2Q2QA

Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
250
Chain Sequence
TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-D-hydroxybutyrate dehydrogenase
publication title Cosubstrate-induced dynamics of D-3-hydroxybutyrate dehydrogenase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 91
structure length 250
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q2qA00
3W1VA 9LDBA 1FDTA 3CKYA 1LLDA 4MVJM 4DQXA 3KYCB 1ZVMA 3R1IA 4WCFC 2NU7A 3PHIA 3WGTA 3BMNA 3F1KA 2EV9A 3DDNA 5BSEA 5JO9A 2PTGA 4P22A 1U2GA 4DIOA 1YQGA 1N92A 2ZTVA 1LEHA 1FDWA 3P5SA 4EITA 3PGJA 3OF2A 2GPTA 4GI2A 1ISFA 2P91A 3A28A 4IQGA 3D5TA 2ZK7A 3TRIA 1ML3A 2O3RA 3RJ5A 3HJAA 3JCZA 5G0VA 3WLFA 4KUGA 3PQFA 5A1TA 2W2LD 1EFLA 5IN4A 2ZB4A 4C7JA 4FFOA 4BGIA 3ZWCA 4BNIA 4DQUA 4MVJI 1R0SA 1GAEO 3QQPA 5DT9A 3H4VA 3L77A 4CLXA 3D5QA 1E5LA 4D46A 2CUKA 3WFIA 2W8ZA 3ZN2A 3Q9NA 4W6ZA 3RBXA 3PP8A 5F5NA 4Y6RA 3FTPA 1K2WA 4FR5A 5A04A 3GZ4A 1E3IA 1J0XO 3NT4A 1NWCA 3ST7A 4A7PA 2DPGA 4ZU3A 3PYXA 2CMDA 1PZHA 2YDYA 4PLPA 4FB5A 5A9SB 5I7FA 2GNAA 2D2IA 1F12A 3ADPA 1PL6A 1E92A 3OQBA 4MIYA 4WLNA 1H6AA 1WW8A 3IJRA 2D59A 1KIFA 1QYVA 1NVGA 2BGKA 3Q2KA 4RVDA 4ND3A 1EE2A 5B12A 1GCUA 1SMKA 3AY3A 3WJAA 5ICMA 4E13A 1BXGA 1CIVA 2JKVA 3VHRA 2X58A 3AWDA 1DOHA 1LLQA 4FC7A 1DC4A 2Y1EA 1DRWA 1K89A 4R01A 4WGGA 3DR3A 3DBRB 1GEGA 3FNHA 5L3ZA 2O48X 3AM5A 2NU9A 2VYVA 1T1RA 1U4OA 3RFTA 3WMXA 3NGLA 1NXQA 1ADGA 5CG1A 3GZNA 3K6JA 4ZJUA 4GLLA 2B69A 4A03A 2CZCA 4YAIA 3G0OA 1UDAA 2QZ9A 5IDYA 4YT2A 2C54A 4YRBA 5BT9A 1I10A 5JLAA 3GGGA 3PDUA 1T2EA 4NU5A 5CPFA 2OORA 4BMNA 1EUCA 1UH5A 4KMSA 5ADHA 1WLYA 1YE3A 3CE6A 3OP4A 3FRJA 1OZAA 1QSGA 1VL6A 4JBIA 4PIVA 5T8KC 5JCJD 4E30A 3U4DA 4Q3DA 2DFVA 3I9MA 1YXMA 1EDOA 3GEDA 2EW8A 3ETEA 2BKAA 3PWKA 4M86A 3O8QA 1L1FA 2O4UX 1KY4A 1MP0A 4BKOA 2Y1OA 5ENDA 3RWBA 1WVGA 3O03A 3ICCA 2V6FA 3T7CA 4II3A 4FFLA 4WNCA 2H9IA 1R37A 5T57A 4C7KA 4DL9A 1R66A 4WEQA 1Q0QA 1UAYA 3TZQA 3ZHXA 5COBA 3A9WA 4F6CA 3AUAA 1B26A 1FK8A 2IZ0A 4BB5A 5C37A 1R4MA 1LJ8A 2D1YA 2GRAA 5KVCA 2DUWA 2RIRA 2NQ8A 2FHSA 4JN6B 1GV1A 1BTOA 1H2BA 3DZGA 1A4UA 4XGKA 4WKGA 5AXCA 3JD3A 1DB3A 4QFDA 3VVCA 5FF9A 1ZK3A 1KVQA 3BTUA 1JA9A 4BVAA 2V6BA 3OJLA 1GYPA 3ASUA 4U0KA 3H6KA 3GFGA 1SC6A 3DQPA 3QA9A 3RCBA 2X9GA 4DTIA 1PJLA 2X22A 4J3FA 1PTJA 2C0CA 3ETGA 5IFLA 3WG9A 2AG5A 4R3WA 3Q6IA 1H0KA 1ZK4A 1T2CA 3NUGA 3MJSA 3JQAB 4L4XA 5DOZA 2Y1DA 3WLEA 1NPYA 1NPDA 4ZVVA 1OC2A 3IP1A 1YJQA 3VDQA 3VTFA 2I76A 4BUCA 3LLSA 3PRJA 1YONA 3L9WA 2UVDA 3PZRA 4QTZA 4GBJA 5LDGA 5TT1A 3WYBA 3JD4A 2EJVA 3WIEA 4RDIA 1OI7A 1SO8A 4M8SA 4EDFA 4I5GA 3AK4A 1OMOA 3DBHA 2JCXA 3VZSA 3KBOA 2IEDA 4PG6A 4DMMA 1MC4A 4N5NA 1B14A 4YT4A 4NR0A 4XA8A 4BO1A 1RYEA 1Y5RA 3Q9UA 2DTXA 3EK2A 3HFSA 5TNXA 4HWKA 4W99A 1HE3A 3KTDA 3ZWVA 2PD4A 3TSCA 3D3EA 2B83A 1G0NA 4L8VA 5T64A 4NNJA 1JN0A 4B4OA 5CG2A 3CXRA 1U2DA 2JD0A 4D79A 2X9VA 3PLNA 4CLOA 3KZVA 3TF5A 1GUFA 2P9EA 3WB9A 2DBQA 3QP9A 1O94A 3FBGA 5THKA 3LC2O 4BNVA 1O6ZA 1YGYA 3NTOA 1LC3A 2BH9A 5HWSA 1ZIDA 3HDJA 3GLQA 4YBZA 3DAGA 1DXYA 1ZSVA 1EQUA 4U0JA 4UEJA 3F3SA 4RF5A 3GVXA 4WE3A 2I6TA 1ZEJA 2GZ3A 4DPKA 1NNUA 1ORRA 1HSZA 2DPHA 1GYQA 3K8ZA 1PL7A 1X13A 4QQRA 3GNQA 1LDGA 2VCYA 4LSMA 1EMDA 3H9UA 5G4KB 6ADHA 2AG8A 1TI7A 2VNAA 3K96A 4UVHA 1ZNQO 1U4SA 4DYDA 5F21A 4BO2A 3JQ8A 4ZN6A 2OZPA 3ZNOA 4BNJA 1GR0A 4XKJA 4DMLA 2VYND 4FFNA 2PH3A 1F06A 4CLEA 2ILTA 5IN5A 3WMWA 3QWHA 2O4CA 4MVJP 2O7SA 4JJGA 3CUKA 4JK3A 5JMWA 3DXFA 4L4SA 1ZSNA 1TVEA 2PGJA 2B4TO 1UXJA 1VPDA 5TGDA 1W8DA 3B1FA 3H5AA 4B7XA 4CMGA 4CJXA 5MGBA 5JDIA 1P45A 2WYWA 2EIHA 4AJ2A 2O2SA 2IZZA 4XWYA 3HG7A 3PJDA 4I1IA 1FMCA 1SNYA 4II2A 3TL2A 3ZGYA 4AJHA 3LZ6A 1A9ZA 1B16A 4XR4A 4AJPA 2DTEA 4WOJA 1I36A 1EVIA 3KSDO 2GN6A 4CQMD 3VH3A 4IGFA 5C7OO 1E3WB 2GN8A 4UEKA 4GWKA 4WECA 3RUHA 3PVZA 4IDGA 2CNBA 4OO3A 4R4JA 2HMTA 2Z5LA 3ZWPA 3GAFA 4NDNE 3I9LA 1O9BA 2D5AA 4DXHA 2XOXA 1UZNA 2O50A 1RWBA 3VZRA 5DN9A 2POQX 3WYCA 1GUZA 1NR7A 4R1TA 3ZV4A 1T2AA 3LSYA 4MINA 2HDHA 5B4VA 1UJMA 4N5LA 4CPDA 2UUOA 1ISHA 3GPIA 1LDYA 3G17A 4LSWA 4R1NA 3E9MA 1I2BA 1EEHA 4AJ4A 3R0IA 4MOWA 4MP3A 3KVOA 4NBTA 1Y6JA 3RUIA 4OIMA 4J1QA 1KY5A 1W4ZA 2WSBA 1O8CA 4ZD6A 3WSVA 2A4KA 4G81A 4AVYA 3OJ0A 1DAOA 2VWQA 3PWSA 1H9BA 4BKPA 4YT8A 4GPD1 1P3DA 3IDSA 4LMPA 3KO8A 4LCJA 1WDKA 1E7RA 1PQPA 2JD1A 2CVOA 2WTBA 3B1JA 3S1LA 1JAXA 4W9NA 5I9MA 4DLLA 3RFXA 3BTOA 4BNMA 5TSDA 1XR3A 4ND4A 2QG4A 1HKUA 1E1LA 4R41A 1I24A 4MP6A 1AHHA 3BHIA 5LCXA 4YWJA 3WFJA 4ZRNA 1BVUA 1HDCA 1Z75A 3WXBA 2R00A 2BI7A 2C5AA 2LDBA 3L9XA 3U0BA 4IJUA 4Y6SA 4Q39A 2O7QA 4J4BA 5EESA 1YQXA 1V8BA 2GO1A 4NU6A 1KBZA 1LI4A 1PJTA 3EC7A 1DFIA 3OJFA 4TSKA 4J90A 4LVCA 1XWFA 5JFOA 1EVYA 1BXKA 4CMEC 4CM4B 4D43A 1YDWA 1H93A 2NM0A 2VZ9A 2FP4A 5L4LA 4FIZA 4XYGA 4BGVA 1P0FA 3C7DB 3G49A 2GLXA 3H7AA 3ZHYA 3I6IA 5EMHA 3OQ1A 3SC4A 2YDXA 4IQ0A 3C1TA 4GL4A 4J4TA 1RM4A 3LT1A 5U1PA 4ROSA 1EFKA 3MTJA 1UDCA 1YL7A 3NDRA 4H15A 1SB9A 4QEDA 4N54A 4MVJE 4E5NA 3GC6A 3JQEA 3WOHA 3RU9A 3WX0A 1DRVA 2UV8A 5AXAA 4CQLB 3NJ8A 2IEBA 5A05A 3JQ7A 4J43A 4LRSB 1Q0HA 3EUWA 3ENNA 1PGOA 1T24A 