4D92A

Salmonella typhimurium d-cysteine desulfhydrase soaked with beta-chloro-d-alanine shows pyruvate bound 4 a away from active site
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
328
structure length
327
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 118
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d92A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d92A02
5CGQB 4D96A 5E0KB 3VSDA 1A5BB 2CLEB 1D6SA 1TTQB 1A5AB 4D97A 2ECOA 1WTCA 1UBSB 1E5XA 3AEXA 1JBQA 4I1YA 5B3AA 3PC3A 3IQIX 3R0ZA 5D86A 4D8WA 3IAUA 3PC4A 4NU8X 1J0DA 4D9BA 4L3VA 4PCUA 4QYSA 2ZSJA 3PC2A 5BW6B 1KFEB 4L28A 5D87A 1KFKB 4Y6GB 3FGPA 4D9NA 1F2DA 4D99A 5JISA 3RR2A 1C8VB 1O58A 1Y7LA 4D9EA 2CLKB 5DBHX 1QOPB 5B55A 2BHSA 2CLLB 4D92A 2C2GA 2CLOB 3T4PA 2C2BA 1K7EB 2GN1A 2GN0A 3PR2B 4IL5A 1K3UB 1TJPB 5DVZA 5T6MA 4KKXB 1CW2B 5DW3A 4HPJB 2EGUA 4D9CA 1TZKA 2V03A 5CVCA 4D8TA 2DH5A 5D85A 2TRSB 1KL7A 3FCAA 5B1HA 1KFBB 1M54A 1BKSB 4D9GA 1VE5A 4AECA 2ZR8A 2CLMB 1QOQB 1TZMA 4JBNA 1UINA 1RQXA 2ECQA 4LMAA 3V7NA 5IXJA 4WX2B 1J0CA 4ZQCB 1K7FB 4D8UA 2Q3DA 3L6RA 4COOA 1A50B 5J5VA 2EFYA 4ZU1X 3HMKA 1WKVA 4D9MA 5IWCA 2Q3BA 4D9FA 3AEYA 5HBGA 1KFCB 4L27A 3R0XA 4HPXB 4NEGA 3IQGX 5IW8A 3VSCA 1TYZA 2TYSB 1WDWB 2GN2A 1VB3A 4LMBA 3IQHX 3VBEA 1PWHA 2O2EA 4AIRA 4HO1X 2RKBA 2J9XB 5DBEX 1J0BA 1C29B 1UIMA 2CLIB 3X44A 4D9IA 5KINB 1V7CA 5I7RA 4L0DA 5B1IA 3L6CA 1WBJB 1V71A 1TZ2A 5I7OA 1KFJB 5I7WA 4JBLA 4ZU6X 1TDJA 5KZMB 4HT3B 3CEPB 1VE1A 1BEUB 5C3UA 1X1QA 1K7XB 5D84A 3TBHA 2PQMA 4H27A 4HN4B 5B53A 5B36A 3SPXA 3DWIA 3SS9X 2J9ZB 1PWEA 1P5JA 3L6BA 2J9YB 1OASA 3VSAA 2CLHB 3DKIA 3BM5A 2CLFB 1TZJA 5JJCA 1V8ZA 5J43A 1FCJA 1K8XB 1Z7WA 3X43A 1FUYB 4OFXA 2ISQA 2DH6A 1CX9B 1TTPB 1J0AA 2WSYB 2BHTA 2D1FA 3DWGA 2ZPUA 3VC3A 5I6DA 4OREX 2Q3CA 1J0EA 1K8ZB 5DW0A 1Z7YA 2TSYB 4LI3X 1K8YB 4F4FA 2RH9B 3ZEIA 1A5SB 1C9DB 2JC3A 5I7AA 2O2JA 5I7HA 4XUGB 4D9KA 5EY5B 2RHGB 3SS7X
chains in the Genus database with same CATH superfamily
2Z6UA 4Y1RA 4F1KA 4F6RB 2I6QA 2NVUA 3FMPB 1L8QA 2GO7A 3BD7A 3ID6C 1ZH6A 3QHQA 3SM9A 2WZCA 4LFBB 1WMSA 2BEKA 1LJUA 4CLRB 1O97C 3QLJA 2CSXA 4LJLA 4GAEA 2D59A 3T0IA 5HS4A 5JSHA 2IYWA 1SOVA 3L92A 1YHZA 4CBVA 1RACA 4I8DA 3NHSA 5K3DA 1MNAA 3OJ0A 2Q2WA 1USVA 1NVAA 1SIWA 3QU5A 1B6RA 1ZJZA 1Z16A 2IDJA 1LW6E 3EGCA 2QR2A 3OAAA 3ORRA 3CGWA 4PAMA 5I7EA 3W3ZB 1LPNA 2CCKA 4EGQA 2EATA 3D8HA 1EFLA 5FPYA 4ECAA 2I7XA 4RC9A 3RS0A 1XDBA 5B3KA 1E7WA 2X0KA 2VHEA 1F3OA 4X8LA 2W70A 3WHIA 1DKUA 2EIXA 2W7TA 3X2SA 4ZZIA 1G21E 4Q03A 2DPGA 2HPVA 2I6SA 4B3CA 4ZEVA 1QMPA 5HF9A 2OD9A 5BSHA 1Z34A 1KK1A 3IX7A 4WLFA 3OOEA 1E3EA 2PPLA 3V7NA 1WETA 4B2IA 2V6GA 1NNUA 2P8SA 2A88A 4MPPA 3VDQA 4G0YA 4OTZA 3TK1A 4E7PA 1SZJG 2EERA 3RV3A 3UCXA 3S1LA 2GOYA 2QSYA 2C5GA 1Y3AA 4R9NA 2VHQA 4V24A 4AY6A 4RK6A 1KMHA 2ATIA 3PHLA 1N5LA 4IH4A 3GLHE 3ZU6A 2CV2A 2B4KA 3JSAA 4BHTA 3Q85A 2HLNA 3DNPA 4FOTA 5FI5A 2O8FB 3N87A 1WXXA 1ZK2A 2AR7A 4KRGA 5IT4A 5LU9A 4JLUA 4N5MA 5G53C 4H59A 4KPFC 2OMKA 5IW8A 3TRHA 2Q0HA 1W73A 1KDVA 4B3TB 5C1OA 721PA 4MR8B 4R9SA 2BUBA 1PS9A 1JWLA 4BUCA 2Q0QA 2VK2A 1R8YA 3SR0A 2J7PA 2FQYA 2IGTA 2Z4TA 3VKFA 5A4MS 2RIRA 3EZFA 3DBRB 4HL6A 3ZY3A 5A4DA 3EX7C 5ALMA 4CKXA 1ZI8A 3DZJA 4R51A 4TSFD 2VQEB 4LVOA 1OZAA 5I7WA 1YB2A 3W8RA 2G07A 1KSFX 5F2KA 1EU1A 3UJCA 4XDZA 2CFCA 4LXHA 2NO4A 2RHRA 5B1SA 3OU7A 1OH6A 4U7TB 2EYUA 1HUQA 1RHQA 1GT6A 4KN9S 4RFVA 5DHRA 1R6DA 1RWNA 8AT1A 2O52A 4PZ0A 4QU8A 4JVSB 2B7BA 1QRTA 5JNLA 1CVLA 1SC4A 1TQHA 3IUEA 4M83A 2PZAA 3RDPA 1WQ4A 2QUIA 2R8YA 3UAGA 4KKVA 3UIEA 4FLFA 3K09A 3M89A 3KSAC 3N2KA 4PGGA 1CY1A 2QJTA 3C8DA 4LZJA 5FIUA 3FWHA 3W1EA 4IHJF 1EFUA 2WSYB 4MJ3A 2VHJA 3ONDA 3A70A 1GTRA 1ORIA 4Z7QB 1KJWA 3ZE2B 1CRLA 1TEHA 3LDFA 3PSAA 3ROMA 4OHWA 1XLWA 1L5GB 1J8MF 4NBWA 1JEAA 3CNOA 3ETHA 3FX2A 3QF4A 4AMVA 3A1TA 4WBNF 2RGNC 5JH7A 4IJVA 1Y3DE 4Q66C 3ONEA 4BE4A 5LXTB 1N2GA 4M1OA 1U4SA 4JBHA 4LUCA 1DLIA 1ZM3A 4DQVA 1A27A 3FR8A 3PICA 2VP5A 3CZPA 3SYKA 3RM3A 2UZ0A 3THSA 4FKZA 3ER9A 2AGVA 2OA0A 4A10A 4J8PA 1JBKA 1M72A 2EZ8A 3EXG1 5EIXA 2ZJ8A 3TBFA 4X95A 1NLYA 5TNXA 3N7TA 3T1HB 1C1XA 4LZAA 2E7ZA 4D74A 1SU6A 1CQJA 4KMMA 2CVOA 4NQZA 5JISA 3AL0C 2HAEA 4BYGA 2BJVA 4LHWA 1NVDA 4D9JA 1RYMA 1V9SA 3C0KA 1MIOB 5ITZB 2IEBA 1MO2A 1HF3A 4D0GA 2A1TR 4CQMD 5K3CA 1K3UB 1Q95A 2AG0A 2XKBA 3IESA 4YC7A 4B71A 2GMWA 3R0VA 4HLUC 4U6NA 5DW3A 2AMLA 2LW7A 3P9CA 3TSOA 4EYGA 2Y4OA 1UZNA 4MUFA 4XTCS 2IS6A 2AUTA 3JPWA 1WBDA 3F9IA 2CD7A 1SKUA 2AJBA 3TIFA 4R3WA 1T2CA 4Z4CA 5HZMA 1IQUA 3TR0A 2J31A 3B48A 4GX1A 3W7AA 2O8EB 1YCGA 3JQGB 4QHYA 5EN4A 2P27A 4WX2B 5JJBA 2YJ6A 5EZYA 1XDGA 4EZIA 5C5DA 2F55A 2WJJA 3F46A 3QX8A 2ZR0A 5DYGA 4DV3B 1A50B 1ETUA 2IY7A 4EQZA 2E87A 4H6WA 1XZLA 3RVDA 2VRWA 2AG6A 3SMVA 5B6PA 1BRTA 3UPDA 1HDOA 3A11A 3BF7A 2VBFA 3F6BX 4NCHA 4DNQA 5EJ4A 4KZKA 1FFGA 2EKQA 3B36A 1PR9A 5ALRA 2R6ZA 1YBAA 2QUHA 3R20A 4P0TA 2ZRBA 4JI1B 3ZNQA 1S2GA 3VHRA 3P71T 1ITZA 1HY3A 2JAUA 4OI0A 1EFCA 1T2VA 3Q3EA 2HRCA 1PFGA 3TKAA 3W6UA 3L0DA 1PQ4A 3AEZA 3L8ZA 1O1YA 2DZDA 1H2HA 3B13B 1U1EA 3AFNA 2PSHA 2PNFA 3DOFA 3OCJA 4YP6A 