2FGKA

Crystal structure of the abc-cassette e631q mutant of hlyb with bound atp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
241
structure length
241
Chain Sequence
DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
publication title A structural analysis of asymmetry required for catalytic activity of an ABC-ATPase domain dimer.
pubmed doi rcsb
source organism Escherichia coli
total genus 69
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fgkA00
5P21A 2ZI6A 3ADCA 3PQCA 4I1SA 1Z6AA 2F1HA 3R7WB 2QRZA 4F93B 1G3IA 3OFNA 2AWOA 3MG9A 4UNQA 3SE0A 4MYHA 3RRYA 1HA3A 2CHGA 2GXQA 4P33A 4RSGA 2V54A 1TL7C 1KDOA 3NTUA 1DAHA 2OSBA 3I8XA 3L0SA 4UXIA 5IF9A 2HCJB 5FOVA 1OXTA 1U0JA 2SHKA 3D7MA 4BFUA 4Z1MD 2F7SA 2ERXA 2W83A 4CF7A 3UMFA 3B85A 3GP8A 3U44B 1YJ5A 3FB4A 1W4AA 2DBYA 2GKSA 2WTUA 1Z63A 2LCFA 1NSTA 1XFAA 4RD1A 3BFXA 4L4UA 4ASUD 5LBIA 1FOEB 1GRQA 2J0VA 3IHWA 1LF5A 2IS1A 3C16C 5FTKA 2QEQA 4LBWA 2G1JA 1OH6A 2UZ3A 1F2UB 2GAAA 3RAPR 2OCBA 2QTVB 2KSQA 2ZI7A 1NMXA 3GJ8A 3TAUA 4DT1A 3GJ7A 3CIOA 1G7SA 2QU8A 1VCIA 1DG1G 4GMDA 3VQTA 3KJHA 5EP1A 2OLKA 4QKQA 1JR3A 3TSWA 1ZD1A 4M53A 1Z0AA 3J81k 5LD2B 2O0KA 1KI9A 2XSZD 4ARZB 1XBTA 2ATVA 1GKUB 2O8DB 3A6PC 3DO6A 2IS6A 5C1BA 5CM9C 3W3ZB 4UNSA 2ZRFA 4CRWB 2QZ4A 2GZHA 1E9EA 1U8ZA 2O0HA 1ZU4A 3S1AB 1YR6A 3WXMA 4AURA 2A5FA 3NBZC 2ORWA 4F38A 3K9GA 2GRJA 1PLLA 4PX9A 4NYIR 3DEFA 4MUAA 1OH8A 4QM7A 2GCNA 3M1IA 5EUQB 1H65A 4HZUA 3TUZC 1IN4A 1Z08A 3SBDA 4BUJA 2D7DA 3BAFA 5KOYA 3WMGA 5IHPA 1KI8A 4PO9A 3VFDA 3NDPA 1FNNA 3JVVA 3UMSA 5BXQC 4LGMA 4KSCA 1E98A 1OYYA 1E32A 2FDCA 1OH5A 3T5GA 2CK3A 2XOKA 2FSHA 3K8YA 4DSUA 5L3VA 4KBGA 3MJHA 3OAAA 1IXRC 2ZJAA 2JJ2A 3AGPA 3H0KA 2ZUBA 1NI3A 4LYAA 4PHHA 3K0AA 5HTKA 2Y8EA 3RC3A 4EDHA 4B3BA 3DVLA 1R4AA 4M9QA 5FUYA 2AR7A 1XX6A 4FN5A 3R7WA 2KE5A 3B7GA 4GNKA 4NMMA 3WMEA 2IK8A 3LDAA 5KUTA 2IEYA 2A3RA 721PA 