4D92A

Salmonella typhimurium d-cysteine desulfhydrase soaked with beta-chloro-d-alanine shows pyruvate bound 4 a away from active site
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
328
structure length
327
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords D-cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 118
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d92A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d92A02
2ZSJA 2TRSB 3PC3A 1X1QA 2JC3A 1PWEA 4AIRA 3PC2A 1C29B 1UBSB 1TZJA 4KKXB 2CLOB 1TZMA 2GN2A 4LMBA 4NEGA 1A5SB 2BHSA 3IQHX 1K7FB 2EFYA 4JBLA 4D9KA 2DH5A 3DKIA 1K8XB 1K7EB 2DH6A 4HPXB 5BW6B 1FCJA 1A50B 2GN1A 1WTCA 2O2EA 4D96A 5E0KB 3IQGX 1VE1A 1J0BA 4L28A 5D85A 4HO1X 1CW2B 4F4FA 2CLMB 5DW0A 1K7XB 5I7WA 5IWCA 3PR2B 2ZPUA 5B55A 5KINB 4D8TA 1V7CA 5B1HA 4JBNA 5CGQB 3R0XA 2D1FA 1BEUB 1A5AB 1UINA 3PC4A 2CLLB 4D8UA 5D86A 4D9GA 5B3AA 1D6SA 4OREX 5DBEX 2ISQA 1WKVA 2ZR8A 1V71A 4XUGB 1TJPB 5DVZA 4D9BA 5JJCA 1BKSB 3L6BA 3VC3A 2TSYB 2C2GA 1O58A 4D9IA 5IXJA 2RKBA 1Y7LA 2CLIB 4OFXA 2RHGB 2J9YB 4NU8X 3VSAA 4D9NA 3L6CA 5B53A 5I7HA 1KFEB 1J0CA 4D99A 3FCAA 1TZ2A 4I1YA 1C8VB 2C2BA 5HBGA 2O2JA 3HMKA 4D9CA 4HPJB 3VSCA 3SS9X 2ECQA 2PQMA 5I7AA 4WX2B 3AEYA 4D92A 5IW8A 4HN4B 5J43A 1WDWB 1PWHA 1TTQB 3L6RA 1E5XA 1VB3A 3IAUA 2Q3CA 5I7OA 5B1IA 5J5VA 1K8ZB 2TYSB 1VE5A 3FGPA 4ZQCB 1Z7YA 2CLFB 3RR2A 1J0AA 1C9DB 1FUYB 4COOA 4D97A 1TTPB 5B36A 1F2DA 2RH9B 4LI3X 5D84A 1K8YB 1V8ZA 2CLKB 4D8WA 4ZU6X 4D9EA 4L27A 3DWGA 4D9FA 5JISA 3V7NA 2Q3DA 5C3UA 2J9ZB 3T4PA 4L0DA 4Y6GB 1K3UB 3R0ZA 1UIMA 4HT3B 3BM5A 4ZU1X 1KFCB 2CLHB 2V03A 3TBHA 3VBEA 1P5JA 1J0DA 1M54A 5D87A 3X44A 2GN0A 5KZMB 1RQXA 1KL7A 3SPXA 4AECA 5I6DA 5T6MA 4IL5A 1CX9B 3X43A 1QOPB 2ECOA 4LMAA 4H27A 4D9MA 4L3VA 2WSYB 2CLEB 1JBQA 5I7RA 4QYSA 1QOQB 2EGUA 5CVCA 3SS7X 1OASA 1TDJA 3DWIA 1A5BB 3IQIX 1TYZA 2J9XB 3VSDA 1TZKA 5DW3A 3AEXA 1KFKB 5DBHX 1Z7WA 4PCUA 3ZEIA 2BHTA 1J0EA 1KFBB 1WBJB 1KFJB 2Q3BA 5EY5B 3CEPB
chains in the Genus database with same CATH superfamily
1CWUA 3LUDA 4ZOLF 4RF3A 4BEBA 1EFKA 5DTEA 3ZV3A 4CV3A 3N0WA 3GEHA 3PGMA 2OG1A 2ZIAA 3GLVA 3RYFB 2NYRA 4TQ9A 5KKAA 1MJNA 4X62B 3N0RA 1PZEA 1Q6YA 1YS2X 2D1RA 3IBTA 1IHXA 3OUZA 3PWTA 4FFDA 4JLNA 4LY9A 5DBGA 5IJ0A 2OBMA 2PXCA 2XWPA 3NHJA 3JAKA 3K0CC 4RKFA 2P4EA 4UBOA 4JJ4A 3RHFA 3KR9A 2GFIA 2QD5A 1VLLA 3NB0A 621PA 4BVJA 1YRBA 3G5UA 3PT5A 1JTVA 4IDGA 3EDMA 5AW5A 4BL5A 1OFUX 1X9IA 3I01A 4HWKA 4HNVA 4KBGA 2O8BB 1XVIA 4I46A 1LKZA 1IZYA 1AKMA 2IY8A 5B1HA 3RWBA 2QTMA 2I71A 1OLXB 2JIZD 4KRYA 4OSOA 3LAWA 1EWRA 2Q5FA 1K7CA 1MD9A 1MX9A 1V48A 1D5CA 1NYQA 2AGVA 3KPVA 3PYLA 2AX4A 3I6MA 3D9QX 4I1RA 3HXOA 1TJPB 2BKLA 5FTJA 4BLOA 2JHPA 1ZP6A 2QP3A 4NMLA 4WXPA 3PE6A 1T3ZA 4XQEA 3ZQUA 5JY6A 3EW9A 1PGQA 1VMDA 1ZM3A 2ZXUA 4BFSA 3OEEA 5BNIA 3Q5EA 4IFBA 4OFXA 4CDGA 5KYXA 2O2ZA 2HLDD 4FCVA 2UUAB 2AZDA 3QNMA 3QUAA 4AWXA 2CXXA 4QPPA 4OJYA 3VZRA 4JITA 5AKYA 1AS0A 3MGAA 1B8PA 4ZXPA 5TPZA 1TADA 2OMKA 1KDRA 2R6R1 3PFNA 3Q40A 2QAIA 5DIZA 1A2BA 4CKYA 3VSCA 1MV5A 2I6TA 3KNZA 4TZKA 1KC3A 3OJ0A 5H8WA 1QVVA 4O59O 1X80B 5CNJA 3TG2A 4FCTA 4ND3A 4C5AA 1WSAA 2CL6X 3EZYA 3ZJ4A 4EITA 1Q95A 3VDRA 4ATNA 2I2DA 3LIPA 4PX2A 5H68A 3KHTA 4ZVLA 3TB6A 9ATCA 4ZXFA 3FPSA 4RTKA 1SXJB 4MHOA 2D3WA 2IUSA 3ZUPA 4P2BA 4EYQA 2CJXA 1MFZA 1XIVA 3ACDA 4OYLA 3PQ6A 3FSEA 4HWRA 5ESXA 4A6DA 2JBAB 4O02B 2GK6A 3W5IA 1EIZA 1EGVB 1NVVR 2GTPA 3OTOB 2QUHA 2HWUA 2FUCA 1A76A 1KJZA 2EKPA 2I3DA 1M0WA 1M34A 2O5RA 3CEJA 2VZ9A 3L0OA 1QXSA 1M0TA 4MA0A 4HT3B 3A7EA 4DLRA 3EMBA 3RVJA 4N3BA 2YHAA 3STVA 4CTJA 5BMVF 3ELWA 1PZFA 1S9HA 3RJ9A 4O2BF 2P0EA 2H1OA 3M9LA 1Y9JA 1JB1A 4PHHA 4YO7A 3VI3B 3A3OA 2JJ8A 3JSXA 3ECAA 1X86B 4BN4A 5HCNA 4QT4A 3LDFA 2Q6IA 3QVGB 3GPIA 2EFGA 5CX1A 1G20A 3I0NA 3L02A 2HU2A 3QVKA 1OD6A 4HGPA 5REQA 4TXJA 4IDNA 4ZO9A 1BJKA 2D1SA 2WWWA 4ZREA 2YH2A 4P4NA 5BV8A 3AH8A 2D2VA 1TCUA 2XE8A 1BHO1 5CRIA 5FWXB 3CRNA 1YRYE 3BXEA 4IJ5A 3EA5A 1LC3A 2XNKA 4N03A 1LTQA 5BV0A 4UMFA 1Y6JA 1EFCA 1ZEMA 2PRKA 1EG2A 4GYWA 3FNQA 3K5HA 3X2FA 1WZEA 5CYPA 5C53B 3HA7A 1A5SB 2A4KA 5BSVA 2G1AA 2VUUA 2E37A 1GLVA 3PF8A 3LGXA 4QGBA 4DN6A 2FMKA 2PGAA 4P93A 1SA0B 2UUCB 4R51A 2ZYIA 2WSSD 3BF8A 3Q98A 4UVEA 4IF4A 4KGXA 4FZ5A 4Z9FA 3W8FA 5JMOA 2R1TA 1KEUA 2O2EA 4G4SO 2ZG6A 1VHJA 4FFMA 5LZ4A 3DO8A 5IKPA 2DPGA 4GZ6A 1FTNA 4M0KA 1TK3A 4NTZA 4DF3A 1RYZA 1QG4A 1UJBA 2RG1A 3MJ4A 1P80A 1NURA 2GKSA 3O3CA 4DYHA 2HW8A 2A5GA 1KK3A 2DFVA 2WU0A 1NVMB 1HFWA 3SVTA 1SU8A 1BZYA 4AUMA 4ZV4A 1NXVA 2DQKA 4UE2A 1R8XA 1ZIDA 3HDGA 4UXJA 2PK3A 2HFKA 5AM5A 4UFOA 3G9ZA 4DAEA 1U0BB 2PLWA 4ACAA 2C84A 1RU3A 1UBUS 2YVKA 1IULA 1BN6A 3IUEA 2EW2A 3LO8A 5ER6A 1VSBA 2IRWA 1YVRA 4EPRA 4FFWA 2XSZA 2ROQA 3QFRA 3L7KA 4LBVA 4Q0MA 5CH8A 1QIHA 3CSDA 4I4TF 4C89A 1C1DA 3TXYA 1Q7GA 3LBFA 1YJQA 3IQWA 2H3HA 1GZHB 1WXDA 2V74B 4D26A 2WG0A 1DBPA 5KB3A 4ZQFA 3QEKA 1I7NA 2ZE5A 2MJLA 4S3MA 4MWBA 2QMEA 1YDFA 4FW8A 1JEEA 5EIAA 4RM3A 3A2KA 5JXHA 2B4QA 2GX6A 4V1CB 1M1NA 4HMQA 1KZGB 4R9RA 3O8OA 2QAGB 3R7WA 1W5AA 3PJEA 3KXLA 2NACA 3RSSA 4F2WA 3PWKA 3MRVA 4RVSA 3QX9A 