4G4SP

Structure of proteasome-pba1-pba2 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
267
structure length
190
Chain Sequence
MSCLVLPLVSVGNIPQLSIDWLLNSQANEWEYLEALDSKYLVEFVGPLDRPEDGSDSLYKDADMKYSSALEVFYNKKRGLFAIQQRTPLVSVNYLNNFIVEIILPFLSKYNISEICIWDSLYAMVDQPIFKILFQSIKYCSCLANEGDNSLDSQQFLQWIISQVKFVRPISWQGAYGMADARDKFVDLYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Proteasome Pba1-Pba2 Complex: IMPLICATIONS FOR PROTEASOME ASSEMBLY, ACTIVATION, AND BIOLOGICAL FUNCTION.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/chaperone
molecule keywords Proteasome component C7-alpha
total genus 51
structure length 190
sequence length 267
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4sP00
4G4SP 3WZ2A 3VR0A 3E35A 2WAMA 2P90A 3MNFA 3GAAA
chains in the Genus database with same CATH superfamily
2V7UA 1HI9A 4CF4A 4XPZA 2HJ9A 1WP9A 4QLOA 2IZ0A 2CLEB 2YDYA 1TLLA 1UAGA 4ZV9A 3LSYA 3OOJA 1WNFA 3LLUA 2W6IA 4QEKA 3U3JA 1TA4A 1SKYE 4E0BA 5BSFA 3AETB 4BX9A 4GE0A 4N4AA 1U0TA 4JLJA 1EFVB 1XDWA 5DCLA 3S2EA 5DHSA 3FB4A 5AJZA 2WPDA 4J0JA 4UHKA 1A8IA 1IDOA 1VKJA 2W22A 5C81A 3PLAE 2CHUA 4D43A 2FF7A 1GQYA 1CJVC 2X8AA 1UMBA 2H31A 5AM1A 1KFKB 1V2HE 4LXYA 3R3XA 4OHPA 4BIIA 4NBKA 2C2XA 1CEYA 3OTOB 1JLRA 2Z83A 3C16C 3VV2A 3QNUA 2QKYA 3IO3A 2V1XA 4GXTA 1H2BA 3O2JA 3WGZA 5KYYB 1BCSB 2BISA 2I3GA 4KDRA 5H81A 4Q37A 4TWAA 3EQZA 2WF8A 4TWZA 2B3TA 4EKYA 1C0EA 2IZ6A 2Z5VA 3CWZA 3GJ8A 3NB0A 2GEFA 2VF8A 3JD1A 4Q9JA 3KAPA 1FVOA 4P1ZA 1ZY2A 1T2CA 1XXHB 2QMOA 4DYHA 3NCHA 2A5YB 3OWHA 3VYUB 5CLJA 2FXVA 3B5JA 4FFBB 5EZYA 4DBVO 2Z9DA 1TLFA 1QHNA 3JS5A 1FPQA 2VZ9A 1S3FA 2C99A 1KOFA 3H9JA 3SR0A 5C8XA 5DPMA 3WB0A 2AX3A 3K4PA 2ORIA 1DJMA 3CNQS 1IUPA 1CEEA 4M1MA 4BO2A 1NQTA 1WDWB 2QJRA 3CX3A 1P1JA 3GLHA 4NBTA 2ZAIA 1N25A 1QO9A 3C7TA 4RA6A 3W1EA 3ZVRA 2EGHA 2QU8A 2OC4A 3P26A 5D85A 1WE2A 2CZQA 1ZESA 4IGKA 3U6KA 4RTNA 3LPNA 4I50F 2XA9A 4P54A 1ONPA 2JFZA 3KKQA 5FTJA 4JYAB 4JI3B 1WX1A 1WXGA 1V4NA 2GO7A 5JNRA 2H8GA 2ZI9A 4IHJF 1BXGA 4QA9A 5EUMA 4P83A 3WK9A 5JJ5A 1JJIA 4RYLA 2ZBUA 1TCUA 3BSSA 1F8UA 2FZVA 2Q41A 3NJ4A 1Z06A 1EQ2A 3JRNA 4G0QA 5FDFA 1NVMB 1QCZA 3OOSA 3HYRA 5BRJA 1RHMA 3IDZA 3F1LA 5FUVA 2BONA 2HTEA 4ZYYA 5A1TA 3FBWA 2NUTA 5IUJC 5K3EA 2F55A 4TXLA 2DLCX 3S44A 2XOEA 3LUGA 4RK1A 2P2GA 2VHVA 1JNXX 3OLZA 2G71A 2HGSA 3GCWA 3S6JA 1ECJA 2O0KA 3RLFA 3DOIA 4ARZA 3OUZA 1PZGA 1F4VA 5JLJA 1JL3A 1JTEA 1ZD8A 2KE5A 3JVIA 4DG9A 4RE5A 4ZVRA 4DVGA 4MVJA 2RBGA 2QTCA 4I81A 1PYDA 3T1YB 3ZGVA 3KETA 2DECA 3EJWA 2PZJA 2E5FA 4GYWA 2JK1A 2QQGA 2R8ZA 4HQ0A 4M0EA 1AOXA 4TLMB 3SX2A 3JU3A 2WKQA 1QGAA 1DJQA 5K3OA 5EEHA 3RR2A 2E55A 3OY2A 1Z2PX 3EGWA 3A4YA 1HZZA 1PQPA 3KZOA 4KEAA 4N3NA 3O84A 3N2EA 4GR9A 4QYMA 4Y2JA 3SBEA 1QGZA 2HWUA 4ZEWA 5FV4A 1V48A 4ENTA 2C3YA 3ETCA 5F9MA 3B6EA 2EG9A 3R3ZA 5FWYA 1BRTA 2P0EA 1E5LA 5EMMA 3I8XA 5K01A 4PYIA 4CQNA 1TTPB 1K0UA 3IVRA 3M81A 1A5TA 1C8BA 4O2BA 3FPJA 3IPCA 4QPDA 1ZOIA 4LXHA 4M9QA 2XXAB 2W48A 1NXTA 1USVA 1JKJA 1H22A 1JQ5A 4RV5A 1JLHA 4A82A 1PU2A 4X85A 2FWNA 1K2WA 1G6KA 2O6HA 4BN4A 3Q7PA 5MDHA 2NO4A 4R05A 2Q8NA 2FZKA 5J4KA 4S24A 2PKWA 5JNVA 4BLWA 2WJIA 1FYXA 3NT5A 5BUQA 3PEEA 3QY9A 2Q4RA 3BMOB 3DKIA 3CTPA 4FDMA 5JY1A 4A27A 3WK5A 5EY5B 4BQIA 1TJ5A 1JG2A 4B3HA 3K8OE 2JIRA 1G2PA 1MB9A 1VKHA 2I4OA 2NPIA 2VDJA 3DBLB 3DBRB 3R44A 4MARA 3W04A 3ZXYA 3JZFA 4G01B 3G13A 1IYZA 2PZGA 5JFTA 4JGGA 5EJ4A 3HXTA 4L8YA 4ENPA 1USUA 1RJWA 1YAJA 4Q3LA 1G7RA 4YAEA 2ASEA 5B2EA 3EC1A 1R9NA 2AR0A 4I6JA 4RK6A 3ZE8A 2MOKA 5EIAA 3MCVA 1F17A 3SEQA 2C4TA 1NR7A 3PX3A 5FWAA 1QKIA 3TTSA 1YQEA 2XCUA 2PWPA 1WDTA 2DBYA 4HQNA 4ZTBA 4DA9A 5EHZA 2UUOA 3QPVA 1JH8A 3WQHA 3HYLA 4K6MA 3GFVA 2P3QA 3PCTA 4IIGA 4DUPA 1Y6RA 3OIWA 3VU0A 4LY3A 2AHOA 1OIXA 2P9QA 5EJGA 3KFXA 3PTZA 3F4KA 2UAGA 3ZIUA 4ZAYA 3T1OA 1HKUA 3BC1A 2AKEA 4O25A 3TSYA 5KVAA 2V6JA 1S8OA 1XNJA 3RIEA 1BCRA 4G41A 4RCYA 1XDZA 5BT8A 4JWKA 1Y6QA 1P1RA 1W5AA 4PAWA 2E4WA 1WM1A 1TTQB 5CBKA 1BXRB 2IH4A 1XCOA 2VZEA 3PEWA 3PIIA 1VMIA 4ZVMA 4BO6A 1P61B 4XFJA 2A1TR 3IBYA 4QAJA 4TMVA 2ZTVA 3WAKA 5MN5A 2BH2A 5KWSA 4UQOA 1DJNA 4BMSA 1UP6A 1HT3A 1MO2A 1VLVA 3B3FA 2DKNA 1II9A 3DL4A 3QBEA 1SBCA 1E2NA 4F11A 3ULKA 1VMKA 3EZ9A 2PSJA 4MUMA 4WKBA 5F52A 1OB5A 2XZTA 3BA1A 3K1JA 4D4HA 4JSYA 3UH1A 2B1JA 1JQBA 2HIMA 3BL6A 1QOZA 3WVNA 5KVCA 3C3MA 1V71A 3OZIA 2CCKA 4IO1A 4JXXA 1JTFA 1UXHA 3TIIA 3UNXA 3ZYCA 2OXFA 2PSFA 4LJYA 5B5SA 4B09A 2BI8A 3EGXA 3DVAB 2IS6A 2WAXA 1L8AA 4I5FA 1W96A 5J23A 4Z0HO 4CDMA 4KN5A 3FVVA 1I94B 2ZJ0A 5HEKA 3UGJA 4RTSA 2VK4A 4OQDA 3SYRA 3IAXA 4BEBA 3RVSA 4OXXA 4CR7A 4O4JB 4F45A 1V1MA 3L4JA 4X6UA 1RW4A 2Q28A 4KN6A 4A5OA 4JVNA 4BLVA 1QFXA 3AEKA 4G1UC 4RY9A 5KQPA 4IP0A 421PA 1EPUA 1K2VN 2OLKA 3F98A 4U2KA 3QPUA 1R5NA 1FTSA 4KFSA 2HK9A 2KPOA 2OZVA 4FCWA 4MVXA 4CZ2A 4K88A 4D3YA 4HVAA 3WISA 4FS8A 1FTGA 4M8NE 3ZWAA 1FQWA 4EUEA 4YJKA 5CX1B 2QJTA 4GW3A 1S7GA 2RG7A 1S8NA 2XECA 5JAPA 5MFPA 3EULA 2HF2A 4OP1A 1DV2A 3OPYA 4QEZA 4IFBA 2A59A 5EG5A 2LCQA 2WSLA 3D8RA 1X1QA 3TQCA 5J5VA 3ZD8A 4EABA 5DB4A 2FSGA 2QRPA 4UBNA 4D4IA 2OXTA 2ERCA 4TTPA 2IDZA 1H66A 4YRJA 4B4DA 3THWA 4G0UA 2XAAA 