1HE2A 3P19A 3RUCA 4JGBA 1MFZA 4O5OA 3UHAA 2X0RA 1NYTA 3RJ9A 1U1IA 2PV7A 5I7SA 1MX3A 1PJBA 3CEAA 3WSWA 1GQYA 3OHSX 5KTKA 3FR7A 3AI3A 3PHJA 5AVOA 3DHEA 3G1TA 3DEYX 5L40A 1EDZA 4HP8A 2CSUA 3EGOA 3QY9A 3I9KA 5A5EA 1D7OA 1M75A 2GZ1A 1I3LA 2DBRA 2GR9A 1Y8QA 3VPHA 1DHTA 4XQEA 2FSVA 2HLPA 3GVPA 3TOZA 1HF3A 3E6AA 3GG9A 5IAAA 4AJEA 1K6JA 1MLDA 5ILGA 2DQ4A 1YJ8A 4IDCA 4B4VA 4FCCA 1BG6A 1WMBA 3W6ZA 4W7HA 4E5MA 4EUHA 3MEQA 1U3UA 4P4NA 1YWGO 3N7UA 3ZU3A 4E2YA 3PLRA 4CR7A 1FXSA 2EW2A 4FDAA 3GN2A 1A7AA 1DPGA 2P5UA 3GUCA 4PZDA 5C5IA 4Z0TA 2E49A 2W98A 3D64A 3U4CA 4MIOA 4YAGA 1BXZA 3UN1A 4J9UE 3KSUA 4E5KA 3WGHA 2P4HX 3ONDA 1LRJA 1Y81A 4CMIB 4F46A 3AUUA 2DU8A 4JIGA 1PWZA 1JKFA 4YTEA 4TMFA 4MKRA 3B70A 1PJ2A 1HSOA 2Q4EA 3DHNA 3ICPA 4QT0A 1T2FA 1DFHA 4MDHA 2TMDA 4EBFA 1LLUA 1HLPA 2WYVA 5A3VA 1YBVA 4EJ6A 4FGWA 1HYHA 3W8DA 1P1KA 1HETA 3VH1A 2EP7A 1E0DA 1KETA 3BXXA 2ZYDA 5A06A 3JSAA 4YEDA 4YJFB 4J91A 4B3HA 3WGGA 5ITWA 4ONEA 2DBVO 4PLWA 2Y0CA 3EHEA 4D3SA 1A5ZA 4PVDA 1PJ3A 1RM3A 1XEAA 2X0IA 4RPLA 1VC2A 4BNGA 2E6UX 2JAPA 3QW2A 4XB1A 4YYZA 3ITDA 2CVQA 3CH6A 3MWEB 3RI3A 2RH4A 4ZICA 2AEMA 4L76A 3IKTA 4TVOA 2VHVA 2Y99A 3W6UA 2WWRA 3DOCA 1PJQA 4FFRA 3D4OA 3EZLA 3GF4A 3IQDB 2OP0A 3QLJA 3GRKA 1IZ9A 2WEKA 4JCOA 3TZ6A 4KDFA 1Y8RA 4EUFA 5A5FA 2A9FA 2WM3A 3FNFA 5I9NA 4K6CA 4LVUA 4BV8A 1GPDG 2B5WA 3LC7O 4CMCA 1NQAO 1G0OA 1ZJYA 3D4PA 4CODB 2Q2QA 2X5KO 3ZWOA 1JAYA 1UAGA 2VYVD 4QX6A 1UP7A 1VI2A 1O95A 4ZQBA 3UGKA 3WGOA 1N9GA 4D45A 2DAPA 1F14A 2HO5A 4UVDA 1LQUA 3ETDA 4IBOA 4TZTA 3TL3A 1Z7BA 2Q49A 3GY0A 4JP3A 5T67A 8ADHA 3SJUA 2GF2A 3NTQA 4E5PA 5K9ZA 5JS6A 4MKXA 5TJHA 1CETA 2C2XA 5ITVA 3NRCA 2OGUA 1F0YA 3HB5X 4IDAA 2OHXA 3A1NA 5FI3A 1NFFA 3DB2A 1ZK1A 4C4OA 2B4RO 1HE5A 4XGNA 4ALIA 1LLCA 3AUSA 4CV3A 5JNLA 5EIOA 3JD1A 1WWKA 4AJ1A 5BR7A 1UXGA 4OSOA 4AJNA 4AJKA 1KC3A 3M2PA 5DBFA 5ES3A 4WOKA 2Q4BA 4EEXA 4E31A 2B0JA 5FI5A 1VL8A 4CQMB 2BELA 1RM0A 1ZH8A 5CAEA 2VOEA 5EPOA 5JDCC 4MVJF 2C07A 3W4KA 2ZCUA 3W4JA 5C3MA 2AE1A 4E2XA 5G2OA 3MJ4A 4YJHA 1RYDA 4ZQGA 3L4BA 1HRDA 3DMYA 4L4RA 1GUYA 1KEPA 2PGDA 1NQTA 4CM3A 5K6AC 2FPGA 5F1OA 1ZZEA 1I0ZA 1N1GA 2J5KA 4URFA 1O0SA 3VOSA 1N8KA 3WJ7A 1EQ2A 4IINA 3FR8A 5DBIA 4WCFA 3I1JA 1WMAA 4WLVA 1LA2A 2NVWA 1WPQA 4DIBA 4TVBA 4M55A 3ZV5A 4DA9A 1I5RA 3BZUA 4RO0A 5LDHA 3IOYA 1HDYA 4PLGA 2F1KA 3VAZA 2JFGA 2EXXA 3TZCA 1BW9A 4CM6A 1DBVO 1E3SA 4KTTE 2WJPA 3JQBC 4P4LA 4Y8VA 3WBFA 3WNQA 4O59O 4UUMA 3DBLB 4IZHA 2VHWA 1RKXA 2D8AA 2Q1WA 2QYTA 4TWRA 1HDGO 3ZWMA 4WUVA 4DVJA 4JNKA 1TT5B 3DOOA 3OIGA 1PR9A 3ZW8A 3EW7A 4HUJA 4BB6A 3GAZA 4YJGA 1NM5A 1TA4A 5F5LA 4A10A 1B15A 2Q3EA 1T4DA 2YYYA 4IS3A 2HMVA 2X0JA 5TX7A 2G0TA 4Q3NA 3FD8A 2DVMA 4UREA 1E77A 2A92A 1KYQA 2ZTLA 3RC2A 1ENOA 2O3SA 5ER6A 1TLTA 2ZJ1A 2O3UA 2ZB7A 1E7YA 4XDZA 4IDDA 5TQVA 1KVRA 2BFMA 4RVHA 2O2YA 3I9OA 1L7EA 3OIFA 1OC4A 4R69A 1IHYA 5BQFA 4NBUA 1YBMA 5IJZA 4YVFA 2B37A 1BDBA 4RLSA 4KWHA 3MOIA 1AXEA 1V35A 1C1XA 2W2KB 3D3WB 3IJPA 2C7GA 4OOFA 1HZJA 4U6SA 1NQOA 4NFHA 1ZXLA 4Z3DA 4I5DA 3NAQA 4CMHA 1BDMA 4BQPA 1YOVA 4OQYA 3KETA 4XQ9A 3TFQA 4BNLA 3JQGA 4KOAA 1FDUA 1V3TA 3IKVA 5KWEA 1Q7CA 1GQQA 2XXBA 4UUPA 2GGSA 3RQSA 2Y1FA 5CDSA 2I66A 3PGXA 3T7EA 3RUDA 1PR3A 4IPTA 2EGGA 2JJYA 4BO4A 1ENPA 3ULKA 4TRMA 1I2ZA 1XQ6A 1G6KA 4GMGA 1P44A 3EDMA 3OH8A 3WWYA 2NNLD 5T8KA 5BNIA 3Q11A 2OUIA 2ZYGA 3GRPA 2FRDA 1XG5A 2P68A 4WLUA 3K92A 4R9SA 2DLDA 3GR6A 2FWMX 3H5RA 3DFUA 3JYLA 4A2CA 1HL3A 4GVLA 4FQ8A 4CM8A 1ADFA 3UKOA 1PGJA 2EP5A 2D0IA 4PG4A 1EUZA 1PEDA 1A7KA 3ZHBA 4FN4A 5JCXA 2I9PA 3BMCA 1WXDA 3DTTA 3M2TA 2H5LA 2CDBA 4NI5A 3F5QA 4WASA 1IE3A 5EERA 4EEZA 3NDJA 5CEEA 2NWQA 2QHXA 4CV1A 5C7IO 4B7CA 4L74A 1RPNA 1U8XX 2O3TA 4Y9DA 3JTMA 1WZIA 1V3VA 2OMEA 5F3RA 4BNKA 4BNXA 2VHXA 3D0OA 4DIFA 3BMNB 4YRAA 2D3TA 3OMLA 5EQDA 3KYBA 4RGBA 4U5QA 1HYGA 1UXKA 3P2YA 4OKIA 1GADO 1LDEA 1G1AA 4Q3AA 4RCVA 2PR2A 1BGVA 5L53A 5A02A 1IZ0A 4R5HA 2I67A 2YQ5A 2BGMA 4AG3A 4FJ1A 2VUUA 4BNTA 4Z3KA 3C7CB 1A27A 1PL8A 1X7HA 4ND5A 3JQFC 4BGEA 2BF7A 1E6EA 2QQ5A 4AL4A 1PZFA 4RPGA 4I9UA 4R1UA 2NQTA 4KP7A 1JWAB 4NBRA 3AOEC 3GNSA 3O4RA 4CLRA 3DONA 4QO7A 3AFNA 4BS9A 5IXSA 1JLLA 4XJTA 4L75A 3KRTA 1KS9A 1P1HA 1CF2O 1SOWA 3NYWA 2BRUA 3JQCA 3UVEA 2E82A 3AU8A 2H63A 3OM9A 5L95A 4YAKA 1WDMA 1NX6A 1PQUA 4OH1A 1E3JA 3OIDA 4HFNA 5JMPA 4TROA 4LMRA 1UXIA 3FCOA 2VNSA 1BMDA 4RV9A 2NVUA 4FW8A 5I7VA 3UH1A 3JYPA 4AJLA 4BHTA 3OSUA 3KEQA 1EZ4A 3T4XA 2JL1A 3GK3A 1PJSA 2I65A 2E4AA 1VRWA 3D7LA 4WLEA 1ISIA 1XELA 3GMDA 4MPDA 1DC5A 1XQ1A 4LK3A 3JQ9C 2D4AA 5GZ6A 4XYLA 3MJVA 3SEFA 2X1HA 5JAZA 1BXGB 4JQCA 2B4QA 2I3AA 4YB8A 1K3TA 1U28A 3NT5A 1DC6A 1YB1A 2HMUA 3OJOA 1BVRA 1JW9B 3KB6A 1RJWA 4XB2A 5L7YA 1UZLA 3I9NA 4PG5A 3ZW9A 4PRLA 3E8XA 3TZHA 4GMFA 4O63O 4KUHA 5CPBA 1Z74A 3ZH2A 5I9LA 2XF8A 4IJVA 2EERA 1NBOA 3GZNB 4R54A 1XA0A 1IPFA 3ZNNA 5TS3A 3ROPA 1SB8A 1AHIA 3W4IA 1CQIA 3HE3A 4P8RA 3NJ4A 3C8MA 3SLGA 4CM5A 2IRWA 3DMTA 1NR1A 4FFPA 5DBGA 2AMFA 2VN8A 2W4QA 4J7UA 1QLHA 3W8FA 3FWNA 3O8QB 3ONEA 4BKRA 2CF6A 4J4HA 4CLDA 2VUTA 3ASVA 3NV9A 4QECA 5JC8A 3OQ6A 2EEZA 3TJRA 5FYDA 1QXSA 1B2LA 2QYSA 