2FZKA 4RD6A 4YP1A 5T8KA 4O4JA 5JTUA 2JLWA 4JC0A 1W2WB 5LMCA 1R5BA 1H6DA 2H9IA 3EXHC 3SJCA 5A5EA 4YIHA 2NZ8A 3B82A 4QYIA 2WUEA 2JDID 2IHBA 3C70A 4OMUA 4L27A 3TGWA 2I55A 4TTRA 4U63A 4WI1A 3CEMA 4LYDA 2IYUA 2HF2A 1QYRA 1OH7A 4AKIA 5K9ZA 5D3QA 3FBGA 3I05A 4RHYA 4UPDA 5AM2A 5E4YA 4O4LF 5CEEA 2DT5A 2ZQ5A 5GOTA 1SBCA 3GGCA 4Y67A 2GNPA 3ECCA 4BWVA 2QG4A 5FBQB 4N41A 3P2YA 5JATA 4E21A 4XI9A 1MU0A 1RZUA 5LZ8A 2VAPA 1QQTA 3QI2A 2CV1A 1Q15A 1LRJA 3ZCSA 2D5LA 3H83A 4BB0A 2ZWOA 3MJTA 2IXDA 4O2AA 4K9KA 4KU4A 4WNIA 5EWJA 4OATA 2IYPA 4A03A 4B74A 3MA0A 3R0QA 2X42A 1Y48E 4RZ3A 5GGYA 2FE1A 1SRRA 1CYDA 2J3DA 3ESZA 4JYCA 4CG3A 3GJTA 1FRFS 1I2DA 4N76A 2X77A 1E2QA 2CJPA 1U7XA 3LRXA 4MX8A 5CT8A 5FTLA 5JI3E 2UYCA 3NEJA 2UYOA 3FB4A 2Q3BA 2REBA 3C8MA 3BJIC 3JALA 3LFUA 1G9TA 1DMRA 2C2MA 2DZDA 4G67A 1EQ2A 4Q48A 5EPEA 1NZDA 5K3OA 3M4XA 4FFPA 4PVDA 1NRXA 2AFHA 2PT7A 1B93A 1EWQA 2YIJA 5DFAA 3KXKA 1FDOA 2FUNB 5HYVA 4HDNA 2NYUA 4FS3A 1K7EB 2H85A 1ITZA 1ZK0A 1Z9BA 2JH9A 3DOFA 3EMVA 4OQDA 4KREA 2Z2XA 2PBRA 3PENA 2OVBA 2L82A 4XUDA 3OVMA 2BM0A 1J9EA 1UWLA 2QJFA 2W93A 3A3KA 3OBBA 2WU3A 3FLBA 3DF7A 4XYMA 4ALNA 5IS2A 4LBWA 2WA2A 4LX8A 3HC7A 1ETHA 1C80A 2CZGA 3ILXA 3ANMA 1GVNB 3O91A 4MR9B 4R16A 4QAQA 1R37A 5HDQA 2O7QA 3BXHA 3EQZA 1XTQA 2HCJB 2PH5A 2BFFA 4CLXA 1RZRD 2AQIA 2BFCB 3UUFA 4BO8A 2PX4A 3FRIA 2WUDA 4HNAB 2HSWA 2VK1A 3IUQA 5K0CA 1HNWB 1MW9X 1RYYA 5A3JA 2FW8A 5DVZA 3T3GA 2VP3A 3EDOA 5KWJA 5FPTA 1YB2A 1E4OA 3OPYB 4L5CA 1V47A 3K9LA 2QQGA 1N3IA 1XKXA 2RHDA 1K88A 1X7DA 4RQTA 4U2BA 4OOFA 4EHAA 1TX4B 2ZM6B 1MNAA 1ZUD1 1L7MA 3G8YA 5IDYA 4QUEA 3MHTA 5KVCA 5DM0A 1Z6XA 1ZVMA 2GD1O 2IK8A 4EW6A 4HXGA 5MDHA 1UBJS 4FP9A 1CJUC 4RH3A 1CJMA 5A3RA 2XUDA 4PYQA 5LD2C 2O48X 1Y6RA 1Y37A 4IS2A 5L3SA 4YAIA 3KTAB 2H2AA 5TY0A 3OICA 3OLZA 1JHOA 2FW6A 2QVLA 3F0TA 4RWZA 3KQHA 1M76A 3W4JA 2Q6TA 3MEQA 2Q49A 4ZI2A 5J5VA 4QIHA 1ISHA 2XYHA 3K96A 1MTOA 1RQ2A 4FI3C 1YFJA 1U2TA 2JAQA 5K8TA 1SELA 4D8UA 2WT8A 1WPXA 3T41A 2FWIA 2PL1A 1FRVA 4EI2A 3P9XA 4LTNA 1WO8A 1RBQA 2OP0A 2PZBA 1T1IA 1Z7EA 2PGJA 5AI0A 3MZ0A 4MQMA 5TGDA 3RNLA 1EFVB 3DDZX 4H6PA 2XD4A 2Z8ZA 2I34A 1W85A 2Q3DA 4JQCA 3V1TC 2PUDA 2PKRA 1UT8A 1DVRA 2E55A 3V4RA 5EMKA 1Z6YA 2QG6A 2A9RA 2XZLA 4W63A 2WK1A 2WDZA 4CLOB 5E9QA 3OOHA 2X4IA 1R4NA 5FEUA 1CR6A 4ZVNA 3RYIA 1Q7TA 4XD7D 5HJ5A 5JQGA 3SLRA 1JDPA 1PL7A 4P4SA 3HVJA 4F8YA 1I7SB 1GKUB 3T3DA 5GTDA 5DGHA 3GLFB 1Z7GA 2B1GA 2LZ0A 4TQAA 5JRDS 3FDFA 1DTWB 4KWEA 4ZCQA 1P33A 3OLCX 2CFCA 1X1BA 4TV8F 5C80A 2B3TA 4UTOA 1HM5A 3VR5D 2IHVA 2SNIE 3G1UA 4FLMA 2Q4EA 5EE0A 4ESHA 2FK8A 2D74A 2EX0A 3N8GA 2N46A 3QWHA 1ECGA 1MDFA 4JUIA 3KSUA 1AGNA 4PTLA 5EIBC 2Y1GA 3HN7A 4FKBA 2H2HA 3E8SA 4PEVA 4JI2B 2QR3A 4JNKA 3JCZA 4KNWA 4TWIA 1F2VA 1KFJB 3TOXA 3NTRA 4OLFA 4L5AA 3KT8A 1DADA 3F6PA 3MRTA 4IV5A 4MW7A 5DO9A 5ALHA 2P40A 3C1TA 4FN4A 1QVWA 3D3QA 4GC9A 4J0JA 3ZZ1A 5CX4A 3ABSB 5EI5A 3NHRA 2R8BA 1R1DA 3MGCA 1Z4LA 1YC5A 4KX3A 5FJJA 2JLRA 4OI1A 4J1QA 4TOIA 1R50A 8ADHA 1JIQA 2D54A 4I4NA 3PB3A 4DPKA 2CHQA 1AT1A 1L7EA 3DQQA 4S12A 1PFYA 3IESA 3TRKA 2GF2A 2R5WA 3DAYA 4K2AA 1ZN9A 4A9AA 4DCPA 4TLLB 2C31A 2BBWA 1K7YA 3HBAA 4NESA 3FPHA 1DIAA 1RCFA 2C9YA 3LO5A 4NBLA 5JNSA 3EFOB 3TQFA 1RQPA 3KLNA 2VWPA 3BE4A 4DPMA 4FR2A 4DSUA 4LVNA 3TTXA 4LBYA 1Z5VA 4ROSA 3DMNA 4JD5A 4RFLA 1R6VA 3CE6A 2FQXA 3FUCA 1ISMA 3JD0A 5ENVA 1WW8A 4RA6B 2ISQA 3C3EA 1EDDA 5HSGA 1MUUA 3BILA 3I2YX 4HUQA 4C1NA 1UUFA 3GN1A 5EE5B 3EULA 3G2MA 3WLMA 1NE2A 4JP2A 2RGEA 1W4RA 2FPOA 5IZCA 1F14A 1LX7A 1YT5A 2BTEA 2OL4A 1OI3A 1UK9A 4RXUA 4H9GA 1QANA 2IYTA 3PFWO 1UPTA 1CUZA 1KZ9A 3E7FA 4HGYA 4A6PA 1OX5A 2JI9A 1ZD8A 3UC5A 1CU1A 3O8CA 4ZN6A 3JQQA 2A5JA 2I03A 3DHYA 5FPKA 1P3Y1 1XLVA 4C2UA 4BAUA 4M1WA 4UHBA 2XE6A 2WG1A 1N6HA 2WSLA 2BOVA 2O8EA 1DCFA 1MOSA 3A27A 5DN6A 3L8HA 3GCWA 4HF7A 1VLJA 1TTPB 1YQUA 3VHLB 2QJTA 2DU8A 2CDNA 4BX2A 1JA9A 3GJYA 1IWPB 1ZNYA 4Y9TA 2C2WA 4YWJA 1U1GA 3R77A 5FPQA 4E08A 1JBEA 4RTPA 1E8MA 3HJTA 2ZB7A 1G8PA 3HSSA 4WSOA 5DLYA 5C3UA 4KR3A 1V11B 3FFXA 5K0ZA 1RKBA 1JTFA 1USKA 1BCRA 1ZWLA 1FNMA 2GZDA 2NO9A 3I32A 4CE6A 3PFGA 3RS8A 1XDSA 1ZC4A 1XZMA 2AVNA 1ZN2A 2AJLI 2CF6A 1S3FA 2CD9A 2WVGA 3GPLA 1PJ4A 1K6EA 4HDQB 3GELA 4CLRB 4WNAA 1DC4A 1UKYA 4K2HA 1GZSA 4Z51A 2B98A 3D8TA 1MPXA 1NN5A 2ZJAA 3RKUA 5H3LA 1VYHA 3DKPA 2ZS8A 3DD5A 2PSJA 3JD2A 3RUDA 2VHEA 2WM9B 3GDHA 3WHIA 1Y6GA 4CKBB 4JT9A 4HSGA 1TMOA 4IRXA 5HRUA 4JASB 4KLRA 4HMPA 5HVNA 3GVIA 5EJMA 1DEAA 2C58A 5D7BA 3VI4B 3TSWA 4JELA 2QD2A 2ILVA 1UPUA 5IH7A 5FLYA 4GNKA 5AXDA 1L7PA 1UBSB 2N1BA 4OHFA 4RSGA 1XTUA 3KQOA 2HNAA 2Q2WA 5F7JA 1SGWA 4C0AC 5I5GA 1P2TA 3NKLA 1KRHA 4EVIA 1L5OA 1T9CA 3OCJA 4WZBE 4CR7A 4G0XA 5L3ZA 1RXYA 1QLJA 1M10A 3Q8LA 3RAEC 1SOAA 1WVGA 1XMVA 1H1TA 3CVYA 5LMUB 1ADFA 4QGFA 1J7KA 1XVVA 4AQ7A 2BYTA 4DLTA 4B3TB 3DL0A 4ZVKA 1Y8CA 1SEVA 2LR0A 1IAVA 4FYWA 1SPXA 4J4TA 2FPGB 2RE8A 1CDOA 4HEJA 4E03A 3H97A 3CF4A 1BQ4A 5GP1A 3WLEA 1J8YF 3WHKA 3PPWA 5JCOC 5KYUA 1HRKA 1XWFA 3L8DA 4U6QA 5C34B 3GLIA 1QWOA 5K3AA 1P45A 2J0QA 3T7AA 1HC7A 2CEAA 3JX9A 2IZ0A 4KQIA 1JHPA 1EINA 1A96A 1OBFO 3A14A 3MJDA 2XXBA 