1W8DA

Binary structure of human decr.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
294
structure length
288
Chain Sequence
NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Human Mitochondrial 2,4-Dienoyl-Coa Reductase: Enzyme-Ligand Interactions in a Distinctive Short-Chain Reductase Active Site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL PRECURSOR
total genus 97
structure length 288
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.34: 2,4-dienoyl-CoA reductase (NADPH).
pdb deposition date 2004-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1w8dA00
1JAXA 4PLZA 4RV9A 1TT5B 4FD3A 5TS3A 3UICA 5FEUA 5T5QA 2GUGA 3DMTC 3A28A 1M2WA 4BMNA 1NPDA 1GV1A 1NVMB 1D1TA 5AVOA 3VHRA 1V3VA 3VPGA 1FDVA 3ZWPA 2GR9A 1VJTA 1JWAB 5G0SA 2YZ7A 4ALMA 2EGHA 1HE3A 1LTHR 3EVNA 3GDFA 1DAPA 4LK3A 1LX6A 2YY7A 3WYEA 4BO2A 2O3UA 3FTNA 3DQPA 2WYWA 3MZ0A 1LDBA 3GAZA 1PGNA 4UVGA 1I01A 4CM3A 3MWEB 2PR2A 1ZK0A 5JDCC 2TMGA 5IN5A 3IJPA 4IJKA 4OM8A 1SB8A 1HYEA 2I67A 3WYBA 1NM5A 2FOIA 2NADA 2O50A 3C7AA 3K2BA 5GZ3A 1KC1A 4H7PA 1H94A 3WIDA 4CV1A 4IBOA 1WP4A 4EGFA 4UVDA 2PZKA 1IPFA 4XX0A 4O59O 2IZZA 1X0XA 3JQFC 4YEDA 2P9CA 2FSSA 1P0CA 3IKTA 3GEGA 1U3UA 3W8FA 1IZ0A 2OXIA 1R0LA 1OZAA 1JVBA 5GMOA 5DP2A 1GZ3A 3D3EA 3HQ4O 4WLVA 3WNQA 3ANMA 1R4NB 2A35A 2DLDA 3H8VA 4HV4A 3LT2A 5C5IA 2A92A 2D8AA 2WJPA 1BHSA 3OJOA 2YFQA 4W99A 3DC2A 3LZ6A 5CP8A 3KLPX 2GERA 4MVJD 2H6EA 5DCYA 3TL3A 1VM6A 3MJSA 5JPIA 3KM0A 4K28A 4EYEA 1RKXA 1E1NA 3IAHA 4RVDA 2G76A 4D7AA 4JJIA 4P4LA 3RU9A 1HYHA 1FF9A 1E3JA 4WLOA 5JBIA 1ZEMA 2PV7A 4J7CA 4B7CA 4BNXA 4XIJA 1GYQA 1ULSA 4WEQA 2HUNA 3DTYA 1OC4A 3O38A 1IE3A 3UHAA 3VKVA 4N5NA 1E3WA 1LLQA 4FFRA 3GGPA 1E0DA 4MJLA 1QYCA 5JMPA 5K9ZA 1VL6A 4CPDA 4JN6B 3P19A 1PJTA 2WE8A 2AE1A 4FDAA 2VHXA 1Y8QB 1E1KA 4NBTA 1VE9A 4II3A 2B5WA 3PLNA 1X1TA 5EL0A 3JSAA 5BSHA 3RBXA 3H65A 5L3ZA 4XJSA 3C8MA 3DWFA 2PGDA 1LI4A 3WNVA 4W9NA 1YL7A 1SB9A 4BHTA 1EBUA 3CZRA 2YDYA 3JD1A 2UAGA 4M49A 2JHGA 1EK6A 1N8KA 4O6VA 4A7PA 5I7VA 2HLPA 1N5DA 3ENKA 2JL1A 5F3RA 5A5EA 3ZWVA 1PSDA 2VUSA 4L8VA 1KVSA 4UUMA 3S2IA 1ZIDA 2Y1GA 3WMXA 3JQ8A 3O8QA 5AOVA 1BVRA 4TSKA 1SEVA 1Z82A 4OXNA 4FFPA 1FDSA 1JKFA 1VSVA 1ZVMA 2Q2VA 2VOJA 1LDGA 5JFOA 1GPJA 3AU9A 4EUHA 2FPIA 1RM0A 1MC5A 3SLKA 4CMIB 2R00A 3HG7A 4J1TA 1P31A 3GFBA 5ER9A 1NPTO 1GEGA 4QECA 2X22A 3ZWAA 4E5KA 5I7EA 3DAPA 3GG9A 4HFNA 2VN8A 3DHYA 3GUYA 4PG8A 4KUHA 4RJTA 5I7SA 2FR0A 4D41A 3RUAA 2CDCA 3EMKA 2Y1FA 1YE3A 3E18A 5F1OA 1IULA 4CLOB 1UJMA 4GX1A 1X13A 1GCOA 4XRRA 3M2PA 2VRBA 3UCEA 4BO3A 1LQTA 4OSPA 1LRJA 3P7MA 2OBNA 3QLJA 1VL8A 4IZHA 1LEHA 5DDIP 4R9RA 1YBVA 4A2CA 1ZSNA 4FB5A 1VPDA 4Z0HO 4YAKA 1P45A 1Y9EA 2X7HA 1ADGA 1EUDA 4OQZA 4XGNA 3JD0A 5T6BA 2QX7A 1LRKA 4R3NA 3ROMA 1JW9B 5BQFA 1QR6A 1M6WA 1P3DA 3D3WA 3GN2A 3JQFA 1U8FO 4CR7A 1ZXLA 5ENDA 5KJFA 3C1OA 4CM1A 2C5AA 4MINA 3FWZA 5H81A 4NI5A 1EBFA 3ROPA 1CRWG 1ZK3A 4JNKA 4OKNA 1LLCA 3R3SA 1A4UA 1H6BA 2H9IA 3FHLA 3L9XA 3OQ1A 3HSKA 5B1YA 3AUSA 4CL8A 1U5AA 2X5OA 4Z0PA 1P1IA 2E82A 2GN9A 2OZPA 2O23A 4J16A 3M1LA 4DTIA 2C07A 2J5KA 3BMCA 1ZK4A 4LRSB 3MJEA 9LDBA 3OSUA 1Q0QA 3V2HA 3WICA 4I5DA 3OHSX 4WLUA 3IKVA 4UVEA 3GVXA 5IZCC 1EUZA 4E6PA 2YQ4A 3C7CB 1YDWA 1NWCA 5JS6A 4DIBA 4YACA 2IEDA 4RDHA 1PJLA 4J2OA 2Y67A 1GUFA 1U3WA 5TT0A 4JJFA 1MG5A 1ZCJA 2VNAA 3S55A 2AA3A 2RIRA 3EZLA 3RIHA 2V6FA 2VWHA 5TGDA 5THQA 3BYZA 4OYRA 1Q1NA 4F6CA 2BFPA 3FRJA 1Y8QA 4XWYA 2BLLA 2O2SA 3E1KA 3DOJA 3R0IA 3QW2A 4KWHA 2C5EA 4MVJP 3MOIA 3O03A 1L7DA 3HDQA 2G82A 3ZWNA 3UKOA 1LLUA 3I9NA 1PZEA 3WJAA 5L7TA 3L4BA 4CMKA 1ISJA 1CERA 4D3DA 4RGBA 3LLSA 5DBIA 3AUUA 3IOYA 2Y68A 4ZJUA 1GU7A 4U8GA 4EW6A 4QX6A 4R51A 1U4OA 3L4BC 4AJ1A 5MDHA 4UEKA 4BB5A 4MKRA 3QWHA 1H2BA 1V6AA 1U3VA 2P5YA 1O9BA 4OKIA 3RFTA 4DPKA 4K1LA 5C7LO 3PIIA 4EDFA 5JXWA 2UUOA 1CWUA 1GADO 4BS9A 1K0UA 1W73A 3FD8A 5DZSA 2FR1A 1DJNA 3OJEA 2CDAA 2F1KA 3U49A 3C24A 1R4MA 4CQMB 4UEJA 2VHYA 2CF6A 3ETEA 3ZHYA 3TNLA 3WS7A 2D0IA 1DHTA 4NFSA 1I24A 4WGGA 4BQPA 1A9ZA 2Y1CA 1P9LA 3EC7A 4IXWA 3H3JA 4R1SA 1GL3A 1DJQA 4ONEA 1I0ZA 2X0JA 5KVCA 1SBYA 1JWBB 3TL2A 4A5OA 3PJGA 4J0FA 2WE7A 1R12A 4JROA 1SO8A 2RBEA 3PZBA 4K9DA 3JD2A 4R68A 1XWFA 4CUJA 5IXSA 1NQOA 4O1MA 2DTXA 2HMTA 1N2SA 3U5TA 4RLSA 2WEKA 3OJ0A 2AMFA 1QLHA 3C3XA 4FJ0A 3ITDA 3FNFA 3RSHA 2Q1TA 4UVIA 2P91A 3KOUA 1O95A 2O3JA 3AY6A 4HXYA 4YJGA 1QV6A 4Z3DA 1B16A 4XKJA 1JVSA 1ZSVA 4OSOA 5KKAA 4AJIA 4BO1A 1ZJZA 4DPMA 2W2LA 1EDOA 4WOJA 3WGZA 1K6XA 3H5RA 1LNQA 3P5SA 4P4NA 3U4DA 1TA4A 3PP8A 1AUPA 4E0BA 2YV1A 5TSDA 2JAPA 5AXDA 2X0RA 3VDRA 1FMCA 3AWDA 1ZH8A 3PIDA 4M8SA 1KEWA 4FW8A 1KC3A 2HMVA 4NG5A 2YFHA 3CKYA 1FDTA 1GUZA 4H3VA 4RLHA 4FOSA 1OMOA 4D43A 1U7TA 3HN2A 3RUCA 1DPGA 1AHHA 1GAEO 1DC5A 1NBOA 1LSJA 5KVSA 4YTEA 2ZYGA 4KTTE 2X86A 2FZWA 5JC1A 1E6WA 4RF3A 1ZKMA 2GDZA 5EJ2A 1NFQA 4J3FA 4ALLA 2VTEA 4U0JA 3AI2A 1LA2A 4C7KA 3UUWA 3PYMA 1ZO8A 2BF7A 3H9GA 1LJ8A 4MVJG 1NPYA 3GOHA 3Q3CA 5EQDA 4NBRA 2PH5A 3JD4A 2JFGA 1VKNA 4Q39A 1Y81A 4A26A 3UVEA 1CETA 4YRBA 2J8ZA 4BO6A 4XR9A 4FFNA 2YV3A 2BMAA 2O3QA 2EJVA 1HF3A 3G0OA 5A04A 3IL2A 2GPTA 3FNEA 2CMDA 