4D92A

Salmonella typhimurium d-cysteine desulfhydrase soaked with beta-chloro-d-alanine shows pyruvate bound 4 a away from active site
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
328
structure length
327
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 118
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d92A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d92A02
1O58A 4QYSA 4D8UA 3X43A 4I1YA 4OFXA 2ZPUA 1V8ZA 5DW3A 2ZSJA 5B1IA 3TBHA 1RQXA 3DWGA 4F4FA 3T4PA 1A5BB 3VBEA 1TZJA 1K8XB 1TTQB 5B1HA 5I7HA 1P5JA 1TJPB 1BKSB 2DH5A 4JBLA 3VSDA 1WBJB 2BHTA 1JBQA 2J9YB 3IQIX 1J0CA 1KFKB 5J43A 3VSCA 1PWEA 1PWHA 1VE1A 5D87A 2ISQA 5IWCA 4D9GA 2JC3A 1J0AA 5D84A 1J0DA 4D92A 1K8ZB 1KFBB 1TZMA 2RH9B 4HPXB 3L6RA 2ZR8A 5D85A 5I7AA 2O2JA 1C8VB 1CW2B 1Z7YA 4D9IA 5CGQB 2EFYA 2TYSB 5BW6B 1Z7WA 4OREX 5I7RA 4L3VA 2V03A 5EY5B 3R0XA 2CLLB 1F2DA 4D97A 3L6CA 1KFJB 4ZU1X 1UIMA 3AEYA 4NU8X 1D6SA 4L28A 3V7NA 3ZEIA 5JJCA 2Q3BA 5C3UA 4D8TA 5B3AA 4KKXB 2O2EA 5E0KB 3RR2A 1WDWB 4L0DA 2C2BA 2GN1A 5I6DA 3IQHX 1KL7A 1K7FB 4IL5A 5KZMB 4Y6GB 1K7XB 1TZ2A 2ECQA 1KFCB 3IQGX 2CLEB 5I7OA 2J9ZB 5D86A 4D9KA 2CLFB 1TTPB 2TRSB 1UINA 3PC2A 3PC4A 4ZU6X 1V71A 3CEPB 1K8YB 2J9XB 3SS9X 4LI3X 1VE5A 2TSYB 1FCJA 2Q3DA 2D1FA 3R0ZA 1UBSB 2RKBA 3HMKA 4AECA 3SPXA 1J0BA 5B36A 1M54A 1OASA 4NEGA 1X1QA 2CLIB 2EGUA 3FGPA 1A5SB 4HT3B 1CX9B 2CLOB 1VB3A 1V7CA 1QOQB 4H27A 1C9DB 1C29B 4LMAA 5JISA 3X44A 4PCUA 4D99A 1BEUB 1K7EB 5IW8A 1A50B 2GN2A 5B55A 1K3UB 1TYZA 3VSAA 1A5AB 1E5XA 1TDJA 1TZKA 4LMBA 5DVZA 4D9EA 3FCAA 3L6BA 4HO1X 2BHSA 3VC3A 4AIRA 5T6MA 2C2GA 3DWIA 4D9NA 2Q3CA 4D8WA 5J5VA 1KFEB 5DW0A 2WSYB 3IAUA 5DBHX 4D9BA 1FUYB 3SS7X 2DH6A 2CLMB 4L27A 2RHGB 2CLKB 4D9CA 1Y7LA 5KINB 2PQMA 1WKVA 2CLHB 3DKIA 4JBNA 1QOPB 4D9FA 5I7WA 4D9MA 1WTCA 4HPJB 5HBGA 5CVCA 4COOA 5IXJA 4WX2B 3PC3A 2GN0A 5B53A 4ZQCB 1J0EA 2ECOA 3BM5A 5DBEX 4XUGB 4D96A 3AEXA 3PR2B 4HN4B
chains in the Genus database with same CATH superfamily
1T3GA 2MSLA 4K3UA 2W43A 5FUWA 1ACLA 2NVUB 2QORA 4BNDA 5A2QA 4N48A 2HMVA 1DCMA 3F9RA 3ZLBA 1NRXA 3C3EA 1L8XA 2QTZA 3A11A 3OTHA 4X7BA 2H65A 1YA8A 2Y6VA 2H1HA 2F9FA 5ALMA 4Q1DA 3JYHA 4JEHA 1TGVA 4FVTA 2OCIA 2XAAA 3IJPA 2G8LA 3EZ6A 3JWIA 1EXWA 3ELUA 3LXXA 1GAQA 2RB4A 2XBUA 3IP6A 4KIUA 5FNVF 1JHMA 2WP0A 5FRDA 4GL2A 3BRCA 3GF4A 5LUAA 3ZY2A 4DQDA 3HYSA 3ZWXA 4MVJG 1E9CA 3CN7A 4EO9A 2OSBA 4F9GA 2AZMA 2J0EA 1N0UA 3IIKA 3L0BA 3NNDA 4WEQA 3WWDA 3UEOA 2CFCA 3AX6A 2BZ0A 3SEFA 3IAS1 3ZJYA 5L4NA 1Q77A 2HJWA 2GBCA 5EUMA 4V39A 3RIYA 5CEEA 2UYCA 3S8MA 5L4LA 4E07A 1L0BA 1MKYA 2CUNA 1ENPA 4PLYA 1NRIA 3DMTC 3QX7A 5BSRA 4INJA 4DZTA 4LY0A 4AJIA 5AUNB 4W5NA 2CXTA 3WRXA 3P9RA 4Q00A 3ZD6A 1JJ7A 4O63O 5HG0A 3QYAA 4FOTA 3WNCA 3ZY4A 4ZVQA 1LK7A 3HQ4O 5A3JA 3EAGA 1O6BA 3N53A 3FBWA 2HD4A 2NVOA 4HPWA 1R3UA 2QPOA 3O9MA 4LGVA 4EW2A 3U7GA 2W7TA 3W8NA 1DIRA 2CJXA 4NBVA 2C59A 1A7JA 4NRDA 4PLWA 4B7XA 4DJFC 3TSAA 2V6IA 4YB8A 2QRLA 4UZSA 3VO9A 2EFHB 3KVNA 3GUVA 4PO3X 3W5UA 3ZZNA 1LS6A 2HOQA 3ZXSA 2I5PO 1EA5A 4BB0A 1KU0A 2OK7A 4J0JA 4HNUA 1KQOA 4Y2QA 4D4MA 4XOUA 2J4FA 4TVKA 1PGQA 2P4SA 3KSRA 1Y0BA 4S35A 1FUUA 2VCEA 1ODFA 1QG0A 4LV6A 2V0NA 3ZVMA 1EGHA 3K70B 1X1BA 1FU7A 2I2XB 3AHGA 3PDUA 3P45A 3WJ7A 2DXIA 1TJ3A 1MP0A 1V16B 1U0LA 5LZ7A 3OZXA 2FWRA 1E32A 3FTCA 1G42A 3I09A 1S2NA 1E59A 1O97D 1W52X 4AWXA 3TE7A 3IHTA 2PD3A 1QRSA 4ZYZA 5CNJA 5ILQA 4HVAA 1UDWA 1Z18A 5WRFA 4K9NA 2IY7A 3R75A 1E3WB 2ZJBA 1G291 1CUIA 2FN3A 4YJ3B 2AJCA 3U31A 1B00A 2PRZA 4DSZA 3I62A 1Z25A 2EJTA 5A5VA 2WVGA 1DBPA 1YQTA 2JGJA 2ZQ5A 3HABA 4JMLA 3VM6A 1Z15A 4J4HA 2PH5A 3KKNA 4UE3S 5GQSA 1ZD8A 3RAGA 3WLLA 3SS7X 4EUNA 1M0EA 3BGDA 4RA6A 3W5AA 1MNAA 1H6DA 4BRSA 5C31A 4AY2A 1XD9A 3FVWA 3KJNA 4I4TA 1M2GA 3UB3A 4BX8A 1T2FA 1U1EA 1ZU5A 2JLQA 1CDEA 1KIAA 1D6NA 3AIOA 5JG7A 3WAKA 2O8EA 1E3TA 3CVOA 2ZUEA 3D3KA 4TROA 1NYQA 1VPWA 2I7VA 4FN4A 3OA0A 1RAAA 4C14A 2AGVA 3DJFA 4UHFA 4JQZA 2OCGA 2Q8NA 5CIQA 1WX1A 5A5FA 4BVJA 2GAFA 1O58A 2MSDB 3OT5A 5G4KA 1ECGA 3OZDA 3ZGNA 2FK7A 4OH7A 3NJRA 3WYAA 5AW2A 1RLUA 2XMZA 2QNIA 3OPYB 4DLUA 4FMDF 1CEEA 3SX4A 4CCAA 1CS0B 1J00A 3I52A 1GVNB 3H9BA 1WMFA 1VL2A 1QHSA 3AHIA 1FW8A 5EJGA 4DJJA 3EASA 1YNSA 4Q3DA 1JYEA 5FNVB 4PYMA 4F5ZA 5IM4A 3T5MA 5TPZA 2ZPAA 3H17A 3JASB 5A4MS 2O8FB 3RUIA 3F1KA 3FOBA 1W49A 2RH9B 4PLFA 2HDHA 1FC0A 1P80A 1UKVY 4C87A 4CL0A 1GPAA 2NTVA 3N87A 4CDRA 4F1WA 3BD9A 1NG1A 2C9YA 1XOIA 4U6NA 3FTEA 1CUJA 1J5PA 1KBZA 2GJKA 3HHEA 4GGPA 5MN4A 5DBGA 3CO0S 5EP1A 1NVAA 4R1LA 3H0EA 4G6ZA 1PT5A 4G5XA 4PBSA 2H54A 1DXQA 4H60A 4QOSA 4I9FA 4A6XA 2XR1A 1U90A 2XT6A 2FB9A 1BW9A 3GCXA 3U9SA 3AHCA 4C01A 4F5WA 4MRPA 4KQMA 3IUPA 3VR3A 5K7SA 3DULA 2QNBA 4NDNE 4XX0A 3SFZA 4J94A 1UPAA 2XCQA 4NMHA 3GA5A 2J32A 5DHAA 3U37A 5P8WA 4C2BA 5E4JA 2GJ4A 4TKUA 1ZONA 2CV1A 3QVUA 1V95A 1BOFA 1BQ3A 1CNFA 1E2UA 1GAWA 2CMHA 3C5HA 3I23A 1PT9A 1AKMA 4U7HA 3VVCA 4BQNA 1R1DA 1FQOA 1ZZEA 4GXTA 4RIFA 2X13A 1D09A 3ZDRA 5IJWA 1UM9A 5T4BA 4ZDWA 3PJDA 5T7BA 1ZJWA 7GPBA 5IBQA 4EMTA 1AC5A 1Y34E 2FV8A 2IOQA 2IUFA 5EG5A 3BDAA 3UG6A 2QVYX 3HWWA 1J6UA 4XDGA 