1W8DA

Binary structure of human decr.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
294
structure length
288
Chain Sequence
NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL PRECURSOR
publication title Structure and Reactivity of Human Mitochondrial 2,4-Dienoyl-Coa Reductase: Enzyme-Ligand Interactions in a Distinctive Short-Chain Reductase Active Site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 97
structure length 288
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.34: 2,4-dienoyl-CoA reductase (NADPH).
pdb deposition date 2004-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1w8dA00
4A0SA 4R1SA 3JYQA 3PZBA 2B4RO 1W0CA 3H9QA 3BMOA 1XEAA 1B8UA 2O50A 3A4VA 3T4XA 5EPOA 1GEEA 4GPD1 3K30A 1C0IA 1LDGA 2E49A 4AJJA 2TMGA 4IQGA 1R0KA 3VHRA 3W8FA 1DEHA 1LC3A 2YY7A 1HDZA 3GAFA 3LC7O 1HDGO 1KEWA 2W2LA 4DUPA 1WAMA 2J8ZA 2CD9A 1EVIA 2PR2A 3G49A 2I5PO 5JO0A 1ZFNA 1X1EA 3WGQA 4ID9A 2W4QA 3C3XA 5ICSA 1Z75A 4YBZA 4B3JA 3GT0A 3RJ9A 5TSDA 3SBOA 4WEOA 1BG6A 2D3TA 6ADHA 5F5NA 3H8VA 2RH4A 3AWDA 3HDYA 3UCXA 1EZ4A 1ZMOA 2I99A 4AJKA 1N7GA 1YOVA 4O5OA 4KQXA 1WXDA 3S1LA 2AQHA 1ISMA 1DC6A 3AK4A 2R6JA 1P1KA 2JFFA 3GDOA 3H65A 3I4FA 3FHLA 1RJWA 4IS2A 4TSKA 4CMGA 3O26A 1VE9A 1E3EA 2G0TA 4FFNA 4BKPA 3LLVA 3QSGA 3WTCA 3V2UA 2GN8A 1BDBA 1HRDA 1JKJA 1EDOA 4TQGA 4B8ZA 1EFLA 4CMIB 8ADHA 4Z6KA 4UUMA 1NFRA 4YVFA 2QZ9A 4Z0HO 1QYDA 4CV3A 3IUPA 1GEGA 1UP4A 1VLLA 2BRUA 2QQ5A 3INRA 4LK3A 4XRRA 4FD3A 2WD8A 3F46A 3K2BA 5A9SB 4IMPA 4L73A 5DDIP 2PH5A 4NFYA 3ZWVA 2BFMA 5CG2A 3QVXA 2C5EA 3DZIA 1Y8RA 2EKPA 1UXGA 2ZQZA 2D8AA 1ZK0A 4Y9DA 4B3HA 3OICA 1QSGA 3GMSA 5A3JA 5T5QA 2NACA 4CUZA 4MVJH 1F14A 4U6SA 2EJVA 2X9VA 1L7DA 2D4AA 1DPGA 2PLAA 5ILOA 3JQ9A 3GVIA 1T1SA 2JCXA 2R2GA 3WYCA 1NM5A 2EKLA 5JCJA 4E5MA 4FW8A 4G5HA 4NIMA 3OEWA 3WLFA 2ZCVA 3WB9A 5FEUA 1GFSA 4LW8A 3BAZA 1U2DA 4JN6B 5U4QA 4CM9D 3Q9NA 3M1AA 1IZ9A 4UREA 1PGOA 1LLQA 4E3ZA 1NNUA 1NQOA 2PD4A 3ANNA 3CE6A 3PFWO 5A5FA 2DM6A 1I24A 1L1FA 3H2SA 4A27A 4YR9A 5FI3A 1Q1NA 4R68A 5JDCC 4XYEA 4R69A 1UXKA 1Z6ZA 1X15A 1DIHA 1XR3A 2C59A 5CEEA 4ROSA 2VWHA 4ZN6A 3JQAA 1WVGA 1MC4A 4E32A 1X0VA 2I66A 2P5UA 2BD0A 2Y05A 3NT4A 4J43A 4XDYA 3OETA 3WQQA 4JP3A 4HWKA 4GWKA 3TL2A 3BYZA 4IDDA 4PVDA 5JAIA 4U7WA 2VT2A 1D4FA 1LSOA 5CPFA 3OJOA 1E0DA 2J3HA 2Y1GA 3VPXA 3QIVA 4NBRA 1PGQA 3HSKA 5AXCA 4BNWA 1DHRA 3DAFA 3UOGA 5EQFA 1EK5A 2O7QA 3TZCA 1YQDA 5DULA 1ZMTA 2Y93A 1YS4A 2ZJ0A 5H83A 3U62A 4BKOA 3K8ZA 3MEQA 1I36A 1MG5A 4FOSA 3DAGA 3G3EA 4CM7A 3U4CA 1H94A 4BO1A 4GVXA 4Z0TA 4E13A 1YE3A 1BRMA 4RVHA 1PEDA 4D0RA 4GI2A 3H3JA 2EGHA 4L76A 2VZ9A 5BNTA 3F5SA 3AM5A 1B26A 4CUJA 3DMTA 3H9JA 4ZRMA 1DIAA 5G4KB 2CNBA 1KVQA 3OJ0A 3GRKA 1ZH8A 2VTEA 4RL6A 3DZHA 3S2EA 5A05A 3DAPA 5BR7A 1CQJA 4CMCA 1QG6A 3Q2IA 1FXSA 2Y1CA 4P38A 1GCUA 1ENZA 4O6VA 5T67A 5TX7A 5IF3A 5L7YA 3P2OA 4BNNA 2JKVA 2DBQA 4CLOB 4UVGA 3KB6A 2VCYA 2UAGA 1NBOA 2Y67A 4JXKA 3H7AA 1ZJYA 3KHUA 1DFGA 5EERA 4UULA 4A03A 4A73A 1T2CA 1UH5A 3GG2A 1PSDA 1QYVA 1NPYA 4RDIA 2FRDA 4AJNA 3VPFA 2J3IA 4NMHA 1O8CA 2Q1UA 1AUPA 4J1SA 3NRCA 1GD1O 1IUKA 5AYVA 5T57A 2YYYA 2FHSA 3Q6IA 2GZ2A 3NUGA 4FFMA 1WP4A 1QYXA 3I9KA 4IDBA 4OHUA 2PKQO 1WMBA 4TKMA 4GMGA 2VOJA 3RBZA 3VZRA 5G2OA 4RLHA 2EP5A 4NK5A 2Y68A 1PU2A 3KEQA 3ZV3A 4YPOA 1ONPA 4W7HA 1CJCA 1GAEO 4JX8A 4TRRA 4BMSA 5KVVA 1LDNA 3WX0A 1K5HA 3ANMA 1W73A 3OIFA 5KKCA 1DC5A 2JCYA 1P44A 3WYBA 1C14A 3HDQA 1UXIA 3HWRA 4K6FA 5HS6A 1KC1A 5ES3A 4FFOA 5C7LO 4BUCA 4MIOA 4IGFA 3TFQA 4XWYA 1I0ZA 3BHMA 3JQ9C 1ENPA 3C1TA 1LRJA 4XQGA 1E3JA 3D4NA 1GZ6A 1NHWA 3C8MA 4GX2A 1DC4A 2DU8A 2RHCA 5IDYA 1UJMA 2X5KO 3GZ4A 3JQGA 4MVJG 4D43A 5FWNA 5KVSA 2FZWA 4M87A 4P4GA 4PN3A 2EV9A 2FR0A 4C7JA 4EEZA 3AOEA 2WJPA 3WWYA 4R16A 3B1FA 3LQFA 3MOIA 4TRMA 1X7GA 4BO3A 1LSJA 2R00C 2DTEA 3HE3A 3CPSA 3JQBA 1VL8A 3EC7A 3PTZA 2Q49A 4R1TA 4GGPA 3GDGA 4BNIA 3E18A 2Q3EA 3BTVA 2DBZA 3VKUA 4D42A 3K5PA 2E48A 1PJBA 4I5EA 2UDPA 3E9NA 3KYBA 3ASVA 4BHTA 4D45A 5B4TA 3SJ7A 4UUNA 1T2AA 3UICA 3B20A 1TVEA 3KO8A 1G1AA 1UZNA 2YFHA 1KS9A 1XCBA 3IUSA 3QVSA 1KVTA 1UDBA 3OSUA 3PI7A 4D3DA 5JO9A 1SPXA 1NQTA 1QYCA 1DFHA 1I01A 3WIEA 1SZJG 4RPGA 2O3JA 3RWBA 3S2FA 3WQSB 1P0FA 3F4BA 4CV1A 2ZB3A 3OM9A 5GMOA 4YT4A 3TOZA 3GFGA 3HB4X 4BV9A 5F1PA 4EZBA 2D0IA 2X6TA 3D4PA 3UXYA 4YRAA 4YDRA 3D0OA 1IULA 4M54A 2BF7A 3TQHA 4TROA 3JQ7A 2NADA 3E9MA 4KOAA 5KJCA 4GKBA 4NU5A 4OH1A 1YL7A 4UVEA 1A7KA 1FK8A 3PP8A 5I9MA 3V2GA 4EI2A 4BKUA 1ZEMA 1UDAA 3I83A 3JD1A 3TN7A 2X0RA 4F3YA 2VT3A 1E3WA 4GWGA 1KVUA 3MJCA 1P77A 2Q2WA 3RFVA 4CM1A 2WMDA 3I52A 3MZ0A 1JVSA 1P1HA 3L9WA 2H9IA 1R0SA 1PQWA 1FDTA 4A26A 3ZV5A 3IS3A 1AHIA 1CQIA 2BFAA 4RQUA 4ZJUA 2O3RA 3ROKA 1HE3A 2YHIB 4BB5A 3NTOA 2QRLA 1CDOA 2ZATA 4R1UA 1AXGA 2J5RA 3NGLA 1JDJA 1PIWA 1X7HA 3VZQA 1NVMB 1TT7A 1XWFA 4GX1A 4AFNA 1YB5A 3GRPA 3BTUA 4KZPA 2XF8A 2VNSA 1H0KA 3ITKA 1DJNA 4IQ8A 3TF5A 1A71A 2FOIA 3LDHA 3FNHA 4WJZA 4IBOA 5KVQA 2NU8A 5B37A 3KOUA 1M76A 5I9NA 3OJEA 1T2EA 4B7UA 2GASA 2PGJA 3QWBA 3ZI0A 5IDXA 2NWQA 3QWFA 3DXFA 3VPGA 4ZQFA 2NVUB 1E1MA 4R9RA 3QQPA 5BNFA 1DC3A 3AI3A 4D46A 4NQZA 2NSDA 1HDYA 3S8MA 