3LOUA 5C8VA 5F33A 1UJMA 2C78A 2AXNA 2XGGA 3H8WA 4QJ4A 1A0OA 4QPPA 4RPLA 1NE2A 1T8WA 4DDMA 2DLNA 1MB4A 2RHDA 4HS4A 1ZOLA 2ZOSA 3KYDA 3GA7A 1U2PA 4FKMA 5HCIA 3TR5A 2Q2QA 2WT4A 1GJRA 2UXDB 4ZVTA 3FCXA 3TBHA 4PYIA 1VHLA 4URYR 1AN0A 2JLZA 1EFPA 1NJGA 1Z2NX 4PU0A 3ZDCA 4HNRA 2C95A 1M34E 4UD6A 4EJFA 1QH8B 2VHUA 4HEA1 3A9WA 4DA9A 2QTBA 4XDYA 4EFLA 3K4PA 4W99A 3GLFA 1K3FA 3FKSA 4BE9A 4LI0A 2M6LA 4CIBA 1R0CA 4MWOA 2X3FA 3R3ZA 1BWSA 4BVHA 4QX6A 1YH3A 2BZ1A 5DCUA 1CFZA 5JMOA 3HJAA 4LQLA 3AKCA 1QP4A 3AJAA 1XTIA 3K73O 1QHXA 2IXGA 3CIFA 1FB5A 3R41A 4QUBA 5EKXA 3TDKA 4DL9A 1K6IA 2A3RA 2WF7A 1FXSA 4QDZA 2O2JA 1M74A 4UDYX 4UXHA 4EEKA 4MOWA 5DYWA 5FUVA 1T3HA 3N3AC 4TUYA 5CH3A 1CVIA 4LYEA 2ZRMA 1W4BA 3PXCX 5E2BA 1C3VA 3AX6A 3ZDRA 3A04A 3INYA 3K8ZA 3CX4A 5CNJA 3SLGA 3FCCA 3EIWA 3EDRA 2IHYA 5B6IA 1SZDA 2ZSHA 4E33A 1FU4A 3DW1X 1P73A 1ZI6A 2QD2A 4AICA 2CVFA 2NVOA 2HQOA 4NU8X 1CV2A 4XPIB 1P45A 3QJYA 5E1MA 4YN3A 1W7AA 3R6LA 4MIOA 3DCYA 4L57A 1NBWB 1SEVA 4IOLA 2V7VA 1EM8A 4NH4A 1MFPA 4UUBA 4ZRMA 3W8EA 4F7WA 3AI2A 5HQ3A 3Q2IA 1OLXA 4P4SB 4UU1A 5AK3A 1T0UA 2NOAA 1B8PA 4HD8A 1NXOA 4L74A 2D1TA 2H1IA 3WZLA 1NDUA 1YOVA 2BBTA 3UWDA 4BKUA 4X6LA 4MVJI 1GCGA 5CLGA 4F4JA 2DBRA 3IULA 5TDHA 4ZVOA 1ZH4A 3KETA 1T9HA 3THOA 2DLCX 1XZFA 2ZBFA 4QXQA 1ZMTA 2NZVG 5AKEA 1ZCFA 4HSGA 1DCKA 1NAHA 2WUFA 4LRQA 4G1EB 1DQPA 3A1DA 4NATA 4RTLA 2AMYA 3Q8KA 2FWAA 5E6SA 2ZE7A 4LJ8A 2XMQA 4CM4B 1QQ5A 2NO1A 3ACCA 1LWOA 2Q6IA 1AO0A 5IFLA 1N2OA 4UHDA 3LWBA 1P6QA 3QQPA 1JG7A 2P1DA 3QE2A 1QFZA 2I22A 5TGDA 1EX7A 1PT8A 1OFGA 1H3NA 1CIPA 1UANA 1ZUWA 1DIGA 2EFYA 5K09A 4F3TA 2GM9A 3VR6A 3FFAA 3TLGB 4DSNA 1LKZA 3WP0A 2DQKA 3W9UA 5KKNB 3CF6R 4CF5A 1RWOA 1EDOA 3KLMX 4HAUA 3TBKA 4J75A 1PUXA 3DVSX 4LDRA 5DXJA 4BO6A 2B6HA 3TGLA 3ZW7A 7MHTA 3MCZA 4Y8VA 4OYHA 3RTGA 1AMOA 2C61A 1HNZB 4Q4AB 3BWCA 2GEJA 2OCLA 2Z2ZA 2J0EA 3VVCA 2A9PA 4IKPA 3IP5A 1XZEA 2I8LA 1PWXA 4R01A 3T3EA 1U0HC 5AVUA 1BROA 2M2IA 2MSLA 3PHIA 4FGJA 1K4YA 4OHZA 2I1VB 2JHGA 3R3SA 1H1TA 2ZSIA 5TC4A 2EWWA 1LLQA 2I80A 4G0ZA 2QENA 2VOJA 3LD9A 3VQTA 3T7JA 4NABA 1NBHA 2MSKA 1GR1A 2DQSA 3GAMA 3ZHCA 4FYPA 5I4KA 1A9TA 2XGSA 1OE0A 5EESA 5FOXA 4O0MA 2ZWPA 2IL1A 3O73A 2BC9A 4I50B 5AESA 5KVSA 1H1LB 3PCRB 4C5BA 1MA3A 3PFCA 3WKCA 2WTAA 2Y1OA 1JI3A 3I2YX 3ENVA 2O48X 3IP1A 3AUSA 4QNNA 4JHXA 2HMVA 3HA5A 2PGLA 4PIPA 3IBSA 1FX0A 3Q3JB 5CG1A 2OG1A 4YRGA 1LC0A 4JU9A 2OZLB 2P7HA 3VVBA 3KPUA 1I2MA 4Z0NA 5IAEA 3HDQA 1ZK1A 3STTA 2VPTA 4XIFA 4FONA 5BWNA 4KGZA 2OAEA 3ZD8A 4GMFA 1ZSNA 1X92A 2YTZA 2IYLD 4R16A 1GAXA 1O95A 1ZBQA 2M9MA 1UBFA 2NM0A 2Q1UA 3VZCA 4V1CB 3P2KA 5J2UA 1L4NA 4XQEA 5KC9A 3J7AC 2K87A 1YR3A 4DSAA 1KH1A 4IG9A 1YO6A 2GFHA 2GTHA 1CJTC 3DGFC 1SXJE 3AESA 3KM0A 3MD0A 5HFAA 3ORQA 2EKPA 3GUVA 3H6KA 5E9QA 3NBXX 4KSCA 4N40A 3AR9A 5AXAA 2GFIA 2FW9A 4N3CA 4OI2A 3NGLA 2BM9A 2HEGA 2Y99A 1UXOA 3DEZA 4MV8A 3R3JA 3NNSA 4IFBA 1GZUA 1GQ2A 2P5UA 4GIBA 5HBRA 3P97A 3QMMA 3M5WA 2G67A 5JASA 3FRJA 1EVYA 5B58T 4H4CA 4ND3A 3LX4A 1RXYA 1II8A 4N01A 3EPHA 4HXYA 4JLSA 4B3HA 3RU7A 3NM5A 3VR5H 1TU3A 4IRUB 3VTKA 3AIIA 4L16A 4NE2A 4EARA 1G6OA 1X13A 2BFDA 5LIRA 3QUCA 1T91A 3MS2A 5F7XA 1XT6A 1Q91A 1QLHA 4BRSA 2EV9A 4ZJUA 4IJUA 4LYHA 2IU4A 1A2KC 2W90A 3HKDA 1HYHA 1E2IA 3H42B 3FFXA 1ZH8A 5GV8A 4RTQA 3IV9A 4YJGB 3EXHC 5J58A 4XUCA 1BVUA 3O7MA 2ETVA 1ZYUA 2FN3A 4ABYA 4JOBA 2JS7A 1Z2CA 2V0CA 1JB1A 3QVKA 4G5SA 5FLKA 5IK2A 1C8BA 3AP2A 4RF3A 4DTCA 3WJ1A 5EJ6A 1FLNA 1OUMA 4CIDA 1TLLA 2AEEA 4PNPA 4DE5A 4RTSA 3CW8X 4Z9AA 2QTRA 3L01A 3B1JA 1N2JA 2VSNA 1V43A 1NPDA 1Z08A 2Y2VA 3C3PA 1R0XA 4C22A 2YRWA 2B25A 1KERA 2ORIA 2P3QA 3JD2A 1QPGA 3STXA 4YPVA 3TH5A 1KF0A 1Q0UA 3LBAA 2EKBA 4D9IA 4JZKA 3CVOA 2WA2A 4GR4A 1RRGA 1WW2A 1XRRA 4XRRA 3T3NA 1ZHOA 3FZYA 2VPIA 1H6BA 3ORSA 5JCOA 2P78A 3RNOA 1W6RA 4ZU6X 4F92B 4KXVA 2FN4A 1CDEA 2NUTB 3WHLA 1ENPA 2C8VA 2FP4B 3DMTA 4H1TA 3RYHB 4LYAA 3V7FA 1UMCA 4D7AA 3RBAA 4BJ1A 5A9SA 1T6NA 3GO4A 4MP3A 2ORWA 2QR3A 4OIMA 3SGLA 4K6GA 3LM8A 3TSAA 2DQ4A 5FL3A 1NE7A 2DFDA 4O5AA 4OOEA 2E3JA 5BW8A 4EA6A 2IZ6A 1XZDA 4CMIA 4Q7QA 2OC4A 4DQLA 2FSVC 4IZIA 4YALA 3PLAE 3EDOA 1MG5A 3LAWA 2R2GA 2YYYA 2CCGA 2XHZA 5J4KA 4NBRA 3NHBA 1RIIA 3GPLA 2A67A 4QXPA 3NVMB 2DM6A 3BL8A 1NVXQ 2IOYA 4NZPA 1N4AA 3A6JA 4OLJA 1I3CA 1IONA 1YS1X 5IJ9B 2ZGVA 2HDNB 2E4WA 3LY7A 5C1IA 1SNYA 1XPJA 3M1YA 1QGAA 1II0A 1ZN8A 5HJEA 4BWFB 1FS6A 5D1NA 2G9VA 1L8XA 3RT1A 1WKBA 1KYZA 3JQFC 1TAHA 1XHFA 4LDQA 5HILA 4INPA 5A9TA 4MV7A 1WZUA 1HI9A 3T5MA 3PITA 4YR9A 4W5WA 1U04A 1A9ZA 2X0IA 2SHKA 2CLEB 3DA8A 3F2VA 1VI2A 4MQFB 5CLLA 4YCSA 2OMEA 4F11A 4GC5A 4YRJA 3WYNA 4KG7A 4MS1B 1XJCA 1VLHA 3EOZA 4LQCA 1OFVA 4TKVB 1E1MA 421PA 4BU0A 2IDMA 3G0HA 1AQYA 3IKMB 3ZY5A 4GKVA 4RS4A 2PYZA 3VGPA 2VWQA 2A9VA 3MJFA 3IR5A 3F0TA 5T57A 3H9GA 3MSXA 3ZGLA 4BMCA 4CHGA 3LSYA 5BQ3A 4ZV9A 3P9XA 1KFKB 3BGSA 3OQ1A 1N33B 1AGPA 1WX1A 3NC0C 4ON9A 4J7XA 4KTVE 2R00A 1YR7A 3T3DA 1USWA 4B17A 2QBYB 5F1PA 2HK8A 5AT1A 2XJ4A 4HX9A 1YDEA 5E9AA 4AJ9A 4HBGA 5KYVA 1J5EB 3LL7A 4G0WA 3PR3A 2W2OA 2W6ZA 6LDHA 3K1TA 2D00A 2RGXA 3G2LA 3WGGA 1KYYA 1LBIA 4C0WA 