4G4SP

Structure of proteasome-pba1-pba2 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
267
structure length
190
Chain Sequence
MSCLVLPLVSVGNIPQLSIDWLLNSQANEWEYLEALDSKYLVEFVGPLDRPEDGSDSLYKDADMKYSSALEVFYNKKRGLFAIQQRTPLVSVNYLNNFIVEIILPFLSKYNISEICIWDSLYAMVDQPIFKILFQSIKYCSCLANEGDNSLDSQQFLQWIISQVKFVRPISWQGAYGMADARDKFVDLYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome component C7-alpha
publication title Structure of a Proteasome Pba1-Pba2 Complex: IMPLICATIONS FOR PROTEASOME ASSEMBLY, ACTIVATION, AND BIOLOGICAL FUNCTION.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/chaperone
total genus 51
structure length 190
sequence length 267
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4sP00
2WAMA 3E35A 4G4SP 3WZ2A 2P90A 3MNFA 3GAAA 3VR0A
chains in the Genus database with same CATH superfamily
1XQYA 4FK8A 3ETDA 4LXYA 3FTPA 3SS7X 3WGZA 1Y8AA 2J0UA 1R37A 3C3PA 4QT0A 2O1XA 2YBDA 3B1WA 4P3OA 1KP9A 2C9YA 2I34A 4TGLA 4AUEA 4FYJA 4LQLA 2CC2A 3VPBA 3Q7PA 1S4MA 4WXPA 2ACKA 2YHIB 2K2WA 2OECA 2Q0SA 4TTTS 1UMBA 2I91A 3NVKI 2YXEA 3PJDA 1D4ZA 1WL8A 3KZOA 4L5CA 1ZEJA 5A4DA 1QRTA 4G86A 3RAEC 1C0EA 1U5BA 3PYMA 4UVDA 4KAAA 2KHZA 1YRWA 5AHRA 2X2FA 3KB6A 3PKZA 3WK8A 1GVHA 1I7LA 5FO0A 1TPZA 3L01A 2ODEA 3DXYA 3PNVA 1C9EA 5CA0F 3U4QB 2EAUA 5HKKA 4IDFA 3AJ9A 1IY2A 1RBQA 1KMHA 5CFLA 4TMWA 2DHDA 3JQ6A 4UUAA 1G5IA 2Q5HA 3AU9A 4FJ1A 4IO0A 3DTVA 4KIUA 2IQIA 2V58A 5F1PA 2X0RA 2Y2UA 5TJ9A 2DUNA 2X9GA 3GNLA 1TUEA 1JIXA 4JMPA 1BTOA 3SQWA 4ZODA 4A2WA 1PYOA 2A0FA 4NCNA 5KYUA 2GO7A 4MGIR 5B6JA 5H4HA 1FNBA 1KMIY 1JH9A 3DVRX 1SKUA 3BIWA 3F97A 3UJ8A 2F8MA 4W7HA 2C0QA 5CLLA 4PRKA 1DVRA 1JKIA 1P3Y1 2PWAA 4NX2A 1ZX1A 1NT4A 5HIIA 4WZBE 1XRLA 2ZTVA 5IP5A 1ZIYA 4BVAA 3RVKA 3IP1A 3MB5A 3QOYA 4HQFA 5DSTA 3HJRA 4M1EA 2I3BA 4BFLA 2AMVA 2NO6A 2ENUA 4XEUA 1EFRA 4FYMA 1R0BA 1DRWA 1GT91 1OROA 1I6MA 1WQ1R 2E4AA 1NJ5A 1HG0A 2Z2YA 4LJYA 2Q7XA 2WU1A 4MUHA 4UCFA 3FPLA 3M89A 5A3VA 2WWGA 3ZV4A 1GUAA 3KR2A 5DGCA 1E2FA 1GL3A 2W8ZA 4DT1B 4RTQA 1R8JA 4LJ7A 4XZ3A 4NFSA 1K66A 3LFTA 3FF4A 4RFSA 2C5HA 3CO0S 4GM0A 2XDAA 4BVFA 5FUMA 3HK2A 4INJA 2J3IA 2ZUBA 4KR2A 2XA2A 1OV4A 4F92B 1XMJA 5K2OA 2D5CA 1T0PA 1EFLA 2XUQA 3STTA 1C3XA 4Q21A 1A7UA 2DPMA 1XXHB 1DQYA 4ASUD 1VPTA 5EVCA 1ZJ5A 1UMCA 3B2QA 4MPJA 2ZS8A 4HZGA 4DG8A 2JB9A 2R6CA 3KDPA 3PEEA 4Q1AA 1UXIA 2Q50A 3HRKA 1PGNA 1U2SA 3QXGA 5A05A 3ENZA 1S6YA 3AB8A 3NPAA 4RETA 4NF2A 3RYTC 1QLHA 3P0JA 4Z4CA 5GWXA 4EHFA 2C20A 4YXFA 2QLBA 2ZRDA 3HA7A 1WP9A 3DOOA 3LC7O 4V24A 1ILWA 3TSZA 2BR5A 5HP4A 3F6YA 3NP9A 3DOIA 5BWNA 3W2FA 1S9DA 4BZQA 3K6SA 3QIVA 5K01A 2QQ5A 4ZOCA 2QQEA 3V1TC 4F86A 3JWJA 2EFHB 5CH8A 5HJ2A 3ZU4A 5A04A 2PH5A 5JI2E 1UJMA 2ZANA 1GN8A 3AUJB 1M73E 2QT1A 5ALMA 2V4ZA 3ANYB 2ZB8A 3B6MA 3F8TA 3B8EA 3CJRA 3QY0A 4GFDA 4LG1A 4MWCA 4TKUB 3S7TA 2QROA 1ZDMA 2C5LA 4B71A 4PN7A 3EY4A 4TZKA 1Z0UA 3OZAA 2IHZA 3VR5D 3C8ZA 2AK2A 4IVQA 4EF6A 3QLVC 1QDUA 1JQ5A 2D62A 3L7YA 4AZSA 2CT8A 2QW0X 1RMQA 4R16A 5DTRA 1EAMA 2GK7A 3BIJA 2VAXA 1SJ9A 2QVBA 1U5CA 3BH7A 1WETA 5AI8A 2BJWA 3NGXA 5CX1A 4N82A 4LHEA 3RH0A 2DUWA 4CMJA 2HFKA 3U7QA 4LJRA 2C4VA 1VLHA 1ZGJA 4TM7A 1L5WA 4D4LA 1TVKB 5KAMA 4G56A 2C96A 3SXJA 2ORED 4E07A 4YUYA 3A9WA 3VI4B 4OHXA 4QQ8A 1HUQA 2BGIA 4I6GA 4W63A 1KWKA 4W5RA 4OLJA 3I04A 4R9VA 4FBGA 4DLPA 4FVTA 4NR0A 4X8OA 3GH1A 1FFDA 2V74B 3UA4A 1SBQA 2BKEA 1VBKA 1MABB 3OICA 4OD0A 3D7LA 4JZYA 4MRNA 3WLSA 4YAKA 3QQ5A 3HXPA 3R4CA 2G06A 3DOEA 3L43A 4Q7KA 4XW2A 5H70A 5KQSA 1KERA 4RSMA 1LPMA 2Y27A 3A2NA 5CVEA 4LZLA 4DLSA 4QYWA 4BEWA 4ZVNA 1SMKA 3N2KA 4YO8A 5D51S 4G26A 3VDXA 3ZYCA 5FV4A 3JATA 3AL3A 1P61B 4P82A 5KSPA 4AM8A 1XLTA 2HM7A 1KF0A 4YJDA 4O2AF 4NESA 4EW1A 13PKA 1WU8A 4C07A 1IQUA 4HKTA 4BNDA 4F5EA 3V34A 1WKCA 4UEOA 2Y76A 3U9TA 1UPFA 1JUDA 4LX8A 3ULKA 1S3SA 3DF9A 1E1MA 4MA4A 3IKTA 4CT0A 5CDYA 3CUKA 1OGIA 4Q48A 4MUMA 2AWOA 4L22A 2HJSA 1SKYE 5KREA 3KETA 1BRTA 1Z0ZA 4MB0A 5FTWA 2IY7A 3H6GA 1ZD9A 1I1HA 3GFBA 5K0EA 1RWKA 3I9JA 4OXXA 3G8DA 4YCNA 1FDWA 5H4GA 4DV0B 1YULA 2G9QA 3EGEA 4HRYA 1CIJA 4YP5A 1GRQA 3VMFA 2DT5A 3LYHA 4MDYA 4Q4HA 2NU8A 2BJHA 2O23A 3MLEA 4LYGA 4BQFA 4XX1A 3K09C 2AVNA 3QU2A 2PX5A 1YT5A 2PZKA 1SBNE 3M6VA 1Q7TA 2ZPAA 3EEQA 1OWPA 2GASA 5LZ4A 1FB5A 3M4XA 1FFYA 3IEVA 4LF4B 3H1EA 2XKAA 5I9NA 3O8OA 4GI5A 5IWAB 1XALA 1JB9A 3T9DA 1XL0A 1PJ3A 1R00A 2B35A 1X7ZB 1TYZA 3V4SA 4CEJB 1R6TA 3TNJA 5IFKA 1A95A 1GSOA 4DRXA 5LD2B 1JDBB 3NBYC 1ONNA 1HLPA 3HVUA 4JUAA 2R7LA 4TSKA 1K7YA 1QV9A 3SF0A 4AY2A 2P2ZA 4MX8A 5LOVB 1D8TA 1B42A 1HQCA 2FW9A 1HQYE 2CN1A 2CYCA 2N3ZA 2VJCA 2VZ8A 3ML1A 2MSDB 3EWAA 3C6BA 2A9PA 1DARA 3F6BX 3KKZA 2G07A 1J06A 3H4MA 4PQGA 1V8DA 1QB8A 1FLAA 4X7MA 3M6WA 1OI4A 4PG5A 4BO8A 1RZRA 1UKEA 3N6RA 4S2UA 2OK7A 5EE5B 5HCNA 3TVDA 4YASA 4LZOA 1R5BA 3DHEA 2PZMA 5CGQB 4TTQA 3AY6A 4L95C 1PG0A 3L1VA 3VOTA 1PO7A 3RKRA 1E3SA 1EWRA 5IK2D 1P2SA 2Z5FA 4RPLA 4AKTA 2Q21A 2Q3JA 5F35A 3SKVA 3ZHUA 2CFOA 3LRTA 3SZRA 3RTGA 2N42A 4GZLA 4WLUA 4EY6A 2OYSA 4R98A 4UBJA 5U9CA 1D6JA 1HYEA 2FR0A 1FOEB 4FI3F 3EVGA 2O2DA 1XTTA 1D2HA 2Q1TA 3BB3A 1EP9A 4ZU3A 5FJIA 5THQA 3DBVO 3AVOA 3DD1A 5EIEA 3S8YA 