2HQBA 4H7PA 4L78A 3RKSA 3EBOA 3GJ6A 1DKLA 3ZY4A 4CM1A 4GMFA 1E1KA 1B14A 4M6WA 2OYSA 1IM5A 2YS7A 4FEGA 1A77A 4WI1A 4CKBB 1C3EA 2F3PA 2Q3FA 4G5HA 4ZAGA 1N33B 4B4OA 3BJIC 4YRRA 3WO0A 3ZNNA 1R6AA 1C9YA 2X1MA 4CWAA 3DHVA 4N5MA 1BFKA 1GQSA 1O6FA 3GVCA 1FFYA 3OCXA 5JS6A 4KQEA 4K03A 1UM8A 3QU4A 3WNBA 2G0NA 4NBVA 2UKDA 4R7TA 5B1HA 4DNQA 3RIHA 3WIUA 1BWSA 1YJBA 1LNSA 1GVHA 1SUEA 2ZBPA 3IUPA 3BICA 4TUYB 4WKCA 1KDVA 5IN4A 3GPLA 4AXBA 5JSZB 1Z07A 3RPEA 1NW8A 2AJCA 4MB0A 4I4TF 5A05A 3BREA 1F2TA 2FPKA 1TYZA 3GFQA 2O5RA 5JD5A 1ZU5A 4IZHA 4LYJA 2FP3A 3FBGA 1W581 3CXRA 3MNFA 5DGTA 2JVKA 4ZIRB 2D3TA 2FWJA 2VHQA 2OPHA 5JJIA 2UZ1B 5FWXA 4IINA 2A0KA 3ELDA 1H9BA 5A03A 1GLNA 5INTA 5AKXA 1PHPA 1ARZA 3ENWA 5COQA 4M76B 3SR3A 3TGLA 3CSSA 1Z0AA 1OB2A 4BPBA 1YNSA 5HCNA 1N1MA 3KTFA 1N2ZA 5TSDA 3TTVA 3LDGA 5JD4A 5JS7A 4A36A 2LWIA 1VL6A 2ES4A 3AESB 3GNTA 3SHVA 3X0DA 4Z6KA 3E4DA 4ZODA 4AS3A 1MCZA 3ON5A 2C9MA 5K7SA 2PZAA 4DLBA 3K8YA 1U7WA 5EQTA 3VKUA 2PRJA 3F5MA 4TTAA 3HR8A 2VNHA 1N8SA 4ZANA 1EJ0A 1GZ3A 1TA0A 1TDJA 1WDLA 2EKBA 2FFAA 3KUUA 1CR2A 3TJRA 4MMZB 4AW9A 3K73O 3PUHA 1U8YA 3I1JA 1KFBB 1B1AA 2PRZA 2BKVA 3JWEA 1JB1A 4XJVA 1PZHA 4ZAZA 3W0LB 5KTMA 2I76A 1QH0A 4L9AA 4L4ZA 3C1TA 4YUVA 1MFPA 4GZMA 5EMLA 1NPDA 1ODFA 3ZLBA 1BH2A 1M2OA 5FBWB 3VZQA 3BAFA 2HA3A 3AWIA 1I7PA 2OFWA 5DNDA 3UMVA 3ZK8A 4PIMA 2ACEA 4LF7B 1RQNA 2Q9UA 2QOEA 2V98A 3ZDXB 3G7UA 1GZ5A 2BR5A 2R47A 3GFFA 3R5FA 3JQ6A 2QQ0A 3T54A 3EQ2A 5CXXA 4EL0A 1BX1A 2GPAA 3QKUA 1YA6A 4DPLA 1YU6A 4Y6SA 1NVWQ 1XQYA 3PGKA 1OT3A 3UMJA 3GUUA 1I9CA 3RRJA 2DEUA 1PR2A 1QK4A 3OTWA 4MI3A 2EP5A 2IUYA 2OENG 3IOYA 3P45A 1G5TA 2ZROA 1XJWA 2AJDA 1EXNA 3W2FA 2XXAA 4F2PA 2GZSA 3BSFA 4XUDA 2DJ5A 2F1HA 1VBFA 5DI3B 4YXWA 4F46A 4LBYA 4LZPA 3AM3A 2KYRA 4MINA 4Q9KA 4ZHQA 1N77A 2NVBA 1X7ZB 2QLTA 3FCAA 3RRFA 1BKYA 5GOZA 4XUGB 3GARA 4XQ9A 3LGSA 4HFNA 3NAQA 3WLQA 2JJ1D 4BO9A 2TECE 4BVBA 2W6ZA 2GILA 5BSMA 4DQVA 4EJSA 5KWJA 4DDKA 4JT8A 3C0KA 5FBQB 1X9GA 1XAJA 2VHEA 4N65A 4OUDA 4POAA 4JI6B 4LRYA 5C1BA 5DM2A 4R2LA 2CLFB 1UMCA 2XD4A 4YP5A 1EDBA 2GZ1A 2YQ5A 4JP2A 5HKBA 2O7SA 1QO7A 4G36A 3UKJA 3H0CA 3TLXA 1YVUA 3OT1B 5GY7A 3Q5GA 4JCOA 2IOQA 1JFRA 3I28A 2Z04A 5IKXA 3NHAA 4IHAA 2OCAA 3NG1A 1AMOA 1VLHA 3NDBB 3PENA 3EVAA 3ZWBA 3T5PA 4R9VA 1Z38A 4HYEA 2YWRA 4FTWA 5EKSA 4Y6LA 4DLVA 3ZDCA 4ZRNA 1TJ4A 2BM8A 1QQBA 2XB9A 4DQXA 3KL2A 3WB2A 4XARA 3QVVA 3UCEA 1X1DA 1GKKA 1Y37A 3S99A 1C14A 1U0EA 4GLLA 1X2EA 1XXHA 3WLOA 5CDYA 4TUYF 2NTVA 4LZZA 3D3QA 5AI6A 4QM6A 2ATVA 3AU9A 1KWKA 1O7JA 1PEKE 4PFKA 1FP1D 1AXGA 1G8SA 3BB1A 3GT7A 4LRUA 4UAJA 5HZGA 2PLNA 3DZBA 5CH8A 1U2ZA 4KQHA 1KEVA 4XYMA 2JFPA 3OCUA 4XB1A 3TNJA 3TZ6A 1UC8A 3BF7A 3ZV5A 4QUAA 5DULA 4B3RB 1F20A 4OSEA 4E51A 4GMHA 4IWNA 2QVXX 4D4LA 3O8CA 1GNSA 4OQQA 4ZMRA 4IUCS 4GDFA 2O3SA 1U94A 1UPFA 3IGFA 3JQ7B 3FTFA 3O91A 2BEKA 2WU1A 5GJVC 5HQTA 2VF4X 4Q3OA 5ESXA 1I2DA 1GLVA 4O8CA 2BSQA 2X19A 4IF4A 5JSFA 4KQWA 2AI2A 1ENZA 2W8BA 5DGCA 1WXWA 1D1SA 1RCFA 1VTKA 4PSDA 1PS8A 4I8XA 4TV9F 4JOQA 5A5GA 2HHJA 1QFZA 2J9GA 2P27A 3WXMA 4D9EA 2GN0A 3R5KA 1DWPA 4YA6A 3A2LA 1TF5A 1U8FO 5IBQA 1NGSA 1YVRA 1Y3AA 3FW1A 3GFBA 4D81A 3P2YA 1QP0A 4WGGA 2BGWA 5HF5A 3LCJA 3DOFA 4RJIA 4DKXA 1O96B 1QPGA 1BRMA 2G1AA 2Y0PA 4DY4A 3GPDG 1A69A 1XWWA 3A9UA 1CZLA 4UZFA 2FEKA 2VPQA 3DTTA 3BPSA 3H8VA 3RWOA 1TMGE 1E1CB 3HACA 2HGZA 2WYIA 3AEYA 3CEJA 5CX4A 3RHZA 4JH0A 5EIHA 1G291 1WR8A 1YNOA 2WG1A 4JI7B 3D6MA 5AJTA 2X0FA 1TM4E 1UXOA 1ZMRA 2PMCA 4I4LA 4XVCA 1MH1A 2G9VA 1AN0A 5F12A 3DMFA 1V7CA 3VKWA 3W2EA 1OPXA 4M3NA 3LRXA 1AKNA 2QX7A 4X1IA 2VK2A 3DNMA 1SB8A 5JNUA 2VBCA 5KNBH 2IBSA 1SVOA 4U39A 4H1TA 1BMQA 4TZ6A 1JEEA 2XZDA 3B3AA 1QORA 2C4NA 2HA0A 3KOUA 1HTTA 3IC5A 3L7CA 2AFHB 1J2UA 4ZCLA 1TADA 4ZAXA 1H6BA 2IH2A 1NW7A 1JMYA 1B00A 1U0GA 4CNBA 4DA0A 1GP2A 2C98A 3B5EA 3QUBA 4B43A 1ZNZA 5TF4A 4YRMA 2H2HA 3DMGA 4HYQA 3F4LA 2AR7A 2I80A 3P9KA 4OHFA 3PUVA 5EQDA 2Q5HA 4CTJA 1QX3A 4GNKA 4FCVA 3K2EA 3JQGB 3LY7A 1V35A 3IUEA 4PONA 3WL7A 3GPBA 1DMSA 1MX3A 4QDTA 5JQWA 5JZSA 4RADA 4X7BA 5A4MS 2D62A 2DFNA 2IEDA 2WTAA 4YJHA 2Q5IA 1U8CB 1U0OC 3T15A 4A2QA 5KZMB 1CSEE 3CLRD 2Z3ZA 1D03A 1Z5WA 2JZCA 3HYNA 3NZEA 3R24A 4K9QA 1PK7A 5LL6P 3CY6A 3TAUA 5EP3A 2IIVA 2NPOA 3AF4A 5B6JA 4UMEA 1D9ZA 1Z7EA 3OFVA 5L3VA 1XZLA 3KEGA 4RQTA 1EFTA 3AHCA 4ALJA 5A6VA 1I7SB 4QSHA 2XWJI 4L5BA 1GRNA 3QVSA 3OICA 4NNPA 4RHUA 4RPGA 1GAXA 4CR8A 4Z7NB 1R0RE 2P1DA 4XDGA 4M21A 1Y1TA 4X1KA 1E6WA 3EFBA 1IEQA 4YS6A 1NP3A 3FGOA 5AJYA 1FUEA 2XDQB 3RTGA 2FLWA 3TINA 2H7XA 1C8VB 5ARCA 5WRFA 1CETA 1F51E 2ZRMA 4W1QA 2B2NA 2JJ2A 4PX2A 2VG8A 1UFOA 3BDAA 3PEUA 1NVVQ 1YK0A 1ZAKA 4G8DA 4MVCA 4RVCA 2X0EA 4F12A 3RBAA 2IUTA 2XRMA 5TQ2A 4RAOA 2ZDHA 2CJPA 5HOEA 2BH9A 4JLAA 4YC7A 1XDDA 2B8TA 1M6WA 1X80A 1NIJA 1L5YA 4TQAA 1XJ0A 3K53A 1CS0B 4E30A 5JBNA 4RIIA 4WOBA 1RVV1 1V25A 4OJTA 2DZDA 4E4YA 1OKKD 3B2NA 3EDCA 2IYYA 2WTBA 2GBGA 3MMZA 3PC8C 5I4IA 2I62A 2PKXA 3MJEA 1ZCBA 4O2AF 5JMPA 1W4ZA 3TWOA 4CL0A 2F17A 3LXMA 1W4CA 2ZYHA 4M0DA 1F5NA 2QRLA 4M38A 1AE1A 1P75A 4QD3A 1SUDA 3UXYA 4W9NC 3V2UA 1BX3A 3Q85A 3DXZA 3KELA 3JQ8B 1PYOA 4UEKA 3E2IA 4XLLA 1NNI1 1E5TA 4M22A 