 4KUHA 4BO0A 3UVEA 4IZIA 1I36A 1P1FA 4ITUA 1B3BA 4DPKA 5G0VA 1YS4A 2UUOA 3AOEA 1PJ3A 3UW3A 1OZAA 2EGGA 2ZQZA 2P2SA 2PZJA 3TZKA 2WTBA 3CEAA 1NFFA 1ZH8A 4XQEA 1LRKA 3ASUA 5JBIA 2PKQP 5LDHA 3FBTA 2VNAA 3JCZA 4HP8A 4YAIA 1EE9A 1ADCA 3OIFA 3QQPA 5JS6A 1PL8A 4GLOA 3VKVA 1GUFA 1UDAA 3PGXA 4DC1A 1DFHA 3ZZNA 4Q3BA 3AY3A 1OAAA 2B83A 4FFRA 4DQXA 2EP7A 4Z6KA 3VH2A 2B36A 5DBIA 1J5PA 1P1IA 1GPDG 3W6UA 3RU7A 2F1KA 4PGFA 3AU8A 1C0PA 1J6UA 3JYNA 4JROA 3NGXA 4XYEA 4R69A 1PJ4A 2DM6A 4MP8A 2NU6A 3IC5A 1RM5A 4A73A 1W73A 1LNQA 1EQ2A 2Y0DA 5JDIA 2NTJA 5TLSA 3GGGA 5AXAA 4YJHA 1O6ZA 3BMOB 5A3JA 1CQJA 4QECA 2X5KO 1Q0LA 1UXGA 1F8FA 4ND4A 2RBEA 4NU5A 1QR6A 4FFOA 4E2XA 4QT0A 2HUNA 2NQTA 4UUNA 2NVWA 2AA3A 2VYVA 2AXQA 4W9NA 3DMTC 1ZEJA 4FS3A 3AI2A 3GK3A 3ENKA 2VHZA 2EJWA 2FHSA 5U4QA 4YYZA 1E6WA 5DT9A 5CG1A 5HTOA 4Y6SA 2YZ7A 2YFHA 4CMHA 4HX5A 4OOEA 4MJLA 4MIOA 1JW9B 2BD0A 3JQCA 2O7SA 3I4CA 2Y05A 4YR9A 1TA4A 4Y8VA 4BO8A 5AXDA 3ICPA 2QRKA 4KWHA 3HFSA 4FN4A 1NAIA 1ZJZA 4KQWA 4EZBA 1H94A 1N9GA 1GYQA 1E6EA 4TVBA 1UH5A 2FWMX 5IAAA 4IZHA 3O03A 3QIVA 2XOXA 5ITVA 1WDLA 1LC0A 2CF5A 5JSFA 3PHHA 1GTMA 1DHTA 1D1SA 2A4KA 3OIGA 1ISHA 3AM5A 2I6TA 4EJMA 3FI9A 3M1LA 1H2HA 4EBFA 1DIHA 4FQ8A 2Y1DA 4J3FA 1WZIA 4MIEA 5A5EA 4Z3DA 3IMFA 1K6XA 1NPTO 1S6YA 3DZKA 5KKAA 3JYLA 4E2ZA 3C1AA 1AXGA 5L95A 4ZGWA 1X14A 1PIWA 4TSKA 1VJ1A 3C7AA 3LT0A 1SMKA 2NACA 3PFWO 3IUSA 4I5DA 4YQZA 3G3EA 5L40A 3WGGA 1U3TA 4DBZA 5JO0A 3PHLA 2CSUA 2FPPA 2X22A 5I7FA 2HO5A 4LRTB 1AHIA 1CWUA 1P33A 4DRYA 5LC1A 3ZH2A 5JYDA 4HV4A 4OQZA 1ZKMA 3VOSA 4B4WA 3KYCB 3D4PA 1GCOA 1IZ0A 4D79A 3E9QA 1TVEA 4E2WA 3FR7A 2WDZA 1MXHA 5C7IO 3E18A 5ES3A 4YAJA 3LSYA 1LSSA 3FF4A 1YL7A 4LW8A 2Q50A 1IYZA 3ABIA 1GAEO 2D59A 2QZ9A 3JQ6A 1O9BA 3JYQA 4B7CA 4MVJH 2BKAA 4GGPA 3FPCA 4GMFA 3R3JA 3HUDA 2DBQA 4P4GA 5T67A 3V5NA 4YRBA 2XAAA 1HYHA 4QO7A 4BGIA 4J2OA 4LSMA 3OJEA 1BRMA 2EXXA 3C7CB 3DTTA 4TRJA 2FZEA 3KVOA 1OI7A 2H9IA 4GVXA 2B5WA 3PWZA 3VZQA 1XG5A 2NVBA 1M6WA 2Q99A 1WAMA 4AJIA 2VUTA 3L0DA 4NPCA 4Z9FA 4F45A 1X7GA 3I5MA 1R4MB 1NR7A 2PFGA 1E3SA 2WYVA 2VT2A 1Z7BA 1NQ5A 1LTHR 3ROMA 4ALKA 4IIVA 4BGEA 2O7QA 1ZXLA 4XIJA 3BMQB 3HFGA 2W2LA 1NQOA 3ZCXA 3R0IA 4M87A 2O2YA 1HZZA 3DOOA 1T2EA 4BNKA 5JFOA 1E3JA 4IJVA 3NT5A 5EIOA 4E5YA 1U2GA 3WBBA 4D43A 4R54A 5KJFA 2GDZA 2HK9A 3TZHA 1NWCA 2OOSA 4FFPA 4XGIA 3VKUA 3KLPX 3DBVO 5DOVA 4BGUA 4CLEA 2O3QA 4I1IA 4OSOA 5F5LA 2O23A 3RFXA 4PG8A 3LYLA 5TC4A 4L4SA 4YT5A 1H0KA 4F6LA 2CY0A 4LGVA 4PLCA 4BS9A 4BNTA 3EGOA 2ZCVA 1H6BA 2EP5A 4O59O 2ZYAA 5KVVA 1BGVA 1DJNA 4KMSA 4Q39A 3ENNA 3FNHA 3LZ6A 1ZK2A 2R6JA 2BGLA 1R4NB 2VYNA 6ADHA 3OETA 3UCEA 2BF7A 1X7DA 2JHFA 3OQ6A 4A2CA 4FOOA 4PIVA 3PYXA 3L4SO 4R4JA 4GI2A 5IF3A 1Y8QB 4UULA 5COAA 4IBOA 1QV6A 2D1YA 3WFIA 2UUPA 1M76A 5F21A 3WIDA 2O3JA 4ZU3A 4OSPA 1Q7BA 3G1UA 4PFJA 5BSHA 2CDBA 3KBOA 1WW8A 2NTNA 3K2EA 3ON5A 3VPHA 2TMGA 1E5QA 2IYPA 1ENOA 2VWGA 3BMOA 4A03A 3IKVA 3OJOA 3K5PA 4Z0TA 2VOEA 3ITDA 5CPBA 1GU7A 2ZB3A 3E8XA 3IOYA 4RF5A 2YFQA 1NAHA 2YHUA 4INAA 5F3RA 5TF4A 3SLKA 3MOGA 1GZ6A 4ALJA 3V2UA 5KKCA 3QJ5A 5ILGA 3S2EA 1NM5A 1H9AA 1P1JA 1LDEA 1PQPA 4CR8A 2AMFA 2JCYA 3DBLA 4GKBA 4J7UA 1O89A 1A5ZA 3PYMA 4CR6A 1QP8A 4WCDA 1F8GA 2P5UA 1I33A 5BSGA 3JQBC 1Q7GA 2Q1SA 3H9EO 2WMDA 4WNIA 4EGFA 2QQ5A 3HQ4O 4FGWA 2EW2A 1CEQA 2VZ0A 2DBVO 3QVXA 2RH4A 3ZWXA 3PWSA 4F6CA 1VSUA 2ET6A 3B20A 5JCXA 2GN8A 1Y8RA 4Z3KA 3OMLA 1G1AA 3VPSA 5A06A 1HDGO 1T26A 4MVJM 4MKXA 3ANMA 1EMDA 4DWVA 1Y9EA 1WP4A 2C29D 1N9GB 2Z5LA 1NFQA 1ZUD1 1R16A 1BHSA 3JQAD 1QYXA 3ZWMA 1PL7A 4BIIA 3M1AA 4HBGA 4NMHA 2BFOA 2IEBA 2FR0A 3OQ1A 4RVGA 1SCUA 3V2HA 2BFPA 4OXNA 1SPXA 2AQIA 2X0RA 3JQ8B 3WB9A 4J49A 4CMBA 3D4NA 5G0UA 3JQAB 3A14A 4JIGA 3DBRB 4ND3A 4OXYA 3D3EA 3EK2A 2BLLA 2C20A 3FR8A 5COBA 3WYEA 4AG3A 4XYBA 3K73O 3W8DA 4YAKA 4XRGA 3MTGA 1FF9A 4WNCA 4D0RA 4RLHA 4HXYA 5TT0A 3NEPX 3RC9A 5A5FA 2BI7A 1ADBA 2EKQA 2B37A 1HSOA 1KEWA 3BTVA 9LDBA 2O2SA 2HAEA 3PZRA 1NHGA 1YQGA 1E7RA 4ALIA 2X23A 3DZIA 2GD1O 1NX6A 3MOIA 1NPDA 5T64A 1ENPA 2AHRA 3IUPA 1JU9A 2J3HA 1PL6A 4OOFA 1YB1A 3G79A 3U9LA 4DMMA 4ZQEA 5ENDA 4G5HA 2ILTA 1X1TA 5G0WA 4BUCA 1R15A 3I9MA 1U5AA 1XEAA 1F06A 2SCUA 3MEQA 4LRSB 4XJTA 1HYEA 3TOXA 3VC7A 3ST7A 4L4RA 3Q9UA 9LDTA 2BFMA 3H5NA 1PWZA 3QA9A 1YONA 5TQVA 4QFCA 1TLTA 3UGKA 3OHSX 5BNFA 1DHRA 1NBOA 4IINA 3I1JA 3D3WB 4NJMB 1OC2A 1PS0A 3KYCA 3R6DA 5A3VA 3GUCA 1PJCA 5JW6A 4L4XA 4BMNA 3ONFA 4R1UA 1KOLA 2B5VA 2UVDA 1IHXA 2YQ5A 1YDEA 1FDVA 3NJ8A 4N5MA 4ZA2A 5FYDA 1MV8A 1ZJYA 5EN4A 4PZDA 4J0EA 4B3JA 4DLBA 1LSJA 3INRA 1GQQA 3WG9A 4BB6A 2GCGA 1J0XO 1Z45A 1I2BA 2QHXA 3C1OA 3FNEA 2E49A 1DIAA 3BAZA 1Y6JA 3OA2A 4AJ4A 4Q3NA 1WMBA 2AQ8A 5A9RA 4BVAA 3OEWA 4HFNA 3I4FA 1D7OA 2CD9A 5U1PA 5A9SB 4CMEC 3KXDA 1GEEA 1D4FA 3H4VA 1XDWA 4FSHA 2WYUA 5G4LA 3RUAA 3FN4A 1OFGA 3LF2A 1I3MA 