4J4TA 4RIGA 5D85A 3UMJA 1ST2A 3I01M 4E5VA 2R7AA 4NDAA 4NV1A 1E1RD 1C0EA 1XTSA 4QYIB 1BKSB 1KZYC 3AC0A 3R8CA 3PQ2A 1B15A 3WAGA 2UZIR 3TF5A 4OXRA 2WV7A 1MC5A 1WMEA 2PA3A 3UV7A 2PRKA 1T1SA 1E58A 2BFCA 1ODLA 1HNWB 1LEHA 3QBJA 1AQLA 3LO8A 1RU3A 2YN0A 4ZO4A 4Z99A 5ESXA 4ENTA 4W5RA 3WQHA 4UDNA 3A1FA 4X66B 3MHPA 1YDMA 1O8CA 2FZKA 1I13A 3H4TA 3CZ9A 1GXSB 3LW7A 4HVTA 4G1FA 3WFIA 5BWCA 1YB1A 1N6IA 2YWDA 3IPAA 1HXHA 3O3NB 1LD3A 1GU0A 4J0EA 4WFJA 4EJSA 5JYCA 1L5YA 1R6AA 4CLOB 2HB6A 4ENQA 2NU6A 1HZZC 1QGUA 1QIEA 3BK7A 2C2OA 3CUVA 4HVAA 4OL0A 3RRJA 4LCJA 4LMBA 4P5PA 4EZBA 2I34A 5L4LA 1Q83A 1NLUA 2VF4X 3H5VA 4NJOA 3MOIA 1XWWA 2L2QA 2C97A 3BJZA 1X19A 1SPXA 3E8MA 1NMSA 1PFUA 4MCHA 4P4UA 4RENA 3R9KA 4O25A 1QM5A 3VAZA 5JU6A 3O4GA 5FTWA 3O4VA 3T0FA 4A2CA 2J3IA 3FWYA 4AD8A 3LHKA 1DX9A 1DV2A 5BORA 5AW4A 3KLOA 4WFIA 5EXXA 4CEIA 4JJ8A 3K0BA 2NPOA 1K7XB 3OF2A 3OZ7A 5D3QA 4YHHB 1F7UA 3V34A 3B1WA 2KBFA 5FF9A 2ZRIA 2WY2D 2V7GA 4X1YB 4LJ7A 2B2XA 5I01A 2BGJA 2D13A 1W44A 2WKQA 2XZTA 2NSYA 2YZMA 3F3SA 1NTOA 1PJTA 1ISGA 1QQ6A 1XD2B 2EP7A 2NVBA 2REXB 3BM5A 2EEZA 4LRTB 4NJEA 4NNPA 4RHUA 2HD4A 4PXSA 1AUXA 4ASUD 3AETB 4EPXA 1NBME 3PRHA 4WN3A 1QF7A 3JRNA 3WMEA 4C3VA 4Z4IA 3U3DA 3CVWA 3NZEA 3KJQA 4IOJA 2QEQA 4G0OA 1IG3A 1OYVA 5KTPA 1RKXA 1XK6A 2CDRA 1CS0A 1JLRA 1Z7YA 3QKSB 4V3BA 4P4LA 1IOWA 5ERXA 3WLTA 4HZGA 3P9YA 2JGDB 3INRA 3M70A 1FVXA 5B64A 3ZCUA 1N5OX 2H7VA 5DLDA 3JS5A 1RHKA 3B2NA 4I08A 2OOKA 4KACA 4DJTA 1G1MA 1EAMA 1U8EA 2J5QA 3H9QA 1THTA 2BCEA 3BMXA 3GFTA 1WVIA 1G5HA 3WYAA 3DVAA 3QPBA 4GMHA 2GPTA 5K45A 4LXGA 5G02A 3VJMA 1ID8A 3GARA 1CF9A 1NLZA 4UOEA 3SZ3A 2GD6A 4OB8A 2SKEA 3ZDXB 5AOBA 2JAXA 1I4OA 3S4YA 3VI3B 1XF1A 2ILTA 1VRWA 3REFA 4AJPA 1U2EA 3NOOA 3L1UA 2DUWA 2YR0A 4BN5A 2IKSA 4Y2UA 3R7DA 3FROA 1J2JA 3GUZA 1MV5A 3HA2A 1D6JA 2OVFA 4YRSA 4JLKA 3DFMA 5DOZA 4BLQA 1XV5A 5B5SA 2O8CA 2YVAA 2VAVA 4PCAA 2JG3A 4DWVA 1M8PA 2EFEB 1GEGA 4NCNA 3A3YA 3ZJUA 1VSQA 5EWJB 4A2QA 5G4LA 5KQRA 3IURA 4TWAA 1X2BA 1B7GO 3NT5A 1N6HA 2FW8A 4J9VA 5JQGA 2HJ9A 4IJ6A 1OBHA 2A5FA 4FYXA 2CDNA 2M6RA 3EEQA 2BFFA 3ZS9A 2GETA 4K05A 4NBNA 4OJQA 1F2UA 1FYEA 2X3YA 1MX5A 3AV3A 1EGVB 4KWIA 2RB4A 2BDUA 1PAUA 1QZTA 2Q5EA 4IY1A 1L5WA 1R2QA 2AQHA 2K2QB 4D3YA 1TJNA 1D5WA 1U5BA 2FH5B 3A6KA 3D1JA 1R1DA 2DTDA 1JIVA 4ODIA 4YEDA 5J1TB 3THXA 2Z04A 1CPYA 2ZJ4A 3P2EA 1G7SA 4YECA 1OV4A 2IE8A 4UNPA 2WE8A 4K2AA 2RG1A 3I4CA 2H31A 4OHYA 3N0RA 2CMDA 2ATXA 1QU3A 4LOLA 2VEOA 4EQ6B 2QLMA 1QIKA 1RQ2A 3H87A 1SBIA 2BP7B 3IQFA 2OM6A 3PJEA 4PGHA 3QHPA 4UHBA 2X2OA 1G5TA 5FTJA 3UOGA 3G9TA 5B2ZA 2TMGA 3NRCA 4EA7A 5BR7A 4G26A 3QFHA 1E94E 5AI5A 4UM5A 1HDYA 3UXYA 1DTSA 3T6KA 3HO1A 5K4HA 2DFLA 1N2CE 3U44B 1EP3B 3JATB 1R0KA 2CUNA 5MHTA 3CISA 3MRSA 2C88A 4FEGA 4DIEA 4FGLA 4ZWNA 2YICA 2MCFA 3VR3A 2QN9A 1KI3A 1TF7A 3D4PA 2FE1A 3RVLA 1DEKA 1UOOA 2E2WA 3SC6A 4GICA 2C94A 3H18A 2ZIXA 3NYWA 4N5NA 4Y6OA 4AZWA 3D7SA 4R83A 1ZN9A 4LXXA 3K8OE 4H7JA 2IHVA 3W3AH 4B5LA 3VDRA 4ML3A 4OM8A 3GNQA 5A3QA 1C1DB 5ALIA 3LT4A 3JQAA 5FPKA 4DC1A 1UK9A 3P2YA 5E1DA 1XPOA 1VCNA 5AVKA 4MA4A 2XYHA 5LQAA 3QPUA 3DOUA 4LBVA 1ULHA 2QD1A 1EX9A 3FN4A 3QXJA 3DM5A 3MT8A 1G8FA 1L5HA 4WK4B 4B6FA 5AM3A 3WA7A 4ARBA 1GKYA 1U7UA 1ZA2A 3HFRA 1OXUA 3Q40A 1FF9A 2C2ZA 3A6ZA 1VLLA 3QKRB 5ALYA 4YJ2F 3VTAA 2XRFA 4QXRA 5FD8A 3AB8A 3OIWA 2GCNA 4H18A 4QASA 1TTTA 3GWGA 3JVUA 5EZ5A 1N1MA 1CDOA 3OT1B 4JWTA 5I7SA 3AVVA 3IOMA 2XA1A 4I6JA 4O4IB 2QK4A 2PUDA 3ASZA 2YHSA 1SY7A 3G5MA 3WGJA 1IK6A 2NUBA 5CFNA 2OB2A 3VSEA 2ACWA 4X92A 1ZKMA 4RF2A 1YJBA 3PGKA 4UMDA 1KSGA 1PJ4A 2X2PA 4I66A 3W90A 1T9KA 4RCZA 2GX6A 1PFKA 4OV6B 1T0IA 4D9NA 3JRXA 1TT5B 2ZYGA 5IBQA 1J7JA 3BHJA 4XJVA 4ZPXA 1U65A 3ETJA 3T3IA 1Y6FA 4IDFA 1LNQA 3UMFA 3R9XB 1LK5A 5HMLA 4YX9A 4MJXA 5EUCA 3PX7A 1P1BA 3NM6B 2Z3WA 4MR9B 4EGFA 2GLUA 1YV9A 1PBTA 2PLFA 2H1WA 1WW8A 2ASVA 1SELA 2WF5A 1LRKA 4DM4A 1BYUA 1VJGA 4UOZA 1OVGA 9ABPA 3A1CA 2PLWA 3QBDA 4MSUA 3CLTC 3RU9A 2X5XA 3SQDA 1A2OA 4N7MA 4AECA 4F21A 4TTSA 4QKQA 1HDCA 1L5QA 4IOMA 5E7IA 3Q6MA 3P4YA 2ZP1A 3P0EA 2JLYA 3HKBB 3RC1A 2O8BA 4FEAA 4CM7A 1HT2E 1H66A 3H75A 2O59A 1NKVA 2QPOA 4B6OA 1YMUA 1MAAA 1N0VC 2PV0A 4QQKA 2EHJA 2ZTUA 4A0FA 4D9MA 1K8RA 3RCBA 1ZZGA 2YZ2A 5BT8A 3PKIA 4DABA 3IVCA 3PNKA 1ZFNA 2ASEA 4TMTA 3G2QA 1SPBS 3AVTA 1S01A 2P79A 1VRVA 4OQMA 1WE2A 4D6XA 4RVGA 3RYIA 5JJLA 4EKIA 3WFJA 2VJPA 1Y9DA 1Q84A 2GF2A 3FFWA 4ADSG 2NZXA 4V3CA 5CYFA 3ZQJA 1J1UA 3CSSA 2QTHA 4Z9XA 2DTXA 2QN8A 1L7DA 1UZUA 2P0EA 3H4IA 3T3PB 4MS4B 3V2HA 4MHOA 1P3DA 5JCXA 1TRKA 4TV9F 3EPLA 3OKPA 1GVNB 4Y9SA 1QTIA 4AG6A 3QA9A 2J3MA 1PFWA 3OT4A 2C5LA 3KT8A 2LP4Y 4OATA 5AJZA 4YLEA 5F77A 1MC1A 2FWMX 1QNLA 5EINA 5D84A 3QLUA 2W4MA 1H0RA 1W36C 4CYMA 1INLA 3GGSA 1PGNA 1BMQA 1L5LA 3ZZNA 3CONA 2X5OA 1MLDA 1ZGJA 4NCAA 1UH5A 4GLBA 4O4JF 3FGOA 4DSTA 3RTEA 3VSAA 5CLFA 3LFUA 4XR9A 4RAOA 4G24A 3IPLA 2C96A 2L17A 2YZ7A 2ZB7A 3FDIA 2SBTA 3MNFA 5FBKA 3DDWA 3GB9A 2FR8A 2EW2A 5HQJA 3SMQA 1R0SA 2EL9A 4EPVA 5JJCA 1D2MA 1H2FA 1RI3A 3T34A 2H57A 4BUZA 3UT5B 5A6VA 4BQRA 2FFQA 4LY9A 4BTVA 5IAOA 1DS6A 1SCIA 2R4QA 4JI6B 3PGVA 3TX2A 