4WNCA 5F1PA 3LU1A 3PHJA 1KERA 3KYBA 2GYYA 1AE1A 3F1KA 1KVTA 3ONFA 4TKLA 1ONNA 3H3FA 2F00A 3NUGA 4CM4B 3S2GA 3NT2A 4MIYA 4J4BA 1MC4A 1NP3A 4NJMA 1CDOA 1M76A 4EJ0A 2PD4A 1B0AA 3H5AA 3NT4A 2QYTA 4H16A 3H9JA 1AHIA 2D5AA 4N18A 1WNTA 4CMAA 3MJTA 1EQUA 1V0JA 1T1RA 1EQ2A 3LSYA 3NDIA 3PTZA 1PJQA 2EP7A 2X58A 4QO7A 1B26A 1GQQA 5FWNA 1XSEA 3H4VA 4OXKA 3I83A 2Y93A 2X9VA 5H83A 2AW5A 1X15A 1A72A 4WCFB 3ZWMA 2C29D 4YA6A 2CZCA 4JBIA 1HETA 1XELA 2QIOA 3OETA 4KMSA 3ZU2A 2Y1DA 2ET6A 3FBGA 1C14A 5DBGA 5JCJA 4IJWA 3DBRA 3MTJA 4KDEA 2EW8A 4UAGA 3TOXA 5IDYA 3QVTA 2PH3A 3NT5A 2X0NA 3G1UA 3CSDA 4NBUA 3GY0A 2A4KA 4AVYA 5IF3A 1XIVA 5HBRA 3ZW8A 3KEOA 1DIAA 4GWKA 5IDWA 3KYDB 4PLFA 5IG2A 4IDBA 4CL3A 4Z6KA 3WFIA 3IS3A 5COBA 2B4RO 3DHNA 1DLJA 3WXBA 5MGBA 1S7CA 3RBZA 3OFSA 4A27A 3VDQA 4NMHA 4LVCA 1NFFA 2QYSA 5F21A 3C85A 1I30A 2X5JO 4G65A 3EK2A 4JP3A 2NU6A 3SC4A 3AM4A 1NYTA 2GN4A 1E3SA 5I7FA 1VJ1A 4B4WA 4HFRA 4Q3EA 4BKUA 3MTGA 4BNMA 1PS9A 5JAQA 3ULKA 4IS3A 3ZWCA 1EFKA 4AICA 5JSFA 1NX6A 2B5VA 3KSZO 5JDCA 1C3VA 4J4TA 5A3VA 2NSDA 4RVGA 3PJFA 1CF2O 1BDBA 2VYVD 3ONDA 4IIVA 2ZTLA 2UDPA 2AQKA 3MEQA 1HKUA 3RWBA 3E5MA 1GCUA 5JY6A 2PLAA 1E7MA 4GGOA 3FPLA 4DLAA 1E3EA 1NVGA 2ZYAA 4ND2A 5ILOA 1EUCA 1DB3A 3DZHA 1RYEA 4WE3A 3AFNA 2CY0A 1U8XX 4DQVA 5L40A 2HDHA 4AJ2A 5DT9A 4CMEA 3K9QO 3RI3A 3ZNPA 5BSGA 2CUKA 5CDYA 1GFSA 1HDCA 1IY8A 2OFPA 4CLOA 2DTEA 5JC8A 1ISHA 1MLDA 4DMLA 1JTVA 1P44A 4AJEA 4TVBA 1CIVA 4RDIA 4CV2A 4JIGA 3PWKA 2UYYA 3W6ZA 4B4VA 1BXKA 1HZJA 4P4GA 2VT2A 1DC4A 1TB4A 2FPGA 2WTBA 3DBHA 2QZZA 2HK8A 2W98A 3CTMA 4DLBA 4YXFA 3I9MA 1BG6A 2W2KB 4TZKA 5L7YA 2JJYA 4PZDA 2HK7A 3WIEA 3VPSA 1M67A 4AJ4A 4HUJA 3Q9UA 4IJVA 3RU7A 4CQMD 1QMGA 3EDMA 4UUNA 5KIAA 3DZJA 1N1EA 4EITA 4CMHA 1WPQA 3PGXA 1EEHA 4G5HA 1KVQA 1SZJG 1GZ6A 4D0RA 4BO4A 3B6ZA 1ZBQA 3G79A 1D7OA 3ORFA 1K2WA 3RROA 1JAYA 4IQ8A 1P1KA 1KVRA 1KYQA 3QHAA 4TRNA 4OH1A 2OUIA 4FPXA 4LSWA 2OP0A 2B35A 4PLWA 4IY1A 3MJ4A 4YR9A 1UUFA 1YXMA 3TQHA 2B4QA 4IZIA 4Q3AA 2EP5A 3BZUA 4R5HA 5T67A 1P33A 3QVOA 4EUFA 2DC1A 2J5RA 4E12A 5JY1A 2NVWA 5CHEA 4EZBA 5DOVA 4E5PA 2B36A 2H63A 4NNJA 4XDYA 1LSUA 5A1TA 2JCXA 4R5MA 3AM5A 4Z9XA 4Y6RA 3BTSA 4LRTB 5EMHA 5T64A 4R16A 5DCUA 3PJEA 1MUUA 1UXGA 3PI7A 3QSGA 3TZCA 4I5FA 4J7XA 3ZW9A 1E5QA 2DU8A 2YHUA 4MVJE 1ISGA 1T2CA 4LCEA 1R6DA 3JQ9C 2HMSA 2EERA 4RF4A 1EVZA 4X54A 1F14A 5IZ4A 3QV1A 3E82A 2DVMA 5JYDA 3CH6A 2DFDA 1UP7A 3WX0A 2A9FA 3AY3A 4MIEA 2OORA 2QRLA 1I5RA 3ZWWA 4PZEA 3X2FA 1XEAA 1UZNA 4II2A 4FJ1A 4R1TA 2NLOA 1N92A 2ZB7A 5G0TA 4AJLA 4BGIA 4MVJH 2X1HA 4DC1A 3OA0A 1Y7TA 2VUUA 2ZCVA 3OQ6A 5ITVA 1I36A 5KJ1A 4RQTA 3ABIA 4NJOA 2JKVA 3DBVO 4CR8A 4RQUA 3VH4A 3PHGA 2OL4A 4B4UA 5JAIA 2ZJ0A 1K6JA 4E2XA 2E37A 4I08A 4HNGA 4L4RA 3GVCA 1PX0A 1K89A 1HTBA 2AEJA 3BA1A 1ML3A 3NTQA 1I3NA 1QYWA 4YJFA 2CDBA 4WLFA 1LDYA 3RUDA 4C7JA 4PLPA 3AUTA 4ZGWA 2WD7A 3LDHA 5C7IO 4CQLB 4J43A 4KTVE 3B1FA 4XR4A 4YYZA 4AG3A 1IB6A 5JO0A 1Z74A 1HWYA 2GN8A 2WM3A 3NJ4A 2NTJA 1LC0A 2FHSA 3VZSA 4DIOA 3KHUA 1MV8A 2Q2WA 3NEPX 1T2FA 1A9YA 4HY3A 1YL6A 1U2GA 4GKVA 1WVGA 5KOIA 5IDQA 5IZCA 2PK3A 3WGGA 3G17A 1T2DA 1PJ2A 1WZEA 1U4SA 3RBVA 3VH2A 1QXSA 3HE3A 1ADBA 1EFLA 3PFFA 1WDMA 1PJ3A 2GN6A 1F8FA 5CDUA 3R6DA 1LLDA 2IDZA 1N1GA 3HN7A 3RC7A 3WBFA 4BL5A 4YT4A 4RPLA 3PZRA 4ZU3A 4KP7A 1XLTA 3WDSA 1Y6JA 3NJ8A 3AOEA 1GEEA 2DT5A 2NQTA 4L73A 2JCVA 2O7SA 2PZLA 2JD1A 3Q1LA 1HSOA 3WGYA 1WLYA 3EVTA 4RZHA 2BI7A 1YB1A 1UDCA 4ZA2A 2I3GA 1E7SA 4M55A 2HQ1A 3NRCA 1EVJA 3WGHA 4IDGA 3AFMA 1UR5A 1Y5MA 2D2IA 1T4BA 4XDZA 4D46A 4DQUA 3ZWOA 1HLPA 4QFCA 4MO2A 2FR8A 1Z6ZA 1Q2XA 5G0UA 4GQAA 2FMUA 3LVFO 4L76A 2HJRA 3RUFA 4CMBA 5AXBA 4PG4A 1E7RA 4YRDA 3JQCA 1JN0A 2CVZA 1F0YA 1T4DA 1E1MA 3L0DA 4MKXA 2OHXA 3NV9A 3UCXA 3AOEC 5IXYA 4YB8A 4YAGA 3KLMX 4AFNA 1AGNA 3UGKA 1ZJYA 4ZN6A 4I5GA 5G4LA 2NNLD 1VRWA 2PTGA 3DZIA 1NQ5A 4JCOA 1E7QA 2J3JA 1E3IA 3KYDA 4ZRNA 3VTZA 1FK8A 1UAYA 5COQA 1I33A 3GZNB 1C1XA 3ON5A 1NHGA 4NBVA 3JQAB 3RC2A 3AW9A 3H9UA 1JU9A 3D7LA 3WGOA 4PVCA 4CMCA 4D3FA 5K6AA 2GRAA 2HMWA 3C1TA 2R00C 4EBFA 2X6TA 4RCVA 3AK4A 3VOSA 2UV8A 3LYLA 3N7UA 3G49A 3ZV3A 1E3LA 1J4AA 5TX7A 3EY4A 3WQSB 3I1JA 4IXTA 1UZLA 2X8LA 3ZNOA 3ITKA 4BO8A 2I9PA 4J91A 5JDIC 3OJLA 2BFMA 3GMDA 3K30A 1E3WB 3F5QA 4MP6A 1D3AA 3V1TC 4DREA 3I9LA 1YBMA 3PDJA 3DB2A 3I6IA 2DTDA 1I3LA 3DTTA 4E3ZA 3GRPA 1U2DA 2BGKA 4LVUA 3ZU3A 1V9LA 1UXJA 4YQZA 1H0KA 3K8ZA 1L7EA 4NK5A 2P9EA 1SCUA 2IZ0A 1MFZA 4JQCA 1D1SA 1PJCA 1U5CA 1YGYA 2EJWA 7ADHA 3JQAA 5L7WA 4J0EA 4GH5A 4JGBA 4QXMA 2BRUA 2Y66A 3NTRA 4KZPA 5U9CA 1BDMA 2HCTA 2O3RA 2LDXA 4RPHA 2PY6A 2ZB8A 1NR7A 4HFJA 3G1TA 2CSUA 4XQGA 2UUPA 4RF5A 3O26A 1PGJA 5TRTA 1MXHA 2JD2A 1SOVA 3GH3A 4E13A 4BKOA 8LDHA 4IINA 4J1NA 3UN1A 3H9EO 4GX2A 4CMGA 1PWXA 5I8WA 3EW7A 2IE0A 1ZSYA 1FJHA 2XAAA 3NTOA 3OICA 3GDGA 3K73O 5JYEA 4NH4A 3K96A 1ISIA 4IMRA 4BNLA 3PVZA 5H82A 4PG5A 1Z7EA 3QP9A 2VHZA 1RPNA 3TSCA 1Q7GA 4FOOA 1K5HA 1CQJA 5L51A 5JDIA 3VZPA 5IFLA 1HEUA 5LC1A 3RC9A 4J1QA 3PFWO 5JAMA 3IC5A 3WFJA 2ZCUA 5DN9A 1B3BA 1C0LA 3E5RA 4PG7A 4MP8A 4MVJA 3ZV4A 3RFXA 3SX2A 4XB2A 4BGUA 2NV6A 2VYNA 4M86A 2EGGA 4C4OA 4BNHA 4URFA 