4L76A 3ZWPA 1QSGA 3W6ZA 5L4SA 2J3KA 1J4AA 2GF2A 1IPEA 1C1XB 1H2BA 4NBTA 4Z0PA 2WSBA 3E5RA 1EK6A 2PLAA 4E4YA 1Z7EA 3KSUA 2HRZA 2QYTA 3ETEA 5JMWA 4Y98A 4YJDA 3PQEA 4JXKA 2YUTA 1BVRA 1JQBA 3TJRA 3ASVA 3GDGA 2X9GA 4AFNA 4NBVA 2DFVA 1PGPA 1NASA 4W9NC 4DQUA 2C5AA 3RBZA 1G0OA 1ORRA 1T4DA 1U8FO 4CM4B 4A26A 4LSWA 4XWYA 3GVHA 4O5OA 4KZPA 1WWKA 4BNHA 3WQSB 3BMNA 1B26A 4H7PA 3H7AA 4MVJG 3VVBA 3U0BA 1PJQA 4D3DA 4YJGB 4K6FA 4R3NA 3S55A 3ZHBA 1RPNA 3DHEA 4I9HA 4IIUA 1P1HA 4M54A 5DN9A 5I8WA 4EUHA 5L7TA 3NAQA 3MJCA 3UUWA 1LQTA 1JAYA 2RH8A 1W0CA 1I8TA 5ITWA 4FB5A 4O0LA 4P4LA 2C5EA 1EDOA 1N92A 1YDWA 4U6QA 1I3NA 4BOYA 1XGKA 1T1RA 3ZV5A 1CETA 3NV9A 5GY7A 1E6UA 1XR3A 2PD3A 3HZZA 1BW9B 5EQDA 3GC6A 1B16A 3WGIA 3CH6A 4CQLB 1ISJA 5EPOA 2OHXA 3U4HA 3KHUA 4XDZA 1B3RA 2B4TO 3O4RA 3L4BC 3JQ7B 4MVJA 1SZJG 1H9BA 1WMAA 4S3MA 4B4UA 2C2YA 3PXXA 2HQ1A 1GFSA 4RQTA 2AE2A 3DONA 4L9RA 3PIIA 3IS3A 4AICA 2I3AA 4WCFA 3QHAA 1VL0A 4OGWA 3DOJA 4E5KA 3ZI0A 3QRWA 4BO1A 3HB5X 4Z0HO 1NYTA 1L1FA 4JNKA 4HADA 3QW2A 3G0OA 2D3TA 1DDOA 4EITA 3DXFA 1UP6A 5DOZA 4IDFA 3VDQA 4R3WA 2UYYA 3AU9A 3I9KA 4R1TA 3ZU5A 4C7KA 3H6KA 3H9UA 2POQX 4WPGA 4Y9DA 1JKJA 1WXDA 4KWIA 4Y6PA 2Q2WA 1SB8A 1VJTA 4YWJA 4J1QA 3GVXA 4RQUA 1Q1NA 3BZUA 2GLXA 1M66A 1KEVA 3L6OO 4NJOA 3L07A 4CQMB 1VJ0A 1E3IA 4TKMA 3KETA 2DPHA 3GN2A 1SOWA 3FCOA 1V3VA 3H9JA 4EI2A 4PLWA 1UDBA 3B70A 1V3TA 3PYLA 1EE2A 3OA0A 1KERA 5BSEA 3MJVA 5JMPA 1SB9A 4CMJA 2P4HX 4BKOA 3NYWA 3HB4X 4K26A 2A92A 1F0YA 3PJDA 5L9AA 4H3VA 2NM0A 3N7UA 4JGBA 1J49A 5AQ1A 1U3WA 5GZ3A 1ISFA 2PZMA 2Y66A 1DFIA 2EKPA 5G2OA 3STHA 2HRBA 2X8LA 4XR4A 4QQRA 5H81A 1HETA 4E3ZA 2D0IA 3PEFA 4IDEA 1T2CA 1GY8A 3U4IA 3RFVA 5IXYA 1KY5A 3GGPA 3WWYA 3Q0EA 3RUHA 3JQ7A 4WASA 2C54A 3BHJA 2RCYA 2WWRA 3PI7A 5JE8A 3S2FA 3KEOA 4YJFA 1FDUA 3GFGA 3MJEA 1R6DA 4B4VA 4LN1A 2V65A 3QY9A 2OP0A 4YQYA 4MOWA 4UUMA 1F17A 4Z9YA 4CLRB 2CFCA 5DNAA 2X9NA 1OC4A 1AGNA 3ZNQA 3ZWYA 2VYND 3BMCB 4XYGA 3BIOA 4XIYA 1LDYA 2D4AA 2EIHA 4YPOA 3S2IA 1UJMA 4E13A 1ZVMA 1EFKA 2GRAA 3B6ZA 4YJGA 4JN6B 1JVSA 4L73A 1X13A 4NK4A 3ADPA 1EQUA 3DR3A 3HE3A 1TT5A 1XHLA 5T5QA 1LX6A 4D42A 3H3FA 3T4EA 1E1NA 4R5HA 3O9ZA 2DBRA 1LRJA 1SC6A 1ONPA 3A4VA 2J8ZA 3V1TC 1LDBA 2PD6A 4FC6A 3BMCA 5LDGA 1SNYA 4ZQGA 1U3VA 4KTTE 4IJKA 4YEDA 1QYCA 4IXTA 4J4HA 2W2KA 2DPGA 2QYSA 4R9RA 4DGSA 3GG9A 4FGSA 3VH1A 1NQAO 4L75A 5KJ6A 4N5LA 3AY6A 4DIBA 3NRCA 4XDYA 4LMRA 1MC4A 1WDKA 2EV9A 4NK5A 2P9CA 3V1UA 4DYDA 2I9PA 4CV2A 1RM0A 3JYPA 1PJ2A 1W6UA 3LU1A 1R12A 4JBIA 3X2FA 3I9JA 5G4KB 4M89A 2NVUA 3DWFA 1T1SA 1HLPA 3HN2A 3P5SA 5DCYA 3RQSA 3GVPA 3MJ4A 3UCFA 1F12A 2O4CA 3VDRA 4B8ZA 1LI4A 4WK6A 3ZWNA 3DL2A 3VPFA 3FNFA 1A72A 3OM9A 3LC1O 4FJ2A 3JD3A 4I9NA 3ANNA 3KSDO 3PDUA 4BMVA 1PQUA 3RUIA 3GZNA 4GGOA 2C07A 4I9UA 5HWSA 3CPSA 3JQ9A 4RPHA 5BT9A 1HDOA 2PNFA 3GPIA 4CLXA 3DEYX 5I7SA 1TI7A 4PLPA 2YQ4A 2I76A 3N58A 3GDOA 1YVEI 2PZKA 1T2AA 1E3WB 2P4QA 1NWHA 3WIEA 3K6JA 3QWIA 1DBVO 4MKRA 5KNLA 3CMMA 4N18A 4NHEA 1QV7A 1UAGA 3KTDA 3WYCA 4NFSA 5CDTA 3GVIA 1B7GO 2EW8A 3KOUA 2Q1TA 5I7EA 3DZGA 4PG5A 5H82A 1PGQA 1HXHA 1ONOA 1A7KA 1ARZA 1PZHA 3DDNA 1QG6A 1JLLA 3I9LA 3NDIA 3BTSA 5L4LA 1DEHA 1MLDA 3DAPA 1A71A 5G0SA 3WTCA 2PH3A 1DRUA 3GVCA 1T2FA 2QRLA 3PFFA 5CDSA 5L7YA 3HADA 3WGYA 2GR9A 1CERA 4UREA 2Y1FA 1KC1A 3PLNA 1O94A 3KLMX 5FI5A 3QP9A 2O3RA 1X15A 3BTUA 5C37A 3UHAA 1EFLA 3GF4A 1WNTA 4D41A 2IXAA 3F47A 2YW9A 2VCYA 2PKQO 3CZRA 4PLGA 4CM3A 4TZTA 2IZZA 2OBNA 4BGVA 3K30A 4ZJUA 3EHEA 1WZEA 2E82A 3BTOA 3ZWOA 3CINA 4BO2A 3HN7A 5KWEA 4EJ0A 3F1LA 3C1TA 2JFGA 3KM0A 4YRAA 3ZWCA 4HNHA 1ID1A 3WS7A 3SVTA 4IDDA 2OL4A 4CMCA 1VE9A 1U4SA 3DB2A 4ZVVA 3WSWA 4AJKA 5CG2A 1T2DA 3I6IA 4OMUA 4CLDA 1Y81A 2E6UX 4XCVA 4DMLA 2X0IA 4FOSA 4AJHA 3ZW9A 4RPJA 5JYEA 3VH3A 4BNNA 4R9SA 3TPCA 3Q3CA 5T8KC 4CUJA 1MA0A 4BHTA 4E21A 5I9LA 2UAGA 2EF1A 4XR9A 2UV8A 1DLIA 2LDBA 1IPFA 1VSVA 1WLYA 3FNGA 1AN9A 3BA1A 2DUUA 3IL2A 1NTOA 3ONEA 2OGUA 3G1TA 1NVMB 2IZ0A 5TSDA 1K5HA 1CQIA 1O5IA 4JBGA 4B79A 3K31A 3IJRA 4YTEA 1HSZA 2E37A 1YRLA 1ZBQA 1SEPA 2CZCA 2JJYA 5A02A 1RYEA 2NVUB 4RF2A 3PZBA 3CXRA 1HLDA 3TRIA 3LT2A 1EZ4A 1RYDA 2XXJA 4N54A 4UVEA 1U9JA 1FXSA 1Z82A 1DO8A 3UF0A 4NH4A 3RJ5A 4A5OA 5HRUA 1AHHA 3AJRA 2DKNA 2PK3A 4JX8A 4DA9A 2VZ8A 3UFXA 3NTOA 3GPDG 1HDYA 5BNTA 3WJAA 1C0LA 2HMTA 5T6BA 1TT5B 2AQHA 2OZPA 5JAMA 1WPQA 1Y7TA 3C8MA 4ALNA 3DZFA 3FBGA 4XB2A 1N2SA 1NFRA 1P44A 5B1YA 1XWFA 2J5QA 5ER6A 4WCFC 5JAZA 3D4OA 1IUKA 2DTXA 3AUAA 2CVQA 1HDRA 1U2DA 1NVTA 1XSEA 3FSRA 1KEPA 1A4UA 3X2EA 1VI2A 1DIGA 3JD0A 3RFTA 4J43A 5KJEA 4YB8A 3U49A 4RPLA 1XYGA 1OMOA 3JQ9C 3N74A 4BO6A 2C0CA 3P19A 3U09A 5IDYA 3SJUA 4XA8A 2PGLA 2PKRA 3GEMA 2YHIA 3WGQA 4CQMD 1WDMA 1E7YA 2X5OA 4B3HA 2J3JA 4WOJA 2IDZA 4IDGA 4XYLA 4AJEA 2P9EA 4A10A 4J1SA 2ZQYA 4JQCA 1ISMA 5BSFA 4H15A 3L77A 2BGMA 3M2TA 