4G4SP

Structure of proteasome-pba1-pba2 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
267
structure length
190
Chain Sequence
MSCLVLPLVSVGNIPQLSIDWLLNSQANEWEYLEALDSKYLVEFVGPLDRPEDGSDSLYKDADMKYSSALEVFYNKKRGLFAIQQRTPLVSVNYLNNFIVEIILPFLSKYNISEICIWDSLYAMVDQPIFKILFQSIKYCSCLANEGDNSLDSQQFLQWIISQVKFVRPISWQGAYGMADARDKFVDLYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/chaperone
molecule keywords Proteasome component C7-alpha
publication title Structure of a Proteasome Pba1-Pba2 Complex: IMPLICATIONS FOR PROTEASOME ASSEMBLY, ACTIVATION, AND BIOLOGICAL FUNCTION.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 51
structure length 190
sequence length 267
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4sP00
3VR0A 2P90A 3WZ2A 3MNFA 3E35A 3GAAA 2WAMA 4G4SP
chains in the Genus database with same CATH superfamily
1T5TA 3DF7A 5F12A 4BV3A 5A5EA 4ZALA 3UA4A 4PZCA 1LVGA 1Z83A 1BCRB 5F1PA 3DEIA 4QFBA 1OGIA 4F92B 3CONA 3NIGB 3F3KA 1ZEMA 1O77A 1J7JA 1U8FO 3HDYA 5F7JA 1Z26A 1X14A 1GEGA 4Q9HA 2ECOA 1E3EA 1AMOA 3UHFA 2UU9B 1THTA 4QXMA 3TTSA 1QS0A 3IQDB 3P0RA 4B6PA 3MXTA 1GDTA 2WSLA 2A9KA 4XX1A 3TW6A 2QS9A 2UZ1B 5AM3A 3KOYA 3DC2A 2OLEA 2YOGA 2M98A 4QYTA 3A32A 5E3HA 3UG6A 1OH8A 3QOWA 2B0CA 1W59A 3IP6A 3ANTA 2HWKA 4TRMA 2WF9A 3GRCA 3LBNA 4N01A 3V1TC 4AKSA 3TE6A 3D59A 3CSSA 5EIBC 5F3RA 2QR2A 1GNPA 4TXNA 1X1DA 3I2FA 2PZBA 4DLUA 4AZ3B 3RIYA 3UUGA 2VUSA 1QDUA 2H7YA 3ENVA 2GETA 3GZNA 4FONA 5EEGA 3GL9A 5F33A 5K7SA 3CIOA 4WLOA 4OUDA 2NSJA 1LA2A 2HHHB 3VHXA 3P97A 3ACBA 1K88A 1JSZA 4ND8B 3HTXA 1Q1EA 1SUBA 1TRKA 1VYTA 1T4DA 3KXLA 3KSZO 4WJKB 1PUJA 3UBMA 2EDAA 4EPXA 1PGPA 3C6KA 3TQCA 4MPJA 1H4SA 5FLEX 3SS8A 3H04A 3NT2A 4AY2A 1M6VB 2QTWB 3NALA 4JITA 4TYNA 3EIQA 3NWEA 3FI9A 3WNDA 4QSHA 1GT91 4J16A 2IE0A 1T2EA 2IXEA 3GMSA 4RX1A 4B31A 5ULLA 1PFWA 1O96B 3HKDA 3UPUA 1WV0A 4KXMA 3RYTC 3CTPA 1R27A 4RFVA 3D6JA 3DBHB 3IQGX 3TM4A 4DCGA 3LUGA 1WVGA 3WRVA 1C3JA 1T36A 3EGXB 3MM4A 4BVBA 3DMHA 3FWZA 3KEMA 1QLJA 1KEVA 4EUHA 3EW7A 3A3KA 5C1OA 1ZL2A 2IYUA 2MWMA 1K9SA 3WAGA 2NXNA 1Z7GA 1UIMA 1VIAA 1Z3IX 3UXEA 2Q5EA 1C3VA 3OQIA 4HYTA 2CHQA 5ITWA 1Y3IA 2VWQA 1MGOA 1N9KA 1S96A 3IVRA 3RCBA 2E4WA 3BRSA 4BCDA 1KO5A 4CQMD 2JCGA 1NLMA 4YJ2F 3T7EA 4B7UA 2C77A 4LFCB 1SVMA 4J0FA 4V03A 4EWLA 5JZBA 2B8EA 1PYDA 3RSGA 2VYVD 4R3NA 1L1EA 4PRLA 2H6EA 4IXTA 3ZNPA 4PCVA 1ECGA 1GM5A 5CJPA 2B1IA 2E48A 5AM2A 4YROA 5GADl 1ADYA 2HBZA 2VP4A 2RH4A 2OYRA 1S2OA 4KB5A 2C8JA 1U2QA 1KEZA 4PGMA 2CXSA 1FRNA 4KFCA 2HU2A 5L6LB 3B9RA 1L7XA 4MQEA 2GCPA 3FYSA 4I4TF 4XASA 4FMDB 4FTWA 3SDZA 1N1MA 3QNWA 2XX3A 5JVDA 4G2TA 1Z2OX 2QN6A 2FZEA 1FU8A 4G4IA 1COWD 2B8WA 3LA6A 2PEYA 3DLPX 1A8HA 1ZMOA 4P33A 3QWAA 4R0NA 3T5TA 3TPZA 2OMKA 2VZ0A 1U7WA 3EMVA 4QHYA 5BN4B 4F8JA 4HDNB 1NJ8A 2RGBA 4RZQA 3CNQS 1U7UA 3D1VA 3ZW8A 1N3BA 1XQXA 1SZPA 5D3KA 1E8DA 3M4ZA 3FTCA 3OIVA 1H1TA 3LDUA 5KQMA 1IHUA 3TXXA 4ZDJA 2Q7XA 1YAJA 4EJ0A 3TH5A 2UVDA 4LJLA 2C20A 1JQLB 2JJMA 1T9GS 4MVJA 5BXYA 1IBCA 1NC1A 3VGPA 1UDAA 1KBQA 1P1CA 5B30A 1KA9H 5GGXA 3R7AA 2I6XA 2WIFA 3SQOA 2QJFA 5GZ3A 1Y9ZA 2OM2A 3UJBA 1HFKA 1QVWA 2H63A 1E92A 2BJVA 3IIKA 2GJSA 3DOEA 1TW2A 4KXVA 3OO0A 2D4HA 1F3OA 2BBSA 2PU5A 2QNIA 2R2GA 1AGXA 2WT4A 2NM0A 3MFYA 1YQUA 3FMIA 4B6GA 3PFFA 5IVIA 5T5QA 1F5NA 3MJVA 4CMAA 1KSHA 3N53A 5B6JA 1CQPA 2EJBA 4KQWA 3CKYA 1QGOA 1KJYA 2HSGA 2QT9A 2WLTA 2W00A 3PIDA 2AJDA 3GT4A 1Q77A 5TRTA 1VSUA 4KPUA 5EIEA 4Z6KA 3KFXA 1U9ZA 5FCDA 1LFAA 5LN1A 2PHZA 1XKQA 1CF9A 3Q88A 2ZW9A 1KKLA 1QS0B 3H4MA 4B4OA 3OESA 5T4EA 4M1MA 3U3RA 3UICA 3AWDA 5ARBA 3RVSA 1ZMTA 3CISA 4OHUA 4UU8A 4YQZA 4INAA 2X4GA 1QP0A 3G0BA 4MVJP 4WY8A 3HCWA 3FVWA 1JUDA 2AKYA 3SP1A 3AJ8A 3TL6A 5K0NA 3DE3X 2ZE7A 1KRXA 1GKKA 1Z22A 4MUFA 3GJQA 3NEAA 2JGKA 4HOYA 5C7OO 1N33B 2Q0XA 4ARUA 2PA0A 1TVEA 3SM9A 3GZNB 4LJ4A 3QVWA 1C2YA 2ZRFA 4X94A 5JCJA 4E5YA 2PUCA 4OUDB 3ANXA 4DEXA 1UDRA 2DR2A 1MN6A 3CUSA 3MTQA 3VHXB 1A9QA 3ZGYA 4HXFB 4W5OA 2G17A 1JIVA 1UJ5A 3ZWBA 3TJZA 2HYDA 3A4TA 3W9UA 1XFAA 4UZFA 3IA2A 1YR3A 1EVZA 2FF7A 1L5QA 5J4KA 2A58A 4EB0A 1CUHA 1UBOS 2VAVA 3FAKA 2AI1A 1VHQA 1QKJA 1DRUA 5EI5A 4RTNA 5L45A 3MAAC 2FPWA 1NXXA 1Q19A 2ZTHA 3D54D 3M89A 5HDQA 1CYDA 2R1ZA 2VAWA 2XOEA 5K3DA 3I6BA 5F1YA 5BV1A 3HKDB 2CNDA 4NABA 1IAVA 3RGGA 3TQTA 3KQUA 4RSHA 3LRPA 2I91A 3CNNA 1T36B 2IGTA 3QJGA 5JARA 3UGJA 4I5EA 2RAUA 1DEOA 4D6XA 1OJ7A 1I4WA 2AA3A 5CA1A 3AF3A 1FSZA 3EPRA 3NAQA 3WP1B 3LK7A 3IOBA 4QM7A 3OQIB 3TIXB 4ENWA 5HRUA 1WZEA 3U7HB 3ORSA 1WZ2A 4Q3NA 1TOAA 2Z3WA 4UHDA 5J2TA 1VKHA 3ISTA 2YWBA 3QUSA 4P2BA 4TL6A 5IRCD 1EHCA 3RRYA 5AKKA 1TCCA 4UCQA 3KZKA 3ZW9A 3E84A 3GJYA 4OYLA 4EEXA 4HQNA 1KPGA 3C16C 1NVWQ 1SIUA 3LUPA 3L8HA 4HTAA 1VPLA 4QTTB 4JLOA 1LK7A 4AM8A 4NAUA 4ZVVA 3BMXA 1ZK1A 3C6XA 4OSEA 4ED9A 4XYEA 3WHKA 2E9SA 5DW0A 4K6OA 2Y1OA 3TW4A 5DASA 5HKOA 3EPLA 3T1YB 2PUAA 1UK8A 8ATCA 3LDGA 3SS7X 1HE3A 3DR3A 4MQEB 3FPLA 4H18A 4Q3LA 4PPNA 3BF8A 5KNCD 3VR3A 1OFGA 3DMNA 3VTKA 5JVDB 1NG1A 3H2YA 1QGDA 4ZVRA 4OKIA 3HPRA 2FPMA 4C20A 4RF3A 2FWMX 5DISB 4UDXX 4A5SA 4AJ9A 3DVAA 3FG9A 3O38A 4R05A 4XIJA 4WVLA 3AILA 2XRFA 3WC4A 4R8KA 2I03A 4NJMA 