4TYNA 4NP6A 2DR3A 1IN5A 1LS6A 3I5YA 2VP2A 4U7DA 2YC4C 3MCAA 1WQ1R 5CIQA 2H18A 4X8OA 3TUJC 4M1YA 5TARA 5FBVB 5IK2D 2PJRA 5GVSA 4M9ZA 4ZO4A 3W5IA 1JEDA 2HCBA 1NSFA 2EW1A 3U44A 3O47A 5DHFA 2ONKA 4B35A 2IL1A 5HZHA 1VG1A 3DM5A 1HV8A 1Z6XA 4JVMA 4BZXA 1T6NA 1CR1A 3UG6A 4DUGD 2O8CB 4WZBE 2TMKA 4MKFA 1VHLA 3SHWA 2Q0HA 1F2UA 2ZE7A 3DZDA 1W36B 1LB1B 1ZYUA 5EE0A 1AQUA 3U3MA 1XMIA 2IYLD 3GLHE 1N25A 4EPRA 3LLUA 1N6KA 4PZZA 1D2EA 4QBGB 3VU9B 1Q22A 1W47A 5AUOB 3KKNA 3CF0A 1CXZA 1R5BA 2GZDA 3IHLA 5FBRB 2IYRA 2W0SA 4Q9LA 4K81B 5HKKD 3Q85A 3RS3A 5AJYA 1JECA 1SZPA 2FWRA 5B64A 2O8DA 1VDZA 2DCUA 2BMFA 2GJ9A 1JXMA 3ZGXA 2AFHE 2WBLC 1DAIA 1G8YA 3LV8A 4RKFA 4V0LA 2B7CA 1VMAA 2ZAMA 3S1AA 2JGNA 2W2TA 3L8YA 3U5ZB 3BH6A 4DCVA 3EARA 1XP8A 2F6RA 3QF7A 4TLBA 1IN6A 2R44A 2OAP1 2IYYA 5KDLA 3O8CA 5F9FA 3FFAA 3TKLA 1E2QA 1FP7A 1NG1A 1KJWA 4KCGA 1T8TA 2JDID 3FGNA 1LW7A 3BOSA 1IONA 1ZNWA 1YZLA 1CULC 1Z2AA 2ZE8A 3SJAA 4C9BA 1S3SA 4DIDA 1E9DA 1G3MA 3OE7D 4B2PA 2FV8A 5FL7A 1ELOA 5JI2E 1XB2A 1M74A 5EE1A 3M4YA 4JLVA 3U3JA 2RB4A 2ONJA 3C41J 4OHVA 5FTLA 1NN5A 3L8ZA 1JQLB 4Q7JB 1KK2A 3BRWD 3U60B 2WOOA 4QFMA 5FFMA 5F98A 1F2TB 4ABYA 2PBRA 4JKIA 1ZNYA 5D3MA 4PO8A 1FZQA 3CRRA 1XTJA 3E2IA 3OIVA 2C8VA 4NHOA 1TADA 3PEUA 3DKVA 4XSGA 1A82A 2JA1A 4RZXA 2CE2X 2J41A 3CR8A 2DWPA 4IOMA 2IS2A 1OIWA 1RRGA 1U9IA 5J4HA 4JL5A 1Z6TA 5DISB 2C96A 1G19A 4LBZA 3B1YA 3GMTA 1GOTA 1Z0FA 3D6TB 4LY6A 1G41A 4JLOA 1XMSA 2WJHA 4P4SB 3T1TA 2OXCA 121PA 2QENA 4DEYA 1ZM2A 2RGBA 5EE5B 2NQ2C 3OEED 4AIIA 4MKIA 4C3ZA 421PA 5AWFC 5BWMA 4DCUA 4XJXA 2N42A 5EXXA 1VYUA 2QM7A 1G5RA 1IJEA 3GJ0A 4ZIRB 2O8CA 5L3SB 1M7HA 2ZJOA 2OBLA 4LYJA 2GHIA 3NWJA 3ZZ0A 3SOPA 2J1LA 2QMEA 1IXSB 1W49A 4HLDA 3EX7C 2YC2C 3OEHA 1E2JA 2EWVA 1YZTA 2ZJ8A 4G5RA 4TLCA 1OB5A 1BOFA 3VU9A 1VCNA 3U2QA 3SEAA 2EFEB 2FPKA 1ONBA 5KYKA 1FW6A 3A1SA 4LC1A 5FPTA 2J59A 3BERA 4HAYA 4Q4JB 3OF5A 2GF0A 