3PJEA 3VZRA 2CUKA 3JQFC 4LCEA 4J6FA 1WVGA 1MG5A 3DAFA 1BW9A 4JK3A 3RD5A 2OFPA 1FMCA 1BVUA 1P0FA 3TZCA 1V3UA 3RSHA 2EJVA 2NWQA 5KJ1A 1E1LA 1VL8A 4PCVA 4B4OA 4X54A 2C7GA 5EERA 4DREA 3PK0A 3MZ0A 3Q2IA 4BKUA 3LLVA 4Q3DA 4R68A 3ZGYA 1U5CA 1YJ8A 1DFGA 1NQTA 1NP3A 3PGJA 5T8KA 4EEZA 1IL0A 2IZ1A 4WE3A 3M6IA 3WFJA 4Q3EA 4JJIA 3GA0A 4QO8A 1YB4A 3F46A 4PLTA 5DULA 3L4BA 2GNAA 3ZNNA 1ZZEA 3LT1A 4UVHA 4ONEA 3E48A 1YJQA 4WLEA 4QSMA 2X7HA 3QVSA 3EC7A 3PDJA 3T7CA 1UP4A 4TRRA 1HL3A 1HWYA 4CM1A 1XKQA 2P91A 2Y0CA 5JDIC 3I52A 1E7QA 4TKLA 1LLUA 4B8WA 4FW8A 2VHWA 1KS9A 1GCUA 1ZEMA 2WE8A 5T57A 1Q0HA 5A9SA 1BXGB 1SAYA 4RLSA 3AWDA 4EDFA 2HU2A 4WLUA 3H2ZA 1SO8A 3F6YA 5F1PA 2Q1WA 1MFPA 2GSDA 1EVYA 1PGNA 3KB6A 4C4OA 1LU9A 1BMDA 4Y67A 2Y1EA 2ZTVA 3RC1A 2E48A 2A35A 3ZU4A 2VHYA 1BDMA 2Q4BA 2R00A 4H16A 1U8XX 3JQGA 4WLVA 1TT7A 4E5NA 3TF5A 3WGZA 5GMOA 2OMEA 4MDHA 2W90A 3KYDA 2I5PO 2GPTA 1E1MA 1HEUA 2Y1CA 3QSGA 4OAQA 3SLGA 1VC2A 1O95A 3WSVA 4O63O 4NJMA 4WLNA 3ZDFA 1QKIA 4ID9A 1C0KA 3NUGA 4BO7A 1ISIA 3WGHA 3V1YA 4Z9XA 4QFDA 2YV3A 1KC3A 1O0SA 1UXHA 3C24A 3ROPA 4W99A 3WICA 1MUUA 3SEFA 8ADHA 1GYRA 4XGKA 2YV1A 4MKZA 3T7EA 4E31A 3GG2A 1A7AA 3W8FA 4GWGA 5EINA 2HMWA 3L6DA 3MJTA 1N5DA 5FFFA 3WGOA 3EZLA 4AJOA 1RJWA 5KTKA 3JQFA 1N7HA 1DIBA 3GEGA 1XU7A 2BRUA 3I9OA 4HY3A 5IG2A 5IJZA 5IDXA 1B15A 4RVHA 1TEHA 1KVTA 4NZ9A 1TB4A 4J16A 2JCXA 2O48X 1UZNA 1XQ6A 2NU9A 4TZKA 3WX0A 4BKQA 3RI3A 2J5KA 4R41A 3MJSA 3WR5A 3ZU2A 2FPGA 2YYYA 2Q4EA 1B8UA 4IQ0A 3RKRA 2X5JO 1GUZA 2FY8A 4CQLA 5IDWA 2OORA 4HFRA 2W2LD 4AJJA 1ULUA 3VZSA 1EK5A 4GVLA 2A94A 4KUEA 5GZ6A 1XLTA 3AY7A 3TZQA 3Q6IA 2YHIB 1I5RA 4NDNE 1LDGA 2PA3A 1LXCA 1Z75A 4KUGA 3WLFA 4BNXA 4TMFA 1CF2O 1DC5A 3WQRA 4YRDA 1LSUA 1VM6A 3IDSA 1IHYA 1IB6A 1LQUA 2ZB8A 4FBGA 4P4NA 5F5NA 4BMSA 1ZFNA 2DLDA 3K92A 1YXMA 4CPDA 4OKIA 4FCCA 1FDTA 4UVDA 1N7GA 3PPIA 5TX7A 3ZV3A 2Y67A 2WD7B 2B0JA 1AUPA 3PHGA 5CHEA 4CR7A 5BNIA 2FZWA 4DXHA 1KYQA 2QW8A 3G17A 3D64A 2J3IA 3OIDA 1ZK3A 3S8MA 3ETDA 5CEJA 2R00C 3UH1A 3UAGA 2HJSA 5CPFA 3ITKA 4EEXA 3NJ4A 2CF6A 4J90A 4K9DA 4XEHA 1A9ZA 2V6MA 1E3LA 3RUDA 4RZIA 1IULA 1HE2A 4JP2A 3PWKA 4IJUA 1ZMTA 5AVOA 1YL5A 5I8ZA 4DC0A 3DTYA 5F1OA 3RC2A 3SX2A 2RIRA 1PJLA 2DTEA 2JL1A 1JKFA 2J5RA 1K6IA 3AM4A 4RORA 5CEFA 3LC7O 3OSUA 1GD1O 2JAHA 2EEZA 3RCBA 5BQFA 1VKNA 4PLYA 1Q7CA 2DC1A 1U4OA 2NTVA 4E5MA 2FMUA 1QYVA 2X86A 4OHUA 3HDJA 4PLVA 4WEOA 5TT1A 4OL9A 3CKYA 1SOVA 4AJ2A 2HMSA 3O38A 4GWKA 4DLAA 2FRDA 1YWGO 4MPDA 5JDCC 3RJ9A 3WXBA 4RDIA 3ZU3A 4AVYA 1PZFA 5TIIA 4GBJA 1BXZA 4R1SA 2Q2QA 3TL3A 3FD8A 1JAXA 2CNBA 3E1KA 1T25A 3C3XA 4YVFA 4JJFA 3AK4A 5IN4A 4J4BA 3ZWWA 1U1IA 1LC3A 1I32A 2GZ1A 2HDHA 2QRJA 1LDMA 1EVZA 3EMKA 4BNLA 4NIMA 1Y9AA 3I9NA 4WOKA 2BH9A 4UUOA 4A7PA 1R4NA 4B7XA 4IY1A 4MVJD 4BNUA 3PHJA 3LDHA 2BFAA 4O1MA 4U0JA 5L7WA 3NTQA 1XIVA 2ZK7A 4BO9A 2ZTLA 3PJFA 4D44A 3GAFA 4WEQA 5I9NA 3BXXA 1B8VA 3JD1A 1YBAA 2IXBA 2WE7A 5DF1A 3KYBA 4J7CA 4BKRA 2I3GA 2W98A 2EGHA 3RBVA 1YGYA 3GOHA 2X58A 4NBUA 3AW9A 3R3SA 4D45A 4J7XA 4JP3A 2VUSA 2X0JA 1BSVA 3D0OA 5JCJD 1PS9A 1E5LA 5DCUA 4BB5A 4QTZA 3K2BA 2PY6A 3PQDA 1ULSA 4JJGA 4MP6A 3RIHA 4BQPA 1VL6A 3BHMA 4J9UE 1DC3A 3Q11A 2IYOA 3RU9A 2JCVA 4RF3A 1LEHA 1H6DA 1R0SA 1P1KA 4FD3A 1AE1A 4AJPA 1P3DA 4PZEA 1DLJA 1QMGA 3NDRA 4AL4A 2IODA 3HHPA 3GQVA 4IQ8A 2D5AA 3JTMA 2I65A 5A4DA 3BMQA 3W4IA 2I67A 4IS3A 1DC4A 3U3XA 2OP1A 4GQAA 3NX4A 1PX0A 2C82A 5C3MA 1PJBA 1F14A 2HK8A 4XJSA 3GGOA 3WTBA 3DBRA 5TJ9A 2GUGA 3T4XA 1R4MA 4CL8A 3AM3A 4IMPA 5ADHA 4GH5A 4XYMA 3OQBA 1YE3A 1ZO8A 5JY1A 3AFNA 1FDSA 1LDNA 2JD1A 1LSOA 2ZIZA 3A9WA 2WYWA 2NSDA 4L0QA 4RPKA 4YJHB 2Z1MA 3ZHXA 2VWPA 5KVQA 4E5PA 1PWXA 2OBYA 2ZYGA 2VN8A 1K2WA 1ZK0A 4R5MA 3IQDB 5CAEA 4CM6A 4EYEA 2X0NA 3M2PA 1UXKA 2EHDA 2Q3EA 2WEKA 1V8BA 1M67A 2G76A 2X6TA 2PH5A 1ENYA 2GN6A 4PN3A 2XF8A 3KSZO 3MWDB 3E82A 2AEMA 4K28A 4DLLA 5IN5A 1LBEA 3IIEA 2QX7A 5K0ZA 3GNQA 1YKFA 2HMUA 2GZ2A 4G65A 3GEDA 1HE4A 1PU2A 1ZCJA 4W7HA 5TGDA 4CMIB 4XGNA 4NI5A 3W8EA 3DZHA 5L3ZA 3ZNPA 5EMHA 4J0FA 4J9VA 4RCVA 3GHHA 2YDYA 2EERA 3TDKA 2JHGA 3JV7A 1HZJA 4GSLA 5HA5A 4U6SA 2ZTUA 4XD2A 5B12A 4NNJA 4L74A 3IP1A 3NDJA 1E7SA 1E7WA 4BNIA 5TS3A 1GL3A 5JDCA 2V6GA 4KDEA 1NPYA 1A4IA 3F4LA 1JWBB 3DAGA 4ND2A 1HE5A 4E12A 1GPJA 2H6EA 4UEJA 4OIMA 4ZRNA 5FEUA 3DMYA 1FDWA 4MO2A 1BXGA 3EVNA 3D5QA 4CQMA 5ICMA 5U9CA 4RVUA 4N7RA 3O26A 4Q9NA 3GDFA 1X0VA 3PLRA 2VHXA 2CVOA 3CIFA 3W1VA 4ZRMA 2VUUA 4I08A 1XELA 3E5MA 1R0LA 3HNPA 2Y99A 3DZJA 3A1NA 2WD7A 3FWNA 3OEYA 2QG4A 5H83A 4RF4A 1Q2XA 2Z95A 3JD2A 4GPD1 2FSVA 3TL2A 3VTFA 5EL0A 1DOHA 3IJPA 2DQ4A 4S1VA 4OJNA 1V6AA 1BWSA 3ZW8A 1JDJA 4IGEA 1P9LA 2GERA 3HSKA 3LVFO 4M1QA 3V8BA 3OF2A 1UR5A 3FTPA 3VPGA 5B4UA 4YDRA 1YQXA 4ZQFA 1C1XA 3WMXA 1P45A 1PTJA 1UZMA 2DU8A 3DHYA 4G2NA 3GLQA 3GRPA 3INGA 4BNJA 4PLZA 4BQRA 4LVUA 