4BNGA 4PX5A 5EKTA 2VF5X 1L4FA 1NNI1 4EHBA 5JQGF 1NW7A 1M0EA 3QU4A 1NMZA 1VE3A 3EPRA 5T6MA 3A6LA 4FNOA 1YK1A 5LSAA 2HF2A 3RG8A 4J0KA 2FNAA 4JL6A 2Y0CA 2PKQP 2ZYVX 3TOXA 1OFVA 1BXKA 1P18A 4ISBA 2JGRA 4AN1A 1FCJA 1C80A 2OTCA 3QELB 3KPYA 1HYBA 3RFCA 1G8PA 1PZNA 2CNKA 2NZUG 1X38A 3B3FA 2K2QB 3LCCA 3OQIA 2GEKA 4D45A 1TMKA 2GDJA 4TXHA 4ZCQA 1ZOIA 4BAGA 4D46A 2IUSA 2ZYGA 3MJTA 4CUZA 5IJ9B 4QYTA 2W6IA 2XVAA 1X2BA 2YC4C 2R5NA 4Q3AA 4HUTA 4BJ5A 3CF4G 3FNFA 1Z07A 4MRSA 3PV0A 3OT5A 5CVVA 5CAEB 3FPEA 3QWFA 4CM4B 3KELA 5IUKC 4KITB 3DT8A 1Y33E 3VAYA 1HBJA 5J5AA 3AUTA 3UUWA 4DQLA 3C7AA 1S89A 1RABA 3KO8A 4M9QA 1VKJA 1GQOA 4D4GA 2BEVB 2DTXA 3NHMA 4GS5A 2RK3A 4EHDA 1VRVA 1HT0A 4QFCA 1CUFA 5HM6A 3FWYA 3TRHA 2RAFA 2P2GA 2VHXA 1W0CA 3ET5A 1GPKA 4P3NA 1U0LA 5JI3E 1OYOA 3IUQA 3L4SO 1E4EA 3EYWA 3GL9A 4TKZA 1MHPA 2CXHA 4MTCA 1XVAA 3NWEA 1JTFA 5DNWA 3VYUB 4D9IA 4QXOA 1VSUA 4AUMA 7REQA 1UANA 4FSXA 3KLBA 1G1MA 2Q45A 3FMIA 3GLQA 4M3NA 1T34A 2VUIB 5TXGA 4JGBA 2EQBA 2G8LA 2IXEA 4PZYA 2C3OA 3C8UA 3MUOA 2CHGA 4GF5A 1KO1A 4PXAA 2GARA 3LS2A 1AKTA 3K1TA 4R84A 1P2TA 2GM3A 3HKDA 1O77A 2KMLA 4F1WA 3ANXA 3LY7A 3NTLA 4MPDA 3VYSB 4QT4A 5JPCA 1N8TA 2YZ2A 1O89A 5EPEA 1EDOA 4BV3A 5JHHB 4X84A 3OZCA 4E3ZA 4O3MA 2WG0A 1F2UA 1QHIA 2B82A 4RQBA 1EUZA 1EWKA 4BKMA 4EG3A 6ABPA 2ATIA 1IXZA 2FWNA 4L3OA 4YPOA 1LRLA 1PEAA 3I6YA 1NXOA 1L3CA 4YT4A 4MITA 2R2AA 3I3OA 2RGUA 5TIIA 5AYVA 1Y7PA 3LTNC 3ZE8A 1J33A 2F2TA 3MJVA 1X1EA 4PX3A 5FHRA 1RYBA 1W5AA 3GB9A 1ECFA 4QBIA 3F4LA 3WL6A 3BORA 3KZKA 1WDMA 2E4ZA 3JAWB 3P4XA 4OHVA 3GLRA 4GHWA 3BWBA 3WYFA 2BEJA 2F8LA 2JGNA 2VVTA 4AFNA 4O02B 1K6XA 3RVRA 1JXOA 1QFJA 3CUSA 4MWTA 1ZUHA 3ZE9A 4N0DA 2IV3A 1IBKB 2E37A 4EUHA 2D5AA 1Z6XA 3N8NA 2AR9A 4I81A 3UJ9A 4KUHA 1KJNA 5AI4A 1W76A 5IPFA 3NT2A 3GLVA 4UQPA 4EG4A 1I5RA 1VIAA 1VL2A 1PKXA 2PSSA 3CZAA 4EKIA 1AQIA 1ZK0A 1H0RA 1LQTA 4M21A 4MP3A 4FMPA 4UDYX 1MJHA 3DZFA 3L04A 3GNSA 3EIFA 3EPLA 1HWYA 3DKVA 3TLJA 2FPWA 2VBFA 4L50A 3WLIA 4DE5A 1GOTA 3ROEA 1TPYA 1WXIA 2VQ3A 3TQRA 3JQ8A 2PL3A 4MVWA 3H0CA 4JA0A 2EG9A 4WOCA 1CEYA 3ZU5A 3FXAA 1KJQA 3N2EA 2B7LA 3WLRA 4XWTA 3E48A 4JMLA 4WFQA 1TX4B 2CVQA 3O0DA 4CQLB 4RTRA 3L7MA 4MROA 1EK6A 4OQPA 4Z5XA 2ORYA 1G2IA 3HP1A 5LC1A 4G4JA 4UREA 2H1WA 4BCDA 4KFCA 4ACBA 3O8RA 1F38A 2OV3A 3H5WA 3T95A 4DILA 4A0RA 2VBCA 5HKBA 1O0BA 3G9XA 1PQYA 1E3IA 1HK7A 2VK2A 3RBVA 4Z7OB 3NWBA 3SM3A 3ZY4A 1MZVA 1X3SA 1H6CA 3AVPA 2V97A 4O4JA 4PR3A 2V5UA 2WWIA 3VSDA 2C9ZA 4A16A 3VISA 4PRZA 4LV8B 5DBOA 2J8ZA 1Q0HA 2YN0A 2Z1DA 3BXXA 1SELA 3KKOA 2B9EA 2GFIA 3MD9A 4R7GA 3ZHOA 2JBWA 3PDUA 5I8WA 3AUSA 4WNAA 4MZDA 4YJ3B 5ALKA 5IBQA 1XEXB 3F1LA 4CLRA 2C3PA 3H05A 4PN3A 2RSLA 1KYIA 1OAOA 3AIOA 4XSHA 4XCVA 4C06A 4JH0A 5TMEA 1OXSC 4C6HA 1GRRA 4XWKA 5L45A 1YKGA 2FUCA 2OHFA 3EXHC 3EZGA 2DX7A 2YNMA 2ZTHA 2QG9A 4MO9A 1NW4A 5BUQA 1E9DA 1ZOSA 2MJLA 1XNJA 3WWOA 2OKCA 4B6QA 2FG5A 5TEVA 1J5EB 1ODFA 1XD9A 4YB8A 3V8QA 4DPKA 4R1OA 2ZB2A 3GRRA 2JH8A 4IWYA 1ZUNA 1N3LA 3EIXA 3PD7A 1G20E 2R86A 3M6IA 1QE5A 2XDYA 4TVSA 3WK7A 2OV4A 4NJMB 3V8MA 2OSVA 2Q5QA 3CVXA 3CEAA 2ROQA 4NECA 4IOLA 3TTXA 3UT0A 2X2OA 4L4ZA 2X0KA 1CQIB 3DFZA 4FMCB 1KZYC 4G0NA 3JAKA 4JBLA 1NXQA 3R1IA 4DC0A 3HWWA 1M1NB 2WWRA 3PFWO 5CM9C 1LV7A 1XI2A 2A86A 4H4DA 4KTTE 2XT6A 4UFNA 3SX4A 1P75A 5M34A 4HNUA 4ZCRA 3R3YA 2BRUC 2FFJA 2CL0X 3VH1A 3B85A 3TRJA 4ARUA 5KKNB 4X44A 3VU1A 3F96A 3MMSA 3ND8A 1QK4A 3R0XA 5DM1A 5E6RB 3ADOA 1IATA 4Q7EA 2NSLA 2B4YA 1M1XB 2E4XA 2NPIA 1LY1A 2W9XA 3T9BA 1RR6A 1WSBA 4XM2A 4ZCLA 3NHLA 5DI3A 2JA2A 2WYUA 3HYCA 2QY9A 2QMHA 2C4UA 4UHCA 1UDWA 5IX8A 4IRUB 4AP6A 5H02A 4XQCA 4H1UA 1CJBA 1W6UA 4PLWA 4ZT6A 1W29A 2G83A 5EHGA 2AK3A 3N7UA 5JCZA 3G0IA 3VX3A 3MCVA 2CF5A 1MQ9A 2OXTA 2YRXA 2OZEA 4DR1B 1E98A 4XEHA 4EHIA 1CSEE 3K9CA 3AILA 3HJHA 1E2DA 1C8KA 3HNRA 4V0OA 5IM5A 4FIZA 2CV0A 4MLCA 5KX5F 4ND2A 1GNRA 2V98A 3OIVA 2AX4A 4KWHA 2HLDA 2IYZA 3EDRA 4MDHA 4ND1A 1OWOA 3PGXA 1M6NA 1C3OA 4XFJA 1B0PA 3REFA 1O0SA 2BM8A 2F3RA 3ZCPA 4DA0A 4P7FA 3IAM1 2CSXA 4JU9A 1UXOA 4QX6A 4QXMA 2YR0A 1IAQA 5CA1A 1A0OA 5E38A 2FEXA 1TEVA 1FL9A 1U4SA 3H6KA 4EUKA 3N8IA 3QUSA 4KQFA 5JMPA 2UVPB 1E6LA 2CL5A 2C5AA 3ES9A 5EMNA 5BYAA 4CEHB 3SXPA 3F6EX 4O4IB 3QZUA 3R5KA 5LQCA 1QF9A 3O1HB 5EJ7A 5HJ5A 3VNUA 4PEVA 4PU0A 3IT1A 4HRVA 1Z4QA 4JLVA 3V55A 4UU8A 2B1JA 4TYNA 2GN1A 4O4HB 3LUKA 1DC7A 1JN0A 2ZW9A 2C1XA 2J9GA 1CR6A 3EVTA 1QTIA 3HEBA 1NC3A 3QE2A 4FYKA 4IDPA 1N9GA 1Q5PA 1U2DC 1U7OA 3G79A 2FI1A 3PQ4A 3GEEA 4FFBB 4ZU1X 3RHFA 2QNBA 3WYAA 4YIKA 3IT3A 1FRZA 3QF4B 2IXTA 2JGLA 4RD2A 4LY0A 1C0PA 4P2BA 3D0OA 1ZUD1 1U0BB 1XMIA 1P72A 2WIJA 4JCOA 1HO3A 1U9IC 1XDSA 2BDTA 3CPHA 3NHJA 1ZD4A 3GG9A 3PUZA 5KDLA 2WHYA 5ECGC 1YR9A 2UYYA 3QVKA 2F59A 4J75A 4Y2VA 3PTZA 4KTVE 4IGKA 2P30A 2GZ2A 1W88A 1H9AA 3LKVA 2XUIA 1PS0A 1UC8A 1UBHS 4URHA 4A0FA 2C2BA 1D4FA 1CJSA 4NOLA 2RK6A 5DMHA 1ODJA 1P2BA 4ND8B 4N5NA 5DEOA 2ORIA 3NHZA 1WMAA 4PGHA 5A7HA 3UWSA 1WUJS 5BT9A 4KC0A 2WF6A 2B37A 4DSTA 1I7NA 3MJDA 5H5JA 4DIMA 1MENA 1URPA 2PJRA 3B51X 3DZJA 8MHTA 4DA7A 4U6SA 5I7HA 3TGPA 1ZXLA 1NP3A 1N1MA 1HMYA 1VFPA 3GPCA 3HH8A 3LL7A 3NAMA 2AC7A 3U17A 3MF4A 4EG7A 3SXUB 