3DPUA 4RGYA 3JV7A 4WK4B 3W4IA 1AC5A 1C81A 1GZ7A 1H1LB 3HJUA 1MHPA 4XWAA 4LF9B 4CUJA 3M82A 1QIIA 1PSZA 1S9HA 2YJNA 4WK0B 1VZ3A 1ISFA 4X71A 1AGRA 3ESBA 5HGJA 1F3OA 2JLYA 4FW9A 1LW6E 2X4IA 2WOJA 1OLSA 2OAP1 3PD7A 2BDTA 3MT9A 4J76A 4Y1FA 5D86A 4NPHA 5DEOA 4ZHQB 3HHEA 4MZXA 4FBMA 3LQ2A 1TJYA 2BPOA 3IP9A 5I3ZA 1G8MA 4JR1A 3AXTA 3PQ2A 2P6OA 4RZIA 3W8NA 2YWCA 4LRSB 4ER7A 5CAEA 5JTTA 4MHSA 3DOCA 1PJBA 1IN6A 1G2QA 6LDHA 5KNDH 3WSVA 3CB4A 4Y1GA 1G6HA 3QX9A 1QO0A 1G3IA 4H3HB 4HDSB 1JHYA 4EFKA 4MTCA 3USES 1TFRA 1YZTA 2VH5R 4NCIA 4D9FA 2Q5LA 2IPLA 4FMCF 4RORA 2IYSA 1EFRD 3EVEA 4PSVA 1IBLB 1O94D 2HPVA 3IOCA 4DUZB 3I2JA 4OI0A 4N8EA 2H06A 1EXDA 1LF5A 3CRRA 1UT5A 1DBPA 3C6MA 4JP1A 2JIZD 1DT3A 3AIKA 3D3KA 4BB9A 4BWVA 3WRYA 1NP7A 1ATIA 3PJFA 3B1WA 3TLZA 2HX1A 2OD7A 3ZZUA 4BWYA 4DMFA 2XUPA 1A9XA 2P9HA 3MBOA 1TEZA 2HUPA 1R0BA 4X45A 1TO6A 1YJ5A 4ZCRA 1GL9B 2Y1KA 4NU6A 3M3DA 4NXNB 4C7OB 4K1LA 4OEHA 1Q44A 1M2KA 2I6TA 5F4BA 3SLGA 4PHHA 5JW6A 3FHLA 1JBQA 5K3AA 1GXSB 2EBHX 3KB6A 3CCFA 5REQA 4YP0A 1ORWA 3FZQA 5FOSA 2A94A 1KYWA 3CF4A 2P3SA 4QT4A 2CL7X 3MAGA 4AFNA 3DO8A 2A35A 3JX9A 3EXEB 1C9NA 1M1UA 4TKVA 5F3WB 5DDIP 5L7YA 3O21A 1WVGA 4C78A 4ZGWA 3H5LA 4ZA2A 1QR6A 2I6FA 4BY9E 3TAXA 4I99A 3FDXA 4JYMA 3MAAC 4AP9A 2H1CA 2VPIA 3TG8A 1TCBA 1M72A 1GEEA 4AVYA 5LU9A 1SRQA 3PLNA 2MMGA 4JBNA 3RRXA 3VXKA 3ZBQA 3MFQA 4OQXA 3UW1A 5IMBA 2B37A 4PHGA 8ATCA 1KHTA 1EJ2A 2C4WA 2VOJA 3FWKA 1L3CA 2W2LA 4IVRA 3L40A 1XVLA 1N4AA 3RUCA 5K20A 2VDNB 1Q12A 1Y63A 3DE4X 3CRMA 3SEFA 4G5OA 3MJVA 2H0QA 1P72A 1LB1B 3JD0A 4QGBA 3NFYA 4UU8A 5JCOA 4C43A 3F5DA 2Z56A 2J4DA 3OF3A 1U7DA 2J9XB 4OLBA 1STOA 2GWRA 4U7GA 5HJEA 2FMUA 1XVTA 3AIMA 3D4NA 5C8ZA 3I01A 4BX3A 4AKHA 5TIIA 4PYKA 4HYYA 1LSSA 1XX6A 1E8DA 5C18A 4UTVA 1MOQA 2J9FB 2F4VB 5L3SA 3ZHBA 4HGYA 2AA3A 3T7JA 1LNQA 1NONA 2QR5A 2WABA 2WSSD 2L0XA 2XPCA 3GZNB 4Y9DA 5IWAB 2GF2A 1D6NA 5E9AA 1BS2A 1SK9A 2Z1NA 5FR2A 2H5JA 4ND5A 4EI7A 5I51A 2O8DB 1FXUA 4MW9A 3AJRA 2Z4TA 2KMLA 4WKNA 1AKEA 1YB4A 1VGRA 3LOPA 3ASVA 5FR1A 821PA 2WAOA 2MR6A 1E96A 1QYCA 3L6OO 3P20A 4M1YA 4UNRA 2WB2A 4RLSA 1XF9A 3FTNA 1ZD5A 4NBRA 3W79A 3URKA 4QM7A 1NJSA 3C3DA 1H6DA 4NR0A 4C4ZA 2A9QA 6AT1A 4XYLA 3V3KA 3QHQA 4ICIA 4GLOA 3DDSA 13PKA 1OFHA 2C2GA 3GGDA 5IJ9A 3V8MA 1XCLA 3MMPA 1W0JD 5AUOB 4JENA 1FVXA 1NP6A 2D4HA 5BOVA 2HN9A 4HH1A 1ZNQO 5YASA 3FE2A 4V0KA 3C4QA 3STTA 4NDZA 3UA4A 1SU6A 2W83A 4B34A 1ISRA 2C82A 3SYTA 5FP0A 1ZC3A 1AKMA 3BTUA 1AKYA 4O4IB 1TUIA 3CUVA 1G7CA 1CE8A 3FNRA 1B6SA 1DCTA 2FI1A 3FUWA 3T95A 2QAGC 3I6BA 1XZMA 2HRBA 2PSDA 3G9QA 5DSXA 5K8UA 4Z4GA 3EGCA 2FK7A 4QDZA 3AG6A 5KKAA 1ZFNA 2PMEA 1P91A 1E8NA 3NHYA 3RS9A 3VSDA 4EO4A 2R6HA 4ESEA 1RHRA 1WW8A 2VCHA 3N74A 4PSKA 2FR8A 2PGOA 4MGIR 3VPFA 4GF5A 2DH5A 4QOGA 3ZE7A 2ZI4A 2UUBB 3K0FB 3HMQA 1FFGA 2CBXA 3EARA 1LA2A 2AXPA 2PK3A 4G9BA 4P08A 4OMCA 3G2JA 1IIBA 1MRSA 4RJKA 4HB2A 1SVWA 4RXTA 2X9VA 3IV7A 3O8LA 4BUCA 1RQ2A 2H2GA 1MVNA 3U1BA 1GDHA 1HDRA 2G6TA 1R4MB 1I7DA 2HV8A 3D0KA 1FBTA 3FOBA 5IRCD 1XP8A 1GCIA 1C7QA 5FV7A 3E5MA 2FSSA 3DFUA 4BXOA 4DJFC 1LDYA 3I05A 1S3IA 4R40A 2GAOA 2JGKA 1OZAA 2MYTA 4GI2A 3CRZA 1E4YA 4ZPJA 2PUAA 3GDFA 4HNHA 1MVOA 4EA8A 2E49A 3R3WA 1DCMA 3ZU3A 2YIDA 3O1IC 1QCDA 5TQ2B 2MTBA 1HX7A 2X5KO 1T2FA 1U8EA 4A0RA 1JMKC 4D1YA 4JXZA 4MV6A 1QGOA 4FI3C 1BMTA 2JJ8A 4R9NA 4Y2QA 3VU9B 2FWBA 6YASA 4GEKA 1X1AA 3SZLA 2NZ8A 2GPSA 1HDCA 3BVPA 3F6BX 4H31A 1HK7A 2JVIA 4ROTA 1P7WA 3DLHA 4IXWA 4RPJA 2Q6OA 5CIWA 2F8LA 1Q7RA 4MB6A 2XOKD 5AW2A 3RJMA 2XA1A 4JI4B 4OGGA 2W2MA 1NBHA 1XLVA 1B3BA 3PJGA 3WGHA 1KO4A 4EGQA 1N0VC 1TVEA 3WR5A 2Q07A 1RRPA 1EX6A 1XFDA 1IEWA 1Z0SA 4KBFA 4PZ9A 5ALDA 1USIA 4DAEA 3BMQA 5J1TB 4F3TA 1ZCZA 5JALA 2IEYA 5FUWA 1OC4A 3DMYA 1Z16A 3QPCA 5AHRA 5EZYF 4CL3A 1HNWB 4HO1X 2J0SA 1QAOA 4G0NA 3FR7A 4RD2A 1BFUA 4OMFG 2YYZA 4BGDA 2BEUB 4JYPA 4DCUA 2ZSJA 5DCUA 3GLFE 1QRAA 4AROA 2ZITA 1SMKA 4HN9A 3PP8A 3I0NA 1L5VA 2UXCB 5TS3A 3IDSA 3A0RB 3ZHTA 4XZ3A 1E9SA 5JD3A 3VBEA 3WDSA 1BHJA 2NO7A 4BFYA 4ZJUA 1WB9A 1WCV1 5HTKA 1J4AA 1WWKA 5DIFA 3N8NA 2OXEA 3RS7A 3O3NB 4II7A 4LJ9A 1QHYA 4NJEB 3VKGA 4LDQA 2X8BA 2REBA 5BR7A 4NDNE 2DFKB 1PZFA 3D6AA 4DR4B 3KB2A 1H94A 1TCCA 2GH1A 2O1WA 2Q0SA 1DC6A 1XD9A 2HQSA 2FEAA 1Q7GA 3GUZA 3V4ZA 2E3JA 2GTHA 3N6VA 1K98A 4ZV4A 4K9SA 3DCNA 4E94A 5BW6B 3R9XB 1G21E 2ZE8A 3QVGA 4RESA 2EFHB 2H4WA 4H3VA 3TEMA 1ND6A 1OAKA 1DEHA 2AG6A 3R40A 3FMFA 4Q4JA 4FHCA 4E88A 1L7RA 3LP5A 4Z49A 3HFGA 3BMXA 2HT6A 4JLSA 3AEUA 5IT5A 3HO8A 3OJXA 1RP7A 1AKWA 1QVAA 4X20B 1ZRSA 1U3CA 2AVDA 2XJ9A 4JITA 3VFDA 4BN5A 3PWKA 3Q7SA 5IANA 1MIOA 4F4UA 2X6QA 2QL5A 2JEZA 1YS6A 3DWEX 3Q8WA 1JR3D 3OECA 4TL7A 4TN1A 3OFND 5DO9A 1GU0A 4MJ3A 4ZXFA 4RV9A 4Z9AA 5HYVA 4E1VA 3P4UA 1V45E 2P9JA 4NL4H 5E8RA 1YL7A 1OKKA 3TI7A 2PE5A 2CNWA 3TW8A 4IIJB 2CLCX 3KQTA 2N1BA 4IIVA 4IIFA 2QJOA 4HH0A 2VS1A 3LKBA 4KSBA 3GJ4A 2PA0A 2AEFA 3ZBUA 2WZDA 1MB0A 3I72A 1VA5A 1LFAA 1L7MA 2OQIA 1K92A 2QM0A 3HR4A 5IK2D 2I6SA 3ABIA 1R4AA 4LYEA 3TTYA 2OESA 3LG2A 2J6CA 4J0HA 3EYWA 4JP8A 4O08A 2XZLA 1VOTA 4AN0A 3MCAA 1VHJA 4RKYA 3N2IA 3U7JA 5K3FA 3IUBA 1JIVA 1JQDA 2EZ8A 4IHQA 4JQCA 4YJ3B 1YHZA 1D0SA 1MX9A 