4Y67A 4JX8A 3PWZA 2AE2A 2YHIA 4ZQFA 3TWOA 1R4MB 5T5QA 3HUDA 4BNNA 1NAIA 4GLOA 3TQHA 1U3VA 3ANNA 4J1NA 4FJ0A 4UULA 2O3JA 3O9ZA 1CRWG 1F8FA 2YV3A 5U9CA 1NPTO 5JW6A 3M1LA 4O6VA 1IUKA 1ENZA 4ZA2A 4M49A 4A5OA 1JVBA 2V65A 1LSUA 4CL3A 4XYBA 1B8VA 1ONPA 1KVSA 1A4IA 4TRRA 5H82A 5CDTA 4FD3A 2WD7A 3QRWA 4ZQHA 5JYEA 4E5YA 1P74A 3VZQA 2UYYA 3ZU2A 3MZ0A 4XIYA 2A94A 2P9CA 3NTRA 1E7SA 2RHCA 4IUYA 3OBBA 2DTDA 4Q3EA 1PGQA 1U7TA 3HDYA 4YT5A 1AUPA 2HJSA 3BMQA 4IDBA 4PLCA 4D41A 2NVUB 1GEEA 2BFOA 3DBHB 3MJEA 3V1YA 1B0AA 4RQUA 4AJIA 1VKNA 4YACA 3LT4A 2GN4A 3GVCA 1H9AA 2FN7A 3AOGA 4JBGA 4PN3A 1FJHA 4U6QA 3WGZA 1D1TA 1I3KA 5CDGA 1WZEA 4CL8A 4YJDA 3KXDA 1XDWA 3IMFA 1R6DA 4L0QA 3DTYA 2Y0DA 4R51A 1EBUA 4E6PA 4BO3A 2SCUA 3NEPX 2AXQA 4ITUA 4CLOB 5A3JA 5HA5A 4J1TA 1EK5A 2PKQO 2C29D 2TMGA 3GH3A 4HY3A 1YVEI 3I6QA 4KTVE 2EKLA 5IDWA 2PY6A 5IF3A 1DJNA 1Y5MA 4MKZA 2IYOA 3QVWA 3KLPX 3NT2A 1B8PA 5ILOA 4BKQA 1PQWA 4CMEA 1T25A 4XDYA 5DNAA 2ET6A 4O1MA 3ROMA 2DM6A 3LVFO 2Y67A 4S1VA 4F6LA 4K26A 4CUZA 4I9NA 3TOXA 2YZ7A 3SXPA 4EGFA 5JXWA 4PCVA 4GWGA 4IGEA 1R12A 3SX2A 3E9QA 4E3ZA 4HV4A 1H5QA 3QVXA 4B4WA 2VOJA 4YA6A 3V1UA 2CD9A 2VQ3A 4TRNA 1MB4A 3JQ8B 2RHRA 4PLHA 2EHDA 1SCUA 2ZTUA 2ZTMA 1LC0A 3ZWXA 1X7DA 2WE7A 3E82A 5DCWA 3KSZO 3S2IA 1QORA 1AN9A 2OXIA 2PKRA 1KERA 3H2ZA 4A27A 4EW6A 2G1UA 2IODA 1ZO8A 2IE0A 2FPPA 5CFZA 1N5DA 4F3YA 1QLJA 3ENKA 3WQSB 1R4NA 2ZQZA 4PLTA 4GX5A 2FPIA 4YRDA 2I3GA 1JU9A 1S6YA 3CMCO 3R6DA 2PZJA 3PIDA 5JPIA 4XIJA 1P1FA 1M67A 2FR8A 1LDMA 2Z1NA 3KLMX 1U5CA 3SC6A 4RJTA 1ZW1A 2P2SA 3PZBA 4CV2A 3L6EA 2QRLA 3AY7A 1FDVA 3K30A 1LX6A 5KJ6A 4BNYA 3KM0A 5HTOA 4BIIA 3CIFA 1ADCA 5BNFA 5JO0A 1PIWA 5G0SA 4D3DA 4J9VA 3K2BA 3K2EA 2CFCA 2Y93A 4ALJA 5B1YA 2HMWA 4RPJA 4PRKA 2WDZA 3H9QA 3AM4A 1HEUA 2B5VA 2NVBA 3DAPA 2A35A 1M6WA 1C0IA 3H8VA 3GEGA 1NAHA 2DUUA 5TJ9A 3H9JA 3LF2A 2VHZA 3E1KA 2VTDA 3FN4A 4Y6PA 2ZATA 1MG5A 4OYRA 4GKVA 5G4LA 3AM3A 3H9GA 3R3SA 3HZZA 3ZWBA 1B3RA 5KVVA 1PZEA 3IP3A 3AFMA 4EJMA 3FF4A 3KYDA 1B8UA 4TQGA 2J6IA 3S8MA 3ZU4A 5IZ4A 1SZJG 1B3BA 4JP2A 4CR6A 5IZCC 1NP3A 4G2NA 1DFGA 1ZMTA 3GOHA 1VJ1A 2Q2WA 3LDHA 2ZYAA 3MCVA 5CDYA 2AQKA 1P1JA 1Y9EA 2HRZA 4FFMA 4I5EA 3WGYA 4YXFA 4DUPA 1ISGA 3CZRA 2IYPA 1I2CA 3EY4A 3WDSA 1P1IA 2FR0A 4OL9A 5G0WA 3PHGA 9LDTA 3FTNA 5L45A 1TXGA 4HADA 4WLFA 1YRLA 1Z6ZA 4Q3CA 4NK5A 3UXYA 1W6UA 4LW8A 5L4NA 1ZK0A 2WD8A 3BMOA 4E21A 2NLOA 4FJ2A 4NG5A 2CDCA 1HLDA 3QWIA 4PLFA 1RM5A 3WGQA 1DJQA 1U3WA 2JFHA 1P0CA 2E37A 4LCEA 4HNGA 4YCAA 3RUEA 4DGSA 1NVTA 1PX0A 2GD1O 4Y98A 3U4HA 3LF1A 3UCXA 5K0ZA 4WK6A 1EK6A 3D1LA 3BHJA 3HN2A 4IDFA 5ICSA 3RSHA 4Q3BA 4MP8A 1V3UA 1LSOA 4OMUA 1PJ4A 1H94A 4GX1A 4RQTA 1VM6A 4G5HA 1GFSA 1SPXA 4E12A 1C1DA 4ALKA 3JQ7B 3U09A 1YH3A 3PXXA 3P7MA 4FSHA 3CPSA 4WEOA 3AUTA 2DFDA 2H1SA 3GA0A 4Z0HO 3G3EA 2DBZA 2PD3A 2DT5A 2NADA 4YQYA 4DREA 4GVXA 4BNZA 2UUPA 1WNTA 1DIBA 2HK9A 1LTHR 1QKIA 2DKNA 1Z73A 1R0LA 3OA0A 5CP8A 5AQ1A 3HNPA 4MIEA 2NV6A 1SAYA 2J3KA 3UUWA 4NFYA 4AJJA 2P4QA 2NACA 2YJZA 4U7WA 4Z0PA 2PWZA 1ZK2A 4PGFA 1N7GA 1PS8A 1LRKA 4RLHA 4OOEA 1YL6A 2C20A 3H9EO 4Q9NA 3DZFA 4N18A 1Y8QB 1X1TA 2Z1MA 1GZ6A 3DZKA 4I8XA 1CQJA 4JXKA 5KJCA 3KYCA 1CWUA 3S2FA 5BSGA 4FOOA 1ISMA 2AHRA 1EE9A 1KVTA 1IYZA 3GN1A 3I5MA 4GH5A 2BLLA 5G0UA 3ROKA 4J2HA 4DPLA 1MG0A 2VT2A 4J7CA 2V7PA 3I9JA 5JDCA 2EKPA 3DZIA 3OJEA 5AXDA 5U4QA 5TIIA 2X6TA 3INRA 1OFGA 1MV8A 3JYNA 4NH4A 4OQZA 5ER9A 2X8LA 2VZ0A 4UEOA 3C1AA 1NHGA 3BA1A 5K6AA 1NTOA 1XSEA 1XHLA 4ZHSA 5KVQA 3PEFA 2J5RA 3CINA 2G76A 1UR5A 4RF2A 1R0KA 4OXYA 4J2OA 4CMAA 2FSSA 5JBIA 4CLHA 2Y05A 3ZNPA 3A06A 1I32A 4J6FA 5EINA 3L6DA 3K73O 3QWFA 2BI8A 5COQA 1GD1O 3BAZA 3PI7A 3AY6A 3ANMA 4PZEA 4TKLA 3LQFA 4UVIA 1BSVA 1ISJA 2NTVA 1E7WA 3Q2IA 4Z9XA 5JYDA 3JQBA 5A9SA 1HWYA 3IAHA 2BFPA 2HMSA 2PK3A 3G79A 1W73A 1W0CA 2IXAA 1T26A 4CMJA 1GL3A 5KOIA 1JKJA 3K5PA 1ZJZA 2X0NA 3FBTA 4OJNA 3F1LA 1ONOA 2PD6A 2C59A 4Z9FA 2IXBA 4M87A 1IOLA 1QV7A 3JYQA 3FPCA 4IXWA 4JLWA 3DWFA 1GYRA 4AFNA 3F4LA 3H2SA 1T2DA 4DBZA 4IJKA 1CERA 3I3OA 1DAPA 3DBRA 1I8TA 4IMPA 4IQ8A 1QR6A 1Z45A 2PGLA 2AQ8A 4JJIA 1QP8A 1Y8RB 3ITKA 4TKMA 1Q2XA 5ENVA 1XYGA 5JY1A 1LRLA 5IDXA 4HFRA 4WPGA 2WE8A 4H7PA 3AW9A 4BMVA 3WIDA 2UDPA 1XU9A 1LDBA 4NZ9A 2WMDA 4Z9YA 5GMOA 3ZI0A 1GPJA 1DIRA 1MA0A 4NBWA 1ENYA 1ZFNA 1N9GB 3MJTA 4UAGA 1R15A 5A9TA 2FOIA 1H6DA 1K5HA 3RKRA 3K31A 3RD5A 3RKUA 1MGOA 3EVNA 3S55A 1CEQA 3GG2A 5DDIP 4EUEA 4XQGA 3ZHZA 4MVJD 3L4SO 3S2GA 4R68A 2YY7A 2Q46A 1Y1PA 2WYUA 4HXYA 3X2FA 3UW3A 4A73A 4HBGA 2ZIZA 2HKIA 1DHRA 4J16A 2NTJA 3IC5A 1X7GA 1JQBA 3D4NA 1BRMA 3DAFA 4YR9A 2IZ1A 1ZEMA 1ZKMA 2VHYA 3F46A 2G5CA 3L07A 4CM1A 1JTVA 4XD2A 1XGKA 2HRBA 4UUNA 4PLVA 5IDQA 3PFWO 1KEUA 3VC7A 4KWIA 4BNHA 1I01A 4XR9A 1DO8A 4XQCA 3ZWNA 1LNQA 4AICA 2AQIA 3R3JA 4CM9A 1VLLA 3RBZA 3JQAA 3UF0A 4B79A 4BO6A 4D44A 4IM7A 3ORFA 1HXHA 2YW9A 3CSDA 5BNTA 3GHYA 4CMKA 5H81A 4DRYA 1N7HA 4NPCA 4YJHB 3AI1A 1GV0A 3GGPA 1JDJA 1ZSYA 1YL5A 1E5QA 3BIOA 4QO8A 2GERA 3PIIA 1BHSA 1ULSA 3E03A 2ZB8A 4XRRA 4LGVA 1HT0A 1LBEA 4ZRMA 3BTVA 3OETA 1E1MA 3IS3A 4XGIA 1EVJA 1UP6A 2JAHA 5I7EA 2B35A 2J8ZA 