3MCZA 1DCKA 4FFOA 4W7HA 4KQFA 4PIPA 2XMSA 3I04A 3WQQA 3PDCA 3U3JA 4GOKA 1DKNA 5TF0A 1LK0A 2GLUA 3KBOA 4I50F 1CDDA 3RSHA 5ICEA 4BLOA 5EYPB 2O7QA 2PSFA 3EJ6A 3NHZA 1C5KA 1FBTA 3OD1A 3WE7A 4B8ZA 3JAWB 3LIIA 3LLMA 3R5FA 4P54A 1JTFA 1IJKA 4DR7B 1R9GA 1N5DA 4EW1A 3AKEA 2B8JA 1N8TA 2Y1LA 2KX7A 3KQPA 4BNWA 4QT4A 2B21A 4P34A 4M1YA 3LUHA 2IP2A 4F3KA 1XLTA 2E4XA 3D2BA 2A6PA 3NAMA 2XNDA 3M3DA 1R4NA 3IV7A 1ISRA 2B4YA 2ENUA 4RJKA 3VVBA 3VYTB 4A92A 2QJTA 3A06A 3CKLA 2IPAB 2XAUA 3F6RA 1Y7LA 5KTRA 1NFQA 1O89A 4EKGA 5A6SA 3FSGA 4CQMA 5IAKA 5SZKB 1OWOA 3QVJA 3G2OA 1E2DA 3NM6B 3FG9A 1HOTA 3S44A 4UOEA 4RA9A 1WQ1R 3CEMA 4PFSA 1FP1D 2GHTA 3E5MA 3B9PA 1MFZA 1NOJA 2G88A 3CX6A 3GRYA 5K4GA 4B3RB 4KQIA 2BFOA 4JR0A 1VLQA 1YB1A 3NDIA 3SSNA 2WU0A 4A26A 3T8YA 3ONFA 4QDJA 3UYKA 4ZK2A 3HCAA 2LPMA 1TKAA 1VMDA 1LPNA 4YQFA 3R5JA 5K3BA 3GOHA 3NP9A 4ASUD 4DDUA 2IIPA 1WY5A 4J2TA 1JJIA 1TQ4A 3UTDA 1PU2A 1AS2A 1RYYA 1ZI6A 2H1RA 1FNNA 4W1QA 4TLCA 1Y6ZA 1L7XA 3TINA 3WGJA 3KQLA 1EB9A 5DI9A 9MHTA 2OZEA 1BVYF 2VRBA 3QV1A 3ZQUA 4N3GA 2KBEA 4CR8A 4Z54A 5LM3A 2EVWX 4FYWA 1EFVB 2NTJA 4IIJF 5EQJB 2PLWA 1H3FA 5AKJA 2GO1A 2O23A 1EFUA 3PQ2A 1I30A 1R6UA 1T8TA 3U3MA 1T1RA 3E81A 4UHCA 4Y1RB 3LCUA 4RKEA 5TS3A 1ABFA 5K09A 5KKCA 1W59A 5HSGA 4N3NA 2PMFA 4G41A 2AHOA 5BSGA 3UXYA 1TJNA 2PE5A 3DPIA 4S05A 1I4WA 1KDRA 2UYYA 3WNBA 1ELOA 3VOAA 5M7EA 4A2WA 3KZCA 3DMRA 5JNTA 4G8BA 1IZ9A 3PQCA 5GGYA 2XYPA 3L82B 1AV7A 3B3QA 4MRMA 2VHTA 2X5KO 3CE9A 2VCYA 4EATA 4ER5A 3Q3GE 5EHQA 4YV1A 2W6ZA 1U7XA 3GPCA 4QBHA 3RRZA 1FPMA 4Y2TA 5AVOA 2VJQA 3W77A 1MX3A 2J9XB 3B13B 2J3HA 3CUWA 1BNCA 1CZRA 4NQRA 1NF8A 3E15A 3DQPA 1IPFA 2PU7A 1QMGA 3DEIA 3KXKA 4JYCA 1S3FA 3W3AH 3L8EA 4IHQA 1YRWA 4NYMQ 4BUZA 2LCFA 3Q7RA 1LKZA 3A6LA 4O8CA 3ECCA 4L15A 5LBUA 4QPNA 4F2WA 1QC5B 1CIPA 1C7FA 1W47A 2ZWOA 3DOHA 5F9HA 1DLJA 1X7ZA 1CX9B 2E4AA 3CTMA 2VPPA 1U8XX 2P6NA 1IRXA 1UPBA 4I50B 3ZCTA 5LFAA 4WKOA 3KFXA 3WRYA 3KPWA 4DLPA 5DEOA 3UPDA 3RB8A 1MAHA 1Y1PA 3FTQA 1VCIA 1E79D 3SXPA 4AO6A 1HORA 1DC4A 3QLVA 4ZTBA 1XJCA 5J5CA 3FJYA 2BC9A 1UMCA 4W9MC 1DADA 3V46A 3BMCA 5A9RA 1HG1A 3AZPA 3ENVA 2H4ZA 3JVVA 4M9SA 3W4KA 2HFJA 4EX7A 3JWHA 4H4CA 2EQBA 3REQA 2QD3A 3KOWA 1GQYA 5DNWA 3M2PA 4B2PA 1RJDA 1OFHA 1Y6GA 4HHEA 3VR6D 1E2EA 1L7OA 1P1BA 1K5GA 2CJYA 4P7FA 1W5AA 1RMTA 3D5QA 3UCXA 4A0QA 4HEA1 1FU8A 2FG7C 1CEQA 2C83A 2CL6X 1N5MA 2JFOA 3MUEA 4BNLA 4HFNA 3ZCSA 1CCWA 3KDAA 2ZU0C 4R9SA 1JA0A 3LLUA 1OH6A 3LBIA 3Q7QA 4IJUA 3T3OA 1QIFA 2IPMA 4UUBA 4B3CA 4KMRA 1JP7A 3MGBA 1GTSA 4QICA 3V8PA 1MFPA 5C1DA 4TWRA 3DP7A 2CCGA 2M1XA 2YJ3A 1Z0DA 2WUGA 3AM5A 3QA3E 3L9XA 3BQ9A 4OI0A 2OCPA 2Z5GA 2Q2VA 2Q4TA 3TDNA 3OO1A 2AMFA 5IS2A 4EF6A 3GDHA 3IAFA 1TMGE 1MB4A 1GLNA 3X1KA 2YIJA 1YRQA 2Q5LA 4IICA 1A77A 2BE9A 2VHUA 4JD5A 4IIBA 4KQ6A 3GL9A 3LXMA 3OAAA 4Q37A 1AS3A 4ALKA 4DBLE 2FR1A 1DKQA 2YDYA 3UMFA 2C4HA 3KCNA 3O8QB 1HDIA 3DHYA 4IIJB 4LMPA 2WPDA 4P4UA 1N7IA 2VRCD 2QSJA 3O92A 4HLUA 4A91A 4D4KA 4LZNA 4IEEA 3TTSA 2OAP1 1XRNA 2X0IA 3NV9A 4MVJE 3M4YA 4X8LA 4XLLA 3NNSA 4A0GA 3WISA 2IYNA 1G8FA 1YE5A 2HWXA 3L6OO 4RD0A 1M2FA 5B3LA 5BN3B 1QHXA 2ASEA 2QRVB 3T3EA 1VSUA 4N1AA 4CTNA 1ECCA 3HDJA 3FCXA 1K97A 3HN7A 3OM0A 1W36D 1KH2A 1PR0A 3CURA 4IFEA 4N0QA 3BWBA 1SKUA 4RH1A 3DNMA 3FWZA 5JY1A 1KMMA 1NL3A 1UP7A 5C34B 2ZIFA 2AG6A 5K1ZA 4YMGA 2ZSKA 5ALFA 2GN1A 3ZHBA 1CJMA 4C2AA 4L9WA 5BUQA 2XTNA 4ABYA 3CZQA 3HBLA 3KEQA 4B4KA 5CYGA 5T3YA 3PDIA 1VDZA 3DOCA 4CUJA 1JMYA 3MA0A 1UKEA 2NVBA 1JR3E 2AX4A 3BMOA 4I4IA 4Y8VA 3P97A 3DM5A 1PDVA 2A1IA 3A4IA 4XTCS 3TQFA 4DDVA 4FGUA 1PE0A 2M6LA 1XDDA 1KH3A 1NLFA 1YDGA 1SZPA 1CJTC 1NATA 2EV9A 3BB3A 3JS5A 4KIJA 1IQRA 4LCEA 3SPXA 3GRKA 3IAM6 2ONJA 4IFTA 4DIUA 4IXWA 9LDTA 2FDXA 1IN8A 1VJ0A 5EOVA 5CG2A 4HUJA 4G0PA 5G1OA 5IASA 4EPRA 3IKTA 4GXRA 3W78A 4IJQA 1FNBA 4TMKA 1R6VA 2PIAA 3VVMA 4FD3A 1ENYA 4LN1A 3E61A 4X1YB 4LJ6A 5JMPA 3T34A 1TMKA 2AWNA 3KYJB 3FA2A 1BE1A 4FC7A 4LOKA 2EFEB 5AHKA 2HA4A 3ANSA 4ETMA 2YHSA 1M10A 4IILA 2PUGA 4UTXA 1E2MA 3AUKA 3TRHA 1G2QA 3UJAA 1GV1A 3RVPA 3B53X 3IUNA 3MHTA 3DDCA 1ZJ6A 4G2TA 4Q3BA 4ZVPA 3GR6A 1YZYA 3PJFA 1FDTA 1U2PA 2ZWAA 1X92A 4XLZA 4R81A 2AW3A 3MAJA 3CF4A 3TIFA 5LYJF 1Z4IA 2DBYA 3BDIA 3TE6A 4B43A 2WSYB 4E88A 3DWEX 2IGTA 1W25A 3D8TA 1U4OA 3HL4A 3VV2A 3SJUA 3TDKA 3ZI4A 1JIKA 5JZBA 1GT91 4M0PA 1N9GA 2HXGA 1M2VA 5LP1A 2MTBA 4BHTA 3O21A 1ZNXA 4KMSA 2E9SA 3DONA 1OPXA 5EN4A 5KTMA 3F5SA 2Y9MB 1J2EA 5HKKD 1DBQA 2VF7A 4HUQA 2JVKA 5E95A 2WHXA 2PNJA 3SM3A 3KYIB 1UWVA 4YXWA 4NAHA 5TQ2A 5BNFA 1RM5A 3JQQA 1ATIA 5B7NA 2XGOA 2K4MA 3V34A 4WADA 3DAPA 4LXHA 4OFXA 2ZQYA 2V55B 1HK7A 1KRHA 4L73A 2PUBA 1RPZA 1J1UA 2V1UA 2WWIA 1TLTA 4WBSA 1RQXA 3MJFA 1GILA 2J6BA 2PPLA 9ABPA 5COAA 2YICA 4JQYA 1Q6ZA 1J2JA 5EVJA 1JFFB 2N0SA 3D7RA 4NCXA 2P7HA 2YHBA 3NLLA 2ZPTX 3QPWA 2EWWA 3DW1X 5TF4A 3TKYA 1JQEA 1X0XA 4KQKA 1EE2A 3ZD7A 4MINA 2C78A 4L5JA 4DJTA 1AUQA 2VPWA 1WB9A 4G1MB 2VTDA 3FPKA 4OQEA 4OA8A 1HYQA 4LK2A 4Y30A 4RTRA 8ADHA 4GKKB 1A8UA 2VVTA 2QD5A 1RLOA 2YYYA 5C8ZA 2PGNA 1Z7GA 2HCBA 2XOKD 2ZRGA 3GAZA 4NU5A 3U4QB 3EYAA 4NHEA 1A4RA 1Z68A 