2W42A 3KAPA 1K8QA 3PNOA 3FR8A 1HT2E 1TKRA 4JKIA 3P0RA 3S4YA 3VQTA 4LWQA 5LNK1 1KK3A 5IKEA 1DBRA 1J70A 2CHQA 4LC0A 1YBMA 4RDCA 2K87A 1UZLA 4MEJA 4AJPA 5LMCA 1JYSA 4H17A 1N5JA 2CDRA 2D5LA 4UD2A 4E5VA 1F1BA 4BBZA 1HOTA 1AIPA 4WA8A 3CGGA 3ESDA 2AMLA 2HA6A 2UZ1B 2X8JB 2DFPA 4OQZA 1H5UA 2FPUA 2OB1A 4FR0A 2ODQA 3OQNA 2IXDA 1GA4A 3W05A 1QAOA 5CDSA 4V2IA 3PNQA 3KQVA 2H59A 4EKGA 4Q93A 1EUDA 1ECPA 5JAPA 3P0HA 5MGBA 4EHNA 1AB5A 1NAHA 2ORVA 1MJFA 1JDPA 2CL7X 4FHGA 4O1HA 4QJ3A 1NVTA 1TQ2A 4GSYA 2M1ZA 4JCCA 2DXIA 1QC5B 1W7AA 1BA2A 3MMPA 5CG2A 2AXPA 2J3LA 1YOVA 5FPPA 2Q1UA 4AKHA 3JRXA 1QCCA 1STOA 2EDAA 1KTIA 3EIUA 4KI7A 4G84A 3RNOA 5J4VA 1LWOA 4X60A 3TPCA 3PGVA 5JEEA 3Q8LA 3S81A 3WHIA 2WHQA 1DKNA 2WF5A 2XDQB 2BTQB 1R66A 3GU3A 4BQRA 4UUOA 1ND6A 2IH4A 1JEQB 1Z4OA 4HNAB 1Y48E 3AUYA 3BG5A 1GKLA 1M3SA 2QB5A 2CLOB 5NLLA 1Z63A 2FK8A 1Y0BA 4JQZA 5H7XA 2NPFA 2HHHB 3F3MA 4I5EA 4L27A 1JDTA 1T6XA 2QT0A 2R1UA 4E5MA 1ORDA 4D25A 2V4UA 1N7JA 2RGDA 4PY2A 3H1AA 3CZMA 3RFUA 1CHDA 1Z5NA 2AFIA 3IGFA 1GIAA 1V9CA 4E4TA 2IIPA 2DUJA 5JZBA 1HNZB 1RAFA 2NLOA 1VJDA 3DL2A 1UFKA 5EMKA 2OK8A 4F46A 3GLTA 3Q6IA 1R0XA 3K2IA 4ZRNA 5K3DA 5DHAA 1USIA 4TTVA 1MO5A 3E5HA 4RF2A 1Y8RB 3ZCVA 4BO5A 3AM1A 3PSHA 2ZYTX 4R5MA 2FX5A 2ECQA 4F8YA 3EVEA 4ADSG 1TCBA 4K0KB 4V0ME 2I2FA 2JJYA 2VXCA 1AS3A 1BVRA 4W8GA 3K8ZA 3FTFA 1QIMA 4UNQA 3RROA 2UUOA 4OAOA 3DE4X 4M0FA 5ICEA 3AFOA 1JLLA 2JVKA 1DMRA 1U28A 3X44A 1R0YA 2WJWA 5IYZB 2V96A 4MV6A 421PA 4QM7A 2H1LA 3N7AA 1MB9A 4YRPA 4EJ2A 1GU0A 4MMZB 1HE1C 1Z6GA 1EUCA 2FWBA 1FF9A 4HWTA 4LYFA 3LUFA 2X86A 4IWNA 4BMYA 3T1YB 1HSOA 5GADl 2BFWA 3QNMA 4DLNA 3KIPA 4DSOA 1SC9A 3IR7A 2HJHA 1BVYF 1PLJA 2OUIA 2XUJA 3QMWA 5REQA 4ZO8A 4FT4A 1P1KA 2WFAA 2BBSA 2HEGA 1JF8A 3ORYA 1E9CA 4IVRA 1VECA 2WAXA 1ZIOA 5GQSA 2PMFA 3H84A 4NLLA 3UY4A 3U6KA 1F6BA 1U2GA 3C6XA 4FGJA 1K7XB 5BYJA 3NYQA 3UICA 3MRSA 1HSZA 3J81A 2KSQA 5E6UA 2GTHA 4GP9A 4IXNA 4II3A 2KW5A 5LP6C 4BASA 2HF8A 3GGCA 1TCVA 4GPAA 4MVJH 4TL9A 4GUDA 3EZ2A 1R0KA 4YACA 2GZMA 4DLXA 1UJ5A 3UWKA 2DBVO 5EWMB 2JA1A 2I1QA 2IHBA 2QR2A 1HYHA 1UPXA 4TMYA 1P2FA 3JQRA 5HUJA 2WZBA 4QVIA 1GLVA 1UK6A 3DWFA 4MZXA 3O3MB 1AGPA 3JD1A 4B2IA 3J81k 1XA0A 4L75A 4MR9A 5M5BA 2RGNC 4PCAA 4KGXA 4M0CA 5IG2A 1A4XA 2R6AA 1KE1A 5LQKA 2INGX 4TROA 4C4AA 2GJ8A 5L51A 2JK0A 3FYTA 3QPAA 1JVSA 3LPLA 1V3QE 3SNHA 5EKSA 1OLOA 4P33A 1N2EA 1GNQA 3OI7A 3OZRA 3HXQA 2ZM6B 3P1JA 3UJ6A 4TT3A 2R751 4H7HA 1EHYA 2WSIA 1HH4A 1OXBB 3CQ9A 3M4JA 4E6EA 4J7XA 1EVLA 2IGTA 5CCBA 3DYBA 5JBIA 2J9RA 2OG2A 1CS0A 3KKQA 3WAJA 5HFJA 4QGGA 3RW9A 2JEOA 3B6ZA 3MQ2A 1GNLA 3OUZA 4RIGA 3RT1A 3SJCA 1U02A 5JAUA 1FXSA 4TTSA 3EGCA 2I2WA 1CUCA 4WX2B 1PD0A 3A3NA 5GGXA 1G291 4F71A 1XCLA 3WADA 4OVKA 4HRAA 5A3SA 4BMNA 5SYMA 1SVWA 2OB2A 2XZPA 1I0LA 4AP5A 4NY1A 2ZB7A 4Y1GA 5DN6A 4HEHA 1WE2A 1E32A 3QLUA 3QPDA 2V0CA 4BBJA 3RAGA 1CP3A 4IMPA 3ZGYA 3T3DA 3OPMA 3FLBA 2WDZA 4ENQA 4IW3B 4A27A 1SU6A 1PHRA 1YQUA 4YDHB 1PWEA 1SUDA 3OLVA 4F8JA 4GVLA 4PZAA 4AF7A 1JJFA 4AJ2A 2AWNA 4BFTA 2LCQA 2VKQA 5ALGA 2PUCA 4BOYA 4BEBA 5A03A 1Q92A 4E14A 4AUNA 1I3CA 1ESZA 1Y7LA 2H0AA 1SG0A 5KS2A 4I50A 2O2XA 4UTZA 3ZDXB 4KJXA 4ZIRB 1LPNA 1UK9A 5LP6B 2HSDA 5CUQA 2DQ4A 3LHDA 4G1UC 4WA7A 1L4YA 2KLBA 3QM1A 1QDEA 4HDCA 2R5WA 3QK7A 5EYPA 4PICA 4DREA 2DFVA 4FOPA 2H5EA 1OREA 4B6OA 1K6MA 1KOFA 5K7SA 4XPIA 1J8DA 3L18A 1OWNA 1QWOA 1NI4A 1E8NA 4GOMD 4BFCA 1IBLB 1DKOA 1ZHHA 1WUKS 4XWYA 3RVSA 4QD3A 1RI5A 1FYEA 3AUKA 3PE4A 1VKHA 2QV7A 4FX5A 4O8ZA 4DIBA 1GRNA 1I7DA 1W34A 4NZZA 3OZGA 1NLYA 4S12A 2QVGA 1QCYA 4M7RA 3UPDA 4TV8B 3ZTYA 2EFYA 2FR1A 1Y5LA 2VHYA 3CINA 3K15A 2C84A 4A1FA 4C0JA 5JBNA 3ZI7A 4BHTA 1ML4A 1TXGA 3OCVA 4LTMA 1XZHA 3M6MD 4M22A 2PZGA 1K1EA 1OKKA 1KH3A 2ZJFA 4I9GA 2Q46A 4BE9A 3WLKX 4DKXA 2J4CA 5JAHA 3VSBA 4ZPXA 3T54A 3PICA 1UBNA 5KYNA 3NBUA 3UJBA 4RKRA 4X1KB 3Q6NA 2BGKA 3LP8A 3HI6A 5IKOA 2EYQA 4GZ3A 3TRDA 3L7CA 2Y0EA 3HPRA 3V5NA 1XKLA 3AJEA 4JBWA 4EPRA 1UJCA 1KO8A 4WXEA 3EVFA 4ALMA 4AKIA 4L07A 3SIXA 4YAIA 1WHSB 2HN9A 3JTEA 3EAFA 1BO6A 2GEFA 2ZTLA 3WL5A 4D96A 1BMFA 1G2OA 1M54A 1OXTA 2E6UX 1XZLA 2D74A 2EHJA 4GOXA 2D1FA 3FWPA 4LMBA 2B20A 3WMGA 2PGIA 4B6RA 2FKNA 4YRSA 3UT5A 1W9MA 2YUTA 3VXKA 3G82C 2W6NA 2WZQA 2EU8A 3JQ9A 4DLWA 2PGXA 4OL9A 2Y9MB 4IDCA 5K3CA 5K0TA 4M0EA 2RHMA 1J56A 3A06A 2G5CA 2OLKA 2LKDA 4QXRA 3HA5A 4KXMA 1JJBA 3KTAA 5LWHA 1RTKA 3ENQA 3UK7A 3MJSA 3BJMA 2HDWA 2Z2ZA 4M49A 1F8UA 2YFHA 2V6JA 3S5JA 2RJOA 5DRTA 2A1IA 2E4UA 2ZJ1A 1L9XA 5C4GB 1FFBA 1FC0A 4W5JA 3UG6A 2WIDA 1FFWA 3CVWA 1JWBB 5LB4A 4BN5A 3MN1A 1YQTA 2YFQA 3A6FA 4DR4B 1MO3A 1PZXA 3KS9A 3L0DA 2XVYA 1AKQA 4I1SA 4BNLA 5B12A 3W5AA 2HI0A 1RWXA 5CVUA 2PPVA 1JHOA 4FYYA 3PXDA 3KDAA 4Q47A 1SUWA 3N8DA 2RBKA 5PGMA 1M1YE 2ZSBA 1EQUA 3KLPX 1J6UA 2PFKA 4HLQB 5L53A 4IYJA 3HB0A 2VA8A 2O8VA 3WYBA 7MDHA 1UEIA 1GTL1 5C7IO 1QTQA 3NZEA 2X4GA 4ZI7B 2CKDA 1Y1KE 2QJOA 2C9DA 3D7MA 4I6JA 3WP0A 4DEXA 3FUXA 4NE9A 3H2JA 2IYOA 2QUIA 2CUTA 2XYRA 1T1RA 5LYJA 4PYOA 1W25A 3WGHA 4UFPA 1XF9A 4HNVA 2IYVA 2WWWA 4H08A 5CNMA 2Q5OA 1REQA 2BLNA 4CMIB 1C9DB 3EVDA 4ZREA 3SY8A 3QVXA 3JQPA 1SUAA 1DWOA 4H6WA 4KQCA 1W1UA 4YQZA 1C9JA 1UUFA 