4YT2A 2PD4A 1VRWA 1NR1A 4CLRA 4TVOA 2EKLA 3QWHA 1GADO 2FP4A 1YO6A 4ZQBA 5FF9A 4BV8A 3RUFA 4I5GA 2BMAA 2H63A 3BHIA 5EJ2A 4CMAA 4CUKA 2Y1OA 3GHYA 1TXGA 3GT0A 4OQYA 4QX6A 5ENVA 5JPIA 1QYWA 1DSSG 1HKUA 1K6JA 1R66A 2JAPA 2RHCA 3DBHB 3SBOA 4DIOA 3ORFA 1ML3A 5JAQA 5HBRA 1FJHA 3P2OA 1DXYA 2Q49A 3MTJA 2RAFA 2ZCUA 3ADOA 2BGKA 3K96A 3ZWAA 1JN0A 3VPXA 4NBRA 2J6IA 2YY7A 4BV9A 1MXFA 1ENZA 1HTBA 1V35A 5TRTA 3TNLA 4UAGA 3ZHZA 3D7LA 1Y8RB 1I30A 1KVRA 5A04A 2HK7A 1CIVA 4UVGA 4B3IA 2EWMA 3W4JA 4ZN6A 1UXJA 3D5TA 4OYRA 1HT0A 3JQDA 5IZCA 3LC2O 1EUDA 1N1GA 1PS8A 1YQDA 2O4UX 2PZLA 2VYVD 5CDUA 2ZKLA 3LT4A 2G82A 2Y0EA 4IMRA 2B4QA 1M75A 3OBBA 5DDIP 3EVTA 4FDAA 4JCOA 3TSCA 1FK8A 1H6CA 3GAZA 2VWHA 4HFMA 4NQZA 5IZ4A 4OKNA 3WBFA 3OJFA 1V9LA 4YJFB 2ZYDA 3HWRA 4YBZA 1P1RA 4LK3A 2WJPA 2ZB4A 5G4KA 1T4BA 5AOVA 4RZHA 1KVQA 3IKTA 4PG7A 2UDPA 3VZPA 1C3VA 4RV9A 3AUUA 1EDZA 3H65A 4J1NA 3EAGA 2E4AA 4TRNA 1U3UA 1KVUA 2O50A 1B0AA 2NQ8A 2CDCA 2GGSA 1CJCA 3PJGA 3FHLA 3Q2KA 4A0SA 4CM8B 1Y5MA 3AFMA 4DVJA 4E2YA 4E30A 1DAOA 3IAHA 3OJ0A 3ZN2A 1GV0A 4A27A 4B7UA 2ZJ1A 1D8AA 4E0BA 4KDFA 2CVZA 2NU8A 3TN7A 3LQFA 5KJCA 5JLAA 1CDOA 1K89A 3HG7A 4J91A 3B1FA 3SC4A 4DUPA 4HFJA 1U7HA 4ALLA 5BR7A 3AOGA 4EUEA 1DPGA 1A27A 4YAEA 1GQ2A 1W8DA 2JD0A 3QVWA 2ZATA 4HWKA 2FOIA 3CMCO 4BNFA 4E32A 4HUJA 2NNLD 4J4TA 4MP3A 5G0TA 1H5QA 3UICA 3OFSA 1GYPA 1LLCA 3UOGA 5LCXA 1PEDA 3U4DA 4MVJE 1XQ1A 3E6AA 2B35A 3RUCA 2O3UA 4IQGA 3OH8A 1EEHA 4D3FA 3GUYA 4W82A 1PR3A 3E03A 1YOVA 3E9NA 3H5AA 5CFZA 5IXSA 1HDZA 2GN9A 3ROQA 3GY0A 1RM4A 2NUAA 2GYYA 3NT2A 1GQYA 1K3TA 3TQHA 3INTA 4D7AA 4RVFA 5I7VA 2QIOA 4PLHA 5A05A 4IS2A 4AJ1A 5CDGA 1UAYA 4XQ9A 4FJ1A 4MINA 3P7MA 4RL6A 1U7TA 4CM4A 2V6FA 3QVOA 2XPCA 2X1HA 3H9QA 3MWEB 3HDQA 4DQVA 5ICSA 3VAZA 4GAEA 1PJSA 4CMIA 2F00A 3CSDA 1ZIDA 4E6PA 4RGBA 4YT8A 3JSAA 3WNVA 4UEKA 1MP0A 4WLOA 4IUYA 4BO4A 4XZ3A 4CMEA 3K9QO 1XCBA 1Z74A 3R1IA 5THKA 1I01A 1HE3A 2IEDA 3L6EA 3PP8A 3OJLA 2QZZA 5HS6A 2FR1A 3JYOA 4ROSA 4MVJF 4GL4A 1EVIA 1JWAB 4XQGA 5JO9A 2ZJ0A 2WD8A 3UXYA 4F46A 4GLLA 4WKGA 2VZ9A 3ICCA 5L45A 1GEGA 1LA2A 4PRKA 1I2CA 3QVTA 4HKTA 3SJ7A 1QYDA 4IDBA 3LK7A 1DC6A 4DPMA 1ZK1A 3FPLA 3WOHA 4CM9D 2HCTA 1H6AA 2AW5A 3QE3A 4CLHA 1P74A 4CMKA 1XU9A 4CMGA 3CE6A 3E9MA 5COQA 2GZ3A 1X0XA 2VTDA 3BMNB 5THQA 4M55A 2PR2A 2GN4A 3U5TA 2D8AA 2IRWA 3AUTA 1KY4A 2P9GA 3DZBA 1PGJA 3P2YA 4I8XA 1GZ3A 1N1EA 1E77A 2YDXA 2VHVA 5B37A 2FSSA 5KOIA 3SXPA 2PGJA 4QEDA 5A1TA 5DCWA 1S7CA 4CV0A 1BG6A 7ADHA 3PQFA 3D3WA 4CJXA 1I3KA 4DIFA 1ZSNA 2DT5A 2YJZA 4R16A 3H2SA 4BNMA 2HKIA 3C85A 4ZQHA 5C5IA 3F5QA 5JCJA 1IOLA 2I99A 4FFMA 4BO3A 2V6BA 2JFFA 1DIRA 4IGFA 5EQFA 2W2KB 4DL9A 3GR6A 1PR9A 4CODB 3K8ZA 4ILKA 1Y1PA 1OBFO 1GDHA 2ZTMA 4EUFA 2DAPA 4K6CA 1GZ4A 2R2GA 3ANLA 3PHIA 4TRMA 1KEUA 2D5CA 3KRTA 5GZ1A 3RROA 8LDHA 5L53A 5AYVA 1T24A 5DBFA 4TQGA 1I3LA 3GMDA 2GASA 5CEEA 5AXCA 3ZNOA 5A03A 2FN7A 1GV1A 1UZLA 2V7PA 5IDQA 1DAPA 2O3SA 1M6HA 5EESA 4IDCA 3RASA 2DFDA 4O6VA 3D1LA 3MCVA 1VPDA 1N8KA 1SBYA 1YBVA 4KQXA 4CLOB 4NU6A 4RDHA 5K6AA 4CM7A 2NV6A 3WGTA 2W4QA 3SC6A 3ONDA 3QWBA 3QWAA 5I9MA 3GZNB 1V0JA 1P77A 1E1KA 4RVDA 1KIFA 3GH3A 3DO5A 4URFA 1EBFA 1C1DA 3EUWA 1DRWA 2Q46A 4MVJI 4BKPA 4GX1A 1IZ9A 2VRBA 1K0UA 5MGBA 3GMSA 5F1KA 3F9IA 4IM7A 4BO5A 3EDMA 4LVCA 2B4RO 2FPIA 2VRCD 4GX0A 4J1TA 4AJNA 5IFLA 5KVCA 1X7HA 4MVJP 5KIAA 1DB3A 2H1SA 3NGLA 4II3A 4UEOA 1NNUA 3DC2A 4WUVA 1KETA 3KUXA 1MG0A 2VNSA 1PGOA 4RJTA 1I2ZA 1ZSYA 3U4CA 2AE1A 2D2IA 1BDBA 4GSKA 4EJ6A 3G49A 4YAGA 2LDXA 5HM8A 4BNWA 3KO8A 4DYVA 5MDHA 2NU7A 1D1TA 4CM8A 2X4GA 1HDCA 4NG5A 4ZICA 5L51A 1XA0A 4Y6RA 1PZEA 3QV1A 3TOZA 3DBLB 1JVBA 3PVZA 3HJAA 1QXSA 3Q9NA 4YT4A 1L7EA 2AQKA 3OECA 2VQ3A 1OOEA 3COSA 3NT4A 3QWFA 4GKVA 6LDHA 1UP7A 3FRJA 5TJHA 4ESOA 3RAJA 3GFBA 3OP4A 1H93A 1B14A 4OH1A 3JQAA 4D46A 4GX5A 3JQ8A 2H5LA 4MIYA 1IY8A 3UN1A 2C2XA 2WM3A 3DQPA 1NHWA 3FTNA 1JTVA 2G17A 1VLLA 3JD4A 2Y1GA 4Q3CA 4AJLA 1R37A 5C7OO 1M2WA 1MFZA 1ZK4A 1G6KA 2GO1A 4WECA 1I24A 5JXWA 1ONNA 3I83A 4RVSA 5FI3A 1Y8QA 3WNQA 4FPXA 3PIDA 3GNTA 1PJTA 4NBWA 3ZWVA 4UVIA 1MB4A 2P5YA 2X9VA 2BI8A 5J23A 4R01A 4UUPA 2Q1UA 3NTRA 3A06A 3F3SA 1X1EA 4KP7A 4DPLA 2JKVA 2DVMA 4QUKA 2AG5A 5DP2A 5K6AC 1GR0A 4CV1A 3DFUA 3F5SA 3KZVA 1YBMA 2NLOA 1UUFA 3ZWBA 3F1KA 5JC1A 1BTOA 3W4KA 1ZMOA 3B1KA 1PSDA 1QORA 3I3OA 1G0NA 1Q0QA 4YA6A 1LUAA 1L7DA 2EG9A 3HDHA 3EY4A 4IPTA 4BNYA 4OXKA 5B4VA 4TWRA 1W4ZA 4U5QA 3VTZA 2PGDA 4W6ZA 3VVCA 4DBVO 4Q3AA 4M8SA 4YCAA 3CZMA 3ROKA 1KVSA 5L4NA 4C7JA 3AI3A 2DUWA 2JD2A 1I0ZA 4FC7A 2XXBA 4PRLA 4R51A 4XB1A 4M86A 4BL5A 2TMDA 3EYWA 1E3EA 2O3TA 4FR5A 3WDSA 5KCZA 2C59A 1LLDA 1CYDA 2AEFA
chains in the Genus database with same CATH superfamily