3EIHA 3IHKA 4G0YA 1GNVA 3K0BA 3SC4A 2DKOA 5BW8A 1GZHB 5IEJA 2ZRBA 1FSFA 2OFOA 2FPSA 4BO4A 4LRTB 1V8BA 2F3SA 3W5JA 3WQQA 4FZRA 5A3JA 3S2GA 3SE0A 5JEDA 1XQVA 1YBVA 3T35A 1BDHA 2I8CA 3E81A 3CN9A 1UKAA 2OMKA 1P4AA 2FTKE 3B9PA 2J3DA 4QDKA 3OU6A 3PC4A 1YJAA 5DYIA 2H1WA 4E2XA 1CR6A 1F14A 1I32A 1ORDA 3VC2A 1MR3F 3CONA 3KE9A 4YP6A 4C1NA 2F1OA 4NCAA 3OEHD 3FHJA 1U0LA 3HBNA 4WVFA 4I55F 2OLJA 2H1LA 2X77A 4UEOA 4JQZA 1VGVA 2C20A 1JZTA 1TIPA 4FGKA 3O1LA 5LDGA 3JVDA 4DVJA 4N0QA 1V7PC 4QYIB 5TPWA 3NWPA 1DEOA 1PLJA 2AHRA 4UUNA 1E61A 1PW5A 3UC5A 2UU9B 1HR0B 2K6GA 4DAOA 1GTMA 1E69A 2WFMA 3F3KA 5AP9A 1JIUA 2GJKA 3MPUA 5F35A 5KQRA 2ZWOA 4CXMA 3CZAA 4OU4A 4Z3DA 1QTQA 1GG8A 3QI7A 3LKZA 3K32A 4K0RA 3D1VA 2G7MC 4BLUA 1PT9A 2X0IA 1G41A 2Q29A 1MF7A 1U80A 2QZPA 2HAEA 3I9MA 2W00A 1S01A 3ZE2B 2H57A 5BR1A 1A9SA 4QUJA 3M89A 3CVWA 3AERB 4EZIA 1DINA 2ONCA 3Q15C 4D0RA 4EUHA 4PYNA 1YR9A 1Z6PA 1TM7E 2I66A 4PLPA 4BKRA 2AGVA 2IDKA 3QOYA 4Z9XA 3SU8A 2WJ6A 3ER6A 1N6LA 4OIFA 4OM7A 1Z2CA 3FD8A 1HG0A 1JHZA 3PD0A 3C3XA 1A3CA 5CAEB 4JEHA 3H2YA 4YWHA 2ECKA 2PDAA 1CUCA 2I4MA 4CKZA 1GYPA 5LNK6 4RD4A 2II6A 2PX8A 4WACA 1OLSB 4CT5A 1YQUA 2W90A 1YH3A 2CV0A 4XR9A 1W8DA 1HY3A 2ZR8A 2ZJAA 1M0EA 3E1GA 1XIVA 4YASA 3JD3A 3KXDA 4A7PA 1LY1A 2I7VA 3HUEA 4EW3A 1ZIYA 2FPMA 2I1QA 2VSFA 3AR5A 4XB6B 1RI2A 4A2WA 1E2DA 2GD2A 3ZTYA 2BMFA 2PBLA 2ZFUA 1A7UA 1JA0A 2I78A 3B1FA 3JZIA 3OX3A 1W29A 1QV7A 4PFSA 3KQLA 4IDCA 4LHVA 1JKJB 1MEJA 4NJMA 4OOEA 5EL0A 5FTWA 2JAXA 1U0FA 3UTCA 1M34B 1I0LA 5K8IA 2PLWA 2QUBA 4K87A 1MZPA 3T7AA 1XVUA 1GGVA 2A86A 4LX0A 2COKA 2Z43A 2UUAB 1KZHA 5CXQA 1YOVA 4A10A 5GMOA 5KJCA 3HCOA 5BN3B 2V3CC 4PE5B 4C4RA 4CL2A 4TRMA 5B2ZA 1CDEA 1KPGA 2ZJBA 4BP3A 2O0MA 1ZM9A 4MUBA 4C76A 1RRMA 4EG1A 2VWGA 1DIAA 4R1LA 3T7KA 3K71B 4MUYA 5FBKA 4MDEA 4R1UA 4GI5A 2ZVQX 4NBWA 2Z2YA 5H59A 3I37X 3WRYC 1RYNA 1JDSA 3QVTA 2H8KA 2PCLA 1I2MA 5LZ7A 4AX8A 5CDHA 3ET5A 2Q5OA 2HTFA 1L4EA 3BGVA 4PRYA 1KVTA 1WEKA 4IV8A 2G70A 4P3KA 3SIWA 1DG9A 2WHXA 3CIOA 3E0QA 1VB3A 3BDVA 3COPA 3EUWA 3VHXA 1VL8A 5I7AA 2O2DA 3PQ6A 3WLRA 3H2HA 3GGGA 3OEHA 2CMGA 2AJLI 3M1IA 4LJKA 3BBPA 1PV1A 2AFRA 1SHZA 3JW8A 3RE1A 2L18A 1XU7A 1DV1A 1AG9A 4KW7A 2WFZA 4UVDA 4CIVA 4EW6A 5CNKA 3IHTA 3I2IA 3KD2A 2P3LA 3RHFA 5LN1A 4O2BB 5F4ZA 1SXGA 4ZRDA 2ZEJA 5IT9A 2OZLA 4OFXA 3F6SA 1DX6A 3EWSA 2JCGA 3PFKA 4U0JA 4YDRA 3VPDA 4AZ0A 2EF1A 4FYPA 3THOA 3QU9A 5EXDA 1RYBA 3LIIA 3TRHA 4C7JA 4TVOA 2D13A 2ENUA 1ISIA 2P9BA 3PU6A 3QLUA 2NXJA 3HJBA 5JQGF 3C6YA 3UFBA 5HA5A 4MLCA 5CYOA 2JCXA 3DHWC 1D07A 3TECE 3A1UA 1ZGBA 1KI1A 1VKNA 3OCVA 4IEEA 2WLTA 1SN7A 4M7WA 3F74A 3F7OA 3S55A 2NSDA 2X8WA 3CC8A 1THGA 2YMQA 4B3FX 1VG9B 1W0KD 1A7AA 4KJXA 4OMUA 4R54A 1YR6A 2HY7A 1U1IA 3KP1A 4Y1RB 5F7OA 5C8YB 3MTJA 1U7UA 1AUXA 1SWWA 3FA2A 1UOOA 3MWJA 4H6PA 3ILVA 1DKNA 2GHIA 4D98A 4EHIA 5A06A 2FDXA 1AGPA 4IJVA 4LBWA 3BZWA 2XWQA 1HF3A 5CJJA 4OXNA 1UMDB 4GKBA 5JHGB 2FW1A 5HE8A 1RPTA 2CN1A 3SX4A 4OQ4A 1U8AA 4RK7A 4KMOA 3L0PA 4KQXA 3T0GA 3W1WA 5SY6A 3B78A 1NBMA 2J5RA 3IV6A 3KM0A 1X74A 4E5DA 3GT4A 1UBFA 3O82A 3OG9A 4MWZA 3UFXB 3ZLTA 1UBGA 3LQ1A 3LSTA 4K9PA 1JGTA 4O02B 3OBBA 3NFRA 2JW5A 5K2OA 1Y3BE 1MAHA 3A9RA 2R0QC 1XQ1A 1XZ8A 1SU8A 3Q7RA 1SG0A 2CUZA 1XMQB 4OMDA 1LDNA 4JC4A 6REQA 1NHWA 1P4JA 2P9TA 3CYFA 5TJ9A 3U4AA 3K72B 1RT9A 5EUQB 2H4FA 3WHIA 5FUQA 4FMCB 1JBKA 4LCBA 2MSDB 1B0AA 3TZQA 1I3MA 2Y6UA 2YYYA 3NVDA 4QJ3A 1O97D 1P3Y1 5FULA 3SQMA 4UNNA 2YV3A 1HQYE 3K0KA 3NBKA 5CM8B 2G9QA 1RTKA 4QTTB 1HE5A 3FCYA 2O7QA 3A27A 4WW0A 1EX7A 3N6XA 1ZCJA 5KQGA 4YPFA 5KYGA 2PUFA 2XZPA 1JHOA 1VP3A 1NYQA 4BJHB 1EFPA 1EB8A 1ORHA 2JASA 1CLEA 2ZAGA 2N3ZA 1BN6A 2WSYB 1YU9A 4TTVA 1F2DA 4YAOA 2F3RA 3RC1A 4M0PA 4YB8A 2CY0A 2NT4A 4KO2S 2C3MA 1TF7A 3S1LA 1E2UA 1E2GA 2YY5A 4JZYA 4Q02A 4MOWA 4ZT2A 1UBMS 4UBKA 4YAWA 2M6SA 4OGLA 1CCWA 1CUGA 4G8JA 4HR7A 4JX8A 1A8UA 5HKKD 3A26A 2ZJYA 3CE6A 2YIVX 3EUAA 4NK5A 3JVVA 4B8WA 4DM3A 2O54A 2SKCA 3AR4A 2IHKA 2JFFA 5F23A 2C2YA 4I1OA 5I45A 2PHZA 1MXHA 3EA5A 3TLYA 2OT3B 4G07A 5KAMA 4C3UA 1VJCA 4RE6A 3MCUA 4DA4A 2AMVA 1RJEA 1SVSA 3O4FA 1XZCA 3H3FA 4IFIA 4KTTE 4N8DA 3JD2A 5J2UB 3U7EB 4B3JA 2GK4A 3ORYA 3QENA 2VWPA 4M1EA 2D0OB 2VAPA 4TVBA 4CMEA 1QCCA 1MC4A 1CQZA 3MUFA 3OTQA 3SQOA 1BWRA 1M2VA 1CJCA 1ONOA 3KHKA 5AKGA 4Q7JB 3AB8A 2ZUBA 4QOEA 2B4QA 2IXFA 3H4VA 3UK1A 3UQYS 3ZCSA 1LDBA 3L5OA 1BN7A 5KSOA 3F73A 4CV0A 2P11A 3W2TA 4WESA 4R0MA 4XD7D 2YASA 3I58A 1R00A 3CBQA 1BQ4A 3DDCA 1U5BA 3Q7TA 4ZDJA 5G40A 1UMCB 3SSNA 3JASB 2VHTA 3TMAA 5LUAA 3H8JA 3IQGX 3RC7A 3VMFA 1Q1GA 4S12A 1IOZA 1VE1A 1QHXA 4MUEA 5A5FA 4NBNA 4Q18A 3AM1A 2X23A 2H9IA 3LBAA 1D2EA 2YR0A 3NTQA 2X40A 2JHCA 5JSKA 3WGNA 4YUAA 2OSVA 4DLYA 4OYHA 2ZB8A 1FL9A 3IRVA 1JDTA 4Y18A 1TU4A 2DFDA 1K8XB 3DD5A 4GLJA 3HGTA 3K9WA 2VPXA 4RA9A 1SXPA 4ER6A 5K99A 4P93A 2AQ8A 3GLQA 1FUIA 1PUXA 2R84A 4B1FA 1E60A 2XXBA 10MHA 3BMQB 5EP1A 5KNBD 2ONKA 4JL6A 3JQAD 2AF4C 4NE7A 2H00A 5KSPA 3DLAA 2BIFA 3EA0A 2DG2A 4V03A 3ZY6A 1XWIA 2AOVA 2VR1A 4Q00A 4BJ1A 1EQUA 2B8WA 2XUJA 3H6KA 4K9RA 3EZ7A 1KVSA 1YC5A 4LG1A 1QG4A 1YS4A 2LKDA 3OESA 2C8LA 1BWPA 1HYGA 1KMNA 2PMBA 4QQFA 1KRWA 1N6HA 2EC5A 2PYDA 