5J2UA 3V7YA 4ZYWA 1K98A 3F7OA 2J07A 4FFRA 2RKBA 3GP3A 3SSMA 1NAHA 5ALZA 2IEZA 1EWYA 3COVA 2B34A 3RAGA 4D3FA 4DEXA 1ODTC 7MDHA 3FOWA 4W9NA 3D3WA 3VJMA 2JLAA 2DRIA 1SIUA 3MTJA 3U80A 2ZRPA 4ER0A 5HBGA 5IM4F 5HK8A 5F98A 2F4VB 4Q7KA 1M66A 1K27A 1J2TA 2W2KB 5JCZA 3L7CA 3O7MA 1Z6ZA 3GMTA 3QSGA 2X0NA 3PFKA 1NSYA 5A4FS 1CERA 3AM4A 3Q10A 4ER7A 2WILA 3IB6A 2JFFA 3L93A 3B78A 4KFRA 3EVBA 3CF2A 4H35A 3U3XA 1UBGA 3VU3A 1B41A 1JTEA 5I9TA 1PD1A 3GLHA 3MTIA 4S2UA 2DB3A 1R8QA 5BYKA 1GL9B 5IU6A 4UU7A 1A9OA 1L5YA 2DECA 2NZ2A 3QPBA 4IM7A 2NLOA 3FSGD 2H5LA 1WV0A 3B5IA 1PDVA 2IPNA 3EG9A 5DBIA 2KLBA 2IUEA 1OHHA 2B5OA 5CIQA 5CUQA 1Y6QA 1X1AA 4QGHA 4KE9A 3HWSA 5FBKA 1J5PA 2QVGA 1DBWA 1SWVA 4OJQA 4DLAA 1KJNA 1FY2A 2C2OA 1SURA 2F43B 4AZ0B 3K0FA 1YVPA 4GR5A 3GQBA 1DDGA 2P65A 4JX9A 3T1TA 2CJWA 1T1GA 4X8MA 1IXRC 1KY5A 1FQOA 3X43A 5F5NA 1OXVA 4Q66C 1N2OA 1JBQA 2NQ2C 4JIGA 4OXNA 3HVKA 4ITRC 4F11A 2WAOA 2DQZA 4RSMA 1EUYA 4UTRA 1QIDA 1QO0D 2P35A 1K68A 2R2AA 4UCXA 4AQDA 3TINA 4P36A 1IOVA 3KFVA 3RVLA 4QTTB 4MKGA 1E1LA 3AK4A 5BN5B 1MQAA 3L0DA 4A8TA 3L4EA 2ZSAA 5CURA 3V1KA 3RTDA 3UYKA 5F21A 4QTXA 3CX8A 5LIPA 4XQ9A 1IB0A 1PR4A 2P11A 3I6QA 4JENA 3EXHB 2IIQA 2HY7A 3HP4A 4M22A 5H1YA 3S44A 2X7XA 4NYJR 2OM2A 1N92A 4MWOA 5EZYF 3ZH9B 2OEPA 1NPYA 2PGOA 4LYHA 4NNOA 2G82A 3WYFA 3ZWXA 4ZHQB 3W5BA 4R1OA 2R7MA 3GA7A 1QO9A 3ETDA 4LF5B 3TBFA 5AHXA 1D1TA 2FEWB 2TMDA 1SRQA 2GXAA 4UZSA 1KYQA 2CUKA 1CZUA 4JI3B 2VJMA 3NDRA 3GDFA 3AKZA 4NDAA 3V48A 1D2HA 2BGKA 1VP3A 2WQ7A 1CRLA 4RACA 1DKQA 3WBBA 1PJ8A 1CPYA 2CE2X 4G07A 4WN9A 4NK5A 2FRXA 5E6SA 5FL7D 5KYNA 1A9XB 1VOTA 2FLWA 3DLBA 3A4MA 1MIOB 1OZFA 5JR3A 2DHEA 3FPGA 3EY4A 1O58A 4H3VA 1YQWA 2AEMA 2QSUA 3F74A 1QH8A 3FLEA 5DTJA 4AJ1A 2W6ID 2LUOA 2OCGA 2PUFA 1Y8RA 2YMLA 4OGLA 3AXTA 3T5TA 2JBHA 4H2DA 2I22A 4E3WA 1T4DA 3F3SA 3HE3A 4RY9A 1YMVA 1H93A 1Q19A 1ZY2A 2QRHA 1HNNA 4KK4A 2X9QA 4LRUA 3G49A 2I2FA 4N0PA 1R3UA 4RZQA 5C8YA 3ZV7A 4D79A 3DE0X 3AI3A 2YVLA 3WJ2A 1Z34A 2H2FA 4PQYA 3ROQA 4LMRA 5J3JA 1DEKA 3OEHA 3P96A 1E3MA 2OLJA 5CT9A 1D9XA 4I8XA 3QX7A 2HH9A 1HWYA 2OSBA 1ESDA 1TD9A 4C04A 3LUBA 1O9GA 3DPIA 1ZAKA 1VCHA 2GO1A 2H2IA 3WRYA 3AHJA 1ZCJA 5C81A 3O1IC 5FUWA 4D6YA 4J7AA 4DC0A 3GIDA 3M70A 3VYUB 5K0BA 3I2FA 4FYYA 2GEUA 3PDHA 2W6JD 4NMHA 1C50A 4Q1EA 3NIWA 4FU0A 3A1FA 3R6DA 3NOXA 1N6NA 3GFQA 4TS9A 1N33B 2B1QA 3HV0A 3TNJA 1OTYA 2J9ZB 5CFLA 3GEMA 1K4KA 4WKPA 1ACMA 2Y2UA 4JMPA 1A8IA 2GEKA 2EEPA 3ITKA 4RVGA 3IEPA 4B3RB 1JIJA 3P9ZA 1DAEA 4D0GA 3FCXA 1Z62A 1M2OA 1H4SA 3ZGZA 3U44B 1JYSA 1T8WA 2FETA 2XHZA 3JRNA 1W0JD 3BWXA 3LT2A 1EVZA 2BGGA 1JG6A 1KP3A 3HKCB 5B4UA 2BFNA 2OCKA 4A1FA 5EINA 3CRRA 3ZJYA 2DY0A 1HR0B 1DIRA 4GU5A 2Q62A 3T4UA 5LD2B 1JEYA 4MW1A 3U3OA 5IF3A 1R0KA 4P84A 5J58A 2JW5A 2Z1MA 1GSAA 4KQ9A 3SZMA 2C9MA 4D43A 4RULA 2WP0A 1DMSA 3VHXB 4QHSA 3RSCA 4X1IA 4KR7A 1JHDA 3WDLA 4JROA 1N0HA 3DE5X 1NPTO 2G08A 3ABIA 3OPXA 2IEAA 1OWPA 4BZPA 2H5JA 3FYUC 3PKZA 4KO3S 3QOYA 3MOSA 1GTSA 4BV3A 1SUWA 1JKIA 2DH5A 4LDAA 4TWBA 4CR6A 1YNSA 2JAHA 5TIIA 5BOSA 4KQGA 2E4YA 5BQXA 4TTJA 1A50B 2PY6A 2YWBA 1LW6E 3FR8A 4TMFA 1M8GA 4M83A 4TPKA 3ZK9A 1GCUA 3P4YA 1B74A 1LVUA 2J09A 3DXFA 1EFRD 3LX5A 4XCXA 3FNGA 5IBCA 4Y1GA 1HK7A 3E05A 4JWTA 4S0XA 4F12A 1NDUA 3CZ9A 1YB4A 4NL4H 5SICE 1KYVA 3CU5A 1NVAA 2YN0A 4UMDA 5KVVA 2WAMA 1TU3A 4JBNA 3IBYA 5K4GA 4LOJA 2QX8A 3I5AA 1GGJA 4WJLA 3I39X 4ZP1A 4G1EB 3JYPA 2XNSA 1WCIA 2DWCA 2GEVA 2HXYA 3A4TA 4BFZA 2I4TA 3FOFC 1O0BA 1H9BA 2G4LA 4RQBA 1FDWA 3RFTA 4DV7B 1TYEB 1GU1A 1E2UA 1MH9A 4N0DA 1OY1A 2VLIA 3FA2A 1G38A 5ESWA 2VDRB 1J4AA 1CY7A 2ID7A 3EVAA 2RGCA 3WYGA 1UM9A 5LQJA 1OFVA 3DMDA 2P4HX 2K6GA 4ALLA 5BV2P 1WY5A 2ADFA 1IHPA 3LJKA 2QL5A 4QUKA 1ZH0A 3C3PA 1C7EA 3JSAA 1TGVA 2PPLA 2Y2VA 3PHIA 3HDYA 2VYNA 1Y1QA 4YN3A 4BCBA 3WGIA 1G3RA 2EJTA 1ZX1A 3KYCB 3NHUA 4FOPA 4KC0A 5ALKA 3UJ7A 3W5SA 3WB9A 2HC9A 3KBBA 3X3HA 1P19A 5KNBD 3GV0A 3MTBA 5L40A 3UMRA 1GGNA 1Y4DE 4CM8A 1RJFA 2FPKA 3S7TA 2II6A 2P3SA 5CFZA 1XDDA 1XTSA 2FTKE 4BO1A 1TO6A 1TJNA 1K4YA 1LRLA 2ISSD 3FVVA 1UEJA 1EWKA 4US0R 2PL3A 4FDLA 2GD0A 3EEIA 5ALNA 2FB9A 1SKYE 5TQJA 1MOPA 2QP4A 3BGDA 4RCYA 1FSSA 1DCMA 1DUVG 2ECPA 4JLUA 1TC1A 2Q4DA 3DM5A 4JJKA 4U9HS 2FLVA 3DHVA 4CMHA 4YJ2A 3H1TA 3SQLA 3B1XA 3VU9B 2HT6A 3WK5A 5AQEA 1L7BA 1XA3A 3MWEB 4LIPD 4KYTA 3T8YA 2J0SA 1L4UA 1JR3A 4X7PA 4G1UC 1XX6A 4UEOA 2GZ2A 2J4DA 3LYHA 2J5QA 3ANNA 3LBIA 5HTOA 4QVKA 3OZSA 4MYCA 1B14A 1PDOA 1KIFA 4XCVA 4WA7A 4EJFA 3GDWA 4P31A 1B8NA 4NPAA 4CCYA 3OQBA 4MVJP 3M9XA 1FDVA 2WFLB 4Q9LA 3ETLA 4B44A 1YFLA 2AR0A 4B4VA 3DW1X 1VYTA 2HMSA 1DKMA 4BGVA 3LC1O 3GRVA 3HJCA 2AW5A 4H0CA 1IEXA 2Y92A 4XR9A 5P8WA 4R81A 3VX3A 3WXBA 3ZD8A 4CV2A 2RGBA 4IJWA 4RJ2A 2O2CA 4PX5A 4X94A 2A0XA 1U7DA 4GICA 2BKAA 4DDVA 2YIMA 3CW2A 5J1SB 1K06A 1XT6A 1G6OA 2Z83A 3N8NA 3H2SA 4FMBB 3FOCA 4ENUA 3VNSA 1QQBA 1TAHA 4PZ0A 5JRZA 1VIAA 1GR0A 1LDYA 2XB4A 2YWRA 1ACJA 3D4IA 2AE1A 3DBLB 1HQDA 5J2TF 2EJVA 1E2EA 2OHVA 4WRRA 4O1HA 2B9VA 4JI1B 1LXCA 5KJCA 1Z8NA 3PEVA 1C7IA 4OGGA 5JEDA 2YICA 2EWVA 3O73A 2LRHA 3DZFA 2Q2OA 3KSRA 3DZBA 1QF9A 3ME5A 1F8UA 4YGYA 4AYWA 