4WLEA 3C1AA 2VWGA 5A5EA 9LDBA 1GQQA 2Q46A 5DN9A 1B7GO 4K6CA 2POQX 4J7CA 5TJ9A 3PQEA 2VRCA 4ITUA 5B4UA 2ZB4A 2HMUA 3DMYA 1XU9A 4PG7A 1IY8A 1Y5MA 3CSDA 3PQFA 4ALLA 4CLDA 2CSUA 2BI7A 4BNYA 2EHDA 1CYDA 1KVSA 4EDFA 4TWRA 3O38A 4MKXA 3RUEA 5FYDA 4E5NA 1N7HA 5IXYA 5GY7A 5JY1A 3BHIA 4XYLA 6LDHA 4NFHA 4YJHB 1HSZA 3PJEA 1PJQA 2EF1A 4CM8A 3RBVA 3AOEC 2O4CA 3H2ZA 4WOKA 4WUVA 4BMNA 4EUHA 1T24A 2VYNA 2YW9A 4AJLA 5F3RA 2P9EA 3B1JA 4I5GA 2VTDA 2X5JO 3K92A 3DBVO 1JW9B 4Z9YA 1V3VA 4HUJA 2D5AA 3HNPA 3BMCB 1HEUA 1NXQA 2RCYA 4RO0A 3R3SA 1RM4A 3M2TA 3DOOA 3H6KA 5JC1A 2FWMX 3WDSA 4GAEA 4PLFA 4R4JA 1BGVA 1P3DA 1VJ1A 1PJSA 4MIEA 3E8XA 3TJRA 3W4KA 3HDJA 1Y8QA 3HADA 3KETA 4Y98A 1FDSA 3TWOA 4QTZA 3WNQA 3IKTA 2Q1WA 3CZMA 3HFGA 1U8FO 2WYWA 3MTJA 4PLVA 1CIVA 4FOOA 3FRJA 2X0JA 3LT0A 1MA0A 4XGKA 4WCFA 4TRNA 3EHEA 2YV3A 2QHXA 4NR0A 1LUAA 5IZ4A 4GSKA 1P31A 2P68A 2X1HA 2GO1A 5DOZA 1JAYA 2OO5A 3W4JA 2A35A 3ZU3A 4LCEA 3ROPA 3TOXA 2VZ0A 4PZEA 1NYTA 1C0PA 3FWZA 1Q7CA 2B5VA 4CM5A 4DTIA 5LC1A 4N5LA 1XQ6A 4PGFA 4RF4A 3NAQA 2ZB7A 1TLTA 1O0SA 1PR9A 4E12A 4F6CA 1R66A 2UYYA 3L4BC 3AFMA 3ENKA 3H9UA 4D0SA 2AQIA 3D7LA 1E7RA 2Z1MA 3VZSA 1S7CA 2NLOA 3EZYA 1HKUA 3P5SA 1J4AA 3PHJA 1C1DA 1PS0A 2B36A 5AXDA 2Y1DA 1E3SA 1YBVA 3ZWOA 4YAEA 1N8KA 1BXGA 1YXMA 5DBFA 2H63A 1E6WA 3PPIA 4RGBA 5I7EA 4KP7A 1P0CA 1LLCA 5DCUA 5C7OO 4AG3A 1C0KA 5JYEA 1M2WA 3KBOA 3LT4A 3UH1A 4RZHA 4NHEA 4RVFA 2NNLD 3ZN2A 3DWFA 4DGSA 2DLDA 2NM0A 5CDTA 1W4ZA 2V6MA 3KRTA 4FN4A 4IY1A 1I10A 2C2YA 3I9NA 4PLWA 3JYNA 4DQVA 3PGJA 2O2SA 1C1XA 2GPTA 4XYGA 3RROA 1OFGA 4IDEA 3ZNOA 4BNKA 2DFDA 3ETEA 2OP1A 4LMRA 1Q2XA 1M67A 2P9GA 2PV7A 1ADBA 2VHXA 3LF1A 4J91A 4RPJA 1HLPA 4ZA2A 2PWZA 1DJQA 4IZHA 3STHA 1PJ4A 5JDIA 2JAPA 1R4MB 1BXZA 3GH3A 3C1OA 2EWMA 3KYCA 3LC1O 4CODB 2YJZA 3NYWA 3ABIA 3D4OA 3O03A 3OMLA 4PG5A 3OP4A 1G0NA 1N2SA 5COQA 1N9GA 1JLLA 3EDMA 2WSBA 3BA1A 3D3WA 1PJ3A 1O5IA 5JAZA 3RKUA 2YQ5A 1WMAA 1H2BA 1JWAB 4ZD6A 3QA9A 4L4RA 2ZIZA 4J4BA 2O3UA 4UVDA 2QYSA 2NUAA 5KVCA 4Z9XA 4YJGA 3RUCA 4A2CA 4OSPA 2PGDA 4BO0A 2I67A 3PYXA 5EMHA 3T7EA 1GUZA 1Y6JA 3C7DB 3E03A 4YAGA 5TT1A 2ZCUA 2PTGA 1LTHR 1E7QA 1UR5A 2VRCD 3DONA 2CVZA 1X0XA 3DBHA 1YDEA 5EQDA 3ZZNA 3WYEA 4BNHA 5KOIA 4EYEA 4XQ9A 1XG5A 3OEYA 3WJAA 3Q11A 1TEHA 3LF2A 3W6ZA 2OL4A 4Q3BA 4PLYA 3I9MA 3I4CA 3WICA 2CDAA 4XIYA 4QXMA 5IZCC 4OOEA 3INTA 1B2LA 3P7MA 1CF2O 3K9QO 4TVBA 4W7IA 4AJ4A 5TIIA 5JE8A 4MVJM 4CMAA 2AG8A 1VKOA 1BTOA 1PL6A 5I7SA 4CQLB 4NDNE 3JD2A 1IHYA 5EJ2A 1YJ8A 2X9GA 1EE9A 2B4QA 3M1LA 3P2YA 3PGXA 5JXWA 5KIAA 1U1IA 2YV2A 3KYDB 5TT0A 4BO8A 1BW9B 1DRUA 1TT5B 2WYUA 4FCCA 4CM8B 3GFBA 1DFIA 3FTNA 4BGEA 3CUKA 4L4SA 2HRBA 4YJFA 1DIRA 2G5CA 3OH8A 1R37A 5A9TA 2AQKA 2O48X 3JTMA 3KEOA 4P22A 1LU9A 4M55A 4QUKA 3S2GA 4DC1A 3WSWA 2VHVA 2J3KA 4XB2A 4D41A 1YB4A 1GYQA 1QV7A 2IZ1A 2UUOA 3RQSA 1I2ZA 3B6ZA 2CF5A 3TRIA 3OQ6A 4BGUA 2IXAA 5JC8A 1WZEA 3ZWXA 4LSWA 4B4WA 3Q1LA 2W2KB 4YT5A 1UXHA 3PVZA 1DHTA 4FGSA 4J4TA 3VDQA 2GR9A 2WE7A 3VPSA 5U1PA 4F45A 5I7FA 1GPDG 2AXQA 4KTTE 5JFOA 1J0XO 3DBLA 4ALJA 3TFOA 2WD7B 3O8QA 2VYVD 3WFIA 2ZYAA 2I3AA 1RKXA 1N1GA 1F8GA 2V6GA 3ICPA 3DDNA 4ZVVA 3RUFA 3RFXA 4BGIA 2JCVA 5TNXA 5ADHA 3RUAA 2Q1SA 1KY5A 1RM0A 4LGVA 4KUGA 4ZQEA 4EGFA 1E6EA 4OOFA 1UUFA 3JYOA 1UP7A 3NJ8A 4E5YA 1AGNA 4FC7A 2BHLA 4DBZA 2NQTA 4OMUA 4CMKA 3LYLA 4AJEA 3VZPA 2XXBA 4PLGA 4QT0A 3ZV4A 1DXYA 2PD3A 2HK7A 4O1MA 4M89A 2EERA 1U7HA 3DBRB 1IL0A 2AE1A 3W6UA 4LSMA 4YQZA 1Z7BA 4CLRB 3PDJA 3IP3A 1PJCA 1K6XA 2PZMA 4YXFA 1TA4A 2PZKA 2Y0EA 4IINA 3WGOA 4OKIA 3F9IA 4KDFA 4UUOA 3W8EA 2H6EA 2C07A 4MP8A 4C4OA 5THQA 4E2YA 4J90A 1JWBB 2IXBA 4M1QA 4GSLA 4NJMB 4L4XA 2VNAA 1UDCA 3E5RA 1GZ4A 3Q9UA 1PJ2A 4EBFA 3FWNA 4R5MA 2HK8A 4Y67A 2VOEA 4BNXA 4YRBA 2NVBA 1PS8A 4TZTA 4AVYA 2FSVA 4LVCA 4E21A 4NBTA 2AA3A 2AHRA 2X9NA 2J6IA 2QG4A 4HY3A 2NV6A 2E4AA 3T7CA 4W4TA 2B37A 3NGXA 4NFSA 3OQ1A 3I9OA 3PJFA 1YO6A 2XOXA 3H5NA 2P91A 3NDRA 1PTJA 4J16A 4I5FA 1PQPA 1K2WA 2VRBA 3VPHA 5CHEA 5L95A 1Z73A 1ZSYA 1EQ2A 3AY3A 1MUUA 3RC2A 3C85A 4WLOA 1EDZA 3WGGA 4J1NA 4DIOA 4K9DA 2PZLA 3LVFO 3GNQA 2RIRA 2Y1EA 3NEPX 3JQFA 1LA2A 3ZNNA 4XGIA 4BVAA 4NZ9A 1KBZA 3LSYA 1HDRA 1VSUA 1ISFA 4NK4A 2HJRA 2O3SA 1U7TA 3UCFA 1H6CA 2FR1A 5TLSA 4O59O 1KEPA 1MC5A 1HF3A 2OZPA 2Z1NA 3AW9A 3JD3A 3LC2O 4L8VA 5FI5A 3WR5A 4CM4A 4UEOA 4EJMA 1H2HA 1P33A 3H9EO 3GF4A 1H6DA 1UP6A 2LDXA 3RC9A 5A02A 1AXEA 3JD0A 3QVOA 4Q3AA 4BNFA 3GZNA 5C37A 4PLHA 5TRTA 4EITA 3E1KA 3JYPA 1Z74A 4UUPA 5KJ6A 2P2SA 3GQVA 4MVJD 1VC2A 2HMSA 3GNTA 4DMMA 3JCZA 3EW7A 4YAKA 3L6EA 2GRAA 4DPLA 5B1YA 1K6IA 1SCUA 4AJHA 4DLBA 5EINA 3OFSA 3IIEA 4NBUA 1G0OA 3BMNA 4ND4A 1ZCJA 3OJLA 1R4NB 3AJRA 2X22A 3PZRA 1LDEA 1ULSA 1TI7A 4S1VA 3TZQA 4ALIA 5TS3A 3GUYA 2EGGA 1SAYA 5F21A 4B4OA 5BSGA 3I1JA 1GZ3A 1P1FA 5CDYA 3GEDA 1OOEA 1H93A 1YQGA 4E31A 5JCXA 3ROMA 3BMOB 1HXHA 1EBUA 3JQ8A 4D79A 1A4IA 5EL0A 2W2LD 5EIOA 4MINA 1LXCA 2P4QA 4CR8A 5K6AA 1HZZA 1PS9A 1FJHA 4INAA 4MIYA 1HDXA 1UZMA 3F4LA 1GR0A 4OKNA 5IJZA 1LNQA 4IS3A 2BI8A 4N54A 3GMDA 4YQYA 1N5DA 1SOVA 1VPDA 4HX5A 3WGHA 2OUIA 4E2ZA 4BL5A 4XX0A 3EZLA 2FMUA 2X23A 4CR7A 1GY8A 3ZNQA 2ET6A 