4RHUA

Crystal structures of mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
180
Chain Sequence
QTAELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRETTGQDLLLITVLKGAVLFVTDLARAIPVPTQFEFMAVSSYSGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase Hpt
publication title First Crystal Structures of Mycobacterium tuberculosis 6-Oxopurine Phosphoribosyltransferase: Complexes with GMP and Pyrophosphate and with Acyclic Nucleoside Phosphonates Whose Prodrugs Have Antituberculosis Activity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase/transferase inhibitor
total genus 50
structure length 180
sequence length 189
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rhuA00
2H06A 1VCHA 4MB6A 4LZAA 1I14A 4X45A 3O7MA 1ZN8A 3MJDA 1QK3A 2PS1A 1U9ZA 4P84A 4WMLA 5IAOA 1A96A 1GPH1 2P1ZA 2JI4A 3ACCA 5KAMA 2JKZA 3GEPA 4RHTA 1GRVA 1IBSA 2GEBA 3GGJA 5K51A 1J7JA 1WD5A 3OZFA 4RQAA 1A97A 1STOA 4M0KA 1DKUA 2WNSA 4P80A 5BSKA 3LPNA 4LZNA 1ECFA 3N2LA 1HGXA 1XTTA 1JLRA 1QB7A 1I0IA 1DBRA 1QK4A 4RADA 1P18A 4QYIB 5BQOA 2PRYA 3ACBA 3GGCA 1P19A 3H83A 1U9YA 1Z7GA 4RAQA 2C4KA 1QB8A 3OHPA 4RABA 1UFRA 2YZKA 3DAHA 2IGBA 1NULA 1XTVA 1D6NA 1ECBA 3LRTA 4QYIA 1LH0A 4RQBA 1DQPA 1TC2A 1O5OA 4WN3A 4S2UA 4RHXA 1NONA 1BZYA 4QRIA 2XBUA 1XZNA 5ESWA 3OZGA 3HVUA 4ZFNA 1VDMA 1ECGA 4P83A 1VSTA 1ZN7A 4IJQA 4RANA 5BQPA 2H07A 1UPUA 4PAWA 3NAGA 1G9SA 2JBHA 3S5JA 4X44A 1TC1A 4KN6A 4FYMA 5JSQA 1AO0A 2HCRA 4Z1OA 2VFAA 1YFZA 1CJBA 1A95A 1QCDA 1JLSA 2H08A 4P3KA 4TWBA 3KB8A 5BRNA 4P82A 3DEZA 2EHJA 1W30A 4M0PA 4OHCA 3G6WA 1UPFA 1QCCA 4PFQA 1A98A 3M3HA 4F8EA 1G2QA 3EFHA 1BD3A 4JLSA 4LYYA 1HMPA 1XZ8A 1ECCA 1A3CA 1L1QA 3ACDA 5HIAA 4LYGA 5JV5A 1P17A 1ZN9A 4RHYA 1V9SA 5ESXA 4RAOA 4RHUA 5HKLA 5KAPA 1L1RA 1QK5A 2JKYA 4M0UA 1DKRA 3DMPA 1I13A 1Y0BA 2E55A 5E38A 1I0LA 4RACA 4JITA 4P86A 4RV4A 1A4XA 1BD4A 1MZVA 1FSGA 1XTUA 1I5EA 1OROA 1PZMA 1P4AA 1DQNA 2PRZA 3QW4B 1G2PA 1OREA 5IPFA 2FXVA 4P81A 1G9TA 4LZOA 3MBIA 2AEEA 1O57A 1ECJA 5EUCA 1R3UA 2DY0A 1OPRA
chains in the Genus database with same CATH superfamily
3O83A 3W8FA 2JAOA 5DP1A 5DTIA 4Y2TA 3WRXC 5B6JA 4W9MC 4BWYA 1O97C 1PV2A 3O7WA 1HF3A 1F4LA 3CSSA 3SDZA 1P73A 4IDFA 4XKJA 5DCUA 5JRZA 4MVXA 5IUJC 4NPAA 3L4BC 2WKSA 3NORA 4HAXA 2BEUB 2C3YA 2JI4A 3F49S 4H3KB 4HF7A 2WEKA 4YJ2B 4DWJA 4L8FA 1OZAA 2Q3EA 3HSYA 5K3FA 4BO3A 4ME6A 4PGHA 3P32A 5CBPA 1OR8A 1AE1A 2YXPX 3LBAA 3V3KA 3AILA 4XPIA 3V3TA 3WAJA 4ABYA 5JC1A 1Y4SA 2PD3A 4CTKA 2C07A 5KNDD 2GVZC 2EW1A 4ZQIA 3N6XA 1HBJA 2ZJZA 1AZWA 4GLJA 3HSSA 4FQ5A 4Z9BA 4DMHA 2A7XA 5AUPB 2AJLI 2VHXA 4YAOA 5T3UA 4HDRA 1V11B 3DGFC 2IEDA 5LQMA 1FMFA 2R62A 2V1XA 2QRLA 4HDMB 5A05A 3HJAA 4S0ZA 1L7NA 5F1YA 5B6PA 2AMJA 3THXA 4EFKA 4WFIA 1TZ2A 4AKTA 3ESCA 4AYTA 5IKPA 1I94B 4I55F 4FGUA 4PYQA 3ZDZB 2CNNA 5AQ1A 4GRIA 4U7JA 1XBTA 3HE3A 4FR2A 4RDXA 2CFOA 5IKXA 2EC5A 4EBBA 3AEXA 3L5OA 2W6PA 2XXBA 5ICCA 1KHTA 5FNVA 2OP1A 3A9UA 4GF5A 4BV9A 2EIXA 5DSXA 1N33B 1G1AA 2YJ4A 1DIOB 3PD7A 2FEAA 1N6NA 3RTBA 1SVLA 2DLDA 5IJ0A 4DLVA 2A0XA 3PQCA 5HM6A 1K8XB 2X2PA 2YWCA 2XVXA 2BPOA 4OA5A 5F23A 1DTWB 5E4FA 4F92B 1DFIA 3OJOA 3KLBA 3UH1A 3T41A 1LSOA 3BMCB 1ZZGA 2VAVA 4QM7A 1LFDB 4AZ0B 3R77A 2HEIA 1BG6A 3V8PA 5CVTA 1TCBA 2VCYA 2HF9A 3G1UA 4K40A 2G83A 1IDOA 3N28A 3RC9A 4TTQA 1YHNA 1YZTA 3AUXA 1Z06A 2ZYTX 3ZD9A 3QFSA 4GMHA 4BAGA 3D2LA 4LZPA 1QYIA 1XDBA 1NUSA 1ZD3A 2QQEA 3CE9A 3GQBB 2X86A 4RTSA 1V6AA 4UDYX 2H9YA 2ZE6A 5DBHX 5FBZA 2RHBA 5C0OE 1D8TA 3I0MA 5AW7A 4CQMD 5DHPA 3FLEA 1H3NA 2FW6A 2VDPB 3QGMA 5KWSA 1N9GA 1Y6FA 4MUIA 1K1EA 2IU6A 1MJGM 4LFAB 4IGAA 3RVRA 5A3QA 2M6SA 1GQRA 2AMLA 2C59A 5DN6D 1Z5WA 3A3PA 2APJA 3C7AA 1L5OA 2WTNA 4WW0A 3T3PB 4AMUA 4EI2A 4DV0B 4WKOA 3N2YA 2V9ZA 1TVMA 2A33A 3KPVA 4R0NA 2VT2A 1RWQA 1QE5A 3EFEA 2VYFA 3T5CA 2WIFA 3CNLA 4QPPA 4WD3A 1KI9A 4G4IA 3WNBA 3EXEB 4BO7A 1WDTA 1XRSB 5GMOA 3TZEA 3TIFA 1ULZA 1Z07A 2O0MA 3K0CC 1AKEA 1YOBA 3BZUA 2VUUA 3P97A 5SY4A 2J0VA 2JBAA 2P7IA 4OYHA 1WHSB 2JLQA 1PJAA 1OLUB 3VTFA 3R0IA 5BY2A 3HCBA 4LN1A 3HY6A 4CKWB 5BQFA 3MCAA 4PPNA 4AMBA 2RGXA 1ZM4A 1EZ1A 2HWKA 3DO8A 2Q07A 3F78A 3LIPA 3CX6A 4H3SA 1B8PA 4F60A 5MGBA 2IYRA 5F3DA 3W1WA 5AESA 3RAEC 4WKGA 5H3LA 1UFVA 3ZCXA 4O0MA 4PAMA 4JOBA 4LXTA 4F86A 1YR1A 4DDVA 4GVPA 1L7OA 1SUAA 4XI9A 3ZQ6A 2X9LA 3QE0A 2PX4A 4ALIA 5D00A 3ANNA 4RD6A 1OZGA 2CLKB 4UC0A 1TF7A 3PF9A 3IP9A 4NARA 4OMUA 4TKVA 4GU5A 5CIYA 5HQ3B 5A3JA 3L6OO 4RABA 4NNOA 2DUMA 2PV7A 3NP9A 1JBQA 5BO5A 4BY9E 1GFZA 4MCJA 4JLDA 3NBKA 2XNCA 3HKBB 3VR3D 1W85B 1J00A 3GJSA 4HQLA 5CLGA 2FSGA 3DZFA 2HUNA 2ZTUA 3GAFA 4AIRA 2QUZA 2HMVA 2NG1A 4FKMA 5EINA 5TB5A 2R84A 4BO0A 1EIWA 4OQPA 2OAP1 2VDLB 4J03A 3RYIB 4B4KA 2AT1A 1UWKA 2FJUA 1ZFNA 2QLNA 4PAWA 5H0IA 5JEDA 3D81A 2JLBA 2PMFA 3R9IA 2WUDA 4B6JA 4IOKA 5LMNB 3EGXA 5AVJA 1EPUA 1DWOA 1LA2A 2TS1A 2VBIA 2RSLA 4QBGB 4TWRA 2HK8A 3MOIA 4UHKA 4PZYA 3PU6A 2CXNA 3A05A 2MJLA 3P2IA 1KVRA 1FTWA 5E6SA 3TECE 5EN4A 2V4UA 1QGDA 2Q9UA 3W2GA 1EAMA 1D2HA 1C8LA 2XEXA 3AUYA 3VSAA 1P8AA 4FONA 2J6HA 3OHMA 4C22A 2C04A 4QBIA 3LP5A 4X94A 1X7YB 2H31A 3GPCA 3V80A 3PUVA 4E1BA 2QGNA 4LF5B 4PLFA 