3GN1A 3ORHA 2FW0A 4AIRA 1CX9B 3EZXA 5L6LB 1OE0A 4CLOA 3AVUA 1N2IA 1WBDA 2AG0A 3NUZA 2PMFA 1BS1A 2G1UA 4ZV4A 4CN8A 1UIRA 2FMXA 2JDIA 2I2BA 2A5JA 2AEJA 2PT9A 4TROA 5T4BA 4CI9A 4Z7QB 5FWNA 2H7CA 4K1LA 4EH1A 4F3YA 3CEPB 3H5RA 2ZWPA 4MNTA 4KXWA 3ZV4A 4QXMA 4RXUA 1ULTA 4G0WA 5DSZA 1EUZA 3UCXA 3WE7A 5F3DA 4ZO7A 3SC3A 1QMPA 3T94A 3NYQA 1ESZA 2O06A 2QTCA 3EQ9A 2FFJA 4PYMA 2PDAA 2BBWA 2XRZA 1JWLA 2A0XA 1ISGA 4JJEA 3OHPA 4II2A 1O8CA 3CLRC 3O73A 3TIFA 4JLWA 1RWBA 4NMMA 5EMKA 4ZGBA 1RYMA 5B3AA 1Z9BA 2J3DA 1NATA 1W36D 2DBZA 2PT7A 2QLFA 1XV5A 1P31A 1HT3A 4WCFB 1LJ8A 2H16A 3QUSA 4IXDA 3MXOA 1AGXA 4FBMA 4IOKA 3AZQA 4XX0A 1XNQB 3GJ5A 4JP1A 2PWZA 2F9MA 1RKXA 1UXIA 4R1PA 3IOCA 5A0FA 1V7PC 3LMKA 1NV9A 3OUTA 3WYNA 1YF3A 3TW4A 4KACA 3NOQA 1OYOA 1QLJA 2PLWA 4H6XA 4ZT7A 3DWGA 2MWMA 3TLAA 3O82A 5IYZA 2HT6A 1YBFA 3EZYA 1V5FA 4U8GA 3KSRA 1DZ3A 4PG6A 2ZSKA 1ZW1A 4G8DA 1CRQA 5F2KA 4Q00A 2PRYA 4Q1VA 2G04A 4D3XA 4IXWA 4PSCA 3TB4A 3I01M 4P22A 1SUEA 3AB8A 3NHBA 4IDAA 4MARA 2I2XB 5DZSA 1BYIA 1VKOA 3AEXA 1A9SA 4Q1AA 4BQEA 4UCXA 3K0SA 4CTNA 2ILVA 4L0CA 5F9HA 5CB6A 4RPCA 5AP9A 4QEZA 4PG4A 4QBKA 4GUAA 5K8UA 2OE2A 3E81A 3PSAA 3U4QA 1HT1E 2PG3A 2Z1NA 1EUCA 1K8RA 3QKUA 4QQKA 2YV2A 4QBIA 2ACWA 3NJRA 4WLFA 5GJWC 1DNPA 2VHUA 4GW3A 3S2YA 1KP3A 4I4TB 1KRWA 2YZ2A 3NNNA 1RM3A 2XUQA 3QYAA 1ZNQO 2VEDA 2QEQA 2ZR0A 1G98A 3BYZA 3SIXA 2YV5A 5BW5A 4DM3A 4RPGA 4WGGA 3RVNA 2SBTA 3FROA 1AXEA 2PSHA 1IJKA 4GHWA 4YCCA 2G80A 2QL5A 3MGGA 4LMPA 4NEHB 4ZD6A 4CL3A 3GJ3A 1U8ZA 1SIBE 5TPZD 3EB9A 1K92A 2VR1A 4FFNA 2ORIA 2I7VA 2DPLA 2X4LA 2M6KA 3HA3A 4YAUA 1QJ4A 4WZAA 2CLFB 5HFJA 4A0GA 4G0VA 3AI1A 4EJSC 2EFCB 1SUPA 2HGSA 2ZBGA 3LYUA 5H4HA 4HJRA 1SHUX 1UL1X 2JFHA 4LTDA 1CVIA 1Z73A 3BH0A 4P6VF 5WRFA 4DLTA 4ZEVA 1DBWA 5JY6A 4KLZA 3QLJA 3LA8A 2P4EA 1BQ3A 1MO4A 3WKEA 1UC9A 1MX3A 5AVTA 3K9FC 2D8MA 1ZHOA 5K3BA 5CFPA 4QLOA 2QX9A 5HQ3A 3JQEA 2O5RA 2XOKA 2FLWA 4M9CA 5ER9A 3S2GA 2GVZC 4BJ1A 3CR3C 2O6LA 3THXB 2D7JA 1DRVA 1WKVA 3IQWA 1KPHA 2AIRA 2IHBA 3QPUA 5D3QA 3I32A 5CA1F 3UJCA 1WKCA 4MDEA 3AHCA 3EVEA 3NBQA 1Y5RA 4X1YB 2OAP1 1BMTA 1PP4A 3ZYCA 4B73A 1EVJA 3CIOA 3BH6A 4E5UA 3D3KA 1I0IA 5FLXA 3SQWA 1IY1A 1NRJB 2XIQA 3HZOA 5BPFA 2PTGA 3FWZA 2AMVA 3SBXA 1A88A 3CWQA 3RRBA 2VTEA 2WUWE 3D9QX 4P93A 5DGDA 2X5XA 5I4IA 3UAOA 2GESA 1UBLS 2GA9A 3NIDB 1CQIB 2Z04A 3UFBA 1SWVA 4BBPA 2DFKB 2X15A 5CYGA 4OO3A 5KYNA 1R9NA 3MA0A 5G41A 3U4MA 5AQEA 1M5TA 4G86A 4HAZA 1Z8DA 2BEVB 4WOCA 5L3SA 1BDHA 4YV7A 2GZRA 4B6QA 1VLHA 2VQDA 3O8QB 5KWJA 1Z0UA 3EIHA 2ZRHA 3UTCA 3TIIA 1GPYA 2J0UB 1GO2A 3R74A 4YMUA 3NEAA 5F2NA 3DB1A 3ABSB 2H06A 4BO0A 4EHKA 3UVEA 4IZIA 4X90A 2I4TA 1PYGA 4MR8B 2FQYA 2ZI3A 2EX1A 4HBZA 4AMVA 1JDNA 3ERCA 3QYJA 1PJ3A 3TW6A 5IJAA 2EGGA 1UJ5A 4ZDKA 2YXNA 1GNLA 5EY5B 4BRUA 2JVIA 5CDFA 1H22A 4UJ3A 1NFFA 3QW4B 2WHQA 3FHCB 3I12A 1A8UA 2W83A 3JCZA 1EE9A 1ZRMA 5CLLA 3E3NA 4BFUA 3E27A 4RKEA 4YMTA 4YHHB 1FC0A 2Q1XA 3JVIA 4JB3A 2C9DA 3SZRA 1DFHA 1P61B 1PDOA 4Q3BA 4Y1FA 4L5IA 4ZCIA 5IBPA 1MB3A 1JXMA 1VSBA 2B1RA 1OAAA 2B83A 3EXIB 3NG1A 4DQXA 1Y48E 3M7IA 2FZKA 3VH2A 2IC5A 1D4AA 1FEZA 2O52A 2RGYA 4YUYA 1N7JA 3DZCA 1JEQA 2PIAA 3BWEA 1P1IA 1VFNA 1GPDG 3MGCA 3S5JA 4XM2A 3W6UA 4F7WA 4F71A 2CV2A 3DYIA 1Q57A 2ZBEA 5M3BA 2HD4A 2GT1A 3LUKA 4EBBA 3NGXA 1JAHA 1Q6YA 5B55A 4P0QB 1NF2A 3GP3A 1N6IA 2FJ0A 4DHWA 2DM6A 2D2XA 2NU6A 4MP8A 5FUBA 4QVIA 1PRYA 1Y1KE 2KLHA 2PX3A 4HRXA 1S8OA 5DIFA 3G0HA 2OA0A 3GGGA 1X7XB 4YJHA 3L82B 1O6ZA 3BMOB 1JR3A 5CDGA 5IUJC 2NUTA 3SM3A 4W5NA 2HYIC 1WHTB 2HJHA 4CCAA 5K09A 1X38A 2REQB 1Y4UA 3KTFA 1U98A 3TRKA 5KYYA 1E96A 2QL7A 3MLBA 3SHWA 2PYIA 4DF3A 2OC9A 1G9SA 3DMTC 1XL1A 2BFDA 4MQBA 5BN3A 3RQIA 4HQFA 1AVTA 1XKTA 1I4WA 1XRQA 1PZNA 1E6WA 3UHJA 3LPLA 5DT9A 3W5JA 3M1IA 3IT2A 4KQ9A 5IHPA 2YZ7A 2HEIA 5CH5A 4C0XA 3GGJA 5J63A 4PF1A 3R5JA 2GILA 3MTAA 4JVOA 4C29A 2NMVA 4MIOA 5A4MS 2R6CA 3AESA 3DEAA 3TLZA 2A7XA 3N70A 5AW1A 5IVPA 2O7SA 2HADA 1IWOA 1SXJC 1E66A 3LBIA 3LPNA 4MIKA 5IBQA 4YR9A 2AR0A 3RYFB 2FG5A 3VHXB 4BO8A 1IEXA 2VH1A 2YC2C 5AXDA 2I2CA 3ICPA 1XZIA 2QRKA 2VQFB 3RAEC 2HPAA 3HYLA 1EP3B 1NVBA 1TYEB 2FP3A 2HCFA 3HFSA 4N6GA 4NS4A 5ALHA 1EX9A 1VKZA 4EZBA 1H94A 2OV4A 2N9UA 4S1OA 1E18A 1NJ6A 3S1SA 3ZE9A 2OCKA 4TVBA 1GYQA 1TUGA 2F2TA 4Y6LA 4CCYB 4KODA 3O7WA 4YO7A 2I8LA 2JH8A 4K9NA 2XOXA 1PWHA 1TF7A 4H18A 2F1HA 3GRAA 5IDVA 1E9RA 1KMCA 1DHTA 2JRLA 3RSQA 1ISHA 4CT5A 2SKDA 4HMPA 4DCUA 1ORDA 1FMLA 2FSUA 5EHGA 3AR6A 4EJMA 3CV3A 5M2QA 2JGAA 1L7AA 4EJSB 1NN3A 2AZTA 3QU2A 4HH4A 4KXMA 3QPBA 4J0DA 1SK9A 2HU5A 4ZXPA 1FTWA 2V55B 3IPRA 1WZIA 1JECA 2J48A 4L8LA 4MIEA 4OGLA 1LVUA 4QJBA 4WFQA 3RJZA 1FYFA 1O58A 3IMFA 4E1AA 3B1WA 4LBWA 3QLVC 1T0IA 1XXLA 1CJKC 2XNSA 4B82A 4ZKEA 3OQIB 4OHCA 4D25A 1R0YA 1BDJA 1QDLB 2G77B 3TO5A 2YKGA 4XCQA 3OLWA 3R09A 4G5FA 4D9KA 4E09A 2XCIA 1O03A 1M1YA 3PFWO 4FYWA 2AI3A 4MW1A 2CLEB 4DKJA 3A6KA 4OK5A 1AZTA 3FOWA 5L40A 4N0QA 2X22A 2O2CA 3NVMB 4JQOA 