1LI4A 2PH3A 4XGNA 1XELA 2NU9A 1YL6A 1YOVB 4WASA 3R6DA 2HDHA 2Y0CA 4GVLA 4PZDA 1BMDA 2UVDA 5MDHA 3Q2KA 3ZDFA 4MPDA 1I3KA 2C0CA 3AI1A 1YDWA 4U8GA 1LQUA 1EUZA 5ITWA 3TPCA 4EJ0A 1JKFA 4IGEA 4EEXA 2PGLA 3ULKA 1ZUD1 3QW2A 4PLTA 5TGDA 3A28A 1XQ1A 4RORA 1PR3A 1U9JA 2PFGA 3UN1A 1ZJZA 3I9JA 5B12A 1DSSG 5IDWA 3DO5A 4FJ0A 3VH4A 1DLJA 4HFNA 2B5WA 1DIGA 3R1IA 1R15A 3UHAA 4FS3A 3ZHZA 2F00A 5JBIA 4OXYA 3CTMA 5C5IA 3QWHA 4JJFA 1PQUA 1K0UA 4IJUA 5HWSA 4FFLA 2PKQP 1Y8RB 3ZHXA 4NBWA 2SCUA 5HM8A 1Y7TA 4TMFA 4YA6A 2FP4A 1B3BA 2EIHA 3GEMA 3H4VA 1X13A 1VSVA 4DRYA 2IEDA 3UKOA 1Z82A 1Q0QA 3RD5A 2Q45A 4BNUA 5JCJD 4FQ8A 1NX6A 3CIFA 1ULUA 2HKIA 2PZJA 1SNYA 2DTDA 4XYMA 4ZQGA 2HU2A 2GYYA 3AI2A 3JQFC 5G0SA 4RJTA 2F1KA 4I5DA 4CJXA 4BNVA 3FN4A 1I2BA 5CEFA 4I8XA 2I76A 2C20A 5L4NA 3GC6A 2OBYA 3KSZO 1EFKA 1IYZA 4MVJE 1B8PA 3SXPA 4BKRA 1H9BA 2V6FA 3Q0EA 3WS7A 1RWBA 4RVUA 2BLLA 4HP8A 4RPKA 5IFLA 1A5ZA 3BZUA 4B79A 1CETA 4QECA 2J5KA 4DWVA 1ENOA 4GKVA 1HLDA 2CUKA 1ONOA 3JQAD 5A9RA 1T2DA 3MWDB 3FR8A 4MKRA 4P4LA 2OORA 2HSDA 2DBVO 4K1LA 4QFCA 5CEJA 2VZ8A 2CDBA 3JQAB 1QV6A 5L4LA 4S3MA 5CP8A 1ML3A 3ZV6A 3L6OO 1UAGA 2UV8A 3DMTC 2XPCA 4RVGA 4OO3A 1NQAO 1BWSA 4I9HA 1ISIA 3W8DA 3RI3A 2ZTVA 5COAA 1SEVA 4J3FA 4B8WA 5BNIA 3A1NA 2VWQA 4H16A 1XHLA 5T8KA 2Y1OA 1WLYA 1KOLA 4FBGA 3EYWA 4CM4B 2C7VA 2GGSA 3HDHA 3HUDA 4J2OA 3PXXA 1NFFA 2UUPA 3IQDB 4MOWA 3QHAA 3G79A 1JVBA 2XXJA 3A14A 1X14A 1SB8A 3GGOA 1XSEA 3FNGA 4N5NA 1WPQA 4QQRA 1HTBA 1T4DA 4Z3KA 3WJ7A 2JHGA 5DT9A 1JA9A 2AQ8A 4KWHA 1DOHA 1E7WA 3VAZA 1J49A 4WKGA 4FFRA 3FPLA 4OXNA 1U28A 1LX6A 4WOJA 4Q3DA 3IKVA 2E82A 2XAAA 3E5MA 3O4RA 1PGNA 3GY0A 3WMWA 4DBVO 4OXKA 4WLNA 1NQ5A 3FTPA 1I3MA 1K3TA 5IN5A 4FDAA 4FFPA 2YDYA 3WFJA 4AL4A 1QLJA 1RYDA 1V35A 1KYQA 2DQ4A 4TKLA 3VKVA 3PRJA 3RSHA 3SC6A 3DOJA 1GCOA 3GUCA 1ADFA 2X4GA 4JBHA 3I6IA 2YQ4A 4W6ZA 4UVHA 5IXSA 2GN6A 2C29D 3NDJA 4A5OA 2A9FA 2WEKA 2BGLA 1T25A 2ZJ1A 3GN1A 3ZHYA 1XKQA 1E3IA 4BQRA 2Q2VA 5JY6A 5JSFA 5K0ZA 3FF4A 2VUSA 3K73O 2PA3A 3L6DA 3N58A 3PWZA 3WBBA 3NT2A 4GH5A 4P4NA 1B16A 4H15A 4ZRNA 2O2YA 1IPFA 3PHLA 4PIVA 5DNAA 4CM3A 3K31A 1P74A 2FPPA 3JV7A 4QX6A 1E5LA 1ZSVA 3HZZA 3B1KA 3JQBC 2A92A 4MVJI 2BFPA 5ILGA 1H6AA 1PL8A 3U5TA 1JN0A 1CRWG 2B0JA 4YAIA 3FNFA 1D8AA 3FCOA 4JNKA 4O63O 3ADOA 1O6ZA 3RASA 3WGZA 2GUGA 5JMPA 1YGYA 2GCGA 4JIGA 4D3SA 5BSHA 1YRLA 4GMFA 1DBVO 2IZ0A 1B15A 3HJAA 2NU6A 5ER6A 3OA2A 5A3VA 2ZTMA 4A10A 1HDOA 1U3TA 4JLWA 4BGVA 1VM6A 2JAHA 2OP0A 3DTTA 3KXDA 3JQGB 3JQ6A 1WNTA 1FDUA 4R54A 1IZ0A 4CLHA 1YWGO 3GR6A 1D7OA 3FBGA 3HB5X 1EVZA 2YHUA 2FN7A 1LSSA 4BKQA 1X1TA 3AFNA 3DL2A 2B35A 2GD1O 1KC3A 1LJ8A 2BMAA 3GGPA 3L0DA 4E6PA 1Q0LA 2IDZA 3DC2A 1NR7A 4JCOA 4RF5A 1DLIA 2JFHA 2IODA 2Q1TA 3C7AA 1NHGA 3LLSA 4CLXA 2VHZA 2AMFA 2X0IA 2YFQA 5F1KA 3PIDA 2NU7A 3V1UA 3ZWPA 1F8FA 1P45A 2WDZA 3PFFA 1XLTA 2JJYA 1VL0A 2HMWA 1U4OA 4N18A 4CMIA 3F47A 5DP1A 3KSUA 1QMGA 4Z3DA 1EVJA 2ZTLA 4D3FA 2B4TO 4YACA 1NWHA 2AEMA 4WLFA 4DIFA 3GHHA 1EEHA 1HYEA 3INGA 5G4LA 5JNLA 1QLHA 5A9SA 2OBNA 2HAEA 3JQ7B 1D1TA 4MJLA 4XA8A 4ND3A 1VL6A 4U0KA 2OGUA 3KLPX 3TZHA 4ONEA 3H5AA 4BO5A 3E82A 3QWAA 2Y66A 2I3GA 5I7VA 2CY0A 4DLLA 2AEFA 2I65A 3D64A 4H7PA 4CMEA 4MDHA 3RVDA 2ZTUA 1BDMA 1E3WB 4GBJA 5T64A 3WOHA 5CG1A 3TNLA 2G17A 3N7UA 2B83A 1BHSA 2DC1A 1R16A 1T4BA 3CH6A 4IPTA 4RCVA 2Q50A 4I1IA 1E1NA 3NV9A 4M49A 4HV4A 1NVTA 3EUWA 1T1RA 1B14A 1V9LA 1ZXLA 4RF2A 3G1UA 3OF2A 4YEDA 4K28A 2DPGA 5CDUA 3F6YA 2W90A 1D1SA 4E33A 1VJ0A 2DVMA 3DQPA 1KERA 4OGWA 4LRSB 4AJ2A 1G6KA 2C54A 4YAJA 1NAIA 1UAYA 4DREA 1V3TA 3CMMA 2HUNA 4J7XA 4BNJA 3LZ6A 3QY9A 5CDSA 4GL4A 4CM6A 4B4VA 1EBFA 1GQYA 2W8ZA 3A06A 4L75A 1A7AA 3QP9A 4ND1A 5AVOA 3VC7A 1OC2A 3WIDA 2EW2A 4ZQHA 5JAMA 5DBIA 4IQ0A 2E6UX 3D5QA 3LK7A 3RKRA 4KUEA 1RM5A 2D59A 3DEYX 4ZHSA 4OSOA 1ORRA 1I8TA 1U5CA 1YONA 2HMVA 3GVCA 3ZWNA 3DHEA 5L53A 4Q39A 1HE2A 3QVTA 1CWUA 3CEAA 3COSA 4DVJA 2DFVA 4GQAA 1MV8A 2VHYA 1HWYA 4YYZA 1MB4A 5K9ZA 4PLZA 4IJWA 3GN2A 5HBRA 3AU9A 4BNMA 1YL5A 1K6JA 1F06A 3JQCA 3UFXA 5EN4A 4C7KA 4DYVA 4U0JA 4BO2A 1LRKA 2CDCA 3IAHA 3H3FA 3IL2A 3RCBA 1WZIA 2X58A 5JDCA 1E77A 1L7EA 2A94A 4LISA 1RM3A 3PDUA 2VYND 4GLOA 1BSVA 4FJ1A 2P5YA 3ON5A 3CINA 4BS9A 1JQBA 4D7AA 2WTBA 2Q99A 1HZJA 3ONFA 1Z45A 4FB5A 4O0LA 3GPDG 4JJIA 1U2GA 1A9YA 4K26A 4WCFC 5G4KA 1J5PA 4G81A 1M75A 3BMQA 4IM7A 5H81A 1Y81A 5DCYA 3AUUA 4YJDA 3GGGA 4GGOA 1I32A 4IIVA 5JPIA 5MGBA 4CL8A 4J49A 4J0FA 5DP2A 5FF9A 4U6QA 5JMWA 3G17A 2QYTA 3U4IA 4XYBA 5JW6A 2BGKA 4CLOA 2O7SA 2AE2A 1U3VA 2B69A 4HADA 3ANLA 3PLNA 1Y8QB 2C82A 4R5HA 1LDBA 4OJNA 3GLQA 5BSFA 3BHJA 4ALNA 3DZJA 1JAXA 3TL3A 4WNIA 2PY6A 3ORFA 1KIFA 3RAJA 1ISGA 1LDMA 2EXXA 3F5QA 7ADHA 4WCFB 2O3TA 4XD2A 4CQMA 3E6AA 1FDVA 1I3LA 4HKTA 3U49A 3V2HA 4EUEA 5KJFA 3FSRA 2VUTA 3AM3A 4NJOA 1DIBA 3AY7A 2HMTA 4QO7A 2IE0A 3OIGA 4J9UE 1PGJA 2HRZA 3L77A 2FY8A 2LDBA 8LDHA 2CMDA 3UGKA 1E6UA 3VTFA 4KMSA 3BXXA 5KJEA 3E48A 1E1LA 3UW3A 1ZW1A 1HYGA 2OXIA 4CMEC 1MFPA 4MVJF 3PHGA 4IXWA 3GG9A 3KZVA 3I23A 3RIHA 2Q2QA 2OFPA 5AXAA 1A9ZA 2IZZA 1C1DB 2VN8A 4CPDA 2J5QA 2JD0A 1JKIA 2PNFA 5TC4A 5DBGA 4ND5A 4PLPA 5GZ1A 1BXGB 3QJ5A 4LCJA 