3RROA 1QNLA 9ABPA 2IXGA 3BJMA 3JTEA 3TPFA 2VQFB 3EIUA 4ETNA 1TK9A 3E9YA 4B40A 3TLEA 1OXMA 2NGRA 2Q50A 4LNUB 3OURA 2WIGA 3IVMA 5DOZA 3ED5A 3UC9A 1PFQA 3HGTA 2W6CX 1FFXA 3IIIA 1G6HA 3HN2A 1KJIA 3MMSA 3NHYA 1GPMA 3ONDA 5DBEX 1JE0A 1LDMA 3IAM6 3RC3A 4DFDA 1KOLA 3EXG1 4DQXA 3DTTA 3Q72A 3Q85A 4PZEA 1QHSA 4QU8A 1YZNA 1WCXA 5EMNA 3A32A 5F64A 3X1WA 1SCBA 1QJCA 3A6HA 4JLKA 1J99A 4C01A 4DXDA 1CY2A 3IRVA 5D3KA 5TJHA 4L08A 5IJWA 3PFIA 3S55A 1YMQA 3ZE0B 3ZPXA 3C4QA 4BNTA 2BUAA 3AV0B 5F4BA 1PT6A 3W8EA 2AC2A 1JB9A 4D4MA 2QGZA 2FN9A 1LK7A 3PSHA 4CYMA 1E2DA 4JEHA 4AJ9A 2XCSB 4LSWA 1V3UA 3PD0A 3B8EA 1ESMA 4ZVTA 1SD1A 4Y2RA 2FYTA 3NPAA 4QARA 3UUEA 1TM1E 5SZKB 2UUBB 3BJEA 1MAVA 3KR2A 3ORRA 5AUNB 4IHJB 4ZYXA 4OP3A 3SJAA 1NVTA 4PFSA 1L8OA 3FGPA 4W5HA 1ENOA 2PZKA 4D1YA 3A4VA 1G0OA 5BW4A 5A3VA 2A2ZA 3F5QA 4FJ1A 4NENA 1F9EA 2C5FA 3RHSA 4R7ZA 3U39A 1FXUA 4RIIA 4XB6B 2FFJA 3VZPA 2EW1A 5BOVA 3OU6A 4N9QA 4B4DA 4URUR 5ELMA 2PUVA 4BLSA 2WUWE 1HKUA 1NQUA 1BVUA 4IMIB 2QRZA 3OP1A 2ZAIA 5TJ9A 2PJZA 3CLUC 5BT9A 2W0SA 4Q05A 4WTOA 3ZD9A 1AO0A 3THWA 1BN7A 5CFRA 4LXXA 4H15A 3AI2A 3RFUA 3T38A 1NW3A 1LSOA 1XTVA 4UXHA 4WDQA 1R27A 2APJA 5EJ9A 5KTSA 3WMFA 3IV6A 2C8KA 4HLDA 3SYRA 3T94A 3D0OA 3Q0TA 4L4XA 1KYYA 4UEKA 3DQZA 3LHDA 4ZTZB 3S8MA 2WFMA 3ENKA 1KK2A 2H06A 3SPXA 4WLUA 5ICSA 5FOWA 5IKEA 4KMOA 4DCSA 1WF3A 3CNHA 4NFSA 4ZAZA 2ENUA 2ODPA 3D7NA 1SEPA 5AW7A 1UP6A 4JBHA 4OUDB 5CJ2A 2BFDB 2YKGA 5AO9A 1NXQA 1VZ2A 2JVKA 3L8YA 4DG9A 3V33A 3G82C 1Y1SA 2QMYA 3S1SA 5B30A 5ELXA 5L3QB 2AFRA 2W4IA 2ZSJA 1SK9A 4PSKA 1SKMA 3NHPA 1L5LA 5K2OA 4J0IA 1QG0A 4R4JA 4EI9A 2Y76A 4CUJA 5KC8A 4XE5A 3LQYA 5MHTA 2HV8A 2J3IA 3L7AA 5IZCC 2LKCA 3H1AA 1A9ZA 4AQYB 2ATEA 2VZEA 3QMMA 1D2GA 5FAXA 5L7WA 3KJIA 3DE6X 4LOAA 4JGGA 4MW0A 5DYIA 5EP3A 2CJFA 4GS5A 4K88A 4QBKA 5LM3A 4NSNA 1YZHA 3FHLA 1YSCA 1W25A 3SZOA 4BQNA 3CWQA 3EGXA 1OWOA 4HO1X 1L8QA 4RS3A 4ODIA 2BFMA 4JLOA 4CCWA 421PA 2X0KA 5IDXA 5IJ0B 4Q4LA 3S2SA 2QYHA 3JAKB 3BK1A 2R65A 4YY3B 1PIWA 4TSRA 3WRYC 1L7DA 4D3YA 4YS6A 2OGZA 2E5WA 1GZ5A 4HDCA 3LUJA 2W71A 1I51A 2NTEA 4MTCA 2DLCX 2J08A 4M1YA 4D9IA 1ZN7A 4U00A 4YRAA 3LPNA 2I54A 3CV3A 3PWZA 3U60B 1AU9A 2KE5A 3LUPA 3AY0A 5BNFA 3RSZA 2VA8A 1CS0A 3OX3A 4QWMA 2HO4A 3NC0C 3WWDA 5LOVA 1YGPA 4ZYVA 3OC0A 3FHTA 3IUYA 4QPJC 4EFKA 3NKVA 4IDAA 1XZIA 3NBZC 1IY2A 4IQGA 4RHXA 4QPCA 1SCUA 3MLEA 4KQ2A 1KAOA 3C8HA 5JY1A 4QDXA 3ABRB 1P9RA 1TTQB 5E6UA 2ZK7A 2ZDQA 2W6NA 4ND2A 4EHBA 1GQ2A 4KPFC 3WKAA 2P78A 3G7UA 4X41A 2C03A 2VRCD 3TPZA 1LZKA 2ZR9A 1XCPA 1Z7YA 3L7BA 4HHEA 4PBRA 2PD6A 4AXBA 3DVLA 1Q0SA 3W4KA 1JFSA 2ASEA 5DJ5A 2LKDA 3MIIA 4IV0A 1ZA2A 1ZJJA 3H4VA 3D8BA 3VR2A 5HKLA 4D44A 5JS6A 4KRXA 3I3OA 5I48A 2RGDA 3OE7D 3HM2A 5IVHA 1G16A 3GGGA 4TSKA 2XGJA 3BWYA 1I01A 4WK2B 2VYFA 1EK6A 3A1DA 3K0EA 4MNTA 3RG8A 1GFZA 3QEOA 1A4XA 5IJAA 3W4IA 3W6NA 3HCOA 1WUIS 3CLRD 3EGOA 4IZHA 1K6MA 4IWNA 2X0IA 4E1VA 4JI6B 5A5VA 1TM5E 1LQTA 1X3SA 2HPZA 4G9GA 3OOEA 4Y2YA 4DNOA 1FQWA 2GF0A 1SQ6A 4W1PA 3LP5A 3WGZA 4P7JA 1OFGA 1M34B 3F3YA 3E4DA 4FMCB 2CMHA 1W5FA 4EFDA 1I3OA 3IBSA 4UULA 1RFGE 1D6JA 3OX2A 2IUTA 5JSZB 2W2PA 3D8UA 4R0VA 3D3EA 1ZIYA 2XDWA 3VVBA 1E6KA 1RJWA 2WFAA 1S5PA 3HBJA 3I0MA 1XKQA 3HZOA 4L76A 4JYZA 2P9EA 2XA2A 1ZU5A 4LS3A 3VNAA 2XMBA 3LTNC 2P9TA 4MUJA 2A9VA 3OETA 3LU1A 3SQDA 4IIFA 4Q15A 1TZBA 3ITDA 1SC6A 3QJ5A 3EDYA 1EP3B 5CX1B 3ZWCA 2QTRA 1G20B 4HFMA 3TQCA 1MLDA 1UPXA 2JK1A 1WG8A 1KAQA 1LSJA 2IUYA 5REQB 1U31A 4BEVA 2QT1A 2QY6A 3T9AA 4DKXA 3IUMA 3K0AB 1WEHA 1K7FB 3O75A 1HT3A 3K5IA 4GBGA 4LWOA 4NIMA 4UEQA 1KAGA 1VQ1A 1QCCA 1U3TA 1WZNA 1T6ZA 2JVJA 3ICVA 4W9NC 4Z3DA 3SKXA 5JFTA 1F9AA 5L3VA 3QX3A 1Q5PA 1ZEJA 4TMXA 4I66A 3LQ4A 3B6KA 5AJTA 1A72A 1F3LA 1U6KA 2I78A 3HWWA 3H8WA 2OWDA 3OWXA 3HK2A 4MUYA 1FTSA 1XZJA 1UDAA 2JIZA 1K86A 4RVDA 2WHPA 4G0QA 5C1OA 1Z82A 4EY6A 1SBYA 1U81A 1BX3A 3BDAA 2YW2A 2CXTA 4XVHA 4Z9YA 4D02A 5ITZA 3KPYA 5JNWA 2GN9A 3T3MB 3LH5A 4IILA 1XELA 3PDJA 2ZIFA 2I33A 3HA2A 4MKHA 2OORA 2R1TB 1ULUA 3H18A 4MCJA 4HVAA 5L7TA 2CNOA 4QPZA 1HNZB 1R0XA 1W581 4DHWA 2HLDA 3IUPA 1T5BA 4LJYA 1GTVA 5M3BA 1CP3A 2OHIA 2PTGA 3ZDZB 3PZBA 4OHPA 2ZM5A 2GJ4A 4AXXA 2FWJA 4I5IA 3SJBA 2Y66A 4MS3A 5GONF 1LFAA 2VI5A 2PDAA 4MB2A 3GJ7A 2OC9A 3H2YA 4XD2A 3T0IA 1DZ3A 4FXOA 1ZJZA 3GJRA 1W4LA 5I7FA 1YOVA 2AR7A 3CNOA 4RSHA 3FYUB 4PGFA 2GFQA 2P3QA 4CT0A 4HAIA 4MWTA 3ZQ4A 4JX8A 4OCZA 4X8LA 4CKCA 2P6OA 4GOOD 4HOYA 2VXCA 2I1VB 1C1DB 1NN0A 5HG0A 5B7GA 1NVGA 3QZUA 2COKA 3O0DA 4JVNA 3DEIA 3SC2A 2J45A 4GF5A 4WMLA 1GV0A 1H0KA 3FIUA 2FR1A 3O6VA 3PC7A 4RV5A 2YFYA 3CM0A 4RTJA 1MB9A 2POQX 2QTWB 5DTIA 3O4GA 1M1NB 1QONA 3M1IA 4FYHA 4KVGA 3TDMA 2PU5A 1P4HA 1MN6A 3O8OB 3R7WB 3OFSA 3SF0A 3EC7A 3QX8A 1PSWA 2OCLA 1WE2A 3HYRA 5F2NA 1TKBA 2WVAA 4O4JB 4PQGA 2JCYA 2I6UA 2QXTA 5DM70 3R9WA 4W5NA 2ORED 1NW4A 3WQQA 1P7ZA 3D5EA 3BFXA 3E5HA 4QYIB 5BSRA 3RBVA 4B46A 1WMBA 4RCZA 1BX1A 1KI3A 2B35A 1NG1A 4AP5A 1Z2CA 4IJVA 3EOAI 2ZWPA 3JZFA 4UNSA 6GPBA 2GCGA 3BH7A 4OK5A 2WWIA 3WMXA 2B2NA 2PO5A 1XTPA 1KU0A 3NATA 5ES3A 2Q5OA 3GUHA 4RM2A 3N0TA 4BNDA 4BE9A 2YBEA 1V96A 1OOEA 3LBYA 3LKBA 