1X38A 1ZD1A 5EIFA 4KXFB 2PJDA 1FJHA 2PWBA 2RGYA 4GQAA 4L50A 2ONCA 2H5JA 3AR6A 3CVVA 1K9VF 1QV9A 2COUA 4F4UA 3NP7A 2QRNA 2ZUEA 3DAOA 1JHRA 1LNZA 1E1CB 4CTJA 3KHSA 4EMUA 4M0MA 1M1NB 3AM3A 2YMQA 3NXKA 1PV1A 3GVIA 5LZ2A 2J4DA 5E6UB 1R00A 3SJZA 5ER6A 1QQTA 1T36B 2NUPA 5C8YB 1JXQA 5DN6D 3N75A 3U60B 2YJ5A 3ZDAA 1U3GA 1WY7A 3A3OA 1WDTA 4A1OA 1Q12A 1YIAA 3R0ZA 4HYYA 2JFFA 5C81A 1IQ0A 2H29A 1M8FA 2QZZA 2QTVA 3GXBA 3LCMA 4I3FA 1Z4OA 3OFND 1JQBA 2QW1A 4HGNA 5D5HA 5F64A 4CMJA 1BJTA 3OIFA 1SO8A 3HWWA 3LT1A 4JQYA 4D99A 1XTRA 1E9VA 1T5IA 3L7IA 4EBBA 3CRQA 3SLRA 4BVFA 3IRVA 4L78A 2G3YA 2CZCA 3IEMA 1AF7A 2CUZA 1Z68A 1PFYA 1OZ0A 1ZSYA 3C41J 4CQJA 2G5PA 1K7EB 1GGNA 2OCPA 2CMKA 3PXBA 3N7AA 4GOXA 4TS3A 1N2XA 1HMYA 2V54A 3H19A 4ZICA 3NTLA 2OENG 6AT1A 3MJDA 1CP2A 1JECA 5CFPA 3D2LA 3CIOA 4MYHA 3OCUA 3S27A 1MH1A 5DN9A 1SCUB 3BSSA 5FAKA 3DHEA 4D0RA 2OQVA 4R41A 3QV1A 4FBGA 3NHRA 4PG4A 1VHDA 2W43A 3NGMA 4XYBA 2NTYC 1V3VA 5F2OA 3RC3A 1ECLA 3U6KA 1JGTA 1TX4B 1VJ5A 2BEWB 1H6CA 2WYHA 2QJWA 2ZYVX 3DKKA 3MQ4A 1ADBA 1L4HA 3C15C 3PHJA 3MWDA 5EUQB 3ZHRA 5IBCA 2ZBVA 1SXQA 2H7YA 2RGGA 2VJDA 2WUGA 2Z5FA 3QXXA 2BUAA 1A69A 2ATVA 2AZDA 3AERB 4JR1A 3AONB 2ZAMA 1S2DA 1YR9A 2BN4A 5JAUA 1I7PA 3P4XA 2QSZA 5EOVA 3HL4A 2F9LA 3BQMB 3TNDA 1FC0A 4ZA2A 3UHJA 3JSXA 1DT5A 3LPNA 4FBLA 2WLTA 5CEEA 3E0XA 3GELA 5D7NA 4A6PA 5K0JA 5K0SA 1G2IA 1KQPA 3MERA 5LUAA 1LDNA 1UWKA 3WQBA 2O0KA 2X0EA 5AKZA 4ARSA 1Z0DA 5DH9A 1LI5A 3CH7A 2OD7A 4R1PA 2J3DA 4V02A 3EEBA 3RR2A 3ITKA 4B6SA 3MILA 4NNOA 1C1HA 1V5WA 3HVHA 3N5CA 4K6HA 5ALSA 2EJVA 3AIKA 5CYGA 4ZTUB 1N92A 2AYXA 3N8NA 4FJ1A 4Y1EA 1Y1RA 3WIUA 5C9ZA 3GRCA 4QTYA 4JLDA 2WFMA 2VK4A 1IE3A 2FAXA 2Z1MA 4B3XA 4KQ2A 3IEXA 4AY5A 4YRBA 2FUNB 1YDHA 3LP8A 4O5OA 5SZKB 3TTTA 2IPXA 2HY7A 1G6Q1 1F51E 3MT0A 5DMHA 2NTNA 1UIRA 1P62B 1B76A 2JHAA 2IZ5A 3CFYA 2RKWA 3RG8A 1E9FA 4A2WA 4MUNA 3A1VA 3W77A 2OV2A 5FX2A 3GX1A 1ECPA 2VJBA 1XQWA 1P4SA 3UM9A 1OLSB 1EDZA 2LGJA 1GV1A 3GN2A 1BGXT 1RPJA 2ZUDA 4CL2A 5TV2A 3P45A 2EBHX 4QDXA 4BBAA 5LBTA 1QDUA 4XYLA 4BO8A 1E61A 3ICPA 3OU2A 4JSRA 3TR6A 1PDWA 3W4IA 2ADMA 4DJAA 4TYNA 3LWZA 4TN1A 3A4TA 5IAAA 1NM5C 1CULC 1GU1A 2J9FA 2CXRA 1QCDA 5DXFA 2AHRA 3I30X 3MTEA 1JR4A 3GFQA 4CMKA 1W1WA 4FYVA 2F3TA 4BP8A 3A9SA 1JG6A 1Y7TA 4LE2A 1WTAA 4MWCA 3F1LA 2G1AA 2V45A 4DJEC 3FFBA 1PVVA 3ROGA 1ECFA 1KDYA 3I2IA 2BFPA 1XZMA 4MIKA 4U2FA 4M88A 4X5OA 5DFAA 4YAJA 3ADBA 1WAMA 3F6EX 2YJGA 3KZNA 1HL7A 3K0EA 4I1PA 1FNCA 5IS2A 4WOBA 2BFMA 1I51A 4HPJB 1Z5NA 4A8PA 1E2EA 4L2IB 4X64B 2PYIA 2IV2X 4XX0B 5I5EA 3D4IA 3LL4A 3UJNA 4R71A 2RJOA 5AVVA 3L4BA 4QO8A 1U2GA 2F1OA 4IV5A 1QVAA 4D9GA 5C2JB 4N0PA 1UMKA 2J4FA 4YFVA 4DDKA 4OP3A 5FCDA 5KB3A 1WLYA 3AUAA 4CZ2A 4E12A 2OAGA 3UJ3X 3PYMA 4UMEA 2YJ4A 4PC7A 4P7FA 1NN0A 4Z51A 1N0HA 4JI4B 1AQ6A 2Q3MA 3L7LA 3MCWA 4PQGA 4XGQA 4WWHA 3RUIA 1LJ8A 2B1GA 3GCGA 1TQ6A 3EBOA 2AA3A 1HE4A 3H0EA 4TRNA 3ZWYA 3UHFA 1GARA 4ZCTA 4JV5B 5KKCA 1FNBA 2BFAA 2R85A 4YIHA 4QOFA 1RBMA 1XXHB 2O7QA 5AMXA 5JV5A 4DY6A 5KJCA 2VH1A 1NI3A 2WWWA 3NWJA 5CTAA 1QZ3A 2VKTA 3HRKA 2WJZB 1U2ZA 1V7QA 2CF5A 2BCJQ 1JYEA 1XAHA 1YZTA 2DHRA 2I1QA 2ZQYA 4HKTA 4B6PA 2OHOA 1ISPA 2NN3C 2WR8A 3EDMA 2WWRA 3FVWA 1QYDA 4XWGA 1VL6A 4UVDA 3B7WA 4D6YA 4WI1A 1P7PA 5FJJA 2PX8A 2PMKA 3D0QA 2NAPA 2QLFA 4DBZA 2UXCB 4ARZB 1PVDA 1S8AA 3MAJA 4H7EA 4MUKA 5BYKA 1ZD8A 4ZOLF 1T4BA 3MT7A 3HUFA 2NYVA 1IXSB 5F35A 2BTEA 3S55A 3W1WA 3JRWA 1KMCA 5EKSA 2VRNA 4CT4B 4YMLA 5GQSA 4DG9A 3THRA 2QLLA 1US8B 1W48A 2RCYA 4GFDA 4PC1A 4JQCA 4Q34A 2EX4A 3ELUA 2NU8B 4EEZA 2XCSB 1N7JA 3A4YA 4C4AA 2DY0A 8ATCA 1BFKA 4BGUA 4M0DA 3V32A 4CFSA 3T3MB 1NDQA 5F12A 2J0VA 3SSAA 5FV7A 3E7FA 3G6KA 3CWQA 2D1FA 521PA 3TQTA 4ITUA 3OQIA 2WTUA 4Z7OB 3GZNA 1Q0PA 1J49A 2YHAA 5H81A 4F9GA 4FFBB 1KAOA 2H9YA 2PT5A 3O8NA 4NOLA 2PKQP 1A5SB 4MLDA 2J3JA 4MKXA 3HJBA 1O95C 4P58A 4QFCA 3BTUA 5DTQA 3IAXA 3UHOA 2I2WA 2IIQA 4EIWA 3BGOS 1RJGA 1C4XA 3I12A 2AI2A 4ZOEA 1L7PA 3NTUA 3TQOA 3ZE0B 1I94B 3CTMA 1B23P 1QYCA 2JAPA 1RQRA 3HK2A 3SHFA 2R5WA 4ZCRA 1FUUA 1I4WA 4YH1A 1SXPA 1N6NA 1P5ZB 5CNIA 1KI6B 1SKYE 5LA6F 1DUSA 4V0OA 2JA1A 1I3KA 1NUAA 3FXAA 3PC3A 5J5AA 2A0WA 1DJLA 1WQ1R 1VHTA 3IAUA 4P35A 3MVEA 1Y82A 3ABRB 5DHTA 3G89A 3QEAZ 2PWAA 4F4DA 5G0WA 4D3ZA 2EW8A 3AKDA 2PX4A 5JG7A 3QLVA 2PBFA 1XQ1A 1AY0A 1VL8A 1D2CA 2F67A 4BTEA 5BMOA 3CEJA 1M7BA 2Q29A 4OM7A 3FLAA 4KLRA 4QUHA 3TW0A 1XN4A 4A8HA 4KITB 1P7ZA 3O8BA 3WLFA 4C0AC 3D8NA 3WB2A 3M1IA 2ATCA 4KK3A 1KEZA 1RKUA 2X4IA 1YRLA 2IYXA 2ZBPA 4Q6WA 4PX3A 1TZKA 2GJ8A 3IVXA 2HFKA 1UMDB 2RC5A 3CG4A 2H9IA 4BFTA 3EVAA 3SBOA 1WUKS 1ZW6A 3GLGE 1Z38A 2PX0A 4QU9A 5JI3E 4BJ3A 2UYYA 3KQNA 1XZBA 1YVUA 4JBNA 3O95A 3W4JA 3X1XA 4OLHA 4CCWA 1ZD3A 1H42A 2C7BA 4ILKA 5EFOA 2ORED 4KIJA 5AICA 1R9NA 5ALXA 5LUBA 3KFVA 4H6VA 5ER9A 4A27A 4ZI7F 5FTMA 2BGGA 1NATA 1BOOA 3OWOA 4ARCA 1W0CA 2J07A 3QBEA 4B4VA 5A5DA 4RPGA 3L8YA 1FSGA 4FR0A 5TT0A 3W2GA 1MR3F 1L7EA 5FHQA 1QS0B 3GOQA 3O21A 1CFJA 4QO7A 1HWYA 2X42A 3QIAA 4JVMA 2CCJA 4R1LA 1TF2A 2ODEA 5FO1A 1OB5A 1GL7A 2H6EA 1FJGB 2VYND 2YFKA 1AKQA 3CLHA 3HO6A 1O9GA 2DCUA 4O8CA 3V1KA 