3B1ZA 4YUYA 1GFIA 4KLNA 1VIDA 1XRMA 3GJ5A 1J99A 2OQVA 5DX0A 1XI2A 4CM6A 3DMGA 4HX9A 4BB6A 1FPQA 2Q6IA 4BB5A 1V8OA 1PFQA 2WAOA 1K4KA 1G20A 3NYWA 3C6MA 1AU9A 4YCMA 1TVEA 1V1RB 3I76A 3IUEA 3K6JA 3M1YA 2JIZD 2FSSA 2GFQA 3H11B 4PXSA 4P92A 5AI5A 2E1RA 1QB7A 3UW3A 1ZR2A 3BJRA 1X80A 4LJ8A 2HK6A 1FTGA 5LBIA 3RVOA 4AYXA 1AHIA 5HEKA 4WV3A 5F4BA 2ZM5A 1GY8A 1O57A 3VYSB 4AJOA 1M8PA 2B4QA 4UVGA 4I5EA 1IXZA 5A5EA 2H52A 3PUXA 3U3KA 2J5BA 4CMEA 4LF6B 4ZPJA 2J9RA 3VO1A 4DIFA 1ODCA 1F38A 5DNVA 4A6PA 2OEPA 4EUHA 5JSZB 1B73A 1SG6A 2Q5FA 3DHVA 1Z6QA 3A27A 3A9VA 4Z8YA 2J87A 4MIKA 5LQSA 3UGJA 4BV2A 3RROA 3NIDB 2PEZA 3U26A 2VDWA 1T24A 3RT9A 5FAXA 5HPYB 1XCJA 4Z4CA 5H9WA 3SHOA 4C7OB 4PLGA 6AT1A 1WP9A 3VPDA 5LYYA 1N4AA 3WSWA 3GK3A 1G1MA 4ZV4A 3PPYA 2W11A 4JL5A 1NN3A 2JHPA 3BJEA 1E3LA 3BIOA 3LF1A 4I6EA 5SICE 1P4JA 5KVSA 4B32A 2J59A 4NSNA 1G3MA 4PPYA 4QM7A 1AT1A 3DYVA 1F4VA 2B4RO 4H59A 4HS4A 4IXDA 4Q05A 1BG6A 1UKCA 5LYJB 3HJCA 1FTQA 2JEZA 1FRFS 1NKSA 1QV6A 4QTTB 5ALTA 4E3ZA 3K53A 4JLAA 5A4AA 1CEXA 2V1XA 2ZRKA 3CE6A 3RTAA 4CIVA 5FX2A 5C32A 1VSTA 2W6PA 1XZFA 4EUEA 3WL7A 1OLXB 5E2BA 2QTWB 4BEBA 4ZCMA 5JAMA 1F20A 4KFRA 4I5IA 5I51A 3VOBA 1KMIY 2PVSA 821PA 2FKAA 3NT5A 3U4IA 4E5NA 3QUBA 3FNHA 2YV5A 3LUAA 3VI3B 3RDPA 2W9XA 4GQIA 2VT2A 1T6XA 3RV4A 3T5TA 3N2YA 4GFDA 4R2HA 4WT7A 5J1TB 3SQLA 2O9JA 3NWEA 3PGKA 3T3GA 1JIQA 4FDVA 2QW0X 4MQEA 3P0IA 2XDQB 4MP8A 1DAFA 1E2NA 1W87A 4ZRMA 2ZROA 2PRJA 4MS3B 4RD3A 4GQAA 3WR5A 2O8BA 1IXKA 1JXOA 3WAGA 3WLOA 1W581 4ENUA 2NXNA 2GBPA 3USZA 4CLXA 4BKQA 2B4TO 2Q9BA 3OZCA 3Q3HA 3MZ0A 4LZPA 2DB3A 4ALJA 3NC0C 1JHYA 2ZRMA 4L85A 2PS9A 4OHOA 1WE2A 5KJEA 2HWKA 4FC6A 2AXEA 4RZHA 2H7XA 3RYFB 4BL5A 3O2SB 6NULA 4ZKDA 1NXOA 2PR7A 3ME5A 2PJUA 3OLXA 1NR1A 2KQUA 2DULA 3EW7A 4Q7JB 3PJGA 2ONCA 1ESDA 4FE3A 4KNWA 5D84A 3R5HA 4EZIA 1C1XB 4X90A 1FFSA 3NBYC 1N2BA 1CW2B 2D0DA 2X3YA 2EDAA 4G67A 4RKYA 5CGQB 4IDCA 4DMLA 3HO1A 4G9GA 4KWEA 3B51X 4OAQA 1H4TA 1M2OA 1U2QA 4BEVA 4CMKA 3K09A 5JDCA 5KNDA 2O4CA 4FW9A 4A23A 3AR8A 3V2UA 3GFTA 5JZSA 2YUTA 3WBBA 3TIIA 1IM5A 1K3FA 4PZEA 5REQB 1X15A 4OOEA 1SXQA 4P2BA 4UU1A 1S8FA 1H93A 1AV6A 1EBBA 4HDSA 1V7ZA 3VR4H 1Q95A 3FLBA 2QM0A 2WUEA 1WWKA 3LUDA 3TCKA 4BO4A 1J7JA 2ECQA 2FR8A 5B4UA 2DQYA 3IT2A 4C4AA 2W22A 1SCAA 1C9MA 4R7ZA 5I7OA 1AZLA 1WU8A 1FQJA 2CC2A 1NVBA 1QHHB 1S5PA 2NT4A 2NZXA 2YDXA 3D0OA 3O3CA 4J0QA 4GX2A 5COBA 2RBGA 4W9NA 4GZ5A 3EQ6A 1V3VA 1EFLA 1DS6A 2CNLA 2ET6A 4G9EA 5HK8A 1PX2A 1E1NA 2EKQA 2IDMA 4LMRA 1W4RA 1T4BA 1ZOOA 3UAYA 4WNAA 3HRIA 5KAMA 3GROA 4CWAA 1IM8A 1RS0A 3BPSA 5DM1A 1PZNA 3AR5A 2J3DA 3X2EA 1U7UA 5BPFA 5C37A 2JAHA 1GGKA 4Z9FA 5KNBD 2V4ZA 5LBTA 1W1UA 2FMKA 2Q1TA 1S4QA 2GESA 3C1AA 4Q3OA 3CUKA 5ECDA 2C0QA 2BBWA 3TPZA 4CFSA 3HDYA 1E9VA 3OT1A 4LTMA 1T26A 2R4UA 5I7UA 2VTBB 3IMCA 4YK7A 3M5CA 4D81A 1VTKA 4FM9A 3R9KA 1E1QD 3D7SA 4MA4A 1QVVA 4X9XA 4MV6A 3BBPA 2E87A 1HE4A 4ZT2A 1ECPA 3H2HA 4TV9F 4GECA 4Z4HA 5GJBA 2E48A 2HXYA 1ZW1A 4HNTA 2MMCA 3VNVA 4GM0A 4O59O 1VHQA 3IUQA 1HLGA 2RGBA 3NJ8A 4CEIA 1ADYA 5DGTA 1N3YA 2AVNA 1A7KA 1JPNA 1NLMA 1T1JA 1ZUNA 1G5IA 2JAQA 3DVQX 4OP2A 4G0OA 5AUPB 3MCVA 1QG2A 2JGRA 2CLHB 5IEBA 2J09A 1JMKC 4MS4A 4NF2A 5J2UF 2AB0A 2IHUA 3BYZA 3UAZA 1EFKA 3WNQA 2ZYWX 1JKXA 3MINA 3OX4A 2TMGA 2XI4A 2EJVA 3OCVA 4KN9S 3EEQA 3RREA 3FH0A 1AO3A 1J0EA 1V6AA 4XQCA 3I3SR 4ESVA 5L51A 4O4HA 2QE6A 1R0CA 3ONDA 1I24A 1P7WA 4FONA 2ZUBA 2H17A 4DDTA 1FA9A 1VQ1A 3G5MA 2JCVA 1FVHA 1P73A 4NP6A 4LY9A 2YUIA 5A3RA 2EF0A 4D5EA 2JCXA 5IRCD 4OQNA 3GPLA 1GDHA 2GEFA 2WYOA 4HBZA 3ZDXB 4ARBA 1HYHA 1E64A 4KYIB 3WKAA 4FDLA 3EVBA 4MCHA 3ZHSA 1QQ6A 1K3TA 4OHWA 1YI8A 1HQCA 4WQMA 3FROA 1QP7A 1VKOA 3CF4G 3CRZA 4DLXA 2R65A 4YACA 4X62B 1EUDA 1O4VA 3KJGA 4AY3A 4D41A 3QEBZ 4EBFA 3OH8A 3JQ8A 4KAAA 3MMSA 1I7LA 2HMWA 3OE7A 5K6AC 2H92A 3KPYA 3SHTA 1TK9A 3UANA 4KRGA 4Q4JA 2OYRA 4ES6A 5DK4A 2V6MA 1E92A 3L1KA 1Z17A 5FA5A 4JVLA 1GXSB 1P2GA 4C0QC 3G2LA 5B6IA 3VNAA 1UK7A 2JFBA 1CNMA 3DDSA 3WB1A 5KKNB 1EK1A 3QLUA 1QX3A 4OQYA 4V24A 5CTJA 5TX7A 1VIYA 2R6CA 4C4ZA 4EFDA 3UFXB 4O0MA 5KEIA 3F7NA 4YAJA 3OIFA 1D7AA 1FTNA 5D5HA 3REOA 5JARA 4PPGA 2ERCA 1GTJ1 3FOCA 3QXSA 2BSQA 5EFZA 2BEKA 3ISVA 1J23A 2VDRB 2FPPA 4GI3A 2VF5X 1C1DA 2FX5A 4R71A 4JGBA 1L1EA 3NTRA 4OI2A 3R5TA 3AEQB 3SQOA 2JAXA 2SKCA 1E3IA 1CK4A 2V3WA 3IVMA 4LDPA 3R7AA 5ARBA 4DKXA 1C9KA 2O19A 1RYEA 4XUEA 1ZAYA 1TD1A 4JI2B 2ZI6A 4YJFA 1ZAKA 3N2GB 1HNWB 3GEGA 4HYEA 4QARA 2JD1A 1DBVO 2A1TR 1E6MA 2B6HA 1K6IA 1XTPA 5ALNA 1DT3A 1NTOA 1U9IA 2Q1SA 3MTDA 3ROFA 4Z4FA 3FJ1A 4CIXA 1EUCB 3G0BA 3OQMA 1N5KA 5DTMA 4E22A 1MGOA 1YNOA 2OESA 3K0AB 1CUCA 3MJTA 3PQEA 1YFZA 3CYFA 1JHUA 2G06A 3LY9A 2O8DB 2WR8A 1NUAA 1WXQA 3KR9A 3RUFA 2QD2A 5CX1A 3QG1A 5GONF 4AMVA 4WN3A 4DT1B 4ZCIA 3H2IA 4C30A 2IV3A 3HB5X 4Q9AA 1G55A 3VR2A 1N9ZA 2HQ1A 3Q11A 1GPNA 4G65A 3WFJA 4F72A 1N33B 2ADMA 1NXWA 3EA5A 521PA 4QDKA 1RHKA 1VG1A 5J5VA 1HSZA 3I9MA 4E5VA 1G5TA 1U81A 4LHVA 3VFDA 3W8DA 4ZAVA 1QRUA 1VI6A 1X8XA 3JQAA 1WB6A 2RCYA 4Z9XA 3UZUA 2O7SA 2OMKA 2R2GA 2W8BB 2Z3ZA 3L8FA 2E0IA 4Q66C 4NNJA 4BMYA 1FLAA 3KAKA 3JZDA 3A0RB 