3BFKA 3U19A 3VNVA 2QORA 3N39C 1PV4A 3WLTA 3BTVA 3HDGA 4PNEA 4IJUA 5EJEA 3PD0A 4L8VA 5JSHA 4F2WA 4KE7A 3T3EA 2H1SA 4JK3A 5AW5A 4UAJA 3BXFA 2BDUA 3FETA 3LXMA 1P1BA 4I66A 1OZHA 5G4KB 3SDZA 3BMNB 1I10A 3F9IA 1VYHA 3MWEB 5ENVA 4C4ZA 4QPPA 3EIHA 4AY5A 2D5IA 1SUIA 3DHNA 3HR8A 2A9VA 5C8YF 2C2OA 5FHQA 2REQA 1DB3A 1RQLA 1FSZA 3IBTA 3JPYA 1NPDA 5JIBA 4RMNA 5DKFA 3RVPA 5EUMA 4MWGA 2JFXA 3VKUA 3IVRA 5AESA 2PLRA 3D02A 3F8WA 3E6AA 3E9DA 3SLGA 2NVUA 5IW8A 4BRSA 1RHMA 1F0NA 5EUBA 1CUBA 4I9FA 5AW0A 1Z17A 3F0TA 5JH7A 2XCUA 5K8JB 3H13A 4ATNA 4KR6A 1JAXA 2QRGA 3CUTA 2JIZA 3ROFA 3VR3A 4TVKA 5KYXB 1L4NA 3F67A 4P4LA 4EVIA 2B7CA 3DUFB 1UOOA 3AYXB 4DMMA 1ADBA 1FRQA 3X1MA 5EGSA 3D3EA 3V48A 5AUOB 3W4IA 4H7DA 4B7ZA 1G7SA 1X87A 2ZBRA 3CUYA 1UBGA 2NP6A 2IP2A 1PR9A 2ETXA 2SKEA 3HRHA 2PV7A 4QNNA 4YRNA 1NXTA 2O5VA 3CUVA 3FH0A 4MINA 4MMYB 4AO6A 5ARBA 1DX6A 3TN7A 3M9WA 2QRVB 2KQUA 1A4UA 3MMZA 1CRQA 2J5XA 3W3AH 1JA9A 3KJZA 4NMWA 4CM3A 4MTLA 3A9VA 5EEHA 3P7MA 4Q9DA 2YL2A 3B20A 4BY9E 1UJ6A 2HZBA 4HRXA 2VPQA 1H2XA 3GUZA 4CI0B 2QAIA 2VSQA 4RAQA 3HI4A 1JG2A 3TMAA 3H8VA 1AQJA 2JIOA 4MIOA 5CA0B 1PFQA 4S1VA 3JYOA 4KVFA 4LDAA 2BCGY 4PRLA 2WHPB 4BU0A 4G5SA 3LKZA 1Y9EA 2G28A 2XKBA 3GEPA 1PEYA 4EF5A 3A7DA 3OC6A 1MQSA 3T7AA 3OO0A 3GLHB 5LZ5A 1WOYA 2XVMA 3NI2A 4IGIA 5A5FA 1PZEA 1DADA 2ACEA 3HLTA 3GBSA 3JR7A 3PL5A 3QKRA 3M3HA 1I3KA 1ZD5A 2Y1EA 4IY1A 5A6SB 2RGAA 4GMDA 3B1XA 3KKPA 4NH4A 4GXRA 4Y2UA 4D4KA 4UC0A 1IN4A 3AL0C 3KQYA 3OZBA 4FDAA 4DIOA 4BE7B 1M2JA 1NJ1A 4KUGA 2X8WA 4FIDA 5LM3A 1J23A 3VO2A 2ZJ5A 4K2AA 2HB6A 4TV9B 1IRXA 3PQFA 1TJYA 3TW6A 4EO9A 3R77A 3EWSA 1GCUA 2BH2A 3NUQA 3M82A 2OAEA 1K27A 1KTVA 1Q2XA 1ZN7A 2A59A 2RIPA 3MGKA 3O3NB 4KL8S 5AHWA 1PE0A 1ZJJA 4G3XA 2I80A 2YXBA 3V1NA 1HORA 1CDDA 3KFXA 4X6LA 4P4SB 2O3JA 3HE3A 4FDVA 3DPIA 3LUJA 2WFZA 2G0TA 1USWA 4MGEA 1DQNA 1X77A 4QEZA 3R7WB 2IHNA 3B60A 1DEOA 3WGUA 5JS7A 2VFAA 4EG1A 4LYHA 1EFVA 2OPBA 3ETNA 1MAAA 2ES4A 1SQ5A 3QXCA 5E9JA 4GWLA 4W7SA 5IHXA 4R3NA 3E22B 1IOZA 4RVNA 2JG3A 721PA 2A9QA 4DJDC 4HO1X 5JADA 2ZYUX 4CM6A 4MVJA 2WM2A 2W93A 1NBWB 2C58A 2VP4A 1XAGA 4NENB 1MLDA 5DHTA 4YXWA 4AN4A 2EVWX 4RDXA 1GV1A 1PT7A 2LKCA 5BPHA 5CB0A 2PJUA 1YVRA 4OU5A 5B4VA 5I7WA 5I9LA 1KDZA 3WLFA 1DNPA 4R9UC 3ABZA 3R74A 2QLJA 4L0QA 1VCNA 3EGDA 4RMGA 1DQSA 5IABA 1JFLA 4MI6A 1L4BA 2P40A 3EMKA 1T5DX 2OHVA 4UJ5A 1K9SA 5SICE 1FDVA 1RWBA 2HD4A 3C7TA 3NTVA 3LCVB 3QNUA 1E3LA 1GPLA 3FTNA 1JU9A 3R09A 1V95A 2PLNA 1OFIA 2QTWB 1L8QA 1EP2B 1W47A 2N1MA 3I1FA 4H3HB 3KR0A 1FVHA 3NEYA 4QAJA 1WMFA 2GZRA 3IAUA 3KAQA 4V3BA 5GONA 3TX6A 4B9EA 2P6PA 4X3CA 1U9JA 4E33A 4DUZB 2HREA 2Q3BA 1SU4A 2J7KA 4QPCA 4AZWA 1V26A 3OPXA 5GINE 4J9UE 2JI8A 3H8WA 2PCJA 5IUJC 1OU4A 2Q29A 2NZVG 1Z68A 1F5NA 3KUXA 2ZVDA 1T0HB 1YAHA 2O8EA 3NDBB 1ZNXA 1JR4A 3FOCA 3OX2A 2XZTA 4OQEA 2AJBA 1UXGA 4WN9A 1ZHFA 2NQ8A 4D41A 1MQ8B 3K9HA 1AVTA 2DTEA 4HWRA 1XNHA 4MCHA 5D01A 2GYWA 2DAPA 4PINA 5H80A 1WZEA 4U5XA 1TYCA 1BDMA 3WJAA 2ZTUA 1J21A 2G4VA 5DGDA 4BFXA 1Z83A 4IILA 2OMKA 1PFKA 3OUTA 2IYEA 2QLFA 3FWNA 4RWZA 5CDHA 2B1GA 5IVIA 3RYIB 4OQXA 1VL0A 3DFMA 1HTWA 3OWOA 1NN0A 4F2HA 3KDSE 4G4IA 1G63A 4QPDA 4DJTA 3U13A 1OUMA 1QPGA 1VCHA 2WYIA 2H6EA 1G3UA 3NTRA 4B09A 4F85A 2QMOA 2WG1A 3GUCA 2BMFA 5CLQA 1JZQA 1V2HE 4MJ3A 4OJYA 4XTCS 1FFXA 1FFGA 2QP9X 3QHPA 3AWIA 5MF6A 4RK1A 4KBYA 1L8AA 2FG6C 3IIMA 3WIBA 1KA9H 1G3RA 4JBHA 4PQEA 5HE8A 3W4JA 2I03A 4DCTA 1HQKA 1OHHD 3A26A 2XQFA 1EHCA 3UUGA 3VVLA 4ZZ1A 5BSWA 3ZJTA 1GU7A 2VF7A 2QPLA 2OBFA 2EHDA 3CVOA 3DMFA 4YAGA 3RBAA 2JIPA 4UAVA 2QBYA 2C4MA 4C22A 4LXIA 1QYCA 2D54A 2IEIA 5LJLA 5F3RA 3KXKA 2IYRA 3RWBA 1VJ5A 4R69A 1O97D 3Q87B 4J0FA 5CLFA 4ZQIA 2H06A 3MS7A 3UXMA 3EIQA 1G9TA 1N32B 4DDTA 4R5HA 2VJKA 4CT5A 2FZKA 5C8DA 4KE8A 4W8HA 4WINA 1RXUA 1RKUA 3MSCA 5FLEX 5DYNA 3SC2A 4ALIA 3AUUA 4C7JA 4ZVTA 5EJGA 3ESYA 1J2YA 5FTMA 3QJYA 4WLNA 3MBIA 5DNCA 1VDZA 3B6JA 3I45A 4DEVA 3O74A 1FYXA 1L7BA 3NQ41 5I9MA 3DLCA 3LY5A 2BSAA 3NTQA 5FUXA 4EB6A 3G8BA 2WJPA 4AJIA 1D2NA 4YAUA 3LXXA 1JWLA 3CZ9A 4EPTA 3OFNA 1YZLA 3KZVA 1K4MA 1Q50A 4C0HA 4HTFB 1KQGA 1EESA 3NNDA 1JHXA 1W0KD 1VHLA 1ZOLA 3R2JA 4JASB 5HZKA 3E3AA 1QTRA 5T4BA 1SUBA 1UZUA 2BUCA 3PGJA 4IUCS 4MUKA 1TJPB 3TSOA 3GFOA 2LDXA 2HFJA 3COYA 4KWCA 4K9MA 5JZVA 4L4UA 2NAPA 2QTAA 4CIXA 4G5GA 3VC2A 2O4UX 2D7JA 4ZVMA 1H4VB 2X8LA 3B53X 1S1MA 1PRYA 3BRWA 4OHMA 2QF7A 1XROA 2I78A 4TLMB 3MHTA 3C16C 2FA9A 4P3KA 1ZN9A 3ZC3A 2YVQA 3NGLA 2I22A 3FUUA 5D5PA 4DCUA 5JDIA 4R51A 5FUBA 2OCIA 2VTEA 2PLWA 2YINC 1T4MA 5K0JA 2JKVA 4KP7A 2D2EA 2Q07A 2ZIVB 2Q5FA 4C7KA 4IUYA 2AG6A 1AZSC 4ZAXA 3QVOA 2GMWA 4LGMA 4AJ1A 3KOWA 2IIBA 2NU9B 1BWPA 1K4KA 3HCPA 2G1JA 1RFLA 3W9UA 5A5VA 4DR5B 1NBME 1SVUA 4TZTA 3KEGA 4GOJA 1K7CA 1T43A 3IALA 3ZWPA 4IMIB 2YJGA 4AX4A 4A0GA 2CLLB 4TUYB 2FSGA 2P0AA 1MORA 3KB8A 3SR3A 1W5SA 1AE1A 2WM3A 1E9BA 4FB4A 5F9HA 2AFHE 3BK1A 3ELUA 1JEAA 2GBLA 4Y6SA 3VV3A 4F0JA 3VKHA 1J49A 2L82A 2Q3EA 4G4SO 4GR4A 1NLUA 2JLCA 1A1VA 1BROA 1NY6A 3B82A 2CDCA 4ZICA 3STXA 4HEA6 2QTNA 4KGDA 4F9GA 4R01A 3BB4A 1BG6A 2MINA 5AM0A 5B3JC 4RQTA 3ZCXA 4GC5A 4A1OA 2R8RA 4DCMA 1Y80A 2FEAA 3LYAA 3FNQA 1VE5A 2F1KA 