5JR3A 5IJZA 1S89A 1X7WB 3DQQA 1DTWA 4QNMA 1IH8A 2QMYA 3D3WA 2AKYA 3ESRA 3RIMA 1KPIA 1ZA1A 3WSVA 4E5NA 1B2RA 2H9AA 3L1IA 3NGXA 2NQ2C 1ZP6A 4H3HB 1G63A 1SCAA 1VMIA 2HSGA 3AFIA 4KGXA 4US1R 4RIFA 4E46A 3DMTC 2XF8A 4YJHA 2POQX 5ENVA 2C2YA 2PA0A 1L5MA 1Z4JA 1C3OA 4GWLA 3GJZA 4ND8A 4YBZA 5FBVB 3F1KA 1AKYA 3H2GA 3U3OA 4FB5A 4M54A 4OLBA 2H4FA 4PYRA 1QG2A 4W5OA 2J9ZB 1FUKA 4OUDB 4YMWA 3VNAA 5TQJA 2WJWA 3TM5A 2CLHB 5CJJA 1MUUA 3EB9A 3IUBA 3T1VA 3Q7RA 4AN1A 4V0KA 4Z8YA 1JIJA 3NW9A 2VOEA 1HEYA 3QOWA 5E6RB 4RHCA 1OYWA 4DOMA 4F1WA 4JBIA 4M0EA 1JHDA 4OB7A 1G21B 2YH2A 3NHUA 3X1JA 4HUQA 1GV0A 2X23A 4HS9A 2ZREA 2GFQA 5H02A 4ES6A 2Q1WA 2YBEA 4ZGWA 1TQ8A 4URVR 5JYBA 1RQGA 1C9DB 3FNFA 4JT9A 4KN6A 2W6ID 1AXEA 2GAJA 3OZFA 5DGCA 2PS3A 5DNEA 4Z4QA 2V7XA 3D7KA 1SU4A 2V9CA 2J59A 1UDCA 2J3EA 3UJ6A 3WGOA 4D96A 4LGVA 5J2TF 1Q74A 3GLHB 3SF8B 3P4UA 1D6SA 2QMHA 3INGA 2IOHA 1O5IA 3Q3GE 4BLRA 1H4SA 2PZGA 1NRWA 1SCNE 1BX3A 2Q2VA 3F71A 3OZBA 4OHBA 4MARA 3OJFA 4CFZA 1AKEA 1SBTA 2G1KA 1PZFA 2PSDA 2GUGA 4WRRA 2GI4A 2XCQA 3EPPA 3MOSA 1GTVA 4PO9A 4LK2A 2EU8A 4ENUA 5KJFA 1QTQA 2YY6A 1KTIA 2R00C 4KXYA 3P9NA 5F4ZA 2ZUVA 3P9IA 3KOYA 2ONJA 1H85A 3AU9A 3DKPA 1JKXA 4NMWA 5G41A 1RMQA 5LMNB 2FOLA 2CLOB 1I14A 1G3QA 4J4BA 2CB9A 4Z4FA 2RB5A 2ZSEA 1J42A 3OWXA 4RJJA 4TSFA 3EOBI 2NPFA 4K2HA 2K4MA 3RW9A 1ZPDA 1PSWA 3TI7A 3U9SA 5A5GA 5ENZA 2PD3A 2VWGA 2YHIA 3FCUB 3HCAA 4PQRA 1SULA 1NZDA 1E4VA 1Z6YA 3C3DA 3PHHA 3ZY6A 4B4KA 3DJYA 1L2TA 3QSYA 1RYNA 3V97A 2C0PA 1M6NA 3BZBA 4KZPA 3IAM1 4UHEA 4ARAA 2I7TA 2P65A 3GPBA 5DNAA 4C6TA 4QULA 1RMTA 1XDWA 2B4AA 1M6VA 4DUPA 4MPRA 3UUGA 4WCFA 5EEHA 1NG1A 2ZR9A 1V1MA 3E7DA 1YC5A 3OE7D 1AUOA 1YCHA 3A9TA 1SH7A 3GRYA 4EJSC 5E4TA 4Z0TA 3ED1A 3QYFA 1IHXA 1U8YA 3MHTA 1P5HA 2NU9A 2HNBA 3SYRA 4B3DA 1GGEA 4ZKDA 1WZ2A 2V7QD 3HR4A 1UL1X 5DBFA 4AK9A 2H1LA 3DBVO 4PHGA 2H06A 1CE8B 4X6YA 2HQBA 1UBNA 4ZJPA 3EF3A 4P3KA 4NH0A 3HYSA 4R81A 4KBGA 5KTOA 2N1BA 4G5QA 3EYWA 4BCCA 2BE9A 1YRQA 2Y1LA 3BN3A 3E03A 1LI7A 3C4QA 3FPFA 3HKEA 3I1JA 2ZJ5A 4MWSA 1B41A 2C9OA 3MJCA 1AS3A 3CV3A 3MJVA 1PG0A 1MB2A 4JLJA 2BSAA 3K9QO 3G9QA 5EJ9A 4B8WA 5JPDA 1UDWA 4PIMA 4TLEA 4D44A 1UBHS 1RC0A 4Z8XA 2J9YB 4GI2A 1CQPA 1MMFB 3EWIA 3N1UA 4K6MA 3RC8A 1EX1A 5FNVF 4F9FA 2CXUA 2IZ7A 3I2KA 2WLSA 1PF7E 3UFXA 2YV1A 3N5KA 4XWKA 4TL9A 4M0UA 4RKWA 4NRDA 4CQMA 4IIJF 2HRZA 4IGIA 5FPTA 2R3SA 1C14A 1NY6A 1CNMA 2EDCA 2LTAA 3Q7IA 1ECJA 3DQPA 3L7CA 3JAKA 2BELA 4AZ3B 2FZ5A 2B37A 3ZIUA 1NJ1A 2PKQO 2XVAA 1GUYA 3I5AA 3RYFA 3K9HA 3L0SA 4X62B 3VDMA 4TVBA 1W4AA 2SICE 4K86A 2IVZA 2VAPA 3KXIA 1PN3A 2PXHA 2XDQA 3C1AA 4G9BA 3TJMA 4B8ZA 5ALTA 3JARA 4DLTA 1AXGA 1QHHB 3DB1A 4JP1A 3CSUA 2MSEB 4XFDA 1ZR2A 4OSEA 3W05A 3BMCA 4LXYA 2F8SA 3L4JA 1JVBA 2H1VA 3NBMA 6GPBA 5GM2A 2A7XA 3FMVA 3ONVA 3VV2A 2QG9A 5IAJA 3WRVA 1DC7A 1CBUA 1DWOA 1V5GA 3LUDA 4NCBA 4XEUA 1GG9A 2O0HA 3L0PA 5K0FA 2JLRA 3ZDZB 2AFIB 2JGMA 3F78A 2Q5OA 2D74A 3HFJA 3QU7A 5FNZA 4N65A 3OLQA 4E22A 4E5MA 2IH5A 3VKHA 4K9NA 5BY2A 3NWEA 2OC9A 2WTEA 3HSKA 2ZUTA 4OBWA 4D82A 4DDVA 3E84A 4PTZA 3PR2B 5JWHA 4ZO6A 1GTJ1 1EGHA 3HEMA 4NBVA 5JRJA 5K8VA 1NSTA 5AVJA 2HZBA 5DVZA 4JFAA 3WGKA 4JUAA 4DMKA 3VPDA 1Q0ZA 2NT3A 3V48A 1G8MA 3A3PA 3F97A 4HZUA 3R7WB 1RZRD 2E5FA 3R75A 4BPBA 2I1LA 1IB6A 3SQMA 1CC1S 4W8HA 2ZAOA 3WYGA 2CXQA 1IU9A 1JSZA 1E66A 5EJ2A 4CM8A 1M34B 1FMJA 3N3BC 3MTBA 2R1TA 2NZ8A 3OFJA 1GQRA 1YI0A 3ZHBA 1GKIA 2ZXFA 4OQNA 4BNWA 1ODCA 1MAUA 5H59A 4BYMA 3ZDQA 3IUPA 3KTFA 2YXLA 4OJKA 3I34X 2J8ZA 1XZGA 5CH5A 1UCFA 3CX3A 2Q9CA 4G3XA 4YO8A 3VU8A 4MI1A 3PL1A 1R0RE 1XTKA 5EWLB 1PWZA 4KN8A 2VJMA 2QF7A 4U9UA 2UYOA 3E70C 3BRSA 1YKFA 1GZSA 1NTRA 1ZD5A 4ZYYA 1XAIA 2CJPA 3GIWA 3PTZA 3EQZA 2ZR7A 3Q41A 1SKMA 4LAFA 5DJ5A 1QIIA 4PY2A 2XUZA 4Y9DA 2IYSA 3LKZA 4GXTA 5HKLA 4U02A 2HWUA 3NUQA 5TE9A 4N41A 3PDUA 4NOKA 4MO2A 4LOHA 1PQWA 2PT9A 4ECEA 4DDTA 2EWMA 1JDUA 2HT6A 2C59A 3IKLA 1LBEA 3OEED 4BEBA 1ZOPA 2BM8A 1N8KA 1R0BA 5IT5A 4KQMA 2E0IA 1HDIA 4I55F 2OXIA 2QYSA 4IBOA 1EFDN 1BVYF 3LT5A 3NJ4A 1GQYA 1RXSA 1SURA 4FT4A 2ZM5A 3DXYA 3HN6A 2G76A 4GZ3A 2YCBA 2YBDA 3HEBA 4X71A 1USUA 1X7ZB 4MP8A 2G1PA 3KB2A 4E03A 1EH5A 3AK4A 4KQFA 4ME6A 2IQIA 1A1SA 2FPIB 2W8ZA 3H2SA 1BDBA 4P3XA 3DEIA 2F3UA 3OZSA 3OTQA 4NFSA 4ZHSA 5AXBA 4BFZA 4KHZA 3O26A 4U7GA 2I2XB 4ZT3A 2E82A 4DARA 4ER0A 5IH7A 1JF8A 1KOGA 1CUCA 1EQ2A 1V5IA 1YCFA 3LBFA 2MJLA 5J9FA 2PUBA 1ZC3A 4FMCB 5JJ5A 4HLCA 1C2YA 1Y4ZA 1P74A 1FMTA 3F6RA 2AHOA 4B2PA 1G64A 3VH3A 3W9BA 3AHGA 1IZ8A 4MCJA 3LO5A 5HQTA 1JHVA 1Q16A 2HO5A 1X1SA 3FSGD 3DZHA 4CDRA 4HEJA 4DEVA 1QP7A 2IDZA 4QECA 3QP9A 3EWSA 3K7EA 1RE1A 2ADOA 1I4LD 1XMJA 2WYOA 4HNHA 1MRZA 4IKOA 4X8OA 2WSBA 3EXHB 4NCKA 3KLNA 1K6MA 4IIYA 4KLNA 5FL7D 1J70A 2F7SA 4JJ4A 4RKQA 5F4BA 2RE8A 3VMMA 3M3PA 4L5AA 1ZXLA 1IK4A 3DEKA 1KDTA 3EGDB 3K2EA 3SIPA 3ADCA 2Y66A 3VHLB 2YIDA 3AUTA 4ND6A 4L6CA 4YRRA 5A4FS 2DWQA 4BB6A 2DHQA 4KE9A 4LBYA 4UEQA 5KX5A 5L45A 1LJLA 1SRQA 2CL7X 3GJXC 3GGPA 4LNUA 2NZ2A 3CF4A 4X1KA 5ADWA 2A84A 4X3CA 4JEMA 5TQVA 4BQSA 4CI0B 2C5BA 4X00A 3G8YA 3PZBA 3HBNA 4IMPA 4JROA 5CNMA 1Z26A 5TPWB 1LV7A 4CLRA 