1YWGO 5IX8A 5J2UB 3Q8MA 1E0DA 3SZGA 4FHFA 2VK8A 3P9XA 5DHTA 3RYHA 3WIOA 3HB7A 3ZBQA 1CKEA 3PI7A 1ZXBA 4NZYA 4QYIA 2X9GA 4RHTA 3OMWA 3TKLA 2FWAA 1WW3A 4YGXB 3KT3A 3BGSA 4YEDA 1Q83A 1COWA 2CXHA 3HLKA 4LJ7A 1E20A 1LQ2A 1Y81A 3C8MA 3WGOA 1W5TA 1HFJA 2IT1A 2UZ3A 3CNNA 2ANCA 1DWPA 2YY6A 1ZY2A 4FOLA 4PQGA 1N34B 5DLPA 5IMBA 4KLAA 3DBVO 3K30A 1RBMA 2J8ZA 5KREA 5F1KA 4QYTA 1QPBA 5T41A 1JU4A 4EAAA 1QS0B 1U8FO 3SZMA 3QHQA 3OEED 2E85A 2PKCA 4G86A 4EI2A 2WFAA 3Q5EA 3B1YA 1ZIDA 3ZZMA 4YQZA 1KOGA 1G21B 2HHCA 4AUEA 3STVA 1D6JA 1EFRD 1TK3A 1WUTA 1ULZA 2PZBA 2RHHA 4GU5A 4QDUA 4X8HA 2O2JA 1Q5PA 3B78A 3HJBA 5F3DA 3W6NA 3ZCRA 2QJRA 1Z4LA 5MFZA 1ZGHA 3GAMA 1H2EA 4GBED 2HIHA 2DETA 3V5NA 3EQ8A 3K4HA 4HVTA 2P40A 4RF2A 3WIVA 1CUZA 3KUKA 1Y9ZA 4P4NA 4WI1A 1C7EA 2B8WA 1WAMA 4EA9A 2Q3BA 1ZUWA 4RHFA 1ZRNA 4PIMA 5D3MB 5ALLA 2ILTA 4L4ZA 4NJMB 4HJRA 3MLEA 1KQPA 5AKIA 3ADDA 3W6PA 3IEXA 2QTCA 3LPLA 3KEGA 1TB4A 5LQMA 4Z7NB 3KEFA 3R9XA 2AX3A 2PSSA 1Z6PA 3N8GA 5EC8A 2JBWA 4L6IA 2O2SA 1AB5A 1QIDA 3FYUC 3JARB 2YHAA 3Q85A 4R1PA 5ARCA 5JROA 3QRWA 4HB0A 4PQYA 1ABEA 4G37A 1IHDA 1P6UA 3PNLA 4FCTA 4JB2A 5FTNA 4EKYA 3TW8A 2QI9F 1PW7A 2LKCA 4B6RA 4EQ6A 2HF8A 3C3DA 5TVGA 3P9NA 3F6CA 3CEHA 1L2TA 4POAA 4CM7A 1EX6A 1GCOA 4DNFA 2V7EA 3JZAA 1JS1X 1VHTA 3D6UA 2IVZA 4NU0A 3Q98A 5FO0A 5DI3B 5GP1A 3HSKA 4HYYA 1CTQA 1DDGA 2VKQA 4RKFA 2BD0A 4LYEA 4AJ1A 4LV8B 4J1SA 4A4DA 1H0RA 3L2OB 3UGTA 2VH2A 1EXDA 4FHCA 5TT1A 1JALA 4LTNA 1JH8A 4G5FA 3RBZA 3K9NA 5GONB 1CUHA 4OAOA 4DIMA 2PX3A 3O3OB 2ZB8A 3WIEA 5EZ5A 4CE6A 1BDMA 4KEAA 4IH9A 4KSBA 3BFPA 3LHIA 3FHTA 2ZB7A 4Z3KA 3TNDA 4QE3A 3W7BA 3KHTA 4JB8A 2GA8A 4NMLA 4ZO9A 4CM8B 3H9JA 1HMPA 3ET5A 3BVPA 3KSZO 3UMRA 1P2TA 3OCXA 4YONB 2DLCX 1GL7A 1HNNA 2BR3A 4LQCA 1UBOS 5AI9A 4EI7A 1W88A 5D1NA 3TR6A 3B1WA 3ONEA 4UTOA 1QYXA 4ZZ3A 4NJEB 2ZJ2A 5EINA 5CA1A 3BULA 3KL4A 1D8AA 2TECE 3H04A 5AW0A 1U8EA 3B9BA 2PZJA 1Q50A 2GN0A 2JIBA 1MC4A 2DC1A 1N8NA 4HVCA 2BKAA 4D0GA 2H1SA 2ENWA 2X1LA 3KJIA 2YFYA 1P75A 3DUFA 1GZ5A 3DVRX 3WHKA 5FADA 3T7TA 5IAOA 4AKIA 5DMHA 3TH5A 5JZVA 1H4SA 2D62A 2R6ZA 5IFLA 1QQ5A 2G72A 2AXQA 2DCMA 4Q3EA 1LPBB 5KVQA 2QLBA 5LQJA 1PD0A 4DVGA 1JBQA 1M1NA 2PUAA 2NP6A 2GJ8A 4I1UA 2EQ5A 2X3FA 1K8RA 5IKOA 1IG3A 1T1EA 1WNTA 1PT7A 3HC7A 2Q7XA 3HXQA 2HA0A 2P8JA 2WJHA 5JS8A 4D9IA 1YVPA 2EFDB 3IH5A 1YB5A 4DR2B 1VJDA 5KNLA 4RVDA 5BQOA 4V0SA 2ETXA 2QMHA 2X8LA 3Q3JB 1FZTA 4FCVA 2HPAA 1NGSA 1XCBA 5BY2A 3TZCA 2QQ5A 4JVOA 4AJ9A 3GLHA 4XVHA 3HM2A 2D2EA 4G5GA 1HUQA 2XV1A 3G0GA 5IVIA 1QBGA 2BEUA 3FRHA 1NKVA 3WO0A 4YT2A 5HR5A 1UJCA 3WS7A 4XE5A 3UMCA 5KSOA 5ALZA 2AOVA 4OBEA 1QG4A 4WZZA 3GT4A 4BBZA 1YQUA 4G5QA 4GH5A 2WU4A 1OUMA 3BA1A 2XVMA 1WNFA 3RW9A 2YXEA 2IX9A 1NYLA 3O7MA 4JDUA 5D86A 5F2KA 3HCRA 3EAFA 1C7ZA 4L02A 4WH0A 3SYLA 3L4JA 3UHPA 4BO3A 2GVZC 3A6EA 2PUFA 2VXBA 2R8ZA 3FGZA 4I1PA 2Q3DA 1CZUA 1C0EA 4YCAA 4K6GA 2QY6A 2IC5A 3KTAA 1PS8A 4E31A 2WTEA 3DXXA 2EL7A 4ZEXA 1PHPA 1IHUA 2GH1A 3CUTA 3AERB 3F71A 3MJDA 1WD7A 2G76A 4NNOA 1PLKA 4Q7KA 4IQ8A 2P3QA 4RZXA 3GJ3A 4RK7A 1QP0A 4B48A 3RRMA 4RV4A 3DMDA 3EG9B 1XDUA 3WB2A 1U3WA 4H3KB 1OR8A 2A94A 3JQBC 1E63A 3U7QA 3WAJA 4HXYA 1HV8A 1IOVA 3PNSA 3WGYA 3KXPA 5KYYB 3KPJA 4BUJA 3THYA 2CWWA 3H7AA 3K6KA 2RDMA 1ADBA 2KJQA 5I48A 1J8VA 4B3BA 4Z4GA 3C6BA 3CLKA 4EM6A 1U65A 4O33A 1JT2A 3TJRA 3AR4A 2NVUA 5HKAA 3T5DA 4RY0A 5LIRA 2A1TS 5FOQA 4F11A 3C8DA 5ALUA 1KFEB 2OBNA 2B9VA 3GXBA 5ALVA 1I0LA 5E9QA 2RKOA 1XO1A 2FPKA 2FW1A 3O95A 4Y6PA 2OBYA 2V97A 3T7EA 4L8WB 3HYTA 4BLQA 4YJ2F 5BPHA 1YGPA 1N3IA 1XYYA 2BBSA 3ASYA 2G4LA 1NASA 4CEHA 3R3UA 1GCUA 3DDNA 1RLTA 5F7XA 1Y8QA 3IIEA 5CH3A 4EJSB 1DRVA 1ZGZA 1AXGA 3NHAA 3IDOA 5JQGF 2Z2YA 2HLHA 2HQSA 4OJNA 2DERA 1O4WA 2W2XA 3TLKA 1VRVA 1QDUA 1G8PA 4JGIA 1I2DA 3QFTA 3D9QX 1TT5A 3SCZA 2R5WA 2FG5A 3BWVA 4BBAA 1EH5A 1NVMB 3S1AB 3PEYA 4G01B 4HQRA 1H5QA 3IEIA 3IUJA 2C2YA 1AN0A 2BAGA 4UEOA 1GP2A 2Z04A 3N8NA 4K8OA 1KMHB 3TIXB 4EKIA 2I4LA 1LD3A 1RSZA 2VUSA 2Z4RA 3H3FA 2BM0A 3OX2A 3UT5B 1IVNA 3BOSA 2DOKA 5FO1A 5I4KA 3B3AA 4AUKA 1RHRA 1DRKA 3GY0A 2ONKA 1T9CA 4BCBA 5K3SA 4INOA 5I9LA 5BV1A 1BCSA 2JC3A 3W2GA 3QW4B 5B30A 4LY3A 3C85A 3WL4A 5BN4A 4BU1A 2V9CA 1UZLA 4CCSA 4TLEA 4XFKA 1LBEA 3JRNA 1XXLA 3LRPA 5FLEX 2QL5A 1JDBB 1C9YA 2H9IA 1F60A 2QTBA 4YAFA 4JHLA 5JBIA 1N0IA 5EJ6A 2VPXA 5K5EA 4ML3A 5KOIA 3O47A 3SQNA 1MTOA 1EE9A 2DUWA 4ARSA 4DRYA 3HM9A 4MAAA 3K16A 3DLPX 2QOEA 2RAUA 3PFFA 3CIFA 3HY3A 3TRIA 3W6OA 4WLNA 4RVFA 4Z9BA 4OOFA 4TV8A 5B64A 2EKPA 4AURA 2I3AA 1PK8A 2GB4A 2WV9A 3M4ZA 1Z0FA 4JJAA 1FP2A 1ZINA 3IQFA 1FFCA 2OQ2A 2XB8A 1DBSA 1V16A 4KFUA 1QUFA 1V1MA 3OJWA 2JGDA 1MF7A 4U2KA 1PZGA 3ROKA 3PWZA 4DS3A 1IUKA 1AGNA 2ZB2A 2VHVA 1WMDA 3PKIA 1J8QA 2DY1A 3PC4A 4ZVVA 1AUXA 2BKLA 3BFXA 4I5GA 4QDTA 4AYTA 4EY4A 1E3WA 1JBEA 3BWDD 4YJ3A 3P32A 2BKXA 3N2KB 1SU6A 1Q0PA 3A2LA 4ED9A 1GITA 2FHSA 3N7AA 2QLMA 4KUEA 4U9IS 2F9LA 1JNXX 3IFSA 1P61B 4E32A 5K8CA 2HRRA 2OM2A 1PEKE 3AOGA 3TEFA 3VNSA 2ZSEA 3DHNA 4EF5A 4ZXPA 4O5OA 1SAYA 1GNQA 4WFQA 3SM9A 4YPVA 2NUTB 3MTJA 3AG6A 1I36A 3EVEA 1WMBA 1SWWA 2FH5B 3I34X 1RWXA 2II6A 1LDYA 