1IOVA 4UTVA 2WQ6A 3QYAA 2Y1GA 5JCOC 3ZE2B 2PV7A 1N7IA 4KKVA 4LGMA 2QORA 5E9WA 4BBJA 1OC2A 5A1TA 2VT3A 1FOEB 3GVPA 3GJXC 5DM4A 1UIRA 1L5GB 5A5DA 5GQSA 3DHWC 1HDCA 1XXHE 1W19A 2X0IA 3O82A 4PX9A 2YV5A 3A70A 3EH1A 1ORTA 4YRNA 4QRIA 1PLLA 2RJOA 5IH3A 4NU8X 2I8LA 4V1CA 3ULKA 1ZSVA 3QBEA 4LVUA 3PC8C 4IIVA 1HNWB 2GCIA 5H4GA 4XGIA 1QNLA 1ZKMA 1SXJE 3MJ4A 1LPAB 1CZOA 1L5YA 1M67A 3O2QB 2O3SA 4HUQA 4PSVA 2V7VA 3L7OA 3UJ8A 1G59A 2Z95A 4D1YA 4N9QA 1YDWA 4LXYA 3A9SA 4CQLA 4OBEA 1D4OA 4TV9F 5AHXA 2VNAA 4FKBA 3IOYA 4YMHA 5J1TB 4HP8A 4KPUB 3T0GA 3V34A 1N8KA 4B6FA 4D99A 4FQ7A 1J5PA 2WK1A 4GKBA 3UMSA 4H1HA 1TZBA 4LV6A 3CEJA 3HKBA 3SLKA 3WRWA 3UXHA 3ZLUA 4W5TA 1G19A 2QG4A 3AO0B 3DM5A 4L3VA 4LYGA 2J31A 3VOSA 1T10A 2FPLA 3WRXA 1JFTA 2XI4A 3IEVA 1YFZA 2PKCA 5CYFA 1KYYA 2QTHA 3OPQA 2WU4A 1ZSYA 3C3WA 4L02A 5CFZA 4GS5A 2IELA 1YB6A 2QX4A 5B1YA 1R5JA 4E51A 1ND5A 2AC4A 2GLUA 5HW0A 1MQAA 3LD9A 1SU6A 5K51A 1JFFA 2GJ8A 1K6MA 3AR4A 4YT4A 3SICE 1XKLA 4MHTA 3ZTTA 3GD5A 1JKIA 4IZHA 4H4CA 2DR3A 2PAFA 5B1HA 3UAGA 1BU8A 4G1BA 3KB6A 4C4PA 3ICQB 4AY3A 1YK1A 3HFJA 2YHSA 1NN5A 2PGJA 2C95A 3W6OA 1CY4A 4QGGA 4CT4B 1MRZA 1JQDA 3D0RA 2O3JA 4H3KB 3D2CA 2V8BA 4ALJA 3HB7A 2GA8A 5SY6A 3SC6A 2C5SA 4LZNA 4F1JA 2A57A 4NFHA 4LNHA 2IWRA 1ZDMA 3U17A 3ZLTA 4KRGA 2PUEA 4PSAA 2VPPA 1SBCA 3FYUA 5F2KA 4CT0A 4AXBA 5AVRA 3RUFA 4XSVA 3JARA 1Y6FA 4AJ2A 1JILA 2HQ1A 1YFJA 3EEQA 3U62A 3C0KA 1F0NA 3OIFA 3W3ZB 1ES9A 1P33A 2PO5A 3GRRA 4TWZA 4O59O 1P1HA 3H4IA 2P40A 1YOVA 4DZZA 4ID9A 3MTAA 3ASUA 3NTXA 1YR6A 4D02A 1QPZA 2HDNB 4J7UA 5ALVA 1E1YA 1YRYE 5DO9A 1HYHA 2RH9B 5CA1B 3QWHA 4Y98A 4Q82A 2XBLA 1M34E 3TNYA 4FW8A 2RDMA 5KNBH 3Q98A 2UXCB 2X4LA 2XUGA 5REQA 5J2TB 4QSMA 1PZMA 1GN8A 4YCCA 3BKWA 4Q00A 5DP2A 1TU0A 3QXCA 3L8EA 4N0EA 1QB7A 2EYUA 5FHRA 4RHEA 1Z13A 3EIXA 4FFRA 5FTJA 4ZXFA 1L4KA 4M83A 2XB4A 3Q6IA 3R3VA 1VKJA 3ZWPA 3GAMA 4D97A 4DLVA 2RE8A 1Z6YA 3FFBA 2WJZB 4K6FA 3M6IA 2UZ4A 2FMXA 4G0VA 4NCBA 4C06A 1TUBA 2BTOA 3B1XA 2Y1CA 2YDYA 5KWVA 1BXRA 2NP6A 3QVJA 4HZUA 4EMSA 1ZD1A 4ARCA 4HFMA 3RS9A 5KS2A 3GJRA 2GHQA 1L4FA 3ICPA 3L7DA 2R66A 4PQGA 1QV9A 2OHHA 3V3KA 4A73A 3RBXA 3P2OA 2FG5A 2Y2VA 3HP7A 5GOZA 1IM8A 3LLSA 4KDRA 2XMCA 4LOLA 3BC1A 4EYOA 2O59A 4O1HA 1MA0A 1UH5A 3GUZA 1ZN9A 1I32A 4F2WA 2ZSHA 3K0SA 4JLDA 2QPOA 4NEHB 1NR5A 1P17A 2G1AA 3DVAB 3QUTA 2WYIA 4FIDA 2FUG1 2WUGA 2ZB3A 3PU6A 1I2AA 4G0MA 4JOCA 3I12A 2NN3C 3FNQA 3LO5A 4NJMB 2FETA 3DB1A 2PTGA 2GASA 4IDOA 4EKDA 1DDGA 1G4AE 3UO8B 1HQDA 1EQ2A 3GEGA 3FWKA 1JQKA 3D4BA 4QX6A 2V4MA 4UM9D 3AHHA 4LVOA 3X1JA 4C5AA 3GJ3A 3L18A 4R1TA 3RSZA 5KNBA 2AV6A 4RVCA 3DVSX 5L3SA 2WF6A 1I6KA 2BKUA 4Y2VA 4TVKA 1J39A 3HU1A 1CPYA 4XYBA 3WMXA 1DOAA 4JYPA 5JXWA 4G1EB 2J4FA 2WV9A 4O2LA 4BWVA 4O4HF 2H7VA 2I65A 5AUPB 3DEHA 4G8BA 4V1CB 1I4LD 3TF5A 5AWFC 1GRRA 1J25A 4U0KA 4N0DA 4WZAE 2FOLA 2GUGA 2VF4X 4HUQB 3HWRA 3HCPA 3FHCB 1EP2B 1SXQA 4LECA 1XCBA 4HZIA 4BRZA 4M98A 3H4TA 5KTPA 1C0PA 5K2OA 4YWHA 3EEOA 2OUKA 3RAGA 2QYSA 4CQLB 1CHNA 4O4LA 2PVPA 3DFKA 5FWXA 2B94A 2C5HA 2P2DA 3T4PA 1XYGA 3ENZA 3U16A 4HWTA 4QPDA 3OCYA 4L5YA 1RJWA 4DNPA 2X9LA 5CD9A 1T43A 3HKBB 2SECE 2PUVA 1XR3A 2VH2A 4IQ8A 4PHCA 5BWCA 1B0ZA 2B4YA 4L4XA 5CAEA 3PVCA 1TCVA 4TROA 3ZNNA 1PW5A 2Q2VA 3TCXB 4EDFA 1NUSA 4KMMA 3BEDA 1KH2A 5HF6A 4EYGA 1IULA 2HRZA 4K3VA 2JJ2D 3INGA 1WW3A 4B2IA 3IDAA 4LY0A 2JAPA 2OENG 4C4YA 1WB6A 1G4HA 2H5LA 2ORED 5GM2A 2ZVDA 3KC2A 3SGLA 4X63A 2H1VA 3GARA 1BMTA 5GONA 1DEHA 4G0NA 1JFFB 1C7EA 3CLHA 2OCYC 5K3OA 1EX1A 4QPJC 4HADA 4CF6A 1ZUWA 4ASUA 4FOLA 1W36B 5E7JA 4KZKA 3F97A 1WD5A 4KREA 4GP7A 3HUDA 5FUMA 3HYTA 3VSBA 2VQFB 3SC4A 1IG3A 4FC6A 5DSTA 3QP9A 5DI9A 2HT6A 1K4YA 1G2PA 1HKHA 3OE1A 3ACCA 3B5IA 4BP3A 2IYWA 3EDOA 4WECA 4B40A 3NI2A 4L0QA 5A2GA 3FYUB 1XMOB 4W82A 2PWPA 3W3AD 1Y9DA 2HN9A 4BB6A 1V6AA 5A0FA 1CVLA 3JARB 1V16A 4DDMA 1A5AB 2NZYA 2IW1A 1OZ0A 4CL8A 1JVNA 1E64A 1TRHA 3O8NA 3PPWA 3C3EA 5D3ZA 5THXA 4YRAA 1XZGA 3AM4A 2IEIA 1ZZGA 4DSUA 5EY5B 1YOVB 2JHCA 4RVOA 2OKGA 3NUZA 2AMYA 4UOZA 5IT4A 3ADBA 1EWKA 2AFVA 2HK7A 4Z1MA 3TEFA 1M6EX 2VUUA 4GM0A 4EGAA 3ZXXA 3PIIA 1J0XO 2EKQA 1Y5NA 2XA1A 1ENZA 5F52A 3LT1A 2J5KA 4RF4A 4C4SA 2GUWA 1P80A 4PTLA 2BZGA 1SH7A 2QLNA 1NTOA 2I6FA 1IMJA 2QE7A 2X4DA 4V39A 3GXOA 3UWKA 4POOA 3G9ZA 3T7JA 1AKRA 1XX6A 5ELMA 5REQB 3Q2KA 1I0ZA 2I1QA 1Y8RA 3AFNA 4QRHA 1P9OA 5BURA 5A4AA 1P44A 1TO6A 2B1RA 1GZ4A 1THGA 2COKA 1SBZA 2WWRA 3LPMA 4JOQA 3B89A 3C7AA 4J1QA 2D2FA 3T7KA 3WYDA 1IM5A 3HU3A 3OOSA 1ONNA 1PL0A 2C83A 2F62A 3HDHA 4OIMA 5A7GA 3SIWA 3VH3A 4MS1A 1MJGA 3B85A 4X6LA 2VQ3A 2ZBGA 2OVBA 3KX2A 1FSSA 3NP7A 4M9XA 1TUBB 3FPJA 3HJAA 3ILYA 3SFTA 1ISPA 1BXRB 2YV2A 5AXDA 1KE2A 4HZUB 5JTTA 1CJTC 2QE6A 3TRDA 1KXJA 2VYCA 2F17A 1GO2A 3B7PA 2A5DA 3HJBA 5MN5A 3MK31 1CUAA 2J4CA 3IGFA 3DNPA 1EP3B 3GNQA 4N4AA 3T35A 1NQWA 3PI7A 1ZIOA 1GNVA 1ULZA 1AOXA 4W8OA 1A77A 3OO1A 3Q15C 4CMEA 1T4CA 3UUWA 4ZK2A 2F64A 3TQSA 1YIAA 1N5LA 3HYNA 1BRMA 3U13A 1EZ4A 2ZRLA 2QRUA 3BMNA 1DPFA 4K6GA 3T7IA 3Q3CA 5KHLB 1E0DA 1YE5A 5B4UA 2ZIUB 1HF3A 2UYCA 3FKSA 4YP6A 1ZM7A 1SG0A 4LSZA 5AKLA 4RWEA 3BBPA 1R0ZA 1W35A 3DOIA 2Z4TA 2FGJA 5L3SB 3FBWA 3PE4A 3I6IA 