2ZWMA 3AY7A 3OJOA 5EHXA 2P6OA 3AVVA 3RANA 4YP6A 3MIIA 3QBVA 4U6NA 3CR8A 4TYQA 1I4TD 1MEEA 4X85A 2OORA 3T3PB 1FQWA 2XUPA 3CC8A 3UJPA 2HA2A 1CQXA 1PZFA 4HS9A 4ZHSA 1HZZA 3BULA 4BVHA 2XUFA 2XB6A 3LECA 1QHHA 1SXJA 1BCSB 3ER6A 2P3OA 5CVDA 5D8DA 4HDRA 2QG4A 4LHWA 3PEYA 2XF2A 4ZO6A 2NUAB 3DT9A 2GJ9A 5IT4A 3P9KA 1EXMA 3MWYW 5JFGA 2ZM5A 1EFUA 2O9JA 5ARDA 4DMRA 3HO1A 2JFWA 3G0DA 2D1SA 3WB9A 1R12A 2O20A 1IL0A 5C1OA 4CTOA 4NC9A 2ZAMA 3R0ZA 2V8BA 3GJQA 2V7PA 3VVCA 4M0KA 4MVXA 4ER3A 5EE0A 3T3HA 2ZUWA 1Y1RA 2I6TA 1GXSA 2VK4A 4HH3C 4M55A 4MQFB 4O33A 4QREA 5L3SA 3EMBA 2LV8A 3U61B 1PQPA 2VPWA 2ZRBA 3IDFA 4HS4A 2OGSA 1P4RA 3KJFA 4RMIA 1DTSA 4YN3A 3CTMA 3HWRA 5JROA 2R6HA 3GEHA 4WBNF 1UP4A 1RPAA 3PFKA 3FNHA 1E6EA 4OYYA 1WSWA 3GJ3A 4MQUA 3RASA 4MICA 3FOFC 1MRSA 1KJIA 3DBHB 4OQDA 2BKUA 2ZSHA 3C7CB 2V9PA 2EFDB 4TYYA 3B6IA 3LL4A 2VYCA 3U3MA 3PJRA 2ADOA 1L4LA 1KAGA 2PGAA 1DPGA 2VF4X 3HEAA 3QU7A 4LX0A 5D5QA 5HF9A 1CZHA 2DUMA 3T4UA 4P5DA 4W7IA 5HSGA 1VJ1A 4QUAA 2UU9B 3N05A 1XTSA 4QQNA 4N48A 4PLYA 1SBYA 1U3FA 1BVUA 3DO5A 3QIAA 4O59O 1A5AB 2C2YA 4J9VA 4RJ2A 4ED9A 4HQ6A 1KI7A 2PTGA 2ZJ4A 2B5VA 1KRWA 1Z3IX 3E7DA 3I32A 4CDNA 1H0HA 1Z82A 2I7CA 4F4UA 3LMKA 1TJNA 2GWHA 3Q15C 4PYMA 4EJSB 2BFCB 3CW8X 1U3VA 4LWPA 2CJWB 1ONPA 3FCYA 4OXYA 5EZYA 1QZTA 3S2IA 1WIWA 4S04A 1S3FA 2VUTA 1AF7A 2V6MA 4YCLA 1T9KA 2M6LA 3W3AA 1LBTA 2XH8A 1R15A 4L4SA 2CUNA 2AS0A 2CLIB 3BE8A 5AKHA 1V37A 3S3TA 4E22A 1NRWA 3IBGA 3PHHA 4GD3Q 4L08A 4PBSA 4PW0A 1P45A 5K8LA 3VR2D 3H19A 4X1IB 4ZOLB 4GR9A 4TLEA 2J5QA 1E2IA 2OQIA 4Y0NA 5CLIA 3UJNA 3ZCTA 4ZHQB 2CF6A 2JAQA 3AP3A 1L7NA 2C8VA 3K6RA 5L6LB 3LDGA 3OTOB 2GI4A 1E0AA 1IYZA 1ISSA 3U81A 3V3KA 2FEWB 3U60B 3I9MA 4GT1A 1X1QA 1BDIA 5ELLA 1Z8DA 1DJPA 4PPNA 3GT0A 1BMDA 4XARA 1J1UA 2AT1A 1YU6A 2ZJ2A 4CM8B 4LF7B 3L8HA 1G17A 4CIDA 5EHNA 3OESA 5JJCA 1CUUA 1W0JD 1OBOA 1UZNA 4ZZ2A 4I4TA 4DTIA 4EZBA 3UPUA 1M10A 1XQVA 4GH5A 2B1IA 5KWIA 4RAOA 3FHTA 4R1MA 3SQXA 3OE7D 2QX9A 4L6AA 1E6MA 3RWMB 1IN8A 2PT9A 4M83A 3T5AA 4M37A 1I6WA 2WUWE 4MEBA 3GLHE 1DAKA 1DKQA 2IOFA 3I01A 3OBBA 4IHJB 4TS1A 3L6OO 4NYMR 2QP3A 4I14A 2C2WA 4OYRA 1U2RA 2ZI5A 1X39A 2I4LA 2Q49A 1O94C 3KHUA 1UZMA 2CVPA 5AI0A 4BVKA 4DMCA 5CX4A 1XRQA 4PIPA 1BX1A 3DBLA 3RV4A 1A27A 2HA0A 2JD2A 1XE3A 3PC4A 3ME5A 1P5RA 3SJAA 1EXDA 4ZI5A 4XD2A 3CKLA 4AJ9A 1FJ2A 1V1RB 3E9YA 1FJHA 4JUDX 4KFTA 1GSAA 4H6PA 3K4QA 3S1AB 2ZJ0A 5JSZB 1Y42X 3O8QA 2A2ZA 1VLZA 4Q16A 3T7KA 5IT9A 1LQ2A 4TM8A 1VTKA 4JFAA 3T0IA 2IHKA 3IDSA 2EF1A 1KFKB 3C5HA 5D3MA 4NAHA 3HB5X 2I1WA 1SIUA 1RAGA 3DMTA 5CT9A 3IH5A 3D4PA 3SSNA 1VIDA 5KQGA 4BWVA 4ARVA 1FJXA 1QKKA 1Z7BA 3F98A 4U63A 2IPMA 1Z2OX 2OUKA 1YACA 1SKBA 1E9EA 1BDJA 1GGVA 2A7XA 1PV2A 2QVYX 3S55A 1ZJZA 3BE4A 5D87A 5I9BA 3T4PA 4EKNB 5LLDA 4OYHA 3D64A 6PFKA 4N3GA 2H8KA 4INAA 3WL4A 4QC2A 4DS3A 2ZE7A 2DQSA 1MRZA 3FDZA 1G7RA 2BFNA 3DZHA 3ITDA 3L07A 4PO1A 4RVFA 4XLLA 1U0TA 4C0XA 3UTCA 4C1BA 3STHA 2MYUA 3O4HA 5JAZA 1ICEA 4RANA 1AUOA 3GCWA 2VQEB 5EE9A 1GGNA 2FK7A 3P5BA 4Y6LA 3UCEA 3AIMA 2PD3A 4DSUA 2O8DA 1QR6A 3BWVA 3DLAA 1I32A 3A32A 3KKMA 5A0FA 4ASUA 1TTPB 2A5LA 3JARB 3TOVA 3CNBA 3WO1A 3LRPA 1Y8ZA 2VQSA 4FNGA 1UAYA 3T5GA 1XXLA 4F4JA 1A9YA 4ZCIA 3EG9B 2Z95A 1Z5PA 2QZZA 3DE5X 5D7BA 4KXYA 4B80A 2RB4A 4YWHA 2PFGA 4P54A 1IN5A 4H0CA 1N4DA 3THWA 4PTZA 4FWIB 1H1LA 2J0UB 4YO7A 1V5EA 3FNBA 4GQAA 3OZSA 4I9HA 3T5DA 2C7QA 1PSWA 2OBLA 4N6OA 1B8OA 1L1EA 1PS8A 2VF2A 3NHFA 1WV1A 4V0SA 5CW1A 1V1JA 4M38A 2YXLA 1L5HA 4PX9A 2N1BA 3KEMA 4FOSA 2OHGA 1FUUA 2GXAA 1BQEA 2TRSB 2CXXA 2IW1A 4EUNA 3AR6A 1II9A 1G3QA 4RVCA 2J85A 4K9QA 1U5BB 2FPSA 3GCGA 4KE9A 4YP1A 1EMDA 3PWKA 3EOZA 2XBUA 1P0QA 4ENTA 1LEHA 2PKXA 2HQ1A 2JATA 4ER0A 5HR5A 4XKJA 4Y9UA 1U11A 3ZXYA 4F9FA 1X7XA 2Z8XA 4ZVUA 1KMHB 3DL4A 4EH1A 5BWOA 2ZAGA 3H2GA 1JSRA 4N0EA 2PUEA 4CEIA 4Q39A 3F47A 3DTVB 3CIOA 2NADA 3FPBA 4NNOA 2YFYA 4RACA 4IZIA 4BTEA 3PEWA 4K9NA 5GPBA 2IVFA 4CRWB 5DHRA 2DSTA 1A9SA 1IZ7A 5I3CA 1YDFA 1QP4A 5DXJA 5ARCA 5KYUB 2P9JA 2E7ZA 2I2AA 3SAJA 3HY6A 5KVSA 3ZU2A 1SZCA 3ERCA 1P0IA 3LF2A 4UATA 1QV7A 4G2NA 4Q1BA 3CXUA 3IBFA 3ND5A 3ESQA 3GA5A 1KI3A 4HOYA 4R1PA 1SCQA 5HW0A 1EGVB 4FHZA 3CX8A 3INGA 4P58A 2WHRA 1E0JA 1P2DA 3BSYA 3LDUA 4ZCMA 3MYYA 2IPNA 1GTSA 1DJQA 4Q02A 2HF9A 1K98A 2V9CA 2ST1A 3EF0A 3OSZA 3SIPA 4DCCA 2AG5A 3DEFA 4Z53A 2BGRA 1DEXA 3W6NA 4BNTA 4PBRA 2OR3A 4E32A 2P8SA 4D0SA 4I55F 1BH2A 3IEKA 3KVOA 5EUCA 4P53A 3UATA 1T0IA 3DMNA 1AKRA 4RK7A 5EEGA 3E58A 1EWVA 1M6EX 2DH5A 4NDAA 4ESOA 3OU2A 2FEKA 4RFSB 3RUCA 2Z83A 1R8QA 4E21A 2LRHA 4BS9A 1UPTA 4CF6A 1RJDA 3E9CA 2YTZA 1XQ9A 1S2NA 4R6WA 3E8XA 2P4UA 1WZIA 1Q1NA 1YR8A 1I51A 3IEIA 4DRYA 1J5XA 1GSHA 4ZQBA 1UMCB 3ZKAA 4R8SA 1ZH0A 1N6HA 2GAJA 4D9CA 2G82A 4XOIA 4XUEA 3JVIA 5J2TF 2NVOA 3WLLA 3ZJ4A 1KYYA 5HRAA 1Z9BA 3FBTA 4YPVA 4XJSA 1TNDA 5ED4A 3EA0A 1NKSA 4RULA 3T0FA 1PNTA 5JJKA 1P73A 3Q3JB 4CKZA 1C1DA 4HFNA 5CDGA 1G9XA 1N0WA 2WD7A 5C34B 3SHFA 2XZDA 1O9HA 4BQPA 1PL7A 3K6SB 3G0HA 1SC6A 2OFOA 4WESB 1XTPA 2PIAA 1XQXA 5FYDA 3EY9A 3NBFA 2O3RA 1E1KA 5TPZD 3T15A 3M83A 3N5CA 1CZUA 1PKEA 2R65A 4REQA 3TQHA 1N6PA 4CLOA 2EW2A 3ORSA 1DAIA 1A82A 4ZKDA 1JG7A 1XP5A 