2VQ6A 2Y0BA 3AG5A 3O38A 4OK3A 1TPZA 4BZWA 1IQUA 2GZAA 3FHCB 3N59A 3NAQA 1SRRA 2I7DA 1OIXA 3ECSA 3MT0A 4D9HA 1UBUS 2GK4A 3ICEA 3IKVA 1MIHA 4RWEA 4RLHA 3CZCA 3ZK8A 3MT7A 1RXUA 1G20E 3H2ZA 4RKQA 4E33A 1Y5MA 3VC3A 2I2AA 3L7KA 1C3EA 2GOYA 3CIOA 4OIFA 5CDUA 2Q9UA 4MTLA 4IOKA 3KAPA 1RWBA 1ESEA 3ZI0A 2I3DA 3OPYA 1RCFA 2AN5A 2B3TA 1U28A 4CGZA 5KQLA 3MBOA 4NECA 4YJ2B 2QTNA 2WVJA 3ZE1B 1N6PA 1OXKB 2GF9A 3C48A 3NXKA 3RS4A 1UPXA 5FUBA 4F60A 1E4EB 4NYMR 1P9RA 2FPRA 1CBUA 1VCMA 2HZBA 3G17A 3FFTA 4I55B 4DV1B 4NXNB 2YJ5A 5IXJA 2J0UB 4YR9A 1T15A 2FTKE 3OLQA 5JQGB 1ILEA 2XECA 3AB8A 4U2DA 4LNAA 2ATIA 3TS1A 1ES9A 1MQSA 2C99A 2I29A 4S0ZA 2WAAA 4H35A 3WB0A 4IRMA 5TEWA 2HWYA 3JQDA 4PV7A 5TS2A 5HJEA 1M66A 3DAFA 4TUYF 5ISMA 3SJ7A 1O94D 4RF4A 1ULTA 2XUIA 4J8PA 4P98A 3HCOA 1GADO 1EFPB 2RJNA 1T0BA 2G63A 3MJ4A 5JDIC 1N5JA 1F7UA 5I7HA 4KKVA 1PNVA 4MRVA 2B98A 4JP1A 4LJ4A 1BA2A 3QSGA 1KSGA 5MDHA 5DGCA 4RIEA 4E15A 4P0PB 1G4UR 3FDJA 3KKLA 3OFKA 2GZRA 1RQRA 4U63A 3T5PA 1DVRA 2G9RA 2GPAA 2J31A 2QDKA 4TYQA 2I55A 2Z1MA 4KQCA 4RD6A 5DTEA 5BVHB 2SKDA 3G88A 3UMMA 3EMVA 4R9NA 5ERYA 4QHYA 1X38A 3HCFA 3U3DA 1YF3A 5KWJA 2H29A 1RBZA 2MSNA 4PQFA 3SYKA 3ZUPA 2QUHA 2YJTD 4LVCA 1CQJA 2OOKA 4TSKA 3FIUA 1BMDA 1NP7A 1LRJA 3EWAA 3AGPA 3GUCA 4FBGA 4PLZA 1IWPB 1Z6ZA 1P1RA 4RD2A 2IZOA 3KQYA 1AQNA 2DZDA 4NDZA 5H3CA 4RIGA 3HDTA 3Q1KA 1OWLA 2BHRA 2QL9A 2YS6A 3ESZA 4UPVA 5EGNA 3A6DA 3DE6X 5AJUA 4Y0NA 5CCXA 3GJ6A 1OGIA 2H2GA 3VSBA 2E4YA 3D64A 1KJWA 5HIJA 5EYPA 2IK8A 1XNQB 4QFBA 3FOWA 3FHJA 3IULA 2XCUA 1XF9A 2F6RA 2QK4A 3N58A 4KQ2A 1OI4A 1D03A 1SA0A 4MW4A 4OF4A 3QIVA 3IXQA 1J2YA 4IIXA 1NJ2A 2JLSA 2BELA 4FOSA 2QQ0A 4RZIA 5AW1A 3AUFA 1KGSA 4RACA 4RD4A 3RU3A 3TIGA 2HGSA 4MW1A 3N7UA 4B45A 1E2BA 5C81A 4FUQA 1YQ9A 1YRAA 3LM8A 3NHYA 4LGMA 3HBJA 1X1QA 4G97A 3SE0A 1FMTA 1WZUA 2OO3A 3ZNQA 2AG1A 2CLOB 2R8PA 5SZIA 4B3XA 2WF9A 4ZJUA 4O2RA 3QVTA 1GZHB 1TEVA 4IFBA 1QORA 2FAXA 3A70A 3H83A 2PSHA 1NU6A 4FYKA 4KI7A 4DSOA 3ZLJA 1RI4A 2P2DA 4IIHA 2ZU6A 3ZW7A 4LF9B 5L8VA 2G5GX 2QPAA 2FETA 2WUDA 5K8VA 1JHXA 1NONA 2N75A 4U6QA 3W2TA 1ISMA 3LVRE 2A9VA 4N01A 4RXMA 1VYVA 5AHRA 4D8WA 1L7DA 3QWBA 3Q1LA 4LF7B 3RTDA 5IDVA 3WGNA 4BO2A 3BE8A 3L7DA 5AK4A 2NAFA 1JAZA 5HQJA 1EP2B 5JW6A 3QU4A 1JJAA 2FKNA 3OPXA 1AXEA 3BCSA 1KOLA 3OC6A 3U17A 3GGOA 4QNMA 2CJFA 4A8JA 1DC5A 1WP4A 3DVAB 3EDQA 4DZRA 4UBKA 4F86A 5JI3E 3H2KA 3U1BA 2GM4A 1CQPA 1D4FA 1EFVA 3A4NA 3RM3A 2ZJ3A 5C8VA 3UMJA 1EXVA 3ELYA 2OD2A 3JR3A 2BGRA 1XELA 4ZVRA 3PV0A 4DMHA 3T4EA 1KNQA 2YCBA 1E2IA 3PR2B 3V4ZA 2OYSA 4EG4A 4JJ8A 3VZRA 1Q12A 4LDRA 3JQ6A 4I1YA 3FDZB 3UUEA 5MGBA 8LDHA 2C54A 2BE7A 3UCFA 3RYTC 3FWKA 2X9NA 1JHVA 2G07A 4DQVA 2Q2QA 1M2JA 2HU7A 2I34A 3KZVA 4IPTA 3W1EA 3V4PB 2GNAA 4F8JA 2BHTA 4QJ3A 4DPMA 1N25A 5BUCA 3V8NA 4IKOA 2RONA 2J67A 3L7YA 3PG5A 4FR2A 3V1NA 4AZ0B 1GG5A 2FPSA 3ICCA 2Q99A 1DBWA 2Q45A 3MYRA 3W5BA 1E5LA 5C7YA 2C82A 3PJRA 3OJEA 5J1SB 4II2A 5YASA 3W34A 1C8VB 1KZ4A 6GPBA 1SNYA 2MMGA 1JHDA 4U7FA 4Y6OA 3LKBA 4MLDA 2CDRA 1U2TA 2PQ6A 2PS0A 5F5XA 4PCVA 1X7GA 3OZTA 4ZCTA 1I3CA 5BW8A 3L6CA 1RLIA 1MOQA 2Z2KA 3NDPA 1WCV1 1NM5C 4B1FA 2IS6A 1BDJA 3ZEIA 2XMPA 1W2WB 4DQLA 4I8IA 4JYBA 1VPTA 1UXKA 3EEFA 1CC1S 1QC5A 3FYHA 3QEKA 3QEAZ 2XXAB 4LWPA 4HAOA 4R8KA 2ADFA 1KR2A 1YJAA 4IF4A 4KL8S 4X44A 4BNVA 1G3UA 2JNWA 2FRVA 4D6PA 4NFSA 1RR6A 1V3UA 1ML3A 3OFVA 3OPVA 2ZYIA 1TZ2A 1XEXA 4MH0R 4TXNA 2OV2A 3VYRB 3ZHVA 4BP3A 3BMXA 1ZK1A 4QXOA 4CJXA 4KPUA 3CQ9A 1TTPB 2FSHA 1TO2E 4DV6B 4MJ3A 2XHZA 3KKEA 1A98A 2IFTA 4HV4A 4IGKA 4C03A 4Z7QB 1YK0A 1YBHA 4S1PA 5FLYA 3JZIA 4HB4A 1DUVG 3P9IA 4H1WA 1R8JA 2MOKA 5DN6D 1G6OA 2BOVA 2IYAA 2TMKA 2E5LB 1AQYA 1AMOA 1JMVA 4F12A 4QAQA 4MROA 2NMVA 4M8LA 1IBCA 4GOLD 2GX6A 4PS0A 1R0XA 1MH9A 3K92A 3P2IA 2ZT6A 4QDXA 3RFXA 4DCJA 4L51A 3FPFA 2QPTA 3IAAA 2AN3A 1QRRA 2VHJA 4FNOA 1ADJA 2EX4A 2GWHA 2NU9B 2O3UA 5KUTA 1E1RD 4QUIA 3FKJA 4K6HA 5BRAA 1QFJA 1M3SA 2ZUVA 1WSDA 3GGPA 1RQNA 2D0PB 3OX3A 4KQ1A 4OHMA 4Q39A 3CS3A 5GZ6A 1F0PA 1AMNA 4F7WA 2WZDA 4X7PA 3V3KA 4EJ6A 2Q5HA 2WJ4A 2ZTHA 3PQDA 3OURA 3M34A 4NMMA 2QVXX 2JJ2A 1CZHA 2DH6A 2YOFA 3Q7TA 2CLKB 1H0SA 2CZCA 4YASA 2M9MA 4ODIA 3ILHA 1JQ3A 3AKDA 5GM1A 1A9ZA 1NDHA 3HEMA 4KXYA 1UXJA 3BXPA 2IV7A 4PBRA 2IU3A 1TAUA 2Q3HA 1GGJA 5K99A 3O8QA 1ZNWA 5M04A 4F4UA 2FLWA 2QYTA 5EXTA 4L50A 5TSDA 4J1TC 1VECA 5E3HA 4B3JA 3E18A 3O75A 2OZKA 4XARA 4OFZA 2OZLA 3T1YB 5NULA 4BO1A 1PK7A 4PYOA 3V4OA 1QP4A 4BWGA 4KGVA 3U44A 2C2MA 2VNSA 4D8UA 5BOSA 6CHYA 4BP8A 3I5YA 1B8VA 3SQMA 1FYXA 1Z73A 2ECFA 4Q9JA 3Q3IA 2REOA 1G38A 1XJWA 2H3HA 2XMDA 1A4IA 3MS2A 4OL0A 1KRWA 3IUBA 1RKVA 4OU4A 2QRHA 4LS3A 1DP4A 3BWYA 3T0GA 1D2AA 3WOVA 4AMYA 4D25A 1J22A 4IV0A 5DK6A 3LVBA 4TSFD 4Y2JA 2NUAB 3TOZA 4D2IA 1KHHA 2AZDA 1YVRA 4TQGA 2JCSA 1WSWA 3RIHA 3VZPA 4CU5A 1C3VA 2O7NA 3WMEA 4N7MA 2Z3VA 1N7GA 4DRXB 2ANBA 3NYQA 2Z8ZA 4HP8A 3ZU2A 2QN9A 4BMPB 5F9FA 1KJZA 1VM6A 3GGDA 3O2NA 4OXRA 5EQDA 4PXAA 2G70A 4I9NA 3P26A 4ZANA 3SXUA 3OZIA 2HSDA 3O90A 4L5YA 4Y67A 4RESA 2JAUA 3RTGA 3G2MA 5HIAA 2QRUA 1SCUB 5GOZA 5CDFA 1R4MA 1O3YA 1GTZA 1Y4AE 3M0EA 2UUBB 4IQ0A 