2GO1A 4PLPA 5E3JA 5H3HA 4L72A 3EXAA 2OT3B 1SO8A 3L5KA 2Q3LA 1AKNA 4WUVA 3WLKX 3PCRB 4S3MA 1FYWA 2F8MA 2C7RA 2X8JA 1MHPA 5I8PA 1EVIA 4C7XA 1KDOA 3COWA 4RXTA 1VLJA 4O4LB 1M7HA 4J0JA 4D0NA 6NULA 4OH7A 1IZ8A 3JQFC 2AMVA 5FWXB 3TGWA 3A3NA 3SVTA 3JYNA 1C4XA 2VSFA 4R9UC 1YFKA 2C29D 5JSZA 2VKTA 4KQXA 2QMOA 3WR5A 4AKTA 4BNXA 1QO0A 4RS3A 1GQSA 4ER6A 4XVCA 2Y2UA 2QD3A 2GJAA 3A2NA 2P7HA 5CAEB 3U1BA 3LM8A 2BMFA 3ND8A 4P3KA 3A6FA 2GSWA 4U7DA 1R12A 1G5HA 2L17A 5B1EA 3J81A 2ALJA 4G8JA 4P86A 2ZUUA 1TAHA 4S2EA 2Q9AA 2NG1A 1U0SY 1UKCA 4J91A 3WLPA 2I55A 3COZA 2JS7A 2XF2A 4PZPA 4IIHA 3LX5A 5GONB 2ISQA 5H81A 1ZG3A 2CVFA 4LMRA 3B3QA 1KK0A 3DEYX 2WU0A 1Z0UA 1HFEL 2Z5FA 3CBGA 3NNNA 4UC0A 3R75A 1H0HA 4B4UA 1Z33A 1NI3A 1Q6YA 2UUCB 2V7WA 4MO9A 4WKGA 3U7JA 1ZGGA 3E9CA 1YTLA 3LF1A 1OT5A 4J75A 4ME6A 2GBLC 4DDHA 1IYZA 3H1TA 4MX8A 1OZHA 3E9MA 1VGRA 4EFMA 2OV6A 2ONKA 5H9VA 1H8HA 1W5EA 3ZY4A 2XT0A 1TGVA 4BO5A 2KW5A 1C8BA 4J0DA 4RK1A 3UK6A 1OHHD 1XTBA 1YASA 2FX5A 4AB1A 1QFXA 1HT2E 1RQRA 1XJWA 3VSAA 2J08A 4IZ6A 2PWAA 1NVDA 4PYIA 1V16B 4WK4B 1VYHA 4L6AA 1GPNA 4ADSG 1H3FA 2VJKA 4XI9A 1GPDG 1B0AA 3NGMA 1GVNB 2WNHA 2ZS7A 3PTLA 2IKQA 2QI9C 4Y8VA 4XE5A 2XTJA 2YY6A 1L1QA 4LF4B 2ZZKA 5EN4A 3LL4A 4MI1A 4DFDA 13PKA 4DSNA 4B3SB 3N07A 4UBJA 2NX2A 2PMWB 3GGDA 4DN6A 4IICA 1Z7YA 2FPRA 2MSLA 3ZGLA 3YASA 1XCGB 1NY6A 2BGUA 3FROA 4HEJA 4NEGA 2P9QA 1H4QA 1L5VA 4KN6A 3TRHA 4JVOA 1DWQA 1R1DA 3GA7A 4EBFA 3VTZA 4OHPA 1Y8RB 5EZ5A 2P6MA 3E3AA 1N2HA 4QEZA 2GN9A 2R8EA 3A11A 3F96A 3IELA 2P5SA 4QARA 4QQFA 1UZUA 1FNNA 1RM3A 1YI0A 3EXHA 5EIOA 5JU6A 2PZKA 1ZCBA 1HEIA 2LE0A 3GA5A 2RHDA 4PNPA 3L4BC 4YACA 4MS1B 2V0GA 1E60A 4BE7B 1V47A 6Q21A 2Y0EA 1NVMB 1OQAA 2DERA 5FR1A 3B82A 1Z06A 2Y9MB 3IP7A 3L6OO 4I9FA 4BFVA 4AF7A 4EO4A 2MYPA 4FIZA 3GNSA 1Q17A 5JJ5A 4F5WA 4EJ6A 3I45A 2RARA 1D03A 4DG8A 2VATA 3DV9A 3V4RA 2JHAA 1UBUS 1HXHA 3L0SA 1DIAA 1U28C 1MIHA 4F2DA 1MC8A 1SC6A 2GNOA 2IYZA 4MI9A 4EPWA 1HMYA 3RWBA 5FBLB 1VYUA 4NMHA 3D7MA 2Y0PA 3UOWA 3AM1A 3LX4A 1T6XA 1Q22A 3W77A 3ROEA 4IS3A 3X1DA 1T4CB 1B3RA 2YICA 2A0YA 3LW7A 1MJHA 3H16A 1LCIA 1D4FA 2YWDA 3NUQA 2FJUA 1KPHA 3A0UA 1DKOA 1QIIA 3BMNB 1KP2A 3QHQA 2EBWA 3V4PB 1ORRA 5KAPA 3PFHA 2EKPA 3ZBTA 3COYA 4P6VF 3DXXA 4NNJA 2YVKA 1ADBA 1L7BA 3SWWA 3T4EA 3PGVA 2M6LA 5JRJA 4NBTA 1YF3A 2EFYA 4OXYA 2CJWA 3N2NA 3EQZA 3V8PA 5K03A 3KE9A 4DIFA 4BNIA 2P78A 4G5OA 3ME5A 1YE8A 3O1JC 2C2GA 5TQ0A 3CMCO 2GAOA 1KJQA 1WBDA 4G9GA 5T8KC 3QMPA 5C0OE 4Y2QA 3IAFA 2HJWA 1ZD4A 2X8JB 1Z4IA 4S04A 1DKUA 3BN3A 3KJNA 4KLRA 4MW4A 1PZXA 3QVSA 1RU3A 3BFXA 3T3GA 2JEOA 3THRA 1OV4A 1XZAA 4AWAA 5BYBA 2DVMA 1XTQA 3KOZA 4ZARA 1CUCA 1SBQA 3GYGA 1PEAA 2FCRA 5JSZB 5G1NA 2DPXA 4GZMA 4HUJA 5F1KA 1JQBA 3FR8A 4QL3A 2BEWA 2NZVG 3DAHA 4HNHA 1JEEA 2IXFA 4B8WA 2WICA 2CDAA 4KQ6A 1TADA 5FV4A 1DZIA 3KD3A 5TVGA 3CZMA 5A4JA 4DA6A 4M88A 3WWZA 5B55A 1EMDA 1H2ZA 4DQVA 1NNEA 1Z68A 1EXMA 2BDUA 3FTNA 3SYNA 4YCDA 3URMA 3WWYA 2GYVA 5LFAA 4BOYA 1AN0A 1PRYA 1QIDA 2ZUWA 3EZNA 5BT9A 1VI6A 3U7IA 2D54A 4BRWA 5F98A 4K3UA 3TNDA 2R97A 4DUYB 4YCMA 3I9NA 5IN4A 3JQBA 5THQA 2PWYA 3ITEA 1XUOA 4QOJA 2Q28A 3ZJ4A 3IE2A 3UFBA 5DTMA 1Q91A 1HSOA 1KP9A 2YJ6A 1UWKA 1X9IA 2AIRA 3KP1A 3QOFA 1DBWA 2JLQA 2DBVO 3H0KA 4RANA 3IV7A 3FLBA 1ECBA 2JGNA 2XJ4A 2YJZA 3IP8A 3C41J 5H59A 3QEBZ 2NSHA 2XTMA 1RQ2A 1C5KA 1Y7TA 2IHZA 2JLSA 5EKTA 1QHHA 4BVKA 3KXKA 2EF1A 3I2KA 1NAHA 3K9LA 4OJKA 1RWOA 5HEKA 4KFRA 2GWRA 4Q3BA 3VR1A 2ZITA 2IXTA 4FM9A 3SZGA 3IFSA 3TUIC 5JECA 4I1OA 2H29A 4KAXA 3IBGA 3AETA 4R68A 3RKRA 3OD1A 5AKEA 1M1NA 3ILSA 5GJVC 3AJ9A 2ZRPA 3CUWA 4A03A 3S2SA 4PZUA 4CNBA 1CY2A 3N05A 2AG0A 2LKDA 3M5DA 4KBGA 3GEDA 4ZI3A 4PIPA 3FBTA 3W7AA 1DFHA 2YYAA 4LW8A 4URVR 1XZKA 2HQBA 5EPOA 2H7XA 2HTEA 1T8UA 2W0SA 4HWRA 4JUCA 5COBA 4AS2A 4BQSA 4XYMA 4H6PA 2XE6A 2PK3A 2IS4A 5H16A 3NDBB 3KKEA 4JUAA 5ABPA 1U1CA 1Z4PX 3MMZA 4ALKA 3L6CA 4J9UE 1AMUA 3GDHA 4QLBA 4RXUA 2R47A 3EXHB 2X1VA 3P4YA 1MNAA 2H85A 3B48A 4FCTA 3S1AA 3MTBA 1V5WA 1YBHA 4OATA 5C80A 2FUKA 1GADO 4KIFA 1WPXA 1JDUA 4LSGA 2CD7A 1TM7E 2JFOA 4IDBA 4OBBA 4ZOLA 1M2FA 1OXUA 3ZWAA 5HKKA 1JWLA 2XMRA 2UVQA 3ZE8A 4BJ3A 1FFXA 3IJEB 1EUQA 4LXUA 1X19A 1ZUD1 2PFGA 3MWYW 4MEBA 1L5OA 2HMVA 1F14A 1FJGB 2OFFA 1YQWA 3G23A 2YFHA 4C9BA 4ITUA 3K0CC 1DX4A 2JGDA 4R2WA 2DSNA 3TCKA 2L69A 5JBQA 3KR2A 3UK1A 3RC7A 5ARCA 3BJRA 4L6IA 2FR8C 5LLSA 3IBYA 5DWQA 5HXAA 3PIRA 3PE6A 3BWVA 3EZFA 4I81A 2EFCB 2JAWA 3DNFA 3ZGXA 1XROA 3AFHA 4OG2A 2E4ZA 2FJ0A 4FR2A 2OO5A 2OHIA 5C8VA 1NP7A 3GP5A 2PSSA 3MRSA 1O97D 1MB9A 1ONBA 4KE8A 1QV7A 1Z8HA 2ZETA 1XN1A 1RXIA 2WMNB 3VKHA 2ZRQA 1DHTA 1JIXA 1K0FA 1YR2A 1Y3DE 3IJRA 2XQVA 4H77A 4C0SA 4KMOA 1I30A 1H9BA 1UEIA 4Y2GA 5CLJA 2CJWB 3HFGA 2AZXA 3IRVA 1QRSA 2NYUA 4I7EA 1R9JA 2Y1EA 2Z8ZA 3ND7A 4HX2A 2VUHB 2PIAA 5TQ0B 4BLVA 1AGNA 1WSAA 1NMYA 1UXKA 2PLWA 3CG4A 3I6QA 4I1UA 5D3QA 3ZDXB 4YCSA 2O23A 1Q83A 2QKYA 5P21A 1Y6GA 1NOKA 4XOIA 4LG1A 2AWNA 3W79A 2G5CA 3ESZA 3Q7TA 4HQ6A 2X41A 3VC1A 1E2DA 1M2WA 4LYYA 1ZJ6A 4FE4A 2GM9A 3UWPA 1H6CA 3EVEA 3CX6A 4ZQCB 2XOXA 5EMMA 1FL9A 4Z4IA 2QRPA 2W2LD 1TJYA 3DCJA 3TZCA 1E69A 3HY6A 3IC5A 3BE6A 5FWNA 4B73A 1ORIA 3E9NA 3K8OE 