4MIOA 4IHJF 1C7IA 4EP1A 3OZWA 4BTVA 4KK4A 4ZALA 3K6JA 4C0BA 3H5RA 3F74A 1E6WA 3MWEB 2J5KA 4NBTA 4NFLA 2F4VB 1XCGB 3N6RA 1ZIPA 2ZBRA 3O2JA 2VIIA 5JBQA 1ZMTA 3A04A 4MPTA 4UPDA 2XDQB 2ONJA 4O2AA 4ZVKA 3PLAE 2GN9A 1RACA 1IOLA 5DTJA 1XO1A 1JEDA 5EG5A 4QG3A 4FXPA 1ZRHA 5CEFA 3R6WA 3ELUA 2PKCA 2V8BA 3TOXA 3IP3A 5LL6P 1RBZA 4AB1A 1XRPA 4RACA 1T6XA 2WD7B 1EI9A 3KHTA 4GEGA 4B9AA 1E3QA 2F59A 2GLUA 3AG6A 3KFVA 3OE4A 5DX8A 2IEZA 2CNLA 2RGUA 3QXGA 4QOFA 4URFA 3ZLTA 2H54A 1GNLA 1N7HA 3FFTA 3PQ7A 4UOZA 3CUKA 1YHZA 3B1FA 3G9UA 3U61B 5ALXA 5HOQA 2IW1A 3FVVA 3QE9Y 2IU0A 3CE6A 5TGZA 1EHCA 1QOPB 3Q2KA 1FLNA 4JK3A 4EPXA 1WKVA 2G1PA 4EG8A 5EXEA 3K6SA 4UZFA 3EUFA 4HQFA 1DWPA 2V6JA 1QZUA 4IDCA 3V8RA 5JYCA 5K2OA 3OOEA 2W4IA 2OZKA 4V0SA 2AFIA 3JQBA 3U4GA 1I2MA 4HUQA 3GJ8A 1CUSA 1UOPA 4P9NA 1O94A 2JJ1D 2X4LA 3KT3A 2GN1A 1PJSA 4AN0A 2G4CA 1SUIA 1FUIA 2P77A 3E5NA 1G64A 1RAGA 3BB1A 3LOQA 4FNAA 2IYLD 5U1PA 2BTQB 2V96A 1IUNA 1RT9A 5HM8A 2OBNA 2J5QA 4FEGA 4DMLA 2D7CA 3EXIB 3GMDA 4MUEA 1AQJA 1O0CA 2AUTA 3H3JA 3M89A 5GIOE 5BP7A 4TRMA 4DJTA 2X4IA 4IH1A 5B2EA 4ID3A 3DE5X 1AZSC 1EVJA 3O3NB 4U0KA 2IYZA 2VBGA 1AZLA 1W46A 3DYIA 1C3VA 2IZ1A 3IAM1 2O59A 4J1QA 3DFUA 1MAVA 1R6BX 4JFRA 4ZO8A 5ERGB 3HU3A 3S8YA 1SXPA 4QQFA 1XN4A 4UTXA 3V1NA 2P9BA 1G63A 3VR2A 1UC5B 3QU7A 4CG1A 1LC3A 1Z6GA 2NUTB 4LZZA 3CX4A 4LRTB 4W8HA 5AXCA 3GL9A 3E3OA 3O03A 2QPAA 4A1OA 3RABA 3JWJA 2VJAA 2G08A 2VWPA 4N9WA 3CLTD 3RIMA 4D3ZA 3FOEC 1L7DA 1M6VA 2NSJA 1RLUA 1E8MA 1LJUA 5KOHB 4COOA 5I8PA 3K5IA 4B83A 3ZTYA 4BV8A 2GF2A 3ICPA 2FGKA 3JQ9C 3NLLA 5JDCC 2ZI4A 2AFHA 3RFFA 3DLBA 1KWKA 2XIQA 4LMBA 3AHEA 1YMQA 2B8WA 2JD0A 3NTQA 4K2HA 4YDRA 5BRJA 4N7RA 3W5DA 1A1SA 4Z2YA 2IYUA 2GHTA 1I2AA 1LW7A 3FUCA 4OF4A 5B7QA 3QOYA 4FYIA 4EYEA 2PLFA 3JZAA 1FSSA 1AF7A 2OGSA 3UMSA 3CJQA 4CCWA 3OBBA 4NYJR 2I7CA 4HFRA 1NLZA 4MH0R 4R8VA 4EDHA 1QIDA 1TD9A 3ILYA 4XOUA 5EYPA 3O8OB 4MLZA 1PYOA 4Y9SA 3K1AB 1G8YA 1U0FA 3MC1A 4ONEA 3TB4A 3U3ZA 4EW6A 1P4GA 1U7HA 2PAFA 1SB8A 4PFSA 3SN6A 4ZTZB 4HS9A 4GM4A 1Z83A 1RM0A 4I36A 4J9UE 2JA2A 3ROFA 1M2WA 1U8CB 3R7BA 1E89A 1HXHA 3IAS1 4HDNB 1DIAA 2PX2A 3CGWA 4W7SA 3W6OA 3WMEA 3HJFA 3E53A 4LYAA 4V0LA 2JF0A 2FR0A 1JTVA 1V6SA 3W7AA 4MUFA 6AT1A 3R6LA 3U39A 3ZHBA 2Y9MB 4ROTA 2PWAA 3QU5A 1GTSA 2AUNA 2FRXA 4MZXA 3CY6A 2ZYDA 4UNPA 4F2DA 2JGDA 2OC9A 4CQLA 1ZU5A 2GBFA 2QG9A 3LZCA 3UT5A 1ZIYA 2JB9A 3BSWA 4JI8B 4GMFA 3F4LA 3DCJA 1SXJA 2BEWB 2PUFA 1VM6A 4BVHA 2C29D 5LUAA 4EGJA 4E09A 2E9SA 1ZK2A 2JFFA 4RTLA 2B5OA 2QTHA 3GUCA 1D4FA 2BFCA 1FXWF 3LK7A 3O84A 3PNYA 4R40A 4ZYVA 1PX2A 1OYOA 1YQXA 3CBQA 1OAKA 3NRCA 1XFDA 2VH1A 1OXUA 2VQSA 2EFEB 3GA7A 2IWHA 2CBGA 4CKXA 4F96A 3WJ2A 1SQ6A 1D6SA 4URXR 3P20A 1LQTA 3GBSA 3GFSA 2NU8A 3N07A 4EVSA 2LNDA 2WJJA 1R1DA 4PNPA 5IBPA 4AN1A 1KZ7B 3AUKA 7AT1A 1M1YA 1JXMA 2W6QA 4HR7A 3ESBA 2J07A 2I2FA 4PR0A 1V35A 3W8RA 3OLQA 4HH3C 3QVOA 4DXHA 2UV8A 1XZBA 4AUMA 1Z0UA 1LI5A 3OUUA 2DR3A 3KD3A 3EVEA 3BTVA 3I64A 1N5RA 1RBQA 4F6RA 4CM8A 3WGQA 5CDHA 1TTHA 1WCIA 3BSFA 2ZI9A 3TWOA 1DG3A 4IO0A 4R68A 1T3TA 4BZQA 1Q7EA 3GP3A 4RCZA 2PMKA 1ZCBA 1EHYA 5CEJA 4B3RB 2VPTA 4IWYA 3QVUA 2IVZA 2H2DA 1JG2A 4MCIA 4Y0VA 3IE1A 2FK7A 2JLRA 4X6UA 1P9RA 2P7HA 1TVKA 3N0XA 9ATCA 3GAAA 2GDJA 4B73A 1CRQA 1R0LA 2O50A 3HJBA 3O73A 4I2NA 4CWAA 4ZVUA 3BWCA 4PANA 5EOVA 4AMYA 4G4SP 2VI5A 2EKPA 3I8OA 4NBLA 4Q9AA 5EMKA 1YNOA 1CF9A 1XTRA 2BGUA 3A1FA 2Q7DA 2FPUA 3KC2A 5DWDA 3OICA 3WFZA 1VG9B 4JWTA 5BUCA 5JNWA 1NNLA 3R0VA 1X39A 1FZTA 3R0XA 4TVBA 4C78A 3N5CA 4PAGA 1NSYA 1CB0A 4M8KA 5DMHA 5KJ1A 4MV9A 3I0NA 3A9SA 3KD2A 4FZVA 2O05A 2DBQA 4LGCA 2K5UA 2R60A 2PYIA 1KEEA 4UBKA 1NZJA 2Y9PB 3SMVA 5AW8A 1COWD 1P7ZA 1UOOA 1X8LA 4WSOA 5EJGA 4YUWA 2WE8A 4B0PA 3CJTA 2WWWA 3SSMA 2IC5A 4H1UA 2Q9BA 4JI7B 2O2IA 2VCHA 2YCBA 3A4VA 2HZ7A 4IMRA 2ACEA 2IYYA 3IDOA 4C4RA 5C5DA 5LMCA 5FWDA 5E4JA 1L4HA 3SVTA 3W5CA 1RI1A 3EDOA 4AF6A 1KYTA 1WPGA 2VPIA 2EZ9A 1RP7A 1RFGE 3ESZA 3N2KA 2HBZA 2ALJA 2CNBA 1BS9A 3F7TA 1JQKA 1KK1A 3KQWA 3QSGA 1F2TA 1SBHA 4LRUA 4XSHA 4CKEA 1I33A 2QVXX 1XR3A 4B3TB 2ZIUB 1E99A 2WYOA 4C0QC 1ADJA 1TZJA 4DLRA 3TBFA 5CCXA 1G21E 4GS5A 3C3YA 3TKLA 2JFQA 2IWRA 3D6MA 1DUSA 1J6UA 3OBIA 2H57A 2QZJA 2YWGA 4EPWA 3DXZA 4AW9A 4DLPA 3I6BA 3W1EA 4YR7A 2W70A 2AGVA 1KY4A 1TM5E 2R2GA 1I13A 1KO8A 3EXHA 2FSVA 3QITA 4IV0A 4WLFA 3U7FB 1NLYA 2YWRA 3FIUA 3H9EO 2YHBA 3LBIA 2WJVA 1YI8A 1QGOA 3OUZA 4GNKA 4PFJA 2CJYA 2VPYA 2XKBA 5AUQA 2I76A 3F9RA 3C1OA 3NT5A 2EWWA 3HFJA 1EDOA 1H0RA 1HEIA 3T7TA 2IS4A 4MPRA 5JY6A 1GVHA 1II8A 2E82A 3H2YA 2IPNA 2GPYA 4ZT4A 1OGJA 5LP6A 1W29A 3ZVNA 3O8QA 1AKNA 3SLRA 3I23A 4DLNA 4O4IB 1V2HE 1T3ZA 1ORTA 1JDUA 3KJZA 1V7ZA 3NV9A 4LJ9A 3N53A 3E7PA 3PNBA 2LPMA 4D02A 1KZGB 4XRGA 5CFMA 1OBOA 3SEQA 5CVVA 3QHQA 5TY0A 1UJ6A 1WM1A 4NMHA 3UK2A 4CMAA 2NO0A 3IB6A 1XEAA 2JFHA 2Y0CA 2CLFB 4MWEA 3K2BA 3F7MA 3PXEA 4MV1A 4WZAE 1RTTA 2ZYGA 3B51X 3GDGA 4JP8A 3STUA 3TTSA 4BNFA 5L7WA 4QJ4A 3T06B 1QTQA 2Y27A 1K92A 3MK31 4Y0NA 4FFNA 2HSEA 3LCMA 3ZC3A 1I3MA 3SXPA 2K2WA 3V7WA 4TQ9A 4PLTA 4U7WA 4KE6A 4OHZA 2E85A 2K2QB 4KRFA 3R7AA 4LS3A 3PQ5A 2ATCA 2ZXEA 4UM7A 1GU1A 2OFOA 1I3CA 1RZVA 3DNPA 