4CM4A 4DC0A 3OF2A 3GVPA 1QKIA 5BNTA 3HFSA 3INTA 4LN1A 5TJ9A 4WK6A 3QJ5A 2ZYDA 3JCZA 1Z45A 2VRCD 4W7IA 4DRYA 2NU9A 4XQCA 4DLLA 3BMOB 3GNTA 4YJHA 1ULUA 3HADA 2XOXA 2D5CA 4DQXA 5A4DA 1A4IA 4KQWA 3D4PA 4O5OA 3UXYA 3WBBA 3E9NA 2G1UA 2Y0EA 4TVOA 5BT9A 5B12A 2HO5A 1EVIA 2ZQZA 3Q2KA 3AI1A 2HJSA 3DBLB 1E92A 3HDHA 3UH1A 2EG9A 4TRJA 4BNNA 4D42A 4L0QA 3DDNA 3FPCA 1BXZA 4GX0A 4XEHA 4Y8VA 4HNHA 1N9GA 5A9RA 2VWGA 2ZTVA 3PQEA 2CVOA 4IIUA 3NDRA 1VSUA 3TRIA 3A4VA 4MVJF 1HDOA 3DEYX 5HTOA 3WB9A 5IJZA 1E1LA 1KEPA 2YJZA 4ESOA 2EEZA 3D4NA 3F5SA 3ZWYA 3NX4A 4OIMA 3DBLA 3H9QA 4YAEA 5CPFA 3GRKA 2OP1A 5L53A 3HDYA 4XRGA 4Z3KA 5HS4A 4IS2A 3DOOA 5KVVA 1W4ZA 3ICCA 5I9LA 1GTMA 3HUDA 3O8QB 3BMOA 2DUWA 1PZHA 3BXXA 3QWFA 1H9AA 4E2YA 3PJDA 2NTNA 3E9MA 3FR8A 3JYQA 2FWMX 2NACA 4RZIA 1DXYA 2ZKLA 2Q46A 1O6ZA 4PGFA 3QRWA 5EERA 2DBVO 5CG2A 3D64A 4Q3CA 4BKQA 2B69A 1SOWA 3I4FA 5G0VA 4I9HA 3UOGA 3RC1A 3FF4A 4E5NA 4BMVA 2WYUA 3GC6A 1SC6A 3WLFA 3W8EA 3WSWA 3RD5A 3LC1O 4BO9A 4D44A 2DBZA 1BXGA 1QYXA 4L9RA 2EV9A 3ADOA 4W4TA 3V2GA 4F45A 1X7DA 4YCAA 1R4MB 5ITWA 3JQAD 5DNAA 3NAQA 4MDHA 4EJ6A 4IMPA 2Z95A 3GN1A 1D4FA 3PRJA 2HMUA 3IJRA 5CEFA 3ZN2A 1K6IA 2JFFA 1U9JA 3RVDA 4E5YA 4RVSA 4LSMA 4BNIA 4ID9A 4XIYA 3DFUA 5DF1A 3ROQA 3F47A 1GYPA 4RO0A 3PK0A 3E6AA 2IXBA 4L74A 4RPJA 4GMFA 5THKA 4IGFA 2BHLA 3ZHZA 2E49A 1ZFNA 1LDMA 4A03A 1UXIA 2RHRA 2PA3A 3KB6A 3DXFA 3PYXA 4HKTA 4S3MA 4YBZA 3WWYA 5HRUA 1J0XO 2AQIA 4K6FA 3FNGA 3K2EA 1J49A 4BNKA 1XU7A 1MA0A 5KNLA 4YJDA 3ZZNA 1LXCA 3B20A 4AJKA 4P8RA 2HSDA 1ADFA 1AN9A 2J6IA 3OIFA 4GSKA 4NQZA 3SVTA 3RAJA 1C0IA 1K3TA 3ZDFA 4O0LA 1ZUD1 3T7EA 4I8XA 5L45A 1P1RA 3TOZA 2ILTA 2C2YA 3TF5A 2VTDA 3KXDA 1GYRA 2Q4EA 3LT1A 3GQVA 1B8UA 4XJTA 5ENVA 4CM9A 3AM3A 4FR5A 2SCUA 1G0OA 2Q50A 2ZTUA 5KKCA 1ENZA 3KSDO 4M87A 4RF2A 5JNLA 4FGSA 3GEMA 3H6KA 4ZD6A 5ES3A 3K5PA 4CM8B 2P9GA 3INGA 5I9NA 2DM6A 1ISMA 1RM4A 3L6OO 2FRDA 1YBAA 3DMYA 4TRMA 1VLLA 1H93A 2ZIZA 4EUEA 4Z9YA 1DSSG 4JK3A 2Y0DA 3RJ9A 4J6FA 3ZHXA 5TLSA 3LC7O 4E32A 1DIBA 3LLVA 4B79A 1UP4A 1O8CA 2P5UA 1HDYA 1ZMTA 4J1SA 2AQHA 4ZVVA 3TWOA 1QSGA 2E6UX 3LT4A 2I76A 1C0KA 3JV7A 4WUVA 2YV2A 4ND5A 1E77A 1WAMA 1WMBA 3D0OA 4QFDA 1EZ4A 2YW9A 1ID1A 3DZBA 4BOYA 5CFZA 2E48A 4LMPA 2PZMA 1JKJA 4OXYA 4BO0A 1X7GA 2GSDA 3L9WA 4RL6A 4XYMA 2DUUA 4LGVA 2R2GA 3BMNB 1EE9A 1YRLA 1U7HA 1X0VA 1I32A 4HADA 4BNZA 2Q99A 4CLDA 2X4GA 4Y67A 1PJBA 4DXHA 4GVXA 5C37A 4ROSA 4I9NA 1A71A 4AL4A 4IPTA 4CUZA 2DBRA 2PWZA 5EPOA 3JD3A 1R0SA 1A7AA 2Q1SA 3T7CA 3TFOA 4XGKA 5TJHA 4E21A 3KYCB 3FTPA 3KEQA 2IZ1A 4M1QA 4ZQFA 2CD9A 2DKNA 2PKRA 1GUYA 3TFQA 2DQ4A 3H2ZA 3R3JA 1VL0A 4OOFA 3RKRA 1U28A 3F46A 1T25A 1UP6A 4FQ8A 1UAGA 4WASA 3ADPA 1PZFA 4CMJA 4YJHB 5CAEA 1I2BA 4L75A 4W6ZA 2CNBA 3EUWA 1IHXA 3GZ4A 1DRUA 3GF4A 3QVXA 4RVHA 1B7GO 3C7DB 3IDSA 3BTOA 4CV0A 1PJSA 2J3KA 1ZK1A 2WD8A 2GF2A 4B7UA 3HJAA 4JLWA 4XYLA 3WG9A 1DAOA 2P4HX 3KO8A 2P4QA 1PQPA 1ENYA 3GK3A 4WCFC 1PS0A 4XZ3A 4ZQBA 3M6IA 5B4UA 3AUAA 2JFHA 1SNYA 4G81A 3IUSA 1YS4A 3OP4A 5B37A 1GZ4A 2IRWA 4U5QA 2V6GA 4ALJA 1EVYA 5L4LA 1B15A 4PIVA 2A94A 4FFMA 4TZTA 2WDZA 1YQXA 2C20A 4JBHA 5TC4A 5A06A 3OIGA 1BWSA 1NWHA 4BNYA 5K0ZA 2QRJA 3MJCA 1WXDA 3QWIA 2R6JA 3L07A 3A14A 2XXBA 1G0NA 4BO5A 1HT0A 1QLJA 1HXHA 3ST7A 3OA2A 2V7PA 5ICSA 1TLTA 2BELA 1LSSA 3I23A 5I8ZA 3PHIA 1F8GA 3RKUA 4E33A 1HZZA 3U9LA 4B3JA 1QORA 3BMNA 4H15A 1NAIA 3BIOA 2QG4A 4GKBA 2RHCA 1JA9A 3CINA 4WOKA 1LRLA 1LQUA 2DBQA 4WJZA 4TRRA 1ORRA 3SEFA 1PEDA 3ZV5A 1U3TA 3H2SA 4WPGA 4Y6PA 2JD0A 4F3YA 3WOHA 2QQ5A 1WW8A 1CQIA 3KVOA 5U4QA 3WTBA 4E30A 2X9GA 4ALKA 4FSHA 4L4SA 1IHYA 3EAGA 1F12A 1GPDG 1KETA 2V65A 4FN4A 4K26A 3DO5A 4CR6A 1NVTA 4UUPA 1PIWA 1HLDA 4UUOA 3F6YA 2VZ9A 4KOAA 4J7UA 3W6UA 1SPXA 3PQDA 1E6EA 4N5LA 1RYDA 1XYGA 4RVFA 2B4TO 1VI2A 2VOEA 3D5QA 3PXXA 1C1DA 3BTUA 3PLRA 4ZQEA 3I9JA 1DHRA 3DAGA 4CM8A 4DYDA 5TF4A 4B8WA 2G0TA 1I3KA 4MPDA 4E4YA 3RQSA 1GDHA 2ZJ1A 3GHYA 4OJNA 2AG8A 1Y9AA 4NFYA 4CMEC 3COSA 5TT1A 5C3MA 4GAEA 4BMSA 3VZRA 4BNVA 2WSBA 1YQGA 1A7KA 4E5MA 2EW2A 1KEVA 3DBHB 4M89A 3W4IA 3U62A 3JYOA 3PWSA 4WCFA 1Q7BA 3Q11A 1W6UA 2GZ3A 1LDEA 3QWBA 1KEUA 4ZHSA 3VZQA 3GZNA 3MCVA 2XF8A 3X2EA 3CMCO 5JLAA 3S2FA 5A03A 4YT5A 3SXPA 2C0CA 5EQFA 1HDRA 2QZ9A 3VH1A 1C1XB 4PRLA 2ZATA 3KSUA 4D3SA 1TXGA 3GUCA 4ZRMA 4PLTA 1DFIA 2V6BA 1NR1A 3HB5X 1A27A 4AJHA 1R16A 3I9KA 5CPBA 2VUTA 2OMEA 1KS9A 2PD6A 5TNXA 4B4OA 3KBOA 1JKIA 5HWSA 4ITUA 1H2HA 4J4HA 3OEWA 1I10A 3L6DA 3V2UA 3MOGA 1YKFA 3LT0A 1GR0A 3DR3A 4PLGA 4EI2A 4EEZA 4DBZA 1SAYA 5EINA 1O5IA 4NU5A 1DO8A 1PZGA 3TJRA 3OECA 1PTJA 1YWGO 4FIZA 2DPHA 1KY5A 2JAHA 4QEDA 2G5CA 4E2ZA 3ZWBA 4IDFA 4PLVA 3WGTA 1YONA 5CG1A 4PLCA 1I3MA 4R3WA 5AXCA 2H5LA 2GLXA 3L6EA 4XD2A 1X14A 1XHLA 4ZICA 4NPCA 2Q49A 1R66A 5F5NA 5A05A 3E9QA 2Y05A 1ENPA 1ZXBA 1D8AA 4BNTA 3JQ8B 2Q2QA 3K31A 4B8ZA 3OMLA 4EJMA 2IXAA 2I66A 1YQDA 1P1HA 4MKZA 4E2WA 3D5TA 3LK7A 1X1EA 1EMDA 4J9VA 4FC7A 4BNJA 5L9AA 3F1LA 5CDTA 3BMQA 1YH3A 3JYNA 1MFPA 4UREA 3S8MA 4YQYA 1XG5A 3W8DA 4U6SA 1O89A 2W90A 3F4LA 1HDZA 4GPD1 2B0JA 3JYLA 4QT0A 3G3EA 4W7HA 1H9BA 5LCXA 4YAJA 2POQX 2FN7A 3FCOA 1Y8RA 3IQDB 4CQLA 