3NRCA 5AKHA 5G02A 4ENSA 1X42A 2A30A 3F47A 3BF7A 2VUTA 1RWMA 1FVFA 2BEWB 2G9VA 2BFEA 2PS9A 4RWZA 3KKMA 3DULA 4UU0A 1LZLA 3IBFA 4G8DA 3S2YA 3WSTA 3PNBA 3FZQA 2CUTA 3L8GA 5KSYA 1LD3A 3BT7A 4LTNA 2G3YA 4BJHB 5B4VA 1O4VA 2YJTD 4NZZA 1W8IA 2E0IA 3ICWA 1EEHA 1L0BA 1USGA 3KD2A 3WK4A 5K0BA 4FZ5A 1GG8A 1QQ5A 4RCYA 1NDUA 1ISSA 2LWIA 2Q8PA 1DWUA 2VRNA 3NHZA 1KE1A 3EWIA 5EWLA 4LEIA 1J22A 1JJ7A 4TTQA 2PRJA 3KTFA 4YVFA 1EE2A 1KAQA 3VGJA 1QK3A 4EA7A 1L7QA 4JL8A 4N8DA 3X1KA 1OZGA 5AI0A 4CM7A 3ZVLA 2G4LA 4EB3A 5SY9A 1JR3E 5HGJA 1NSTA 3THWA 1FFHA 1UZAA 2WSBA 1JAYA 3CX8A 3H75A 1KNQA 3GEMA 3OKAA 4JY7A 2AJLI 1KK3A 3GZTB 2PUBA 2N3ZA 3F6PA 4R71A 1TM1E 3MQFA 5I9BA 1WMAA 3E5HA 4PLFA 4Y0AA 5FXMA 4ND1A 4ZOBA 5FFFA 5JXGA 1AUVA 3FTPA 1SXJA 2FG7C 5D7BA 1QHHB 2PY6A 3QFFA 2F43A 4WW0A 3VMMA 1WCIA 4NOKA 2YN2A 1W73A 1P72A 2D7CA 1GZ6A 2ZPAA 4M2LA 5JZ9A 5KYKA 1EINA 2N9UA 3ZYCA 1A04A 5M04A 2OSBA 3DKPA 1O58A 4WNAA 4MEJA 4UNRA 3AETB 2XQKA 3G2OA 4D3DA 5LQNA 2Q6TA 2GLTA 3ED1A 1M1NB 1I3CA 3MRVA 4X61A 3F9RA 5EIFA 3AVYA 3A9RA 3NEPX 3SCZA 5TARA 4KVGA 1E8NA 1L7EA 3KU4A 1MTOA 1QANA 1NURA 3HB1A 4FYHA 1YR7A 3VPSA 2I3BA 4WNYA 2JCYA 3IAM6 5BWMA 2R79A 4C0HA 4EF5A 1GVHA 4U9UA 3RS4A 1FK8A 4L9RA 2X3UA 2ZRDA 4NYMR 1RXWA 3L9WA 3RGWS 3TPFA 2C9DA 3AG6A 4LVNA 5TB5A 3MJFA 1EGMB 2C59A 2NQ8A 4WEOA 1O95D 4MCIA 5AJUA 4DWJA 4GUAA 2RGAA 4FSDA 2WNIA 4N1AA 1LBTA 1TFUA 1JLKA 2MSCB 1BE6A 3C6BA 3TKLA 1E1QA 4FR0A 1D1PA 2VC2B 3O31A 4BATA 4D25A 4M1ZA 3S1AB 1CBUA 4IYJA 2O54A 5AW2A 1YJCA 2NO1A 2J9ZB 4WGFA 3BREA 2YXLA 2QQ5A 3HBLA 4ZOLB 1CY6A 1Y33E 1KK2A 4AZ0A 1P45A 2QVYX 1PQUA 1FFXB 1U8EA 2D1QA 2AYZA 3O74A 2P9YA 4TXLA 4UTOA 2X23A 4HAOA 4NV1A 1T9BA 3HWSA 1KY2A 3PNVA 1RPAA 4HQ0A 3COJA 1JG1A 5F64A 1HNXB 1WEKA 3DMRA 4L9AA 3BS4A 4LTMA 3MQ2A 1W34A 2R2AA 1T6YA 5HF8A 3UPDA 3CVVA 5AVYA 4UPDA 2JGDB 3TX6A 3HYLA 4TTSA 4LZJA 4U9HS 2GPYA 2V9CA 2R7LA 2ZPUA 3AEZA 3FCAA 3OOYA 4NI5A 3TTWA 5FKJA 2JLYA 3DHEA 5F9HA 4X44A 3WL8A 1IDOA 3KAKA 4PX2A 5JSKA 1D1TA 2CBZA 4ER7A 4WJLA 3ACDA 1BFUA 5JT1A 3SZ3A 1AK1A 5D5PA 3U19A 1P0QA 2NXJA 3ENNA 1RXUA 5IXJA 1JALA 2PKQO 1T5DX 1BW9A 2BWJA 4UVIA 3W5AA 2D1RA 2QX6A 3CC8A 4P0PB 3WG9A 4LHWA 2CNBA 4JVLA 4B79A 3ZHQA 2FTKE 4YRDA 3PUJA 2NOAA 1ZOIA 5BSHA 3VR4A 2Z98A 3A9CA 4MQ4A 2UUAB 1I6MA 2H31A 1CWUA 1M34A 1PK8A 4FZRA 4GAEA 4P4NA 4D4JA 5K6AC 4LXTA 2WWGA 1RYNA 3NTQA 5DNYB 1GFWA 2Q99A 3ZWOA 1EWTA 1AA6A 2OCGA 3JQQA 3M2PA 1VXRA 2DQYA 3RK1A 4PX3A 3MHTA 4ND2A 4ETIA 3PPVA 4HN2A 5JDCC 1Q1ZA 5CLQA 1KS2A 5MGNA 3EIFA 1I01A 3L7YA 4G26A 1P2FA 1NYTA 3ZWQA 2DFDA 2DTDA 4YR7A 3LRTA 2BVNA 1TT7A 3BD9A 5ESWA 3V1LA 3JPYA 2A1TR 1FQWA 5JZSA 2V65A 1NV8A 3K4QA 4OA5A 3UV7A 4ZCTA 4WCVA 5U1PA 4B5LA 4AKGA 4WFJA 3GK3A 2LZ0A 1Z4OA 1JZQA 4BQPA 2IHJA 1KJZA 1ZJ5A 2VP0A 1BOFA 4OAOA 4RS4A 5DX0A 3TX2A 3VSDA 3GOQA 1I2BA 1A4UA 1ADJA 2CNWD 3LUHA 2BFEB 5CVJA 2DGDA 4RD3A 1ZXLA 3GJ7A 3WGLA 1EEXB 1ZK3A 1MT3A 3FWHA 1JKJA 5TT1A 2WP0A 1FFAA 1O87A 1OBOA 3KEGA 1EGQA 3QXXA 4XFJA 3DXZA 5KOHA 1NVKA 1SOMA 2OL4A 1Z6AA 1Z0AA 3C74A 3Q7IA 4IKPA 5C8YA 4BNKA 5KTYA 5EWLB 2D00A 3AR5A 4G89A 4KR6A 1QIEA 1J33A 5BQXA 4YXWA 4AN1A 4FPXA 4KN5A 2HJHA 5IEJA 3K09A 1BDJA 3ZOKA 1G66A 4Z4HA 1F0YA 1JIJA 3THWB 3WWPA 2HIAA 3LT5A 3BJIC 3AI1A 4IG4A 2GMWA 1E2JA 1X80B 4PY2A 5F4ZA 1W52X 3DZGA 2FZLA 2ODNA 4IIYA 2JW5A 3G7NA 4H1UA 4XPZA 1NPDA 1Q3KA 4B35A 1FTQA 2ZTVA 3TZEA 5HRCA 1P0IA 1YA4A 1SXJB 4FDMA 5TMDA 1SHTX 1ZUNA 3OMLA 2F43B 3TLZA 1WCIB 2C61A 3NOVA 3I4FA 1YGPA 2C2MA 4KK4A 1G55A 1XCOA 3AHFA 1KMCA 3LQKA 3PUHA 4GH5A 3ZH2A 4HQFA 2EFEB 1G8PA 2DT5A 2R6DA 4HAXA 5F35A 4WNAB 2VT7A 1W25A 4GKVA 4MKGA 3ORYA 3DXFA 2AD1A 1GCUA 1NI5A 2XD9A 3EMBA 4ZD6A 1SWWA 5JQWA 3D8BA 4ILKA 3VO1A 3ADDA 4D8VA 2HSZA 1H85A 1XQ1A 2EXXA 4DR3B 4ZAZA 1HNZB 4PVCA 4MW7A 4TTRA 1A88A 2B36A 2JAUA 1YSCA 3UIEA 4JT8A 4M1OA 3TQIA 4B45A 2N46A 3FVRA 1FDIA 4PVDA 3FIJA 2HSDA 1UCFA 3RS0A 3HA5A 5CX1A 5ALOA 3T5CA 3ZCXA 3R6TA 5FPSA 4ZT7A 3VH1A 1SBTA 4EG8A 1Q2XA 3FCXA 4RPCA 3D7LA 1W9HA 5EYPA 3A04A 3TZKA 1Q0HA 1PS8A 2FLKA 2NT3A 3M70A 4EJ2A 1RHUA 5LU8A 4Q37A 2ZJYA 3TTTA 3MTEA 1B41A 4CIAA 1S1MA 3O75A 4AZ0B 1K6IA 3HDTA 3ABOB 1RWKA 4OL0A 1FP2A 4E3WA 2IH5A 2XCUA 2ZDGA 1CY1A 2H0QA 2GBCA 4CHGA 4A2WA 4TKMA 1RYEA 2M6RA 1WCYA 3SS9X 5A04A 1KAHA 1LV8A 1Q6ZA 2FMKA 2W2VA 4H0NA 4TS3A 3DV0A 1O95C 3A27A 4TN1A 1J8YF 3KV1A 4RJ2A 2CLFB 1UP6A 1TQHA 4JWTA 3CVYA 1G21E 1UJBA 3PJRA 3K5HA 1RLUA 3QRWA 5E4JA 2G8LA 1GPWB 1D9XA 1XZMA 3B6ZA 4KBYA 4YAGA 2O19A 2WMYA 5IBRA 5AW8A 4R8RA 4Y6GB 4PO1A 1M8JA 3E7FA 3AFOA 4BLQA 2RGUA 1WQ3A 2ZBPA 1BW9B 3OZAA 4EGCB 3I9FA 3L01A 1N0UA 4ZO7A 5KDLA 2IHUA 2CLHB 5TT0A 2VHEA 5DGDA 2VHXA 1TC1A 5AI5A 4JJIA 5IHXA 1M34B 3KPVA 4JX9A 2ZRJA 2XADA 3MG9A 1GQFA 5EUQB 3VYSB 7ADHA 2PRSA 2PQ6A 3CPEA 1AKUA 2C7VA 1KGDA 1W5BA 1NASA 1XPJA 2FPSA 3NBQA 2HT1A 3F5QA 4GBGA 2GF2A 4Q18A 3N0XA 3W6NA 3U2QA 2FFHA 1QVAA 4IMPA 3AR7A 4Q47A 2JLXA 3AESA 3EIWA 2D0DA 2VHVA 2J33A 1L1FA 4B71A 5B5SA 1PK9A 2C57A 2HDHA 4TS4A 2DLDA 4C7VA 2ZBQA 4HEA1 2AN5A 3OFND 3OHMA 3JVUA 3LI2A 4UVDA 3MELA 3IAXA 3Q3HA 4PSCA 5KYTA 5DNUA 5LP1A 1BEZA 3O2JA 2FZWA 4F2PA 1HLGA 5K20A 1B74A 2H1CA 2C3PA 1TEHA 1WXIA 2JAXA 