3O8BA 2PBLA 5KNBA 3C98A 2B1QA 1JXQA 4B3JA 2VRNA 2IH4A 4DCOA 1UDRA 3W2FA 3EEBA 2YN2A 3GYBA 4H3HB 1DNPA 5LJIA 1KYIA 2OLEA 4JUBA 1FW6A 3B78A 1YR7A 4RHCA 5ILGA 3AF5A 1JUDA 4FD3A 4GZLA 4KJXA 3J7AC 2Z2JA 4ZI7F 3CW8X 1L5ZA 1Y1KE 3D8UA 1NUHA 2PL3A 3LDUA 2D54A 3LT0A 3NEYA 3N5KA 3AHGA 2PQ2A 4JLMA 1PJBA 1VBNA 4EY3A 2ZSBA 3PXXA 2WU4A 3WGUA 4KQWA 4D4HA 3FR7A 5D3KA 5JEEA 4XD7D 2PVSA 2V65A 2ZJOA 3JQGA 3HQ4O 3ZWKA 2VJKA 1V8DA 1VSVA 1V16A 4RIIA 3SZLA 1EMDA 2ZPUA 5TXGA 1K7CA 2FWMX 1GT6A 3AETA 3HZZA 5CT5A 4G0VA 1NJ5A 1QSGA 3K4HA 4R2LA 1RJEA 2NO5A 2A3RA 4IV8A 1AHHA 5ERYA 3KBOA 5AIAA 3X44A 1T13A 2XOKA 2B94A 4LJ8A 2PX6A 1UM9A 3LT1A 4Q4AB 2IKQA 3RREA 3G6WA 4Z4HA 3BE6A 5M3BA 1I2ZA 3BXPA 5KYKA 5FL7D 1OWNA 5IBCA 2Q28A 2ORYA 1C4KA 4MUMA 4HTFA 4BPBA 4Y6GB 5AM2A 1LTHR 2WHQA 1NJGA 1N0IA 3HSKA 3CBGA 1DHRA 2C8JA 2CSUA 2VRBA 1TA9A 1L1QA 3G89A 3MJRA 2OCGA 3KXDA 1ZNYA 4OQ4A 3VO9A 3ZNQA 4BZZA 1HY3A 5CU7A 4NOLA 3TQFA 4TLBA 4EUSA 1T6BY 3CTMA 4JYCA 4JZKA 1T0JB 1CLUA 4HWKA 2I8LA 3EARA 4LJKA 3ZKAA 1T8YA 2GJ8A 4BP3A 2ZSHA 1UJ2A 2C20A 4XA8A 4B3SB 3ZWCA 3GJ6A 1F60A 1GR1A 2OB2A 3PDUA 4R1LA 2VDWB 4YXWD 3TEJA 4F2WA 4M55A 4BMXA 4FBMA 1LLCA 3V8EA 3HP7A 1CJSA 4NZZA 4G23A 1EBUA 3FPHA 2AV6A 2AJTA 1Z0JA 3TIVA 1RKUA 1HLFA 3FGOA 4LHZA 3S68A 5FBVB 3FWPA 3AERB 3PL1A 4Z49A 3COVA 1PGJA 2AS0A 1FSFA 2NNLD 2OHJA 5IHXA 2GOYA 3THRA 3AFMA 1GPNA 1WO8A 1AA6A 2ETXA 2Z56A 3U7QA 1O57A 2QLFA 3CR3C 4KIJA 4AO7A 4CMJA 1D1SA 4J2HA 4LXUA 4R6XA 5HZGA 4DA0A 3AK4A 1VJ1A 3GEMA 1VPEA 3RFVA 4DGQA 4G0MA 4M87A 4CETA 4N76A 5FADA 4HJRA 3IDAA 3ZWPA 3EZ7A 1W4BA 2C2WA 1QRAA 2F62A 4YJHB 1VRVA 4JLUA 4U63A 5C8ZA 3DH0A 1CQIA 3VR1A 3D6UA 3TLJA 2J9FA 3H05A 3F3KA 1DOAA 4KMMA 2BFBB 2J59A 1T34A 4TVOA 4B32A 5A5EA 2JGNA 3U4QA 2H4WA 2Q3CA 2XNSA 2O8DA 3W2TA 1XD8A 1DKUA 1R8YA 5DCLA 4E3ZA 1NVFA 1NYRA 3UFXB 2B83A 5A3SA 1LXCA 2NM0A 3EEQA 2QM8A 1KJQA 4UU1A 2WAMA 3RC7A 2QTMA 1Z33A 2Z4SA 3AEQA 1P5RA 3FTDA 4LRWA 4DUGD 2V1UA 1OX4A 5G1OA 4RK5A 5AW2A 1JPVA 1PSDA 2RJOA 3I0ZA 1J5PA 1T5OA 3CGGA 4YIHA 1VLLA 2J1LA 4KQGA 5K4GA 1JDBB 3QYFA 2C1XA 4FHGA 3FNFA 5AKLA 3SSOA 4OXIA 5CB8A 2IYNA 4UM5A 3NRJA 4Y1RA 2XCTB 3NI2A 2YOGA 4YDSA 4Q9HA 1ISGA 4BNJA 1DXHA 2G0TA 4TVKA 5JYEA 3D7SA 1AIPA 5IM5A 1NQTA 3RS2A 3FX2A 4HGQA 1EQAA 3FPAA 3O4HA 4QICA 1B3RA 5HNKA 3NTOA 1E1LA 2ODBA 3L0CA 3A1EA 3ZKWA 1P81A 1TPYA 3ZHRA 4D9BA 1YV9A 3S6JA 1FY2A 2O23A 2WA2A 1QYDA 3PRJA 4YRJA 3EMDA 1Z5GA 5E7IA 2IQIA 1V1MA 3D7MA 2UYHA 2CHGA 2GCNA 2G8NA 3T5GA 3ND9A 4FI3C 1RQRA 5IZ4A 1H2FA 1X7GA 4KWIA 1Z37A 2E4UA 2PUWA 1GZ7A 2IYTA 3P2KA 3E9DA 3LT4A 4BNVA 4WUTA 2YV5A 4XM1A 3DV9A 2HNKA 1M7HA 5T3YA 3C14C 2PGOA 2CW5A 1N5DA 2HRRA 3MGAA 1CIJA 1G20A 5FWAA 1ETHA 4S2EA 4WN9A 2E18A 3WIEA 3B85A 1CUFA 1EK2A 1RKBA 4URYR 4E7PA 3S5UA 1IY8A 4DM4A 3RVDA 1Q7RA 1V3TA 3R8FA 1LPNA 4LJYA 5JAIA 1RZ3A 1VA5A 4XWAA 2G76A 1X92A 2PKRA 2FZEA 7REQA 4KGXA 2AMFA 4KQCA 1KYVA 4NOKA 3V33A 1A0OA 5E38A 1UMBB 2FPGA 3SEAA 2PO5A 4JITA 4M9QA 5DLEA 5TPZD 3TZCA 1IB0A 4BP1A 4FW8A 3RV4A 3H8VA 2P68A 3E9CA 3AYZB 3BDAA 3LVRE 5EJAA 4RFLA 4MVJD 2ZGVA 4AJ2A 2W6JA 1PZMA 2C57A 2PKQO 2EV9A 5FAKA 4L22A 4C6SA 4D9FA 2GLTA 4ZCRA 4CR8A 5IMSA 5TARA 3F7OA 4G0NA 2BMFA 4UTPA 2VLIA 4JJKA 5BSHA 2WUVA 4MP3A 3NKLA 3R3ZA 3CLVA 2GPTA 2G9ZA 2DGDA 1P1HA 2Y2VA 2QXUA 3L0OA 1FQJA 3GWZA 2PMEA 1JQJC 3DOIA 3QX9A 1P2GA 3Q7QA 3QVGA 1V71A 2FLWA 5TC4A 4EPRA 1C9KA 1WVIA 1ZIDA 3NVMB 4WINA 5SY6A 4ZCIA 3QLTA 1W0CA 1UMDB 4P34A 3MD0A 2WHRA 2OXFA 3WLOA 4CG2A 2D2VA 4LHVA 4EF6A 3THWB 3NO4A 2I1QA 4HAVA 4EUEA 1J7JA 1E2DA 4KR2A 1E6EA 5DB4A 3A1DA 4XIGS 1N5IA 3PEEA 2W2OA 1N36B 2KSQA 2G5PA 2DUNA 3PZBA 1GQSA 5BPHA 5LYJF 3TSCA 4KXYA 5LP1A 3E15A 3F4KA 3BKXA 1G8GA 5CT4A 3KOXA 1MC1A 2ZIXB 1MX3A 5JCJA 1RAEA 2Y4NA 4RD0A 3OPYI 4M9XA 3GMTA 4B31A 3PFKA 4L5JA 1DG1G 4Y2SA 4JODA 1P6QA 4OAOA 3WWEA 1ZMBA 5BN3A 4I1PA 2FUKA 1YRHA 1GIAA 3H65A 1QS0B 5JZMA 3DPIA 2GFQA 4KK3A 4KXNA 1XRMA 2EQ5A 4I9FA 3NHBA 2WDPA 3TCXB 4P93A 4XGQA 1S2LA 1QIMA 2EFGA 3L7NA 3JQ7A 2P91A 3M9XA 3GO4A 2F8SA 2C0CA 4WI1A 3MGCA 1CJMA 1SHLA 2C8VA 2ZREA 4KOEC 1Q19A 5INTA 2QL5A 1GV0A 1DX6A 2QG6A 3K0FA 1U2SA 2WPDD 5FUMA 1WUJS 3R7WB 3P52A 4CNQA 2XTAA 1T43A 2C8LA 3BH6A 4V3BA 4KI0A 3QMMA 3U4AA 2HYIC 3L8YA 1RYYA 1VE6A 3FPFA 2KBFA 2WSIA 3RANA 2XKJE 2O1WA 3MA0A 5K0CA 4YPOA 3WLNA 4S1TA 5TQ0B 4DLKA 2PTGA 4BJ1A 4HQKA 1YR9A 2CZQA 2VSQA 3D4BA 1N2JA 1CU1A 3FPKA 4RA6B 4WNIA 4EHKA 1WW2A 4FDLA 1MEJA 4OBWA 5DH9A 3ZK9A 2BMEA 3DMGA 1ESEA 3A8TA 3HCEA 2ONCA 3ED5A 4OHCA 4B7UA 5LLDA 3R3XA 3M4XA 4OMFG 4K81B 4NEHB 4DIFA 3A6DA 1IWOA 2I1LA 3JQ6A 3Q2IA 4C9BA 5GONB 2DH6A 3I1YA 1ZEJA 2I6GA 4MQFB 3AFHA 4C87A 5KTRA 2FFRA 3KKOA 4E5YA 3I4LA 1WU7A 1ACMA 1HYHA 1HE2A 2QU7A 1EFTA 1BXRB 1XMJA 2GHIA 2JKYA 3EVFA 2H0QA 2Y1EA 3S7ZA 4PLZA 3ULKA 5JY1A 4ZD6A 1E2MA 5TT0A 5B4VA 1YVEI 4ZQHA 4G67A 4G86A 3AHJA 2O8FA 4X8HA 2IVFA 4TLEA 5LKAA 3L82B 3VSBA 5MDHA 1JGTA 3M33A 2PIDA 3IP6A 4MVYA 1XMVA 3QPDA 4C6HA 4GR9A 2IPAB 4BBAA 2QQ5A 1FQWA 3G0GA 1A7JA 4PLGA 3Q6NA 4AJIA 4KO4S 3Q3CA 3P19A 4LE2A 5IDYA 4MIKA 3TJRA 4OAPA 3OQ6A 1G7SA 4RKEA 1TNDA 1ZW6A 3F46A 4JOQA 1E98A 1JJIA 1GZDA 2XDWA 1RC0A 1T1GA 5B53A 3TW8A 1ZICA 