4BO0A 4N5MA 3QIVA 1MUUA 2PKQP 4WCFB 3ZCXA 3DL2A 3RASA 5EN4A 2JCYA 1LU9A 3DO5A 1I3NA 2Q50A 3JQ6A 1LXCA 1B7GO 2X23A 2YFHA 5KKCA 8LDHA 2X4GA 3E9NA 4G65A 4E32A 1A71A 5I8ZA 2EWMA 1C3VA 3O38A 4XJSA 3PJEA 1DDOA 4XEHA 2HCTA 3SLKA 1BW9B 1Q1NA 3NKLA 1TEHA 1E7QA 4PG7A 1QYXA 3GDGA 1D3AA 5DULA 3ZV6A 2PFGA 5EL0A 5AYVA 1KOLA 3JQFA 3UOGA 1PSDA 3PHHA 3F5SA 3CMMA 1M2WA 1X0XA 4QSMA 1H6CA 3FI9A 3A4VA 1Q7BA 3AOEA 4GX2A 2C5EA 3WS7A 5JC1A 1UUFA 1J4AA 2X9NA 4L9RA 2GUGA 4YJGB 3GHHA 3EZYA 1PJCA 3V2GA 3PFFA 2I99A 1HDOA 1H2HA 4WNIA 5B37A 4BO5A 5CHEA 2HUNA 3GT0A 3FNGA 4JJFA 4IIVA 5G4KA 3OECA 2RH8A 4BNUA 2AA3A 2I5PO 5KKAA 2YHUA 1MXFA 1PWXA 4OM8A 3LLVA 5A9RA 4INAA 2GCGA 3COSA 3MJCA 4HFMA 3ROQA 2OBYA 3JQ9A 2DC1A 1ZXBA 4KDEA 1K6IA 1YO6A 3Q0EA 7MDHA 3GDOA 4QFCA 1C1XB 4NJOA 5AOVA 3U9LA 1I30A 4QXMA 2C7VA 2J5QA 2B36A 3PYLA 1F17A 4UVEA 1YQDA 2NU8A 1PGPA 4FPXA 2QX7A 1OAAA 2Q1TA 1PS9A 3F47A 4EZBA 1YOVB 2QW8A 5THQA 4YQZA 3JQGB 1GDHA 2FR1A 2PZLA 2Y1GA 2JHFA 4KUEA 3ZNQA 1E3WA 3FWZA 3WR5A 5BSFA 2C2YA 5GZ1A 1GQ2A 3E5MA 1GY8A 1KEVA 1A9YA 5H83A 1ADBA 2VTEA 2NTNA 2EG9A 1LSJA 3GUYA 1N2SA 4YAEA 3RAJA 4GGPA 5FFFA 4PG8A 4BOYA 3U3XA 3GGOA 4FBGA 5DCYA 1NHWA 1YB4A 2E48A 2CVZA 4RPKA 3EMKA 3C7AA 5DZSA 2RAFA 2EF1A 1U9JA 1ONNA 3G1UA 3DHYA 4CM8B 4QUKA 3IL2A 3ZZNA 4RVSA 4RF3A 2UAGA 1IULA 1ZBQA 4JROA 1JKIA 3QVSA 1XLTA 3N58A 3C85A 1S7CA 4GGOA 3X2EA 5IXYA 1TB4A 1IL0A 2HU2A 2X5OA 1DC3A 3BMCB 3JD2A 3PTZA 4MVJA 4E2ZA 4ILKA 4NQZA 3OICA 3KEOA 3LU1A 4BMSA 5JAQA 1NFRA 3ZWAA 1E6UA 3I4CA 4CV0A 1QV6A 1HDXA 3I52A 4P38A 4B8ZA 2OOSA 4CR8A 2ZQYA 5C7LO 2J3IA 3MTGA 5L7TA 1DLIA 4OXNA 2EJWA 4PLZA 3JYOA 4CUJA 4NK4A 1ARZA 4FGSA 4R5MA 3QVOA 3MWDB 1V0JA 2FZEA 1QYCA 4EYEA 4EI2A 2Q45A 3E5RA 3VPFA 4GX0A 4D0RA 3Q3CA 3LC1O 1M76A 1QYWA 4P4GA 2X7HA 1O5IA 2W2LA 4BO7A 2YQ4A 2VZ8A 3FNEA 1Z82A 4U8GA 3KHUA 4XZ3A 3WICA 1GCOA 2HAEA 5DOVA 1QG6A 1LSSA 3ZWYA 1WAMA 2PH5A 1A72A 2V6GA 3WYEA 4BNFA 1LQTA 3L6OO 4RDHA 3EAGA 1DLJA 1XU7A 4CLRB 2NU6A 3AU9A 4RVGA 4CM4A 1GU7A 4BKUA 3EVTA 1KVUA 3WQQA 4B4UA 1X14A 4W4TA 1YKFA 1DEHA 5HS4A 3ANLA 4IY1A 1DIGA 3JQDA 3KV3O 3VKVA 3U62A 4OKNA 1MFPA 1UXHA 4RZIA 4X54A 1QYDA 2O23A 3DMTC 3ADOA 4GSLA 4B3JA 1L7DA 4NJMA 3OEYA 4PFJA 3HSKA 2CF5A 1VL0A 1IHXA 1E6WA 2IDZA 4D42A 1E7MA 4XYMA 1E3EA 2PNFA 2J3JA 4CQLA 4ND2A 4I9HA 4BL5A 4XYEA 2XAAA 4K28A 4E0BA 4DPMA 5KIAA 2Q1SA 2QIOA 1LUAA 1IY8A 3OEWA 1PGNA 3IUSA 1V6AA 1D8AA 2YUTA 3C3XA 4I5FA 5J23A 1E3LA 5TRTA 4DLAA 2PZKA 3I23A 2V6MA 2QRKA 3PK0A 2JD2A 5JDIC 3N74A 4OGWA 3VZPA 3PDJA 2HSDA 3V8BA 1HDRA 2GZ2A 3GVHA 5JCJA 1JWBB 1J5PA 5DF1A 1XKQA 1DIHA 2G17A 1E1NA 4HKTA 2XPCA 1M66A 4W82A 3HDQA 1T4BA 2AQHA 1C14A 3LK7A 4ND1A 3TZKA 1EBFA 5BSHA 3RUFA 3OA2A 3E18A 4DLBA 1YBAA 1I33A 3T4EA 2BD0A 4I08A 4AJOA 3VPSA 3B6ZA 4DC0A 2F00A 3NX4A 1U7HA 5TF4A 3UICA 4UVGA 3I4FA 3ZV3A 2NUAA 3ABIA 3RFVA 4J1SA 4E33A 4IS2A 2BHLA 5F1PA 4OXKA 5KNLA 4M54A 1ZMOA 1VJ0A 5CEFA 4TZKA 2BGLA 3LYLA 1HE4A 2OFPA 5FEUA 3HN7A 1P33A 2YHIB 4RVUA 1AGNA 2VWGA 3GQVA 5G0TA 1YB5A 5L4SA 2QRJA 4OAQA 2R6JA 2HK7A 1DSSG 4MO2A 4ZQEA 4CMIA 2VT3A 3VH4A 1HZZA 1NQ5A 3GFBA 4MVJH 2VUSA 3H65A 5AXBA 4DQVA 1Q7GA 3V2UA 4J49A 1C0PA 1QRRA 1J49A 4W9NC 1IB6A 3FHLA 1D4FA 2OBNA 1CDOA 1DIAA 2WD7B 2ZJ0A 3NGXA 4LN1A 5DP2A 1HDZA 2GDZA 4ZGWA 3HHPA 4B8WA 5GY7A 3LT0A 5DP1A 4D3FA 5MDHA 3DBVO 2GASA 2R00C 1P1RA 3TDKA 4YJFA 2RCYA 4NJMB 4E2WA 1FF9A 4IIUA 3BMQB 1BWSA 1D1SA 2H6EA 3QE3A 4RZHA 2VWPA 3M6IA 3PQEA 4YPOA 4XRGA 4DYVA 3Q1LA 1K0UA 1GZ4A 5EJ2A 4RVFA 3O26A 4H3VA 5T6BA 1MC5A 2JFFA 4J0EA 3DZBA 5IZCA 4NIMA 3OFSA 1FDSA 3V2HA 5TT0A 4IJWA 2PLAA 2X86A 1JVSA 1OOEA 4GKBA 3TN7A 1GTMA 3VKUA 4ALLA 2R2GA 4M1QA 3AJRA 2D5CA 1WDLA 3GVIA 3PYMA 5A4DA 4RF4A 3NDIA 4IZIA 1XCBA 2HQ1A 3ZU5A 2VRCD 4E4YA 4HX5A 3RC9A 6LDHA 3VTZA 3QVTA 4GQAA 4NBVA 3CZMA 2OL4A 2GYYA 1C0KA 3RC1A 4J0FA 3W8EA 4J7XA 2FY8A 3BYZA 3S2EA 3JD0A 2VYNA 1CJCA 1SOVA 4HNHA 4N7RA 1ID1A 4XX0A 1ZUD1 4H16A 3C24A 3GEMA 3BTSA 3PQDA 1SBYA 2YFQA 3H3FA 2VWHA 4XCVA 4OHUA 3U5TA 4K1LA 3VVBA 3B20A 3P2OA 4PVCA 3RIHA 5I8WA 2Y1CA 3WNVA 5EQFA 4FS3A 1M6HA 2AW5A 3UCFA 1VSVA 4UUOA 4MVJG 1IPEA 4R1SA 3WTCA 1U3TA 5KJFA 1VSUA 4HFJA 3TFOA 1QMGA 1EUDA 1K6XA 3HQ4O 4TRJA 3RUAA 3UFXA 4BQRA 1Z7EA 5DCUA 4CQMA 1NVMB 2YV2A 4BGUA 2JCVA 7ADHA 3WBBA 4JBHA 2EKQA 2P9GA 3A14A 4MJLA 3ZWWA 5KVSA 5L9AA 3DOJA 1ZCJA 3QWBA 1R4NB 4PZCA 2CY0A 4S3MA 1SEPA 2Q2VA 4DBVO 1X15A 4WJZA 3H3JA 3WGIA 1HTBA 2AEFA 3AI2A 3U4IA 5L51A 2BMAA 3GNTA 4CUKA 3RU7A 1UP4A 2PZMA 2EGHA 1KC1A 3INTA 5COAA 4BNWA 3U49A 3HDHA 4CM9D 3JQAD 4W7IA 5TC4A 3SVTA 3DFZA 3SJ7A 1PU2A 2XXJA 1AE1A 2GSDA 3KUXA 4IDEA 2OO5A 4PLYA 3QV1A 3WTBA 2Q1UA 1P77A 1NASA 3EYWA 3B1KA 4LRTB 4CM7A 3DC2A 1R16A 3JV7A 4ESOA 1ULUA 4B7UA 3FPLA 3ON5A 2HK8A 2AEJA 2Z95A 5KCZA 1NWHA 2G82A 1YS4A 4B3IA 1U8FO 1E1KA 4ALNA 3DBLA 3UCEA 2PA3A 4Z6KA 1AXGA 4KQXA 2C82A 5HS6A 1O89A 3UAGA 3TNLA 4BO9A 5JSFA 1VE9A 3RVDA 1TT5A 3LT2A 3WWZA 1C0LA 3I83A 3QJ5A 1N1EA 2RBEA 4YAJA 5JY6A 1X0VA 4K6FA 5L7WA 2BFAA 2ZCVA 2Y0EA 2Y68A 1MXHA 1VJTA 2GN9A 5FWNA 1U5AA 1KEWA 3QSGA 3RC7A 1WP4A 2Q99A 3KYDB 4R16A 4NHEA 3VH2A 4OSPA 1CYDA 4RORA 