1TJ5A 4UQOA 2D5IA 3DFUA 5E3IA 5FOTA 1R0ZA 5I3ZA 2MSWA 4HGQA 3OSUA 4ONEA 5JI2E 5DYYA 2WM3A 3E9MA 2WW8A 4O2AB 5EWJB 4NF2A 1V3TA 4EM6A 4IHQA 3EIOA 2F9MA 3IIJA 1O94D 2VP5A 1ISFA 2WJ6A 5HUJA 1UC5B 3EFBA 1IEQA 1W5TA 5EUCA 3LUAA 2OBXA 5K3EA 1NQ5A 4BVKA 3D3NA 2WSSA 3KDSE 4UHKA 1A97A 3EAFA 4F5ZA 1JYFA 5HIKA 4MVCA 4H16A 5E95A 3WMGA 4ZK6A 2HQRA 1CUBA 1TXGA 3O38A 4W9RA 4Y2GA 1YZFA 3JALB 4DAOA 1T35A 4F56A 3PXBA 1WNFA 4IQFA 1R0RE 4IGFA 1ZNZA 2ZUVA 1DSSG 2AFHB 3ZVMA 1I24A 4OHKA 3V4VB 1TI7A 3I6YA 4FLFA 1YJ5A 2C5BA 3VPAA 1YJAA 1DQRA 2RGYA 3RTGA 3TGPA 3FCSB 4HDNB 3HN6A 3UNXA 2CE7A 4QHYA 3KQYA 3BXPA 2W8ZA 3EGCA 1XGKA 2P2ZA 2V98A 4OBBA 4O8ZA 1NONA 3G79A 2ZJZA 2PAAA 1P0CA 5EZYB 1G8SA 4RPHA 1WKVA 3GZNB 5KTTA 2XVZA 4F5EA 4HNUA 4N5LA 4L73A 2FGKA 4K9NA 3PHCA 4EDFA 4MUBA 2JFZA 4Q9KA 1UZLA 4YCJA 1UKAA 5FB3A 1JDSA 2BFFB 3IEUA 1E4YA 1T9GR 2Y3IA 4PHCA 4YAFA 1AZSC 1PZGA 2DWUA 2JCSA 1A2OA 2H00A 2VPYA 3B5EA 4C30A 1ODCA 5KTRA 3VR6D 1NWCA 1JQKA 4KIJA 3SS8A 3ZLJA 2EX1A 3M34A 4F46A 1ST3A 1AZWA 2I1WA 5E1DA 5G1NA 3T3EA 1FMFA 4FTWA 3W8NA 4EZIA 3PXGA 2JD0A 4MRAA 2HHHB 5BYJA 3F7MA 3LLVA 3KQNA 3L7YA 4DWVA 2IVFA 1DJMA 2PGXA 1F20A 1CJCA 1GTRA 2FJPA 5A04A 3NP7A 3ZLVA 3ZYCA 5L95A 3RBZA 4FB4A 4L5BA 1WS6A 3AL0C 4Q9JA 5F1PA 4H59A 4HMOA 1HE2A 1OWMA 4HJRA 1KEEA 3GFVA 3WLLA 3GJ0A 5JE8A 3R9XA 2X5NA 1XAJA 4MQ5A 4TKZA 4F71A 1URPA 3EAQA 2PXAA 1ISRA 1QG6A 4CM1A 2R79A 4M89A 3AERA 3R7SA 1DAOA 1E1RD 4DWOA 5GMOA 5LWQA 1PBNA 5LYJA 3A4IA 1XI2A 2SHKA 3SX4A 2LD4A 5HUQA 1T5SA 1K3UB 4MCAA 5DZSA 4EJ6A 4F3CA 2O8FA 4UBMA 1I5EA 4UHDA 5JSKA 3DFZA 1BROA 5BSTA 4K9MA 1T0BA 2R4QA 3GIWA 3FMOB 3KQPA 4BV2A 3TZ6A 2QROA 4LGVA 1T4CA 2IYSA 3FYDA 2C4UA 3QU5A 1B26A 1W85B 2VP0A 3F6RA 4L74A 4BMCA 4TVOA 3AL2A 3L0PA 3T9BA 1XAIA 2R8XA 3EUFA 1BD4A 4BFVA 3R3UA 4F21A 4C0KA 4OL0A 4DR1B 1XRJA 5GJCA 1R4NB 5JQGB 2M6KA 3RYIB 4WZBA 3K1AA 3ZV5A 1QJ4A 4JY7A 2VUTA 3RRZA 3WIDA 2C7RA 4P4SB 2V45A 1JPUA 4UMEA 2GTIA 4HDSA 3UMVA 3DC7A 3MYYA 3COPA 4QT0A 2F1RA 2P6MA 3EZ6A 4HB4A 1I4WA 4HGNA 3LZDA 2WAAA 2XQKA 3PNPA 4OPMA 3FPLA 1BXGA 5IDWA 4ZANA 5SYNA 2EV9A 2VT6A 1DX9A 1NC1A 5EJAA 1R9NA 4ZI3A 2QPOA 2CZCA 1JNXX 1F3OA 1YACA 4MWDA 3OZIA 1ZOSA 1T3SA 2GN1A 4Q3BA 3ASYA 1RYEA 2QNBA 3IQGX 5DGIA 5E7IA 2GPBA 3G5TA 3RJTA 4G85A 1DJQA 2JFPA 5KYTA 2XUAA 3WGGA 2WTMA 3DBRA 3BZBA 3NZEA 2GYVA 5JS1A 3KAQA 5JXIA 1I5OA 3L0IB 3ZX5A 2X9GA 2HSJA 4C6RA 2P9HA 4F4JA 3P9QA 4J0HA 2MT9A 4IX1A 4RZUA 2O5CA 3P4UA 3T3IA 4E22A 1P2VA 3WIUA 2ZSHA 4C4SA 2B1JA 1N5JA 4MQBA 1DDOA 3WLQA 3T6KA 4LNAA 2BJWA 1Y7TA 1XLTA 3IALA 3AINA 4OL9A 4HL6A 3INTA 3OLWA 3QUCA 4EF4A 3LKZA 4I9GA 4RZHA 2EZ8A 2YNMC 1NRJB 1ACLA 4AY2A 3OQHA 2N1MA 5DE3A 1XJ0A 3NNSA 2OGTA 2DJIA 1MQ9A 2FPPA 1Y7HA 1XXHB 4AW9A 1HDYA 1Y1KE 4E1BA 3TPCA 3C48A 4HUQB 4RZXA 3FUVA 3FBTA 4WLFA 1IY1A 3IR6A 5COBA 4DG8A 2P67A 1TA4A 3ECSA 1RT9A 3KQTA 4HN4B 4OM8A 4PHGA 2FX3A 3I1YA 3LVBA 3A3PA 4WCDA 3VNRA 3SVLA 3MLAA 2GBCA 2XIJA 2ZRJA 3ZHYA 1CB7A 1P1RA 1E58A 1T8SA 1AC5A 2F48A 3RS3A 1NUSA 4DMCA 4Q7QA 1GUBA 3KALA 3N75A 1G8FA 3IJ5A 3LXRA 1RAAA 1GU7A 2RAVA 4IIJF 5C1BA 4WK0B 4YJ3F 2DSNA 3E5NA 3K53A 1JPJA 4GPEA 2ZYGA 3RUAA 3IKTA 1PF7E 2DFDA 2ODWA 2RGUA 1E18A 2OQ2A 4XIJA 1HRDA 4Z9XA 3RAFC 2DJ5A 2J41A 2ONYA 2VSFA 1Q83A 3KTDA 3AFHA 2PBZA 3BRQA 1B6RA 1DRUA 1JLRA 1OIVA 2J0VA 4FIZA 4HJXA 1SC4A 4M0FA 4OLHA 3CUKA 4REMA 4RK1A 4BCDA 4XD7A 4P3OA 4D4IA 1WEKA 3GGSA 4XWOA 1X3LA 4QUGA 1S3IA 1WY7A 1X87A 3NR2A 4EELA 3MN1A 4Q1BA 2SKCA 1KOFA 3H2BA 1FF9A 2IPAB 4LY6A 2QHXA 3PYXA 3ZWBA 3R3ZA 4CXMA 3PR1A 3DEFA 1YC2A 1MF7A 1PN3A 3FCCA 3KCQA 4IXWA 3RQIA 3U62A 5TMEA 4YDSA 3UMMA 1Q16A 1T2EA 2GBLA 4L3VA 2C77A 4KRGA 1WHSA 2VF4X 4NZYA 4EPWA 1BCRB 1FXWA 4RENA 2ZUBA 4ZQIA 3GEBA 3AQIA 3ANYB 3I2HA 1UM8A 1QO7A 4PW0A 2HSDA 4HATA 4MEAA 4WNAB 4QEKA 2ANBA 3MWKA 4A8HA 4PXAA 2I7CA 3IP9A 4RZSA 5JXWA 2IYOA 1QIEA 1GDHA 2W4MA 4NV1A 4LKOA 2HMVA 4OX9B 1Z29A 2J9RA 2YBDA 3AF0A 3ND8A 4GG1A 4X8HA 3U9SA 1RRPA 1L3CA 3ZZ0A 1E5DA 1ULZA 3A28A 3PQCA 4FN5A 3RV3A 3INYA 3PITA 4LDPA 1C41A 1E9VA 3ONWA 4L7VA 2O2IA 5DX1A 3H6KA 4D0SA 3AEZA 3ELDA 1E9EA 3IAS6 3TCXB 5KTYA 4DLPA 1WZUA 2NSYA 4O2LA 4Y0VA 2QR5A 1DS6A 2BM1A 1XZPA 1V0JA 3BQMB 4GKJB 1M6WA 2X7HA 3N87A 1J2EA 1YVUA 5CH3A 4WPGA 1R8JA 3SE0A 4CM9D 1FVHA 2P30A 1YVEI 1G1MA 1CR4A 3ZDQA 3L46A 1U3DA 2YYAA 5L7YA 4BZWA 1NQAO 2E87A 1SUFA 4PLCA 4XUGB 4NMWA 5DHSA 5E9AA 2C3OA 3LUCA 1ZCAA 1ZBDA 3BE8A 4TMTA 3AZPA 4J0GA 3MMXA 1BCSA 1IBSA 3GEPA 2I87A 1GD1O 2HCFA 2IXTA 1H6CA 2BZGA 3QQPA 1AIPA 1K2WA 1CZKA 5KYUB 2OLKA 3TVDA 4G1MB 3B6MA 3DV0A 3GLIB 4V03A 1GAEO 1EE2A 1P2FA 3DZGA 4CKEA 1EUQA 4IDEA 1C0LA 2H7YA 3V6LA 1PX2A 5J2UB 3P2OA 3K70B 4TZ0A 3N0VA 2V7WA 3REOA 1O96B 4O4HF 4D41A 1Q12A 2ZB4A 5JCPA 1AHIA 4GD3Q 3MWJA 4HVTA 2EFEB 2BCGY 2IH5A 1F8GA 1J9GA 2VYVD 2FZGA 1HA3A 3OWHA 2BP7A 3Q7IA 121PA 5FPPA 4DJAA 4JQZA 1C3JA 1T15A 3O2JA 3KOZA 1IN7A 1Y8AA 4PAGA 4RO0A 2R7LA 5B36A 2ZTUA 1ZPDA 4Z99A 4FZJA 3PUXA 2ERYA 3IHTA 4M55A 5LMZA 2AJCA 5LSAA 2H4XA 3K9FC 1TW2A 4XWYA 2YJ6A 1ML3A 4M8SA 5FBVB 3VPBA 4FDAA 4GMDA 4TL7A 3D3KA 1NPDA 1TF5A 1CDDA 1YR2A 3QYPA 3GLHB 5EA2A 3V2HA 2OD9A 