4XJTA 5JDIC 1HSOA 1PWXA 2GZ3A 3FBTA 3L4SO 2DUUA 1YB1A 5COBA 3IOYA 5ENVA 2D5CA 5C7IO 1XA0A 3IDSA 2GSDA 5DF1A 4J0EA 1ISJA 4WGGA 3SLGA 5G0VA 3ETDA 4J1TA 1BXKA 3DHYA 1ARZA 1GUFA 1XGKA 3V5NA 1NVGA 2DKNA 4Z9FA 3JD4A 2JL1A 1PZHA 1ZIDA 3DHNA 4LVUA 5KCZA 5L7TA 2GERA 1C1XB 5DZSA 5BT9A 3SC4A 3I3OA 1T26A 3PJGA 4MO2A 5ENDA 4E30A 3ENNA 3ICCA 3NT5A 1DDOA 1EQUA 4WE3A 5EESA 1PWZA 4KDEA 4QO8A 4DLAA 1DO8A 1E3LA 5L7WA 4DYDA 4KWIA 3TZKA 3I9LA 3U4HA 1P1JA 3UAGA 1GTMA 2VHWA 4R01A 3ONDA 1LRLA 2NTNA 3K96A 4B4UA 2DTXA 4I08A 4IIUA 4NU6A 3KYCB 1KEVA 4F6LA 3UCEA 3TSCA 4E2WA 3EVNA 3I6QA 2HLPA 5LDHA 1O95A 2X8LA 4IJVA 3W4IA 1U4SA 4ZU3A 3DZFA 1N9GB 2R00A 3D3WB 1FMCA 2AEJA 3EY4A 2E37A 4OM8A 2J3JA 1QYWA 3GNSA 5JAQA 4DMLA 2GDZA 5DCWA 4BOYA 4JP2A 3DFUA 4YJGB 1I33A 3NTRA 4J7UA 2V65A 3GVXA 4WLVA 1OC4A 5HRUA 2G1UA 4KTVE 4BO9A 4RVDA 4IDAA 4WNCA 1GPJA 4E5KA 3DBHB 3ZU2A 4XJSA 3TDKA 1GV0A 2GF2A 1ZSNA 2YDXA 3GHYA 3GK3A 4L0QA 1H5QA 3ZCXA 1YVEI 3UUWA 4Q3EA 4EUFA 1Z7EA 3I5MA 2O23A 3KV3O 3OIDA 4Q3CA 1PL7A 5L9AA 4UAGA 2DAPA 1TB4A 4Q3NA 3HQ4O 2YHIA 3DR3A 3CZRA 1ZEJA 2IYOA 1MXHA 4EJ6A 3DZGA 5CAEA 1A4UA 3E9QA 1HYHA 2H5LA 3JQEA 3SEFA 1GYPA 1XYGA 2GZ1A 3ZWYA 3PWKA 5KJ1A 3RUDA 1HE4A 1PJTA 1PZEA 5CPBA 2O4UX 1EE2A 3H5RA 1HE5A 4FC6A 4IJKA 4LRTB 2HCTA 4YWJA 4AJPA 5L40A 5G0WA 4ND2A 1IOLA 1Q0HA 2FSSA 1P9LA 1RPNA 1FF9A 3WSVA 3V8BA 2OHXA 1BVUA 1V0JA 3PYMA 4MP6A 5IG2A 4YJFB 5IAAA 3HN2A 3N74A 2C5AA 3KSDO 1DAOA 4DXHA 2EKQA 1RYEA 1IE3A 1LC0A 1U5AA 2ZK7A 3BMQB 2NVUA 4PRKA 2BKAA 2EP7A 4M8SA 4RQTA 1YBMA 1ZK1A 2QRJA 4L9RA 2ZYDA 3MJTA 4FGWA 3X2FA 4OQZA 3T4EA 4DQUA 4P8RA 1R6DA 2Z95A 2DPHA 4QEDA 2C2XA 5KNLA 4FPXA 1ENYA 1NAHA 4F46A 5GZ6A 4YT2A 5H82A 2CF6A 3WQRA 3PEFA 3DBLB 3ZWWA 4LN1A 2HK9A 3PWSA 4PRLA 1A27A 1ZO8A 2WE8A 3O8QB 3SJUA 4NPCA 1IB6A 4BNLA 2OOSA 1VI2A 4CQMD 1E7SA 1WDMA 2GNAA 4QSMA 2X7HA 1I30A 4DA9A 3F1LA 3AM4A 3GA0A 1A72A 1VJTA 5DOVA 3EK2A 3HG7A 2QIOA 4CQMB 4ZGWA 4YJHA 3IC5A 4TVOA 1QKIA 2CZCA 3KUXA 4PLCA 1C0LA 4FIZA 4XZ3A 5BSEA 1MFZA 2DBRA 3LU1A 4DPKA 1ZK4A 4PVCA 4IDCA 4XCVA 2D1YA 4ALMA 3AU8A 4CV2A 4XR4A 2JD1A 3Q3CA 3GVHA 3P19A 4XQEA 4JGBA 1NP3A 2I6TA 3WNVA 3BMCA 4LMPA 5KKAA 4U5QA 5A1TA 3D3EA 3RU7A 1E92A 1SB9A 3WMXA 1YJQA 3QVWA 4CMHA 4GX0A 2X0NA 1ZZEA 1OZAA 1Y5RA 1GL3A 4ILKA 5I8ZA 4RVSA 1KVRA 1OMOA 2EW8A 3AUSA 5JLAA 3WGTA 5ER9A 1T2FA 3MJEA 4OIMA 1LLUA 2WYVA 2IRWA 4Y6PA 3OJFA 3ZW8A 3RUIA 4WEQA 1CEQA 4HNGA 1Q7BA 4NH4A 4BB6A 5L51A 3IP1A 5BQFA 4Y6RA 1NPDA 1ID1A 4PG4A 3ZH2A 5A03A 2V7PA 1X7DA 2I9PA 2Z5LA 5C3MA 2JFGA 2CVOA 3IMFA 4URFA 1B3RA 4IZIA 1YBAA 4D44A 1NR1A 1EUCA 1M66A 3W1VA 3UF0A 2BELA 4XRGA 3OBBA 3MOGA 4WPGA 3VH3A 1Y9AA 1NPTO 1E5QA 4EW6A 4JBGA 5A4DA 3U09A 1D3AA 1KY4A 4W9NA 1QORA 5I8WA 1HL3A 2P9CA 1ONNA 4I9NA 1B0AA 1U3UA 3X2EA 2NQ8A 4WLUA 2CFCA 1R12A 1MG0A 4WK6A 2P4HX 3H9GA 4NG5A 3WBFA 5HA5A 3JSAA 4H3VA 2WWRA 3AUTA 1AHHA 4CV0A 4E4YA 3RFTA 1F12A 1R0LA 4JJGA 4PG6A 4B3IA 4QFDA 3WLEA 3G1TA 5KTKA 3WWZA 2DUWA 3C7CB 4IMRA 1MP0A 1VRWA 3AOGA 3VVBA 5ITVA 4PCVA 2BFOA 3GZNB 2HQ1A 3ZWMA 2FPIA 4RPLA 3WTBA 5B4VA 3L4BA 2PK3A 1GV1A 1GADO 1SO8A 1PGPA 5G0UA 4JK3A 5K6AC 2WM3A 4XDZA 1HDCA 1PJLA 1U8XX 1LEHA 2NTVA 3LT2A 3ASUA 4IDGA 2NVWA 4BNTA 1H6BA 5G0TA 4RDHA 4A7PA 2Y99A 4R1NA 4WECA 5AOVA 4AJIA 3BMNB 3TZ6A 5A06A 5U9CA 1ZK3A 1R4MA 1WDLA 2ZKLA 5KWEA 3PK0A 1ZNQO 4MVJP 2X86A 3ZU5A 5I9LA 4DIBA 5TQVA 2VQ3A 2HJSA 1IHXA 3QE3A 3DZBA 4BMVA 1TXGA 3DOCA 2RBEA 4UVIA 4CR6A 3JQ8B 2Q4BA 4BNGA 3AUAA 1QRRA 1NWCA 5THKA 4Y6SA 1W8DA 2AW5A 4G2NA 1Q7GA 4J9VA 4XEHA 4B7XA 3L9XA 1VKNA 4R3NA 1WW8A 4J2HA 1ADGA 3DTYA 1DAPA 3HFSA 4YB8A 3DZKA 2H1SA 3ZWBA 3B70A 4R41A 1LLDA 1F0YA 3K6JA 2JD2A 2X5OA 5TF4A 1Y1PA 4PFJA 3WG9A 4DL9A 4BNZA 1V6AA 2YV1A 2QRKA 4RPHA 3ST7A 2QW8A 4E2XA 3MJSA 5LCXA 1WWKA 1WDKA 1MGOA 1YKFA 3PHHA 1SBYA 3ITDA 1H9AA 4N7RA 3ZNPA 3DFZA 3QLJA 3ZW9A 4Y8VA 4DPMA 1LDYA 1I5RA 4J1QA 1PZFA 4Q9NA 1GDHA 2G82A 4CMBA 4CQLA 4HFRA 2VWPA 4G65A 1J6UA 2JHFA 3MJVA 2Y1FA 1E7YA 5L3ZA 5CDGA 3KYDA 3M6IA 4NI5A 1BW9A 1TT5A 2D2IA 3EMKA 2ZYGA 1LQTA 1SEPA 3SVTA 4OAQA 4BIIA 2BH9A 3ONEA 3OHSX 3EVTA 3VH1A 4JROA 1MLDA 5IN4A 5AXBA 3FI9A 2CVQA 3RC7A 3U3XA 5IZCA 4KUHA 4R3WA 3RBXA 1EMDA 3ZWAA 4DC0A 3ZGYA 3FPCA 2QZZA 4GX5A 1N92A 2IEBA 3NDIA 3GDFA 3WGIA 4TRJA 2W2KA 3SX2A 1ZXBA 1F17A 1EK6A 4OL9A 5ICMA 4RV9A 1KEUA 3BTOA 1N1EA 3NJ4A 4NBVA 1UXJA 3FD8A 2ZB8A 4XR9A 2WD7A 3EAGA 4J4HA 4W9NC 1Y9EA 4X54A 2GN4A 3PQDA 3VOSA 2AG5A 4GLLA 4MKZA 5CFZA 3JQDA 1V8BA 4OQYA 3U9LA 3VDRA 3CXRA 2VYVA 5T6BA 3R3JA 3L07A 2PKRA 4RF3A 3BIOA 1FDWA 4RZIA 5T8KC 3CMCO 1EVYA 2A4KA 4IUYA 3OA0A 4UEKA 2RHRA 1NFQA 2YZ7A 3FNEA 3MCVA 1QP8A 4M86A 3ZHBA 1M6HA 1SMKA 1ZVMA 3R0IA 4WCDA 3RU9A 4YCAA 7MDHA 3M2PA 4R9SA 4AJOA 3DBRA 1W6UA 3VVCA 4W99A 1E7MA 4CLRA 4FSHA 4OYRA 1BVRA 1CERA 2TMDA 4HBGA 2RAFA 5L4SA 5IDQA 5L45A 3MTGA 3D1LA 1B8VA 1PZGA 3OQBA 3A9WA 1P1IA 4YRDA 5LDGA 3NKLA 3FR7A 5F1OA 3CKYA 1QR6A 1O89A 1MX3A 2C7GA 2EG9A 4HFMA 3EGOA 4NJMA 2FR8A 4IDFA 1QXSA 3S2IA 4YT8A 3RC1A 4XKJA 4FR5A 3ZWCA 2BGMA 2FPGA 2EJWA 3QV1A 4RLSA 3GVPA 1ZK2A 3G0OA 1P1RA 2GLXA 4DQXA 5FFFA 4ALKA 4ZICA 4AICA 2DT5A 3HN7A 3JYLA 2O3QA 5A04A 1ZKMA 