4BO8A 5KJ1A 3PPIA 4IMRA 4FOSA 4GSKA 4D0SA 3KOUA 5JAIA 5JE8A 4A26A 1LDNA 4ID9A 4KZPA 1XIVA 1YDEA 2HJRA 2QZZA 1OBFO 3GPDG 3IIEA 3GMSA 3L0DA 3ONFA 1Y9AA 4LISA 2CDAA 3FSRA 4ALMA 3GDFA 4O0LA 4RL6A 1I3MA 3QHAA 3WQRA 2VRBA 2ZB3A 2O3QA 4KQWA 4WCDA 2W2KA 3D3WA 5F1KA 2FZWA 2NSDA 1P9LA 1UZMA 4L73A 3TPCA 3VPXA 3BMOB 3CTMA 3HADA 2P5YA 1J6UA 2X5JO 3M1AA 1EVZA 3F9IA 3F6YA 5KJEA 3HWRA 3STHA 1T1SA 4RPHA 4DC1A 3C1OA 4NMHA 5B4UA 5A03A 1H6BA 2YV1A 2Y66A 4R9RA 3K9QO 1Y7TA 4IXTA 4NFSA 1X1EA 3HB4X 5JAMA 5TLSA 1DRUA 2W90A 1GZ3A 2JHGA 2OP1A 3MOGA 3BHMA 1SEVA 4BV9A 1PZGA 3DZJA 4K9DA 5IG2A 1C1DB 1P31A 1F8GA 2ZKLA 4M89A 3E48A 3RROA 4CMBA 1TT7A 1NFQA 3HFGA 5CEJA 4GAEA 4R3NA 3IUPA 2VRCA 4YDRA 3SBOA 3V5NA 1V9LA 5HRUA 2FMUA 3ZDFA 3PJFA 3DZHA 4DWVA 1Q0LA 3F4BA 3PHLA 3PJGA 4D7AA 5HBRA 5LC1A 3VPGA 5B4TA 5HM8A 3H5NA 4EJ0A 4A0SA 5GZ3A 1PS0A 3L4BC 4F45A 2LDXA 3INGA 3RBVA 5CDUA 1UDBA 4FC6A 4WLOA 3VDRA 3V1TC 1VKOA 1HYEA 3QWAA 2J3HA
chains in the Genus database with same CATH superfamily
4YLEA 1Q20A 4L85A 4I1PA 2C2ZA 1COWD 1NW8A 3IUMA 3R7DA 1E3DA 3W1VA 4EHNA 1KYIA 1DTWB 2IHTA 5H3CA 4ITRC 2WU4A 4NJEA 1CQJB 4FYYA 4MVJM 3TUIC 1CYEA 1PUXA 3WL6A 2WHEA 3R1IA 1DO0A 4HH4A 4WW0A 5SZIA 4D4KA 2F8TA 3WGTA 1M2FA 1V1JA 2EV9A 3CF4A 3F97A 2JIRA 3QE9Y 1VG8A 2HMYB 2O7VA 5KSYA 2NT4A 3BGIA 3KSMA 4DRZA 2IXGA 4FFWA 2ZAOA 1NXPA 4IIBA 4DSAA 3VU0A 3T3NA 4Y9SA 3VR4A 1FDWA 1GA4A 2AFHA 5FPPA 3KPVA 1SG6A 5EFOA 5BN1A 4DAEA 1U4NA 3A28A 4ZYUA 3D5TA 2OHJA 3MS2A 1PJZA 4HN9A 4JI4B 2VK2A 2VYQA 2BEVA 1SCQA 3KJGA 1IC6A 2HJHA 1UJ2A 1EFLA 1ZINA 2ZB4A 3CUSA 3O4FA 4C7JA 4MQEB 3G2HA 2EG5A 1MF7A 2JARA 3O2JA 4B87A 4MVJI 4BDSA 4GU5A 4GSYA 2O54A 3H4VA 4TM8A 1RI3A 4D46A 1S4QA 4EMSA 5F5NA 3AR8A 4OAPA 5GGYA 1E99A 1D2CA 3OZIA 4JP8A 3LX8A 4NY1A 3WL8A 2ZWAA 2EFDB 2A9VA 1NWCA 3H2BA 3SHQA 1PNTA 1TK2A 5DM60 2H51A 4ZU3A 1YU9A 4UQOA 1CV2A 2QP3A 2HLNA 4HDOB 3MYRA 1H4TA 3A1WA 3HVJA 3Q15C 4O2BB 5EHXA 4NV0A 1RC1A 4EW2A 2H57A 3KQHA 2GNAA 2D2IA 1DZ3A 1ETUA 2AX3A 1EP9A 3PQ4A 5ECDA 5KMGB 5AKIA 1M2GA 2AKYA 4JOBA 2ZDGA 1QYVA 4RA9B 1NVGA 3BGVA 3LUCA 1NI3A 5B12A 4JELA 1GCUA 3KKLA 3AY3A 4WKOA 3VNVA 3B3JA 5HDBB 2P2GA 1JEYB 1BXGA 5JPCA 1D2EA 1TCVA 3RVLA 3VHRA 5KUTA 3ZJ4A 2X58A 3C4JA 1JHVA 2Q0SA 1EXVA 4MRSA 4OXRA 5D1NA 2RCNA 2JH3A 5TDHA 3G0BA 3R7NA 2HA4A 1ZQ9A 5ALKA 1M2HA 2V45A 2YXBA 3H16A 3JZMA 3T1YB 1M2EA 2J0EA 3QPDA 4BUJA 5LXTB 4H59A 3DBRB 3QNUA 4PYJA 5KVCA 5ALTA 4ES6A 3BA6A 3QOFA 3CRZA 4CN8A 1C2YA 1UODA 1GAWA 4FDVA 1U4OA 1ZW6A 4KQGA 3NGLA 3PSHA 3M9XA 4ARBA 5J2UA 1ADGA 3FIUA 3HCEA 5D2CA 3ENZA 3GZNA 5TV2A 2YZKA 4GLLA 5AQEA 1T6NA 1P7WA 4U7JA 2QZ9A 4KPYA 4XSGA 3NVMB 1NVEA 1I10A 4KGXA 1BZYA 5JLAA 1EI9A 3HCOA 3PDUA 1PZMA 2GETA 3AFGA 2OORA 2YV5A 4BMNA 4EL0A 4M7OA 2HA7A 3A27A 3UC5A 4G4GA 2ID7A 1SVWA 1KHHA 5FUQA 1TQ6A 2JFVA 4M1TA 5J1TB 4CT5A 4ABTA 1VL6A 1VKJA 5JCJD 4HLQB 4E30A 1QV9A 4RXTA 4YQEA 5C8XA 1P80A 2DFVA 3I9MA 4DLWA 4M86A 3U7QB 1M74A 2EW8A 4DCSA 2NSYA 4P36A 4D80A 3L7CA 2A0FA 4E5VA 3RWBA 3O03A 3T9BA 3H83A 4MKFA 4WNCA 4DANA 1IIRA 4L9AA 3SHWA 4AROA 4ENRA 4AULA 2FQWA 1Q0QA 3QVLA 3ZHXA 2RGRA 3AUAA 3LQYA 4AF8A 1BAPA 2JATA 4BEBA 4AXXA 4OQNA 2PYZA 3WMFA 2HHHB 2GRAA 4AO7A 2WY2D 2DUWA 2NQ8A 2FHSA 3HZOA 4JN6B 4XUCA 3UM9A 1GV1A 2WFAA 2AC4A 4D02A 1A4UA 2BM1A 4JLAA 3FPGA 4WKGA 4XGKA 3BB1A 2MJLA 2P9BA 5IP5A 4B6FA 1EESA 3WRWA 1JA9A 3R6LA 1IEWA 1P39A 2PKCA 4U0KA 2XUOA 3OJXA 1UJNA 4QJ5A 3FDIA 1SU4A 4KPGA 3G9UA 3RCBA 2X9GA 1XZLA 2X22A 3P9ZA 2OQVA 4L15A 3OUTA 1XZQA 3REQA 3LA8A 1RWMA 2EL7A 1H0KA 2FQXA 1M83A 3MJSA 2C4KA 2DGDA 1ZLYA 2WT4A 2XAUA 3IP1A 2QGZA 2V0GA 5KCMA 1DAFA 4UNIA 2OG1A 2ZSJA 1QOQB 2I4TA 4RXUA 4FK8A 5AKYA 2CKMA 2ZUCA 4GBJA 1GGHA 3I2KA 3NHBA 3SF8B 1YMVA 3VR4H 5EXPA 2B78A 1SO8A 2JIBA 4M8SA 4X93A 4EDFA 4RZXA 4U7HA 3C8DA 5EIHA 2N46A 3DBHA 1ZRNA 1QHGA 3A6KA 2GBLA 4MRMA 4Z1MD 4RC9A 3E3MA 2IHBA 3EQ6A 4XA8A 3EA4A 1Y5RA 4LYEA 1JDUA 3BRQA 4DQKA 1OYYA 3EK2A 1QS0A 5T4FA 5C52B 1W36C 4URUR 5TNXA 4W99A 3ZWVA 2IT1A 4N65A 2HADA 3AL2A 5JBNA 2BRUC 5E1BA 4M38A 3ZG6A 4B3FX 1T8PA 4PZ0A 2I4NA 1N0IA 4JBWA 2NGRA 1U2SA 4LI0A 1NRWA 5CG2A 3PLNA 4TYPA 5IDVA 1D2GA 1KEZA 3RV3A 4INPA 1B1CA 5IKEA 1CQZA 4IW3B 1NU8A 3REOA 1OXSC 1O94A 3FBGA 3LC2O 1JDNA 5IULC 1WCWA 2QT1A 1V6CA 3LLCA 2VP6A 3NTOA 2DUNA 5SYAA 2BH9A 4UATA 3R5KA 1R0ZA 4L3VA 1MVLA 4WCVA 1WXEA 2VAXA 3GLQA 3IUBA 4FTWA 3RHFA 3STXA 2WF9A 1SXJB 3FAZA 2Q3LA 1EQUA 3QSYA 3NVKI 2HXSA 3ECCA 4IF4A 2R44A 5LLSA 3O1HB 2PLNA 2QL5A 3BDAA 3LBAA 1KMHB 1FP6A 1YK0A 5F3WB 4CG0A 2ZAGA 1NU6A 1ORRA 4FW9A 1GYQA 3K8ZA 1GPMA 4NNPA 4KNYA 5KJCA 4R6XA 3R3UA 2VCYA 1E1RA 5CH8A 4LSMA 1KJZA 5AI8A 1INLA 5KHOC 1JYEA 1YUMA 4INJA 3HKDB 3MD0A 3K96A 1FXUA 4JHXA 2PS3A 4UDOA 1NJSA 4BO2A 1Q57A 5CFNA 5IK2D 3F73A 1ATIA 1I4EB 1TU3A 2OZPA 2MHCA 2X2PA 4JC8A 1J7KA 4JB0A 4OI4A 3TTSA 1G5IA 1H2FA 4LEIA 4XKJA 3W5DA 2VYND 1NNSA 1MO2A 4CIWA 1GRNA 3QV2A 4IG4A 5IN5A 3S70A 1U1DA 2AN4A 1OUMA 3QWHA 2YWBA 2O4CA 3OPNA 1F4VA 1ZGGA 3ZGZA 1PYDA 3FJOA 3CUKA 5JMWA 3DXFA 2HCBA 5FOTA 5EIWA 1UXJA 2ZJ3A 4ZIRA 1DVRA 1NXSA 1VIVA 4D6YA 1QGAA 2YWFA 4KN5A 3W3AD 3HBFA 1Y3IA 