3WQRA 4Q9NA 3I52A 4BV8A 5HM8A 3CXRA 4A0SA 2O4CA 3PGJA 3W1VA 3M2TA 4YJGB 1DIHA 3PPIA 4FJ2A 4Y6SA 3DBRB 3N58A 3B1KA 1PL6A 3C1AA 3Q2IA 4UVHA 3VC7A 2I3AA 1DFHA 1TT7A 3VTFA 2RH4A 4GX5A 4LW8A 5A9SB 2AQ8A 3NGXA 1ZNQO 5A02A 1TEHA 1ZEJA 4G2NA 3TDKA 4U7WA 1YJ8A 4TROA 4XYBA 3DOCA 2EKLA 4FBGA 4EEXA 3Q0EA 1ONOA 3QE3A 2VWQA 1PL7A 3RJ5A 4B7XA 3JQGB 4BNFA 4BB6A 3VAZA 1WDKA 2I99A 3O4RA 4FGWA 3CIFA 5T8KA 1O94A 2FZEA 4IGEA 2UVDA 3H7AA 2CVQA 2J3HA 1NHWA 1CEQA 2AE2A 3IUPA 1YJQA 3UFXA 4AJPA 3RUIA 2E4AA 1M66A 3QQPA 4BIIA 1Q0LA 4BVAA 3RUEA 3OEYA 4BO7A 3LQFA 3Q6IA 2AEMA 6ADHA 4L4XA 5T57A 1XR3A 3I3OA 4QTZA 3WWZA 3IIEA 3K6JA 4S1VA 4DMMA 5A9SA 1NQTA 1I2ZA 3DL2A 3P2YA 4BNGA 2HKIA 1PWZA 2ZQYA 1BMDA 5DBFA 1PS8A 3DFZA 1KVUA 5JE8A 2VZ8A 1DFGA 2O3TA 3HFGA 2GD1O 4OL9A 1UDBA 1MXFA 1ARZA 1GQYA 1XCBA 3U0BA 1XKQA 1XDWA 3D3WB 2I65A 5BNIA 4KUEA 2VCYA 3GR6A 4GGPA 1YB5A 1Y1PA 1O0SA 4IQ0A 2BFAA 2Y1EA 4JXKA 4PLYA 1DRWA 1W8DA 2EHDA 3V5NA 1BVUA 1YVEI 4J9UE 1HSZA 3EYWA 1TI7A 3HWRA 4DA9A 1YDEA 2FP4A 3GAFA 3WQQA 3U09A 3WSVA 1IZ9A 2JCYA 1YOVB 2HRBA 3IP3A 3CMMA 2X9NA 3RCBA 1M6HA 3ANNA 2VHVA 4YDRA 4RPGA 2VZ0A 2J5QA 5G2OA 4FFOA 1OFGA 1E5LA 1MGOA 4LMRA 5JAZA 2XXJA 1I2CA 2PGJA 1NTOA 3P2OA 2NTVA 4CLEA 2Q3EA 3BAZA 3OBBA 2O4UX 3GHHA 4GVLA 3KUXA 5FFFA 5IDXA 4BNWA 4CM5A 1J6UA 4DWVA 5K6AC 5A5FA 3OJFA 4QUKA 3FNHA 4DYVA 2PGLA 3GPDG 1DIRA 1L1FA 5J23A 3SC6A 3I6QA 1LDNA 2D59A 4MVJM 2AHRA 4OQYA 2CF5A 4XQ9A 3GA0A 3ONEA 3STHA 4O63O 1HL3A 1VJ0A 3NGLA 1Z75A 1ZZEA 4B3IA 4YWJA 4Y9DA 4WKGA 3AJRA 5HA5A 3SJ7A 1IL0A 1GY8A 4PCVA 1S6YA 4BKRA 3ZGYA 7MDHA 2XPCA 2VNSA 4TMFA 4CUKA 3DZKA 3RFVA 4OHUA 1FDUA 3FR7A 3R1IA 3DZFA 4DPLA 4YVFA 2DPGA 4GI2A 4MIOA 1TT5A 1UXKA 4GSLA 1DC3A 1LC3A 4YRAA 5BNFA 1NASA 4JX8A 2IEBA 3F9IA 3GT0A 4D79A 2P68A 1W0CA 2C82A 3CUKA 2BGMA 1F17A 3PHLA 3ETDA 3E8XA 2C2XA 1CJCA 5FI5A 5G4KA 3ZHBA 4GL4A 4MP3A 3QY9A 3O9ZA 3JQBA 4QQRA 2GASA 1VKOA 3B1JA 4GLLA 4PN3A 3OQBA 1B3RA 1GD1O 3U4CA 1NQAO 2EXXA 2NU7A 2HRZA 1AXGA 2BH9A 4ZQHA 2WD7B 4YAIA 5C7OO 4TKMA 6LDHA 4IDAA 4HP8A 2NUAA 3CZMA 1PGPA 4CLHA 2DAPA 2D3TA 3IMFA 2VWPA 3GG2A 4MOWA 1IUKA 3WR5A 4BQRA 3WYCA 3L77A 2OBYA 2GGSA 4BGVA 1BRMA 1NAHA 4DVJA 1OAAA 3DAFA 3UW3A 4JBGA 3PEFA 1ZMOA 5IAAA 3CEAA 3PYLA 5COAA 5U1PA 4Z9FA 5KJEA 3T4EA 1HDXA 1E7WA 1YB4A 1B8PA 3ZV6A 2RCYA 3WGQA 3TN7A 2NQ8A 2PKQO 3IP1A 3HDJA 3NDJA 1QYDA 3GNQA 1B14A 1UH5A 5CDGA 1KOLA 1UZMA 1PQUA 5GZ6A 2NU8A 4OOEA 4IJUA 4OMUA 1N7HA 3LF2A 1DIGA 3K92A 4ALIA 3ENNA 3VPHA 1JQBA 3EZYA 4WCDA 2DFVA 5B4VA 2Q1UA 5T8KC 3ZI0A 5ICMA 2WMDA 1HYGA 1KBZA 4FFLA 3AI3A 2NVUB 4NK4A 3E48A 3QWAA 4D0SA 2BKAA 3UF0A 4WLNA 1MB4A 4CM7A 4KQXA 1P1JA 5TIIA 1B8VA 1HE2A 3CE6A 1HE4A 3ZNNA 2PKQP 3W4JA 4XQEA 4INAA 1DBVO 3A9WA 4NFHA 4P22A 5A9TA 5DP1A 2W4QA 3DMTA 5DOZA 4AJNA 4R4JA 1WDLA 2NWQA 1P77A 4R1NA 3QVSA 2AEFA 1BW9A 4DL9A 1NXQA 5GZ1A 1V3UA 5HS6A 1P0FA 5CEEA 4KUGA 4RVUA 3WTCA 2C7GA 1RM3A 4NJMB 3JQBC 3B70A 2AG5A 3SJUA 4CODB 2BI8A 1C1DB 4NDNE 4J49A 3FI9A 3CPSA 3S2EA 1UXHA 1XU9A 2D1YA 2O7QA 4WNIA 4R9SA 4J90A 4P38A 1R4NA 2NVUA 2GNAA 4WECA 4UULA 4I5EA 5KJCA 5JCJD 1PQWA 3PWZA 3AY7A 2BGLA 2Z5LA 3KRTA 4NBWA 2GO1A 2NVBA 3JTMA 3HNPA 3A1NA 1E7YA 4U0KA 1I8TA 1G6KA 4CM9D 3ZCXA 1WMAA 3ANLA 1H6DA 4N54A 4ND3A 2TMDA 2EKPA 1XGKA 3KZVA 3PQFA 4CV3A 4DGSA 5JW6A 1Y5RA 5CEJA 2IYOA 4PFJA 1N9GB 3DHEA 1LSOA 5IN4A 3QVWA 1Y8RB 1RM5A 3GMSA 3RUHA 4J2HA 1Z73A 4CLXA 4D45A 1Z7BA 4CLRA 2X5KO 4R54A 2W2KA 2GZ2A 4BGEA 2W2LD 2YYYA 1P74A 3KETA 1EK5A 2YQ5A 3HB4X 1VC2A 2O3SA 5ADHA 1XQ1A 1ISFA 1ZK2A 2WWRA 1P1FA 2J3IA 2FSVA 4TWRA 3GNSA 4NZ9A 1SMKA 1WZIA 3DONA 4PLHA 3WMWA 4CJXA 3SBOA 2B83A 3Q9NA 5ILGA 5LDHA 1QV7A 1F06A 1V3TA 3U3XA 3BTVA 2Q4BA 1DDOA 3PHHA 3TZ6A 1UDAA 3NKLA 2PFGA 3F4BA 5ER6A 3DZGA 3ZH2A 1LBEA 3T4XA 3V1YA 4IUYA 3QIVA 2GCGA 1XQ6A 4FC6A 1R15A 3BHIA 4XA8A 4BKPA 1ADCA 2YUTA 3A06A 2Z1NA 4BUCA 2ZB3A 3V1UA 2I6TA 1MG0A 2YDXA 3OIDA 3FN4A 1OI7A 1T2AA 4LISA 3FWNA 1M75A 2O2YA 1T1SA 3KV3O 5BSEA 1NNUA 4XGIA 4WLEA 1PJ4A 2VT3A 4M54A 4GBJA 1H5QA 2Y1OA 2ZTMA 4AJOA 2EKQA 1A5ZA 4A10A 3WJ7A 3S1LA 4NR0A 4WEOA 2GZ1A 1X7HA 4KDFA 2C7VA 2CFCA 1MP0A 3RASA 2HU2A 5F1KA 1PR3A 1YL5A 4MVJI 2RAFA 3AOGA 4Y98A 2YHIB 4Q3NA 1YOVA 4LCJA 1PGOA 5LDGA 4R69A 1DOHA 2BD0A 1N7GA 3UAGA 4YT8A 2Q45A 4ZQGA 1PGQA 4PRKA 4ND4A 4PG6A 2Q1WA 4IM7A 4Q3DA 2LDBA 3ETGA 3MWDB 5BSFA 8ADHA 4XYGA 2P2SA 2D4AA 3GEDA 4KWIA 5I9MA 4XYEA 1DC6A 1JLLA 3BHJA 3D1LA 1V8BA 4E31A 2O48X 4CLRB 1BSVA 1XA0A 4HX5A 5FF9A 1AXEA 4CQMA 3GGGA 3I5MA 2NM0A 4HBGA 4HFMA 5GY7A 1U1IA 1G1AA 3VVBA 1CYDA 3BHMA 4F46A 4ILKA 4AJJA 5KTKA 1HDGO 3JQGA 3GLQA 4R41A 2ZK7A 3VPXA 5G0WA 4YJFB 2B37A 3ZNQA 1DLIA 2FY8A 5F5LA 1GQ2A 3TZKA 3WLEA 2G17A 2VYVA 2VYND 4XCVA 4B3HA 1R0KA 3LF1A 1FDWA 1T26A 1PL8A 1V35A 4R1UA 4A73A 3ASUA 5TQVA 3EGOA 3JYPA 4I1IA 2Y0CA 3JQ6A 1J5PA 3OM9A 4JP2A 1E6UA 1WWKA 1FXSA 4W9NC 4YT2A 2AXQA 2V6MA 9LDTA 5CDSA 1SEPA 3F3SA 4I9UA 4PZCA 2VRCA 5KJ6A 1DEHA 2JHFA 5DULA 4ND1A 2EIHA 1C0PA 3JQEA 4W82A 4RORA 3SLGA 3HZZA 2PZJA 3V8BA 3LC2O 3L4SO 5L4NA 1ZW1A 3W4KA 4NU6A 5FI3A 5L95A 3ICPA 3BMCB 5EN4A 5JCXA 1DRVA 4N5MA 3H5NA 2FPPA 3KTDA 1OC2A 1LU9A 1BW9B 4ALNA 4DBVO 