3MYRA 4TWRA 5HW0A 5G3YA 5B55A 4PYNA 1Z7BA 3E18A 2XT6A 2WFLB 3HI4A 4PZAA 4BWYA 2ZE6A 4WY2A 2Z5VA 3LUFA 4PR0A 4NZZA 4BFSA 3K9CA 1PNTA 4ND7A 2W42A 1GPYA 4EA8A 4KSYA 4BMSA 1V7ZA 4A0HA 4KK4A 2FPGB 4JJGA 1TL7C 1XMVA 3EZ7A 3PS9A 3TD2A 3X1WA 1B8UA 1QGED 2AXPA 3K71B 5LD2C 1NUPA 4EY7A 3PJRA 1H4TA 3UY4A 3PIRA 1JQLB 1FXWA 1KZHA 4QBFA 4YMGA 1ZX1A 4LXTA 4YNBA 4P32A 5A0TA 4RJ2A 4O6VA 4ISCA 5ULLA 4KI7A 1ZBDA 4MKZA 1IG0A 4ER5A 3V4LA 5CIYA 1Y4SA 4OA8A 4DV7B 5L4NA 4FWIB 1GUBA 3ZX5A 2Q5IA 3CR8A 3DL0A 3ECSA 2X0NA 3O8OA 1AB6A 1H2BA 4M0CA 4ENWA 5BURA 5HM8A 1A9OA 1PNOA 2X86A 2IH4A 3T1TA 1L4LA 1AGNA 5A7FA 5MN6A 1Y8RA 3JASB 1JHQA 3DOOA 4H35A 1ZIOA 4DZTA 5J23A 4XQ0A 3KTOA 1PJBA 4DPLA 3RYCA 3JQRA 1AD2A 4YMIA 4QBGB 3OFKA 5BV2P 3O9MA 5KYXA 2XUPA 3OQPA 2FG5A 4KVAA 1P81A 4JYPA 4OMCA 1DRVA 2WJ6A 1HR0B 1KK3A 2HCTA 5DEOA 3HV2A 1FFEA 2P41A 1N1EA 1W47A 1X42A 4KIWA 3EQ8A 4IEFB 2FW1A 3W5JA 2Y1GA 5BRJA 1P0QA 1FP2A 2REOA 3KVYA 3NJ8A 3EBLA 1KIMA 1IDOA 1N7HA 4R1SA 3C3EA 5KZMB 3C2QA 2B8TA 4IG4A 1WUTA 4HTFB 2HPZA 1Z8FA 1GZHB 1OIXA 4Q4JB 4KR7A 1UWCA 1GDHA 3CH6A 4RGQA 4RELA 1A04A 3EVEA 5B53A 3RD5A 2F43B 1AV7A 4JL8A 1ESEA 2BFBA 3U7IA 5AHRA 3UJ9A 3FOZA 1C4WA 5BQ5A 3HP4A 3F5QA 4MVJH 5BNIA 2LXNA 3O90A 1ZUNB 3P2JA 1Q11A 1CR1A 3QLEA 1I3MA 1VQ1A 2ORYA 1SA0A 2WIGA 3II6X 1E1KA 2GRJA 3BUSA 4FGZA 4GXRA 5FOQA 3OJWA 1Y6QA 1KDRA 4XFJA 1LX6A 4BBPA 2XB2A 3LOQA 1GAJA 4XWAA 5JXHA 1T0PA 2FWPA 2B69A 2GCGA 1JTVA 3C4VA 2VYQA 4JB2A 4Z7JA 3U3RA 4E1BA 2MINB 2VZLA 3D1LA 2VTBB 1KNXA 1GILA 4LQDA 2GK6A 1RJEA 2NZYA 3DLIA 4X63A 1X6VA 3ZGOA 5K6TA 3ZHZA 3ZNNA 4KNVA 1VMDA 1A8HA 5HGJA 2IYTA 4OQLA 1PFVA 4KIGA 3JXEA 1QCZA 4FYWA 3QY0A 2GZMA 2XVXA 3AI3A 2X1VA 2FJPA 5ALKA 1ONPA 2C2XA 1XHEA 1DGQA 4HQNA 3U31A 3D1VA 1ML3A 4ZK6A 2YWRA 4B9AA 2DB3A 3JZFA 3L07A 1JKIA 2YY5A 1ISMA 4Y2GA 4J0JA 3LLUA 5EG5A 3RS7A 1DC6A 3D3NA 2VATA 4HWKA 4UBMA 5INTA 3AIOA 5BW6B 3ESYA 1W581 5DT2A 2YW9A 1M2GA 4EYEA 2PS1A 2VPXA 4U63A 3U5TA 2Z6QA 2YQ4A 2GS9A 4X1OA 1PU2A 2CLKB 2ZJ3A 3A7EA 4US2R 2R6DA 1Y3HA 3T7KA 5KPDA 3AUFA 4B6GA 4URWR 3JR3A 3PB3A 1ONSA 2R6R1 2H11A 1YR6A 2XAAA 4NWIA 3EVBA 3DLBA 5ES4B 3L79A 4ZD6A 4I4CA 3SHVA 4BIMA 5K3SA 4WJLA 1MIOA 2JFUA 3KKZA 4WZBE 5M7EA 3CG0A 3WGQA 2SKDA 2BMJA 4ZREA 1N75A 5IAKA 1RQXA 5LOVF 3UGQA 3LXUX 3R9WA 5CA1F 3BE8A 1EVKA 2HNAA 5KOYA 3W6PA 4G4GA 2B3DA 2GNAA 3VPAA 4PLCA 1N7GA 4GOKA 4FYJA 2XB4A 2UU9B 3FJ1A 3L8CA 1G66A 2YFHA 1A4IA 3BE5A 3CRW1 3N39C 1CJCA 2GEBA 1ZNQO 2O8EA 4KFSA 3IB6A 4O59O 4MW4A 4Q16A 2XZOA 2OFPA 3KZOA 1Z0JA 4OQZA 2O20A 3HYCA 1Z4IA 4P22A 1V9LA 4A6EA 5BOSB 5JZSA 3VNVA 1RWKA 4L4RA 3G8DA 4GWKA 4YO7A 1WXGA 1ZJJA 1GRNA 3ZLJA 4Y6LA 2R7LA 5CA0A 1JTFA 4JI8B 4BFVA 3OHSX 3OZIA 5BSEA 1ZVJA 4ZYLA 1BWRA 4RFSA 5C32A 2Y92A 3K16A 4KVGA 1ISHA 2HHLA 2XODA 3NCTA 4LRYA 4WZAE 4MYRA 1C0PA 5BWMA 1RM5A 2JKZA 2E1RA 2QAIA 2WHXA 2JGFA 5LWHA 3K92A 1U0FA 3MMXA 4WKCA 4MZXA 1ESNA 2ZU0C 4MULA 5ED4A 3LRXA 4HATA 3IDFA 5B36A 3RREA 3BGIA 1KAQA 1M8GA 1H6DA 1T43A 3STYA 2DETA 3QXCA 1K98A 2WNSA 3TOZA 3D5QA 4JLMA 4ND4A 2P2YA 2EKLA 3U7GA 1CCWA 3LPMA 3V4VB 2UUAB 1XDUA 4S1VA 3SXPA 3GN1A 1FUYB 1NR5A 1VJ1A 2I2CA 4KDEA 5JRDS 1J0AA 4R84A 3TEJA 4QTXA 4C6SA 1VL5A 4YRPA 3HCFA 3QE0A 3ZWBA 3IILA 2J85A 4FYYA 1WZNA 3VYTB 2N42A 1RYHA 2ZDQA 3OLYA 4WV3A 5LLTA 1MJGM 1ZMRA 2JC3A 3HY4A 1JG2A 1PZEA 1TK3A 1USIA 1Z88A 1ADFA 2AVNA 3AXSA 2ZUWA 4FDMA 5H7XA 5TMDA 3W6NA 1XTTA 3B82A 2VBGA 3ZY2A 2WIJA 4CTMA 2R11A 5KOHB 5MFPA 4Q7KA 3MK31 16PKA 1TLTA 3OQOA 3A8TA 4IMRA 2NADA 3WGIA 1U2RA 2DVMA 4Y0AA 4C7KA 5AVXA 5K8JB 3H9JA 4PPNA 2BISA 3C6MA 4FR5A 3S6JA 1KY2A 3PDWA 5EE0A 3WDSA 5AO9A 5CB4A 3F2IA 1E2HA 5IEJA 1L1EA 4Y1FA 3GRKA 1DTEA 1R37A 5AUPB 1NC3A 2GN4A 3V4SA 1HDZA 2QN1A 2QTMA 2IP2A 2BGKA 2DULA 3DKVA 4UUOA 3DZ8A 3QJGA 2CZQA 3Q5DA 1UBTS 4PFJA 1UQTA 1YS9A 3G1TA 1Q3HA 4IR7A 4UTPA 1NNLA 2F2TA 1YIOA 2EJTA 5DKFA 3CHYA 3NRBA 3P2OA 5KYTA 4TXHA 2KB0A 5LQRA 3MMSA 2QMOA 1NVKA 3UG6A 3WNCA 1UFRA 3E9YA 4RLSA 4N0QA 2FMKA 4WTOA 1JFSA 4FNGA 3BMQB 3ZN2A 1OHHD 1U2GC 3UKOA 1SXGA 2VJKA 3WNVA 1GGMA 2WM3A 2SKCA 4ZCSA 1V26A 2WC1A 1EXMA 2WU0A 4WY5A 4LCBA 2UUCB 3LUPA 2MDTA 4H7FA 2ZVQX 2ZWMA 4A03A 3C6QA 3MUFA 2V8OA 3WGYA 4E08A 1DJOA 1Z2OX 2GN8A 2WSMA 1DBRA 4IUBS 5SZHB 5BMVA 1GA4A 4D5EA 1ZGCA 5HM6A 1FY2A 3R3XA 4Q3AA 4YV7A 3QITA 2UKDA 4CM4A 4ASUA 5I48A 4A26A 3KEOA 3HZRA 3QFCA 4HOYA 1EK6A 5C4GB 2ET6A 3NG1A 5IASA 2HXGA 2VTDA 3DONA 2I33A 3A4IA 4OXIA 4LGMA 2OXTA 4OI4A 3HKCA 4E88A 2FRVA 1OLUA 4J90A 1OU4A 1QYRA 3UWPA 3E5MA 3VU1A 4QGAA 3TLGA 3RGWS 2FYTA 3ME5A 2TMKA 5J4LA 1S9DA 1X7YB 3NBKA 3QUQA 2R68A 2WIBA 3GZ4A 4HK4A 4UEJA 4UZSA 2HDOA 2DECA 3AR8A 4LDZA 2YASA 1PQPA 1PT7A 4Y1RB 5BSFA 1JIQA 1G4AE 4UXIA 1HFKA 4JUDX 2NVUB 2OGSA 3UBMA 4Q4AA 3D8RA 3FNRA 2B4YA 4NLLA 4FJ2A 4BMZA 4P81A 1HQCA 1SQ0A 1L3BA 2R4TA 4OGFA 4ZCLA 4LBZA 2ZQZA 5LQJA 3EVGA 1PQUA 3FNIA 3C8HA 3DDZX 5IJWA 3DWIA 2YRFA 3HVJA 1P0FA 3EVZA 1I9CA 1UC4B 1YAJA 4AC9A 3UOAB 1GNVA 2WIKA 4BEWA 3NTRA 3QVLA 3B1YA 3DTNA 3P8ZA 1G6HA 4J43A 1B0ZA 2CE2X 1RXIA 1NLFA 4H1UA 1CRWG 4C7OA 1XVLA 1WUHS 1GNRA 3ZW8A 1NXSA 4CTNA 3OIDA 2JGNA 1K5GA 2AI1A 