2L19A 1A4RA 1ZN8A 4XD2A 1E79A 2IQ5A 5A9RA 4XEUA 1Y34E 2F55A 3TJRA 2O1WA 3TWOA 1A98A 4N54A 3G2MA 1KL7A 3ETLA 4Z86A 1VGQA 3AJDA 4HVTA 1RVDA 4M1TA 2WWVD 1PLKA 2AE1A 1JKJB 1OI4A 1AB6A 4N3CA 5DLPA 1QFJA 2C9BA 2Q29A 3D6UA 4GYWA 1NNLA 2O1SA 3QTBA 4OHRA 3VDQA 5C8YB 3LYLA 2IDKA 2C04A 3GA0A 3ZJ5A 4UARA 1E2GA 5JSHA 5KX5A 4FP9A 3O8RA 4NMXB 3AT1A 1L5FA 1S0UA 4TTIA 2HLDD 3FOWA 4EX6A 1OH5A 3AG5A 4NFLA 4OSOA 2PSFA 2VSQA 3CJQA 1N1EA 1JBQA 1SPXA 5CDTA 3QENA 4YHHB 3ZTWA 2XTZA 3PFKA 5ECWA 2GZMA 1XAIA 1IBMB 2FFQA 5E1MA 1PL7A 3BZBA 3A05A 4OJNA 1QCYA 3COSA 4FILA 3WBBA 1B8NA 5DPMA 3G8YA 3A31A 4IG9A 4OKSA 3DT6A 4DMHA 3L7LA 1MA3A 2DP4E 2XD4A 4XB6B 3IUNA 4PAOA 5A06A 4MS3A 2C2HA 2OBFA 3KKLA 3W5UA 1DB3A 1ZUNB 1J07A 4XVQA 4I1VA 2ZJBA 5EG5A 3FGZA 2G5PA 2VPTA 1DXOA 2ZUCA 2Z30A 4Q9NA 4UDOA 4A8TA 4B84A 3R6LA 4NU0A 1LLDA 4BO1A 2J3QA 2B8JA 1LW7A 3DEFA 2GPJA 1DRKA 4H59A 4P08A 5FWYA 4YECA 4ZANA 5JNLA 2V6GA 4AQ7A 2V3CC 3ETHA 4Q6BA 2VPZA 3PLAE 4JT2A 4F85A 1Y3HA 3AIOA 2MMGA 5DEIA 5E6SA 2IV2X 1DQNA 2FR0A 2VEOA 1UEJA 3F8WA 2NXEA 4Y2JA 3A9VA 1E6MA 1F3LA 4G23A 3QWIA 4LJSA 1QKKA 3AC0A 3AB8A 1L7VC 2IBMA 2A1UA 5CX1B 5J40A 3WDKA 2X9GA 4B48A 1CLUA 5HS6A 2V9ZA 4TV8A 5D6NA 3BKXA 3SYTA 2MSEB 3RQIA 2BZ1A 2O50A 5E1OA 5EYPB 3CBQA 3QVKA 3A3PA 2A6PA 2CLEB 2BFNA 1D2RA 2GILA 2PO7A 1GR1A 2PZGA 2HQRA 3B1WA 3O84A 4L73A 2ZYHA 4XGKA 3AOGA 2HKIA 2IHBA 1RMQA 3RAJA 1GY8A 3EWSA 4DQDA 3I5XA 1B26A 2F7SA 2H4ZA 2RK6A 2VDKB 3EF3A 4NH4A 4YQEA 4KPFC 1SRQA 2PX2A 1H8HD 4R1PA 1YRWA 3RIXA 4OPMA 3HR7A 4E7OA 4CIBA 4V2IA 2WPDA 3QLUC 3DV0B 3CYFA 4H3HB 4OGWA 1MQ8B 5ETJA 1WDMA 3KOOA 4HMQA 4YR9A 5ALSA 1KJJA 3GJ4A 1L5KA 4Y2SA 4BV2A 4EFDA 3NDRA 4Z4GA 4H9GA 1E3SA 2JIDA 2AH5A 3FOBA 2PL3A 4H17A 4UHJA 1YT5A 1XOIA 3H65A 4LBVA 1KJ8A 4BX3A 1W4BA 2DFNA 3DFUA 1Z0DA 4AJHA 2HEGA 3TXYA 3QFRA 4QJ5A 4IR7A 3UHOA 4CETA 1P81A 2DWQA 4G4SO 3I8SA 3L1IA 3P5BA 4KNYA 1OE0A 1YVEI 5K45A 3LP6A 3NC0C 1N4DA 4O25A 1NPTO 1SXGA 3OG9A 4MCAA 3K71B 1C9EA 3B13B 5TGTA 4GMKA 3FBGA 4G09A 2DBQA 4IMJB 2JD1A 4FQ8A 1A76A 3WHIA 1FX0A 3FCEA 4WHMA 2ZTSA 2EF0A 2XWBF 5C1BA 4P31A 3N7UA 2H4WA 3RV3A 4DB4A 3H2GA 3AESB 3CZ5A 4C6RA 3A4NA 5IUNC 3KZNA 4A2QA 5FH9A 1JDZA 2EX4A 1RQXA 2VP3A 3ZKWA 5JAZA 4YS6A 1RZRD 2CEKA 1PG0A 1EWRA 3DD5A 2Q6LA 4S2UA 1WHTA 4N41A 2FK8A 3E2MA 2VHQA 2VP2A 3BCSA 2KYRA 3FMOB 4OHMA 3N2GA 4J2HA 4DBLE 1NJ1A 3BAZA 3KWFA 1TLTA 4GBJA 2I5PO 4RZIA 3V1UA 4N8EA 4F9GA 2ATCA 2CUZA 3WL4A 3OF5A 3W1WA 2ISSD 4BU1A 4BX8A 2VDRB 3PFIA 3DBIA 3PR2B 4U7GA 4ZWNA 4Q05A 5BSGA 1QF7A 2OD9A 3FSJX 5H3LA 1JXAA 3UCXA 4DLAA 1AJEA 4C6SA 1IC6A 2ZSFA 4F46A 2GBFA 3GUHA 4DXHA 3HUFA 4ZAVA 1TI7A 2QTZA 3SSAA 3I52A 2EU8A 3KQSA 1H8EA 2PD3A 3RVJA 4E21A 5K99A 1GNRA 2ZCVA 5KX5B 3DW1X 4OOEA 4E1VA 2RGEA 3JD4A 3QELA 4IMRA 1K66A 1M1YE 4MB0A 3V32A 3ZDFA 4J94A 4K2HA 3R9XA 1QXSA 4IIFA 3U1TA 5IF9A 1X2EA 1YDEA 2EJWA 1OB5A 2BM0A 1LK5A 5KJEA 1HDOA 3U7GA 2FSVA 2FZ4A 2XE7A 1CEXA 2ZSIA 4GX1A 3TKYA 1JMKC 2YMLA 2CMKA 3KK0A 2IBSA 1Z4JA 2ZRNA 5F2OA 1WG8A 2YZNA 3GP3A 3NHUA 1DZ3A 2NAFA 5KYVA 1NVVR 3NASA 1A0OA 4GRDA 1IM2A 1YC5A 3CR7A 1CR2A 3A4YA 2G8NA 4HVAA 4K9DA 4MS3B 2JZCA 2XMQA 4L95C 3R5HA 4DADA 2G83A 1HE2A 5I7SA 1CRQA 2L2QA 2H7CA 1T8PA 1CB0A 3IIEA 1VLZA 1JLHA 2ORIA 4S0ZA 4IJ5A 1FU4A 1WB9A 1RRGA 1U7PA 5LBUA 1FF9A 4L0DA 2J6IA 4DANA 1GZHB 1QJ4A 3GROA 1Z0JA 1FFBA 2O07A 1ZXBA 2XNJA 4DXAA 2OSVA 2PVSA 2Y0CA 4QBFA 4UOEA 4KAJA 1DEXA 4NICA 5F5XA 3VTAA 4X71A 2CWWA 4KO3S 3GT0A 5FWYB 4A8PA 4BMDA 1VB5A 1MAAA 3MMPA 4YEDA 5LDHA 1Y3BE 2IYTA 3PHLA 2Q6VA 3LWZA 2QUBA 4E2XA 2FVXA 5E6SB 4J4BA 1OV6A 2AZTA 1NG9A 1ONPA 4GP9A 4RKFA 3ESRA 4RPGA 3S8EA 1JA9A 2R7KA 4TYYA 1QQAA 5EHGA 1U9IC 2YFKA 3EA5A 3VPXA 5CD1A 2WHYA 3FLAA 2VAMA 2A1UB 5JMOA 2WJ6A 4JLMA 2GGSA 4TV8B 3QSGA 3K4PA 1IB6A 1QE5A 1JLRA 3NM6B 4D74A 1MJFA 1XGKA 2GK3A 3K9NA 3L7JA 3I5YA 1UBHS 3GEBA 2G07A 3AZOA 1H3NA 1WXFA 3ZI7A 5IANA 1T1RA 2YWRA 3U7EB 4DABA 3IURA 2BFCA 4PSUA 1I10A 3DDUA 4ZYUA 1A9OA 1DOHA 1KRHA 4WUTA 3MCZA 4F72A 2I76A 4G8CA 4ARVA 4YV7A 5KI6A 1YXMA 4DQKA 4FN5A 2FEXA 3TTVA 3LSTA 1R8QA 2I34A 3PJFA 4DREA 1GPJA 1V2HE 1YO6A 2CF6A 1BOOA 5HE8A 1XXLA 3H87A 4X24A 1TM3E 2E5WA 2KE5A 5ANRB 4YRSA 1IWOA 4WJZA 1QJCA 3H9CA 3OLZA 3UWMA 7ABPA 5IG2A 1I2DA 2P9TA 4BQRA 1ZGJA 3IT2A 4K9LA 5EWMA 1OGJA 1IUKA 3LL7A 2SNIE 3OTWA 3P0IA 4OJQA 4M86A 3OETA 1QWSA 4ZCRA 4R1MA 1QQBA 4PR3A 3HVHA 5EGSA 5AVOA 3VDRA 3L1HA 1LNSA 3E7PA 3UWDA 2P2ZA 1QU3A 4BV8A 2R8ZA 3U3XA 2QZ4A 1Y42X 3I1JA 4P3NA 2BHNA 4LOAA 3C6ZA 1EBBA 4BTEA 3SVLA 2VBIA 1FX0B 1VE1A 1MO5A 3AUTA 1JH8A 2E4YA 2QEQA 4RZ3A 1XTIA 3N59A 2FN7A 2I6SA 4MMXB 5DMHA 4ZHSA 3CVXA 3EJ6A 4H6VA 3GMDA 3RKSA 4E32A 3TG2A 3MTJA 3LVQE 4NE2A 5KVQA 1A50B 1JN0A 4RQBA 1G7TA 1KVQA 1VFNA 4XQEA 4RSMA 3ZKWB 5ES4B 3HR4A 3PA6A 4CM8A 4DMKA 4M9ZA 1WHTB 4EGFA 1CW2B 5AM4A 4LQCA 4Q4LA 121PA 4KU4A 4PZEA 4TYMA 4DQLA 1ZVQA 1M0WA 3N2GB 3H5VA 3GBPA 5CDGA 3BTOA 1E32A 3ZXIA 4K86A 1WOYA 4CLHA 1AS3A 1EIZA 1AG9A 1GPBA 1KXZA 3I39X 3KJQA 4TTJA 5IDXA 4A8JA 1LS6A 1YS4A 2WHQA 2Q6OA 4X0EA 2X77A 3CUEF 3GJSA 4LF9B 2J07A 3M82A 1KPIA 3GLFA 3KU1A 2AN4A 2EWVA 2FMFA 4MNTA 4D6YA 1PUIA 4AECA 3NXSA 2PZEA 4UD2A 4W99A 1JKMA 1PR2A 