4CMGA 1Y3BE 1C9EA 3PKZA 4CJXA 4WXHA 4D4JA 4RV4A 2WC1A 3GW8A 4HX9A 1UMDA 2WYWA 2XQJA 4HDMB 4XWYA 4DGSA 3HG7A 4I1IA 4II2A 1FMCA 2VJCA 5K8TA 1P0QA 3RW9A 1ILEA 1AZWA 1B16A 4XR4A 2GRJA 4KU4A 1I36A 2A3NA 4RS3A 4ZVOA 1N5JA 1ZD8A 4EABA 2QV0A 5JTTA 5C7OO 1IK4A 1E3WB 4D26A 1XZPA 3BERA 5JTUA 1DBRA 4LDRA 3VZDA 2XVZA 2ON6A 4EVQA 1PI3A 3IAUA 3PVZA 1QFZA 4CNBA 5E6RB 2CNBA 4AY6A 1YVDA 1UK8A 2HMTA 4R4JA 3O0TA 3PUYA 3GAFA 4PPQA 1JIJA 4NDNE 1FQOA 1RBYA 2Z2ZA 4Q37A 1IJFA 2PKWA 1O9BA 3G82C 2D5AA 3O1IC 5E6SA 4B6JA 4D92A 4EPWA 3T1TA 1OFIA 2O50A 4M6WB 1RWBA 3VZRA 3ZE0B 3MGAA 4JFAA 3CN9A 4ZI7B 1B0UA 4ZKDA 2DWOA 1OY1A 2H08A 3BL8A 4MINA 3ZXSA 4Z7OB 2HDHA 2CE7A 2ZBUA 4ZDJA 4AO6A 1L4EA 3EWIA 2ZE5A 1SKQA 2IX3A 1GLNA 4Y2JA 4EELA 3FFBA 4LSWA 4GKAA 4C76A 1RWOA 1C3OB 1UDWA 1F6WA 2OO3A 1ZICA 3C6ZA 2JEYA 1EEHA 4AJ4A 3SX4A 3KVOA 3UUFA 3RUIA 4C7XA 5F73A 4G97A 3P0FA 2V7TA 2VA9A 2PCLA 4FYHA 3ZEAA 1ACMA 1W4ZA 4IWYA 2WSBA 4TT3A 2VIIA 1THGA 4TL6A 1MVNA 3QYPA 4AVYA 1XC7A 1GUBA 2WVGA 3EX7C 4JQZA 4A5SA 4FHGA 1P3DA 2BMEA 3CRNA 3CZ4A 2WYOA 3IDSA 4X1IA 4BN0A 5C8DA 5JNTA 4BFTA 1WDKA 2F8MA 2OC4A 2FN8A 3HA5A 1BHQ1 2JD1A 2OPBA 1XEXB 3IOBA 3P2KA 1JAXA 4KEAA 4RHXA 3WLIA 4DLLA 4F38A 4YV2A 1W4RA 1HLGA 2XCTB 2Z6VA 1P5HA 4PQRA 1XR3A 4MW2A 2QG4A 3WLQA 2C8LA 2WWHA 5DM1A 3BRSA 5BXYA 1VECA 4UCXA 4Z4CA 1I24A 1O9GA 5D3ZA 2YJTD 2DWCA 1AHHA 4IJQA 4YCCA 4J1TC 4BX3A 1BVUA 1HDCA 3FGZA 2R00A 2BI7A 2C5AA 1VBMA 5K20A 1ZONA 3U0BA 1P2SA 2NNWB 4Y6SA 1KMCA 2IIBA 1P3Y1 4ARSA 3HM9A 1ISRA 2GO1A 4NU6A 2SKEA 1Y5NA 3EC7A 4HDRA 3X1DA 1DFIA 4LZOA 5AKXA 2GLTA 1L0BA 4J90A 2RC5A 3RANA 5JR3A 5FPSA 5JJLA 3VYTB 5JFOA 1BXKA 4CMEC 4I1YA 1Z8FA 3ZY3A 1H93A 3WQBA 4F1JA 2HCFA 3TSWA 3CISA 1FSSA 1BS2A 5EQJB 5CB6A 1GXSB 3O1JC 3G59A 2YJ4A 4XYGA 2HXYA 1B76A 1MJ5A 2H2DA 4QHSA 1N8SA 1E62A 2GLXA 2GVNA 2H0QA 2WTXA 3H7AA 4QHYA 5EMMA 1S2OA 3OQ1A 3SC4A 2YDXA 2H4FA 2RGCA 5EP4A 3L7KA 2AC7A 2Z43A 2HTEA 3A3NA 4YLGA 2ZBQA 2ZXUA 1YL7A 2VHEA 3SK0A 1ODSA 1WXQA 4GXNA 1WZNA 4I4IA 4QEDA 5CA1F 4N54A 5D3MB 2J3DA 1WDTA 3GC6A 4FYXA 4QEKA 5C8ZA 2W71A 1RBMA 4RJLA 2FWPA 2BL4A 2IEBA 4RVCA 3TPZA 4J43A 3TM5A 5EMLA 4LRSB 5GM2A 2F48A 1CUCA 2YXLA 1V5WA 2ZWVA 4MV6A 1PGOA 1ODCA 1U7DA 2ZRFA 4XGQA 1TMYA 4X92A 5BSRA 5JS1A 2O2EA 1QO7A 1T9ZA 3DKRA 1VB5A 2ZYSA 1EVQA 4KFCA 3P8ZA 3TB4A 1MFZA 1KZYC 2X0RA 4GR5A 5AM4A 5HE9A 5IAGA 4RYLA 1AK1A 3I04M 3FUUA 3GBPA 3INYA 3T0IA 3OX2A 2ZI4A 5TQ0A 4DCUA 3EVFA 3FR7A 2COEA 3LKDA 4E08A 4LOLA 2Q27A 3DHEA 3G1TA 3KDPA 1NY6A 4JUCA 1XMXA 1EDZA 2CSUA 1SCNE 1D7OA 1MGPA 5FOVA 3M4ZA 3R0VA 1M75A 5JSZA 4YRFA 4F8EA 1PT7A 4KR3A 4L27A 1I3LA 2DBRA 3KX2A 3BD9A 1Y8QA 1JX6A 2HLPA 3TOZA 3SBEA 2XB4A 1QGOA 1VPVA 2FSGA 4X1YB 3JW8A 3KQWA 4ZCRA 1ZU4A 4G0ZA 4LQ4A 4RY0A 1ZIOA 3W5IA 1CRQA 2QTWB 4L5AA 4S35A 4CCWA 1TUEA 1QVVA 4JEUA 4PPNA 3MEQA 5EEGA 4WBNA 2PBLA 4P4NA 3FVWA 4GZLA 1H1LB 2W43A 4LNUB 4JU8A 2A4MA 3PLRA 3SEAA 5INTA 5HCIA 2EW2A 1BYUA 4FDAA 3GLIE 2W42A 3GN2A 1TQDA 4JT8A 4PZDA 1OHHA 3TTUA 4Z0TA 3DXXA 3QE2A 1QC5A 2E49A 2JFNA 3AB7A 3OZBA 4EAAA 4HNTA 3TI7A 3CUWA 3U19A 5B7GA 1NT4A 2ZSFA 1BXZA 1W46A 2NUTA 4MUFA 3HEAA 2PWYA 3RAGA 3EIXA 3TIIA 1A8QA 2P4HX 1XQWA 1O1YA 3ONDA 2P69A 3M4YA 3O8CA 4F46A 2XNJA 4DR6B 5I7OA 1BN7A 4NULA 2NYVA 3MW8A 1JZSA 5NULA 4BAGA 3B70A 1KJYA 4HZUB 1HDIA 1WX1A 3PX3A 3Q0IA 4I4NA 2X13A 3DQZA 4IWNA 3RE1A 5FI1B 2OK7A 5K8JB 4Y1RB 4ICIA 3E70C 4MDHA 3QEMB 2TMDA 4ABYA 5IM5A 3G68A 3EZXA 4I55F 5LP6F 1VE1A 1U7PA 3MWJA 5LP1A 4FGWA 4BE4A 1W4CA 4O2AB 2ZRKA 4FMBB 3EMDA 4M53A 1BCRB 3P9IA 4LHWA 1K6MA 4BMOB 5CVVA 3TD6A 3BXXA 3Q9LA 3PG5A 1OI3A 3FPFA 4JL6A 3B2NA 4B3HA 4ZTUB 3C5HA 3K6KA 5EXDA 2WTMA 1PLLA 4ZOQI 3E9DA 3PNVA 4GE0A 4JWKA 3D9QX 3EHEA 1CEXA 3WL5A 1L4GA 2I8LA 1UCFA 3BZBA 3ZCRA 2JJ2D 1XEAA 2X0IA 3ISJA 4RPLA 4AC9A 2O8CB 2O20A 2E6UX 1SCBA 1D6NA 3D8BA 5ED0A 1GG9A 4YYZA 2Z6AA 3MBKA 3MWEB 1CUZA 2KSQA 1QHNA 3H8JA 1UJ6A 4FYKA 4N3CA 1QO0A 2OAP1 2B4KA 3NW9A 2CL6X 2WK1A 2AEMA 4QPPA 3VR3A 3WK5A 4TVOA 4EFKA 2XX3A 2VHVA 5F64A 5BMVA 4UARA 1EJ0A 1QKJA 4FFRA 3D4OA 4GYWA 4JB3A 1ZD5A 3I37X 1MU0A 4Y1FA 4X20B 4QOIA 4AKEA 3CZ9A 1NKSA 4JCOA 1NBHA 4HN4B 2YC4C 3FKJA 3FNFA 4KYIB 5I9NA 2JFQA 3N39C 1EIWA 4LVUA 1NP6A 1GDDA 3A6FA 3VX4A 5KOYA 4NZZA 3ZIUA 5B3KA 4LJ7A 4LJSA 4BV8A 2Q6VA 1AKUA 1B8OA 1KI7A 2GX6A 2XRMA 4K6KA 2X5KO 2DCUA 2XE8A 3F9CA 2VYVD 4BZPA 5CA0F 4LI3X 2OVBA 4JZYA 3D8SA 5BN5A 4FMCF 5FA6A 3ZY2A 3FTEA 3GDWA 4X64B 2VJMA 3OUUA 3ODGA 1HR0B 1M2JA 4M9CA 4TZTA 3ETDA 3TL3A 1FJ2A 1FB5A 2B21A 2DQSA 3L7YA 5EJ6A 5EKUA 1V1MB 1Z7BA 1LV7A 2Q49A 3AEUB 1R50A 4MWGA 5T67A 4FYIA 3QW4B 4DMFA 4HMQA 1CUXA 1R3UA 1E8DA 3C16C 3NTQA 4G36A 4D9GA 4EG6A 1KQOA 2C2XA 4N40A 4I46A 5JIBA 1Z6XA 2XUDA 2CHGA 1NURA 5ICGA 2ODQA 2OHXA 2WNIA 4BZXA 3L1HA 4YRJA 1I7NA 5JXIA 5JZ9A 1TAUA 2JS7A 1O0BA 1ORIA 1U99A 5K3SA 3ZHOA 3SZ3A 1USUA 4EP1A 1GN9A 2XMSA 2EFHB 2NAFA 4QYWA 3HCCA 3F5MA 3JD1A 1WWKA 2JVJA 2AT1A 5BR7A 3EPJA 1UXGA 2BIFA 4OSOA 4X00A 3TX2A 4AJNA 2PEYA 1KC3A 5DBFA 2OILA 4BU0A 2DH5A 3OLXA 1TTPB 4BQEA 4E31A 2KWIA 3G8YA 4ISCA 5FI5A 5LJIA 1PLKA 4C4XA 3ZWDA 5IEJA 3THYB 4LOHA 5EWLA 3LLMA 