2YZ2A 3IIMA 2J0QA 3PITA 4N1AA 1E94E 1XJ0A 2QROA 2FFAA 4IOLA 1I2DA 2AKYA 4TYWA 1MH1A 1G21E 1BYIA 1Q21A 2GK7A 2WSSD 4LX0A 4MKHA 2J7KA 3U7EB 2C95A 1Z28A 3H2YA 4Z8XA 3HR8A 4B34A 2KBFA 4BLQA 1W0KA 2CLSA 1W48A 4MA4A 5KNCA 4QGAA 3SNHA 1X8LA 3GJ3A 3KJIA 1OIVA 1Q3TA 1XEFA 221PA 2BHRA 4Q1AA 3QKSA 5DIFA 1ZU5A 3QQ5A 4Q1DA 2WPDA 1HQCA 2Q6TA 3VHLB 4XD7D 1E3MA 1X8KA 3AVTA 1E4VA 1Z6GA 4A6XA 4EAQA 4FINA 3O8BA 4LJ9A 3P4XA 5C4GB 3NXSA 3LH5A 621PA 3NEJA 3PEVA 4KVGA 1ZIPA 3TH5A 2QMHA 3MWLA 3SHFA 4D0NA 3SJCA 4DXAA 5EJEA 4TYQA 2O5VA 4HAWA 2IWRA 1E2MA 3ZDQA 1KK0A 2BEKA 1F2TA 2KWIA 3W6NA 5JEEA 1YVDA 2ZRDA 4JJZA 2IYVA 2WAXA 4DDTA 4LZZA 1R5NA 3CKLA 2ZYVX 2MSEB 3SJBA 5UKDA 2QA5A 2VSFA 4QHYA 3BXZA 2V1UA 1QVRA 3SC3A 4A1FA 3RS0A 2J0UB 2NZJA 4KAXA 2OILA 2OUKA 4D81A 1N6OA 4IHQA 3QKTA 1JB1A 5B30A 1Z8FA 5FOTA 1IHUA 4BFZA 4P4SA 4URWR 5CM8B 3WHKA 1KJZA 1II0A 2CL0X 4PAQA 5SZKB 3A4LA 1TF5A 2VEDA 3FMPB 2R62A 1NBMD 3TK1A 1WE2A 2CCGA 4ZIRA 5JS8A 4HEJA 5L3SA 1KZGB 4GT1A 1SXJD 4TQUS 3SQWA 2XJ4A 1TTTA 2XTNA 2C9YA 1BMFD 3AH8A 1EK0A 4C0SA 1G4AE 1I4DD 1PLKA 5GJCA 3QI2A 1YU9A 4C0QC 4V03A 3ZLJA 5IK2A 3E5HA 3BFVA 2E87A 1A4RA 2BOVA 3PUYA 2RGNC 3AKYA 5BN5A 5KPDA 4Q4JA 2DYKA 3CX7A 4HLUA 2AX4A 4JJKA 3RS7A 1GIAA 3X1YA 4LDJA 2Q3MA 3B78A 3QF4B 3GEEA 1V43A 2WV9A 1G3QA 1H8ED 1G4UR 4A0FA 1II9A 1T3HA 2W6JD 3BBPA 2OZEA 3SZRA 2GZAA 4URUR 4JIMA 3FYHA 4DCNA 1T91A 2D7CA 2BJVA 2VP5A 3X2SA 4LPKA 5DN6D 2XJ9A 3TJZA 2EFCB 5EXTA 2RGXA 3LQQA 4EPWA 1IY0A 5L3QB 1JXOA 2AWNA 4JT4A 4KFTA 2V3CC 3KJEA 3X1XA 3IPXA 1AGRA 3I3SR 3PUWA 2XGJA 1G291 4PAOA 1S1CA 3TW4A 4TMVA 5HKKA 4WOPA 4NE2A 2QMUA 2MMGA 4K46A 3WNDA 3QY0A 1X1RA 4M1WA 1U0LA 4IVPA 4LSGA 1TPZA 2ZI9A 2ZSBA 2FEOA 5CJPA 5J40A 1XTIA 4BZQA 4DLSA 2HT1A 1YQTA 4BFYA 1KGDA 4IDHA 4PPFA 1NMZA 1KY2A 2RCNA 1OV4A 4JLPA 4B71A 3SQXA 1CJMA 1N5IA 4HLUC 3KZ1E 2PX0A 4LJ5A 3LBIA 4A9AA 3NDBB 1F3OA 3QPUA 3VR2A 