1DRWA 2ADOA 2Z30A 3ANYB 4D3YA 3VNVA 1PGOA 1SD2A 4U2CA 4RXTA 1T3HA 1R27A 3GUZA 4Z3KA 2I62A 4P84A 1Y48E 2FPKA 4K9SA 1THGA 3UHAA 3WC4A 5SZIA 3JAKB 4RA9A 1TIKA 1G3IA 3QLJA 3WXBA 5KAMA 2VNHA 4RHTA 3IP5A 1N5KA 1VKHA 1KPGA 1XXHE 3U3RA 1LK5A 3B6KA 4EI8A 5DHRA 2A2ZA 4IL5A 3LLMA 4WK6A 1HZZA 2QQGA 1Q3KA 1HGXA 3D6AA 2Y99A 2CLIB 3BWEA 4Y2VA 5CB6A 1LDBA 3WHLA 5KNDA 1F6WA 2P1RA 3CF2A 3QWIA 3P0HA 4NQZA 3ICEA 1YE8A 1EB8A 1R5BA 5LOVF 2XE6A 2V45A 3UJNA 3C45A 1E9FA 3ICCA 4J76A 1RI3A 4OG2A 5TQVA 5TE9A 3EZNA 2ZM5A 1OIXA 4Q9IA 1ZEMA 2BF4A 3I9V6 9LDBA 5IJWA 1J2TA 5IRCD 3K20A 2DYKA 4QGBA 3RUHA 1AGNA 4HDCA 1JLHA 2N1MA 3ETDA 3FW1A 2IEIA 1E4EB 4GR4A 4UUOA 1OLXA 2AOXA 3D4NA 1TA0A 2D1QA 5E9QA 1GAEO 4HNHA 3JYQA 1NW5A 2Q0XA 1Y5LA 1EUDA 2Z09A 3FNHA 4E03A 2AX3A 3VSDA 3LX4A 1US8A 4TSFD 3F73A 1L6RA 1F12A 3LYAA 4IZOA 4NC9A 2O8EA 4OK5A 2CHEA 3W9UA 3NAZA 4RZQA 4R2HA 2FX5A 3GAZA 5I9TA 4HV4A 1BA2A 2DBYA 5KTKA 1BCSB 3LT5A 3Q0IA 4RKFA 2UUOA 3A6LA 4UXIA 3G2PA 1CVRA 1KJ8A 3TDKA 3EIFA 1WW3A 4I4TF 1B6GA 2P4EA 3B3FA 3A9WA 3NM5A 3ZD7A 1U2ZA 3WBFA 2N46A 2NTEA 3QF4B 5LQDA 3GJQA 4R2WA 5BYAA 1GLNA 1RE1A 1J1UA 1VHQA 4P7GA 1SIBE 5BQ3A 1JHPA 2QPOA 1QANA 3G9TA 1XL0A 1X19A 1PS9A 2GKGA 2DFTA 2P78A 3LHDA 2VNSA 4HAUA 3TNYA 5AVUA 4Q3LA 1TJ4A 4MV4A 1BDMA 1LB1B 4OB6A 4LY0A 4OUDA 1XLUA 2GPAA 4LYGA 4CQMA 3U0VA 3JQBC 1TVCA 1U2DA 3AKYA 1XX6A 1GPKA 2BEJA 1O94C 2AK2A 2H8GA 3NDRA 2OYSA 4N3GA 3WLFA 4DW8A 1T4CB 2OWDA 3NNSA 4O4JF 3D6VA 4DG8A 2Q3BA 3KLNA 5HJ5A 3VKWA 2V6BA 1BGVA 2R8EA 3MAJA 5DN6A 1P33A 1NBMD 2WINI 1QUEA 3LQKA 3TBHA 2C4NA 3UJPA 3ZLBA 4BNUA 4GZMA 4BMSA 4CNBA 2J31A 1H6DA 4DUPA 3RVLA 4DABA 3E9ZA 4EDFA 2ZBDA 3F1LA 2WHYA 4ZXPA 3UC9A 1HSOA 3CLSD 3WNCA 1UWCA 3L6BA 4EG6A 2WF5A 3IEMA 3TZHA 2HCTA 5C46F 1E69A 1W6UA 4ZVQA 5KPJA 2EDAA 1G66A 4Z7QB 3NAQA 1CBUA 4O4HF 2GILA 4X3PA 4PXYA 1ISSA 1TD1A 1AX9A 2P2ZA 2YJZA 4GC9A 4KBYA 4W1PA 2X0DA 1GPMA 1U3FA 4MUYA 1E1MA 4UZEA 5CMLA 3RIYA 1JALA 2GEDA 1M7BA 4NQRA 3BWVA 2FUG6 3STXA 4BUCA 2UZAA 5IASA 3TSAA 1DAGA 4HRXA 5IEBA 3GEHA 3MGGA 1A9QA 2O8NA 4FI3F 4M6WB 3VHQA 8ADHA 1M0TA 5AKIA 3IQEA 3I5AA 5HR5A 3CCFA 1Z4OA 2CVHA 4COKA 2BMDA 4J2TA 1L4FA 2IY9A 3GFGA 1R9MA 4WWHA 3DMYA 2A59A 1SH7A 4DCPA 2ETVA 4IJKA 3HA3A 2WJ6A 4PRKA 3LH5A 4N01A 2BGGA 4OJKA 1MH1A 3VU8A 3MT0A 2DY1A 1E2JA 4EGAA 4AJOA 3SR4A 3U3DA 1N25A 2VJMB 3N8GA 3C4QA 4RQBA 4WDQA 3HK2A 5F64A 3QU2A 4N7BA 2FDCA 2GSDA 4O2BA 4BYMA 4DY4A 1V43A 4CM4A 2BH2A 1SA0A 1YGPA 4L4XA 4EX6A 5BWMA 3RSFA 3T4XA 3W0LB 4UHFA 2IV3A 2FVXA 1ZQ9A 3FCYA 1OJLA 4RK1A 1BH2A 1QO7A 3JTMA 4Z8XA 5CURA 3H9GA 1DEHA 1K2VN 3D6FA 4MOWA 3OE7A 1XNQB 4HNAB 3D4OA 2IS2A 2RI0A 3Q3VA 4F85A 4EOGA 4NKRA 3DEIA 3HU5A 3EA0A 4ZMRA 4BKMA 4S1PA 1NIPA 3FF4A 1A8HA 3SPXA 4GMDA 4DV3B 1IUKA 3CYFA 4BEVA 5FWNA 4TYWA 2XF8A 1T4BA 3EVGA 3GCGA 2IPLA 1LJLA 2J7KA 3KTOA 3L1JA 1S3IA 2B8EA 4ZHSA 1SXJC 5B4UA 4X7BA 1RXSA 2MSDB 3RU9A 2BSAA 2I3ZA 4LMRA 5LPNA 4DCMA 2AKEA 4WESA 3C3WA 5A4AA 3OPMA 3PJDA 4KLRA 4UTNA 5CAEA 5H7XA 1G21A 1Q7BA 2C3OA 2H85A 4YCDA 2OXIA 2X9QA 2C2KA 3QX7A 2Y6VA 3ZQJA 1A88A 3O21A 5IT5A 4LHYA 1BXKA 2MYTA 4MINA 5BSGA 4OI1A 5B2ZA 4ZYXA 4RGQA 3RV3A 2HMTA 3B6JA 1XEXA 1XZGA 2KLHA 2QTBA 2VYNA 3FYDA 3WV5A 5LXTB 4KIWA 3MJCA 3ZWVA 5J1SB 4P3OA 1P9WA 1W1WA 5I4IA 2PL9A 2PRSA 5EIOA 3WJ1A 5IJAA 3OQPA 1P0QA 2DHEA 5FBHA 2GBCA 4X8OA 2II6A 2OFFA 4KDEA 3R75A 3WIVA 1ISIA 1PS0A 4YIKA 2OXCA 2QVGA 1XPUA 3FGNA 2X5XA 2D1SA 3PFBA 5H9VA 5K1ZA 5DM4A 1JF8A 3GLSA 1FVHA 3IXMA 4GPBA 2BTOA 3VU9A 1YQWA 3ZWXA 1TQ4A 3H9UA 4B7AA 5K0JA 1QRTA 4N3NA 4KQ6A 4BHTA 2HPVA 1J2RA 5GZ1A 2REOA 1QG6A 1SKYB 3BIXA 5CLFA 2WNHA 1FXSA 1WKCA 5EXPA 1IM8A 1TLFA 1ZUNA 5IAJA 5CCBA 3QTLA 3U7GA 2BLNA 1SNYA 2JJ1A 4HDOB 2OHVA 3BQMB 3FOBA 1LVGA 3UICA 1YIOA 4DCVA 3ER8A 3VR6H 3EJ6A 2YZNA 2PZFA 4AJLA 1MP0A 3ND5A 3AR2A 3AW9A 4EO9A 1UZNA 1SG0A 2AN9A 4OSEA 5FFFA 3B52X 1F7UA 3IT0A 5ALQA 1H0SA 3K0BA 3DDUA 3ZHZA 3VPSA 4CL3A 5K0NA 3FKSD 3NUQA 2RGDA 3K0AA 5EZQA 3V4OA 4YMTA 2QLJA 1J0DA 1Q0RA 2JH8A 3GLHA 4FT2A 4GDMA 2JEOA 4WKCA 5KYTA 1U3GA 2CLOB 2W2TA 2YQZA 4HTAA 4I2VA 4DMRA 5J2TF 1BMTA 3IOEA 4C0AC 4IIUA 4C06A 2JNWA 5KOJB 4UCWA 3TLAA 3KHKA 1FFEA 2WWFA 1K7SN 3OKPA 3N58A 4QPJC 3BQ9A 1U4NA 4B1FA 3A6HA 1L5NA 2B20A 3TZQA 1JRLA 2ZVPX 4UEWA 1W36D 4YR9A 1P2BA 4NV0A 2CCGA 4KVAA 3CISA 2D2FA 3IX7A 2ZUBA 3IJ5A 1T5SA 4N18A 1CR1A 1RD4A 1UWVA 3HBLA 4N3CA 2ZYWX 1XZPA 2Z8ZA 4DNOA 4FFRA 5AM4A 2JPDA 4DXAA 1UDCA 1JDJA 5CA1F 3BK1A 1QO9A 1GPUA 3AY3A 1V7CA 3IEUA 3QI7A 4IM7A 5KQPA 2PGDA 2Q8PA 2G4LA 3C8DA 3WK6A 3MXTA 4B44A 3LW7A 3H42B 4UNNA 1K8ZB 4DCTA 3BGWA 1PNTA 2G5TA 2ZYRA 4U3JB 2VK8A 5CT6A 4Y7DA 2YL2A 3B1JA 1NU6A 4EPTA 3WMGA 2OVBA 4X9XA 2ZUEA 2BR4A 4W63A 3ROGA 5KQGA 5BW5A 1NYQA 3RVBA 1NBWB 2WLSA 3H1BA 4HAIA 4TTSA 3C6QA 5CHYA 6ADHA 3B2QA 1VJ5A 2C3MA 3HR8A 3I6ZA 4TTTS 3E2PA 1WR8A 1JHVA 3FUWA 1UPFA 3KELA 3KDSE 5LP6C 1B74A 5THXA 4UE6A 3EQ9A 4OQQA 1GNPA 1ZD2P 3WQSB 4F4UA 1FDRA 2XMSA 4I8XA 1PK9A 1YC5A 1J23A 1RPNA 2UKDA 1O95A 4FYXA 1PEDA 2WYWA 1QGAA 3OUTA 9LDTA 4EQ6B 1UJ5A 2CSXA 3A4LA 4NFYA 2YY5A 1RXIA 2NAFA 3GAMA 4H6XA 1O2DA 4EYQA 5BR8B 4JR1A 3DP7A 4IR7A 3ADBA 1LBTA 1KVQA 3FR8A 3K9NA 