1GQ2A 1UZLA 4BO6A 1SOWA 4XIJA 1PX0A 1AE1A 3GAZA 4II2A 5AQ1A 3U4DA 1GUYA 2ZQYA 5TJHA 5F5LA 1IPEA 2ILTA 3PJDA 3PHIA 5J23A 3D5TA 3ZU4A 2OMEA 1NTOA 4BO7A 4BQPA 4IXTA 3NTQA 3WXBA 4II3A 4CM9A 1XDWA 4FJ2A 2HO5A 3PLRA 4CMJA 4L74A 1C3VA 1GU7A 1M6WA 1KETA 3RJ5A 2G76A 1DRWA 1I3NA 3MJ4A 4PG8A 4CL3A 3O9ZA 4TZKA 3KLMX 1AN9A 3KTDA 3MWEB 4BV8A 3GOHA 2PD6A 3QRWA 3F1KA 1MXFA 1EUDA 3QWIA 3V1TC 9LDTA 4YTEA 2FZEA 2RH8A 1XU7A 1LBEA 1SC6A 4CUKA 1JU9A 3ETGA 3ROQA 4B7CA 4JBIA 1NASA 1O9BA 1S6YA 2EEZA 3WGYA 1YH3A 3S55A 2NTJA 3IJRA 1GYRA 3LT1A 4CLEA 4KQWA 3F3SA 4R51A 2VUUA 1ZBQA 3NX4A 4ZQBA 5GZ3A 4Z0PA 4XQCA 3U0BA 3PIIA 1I2CA 3IJPA 4BO4A 1DRVA 3V1YA 2GN9A 1DB3A 2Y0DA 1ADCA 3PYLA 2V6BA 1O94A 4HNHA 3SLKA 5JYDA 1YQXA 4E0BA 4MP3A 5HS4A 1LSUA 2W98A 3KM0A 2IYPA 3HHPA 3KVOA 3UVEA 4AJ1A 1V3UA 3VH2A 5HTOA 4ESOA 4XB1A 3AY6A 4JQCA 2QX7A 1K89A 4MVJA 4PZCA 1JTVA 3ADPA 4UEJA 3RUHA 4HFJA 3GPIA 4I9UA 2Q4EA 1ISHA 1XIVA 3BTSA 4W82A 3C24A 1R4NA 4E5PA 4NNJA 1OAAA 1HETA 3DB2A 4N5MA 3K2EA 1E1KA 1OBFO 1U3WA 2YUTA 4J6FA 3GEGA 3OECA 3VTZA 1HT0A 1OI7A 4HXYA 5JS6A
chains in the Genus database with same CATH superfamily
4A0SA 3N8DA 2GAOA 1W0CA 2VS1A 3H8VA 2WWYA 3QBDA 3WZLA 5DWVA 3A4VA 3T4XA 2YR0A 2OHOA 5HZGA 4DA6A 2J0EA 3CN7A 3GUUA 3LCMA 3DMGA 3SF0A 6REQB 5D00A 2TMGA 4IQGA 1R0KA 1XLTC 3AUFA 3PPVA 4A0HA 2GK3A 2H1WA 1HDZA 3K4HA 1GXSA 2VP0A 1KEWA 1SCQA 5DW3A 4F9EA 1K6MA 2ZG6A 4CHTA 1C41A 3RB8A 2I5PO 2XSZA 3CZAA 4TMKA 2CK3D 5F77A 3UPTA 3AETA 3Q5DA 1EM6A 3KUUA 2ONYA 4ID9A 1Z15A 3Q6NA 4TGLA 4A1FA 4DQ0A 2ZJ3A 2W6PA 5L6LB 3TUJC 4B3JA 4PINA 3MWLA 3GT0A 3JWHA 4QBGB 2MR6A 3JAWA 5KTSA 3WLSA 2VAMA 2WT9A 2FF5A 4H6VA 4X1YA 3UAVA 4PXSA 3WJ1A 4WDRA 1ISMA 1DC6A 3NEJA 1CJTC 1P1KA 2LR0A 3FFBA 3GDOA 1U0FA 4N8DA 1RJWA 4OI4A 4UQOA 1P4HA 4ZAYA 4CMGA 2R47A 2BDTA 4DJJA 2VPTA 4KG7A 3GH1A 3CX4A 2NU7B 4FWIB 1ZOLA 3GXBA 3LLVA 3QSGA 4HBZA 3RABA 4R8VA 1QHEA 1HRDA 4E03A 1JKJA 4B8ZA 3K9LA 3UW3A 4ZI7B 5CCEA 4OUDA 4CMIB 3R0QA 8ADHA 1KQGA 2RARA 2I4MA 3NAGA 5FBZA 4Z6KA 5CVUA 2QZ9A 2A2ZA 1QTNA 4JASB 4M0EA 1C3OA 3DW3X 4RWZA 1QYDA 1MIOA 3A2MA 4CV3A 2YMQA 3IUPA 5EJEA 1UP4A 3JTEA 1AGPA 3PUJA 4KZKA 4OAPA 5KX5F 4DCVA 2G6TA 2JBAB 2PL5A 1RLMA 4FK8A 2QTZA 4FD3A 2YRWA 5DXJA 1U7OA 1IBRA 4J3JA 4F8YA 4WVFA 3RUPA 3EFEA 4NFYA 1XC7A 4RXTA 5T4BA 1SBQA 1GITA 4IIGA 1Y8RA 4JOCA 5MGNA 3KJQA 2Q4OA 4B0OA 3IB6A 4DCMA 5CFPA 4H31A 1QSGA 3GMSA 4XPIB 3QPVA 3FZYA 2ZZMA 3FOEC 4ZTZB 2QEQA 1CY8A 4B35A 2WNSA 4I19A 3SICE 3AUXA 5FD8A 4ISCA 4PZLA 5DIFA 5BPFA 5HOEA 4H7HA 2VJAA 2IXTA 2PLAA 2VNIA 3GVIA 4FLFA 1T1SA 1M1YE 3CLTC 1S9DA 2R2GA 5ALEA 5IM5A 3UXEA 5CLJA 1NM5A 4EJSC 3IKLA 4E5MA 3M49A 4FW8A 4F92B 1CY6A 3VBCA 1JNYA 4ENUA 5JJ5A 2ZCVA 3WB9A 5FEUA 3ICEA 2AXEA 3I73A 3IAXA 2XA1A 5FAKA 4LW8A 5D3KA 4KQIA 4X8HA 1RQRA 4CM9D 4G37A 2O1XA 5DI3A 4V3BA 3LHDA 1LLQA 1I7NA 4E3ZA 1BU8A 3S1SA 2PD4A 1V5FA 3AR7A 5F3DA 2EL7A 4ETWA 3GX1A 3IOCA 1JHOA 1PT7A 2XYHA 3O7WA 4B74A 3C3JA 4D6XA 2CLKB 2HXSA 5CT4A 1WHSA 2C04A 3G9ZA 1OH8A 4LJRA 5HJ7A 3CLTD 3JQPA 3MWDA 4KKXB 1ZRHA 2JCSA 3QPWA 4FFBA 1Y7IA 4R68A 1UXKA 1Z6ZA 1DIHA 2C59A 3AY0A 3NP9A 3PQ8A 3T7RA 3VZCA 3VM6A 2XVYA 1WVGA 1X2BA 1UKAA 1GL9B 3U60B 1MC4A 4AW9A 2C97A 2OK8A 1U8ZA 1E98A 1X0VA 1PHRA 4UU8A 2I66A 5CJJA 2P5UA 1YFLA 3GPBA 3PNBA 1GRRA 1Q1AA 2Y05A 2R8YA 2A0WA 1ORVA 1OGJA 2MJLA 2JFZA 3VAAA 1D0SA 3VR2A 2E4ZA 2ORWA 5D86A 3TL2A 5JADA 5JAIA 3MELA 3PCRB 2VT2A 5CPFA 3OJOA 2J3HA 3G8DA 1KEEA 4IIEA 1TCCA 2O2CA 3QIVA 3RO7A 3ZBPA 4UTNA 4DV3B 2OK7A 1X70A 4B3SB 4BNWA 3UOGA 1RWKA 1EK5A 5JHGB 1T5TA 3JX9A 4QEKA 1M34E 4TTAA 4DLTA 1OXUA 3SFZA 3U4QA 4MARA 2Y93A 4IHAA 4C5BA 4RDXA 4GI3A 4XEUA 3U62A 1LPBB 2BUCA 2FLWA 2AX3A 1MG5A 4A0RA 1Y1QA 4RJIA 3AJ8A 4NE7A 3B1XA 2ZRMA 1H94A 3U4CA 4Z0TA 4B82A 4BO1A 4UNSA 3MVEA 4MA4A 1CY7A 1O3YA 2GD2A 1XQ9A 4L7QA 1DELA 3EGDA 2FPRA 5EFOA 2REOA 3Q7PA 3CUYA 3H3JA 4AP6A 4BX0A 5AVTA 3GT7A 4L76A 6ABPA 2VZ9A 3HGQA 2NX2A 2FPUA 3KKZA 4X7PA 5DTEA 4CDMA 1I1HA 4PRZA 2CXSA 4RMIA 3CWZA 5FL7D 4D0GA 2IYYA 3Q8XB 3F98A 1XZNA 3TEFA 3KKLA 1ZITA 1BEUB 5AH0A 1RR6A 2RG7A 2Q7DA 2WTXA 1NBMA 3DZHA 1R6AA 3DAPA 1MVLA 4LE2A 5FLYA 4CMCA 2Y1CA 4G0PA 5T41A 4B5LA 3LCJA 1V4VA 5T67A 3LWDA 5FPTA 4C5CA 5E38A 4EX6A 3NR2A 4K9MA 2QX4A 4E1AA 1NZJA 1PVDA 2G71A 3AESB 4UVGA 1E2KA 2MYTA 4CLOB 4QYTA 2VCYA 5I4KA 2UAGA 3WRYC 1EDEA 2Y67A 1ID8A 1GZSA 5FBVB 3VKHA 3AIIA 3D59A 3KHUA 2ZVPX 2W6ID 2GTHA 2WIGA 2V7XA 1FP4B 3KCNA 3R3UA 4YJ3A 1CUUA 2YYAA 4RDIA 1ISRA 2FRDA 4AJNA 4EY5A 5SYNA 3GLGA 2ZUBA 4B6QA 3GDHA 1N3BA 4MW9A 1BVYF 4LC0A 5JVDB 3EEOA 4FSDA 1QGAA 3U4AA 1LVUA 1GD1O 4INPA 5AYVA 3SIXA 4RW0A 2KMLA 2V4ZA 4GLBA 2GZ2A 2FPMA 4FFMA 1OYWA 1QYXA 2ZDGA 4IDBA 1FSFA 4OHUA 2BRUC 4V0KA 1L6RA 1IK6A 1NA5A 1UBMS 3D2LA 3U7HB 4TKMA 5SZKB 1YR9A 3VZRA 5K3FA 3PFNA 3ZDBA 1R0YA 1XX6A 3EXFB 2R751 1PU2A 5FWXB 1ESMA 1P2SA 1LQ2A 3MCUA 1FQJA 3WAGA 1XDUA 3QUBA 4JX8A 4LZAA 2QM0A 1O5OA 2LNDA 3EA0A 1LDNA 4IIDA 3TEJA 1L4UA 1T1EA 2VAWA 1W73A 1Q19A 2IYAA 3KTFA 5EXDA 4YP9A 5KKCA 1T0UA 3M9LA 2VBCA 4F1JA 1EESA 1C14A 1RXCA 2ASEA 3M6WA 4MWGA 4B81A 1SA0A 3OKAA 1Z8DA 3G59A 1IK4A 3COPA 3CX7A 3F8TA 3FCSB 1KC1A 5HS6A 