2JDIA 3MMPA 3AVYA 2ZQ5A 2O8EB 2FFQA 2Z6VA 4K8OA 1RC8A 2QTHA 1CLUA 4CVNA 3LAWA 2WKRA 1IN7A 4PZYA 5FBLB 5AUNB 2J0UA 3IBYA 1N6LA 2REXB 4JBXA 4WIAA 4B3DA 4TT3D 4QNMA 4RD0A 2DWOA 2F9MA 3CB4A 1DO2A 2NPIA 2AL7A 3IO3A 1AS0A 2P2LA 3AVWA 1XRJA 1F60A 1IM2A 2ZS9A 3NVAA 3GFPA 1W1WA 1E2GA 2FN4A 3HJNA 2GBLC 4CT5A 1DAFA 3GLFB 4XTCS 3RRMA 4LYFA 1NRJB 1R7RA 1ZRHA 4DCSA 1C4OA 4X8LA 1RYFA 2YKGA 2RGGA 1SGWA 5FOSA 1S9DA 1YHNA 2WWHA 1G20E 2WSMA 2EVWX 3FTQA 5HE9A 3GEIA 1S4QA 2WIBA 3B9QA 4F92B 1XJCA 3QG1A 4A0RA 4DLYA 1OT3A 3O8RA 2E9SA 3DMDA 4M0LA 4AWXA 3LNCA 3U6KA 2QORA 2AXNA 4WXPA 1Z3IX 2ZJZA 5CLQA 1GNPA 5L8VA 4C2TA 2P6RA 3Q3JB 2DB3A 1JNYA 3QEOA 5DO9A 3PEWA 2UZIR 1E96A 1G8PA 1TU3A 2VPPA 3QF4A 1M7GA 4A0GA 3K0EA 1MO5A 2VQSA 2G6BA 2V6IA 3AB3A 3P1JA 4BWYA 3ZD7A 3EPHA 1XPRA 4CEHB 4DLTA 2W58A 2QE7D 4H1UA 3MSXA 3CUEF 1SXJB 5BYKA 1OFTA 4H1VA 2QBYB 4FCTA 1QDEA 4CZ2A 3WNBA 1UAAA 2O8BB 5L3QA 1NVVQ 2Z5FA 2VLIA 2UKDA 2A5DA 1P62B 2YWFA 4N0DA 5LB4A 2BVNA 5JJKA 3PFIA 3W34A 1EGAA 2XTZA 3P27A 4FMBB 1JPJA 3ICQB 4ZI3A 5AUPB 1NF3A 4LHXA 4O25A 1NIPA 5IRCD 3A37A 3CH4B 5HZKA 4LK2A 2NOAA 1XWIA 4B44A 2CLCX 3B13B 3VNUA 5JCZA 1CKEA 3RWOA 4F4CA 5CK4A 2QNRA 2GTPA 2NIPA 2OFXA 3KB2A 2FX3A 3BIFA 2WSSA 1TQ2A 3BH0A 1HT2E 4Q01A 1CRQA 1GNQA 3REFA 4XWKA 4OK5A 4WAUA 3T15A 3GLFE 1S9HA 3NH9A 5AUQA 3B1ZA 1E2LA 3K9NA 1NLFA 3B6EA 1ETUA 1P61B 2C9CA 5AJZA 2O8EA 3L0OA 4JLKA 4CEJB 1G7TA 2EU8A 4KLZA 1AJEA 2IYUA 2GVZC 4Q18A 5J4KA 1MRNA 4ZCLA 1ZJ6A 4EPVA 1P4SA 1BO6A 3FDIA 2G9NA 3UATA 1M2OB 2CEAA 2ZANA 4HAXA 2MMCA 4XD7A 2XZOA 1UKVY 2N1BA 2FSFA 4BRWA 5KSPA 2WWXA 4UKDA 5EE9A 5KSOA 1LFDB 1GILA 1OKKA 4RVCA 4AKIA 2RH5A 2F1JA 2R6DA 1XU4A 2LKDA 5JI3E 4ACBA 1E2DA 3GLFA 2XTMA 4P31A 3CZPA 2NO9A 4V0KA 1XPUA 4G5GA 2G77B 4ZCIA 1DBSA 1KI4A 2FFBA 1KSFX 3L43A 4OI2A 4AYWA 4GI7A 1OHHD 1NBME 4M2LA 1AS2A 1L2TA 4MRVA 5H1YA 4EPTA 1SXJE 3A4NA 2VF8A 1TEVA 3WBKA 1W2HA 