4MIEA 2QQ5A 4N6NA 3FWHA 5IABA 2W83A 1QG2A 4MV6A 3W9SA 1DRKA 3SKVA 2CDBA 1T0JB 3L7IA 2BMDA 2NTJA 2NT3A 4YV7A 6Q21A 2WWGA 4B6GA 1YZYA 3EG9B 3FPCA 4KYUA 3FDJA 1DAHA 1FOEB 1OZHA 2JKZA 1X7XA 1G7RA 2QORA 4QREA 4ZV9A 5K0FA 1THZA 3FF1A 4MPJA 5D3MB 5KI6A 4RSRA 1U5AA 3QKUA 3ZBPA 4OHYA 4ZVSA 5EZ6B 3OAAD 5BWMA 1KTIA 2NMVA 5H81A 1Z8HA 3AEKB 3H6GA 3OZEA 1R8YA 3LWBA 3M33A 1CUSA 3TLCA 4XYLA 4DV0B 3GQBB 3WDMA 4GVXA 4PYRA 2CJWB 2NVOA 2TECE 2WUGA 1Q1NA 1W36D 4E4TA 3IGFA 4NP6A 3UW3A 4JB2A 2MTBA 1FPMA 3SP1A 3D8SA 1VL8A 3RU9A 5LU9A 4U7GA 4TROA 3D7MA 2XBMA 3NM4A 4GZ3A 3HBLA 4FNMA 1NFQA 4IGEA 3RAPR 2ZRIA 4JT4A 4A16A 2XKKA 2PUHA 4DQUA 3Q7TA 2GI4A 3ITNA 3ILHA 4HPXB 2ZXFA 2XH8A 3NBUA 4KAJA 1WUYA 4KAAA 4OO3A 1FL9A 1E2FA 5CM8B 5FEMA 3SX0A 3KQWA 1XTBA 4FQ5A 3RW9A 3ZY6A 2CXHA 3I9V1 1P1FA 2CVOA 4K8OA 4AX4A 4BNVA 1N0WA 3C1AA 5KTKA 3OY7A 3DVSX 3ZE9A 2EIHA 1MABA 2VAVA 2G07A 4BKQA 1P3DA 4OHRA 3Q8XB 5CIWA 1LRKA 2ZYTX 4EJSA 3N2EA 3D54D 5AOBA 1Z0KA 2OUIA 3H9UA 1YB5A 2HLPA 2YY5A 2WJAA 1N2HA 3ZDEA 4HG2A 3N3AC 3L6BA 4RL4A 3UZUA 4YRBA 4BKMA 2VJMB 3HFGA 4R3UC 1PYGA 1G8GA 3ZE8A 3TB4A 1B15A 2H65A 3GYBA 3SMQA 4DVGA 2WYHA 2WV7A 2J0UA 5M5BA 4LJ8A 1TKAA 2FUG1 4EOGA 3MINA 3PD1A 1Q91A 4TXHA 4WN9B 5E6SB 1WU8A 2GGSA 1RRKA 2OD2A 4LOKA 4F2PA 5ILOA 3H5OA 4FGJA 3KAKA 2OFOA 1JU4A 2Y0DA 2NPIA 1AS3A 1OGIA 4I9NA 4IHKA 4NAUA 5CA1A 4INAA 4E2FA 3EEBA 3OQMA 2D0DA 4R05A 4BO4A 2EFHB 4ZQGA 3C85A 3WY9A 1QH8B 5F77A 3GX1A 4GI1A 1OA0A 1SUEA 2QM8A 4KWTA 1E5VA 1Y8RB 2O0LA 2UYYA 3YASA 4DNXA 3HDQA 2JLUA 2Z30A 4WOKA 4CI0B 5JD3A 3IMCA 1AG9A 1QIMA 2WD9A 1R18A 1N3LA 4GM1A 1C9DB 1ZHFA 1PVVA 3ASZA 4HNSA 4LQCA 3EXFB 4ER5A 5C8YB 5K0TA 3FSGA 1F2DA 1OF1A 2PANA 1M2GA 4NCNA 3UJ9A 5BSFA 5GINE 5IKXA 4XRRA 4YONB 2H31A 3A1CA 3C3AA 5NLLA 4JI0B 1DT3A 4M1EA 1IM8A 3FTEA 4I8IA 4NECA 5I51A 3S0JA 1XG5A 2I6XA 5ALQA 1WXEA 4M1SA 1UIMA 4NS1A 5KWIA 3FAKA 4Y9UA 1LGYA 2C83A 1G8YA 3AHCA 1SCQA 4BUJA 4EZBA 1X0VA 1LUAA 2JFNA 3DONA 5K8VA 3IELA 3O8QA 4GGPA 4EF6A 4ESOA 1RRGA 2HRRA 4DUZB 1MC4A 1S96A 2HRBA 2OAEA 4I50A 1O8BA 3EWSA 1CUYA 3P26A 1QOPB 1QO0A 4PC1A 3CVUA 2WJPA 3V4SA 4BFCA 2VTBA 4JC4A 1L4NA 2VPPA 2NSLA 3B85A 4EENA 5GY7A 4ZYYA 1NLMA 2GLTA 4N7BA 5FQNA 1MV8A 4UVIA 2AYZA 2I3GA 1TW3A 1M2OB 2VCHA 3E4CA 3MELA 3L0SA 4LRQA 4RADA 3W34A 5BSEA 3VU0A 1GGEA 4MI9A 1T9HA 2DR0A 2XYGA 2TMYA 7GPBA 1GGFA 2IZ7A 4N0EA 3WX0A 1MOQA 1E7WA 5HW0A 5K8JB 3OTQA 2N47A 1PWEA 2QZ9A 1GYQA 4LQDA 4IMRA 4EW2A 1AUPA 2ADOA 5CGZA 4C7BA 5EJ7A 1LJLA 3L5KA 4ER3A 1UZMA 2GEFA 3M6XA 4EFLA 2RHMA 3QY9A 4LY3A 2FK7A 1PFUA 3UICA 4CKWA 4X1IB 5CVVA 2FXIA 4XFJA 4M0MA 2YWDA 3EWNA 3NQ41 3RE1A 1TLFA 4FKZA 2BN4A 4L50A 5T4BA 1FBTA 5FBRB 1YR9A 4Q82A 5DB4A 3WL4A 3T7KA 4GMXA 1K7XB 2PA0A 1KP2A 1VPLA 2JJMA 5FL7A 3PFBA 5BOSB 3OE4A 4YRLA 1T4BA 1NVDA 5JBIA 2X8LA 3DLPX 1CXZA 5EKTA 3ZZNA 2BR3A 4JJFA 4H6VA 3X1ZA 3FMIA 5DPMA 2VHVA 3EA0A 4I19A 2W6IA 1GPJA 4BNFA 1QP8A 1ODFA 2OCIA 2V97A 3IVAA 1FEZA 1ADBA 1GPAA 2Q6OA 5B3KA 2CXSA 3QEAZ 2C2GA 1U1EA 2IL1A 3HA3A 1NF9A 3I76A 2DPLA 4MV1A 2H9YA 4XDYA 1JDUA 1SUBA 1W8DA 4CVNA 5LVAA 3L8EA 1CYEA 4RMNA 1AN0A 4QJBA 1J8MF 1Z8DA 2RAUA 5LUBA 1WCIB 4C4OA 2WKQA 2WIFA 2WKRA 4EGQA 1YJ8A 1XZ8A 2AG1A 3JQAD 3KRTA 3UJCA 3N05A 1G98A 4DY4A 1FLVA 1GCIA 2Y68A 3K8YA 4WESA 5BWOA 1WULS 1VKZA 2OY0A 4A0FA 3AVYA 1E0AA 4I4CA 5H0IA 3TZQA 5HNKA 1UM9B 4ZC8A 2VDUE 3FI0A 4XJXA 3GQVA 4ZMSA 3QG5A 4JJGA 1IHYA 2OVFA 5AHRA 3LDHA 4EPTA 2X86A 1D6NA 1R66A 3QU7A 1KRWA 3WA6A 2F55A 1SVUA 2GRUA 3W5UA 2W6JA 4B3DA 4X6XA 1GEEA 1T5LA 3PDCA 2YXLA 2FRDC 5HKBA 3FETA 1E32A 1PL8A 3GO4A 4IYJA 3A6DA 4YAOA 1ZH2A 4BN5A 5AK3A 1D1QA 4ZODA 3OFVA 4JAVC 2HZ7A 3QENA 4UHJA 4CM8B 5KNCH 3DMYA 2ORVA 4G56A 3IOCA 1G8MA 5DMXA 1ZDMA 3BCHA 1SBNE 4OHXA 4WFJA 3VJRA 4ZZ2A 4DR5B 1T3LA 1ZG3A 2OO5A 3LCVB 2C61A 4N4AA 3QKSA 4PE5B 4QO7A 3TJMA 2DLDA 3EUWA 3RSHA 2GBIA 4ZMRA 4LF6B 2N3ZA 4KQFA 1IM2A 4R83A 1CVIA 2FSVA 2ZITA 1CLUA 3BRWD 3UBMA 1COWD 1W0JA 2JJYA 3KUDA 4MV0A 4YJ2B 1GZUA 1NOIA 1SO8A 1SN7A 1BH2A 3BSYA 3E6AA 5A2GA 4W5RA 2JJ1D 4OJKA 2CJYA 1GDDA 2P68A 5JUWA 4D57A 1HETA 2HL6A 4MUGA 1G1AA 2LCQA 3UAGA 1Z36A 1N25A 1PYOA 3FI9A 3I9JA 2YV4A 1TQ4A 4KXMA 1IG0A 3H8JA 2ZBRA 3LV8A 4NOMA 4WCVA 4AO8A 1XKTA 3SR4A 3JR3A 2BONA 4CCYB 2A9FA 5K8UA 1SOMA 3Q3VA 3QLEA 3DDUA 4RHEA 5AJWA 1COZA 4ZRDA 1UP4A 2JIPA 3FMGA 3C3YA 3PSAA 4LZNA 5CA0A 2G9UA 4DJEC 5ENDA 4ZKDA 1E99A 2QZSA 4B2LA 3UUGA 1BDBA 1TMGE 4TTIA 4AP6A 4DA7A 1FLNA 3K7EA 4BU0A 3MB5A 4H3SA 5JS8A 1YTUA 1D9ZA 4N40A 1FP6A 4PWZA 4NC9A 3UYLA 2C4VA 2GZAA 4YXWD 5HQ3A 3EZ2A 1XP8A 2MYNA 1S8OA 2BMVA 4GXQA 4NBWA 4BVEA 1IJEA 3DZDA 5K0GA 3OIDA 1EFRA 3WK9A 4Q00A 1ZR2A 2XAUA 1U8FO 1I3NA 2OV8A 3ES9A 1ML4A 1OYWA 4RPKA 4A1OA 5JROA 2MSEB 3WAKA 2JFXA 3L7JA 1SKQA 4EDHA 3IQZA 4MRMA 4B87A 4UTNA 1KZ7B 4TRNA 2CFSA 3V1MA 1T1SA 2E1RA 2EXXA 3VRHA 2FZEA 3G6KA 2H4HA 5EN4A 2WU1A 5KBYA 5DYGA 4BO0A 2VP9A 2BHLA 3ZU4A 2IODA 1GM5A 1Q21A 2X3FA 4H7IA 4J8PA 1GP2A 5C8ZA 3L43A 3D5TA 3I8OA 5ALLA 1EHYA 2MR5A 1XEXA 3BGVA 5FD8A 5A9TA 3ZBQA 2V6MA 2PZ8A 2ZRNA 5IDVA 3THRA 1A4IA 2VXBA 4LPSA 1SVMA 1RAFA 5AR1A 3G0BA 4UZEA 3K70C 5AVTA 5KX5F 