1F9EA 2HI0A 3AUFA 3MW8A 4U5QA 2NW6A 4AWBA 2H2WA 3PVSA 4U7FA 1UKZA 1NQUA 3O8OB 3A1VA 4ID9A 4OO3A 3ZZ0A 2QSUA 2XF2A 3G6WA 4G09A 4HDOB 1AS0A 1J9EA 4I4NA 1CEXA 3V1YA 4DL9A 1I4LD 2WW8A 2BP7B 1QMGA 2QGFA 2VNKA 3K4HA 4LDPA 3Q7EA 4PBSA 5BOSB 4MX8A 5MHTA 1T43A 4R3WA 1Y5RA 1ZJZA 3KKPA 2AFHE 1TYEB 3QXSA 4ZDKA 5BN3A 2QAGB 4M1ZA 4UEJA 4L3VA 1W94A 2RFLA 2IYPA 3VOAA 1AS2A 3MWDB 3RRYA 4BBAA 9ATCA 2AC7A 3UV6A 3L0IB 4KUGA 4ZI7A 4BZQA 4YLYA 4F92B 2C7VA 3WBBA 1CQJB 3G0GA 3L7YA 1SZDA 1RKBA 4KWEA 3DBHB 4MSUA 3LT4A 3UGTA 3RYIB 3WLJA 1A2OA 1JHXA 1FYVA 3RYCB 3KSUA 3P8ZA 1CUHA 4DFDA 3IFSA 3ENKA 1G3MA 3NALA 5B30A 2CHGA 2X0KA 2Q2NA 2XBLA 4Y2RA 3I8SA 4PLZA 3R7AA 3I30X 4PSAA 1I51A 4Z4FA 1FFHA 1IU9A 3SEZA 1LU9A 5TVKA 4ZVUA 1NF8A 5A3RA 3AHGA 2WSSA 5J4HA 3HRIA 2BYTA 2X7HA 2EFJA 2Q1WA 1EE9A 1YS2X 3OTIA 1GPYA 4DGSA 5KOHB 2FMXA 3H5WA 5BN1A 4YCBA 4MQFB 4JBYA 4BFCA 4EI2A 1SA0A 2EL7A 1FMFA 3ST7A 2JH9A 2ZR7A 3NV9A 2WU3A 4KFUA 3I04M 1SC6A 4A23A 3QOXA 3UH0A 3ND6A 1X77A 4ZDWA 1SJ9A 1HEYA 2H5IA 3CG4A 3W9YA 1ZOSA 1Z63A 8AT1A 2JGFA 3BJRA 5M2QA 1N1EA 1P1KA 3RS0A 2R6GA 4KGVA 1JXAA 3KOOA 2CNOA 1CEQA 1KI4A 4PYMA 2B8JA 5M04A 4AT1A 4PXAA 5EWMA 3LQKA 4DNFA 3AVOA 5FHRA 2NMVA 1KP3A 2V8OA 4RMIA 1BVRA 2WR8A 3HUTA 1XEXA 4M7PA 1RWBA 1S2GA 2BZSA 2QYHA 5L4SA 4FCTA 1CXZA 4GD3Q 4J1SA 4MS4A 3EOAI 3RI3A 5B4UA 4UE6A 4MIKA 1YXMA 4G4GA 3ABRB 3RRBA 3LCMA 2Z1DA 1KDTA 1S5PA 1VKZA 2OAQ1 3VJMA 1UKEA 3UPTA 3ETJA 3T3EA 3GUHA 5TPWB 2J0EA 2VT2A 4OOFA 3KJFA 3TVDA 2NXNA 1P7YA 1UT8A 3AF0A 3AJ8A 3OJ0A 4PLCA 5CYFA 5SYAA 4J0QA 2P75A 5U9CA 4ZCQA 2PUBA 2V0CA 2N1MA 2ZSIA 3TJZA 5DYYA 4F3KA 2FQ1A 4KB5A 1AHNA 1G64A 5K0EA 5LKAA 3FPEA 2ATCA 2AKYA 2DC1A 3D5TA 1FMLA 3V7NA 3LUBA 2EFGA 2O1EA 4PNZA 1CZUA 1HEUA 3JWJA 4HQ6A 2GJ9A 2PYIA 4KBGA 1QPBA 4IXTA 4E33A 1XPOA 4LJ4A 4XCQA 3G59A 4UNPA 4LY6A 4QFMA 4M8SA 2HR1A 1O5IA 1YK1A 4NATA 3EPKA 4LC9A 1GRCA 1SU4A 4BDSA 4M1OA 2P0YA 1IZYA 2I7XA 4G0ZA 4N3GA 1N7JA 1Y42X 4XIYA 4CQMB 3G0HA 1B23P 1RHJA 3LPAA 3TOVA 2P77A 2WF6A 3CLHA 3GL9A 1QIKA 3D7NA 4JJZA 4GE3A 1RABA 3RSLA 3B38A 5AVOA 3UIEA 1IUOA 3EQ6A 4ZVKA 3P0IA 2F8MA 2WAYA 4KX3A 2BCEA 2QX4A 4E7PA 3MJFA 2QG9A 4G2TA 2RGWA 3NATA 1OH6A 2C9OA 1W49A 3WL4A 2OP1A 2H1HA 2YWEA 3D7KA 2OCIA 2I87A 1A4RA 2WSBA 3F6EX 1GL3A 4HDMA 4GOXA 2NYUA 3OU2A 3BXZA 3PYLA 2YKGA 2ZM6B 3BGIA 3I39X 4G0XA 1IJBA 3QXHA 4J0EA 2ZZMA 1L4BA 2ZSBA 2E9SA 4OI2A 1IHXA 2E5LB 1X7HA 3DCYA 4DR3B 4IO0A 4LF6B 2H2DA 1YJQA 1ZG3A 1I13A 3L8MA 2QRQA 4QXRA 4R8KA 4X7RA 5CNJA 4A16A 4BFLA 4DPMA 2IIPA 5LKRA 1Y4ZA 1GOTA 1X1RA 3B8HA 4HB4A 4BWFB 5IZCC 2IPMA 4PPQA 3IVCA 4ALLA 5FQNA 1UXIA 2GFQA 2VTEA 2O5CA 2C5LA 1J0XO 1U6JA 4JWTA 3I6QA 4PFJA 3BB3A 2HPAA 3TCXB 3B70A 4IBOA 4KVZA 2GOYA 1YJXA 4RZSA 3PC7A 3HDGA 2L69A 2YICA 5HFJA 3W8EA 4F8JA 3AHJA 2FKNA 2R97A 2VSYA 3VX4A 1C1DA 1KO8A 2GI4A 3JAKA 1LJUA 4F21A 4C05A 1TTTA 2HSWA 1TZ2A 4I2NA 3QYAA 1JJBA 4HNVA 2NTJA 1DUVG 4WKPA 2RHCA 1DC8A 5GGYA 2G40A 3CUYA 3MTQA 4EF6A 2YH2A 1MDBA 2BFEB 3BN3A 1CP3A 3I2YX 1FNDA 3MWFA 1XTPA 3SSMA 4LF8B 1VG8A 3C85A 3PPIA 5CPFA 4W5TA 1XEAA 3RVQA 3CGWA 1DIBA 4G26A 3EF0A 1HETA 2RAUA 3NHBA 2BFDB 4OQZA 4OTZA 2RBEA 1XE3A 4N7RA 2IHJA 5DM4A 3REOA 3WP1B 1BROA 4Q4AB 4DOMA 1L8XA 1NT2A 2Q45A 4JA2A 2QT9A 3JAMA 3AVWA 1M1NA 2O3RA 2V9CA 1Q19A 2FPGB 3HDYA 3CLVA 4GICA 3AOEA 4WZBE 5DNEA 1KARA 4F6RB 1DBRA 1ZL2A 1XTJA 2E21A 3KJNA 1H1TA 2AF3C 2GEDA 2V59A 1JA9A 1FP7A 4QX6A 5JR3A 4HTAA 2QR3A 1LV8A 3KPUA 5JNSA 4Q1CA 4OYLA 4BASA 3Q40A 4MR7B 3DTVD 4I0WB 4PC3A 6ADHA 1L8QA 4JA0A 4PPFA 5HRAA 3TNDA 2HLHA 1RE0A 2R5FA 3IT3A 4KWCA 1MQAA 1KDZA 1H6CA 4EKGA 1YDHA 3SHOA 3GLFB 2ZANA 3PE4A 3KEMA 3QPBA 4CM8A 4DMRA 3GAFA 3IEVA 2B7LA 3T41A 4GM0A 2Q5FA 1EHCA 3M83A 3LUPA 3ZHVA 3EDQA 2CB9A 3DUFA 2GUGA 3Q0IA 2PX5A 1JSZA 4UNIA 3FCUB 5ALTA 5JE8A 3G2LA 1U90A 1XSEA 3LYLA 4C01A 3NDRA 2CC2A 8GPBA 2JBAB 4D4GA 1LC3A 3TW4A 5AKEA 2YFKA 4YV7A 1ZIDA 3U39A 1N9GB 2PRYA 1FQKA 1XROA 3PSHA 1YONA 2FLVA 2WPNA 4H7KA 4MKHA 2J3HA 3GWGA 1KKLA 2J5QA 3H5VA 2ZIVB 3O94A 4CLHA 1CNMA 2FPIB 4H7HA 4WE3A 3WJ7A 3U4QA 1MB4A 3TSAA 4ARCA 1MG5A 1P9NA 2VPTA 3KAJA 5EVJA 5BORA 1LUAA 2XVYA 3T61A 4MS1B 1RLMA 2QW0X 4WXRA 2XTMA 3CA8A 2J59A 3GT0A 1H3FA 1Q14A 2W6JD 3F90A 4FFRA 1UKYA 5EC8A 3HJNA 4ZEVA 4QRHA 3BMCB 2BGTA 5IKMA 3CE9A 2UYYA 1AKUA 1Q0QA 2WHPB 3ZU2A 3HCAA 1GNPA 4QPJC 3IIJA 2I34A 2BLNA 2QBYA 3RS3A 4NU8X 1OF1A 4NAUA 4ZO8A 5ICGA 2J67A 5TB5A 2HBYA 4H6XA 3WIVA 3AQ4A 1I5RA 1NVEA 5EXPA 1Y6GA 4Y30A 1QIFA 4IDBA 2EQBA 4QXQA 1RM5A 2KBEA 3EK2A 3P94A 4QG3A 4ZCIA 3E4CA 1WZUA 3RQSA 4J75A 1FX0B 1R8JA 1A98A 2JGMA 2DJIA 3NTVA 2I6GA 4FJ0A 4QBTA 4LSGA 4ER0A 3LBFA 1MDFA 4OL9A 3UGKA 3ZOKA 1DOAA 4GECA 3WGOA 3ZJYA 1RZUA 3ZLVA 1ZVVA 1VLZA 1MN6A 2ZYSA 1WA5A 1PR1A 3IDQA 4MPPA 3RSQA 1UBUS 2FWRA 3PKZA 3BHNA 3HU2A 3LQRA 4RSRA 3BGSA 2GM4A 1GL7A 4HY3A 2GN1A 4LIPD 4F96A 3W5AA 3HA7A 1MIOB 3KHSA 3MEQA 4IY1A 3OZSA 4RFVA 1R8QA 5D2CA 1LLCA 1GNRA 1NN0A 5EZYB 1BS9A 4GZ6A 5I9BA 5AVWA 1U7ZA 1XWFA 1PK9A 2NYAA 2B1RA 2I2FA 3D4OA 5FX2A 4PIPA 3I42A 2ZSAA 3ET4A 3FSGD 3ILSA 5IW8A 4B4VA 1V43A 4MAAA 1SU7A 1WUYA 1O03A 4IDFA 1XD2A 4FT4A 4NU5A 3FWHA 2ZIEA 1A9ZA 1BZYA 3K0CC 3LX6A 5JZVA 3D4IA 