4QUIA 1CY6A 4JGGA 3WLSA 2LGJA 2H1WA 2C4TA 2DX7A 2YJNA 2INGX 5JDCC 4DLNA 3LH5A 5C3MA 1P81A 1WUHS 2ZI3A 1ZCBA 3S6JA 2BISA 3HXTA 4ZQGA 3DAOA 4UBKA 3V4PB 3WJ7A 1SKMA 3DMYA 4L4RA 1GJRA 1JS1X 1IY2A 2PGDA 1RXSA 3G23A 3LKBA 1NQTA 4CM3A 3AP2A 3EIHA 3N5CA 4PONA 1QANA 1MCZA 1N5LA 3N6VA 2FXIA 3W3AH 3EVCA 1ZZEA 3NM5A 4HZGA 4LTDA 2JLUA 4D4LA 1EXMA 1JG4A 2I34A 3N87A 4B7AA 3N2KB 5B64A 5JQGF 3IQEA 3CNHA 5DBIA 4B0PA 4WCFA 3PQ2A 1AMOA 4WLVA 1YZHA 1SUCA 3NC1C 1V7CA 3NAGA 4TVBA 3ZV5A 3R4VA 2N9UA 2ZS7A 3KHKA 1IN1A 3BZUA 3QVKA 4QAJA 1RYZA 4RO0A 5AHRA 5AJHA 4F97A 5LDHA 2I6GA 3WK7A 4W8GA 1SVMA 1Z35A 2PSFA 1A2QA 4PLGA 4MDFA 2B82A 1TCAA 1TA9A 4IG9A 2A0YA 2RHHA 2JCGA 3ZGLA 3EG9B 3LQ1A 2EFCB 2DHQA 2OM6A 2WJPA 4Y8VA 5TR9A 1NP7A 4DF3A 3DBLB 4IZHA 4Q66C 2ENUA 2GAAA 1S1CA 2D8AA 2FEPA 2Q1WA 3QPVA 4JH0A 4TWRA 2EVWX 1UOOA 2QIPA 1G21A 1TW3A 2FCRA 4JNKA 4JJKA 4KJZA 3G5AA 3DKIA 1JJBA 2Q5JA 4MR8B 4G67A 4XCXA 1PR9A 2MSWA 3S1AB 3ZW8A 4D56A 4LIPD 3PNKA 1CB7A 4XE5A 5DV9A 1KXJA 1Z5OA 4C4YA 2D74A 2G6BA 4LVOA 1Y3CE 1QH8A 3WLRA 4B3RB 1JEAA 1TPZA 4A10A 3VBCA 3U7GA 3LCUA 1T9BA 1AS3A 1B15A 1RFGE 4M1KA 1F0PA 1UL1X 3DEAA 2HMVA 2X0JA 1YQWA 2G0TA 5EHQA 1ZJWA 4KQKA 2QNRA 2HZBA 1C8KA 1JALA 2BMDA 4OQDA 1ENOA 2LTAA 3IBGA 1JSLA 4RK5A 5FH9A 4KBYA 2JAQA 1L5YA 5IJ9A 2WJ3A 3RTEA 4XDZA 3B52X 4AECA 3I9OA 3OCCA 4ZEXA 3T9EA 1N4AA 4LHSA 2D0PB 3ILHA 1WABA 5JANA 2DEUA 1HOTA 3Q4GA 5KSPA 4KR9A 5IJZA 2JGRA 4YJ3F 4CIBA 3KWMA 3BG5A 3AJ9A 4IAOA 3IJPA 3P2JA 5C35A 2J59A 4Z3DA 3TW0A 3ETNA 4I5DA 3UV7A 1E2GA 5D84A 4CMHA 1VGVA 2WQ7A 4BBAA 4G0VA 1S9HA 4BQPA 2E1RA 4WACA 3H5LA 5LD2C 3PC8A 4QBFA 3AL3A 3D2BA 5KC8A 3KETA 4ND8A 3P9YA 4L08A 2R1VB 5AHXA 4JSTA 4KOAA 1G8KA 3S40A 721PA 4FHDA 3OCUA 5JRDS 4UTPA 1V3TA 1NW7A 3CY6A 1YBFA 4BJ1A 4E7OA 5JAOA 1WCV1 3P1JA 121PA 3IDAA 4HEQA 2XXBA 4Q9AA 3RQSA 5CDSA 2I66A 5CAEB 3T7EA 2Q3DA 5KSWB 1G16A 4CEJA 1QMPA 2JJYA 1BWQA 4DDVA 5KQPA 1W75A 2XSZD 3DNFA 1XQ6A 1G6KA 4GMGA 4HQ0A 1P5RA 1AXRA 3GGCA 3B60A 3LT5A 3NH6A 3RSFA 2B6NA 1YJCA 5JZBA 1V9CA 1XJ0A 1XJQA 2W22A 4DLKA 1K0FA 3EWSA 3FPJA 3A8TA 4KAXA 3TX6A 3ILVA 2ILVA 1OZHA 4BQSA 2FE1A 3DW3X 3EGDB 3MPOA 4RJJA 1MB2A 4QTYA 2GM4A 2FWMX 4ANFA 3OZCA 2H06A 3H5RA 3DFUA 3I05A 5IUJC 1XN4A 2D2VA 4CKCA 2GPYA 3UK6A 1OT5A 1N2CB 4M0FA 5BR8B 2JC3A 3UKOA 1KKUA 2J48A 5FNVA 2C3UA 3GOQA 3QLUC 3ZH9B 1SM4A 2IHZA 1PDWA 5J43A 3VV3A 3ZDBA 2Q7DA 3OU7A 3X1JA 4MWOA 3N6RA 4FN4A 4LDAA 2ZRDA 3DTTA 4HWOA 5GV8A 2PWPA 3U0VA 3F5QA 1IE3A 4EEZA 1PNOA 1BEZA 1T6YA 3F98A 5CEEA 4B5KA 2OGZA 4CV1A 1N6LA 1G6OA 1P73A 1TKAA 3ABOB 4YONB 1U8XX 4EATA 2O3TA 4Y9DA 1ZN9A 1W93A 4ZXPA 1ZVVA 1V3VA 1LJUA 3SQDA 5WRFA 4WKBA 3GJYA 1NA5A 2VHXA 2I2WA 1N6HA 2C99A 4DIFA 3MTBA 4ZI5A 1E2DA 2P77A 1B93A 2ZJ6A 5EE0A 2D2FA 1CUIA 2D3TA 5EQDA 1F2DA 4IDHA 1UC4B 5K2OA 3QU7A 4ZV7A 4V0OA 4AF6A 4BVKA 5SY9A 2IHJA 1IZ0A 3SJCA 2AN1A 2V5AA 1KRWA 2GFIA 2HUPA 1T29A 2FSUA 3S0JA 5F2OA 3IDFA 3DOUA 1CE8B 2C1XA 2F1HA 3C7CB 2CWWA 2D06A 2R1TA 3E27A 3M82A 1AIPA 3IP8A 1YRBA 2W9XA 3JQFC 1NG1A 4L57A 4LZZA 2DHEA 1E6EA 2QQ5A 3MMPA 1R64A 3LPAA 4MRRA 3LG2A 3EEIA 5DHAA 3LWZA 4DLUA 3AOEC 2IX9A 4EB8A 4PZLA 3BF7A 5EWJA 1CP2A 4MYTA 1YK1A 3KQMA 4L75A 3G0DA 4K88A 5EZQA 5IAAA 2CJXA 3AWIA 1IZ7A 3NYWA 3PRHA 2QD4A 3ZE8A 2ZRBA 1NBMA 4RM3A 3ITNA 2OR3A 2Y77A 4LBZA 4P4SA 2FJUA 3ER6A 3JR7A 1G59A 1KK2A 1HFJA 2E82A 5L95A 1W76A 2SBTA 3GD5A 3KHTA 5ULLA 3UOAB 3QEAZ 1PQUA 4D9BA 1VIYA 5HIKA 1VI5A 1N0VC 1XPOA 1JHRA 3SYKA 3CX6A 4DUYB 1SHZA 1YS7A 3D2CA 3I2GA 2IH2A 3B6IA 1PX2A 3JYPA 3CLSC 5JD3A 3SNHA 3OSUA 3G6WA 3PPYA 4FHEA 4XUGB 4K6MA 2JL1A 1PJSA 1G20B 4X1KB 5C4IA 1NC1A 1Y80A 2JBAA 4ENTA 5DSZA 3H75A 5HRAA 3HNRA 1VP3A 5FLXA 5JSKA 4XYLA 3MJVA 1DP4A 5JAZA 1Y7PA 4O33A 5GONA 3PUZA 1K3TA 1Z7GA 5CNKA 4I81A 5ALPA 5K3EA 4LF8B 1CS0B 2G5PA 2FRVA 4N3BA 2JLQA 4N9WA 1YDMA 1CVRA 3DYVA 1GO2A 5L7YA 1UZLA 1XX6A 4MTLA 1MENA 5CB4A 4QBTA 3LP8A 3ZDZB 2V7QA 3M6XA 4KUHA 3ZH2A 1G17A 5I9LA 2X7XA 5ARDA 2WHQA 4F4DA 5M2QA 2JHAA 2HWKA 3TMAA 1XZBA 2IH5A 4GBED 1XA0A 5DKFA 1KYVA 4N82A 1IPFA 5JJKA 3ZDEA 2O0MA 4MLZA 2YYZA 3QUTA 4L4ZA 5TS3A 3MIZA 1ICEA 1AHIA 2GCOA 3LBFA 3N8GA 4K86A 4D9NA 4G5FA 5JD5A 3GROA 3G2MA 2UVQA 5LA6B 3M4XA 3G9TA 3R24A 4GC5A 4QVGA 1E1CB 3HVHA 5E4JA 2XMPA 2H2WA 2R48A 4I1UA 2PJRA 3T8YA 4CM5A 2B8JA 1X7ZB 3DMTA 1S02A 2O5RA 2X5XA 4KO2S 4KX5A 4Y2PA 5GOTA 3UENA 3W8FA 4XH9B 3ONEA 1SZCA 2FEAA 1Z0IA 4GM0A 4HWPA 5CITA 4HGNA 1IH8A 3V42A 5F4BA 2A59A 2PA0A 4A16A 1SUSA 1O4WA 3NV9A 3QK7A 1L6IA 2WV9A 2AR7A 1BQ3A 1VHWA 3S28A 2QYSA 2WKWA 2VDRB 3QVMA 3ZDRA 1GZ7A 2YHIA 5FUBA 2NT3A 1M1NA 2D6FA 2CLMB 2H4YA 3TWOA 2LZ0A 1OVMA 1MB9A 3ZK7A 2HRRA 5CNMA 1U3VA 4J1NA 4U2FA 3R3XA 5EKDA 3V4SA 5C8YB 1DWQA 5JSHA 1TU0A 1Z6QA 3O9ZA 5CX4A 5CB0A 4JT2A 1RLMA 3K15A 1A2BA 2CWDA 2L42A 2ZULA 4LXGA 4H3SA 4X90A 4ZK6A 1QOPB 3CF4G 2V65A 4B17A 1AGXA 1LSUA 1WTCA 4HQOA 4J6EA 1B8VA 1ONPA 1V48A 1N2XA 1Q95A 2X0KA 2GK7A 3KAPA 3TS1A 3AEQA 1RI2A 3CBGA 3F6BX 4E5YA 2CJYA 4R1PA 2UYYA 3FUWA 3BZWA 3I64A 2O05A 4ZJZA 2A94A 2YFYA 2JFZA 4EA6A 2P9CA 5C5EA 3PDHA 2XZOA 2HNBA 3HUTA 4L9SA 4B83A 1BA2A 4KQHA 4RIIA 1ZN7A 