4R4JA 4KH1A 3VR0A 1UKAA 2P41A 3AHHA 4PAQA 10MHA 3GN1A 1I0LA 4EHIA 2PQ6A 4B4WA 5LYJB 1PGQA 3EFOA 3B1KA 4UQOA 4DIEA 3VNSA 1NBME 3PC2A 1S9HA 4AZTA 4IIBA 3FTEA 3P2JA 2PXAA 2J87A 2SCUA 1EGHA 3OM9A 5EHXA 5ED4A 1JHZA 1QORA 2JCGA 4JHLA 5K0GA 3HGMA 4L95C 5SYAA 4O2AF 3QEAZ 2V7BA 1BXGB 2GBPA 2GGSA 3QKWA 5A9RA 5D6NA 3EH2A 3TJMA 1GTJ1 2P4QA 2OENG 1FNNA 4OX9Y 2DX7A 2AZTA 2Q21A 3AVQA 3OQJA 3RUFA 3WYDA 4EMSA 1PR0A 3OFVA 3EGOA 4JLWA 2H1SA 1P2UA 3QV1A 4YRPA 3T5DA 4CV3A 4LBWA 3O1LA 3M3DA 2ZPAA 1LDEA 1B2RA 2A0WA 2ZYUX 3BG5A 3P9QA 4J7AA 5IF3A 4Q3NA 1B1CA 3B3JA 4G0ZA 5IH3A 2PFKA 2AI2A 3TLXA 1FMLA 1GRRA 2X1HA 4HNTA 1GN9A 1BHSA 3AJDA 2N42A 2OPHA 5MF6A 1C9DB 4EHNA 4DKJA 1KS2A 2QJFA 4MNTA 4V02A 3EIHA 1DOHA 3AIOA 3GJXC 1SOUA 1H05A 3IVAA 4GR5A 1XSEA 1OTXA 1JNYA 1CNEA 1SXQA 3S2GA 3OESA 2OQRA 4JL8A 1X7XB 4KH0A 1R6DA 4FFOA 1ZJ5A 2DFLA 3HJUA 3NHMA 3X1XA 2R6CA 1R9GA 3LRTA 2PXHA 4JU9A 4WLNA 2BONA 4US0R 2W00A 3IQDB 5KIAA 1IG0A 2ZUCA 1QAQA 2ACVA 2GRJA 3FGPA 1A71A 3LY7A 3NX4A 4GOKA 3FUTA 2CFCA 1YZ3A 1E0SA 4IHKA 4KPUA 4WN3A 4L7QA 2FWPA 4DTIA 4F72A 4U5XA 1QDUA 1BKSB 4DV2B 4IJVA 4ZJPA 4YMHA 4UUPA 1KQNA 3S55A 3W9YA 3TL3A 4QPZA 3KVOA 2VUTA 4DR3B 1R0WA 2H1HA 5T8KA 1LLQA 3TRDA 2IHTA 2MU1A 2CNWD 4AY3A 3PDIB 1IH8A 1B16A 1ODSA 1YQTA 2WU1A 1RQGA 4PWYA 4B8WA 2OY0A 2P2YA 5IBRA 5EJMA 4OHYA 1JL3A 1K7YA 1PR5A 1Y7HA 2QYSA 4QUKA 4RM3A 3ZV7A 3VHXB 1HLGA 2GXSA 4TWAA 3R20A 5AKHA 2JK1A 1G6Q1 1VJCA 1SOVA 1G19A 2VZ8A 1F2DA 2Y67A 4IHAA 5LBIA 1W73A 5K0BA 4J4BA 4NOMA 2IOHA 1MVLA 4YCCA 2IOFK 3KYCB 3H5OA 4XM0A 4YXFA 1JA9A 4BLQA 1BJRE 1XNHA 2X5NA 1UINA 3N0WA 5KHAA 1ZOLA 4RY0A 3OF2A 2OMKA 5KYGA 3FOFC 4OLBA 1U1CA 1EJBA 3QEBZ 1JX6A 3JZDA 2QMUA 2J0SA 1J2EA 4KR0A 1VCOA 4YJFA 5IVIA 3SOPA 2PZBA 3W3ZB 5AW3A 2C9BA 2B82A 2C78A 5REQB 1NE7A 5GV8A 1CUWA 3TQQA 3UB3A 3UMBA 2D2IA 2ZRAA 3TL6A 5IUKC 2QTWB 2FFBA 3HXTA 4C07A 1KDOA 3AOEA 1CT9A 1SUPA 5CFNA 2CUTA 3JD2A 4GX2A 1KRXA 2YC4C 1SR8A 4KQJA 1A5TA 3L0SA 4I50B 1FMTA 2HI0A 4X95A 1PW5A 5TMPA 3ZQ4A 2FGJA 2HJGA 1OE0A 2P40A 3GD5A 2J3KA 5CXXA 4REQB 3FYSA 3GROA 2R1TB 1TT5B 2PUTA 3C7TA 3IIEA 3LC2O 3PFFA 1QQTA 3QKIA 4FT4A 4MGIR 2XVYA 5H3CA 4ZEWA 3VTKA 4DA7A 3ZDDA 1QIGA 1JBKA 2HLDD 4H0CA 4GEKA 4HAZA 4KVFA 3OOSA 4NV1A 1R7RA 2F3RA 4OKNA 4RY9A 4CKZA 5LZ4A 2ZXFA 3BCRA 3E70C 1M2JA 3EBLA 4NVRA 3HI4A 2PJZA 2IP2A 5AHOA 2BGRA 3KL2A 1KDZA 1U11A 5F1KA 3W3AH 2PUEA 5CJJA 4PX3A 2QW1A 4YV0A 4IKOA 1Z2PX 3GJRA 4U2DA 3AF1A 1S2DA 3CV3A 1IU9A 2EFHB 4G1BA 4QJBA 5AM3A 4DR5B 1CDZA 1ZONA 3DHYA 1VECA 2OKGA 2PBZA 3X1KA 2DFKB 3HO1A 1CX9B 1X1EA 1IBSA 1SCDA 2GXUA 2DHRA 1CUDA 3C2QA 1XZJA 2OOKA 1GUFA 5EWJA 2WPNA 1H4VB 1K08A 5FTWA 3MWJA 5KQRA 4IG4A 1XZQA 2PCJA 1U8AA 1P31A 3JQEA 4MLDA 3VZSA 3U56A 2Q8NA 4RJIA 2GN4A 1W0KD 4QHTA 4N0MA 2D59A 4KAXA 2HCBA 1UBHS 2UVQA 3IV6A 4LE0A 1SBCA 2IGBA 1XTVA 2QM0A 4JI5B 4TMFA 3JRXA 4TXJA 1IVSA 3H1TA 2JIBA 2PK3A 3TXXA 3AMVA 1PWYE 4KFSA 5C5IA 2HU7A 2YJ6A 4PBTA 4RE5A 2WF7A 2XA9A 2PH5A 2UVPA 1TTPB 1Z8HA 3KTAB 3L7CA 4YRZA 3A37A 4RHXA 3PUYA 5CFOA 3UMMA 2DVMA 2P79A 4C3OB 4ES6A 4F5ZA 3M6MD 5JRJA 5L3VA 2BFPA 5JTUA 3Q9NA 1U7PA 2KW5A 3PRYA 3WB9A 3G59A 1UBEA 3A4TA 2UZ4A 2FY8A 1UODA 1SO8A 3P26A 1H5QA 2OCBA 2WHPA 2OUIA 2ZJ6A 3AF4A 4J2OA 4PFKA 4GI1A 1IY9A 2X8BA 3HVJA 5IVKA 4BGVA 1T8TA 3OLWA 1F6DA 2BRUA 1T1JA 4L72A 1EGMB 4M98A 4L8LA 4XZ3A 2OUKA 3U7RA 3NHLA 4MR9A 1T3LA 2F1JA 2QPLA 3VC2A 1SKMA 1AG9A 1DVRA 2EWVA 4QYMA 4XD7A 2ZQYA 5I5EA 2FEKA 3LRXA 4YH1A 1H5NA 4DBVO 1QU2A 4WZBB 3W78A 1CJBA 4GI7A 1SVKA 2HA3A 3IAAA 5FV7A 1OLSA 221PA 4D9JA 1VFPA 5KYWA 3AR3A 1NVWQ 1WDMA 1PQYA 1ULUA 2QAGA 2W2VA 1ECLA 3CX3A 3MCVA 4D80A 3RT7A 2JHCA 4L8GA 2IEBA 3I5UA 4HPXB 1ZCFA 2P67A 3RRYA 2V3CC 1IWPB 3M3HA 2HRQA 1GYQA 2C5EA 2XUAA 3C70A 3DB1A 3BT7A 1FFDA 5A6VA 1VYHA 3HMKA 3QPCA 3HA2A 1J25A 1XTKA 3CM0A 4PBRA 2AUMA 3UOGA 2VSXA 3FYCA 3H5WA 2W8ZA 3UV3A 5DISB 3KB6A 2WOJA 4KLNA 4PYLA 4W8OA 4F4IA 2PS3A 4WXYB 3RO7A 4L27A 3M1YA 4N47A 3ZU2A 3QFHA 2J3DA 2J67A 3FAKA 3LFHA 1BMFA 4R01A 3UV6A 2Y0DA 3I5XA 4CEJB 1R0RE 4L1KA 4DMGA 3OE5A 4TUYA 3KPJA 4RPCA 3FNIA 3EC2A 1F17A 3DJFA 3GLTA 3LA8A 5EZYB 2V7QD 2WM2A 2XQGA 3RSLA 1HM5A 5M34A 4RTRA 3AR8A 2CE2X 3KNZA 3JXEA 4BO4A 1NHGA 4BLOA 2PWYA 3AEKA 1T4MA 3H6HA 6PFKA 1LDGA 4FFSA 3SZRA 2NWQA 2VSYA 4HNGA 4BNDA 3FXAA 1I2DA 3N8DA 5EE5B 1YACA 4CM6A 1G3MA 3NBYC 3U7IA 2YVQA 3ND8A 2VZ9A 4ZT6A 4PHHA 3G2NA 1ZIXA 2UYYA 4TGLA 3AG5A 1FDOA 5EQJB 5FTJA 2AK3A 3VPXA 1OAAA 4M0MA 1VL0A 3GY0A 2Q5HA 4TOIA 4G0YA 5K3FB 5CBPB 1T25A 3FWKA 4XJTA 5D7BA 4MYCA 4XPIB 2G6TA 3ZDXB 2YRWA 4YYEA 1W1IA 1M72A 3ZU4A 1OT5A 4S12A 1H6BA 3MXOA 3DA8A 1RWXA 2V7EA 3AVUA 1ZHOA 3KR2A 1QQ5A 5EFZA 2WTUA 2D5CA 2A88A 3AYXB 2ZEJA 4HDRB 5T7BA 3NHZA 3EGWA 1E3DA 3B7GA 3BMOA 4JAVC 1M2OB 2UYQA 2O3TA 5AVVA 3OJLA 2YJ5A 5IABA 5KSPA 3HYLA 2EGGA 4MEAA 4DLBA 2D0DA 4ZAYA 3WFIA 4DM3A 4MB0A 3THXB 1SBNE 1GPJA 1C3OB 2D5AA 2X41A 3BZBA 4GUAA 1EZ4A 2CCJA 2QWXA 1OV4A 1UKEA 1P9LA 3PRKE 2WOOA 3KZVA 4Q1CA 1AVTA 4DUGA 2GESA 4RESA 1K6IA 5DYWA 2WJHA 3A25A 2OPBA 2WT9A 4TV8F 3OCVA 1XAHA 2FETA 4UVIA 5FNVB 2Z8XA 3IDZA 4RH3A 2DZDA 4AQDA 4F1JA 2R8XA 4Z86A 3VPAA 3VKHA 5IJ0B 1NONA 2ANBA 2ADFA 