1AY0A 3RVDA 1N2JA 1SY7A 3TNJA 4D3YA 3QELB 1M72A 1F2TA 3FETA 3MA0A 1ZL0A 3NDPA 2QUIA 2HYIC 4UZSA 1KHTA 3C7KA 2KB0A 2NQ2C 5DK4A 4EEKA 3R9XB 4KV7A 2NSLA 3VA7A 4YAIA 5FV7A 3H7AA 1YZVA 1WXEA 2OZKA 1BD3A 2CCGA 2IPXA 3F71A 3W05A 3AHJA 3LKVA 4A26A 1Y5LA 4UNPA 4IW3B 5EIWA 2P11A 3RUIA 2ERCA 4CR7A 3IE0A 3F46A 3H1PA 4R2IA 2VYND 2R6GA 3LPAA 4RHFA 2B98A 4DZRA 5IWCA 1T1JA 2CUNA 2ZRMA 2GA9A 3GW8A 3RVKA 4D9FA 4F7WA 1JT2A 2OEPA 2PUGA 4OX9Y 3H5IA 3UMRA 1SQ6A 2EGUA 4JJGA 5HFNA 2QLTA 5HA5A 4UHCA 4DLKA 3IKLA 3RO7A 3PJGA 3ZIAA 5KWIA 2O7NA 4IDPA 4DV2B 1DT5A 3O1HB 1XCPA 4P4UA 2ZGVA 3WJ7A 5EJEA 1E7MA 2WFLA 4MRPA 2G5GX 3E3NA 4JD5A 2CZGA 3T15A 4JEHA 1PJQA 1PZGA 5D86A 5JADA 1QQTA 5MN6A 4WE3A 4NCIA 3OOHA 3WTBA 3C8ZA 1Z0FA 3OAAA 4JYBA 4K2AA 2RH8A 2PBZA 4QXQA 2EEPA 3KR9A 3L46A 4FOOA 3JY6A 2JAOA 1NV9A 1J23A 5AMXA 4IQ4A 4RGYA 2AEFA 3DF9A 1QP4A 2NIPA 1XVIA 5FTWA 4PG6A 1JJAA 1FCJA 3CR8A 4RJTA 1TM5E 2JRLA 2ZVQX 2ZYDA 3E58A 1ISMA 3OJWA 3L7BA 5LOVF 4DIEA 2E82A 4JVNA 4CTOA 1KR5A 1L7MA 4G0OA 4NPCA 2CHFA 3KLBA 2K7ZA 3GT3A 1PNOA 4RAQA 2C99A 1L4MA 2B2NA 2BFCB 1W2WB 2HNAA 3FNBA 2PMKA 3PICA 4GVXA 3O9ZA 4R1NA 1NUAA 5ECDA 4B9EA 1YI8A 1WO8A 4U8GA 4ZRDA 2EBHX 3T9DA 2B30A 2NU6A 4DPMA 1NM5A 3QWFA 4F4HA 3VUFA 1ECPA 1NFRA 4A10A 5CYGA 4FK8A 5IJ9A 3FH0A 1U3TA 2F1HA 3IP9A 1H23A 2O3RA 3PC4A 3TUJC 2CFOA 4OHCA 1CIPA 1ECLA 1VBNA 2DE0X 1GPLA 2DQ4A 1S9DA 3BXXA 4MWEA 4WXHA 4WWHA 2OPBA 5BYKA 1E4VA 4PCUA 1OFVA 4H7EA 4LXHA 1TF7A 3NH9A 2B61A 2WC1A 3EEFA 4YAEA 3EVBA 5FFNA 5LWQA 3SIPA 2QGNA 5CNIA 5EWMB 1N2GA 2CXRA 4HWPA 3M1IA 1KZ1A 4IRMA 4X95A 4BKQA 3UMCA 2QX7A 4WAUA 1Z4LA 1BC5A 1U7ZA 1UPUA 1QHXA 2QQ0A 3JZAA 4QOFA 5ESDA 3UFXA 3WVNA 2JEZA 2DETA 2XUDA 3LIIA 3LECA 4TZTA 3T9CA 1TF2A 2XUPA 1I5OA 3BFKA 3SR3A 3FCYA 1FXWA 1BH6A 1G2OA 2IEGA 5AJTA 1M0SA 3DQPA 1TVCA 3P0HA 3H8WA 4TLBA 1DV2A 5BSVA 4OU4A 2XSZA 3G0GA 4B76A 3LQFA 1DC5A 3LQ4A 3PC2A 4KIWA 3V8RA 3BK1A 3FYCA 3ETDA 3E8XA 3LWDA 5IYZF 3W8EA 4FLMA 2MR6A 1SIOA 4NY1A 3ROPA 4NYIQ 2Y76A 3L4EA 3SEAA 4J7CA 2UKDA 3V46A 4QU8A 1M6HA 4CM8B 2UAGA 3JWPA 4A3SA 1BNCA 5EZYA 2GD6A 4CLOA 2W90A 2WU8A 3M4NA 1PGQA 5CEEA 4IH9A 4JYAB 5A6SA 1VJ1A 5KHAA 3JQ8A 4PPFA 2WSSD 1B3BA 5KJ6A 3ABSB 4Y6OA 5EIHA 4MLDA 1MNQA 2BCEA 3QV2A 5DTIA 4JROA 4A8JB 3ND5A 1XALA 3H2KA 1YQXA 4Q7KA 3WQQA 3K1ZA 3FHLA 3HPQA 1A9SA 4URYR 4D9NA 2F48A 3GLFB 4ZDWA 4GOND 3ZZTA 1BS1A 1LBEA 4K0RA 1QTQA 3H19A 1FNDA 3N87A 1OIXA 3DA8A 4C7OA 1V9LA 2FH5B 5A3QA 1ADCA 4RJIA 2X3FA 5I4KA 1F6BA 1F2TB 3M1YA 1U65A 3MD9A 4W7IA 3VR4D 4B3RB 3G3EA 1PDVA 4GD3Q 4J0CA 4DYDA 1T13A 4C5BA 2QM3A 1E18A 2QY9A 5FI5A 3DWEX 4E33A 4UM8B 5BSWA 1VIMA 1BN7A 2QNBA 4NDNE 3EUAA 5CDSA 4X62B 1T4BA 1AZWA 4L50A 1NRWA 1UBMS 4MARA 5T64A 3ZCSA 4BCBA 2GS9A 3H99A 4FWBA 5CT4A 2LKCA 3AKYA 1Z4KA 3BMCA 1D2HA 1B76A 1N0VC 3JXEA 5G41A 3EA4A 1NYRA 1VI2A 4KXNA 4QDZA 3FPSA 3A6PC 3K5IA 1Y6ZA 3BWBA 4B46A 1A95A 2NNLD 3JYHA 3MBIA 3PPYA 4DDUA 2IYVA 5E2BA 3AV0B 1C9YA 2RI0A 3OU6A 3UKOA 5EJ8A 1U8YA 4XGNA 1QYDA 5D3MA 4B5KA 4UE3S 4UMFA 1GNQA 3WWEA 5HWSA 3OICA 2GPSA 3GP8A 3RT1A 3UH1A 2WFLB 4X8MA 4I9GA 2CUKA 4KUEA 3B36A 2Q5FA 3SMVA 1Z5NA 3IR7A 3OLWA 4MEAA 2PPLA 3RABA 3IJPA 3WIOA 3EDMA 1K06A 4C7KA 1U2EA 2G82A 1WETA 4M49A 2XUKA 1RWPA 3KLOA 1CT9A 4MKIA 5CT6A 1CP2A 2NO9A 3QTTA 3P2IA 1G63A 2IYPA 1LI4A 4JMLA 1OCEA 3LNCA 3N1UA 3VR6D 3ZIUA 1AXEA 4OO3A 2Q07A 2ZZMA 1JJIA 4G5SA 3NHWA 4LPSA 3L6DA 4N0PA 4YXWD 1UC5B 4Z99A 4G0YA 4U2EA 4DA0A 2WZBA 1ABEA 1DBPA 1KSFX 1ZM2A 3QZUA 5DCWA 1YJAA 1A4IA 3ZU5A 5JPDA 4NBSA 1GHTA 5BW4A 2H18A 3TBKA 1Q0PA 2Q5OA 2A5FA 2IZ1A 2YOFA 3TIFA 1S3SA 1ZU5A 4WX2B 2NXCA 1E62A 1W0CA 2EZ4A 5K6TA 2NU6B 3AJRA 3DYBA 3V48A 5BPHA 3LYUA 5HQTA 5TMPA 5IJ9B 3PGLA 1FFWA 3C8HA 1JHVA 1UBTS 4HDSA 4ZV7A 4N3GA 5IVHA 5E6RA 4N9WA 2DCMA 2BSXA 3QXJA 3UAOA 3FOZA 3AEXA 3PVZA 3DLBA 1R4MA 1WCWA 2PFSA 4JKOA 4YRCA 1NN0A 1AB5A 1IY2A 3PA8A 4DCTA 2PAAA 2JIRA 3LS2A 3NC1C 1V48A 3CF6R 4A0QA 5IT5A 1MABA 2NZWA 1ORWA 5E0KB 3E3OA 1S3FA 5ICFA 5GJCA 4MKZA 1TO2E 2P90A 4IOKA 1G3MA 2AZ4A 4ETMA 4AF6A 4EB6B 1GRNA 2IZ7A 2G76A 2YWCA 3EHDA 1BS2A 3KBBA 2LGJA 1LXCA 3JVEA 1LF0A 3T99A 5L4NA 2XB2A 1E94E 4QOSA 3UFXB 1XTVA 4JOBA 1WKBA 4XGRA 5DYTA 4MPPA 1VPWA 2AR7A 4MUXA 3LC2O 3R8FA 4TSFD 2MSKA 3KQKA 3S1SA 1JV2B 1R37A 5JG7A 3R7NA 5CM9C 3ZUGA 3MJDA 2EKZA 3GAZA 3G0DA 3CN9A 3HB5X 2MJLA 2PGLA 4L75A 2YYYA 4YCJA 1TE2A 2D13A 1IPEA 3FSGD 3QGMA 5ALWA 1NW4A 3KLPX 5G0UA 5C3UA 3WYFA 3C4VA 7YASA 2XUOA 3EASA 3OM0A 4MW6A 1A7KA 3CO5A 1NY5A 4YI3A 3F3YA 1TA9A 1Z4NA 4ZQFA 3ROKA 4UPEA 1AH2A 4OL9A 1NN1A 3LCCA 3MRTA 4IGIA 4KQHA 1L8QA 2HDWA 3AKZA 5SZHB 1XG5A 1G291 3ZWXA 3CZ9A 3OT5A 4LYAA 3OM9A 3LT0A 2OYCA 4X7PA 3KYIB 4BNYA 4E4TA 1VSTA 5AESA 1UAYA 5EZYB 4CLOB 2GQ0A 2IIVA 1GAJA 1MC4A 4PTZA 4YAUA 1P7WA 2HFJA 5A6SB 5A2QA 1XAHA 3I2JA 1S89A 2YBDA 3JQ8B 3Q0EA 3Q7SA 3QPWA 5BMVF 1NQ5A 2FSIA 2IPMA 2M9MA 3NBYC 1VA4A 3F2VA 3F4KA 3EOAI 3JWIA 5C8ZA 2Y1LA 2MINA 3NW9A 5FI3A 3LZ6A 2R6CA 3C8MA 1QX3A 4GU5A 1JBKA 2AMJA 4P92A 1LPBB 3AU9A 3RIGA 5BQ3A 3JTEA 4RH0A 1ZD8A 4MW5A 1VE5A 2YHIA 3ZWYA 5FUYA 1YS7A 2XNDA 3ZE0B 1E9VA 3GFSA 1DG9A 1DKLA 4C7OB 4K6CA 1LSUA 3QJYA 5DMXA 3ROTA 3O21A 4XDZA 4CF7A 