2GDZA 3FYUC 3GQVA 5FL7A 1NW3A 3N0RA 4DCGA 1SQSA 1LKZA 2GCPA 3H86A 3RT1A 3V4SA 2X4GA 2XB2A 1AUVA 1NMYA 2ZI7A 1EFKA 4LAFA 1CUEA 1IMJA 4TUYA 3WE7A 2I2CA 3E22B 4ZKEA 1M2HA 1V7QA 1HYBA 1YDMA 2XQJA 1SD1A 2VRCD 5A0FA 4MUAA 1GGKA 2QRGA 1Y4DE 3H97A 2DM6A 2YWJA 4KGXA 3LT0A 5K0ZA 1NQWA 2JGNA 2WV9A 2BSXA 2FF5A 1FC0A 3K0EA 4ZU1X 3VHLB 3ZHCA 1IZ0A 1W36D 5JS1A 3W5HA 1S8FA 3HCRA 2XF8A 2W37A 4X94A 5G53C 2P4QA 1IBKB 1LCIA 4ALMA 3RSGA 2SCUB 3EG5A 3L1KA 4ZI3A 1QZTA 4Q1VA 1DOZA 1E7SA 3KTOA 3LS2A 3WWYA 2VAXA 1KGSA 1ESCA 1VYTA 3OF5A 5TS2A 2JGAA 3UA3A 4EJSC 5C7LO 4I66A 1EDEA 1NVXQ 1T24A 1YB2A 1WY7A 2O50A 4HG2A 1CY6A 3CT6A 4C0KA 4YT8A 4W63A 5D3MA 5JPDA 3U7IA 2GPBA 3E18A 3MS2A 5KYTA 3EIUA 2ZAYA 4DNXA 3OO1A 1GU1A 2WMDA 5G0TA 2TMDA 3QUSA 3WHPA 1INLA 5DTEA 5I4BA 3KQNA 1F1JA 4N7MA 1WF6A 2OCGA 4AZWA 3VAZA 3THYA 1CUBA 3M49A 3ZGYA 1PZNA 4YX9A 4QARA 1P7CA 2XSZA 2ZR0A 3P0JA 3G8BA 2XGSA 2OQRA 1F9AA 3BQMB 1O8CA 1BXRA 3JAWB 3K0AB 4NQZA 1FMTA 1T9GR 1L7OA 3AZOA 1YAHA 2GN8A 1QGYA 1SBQA 3WYFA 4U2EA 3UJNA 4PG7A 1UC9A 4XW2A 2IHNA 1UPAA 1JHAA 1JN0A 1AZWA 2QNIA 2QRZA 1ZK2A 3UHFA 2Q3BA 2FZ5A 1SA0B 1EB9A 2VDWA 3O9VA 1J7JA 4FR5A 4NOJA 5L6LB 3IILA 1KMIY 1C30B 1SOUA 2B69A 4PG4A 4YEDA 4DS3A 3NUGA 1Q2XA 3KOYA 4UTRA 1CX9B 1T9CA 4R71A 2B2CA 2W5UA 4LXXA 2ZJ6A 1DWOA 2XR1A 4NONA 4NS4A 1T2EA 5E0KB 2O8EA 2C54A 2PXCA 3OIDA 1L7VC 4RZ2A 4B76A 5B1YA 2AXNA 4O6VA 4N41A 3CVYA 1ZM2A 5I7RA 1HSOA 1K9VF 5KKNB 4O2AB 2P79A 4EFNA 5GINE 1OTYA 2VDLB 2VJPA 3ECAA 1Z3CA 3BGDA 1F06A 1FNBA 1G8HA 4E46A 1FE8A 4KIUA 2WTNA 5TGZA 2BFAA 3REFA 1E6KA 2HU5A 2XDQA 3GVIA 2QENA 4IQ8A 3KHTA 3UWOA 3TSWA 3GLTA 4DCVA 1LLUA 3B3QA 3EPPA 3KKZA 4R2IA 5I47A 4LQ4A 5JNTA 5E6RB 3D6HA 1JIJA 3VDRA 1UXKA 1JDVA 3AV3A 1VE9A 3EAGA 4JB8A 1BO6A 5EHIA 4LWZA 2GMWA 3URMA 1XJQA 2GYWA 4LWPA 1WCWA 4TWRA 3R0JA 3DQZA 4OHRA 3PGXA 4B4KA 3K5WA 4CT4B 5HVNA 5MF6A 4A0SA 2FMIA 2PFSA 2RBKA 3RANA 5FAXA 2VXYA 5KUTA 3VA7A 1JVBA 1ZIOA 2J0UA 2I2AA 5CIQA 2DVMA 3W5VA 1OXVA 3G2NA 4YVFA 4D9JA 2QD4A 3UZUA 1MEEA 3AZPA 3UAWA 2JFVA 1SHLA 3LFUA 5B1DA 4MCIA 5BW5A 5KNLA 2FVXA 5ALMA 3NVAA 3MRSA 4NAHA 3ZWNA 4CIXA 4RXUA 3ZU4A 3AF1A 3UJAA 2R62A 3UJPA 4B6FA 1YFLA 2J8ZA 1GIAA 3CSDA 1O9BA 5AI4A 3IAM1 4Z9BA 3U7GA 5FPSA 1GTZA 3ADDA 5I4KA 2PV7A 2I3AA 1DNPA 4KFRA 3AT1A 4X6XA 3D81A 3GLSA 4EB6B 2A1IA 3IAAA 4QRIA 3OQVA 4B17A 2QM8A 2GERA 2Z2XA 3WHKA 5IF9A 5KKCA 3GVHA 3H5IA 4RTPA 2HF7A 3AI2A 3THSA 3ROXA 1HDOA 3HB5X 1RRCA 2JGLA 1KNQA 2XNHA 1E2LA 2XHEA 2GA8A 4YREA 2CXRA 2J41A 3ZKAA 4Q7QA 2J3LA 1ZOLA 2X5NA 3K92A 4TLBA 5FOVA 4KVGA 5AXDA 1WSAA 4CCYB 4EKIA 1IONA 1TQHA 2F1IA 4NXMB 4B6GA 4CUZA 3TZEA 1PNQA 2VT6A 1EE1A 5AHKA 3O73A 3DVRX 4O4HA 4TS3A 4B32A 3C3EA 1J0BA 1F7UA 4UUBA 1GSHA 5AM3A 5THXA 1IQUA 3G49A 2G06A 3I9LA 3GHYA 2Z9BA 1UBKS 3MTEA 1OQAA 3QGMA 1FYEA 4MUJA 3VMMA 2XUGA 1GCAA 4CF3A 2NUBA 3C14C 5HG0A 3KOZA 5BWCA 8ADHA 3H2ZA 1SUBA 4NRDA 3U49A 5JD6A 4IFTA 3IQFA 1UCFA 3PR3A 1DT5A 5BUSA 4NFHA 3QX8A 4L7VA 4WK6A 1X14A 3DYIA 2B8NA 3KZKA 4BNFA 3WA7A 3GO4A 4AURA 4CTNA 1I7NA 1R6XA 3C3AA 4LRWA 4S1VA 2R8PA 1Y1KE 2LTAA 4HEJA 4FM9A 5BQ5A 5KBYA 1N7GA 2X3YA 4N6GA 5E9QA 3ASZA 2JH8A 4WNIA 5SY4A 1L5KA 1GKUB 2GPWA 4JVMA 4BFUA 3NWEA 1YKSA 4N6OA 2ADMA 1NBWB 3I9FA 4WCFC 1HBJA 3SK0A 4X90A 4ZT5A 2TS1A 3FYCA 4BV2A 2Q21A 5FA6A 4MGEA 3E5NA 2OB2A 2PS1A 4IVQA 1MC8A 1UANA 2D8MA 4UBLA 1RRKA 3ENZA 3L1JA 3UHJA 1GPAA 3KPVA 1CQIB 2RAPA 1T4CB 2W6ID 4NYMR 4OF4A 1L5GB 1QNFA 3GU3A 4D96A 5DXJA 4C4PA 1CBUA 3FM9A 1L5ZA 2ECOA 4FKZA 4XYGA 1VI5A 4KIWA 2ZYIA 1GPBA 1P0QA 3KR9A 2BEJA 2QN9A 4CQMA 1LK7A 3AW9A 2H92A 4YK7A 1II8B 3TRDA 4LYYA 4LYHA 1DQSA 3K9CA 1E2JA 2R8BA 1BEEA 2BFPA 1DQZA 2FY8A 4F56A 1A72A 1GADO 2RGGA 3VR6A 2XBMA 4WY5A 3D0OA 3FLAA 5D3KA 1QWOA 3KKOA 1XZDA 4LI0A 3ELUA 5HXAA 3DAHA 5JS8A 1KTIA 1PGQA 2EW8A 4JLMA 5EIBC 4D56A 2HBQA 2CJWA 2IBMA 1TYAE 1CW2B 3HU3A 4UVHA 5F2OA 3PXDA 1GPWB 1Y6ZA 3EGEA 3OLXA 4DDVA 4OFWA 4Q12A 3WYAA 3ZD9A 1ZO8A 3UB3A 5HR5A 5HP4A 1UBLS 4ZCSA 4E13A 5BRAA 5JAQA 4E5YA 5JOQA 1JRLA 1N5OX 3FOZA 3TB6A 1AURA 2WJVA 1E1LA 4UE3S 1NULA 2HT1A 3C98A 2WT4A 3D5QA 1D5CA 2XVAA 2BKXA 4UTXA 5LJIA 2OE2A 4MP8A 1ZX1A 1YE8A 1NRIA 2CBGA 2NU7B 1NJ1A 1KBQA 4L22A 4WKGA 4BAZA 3NKVA 5F5NA 4HAIA 1GUYA 5KWVA 1PJLA 5FA8A 5KHLB 1BOOA 2H9YA 1PDVA 3K2BA 3KVVA 3S5UA 2P2DA 1Y7LA 2QTGA 1LVHA 4N8SA 221PA 4CF5A 4KCGA 4EG6A 2WIFA 5E1BA 2XWBF 1UZUA 3HBJA 3ICQB 3F6YA 4QYSA 4UMDA 1X39A 5G4KA 1BC5A 1E59A 3DDHA 3R75A 2FJ0A 1A4XA 2WWHA 1WB5A 4EB3A 1JAIA 1GPH1 3B13B 3QIAA 4I1YA 4X95A 4D7AA 5KNDD 1OZHA 1QTRA 2YJ4A 4IVNA 5DN6D 2HLDA 5JCJA 3KJXA 3EF1A 3QG5A 1JNYA 1QV9A 4BCDA 5EZQA 3A6PC 4Q4LA 1Y4SA 1OI2A 2NAPA 4UHJA 4DXHA 2O5EA 2YQZA 2HRZA 4KXXA 1HLGA 3RK0A 4MQMA 4QUBA 4UVEA 4OHBA 4TMKA 4YV1A 5LXTA 4I3FA 2DCUA 3BRCA 1DIHA 1QQ5A 2Q62A 4FSDA 4G63A 3K0AA 4CDGA 5LPNA 1U2GC 1O0BA 3QKWA 4WN3A 3VPGA 1O57A 4I9NA 4YRNA 1MTOA 4XD2A 2O8CA 1CUWA 3IJEB 2YWDA 2FRVA 3CXUA 3IKVA 4MW2A 4JL8A 1JSCA 2C4HA 2HO5A 2YC4C 2ZJZA 1RCUA 2ZTUA 3EE6A 4GPBA 4QGGA 1NX6A 1KH3A 2PX6A 1NKSA 3D6TB 5CFLA 1E3WA 1JYEA 1G4UR 3ONWA 4CCWA 4GC9A 2A4KA 2G0TA 5MGBA 5M29A 3UHOA 5ITZB 4L9SA 3TL3A 5FI1B 1FRVA 2DFPA 2EKDA 