2QI9F 1FFXB 4D9NA 1KH2A 2WJVA 1Z8FA 2ALJA 1XUOA 1MEJA 2WJ3A 2WIAA 3N86A 4Q16A 5HIMA 5KNBA 3PTAA 2CYCA 2IP2A 4L9AA 4C07A 4ISCA 3SHFA 1J22A 3CY6A 1LDGA 3TLMA 3LQ1A 4ZDIA 3AEYA 1H4QA 1FS5A 4JEIA 4JQOA 2OZVA 1QGDA 4IJQA 2B82A 1QRAA 2DUNA 3RH0A 5FCDA 1HDXA 1NFFA 1OLUA 4NFHA 3VR0A 4WE3A 3DAGA 4JQSA 1FSGA 3DXYA 4TVKA 2VQ3A 1C3OA 1T2AA 2PMCA 1H2XA 1V7ZA 2B6NA 2CLFB 1TFUA 2DF8A 2LNDA 2VPXA 3WWYA 3BSFA 4KIWA 3U4MA 4YPFA 3TSAA 3GRCA 2WMOB 4LI3X 3T52A 1FZQA 4LFAB 2RHCA 3KT6A 3ZY5A 3H9BA 1XCJA 4ISBA 2SKDA 4RIEA 3RIXA 3ROTA 4BP3A 3SKYA 2HN9A 1W76A 3D1JA 4U9IS 3C24A 1QHGA 2GO7A 3MWFA 3C45A 4XLLA 3TMKA 1W44A 3NJ8A 5LXTA 3KSDO 2NYVA 4NENB 1SB9A 2A57A 4XDZA 3ZCPA 3HPRA 4LYAA 4JUDX 5HF6A 3U0VA 1WKCA 2QYOA 4FSDA 3NTLA 1JWBB 2J7PD 1MQ8B 3CUSA 1F06A 2FN7A 3JQPA 1P8JA 2NO1A 1KI4A 2GHRA 3RFCA 4W5WA 3TK1A 4PRKA 4DPLA 3THWB 3S7ZA 3W2IA 3KOUA 3GUVA 3AKEA 4RELA 1QMPA 3O7WA 3WS7A 5A03A 5KWEA 3HJBA 4I1VA 2PZMA 4AUNA 3DC2A 1JIVA 2H51A 2PG3A 1V35A 3H5IA 3GG2A 4FOSA 4X60A 2YRXA 4POAA 2Q8QA 1YAJA 1J1ZA 2CNLA 2ZJ8A 3PQEA 4J0KA 2FP3A 4PS1A 3TLGA 1O1YA 1N2SA 1ORHA 1YE5A 2CF5A 1XLTC 1PUJA 5A6SA 3LTEA 3TYXA 3G2LA 3CKLA 1XDWA 5LLTA 3LLMA 4GL4A 1S1CA 3COYA 5D6NA 3GRRA 5TMBA 3RUFA 1SHUX 3SHWA 4D3ZA 3GU3A 4PG5A 4QXMA 4F5DA 3C8ZA 4X91A 1J8VA 3UHAA 2E4XA 3EGWA 3GP8A 1TCBA 3IT1A 1KY3A 2BGLA 3PCTA 4QQFA 1E1CA 4BO2A 3OSZA 3HJAA 3NHAA 4EVRA 4A36A 4P0PB 7ABPA 2MMCA 4AKGA 2HK9A 1GXSB 2IZ5A 1MVOA 1PW7A 2W5UA 4BZZA 4YBZA 4D82A 4WNYA 4F2HA 3ZTYA 4IO0A 4NONA 7ADHA 2RBEA 4FMPA 1DIOB 3B8HA 4FFSA 1Z47A 4C7OA 2ZPAA 4WT7A 4DMKA 4GXTA 3OZRA 4DZZA 3CX3A 1VPVA 3TQTA 1QNFA 4PX9A 2QRNA 1V71A 1YH3A 5A1TA 1DU4A 4UD6A 5TGZA 3EGXB 1YBHA 1QTIA 1WQ3A 5EE9A 1TL7C 2N9UA 5I8WA 4RORA 4Y30A 3OFND 3TUZC 2E89A 3C5EA 3ZC3A 3E27A 2PL9A 3HCAA 4KO8A 4E51A 3KYJB 1IPHA 2YV2A 2IIBA 2ZXEA 1MC5A 2PWZA 1RM5A 2M1ZA 1T5DX 1Y4ZA 1IEVA 1EFPA 4WNCA 2OOSA 4F2GA 5LU8A 1DELA 3DFMA 3CYFA 2GSDA 4Q4CA 3L79A 4ZAGA 2R9VA 5TRTA 5I47A 1PE0A 1W35A 1FU4A 1BRTA 2XRFA 1W30A 3LA6A 1SVIA 2E4VA 5LP6A 1B2LA 3NHMA 1YUBA 4JJAA 4JUBA 3WSVA 4JXJA 3EVNA 2QVZX 1CS0B 4Y6OA 3HY4A 5GV8A 2GBLC 5H70A 4CODB 3P9SA 5DWVA 5HOQA 1BG6A 2O3QA 5FUMA 4LX0A 3ZW8A 3NVMB 5LOVB 1LCIA 1OWNA 1K5DA 4LC0A 2DPMA 1KEKA 2C20A 2YMQA 4HLUC 5LMNB 1HDOA 4OVKA 4PFQA 3T7EA 4YUZA 3QVVA 5EEGA 1SCUB 1V8ZA 3IEKA 3K0HA 5ALRA 3JQ6A 3K32A 2W2QA 3LOPA 1UQRA 5E6UB 3ZHBA 3EPKA 4RZIA 3FROA 2RIRA 4YCNA 1FFAA 3H0CA 2J46A 4V0LA 5C1IA 1BHQ1 5KQLA 1CQXA 5KOHA 1E98A 3CW9A 3WGKA 2P6NA 4X8OA 2AI2A 5IAJA 1PUIA 3BX1A 4UD2A 4MQLA 2Q9BA 4B6FA 4C0QC 2F8MA 1IJBA 3KLBA 2Z9DA 1TYCA 4TKMA 1T0IA 5CEFA 5HR5A 1V95A 2ZBPA 3AYXB 1KQGA 3RVQA 3T1YB 5COAA 4GOKA 1CB0A 4YUXA 2YASA 3EVZA 5GVSA 3WMEA 2QLLA 3HB9A 1KIMA 3PJGA 1WPRA 1G7SA 1T8YA 2C07A 1P7CA 3ICPA 3MJVA 3Q7EA 4JCCA 1MRNA 5HJ2A 1W7AA 3VVMA 3TOVA 3USCS 2IZOA 3GF4A 4EMUA 1Z6QA 5EKUA 3H4TA 1Z2NX 2EBUA 1INLA 3AM5A 3MT0A 4KMSA 3TSZA 2CVQA 2J7KA 1CR1A 4TN5A 3RIEA 5JVDF 1TEHA 2QM3A 3ORYA 1YQEA 2TRSB 3K9BA 4ZA2A 3R7LA 5C32A 4E31A 4BKUA 5JU6A 2ONJA 3EZLA 1YR8A 1ZQ1A 2F67A 2FOIA 2JLBA 3MCZA 4EA6A 4HVCA 1Y81A 3W6ZA 5KPJA 3PGLA 4YROA 2XTNA 1XTJA 1ONBA 2PZLA 3U81A 1Y5NA 1H3FA 4U8GA 4CF7A 1DNPA 3J7TA 4FFVA 4BWFB 2O0JA 3L82B 4W5TA 2XYRA 5G0TA 1N57A 2YJ5A 1DIBA 5FO0A 3I9NA 2VAXA 5D3ZA 2VNHA 3F8WA 2R6JA 4U2FA 4ENVA 3I61A 4BQEA 4ZRNA 2XCTB 5LUAA 2Q3MA 4IPTA 1A9YA 1KDPA 4I2NA 2G7ZA 2NZVG 3KQSA 3U7QA 5BQPA 1D4ZA 1VJTA 2HA4A 3A04A 2YR0A 3T99A 4F97A 5FADA 1WB4A 5EJ6A 1RWVA 4AMUA 2O1XA 3AKCA 3CB2A 2EFDB 2O3SA 4KV7A 4WJZA 2JB9A 3AHIA 1QIJA 2XA1A 2WHPB 1IQ0A 4JP3A 1DXYA 3AETA 3D1VA 3AJ8A 1F17A 1GADO 3E15A 4UASA 4B83A 5BORA 5ITZB 1V5IA 4G0ZA 1EG7A 3V8RA 4BTLA 2A6PA 1O77A 3GZTB 3LBAA 4XGKA 3RK4A 1I2AA 4NU8X 4E2YA 5JADA 3MSXA 4QEDA 1VDMA 1Q0UA 3IQDB 5E4JA 1NQVA 5IYZA 1U7ZA 2VWQA 4R6XA 7MHTA 2FZVA 1CUCA 2HDNB 1ODLA 2ABWA 3WOVA 5CDFE 3G1TA 3CUYA 1GQOA 1GTMA 5IBPA 3TQIA 3C2QA 5KQSA 2JZNA 1EHCA 4MS3B 2ZP1A 1SG6A 2PKWA 3A1EA 3IDZA 4P3KA 1RHJA 3HCFA 1N75A 1NJ8A 1PT9A 2Z5VA 3QNUA 4XWAA 1K0UA 5G3ZA 1I1NA 2BEWA 3ERCA 3PRHA 1T91A 3OE7A 1YOVB 1EBUA 4R1PA 1G17A 3KPUA 2GBPA 3T34A 4ZC1A 3ZIDA 1KK0A 4KXNA 1PEAA 3MGGA 2QLJA 3MCTA 2Q4OA 4JA2A 3TM5A 5BPHA 5C4MA 3EPHA 4CKCB 2Q3LA 5GOZA 1PKXA 3OUUA 4QUAA 4X95A 1PT8A 2WHEA 3A70A 5WRFA 3L7DA 1RKQA 1I6WA 3SC2B 1G60A 1K6IA 2C9CA 3A37A 3NJRA 1CIVA 4RFVA 1U0EA 5FOVA 3SEAA 1RIFA 5KTOA 4Q9HA 4A2PA 4HCJA 2V0NA 1XTKA 4XKJA 4P81A 2HPHA 4II7A 1QQAA 1N2BA 3SWWA 4LV6A 5ADHA 5ANRB 1N1MA 4KXWA 2GKGA 2W48A 1HMPA 5AFSA 2ON6A 1JR4A 5CB4A 1H6AA 1U2QA 2XCLA 4IXNA 5I7RA 1QVRA 3GB9A 4HQNA 3VBCA 1CEEA 3MAAC 5IJXA 1WV1A 1T4GA 3D2AA 2DBQA 2IU6A 1XWWA 3I04M 2X2FA 3N76A 3RVOA 3TM4A 3FTQA 4F4DA 1GZVA 1USVA 1PRYA 1R6XA 1VGQA 2FF5A 3NANA 5DM1A 4C76A 4EJSC 1UBRS 5TVKA 1C30A 1JJBA 2VDPB 4N6GA 1J00A 2XVAA 1VDZA 4QOHA 3W04A 4BNDB 1TJYA 2A8YA 1ZMTA 3IS3A 3ZUGA 4ZYUA 821PA 5MN4A 1DI0A 1PJAA 4GIBA 2DP4E 2Q0QA 2IXAA 1XFDA 2I6SA 2XVYA 1L7VC 1S3SA 3OY2A 1GRNA 3RARA 9GPBA 1F7UA 1ZZGA 4E5SA 2GAAA 1MO2A 1JAZA 4HNRA 4QYTA 4E5PA 1VCNA 3QWFA 3Q5GA 4G81A 1U6IA 3G0IA 4YB8A 4C0SA 4RMIA 