3NQ41 5I7FA 4E5SA 1NR7A 1O03A 5DW3A 2BYTA 1Z4MA 1PJCA 4YT5A 1II9A 1U0JA 1QF9A 4UZSA 4QDOA 4J0QA 4ZTBA 4JVNA 1ISJA 4FSHA 3K6KA 3RNLA 3MWGA 4O2RA 1KDYA 4S0XA 3K9CA 1KHHA 1PU2A 4FFBB 2A0UA 4KN6A 1Z8DA 2GS9A 1WMSA 3BRWD 3KSUA 2C84A 1FNBA 2Y1WA 3GA0A 3PC6A 4NCAA 4HP8A 3OQ1A 1OBFO 1WTAA 2UDPA 2QD3A 4LOLA 1CQXA 4ZCLA 4DUZB 1NPYA 3UFBA 3M3PA 5C4GB 1VHLA 1KR5A 1UBCA 1YJCA 2CHVA 2OVFA 3CRVA 2BY4A 2NZ8A 3I9V1 4RL4A 4FN4A 4N82A 3UJ9A 2RK4A 5KKNB 3I37X 1T8RA 3C8ZA 2E48A 1CTQA 3KXIA 1P2VA 2IL1A 4KKVA 5DLYA 5BRAA 2IH2A 4PFQA 1P5JA 4YO7A 1N9GB 4F8EA 1J8MF 3KKQA 5HW0A 3MUFA 3T12A 4MS3A 4I5DA 1EESA 1J1IA 3G79A 4KEAA 4K46A 4UU7A 2FZ4A 3TB6A 1VBFA 1M10A 1JU3A 2BE9A 4BATA 1IVYA 4CUZA 4N41A 3PF8A 3JVUA 4RIGA 1XA3A 1EP2B 4HYQA 3ZNPA 3TFQA 2ZM6B 1PHPA 1JQAA 3SHFA 2OCYC 3LA6A 2XZTA 2CF5A 1FF9A 4KMRA 3LYHA 1V41E 4D3FA 1H6CA 5C8VA 3GNSA 1ZH8A 4M1EA 1SUBA 2XT9A 4ADSG 3L6RA 3SFVA 4K8RB 3L05A 3VOSA 5MFZA 5C3MA 2JBAB 3BZWA 3TGWA 1F2VA 2M2IA 3OFSA 2D13A 3RROA 1Z2EA 1PZNA 4M46A 4BNYA 3UAYA 2W93A 3HBFA 4CUKA 4NMXB 5DLDA 1CJTC 1OB2A 1PJ2A 1YB5A 2Q1TA 1E1KA 3LSYA 4KQXA 3UJ3X 1N78A 5I3CA 2P5UA 3G8DA 3FYUC 1JHUA 2H8KA 4P92A 2HPHA 1IFXA 4WMLA 1MU0A 5EP3A 3SIWA 1K06A 1V0JA 4BO5A 2O2SA 1IYZA 1Y3FE 1K89A 1F14A 1O6ZA 1VKNA 4S1VA 4LVOA 3OIGA 4U7DA 3IOMA 2IYXA 4NY1A 1VGRA 2VA9A 4TKVB 1IUPA 1JMVA 1ORIA 5ICSA 5JZ9A 4B3BA 5LFAA 1QYXA 3RADC 1JKFA 1SRQA 1GPWB 3O38A 2GB4A 1XTTA 4LSGA 3PXGA 4ENRA 5KSYA 1P2SA 4G5GA 4X8MA 4BJHB 2XNKA 4JC4A 1T9DA 1VJTA 2O7NA 2XXJA 1M2HA 2GYYA 3TLKA 4BNXA 4DZTA 2GN8A 3RSOA 4AY6A 4ND6A 4JCOA 2YBEA 2UZ0A 2RHRA 4S1NA 2R66A 3G9ZA 4OB7A 3EEFA 4TN5A 4TV9F 4DJAA 3DDHA 3F5SA 2RGYA 2EBUA 2HH9A 3BD8A 2VHEA 3K35A 2HJWA 3AJAA 4P3PA 3OZTA 2FEPA 2CEAA 4U2BA 1F9AA 5DYIA 5HFAA 3ROTA 3KUDA 3E0XA 3LC7O 1PFQA 1PVOA 5ALFA 1XN1A 3EGXB 2ZJYA 1E9CA 4AT1A 3QA3E 1P1BA 4RLSA 3VI3B 1YB7A 2HR1A 3I39X 3EBOA 4AZ3A 5KEIA 3AKCA 2NZ2A 3RPEA 3JVEA 4OH1A 1QFXA 5LBUA 1KZYC 4IUBS 5E6SB 1R6AA 2WTBA 1XKQA 2QLTA 2JBHA 1P9OA 1UKYA 2QMEA 3W9BA 5K3BA 2WPDA 1AGRA 2B0CA 1Z2NX 2EYUA 1Q0QA 3QEJA 3ZIAD 2R3SA 3Q11A 4K9RA 3RAGA 4CZ2A 3RWOA 1RYZA 1B0PA 2XPCA 3DEYX 1VPLA 3H7AA 4YRGA 4JL5A 4AVYA 3D4PA 1MX5A 3ONWA 3JS5A 1UL1X 1S2MA 4YI5A 3ML1A 3G8AA 4XVHA 1O9GA 4BX2A 2XKAA 1WIWA 1QH9A 2GERA 2ZETA 1WXDA 4L0DA 4L50A 1ZRSA 4AS2A 4YT8A 3FNBA 4ZOEA 1D9ZA 2R8ZA 2VNKA 2RHLA 3G0IA 4O2AB 4X61A 4ZRMA 1G59A 5CB4F 1DJMA 1JEAA 5LA6A 2OL4A 1PHRA 2PG3A 1YASA 4TSKA 1ZITA 4KX5A 3SCZA 2CNDA 3MSXA 2X8WA 3Q2OA 1M8FA 2HO5A 3WTCA 2VF2A 1HYEA 4PCVA 4Q4DA 1NZDA 5COQA 1YDMA 1L4NA 2H2WA 4AKGA 1L4LA 5FI5A 4ZYWA 4ED9A 4LF8B 4MUHA 2X19A 3SHTA 5KDDA 1IJFA 3P1JA 4ZVNA 4CBVA 1POXA 1XXLA 4LXIA 1NN0A 2IHYA 3R3UA 4HAYA 1KJYA 3PKJA 4RH0A 4YMIA 5HA5A 4E2YA 1EXWA 4BJ3A 4QNMA 1RXWA 5AJZA 1W4LA 4JL6A 3STYA 3GFVA 2IP4A 4K9PA 2GBLA 1X42A 3IVMA 1CC1S 2FZGA 3LO5A 1H9AA 1BDIA 2FPPA 4O5OA 3K6SB 1D5CA 5LQUA 3R7DA 4JYZA 3OD1A 2PUHA 3EDRA 2VLBA 3PXDA 2QVBA 2AFIB 2BMVA 3KL4A 3MJSA 2FEOA 2AYZA 4OVKA 4EHFA 4HUQB 4YMUA 3QZUA 3ZY6A 1R3UA 4CM3A 1Y8CA 5JU6A 1O97D 1Y8QA 3PD1A 5E6UA 1MB4A 5D51S 1P72A 3RK4A 4YUXA 1TU3A 2XGGA 1GXSA 2KM1A 4Y6LA 2QP9X 1WW8A 3HG7A 3TXYA 2EW2A 1A7KA 1YFJA 3SQMA 2H63A 3TD6A 4KXMA 2HA5A 4MXDA 1C0PA 3RR2A 2P30A 3BMQA 3R5HA 1X94A 5TEVA 1W19A 3R7LA 4C6TB 3PHGA 1O3YA 1ZOOA 3DDNA 4ZOCA 5HSGA 5F9FA 3WWZA 3G2HA 2B69A 1KE1A 4ER3A 3ZE0B 4KW7A 5B55A 3MJTA 3I83A 4IIJA 1OBCA 1N0UA 2PQ0A 1I0IA 3M83A 1SGWA 1E6LA 2R6DA 3BFXA 3PUHA 2NT3A 3E7FA 4D9NA 4D26A 3ZVLA 1XYYA 2CEKA 5DYGA 1OKKA 4A6XA 5A06A 4YY3B 4QUJA 4LF6B 2C9ZA 4H7EA 5J59A 4ASUD 4ZQBA 3W9SA 4BCCA 3ESXA 1NYTA 1ZN2A 2QQFA 3SXJA 1M6VB 16PKA 1WETA 2WQ6A 3L0ZA 1EP9A 1FNDA 2PA3A 5EVJA 3TTXA 1Q57A 1YWGO 2REQA 1CZLA 3MW8A 3PC8C 5CVCA 3UGTA 4ENPA 2VP4A 3SJZA 2WR8A 3GLFE 1F8XA 2AFHB 1U9CA 3D6HA 5CM9C 2Y05A 3BCSA 3Q5DA 3BIOA 4Q7MB 3EIEA 3F3SA 3Q6IA 4D3SA 4EMBA 4EK9A 2ZJFA 1VLZA 3DR3A 2R00C 3E8XA 4P5EA 1GADO 4QFMA 2WAOA 3KQMA 5UKDA 3OETA 2DSNA 2QW8A 3L6DA 4ZAGA 4BKUA 3VA7A 4A7PA 3OEEA 3MB8A 1ZVQA 1XROA 2CVZA 3L79A 2GEJA 5EYPB 2P4SA 3CNQS 3W5SA 5KNCH 3KVYA 1FYWA 2EBWA 4GE0A 4HDQB 4GPAA 1IE3A 4P0TA 1L5SA 3RBVA 1LW6E 4R3NA 2DE0X 5IJ9A 3E9QA 5H68A 1L7XA 3AQIA 4WLOA 3S1AA 4CIXA 1E61A 1I4DD 1KY3A 1YS7A 3T61A 3MUEA 5EE9A 1BMDA 1OCEA 1WLSA 4H18A 1L5FA 4W5QA 1IQ0A 4IXWA 1ORHA 5FEMA 3URKA 2FFHA 3TDMA 2OAQ1 3SZGA 2ZIFA 4LDAA 3GUYA 4I81A 3VR4D 4QVGA 3B7WA 2QX9A 4PX5A 3ROZA 1KSFX 3OA0A 3D1LA 1CY0A 1WZCA 2JGDB 4CQLB 1NHWA 1RM4A 2A14A 5KYXA 2R7LA 3N3AC 2OHOA 4R7GA 1PT5A 1Y3CE 1WULS 1SXJB 1RXYA 4DJJA 3ETJA 2VF8A 2QAIA 5FA6A 3GLIE 4UM9B 5CLIA 1SFRA 3KR9A 3BMXA 1XKTA 1BW9A 1Z13A 1Z6AA 1RHMA 2BFCB 2ZKIA 4OAQA 3A9RA 4XIFA 5DGHA 5FWYA 1CV2A 1D6MA 1NBMA 3EEYA 1S96A 4I0WB 4MW4A 1E1YA 3SKXA 5HKKD 1MIOA 2IS1A 2QE7A 1K27A 1AKTA 5IARA 1MJNA 2I3GA 1JAIA 3EPKA 1YFLA 1Q11A 2VATA 5ADHA 2XDYA 3FOAA 2DC1A 2NU8B 2GJKA 4LGMA 3GVHA 1EFLA 4BNMA 3HEMA 4OFWA 1TUIA 3BK2A 3CWZA 5HILA 2AKAB 1CEQA 1VIMA 3TCKA 2ZUSA 3EEIA 4TTJA 4MB6A 3UO8B 4G9GA 4FFVA 2DT8A 4GLLA 2VVTA 5DK4A 3WHKA 1CE8A 4H15A 2P0EA 1DAOA 3C7KA 1DQRA 4K9QA 2AC2A 4F6RB 1KJNA 1HH4A 1L5MA 2BHNA 2JFUA 