1ZD5A 5CCDA 3ZV7A 5C4MA 3A3YA 3TVYA 3RO7A 2XR1A 1PUJA 2QLMA 1AHIA 4DSUA 3U7QA 5EP4A 2QN2A 3DFIA 4BRZA 3K0HA 5LC1A 3TLJA 4ENQA 1T34A 1K27A 4M9RA 4HV4A 2ZSHA 3KR9A 1IEWA 4OQZA 4IO1A 6ABPA 5BQPA 3DQQA 2R62A 1OH8A 1TD9A 3N2YA 1FS4A 3VOSA 3QQ5A 1JP7A 3V00A 2I6UA 4JLAA 3V4OA 4O08A 1IZ0A 2FOLA 2IBTA 1ZOLA 3WISA 1QQAA 4L0DA 4NAUA 4LRYA 3FR7A 1NXTA 5BN4A 5HCUA 5C7IO 4BZXA 1E9AA 2H1OA 3K70B 1H1TA 3B5EA 3CSSA 3AR2A 1E6MA 3F78A 1EB9A 2EATA 1I80A 2Q50A 3ABIA 2C5SA 4S1PA 2QZ9A 2B99A 1O9BA 2JC3A 1H5NA 3ZK8A 3HEMA 2A1IA 1M1NB 2YJNA 3R3JA 5T67A 3W2GA 4P4GA 5ALOA 4M1KA 4DIDA 4YRBA 3S7TA 5D1NA 3JASB 2QVYX 2WTNA 4IP0A 1SXJA 4LSMA 3I0NA 4F9GA 3TTWA 2R5NA 4QRIA 3OJEA 1BRMA 1F8XA 2EXXA 3BF8A 3DTTA 5ESXA 1JEJA 3SE0A 4EMBA 4H7IA 1EIWA 2W2XA 2BM0A 1TM1E 2ZU6A 4GVXA 4G01B 5CJ2A 1KIAA 2XD9A 1XG5A 2F1JA 2VAXA 2Q99A 4AJIA 1MNQA 3RSLA 4NPCA 5TV2A 1XYVA 2W6JD 4YJ2A 4G4IA 2QN3A 3LCJA 3OVMA 5G1PA 1KJ8A 5JSHA 1L4YA 4L7QA 4WNAA 3FFXA 1IDN1 3ZPXA 3K4HA 4MGZR 1E64A 5AIAA 1MDFA 3SC2B 1NQ5A 3D7KA 3WHLA 2AKEA 1E61A 4ALKA 4BGEA 2WHYA 3R0JA 1IHUA 1PDVA 3A10A 4I1VA 1DXQA 4XH9B 4XIJA 1XDGA 2J5XA 3PFCA 2W2LA 5K05A 1NQOA 2V6JA 1FXWF 2WMYA 2X4IA 3AP2A 4I9GA 1VSTA 4QUGA 5FNZA 3LWBA 4Y2JA 4MQEB 1HZZA 1NP7A 4KPUB 4DZRA 3OSZA 5JFOA 4MVWA 2WAXA 1U2GA 2WPDD 4JOSA 4LOHA 4D43A 1GN9A 1FP4B 3VR4A 3IP5A 4XGIA 3VKUA 3G2QA 3KLPX 5DOVA 4CLEA 4PSVA 1C8LA 3VU9B 4JUAA 3RFXA 4YLEA 4A9AA 3LYLA 3WC4A 4UTOA 5FDFA 4L4SA 1W76A 1QANA 5FV7A 2P7IA 2EWVA 4JQSA 1X7ZA 5EG5A 2V4UA 1XEWY 1UFRA 4PLCA 4C7VA 3IIIA 3F7OA 4IF4A 4YXWD 2FPGB 2ZCVA 1R88A 2B61A 4RJIA 4DC9A 1DJNA 4IHJA 4KMSA 3FNHA 2CL6X 4UUBA 4WK2B 1ZK2A 4ZCPA 3KKLA 3V1NA 3VFDA 1NW5A 2VYNA 3MPOA 1ESMA 3OETA 3PKIA 2BF7A 4EUKA 3PC3A 3OQ6A 2QJWA 4PIVA 1TM7E 3AHHA 4EPRA 3BWBA 1SN7A 3RSSA 5IF3A 1DO2A 1F5NA 1UC4B 3MQFA 3F73A 4UULA 4MWTA 1AQ6A 3GJRA 2CVFA 4IBOA 1QV6A 2SKCA 2RI0A 1J5EB 2DFLA 2Y0PA 3G2NA 4N7MA 4CTKA 1Q7BA 5TY0A 3MTDA 3ROZA 1QRDA 1II8A 3G1UA 5BSHA 1PTJC 1RJEA 2CDBA 3AEKA 2CFIA 3EIXA 3WL5A 2NTNA 4L07A 5DHAA 3R75A 2X7JA 3RFUA 4YJ2B 1VGRA 2GPWA 1OXSC 4IVNA 2O8BB 1PSWA 3N7AA 3GAMA 3TOVA 2BE7A 2JLBA 2Q4DA 3DR5A 1JSCA 1D1QA 2YV4A 3IKVA 1F0PA 1M8PA 3D6UA 4DIKA 2W2PA 4Z0TA 2J1LA 2ID7A 1AB5A 3N76A 1Q7EA 5CPBA 4YALA 3IOYA 1NU6A 4LVOA 4Q1DA 2GPBA 2PYDA 2XYHA 4TX1A 4ALJA 2QAIA 2QP3A 2Z6VA 2F1OA 2W8BA 1DE0A 1NM5A 2WU4A 4IQ4A 4YECA 1PQPA 3UWPA 2AMFA 2JCYA 2D5IA 4GZLA 4TS3A 3PYMA 1A5ZA 3WK5A 3ZZUA 4CR6A 2QSUA 4JGGA 4WCDA 4FLEA 2HZBA 4D9NA 2IBSA 1E5DA 1ORVA 1VE5A 2KB0A 4OA5A 1OF1A 1W96A 3BFKA 3HDVA 3IVCA 3LBHA 4RCZA 5BMVF 3SHQA 3QVXA 3K5IA 2AI1A 1GAWA 1HRKA 1JPJA 3PWSA 2ZJ7A 3A3KA 3SOZA 3W9UA 5JCXA 2GN8A 2VA9A 3U44A 1B6TA 1B23P 2Z98A 2CMHA 1A9TA 1ZJ5A 1Z5PA 2QTGA 1HDGO 4OEHA 3LGAA 5JWHA 3R7AA 1OIWA 1O94C 3PX2A 3R5FA 1E98A 1FFCA 4MKXA 4QYIA 1EMDA 2A0WA 2P3QA 3Q5EA 4I5IA 2GPYA 2GWHA 4TM7A 4EYSA 2Z5LA 1NFQA 1ZG3A 1ZD2P 3OJCA 4LK2A 3FDFA 3JQAD 2R25B 3STUA 2ZT6A 3OE7D 2WNHA 3ZWMA 3PVCA 2BTEA 4OQDA 1PL7A 4BIIA 1UFOA 3BD7A 2JK1A 4L5BA 2BFOA 1E2IA 1TJYA 1YKGA 2FR0A 3QZUA 4OXNA 1SPXA 1UKAA 3JQ8B 3UWKA 3GA5A 4JIGA 4ND3A 5LJIA 4OXYA 4M9UA 1U2GC 3QOFA 4EMSA 2CUZA 1ZM9A 2C20A 3EK2A 1HQKA 2Z2XA 4YMVA 4XYBA 3W8DA 4QXQA 1D9XA 4O2BA 2WIAA 3WRVA 2GHTA 3JZFA 4R8VA 1M2HA 3I5YA 1JIUA 1U31A 4BVHA 1E2DA 1OFIA 1RMQA 3HCWA 1A97A 2CLDX 2XUZA 3UATA 2FSIA 2PWAA 4FCWA 3ILHA 2EKQA 2ZBVA 1JLMA 2Z83A 2XQFA 1HSOA 3H87A 2YYZA 1JV2B 1LTQA 3GNLA 4QL3A 3IV9A 3BTVA 1L8QA 4Y2HA 1RQXA 1P4JA 1XI2A 2O2SA 3TNYA 2O8CB 1P62B 2OWEA 2A5GA 4RZ2A 4JT4A 2MYTA 1HNWB 3ZC3A 4HEJA 1C5KA 4W1SA 5T6MA 1LK5A 1A3CA 2RGNA 2X23A 1BVYF 1VMIA 1IIRA 1DUVG 1NX6A 2OTCA 1FZTA 3U3MA 4C22A 2ZWOA 3IOEA 1V8PA 4ARBA 1EGHA 1JU9A 5I9SA 1PL6A 3FZGA 1ZM4A 2BPOA 3PWTA 1UMBB 3OE1A 3G79A 3U9LA 1I7NA 1SKBA 2ILTA 2X1MA 5LQAA 4LXYA 3REGA 4D8YA 4OP1A 5I7UA 3PQCA 3I9MA 4IYJA 1ETHA 4CZ2A 1U3GA 4O3FA 4XJTA 1HYEA 2P3LA 3TAXA 2BR5A 2ODTX 4C4YA 3N0WA 3E3AA 2GEUA 3RS2A 1FFWA 3VC7A 4BDTA 4KHZA 4LV8B 4FP9A 3ST7A 2DG2A 1NSYA 4LJ4A 2GXAA 3A4YA 3GDWA 4L4RA 2AR9A 1RRPA 5DNUA 3EIUA 4UTNA 2JVKA 1SU4A 2TECE 3UUFA 4AAYA 1W59A 2FDCA 2OG2A 4D4LA 3NMUF 4XARA 1SXIA 3OOYA 4GOMD 2H18A 5GJBA 2HWUA 4KQFA 1NBOA 2ZBDA 4IOMA 3CZ5A 4IDOA 1VE6A 3D3WB 3KJFA 3FYHA 4JJ8A 3KPWA 4MUIA 4B32A 2GN1A 2ZYVX 1H65A 2R6FA 1PS0A 3RB8A 3KYCA 3R6DA 5A3VA 4AURA 2PR7A 1PJCA 3VPCA 5IT9A 1Z5UA 3K3PA 2UVDA 1IHXA 1RMTA 2J4CA 1SKYE 4NY1A 3RVRA 3RYIA 3UZUA 5FQNA 4AX4A 3AHDA 2G5TA 4JI8B 1UBTS 1N3YA 3NATA 3A6HA 3VGJA 4YRFA 1W30A 1ZJYA 3PF9A 1T29A 1EVKA 5EN4A 1A1SA 2QTMA 1LSJA 1T3TA 1UJ2A 5KCMA 1N0WA 3AF1A 4QYSA 3INNA 1F2DA 1WG8A 2VSXA 3PNLA 1WHSB 5KTOA 3BAZA 1Y6JA 3KB8A 3KDPA 4Q3NA 3DSRA 4RESA 4F5EA 5L3QB 3R0XA 1WMBA 1Y34E 3C5CA 1Z0ZA 4P92A 1EYZA 2DHRA 3OEWA 4P54A 3EGDA 1BS2A 1ODLA 2E4XA 3DNMA 3EA4A 4PAOA 3I4FA 