4MW6A 2CNBA 1M83A 2GK6A 3GJ5A 3KG2A 1H8HA 4H7DA 3USCS 2WKSA 1EFRA 2WWIA 2XUQA 5EE5B 1IRIA 3SVZA 4MP6A 1ZMBA 1EEXB 2F67A 4A0GA 2WQZA 1QQ7A 4XPIA 5HIIA 1BD4A 2UZAA 4AMUA 3W6UA 2G3YA 1N1GA 1KQFA 2D6FA 5HK9A 4PG5A 5DGXA 4E21A 4EFLA 3PNYA 1WOYA 4ARSA 3OT4A 2DHEA 2DUWA 3MXOA 4LTMA 3O4RA 4XX0B 1P2VA 1QR2A 5L95A 5JY6A 3F8TA 3QFCA 4R6WA 1XRJA 4WLEA 4PNPA 4RKWA 4TV9B 4LWOA 1X7WB 2ZPUA 1SVMA 2WTXA 3WFZA 2MYUA 2PV0A 5ULLA 2HIGA 2Q0HA 3GLUA 5HS4A 3CPHA 1JFFA 3OMXA 2G04A 2R8XA 5IJZA 4HQLA 2V7EA 2CXOA 3MQFA 4KPUB 5ALGA 2C2BA 5B3KA 1WIWA 1ZI6A 5ICSA 2Q5JA 1Q1NA 2E2WA 3KXIA 3U09A 1XPUA 3WS7A 3CQ9A 3SQLA 3ELBA 1Z28A 3EBPA 3MT8A 5EAIA 3DAGA 5CA0F 1NQXA 1T1IA 7GPBA 3BXGA 4TYYA 3IAHA 4WXYB 3FKQA 3I61A 2FUKA 2WJGA 1X94A 4OK6A 3NM4A 2F59A 2Q8QA 2C0PA 5EZ6B 5C8YA 4P81A 2CBZA 2VJQA 3L8YA 3M70A 4NCXA 3QNMA 4C3ZA 5I7EA 5DV9A 3KC2A 3EXHB 3BK7A 3F47A 2GCOB 5KNBA 1J90A 1ZGGA 4GOKA 1IY2A 2BTOA 2RSLA 4EG0A 1X8LA 3K09A 2YN2A 3CMCO 4TL6A 1R8SA 2PTHA 3C3YA 2ACWA 4YECA 4C0WA 4IKEA 2QLNA 3HZRA 3EVGA 3VKVA 3H19A 3WTCA 3LOQA 5D7BA 1SKYB 3H9UA 1AMUA 2VHXA 5J2TA 3OURA 3IT2A 3OHSX 4UHFA 2ALJA 2VP3A 1V6SA 2FW9A 1H1DA 4G0VA 2PU7A 2QMQA 4M0LA 1RWVA 1AGYA 2VZ8A 4REQB 4BP8A 4QU0A 4TT8A 4NSNA 1J39A 2CSUA 1G59A 4A8JA 4WJLA 1RZRD 2WVHA 1MKYA 2AEEA 2H2IA 2IX9A 3Q10A 2PKQP 4HLDA 2HB6A 1XU4A 1NM5C 4X84A 4XASA 2FWMX 3HI4A 4RF5A 2X3UA 4EJ6A 1SD2A 3WNDA 4Z4EA 1JR6A 2EFDB 4K46A 4EG7A 4F3YA 4V0RA 4YQFA 3QVLA 3AKDA 1Q1QA 1XOIA 3LDAA 3UYLA 2HU8A 3MTIA 3H9CA 1NX9A 2ZIXA 3ZXIA 2PT5A 1L4LA 4I55A 1E6UA 2P0AA 4C04A 2Q1YA 3AC0A 4Y6GB 3RU2A 5GJBA 5C8YF 4N49A 3KQUA 1OI3A 1ICEA 5C1DA 1Y6FA 3HPQA 1BOFA 1WUIS 2D59A 3FVQA 3SJBA 1Y0BA 5JVDF 1PR5A 1MC5A 4M46A 3S1SA 4QQ8A 1VJGA 4A5SA 1SURA 3CW8X 1YQ9A 4GBGA 5KWIA 1JLSA 4ZAVA 5TPZA 1YDGA 4NCNA 1JAHA 3HYSA 2IUSA 4MYDA 1OWMA 4PZPA 2B8EA 4INOA 4QXAA 2D1SA 4FDVA 3VTZA 3WGIA 1QUFA 1TM3E 4X1YA 1Z33A 3BFJA 1BU8A 4RMJA 2CDCA 1NRXA 1NUAA 2DULA 4Q9DA 1B8NA 1PWXA 3B85A 5C37A 2EP7A 1T6XA 2QLLA 3FTDA 4K9OA 1VP9A 2HMVA 4EFDA 4FFWA 3TG2A 4FE4A 3E7XA 1VPLA 3Q7QA 1H8ED 2I22A 3IT0A 3JSAA 4YT5A 3UANA 3H2JA 4PTZA 3L18A 3ZUGA 3MINB 1P1CA 4CM7A 1QIHA 1NLYA 2Y9PB 3ISJA 2ZRQA 3ONNA 4J0KA 2I6QA 4ON9A 3VH3A 4CMCA 4Z5XA 1BX0A 1SCAA 2DHCA 5IX8A 5GONA 1C0LA 3DZHA 2B4KA 1R5JA 2JIQA 4HEA6 2R1ZA 1EK6A 3D2LA 2RI1A 3EZGA 3T3HA 5DBGA 4OLAA 4S1NA 3VZRA 1N34B 4ZU6X 3JALA 4FU0A 3OHPA 3DLTA 4WMLA 1G20E 1R3DA 2R79A 1C8KA 4X24A 3JWGA 3KLBA 2JNWA 2XYGA 3STHA 1DTSA 5JJBA 3F9CA 2OHVA 5DMHA 4LHXA 5IUNC 1L7AA 4XCXA 1N0WA 1YT5A 2GAAA 2ZB2A 3I1FA 4E5PA 1U4NA 1U5CA 1UOEA 3KWJA 2AZ4A 1JHMA 4C2UA 4WFIA 1FDSA 3FLMA 5I4CA 1U2RA 5IYZF 3EC2A 4JJIA 4DLSA 5TMPA 3RQIA 4NEQA 1W44A 2PWBA 5DM0A 5FPHA 3TZHA 2GYVA 2F2TA 2GBPA 3BL8A 3BD9A 1KO1A 1SPXA 3L7BA 3OY7A 2WSIA 3DMPA 4IMRA 5TT0A 1XKQA 5PGMA 1O77A 2AZMA 2X14A 1SXJC 3QHAA 3A1DA 4LYGA 3TXAA 4DWJA 2IDJA 4H16A 3H5AA 3CKLA 1TYDE 3HVHA 4C4SA 2G4CA 4K26A 1N2CB 4D4JA 1FFDA 3COSA 3KZ1E 5BWOA 3PNBA 1DJOA 2FW7A 4KKVA 1B6GA 5GOTA 4X7MA 4BQQA 1SNYA 2GBLC 3GDWA 3GEBA 2HZ7A 2BV3A 3ISTA 2ZWMA 3KYCB 3OQJA 4XGQA 3SX0A 3PVCA 2CL0X 1XCBA 4IQFA 3KAKA 1JALA 3BH6A 3DC7A 3OWOA 3P9CA 3T12A 5ECGC 4XD7A 4RVFA 5J2TF 5FAKA 1VRWA 2BKUA 5DHTA 4KPYA 3CLUC 3EXIA 1HLFA 2WIJA 4Q16A 3VH4A 1IBSA 1R4MA 4JU8A 3WV5A 5KTPA 4MR8A 4FHZA 3UPUA 1P80A 7MHTA 4EZBA 1WG8A 3JQ7A 3VH1A 4YHBA 2FZGA 1Y5MA 1JHPA 3S8YA 2VQEB 3JQPA 3C8ZA 3MWEA 4LVOA 2KS6A 1KERA 4CR6A 4DYVA 4EMTA 2B92A 4U4AA 1RKUA 4MCHA 4OREX 1A9TA 4K6OA 2ZVDA 2NP7A 3T3NA 3NHSA 2CYAA 1T9ZA 2GF0A 1SB9A 4FLMA 2J32A 3GRAA 3UXMA 1NPYA 4DLNA 3PRKE 1P7VA 4J6FA 2F4NA 2XDAA 5FLYA 2JL1A 4M9ZA 4HGQA 4H6WA 3G85A 4YACA 3ZU5A 5K5EA 2DQSA 4CL8A 5A4KA 4N01A 4DF3A 4TKUA 3OPYI 4C0HA 3FH0A 2OHIA 4HAWA 2D06A 4X61A 1UMKA 4LZAA 4KWTA 1M8KA 1NWCA 1Z4KA 3BKWA 5HKKA 2ID9A 2I33A 1HEIA 2AWNA 4HNGA 4HZIA 1E7YA 4EHFA 4ASUA 4EH1A 1E0JA 3FUUA 2LR0A 4F6LA 1YQQA 4FFPA 4YMWA 2BFFA 2BN4A 2Z8YM 5BV0A 3RTEA 1BE6A 1EX9A 1Z6GA 4DEYA 1ZOPA 3BAZA 2OD2A 4TX1A 1PFGA 1Q0RA 1Q3TA 2I4RA 3AP1A 2HA6A 4I46A 4IGFA 3VPBA 1C50A 3ZS9A 5C80A 1E79A 4WLFA 4WOJA 3IP1A 3RUEA 3BCRA 4ZGGA 1DGQA 1J9ZA 4TMYA 4IDGA 2YXEA 2IZ5A 4KO1S 4TLCA 2H59A 3L49A 1HQDA 2O9JA 3HP4A 4FYHA 1F2TB 5NLLA 5IXJA 2AD1A 1J1IA 1JKIA 1TMOA 1X3SA 5K8JB 4YBRA 3TVYA 1EP1B 3RH0A 4PYLA 5AVYA 1XEXB 4BZXA 4XX0A 2CXUA 3MTGA 3S2YA 1KDYA 1U1EA 3GFSA 4KWHA 4UDYX 1RMYA 1YE3A 2A5JA 2YFHA 3V1NA 1VQ1A 4RY8A 4J1TC 4M60A 3PR1A 4L4XA 4R0NA 1US8B 2W4IA 4NPAA 4P4LA 3QPWA 4FD2A 3E9CA 1JDUA 1Q6YA 4G9EA 4IH4A 4MQEA 4R84A 3RSFA 3DEFA 1T5LA 5C5IA 2OYCA 2OEPA 4IIXA 2A1TS 2IYOA 3NTRA 4JN6B 5GGXA 4CBVA 1RWOA 5FO0A 3VTAA 4Q6WA 3DE6X 5ADWA 1SG9A 3F7MA 4KXUA 4RHYA 2JFNA 3Q3CA 1GTL1 1XRNA 4TL9A 2V6IA 3QV1A 2O2EA 4MJ7A 1KBZA 1KZ1A 2P3OA 4K6CA 4MVJM 1UBSB 1UC5B 4YRQA 1SXJE 2V7VA 5CM9C 1QS0B 2DFLA 3A1FA 5BURA 2QRNA 5SV2A 4ZQGA 5DNYB 2P2CA 1YL5A 3AUYA 3QE0A 4OX9Y 4KO3S 3LPMA 4EBFA 4IJKA 4GYJA 2RHLA 4L8GA 5DU2A 3IQEA 3TQTA 1TJNA 1BE1A 1Q0PA 2RAVA 3ZDEA 5CVUA 1W87A 5A04A 1SUFA 4QNRA 4H9GA 4WHMA 3TZCA 4OHUA 4ZI7F 5AOVA 4CN8A 3UFXA 2WJ3A 3X43A 1ZD1A 1SOWA 2EGGA 4M98A 4EHLA 3GXOA 5JXHA 2YVLA 5ERXA 