2P30A 3NOXA 3WWOA 2XE6A 4MDEA 1II0A 5SV2A 2G88A 2IP1A 4BUCA 3DXYA 1OWNA 5TVKA 3VMFA 1WP9A 3DBOB 2VDOB 4XWYA 3BHMA 4R71A 1JALA 2Z2ZA 1ZCAA 3O2NA 1VE3A 1LRJA 1E3JA 1FUKA 4G0ZA 1IOWA 3I04A 2RHCA 4B3BA 3GPCA 2IHVA 1YS7A 2X5KO 3GZ4A 1U8CB 2ZBFA 2GILA 3UJNA 2YN4A 4UCFA 2ZJOA 1ZM9A 3FY4A 3OMWA 1DC7A 1WPGA 4C7JA 1U2DC 1G5QA 3IGFA 4JBLA 5EJGA 4QXOA 3WWYA 3ZCSA 4R16A 2IY7A 1JR6A 1P0QA 2VCEA 3FTDA 3MOIA 4EABA 2M1ZA 2DB3A 3C0KA 5HUQA 4DUYB 1X7GA 3UAWA 1ABEA 4OKSA 4RMNA 1BKYA 2XTAA 4A2QA 1Z4LA 3MRXA 4Q5IA 1JV2B 2G08A 5A0FA 3DNFA 3VU8A 4KITB 1QZTA 2COKA 2WPNA 4GGPA 5DGXA 5J2UF 5AW1A 3THYB 2OV4A 4JLBA 3RH0A 2E48A 3PPYA 4BFUA 5K8TA 2H8GA 1GA1A 4KVAA 4PCLA 3QW4B 3N6VA 4IIXA 3RIEA 3LP5A 4D45A 1TM5E 4OHMA 2GB4A 4N8EA 1HLFA 1MAAA 3UICA 1P9NA 2XB9A 5KNCH 3DOFA 5CBPB 1T4GA 2GYVA 1C9YA 2ZBDA 3ND7A 4FMBB 4TQAA 3OQPA 4ZTUB 4M0CA 5DHTA 1KS9A 3ICVA 3HR7A 3PA8A 1P8AA 2C8JA 4MUEA 3UG6A 3FBWA 5GPBA 4QKQA 1AHNA 4QUGA 2CT8A 3DLIA 2Z9CA 5JO9A 3TRDA 5JXGA 1QIHA 4ZO7A 5INTA 2Y3IA 3WIEA 1Q0RA 1XKXA 1IHOA 2IHYA 3RWBA 3RAGA 3S2FA 3P9RA 1TIPA 3OM9A 5I3CA 4NCXA 3EVFA 3BF7A 4DZRA 3O93A 1W34A 5F1PA 2VP2A 3MYRA 4JMPA 2X6TA 5J5VA 5REQB 5L3VA 4JV5B 3D0OA 1N2OA 2WKSA 1Z9BA 2BF7A 5DSZA 2WG1A 2AJBA 3EGEA 3TQHA 1W96A 4TROA 4H18A 4W5QA 3DP9A 4NU5A 4Z9BA 5HP4A 4UVEA 3EZXA 2PZAA 2WU0A 3K0BA 1FK8A 4NAVA 4ARAA 3MD9A 2BGGA 1X9IA 1ZEMA 1ZQ1A 1NSYA 1UDAA 3WKEA 4BKUA 1AHPA 5A6SB 3FKJA 2IUSA 3GJ6A 1NW8A 3LBHA 4QQNA 2J6CA 4Z2AA 4GWGA 1Z56C 1KVUA 3MJCA 3UT5A 3ZHVA 2EWVA 2WMDA 3KKQA 1E3QA 2DFKB 1NX9A 4JVMA 5JCOC 1P1HA 2YIJA 3L9WA 4UBLA 2I03A 2H00A 1N33B 1B8OA 4RKEA 1LD3A 4A26A 1SBHA 2SECE 5JD4A 2IOFA 2DUMA 3DLPX 4IF4A 3BFVA 3WKCA 1AHIA 3NM6B 4GQBA 3M5CA 1NRWA 3ROKA 4GC9A 4RMJA 3NTOA 4BB5A 2AG1A 3DNMA 4R1UA 1D2NA 2GF0A 2J5RA 3TW0A 1QVVA 1YZKA 3MCTA 4YWHA 3HP1A 4GX1A 2BR4A 3SOZA 4IO1A 3T6KA 2O6LA 1TIBA 4MQ5A 2XF8A 4NLLA 4DUGD 5HE9A 3MQFA 2FOIA 4QNRA 4P3KA 2NU8A 3ANSA 4ZALA 1ZESA 5I9NA 4HMQA 2P6NA 1VPTA 3Q87B 4YC7A 2GASA 5ADUS 4EVQA 2R5FA 3TK1A 1HY3A 2CLLB 3QWBA 3ZI0A 1QONA 2JI8A 2NWQA 4WZ6A 3J7AC 1WCIB 3DYIA 3DXFA 3NUZA 3NBUA 4P82A 3S28A 1Z39A 3CNLA 3AI3A 5M5BA 3C3EA 4NQZA 3AR5A 4D46A 3RYIA 1K4YA 5DTMA 2Q3DA 2FRXA 4LZNA 4EYSA 1UKYA 3G8AA 3C1AA 2PLWA 2VWGA 3PXAA 1S4MA 3B1YA 3ETLA 5DN9A 3PQCA 1B7GO 3P9KA 2V59A 4MUYA 1QHYA 4UDNA 3ORRA 1JSZA 4J7CA 5TJ9A 1BMTA 1USUA 5HKKD 5C8DA 1U3DA 2H1RA 4ZDJA 5E7JA 3IRUA 1CU1A 1ZI6A 5EIHA 1GZVA 1A2OA 1DQNA 3D2BA 2HMUA 2Y4NA 4PG7A 4CLDA 2SICE 2PE5A 1E2JA 4QLOA 1KFCB 4D9NA 2YC2C 1IMJA 5AVXA 1K8QA 3AHJA 3UJ7A 4TWRA 2WP8J 3QU2A 3E58A 3AJEA 1AM4D 3O38A 4TV8F 3G23A 1ZNWA 1GKUB 2IQ5A 1FDOA 1N7HA 2X1MA 4Q1AA 4RVCA 3LO8A 1CS4C 1VG8A 4XYLA 6LDHA 5AVRA 5JY1A 1SPBS 3QXHA 1L5HB 4RK6A 1E6LA 1PJQA 1CQXA 1DBPA 3RBVA 1Q74A 5HHTA 4U00A 3L43A 4OA8A 1IBKB 3NHLA 1T24A 1X1QA 1WXFA 3Q9LA 2OAP1 2P9EA 4I5GA 2DUJA 2X5JO 3U1TA 4PHCA 4B6PA 3ZZ1A 4E14A 3F4KA 3W6NA 1RTKA 1LNSA 4HUJA 1KYIA 2OBMA 2OUKA 1FYVA 1LNZA 1Y6ZA 3DD1A 2C95A 4FKMA 3SM3A 1CUHA 3TRJA 4C08A 2ADMA 3ZX5A 1N7IA 1OBVA 4PPFA 1NXQA 2ZSHA 5FPYA 3IERA 4G97A 4BQSA 2CWDA 1U94A 3I2IA 2P9YA 1OFHA 1X2EA 2E89A 2AFRA 2FWMX 2GYUA 2QZ4A 1BGVA 1ODTC 3IO3A 2XVMA 4GAEA 4HZGA 4OBEA 4PLFA 3SQOA 4W5OA 5JZ9A 3RJZA 1AY0A 2RJ3A 3TJRA 4O02B 4BAUA 1Y8QA 1ZN8A 3HADA 4Y98A 3EXHB 1ZN2A 2V45A 1E5TA 1UKCA 5KOHB 3P0RA 2E3JA 1C1HA 2P35A 2XF2A 4D5EA 4EMTA 3PDCA 1WM1A 2P9ZA 1L9XA 2Q1WA 3HFGA 4MRMA 2A78A 4JYBA 3ORSA 3ZLJA 4FOOA 1G8FA 3FRJA 3LT0A 5CB6A 1GT91 1G98A 1MA0A 1ZINA 3KTOA 3FLBA 3O4HA 3USCS 1QO7A 1RHRA 1PV1A 3CSUA 4GFDA 1KSFX 3O94A 4NR0A 1LUAA 5KNBA 1FRNA 1SHKA 3EIOA 2ZIEA 4K1XA 4AKHA 2CJWB 1JJBA 2PMCA 1Y5NA 5DOZA 4CKXA 4PAQA 4PR3A 3SR0A 3ZU3A 2QTHA 3E7DA 1BWRA 3ROPA 1QH1A 4PZEA 3D3QA 1NYTA 2P4SA 3FUWA 3N8NA 4D9HA 2V4UA 4C2AA 1H4SA 1UMDA 3R40A 3ZJYA 4X7MA 4ZZ0A 4DCNA 1TZMA 4WCVA 2HIHA 2CJYA 2MMCA 3PNSA 1IZZA 1O0SA 1LF5A 4FMDB 4FNMA 1MTZA 3FGNA 2UYYA 1EIWA 3EZ6A 3H9UA 3MFYA 3HBFA 4WFIA 1H2XA 3GFFA 1S7CA 2E4YA 2VNJA 4NEGA 1FRVA 4EFKA 3FNBA 1XXHA 3THXA 1CUGA 4MCAA 3TW6A 2VDPB 3DDZX 3GJTA 1PS0A 1RYNA 1EFDN 1WXGA 1R4ZA 2B36A 2P4EA 3MGBA 4G01B 5AXDA 2DCMA 1PEYA 1BXGA 2H54A 4UEWA 1E6WA 4YUWA 4YMLA 5I7EA 1S9HA 5IM4F 5DCUA 3R3WA 3K0AA 1WBDA 2CVFA 3QX3A 1D2GA 4LDJA 2EZTA 4L5BA 4P35A 3ROEA 3TKAA 4DMRA 4JH0A 2QTAA 2J3EA 1PZXA 1P9WA 2W2OA 2IYFA 4RVFA 4IIJB 4AYTA 1UK9A 1ZRMA 3W2TA 4K8OA 2DLDA 4BCBA 4GYJA 1W4ZA 2ZIXA 5KCMA 1JJIA 3O1IC 2YVLA 3SU8A 4PLWA 3QUTA 4JLUA 4TWZA 4RIIA 3K32A 3R9WA 3ZR4B 2KX7A 4OJQA 2XVXA 2O2SA 1G1MA 1AKVA 1NDQA 4RM2A 4FOTA 1OFGA 5HQ3A 1L8XA 2H1HA 4LJAA 3ZE0B 2BBOA 4N12A 2RBKA 1G63A 1Q2XA 2PV7A 4J91A 4RPJA 3W8NA 1U0GA 2PWZA 3RNOA 3F7NA 3KT8A 4YXWA 4CF4A 2F2TA 1N6KA 1TRKA 1PJ4A 3LDUA 3R5HA 4N3GA 4OL0A 3W9YA 1PYOA 1IVYA 2RHLA 2WFLB 2EWMA 1DOZA 4PCAA 2DR0A 4TTIA 4CODB 1YZVA 3RRNA 5IHPA 1SQGA 3ABIA 3D4OA 3BMXA 2AMLA 3LOPA 4LYJA 4HPWA 3T38A 1U1DA 2QL7A 2R4UA 2AFHA 3OP4A 1WIWA 4LNAA 4XGQA 4G09A 4S1OA 5L3SB 1EHYA 4MI9A 4OHPA 4YR9A 4HLNA 5HXAA 2F3UA 5EKTA 1L7PA 4XD7D 3H3XA 1FMJA 1UPTA 3TINA 2O0JA 3BA1A 5BMVF 1IAVA 5JAZA 2NPFA 1IFXA 1FYWA 4D4GA 1JWAB 2CKMA 