1U2TA 4JBWA 4CM8B 1OH8A 1WCIB 3WYGA 3DXYA 4E07A 4ZCTA 3R9XA 3KFXA 2GRAA 1HFJA 1OXVA 4QUHA 3L8HA 3D0RA 2YWXA 4JX8A 5AM0A 1MOPA 1M34B 5EKDA 2FMTA 1ZBDA 2CF6A 2FSFA 4M0KA 1KBQA 1U3UA 1CUIA 2TMKA 4CMEA 2WJPA 4DWOA 4F4JA 4XW2A 2DBRA 8AT1A 1HMYA 1TVKB 3DDOA 2FRDA 3GEEA 2X0RA 2B3TA 4C1BA 2ZG6A 5D01A 1QKJA 2QSYA 3UMYA 4HDKB 4RHEA 3ZNNA 3PFGA 2MMCA 2WHEA 1ISRA 3JARA 1SHUX 2A92A 2H2FA 2M1XA 3QELA 1GA6A 2QIPA 1Z26A 1YXMA 2OFXA 5DDIP 1K86A 3WO0A 3T7RA 1Z6TA 2RHHA 2WI8A 3MMPA 2I99A 3QUAA 4YQYA 5EHQA 1JDSA 3LZ6A 1G8HA 5JXJA 1W34A 2Y0EA 1O89A 2O5CA 4IICA 4PVDA 1ULBA 2VHZA 3PFNA 2FEWB 4PC2A 3RTAA 3SFTA 1DJLA 2Z95A 1DDGA 2ZPTX 1KEEB 4FYVA 1UPUA 4GD3Q 4TX1A 2FTKE 1N2HA 2O4CA 5KSOA 1O95C 4UHDA 1EDEA 2PYZA 4Q7LA 2IZZA 2COKA 2O2JA 3PKIA 4P8RA 1S6YA 1GUDA 1G8JA 1NC1A 5DT9A 1NW4A 3FZQA 2LDBA 1TB4A 3CB2A 4CF6A 1CK4A 4YJDA 1E3SA 2H9AA 3N2KB 3COPA 1KSJA 4CKEB 4NV3A 1VFNA 1PIWA 3DCYA 3O8RA 3IT1A 4TQGA 3E5MA 1SBZA 2XB8A 4KFTA 4P82A 5G1NA 2PCLA 4EUNA 1ESZA 3FMGA 4O08A 3GHYA 3H87A 2AOUA 5TSDA 3ZE8A 5B58T 1N4DA 2R25B 4GOOD 2OXTA 2QX6A 2DQSA 3TPCA 3NKVA 3C4JA 4AC9A 4R8MA 4DANA 1L9XA 3CVWA 2R65A 2LUOA 4DAOA 1E9RA 4UNRA 4PYOA 3LUHA 5A7FA 5HIKA 4KPEC 4LI0A 1B8UA 3GI1A 4QZVA 3EXHB 1SCBA 1W8DA 2IUYA 1DC6A 3Q40A 3GEGA 4RV9A 3H2ZA 2D2EA 1JKJA 2PO7A 5C8YA 1NF9A 1HG0A 2OD2A 5TDHA 2OFPA 1EA7A 1DMRA 1H8EA 1D7OA 1QM5A 3T1NA 1DXQA 1YB6A 2BGKA 3N7AA 3NHFA 3AFOA 4XJVA 3UCEA 2JEZA 2Z6AA 5LP6B 1LSUA 1U3VA 5LB2A 1WS6A 1N5OX 4AXXA 4RDIA 3O8QB 4EFNA 5K6AA 3HN7A 4DV4B 2EBHX 1MZVA 4HG2A 1DDIA 1LRLA 5IC6A 5JFGA 1J8FA 1Q0SA 4IIEA 4C3VA 1JFFA 4ZJZA 3ZD6A 4LNUB 4RPKA 3VO2A 1CUYA 5T4BA 5C1DA 1KMIY 3D8RA 3HRKA 4QA9A 2N75A 1W59A 2DWUA 3B82A 3A27A 1KQGA 3OEYA 1PRYA 1S2OA 1YA8A 4IG9A 1F0PA 5LLTA 1FSPA 1R4AA 3EOBI 3UTDA 3JD0A 1J8YF 2WBLC 1X1AA 1G3QA 3O2NA 4ZK2A 5L3RA 1N3YA 2EFCB 2GD0A 1ZJYA 3HN6A 3OZXA 4OBBA 4ZGGA 5KOIA 1VPWA 1G6HA 2WSYB 2ZQ5A 1DOZA 1QJCA 3D64A 3EIQA 3FMVA 4C4TA 1JDNA 1THMA 3RS0A 2I91A 4OU4A 3K9FC 3HR4A 1NDQA 1LNQA 1E4YA 2X5JO 4ZT2A 4MZDA 3UBTA 1Z12A 4BKRA 2J6CA 3E1KA 1NGSA 2WT8A 2RGNA 3OEWA 1QPZA 3AOGA 3RJMA 3KXKA 1TYBE 1P2DA 5CGZA 5ITSA 5JFOA 1JIVA 1T9ZA 4GGMX 3UQYS 3DEHA 1F2UA 2YIDA 4IEFB 1NFQA 2SNIE 2GASA 3G7UA 3U3KA 2WT4A 1T2EA 1VP9A 3HY4A 3GDHA 3FKQA 1PGPA 3RYFA 1JSLA 5FI0B 4CLHA 3WGOA 2YVLA 4ND3A 2QROA 4LRQA 2R86A 1UXKA 4G65A 4R7ZA 5FORA 2BDEA 2ZRGA 1P4JA 4RVOA 3OIYA 3F4BA 1UT5A 2FZWA 4YT2A 4MS1B 4BL5A 2B98A 4TMKA 1MENA 2WTEA 1XTQA 3BN3A 3KWMA 1FFXA 2PSDA 4RKYA 3N70A 4ZO6A 5BQPA 1C30A 2VO1A 2YDXA 3EFBA 4FYHA 5AHWA 1WSAA 4LG1A 3JQGB 1L8LA 3HFRA 5PNTA 4I5IA 2CNKA 5DIZA 1V16B 5FYQA 4Z1MA 4EF5A 5J23A 1WBDA 5A7HA 2NVUB 4MRMA 5FNZA 1IPFA 3AETB 1F4PA 2IYVA 2OBXA 5SZKB 5KS2A 5TF4A 1RAFA 4RXMA 2D1RA 4AFNA 2HDNB 1PJ3A 4H7JA 1UM9B 2H08A 5FLEX 3UIEA 1PZEA 3LX5A 4JYBA 3WLAA 5JASA 1Y1RA 2Z1DA 2H18A 3K8OE 4HNQA 4O2BF 4R1TA 4IMPA 3RS8A 4A0RA 3HXQA 5TMBA 2V74B 4DEXA 1XAIA 2F9LA 3RYHA 4H6VA 3IIMA 3DHNA 1ZMRA 3MCWA 3OOWA 3SU8A 3TTYA 4DQXA 4EY8A 4Z4EA 1QRUA 1UBGA 2ZSUA 1NVBA 3AX6A 2ZS9A 1G2QA 1L7VC 1MHPA 3OF5A 4GYJA 2HFJA 2XUKA 4JR2A 2GPNA 4X20A 4RKQA 1WE2A 4LWPA 2BMWA 1XZ8A 4UTOA 3VJMA 3PX3A 1UP6A 2BDTA 2B78A 5ALWA 3WDLA 2IFTA 1IHPA 1XHLA 3FZYA 3GOQA 4HYTA 4P36A 4UULA 2BC9A 4S04A 2RB4A 1L7PA 2QTNA 4V24A 1OI4A 2FHSA 3GPDG 4GVXA 4BLWA 4WOBA 2ZBUA 3GJ7A 5E8JA 4DIUA 4QBKA 2J5BA 2WD8A 4EFLA 4N0QA 5EJ4A 5HCNA 1P7YA 5GJCA 1EFUA 3A4MA 1KOGA 2E5FA 4P86A 2Q41A 3HTXA 4AS1A 4H27A 1KYXA 2I3BA 4ER0A 1GRNA 3TUIC 4HFNA 3M5DA 3U7QB 3RHZA 3LBHA 2ZTVA 2YYYA 1A8UA 1P9NA 4D9IA 3IT2A 3KVRA 3KK0A 1V5GA 3RJ5A 3FF1A 3G8BA 4M0CA 4QUBA 2RBEA 2QTVA 5JAZA 3CSUA 4MITA 4RVUA 4K28A 1E7MA 4GKBA 5BV7A 2L0XA 1TU4A 1CQIB 1ODFA 3ADOA 3MWFA 5K4AA 2J9FB 5AI6A 4QPDA 5EXXA 1ONPA 4P7JA 3I9NA 1OFGA 3U4QB 4X7MA 1Z16A 2C9MA 4CFYA 2O8DB 2LIPA 2PFGA 2D06A 5TV2A 1JHOA 4IFBA 5A71A 4B74A 4DSAA 2WU3A 3EZLA 3B2NA 4NRDA 1Z7BA 4DNPA 3AEQB 1STOA 3I9OA 3LWBA 3QUTA 4B43A 1U5BB 3WYAA 5ECDA 1KEVA 4UMEA 4WAUA 3K15A 5CIWA 2JH9A 2WG1A 4PY2A 1GQQA 1UWLA 5DNYB 1KMHA 3AY0A 3PCTA 3BUSA 3OECA 5EAIA 5KTOA 3WIOA 3HADA 3GNQA 4CLDA 3NGMA 3ASUA 4Y1RB 5IM4F 3EAFA 1AK2A 1ZQ1A 4L07A 1VJRA 4CE6A 4CDGA 2IHNA 2HT1A 2NTNA 3X1YA 4HYYA 4YBZA 2YRFA 4RV5A 3K9GA 1RVV1 2B21A 4XGKA 3QH4A 2XXAA 2IYWA 2QAGC 5IC4A 2RHWA 5EJ2A 1W2GA 2CUNA 4PO3X 3IESA 3ZQKA 4C20A 4J91A 4GDFA 1EFDN 3T3MB 1EBFA 5EHGA 3KEQA 1L8QA 2ERYA 2Q0SA 3AR5A 2WYHA 1U02A 2IP1A 2QM7A 3K8QA 3GF4A 3ILSA 2P9HA 4I1YA 1V1MB 2DFPA 3IYLW 4TLMB 3TRJA 5KQMA 4O2LA 1RRGA 4QWWA 1O0SA 1MABA 1R4ZA 1KKMA 2HREA 2X5OA 5AIBA 4ZZ1A 2XGOA 3HCWA 2B7CA 2OBMA 1Q6YA 5A1JA 2CL0X 2BKLA 3CONA 5JI3E 3ENNA 4BTEA 3FPEA 3M6UA 1J2UA 4B7XA 2HBYA 4TMYA 3LE8A 1S4MA 4ZVMA 4HD8A 3U62A 4BQNA 4DIOA 3CSDA 2MSLA 4PZ0A 2DEUA 1G20B 1R5JA 1FLDA 3HV2A 3LV8A 4M0PA 4WN9B 3C1UA 1UEJA 1QCCA 2GYUA 2NV2B 1KQFA 3OZBA 4EB6B 1ZNZA 2FNAA 2OT3B 3THYA 1UKCA 3DE2X 3GZTB 7REQB 2CJWA 3LFTA 2XLBA 4PHGA 2FPGB 3EISA 1URPA 4MVJM 2OORA 3BC1A 4PLVA 2JC3A 5JS1A 4AM8A 5FPHA 5LM3A 2QTFA 5KI6A 3ZOZA 2NSDA 3M6FA 5B3KA 2IU4A 2VNAA 4FMBB 3AF0A 3WHIA 3GRAA 4D0NA 1I7DA 5HMLA 5GINE 1R4MA 5AVKA 