2EDCA 1RQXA 4YT5A 1J2EA 1DU4A 1EFHA 1OREA 1Q17A 3MJFA 1NUHA 3N2YA 1XL0A 4Q15A 4B2IA 2J67A 2NVUB 3H4MA 5D87A 1XPUA 3AXTA 3VA7A 2WAAA 4KGVA 2IOFA 4RQUA 4BAUA 5I51A 2XT0A 4TLDA 1E9SA 3WNBA 3G9QA 3HACA 1WP9A 5KYUB 1Y7IA 2RI6A 2QJTA 4JBGA 3P9CA 4MKGA 1ODJA 1K75A 3EF1A 2ZBRA 2JIPA 1FQWA 1KP3A 4M8NE 1D1TA 4U6QA 1QWSA 2QVBA 4ZOCA 1WZEA 1YQEA 2X6QA 5KX5B 2PUAA 3RRBA 4YJDA 1VTKA 3ZGOA 3A3YA 1JHZA 1X2EA 3QBVA 2QNIA 3I8XA 4R8RA 4WBXC 5AKEA 1ZOIA 3VX3A 3VR0A 3F6EX 4E6PA 4EGJA 1AQNA 1XRNA 2SCUA 3BWDD 3CJTA 4PAQA 4JA0A 2XUAA 1I7QB 5A3JA 3R41A 3H0CA 1A8HA 4XAQA 4GL2A 1EK5A 2IH4A 2C29D 3WIBA 5DHRA 1U80A 4MS4B 1NMZA 1N75A 1QIEA 4E22A 4KTVE 1FU4A 5IDWA 2HF2A 3IAM1 1N7JA 2EFYA 5IF3A 1DJNA 3L43A 1VE3A 3V4VB 3ZVRA 4O2BF 1E2PA 5FYQA 3W2EA 4B6GA 1PFQA 2YOHA 3FOCA 1FS4A 1I7SB 4ZYLA 1ND6A 1U0NA 3EIEA 3O1LA 2AG1A 4ZOLB 3IURA 2QQ0A 2XDYA 1P3JA 1Z8HA 3LVFO 4F9TA 4JS0A 4NMMA 4K26A 1L8QA 2YZ7A 4PAMA 1G64A 3BCSA 1EJ6A 2OHHA 2QAJA 3DOHA 1CRLA 1TGVA 1BKDR 3QVGB 4WRRA 4XLLA 2WVHA 3VU8A 4BJ6A 1XRRA 1BFDA 4PE5B 3RT7A 4RE5A 1H5QA 2DWUA 3G8BA 1Q6ZA 3QVXA 4NMLA 2ZVQX 2CD9A 4RHUA 4YA6A 1IWOA 2GBPA 5DGIA 2FWBA 4GPIB 3J80A 2LIPA 3BL5A 3F67A 3LDGA 1MB4A 1QCCA 1QYRA 1V1RB 4GUDA 4EAQA 5LXTF 4R9UC 1DZIA 6AT1A 2EHDA 3KZKA 3T61A 2ZTUA 3THSA 2WP0A 3U7IA 1U6KA 1IVSA 1WY5A 2YZGA 3E82A 3ESZA 1UC5B 1W85B 4KMRA 1F5SA 2O0KA 3S2IA 4DA8A 1QORA 1JDVA 3WY9A 5BT8A 3I6BA 3V1LA 4E15A 1KO7A 3H2ZA 1W88A 3RASA 4EG8A 4XJXA 2IEAA 2BFEA 2IODA 4GI3A 1W4LA 4H31A 4F3TA 1EP3B 1QHHA 3VNRA 1N5DA 1TMOA 4CTKA 1U98A 3E7PA 4NH0A 4V39A 1QLJA 3OI7A 1AUOA 1YZVA 5CU7A 4PLTA 3WQSB 3N0RA 4GX5A 1XKXA 4Y9TA 4RABA 3NHSA 1RWKA 2W6PA 3CBQA 2YFKA 2FPIA 4G0MA 1JU9A 3R6DA 2PZJA 3VYVA 5K8LA 3DKPA 3AR3A 4XIJA 5IKPA 3NH9A 1XAHA 1CJVC 5EP3A 2BZSA 1U5CA 2AWNA 3DT8A 4G89A 1GRVA 4LXUA 2E5WA 5C32A 3GEHA 2QRLA 2CHUA 3CLKA 3K30A 2OCGA 3F90A 1M6VA 3IPCA 4KNWA 3KM0A 1E2JA 2QUKA 4BIIA 2O07A 3B3AA 1Q1EA 2REBA 1PIWA 3R6TA 4IIJB 2FK8A 4LXYA 3X44A 2XTMA 3PFNA 1JG3A 5E3IA 1KORA 4NEGA 5B1YA 4G0QA 1X86B 4YMIA 4RPJA 4ZOLA 4YP5A 3L7OA 2QTVA 3A04A 5EJEA 3WISA 3H9QA 4S24A 2B5VA 2A35A 3LUKA 3U1VA 2QAGC 4YMUA 4ZVUA 4I9GA 2NXEA 1COZA 1QJ4A 3DF9A 1XQVA 2DUUA 3F6PA 3UT6A 2HW8A 1H3EA 3KJNA 3LF2A 3JALA 4OQFA 2JGLA 3E1KA 1K7XB 2VTDA 4C01A 1R8YA 3CR7A 4QOEA 5E8JA 5CLIA 4KVAA 3V48A 1MG5A 4H4CA 1IONA 4WOBA 4CCYB 1E20A 4MZXA 5BMOA 1GZ5A 2ZJ7A 4O4IB 4X8HA 5KVVA 2DETA 1K7YA 2X1LA 4OEHA 3GFRA 4PWZA 4BZQA 4N48A 4Y6QA 4HNRA 2B92A 3D6VA 3FF4A 3KYDA 4HSEA 2EBHX 3GLHA 4MS1A 1B3BA 1XWIA 3N7TA 4JP2A 1HORA 1V5EA 1JTEA 2P35A 2IZOA 4LZPA 4WZBB 4EG0A 1QCZA 3DULA 4G2NA 1LI7A 3ZHUA 4TV8B 3CNEA 2J0UB 1DOAA 1FOEB 2MINB 2O52A 3L3BA 4OBXA 1EIZA 1M1UA 3L0SA 3NLLA 3KT0A 5CDYA 2CV0A 2AQKA 1PYOA 1R88A 2NZYA 4I5EA 4KO3S 2PLFA 3OWXA 3WGYA 1WQ1R 1E3TA 4OX9B 1AURA 4IFTA 4YXFA 5GADl 4FWTA 3OCYA 3FETA 1C29B 1Y89A 5GJCA 3CUUA 3WDSA 4HVAA 4DUPA 2VF2A 1A77A 5JBQA 2OO7A 4MK4A 1XL1A 5J47A 1R0WA 4UPEA 1WVMA 2J32A 2L69A 4FCTA 3TQFA 4AQ7A 4NK5A 4XFKA 5J2TA 4E21A 3D0QA 5K3FB 2FZLA 2QY6A 2IBTA 2FP4B 3ICEA 2RB5A 1GNPA 4EKDA 1U3WA 2JFHA 3RUEA 3BICA 4JDUA 4B48A 4ZMBA 1UKCA 4C21A 4KRYA 2AFIB 1RLIA 2J9GA 5F7ZA 1TVMA 5JUWA 4NQRA 4Y98A 2WAXA 4NYMQ 3U4HA 4RU1A 1USGA 1W2HA 2HEGA 4HNQA 4WK6A 1KRHA 3VKWA 1C7ZA 2R8XA 4RE6A 1GL7A 4ZV9A 2JANA 1BJKA 3SZUA 1MIOB 1FYFA 3RSHA 2I6UA 1E3MA 4Q3BA 4YS6A 3CWCA 4X61A 2G04A 4EFNA 5FBWB 1PJ4A 3IQFA 3SQLA 4B6RA 2JIMA 3BFVA 4BQQA 1M73E 2AZTA 1VM6A 2WSSD 1GFSA 1SPXA 1K7EB 2BR5A 2YXPX 3A1EA 4AY3A 4EENA 4KITB 2YRWA 3CVVA 3PXXA 2ZSIA 2JGJA 3RC7A 2RJNA 1T5BA 1WMSA 1YCGA 1X1QA 3MS7A 2CNWD 4HQRA 4MR7B 4WBSA 3PFIA 3HA3A 2EARA 2YIJA 5D01A 2R4TA 1SU6A 1LBIA 3DEFA 1RYFA 1FDIA 3G3EA 3HDTA 3EGWA 4RGVA 1PR0A 3QG5A 5K5EA 1IG3A 3BJEA 3KTFA 3DDSA 2XRZA 4DILA 3KDAA 3B82A 4Y30A 2AUNA 5JCXA 1K7SN 1QKIA 2VP2A 3O90A 2HB6A 2HA0A 4FFBB 3SHTA 2HSZA 2VP3A 4BEWA 3DT9A 1IBRA 2V98A 1XZEA 4BJ5A 2XRYA 2GDJA 2NV6A 1FU7A 4C30A 2HDOA 5JZMA 3L0OA 2Q5IA 4NFYA 1QGYA 3ZI4A 1DV2A 1NW9B 3ESYA 4BLRA 3G0CA 2YVUA 2ZUEA 2BVNA 5B53A 4Z0PA 3STTA 2PWZA 1ZK2A 2YJ3A 4Z7JA 1H85A 1N7GA 3EZNA 5H4GA 1QLWA 1R6VA 4GEGA 4RLHA 4DMGA 4DA4A 4OOEA 2EEPA 4DE5A 3KE8A 3A0RB 1TZKA 3DZFA 3GGJA 1ABEA 2GA9A 2YY6A 3OZTA 4N18A 4Q9NA 2I91A 2VYCA 1YKGA 4NYIR 2YRFA 4C89A 2FE4A 3U17A 4HDNA 3DZKA 4JXKA 2PX3A 3DE6X 4KKXB 3KYCA 3S2FA 2NMVA 1L5FA 1ISMA 4P7JA 2LUOA 3HFJA 2A0KA 1JJ7A 5AM5A 2A0XA 1Y3FE 4PPFA 2VT2A 3KQSA 1KI9A 4LRYA 3A9SA 3KNZA 1Q91A 3GMTA 3HBAA 4J7CA 2APJA 4KLZA 4KV7A 2F3QA 5H3LA 3WBJA 2XYQA 4KXLA 4L1KA 3DZIA 3OCJA 2I7TA 3MRVA 3IXQA 1ZXXA 3JYNA 3EFOA 4NH4A 3ERCA 2X8LA 3LKVA 2ZT5A 2VZ0A 1FSFA 2EATA 3C1AA 1OBOA 5K6AA 4OQLA 1DIOB 4ZI7F 3OPYA 1A5TA 1UBLS 4M1MA 1XSEA 1XHLA 4ZVTA 4JEHA 4Q16A 4E5DA 1UKZA 3PEFA 4KE7A 4LJ8A 2J5RA 3TR5A 5DLPA 5HGXA 5B1SA 1KZGB 1ZH6A 1R74A 2G76A 3H1AA 1UR5A 1R0KA 2J09A 3E22A 1SH7A 4FEGA 2IITA 4IRMA 2XNSA 2FSSA 1TDJA 2L17A 5AJTA 3KVYA 4CQJA 3R0ZA 4C5BA 2VBFA 2QQGA 2Y05A 1J8FA 1F8YA 2E7ZA 1FVOA 3U7EB 1M7GA 1IPHA 1NF8A 1Q14A 1DRKA 1VLJA 2C96A 3K73O 4IO0A 4MVJF 4NOMA 2J46A 3NOQA 2ZYRA 3EGXB 3N0VA