3DAYA 4IYRA 4J4BA 1D2HA 1SCBA 1E79A 2ETXA 3MK31 4EPWA 2ZRNA 2G83A 2V7BA 4QPJC 5EJIA 1TAHA 2D1TA 5IAJA 4X6XA 3ZCPA 2JANA 4X3PA 3O1LA 1KNQA 1YA8A 4YJGA 4ICIA 2PGDA 2IU4A 5G3ZA 5JS1A 3PYXA 4KXNA 5EMHA 4R9NA 2OC9A 1RFLA 1H66A 2PLRA 5KNBH 1UK7A 1CFJA 1CNEA 2ZCUA 3BIJA 3LHFA 5EFZA 1E7QA 1UR5A 3WLAA 5LQKA 2IHBA 4BNHA 1YDEA 2A0YA 5EQDA 3WYEA 4F3CA 1AGXA 4PYIA 2GLUA 1ZIPA 1XG5A 3HXTA 3FPBA 1TGYA 3Q11A 2Q8QA 1SU8A 3LF2A 3O83A 1N36B 2HEIA 3B5IA 4Q3BA 3MSCA 4Q6WA 3QFRA 3HVHA 4PLYA 4Y2JA 1Q21A 4BYGA 1XMOB 1R27A 3I4CA 3WGVA 2QRQA 4JBWA 3INTA 4CIXA 4BIMA 3AEQA 3K1JA 4QGBA 1ATIA 3K9QO 3E2PA 3R3ZA 4MUBA 4XWWA 3EY9A 4W7IA 3RVPA 1GRQA 2XITA 3TVYA 1CUBA 2AG8A 2VSYA 3ROGA 1BTOA 1PL6A 4LDAA 2D2XA 1KSGA 4R8RA 5ALIA 4O4JB 1GP2A 1IHYA 1HUQA 4HL6A 3NRJA 5KX5A 4LYHA 4IXDA 1JQ3A 5TT0A 4BO8A 1BW9B 1TT5B 2QV7A 4LJKA 4CM8B 1TZKA 2KW5A 3FTNA 1FLVA 1NKTA 1S8OA 4Z4CA 3MC1A 2ZRBA 2CYAA 4Q7LA 1IONA 5A9TA 3RIGA 3Q8KA 1CE8B 1UFQA 5EJMA 1IZ8A 2AWNA 3DD5A 4KGVA 2XNJA 3AFGA 3S2GA 5B58T 4UOQA 4EHHA 3WSWA 1KI2A 2VHVA 2FGKA 3PD1A 1JX6A 2NXNA 3N3AC 1HC7A 1KY2A 2UUOA 1JG3A 4M46A 3FSEA 1SKAA 2I7DA 3FGOA 5ESRA 3RQSA 1D4AA 3U7GA 1L3CA 3TRIA 4BGUA 2ZYWX 1KBQA 1WZEA 4HSGA 5FBWB 1XT6A 2REQB 3P8ZA 5HEKA 2W2KB 3NM4A 4YT5A 5K4AA 5BR4A 2C2HA 3ANXA 3W1WA 3I30X 4FGSA 3VPSA 2PUFA 3IEXA 4GZ6A 3IUBA 1XBTA 2G9VA 1J7JA 2PM8A 2AXQA 4KTTE 1ZR4A 3KT0A 4Q93A 5DBEX 3ECAA 3FDFA 3O8QA 3T3IA 2ZYAA 4NENA 1ZX1A 3ICPA 1S3FA 1EM8A 3DDNA 1Z26A 4UE2A 3TCXB 3OU7A 4I50B 1ZOSA 3A25A 3HR4A 3HXKA 4OHZA 3UJCA 4MZDA 4KUGA 1VE5A 5F76A 1V11A 3RM3A 2FHPA 2C9OA 1P81A 1H2ZA 1E6EA 1RRPA 1SU6A 3HJRA 3OZFA 1V37A 3EVCA 4MS4B 3V48A 1C2TA 1YKGA 1YDFA 1D2AA 1NLUA 3RIYA 3PGVA 2BHLA 3SFVA 2NQTA 3R4CA 4DBZA 4EQZA 2PCJA 4F21A 1JHAA 1Z4OA 3DE7X 2L82A 1TYDE 3G02A 1FS6A 4K3VA 3R9IA 4AJEA 3VZPA 1JFTA 2A9VA 4MQBA 3HJNA 2A9RA 3VNSA 3GLHA 4ZOEA 4PYQA 3TM5A 3IA7A 2F9MA 2PUCA 3VHXA 2I7XA 1AO3A 3AVYA 5FPSA 5LZ4A 4EO7A 4DV2B 1K75A 1OXXK 2VQ6A 2ODAA 2I7VA 2PZKA 3TOSA 4NV1A 4AURA 3E7WA 4ENRA 1QZUA 2FE1A 1KDYA 2I6FA 1J99A 4GPZA 4KDFA 4OKIA 4B0PA 2BTEA 1AJEA 3ZHOA 4C4OA 5THQA 4E2YA 1LBSA 3UFBA 3DTVB 1MHPA 4M1QA 5H68A 2O5EA 1TQ8A 1QP4A 1O58A 3DAHA 4C87A 3VR6D 1RWVA 4P4SB 2AT1A 3N5CA 3X1XA 1Z06A 2W2QA 1F4PA 3FRIA 5IRCD 4LHEA 1KRXA 2ZI7A 4EBFA 4TX1A 1GKYA 2HK8A 1UJBA 4KQ2A 3ZIAA 4OHFA 1D1QA 2AW3A 1RBMA 3FB4A 4R2WA 2JAXA 3U40A 3QG5A 4A2PA 3PC3A 1FP2A 3OFNA 1NMXA 4FIDA 2WUDA 3TLBA 4CIBA 2AYXA 3QTTA 2AC2A 2AHRA 3S99A 1G8KA 1JXMA 2X9NA 3WKBA 1JYEA 3FDZB 1F48A 1XZFA 2NV6A 4MEJA 5CTJA 2XDQA 3E3AA 1MJGM 3SKXA 3T7CA 3WYGA 5IWCA 1VL5A 2Z2YA 1CUAA 1TQ2A 2Q3LA 1D5CA 1XJ5A 5L8VA 1R3DA 3OQ1A 4NFSA 3I9OA 5ECDA 3TLGB 3L4EA 4W7SA 1LBHA 3O2QB 1PTJA 3T9EA 3KZXA 4EW2A 2HIGA 4I5FA 3ZXYA 1PQPA 2GPYA 1KIMA 1DQZA 3C5HA 3VPHA 1LJLA 4U9IS 1QDUA 4YMSA 4HJRA 1EDZA 4J2TA 4DIOA 1N4AA 2PT5A 2CYCA 2UYGA 3MLAA 4L5CA 4OA5A 5CUQA 3SQMA 1Y0BA 3DV0B 2ZUFA 1BDHA 1SK8A 5ALSA 2Y0BA 1H1LB 4FMCB 1G4UR 2FEPA 4QARA 1BJKA 1EUDB 2JKYA 1FOEB 3ZY5A 4D02A 2C57A 5CT9A 1WJGA 4MLPA 5BWOA 5C3UA 1ACMA 5IKMA 1KZGB 1JLHA 1QTRA 1XTQA 3KYJB 4JC8A 2X8JA 3Q4GA 1QUEA 4H77A 3QXJA 4UTXA 4F93B 3MS7A 4V39A 2WAYA 3HXMA 2BCJQ 3AW9A 3LC2O 3AUKA 1EP2B 3FJYA 1QTQA 3AP3A 4MPTA 4F38A 1UP6A 3RC9A 2LDXA 3DC7A 3JD0A 5EHIA 1FFXA 4C0KA 1Z0JA 3RRFA 3THSA 2HTFA 4C3VA 2YIDA 4Y1GA 3F3MA 3IHKA 2HJHA 2XX3A 4ESEA 3GGSA 1S8FA 3D31A 3E1KA 3JYPA 3GIWA 4UUPA 1GTJ1 3V32A 2QLLA 2C2ZA 3F6EX 4MVJD 1VC2A 4DDWA 1RIFA 4G8BA 1XF1A 3JCZA 3A9VA 4KO4S 4ZIRA 1VGRA 4GOXA 2YFYA 4K86A 1QNFA 1VKJA 3MINA 4WINA 1DAMA 3DFIA 3DKVA 3RYHA 1E66A 3FDXA 2Z4TA 4RK4A 3HO1A 2EX0A 2JDID 2VJKA 2ATEA 3ZDQA 4Z5XA 3WK9A 4AN0A 3MUOA 1R4NB 4RU1A 1M8JA 1TMYA 2J1LA 3CIOA 3ET4A 2X22A 2I6GA 2V5VA 2PRIA 3QZUA 1MENA 4EG6A 4AG5A 1FFSA 4Q12A 1SAYA 3BGDA 3UY4A 4B40A 3CBGA 5BSGA 1V1RA 2G5PA 3PC6A 1A9XA 2RAPA 1GZ3A 4JUCA 1MOQA 1LCIA 3GEDA 4DF3A 4DMFA 1E1RD 4D8WA 4Q7QA 3ZCUA 2QSUA 3TQSA 5JCXA 5H5JA 3BDIA 4LJ4A 2E4XA 2ENWA 2JZCA 1HXHA 5F7OA 3JQ8A 4BATA 3R77A 4LE1A 2V5AA 3SQDA 3QPAA 3GI1A 3J81A 1W0JD 4US0R 2F3QA 2P4QA 3AEKA 3PXEA 5CT8A 3UXMA 2HV9A 5MN6A 1PS9A 4EY7A 3COWA 2IEYA 2F3TA 3C5VA 3E8SA 3KL2A 1GXSB 1HDXA 3F4LA 2I3DA 4OKNA 5GGYA 3N07A 1O54A 5C4IA 1PYDA 1J2EA 1SCNE 5A7HA 1Z2CA 4X7RA 2BI8A 3EW9A 1N5DA 5DTRA 1V95A 1Y1LA 3AETB 4X8MA 3T9BA 2OUIA 1JH9A 4L5YA 1DKNA 1PFUA 1RFGE 4I0WB 3TQCA 2VZLA 2XWPA 1I4WA 2FMUA 2H4XA 1ODKA 4RC9A 4B3MB 4C2TA 2XZOA 4L50A 1QIMA 3JAWB 4I4TF 5EE9A 2XZPA 2P3QA 1CY1A 1SVWA 2JIQA 2PH3A 3TX6A 2R4QA 5KTNA 4X1YB 1HO3A 5IVKA 3Q88A 2HDHA 1EEXB 1GPH1 2EFEB 3M1YA 1GGJA 1T8TA 2GA8A 4DMUB 2V3VA 2PH1A 1FJGB 3ZDFA 3ME5A 5JISA 3USES 3VAYA 1YA4A 3AI1A 3KVNA 2H31A 1E2NA 3T34A 3WDKA 3P71T 5IVPA 3IEMA 1EUZA 3FPFA 2JVJA 4Q9DA 2HHAA 3I6MA 1CIJA 1JKJB 3TPCA 1C9EA 2G5TA 4EJ0A 1C7FA 4F1KA 3GLFE 3PT5A 4OUDB 4EEXA 3KKNA 1QRDA 1Y4DE 3QVMA 1F3OA 1O77A 3ESBA 1ZUD1 4YRZA 3QW2A 4PLTA 2G4CA 5D6NA 1C3OB 1DWOA 1G3RA 2GARA 4M36A 1MIOB 4RORA 1EFVA 5EKXA 5HDQA 5K0JA 3KOWA 4PEVA 3UN1A 3ZD7A 5AO9A 4A8PA 2FPOA 1DSSG 2OCAA 3DO5A 4FJ0A 2FSVC 1Y82A 3QY0A 1LV8A 3BZBA 1XZPA 3R1IA 1XTSA 4A4DA 3IP5A 3FFAA 