1IOLA 1HRDA 3GFGA 4BV9A 2PNFA 2YHIA 5EESA 5AYVA 3VPFA 3GGOA 1RWBA 2C59A 4N7RA 4FCCA 4GWGA 5L4SA 3MJVA 4NHEA 2EF1A 1Q0HA 1TVEA 3ASVA 4TQGA 1PR9A 2H1SA 4GMGA 5B4TA 3I4CA 3VVCA 4FS3A 3FBTA 3GVHA 3JQ9A 3TZHA 4NIMA 4QO8A 4GLOA 3I9OA 4IDEA 3GPIA 5EIOA 2PD3A 3JQ7B 2HAEA 1H6AA 1T2EA 2IODA 1ONPA 3OH8A 2C54A 3TPCA 4K6CA 1BXGB 1BGVA 4YPOA 2OO5A 1GV0A 3GVIA 2I5PO 3KYCA 3HHPA 2OOSA 1KY4A 1HE5A 2QW8A 5FYDA 3WGIA 1QRRA 1EDZA 1PU2A 4OAQA 2Y99A 5JO9A 4XB1A 4U6QA 2WYVA 5G4KB 5JMWA 5DCWA 1RJWA 2Z1MA 1R37A 5AXAA 1QG6A 3NYWA 2X23A 1QYVA 1EE2A 5KWEA 3UCFA 5BR7A 1NFRA 4JJGA 3JQDA 3TZQA 4IDCA 5KVQA 3U4IA 2QRKA 4DUPA 5AQ1A 1OBFO 1YO6A 4DIFA 3VKUA 1MX3A 2HK9A 3D4OA 4HWKA 3ZU4A 4QSMA 3EHEA 2OGUA 3M1AA 1JDJA 2VQ3A 4UEOA 4RPKA 3FSRA 1QP8A 1T24A 3VH3A 2IYPA 5KCZA 2ZB4A 4Z0TA 3JQ7A 4IDDA 3QA9A 4PVDA 3N74A 1LUAA 4BNUA 1IPEA 2QHXA 4Q3BA 3U4HA 3E03A 5A3JA 4OGWA 4CM6A 2RH8A 2VHWA 2EWMA 4F6LA 1ENOA 2X0IA 4CMIA 1KIFA 4R01A 1IYZA 3ROKA 2BFOA 1B2LA 3GDOA 3BMQB 3AU8A 2W8ZA 3PDUA 3INRA 1H6CA 4OO3A 3ZU5A 1Q7CA 1OOEA 4IQGA 1BTOA 3ZWXA
chains in the Genus database with same CATH superfamily
1I4TD 3A1TA 3JARB 2I55A 4FD3A 4S1PA 3UICA 3WWEA 3NWOA 4C0XA 1AKYA 1IEWA 3DLTA 1D9XA 2HJVA 1NPDA 3K53A 4H6WA 5GVRA 1NVMB 3TKLA 3V4LA 1D1TA 1O9GA 4MKFA 5AVOA 3TH5A 1FDVA 3DD5A 1VJTA 1JWAB 5G0SA 1K97A 1Y6QA 3GDFA 1N5JA 4NVRA 2WTXA 3G6KA 5D87A 4ZKDA 1DAPA 4MI9A 2G67A 1KO1A 2OC9A 3ABSB 3RFFA 4HYEA 1V9CA 3BRWD 2X77A 3E1SA 3WKAA 1KJJA 2GN2A 2J87A 2WYIA 4R2IA 1X8JA 1ZJJA 4LK3A 1LX6A 4MUBA 1VDZA 4P93A 2YY7A 2IXTA 4Q24A 1L7AA 3SJBA 3GLFE 1DWQA 3FTNA 1V39A 2WJWA 2JJQA 1HC7A 1LDBA 1PGNA 2XUFA 3GAZA 3O2JA 4GS5A 1I01A 2NW6A 4UVGA 5EXDA 3K3PA 1RIIA 3GT7A 4N6OA 4CCSA 1VHWA 3CUEF 4IJKA 4WY2A 1KK0A 2AFHA 1HYEA 3SS9X 3K9FC 1NLYA 4RSHA 4RKEA 2NADA 4O2BF 4PNPA 4E22A 4XX0B 1KC1A 3FOAA 3LCMA 1H94A 1PE0A 5KDLA 1PVOA 4MV4A 1IPFA 4DM4A 5CA0B 4ZCMA 1X0XA 3CB2A 3PKZA 4BIMA 1U90A 4IQFA 4BVBA 2ZRMA 1QO0A 1T6YA 1P0CA 2EOAA 2Q6KA 2P77A 4P54A 4QREA 4R9VA 3RS3A 4QKQA 1U3UA 2OAGA 4B7AA 1RJGA 2NV2B 1RLUA 3GCZA 5LMUB 3ZE2B 4ME6A 1JVBA 3QBTA 1Y3CE 4YMIA 2IWRA 4C6HA 3FIJA 1EA5A 1JDBB 1RWXA 3FYUB 2B92A 4G9GA 5E2IA 2R6CA 4DM3A 3BK7A 1P19A 2VHUA 1MTOA 3GFVA 3H8VA 3HCOA 1O8BA 3WL4A 3K2IA 1XB2A 3PICA 1TYZA 5SYAA 4YPFA 2ZSAA 4W99A 2A6PA 3DP7A 3RYFA 1JYFA 3OFNA 3E27A 5DCYA 2H65A 1M6VA 1VM6A 1QK3A 3MJSA 3C98A 1RBMA 3EXAA 3NCTA 4K28A 4LJYA 4EYEA 3H5VA 5JSQA 4DV5B 2HU5A 1E1NA 4LZNA 1B0PA 2AL7A 4XXHA 5BP7A 5BR1A 3FUXA 4IILA 3CPEA 5JHGB 2PO7A 1HYHA 1E3JA 2I29A 5JBIA 4J7CA 1T9DA 4OKSA 2C2BA 2G1PA 3CC8A 1XCOA 4OBEA 4MRNA 2VPTA 5B53A 1GYQA 2SNIE 2HUNA 3DTYA 1OC4A 3O38A 2I7VA 2VNKA 5JVDB 3AONB 3OFVA 3NCHA 1E3WA 1UL1X 2Z8XA 4C21A 4MJ3A 3GGPA 1E0DA 4LJAA 4LHWA 2WAXA 4ABYA 3FRIA 5K9ZA 1MJGM 1X7WA 3V42A 1NNEA 4JN6B 2WE8A 4FDAA 1JDZA 4B5LA 1Y8QB 1ZLXA 3ZIAA 3FGNA 4MQFA 2FMTA 4II3A 2B5WA 3PLNA 5K3CA 2EIXA 2WAAA 5AW8A 3JSAA 3FZNA 1DTWA 3RBXA 2ZBVA 3H65A 3ILXA 5L3ZA 4XJSA 3C8MA 4C3UA 4LZLA 2PGDA 1LI4A 3Q5DA 4BQQA 3UMYA 5EOVA 3VOTA 1YJBA 2ENWA 3H04A 5LZ8A 2MR6A 3E2IA 1W2HA 1E9RA 2YXPX 1PFQA 4OQ4A 1T8UA 3W6OA 2YDYA 2UAGA 4M49A 2XCRB 3SD7A 3EVZA 2HLPA 1N5DA 5G40A 2YJTD 5F3RA 5JNVA 3I0NA 4HTFB 2I2CA 4ML3A 4L8VA 1KVSA 4EBBA 1ZIDA 3B9PA 1GU1A 4MROA 4MGKR 4I55A 1Q1QA 1BVRA 3W7BA 5HQTA 1SEVA 3KXLA 1YR1A 4UKDA 2DY0A 2P6UA 2BZGA 4LZJA 3FHOA 2Q2VA 2AN9A 4PAOA 3T3HA 4XDGA 1GPJA 1SH7A 2PXAA 4JVSB 1EH5A 3PDIA 5IKOA 2FPIA 1IOWA 3NALA 3JX9A 1HNXB 3CF2A 4FNAA 3W2EA 2C2WA 4J1TA 5AD1A 3N9IA 4JKYA 4BFUA 5ER9A 4EPRA 4XVCA 5EGNA 1G8AA 2ZRNA 4J8PA 1TYAE 5C7YA 1USKA 3EDQA 3U80A 1GG5A 3G2IA 4PG8A 3AT1A 1ZVQA 3QPVA 4RJTA 3R8FA 3LRPA 3TXXA 2WQZA 4KIGA 3SMVA 4D41A 2CDCA 2GKGA 2XYRA 3PL5A 4UZEA 3J81k 1TZJA 3E18A 5F1YA 5P8WA 3NVDA 1XTSA 2A0XA 2PEZA 4K9MA 5ICFA 1XQVA 4PRZA 5J3JA 4I1PA 1IULA 1UJMA 1X13A 2CWWA 2OM6A 1KZ6A 1NSTA 1N0IA 2VR1A 1KJQA 2IUEA 2QTMA 2FKAA 1DBRA 2KHZA 3DDWA 3OT4A 4I2NA 1LQTA 4MUYA 4X90A 5F51A 1IWPB 4BO3A 4OSPA 1U1EA 4JWTA 3HCPA 4HQRA 4JODA 4EYGA 3HWSA 3LQ4A 4EEKA 5BXQC 4IZHA 2LXNA 4OUDA 3VMMA 1TZ2A 4GR5A 4LGMA 2GEFA 4LUCA 2C2ZA 3OZEA 1LQ2A 1YHZA 4YAKA 1GTZA 1P45A 1Y9EA 2X7HA 2XITA 2OPHA 1UJ4A 3NHYA 2WK1A 2XY4A 1G5RA 1H2AS 2EL7A 5H9WA 2CEAA 1YZLA 3CVOA 3BKXA 3H84A 1KO7A 4EY4A 2KPOA 2EFDB 2CE7A 1U8FO 3PNBA 3PB3A 1XEXB 3PV0A 4FEYA 3C7TA 3C1OA 3MK31 4ND8B 3NOQA 2VQ6A 4DLXA 1TMOA 3H13A 1Z0ZA 3L0CA 1QPGA 3P71T 3WLMA 1GPBA 1CRWG 3PUYA 2LE0A 3B6JA 1A4UA 1H6BA 2EEPA 4FWTA 1L8OA 3R3UA 5CH3A 4CL8A 1KMNA 5ELLA 4D8VA 2X5OA 5EE0A 4LFAB 4HEQA 2GN9A 2O0LA 1PKEA 3VR6A 3M1LA 4Q4CA 2C07A 3NHZA 4OG2A 3ZWDA 2YWEA 3BMCA 4DIUA 1ZK4A 5TMBA 3MJEA 3ZJVA 1TGYA 1I1NA 1N8NA 1UBNA 4MV5A 5MGNA 3HJRA 2R6ZA 3ZOKA 4HAWA 3TSOA 3IKVA 1RQLA 4GXRA 1W7AA 2OKCA 1FU8A 3KQUA 1RZUA 3L8YA 3KOWA 5JJ5A 3BRQA 3R44A 4W5WA 4E6PA 3I9FA 1YDWA 2A58A 5C5DA 3AW8A 1HFKA 4DIBA 2ZIFA 1PLJA 4YACA 5IJ9B 1IVSA 1Q0SA 1TFRA 2Y67A 4J0KA 4J2OA 3QW4B 3UWDA 1ZCJA 4TXJA 4I4LA 4QGBA 2WKWA 1DMSA 3EZLA 3HPRA 1MEOA 4IIGA 5TGDA 5AM3A 5THQA 2FLWA 3WXMA 1YCFA 4OYRA 2Q4TA 2VNJA 5B1IA 3H86A 1RE1A 2H85A 4X6XA 4FGKA 4BN4A 2BFPA 2Z6UA 