4ZI3A 4AY3A 5TMPA 1BS1A 3D43A 4NU0A 2X8LA 3F5SA 3EMDA 3WBBA 2B92A 2VPYA 5CXSA 4KX3A 5KREA 3UUWA 3IE1A 1NQTA 1QRRA 2HHJA 3C14C 2OZLA 4LWPA 5DI9A 2AD1A 2WSLA 1OR8A 1U7TA 1AA6A 3H6GA 5F5NA 1RLIA 5ELMA 5AW2A 2FJ0A 2XZLA 1UK6A 5KVCA 3GFSA 3OA0A 1UEIA 5KDLA 3KSRA 4JUIA 3SXUA 5E4YA 1TKRA 1R16A 1XTPA 3C8MA 3DTYA 4TXNA 3RQSA 1QHYA 4CR6A 4FCWA 4DNOA 2F3SA 4YJ3F 4KFRA 4PQFA 2D3WA 1SXJD 4OGLA 2WAYA 4WLEA 2OHJA 3V6LA 2PZMA 3KZKA 1EJ2A 1G0OA 1XAJA 2IEIA 1O58A 1FK8A 1T9GS 2AOUB 3W5AA 1LSJA 1POXA 4K3VA 4QOHA 1G8PA 2ZS9A 3Q8WA 3MB5A 5I9TA 9GPBA 2HJVA 2ZWVA 2OZKA 3HCBA 3WK5A 5JAHA 1NI4A 1N2CB 4AX4A 2GRUA 3W3AD 4RSGA 5IZCA 3ZD7A 2H92A 1WBBA 3ETGA 3BMOA 4TKZA 5J4YA 1UPCA 3KUUA 3UHAA 1PGQA 1W75A 4GPZA 4E6EA 2A4KA 1V1RA 2FK8A 2XH8A 2EIHA 2QLJA 1JNXX 3KSUA 1FYXA 3L8EA 1ODTC 4RD2A 4X84A 3ZK8A 2ZBRA 2VK8A 4Z7NB 1QR2A 5DP2A 5A0FA 3TNLA 2OUIA 2WU4A 5AVZA 4CODB 2IS1A 1Y4UA 5JNSA 4WCDA 4YJGA 4EB8A 3N2KB 3TRKA 3BC1A 2OCDA 3BEDA 3KOUA 2JJMA 5JO9A 3UJHA 5KU1A 4RCVA 1XZAA 3EA5A 1DRWA 1NXTA 2PKXA 5LP6A 4LV5B 3JW8A 3THWA 1HT3A 2JCYA 4MNTA 1K0FA 2HJSA 4QU5A 2LVBA 2Z8YM 2GHQA 4NZOA 3ZWPA 1GCAA 4X97A 1TYAE 1N9KA 5A2QA 1HYGA 1H65A 1TD9A 4E94A 3QF4B 5JH7B 4PICA 2ODTX 3CE6A 2IXAA 3ZVLA 3NBUA 1QIMA 2ZYHA 3WYCA 3U0BA 4FCVA 1GR0A 1VMKA 3LCJA 3VR1A 2GYWA 2P5TB 1Y5NA 2Q1TA 1LUAA 3RVRA 2X6TA 3GRAA 2IEZA 2XD4A 1SWVA 2OZVA 5KSYA 1G0NA 4MGIR 3GQVA 3Q12A 1Z29A 1OTYA 1QVRA 2V0NA 4H27A 4HN4B 1DO0A 1YFZA 3BBLA 4AU1A 4D5GA 4IKEA 4KWEA 4RZXA 2EEPA 3IDSA 3QEOA 4E4TA 1C1XB 1DX4A 1JEDA 2X0JA 4LRUA 4MVWA 3R74A 3W9SA 2HT1A 3RVPA 5GZ1A 3I62A 1KYQA 1DIAA 3MUEA 2A5LA 2NUTA 2XLCA 3SFZA 3TQCA 3EIHA 4C76A 2JLWA 3EMBA 3IYLW 4R05A 1RCFA 5EWMA 3HYLA 4PYLA 3EEYA 5AM5A 3ZXSA 1CRZA 3F8WA 3NCHA 2IXTA 4AKIA 4ZVNA 3NIDB 5ENDA 4FI3C 1X0XA 4QXMA 2PLAA 1M0SA 1XHLA 2EJCA 4E70A 3A0RB 4GYJA 1AOXA 2ZWIA 3KOMA 1KVSA 1T2EA 2ZJBA 3W8NA 5J63A 4L4UA 1JFTA 1NJ2A 4LRWA 3BGDA 4CJXA 2PTGA 4M8NE 5HZKA 4EFMA 4NFLA 4IDAA 4RTKA 1ZN7A 4U0JA 3DAPA 2WA1A 3FPCA 5IJ9A 4LVCA 5M29A 3JZDA 1P2TA 2UYCA 1FA9A 1DRKA 4OHPA 3I1FA 2G9NA 1NHWA 1WCWA 5ECWA 2ZSFA 4Y0NA 3FPAA 2GPBA 1IBRA 4KEAA 3ZU5A 1EK1A 2VDVE 1E2NA 4CKZA 4OQQA 4WD3A 4ZYVA 4IWNA 1P80A 1J5PA 4PS1A 2FX3A 1BWQA 4TTJA 2RHTA 3P0JA 3MG9A 3QVVA 1NX6A 3NUGA 3GHYA 4MWEA 4MS1A 4ESHA 3K6SA 3I37X 3HRHA 4IQ0A 5BW5A 2IYQA 4DBLC 4MWZA 6PFKA 2PUFA 3PG5A 1NVVQ 2XWSA 4TS9A 4OX9B 1W30A 1RLJA 5BV1A 2YZKA 1M3SA 1RMYA 1KR5A 3D02A 2C9CA 1YB6A 4NECA 1K27A 1IN4A 1E2PA 2O6LA 1J8DA 2P3OA 3F9CA 3R3HA 2DQZA 5CX4A 1NT2A 3DE2X 1P6UA 1KJNA 1VYTA 5JXGA 4HGPA 2CVHA 1G55A 2J30A 3KYDB 2GASA 2XMDA 1ZS9A 4XCVA 4V0LA 5FJIA 4HGQA 2VJQA 2RK3A 3IXMA 4NONA 4FN4A 3OI7A 5J4HA 2CB0A 4EHIA 4LCEA 4L8FA 3WY9A 1AH2A 2VT7A 4R8RA 1T1EA 1FFAA 1W46A 4WCFC 5TMEA 4CDGA 5KWJA 3RSLA 1KQGA 3WB1A 4QYIA 4KWCA 4UNSA 3U3MA 3GLFB 4ETNA 4M7RA 2IU0A 1KAHA 2IW3A 1NR1A 3DLCA 3EIQA 4WEQA 1ABBA 2VTKA 1ZESA 3UJ8A 2BCGY 3UBTA 1NVGA 1R0ZA 4ZQGA 5DHQA 1BEZA 1P2DA 5LYYA 4EG4A 2ZBEA 3IV7A 4F5ZA 3M49A 1EXNA 1P31A 3JQ8A 3R24A 4RD0A 2D7CA 1KPGA 3LFTA 4FPXA 4BO5A 3ZY4A 2UVPA 2OLKA 3ELWA 4MUGA 1C3XA 3BTVA 3CN7A 3ER6A 4OHUA 1FQJA 1YZYA 3DKRA 3X0DA 5JJKA 4EX7A 4AW9A 4L73A 4ER6A 1KSHA 2WABA 4AO6A 4PYOA 4IFTA 1COWD 3IAAA 3OC0A 3VKUA 3PK0A 1BVRA 2C4MA 2KM1A 3OSZA 3OWHA 4HXFB 4TUYB 5CFLA 3HNRA 4PGMA 2P9TA 3I6QA 4QPDA 4XJTA 3QU4A 5DN6A 4BNTA 2D7DA 1XDZA 2R60A 5CVVA 2D5CA 3IOBA 3EMKA 3L02A 3GUHA 3PI7A 2JCVA 4E7OA 4KDCA 4REQB 4TYMA 5AIBA 3GJ7A 2IV3A 3OFNA 3GD7A 4CR7A 3ABSB 4A6DA 1JALA 1QVZA 4E5KA 1FL9A 1ZVVA 2Z57A 1SCDA 1XEFA 2XGJA 1EM8B 4MAMA 3S40A 4L5IA 3PWTA 3V7YA 5BP7A 5JC8A 1OLXB 2VHVA 1U2DC 4A1FA 5M3BA 3PFIA 4CV3A 2XUGA 5JHHB 3NETA 2O4UX 4HZIA 2I6TA 5ADHA 1RYDA 2VP9A 1YOVB 4X1YA 5B57C 1LPAB 3I04A 3ORHA 3WXBA 2AXEA 3DWGA 4CMBA 4NDNE 1NBMD 4J2OA 3FI9A 4AROA 1C8KA 3X2FA 3AETA 4XB6B 2LKCA 1QONA 2D0DA 2K5UA 3E7XA 1NQUA 4G8CA 3ZGYA 4DNXA 3HXQA 4Q3NA 4J49A 1U0JA 2PKYX 5E6SB 2B4TO 4ZOBA 1JR3E 1NW5A 4D4HA 3B9QA 5BSGA 2YY7A 2ZANA 2FZCA 2APJA 3JZMA 5U1PA 3CUEF 5JCJD 4PRKA 3RUEA 4MTCA 1B8VA 3HNOA 2W48A 3N6VA 1A7JA 4GOND 4QPCA 1EDEA 2A94A 4HQFA 4OYYA 4HWTA 5IARA 3CJQA 4A73A 3MRVA 3U40A 5DIFA 2ID4A 3RFVA 4YCCA 2C3UA 4E4YA 4YP5A 4IIFA 9MHTA 3UH1A 4IV0A 2IHTA 4OMUA 3X1YA 3LBNA 1Q21A 2Q28A 1QCCA 2CJWA 2A5DA 1L5FA 4CEJA 3MIIA 1RDFA 2D8MA 3B85A 4J2HA 4BNFA 1QVVA 4UE3S 4AKEA 2CXPA 5EP2A 3UK7A 5EFZA 4EG8A 3GGJA 4I1OA 4JLWA 2DKNA 2XVZA 1KU6A 1ID1A 2GZDA 4EY6A 1II9A 1OAKA 5T6MA 3P5BA 5B3LA 3U26A 1F8GA 1Q3TA 3UXEA 1IM8A 2R86A 4MINA 4PHHA 3FNHA 3MZ0A 4NXNB 3K2IA 2WG1A 3EGEA 2O3SA 2YCLA 1DEOA 3PWKA 2R8RA 5FQNA 5TPZA 3T1NA 2Y1WA 2YQ5A 1GZ4A 1GQOA 3D8TA 4L75A 4WBNA 3VU3A 3A26A 3CX7A 1KMIY 2WHRA 2I4IA 4MKGA 1QH1B 3W7BA 5CRIA 2V5AA 3KSZO 3OM0A 4MKIA 5FV4A 1GO2A 3BIFA 3WA6A 4BX0A 4RHEA 4COOA 4E5UA 3RFFA 6YASA 4R8KA 2R96A 4IIXA 4PHCA 3H1EA 4Y2XA 1Q6ZA 1UJ4A 2JIOA 1ZVQA 5IWCA 3ZDBA 1IUKA 1WKVA 2FV8A 1Z3IX 1LLDA 3ZG6A 4K9OA 1U9YA 2VCYA 3JQEA 5H9WA 5IDQA 5JWOA 1Z74A 5FQOA 1W1IA 3SG0A 1FX0B 1G8HA 4Y2HA 4WLOA 2WP8J 5HE8A 3RFTA 4HRXA 3WLRA 1WHTA 3B1XA 3I64A 1R9MA 3ACBA 