4YR7A 3AVYA 3NOOA 2FZGA 3TFWA 3SE7A 4YRIA 1AH2A 3E4DA 1DINA 4RK6A 5EUQB 3WGKA 5MHTA 3IUYA 3TH5A 2CMKA 2PHZA 4S3MA 3BCUA 4GRIA 4UKDA 1QAMA 1E96A 2EKQA 2XEDA 2YMPA 3EPPA 3RRMA 4A3SA 4B87A 1JKFA 2AHOA 2Y3IA 3AEQB 3OPYI 4WMLA 3BFVA 3U7QB 3V2HA 5I4CA 5JYDA 3MM4A 2ZJBA 4JUBA 1K4YA 2P6MA 1DKPA 1V0JA 4NJOA 1X3LA 2PS1A 1J09A 1D09A 4U2GA 2Q3CA 1RBYA 3LH5A 4YI5A 4EO7A 1BD3A 2VXBA 2HWWA 1KJ8A 5MDHA 3TMYA 5JAQA 1DBWA 4S1PA 1NR7A 3KYBA 2ZVPX 2IY9A 3C6ZA 4JJEA 1PNVA 3VVMA 3K9WA 1G9SA 4CL3A 4DC9A 1USKA 3M0EA 1I4DD 4BN0A 1JLRA 2PBZA 3IE0A 4NSNA 4W5NA 4OKSA 4AQ7A 3HKEA 2BAGA 2P2SA 3N8HA 3UK0A 5AW6A 3TB6A 2MWMA 4NBWA 4B4WA 3HGTA 5M7EA 2YH2A 1TQHA 1WRBA 2JRLA 1VOTA 2ZIXA 2PUDA 4BDSA 3G2OA 3PX2A 4YT8A 2AN4A 1UBKS 2B69A 3VHXA 3V2GA 3PGLA 3IEMA 2R6JA 3N2KB 1ZM4A 4Q34A 2I4OA 2HSWA 1RJEA 1Q11A 1RKBA 1SBZA 2F7SA 2Q4BA 4X00A 2O19A 2IXFA 2W71A 3IKJA 3JATB 3LU1A 3A37A 3VH3A 1ZH4A 4EOGA 3LM8A 5CK4A 1UM9A 4BQNA 2FWRA 4ODIA 4BNDB 2FSSA 1V47A 1AQLA 3HVJA 1KZ1A 1GTG1 3DLIA 3GGPA 3LRXA 4EA8A 1OMOA 1OBVA 3G89A 5CTJA 2XUDA 4A6PA 4LVUA 2WMYA 4LVOA 3WOHA 4B85A 2V6IA 5BR1A 5F2NA 3C8MA 3GDGA 2YHBA 4M89A 1U7TA 3A1EA 3CRNA 1F2DA 1P33A 3I72A 1M34E 1H2ZA 4UHBA 1CJKC 3V7YA 4GZMA 4F91B 4YMVA 1I2BA 1AXRA 1SOMA 1UFRA 1EB8A 2XTNA 3LPMA 2C97A 2GM9A 1IIBA 2REXB 3GA7A 4BMSA 1Y1TA 5K3EA 1FMLA 1XVIA 1EVIA 4FHFA 3KKNA 4Q4HB 3LCMA 5BSUA 5K0SA 2WTUA 3T1TA 4D9GA 4DIDA 2ZWIA 1NOIA 1P9NA 2LIPA 2WV7A 3G5AA 3HLYA 3ROPA 4E51A 2HTFA 3O92A 3T41A 1A9PA 3VJMA 1GO2A 2GK4A 3O8OB 5DYYA 3KTOA 3MBOA 3ZWDA 4OG2A 2VK8A 4JUFA 3T5MA 2B8JA 1J42A 2W7TA 4ZAWA 1CNFA 4AU1A 3U26A 1M2GA 5EWJB 2A9KA 4DRXB 1SCKA 4RKFA 3T35A 1GVNB 2ZSKA 5JTTA 2VRCD 1RIIA 3GQBB 3PRJA 4QUIA 4KPYA 3BXOA 1FSGA 2XMDA 4BB5A 1G8JA 2Y0DA 1BOOA 3JTMA 3KT0A 4DW8A 1U6JA 2GRAA 4Q37A 3IEUA 3URMA 2MSWA 4JC4A 4JA2A 1ZNYA 3B7WA 3MW8A 5FA5A 1SA0A 1SBCA 1GZSA 1GNSA 1U8XX 2I8LA 2DCUA 2OD2A 2ZXEA 5DK4A 3GRUA 2JBHA 1QJ4A 3G85A 5DM0A 5E1MA 4IIEA 5KIAA 3WAGA 5J4YA 1MMFB 2J4DA 1L7VC 5JC1A 1TAQA 2AUTA 1ZWKA 2HGZA 2F1IA 2C7RA 1C8LA 2EW8A 4GUAA 2ZOSA 1KKUA 2R7MA 1RLMA 1HE2A 5AVVA 2Q2VA 1GKKA 4G9BA 1V11A 3SZGA 1ZGZA 2ZTSA 3L8FA 1K5HA 4UM5A 5AQEA 3H9CA 2XADA 3HFRA 3I5XA 4TQGA 4WCFA 3TR6A 3DDSA 1M5RA 1B6SA 2P1ZA 1BN6A 4GAEA 2PX3A 1MC8A 1K0UA 5HTKA 1J9ZA 3L41A 2IPLA 4WCDA 3MB8A 4K05A 2GB4A 3TZLA 3WSWA 3AF5A 3SEFA 1OILA 3D2AA 4DUGA 4KYIB 2ZJYA 5EJFA 3UK2A 4G65A 1JKJA 3HHPA 1G16A 2W11A 3W5VA 2FY8A 2QQFA 3PR3A 4MJXA 1ZRNA 1Z4IA 1DEKA 2F3PA 4Z3DA 2NXCA 1GT6A 2A1TR 1A7KA 2XBLA 3D5QA 2ZB3A 4L5IA 5IM4A 5CCXA 4YP0A 4I1RA 4AJHA 1WCIA 5FWAA 2Y93A 4Z7QB 2BWJA 1R18A 2ZI7A 3HFJA 3U4MA 3DQPA 1G41A 3RBZA 4C3OB 1S02A 2ZROA 1ZSYA 1ABFA 2O2ZA 3DP9A 3LT4A 4KZKA 5DLPA 4AC9A 4YGYA 4FB5A 3B1YA 5LU8A 3QKSA 3OQIB 3QMPA 2J7PA 3TFOA 4KACA 1MW8X 1NN3A 3BF8A 5AJZA 3WWCA 1U4NA 1LWNA 5IH3A 1MR3F 4DCJA 2XTJA 2I2XB 3BGWA 1BE1A 4GDFA 1OA1A 3EGWA 3UANA 3GK3A 3TNLA 4CN8A 3R0IA 1XN4A 3HXLA 3O73A 4M6WA 1BYIA 1ISFA 4O2BA 1VKZA 1ZK3A 5IJXA 4E13A 1T8TA 2GHIA 1H2AS 1MA0A 3IMKA 3X1ZA 3ZGOA 4EL0A 3L1IA 4IDGA 3TDKA 3GEGA 2M98A 5FF9A 5C8VA 4F72A 1H8HA 4P4GA 1D2AA 1YF3A 1V7CA 3UN1A 4FN4A 1P17A 4CLDA 1L7MA 1L7XA 1UM8A 4DQVA 5GOTA 2NZXA 3AKZA 1NATA 2QJRA 3V6LA 5KAPA 2R7KA 4JQYA 1E4EB 3BFJA 3PFNA 1U3GA 2XQKA 4XIYA 1KVQA 3G17A 7REQB 3C41J 3KJHA 3WBKA 5LLTA 3RVMA 2Y8EA 4CU2A 1OIWA 1T4DA 1FTGA 1P0PA 2F90A 1GYPA 2Y1WA 4OHOA 5K4AA 4D0RA 1KSHA 5EQFA 5DBEX 2W2LD 4OGKA 1DBQA 3A25A 5P8WA 1OFGA 5AI6A 4X8MA 1P1JA 2MU1A 3A4TA 1QYDA 4MS3B 1MVLA 1BA3A 3PQCA 5F78A 3HKDB 5BSTA 1C4OA 4ZYVA 4L7QA 1W2WB 5B1HA 1BOFA 1AGRA 1TC2A 4J03A 2BD0A 4RE6A 4YQEA 4HLUA 1ISHA 3VA7A 5KYWA 2QTZA 2VRNA 1FE8A 3G0CA 3NNSA 2VJAA 3TTWA 3ER9A 1F2UB 1Q77A 3EIOA 3D4IA 3OT1B 4QYXA 1J8MF 3PLRA 1DIRA 1ULHA 1UBRS 2F00A 3G2PA 2YNMC 3IR6A 2O59A 4RJIA 1P91A 2QLTA 2CBXA 3HBFA 4JITA 2Q2OA 3TZKA 1TO6A 1YUBA 5AH0A 4TVOA 2JJ2D 3ZK8A 2WT8A 4BGVA 4AKGA 2ERYA 5AVKA 2KM1A 3A4MA 3JASA 3LVRE 5TEWA 4CV3A 2XMQA 3UK1A 1LJUA 3ND6A 4BNXA 2V7UA 3FPAA 1YR7A 5LQJA 3LHIA 3R5SA 3RK4A 3WRYC 4QLBA 5C7OO 4BNJA 3R0QA 2H2FA 4ZVSA 4I8XA 4XD7A 2PTHA 3ZDZB 1ZY2A 3T4XA 4ZQFA 2RHRA 3TNFA 3NH6A 1P4AA 4PAQA 4C7XA 2EKPA 5FEUA 3RE1A 4AWAA 4BUZA 2JEYA 1P4GA 3ZV7A 3FOEC 4TKMA 1KMNA 3IUSA 3M5WA 1Q1GA 4JXJA 4K9SA 3FTCA 4XOUA 2DQYA 4KVGA 3P9IA 1D8AA 3U3KA 4RPKA 1L4KA 5JY1A 1ZXXA 2HNKA 3AR2A 2YS6A 3LFHA 1TF2A 1P77A 3FN4A 4Y9TA 5EP3A 2C4KA 1AA6A 3ER8A 1VGRA 2XWBF 1COZA 3S7ZA 2NW6A 1V1MA 1YRAA 4P4UA 1JSZA 3PLAE 4Y2JA 3JQ8B 4ARCA 3WWEA 1L5RA 4JBGA 4DGQA 5IKPA 1G6Q1 3RUAA 3A6HA 4C03A 4R8RA 3V4ZA 1P7WA 1N2ZA 4YP9A 1S8OA 2Y6UA 1C3EA 3EZ9A 2PUHA 1AT1A 2QTTA 2VDVE 2VJMA 4CG1A 1XTKA 2VJDA 4R2HA 3M1IA 1CQJA 2GPWA 3JQFC 3IPYA 5AFSA 1BJTA 1HYQA 5E1BA 2UAGA 1QCDA 4GRDA 1JAHA 3OEHA 3VPFA 4BO7A 4C6TB 1FIUA 4P2GA 1MAUA 2DP4E 4OLHA 2ZI9A 2JGKA 1W4LA 3AR5A 5JOQA 3DOFA 2EGUA 2HO4A 3E2IA 2WPNA 3AF0A 5ENDA 1D1QA 1Z34A 2FQQA 5AI5A 4BBAA 1RP7A 4HXYA 2WUEA 5BXYA 4O4JB 1ADFA 1JV2B 3AIIA 3CWCA 3N28A 3W77A 3GW8A 4FWBA 2PA0A 4MV8A 3NKVA 4MVJI 2L2QA 1NLZA 2DLNA 3JALA 5CT8A 3BJEA 3V6MA 3AHFA 1VP3A 2BY4A 1XRSB 4KO3S 3JPWA 2ZIAA 2QU8A 4BP1A 4CLRB 3QJGA 