2ODWA 2NPFA 1L8QA 3EA0A 3QPVA 3FMIA 4IDQA 3SS8A 1G8GA 1OB2A 2GJSA 2ZU6A 4D4LA 3TGPA 4O3MA 2CVHA 2AHOA 1K8RA 3G82C 5C2JB 4GFDA 5CB6A 3RHFA 3V4RA 1NNEA 4KFSA 3MJRA 3F3YA 4GOXA 4IOJA 2B8TA 4IEIA 4TMTA 5H68A 3WBJA 1W46A 3ZZTA 2CHQA 3BH7A 4E09A 5B58C 4CEHA 1XTKA 3N70A 1EWRA 4TQAA 1QBKC 1SXJA 4OKSA 4YMWA 2ODBA 2QBYA 2BMJA 2G0TA 1KI7A 1JALA 1ZM9A 4FW9A 4DSTA 2ZM5A 1Z47A 2ATXA 1J7KA 4NPHA 3PJRA 1R6BX 3W90A 5KPJA 1O3YA 3DKPA 4JKYA 1Q57A 2ZR0A 2W2VA 4Q02A 4QBIA 4GSYA 4L16A 3D3QA 1KKLA 2WHXA 1I4TD 2B8WA 4RZUA 1S8FA 2ZRNA 2CHVA 3EASA 4IEEA 2B21A 5E7JA 3FWYA 4GRAA 4DEXA 3THYA 1OFHA 4NCHA 2BIFA 5C18A 1S1MA 3AVPA 3B1VA 1RPZA 4I81A 1ZIOA 2Q9BA 3BB1A 3CO5A 2GXUA 4BEJA 1G6OA 2PH1A 3KKQA 1NY6A 2YVUA 1ZC4A 1TQ6A 2FSGA 4Q9IA 3HYRA 5BW8A 1B23P 2D62A 1Z0IA 1CP2A 1K6MA 2QL6A 1GTVA 1U8AA 4CEJA 2YV5A 1U90A 2BMDA 2FSIA 4RD2A 1W5SA 1XF9A 4OI4A 3W9YA 1SXJC 4QJ3A 5KDOA 4KYIB 2GNOA 3KDSE 2QPTA 1G6HA 5DHAA 4RD4A 1AQYA 3EIHA 2PZFA 1DEKA 5FUXA 3GLGB 4FWTA 3IKJA 4OYHA 3KL4A 1NJFA 4LYHA 2OHFA 2CCKA 1GVNB 3C7KA 3A36A 2J9RA 3CM0A 4XTRA 2ZRHA 3CNLA 4DBLC 5KTYA 5AJWA 3HWSA 4NCIA 5HE8A 4QOSA 4C7OB 3MUFA 3LRPA 1OE0A 5FTJA 5E7MA 4J0QA 3BB4A 4FMCF 4BFTA 1HQYE 3REGA 2BMEA 4IFEA 3X1WA 2YWHA 3PR1A 3ZS8A 1VG9B 2LKCA 2UVQA 4DCTA 2W0MA 5G41A 4BLOA 3GLHB 3T5DA 2JLVA 4OQLA 4RY2A 3N2IA 3NBXX 1JAHA 4Q1CA 1P2UA 4X8HA 4MGKR 1RVDA 3IUYA 3QIAA 2QAGB 4GZLA 3X1DA 2ZYTX 4Z54A 1T3SA 4PQFA 1FUKA 3U61B 5EP4A 2KI5A 4PQRA 2Z4SA 1OJLA 3W5JA 3SU8A 3ZIAA 4YMVA 2PL3A 2HJVA 2YOFA 4KHZA 1S2MA 3BWDD 2HLDD 3CWQA 3LVRE 2WWWA 2H16A 2CCJA 1T0HB 2J7PA 1FMLA 4IFBA 1XXHB 1YRAA 2C03A 1ZM7A 2RGCA 2QN6A 1TNDA 4IOKA 2JLYA 1RRFA 3ZH9B 3HP1A 3NG1A 3THXB 4PQYA 1P73A 2JJ1D 4M1KA 5E95A 3T06B 4OI1A 2GA8A 3WYAA 4GZMA 4C0HA 5LPNA 3NEYA 4V0ME 5CYPA 1DOAA 3PCRB 2JCSA 4NYJQ 2C2HA 3QBTA 3PG5A 4LJ7A 2OM2A 4JZKA 3RRNA 3A1WA 2D06A 2YNMA 4BQSA 5DE3A 1SHKA 2EFHB 