3NHPA 3KU1A 4IIDA 3L49A 3DFIA 4TQGA 4BFCA 2WM8A 5FI0B 2XA9A 4MV9A 3H1TA 3ZZUA 3JALA 1SCBA 1TO1E 1NJ6A 1AGYA 4K3UA 2IF2A 5IC5A 1WBJB 3V2UA 1D04A 5J2UB 4EQ6A 3D54D 2PE5A 4M9CA 1JEEA 4FCCA 3WLSA 2F3QA 4OJNA 3AESB 1E96A 3LHIA 1KE2A 4KFCA 5JO0A 3A2KA 2X8AA 4LG1A 4U2GA 4D0LB 2VF2A 3H84A 4W7HA 1T8YA 4WH0A 5CPBA 2G4LA 3TNFA 2JA2A 2X22A 4G9EA 4D9HA 2FRXA 2YC4C 4CETA 4WDQA 1LPPA 1VP9A 4TMKA 3WADA 1T3LA 3D6NB 4QPJC 1VG0B 4BCDA 4V0MA 2Z4RA 1AQJA 3S3TA 4G1UC 2QTGA 3MWJA 4UZFA 2ZTLA 3CB2A 3DFZA 2ISQA 1JDVA 1T29A 4Q3BA 2HCJB 1II8B 1AZWA 3KXPA 4PONA 4TMWA 1KKUA 5CVTA 1YA6A 1TQ2A 3VZDA 2O06A 1I0ZA 1S1CA 5PNTA 1E3LA 1KEVA 1QUFA 1ZNYA 3PX2A 4H0NA 3WYDA 4P4GA 1EXVA 4O4HF 5P21A 2ZRJA 4Q9AA 4JC4A 4EI7A 1J8QA 4CUKA 1KQ3A 4PX5A 2QROA 4HRVA 3HKDB 1G8YA 5K2MA 4KREA 3PR1A 1B0UA 4U7JA 5NLLA 4DR3B 2HDHA 5CDYA 2FPLA 3NAMA 3BJMA 1CUEA 1U8ZA 1YB5A 5DNUA 3ZWOA 3BSWA 3RF6A 1XAGA 1H69A 1MQAA 1GTMA 2Y1KA 4ZKEA 8GPBA 1RXEA 3UMSA 1KZGB 3RUPA 2SCUA 4ZTBA 3U1BA 3SHTA 3MXOA 4HBZA 4IDGA 5CMLA 4XWWA 5FWXA 2ODPA 1D4OA 2RGAA 1DRUA 4G25A 1WEKA 3UENA 1AVTA 1Z2PX 5AP9A 4JI0B 4C04A 3N9IA 2NSLA 2Y0PA 3R44A 3NT2A 3TPZA 1HKUA 3D3JA 2VWPA 2XMGA 2JVKA 4Q3OA 1U5CA 3JQ7A 4B84A 4K1LA 3PUXA 5AR1A 1YXMA 1WG8A 3H4VA 1VFPA 3E9EA 4TMVA 3CH5A 1E9EA 3SEQA 4Y1GA 1GRRA 4ALKA 3UC5A 1JL3A 4HR7A 1OBOA 4IFEA 4ZIRB 4XWYA 3C74A 1ESZA 1W4ZA 1XN1A 1Z22A 3UXMA 4FHDA 3ZKWA 1M2KA 4DCPA 4BJHB 1D2HA 2WG0A 3EZXA 3KDAA 2ZIGA 3PEEA 3P9RA 4FGUA 1LA2A 4LNHA 4DCCA 1TZMA 2VSYA 1HT1E 4YRTA 4B47A 1UMCB 5A04A 5JFGA 1TAUA 4JI3B 3V3TA 1ZM2A 5A9SB 1MORA 1J0CA 1ODIA 5JT1A 4QL3A 3FPSA 3U19A 4YMTA 2XDAA 4J3NA 2DAPA 3W1VA 4KR0A 2NV2B 1O6ZA 3VR4D 5IPFA 3PD1A 3C5WP 1YL7A 3KRTA 4LHVA 5H82A 3ROKA 3TLEA 3ZBQA 4F9TA 4CMIB 4XRGA 2QQFA 2ZIAA 4HB3A 3RS8A 4CL3A 3KG2A 1IRXA 1R66A 3NOVA 1E0JA 1T2AA 3HKBA 2F3PA 1YVRA 5LB4A 1JSRA 2VA9A 1OIWA 2HHAA 2PRIA 3LHSA 4P3OA 2Y2UA 3EJ6A 3R8XA 2H5IA 2HNKA 1C7ZA 2X6RA 3CPJB 3I53A 3NORA 1UFVA 4CIVA 3RUFA 5K9ZA 2EJWA 5B4TA 3GBPA 3M4JA 4HB0A 4RH3A 4G1CA 3N2IA 1U28C 2O0LA 4N9WA 5C53B 1DAFA 3LRPA 2D2XA 2ECPA 1SKYB 3BULA 3FDJA 1KZ4A 1Z6XA 5KQSA 4B79A 2Z9BA 1NVEA 3PPVA 4O4LB 5EUMA 4BP1A 2RGRA 4KQ1A 1CVRA 5CFOA 1YMQA 4NENA 3GLRA 5DI3A 1S02A 3LYLA 4O2AF 5E8RA 3TW8A 3U1TA 1E2BA 1YBMA 3QW2A 5M5BA 1E4YA 1T9ZA 1YT5A 4R0MA 1M8KA 1PRYA 1XDDA 2F62A 4W1PA 1KI1A 2R6AA 5KJ6A 2VO1A 1E7QA 2HREA 3OEWA 4ZDKA 1V96A 3SF0A 4PZPA 3HWSA 4Z54A 1XJQA 4TSRA 4YCBA 1T0HB 3N6RA 1GD1O 2VHZA 4J0FA 3IVMA 2D3TA 1XEAA 1V47A 2N3ZA 3FFTA 3R4VA 3S2EA 3UKJA 4ARIA 1QYVA 3JWEA 1LGYA 1O0CA 4YAGA 2Z43A 1WSBA 3WGNA 1Y6RA 1DBSA 2Z09A 4IOKA 2PUCA 3R5SA 4QOEA 4LSZA 4TVKA 3UT5A 1P17A 3K32A 1CY4A 2B7CA 2FU5C 2IYVA 2VSQA 3I8OA 4RK0A 1EG2A 3CX8A 2YWGA 5MGNA 2PT7A 2W6OA 1CUBA 1P4GA 2H1CA 3R3WA 1E1QA 2AE1A 3GK3A 3NKVA 4I0WB 5KQPA 3B6MA 4AO8A 3A3KA 3LK7A 3RLFA 1R6XA 1HOTA 2VQSA 3QMVA 4RXUA 1ARZA 2P9YA 2JL1A 3DDHA 5F2EA 5HJ5A 2AC2A 4R9VA 1M1NA 4HDQB 3TL6A 4D8WA 4J6EA 4XEHA 2LCQA 3WRYC 1YRBA 1KY4A 1CNFA 4MZDA 4TLDA 3ONNA 4M9RA 2FJUA 1X1RA 1R4NB 1U3FA 3C6BA 3IA7A 5C8YA 3D64A 2E6UX 2WFAA 1Y3CE 1RFLA 5EVCA 3RS2A 3WGTA 5AKKA 1X9GA 1W0KD 1QGUB 3WNQA 5IVKA 2VYNA 3EZNA 3SC3A 2OWEA 1I4DD 3NASA 3WIEA 1GFWA 3AQ4A 5IU6A 2G71A 3AG5A 3MELA 5ETJA 1SGWA 4C3ZA 1XMOB 1JWBB 5T4EA 1G7RA 1XVUA 4HNAB 4RQUA 3S29A 3O3OB 3DZGA 5AWFC 1CW2B 2FMIA 2DFPA 2E4YA 2PANA 2A9FA 1Q0QA 2ODWA 3F6PA 4WBXC 1WS6A 5JIBA 2JF0A 1GM5A 1UOEA 4X45A 1DAGA 5I7FA 1RW4A 2OVBA 4JDUA 2P9JA 4RVSA 2VAXA 4CEIB 5LU8A 1G2OA 1MNQA 3H5NA 4ZRDA 5ELLA 1QOQB 1O96B 2RH5A 4JK3A 1TGYA 4D3FA 4DSUA 3Q9LA 5HFJA 2FQWA 2GHTA 4TMYA 1LSSA 5F9HA 2C8JA 2PUTA 3GRUA 3DC2A 1V2GA 1D4AA 1S5PA 2YS7A 5E7MA 3OUUA 1SCUA 3FB1A 5SY4A 5KI6A 4GU5A 4GLFA 4NJEB 6REQB 3MPUA 4PTYA 2VQ6A 5KS2A 4C0JA 4L6AA 5ADUS 2QUBA 3AHHA 3TXAA 3CWZA 4L27A 2BEWA 4TTIA 1T25A 2QGNA 4H77A 4A8TA 1YC2A 8MHTA 3BSFA 1JVNA 1XRSB 3N2YA 4EMTA 5I9IA 2P4UA 2CXOA 4M6WB 2IPMA 3AERA 3VR6D 1OX4B 1RWWA 2NP7A 1D2RA 2RGBA 3FLBA 3MFYA 3MWEB 4N0EA 4R9UC 4HAIA 4FE3A 4EVSA 3SJUA 4G1MB 2V6FA 2I4OA 2W6IA 4MQ5A 2C5AA 3RK4A 3RV4A 4MGEA 3AFHA 1DFHA 1E3WA 1UFOA 5A4KA 4BV9A 4AUKA 4GT1A 3VH4A 2A5GA 2JZOA 2YYZA 5G2OA 3DVAB 3DFFA 3L7NA 1EGQA 3H83A 3UWOA 4J0DA 4LGYA 1PR6A 1YOBA 3X1DA 1Q0HA 1A4XA 1APBA 4ETIA 1G4UR 1MAVA 5EJEA 1XKXA 5KOIA 3T5AA 2JIZD 4TRRA 1XLTC 3HHPA 3EG9A 2YC2C 1EDDA 3EVCA 4DTIA 3MAGA 4IHQA 5H4HA 4C6HA 4WY8A 3LXRA 3N2ZB 4DQKA 4IIGA 4CG1A 1P8JA 3ANTA 3UK6A 1N32B 2A0FA 2QTCA 3IBFA 3GAZA 3MJRA 3QJ5A 2PVCA 3RHZA 4K40A 5E95A 3RRNA 4B34A 3ELDA 4FU0A 3KJFA 4Y7DA 1BFDA 4Q9IA 1G8KA 4BFUA 1H6AA 4O29A 3ANYB 3VNBA 4H6XA 3FUCA 5H68A 2XEXA 1E3TA 3RT7A 1NUTA 3ZEIA 4FX2A 1Z13A 5CDHA 3M5DA 5IUJC 4F12A 2IVFA 3JV7A 1F14A 3HNPA 5EERA 2VJOA 3GP8A 4AXXA 5A3RA 4DHWA 3NYQA 1M73E 3U7QB 2EGHA 4Q5IA 4TWIA 3TLMA 4ZT7A 3GC6A 2Q41A 4KQEA 3BEOA 5A3SA 3WGVA 1JBQA 1RLOA 5T3UA 1QB7A 1U5BB 3THXB 4UREA 2QD4A 1TM1E 3OE7A 3ZTYA 4CF4A 2DFKB 2G83A 4GUAA 4YVFA 3D0RA 1IY1A 2ETXA 2P68A 4CW7A 1TRHA 4PPYA 2RMKA 3HXPA 1D9XA 4Y2YA 3WLNA 4EJ2A 1Q57A 2XLBA 2I91A 4B6RA 1E3IA 3JD3A 2AFHA 4K6KA 2V7QA 3JQCA