3L4BA 1XPOA 2PYZA 4Q7LA 4X41A 4D8XA 2L0XA 5K6TA 2GGSA 3C3MA 1BKDR 1EFDN 2QM7A 4GUAA 4ZODA 5HIMA 4GKBA 1JSRA 5JAHA 5J4VA 3A58B 3KKMA 5E0KB 2O2EA 3LVQE 3IE0A 3LK6A 2P75A 4L8VA 3LY5A 4PSKA 4DQKA 2YRXA 2OBBA 3HWSA 4X1YA 3OCWA 1CIJA 2CL0X 3TLJA 3A3PA 5D00A 1T8UA 1MABB 3ED1A 2ODEA 5JMTA 5TY0A 3QX3A 1JZTA 1HMYA 3PGA1 3QLEA 2EWVA 4B2IA 3WLEA 3ER9A 4WXYB 2IP4A 1QKKA 4NPHA 1VE5A 3W9YA 2WD9A 4TMZA 4UPEA 3RVQA 2D1FA 1E7QA 4E4TA 5BOVA 2P91A 2BGNA 4ILEA 4QBTA 2F3TA 2BR4A 4QC2A 1EXMA 2A4MA 4DIDA 2EBFX 1J0BA 4JLMA 3N3BC 5KOJA 5CX4A 2IYLD 3CBGA 5AUOB 4H7KA 2PFSA 1BXRA 2CMGA 2W0SA 5FFMA 3S55A 3FNIA 5LNK6 2VUIB 3UG7A 1NVVQ 2D59A 4F6RB 3QJ5A 4MV7A 4FKMA 1ZXLA 4BKOA 3VDXA 2FEMA 4ZAZA 1XP8A 2VDNB 2D5AA 4RSRA 1IVYA 1TYAE 1ZCFA 1XTQA 2K7ZA 4V0OA 1UBLS 1I3MA 2DRIA 4JC4A 5K0NA 3BT7A 4UBOA 1WHSA 3IBCA 4BN5A 3EEIA 4RTKA 4J3NA 3PD1A 1ORIA 1RXSA 2X8AA 3DEFA 4I1SA 5IM5A 2CZQA 3FUWA 2C5BA 3ZWOA 2INGX 1EAYA 2W4MA 2VHEA 3D2LA 3NDBB 5DYNA 3RFUA 1ESMA 4RVNA 5EJ4A 3MWDB 3OQIA 4R84A 1IBRA 4C2UA 1I13A 1YZVA 1JFFA 2ID4A 2D8AA 1TE2A 4WZ6A 3D81A 4XZ3A 3I1JA 4EGCB 2VSNA 4H7PA 1E0AA 2Q0XA 1SXGA 1CFZA 2IHTA 2G0NA 2RHBA 2W2OA 3PFCA 3OOYA 4MKZA 5AVSA 1FFGA 1MJGM 4B80A 4ZAYA 4TYPA 1IMJA 1EWQA 2ZE6A 3TZKA 3LPCA 4D96A 4KLCA 1ZEMA 4RS4A 3A31A 3NMUF 1GSAA 2WFMA 3PP8A 3IDZA 4MVJD 3KLBA 4H4EA 4YLGA 5E2IA 5G40A 5CCEA 3U4QA 2ACWA 3DVSX 3RJTA 2IPXA 3UMGA 2P1RA 5DM0A 3Q0EA 4C04A 4WMLA 2AJTA 5B3JA 5CTAA 2O48X 4UXJA 5A5DA 1F9EA 4YUXA 4BFSA 4EUFA 4E5UA 5ED0A 3OQ1A 5FYDA 3TLXA 3TLEA 5LDHA 4LF4B 4CM5A 1S4MA 3ETJA 3OLCX 3AB7A 3UGQA 2BFDB 1XXHA 3IP1A 4PGHA 1YMQA 4CIAA 4IQ4A 3ELDA 4QGAA 3AY0A 3M5DA 3DUWA 2CD9A 2I6UA 4EJ2A 3B3GA 2H11A 3FCSB 3WLAA 3OIWA 4UNNA 3PZRA 2DWQA 3FM9A 1GHTA 1KVQA 3AVYA 2WWXA 1F0YA 2RBKA 4ISCA 3VZDA 1NA5A 3A28A 1FVXA 4QXMA 5K0TA 5AYVA 1JR3D 1DJOA 2CLLB 3RFTA 2ZIUB 4TT3D 4XWOA 1F14A 4MV3A 3UN1A 1OZ0A 4WOBA 1JFVA 2VK1A 4ZI7F 1XF1A 4HX2A 2C3OA 2H5LA 4J2HA 1ABBA 5HKOA 2DBRA 4L0DA 2XWJI 4XIFA 1AXRA 3KWMA 2H00A 4C5BA 1DU4A 2DVMA 4ZI5A 2QRZA 4EI9A 2WJPA 4AXBA 3MTEA 1U0OC 1IHYA 1ORVA 1A9PA 4R4JA 5EWJB 3OUTA 2O0KA 2XXBA 2XUFA 3JRXA 4UPDA 3PFGA 1URPA 1VE6A 1WUYA 1Y4ZA 3QLTA 4H7DA 2H08A 3G5TA 4DRZA 5BVGB 3W79A 5M5BA 3E4CA 3JQ7B 5F5NA 2AOUA 1JR4A 4E0BA 4CIYA 5CFZA 1MAUA 1VYUA 1TEZA 2QD4A 4JT2A 2WU3A 1YL6A 3KLPX 5F76A 3JVDA 4DBZA 3WICA 1FJXA 2SICE 1XJQA 2CK3D 2ASVA 1TYDE 1ZGCA 4NEGA 1OC4A 4R41A 3RC1A 5B58C 1NE2A 2Z8YA 4DADA 3ZJ4A 1VP9A 1YS2X 1KEPA 3L7JA 2AUNA 1FP7A 2Q9CA 4IXMA 4JBHA 5CAEA 1XU7A 1YIOA 3QVOA 4B9EA 3ADPA 2ILVA 3C3AA 3E84A 3VTKA 3KE8A 2BZGA 3GLHE 3U6KA 1M2EA 2JHCA 3KT0A 1P8JA 4BNKA 3I92A 2PGOA 3WRWA 1EWRA 1PW5A 2J6CA 1WXDA 2C5HA 5DGXA 3VSAA 4D9EA 4OHBA 3DV9A 1E7RA 2A2ZA 2QVCA 3D8NA 3R20A 4WZBA 1QE0A 3KQVA 4YP9A 3UAGA 4DY4A 3RU2A 1UMDB 2RFLA 3G7NA 5FQNA 1UZMA 3AL3A 5ICMA 1E6LA 2F3UA 2GNPA 5JJIA 1BVHA 2OUKA 1OVMA 3K7EA 1QIMA 2ODWA 4UUAA 4YP0A 3PU6A 4M8IA 3RYFA 4V2UA 2IZZA 1CHNA 3TLBA 2D3TA 4EY3A 4FLEA 2Q29A 2XA1A 1HGXA 4QPDA 2PBLA 1PWXA 3U13A 3MD9A 4RM3A 1RJEA 5HFJA 2EQAA 1CUEA 3H19A 2HTFA 4HNHA 3U80A 3M6AA 4YYZA 1AUPA 2X4LA 4M37A 5FEMA 2WAMA 1MJNA 2CDNA 1E96A 4JI4B 1YTUA 3DHEA 4ZARA 3GAFA 3WA6A 1T0UA 1XZJA 2EERA 4ZOQI 4IDBA 2G5CA 3NV7A 5AOVA 5GAJA 2ZOSA 3OM9A 4YV2A 2YXDA 1EVIA 1YR9A 2GTIA 2YMMA 1TADA 1KO8A 1Y8CA 1PSDA 5EIXA 4YRMA 2P6RA 1SU8A 1WBJB 4KFTA 2B0JA 1LUAA 2R8XA 3I2JA 2ALJA 3N8HA 1JTEA 3V2GA 1EJ6A 4PPNA 4GWLA 3AKCA 2A9OA 4ZIRB 4K0KB 3NANA 2GPNA 1V11A 1UBKS 1KIMA 1XJ5A 2DQKA 2GARA 2GEKA 4BVKA 3NX4A 2B6NA 3HCCA 4Y6QA 4WY2A 1V8PA 3U0VA 1J9EA 5I5EA 3JWGA 1NVXQ 2QDXA 4L9SA 4MR7A 1P44A 3OJXA 4RQUA 3S0JA 1YASA 4IRXA 1KJQA 2WMDA 3A4MA 2R8OA 13PKA 1CVRA 2JIDA 1B4DA 1MIOB 3AU8A 1K9VF 3LP6A 4RVCA 4AO8A 4F4JA 2BPOA 4NQZA 3Q3CA 1SVWA 4OYRA 4EVSA 1I32A 3GCWA 4ZI7B 4S1TA 1R16A 1N2IA 3P5BA 5AVXA 1KDPA 4IDGA 4YRQA 2IS2A 4G1UC 4O2BF 3VDRA 4KSCA 1XNHA 5F2NA 1E7WA 4KQEA 3DB1A 3ACDA 3H13A 4RGVA 2KW5A 4JBGA 2YYSA 3E7WA 3UIEA 4FYMA 1K7XB 1UJ6A 1JKMA 3L4SO 1P5HA 2IYVA 2R1TB 3D3NA 4YECA 5BO5A 1M8FA 5TMDA 3TJZA 4LBZA 4NS4A 3V80A 1DEKA 1L5RA 1PQUA 1Q0HA 4HNRA 1MHTA 3WBKA 5CU7A 3TPCA 2QLJA 3RV3A 1M5UA 4IV8A 4ND2A 4QU5A 5BNZA 3CVVA 5D51S 3QWIA 1K9SA 5A03A 5LMNB 3ECAA 1P0MA 1GPJA 5B36A 3DBHB 4XJSA 2RI1A 1RWMA 2PSJA 5EE9A 1KQFA 4I66A 2ZXUA 1VYHA 2ZRIA 2H1LA 3L01A 4B2LA 2CJPA 3LHKA 4EARA 3IERA 4XM0A 3AVUA 2YNMD 2MJLA 4D9NA 1GKYA 5CR9A 3VMMA 1DX4A 3TG8A 1L5MA 1NX6A 1E0SA 3C0KA 4XCVA 3T7DA 2F1RA 1Z8NA 1Z8HA 1G0NA 1L5SA 1L5WA 4YAKA 1K7EB 2CEKA 3OOHA 4GPEA 4M38A 4MP6A 2Y66A 3DZCA 1CP2A 2HRDA 2VSYA 2IGBA 4KVGA 2IW1A 5ALIA 2XCTB 1QHYA 3ND8A 3PRYA 4EJMA 1EQUA 1CUVA 1V4BA 3GEHA 3KUDA 2VHXA 3BIJA 1TF7A 1PRYA 3CGWA 1LK5A 1WULS 3F90A 4F3NA 5HJ5A 5GADl 2HO4A 5F35A 5T4FA 3NVKI 4ID3A 5KTYA 2C2GA 1AQIA 3I9KA 3STYA 2C2HA 3LTNC 3KX2A 4H1TA 4ZTUB 1YHYA 2REBA 4MVJF 3HKEB 3GNQA 3EGOA 5KVCA 2O54A 1Q17A 2VDUE 4W5JA 2JLUA 1I9CA 2IIBA 4I6JA 1WXEA 2GD2A 3WFIA 4XWTA 3RWBA 2GPJA 2GZMA 4AKGA 2QHXA 3TZHA 3NZEA 4O29A 4A8PA 4WX2B 2C7GA 1VG9B 3VU9B 5EJMA 4ARZA 3VC1A 4BVFA 5LN1A 2V65A 2ZG6A 3FLEA 1UFVA 