1D7OA 2CD9A 2ZUDA 3MB8A 1Z0AA 3WBJA 1HV8A 3BPSA 3H4VA 5HJ2A 4EO7A 3NP7A 1OFGA 3LF2A 3OO0A 4RD3A 4TS1A 4YN3A 2TYSB 3DMDA 4C2UA 3T5PA 1DC7A 1KI6A 1J4AA 3SQMA 3SZLA 2GF2A 1H2BA 1FTGA 4MDYA 4Q7MB 1DG3A 2WSBA 2XGOA 4MUAA 5TF0A 1CEEA 4EG1A 1MJGM 2QRMA 2F3QA 1XDUA 2HRZA 2QYTA 3ETEA 3MXTA 1R4AA 4LHEA 4WTOA 4Y98A 5JMWA 5LB2A 3PX7A 3PQEA 3L8HA 3SEAA 1YZYA 4LDNA 1M2JA 5DLDA 1EDBA 1MBZA 2JFVA 2Q41A 5CGZA 3I2GA 3G9TA 2CW5A 3WL7A 3I5UA 2DFVA 5BVGA 1QFZA 4DQUA 4I66A 1Z6AA 2MYNA 1T4DA 2XCOA 3NVAA 4OHWA 4UE3S 4CM4B 4LV5B 4RL4A 3QELB 3LHKA 4BU1A 3TE6A 2JLRA 4KZPA 4RTJA 2X6RA 4L27A 4UM9D 2PZBA 1QX4A 3NZEA 1EFVA 1EUDB 4H7PA 3H7AA 3EGWA 2EFYA 1RTKA 2V1UA 2C5HA 2P9TA 2EDCA 4HGRA 4R3NA 3TCNA 3TOCA 3ZHBA 4Z7OB 5ITSA 3BCUA 2PBRA 4MW6A 3Q7TA 1AT1A 5A5GA 3C6ZA 1ZNXA 4G4JA 2AN1A 3MJCA 2H4JA 1PE0A 1LNZA 5KQMA 1K0FA 1JAYA 3QF4A 3EZ2A 4HS9A 4D0NA 1I8TA 1WX1A 3RTCA 1MB2A 1KI2A 2B25A 4RHUA 2WFAA 2ATIA 3ZD9A 1ND6A 3PNOA 5AKGA 3EJ6A 5ICFA 1HE8B 2PPVA 4P4LA 2C5EA 3GD7A 1YR2A 1REQB 5HUHA 4V0LA 1FQOA 2XYPA 3FFTA 5LBTA 3GDHA 2JKYA 3W9YA 1LWOA 1XGKA 4W1QA 3NV9A 4LNUA 4YRGA 1RHMA 2JEZA 3O47A 3HL0A 5JADA 5EQDA 3WGIA 2Q2OA 3CH6A 1H5UA 1RT9A 1ISJA 4WKPA 3HXTA 1JEEA 3KHUA 3UPDA 1CD5A 4MVJA 5LP6B 1ICEA 1H9BA 1SZJG 4D80A 1UBGA 4MYRA 1WMAA 3LY7A 4MI6A 4WKCA 3HGMA 4NV1A 4LFCB 3TD9A 2XIJA 5LXTB 4LDQA 1M2VB 4V1CA 2YJ5A 2IOHA 1GFSA 2CNNA 4DWWA 1FW6A 4RQTA 2AE2A 2B8NA 2P6OA 2WBLC 4Q93A 1G8PA 3KVNA 2CFSA 1D2HA 1J2JA 3O2JA 1XTIA 1ODJA 2R6HA 5BR1A 3TR5A 4AICA 1DIOB 1NXPA 1PK9A 1SVOA 2I3AA 1INLA 1ZGCA 4TL6A 4M8LA 4OGWA 4LV6A 2FZGA 5DK6A 3NAGA 3ZI0A 3VV3A 4ATNA 4KQEA 1L1FA 2HIHA 2Q9BA 1WF3A 3HKBB 4JNKA 1MH9A 1XRLA 4ASUD 5K03A 3CSUA 4C3VA 1FSZA 1E9SA 4XPZA 3QUAA 4EITA 3IAUA 2PIDA 4ZT4A 1V96A 1OB5A 4IDFA 2ZTHA 1JS1X 5J2UA 3RAGA 3AU9A 3D8SA 2OM2A 4C7KA 1QS0B 1N3BA 1FFDA 2Q0XA 3FZQA 3OO1A 3SHOA 3THYA 4XM1A 2YWXA 3QHPA 2VIIA 1U0TA 4KWIA 2Q2WA 1SB8A 1S1CA 1EGVB 4YWJA 3GVXA 1GRQA 1Q1NA 1JKMA 1R5NA 2OZLA 1L5RA 1NT4A 1TE2A 1FP4A 2OXRA 3MTQA 4URHA 4Y7CA 4Z49A 4IIJA 1SHLA 1WMDA 2C96A 3L6OO 2IHNA 1G18A 2QMOA 3LCRA 4CQMB 2PRJA 2BEKA 2Z2JA 4Z51A 5CD9A 3ZZMA 2AZXA 4EI2A 3H9JA 1V3VA 3ZXXA 4NMWA 2RGRA 1UDBA 1UZAA 3PTAA 2YWFA 1YOBA 3PYLA 5CRIA 3DD5A 3WRWA 4E3WA 1P19A 4FW9A 1SB9A 4CMJA 3H4IA 2I6SA 1IEQA 3HB4X 5HM6A 3SQXA 3TKLA 4Q4DA 3RG2A 5JAOA 1E5TA 2C8VA 1E6CA 3SLRA 1NC3A 1HG1A 1KDPA 3EG9A 4YR7A 4DV4B 1SZPA 3N7UA 4L22A 2ZKIA 4MQ6A 4OLFA 4JGBA 4TMYA 5ESDA 2Y1WA 2G88A 1U3WA 2REBA 3KLBA 3ZHTA 4CEHB 4W8OA 4DUYB 2HRBA 4AS1A 2BZGA 2JBAB 1P0MA 1V8DA 2AKAB 1MOQA 3EA5A 3C98A 3KKNA 3PEFA 4AN0A 5A1JA 2NSJA 2HTEA 2ZYWX 3U4IA 1NI4A 3ZDZB 2OZEA 3GGPA 9MHTA 3Q0EA 1FNBA 1TF2A 3JS5A 3NVDA 3RUHA 3WKBA 1K68A 1Z5ZA 4KK4A 2HTFA 2RCYA 4CIXA 3PI7A 1YFJA 3ZD7A 4ABTA 2XTMA 3AERB 1C0EA 1R0XA 4B4VA 1D0SA 4R81A 3TVDA 4DA7A 4UUMA 3CG4A 4MICA 1EZ1A 1G5TA 3RR2A 1PT5A 1OC4A 2PGNA 2X9NA 4KSYA 3OPYB 3IODA 3ZNQA 2DCUA 4K3VA 4CIVA 2R1VA 4JC8A 1Z3IX 2CV1A 2FWRA 5JVDB 2EGUA 5IC4A 4RZQA 4ARZB 1GNTA 2P6NA 1D4OA 4IIJF 3KB1A 3GLIE 2EIHA 1LI7A 4M1TA 4CE6A 4YPOA 1WD5A 3KKZA 3L2OB 4G5RA 4E13A 1Y37A 4B0PA 4D4MA 2GRAA 1CZUA 2RJNA 2HHAA 1E6LA 2FU5C 3BC1A 4JN6B 4NK4A 3VZBA 2F9FA 5EIEA 1TT5A 5T5QA 4DCVA 3FTDA 4OI2A 1E2GA 3T4EA 1P0QA 2AVNA 3C6BA 3ORYA 4I4CA 5EIBD 3F6BX 1WLSA 4F3KA 5BPHA 5HQTA 1I1OA 3O9ZA 5FD8A 2ZRPA 5FBKA 4L28A 2LVBA 3MERA 3GGDA 2IOFA 1LRJA 4FINA 2OT3B 3NRJA 4NV3A 3V1TC 3OMXA 1XO1A 2BM8A 2ISCA 3DKRA 2AFIA 5TPWB 3HI6A 1YZKA 2MTBA 2IH2A 1NV8A 3DNPA 2CKDA 3D81A 5LDGA 2JEOA 5I5EA 1XQ9A 1NN1A 1U3VA 1SQ0A 1XTSA 4IJKA 4IXTA 4YEDA 2C3UA 4KFSA 1C4KA 4F3NA 4JYCA 3FRIA 4X1IB 4UHJA 3LUAA 4G1CA 4L75A 4OQMA 3ZW7A 4B6JA 2X1LA 5CT5A 1C7FA 3IQXA 2Y4NA 3SF8A 1Y4DE 5KWVA 3NEYA 4DJ5X 2R11A 3OTOB 2D1FA 4NK5A 4IWXA 2V7XA 4LF8B 6Q21A 5DMHA 4PPNA 1H0RA 3V1UA 4A36A 4OFZA 2EL7A 2Y6VA 3LCUA 5BUQA 3DUFA 4IRUB 4XVRA 3EH1A 4WFKA 4DB4A 4HO1X 1R12A 4P33A 4JBIA 3WK8A 4NHOA 3HI4A 3I9JA 2YY5A 3BH7A 2DWOA 2TS1A 4M89A 2NVUA 1SRRA 1HLPA 2LR0A 1JKJB 1Y82A 3EZNA 4QDJA 4P84A 3DZ8A 4B1FA 3ZHVA 1EP1B 1KQGA 3PXEA 1IAQA 3BN3A 2OZVA 3AR4A 3D8UA 4QPDA 4DANA 4B8ZA 2O4CA 2GEDA 3VPFA 1MO6A 3E8SA 3IR5A 3ZJ4A 2LV8A 3FNFA 1A72A 1JLHA 3VR5A 3IO3A 2GKGA 3EEQA 2RBKA 4W8GA 3HWX1 3ANNA 4I9NA 3T3EA 3VO2A 3T1NA 2YHSA 5I9TA 3RUIA 5EQTA 2CCKA 3DKIA 1JJAA 3K1JA 4RJJA 3T61A 3BB4A 4CLXA 3FX2A 3C6QA 2JLAA 3TH5A 4DILA 2FG6C 4MA4A 1Z6YA 4G5OA 2PZKA 2P4QA 1NWHA 2FPIB 2HA5A 2JGLA 4Y2YA 3J81A 3K6JA 2QK4A 1DBVO 4M1EA 3B9PA 1VJ5A 1QGUB 3CMMA 4PR0A 4EHAA 4CFYA 2FUCA 1D09A 1NM5C 3KTDA 3CF6R 1EG7A 4GP7A 2XB8A 3NP9A 3GJQA 1B7GO 1J8DA 2EW8A 2XXAA 2O5EA 2ZDGA 5LP1A 5K3AA 4LOLA 5JAUA 2FFBA 4UD2A 1QFJA 1PQYA 1RXWA 1MCZA 1ONOA 3I9LA 1A7KA 1ARZA 1JDSA 4HH0A 4KYIB 4TS9A 3ULKA 2BHSA 3ZKWA 4M38A 4F97A 3DAPA 1ZY2A 2EDAA 3R7WA 3GLGE 4H1WA 