1CUJA 3WFZA 4LJSA 2IXDA 5EWJA 3DOJA 4IHJA 4Q1DA 3CWQA 4Q4HA 2PBZA 2E5LB 2O8BB 2G82A 1NUTA 4EI7A 3O83A 4QXQA 4WN3A 1SOAA 5CX1A 3QHPA 5KC9A 1GWNA 2C5BA 2L0XA 5EJMA 1J8FA 1IY2A 4C7OA 4C5BA 4LOIA 4YGXB 1JEAA 3GI1A 3VPDA 1T6ZA 2WJAA 4U8GA 1VDMA 4AW9A 3H17A 4MDFA 1VFNA 5DASA 1OA1A 3C3AA 3OQIA 2R11A 2IHNA 2J4DA 3TLAA 2V98A 1HTWA 3C48A 1U3VA 3KUUA 1A8UA 1S4QA 3RFTA 4UJ5A 1QQ6A 1K3UB 1UT6A 2MINA 4EDFA 4KXUA 3DLHA 1CWUA 1K0UA 3K09C 3FXAA 2CDAA 4D92A 2D0PB 5E6RA 4COOA 2XD9A 1JJAA 3BFPA 3NNNA 4Q4JA 1IMOA 3BGVA 1NI4B 1Q1GA 1UF9A 3WS7A 1D07A 4KLAA 4NFSA 2EQ5A 1RP1A 1JS1X 2CL7X 3ANXA 4NYMQ 3TD6A 4EHLA 1I24A 2OQRA 1G8HA 2LW7A 1QOQB 3QEOA 4ED9A 4RSMA 4FGZA 3UC5A 3SIRA 1DJQA 1H65A 5KYWB 2Q6IA 1CVIA 2PH7A 3FCYA 1G38A 3VKGA 5EIHA 3R09A 3MIZA 1JWBB 4MICA 4A5OA 3J80A 1EM8B 5H8WA 4J0FA 1P0PA 1U0LA 4OAOA 4RKRA 1Z6PA 3ZDDA 2RBEA 4HQKA 4R68A 4R84A 2XYVA 1ZM7A 2QJWA 5IXSA 1Z4OA 4M9XA 1K5GA 2BFEA 3NHAA 1BEZA 4OJKA 1YU6A 3NDPA 5EMMA 2JATA 4XLLA 2NOAA 4D25A 3R0JA 5IAGA 3ZE9A 3VOAA 1X8XA 4AJ9A 2V4ZA 3ITDA 2DWCA 3FNFA 2Q1TA 4UVIA 1O7JA 1UIRA 2FKNA 2VC2B 3KOUA 4J16C 3X2SA 1GTSA 4X8MA 2UKDA 2ZUDA 4KGDA 3ZKWA 4Z3DA 4MTLA 5E7JA 5IHXA 4UTZA 5INTA 4FR2A 1W94A 3UOAB 3WP1B 1JBQA 2BUCA 1BKYA 1XZJA 2PKCA 4N0DA 1EXVA 4D6XA 1DKMA 3LZDA 1EDOA 2CV0A 2DGDA 1M1YB 1K6XA 1NW3A 2J7PA 3H5RA 4OA5A 3U4DA 3RR2A 1TK3A 1WD7A 4LA4A 1IEQA 1S3GA 4YMVA 1ETUA 3NANA 4P80A 4DE5A 5TSDA 3RFCA 1DAIA 3DOHA 3O74A 1H69A 3OQOA 4YREA 1D2NA 1FMCA 3ADBA 1L4FA 1ZH8A 3E61A 4LIPD 3LCCA 3AIMA 3ZCPA 2HA0A 1XTPA 3DAYA 4FW8A 3LO5A 3NZEA 1QUEA 3PXEA 3PQ6A 2XF2A 1U65A 1JA0A 4HL6A 4YCSA 1FDTA 4PICA 3PLAE 2VP4A 3NVAA 1HL7A 3HN2A 4KBYA 1DPGA 1AHHA 4KMOA 1DC5A 4B3DA 1JR3E 4ZJZA 3ZJTA 1NBOA 1B41A 2ZYGA 1JEEA 4QARA 4CETA 4DCMA 1TJYA 4JI8B 2I8AA 2FZWA 2H18A 2Q9AA 2IEIA 1IXRC 5K0NA 3NFYA 1MGPA 3DV0A 4DQLA 5JD4A 2W6JA 2EYUA 1DADA 2VTEA 1RXCA 4U0JA 1VBNA 3PIRA 3A1CA 5IM4F 1HE8B 2GLUA 3DPSA 4UCWA 2HIGA 2RJNA 3JVEA 4FVTA 1P1BA 3UNXA 1YR9A 3H9GA 2PXCA 4FHEA 4MW1A 4QOIA 1M5TA 2QT1A 2V5AA 1PYOA 5HIAA 2QUIA 4K05A 2WOOA 3Q3CA 2WA1A 2R751 1MX5A 1LNZA 3E3MA 3G85A 2G5TA 3LUBA 3WIVA 4UQLA 2CXSA 5DSZA 1F3LA 4LYHA 4UBJA 1VKNA 1YDHA 1BMQA 3PXAA 5HSGA 4DV4B 1F3OA 4BO6A 2O5VA 3AG5A 1D6SA 2YV3A 4FFNA 1A88A 1LVHA 2H07A 4XFKA 1AUOA 1JHOA 2YNMD 4MSUA 3U5ZB 3D2AA 2CMDA 1DDGA 3MRSA 1UDXA 4MNTA 1ESNA 3LU1A 1OAKA 3IUNA 3N2KB 5F1PA 1KERA 5FOUA 3RTCA 1BWPA 1ATZA 1RRVA 2GYYA 2PT7A 4KI7A 1AE1A 2PWPA 1ZD5A 3F1KA 4R40A 3X43A 3D59A 2ASVA 3NUGA 5EKUA 3FYHA 3QEMB 1AKQA 4WXHA 1YRYE 1OV4A 1NP3A 4H3HB 1MO3A 2BAGA 2GHRA 2QMYA 1MB2A 3AJ8A 1XRRA 2QYTA 1L4KA 1V45E 3H9JA 2D5AA 4FFBB 4EYOA 1WNTA 1ND5A 1QK4A 4HQFA 3GARA 4OVKA 1PJQA 4P84A 2Q5LA 1XD8A 5DGXA 2WF7A 4HRVA 2EP7A 2G07A 1N2CE 4C0KA 2FETA 1PT8A 3SGLA 3B12A 1T3SA 3H4VA 4HDOB 2YZKA 4MUHA 3I83A 2Y93A 4IXMA 1X15A 1A72A 3ZWMA 3EXHA 5AI5A 2C29D 1F0PA 3GLHE 1RRCA 4MUMA 4JLDA 1H1LB 3GUZA 3CBGA 3FFBA 5H68A 1NVWQ 3OETA 4N1AA 1J8DA 1KMHA 1XCPA 2Z6AA 3KD3A 3H87A 1W6RA 2DR2A 1EM6A 4GOLD 4UAGA 3CO5A 2R84A 4YP1A 3QVTA 2PH3A 3G1UA 3P5BA 5DBOA 1YQTA 1UAAA 3ZHVA 1O03A 5CD9A 4NOLA 1UWVA 3EDYA 2QT0A 4GWKA 1MR3F 4Q4HB 4B3RB 3R3XA 3KYDB 3RU2A 4Q00A 3LY7A 5IG2A 4WRRA 1S5PA 1SBZA 4CL3A 2IYVA 3NYQA 5K8LA 4QPJC 5COBA 4BQFA 2PRKA 2B4RO 1GL9B 1WBJB 1XAIA 3DHNA 4QYMA 4FOLA 5MGBA 3DFFA 1S7CA 1US8B 1AO3A 1DV2A 2FZKA 2PX5A 5CT5A 1XK6A 4A6XA 4QG3A 3MS7A 3DJYA 3SF8B 5IF9A 3LCUA 2WJGA 5AKJA 4CEHA 2G7ZA 3ZYZA 1P2BA 2VSNA 3TLEA 4RA9B 4JP3A 3EA0A 1DX4A 4RX1A 5HM6A 1V5WA 2GN4A 3IDAA 5LQUA 1XJ0A 4EO4A 4DY4A 1E3SA 4AS3A 1TOAA 4L78A 4HFRA 1IK6A 1MN6A 1YU9A 1NRJB 2X9LA 3EMBA 3WE7A 4HN9A 2O8DA 4HDMB 4TM8A 1XTVA 4L5BA 3UQYS 2K6GA 3RIYA 2C61A 3HI6A 4ZO9A 1E1RA 2LCIA 3SZMA 1GKKA 1UOPA 3ZWCA 4YHHB 4KPYA 4Q9LA 4XUEA 1X7YA 1FPQA 4JJ4A 1XZPA 3C3PA 3HR7A 5JI2E 3MS2A 1AN0A 2ZAYA 4HMPA 2NSDA 4DCCA 2X0KA 1W19A 2R7NA 1TKAA 2YYZA 3KD2A 4IIVA 3ITNA 4GEKA 5LBTA 3OOSA 1LWOA 2QUZA 1W36B 3C3DA 1T9GR 4YJ2F 2XW6A 4RD0A 2YZMA 2G9UA 3FPLA 3ZGXA 3WLOA 3OZBA 4V0SA 2E3JA 4NBKA 1H1TA 2ZG6A 3BVPA 4I55B 2J7KA 4QAQA 3HS3A 1UDRA 2FK8A 1EUCA 5ALLA 3WDLA 3JALA 3WWPA 3JVUA 5KHLB 3AFNA 1E62A 2HDHA 5K3SA 2O2CA 2BR5A 4AJ2A 4A0GA 3TW6A 3MPOA 1T13A 1OLXB 3K9QO 4BX3A 4HTAA 3B52X 1NJGA 1SVWA 5BSGA 4PBRA 1LD3A 1N6LA 3H0CA 4HB0A 1WTAA 1DQRA 4M0DA 4DKJA 2OFPA 4KN8A 3THWB 1WXXA 4E3WA 3R23A 1ISHA 5IBPA 4MUGA 1PG5A 4DMLA 1RI5A 4ASUD 2Y2UA 2ZJ5A 4TVBA 2QM3A 1G8SA 3C5VA 3JY6A 1GPKA 1QH8B 1SG6A 1NKTA 1TM7E 4LYEA 3RHSA 3TRDA 1LS1A 3UJAA 1P4SA 3BB1A 4RDIA 1E0KA 4JIGA 1HDEA 3M34A 3H2HA 2V96A 1ZR2A 2DKOA 2YOFA 3HRKA 3FVWA 3T12A 5E38A 3W2HA 2V7GA 4RUKA 1VE6A 2JAOA 1DC4A 2XYQA 1J2JA 1WR8A 3DBHA 2QZZA 2W98A 3GCWA 1KI9A 4HLDA 4TVKA 4E07A 3I9MA 2AG6A 1A8PA 1Y1LA 2WF5A 4E15A 3QEKA 1SVSA 4HNAB 2A9OA 5KTRA 4KPFC 3L6CA 4RMGA 4XJVA 3WIEA 1E1CB 1NF3A 4V24A 3P0IA 2BRUC 1M67A 3LFHA 4AJ4A 3RU7A 1ORTA 4CQMD 3AEKB 4HSGA 4AZ3A 4TXLA 3QVUA 4DANA 4QUIA 1CUXA 2A14A 2XZDA 4NHOA 4HLNA 5HFJA 1K66A 4UUNA 5KIAA 1TKBA 3Q7IA 1PWYE 4QU9A 4EITA 5KINB 4KVAA 5IH3A 4AB1A 2X7JA 2JFQA 4V2IA 1YOBA 3G79A 4JYMA 4RQAA 2JIDA 5EUMA 3I01A 4HTFA 