3OLZA 1K75A 2IIPA 1M83A 1XZIA 2L19A 3G0CA 3FFAA 1S7GA 1QG0A 2GFIA 1P1IA 2PRZA 4U7GA 1IVNA 4UTZA 2QRKA 2FJ0A 5AJYA 4KITB 5BNIA 1A82A 2WSSA 1MJHA 4ND7A 4E70A 1ODLA 2CZCA 2IYFA 3Q8WA 3QVTA 3QVGB 4YK7A 1E1RD 2HLDA 1CIPA 5EUQB 1FBNA 2NQTA 4GW3A 2H00A 5BVHA 1XKLA 3KETA 3INYA 1G42A 3T5AA 1BEEA 2PJDA 1NX6A 4FEEA 4PINA 1T9BA 4X45A 4L3VA 1HFKA 1P77A 2LBPA 4UPVA 4E46A 5JG7A 1YBFA 4A8JA 1EG2A 1TZBA 1UT6A 2FJPA 3WOHA 3H8SA 2QT0A 3T15A 3W4KA 7YASA 1W5TA 4F4FA 2C4VA 3DTNA 1FC0A 1B8VA 5A6SA 1RXEA 1E4OA 1TAGA 5BUQA 5JAPA 2DWOA 3BJEA 5JSKA 3AEZA 2BOVA 2OZEA 3H84A 3D3WA 4NU8X 3WRYA 1X7DA 4C4AA 2ZTSA 5BN3B 1NG9A 1CZNA 5EXDA 4EHDA 5H59A 1REQA 1GQ2A 4BLUA 4ZICA 4UEOA 2I55A 1DAFA 3C3MA 5DJ5A 1LUAA 1R0CA 3JQ7B 1YB1A 1OZ0A 3GLGE 4MDEA 1B1AA 4QE3A 4YACA 4QPCA 3RSSA 5FPYA 3VDNB 3SKYA 4ARBA 4AP6A 1YNSA 3PNQA 3IUEA 1PD1A 3K0FB 3T7DA 4HFJA 1TGVA 1BE1A 4G1MB 3ABZA 4JBGA 1BZYA 3T0GA 5HRUA 1B6TA 3CUWA 4V1CI 4BMNA 4F7DA 1UH5A 2CDAA 4IIYA 2A0YA 3LGXA 1K7EB 2Q2WA 1NMXA 3KKLA 1PX0A 4DEYA 1NKVA 3K70C 3BE8A 5IMBA 3O3CA 4M7WA 2MINA 2WTMA 3WMFA 2VXYA 3LLVA 4EZEA 4CIWA 3S8EA 5CW2A 4A03A 5NULA 5J43A 2V7TA 5JCJD 4U9HS 2HSWA 3UMVA 2JL1A 4Z4FA 4JLNA 1CVLA 4GFDA 5KWEA 2JIMA 3RNOA 2FPRA 4MB2A 3TDNA 3NC0C 5FF9A 4UFPA 5C18A 1L9KA 1Z2CA 5TLSA 3EEOA 4CM9D 3HWWA 4R84A 4REOA 4C05A 1OX6A 4N40A 4LVNA 1OHHD 1OB5A 1P61B 3ZH9B 1C0KA 3TSYA 1PQUA 4F2HA 3FNEA 4HWPA 1D9XA 4FLMA 4TXNA 4DILA 2VP3A 1FSZA 5HUQA 3I34X 3HP4A 2C31A 1NA5A 3EHDA 5JSFA 5EZ5A 1FE8A 1YS2X 4KWEA 3BL6A 3SF0A 1KP9A 4Q19A 3Q8XB 2R8OA 1QQAA 4QRHA 2H5IA 3I72A 2Z43A 3NTUA 3ANLA 3E7DA 1LSSA 2AFRA 3FRHA 3FUUA 2O8FB 4JXKA 2Q1SA 3I73A 3F8WA 1NL3A 2ZXUA 5GY7A 1LV7A 5EE3A 1MG5A 2QZZA 3NC4A 1A4UA 3UMJA 2GZRA 2HKIA 4I55A 3WYNA 4HNVA 3RSHA 1M5RA 1SD1A 1ABEA 3UHOA 3WGZA 3DULA 3KJHA 4PSCA 4X7RA 1ZVMA 1DJQA 2FLVA 3TEMA 2H9IA 4D9EA 1KC3A 2V7QA 1J5EB 4YYZA 4OJTA 2VDVE 1TO6A 3AHFA 3K72B 1P7WA 2CVQA 2EDCA 1CDOA 4X92A 5GQSA 3TW8B 1IXZA 3FZEA 3W5HA 2X76A 1OPXA 3GJ4A 2R48A 4NCXA 4FGKA 1K5PA 1Y3IA 2CD7A 4IH9A 1JLLA 4PLHA 5E6RA 4DIDA 1VZ3A 2YZ7A 4P0PB 1AB6A 1YBMA 2OG2A 1LFAA 2NUPA 4NG4A 4F8YA 4FZJA 4RA9B 4RIFA 4DMCA 4D9MA 3LPCA 4GRAA 1EXDA 5I9BA 1UEIA 3FG9A 2EATA 3OQMA 1WNTA 2Q0HA 4NJOA 5C8DA 3K5WA 3PWZA 1WPQA 2CLEB 1FLAA 1HDCA 1M8JA 4NYMR 4RSHA 4AMZA 3TNDA 5LWQA 2FLKA 4W1SA 4JP5A 4ZKEA 4F5WA 3QW2A 4JGIA 4N65A 5BT9A 1SIOA 2AXQA 3FA2A 4ZPXA 4YS6A 4YP1A 1CWUA 1MKYA 1GZUA 2XLCA 5DLQC 5DGDA 1PLJA 4EUHA 4YRSA 1KJWA 4X93A 2TSYB 1A9SA 2HY7A 2ZE7A 3KZXA 4OKIA 4M1ZA 3WLHA 5JQGB 1RYFA 2QLLA 3AI1A 1QR6A 4DPMA 2R8BA 3EN0A 5J9FA 4CLRA 5FBLB 3GXBA 2IIVA 2R0QC 1VL1A 5F7XA 5IFLA 3W5UA 2PRYA 1GZHB 2RH5A 1DBVO 3TRKA 4UATA 2DCMA 1SG6A 3BRSA 3ZI7A 3ZW9A 1H1LA 3IDSA 2LCQA 2DQ4A 3A4NA 3C7DB 4B6PA 2PUCA 1ENPA 3VR5H 3W04A 4XWGA 1NF2A 2VTBA 1KFKB 3K8YA 1NURA 3L49A 1EUDB 1Q91A 1UFKA 4H1TA 1US8B 2ACKA 4PYRA 5ITVA 2FOLA 3ZVKA 4I66A 3JWPA 4M9UA 2D6FA 2O8EB 4F56A 2XB2A 3X0DA 2JFPA 5COAA 3D1VA 4MICA 5EIEA 2UYOA 3SYMA 1VSTA 1ZJJA 1Z35A 3NHSA 3RH0A 3VDRA 3USZA 4DCGA 1JKXA 2IHVA 4OGGA 2YWDA 3A3OA 2AI1A 3CPJB 1SK8A 2WIDA 3BREA 1J8DA 1X2EA 1N6RA 4Q1FA 2JAXA 5BVGA 4R9UC 1YOVA 3KLMX 5E3HA 1MO6A 2K6GA 3S2IA 3Q1LA 4YHBA 2CB0A 1G8PA 3CLRC 3CZ4A 5HBGA 2ZBFA 2C1EA 3BRWA 5JQWA 1BFDA 2YWFA 2P2DA 1HDXA 1FBTA 3FOWA 3H3XA 4L5AA 2B5WA 1GKUB 2WVJA 3PNPA 4OLFA 3C3BA 4Y2HA 4R8RA 2QL6A 5F12A 1GCIA 4IQ4A 4ITRC 3IJEB 3SK0A 4EYSA 1EH5A 1NG1A 1GZVA 2GBLC 2VSFA 2OCKA 1V25A 1IY1A 1QE0A 4YMWA 4KCGA 2P2GA 4OUDB 3T94A 1NQOA 4CQMB 1LBEA 2D8MA 2QK4A 2XE8A 5KQSA 4CKCA 3ORQA 4N48A 4RMIA 3QPBA 3PUZA 1PL8A 1UBMS 4R8KA 3HUFA 3U48A 2Q3HA 2Q3LA 1U94A 2HUPA 1BXZA 3E4CA 4XQEA 2AG5A 5AJHA 4JIGA 1PT9A 2NXEA 4ER6A 5JH7B 3K71B 1V1JA 1WMAA 2GAFA 4CM1A 4G5FA 4DDWA 3WK4A 5AUNB 4FPXA 1O5TA 2DR0A 3A3KA 3GLIA 3VAYA 2EF1A 4PQEA 2WKRA 3UK1A 4CG0A 4ZU3A 4II7A 2GN6A 4JBHA 3PWSA 2W98A 4RZHA 2C5GA 1T2AA 3BL8A 3T5MA 2R7NA 1FSGA 1KH1A 2VP0A 3LCUA 4CVNA 1GM5A 4C4SA 2IBSA 2R47A 1X1DA 1FFYA 3WMXA 2EAUA 1I30A 3PWKA 3VH2A 3FM9A 1KRHA 1YCFA 4HPWA 5HK8A 3RVSA 1KERA 4ARAA 4AUEA 3X1JA 4D4LA 1GG2A 1Z34A 3U4IA 5DFAA 4DRXA 3RYCA 3RKRA 1E2NA 3LXRA 2C7QA 1YTUA 3DEJA 5E7QA 1YULA 1GPYA 2HJVA 2V0CA 4Y1EA 3H6KA 3TLEA 1CJKC 4M1SA 1RM5A 3WLEA 5J2UF 3D3JA 2BW0A 1D7AA 4JLOA 1OFUA 4CGYA 1TI7A 3FCXA 1PQWA 5H4HA 1HG1A 1VGQA 3OOJA 5D1NA 3TAXA 3TR6A 4CG3A 3ODGA 4K86A 3OCWA 4P33A 4R1PA 6GPBA 5TEWA 2FWIA 3LKZA 1F48A 4H6WA 4IJ6A 4IWNA 2JIQA 2FQXA 3WZ2A 2J3JA 5DX1A 2DKOA 1YRWA 4AJPA 4IHJA 2X0JA 1A97A 1C14A 2ZTHA 3ETGA 4BGUA 2X6RA 1T15A 2W8BA 1IOZA 2VH2A 1BKDR 3GFBA 4R1MA 3O0TA 3LKBA 1Q0TA 5AP9A 2QGFA 3IKMB 4KI7A 4OBXA 2GD1O 2FDRA 4ER7A 2UUBB 2QGZA 2CZGA 2RKOA 1IAQA 4XLTA 2FPWA 1N3IA 3GDWA 4MQBA 4PC7A 3TL2A 1M8PA 3TI9A 4CM4B 2X23A 3D6NB 2HCJB 2QL9A 2VYQA 2JGRA 3ZWBA 2GKOA 1WF6A 1ZNQO 2XMRA 1KC1A 3GWGA 3M81A 4HWRA 4ZI5A 2G9UA 4TRJA 3WR5A 2R8PA 1PFKA 2W2QA 2BBWA 2YZMA 4K6HA 1JKIA 4BMPB 4ZKDA 3COSA 4S2UA 3DBVO 1XZKA 2IITA 2CMFA 1VRWA 3FKJA 4FE4A 4G01B 3L8FA 3FJ1A 4LC0A 1V5FA 2OKCA 3FOCA 5LU8A 2PAAA 4FS8A 3SJBA 5K20A 2OCXA 5JD5A 2DQYA 1OJ7A 1XT6A 1ATZA 2C61A 2FEXA 4EA9A 4IEEA 3VJKA 3S5JA