5KTSA 1T2FA 1XZDA 2CD7A 2QRLA 1MMFB 1R0BA 3NEJA 3WGYA 1H1LA 1Y8CA 3WO1A 3O0DA 2FKNA 5IHXA 3O8NA 3RRMA 5JSZA 1CERA 1UOEA 4OY3A 4UAVA 2J9FB 4NONA 4UDYX 1O94A 5E7MA 1VHTA 1DVRA 1FSPA 3IAXA 5BV2P 4JI4B 1VBFA 3UHAA 3GF4A 5KYXA 1WNTA 5SY4A 2C83A 4MYTA 2BEUB 2IXAA 1TQ6A 3QX9A 2E21A 4BE7B 1JB9A 4GC5A 4UBJA 3NBXX 3TRFA 3KJHA 1Q0RA 4MYDA 1IDOA 2NX2A 5K8CA 2QNRA 1GSIA 3C4QA 1JIVA 1WQ3A 3EHEA 1WZEA 2E82A 3GLVA 3EDOA 4RU1A 1JYFA 4UOZA 3GU3A 3CINA 3N2ZB 4KYTA 2OOKA 3L7BA 3FSGD 3EVFA 1JEAA 3D2AA 1NBHA 4BMDA 4EA9A 1DWOA 1YV9A 2Z8YA 3NHYA 3JW8A 4HNHA 3I76A 4YRSA 2X2OA 3WS7A 5JD4A 3QPDA 4QDTA 1OH5A 4IDDA 1MEOA 1VJDA 1WVMA 4XVCA 1U4SA 1JA1A 3VXKA 3OZTA 4ZVVA 5AUNB 5LYJF 5MGNA 2EHJA 4O2AA 2E6UX 5IC6A 4CLDA 4CRWB 1PK7A 2PJUA 2RK6A 2DBYA 2X0IA 4FGKA 3SS7X 4X7PA 4CU5A 3ZW9A 3CJQA 1QVRA 1XQVA 4OVKA 3UT6A 3TPCA 3Q3CA 1QO0A 1T3GA 4FZRA 4QRHA 4IQFA 4CUJA 4E21A 1YRYE 2X2FA 1U6IA 3H5VA 3P96A 2B30A 4N8EA 4R9NA 4ZU1X 5LQKA 1JG3A 1XNHA 3K0EA 4ZCLA 3C97A 3VR4D 4BVJA 3W3ZB 1QOQB 2H4XA 1AKQA 1AN9A 5LJLA 2YZMA 3HVUA 1OU4A 4IIJB 3TNDA 1A5BB 2SNIE 2XWQA 3R5XA 3P9CA 3NC0C 3AYZB 4G89A 4K8RB 5DNDA 3L8EA 3IL2A 2OGUA 4LJSA 3G1TA 4FFMA 2JHPA 2VUHB 3F5FA 5E2BA 5GIOE 4YBRA 2WF6A 1K5HA 2IPLA 2NO6A 4B79A 4OX9Y 2W6ZA 4YTEA 1HSZA 1PLJA 3PD1A 4ITVA 5CHYA 3FVQA 1RJ9A 2CZCA 1SEPA 3L0YA 3TJMA 3WLAA 4P80A 1RYEA 3UWSA 1JZQA 2JJMA 4NESA 4TL8A 4TTRA 3IPXA 4H3HB 3G2IA 3VBEA 1L5LA 4Z54A 3LP5A 2B1IA 3LT2A 4XW2A 1RYDA 3AFIA 1Z82A 1NF9A 4LX0A 9ABPA 1CJMA 1FSGA 4M98A 4MQ5A 4A5OA 5K4HA 1SFRA 3ZCPA 1AHHA 3AJRA 5EGNA 2IYLD 1J2YA 4OQFA 5K7SA 3NTOA 3GPDG 5BNTA 2P75A 3QPWA 2IHTA 1XPUA 5T6BA 5JRJA 2FKAA 3D7RA 4C0BA 5BW4A 3BRWD 3GWGA 5KTRA 5AI0A 3C8MA 3QE0A 4XB2A 2VH2A 2G09A 2CLOB 4ISCA 1P44A 2PFKA 3B13B 3DO8A 1XWFA 5GOTA 5B1YA 2R4TA 4IMJB 3D4OA 2C04A 3I45A 5CA0B 3OFVA 1HDRA 3MS2A 3PEYA 3F71A 3FSRA 1VI2A 1ZGBA 2C4HA 3WJ1A 5D6OA 3JD0A 1MQ8B 2AXNA 4J43A 4PINA 2Z2IA 1EHYA 4QM6A 3DZDA 1KDOA 4L78A 1JDBC 4TWZA 3KQLA 4ETIA 5IDYA 5C4GB 3VSCA 1N3LA 3FY4A 4J7AA 4UTVA 2ZVJA 2IE8A 2PXCA 1FNNA 2V5VA 2XEDA 3A9TA 3GEMA 3KCNA 3WGQA 4UHHA 5FQOA 3W7VA 5AOBA 2IDZA 2G4LA 4IDGA 1XTTA 5LP6C 3PQ6A 4HQ0A 5CT9A 1VZ3A 3MMNA 4H1TA 4A10A 2FUG6 1OTYA 4JQCA 5BSFA 4H15A 3Q3IA 1QPGA 2QVBA 3H2YA 3WB0A 1DV2A 1FYWA 3RH0A 3SYMA 4YRMA 4Z4EA 5EWMB 1QZTA 3SFTA 2YWBA 3JQFC 1L7XA 2ODBA 1WVGA 4J6FA 5HDBB 1BW9A 3RD5A 4YCNA 1Q3KA 3HKDB 2VXBA 4FEEA 1PO7A 2IT1A 2KHZA 2IPNA 3N05A 5IH3A 4EQ6B 5JHHB 2NWQA 1B1CA 1T36A 4MV1A 2VH5R 5KJ1A 1NW3A 1TKAA 3EISA 3N5CA 5CB8A 2C7GA 3FLBA 3RNOA 4JI0B 2XB9A 4OYHA 5EPUA 3S29A 4MAMA 4A2QA 2Q8QA 3Q2IA 4Q3DA 3CH5A 1EPUA 1PT7A 2B1GA 1J42A 4BNDB 5EZQA 1YJ8A 1DFGA 1NQTA 2NUPB 3OT5A 3OZIA 2JH9A 3M6IA 1X7WA 1WV0A 1IQRA 1MIOB 3ZS8A 2QPAA 4URZR 2H4FA 1Z5WA 5H3HA 3FDZA 4IRMA 4MS4B 4GR5A 2GNAA 4FBLA 4P4UA 3YASA 1ZZEA 2PJZA 3A6GA 4AY6A 3X1DA 1KJ9A 2Q6TA 4ONEA 5FA6A 2WAAA 3GUZA 4O3MA 1M73E 4KQIA 1V5GA 3PDJA 1UP4A 1GGJA 3DVQX 3RPEA 3GCXA 3HJRA 1PFYA 2P91A 4PGHA 2B6NA 4TKLA 4B8WA 2R4QA 3VR6A 2VHWA 1DKQA 3KUCA 5K0NA 4CGYA 5FH9A 2VLIA 3OLXA 1BE8A 4KR0A 4Y2VA 2JANA 4QGBA 1L1RA 2A2ZA 2CNDA 3E22A 4Q02A 4JBNA 2OCBA 3IE0A 2QZJA 3U1VA 1SAYA 3TMAA 1W1WA 2P62A 3R24A 3LZCA 4L5AA 4WLUA 1N2CE 5B1HA 4H4EA 1P1CA 5ECDA 4OQ4A 2QYOA 4BJ3A 2Q1WA 1XMQB 1EVYA 4LUCA 4EFMA 1SVIA 4NU8X 4Y67A 1FP6A 2ZTVA 1M2GA 3EZFA 3RC1A 4NXNB 3I6BA 3DW1X 4OCZA 1CUXA 3ZU4A 1BNCA 3KTAA 3RYCB 1JR4A 3HVKA 1HOXA 1DTWA 1U8XX 1ODKA 1TT7A 2GNPA 2XT0A 3A1EA 3CPJB 4U3JA 3ZY4A 4C89A 4E5NA 3BULA 2DFNA 1PEAA 5HX7A 2QAGA 4BUJA 4TV9A 2VJMA 1U7DA 1JG4A 4EFDA 5JARA 2ECOA 3K8OE 3PF8A 2Q5IA 4PV7A 1C3OB 3CF4A 4NJMA 3L7JA 4WLNA 3ZDFA 3W3AA 2GAFA 1E9EA 3GCGA 4ID9A 1GKIA 1HORA 4Q48A 1ISIA 1R2QA 2HQOA 2RHDA 4YFYA 5T3UA 1C9KA 1SC3A 4HI0E 4OMCA 3V1YA 1E3DA 2D2VA 1KC3A 1O0SA 4B35A 1OFTA 1GG5A 3EN0A 4WOBA 3S68A 3HUFA 4LG1A 4RM2A 1MUUA 3T38A 2VHTA 2I1QA 3L41A 2NU6B 4XGKA 3A4MA 4MKZA 3T7EA 3TD2A 3F3YA 3NCHA 4KYVA 3D6MA 4GWGA 4MEAA 3L6DA 5EINA 3MJTA 1NVFA 1Z7GA 3B6MA 5FFFA 3NTUA 3KSMA 4BVKA 2FGKA 1E2HA 4AJOA 1BCSA 3NC1C 1ZINA 3DE6X 3LBNA 3ILYA 1YU6A 4P7BA 1DIBA 4MUBA 4JL5A 4M1SA 4WSOA 3ODGA 5IJZA 1B15A 3AF2A 4NKRA 5KKNB 1KVTA 3A3OA 2O48X 4IO0A 1UZNA 1XQ6A 1Z12A 2C2HA 1QRSA 1KE1A 4HEA1 4JB8A 2ZUEA 3I8SA 4QM7A 3NTXA 3VYWA 4RUKA 3U3JA 4MYHA 4BE4A 1QIFA 1RLOA 2YYYA 2C3OA 2Q4EA 3PSHA 3VNQA 1GUZA 1IK4A 3L1VA 2AG1A 4M8IA 2OORA 3RVBA 5LSAA 1P2BA 3CE9A 4MRVA 1ULUA 4RZXA 3VZSA 2DQKA 1BC5A 1UMKA 2VT6A 1EB8A 3GWZA 1QGDA 4HDSB 3TQQA 2N1BA 2FPUA 3TLMA 4NDNE 3WA6A 2QSYA 5B3LA 4AS2A 4BNXA 3IMCA 1OT5A 1CF2O 2YWRA 2V0NA 4MR8A 5DGXA 5HK9A 3WQRA 2IWHA 4HTFB 1JDZA 2GARA 2PGOA 3BZWA 4HDQB 5JWOA 5B2ZA 1ZH4A 1T8RA 4H0NA 1EK2A 2JAWA 2OWDA 2QOEA 3C3AA 5C46F 1ZICA 5FL7D 4ECAA 2JFPA 4I36A 1V9CA 4FBGA 4P4NA 5DM0A 1O3YA 2A0KA 5F5NA 3CEHA 2H29A