3SICE 3RJZA 4JBYA 3GJRA 3E3LA 4LHEA 4F2DA 1U9CA 4KTVE 1U1IA 1KSFX 2FW6A 2VBFA 3PX7A 3FSJX 2ZYUX 2VJCA 1SOMA 3K6RA 5KI6A 2OCAA 2FE1A 3DXZA 5AOCA 3ZV3A 2GM5A 3STXA 3CVWA 2WMYA 3FSEA 4LC1A 1XZGA 4KBGA 1DAEA 1YQGA 4QPCA 2ID8A 3L3BA 4PVDA 2G5PA 1C8BA 4RLQA 4XJXA 1JJVA 4YMSA 2G1AA 4CKBA 3EDOA 3OFSA 3OX1A 4IQGA 2PV0A 3KT8A 3I58A 4XD2A 4XUCA 2YZNA 4G0ZA 4NZZA 2AC4A 1DHRA 2GDZA 2K2QB 3GJQA 2VLBA 2KBFA 4UCWA 1ZJ4A 2AXPA 2J7PD 4PHTA 1SU4A 3DZKA 4AZ3B 3HS3A 1SUFA 3AEQA 3SC2A 5K2OA 1BCRA 1Z7WA 3QLUC 2J3QA 2M32A 3B38A 2IHVA 3I6QA 1AUOA 4HAWA 1L6IA 3N75A 5EVCA 4AMUA 5K6RA 1NT4A 3DDZX 1YI1A 3L0DA 1PD1A 1F2TA 1BFDA 3N2GA 2IYQA 4KZKA 3F46A 3FZEA 3PFHA 3WIBA 4QJIA 3GO4A 5EPEA 4OQQA 4HS9A 4DYHA 4WK6A 4MEJA 1KO4A 2EP7A 4XDYA 4YREA 1V4NA 1GG8A 3A8TA 2VP9A 2IUEA 4BC0A 3B1KA 4YJHA 5IF3A 3VA7A 4Z4IA 1S8AA 1SCIA 2CY0A 2J5XA 4P7JA 5AIBA 1ONSA 1Z34A 4BRWA 4UEQA 4ETIA 3WZMA 1NW8A 3E1KA 1E3DA 4LOLA 3KSDO 3OIGA 2J9ZB 1KI7A 4ND5A 3U7HB 1HRDA 1KA9H 1JZSA 1U11A 4QEZA 5HKKA 3AM1A 4ALLA 1QYRA 1RQPA 2OSVA 1XZBA 3OCJA 2WF6A 1U9IC 5KYUA 4BRZA 2EIHA 3JRWA 2UUCB 3ZVLA 3R0ZA 4Z3OA 1EP9A 2C97A 3PC8C 1KP9A 3C74A 3R7BA 2VJAA 3G85A 2XF8A 3CONA 3HMKA 4BO7A 1M1UA 4RTQA 3LUBA 2YWXA 3LT1A 1Y1RA 2GUWA 4N18A 4ZO8A 1SKMA 1W5FA 3NBMA 2W8BA 4YCBA 1EIZA 1Y1SA 5BUZA 3WLIA 1CQIB 3IBGA 3N2LA 3DVLA 1Y63A 3FMIA 1ZYUA 4GNRA 4M83A 4OHUA 5B58T 3T3MB 3BL6A 4F04A 4ZC8A 2I4MA 3PHBE 2AH5A 1NPYA 1DAMA 2JZOA 1IAVA 4J7CA 4ARAA 3F5FA 4KXUA 4R1UA 2PKXA 2HA6A 1LX6A 1OTXA 4YGYA 1SXPA 1IXRC 1KEEB 1U99A 1QAOA 1TQ6A 4CQLB 2UXBB 2DFTA 2K87A 1KI6B 3A2NA 4K6OA 1L6RA 1LPPA 4OQLA 5IP5A 2C7BA 3N0XA 3FSRA 4EUSA 3P2YA 2P5YA 2V8OA 5I01A 2EJCA 1AQLA 4MWCA 1UPCA 4NZNA 3T5GA 1A9XB 2A8YA 2OFFA 2DHQA 2OUIA 4Z9AA 1IN4A 1Z4QA 1CJCA 3A6HA 4HGOA 2OO5A 3A1NA 3GLUA 4MUFA 3U4DA 4Q3AA 5CDYA 3DV0B 4YFYA 1YA4A 4PE5B 2OCLA 1QS0A 5AKXA 3EGDB 5H1YA 4FX5A 4LGCA 4P7KA 3DL4A 2DFNA 3QELB 4D9FA 5IC4A 1N32B 2OFXA 3EA0A 2COEA 4LYDA 3N05A 2AOWA 4G8DA 4X1IB 5U1PA 1OZHA 1ARZA 1UR5A 2G77B 5JRZA 3MWKA 3S8EA 2VQFB 3E1GA 4ZD6A 1N1DA 5C8YF 3UK1A 1C3XA 4BNJA 1IIRA 4LNHA 1CZLA 1TCAA 2Z09A 3EXHC 1SUIA 2NPOA 1SC9A 4WN9A 2VHQA 4DW8A 4Q1EA 1N7JA 3ZQ4A 3HWRA 1R4ZA 2JRLA 2BDEA 1W35A 3OZ7A 5LSAA 1LLUA 2HJRA 3T15A 3F78A 1GGHA 5G53C 1YS6A 2V3VA 4LG1A 1O96A 1B14A 1RC1A 2QV7A 1BDBA 3H1AA 4IGEA 5ANRB 3UPUA 2WNSA 1G98A 5CA0A 1Z82A 1JSLA 4BNHA 1ODIA 3RNOA 2WA2A 3JX9A 4GOXA 2AKAB 3IHWA 4J0CA 4BDSA 4H3VA 4IMIB 3RGWS 4N5DA 4ZT5A 4FFMA 2YJ6A 4P86A 2BT4A 3L6RA 1M1ZA 2VDPB 1MB9A 4ZALA 2ZT5A 1YK1A 3WIDA 3WYCA 4QTZA 4A2QA 5KNCH 5H5JA 3GLIA 1MO5A 4RAOA 1A82A 1H0HA 4FYPA 4EGAA 2XRZA 1K63A 2GN4A 4RFSB 4TX1A 2I2DA 2VXYA 1TKCA 1MNQA 2VS1A 3O4RA 4BV8A 1H85A 4P33A 1NBAA 1WXHA 5CD9A 5CFOA 2JFHA 3N8IA 1P17A 1ZU4A 3WC4A 1WB5A 1PGOA 2VZ9A 2F3RA 1RZVA 2FFJA 2WYIA 4R5MA 4O3FA 4WTOA 4QXQA 3NWJA 4B09A 4J16C 4O8ZA 1LY1A 4BMDA 3FPBA 4MJ7A 4E1AA 3O74A 3VHLB 3GELA 4RL6A 5CVJA 1QWOA 4E21A 2OXIA 3C4QA 3ZQ6A 2GRAA 4F3CA 5B57C 1Y4UA 4R3UC 4TMTA 4TGLA 4DPLA 3ABZA 3JVIA 5AT1A 1WMSA 5IXSA 3D8BA 4MQUA 3ITEA 5AW5A 2ZJ7A 4DGSA 3OIDA 1JXMA 4LVNA 4G1CA 3VR3D 1FSZA 4YAWA 1MVLA 2WD8A 2WLTA 5EERA 4CN9A 4C0XA 1Q0TA 1I1OA 3CRW1 1VL0A 5TEVA 3V4RA 2FWMX 2OV3A 3CZ4A 1JIXA 4AL4A 2P2GA 4IMJB 1SHZA 1A5SB 5LKRA 2X4IA 5IWAB 1REQB 4NJEA 1XZPA 3R3ZA 4C4RA 2CXRA 3MUOA 2XSZD 1NI5A 1QJ4A 4LMAA 1LV8A 2IVFA 2A78A 5EE1A 2A1UB 1L5QA 2XOEA 2YN0A 2Q8PA 3SFVA 3MLAA 4A82A 2C00A 1X1DA 3GJZA 1F7VA 1USUA 3BZUA 2WILA 3JW8A 1IH8A 2M1ZA 3C5WP 1SY7A 3OFND 1QF6A 5F23A 5HE8A 5EUBA 4YBZA 3AVWA 4NBNA 1FTYA 4XTRA 1G5QA 4ATNA 4HO1X 4ZT7A 3TECE 4S2EA 3PUWA 2R85A 1XZMA 4I19A 3A4LA 3RS2A 3TAXA 4C4OA 1DTWB 2BKEA 2NU7A 3NKVA 1K06A 3WLQA 1JIIA 4KXWA 4BEJA 3ZIUA 3HKBA 1W1IA 3TR0A 3DFUA 5HVNA 2H07A 1QR6A 2QAGB 1ACMA 4PGMA 2QTVB 1WKVA 3OCCA 3H8JA 5LXTB 5K0CA 4K9PA 3NTOA 5CLIA 3KKKA 5FWDA 1EVLA 4QOEA 5AK0A 4FZRA 3FUTA 2QXYA 5BW4A 1CETA 3EDMA 5CM2Z 4A16A 4YS6A 1OU4A 1EEXB 3WOHA 2EEZA 1APBA 3CW9A 1RWWA 4ZQEA 5C8YB 3R0IA 4JSTA 2MR6A 2QX9A 3C8HA 4KV7A 2XNDD 1CE8B 4LJLA 2RGGA 4Y9RA 5AM3A 1E2KA 2JASA 4WD3A 3MS7A 1X9HA 2ZPUA 3I3OA 5IN5A 2FMUA 3FSGD 4CQMD 4YMWA 4NARA 3PXXA 1NNLA 1ZD9A 2I6XA 5E1BA 4BMCA 2CDCA 5AVWA 3F7MA 1JAIA 3O84A 2GAAA 1HETA 3UA3A 1ORRA 4I8DA 3TTVA 1EDBA 1ISIA 1ST2A 2LDXA 2GHIA 4YWHA 4BQOA 5KNBA 4MV8A 2NXWA 2HK8A 3P0FA 4DC9A 5GJVC 3IUYA 4E1VA 1R6XA 1P5ZB 1E60A 2BM1A 2YVUA 2MWMA 5TPWA 1U5BA 4FWBA 2D5LA 4IHJF 4DAEA 1MJFA 4ETNA 3CBQA 1HEIA 2AQHA 3K0FB 4QAJA 4V03A 3NUZA 1EHIA 1GZ6A 3KLMX 3MXOA 1P6QA 2PD6A 3EZ7A 5I8ZA 4DV2B 4FINA 4NNPA 4AU1A 3UV7A 3KVYA 1A9QA 1MDFA 1ZVQA 3AERA 5E4FA 1RWQA 1X7YA 2PZFA 4MR8A 3RHFA 2EJUA 4BMXA 4JYZA 1N0VC 2GCNA 3P0EA 4JC5A 2HBQA 1F8YA 2PAFA 5G3ZA 3W9SA 4WFIA 4ZCSA 5DZSA 2J0SA 3ER6A 1I7NA 4MV0A 3HR8A 3JCZA 4HX5A 4KUHA 3ZHYA 5KYYA 3QFFA 4YRNA 3EH2A 1GQRA 2OZVA 1ST3A 3LL4A 5K3EA 3AF6A 4FQ5A 3ET4A 2X42A 1ZCAA 2IE0A 2PO5A 3I5XA 4CCWA 3THWB 5DNEA 5FTMA 3GOQA 5FUMA 2WYVA 1FCJA 1MQ9A 1NBIA 3AEKB 2HC9A 3BE6A 4HADA 5AI4A 5HZKA 4KK4A 4PCAA 2W37A 1RW4A 4QYWA 3JQ9A 3RAEC 4NESA 1NYRA 3HEBA 4KLRA 1XWIA 