4FX5A 2PU7A 3SX0A 3BILA 2X2FA 5CCXA 4JJFA 1VB3A 4GMHA 3QFTA 1N0WA 4HTAA 3R0XA 1XVTA 1Y8RB 3NKVA 3MLEA 4NBWA 5HM8A 3VO2A 2YL2A 3GEPA 4YA6A 1AS0A 4MRSA 1KH3A 2FFBA 2FNAA 2QD3A 4HH0A 3GEMA 2EIHA 5KAMA 3MYYA 1X13A 3SHFA 1QQ7A 4FYXA 5LPNA 1Q0QA 5FEMA 2Q45A 1X74A 1Z68A 2XA2A 1JJVA 1NX6A 3PKIA 3ZS8A 2HKIA 2PZJA 2DTDA 1SCDA 4KN5A 5CA1F 1QF9A 4NZYA 5ENZA 3ICOA 1V96A 2GYYA 2JASA 1RC8A 1S4QA 1CTQA 1K08A 1K7CA 2F1KA 3MJRA 4HMPA 4Q1FA 1GAQA 1P61B 2YJTD 3HA3A 4ISBA 5EHXA 3HKCA 3JVEA 5L4NA 3KSZO 4R8LA 1G5RA 1XMIA 4MVJE 4K87A 1B8PA 4PICA 3G2KA 1R5OA 2GEVA 4OJTA 4EA8A 5UKDA 3T5CA 5GZ3A 5DI3B 3IEUA 1E89A 2FZKA 2Q6TA 1DEAA 2B4YA 2BLLA 1UMKA 3OCYA 1BX1A 2X4IA 2ISCA 4QECA 4XTCS 4HS9A 4HT3B 1LW6E 4G5XA 2CUKA 5BN4A 1GTRA 1MC1A 3JQAD 1AF7A 2PX6A 3O21A 1WHSB 2ONKA 3F9RA 4OHYA 3OZCA 3QKWA 1RRFA 1SKQA 1Q0ZA 3MWDB 3FR8A 4MKRA 2IGTA 4FFBB 1UC4B 4EGCB 4MV3A 4MHSA 3MCWA 2WF6A 3P20A 3PT9A 1DQSA 4IG4A 3WP0A 4QFCA 5BWNA 3GA7A 2VZ8A 1PNTA 4HVCA 2XKJE 5T3YA 4DW8A 1I4EB 4XUCA 1WW2A 3DDOA 2PXHA 3PUVA 1NVKA 4QM7A 2XCLA 1SBCA 1ML3A 4K88A 4B75A 1QDLB 1K5DA 1UAGA 3UK0A 2OV6A 3UNXA 4RGYA 4RVGA 4OO3A 2GCEA 3R7AA 1ISIA 3W8DA 1KXZA 4IH9A 2XA9A 3IV7A 1P0PA 3CNNA 5BY2A 3PUKA 4B6SA 1KEEB 1Z4NA 3I1YA 3IEKA 4J3FA 4B8WA 3KLBA 4EGJA 4CGZA 1BGWA 1QHXA 1XHLA 2F8LA 2VWQA 3HY3A 3AG6A 1WLYA 3G82C 3OF5A 4H16A 4JFAA 2C7VA 2GGSA 1HTTA 1VHLA 4J2OA 4KNVA 4Q01A 4U2FA 4XW2A 4RTOA 2JBWA 4PE5B 4JDPA 1JJ7A 1HEIA 4TXMA 3TQQA 3VC3A 5E6SA 5LKRA 3U4QB 3UJ8A 5C80A 1JVBA 4WXRA 2BI4A 2Z30A 5EIBC 2XXJA 3ITNA 2I1QA 1X14A 3O8LA 2H2AA 2ACKA 2WJYA 3ND5A 4R1PA 1XSEA 5HBGA 3FNGA 5LQMA 3IKJA 3DKPA 1IQ0A 4OJMX 2VHEA 3VU9A 2VXOA 3EGDB 2JFVA 3HFJA 1BU5A 2CMGA 5JCPA 2DFPA 2O1SA 3KELA 2AQ8A 4D9MA 3M6MD 1E7WA 4JLKA 3MTDA 3VAZA 2OLJA 3JR7A 3VU1A 1U28A 1Q7TA 3K4PA 2OYSA 4Q3DA 4JS0A 1J24A 4QJ5A 1WSAA 3FRHA 1T0HB 4JA2A 1L7VC 4WLNA 1XRPA 3BIFA 3FTPA 5EIBD 1K3TA 1KJYA 1LLFA 3BUSA 3OZTA 3REOA 2AR0A 3PQ3A 5IN5A 3WWDA 2YDYA 1DT3A 3MMSA 1QLJA 2PQ2A 4FYMA 1RYDA 1SJ9A 5IABA 3U19A 3U6BA 1KYQA 2DQ4A 2CNWD 2DERA 3PRJA 16PKA 4BBZA 2NP7A 4QUBA 4UEQA 1JLMA 4FGUA 2QLFA 2DPMA 3ZY6A 3RK4A 4L28A 4JJZA 1Y8CA 3KJHA 4JT2A 1GGKA 4P92A 2XYVA 5IXSA 1JPVA 1HT1E 2DSNA 3EZNA 4MQLA 1CQWA 4YJ3B 1VP3A 2C29D 3PNLA 3CLSC 3LBNA 3NDJA 1IDOA 2IYWA 1EHCA 4ERNA 1NRXA 1ZOOA 1T25A 2ACEA 2MT9A 2ZJ1A 3CH7A 3O8OA 3SR3A 5IKXA 1F2TA 2DSTA 1JIJA 2B98A 2HREA 2J67A 3GN1A 4GMXA 3WK4A 1XEXA 3ZHYA 2P1DA 5CB4F 3BX1A 4LJLA 3W2EA 1NT2A 1M1YA 3GELA 3HR8A 3K73O 2VEOA 1Z4JA 5LP1A 4F72A 3BCUA 1NN3A 3AWIA 4FSXA 3ERCA 5K3FB 4DGQA 4QULA 1GRCA 1IPFA 2O2YA 2ZWVA 3PHLA 4LAFA 4L8LA 4LWQA 1T34A 3WNDA 4B7ZA 4KIWA 5ALGA 1W1WA 1P74A 3L0CA 3P9YA 3TGLA 4CIDA 1U9IC 1KOGA 1X8XA 3ZHTA 3OCCA 3O92A 3HZZA 3LO5A 2D4HA 2BFFB 3A6KA 3CLSD 1KWGA 2I2FA 2P41A 2Q5IA 2BFPA 4B6EA 3H1BA 5ILGA 1H6AA 2HWWA 1SA0B 4M0DA 3U5TA 4YAIA 5AW7A 4QQFA 4OHRA 2PGXA 1YU6A 3CBQA 3P97A 3LDGA 5JMPA 4CLRB 4EHAA 2PBZA 4U2EA 4D3SA 5AI5A 1NF9A 5BSHA 3M89A 4Y6OA 1Q92A 1Z36A 3WMEA 4A10A 1EPUA 1B15A 5ER6A 2NU6A 4CT5A 1V5IA 4M7RA 2JKZA 5J4LA 2OP0A 3ETCA 4OMFG 3VDNB 1ZM3A 2JGRA 2YVQA 3VHQA 3CNOA 5HK9A 1U9CA 5DJ5A 1XMSA 4GR5A 4QDUA 3URMA 3W5HA 1Z13A 2ZWIA 5FBLB 4D80A 4AUEA 1SZPA 1BZYA 1YWGO 1QFYA 3K70D 1EVZA 1Q77A 1XCMA 3IR7A 4BEBA 3FFTA 2YHUA 3CJRA 4W1SA 2Y1LA 3DKIA 4RD2A 3CNHA 1TMKA 4GECA 4FTWA 2VA9A 3AFNA 3B9PA 3EHDA 3ETJA 4Z7QB 4ZYUA 1M34A 1LJ8A 2XCTB 4M37A 4LE0A 1SXJC 5LP6C 1IJEA 2C4KA 1OW3B 2CK3A 1IQRA 3KP1A 4KV9A 4WN9A 2ZXFA 1AO0A 1A1VA 3V42A 3A6PC 2IODA 2Q1TA 3C70A 2XD4A 2QPLA 2WM9B 3I58A 3TXYA 2VHZA 3PE3A 3VR4D 4CLXA 2AMFA 2ZR0A 4NYIQ 2X0IA 5B2ZA 4HDCA 5AFSA 3PIDA 4BE7B 1TAUA 1DV2A 3WQHA 4NESA 5E6RA 3I37X 3IDFA 4CNQA 2P27A 1XLTA 1EGQA 2UYOA 3T5GA 1XE3A 1Q83A 2DWCA 1VL0A 2O2JA 3QELB 4N18A 2JLWA 3BKWA 2PJRA 1M1ZA 3ZU6A 1WRBA 2GBLC 1JJFA 1V5WA 3P2MA 4YRPA 4N3AA 1SXJD 3FE2A 3BWDD 4N3NA 1NWHA 1GNSA 1KWKA 4WLFA 3CPJB 4I6GA 2PS1A 2PG3A 3IEPA 4OGFA 1RHMA 1PFVA 2QM8A 1N2IA 3GBVA 3W5IA 1Q91A 1XAJA 4H7FA 4ECEA 2OQIA 4YCDA 3OE4A 3RTCA 3SYRA 1P5FA 2YWBA 4DA4A 3JSXA 1OFVA 2HAEA 4NJEA 4OP1A 3DEHA 3UEOA 3VVLA 2MCFA 2EAUA 2MHCA 4I55F 5B1IA 2OGUA 4BBAA 4C29A 5C32A 3ABRB 1V4BA 1HMYA 3E82A 4PSUA 5FBKA 5E7IA 3JU3A 2I3GA 3TIFA 5I7VA 4LDPA 5JH7A 2CY0A 5JJBA 4C7OA 2EU8A 2G04A 1A8SA 2QPOA 4KFTA 3K3PA 1R9JA 1PWYE 4CMEA 2OG1A 4F9GA 4KE7A 3AC0A 4JSYA 5T64A 4DIMA 3OJXA 3UT5B 3P32A 1XJQA 2J30A 2WMYA 3L1UA 1TADA 4KO8A 4TL6A 4P7KA 1HFJA 1ZCZA 3N7UA 4IUDS 3SQWA 2DC1A 1ZBDA 3QHPA 5BQOA 1FFDA 3BE5A 4HEQA 3F90A 3I01A 3NV9A 5FH9A 3UMMA 1A7JA 4QPDA 1C3JA 1NJ1A 1QB8A 1V9LA 1TKAA 2ZJYA 3PBKA 4YEDA 1JHZA 5AIBA 4K9LA 4E33A 2ZU6A 3KQUA 4TTSA 4HLUA 3DQPA 2CNOA 4NX2A 1JZQA 1TK2A 1L4FA 4LRSB 1ZM7A 3CLRC 3NAMA 3QA3E 3TTXA 4Y2SA 1NAIA 1TO2E 1E62A 1NY5A 1Q6YA 1XKTA 2FJUA 4AD8A 2ENUA 1ZD9A 5ARDA 3HEMA 5KOYA 3P4XA 1PG5A 2HUNA 4J7XA 2OD9A 3LZ6A 1FFAA 3QY9A 4DADA 5CDSA 4CM6A 1YQ9A 4OX9B 1J0CA 3LUKA 1JG2A 3LZDA 3LDFA 2NU8B 5FWYA 5HYVA 1Z6GA 2PMDA 4L22A 5NLLA 1HL7A 4HUQA 3ZY3A 3KEMA 2JJQA 4WJKB 5BYAA 3O2SB 1A7AA 4QXQA 5AVOA 5JS2A 1XXLA 4LSZA 3VC7A 3DL4A 3G6KA 4LJSA 5JAMA 1OR8A 3FCUB