2X77A 4O0MA 3OHMA 3HR7A 3CX8A 3GLGE 2VHTA 3QENA 3KFVA 4HAZA 4C0AC 5J4VA 3AVQA 1OXXK 4JMPA 4W7SA 3KX2A 3FPAA 4FMDB 5KU1A 4OQFA 3P26A 1HE8B 4DWJA 5GVRA 4PTLA 1FL9A 4HATA 2PEZA 4PO1A 2NGRA 1COWD 2X8AA 4MRNA 4Y0AA 2IXGA 3NBFA 3GLGA 1QVAA 3THOA 2G88A 1RE0A 4MGYR 4LBVA 3MAAC 5J47A 4IJMA 2W00A 1MO4A 4MQBA 1GL9B 3AP3A 5EP2A 3BB3A 2EYQA 5SZHB 4TYYA 2DFTA 1BH2A 2OCAA 1AKYA 4C7OA 5FOWA 1UBGA 4XVRA 3RS2A 4ARZA 1X6VA 1F5NA 4QM6A 2ANBA 4B48A 4ILEA 5DI3B 1E79D 1QHXA 1SKYB 1GSIA 1FX0B 1Y63A 3UIEA 2EQBA 2OG2A 2C78A 3GLHA 3KTAB 5KO2A 5GJBA 3VKHA 1QHGA 5A5GA 3I8SA 1XXHE 1CEEA 1FTSA 1E2HA 4URZR 1RW4A 2QG6A 1P9RA 4C30A 1XEWY 4A92A 1E9RA 2GJKA 4Q03A 4Z8YA 4HAUA 4RZ3A 5FUVA 4JBWA 4KJZA 3NBYC 1OFIA 2QAGA 1N5JA 1VCOA 3GFTA 2V8OA 3WP1B 4JYBA 2C77A 1RIFA 4KV9A 1SQ5A 2A30A 3OIWA 3GCGA 2XX3A 3D31A 4QHSA 1CIPA 3SN6A 2ZVPX 2WJJA 3ZVNA 1AGPA 1MR3F 3HDTA 1KSHA 1OHHA 3AKCA 2QPAA 1WBDA 4G1UC 3TSOA 4KFUA 4WZ6A 1MO6A 4EKDA 1AN0A 1EFUA 1CTQA 1J8YF 2ZPTX 3EG5A 3RYTC 5IT5A 2WWYA 1YR8A 2Z0MA 1U2RA 3CF6R 1XD2B 1HY3A 4HUTA 1TUEA 2NMVA 1FUUA 3KKOA 3RANA 2BM1A 5KHOC 5FOXA 3B60A 2EWWA 2RGEA 3TSZA 3EA5A 3U7GA 5KNDA 2RGDA 3GJ6A 2V6JA 3ND8A 1G64A 4W5JA 1KDTA 1G17A 1HEIA 1XCGB 521PA 4FCWA 2X2FA 1GL7A 1D2MA 3TBKA 2PMDA 1TAGA 4WW0A 4EPYA 2PZGA 2BC9A 1WB9A 2R9VA 2ZITA 3RSOA 4NKRA 4TMWA 2ZRLA 3IO5A 1GWNA 2O8FB 3AKDA 1M7BA 4R71A 1AM4D 2QAGC 1ESNA 3RWMB 1KIMA 1PLJA 4OQMA 4WBSA 4CEIB 1S0UA 2HJGA 4DVGA 2ECKA 1SVKA 1OW3B 1SKYE 1NP6A 4TMZA 1X86B 1MABB 4TWZA 3AVXA 4P32A 4YXWD 4IVRA 3BD9A 4NTZA 5JCPA 4DDVA 1N5KA 1SVMA 3EZ2A 4UJ3A 2VHCA 2JLZA 1X3SA 5TY0A 4EJSB 4YQFA 1Q0UA 4UNPA 2ZROA 4Z1MA 1X8JA 2PX3A 2ZYWX 4LHVA 8OHMA 5JZVA 1R2QA 1ZCBA 4BFWA 3MFYA 3F0TA 2JLSA 4PPGA 3WP0A 5KSZA 3LO5A 4UXJA 3QXXA 5CYOA 5DI3A 5K8IA 4LV8B 3WRYC 4KFRA 4ASUA 4GDFA 3EXAA 3NC1C 4DLRA 5FTNA 1LF0A 3H1TA 2ZRIA 3KTAA 3AV0B 2OEPA 4B47A 2H7VA 2J3EA 1W7AA 