4IQ8A 3SBXA 2W70A 4ARIA 3DDCA 1PR5A 2VK1A 3IBFA 4UFOA 1P7PA 4M7OA 1AQ6A 4LSWA 4NECA 2B35A 3M4ZA 1JHRA 1T91A 1CNEA 2JDIA 3COVA 3L6RA 4NBLA 5DYWA 5FTKA 1HT1E 5TEVA 5K09A 2AZXA 1Y1KE 4ZMRA 1BJTA 1GPH1 4IZIA 3O4VA 4B3GA 1VMEA 4PS0A 3AEUB 2CJFA 5T67A 4R5HA 1YUBA 3PR1A 4RZIA 3UB2A 2P30A 4D82A 2B1JA 2PPVA 2PZ8A 5E9QA 5JY1A 1RNLA 5CHEA 1B8OA 5DXAA 1VI5A 2J33A 4K2HA 1Z39A 3GRVA 2PUBA 1WPRA 3VYWA 4E5PA 4L2IB 2H63A 1J5XA 4WY8A 2R4UA 1X7WB 4KXNA 2JCXA 4R5MA 4YS6A 3G0BA 5JZ9A 2ECKA 1V1RB 2CB9A 3BTSA 3M5CA 4UHDA 2RGDA 3PNQA 5LNK1 5DCUA 3T34A 4JJAA 1OIVA 2C5GA 4ITRC 4KRFA 3PJEA 2O5EA 2ISQA 2CXQA 1WQ3A 4Q15A 3WK6A 3I72A 1UXGA 4AWXA 1GM5A 4I5FA 1P2FA 1E5QA 1S02A 4L5CA 4MVJE 4L4YA 2JA1A 5FBRB 1JT9A 1Q1EA 3CPHA 1R6DA 3JQ9C 4A2QA 4M3NA 4B2IA 5F7XA 2HMSA 4ILEA 2EERA 4RF4A 1QIFA 1AXRA 1NOIA 1JDNA 2IIQA 2Z04A 5AIBA 2D2VA 5EFOA 1JPVA 2C1ZA 4LYAA 1EP3B 5JYDA 3AV3A 2A9FA 2E7ZA 1VLZA 3AY3A 4KQHA 4MDYA 4MIEA 4TOIA 4MITA 3DOFA 4IP0A 4RHYA 4TYYA 2IYTA 3FPEA 1G291 1BKSB 1I6LA 1KQ3A 1OWLA 4BVGA 4FJ1A 1XL0A 4QU8A 4CHGA 2XRYA 2ZB7A 4BLVA 2ZYHA 1ML4A 3AKEA 5G0TA 4II7A 3BDVA 4AJLA 1RAHA 3OOJA 3D7KA 1Q91A 3IMEA 2A5YB 3FB4A 4M0PA 2XGMA 2ZYIA 3ROGA 5ITVA 1I36A 2P9QA 3S70A 2D7CA 3NBQA 4IWXA 2D4HA 5KYKA 1L5VA 4CR8A 4GECA 2C7RA 2JKVA 1JF8A 3DBVO 1EFAA 5BSWA 2YN0A 4RQUA 3VH4A 4ZK6A 5IC4A 2OL4A 4KSBA 3UAXA 1Z3IX 4P3KA 4DSAA 4MWSA 4DMFA 4X62B 3KSRA 4K40A 3H4IA 3GVCA 4G1VA 3OPYA 4G1FA 4GM0A 2P9YA 3WK4A 1ZUWA 4B75A 2E4UA 2DWOA 3GMTA 3OZDA 4OUKX 3NTQA 3U1TA 3EC1A 1QYWA 2CBZA 2WUVA 2QN6A 1IMJA 4D74A 3OTOB 4ZGWA 1T3TA 3QQ5A 5C7IO 3THYB 4CQLB 4RA6A 2FUKA 2KQUA 3B1FA 3FJOA 3H1PA 3H5TA 4LWOA 1U8ZA 4WADA 3U7QB 4D3YA 2EBWA 1IB6A 3B7WA 4YCNA 2GN8A 2GWRA 2VJCA 5AJHA 3UK0A 1KL7A 1LC0A 2ZR8A 1Z0DA 4G0NA 3LD9A 1YL6A 4MWZA 1AB5A 2W00A 1ZGZA 3EQZA 5AO9A 3VR4H 4G9EA 3F71A 3C4QA 3D8SA 3S2ZA 5IDQA 1F5SA 5IZCA 2X1LA 2AFIE 2OCGA 3AR4A 3RU3A 1FFGA 2H3EA 1W75A 3DVAA 1S2MA 1TW2A 1NJ2A 1G2PA 4C4SA 4IV5A 1WCWA 3SF0A 3LNTA 5E3HA 4KYTA 2BE9A 3OUUA 2K4MA 2YWGA 3M4YA 3LC2O 2WJYA 2VSFA 3OE7A 2YZNA 1S0UA 4RZXA 3MA0A 2GN6A 1IJBA 5AUPB 3R6DA 2R8EA 1LLDA 3CYFA 3U0VA 4B6OA 4WBNA 4DCSA 3HN7A 3KWMA 1QWSA 4CF4A 4YT4A 1GZVA 4MWOA 4KP7A 3JASA 2V97A 2CK3D 5BORA 3MTDA 3HCFA 1DBIA 4J0IA 8MHTA 2FP4B 4BB0A 3AOEA 1RABA 4YWHA 2JCVA 4P7GA 3Q1LA 2JIRA 2CDRA 2BR4A 2I54A 4Q1BA 4QNNA 4U7PB 3CTPA 5JARA 1OX4A 1MJGA 1OVMA 1XNJA 1FQWA 2IYEA 3N5KA 3X1MA 1E1QA 1C5KA 4AXBA 5LYJB 5JJLA 1ODSA 3C87A 4ZU6X 3RPEA 3THXB 1CJSA 4N39A 5T4FA 3VI3B 3QPUA 1QQTA 4ZZIA 3AHGA 3MINA 5JAOA 2WU8A 4MGHA 3K9CA 4DQUA 2W6IA 4ZOLF 4QFCA 2FR8A 1Z6ZA 2YJNA 4GYWA 1PFGA 1VOTA 2H0QA 1KJZA 4KLZA 4MULA 4NEHB 4WZAA 5G0UA 4TV9B 2QTFA 5TR9A 4CMBA 5DHTA 3TLYA 4CLEA 3QE2A 4EARA 2ZPTX 4ZVRA 1U6IA 1RYBA 5CLIA 4QZVA 1H8HD 2CVZA 4M1KA 4N6NA 1T4DA 1XAHA 1FS4A 2OFWA 4MKXA 3MBOA 4EENA 3MWGA 4H1WA 4HK4A 1PUIA 4YB8A 1U0NA 3KLMX 2WIAA 3Q3HA 3VYSB 3ZJ4A 1Q17A 5E6UA 1AGNA 3QI7A 1ZJYA 3VR5A 4ZN6A 4UUQA 2HCRA 2NNLD 2PTGA 3SEZA 1NQ5A 1D2CA 2J3JA 3LBFA 4A16A 3KYDA 3VTZA 3OCWA 1NXTA 1QVAA 3HM2A 2O2DA 2D5IA 3AYZB 3T7SA 5EJ5A 2KI5A 3KZMA 3RM3A 2NPOA 3JQAB 4PPGA 5AVRA 3AW9A 3ZLJA 3PTLA 2FVXA 3HYCA 4IVPA 4LXTA 1IY9A 3WGOA 4PVCA 4ES6A 4CMCA 3I2JA 1W49A 1XAJA 2I78A 1K8QA 3N2NA 1U1FA 1FRZA 4TUYB 2V03A 2UV8A 3LYLA 4Y2YA 1L6IA 4BVLA 4F8EA 1I1HA 1YFJA 4DT1B 1GAWA 3EY4A 3TEMA 1F5NA 3H42B 5AKIA 3JWGA 2RC5A 3FDFA 1O0CA 1G5IA 4J91A 1SZCA 1Y1QA 1SD5A 3VUFA 3M4NA 2ONJA 1UODA 1B2RA 1A9PA 5C5EA 1B6TA 2VDOB 1D3AA 2MU1A 2V74B 3I9LA 1YBMA 3I6IA 2YXLA 2DTDA 1E2PA 1F8XA 1R8XA 1QFSA 3WK7A 1XJQA 2P3QA 2CT8A 1WDTA 1U2DA 1NDUA 2BGKA 1OZGA 5AW2A 1VFPA 2J9FA 2HK6A 4CBVA 1OGIA 1Q7TA 1H0KA 1XP5A 1LTKA 5EUQB 4C43A 1I5EA 3PQ8A 3EJWA 2KBFA 1YZ3A 2H2DA 2IZ0A 1MCZA 1MFZA 3EUAA 5BV0A 4I99A 4LRWA 3WKEA 3VKHA 1U5CA 5JJBA 4M38A 2EJWA 2BGWA 2FUG6 3L8CA 1BD4A 3BZBA 7ADHA 1ZRSA 4WOBA 2Q5CA 4HWRA 1A8IA 5SZHB 3RAPR 3CJRA 1SU6A 2D00A 3KL4A 4L95C 1Q19A 2IPLA 5KWSA 2R8OA 1BDMA 4UD6A 2ZB8A 2CCKA 4I4IA 3AUXA 4M1WA 1H3FA 1NR7A 4PF1A 5C8DA 1XTTA 5IS2A 1SCKA 2JIOA 1PGJA 2JD2A 2QGNA 4OY3A 4E13A 3OBIA 4QELA 4BKOA 4W5OA 3P9XA 1SZDA 3W78A 1R00A 2ODAA 5CNJA 4AWAA 3HV2A 2CL0X 1U28C 5FUBA 1EGVB 4EPXA 2JGDB 1QMPA 3DE7X 4MLPA 2ECOA 3A4TA 4A92A 4QDOA 2LGJA 1FJHA 3V4FA 3A1FA 3OICA 1I51A 1RLTA 3R5FA 5EJGA 1ISIA 1QKKA 4OP1A 1KJYA 1IK4A 3TZBA 1T5BA 1MW9X 3EJ6A 4LWZA 4RMHA 3QP9A 2ZAIA 4BV3A 2VHZA 4FOOA 4UNPA 4KQGA 1M33A 2J07A 4AU1A 4UM8B 5LWHA 3MTQA 1MO2A 1OBHA 2ZE8A 3VZPA 1XD9A 5LC1A 3FVVA 3WJ2A 1GL7A 3TMYA 1IPHA 2O8VA 3DTVB 3GX1A 4AKHA 3NC4A 3BXEA 2PXHA 3PVSA 3FOEC 3C74A 4MP8A 4MVJA 2OB1A 3ORYA 2ZW9A 2A9JA 2CC2A 2OCKA 3RVBA 1CUSA 3A7DA 2A88A 2EGGA 3D8RA 4Z9AA 1M1UA 1IJEA 2C2KA 3L41A 3OFJA 4TSFA 4EB6A 4F56A 3OF2A 5C4GB 3RVNA 5B6IA 3S44A 2HR1A 2G9VA 3R3WA 2DUMA 3A9TA 2WTUA 1S1MA 5AICA 2VPIA 3EVAA 2ZJOA 5E9WA 5FNZA 4URHA 1CUWA 1PG0A 2ZYDA 1Z45A 3O1JC 4W7SA 1UEXC 2WFAA 4U2KA 4XQCA 4D0NA 4DLLA 3UA4A 5HOEA 1M0WA 1PF7E 4F84A 3IESA 1ZYUA 3KTAB 4HDSB 4RD2A 3TPZA 1Y48E 2FK7A 2VI5A 4XIFA 4N3GA 4DQXA 1JEYA 4AY6A 5A4DA 4HSEA 2JFWA 1KI6B 5J59A 3D4LA 1N75A 3E9NA 2G1UA 