4EIWA 3ZHYA 1NNUA 4AUEA 1K4YA 5FUXA 1UADA 3AF6A 2R1VB 2RJ3A 3AFMA 2Z8XA 3QWAA 2QTLA 1NXSA 1FFCA 5F51A 2ZTLA 1JKFA 4C88A 4OAOA 2QY6A 1HQCA 3OI7A 3HMKA 4RM3A 4C7BA 1VE5A 5IS2A 2PQMA 3M8KA 2NTYC 2R6R1 1C3LA 2X1VA 1IQ0A 2WJPA 4JAVC 4RVGA 3WGGA 1G3RA 1QLJA 4AD8A 1OXUA 2NZWA 1AGNA 4NFLA 3QEAZ 3U3ZA 4DG8A 5DIZA 2ZI5A 3WGYA 5DHAA 3HN7A 1IHPA 3E82A 4UCFA 2I1WA 2EX1A 3CF0A 4LOLA 3V9AA 2VH2A 5FPPA 2GFIA 3R9XA 1IUKA 2YVKA 4CDNA 2D4AA 1GGEA 2YHUA 4FR0A 4ZREA 5BVHB 3HZZA 2RG1A 3QVJA 1ZQ9A 3RJZA 2CJXA 1RE1A 2IHTA 2WUGA 4JFRA 1TECE 3RC3A 3UBTA 2OCBA 4KMSA 1U0SY 5JG7A 3A32A 4R5HA 5E95A 4EO7A 3AFGA 3HY4A 3OSUA 3L05A 4DRXB 1EGQA 3HY3A 5C35A 4RQBA 2D8AA 4P4TA 5B3JA 3AFOA 1I33A 3DS8A 2W2XA 4NZNA 3ZD7A 1OWLA 2VTVA 2YY7A 2PSHA 2ZS9A 1IQRA 1ZK1A 5BVGA 1QHSA 4J7AA 4HHEA 1UZMA 4EA7A 1UBRS 3NT4A 3V3TA 4EF4A 3BH7A 4X65B 3PJRA 4PR0A 1X1BA 4BX0A 3EMBA 5BQOA 2FUNB 1CS4C 4XJXA 4Z0TA 9LDBA 1IWOA 3OZWA 4FYIA 5IHPA 1FDOA 2OQ2A 1T4DA 4LOHA 1J0EA 1VJDA 1OXSC 1W75A 1I80A 1ONNA 4KE9A 4QHSA 3R7DA 3WJAA 4UM7A 1ZR2A 4Y6PA 4FGJA 3FPAA 2WG0A 3KB1A 2AE1A 3HUUA 5CGQB 2COEA 1IXYA 2XWPA 3R0QA 1IXKA 1U2SA 1U0RA 2QAJA 2VDMB 3K9QO 5KC9A 1GUBA 1MAWA 1PWZA 1KP2A 2OZEA 1R15A 1M2NA 2B5OA 2VRCA 4G1BA 4Z99A 3MLBA 4FOTA 4EARA 3ZVMA 3ES9A 4I6EA 1W76A 3HDHA 4IHKA 2X9GA 5DYNA 1TEXA 5KMGA 3KLPX 4JU9A 5DBHX 4NOLA 2BFBA 1CWUA 3GQBB 1Y8QB 2CHEA 3N6RA 3U4CA 3OFKA 4JK3A 4FFSA 4TTQA 4JGBA 2MU1A 3F2IA 5GV8A 3RU3A 1XQXA 3P0EA 2ZIWB 1UFRA 4L0MA 4A26A 2BL4A 4RKQA 4MW5A 2QN2A 1P3DA 2J3QA 3O26A 1MGOA 1U7TA 5GADl 3GJYA 2QDXA 2ZJ4A 1Y9DA 2PR7A 1IWPB 3IAS1 4OJNA 4QBKA 3H2BA 5LD2C 2PZMA 4B2YA 2CYBA 4ER3A 2WWXA 3VH2A 1KDOA 3SMVA 2R96A 2C1EA 3H2SA 4OJYA 3SC3A 1WKVA 621PA 3H4TA 4HWSA 4QLAA 4W7IA 3DE5X 1KFJB 1FF9A 2Q5EA 1MC1A 2QTZA 4KVFA 1E1DA 1R0SA 1N9GA 1WPGA 5IG2A 4MO2A 4Q4AA 3NP7A 2QLJA 3M1YA 3NYRA 4O3MA 4HDNB 4OXQA 2FPPA 4FBLA 3KTAA 5JPIA 3RDPA 2PG3A 2R11A 4R9UC 5AT1A 1LPSA 3TLGA 1ZHOA 1C9MA 2QVCA 3CJQA 5UKDA 2O0HA 3AL3A 3SR4A 3OF2A 1N57A 3DV0A 3Q6MA 1E9VA 5FNZA 3V2GA 3HVRA 2LUOA 1UBTS 1SCIA 4ARZB 1ECCA 2W4MA 1IE3A 3OCYA 1KEEA 4FKMA 1PNVA 2OBBA 1EG7A 1E66A 4HWGA 1AJEA 2XITA 3O8QA 4F85A 3PQCA 1K27A 1G3UA 2BBTA 4TKUB 2ECQA 1COZA 2DP4E 2OUKA 5EN4A 3WBJA 4HOYA 3OEED 4YFYA 3Q3EA 1ETUA 1V41E 3R0IA 2AX4A 2AEMA 4JIMA 3SXUA 3RFFA 4BP9A 2VA9A 4FD3A 4CFYA 3OFNA 3UMSA 4X44A 5D1HA 5FQOA 4JJ6A 4V38A 3QFHA 1KXJA 1Z0UA 3P52A 3T4EA 4KNYA 2WYUA 1ZVMA 3OEYA 4RLQA 3TDKA 4G9GA 3ICEA 4N39A 5JZOA 1CP2A 1WB6A 3RFXA 4WNYA 1ZU4A 2ZXUA 2R86A 1XZJA 3VNVA 5EJ7A 1WSBA 4W5RA 1Z5UA 2NSJA 5J5CA 4LGYA 4L5IA 4MIYA 4XVHA 1UZAA 1ZCAA 1WUJS 1G18A 3DAPA 2FUCA 5FTMA 4B87A 4H77A 4C7MA 3WDMA 4CETA 3ER9A 3HFJA 3SBXA 4NYJR 3VTKA 3A37A 4RKEA 5KTNA 5A9SA 1YFZA 1E89A 1V3VA 1C2TA 3GCXA 4U0KA 2AFIB 1M1ZA 1TM5E 3D59A 3D8SA 3BIWA 3LP6A 4QJBA 5H68A 3WIOA 2ZRGA 3U62A 2HA7A 4UBIA 3HEMA 4S0ZA 2VNSA 2XCLA 4WZ6A 4UHBA 2JB9A 3H0KA 4GVXA 5CA1B 1XEWY 3MWLA 3DTYA 3N39C 4Z0PA 1ZUWA 2AN5A 4RACA 1ONSA 3T5TA 3EG9B 2Q3LA 2YW9A 2ZQ5A 4ZVOA 5CFZA 2QPAA 4Q4CA 4DMLA 6CHYA 4NQRA 4R01A 2DT8A 3IVXA 5BRNA 1U11A 2NM0A 1LWOA 1PWYE 3GH1A 3MJTA 4HWKA 2QD2A 4Y2GA 1COWA 5F9HA 3IH5A 3FJ1A 3OM9A 3NJ8A 3I9KA 4D5GA 5JATA 2ODWA 3SHFA 3GP8A 4JUIA 3MGAA 3DQPA 1Y9AA 5JPCA 2GM5A 1N2JA 4UBMA 4Q4DA 4BC0A 1N0HA 1HPLA 1VXRA 5ALYA 5JHHB 1P29A 1AKTA 1JYSA 3BXFA 4XYEA 4YJFB 2H5LA 3AM5A 5AOBA 5C0OE 3WK4A 2ZW9A 1HYEA 1QOPB 4LFAB 4IIDA 1W0KA 2AI1A 2P4SA 1GCGA 3DEAA 3V7YA 2X8JB 4HGNA 5FEMA 5BNIA 2JBWA 2ZB7A 4DV2B 4ML3A 1IJEA 4REOA 1I8TA 3OIVA 2WTEA 3S27A 4Z1OA 5AW6A 3EZXA 3FJYA 4RTLA 3EGDB 3ZDRA 1FJHA 3PPWA 5AUPB 4MWEA 2XKKA 3ANMA 2PXXA 5C52B 1LK0A 1JIXA 2LKCA 4J4BA 1FBNA 4YYEA 4XQGA 4MVJI 2HEGA 5IBRA 4ZVQA 1POXA 3KR0A 4GL4A 3RF7A 3QEJA 2HHAA 4G1MB 4QUDA 3VPHA 1I24A 2QJWA 4KQCA 4RY0A 4ZT4A 2IF0A 1ZH0A 4YIHA 1APBA 4P58A 2BKEA 5E6SB 2XE4A 1M34A 5K4GA 4PAGA 2EWWA 3CZ5A 3GAZA 2B9VA 1I4EB 3LXXA 2IY7A 1L3IA 4LXUA 3TX6A 4Q7EA 4XWOA 3TQFA 2HJWA 3W6PA 4H2DA 2ZE6A 5KB3A 2FWPA 2GD0A 3U4QB 3TBHA 2CFOA 3AL2A 3CZQA 1RYHA 5DWQA 4WINA 4WZZA 1BDBA 2FOIA 4HAUA 4XVQA 4H08A 1T26A 4C6RA 2GHQA 1ID8A 3R2JA 4TTJA 4PBTA 1YACA 1GPLA 1HSZA 3AZQA 3W5UA 3OZCA 5C9ZA 1OX6A 5LYJA 3SDSA 2XVMA 3Q8LA 3A2KA 4Z1MD 1E4EA 1WB4A 2REQB 3VC1A 5A9RA 3T4UA 3CJTA 1MRNA 2WNSA 4XOUA 3EG9A 5BQFA 3BIFA 4FYVA 4B74A 5EHGA 5CCBA 5HQ3B 2QX9A 5AW4A 1EMDA 2X76A 3LUJA 3PUKA 1VKRA 4ZZIA 1OE0A 1ODSA 5JMOA 1IRXA 3FMGA 1A96A 5G41A 3FOWA 5JYDA 3WO1A 1IZ7A 1OYVA 2RH9B 3E9RA 4G89A 1NDUA 2AFIE 4PM4A 2QVZX 2QLBA 2NU8A 4AMGA 5C46F 1GN8A 2HXGA 3GJXC 2R4QA 1KSGA 1PDWA 2ARKA 2XKBA 1GTRA 3NDPA 1ZD3A 4PGMA 3I2HA 1JEDA 1T5DX 4ACAA 3A6KA 2YBDA 5KNCH 4WLUA 1GEGA 3TQOA 4ZYZA 4AZ0B 3HKEA 3LZ6A 1PJQA 3VDMA 3FPBA 4TYNA 1Y9JA 2VF7A 1NC3A 1KH1A 1XGKA 3EYAA 1CZOA 4U8HA 4KYTA 2BC9A 1OFGA 2FQQA 4MPJA 3VR5A 1KMCA 1AZSC 4E5NA 4GMXA 3MXTA 1KVRA 3I5YA 4D45A 1M6YA 2IYUA 3HWSA 4D2IA 3DLBA 1KY3A 3SYLA 1E3QA 5LYYA 1E0SA 2ZSKA 4DW8A 5IDYA 4A6XA 1AHIA 4DV4B 2BEUA 4CLRA 2UVPA 3LYAA 1CV2A 3PK0A 1E0AA 1F4PA 1U7HA 2E7ZA 5BV7A 2Q3DA 5FIUA 1CG6A 3K1AA 4FFDA 5DCWA 4E12A 4AN4A 2QAIA 5LYJF 2GAFA 4ZYWA 4UFPA 2DR3A 4ILKA 3EGIA