1LQ2A 2O3UA 2N0SA 3BRWA 1RACA 3RB8A 3IS3A 1GSOA 1T2FA 3D31A 3BB3A 5TPZD 2FPKA 3FRJA 5ADWA 3ZJVA 1P60A 1YMVA 4BRUA 3AL3A 1CEQA 1V8DA 1P74A 2BGGA 3ST7A 1CJVC 3EULA 4X1KA 3FVTA 5EL0A 5FNVA 4QT4A 3SI7A 4IILA 5LIRA 2K5UA 1JTEA 2VPYA 5AKIA 5C51B 1UOPA 5LNK6 5BSMA 4YYEA 1GNTA 2QXYA 2YRWA 3BMCB 1XMJA 4Q34A 1ZHHA 4JBGA 2C84A 1RYZA 1MZVA 1PD0A 1H1LA 2DFKB 3C5WP 4PSDA 4YUAA 1FLDA 1N77A 3H11A 2YUTA 4NK4A 2YQ4A 4IVNA 2K6GA 1CRWG 1MV8A 1NXPA 1Z8FA 3KCNA 5JROA 4Q15A 1TJPB 4F91B 2RHTA 4NMLA 1C0IA 4IF6A 3AEKA 2JI4A 2O3QA 3H8SA 3GHYA 2A67A 1J2YA 5AOCA 3WS7A 3OQMA 1FDSA 5D3MB 2UYQA 3KL4A 1C4KA 2PL5A 4GXNA 4EHNA 5KJFA 1UKEA 2N47A 2WILA 5DYYA 5EJ4A 2XWPA 1IJEA 3ANNA 2V6IA 4HAWA 1ZI6A 5EE1A 1RRPA 5JQGA 2IUFA 2QAJA 2SCUA 3ADOA 3BCUA 3G1TA 4I36A 2RHWA 4RVNA 4BFLA 4KOAA 2ZTLA 4IIXA 2V03A 3W78A 3RVNA 2DHRA 3LWNA 3X1ZA 4GW3A 1LVHA 4Q6WA 4UTNA 4C4ZA 5AJYA 4EUSA 3OTGA 4PFSA 3RC8A 4MHSA 1SPBS 1ABBA 3M4JA 1KU0A 2E1PA 2ZJAA 3WJ1A 1GN9A 2QY6A 1S8FA 2AFIE 2H2GA 4ZJYA 1QF6A 1T5IA 3R6DA 3KQWA 5CFMA 4LJRA 3PDIA 4HQLA 1LGYA 4YP0A 2GJ4A 3P2EA 4BTVA 3SR4A 5K3BA 1YZLA 1IY9A 2RK3A 2ZUEA 1SU4A 3A4IA 1RSZA 2D3TA 4ZIRA 1GZ5A 4TSRA 3FGOA 4UXIA 1U2RA 3HFSA 2VJLA 3KPUA 1FVOA 3NBZC 3P9QA 3R0IA 1B73A 4L3WA 4Z2YA 3A1NA 1SR8A 1SNYA 4HDSB 5E6RB 3IT3A 2ROQA 3BH6A 1OH7A 2H48A 1W0JA 1E3IA 1ATZA 5BPFA 1R4MB 3IYLW 1K5HA 4ENTA 3RNLA 3ZY2A 1TL7C 2C7OA 4N8SA 2ZJOA 1O5OA 4WBXC 5AT1A 2NPFA 2A0UA 1MABB 3LUKA 3L06A 4WBNA 2JI8A 4QLAA 4AJJA 4LE1A 3GAAA 5CFOA 4K7JA 1OAKA 3CEHA 2R1UA 1FDOA 2HB6A 1AHNA 1J2EA 3CWCA 4KXXA 2H1HA 2H1WA 5CR9A 3FGPA 5ALTA 2A1IA 1I7PA 1WE2A 4GDFA 3PWSA 1FX1A 1DJNA 5DP1A 1J0EA 1PI3A 2CFTA 3IT1A 3PWTA 4M6WA 3A6GA 3L49A 5G0TA 3VDXA 4HEA6 1Z75A 3LXXA 3SF0A 1EA7A 4LMBA 2QSZA 1I4TD 1H9CA 2EL7A 1WB5A 4RA6A 4IUCS 2JDIA 2WKWA 4M89A 4XWGA 2EBUA 2JASA 3QUQA 3BAFA 1XRQA 2GAJA 2ZT8A 1I3NA 5ILOA 1BWQA 1KMHA 3ASVA 1BDIA 1FW6A 2ZYUX 2O1XA 3NG1A 3AR3A 3WNVA 4DBZA 1UBGA 1QFYA 1ZIDA 1C80A 1S3IA 3K9CA 3NPAA 4PR0A 3TIIA 4CCYA 4HRXA 1E3DA 4TTPA 4I1PA 3VM6A 5HK9A 1JPJA 1JDPA 2IJGX 5L3ZA 4RADA 4D43A 3IIIA 2GEBA 4M0MA 2VH1A 1Q7CA 1PK7A 4DPKA 4BB0A 3R3YA 1R5OA 4PF1A 3TQRA 5KREA 1T8TA 5L8VA 2AE2A 2TMDA 3KVYA 2XJ9A 4DIOA 2MINB 1Z2DA 1RM5A 4XX0A 4E5KA 3FWNA 2OP0A 4XD7D 3W2GA 3G17A 2O2CA 3D0OA 5F76A 3MPOA 3DMGA 4LXXA 1WNFA 4CDNA 3M9WA 4US0R 4DCSA 2YHIB 3HCBA 2BKXA 3MHPA 1IVYA 1T0JB 3NIWA 1P77A 2DWOA 1UT5A 1E59A 4C1NA 2F1RA 3KSBC 1N6LA 1LWNA 1QP8A 1QZZA 1X1EA 5EWJA 4YMSA 3T3OA 2QAGA 4W9RA 1SKBA 3KVNA 1OFIA 1GU1A 3F5DA 3D3KA 3OZEA 1S4MA 3P9PA 3LBIA 2H1RA 3AR6A 4AS3A 3RARA 4Z3DA 2Y1WA 2IOFA 4DLWA 1M6WA 1H93A 5IEBA 5FNVB 1GKIA 2E1RA 3HGQA 5IUJC 2R65A 2V55B 4MLPA 2UUPA 4C29A 1D2AA 3IQWA 5C46F 2PT7A 4QREA 4DS3A 3G0CA 4IYRA 1H1LB 5CMLA 1MOPA 3C98A 1O94A 3H11B 5JPIA 4NQZA 3F67A 2R96A 4F1WA 1KEKA 3M6FA 4DMCA 2WTEA 5DTEA 4O08A 1BJTA 4OYRA 5JJLA 2OZVA 4W5RA 1KKUA 4U7TB 5LA6A 5K8VA 1T4MA 2XVMA 3AEKB 1Z45A 3ZHYA 5A1JA 2RGRA 2WP8J 2GN2A 2G9ZA 1P7CA 2CMGA 4G37A 4PAGA 3WLIA 3T7RA 2OA0A 1VL1A 8OHMA 1BFDA 2D0OB 1N2CE 2R4TA 1E9DA 3D5TA 3O4IA 4G84A 3FPFA 3TS1A 3IBTA 1UZLA 5DYIA 2BMAA 1I80A 5CA0A 2Z8YA 4E31A 1DDOA 2SCUB 4PHHA 5KINB 4JUDX 1RWXA 3TOSA 3GCZA 3KR0A 3U09A 3C15C 1JHXA 4PHFA 1NHGA 5BXQC 3C7CB 3W2FA 1OTHA 1YK0A 2R87A 4M0EA 4QNNA 4WTOA 4C2AA 1P18A 3LVBA 3WSVA 1FVXA 1YQEA 4L4UA 2J3IA 3VTFA 4YDQA 5K8TA 4TZKA 4AS1A 3KVRA 3PDIB 4AWXA 2IOFK 5DN6A 3KDAA 3C3XA 3KWLA 1ULTA 1XZIA 4F38A 1WUIS 1IZZA 5GPBA 2G5TA 4ZIRB 2PM8A 3PXEA 3AL0C 2ZWVA 4R8MA 2H2HA 1HY3A 2QN9A 2F1OA 2SKEA 3UV3A 4YMGA 3K8YA 4GI5A 4JV5B 3DWGA 2ZSDA 3WGMA 2CB9A 4CG3A 4ESVA 4YC7A 1U0BB 3HSSA 3OZVA 5DGXA 1N7HA 4A15A 1QPGA 1A8UA 3CQ9A 4NBLA 1YKGA 3CTMA 3HEBA 4IWNA 3WB0A 1EFRA 1JSXA 2IE8A 2ZYAA 5T57A 4WBNB 4D4GA 3Q8LA 4RLHA 5H5JA 5DRYA 1W46A 3NGXA 4JQZA 1WUTA 3U49A 3ESBA 3UENA 1MD9A 4NBKA 2H57A 2A9FA 2P69A 4LJ9A 4IS2A 4Y2UA 1JE1A 5IZ4A 2F4VB 3F3MA 4GMXA 2Q0QA 4CV3A 1DIRA 2EC5A 3OE7A 5I4BA 4R1LA 5LC1A 2CHEA 4L5AA 1HORA 1UMBA 3V1NA 4A23A 5C7LO 4M6WB 1YRQA 2XZPA 4KQJA 4MAAA 1WD7A 2DT8A 3FLMA 4GMHA 4QUHA 5ELXA 1KNXA 4EKYA 5AW4A 4RKWA 4RA6B 5JXHA 1V96A 3NBKA 4YX9A 5EJAA 5AVWA 1MXFA 1UBNA 4F56A 4DR4B 2CK3A 1QIHA 2OWDA 3NGLA 1KHHA 1KMHB 1UK6A 4BBAA 1JWBB 2XKAA 4PLCA 1OLOA 3I23A 1M8GA 5CFPA 1Z5OA 3MUEA 3CGGA 4V0KA 4RZHA 4X93A 4KXQA 4MP8A 2X2EA 4AIIA 3H9UA 4J0KA 2Y1XA 3EQ8A 4WKBA 1KEEA 3R9WA 3ZCUA 4FE7A 4QUIA 2W2TA 4E46A 1UKYA 4CCYB 2PH7A 1W49A 2I2AA 4Y1FA 2OGSA 1JXMA 1U3UA 3S68A 4B0PA 721PA 1O0BA 1GYQA 2JLUA 1E2BA 3OECA 4H7HA 2NSYA 3AOEA 3MOSA 1H2YA 5ALYA 5KUTA 1T3ZA 1TC2A 3M2TA 3KYCA 1CU1A 1RQNA 3R40A 1GP2A 1RJGA 5IM4F 1MRNA 4XX0B 1E2PA 4F6LA 4TLCA 4MLZA 3RROA 1WXWA 2TMYA 3H2JA 1W85A 5IPFA 2ADOA 1PQYA 1Z6GA 2IY9A 4RVFA 4ZN6A 2QRMA 1QG0A 1X6VA 3CRZA 4YRFA 7GPBA 1W581 4WEQA 5KNCH 3AZQA 4W5NA 2CBXA 3X3HA 4GXRA 4N6NA 1NN3A 4YRTA 2D2VA 1VL2A 3AX6A 2MCFA 1JB9A 3TSYA 1ODIA 3EAGA 2WE7A 4MQBA 5EWJB 4CLEA 2A59A 2QAGB 2ES4A 1BVYF 4KVFA 4O5AA 4Y3UA 3UY4A 5F4BA 1X7ZA 3AJEA 3AQIA 1D2EA 4KXLA 3M49A 4EJSA 2IYLD 5HFJA 3FR7A 4QYMA 2Z9DA 5BR1A 2I9KA 1NWCA 1XU7A 4GKAA 2EJCA 2VAPA 3GCWA 2PXAA 3IBSA 1RHMA 5EPEA 2CDBA 