1NVBA 3UKDA 4KYIB 1RJGA 1IVYA 4Z7NB 1MB2A 2IQ5A 4K6KA 3NRBA 4L6CA 4UBKA 2RJ3A 3N2GA 1AY0A 2JLCA 2ZJ2A 3TQSA 4BJ5A 4Z49A 5A1JA 1J06A 2DUWA 3RGGA 1K66A 3SXJA 1ZJYA 1CD5A 5B55A 1IB6A 1HF3A 3KOXA 4MVJH 5J59A 2WKWA 2QMHA 1NR7A 5CGQB 3UFXA 1RIIA 5ALTA 3UG6A 4D80A 2V1XA 1YZVA 2HTFA 3FX2A 5B7PA 3SZUA 3K8ZA 3ZCUA 1ID1A 4I5DA 4ZICA 1JXMA 3OIVA 5GJWC 3GLGE 2PS0A 1GCGA 3D6MA 5KOYA 1ORIA 1A98A 4Q3DA 3DL7A 4WVLA 1GA6A 4ZOCA 2HQBA 4HI0E 3V3TA 3VAAA 3WBFA 3KJGA 4EEXA 3U56A 4PWYA 2NU8A 1PQPA 1NOKA 2OHFA 4UPEA 2BF7A 5EHXA 2FSIA 3BFVA 4PZYA 1B0AA 4KWCA 4WFKA 1GG5A 3HZZA 5ESRA 3TQHA 4Z3OA 4YT2A 4B4WA 1ZSYA 4BJ1A 1O03A 2FRVA 2P0YA 4D99A 4BWYA 2IHUA 2R8RA 3P4XA 3UAYA 3E84A 4BTVA 4WX2B 4RKWA 4AC9A 4EB0A 3ETHA 4YXFA 2MSLA 3X1XA 3SY8A 3ZVKA 1BAPA 4NU0A 3UOAB 2HR1A 1Y3DE 1E3IA 1Q11A 4RNCA 5DCLA 3PKIA 3UCEA 4BNKA 1ZINA 2HF9A 4EHDA 1JFLA 3OLVA 2DULA 3P52A 1TC2A 2FWNA 4LGCA 4AJOA 2C59A 1V39A 3IJRA 4MRNA 2WYWA 1S8FA 5ADVA 3C3DA 4B6SA 3BIWA 3VUEA 4JSTA 1E3DA 3PNQA 3CN7A 1U0JA 4EFNA 1JPNA 1EA5A 1S2DA 1T34A 1X94A 3KS9A 4KSCA 2R84A 3BERA 3HADA 2FQQA 2Z2KA 5T3UA 1E77A 1SZCA 1ONNA 3P71T 4PLGA 1XEWX 3HL0A 2CB9A 5CDGA 1E0SA 1N8KA 2B69A 2JANA 1GA4A 1A82A 2IH4A 1KEEB 4C0WA 3R9XB 3BK7A 3DZHA 4II3A 1ZD3A 2FCAA 2GPSA 3O4VA 5FR2A 4YWHA 2AFIE 1ILEA 1A27A 2I4IA 2EZ9A 2I4NA 5EP1A 4ZYTA 1FSFA 2NAFA 4XZ3A 4DE5A 4KN6A 5C37A 5KUTA 5LJLA 2C04A 4IIDA 3S2UA 3AERB 3P9YA 4TT3D 2XT9A 2ZB8A 3BGSA 1HFEL 2QTGA 3DKKA 4IO1A 3ORQA 4FQ8A 1RLIA 2GR9A 4RPCA 5ALFA 1H4VB 2XB8A 5C7IO 3VPHA 3AX6A 1U2PA 3PQDA 3DPUA 3EMKA 4EHLA 2DSTA 2R00C 4O1MA 1MB0A 4EAQA 1MHTA 3MJFA 3MWDA 1TDJA 1W34A 2OOKA 4IZIA 4UAVA 3A1WA 4DV2B 2HQ1A 1O94A 1GPYA 4PAOA 1T4CB 4IZOA 1L4GA 1OE0A 4EYEA 1UZUA 2ODBA 5F9MA 1GTL1 3L9XA 3M82A 1LVGA 4MQ6A 4QTZA 3V34A 2H1IA 1E8DA 2OPHA 3D2LA 3LUKA 1XQ6A 3REQA 1JQBA 1A2QA 3DLCA 2LE0A 1Z6GA 1VG8A 1W2HA 2PS9A 2PX0A 3B1WA 3L8FA 2GYUA 1UAYA 3J80A 2X23A 1JKJA 1RLJA 2X9VA 4WZBB 3OT5A 3K1AB 5C4GB 1QVAA 5HM6A 5JO0A 4P58A 3EISA 1N6LA 1H4TA 4BNWA 4HDSB 1Y4AE 4BFXA 4OHZA 4UUQA 2X13A 1EFAA 3BULA 4LRTB 4ZT2A 3VPXA 4BXOA 4OK3A 3JASA 1L5SA 3TG8A 1DG1G 3GCZA 1DJLA 3F9IA 3PJFA 1BXGB 5TF4A 4RQUA 3R5TA 4B3IA 3A25A 4OD0A 4BE7B 2I4MA 3ODPA 4UUBA 2YHBA 3E9RA 2MYUA 4HK4A 1LJUA 3QE0A 4DYDA 2OV2A 3M5WA 4DJJA 3FGZA 1WF6A 3DZKA 3RJZA 3C39A 4B80A 2JCBA 4UNIA 2ET6A 4IDBA 4WADA 4PC2A 2I4RA 4RGYA 1BRMA 1T2UA 3DBRB 4PG6A 4QOGA 5SZJA 3RUPA 3W2FA 3ICOA 2HTEA 1PT5A 2YN4A 4JEMA 3BFPA 1XKLA 4M37A 1ENPA 3VR6A 1UPFA 1C3EA 1XTZA 2FFQA 2HCBA 2COEA 1QGUA 4N5HX 4NYIR 2GRAA 2UVPA 3DV2A 5CNIA 5IKMA 1J0CA 1RLOA 4V0SA 3DE2X 3IHLA 3DULA 2QX4A 5IX8A 2JD1A 1U4OA 3KDAA 2FSVC 3D0KA 3WLOA 1V8DA 3G9XA 4PIVA 4CTNA 2IW3A 1H66A 3IILA 4R8VA 5LP6F 4P3XA 3T7SA 1N5MA 5IW8A 2J4FA 1GPBA 4LK3A 4NG4A 1X2BA 5JHHB 2PVCA 2HAEA 3DOUA 1VB3A 3N70A 1MX3A 3CSSA 3M8KA 4AYXA 2FPPB 2R6CA 1ZKDA 2BBTA 1J5EB 5AJZA 1PJZA 2PUCA 4Y2PA 5IAOA 2QL9A 1C7FA 1J97A 2G70A 3AJ9A 3BXOA 3SG0A 2BUBA 1O89A 4IYRA 1ZS9A 3L8GA 2GEBA 4TQUS 1YZUA 4Y6RA 2QUAA 3C7CB 1YFKA 1NI5A 1E9BA 1NRIA 2HMTA 2PMFA 1U4NA 1NQWA 3O9ZA 3U4QA 4H77A 1F6DA 4G5SA 3V8BA 4B0OA 2B4TO 2G9QA 2E9SA 2YVQA 4Y6GB 1ISGA 3QEBZ 3KKOA 2POCA 1I3KA 2P2CA 3OIWA 4DSAA 3QP9A 1NVKA 1Q1AA 3N59A 3WNDA 2Y1CA 5ADUS 4RA9A 3H9JA 3AFNA 3ACCA 3HO8A 3UT5A 4F7WA 4EUHA 2XJ4A 4JODA 3C87A 1RWKA 4EB6A 4ND8A 3UGKA 1RAIA 2UZ0A 1Y1PA 2OLEA 1CZNA 3P7MA 3PA8A 1BDMA 3W9BA 3JZAA 2P4UA 2HHLA 3ZXSA 4B7XA 2CLEB 2PCLA 2EBWA 2LP4Y 2G3YA 4JC8A 4G63A 1FNNA 3CB4A 2XT0A 4Z7OB 2LVBA 1EX1A 2V6BA 4WAUA 1NP7A 2B4AA 5AVJA 4LHWA 4DS3A 1RHUA 1W2GA 4Q5IA 5IFLA 2QQ0A 2BI8A 2XMGA 1MNQA 3EODA 4B34A 1RXUA 4U2EA 4R0NA 3MWLA 4F91B 2ZDHA 1ZMXA 3AKDA 3BPSA 1Y3HA 1WHSB 2NP6A 4YYEA 3DPSA 4E14A 3ZWYA 1WP9A 2OG2A 1JHQA 4FR0A 2GJSA 3D3JA 4GHWA 3TLAA 4DV4B 1N6IA 3GVHA 1X77A 3C8DA 3H5AA 1FVFA 1TU0A 1RW4A 1LPPA 4W99A 2QPLA 4BLTA 1GRRA 1R00A 1JHXA 2Q41A 5D5QA 3UTDA 1Z06A 1CUVA 4G8CA 3VAYA 3WNVA 4HFRA 3TLXA 1M7GA 3TSYA 3ZHVA 1OXKB 4NBUA 5HX7A 1RJ9A 4IDDA 2HK8A 1JQEA 4FFOA 5EZ5A 3SNKA 5TARA 4PINA 3NYIA 4ZPXA 2EOAA 2HQSA 4M60A 2IYNA 1RMQA 1IRXA 2WPDD 3TIXB 1SVLA 2FKAA 5AK4A 1X92A 3ONVA 3LVFO 3PUZA 1WQ1R 5B2ZA 2A84A 2GVDC 2MCFA 3SSAA 4ZI7F 4IVPA 1OH8A 1K5PA 3BIJA 1P4JA 3H19A 1I33A 2XZDA 9LDTA 1EP2B 5J23A 1H3NA 4V0KA 1GTZA 5IULC 1A69A 1YQ9A 5F23A 3URKA 4XB2A 4FNGA 5EFZA 4KFTA 1U0HC 3O74A 2WF8A 3U49A 3H5NA 3DOEA 4I1IA 1MGPA 5FDFA 1ESZA 1AJEA 1T9BA 1B6GA 4WXRA 2Z6AA 1GNPA 4X84A 1V16A 2L18A 4F4CA 1ZUHA 2P5UA 2P9FA 5DXFA 4BHTA 1FDIA 2H2GA 2XWBF 3II6X 5B53A 5I9LA 1B42A 3IDAA 3NIFB 4LVUA 1KYZA 3IQEA 4WECA 1L9KA 1OJ7A 3DOIA 5IDQA 3GAFA 2MYTA 4BQSA 1ZA1A 3ZWQA 1OVGA 4XYBA 3HU1A 3CZRA 3LQRA 1YQXA 1BCSB 2NOAA 2C9OA 3LD9A 4GR4A 3ZYZA 3KEQA 1BXKA 5CPFA 5J43A 1DXHA 4U7WA 1B6SA 1H5NA 1CVRA 1ZYUA 2B94A 4RNDB 3P0HA 4PAMA 1SOVA 3DV0B 1SIOA 3GI1A 4KB5A 2Q6LA 4XM1A 4ZCPA 5K0LA 1EJBA 1XRSB 3IUBA 1NWHA 5DI9A 5T67A 1U8UA 3U13A 4C2AA 1GEGA 3BHJA 1HV8A 4OXYA 2IVZA 1F2TA 1U0GA 2AQHA 2VHUA 4BNHA 5IC4A 3INRA 3L0BA 1A4UA 2H08A 1XRQA 4U7HA 5DTQA 3LCUA 1OH5A 2OBBA 4MQUA 5ALWA 1E9AA 2Y1XA 4J2TA 4P98A