3T7SA 4V0MA 1J70A 5JCPA 4RK0A 2FSFA 2RHCA 1RRGA 3BRSA 2X0KA 2YV3A 5L7TA 1JH9A 4QQRA 4H1HA 1AE1A 4Q4HB 1XMVA 2W2KB 3JYLA 4YRDA 1UBCA 4TLLB 3ORQA 5C1IA 4U8GA 5CDFE 1QZUA 4QEDA 1XPUA 3SF8B 1QKIA 4JL6A 2ZRLA 3MJSA 3T4XA 3CEJA 4MZXA 4DA7A 2C8LA 3ELWA 2GN2A 5G41A 1K92A 1Q92A 2C95A 3BH7A 5A1TA 3QE0A 5KQGA 5LR6A 5EWMB 1IOLA 1LSJA 1AO0A 1Q1EA 1IN6A 3H1TA 5CNMA 3K5PA 4P5PA 1M2KA 1PJBA 1KJNA 3VOSA 5DHQA 2QGNA 3IKLA 1T91A 1F17A 5LWQA 3NAZA 1S1MA 1XTRA 3PX2A 4QQKA 3S1AA 1DBIA 4GKVA 5INTA 1FUIA 1CG6A 3EZLA 5IKMA 1K2WA 1Z4OA 1NNSA 3MT8A 2XODA 1BC5A 4MGIR 2DT5A 2DAPA 2FEWB 3IR7A 1XTTA 3DMPA 4BFTA 4DSAA 3LZCA 3GFRA 4TTTS 1XQ1A 2JZNA 3RD5A 1FLDA 1VXRA 1CPYA 1E6WA 5ITWA 2H2IA 1EFCA 2DYKA 1GUAA 4I4TF 1WVIA 3R6TA 1ZA1A 3D59A 3HCPA 1ZGBA 5JE8A 1EK2A 5EIBD 1EA7A 4LRUA 3TAUA 1KQGA 4IZ6A 5GPBA 1NNI1 5DYIA 5JWOA 1R18A 2XB6A 1USWA 3O82A 2X7JA 4JCCA 3PT9A 4PRYA 3T7KA 3GJ7A 1SBIA 4BVHA 4NX2A 1F2UA 4U5XA 3TFOA 4JSYA 1FYDA 5IJAA 2ZREA 4IDAA 4BNDB 3ZS9A 4GMDA 4D1YA 4ZAFA 4EHDA 3G5AA 1I3KA 1R88A 1VGRA 1A8SA 3SKYA 2ZBFA 3EIEA 1G18A 2A57A 4I1OA 5AUQA 1U6JA 4HXEB 4OJKA 3DOOA 4RNCA 4ERXA 4I1RA 2FSUA 2YWBA 3MB8A 4U2FA 1UEIA 3M6IA 4FQ7A 3M6FA 5DM4A 3WLHA 1J0CA 3FYCA 1GPUA 4WA8A 5IM4F 1BDHA 1RPJA 1ICEA 5DP2A 5EJIA 1C50A 2Y77A 3I5MA 5C4GB 3T7AA 4EGSA 5BURA 1FUEA 3TD6A 3NHKA 4IHJB 2VK2A 3L07A 5JXWA 5JJLA 4AG3A 3FKQA 1I5EA 2E6UX 1E4YA 1JILA 3K70C 2H31A 2C0CA 3AP3A 3DZFA 3H3JA 4AMBA 2DPGA 2BFBA 3AYZB 3HNOA 3I6MA 3QEJA 4KX3A 5F52A 4OI1A 4WKPA 4OJYA 4CFZA 5JSHA 4D97A 1A8IA 1CR4A 5JCOA 1SXJA 3U4HA 5J3JA 1KJIA 1VFPA 1YFLA 1L8AA 4B75A 4L57A 4DMGA 5B7QA 4W7IA 5LQNA 1I6WA 3CZRA 2DQ4A 5DLEA 4CMBA 2PX6A 2WPDD 3FPAA 3I5AA 2HA3A 5IXYA 1DOAA 4QO7A 1B0AA 5DB4A 4JOSA 1E9AA 1QQTA 1ZK3A 1KEWA 3IQHX 3OEHD 4Q9HA 4X3PA 1J42A 2Q49A 5TNXA 2WFLA 3WLTA 5H82A 5JWRA 4O4LB 1DRWA 1RHMA 4N8DA 1T4DA 4X94A 2E4ZA 4EENA 1NW4A 3LRXA 2WY2D 3X1DA 1NSTA 1WVMA 3AVQA 3IP3A 4YAOA 1OBFO 5EA2A 4GLOA 3FRIA 1W34A 4M3NA 4LFCB 2X5OA 1RT9A 4CFYA 1CR2A 2QN7A 4Z4QA 5JJBA 1JHRA 4F5DA 1XXHE 2HA7A 2I4OA 2ZB3A 3RABA 3WHLA 1X7WA 1XTJA 1ZSYA 1UH5A 1PUIA 1S2OA 2DWCA 3BIWA 3ORRA 4MQBA 1FDWA 4FFPA 4PZ9A 3L7MA 2X8JA 3REFA 1EESA 5F33A 2QQFA 4CLEA 2VQDA 1N2GA 3LLSA 3F5MA 2PX8A 4BWFB 1TLFA 3MRSA 4I55A 5JMOA 3GG2A 5D01A 1OYVA 2Q5EA 1GR0A 3VXKA 1E61A 2C03A 2JVJA 3VQTA 1JG6A 3F97A 2GPYA 3B6ZA 4W1PA 4RQAA 4DAOA 3CT4A 5JQGA 3OSZA 1QHIA 3DQZA 3OEEA 1L5OA 3R7WA 1H9AA 1U28C 2Q9AA 3DO8A 4FT4A 5BWLA 4BQQA 1RE0A 4RVUA 4YC7A 1BH2A 2NN3C 4GPIB 1FX0A 5E1MA 4RPKA 2D1RA 1CY6A 4N7BA 3UHFA 3UKJA 1NZDA 5JRDS 2XE6A 5ADWA 4GVXA 4DB4A 1SG0A 1W44A 1EFPA 1B76A 3EWSA 1P1JA 4RA6B 2VPIA 1ZXXA 5FCDA 4HRYA 3UA4A 3UNXA 4BE4A 2C31A 2GK3A 2PX2A 4TRJA 2RHTA 4L75A 2LIPA 5EE5B 4HLQB 2D4HA 4HLNA 5CDTA 3NGXA 3RKUA 5JAOA 2AOTA 1BEEA 4ZRDA 5FBQB 3LIPA 1LFDB 3WP1B 4RSGA 2C4TA 1I3NA 4ALMA 4IS3A 1L7VC 4M1TA 4XIIA 3KKQA 4IVRA 4MIOA 1U7TA 2P79A 2V4MA 1M2WA 3IO3A 2AQKA 2JANA 3N2NA 4WGFA 2BM8A 4YAEA 4XWYA 2R86A 3BL8A 5F78A 5G4KB 3A14A 3TLMA 4QSMA 3G2IA 3UWDA 1PZEA 3OTOB 3JWPA 2HBZA 4NIMA 3TBHA 4E4RA 3WDKA 4BEWA 4RXTA 2A58A 5IK2A 4IEIA 3RQIA 3NWPA 1NUSA 4LXYA 3LT0A 4UQOA 1OI7A 4NCBA 3DD5A 1Y9AA 4WZBE 2GR9A 4CNBA 2BLLA 1GGNA 1UDBA 1X1AA 2GPTA 3A36A 4IOJA 2VHZA 5DTJA 5L3ZA 2YWJA 3V7FA 4ZHSA 1YGYA 3C14C 1C8LA 2QP3A 3OEWA 1PR6A 2FGJA 2HRCA 1II8A 4MARA 4RD1A 4D3DA 1XU9A 3MIIA 1C3LA 3LF2A 2WICA 4A0HA 4X65B 5FBZA 4IJ5A 1CUUA 1V9CA 1V8FA 4QTUB 1GJRA 3NIWA 2AFHB 2H48A 4FKBA 4RK5A 2B83A 1J25A 2V0CA 1YUBA 1WUIS 2WABA 3BMNA 4FWIB 3AUXA 5D6NA 3BMQA 3CFYA 3NC1C 1BGXT 2JH3A 1J5EB 4FE7A 1BW9B 2C1ZA 2GRJA 1KXZA 5BQXA 4DUPA 1IMOA 5DHUA 2F1OA 5KBYA 1H5UA 5I6DA 1KEKA 4WACA 5AXDA 1W8IA 4TKUB 1GM5A 1XZIA 2DPLA 3L1VA 2VAWA 3R7SA 1FRVA 3SBDA 2XTMA 1EEHA 3PQ6A 1VE7A 1VSBA 5AI8A 4DXDA 4EX6A 5KX5B 3ZW8A 1FSGA 1SKYE 4LSGA 4RSHA 1Z4JA 5KKAA 4LXQA 4URWR 5B2EA 1UM9B 1HRKA 3IOMA 3UJCA 3L6DA 2PMCA 1XMXA 4TVBA 1KK2A 2BFEA 1KI9A 2EBUA 2WSLA 3CRQA 3OE1A 3QH4A 4IUCS 4CT5A 5J4YA 4C0WA 2OORA 3LK7A 2PL5A 4JODA 2XIQA 2ZATA 2ZYHA 2DTEA 4HT3B 1AY0A 3Q0TA 1OFIA 4LRQA 5HDQA 1D3AA 5CDGA 3EFHA 4WCFA 1Y82A 3GJXC 5CYFA 1YZTA 4MUYA 3FFAA 3BHMA 3R0VA 4HNAB 2CV2A 1W4ZA 4KNYA 3GGCA 2HN9A 3LFHA 5FA6A 3NNNA 4DXAA 3NBXX 1Y3BE 1MRNA 1MT3A 2P9ZA 3BXEA 4M87A 5FH9A 5ALEA 2WJZB 3EIQA 3DV2A 1SHLA 3NATA 1OWPA 3OZVA 3S2GA 2GM9A 2ORVA 1FRQA 3IAM1 2JFNA 4HR7A 4ADSG 4W1SA 3T06B 4TYMA 1NBOA 3M33A 1TYEB 2CNWD 4LVOA 4CQJA 1EG2A 5KMGA 2QT9A 3DL0A 1KZ7B 5FBRB 2JAWA 4RTOA 3ZWVA 2OHXA 5B4TA 4DG5A 4DLWA 1V9LA 4D9CA 1ZISA 3RIXA 5A6SB 4EG7A 2UVPA 4JXJA 4CQMB 2EJBA 1G0OA 2IHJA 5TGZA 4Q3KA 2N46A 1N57A 4KN6A 2GZ3A 3EF3A 3EF0A 2Q4RA 4RA9B 5AK3A 3IBSA 2NPFA 2R48A 4GRIA 4DLVA 5F2OA 1DXHA 1NVVR 1YDEA 4NYJQ 1JLLA 1NN1A 4YCNA 4PNZA 2VNIA 3OEYA 1KYVA 1NP6A 4TQAA 1VLVA 2OCBA 1M33A 1LPMA 1BAPA 1QF9A 3AWIA 3W3AA 4OUDA 4R1NA 2J3KA 4B8WA 4G26A 4HTAA 3WMRA 4ZYWA 3C8ZA 1CB0A 1A8PA 3HJAA 5HILA 3L0SA 1JR6A 3EIFA 3ESBA 2XXAA 1ADGA 5HGJA 1KMCA 1FS5A 1TQDA 1AB6A 2J9YB 2QA5A 2EFCB 1ZIYA 2XT0A 3UJ3X 5J4KA 1CV2A 1KI8A 3FVQA 4QBFA 3AY6A 1M8GA 2PS3A 3FN4A