1EX7A 4FT2A 3NTOA 4AJOA 4QYWA 4AIRA 4F4IA 5B37A 1IU9A 2FRXA 3OZXA 4G5RA 5LA6B 1O6CA 1YBVA 3ODGA 2O0HA 1SC3A 1ZI9A 2E89A 2IU4A 3G49A 2B6HA 3O47A 2ZAIA 3QI7A 4K88A 4ZOAA 3FUCA 4HEHA 4K9PA 1JFVA 4H27A 4PLVA 2WAYA 1HA3A 4OTZA 5ALNA 5IMSA 4AAYA 1YCDA 4ATNA 4IHQA 4BFWA 2O8CA 4Q3OA 3NC4A 1S1CA 1UJ2A 1C1DA 1KO4A 4DLZA 2D5LA 4MUEA 5TEVA 5CA0B 2JLAA 2JLZA 5LLTA 1NP3A 3PFWO 2H4JA 1KMMA 2WDPA 4MI3A 3VBEA 1L9KA 3ZDZB 3ZLVA 4AP5A 4DKXA 5KU1A 3PQ5A 1NVEA 3DBRA 2DMRA 5LMUB 2YASA 2GF9A 3JQ6A 2Y68A 3AVTA 4EAAA 2GVDC 5HIIA 2BDTA 5D87A 1O9HA 2N1BA 3RG8A 3RJ5A 5F7ZA 1A72A 1UAGA 5I9TA 5T3YA 1VKOA 2V6BA 3T5GA 4BVGA 4G6ZA 4NPHA 1EZZA 1USUA 3UGKA 5BT8A 1KK1A 3EHEA 3L8FA 4UNNA 5E7IA 5HMLA 3VYTB 2C7GA 2VNKA 1UL1X 3NHKA 3QQPA 3VMFA 5JNUA 1DCFA 3T5PA 4JH0A 4HSGA 1QIFA 2VG8A 2AT1A 5EJ7A 5EMKA 1Z9BA 2Z6AA 1UAAA 1X8JA 1YL6A 1HZZC 1SG6A 3F6SA 4H2DA 4TRJA 4AG3A 2FPXA 5LPNA 1Y6QA 1I7DA 1CJMA 2D6FA 5MGBA 2D5BA 3HZZA 1FLNA 4HK4A 2ZR8A 4M9UA 1XF1A 3EBPA 1IVNA 3LUBA 3AONB 3BL6A 3MLEA 3U4IA 4UD6A 5E4YA 3RVMA 3EDYA 1DADA 4MAFA 4NU5A 3W6PA 3A2MA 2I6QA 1ML4A 1FA9A 3DLIA 3L77A 4NP6A 4TTAA 2M6SA 1E2HA 1TT5A 5CURA 3H0EA 3N58A 1H42A 4XIIA 1OILA 2CJFA 3JQ9A 3KJGA 2J87A 5CLLA 4XDHA 1Y3AA 1P1RA 4HS4A 5IXSA 5I01A 3N74A 8AT1A 1JHDA 4CNQA 3IVXA 2IITA 2J9XB 2MMCA 2H00A 4EW1A 2ET6A 4HC4A 2GESA 3II6X 4X7BA 4DILA 1D1QA 1OGYA 1UMBB 2HREA 4HNAA 1X87A 5DCYA 1HLDA 1DSSG 1Q0QA 1PNTA 4JZKA 4NATA 3HBMA 3T52A 5HS4A 4Q1VA 3UJ9A 3WK8A 4KAAA 1I1QB 3BXFA 5AVVA 5I47A 2WIDA 1OAOC 4FDUA 3F6YA 4ML3A 1A82A 1LJ8A 3F78A 3HC7A 2NPIA 3W6ZA 2BFWA 3H18A 2XVZA 3HA3A 5IU6A 2RSLA 3HEMA 1TYEB 2PMFA 1TZCA 3LBHA 3C3KA 4LHZA 2GHIA 1VHTA 1Z2EA 8ABPA 2R84A 3X2EA 4GWKA 2DPHA 1KEEB 2ISCA 4ZQGA 3V7NA 4Z4QA 1GAXA 4FGLA 1LRKA 3DCNA 1ZOSA 1L7RA 2X2OA 1NSFA 4AYWA 4F8EA 2RKOA 5ALEA 5JSFA 1XZCA 1NW7A 1ZD2P 4OQMA 3UMJA 1X1CA 5F78A 5L7WA 4WK6A 4NENA 4R83A 2XIQA 5FNZA 2O1EA 2RGNA 2VRCA 1HYEA 2NO0A 2VTDA 3MLBA 3OIYA 4YO7A 4BNDA 4YUWA 3FOEC 1JU9A 1JWAB 3KYCB 4KQFA 1SCNE 4PLZA 3PQEA 4JA2A 2DHQA 3R5XA 3HYCA 4LY9A 3JVDA 3L6EA 1XTZA 1YCFA 3CINA 3D6MA 4K9QA 4U7PB 1W85B 4WN9A 2EX0A 2GTPA 2W22A 2OB2A 3F8SA 4I6JA 4XEHA 2FHPA 5I9SA 2F3RA 4QXOA 2PSJA 5DSXA 4URFA 4PCLA 4MJXA 1E1KA 2V6JA 4DLTA 2ZUFA 1PU2A 1J2TA 2YYSA 2HH9A 4QATA 3RSSA 4EFNA 4D3FA 4XH9B 1INLA 3Q3IA 3KZVA 1V7PC 5A03A 4FDVA 3IP5A 3AR8A 3GFGA 1F4LA 4FMCF 4V02A 3R7LA 3QX3A 1JDBC 1NT2A 3GG2A 2JCSA 4LX0A 4KK3A 2G06A 1P7YA 1V9SA 4DM7A 4B47A 3H5WA 4IJVA 1X7ZB 3BRCA 1TQDA 4CTNA 2J0VA 1XO1A 4RH1A 4LXIA 4EJSB 1JHAA 2FQ1A 1Q11A 2FSSA 2ZJ8A 2UUBB 3D5QA 2AI2A 3ICEA 4EBBA 5EPUA 4C3VA 1FUYB 4O1IA 1A27A 4GM4A 2DM6A 1MPXA 4BB9A 1JPVA 3LBYA 1V4VA 3WX0A 4YB8A 2BTEA 2WHRA 2QHXA 3B2QA 5EJGA 5HKLA 4GG1A 1SQ0A 5AJVB 1S8AA 1M2VA 1FFYA 2NQTA 4E07A 3KEOA 3OZSA 1RHRA 3A4VA 3CJRA 2JCVA 3AKCA 1M8FA 2O8CB 4BMYA 1IATA 1KFEB 1C1DB 2AQHA 2CDRA 2I2BA 3UT6A 4OJMX 1DHRA 3AY7A 3HBAA 1W44A 2XGGA 3C6YA 3NHFA 1ORDA 2OXRA 2R62A 4M1WA 1GTL1 1HRKA 4UE2A 1RLMA 1WZUA 3DBRB 1G5PA 2IPNA 4U2GA 3O3MB 2HSJA 3R8XA 1L4GA 4BE9A 4KR3A 1PWEA 4E2YA 3GJ5A 1UUFA 1LLFA 1GZUA 1S9HA 2EZUA 1R6AA 1WUYA 2OG1A 4TMWA 1WKCA 2QVLA 1EDOA 2WA2A 1UPTA 2XB9A 5H83A 3B1VA 1XLUA 2DHDA 2JCXA 3JQDA 2D0IA 2PJUA 1ZP6A 4TL9A 2Z9CA 3T4UA 3A25A 2PJZA 4NLLA 5AHWA 1S4QA 1JL3A 3SHVA 3ZQJA 3BGWA 4BJ1A 1XKTA 4DV5B 1Z36A 3ZK8A 4XWYA 1CJBA 3U39A 1GV0A 2W6MA 3FYTA 2HCJB 2HI0A 4PPGA 4AMUA 4D80A 3I3SR 4KR2A 3DDWA 1CRZA 4YGYA 2ZAOA 4GC5A 2Q62A 1S2NA 1TT5B 2R4UA 5FBZA 2I2WA 1ZJJA 3W3AH 4D0RA 4N40A 4AFNA 1UWCA 4QFDA 3SQLA 3TLYA 2EW2A 2X42A 1OXVA 4IEIA 4JJ8A 1P5JA 5EP4A 1CF2O 2JATA 2ODWA 3L41A 5CGZA 1OASA 3HCAA 4HNAB 3ZHXA 2Z5VA 1HL7A 4OGLA 2BFBA 4YDRA 2NV6A 2BFPA 3M4YA 2PV0A 3B3AA 4IIEA 1NSYA 1QBGA 3V4OA 4HJXA 2J7PA 3E53A 1O5IA 1PBNA 3KT0A 3HM2A 2DQZA 3KYBA 4LZZA 4P34A 2IUSA 3A1FA 4JI7B 3DEZA 2M1ZA 1KZ9A 4MKFA 4KRFA 2PZFA 2AG6A 4IDHA 3VO2A 5KKAA 2J1LA 1DAPA 3NJ4A 4M1SA 1NDHA 1U8ZA 2ERYA 5FP0A 3O8DA 2O8VA 4Z51A 1W76A 3IIMA 2NU7A 5F77A 4NDZA 1H2XA 4G5GA 4R2HA 5BWLA 2EP7A 1UZNA 2LCIA 1IZ9A 2NU9A 4MGEA 3KKNA 3G59A 4C0BA 4ROTA 4L76A 1JDTA 1XTUA 1Q7TA 3OF3A 3FFTA 3ITNA 1Y48E 2HADA 4KACA 3NDIA 3SY8A 3WZLA 1G41A 3IB6A 1L5HA 3AVWA 1I9CA 2R5FA 1NVBA 2V59A 4NENB 4ZU3A 4BNDB 2OQIA 2OGZA 4F12A 2B25A 4NOMA 3PNOA 4E14A 4KI0A 3HCRA 5H7XA 3VV3A 1GRVA 4DUGD 1PX0A 5DVZA 4WN9B 5CG1A 4J9VA 3MYRA 3N8GA 1RR6A 4UFPA 1DOZA 1NI4A 3WYGA 4P32A 4EJFA 1XMQB 3EVFA 1WXGA 3QYFA 3PKZA 1I7LA 4HG2A 3AB7A 4FN4A 3HBNA 3A1CA 4U2BA 3VR2A 1MB2A 5AW3A 4OMDA 3IESA 2I4LA 1E2EA 1WIWA 4ARSA 5HCIA 3CKKA 3U26A 2HZ7A 3MW8A 1P62B 3DJYA 4BJ6A 3NBFA 4KI7A 2BIFA 5KNDA 1BX3A 2EJTA 3E9ZA 1BQ3A 2YVQA 1V3UA 3D6FA 1RRMA 1P1BA 1XTRA 1J0BA 1KYQA 1Y5MA 4MSUA 1E7RA 3LIPA 5DGHA 1X1TA 2D1SA 3D6AA 1E2IA 2R6AA 3ZV4A 3HXMA 4RK7A 2BGTA 1YVUA 2XCRB 3H3JA 1CQIA 2GXSA 2ZULA 5L40A 2ECFA 1GZ3A 3QQ5A 4OQPA 1BEEA 4DSAA 4TM8A 1M2VB 2B7CA 2CNLA 3HA7A 1IUNA 3QU5A 4WNCA 1Z2AA 1P1JA 3T34A 4FHEA 3PNMA 4JLSA 1U0RA 2VLBA 3OPNA 3L4KA 2WB2A 1XVTA 3MS4A 2WG2A 2CMHA 2PGDA 2VRWA 1XWIA 3BOSA 2HA6A 3QKSA 4MVJG 4BN0A 1R10A 4N5NA 4M0PA 4PIMA 3HHEA 3VU9A 2XRZA 5JJIA 2OB1A 2AG8A 3T7AA