5IAJA 4DANA 1RKQA 3H2ZA 1MQAA 4MGKR 2IUEA 1NVVR 2GPAA 4PNZA 4D7AA 1QQAA 3PIDA 2VCYA 4WDQA 1ULZA 2XTAA 3V7UA 3OQ6A 4HVTA 1N2CE 1TM5E 3HGMA 4CMHA 4OXKA 2BFPA 2XIQA 3I6IA 4IIGA 4KW7A 1WA5A 4Q3EA 2V7QD 2CFCA 2F4VB 3KVNA 2MCFA 5JYEA 3N70A 3O5AA 4U00A 4FONA 3EF1A 1T25A 3TBKA 4HYQA 2JLAA 3UMVA 4CFYA 4D8YA 4CMGA 1E3TA 3A9SA 3MSXA 5EZSA 5HIMA 3GROA 1FX1A 4L85A 2TMGA 3RF6A 3LG2A 2QRHA 3NPMA 3ETLA 4M9UA 2COKA 3QYAA 4WAUA 4JKYA 5KNDD 3JD2A 3NRCA 4PC1A 3PEVA 4B4VA 1DBSA 1WW2A 2JI9A 5LA6F 4UXHA 3K9NA 2PX2A 1ULBA 2OL4A 1L5ZA 2PVSA 3N3BC 4M0UA 1II8A 4QBHA 1G0OA 2BEKA 3UV7A 1SCDA 5BW6B 1EU1A 3BK2A 2YVAA 3BMOA 3DR3A 4JQOA 5ALJA 4K9OA 4HWGA 1ZMRA 3PQDA 1Q0SA 4LHYA 5GIOE 2R11A 2B36A 4NMLA 4YEDA 3FKSA 1K5PA 1TIKA 4F11A 3OEED 1FVXA 1TD1A 3H42B 1U7ZA 4MAMA 2HQSA 2O8FA 1KI6A 4FC6A 1BSVA 3MCWA 2G6TA 3WIOA 2GXUA 2QN7A 3DM5A 1LJLA 2JZNA 5DTIA 5CM2Z 3VPCA 2A58A 2FMIA 3RFTA 2PX8A 1XA4A 1ECCA 1TC1A 1XT6A 3CU5A 2AMJA 2P2YA 2IODA 3CX6A 3IAM6 3JZDA 3SZ3A 1KS9A 4ICIA 1CRLA 2GF9A 2CLSA 1EDZA 2I4IA 2A78A 2QD1A 5IFLA 5DGXA 3VGPA 3W7VA 3RPEA 4AG3A 2FF5A 4LCBA 3BD9A 1QSGA 3W0LB 4BMXA 4PLZA 5CRIA 3AGPA 1JBKA 1K7FB 4UAUA 5K20A 3UAGA 1MIOA 4KXWA 4LBZA 4XCXA 1M2WA 1G38A 4EEKA 1OY1A 2P4SA 2XRMA 1YZQA 2FZCA 1UWVA 1KO5A 1ISJA 1LS1A 2EBWA 1TVCA 2P9EA 4EI7A 2WT9A 1XTVA 1C3OB 1GRCA 1JZTA 3AMVA 3V7WA 1IEWA 5ITZA 5G1OA 2QM0A 2EJVA 1KC3A 5CA1B 4EP1A 2QVLA 1J0EA 3OIWA 4MV7A 3UIEA 4TTRA 4W9MC 1M33A 1IM5A 5KZMB 2GXSA 3GJ7A 1EFKA 1RP1A 3UVEA 2Z8YM 4NYIQ 3MEQA 5FAXA 1W52X 3U7RA 4OAPA 4DCVA 4Y2SA 3ZW9A 4C7BA 2ISSD 3RIEA 1VJRA 1C9NA 1UT5A 3BBLA 1X0XA 1OIVA 1WG8A 3IAS1 1WZCA 1YBVA 1YB7A 4G1CA 1DFGA 4EQZA 4QPJC 2C5FA 4AG5A 4AY3A 1H2BA 1ZISA 3CX3A 4CF7A 2JL1A 1LK5A 3KFVA 1UBCA 4XIFA 3NJ4A 4ZO9A 3WWZA 3ADCA 1FMFA 3GGOA 3H9JA 3UHOA 1U8TA 3A3OA 3TCNA 1YFKA 3LDHA 1V3VA 1N9GB 4R2IA 3RJZA 3UAWA 2HCFA 2YVUA 3FPFA 3IKMB 3QOXA 4GP6A 4WY2A 3SDBA 1RE1A 5JRDS 5KJ6A 3PDJA 1XOIA 1MB0A 1I7SB 1O3YA 2R25B 3FZQA 3FLEA 3QWIA 4MKZA 5FBLB 2ZRIA 4Y2TA 4BBPA 4DCSA 1KPGA 2XRFA 3PPYA 4G09A 3JY6A 3VO9A 1G5RA 4E2FA 3IPCA 1IC6A 1BU8A 4TMVA 3ZNOA 2Z0MA 2GBPA 1MUUA 2OC9A 2O7SA 2VATA 1I5EA 2Q5CA 2CJXA 4EPWA 4JT4A 2VP5A 3FUVA 2BFMA 2IWRA 2O1EA 3UJDA 2ZJ3A 2ON6A 3K8OE 4CQNA 3QHAA 5AKEA 5K2MA 5AVYA 1N36B 1XTIA 2V0GA 2TMKA 4WDRA 3RK0A 3F5DA 4BX0A 2R1TB 1LI5A 5IS2A 1LF0A 1W88B 1Z38A 2WHEA 2WM9B 1T24A 5DTMA 1VXRA 5GP1A 2Y1OA 4JWTA 5IUNC 2GD0A 1FTQA 2HMTA 1AS0A 1TQ8A 3BEOA 5D85A 4NFYA 2PUAA 5MN5A 3EZ6A 3GVPA 1X86B 4K26A 4BFVA 2V7WA 4AJOA 2CXUA 3KBOA 2KI5A 3Q3GE 1H69A 1OE0A 1BC5A 5DX1A 5JSQA 4G5FA 4O4LF 3KQSA 4TRMA 2FCRA 2O8NA 1JR3D 2X5KO 3EQZA 4B45A 5KOIA 1QP0A 1B14A 4IOMA 4LK3A 3KWFA 1RWNA 3CSDA 1U8ZA 3JQ7A 4L8WB 5TRTA 4DB2A 4NVRA 3HKBA 4AVYA 1U28C 1QIHA 3FCCA 1C0LA 3NBZC 5B1DA 5LZ7A 4RKWA 2W6QA 1BGWA 1DIHA 2GYVA 4C0WA 2P75A 3L1HA 4B8ZA 1VCIA 1E2KA 5T4FA 2C3YA 2NZJA 2IHJA 3I9OA 2JHAA 3A05A 1NHGA 1B6GA 2QE7A 2VPIA 3MJCA 3G2IA 3OG9A 2HV8A 9ATCA 3OM0A 3W7BA 4JI2B 3GVHA 3ECCA 3KYJB 1ZGHA 5AXCA 3NP7A 3ZVRA 2MOKA 2PQ2A 1CY4A 3LCRA 2AFVA 5BMVF 3THYA 3UK6A 1X7GA 2J5BA 3GHYA 2X7HA 2FSPA 3K35A 3PQ8A 2DY1A 3PUKA 2JIBA 1P0CA 5CLGA 3UGKA 4ALLA 4IV8A 1OBFO 4XXHA 2XCTB 3IUNA 3KV3O 2OQRA 1HMPA 1TUIA 1U2GC 2D2FA 2G0NA 2OVBA 3B89A 3HEMA 4KN8A 5AM4A 3DEKA 3R3JA 2EL7A 1GPBA 2E4WA 3MXTA 2KWIA 3ESBA 3FUTA 3MTAA 3UMFA 1SFRA 1DO8A 2Z6VA 4DCPA 1Z5UA 2V3WA 4F6CA 1ZYUA 4G6ZA 1NX9A 2W0SA 1SQ6A 3CLKA 5EJMA 4M8NE 3I6QA 4N6NA 1AV7A 1YOVB 1X1CA 4U2BA 3VU9A 2ZYRA 2HAEA 3ZD9A 1ZM9A 3F78A 2QLLA 2K4MA 4CCWA 1JDJA 2Z6UA 3BGSA 3RI3A 2WJ6A 1BWRA 2IHYA 2BGMA 3BGIA 4ZYWA 2O8CA 3DT6A 3GLFA 1Q84A 3TJRA 2EW1A 3HWSA 4ZC8A 2NU7A 4EWLA 2GHQA 1GYRA 4WKOA 4XQGA 1IEQA 2YRWA 4GO1A 2OGZA 3H3XA 3LUBA 2RARA 4WFIA 2WI8A 3OCZA 1ORIA 1WCV1 2QENA 4N54A 3IS3A 3O8CA 5I7SA 1TUGA 3I73A 4UHEA 1OTYA 4BCBA 1GQYA 3QOFA 4FEGA 2AFIB 4HK4A 3SE0A 2GF2A 4LXGA 4BNKA 1RXCA 1ZH2A 3PUXA 4JYZA 2R3SA 5BSKA 1XCJA 2Q5IA 2YJZA 5KTPA 4FZRA 2YQ4A 5BNTA 3WWPA 3DVAA 4OMUA 4IJMA 3JQBA 4DY4A 3PNMA 3EGVA 3PQEA 5BUCA 5C18A 2Z08A 1ZM7A 3QBJA 4MB6A 3U39A 4UHFA 1JLLB 5DOVA 4FYPA 5HQTA 1MHTA 3GFFA 1NJGA 1NW5A 3SQDA 2ZBQA 1T9DA 1NVVQ 2ALJA 2VS1A 2WD9A 3T7DA 5I9TA 3TG2A 2DWOA 4KJZA 3QPBA 4JU8A 3VR6H 4HJXA 3N8KA 1EUCB 5JVDF 1SG9A 2C2HA 4JY7A 1MVNA 3GFQA 4YRMA 1SVNA 2XKJE 4AG6A 2Y68A 3FZGA 4HB0A 1N9ZA 1R6DA 3ETJA 4EI2A 5F77A 3T12A 3BERA 5FPQA 3VJRA 2FEOA 5REQB 5JXGA 1XV5A 3IQZA 1YI8A 3JZMA 4DV7B 1LI7A 3NDIA 1IXRC 3D1LA 3TBHA 3UMSA 3I2JA 2X41A 4G8DA 4AL4A 1NC1A 3BKXA 4J3NA 1N3YA 4GYYA 4ZALA 1LLCA 2HPVA 3M4NA 3RKSA 4F6RA 3IUJA 4L5JA 3QXSA 3M33A 4NNJA 3NJRA 5JJ5A 5DM70 1QQBA 2HK6A 3HN6A 1MXFA 2QL5A 3FCOA 5E6UB 3DZBA 5DSZA 3PTAA 3HXOA 1Y4SA 2JLXA 4NU8X 2P69A 3PNLA 3SJZA 1ZMBA 3D59A 5DTEA 2RGCA 1EGMB 2E82A 2ZUCA 4Z4FA 1BS9A 1OZ0A 1QIEA 3NHBA 5HOQA 5FOWA 1MAHA 2R1VA 1GADO 1NBEA 1GPDG 2ZBEA 3RSQA 5LMNB 2W2MA 1LRJA 3ANSA 3H83A 5JSUA 1X2EA 2BFAA 1XRMA 5KYVA 4R0VA 1VB3A 2P5UA 4MR9B 5B53A 2YKGA 3KG2A 3TCKA 2QDXA 1AK1A 4E5UA 4NFLA 2R9VA 3OTWA 3RLFA 5KJ1A 4YCCA 2UZ4A 1XA3A 1WUTA 4HPXB 4LJ5A 3DSRA 4Y2QA 4L8FA 3CEMA 1WDTA 5CFPA 3HWX1 3H3FA 4H1WA 7GPBA 3K6JA 