3Q8WA 5EXSA 3WBBA 1A0OA 4HD8A 2Q5FA 4Y2QA 4O2AF 3RTGA 2H17A 2F43B 1XVAA 1BU8A 1E92A 3DBLB 1XZ8A 3ZHTA 3MUEA 3H4MA 2B21A 1NVVQ 1NUAA 1OT5A 2GAJA 3DDNA 3E0QA 2OHOA 4IOMA 1HTTA 1MA3A 1CDDA 3QU4A 1BXZA 4AZTA 5AOCA 2QU8A 3CW9A 3KZCA 1FNCA 1RJEA 1SVMA 4KDRA 5DKFA 1RC0A 3IOBA 4HXEB 2VWGA 5DTRA 3VNQA 4IIUA 5CLGA 3ZCUA 2GD0A 5EEHA 2JJ1A 4ZARA 2MHCA 2GK6A 5JRJA 5HTOA 5ALGA 5IJZA 5YASA 1E1LA 1KEPA 1S2IA 3PXGA 1GARA 4CL2A 1EZZA 3STYA 1FRFS 3D4NA 5K3OA 1O94D 2NO7A 3F5SA 4HDMA 3ZWYA 3LECA 3TOCA 4BGDA 3BJZA 4RCZA 3AHIA 1SQ6A 2IX3A 3L46A 3GRKA 3FTQA 3IBCA 5L53A 3HDYA 4XRGA 3U44A 3WLPA 5KVVA 2A5LA 1JHMA 1W4ZA 3ICCA 3H5IA 3EIXA 3IKJA 1EXDA 4E5VA 1CUGA 1MOPA 3BMOA 3NP9A 2DUWA 2P40A 5AHXA 5K45A 1H9AA 5FKJA 2NTNA 3E9MA 2FWMX 5CK5A 5D5PA 2ZKLA 2Q46A 4QGGA 1O6ZA 1TYCA 3ZBUA 3QRWA 3LP8A 5FNVA 2H48A 2VAPA 1WOMA 1PDVA 2JDID 2VAXA 3D2LA 4BKQA 2GXSA 5BUSA 4KXMA 4R83A 2W83A 4I9HA 4B33A 1YMUA 2FFQA 1T35A 3WLFA 4WBNF 4BASA 1ZNYA 3WSWA 3UT5B 5J43A 1YRWA 4D44A 1ZVKA 3HVJA 4WW0A 1QZTA 4X64B 4ZAYA 1X80B 2WU3A 3L8GA 2QRGA 4V3BA 3L1VA 4ESHA 5JT1A 2VBGA 3G7SA 2D1RA 3LW7A 4YCAA 2YJ4A 2XTMA 4IMPA 3MJRA 4C14A 1G6HA 4CHTA 1YRAA 3ABZA 4RV4A 1Z62A 1E2KA 2HDNB 1UZUA 3IJRA 3T7JA 4OF4A 1K6IA 3RVDA 1Z2PX 1HFEL 1E6KA 1II8B 1RWWA 4N4AA 4RADA 3ICWA 1GL6A 4RO0A 1A2QA 3NO4A 1HX7A 2RGEA 3NRJA 1M2OA 2BHLA 2W11A 3CISA 4BATA 2YIJA 3W2TA 4HLUC 4RD3A 4EUNA 3K9BA 2A4MA 3LPAA 1WQ1R 4BY9E 2Q0XA 2ODNA 3VI4B 2PQ0A 4GPZA 2PMWB 4F60A 4FEAA 2VF8A 3JWPA 3G8BA 3KOOA 3LGSA 1SBIA 5KNLA 2A0WA 3IEUA 3PR2B 3B20A 4AJKA 3Q0IA 2OZLA 1AQNA 3R5XA 4EG8A 4X6YA 4HPWA 4IF6A 4B4DA 1OWPA 3TG2A 4ZAWA 2ZFUA 3RTBA 1GLVA 2Q5IA 2ZPUA 1C8VB 4IDQA 4TL9A 5DSTA 5IARA 3ZDFA 3GJ0A 5JH7B 1M54A 4I8XA 4OATA 5FPQA 4DUZB 2NUPB 3CX8A 3EUEA 3QU5A 3ACDA 2GN1A 3PUWA 3EFHA 3TOZA 5EMLA 4F2HA 2G80A 2P0AA 3TF5A 5CVJA 2WT9A 2NSLA 1GYRA 1DOZA 2Q4EA 1X7ZA 1B8UA 4MS1B 4QHYA 5ENVA 4B80A 3J7AC 4UASA 3R5KA 4TV9A 4LBZA 4I8IA 2PL3A 3DKPA 2D1FA 3BORA 3ORRA 1G9TA 1MB9A 2N9UA 3GH1A 2W48A 3O84A 1I7LA 1QCZA 4LRXA 5K99A 5CCBA 2NP6A 1VGVA 1UC4B 3PPXA 1TVKA 4O1IA 1G8GA 4CKEA 1UWLA 1ISMA 1JFVA 3GEPA 3G0HA 4W5NA 1E2BA 3MERA 3ENQA 2UZ1A 1EA7A 4EELA 1N36B 1YBAA 4TRMA 4FKMA 1VLLA 2CEKA 3FWYA 1N2OA 2R6FA 1P9OA 4Z9YA 4WXYB 3W3AD 3E53A 3RJ9A 4J6FA 4AN1A 4FIDA 3MGBA 1PJRA 1DIBA 1MC8A 2VSYA 5DW3A 1OH6A 3FI0A 1LVUA 3M1YA 1PBTA 3OF3A 3ZY3A 4F2PA 3AVWA 3GJ5A 5HMMA 1ZMTA 2DQSA 1V3QE 1W4BA 4UU0A 2Z6VA 1C0KA 4QRHA 4GIBA 1XF1A 3QUBA 2QX8A 2YW9A 1ID1A 1NVVR 4FZ5A 4WZBE 3PXUA 3RDPA 4OXYA 4BO0A 1JIJA 1X1SA 3WGNA 3WIOA 4GRIA 4RL6A 5IW8A 3TRFA 2DUUA 4RACA 2R2GA 3BMNB 1EE9A 4NS1A 1U7HA 1X0VA 3ZLBA 5LQKA 4DG5A 3RRJA 4Y67A 1M6NA 2QVXX 4FI3F 4D9EA 1SKMA 3PQ7A 1YUNA 4MRRA 4ROSA 5L3VA 1E1CA 4F72A 4IPTA 4FCVA 2ZRHA 2B5OA 5D3ZA 1R0SA 3DE3X 1JHVA 5JEDA 4XGKA 5TJHA 3WZ2A 4YCCA 2WJ6A 3N2IA 3EEQA 4YUYA 5EWMB 3S27A 3N1UA 1ZWKA 4ZQFA 2W6MA 3CEPB 3G5TA 1GUYA 1N0HA 1CVLA 1DE0A 2NZXA 2QRPA 3H2ZA 3I2FA 3TFQA 3TLMA 1Y7IA 3RKRA 3MD0A 3F46A 4U3JA 1TYEB 5DI3A 1UAGA 1RWVA 3QTLA 4R81A 3HDGA 4WASA 1UBGA 5CAEA 1I2BA 2QD3A 2ZIEA 4MS3B 2QV0A 3T9BA 2CNBA 3RSOA 5AP9A 1IHXA 1ZH4A 3GF4A 1YRBA 3GPBA 3FYTA 1B7GO 2QPTA 3DLIA 4MPRA 3V9PA 5C8YF 3THWA 4CV0A 4I0WB 2ZJ7A 1PJSA 2J3KA 2WD8A 3T0IA 1UM8A 4C22A 2GF2A 3A1EA 3V9AA 4B7UA 2NG1A 4KVGA 4CEJB 1A9RA 3PGKA 2HY7A 2XVZA 2ZUFA 3HB7A 4DLKA 4WCFC 2ZJ8A 3M3HA 4RGVA 2WICA 1R88A 4GF5A 3FPSA 1KYZA 3JU3A 4RK1A 4RZSA 1XN4A 2IPAB 4KX5A 2HBYA 4P82A 3QPWA 3IUEA 1NW6A 5JR3A 1AUXA 4TZTA 2A94A 2REQA 2QYOA 2WDZA 1TFUA 2C20A 1T6XA 2RGCA 2YC2C 4JBHA 4P6VF 5A06A 4EK9A 1BWSA 3PQ3A 1NWHA 2NAPA 4AN0A 4BNYA 3FWHA 3KTOA 4W5QA 3ND6A 4EABA 3JPYA 2XXBA 1F48A 2XB2A 5GADl 2X6RA 3ESCA 5HTKA 1HXHA 2FJ0A 4J0QA 2XCUA 2HHLA 3NVKI 3EBOA 4NSNA 5KUTA 1TLTA 2XIJA 3R7DA 2X9QA 3EULA 3DE0X 1FVXA 1P0IA 4FMCF 4EZEA 3RKUA 2CHVA 1LI7A 3VSAA 1OXKB 1OBVA 2NTEA 3AVXA 4D02A 5D5HA 3T5CA 2HA5A 1R0BA 2QG4A 2HF9A 4L02A 4TS9A 4YRSA 3CINA 5AVTA 4WOKA 3T4UA 1LRLA 1WXGA 2QUBA 1M1XB 2W4MA 3HVHA 3SEFA 4TRRA 3CLUD 1JA1A 3H2SA 4YAWA 3ETCA 3RG2A 1Q12A 4WPGA 1G21A 4TS3A 4Y6PA 4DG9A 1QCCA 4RE5A 3SQLA 3WOHA 5SZIA 4CIDA 4EYSA 1X87A 1VKJA 4FSHA 5ED0A 4K3UA 3MMXA 5JAUA 3EAGA 1F12A 1GPDG 1KETA 2QD5A 4K26A 3DO5A 1L8QA 4UUPA 4FI3C 1E4VA 1PIWA 1HLDA 2XT6A 2EARA 2GAFA 3Q87B 3OIWA 2ZS7A 1POXA 1SPXA 1R27A 3JATA 1D0VA 3PQDA 2J6HA 4RVFA 3D5QA 3PXXA 4XB6B 3HVRA 1QWOA 4JAVC 4CNBA 1NVDA 3V8EA 2FG5A 1BDHA 3QBJA 1MDFA 1ICEA 3SIXA 3SEAA 1SRQA 2XT0A 4RK7A 4BPRA 2G0TA 1I3KA 1VSBA 1C4KA 4Z3OA 3I2KA 2PG3A 1GDHA 4I5IA 3ZV7A 1PQYA 3FIUA 2COKA 3EQ8A 4JLNA 2IS1A 2Y9MB 4CMEC 5TT1A 5C3MA 1UBMS 4HJXA 3G2NA 3ASZA 1QHSA 1FBTA 1YQGA 4DC9A 4DLPA 4F1JA 1I9GA 3DBHB 2W5UA 3W4IA 2F1IA 3PWSA 1KSFX 3B3GA 1Q7BA 2OESA 4G0PA 2C3MA 4D8UA 4LI0A 2HZBA 4PGMA 4ZHSA 1GKYA 3VHLB 3DTNA 3O7WA 1RXYA 3VZQA 3TRHA 2XF8A 3X2EA 1ESMA 3FYCA 3S2FA 1VBMA 3BF7A 4X5OA 5A03A 3KELA 1SXJE 3Q7TA 3NXKA 3SXPA 2XUKA 4FFBA 2CXXA 4F7DA 3QE4A 4I1VA 4GM1A 4M9ZA 4OK5A 1FZTA 1NKVA 1BCRB 4B81A 1C1XB 4MHSA 4PRLA 4TT8A 4Q34A 4P5PA 4B47A 3KSUA 4HRYA 4MUIA 1UJ2A 2R85A 3S3TA 1L7OA 2JKYA 2ZJZA 3H8SA 3GUCA <