3H8SA 2QWXA 1X6VA 3P19A 3TXYA 4DIFA 1GILA 2ZS7A 2Q5EA 4DLRA 4EM6A 1V8OA 2O0MA 1WXEA 2A4KA 1U63A 1FNSA 3DVSX 3TJMA 1G8GA 1CJUC 2OYCA 2N0SA 1RYZA 1JFVA 1K8YB 1TKAA 2A1TS 2OBNA 2QR5A 3E3LA 3EVCA 1NQAO 4MWDA 5E7IA 1CS0B 1UH5A 3JWIA 2Q6VA 3TI7A 5BRAA 1T9BA 2PGLA 2SBTA 1E7RA 1LKZA 4FFMA 2Q3FA 2ZQ5A 1OLUA 2ZJ7A 2CE2X 2ZRMA 2ECFA 2O0KA 3BDAA 3HP7A 5EQDA 5JD3A 1JPUA 4Y8VA 4BZPA 2FE1A 3EHEA 3LSTA 5G3ZA 1X0VA 2CMGA 3PK0A 4QQKA 5KVCA 1UP7A 2HCTA 2J32A 1B16A 2AQ8A 3WYCA 5ECDA 1QHFA 3GP5A 2I4NA 1RM3A 4BQQA 1QP8A 4N1AA 4OV6B 3UYLA 4R54A 5KWVA 4RIIA 3BBPA 2C82A 3RF7A 1ZUWA 5E7JA 3AINA 4LQDA 4MLPA 4ZT3A 3UKDA 3VZPA 5KTNA 2F8TA 1NNLA 2I65A 3C3KA 3OWXA 3UKOA 4C7OA 1FDTA 1E2PA 3JYNA 2B4AA 2C5SA 2GHRA 2HL6A 3QX7A 3T9CA 4PSUA 1JLHA 2OV2A 3Q4GA 3ZIUA 4U7HA 5FBKA 1H0SA 3KQLA 1U9ZA 3EXIA 3PRKE 2QRZA 1QGUA 2M32A 3TPZA 1XZBA 1YJBA 2JAHA 3OTHA 5EXXA 3ELWA 3D6UA 3RJTA 5J5VA 1TF5A 1QIFA 2ID7A 3LQYA 5SY4A 1XGKA 4RHUA 2VNSA 5LQMA 5FADA 5F51A 2BI7A 4IJWA 4GSKA 2JI6A 3PNSA 1OU0A 1NYLA 1JPVA 2FP3A 2GN9A 2XUGA 4RE5A 5JS6A 5CYFA 5C8XA 5DVZA 5KDDA 1LZKA 1V39A 1EDBA 3D4LA 3M1LA 1KEEA 1FDRA 1FP2A 2O7RA 2VDQB 3HCFA 3FUWA 5EYPB 1CERA 4LYEA 2E18A 1V16A 4XPIB 5JNUA 4TMTA 3HBNA 1RRMA 4A8HA 3WQBA 2YZ7A 1LSOA 4DMLA 4Z7NB 1NI4B 4FOLA 3KQQA 4LRTB 3QE3A 3H5VA 2WIBA 3ZIAA 1YR6A 5HQ3A 2YHSA 2PH7A 1BGVA 3A1FA 4W9NC 1JVNA 4RWEA 1F06A 2IKQA 4J8PA 4L4YA 4KO1S 4YDRA 3VDRA 3ZZMA 1FSSA 1KFBB 2ZRAA 3CF0A 1RAAA 4Q6BA 4DJEC 2GEBA 3ZTWA 4JSTA 3L5OA 3IIKA 3EJWA 4YQFA 2FPPA 1A72A 2C4TA 4P7GA 4P93A 4R0MA 1BWQA 1YB5A 4FOTA 3P9ZA 4Q9LA 1KMQA 2ATVA 1PGJA 1UMDA 2EBFX 3AERA 4TMZA 3WLEA 2CJYA 2MYPA 2XJ9A 3LBHA 4LAFA 3WB1A 1QZUA 2PX6A 5B6PA 3OZEA 1KETA 4EW6A 2F48A 4XCQA 4V1CB 1O8BA 1AQNA 4G37A 5I7VA 5KVAA 5IJ0A 1FMCA 3CLTC 5AR1A 2NTYC 2C7BA 1CLEA 4WZAA 3OZWA 5K8UA 1UJNA 1QRRA 2BM1A 1QHYA 1DAFA 1NQOA 1ZNWA 2R97A 2ZJOA 4EYEA 3OCXA 4P0PB 1PDVA 1B15A 2FOXA 3BA1A 1KYWA 5ILGA 3KE8A 5C1DA 4ARAA 3AONB 4Y9SA 3R7FA 4C29A 3WNBA 3HVIA 2OWDA 3K20A 1D7OA 5C81A 3LUHA 1RC1A 5ECYA 4PFQA 5DBHX 4F56A 5CHEA 3GLKA 1BHO1 1T8YA 4RKQA 5K3AA 1E2MA 3QRWA 2RCNA 4IZHA 5JRZA 3JVUA 1USUA 2NYUA 4JEMA 1TGYA 1T29A 3QEKA 4DDVA 2FOLA 1BCRA 3KTAB 1TAHA 2IEYA 4PAOA 1UWLA 3LVBA 3ASYA 5B3LA 2HPZA 2P9CA 5CMLA 4EFNA 5KC9A 1YS7A 3T06B 2D1RA 4O2LA 5J5CA 2Z2JA 5EC8A 3DMGA 4RSRA 4NH0A 4P80A 2JGFA 3S8MA 1PJ2A 3EGOA 3NIBA 4GG1A 1EK1A 3DVQX 4NHEA 4O1MA 1ECBA 2SECE 4IAOA 1MJ5A 4ZT7A 3D6VA 2OFFA 3RIGA 1YA6A 2FKAA 3FHLA 4PYKA 5FWYA 1VHWA 3TI9A 2QJFA 3C5CA 4GGMX 4GMXA 1KO7A 4M0LA 2PH3A 4HXFB 4MKHA 1IB0A 3U0VA 1CC1S 3V1YA 1W19A 3HS3A 4ACAA 1RC8A 3OJ0A 1X1BA 3A58B 5CM8B 1PGQA 1U31A 3EEFA 4G97A 5L7TA 2I0FA 1O4VA 3EGXA 4QGBA 2PBRA 1E3QA 2C2GA 2E1PA 4UNRA 3A0RB 3NYIA 3VAZA 1NW3A 3FYDA 4LY3A 1E2QA 1JG4A 3FYUC 1CZKA 1YJAA 2DFKB 2YIDA 3QE9Y 3SVZA 1ZSNA 3BQNB 3OE5A 4XB2A 4OSEA 3RS9A 3R6TA 1RQXA 2H51A 1OSNA 3L77A 5EHIA 2Z6QA 4BFSA 1JH8A 4IJ5A 5DCWA 3VZQA 1OWMA 1PK8A 1ZBQA 1YBFA 2GCNA 4EG8A 4L73A 1XVVA 5DT9A 3AIKA 4ML3A 4LDJA 5A5EA 5IH7A 1G2PA 3E70C 3IESA 4J6FA 3CX7A 4X1OA 4YJHA 4YV2A 4CKBA 1NVUQ 2BZ0A 2O7VA 5SZIA 3W5BA 1M2HA 1N75A 4QFBA 1NQWA 3A3YA 1Q1EA 1WY5A 1TM2A 5GJVC 4MA5A 1JRLA 5BSFA 4KWTA 3CT4A 1T3GA 4L2IA 2JKYA 3IODA 5LOVF 2SHKA 1CWUA 3KSRA 4OJMX 1U99A 1EBFA 2J87A 1IUNA 3DZIA 1JSCA 3HVHA 4XUDA 1DEAA 3IXLA 1VMEA 3LYLA 4IOKA 4PG7A 3SF8A 1WF3A 4X91A 5LBTA 4JI6B 2QZ4A 1XCPA 1TEXA 2QAGC 2QAJA 3JQEA 2QJTA 3AJAA 3R3UA 4BNUA 5B2EA 1UWCA 1J97A 3KV1A 4H2DA 2M6SA 1E2JA 1GDHA 1YMQA 2REQB 1DRJA 1XWWA 1YS6A 1ZKDA 3DLTA 3FCSB 4WADA 4COOA 3RYHA 4CR7A 1NZDA 3UB3A 4GYWA 4OBBA 5DGIA 1TUBB 1JI0A 1VP9A 4RZ3A 3ZWNA 4IUBS 3TQFA 2IDZA 4PX2A 3IE2A 5B3AA 2JJ1A 3G2KA 2XR1A 2NVUB 2H17A 3VO8A 3ZXUB 5JR3A 3T1QA 2W2TA 2EJCA 5DM60 4ZYUA 3NFRA 1O96A 1N1GA 1GGEA 1O2DA 2YVKA 3HB4X 3FSEA 3N7TA 3NHPA 3UH1A 2YV5A 4TKVA 5JZMA 2NT4A 1Q91A 4ZOBA 4QTXA 1E2NA 3FZYA 1T1EA 3BUSA 3DNFA 1C41A 2R48A 3L0SA 4N5IX 3AI1A 3IDZA 5A71A 4PSAA 2P5YA 4PS1A 3RS3A 1D5WA 4AMZA 1GLGA 4IMRA 5KYYA 1NXSA 2FWJA 3HYTA 4E4RA 3M8KA 4KG7A 4MQ4A 5GJCA 1YVUA 1Q7EA 4QATA 5G53C 1FSFA 3ZWBA 4IP0A 3Q2KA 3G0BA 4XH9B 3TX2A 3ADKA 1OAAA 3BGVA 4AMUA 2G63A 4J1NA 2WK1A 3DFKA 4AQDA 5AXAA 3TLGB 4DDKA 3ZVKA 1NFRA 2X5JO 2F9MA 2ZR8A 1GNPA 1RYFA 2I6SA 1NN5A 3I6MA 1ESDA 3ZY3A 4DSZA 3HJAA 1B3RA 1KQPA 3ZEAA 4ZK2A 1SHZA 1BW9A 3E27A 1LW7A 1V7PC 1T5LA 2QX8A 4KNWA 1T2NA 4PFKA 2O0JA 4OHYA 1NQUA 2I9KA 3H04A 4D26A 1N0HA 1KE2A 1P1IA 1T15A 2GEDA 2RHCA 1YRLA 4XSVA 5EP1A 3QTBA 3FYUB 2EERA 1XJQA 1JQLB 2XD4A 2VIIA 4WNIA 4Y6RA 2NV0A 2AOWA 3PNPA 2I2DA 3ZDRA 4DA8A 4F9TA 4MA0A 4DLBA 3KJGA 3W6OA 5D1HA 3WKAA 4H7FA 2YUIA 3H1PA 2NNWB 4U8HA 2G4CA 5DT2A 2G5TA 4D4IA 3K53A 3U4IA 1J24A 4X9XA 1HURA 3ZWYA 5KTRA 2CK3D 4DWJA 2VTBA 3FGZA 1P0MA 1L5NA 2YV1A 3VYTB 4A91A 5JSKA 1RYEA 3WG9A 3A1DA 2CHVA 2X0NA 2R6ZA 3D3JA 3BHIA 1NOKA 2ID4A 3HN7A 4HN2A 3TTYA 3VR6A 2VHWA 1Z2DA 4RVGA 4HAXA 1BX3A 3WIUA 4DG9A 1ZK2A 2Q8QA 3ELDA 3L3BA 1EAYA 1PTJA 2QTHA 2AUNA 3DBOB 4Y6GB 5CK5A 2DWPA 3VR1A 5AW2A 5MN6A 3LPCA 1ZUIA 1K86A 2QG6A 3EASA 2QAGB 3MCZA 4G5XA 4LA4A 1R3UA 4QUKA 3WIVA 3AJ8A 4YECA 5B55A 3MTGA 5JQWA 3MA0A 2QV0A