5TMPA 1DVRA 3IEVA 2BCJQ 2GF9A 4BASA 1LNZA 1NVWQ 3FKSD 1OF1A 3Q8XB 2FNAA 3CPJB 4QXAA 3MWYW 1Q20A 2H92A 1TUIA 1OIXA 4ZDIA 1XTSA 1E1RD 1YR9A 1KI1A 2ASEA 2YWGA 4JLAA 1R8QA 2IXEA 2ZRBA 3LW7A 3O8DA 2ZRMA 1CF4A 4PHFA 2XSZA 3EZ7A 4M1SA 4LHZA 3QXJA 1A2BA 3K0CC 5JECA 2BBOA 3ECCA 2ORVA 2CBZA 3PENA 1NN3A 3DZ8A 3I72A 1A2KC 2FGJA 2XZPA 3B1XA 1KMQA 4NCNA 4QBHA 4HLCA 1XD2A 3ZQ6A 2IF0A 1UF9A 5FOUA 2RGNA 1G3UA 3U3OA 2HF8A 3IIKA 1JBKA 4PC1A 4US2R 4P4TA 3EPKA 1IY2A 2A7QA 3AUXA 1E2FA 1E2IA 1TF7A 5FTMA 4LV5B 4RFVA 2CNWD 3N5CA 1N6RA 2FFHA 1VIYA 1NKTA 2HLDA 2I1QA 2O8FA 2AK2A 5FBWB 1PZNA 4D6PA 3LX8A 2QQ0A 2ZS8A 2QM8A 2WZQA 3FE2A 4CEIA 4TZ0A 4LUCA 4PC6A 4D0GA 1Z0DA 4M8NE 4PPNA 3PUVA 1X1SA 2QP9X 1KKMA 2ZJYA 4YC7A 3VNVA 4TLEA 1ZP6A 2QAJA 1MABA 2B7BA 4OK6A 4AC9A 2AXPA 4TL6A 3UMRA 5CB8A 3L0PA 4LJ4A 2V7QD 4IXNA 2FMXA 3AF0A 4OQXA 1MT0A 1KO4A 3AVOA 4EJSA 5FI0B 3HU3A 1KSGA 3CX6A 3TR0A 1R8SA 2BM0A 5DSZA 1KO5A 4B74A 2OFWA 1R0ZA 1WCV1 4B3XA 4KBFA 2OESA 4Q4AB 1AS3A 3UPUA 4HB2A 2GETA 2P0EA 4Q00A 1XJQA 2ZRKA 4HDQB 3ADDA 4CGZA 1I2MA 1YRBA 3AQ4A 4A2QA 5JLJA 1WRBA 4DUGA 2OE2A 1RKBA 4FMCB 4TN1A 4IXMA 1AZSC 2HYIC 3KB1A 1E1QD 4YDSA 1KK1A 5F3WB 2IUTA 3FVQA 4D0LB 3LW8A 4PC7A 1IBRA 3A58B 4GP6A 5TXGA 2OFOA 1XTRA 3I92A 2IX3A 3OZXA 3M6AA 1YZGA 4H9GA 3UANA 1XD9A 4HZIA 5DNYB 3TVTA 2GBLA 1GRNA 3H86A 1DAKA 1RRCA 1E0AA 1WP9A 2F9LA 2CL6X 2HYDA 4PSAA 4GL2A 1EFRD 5DGXA 5ELXA 1N5LA 1E9FA 1ZCAA 4EFLA 4JLNA 3K53A 1BKDR 1BIFA 4EJSC 3VX3A 3THWB 1JR6A 2IBMA 2Z4RA 2A5JA 4A8JC 2YJTD 2VHJA 1WF3A 1ZW6A 2XNSA 3A8TA 2O0JA 3EZ6A 3GEHA 4KYUA 4TSFD 4UQOA 1VHTA 4FMDF 3C15C 4Q1BA 3QNUA 5G40A 4WXRA 1P5ZB 3QVVA 4JVLA 5ANRB 3JZMA 3WMFA 2PLFA 2IHBA 5B57C 2VP0A 1ZM4A 4Q19A 3OE7A 1EXMA 3NHAA 4LJ6A 4HB4A 4TLDA 2BKEA 4NCKA 2JAQA 1DPFA 1GITA 2HEIA 5CLLA 5DH9A 5JSZB 2ZVQX 5FH9A 1VYVA 2QT1A 1JR3D 4D80A 1P2SA 2FA9A 1FMJA 2WWGA 3CNOA 4TZ6A 1PVOA 1PUJA 2ZSEA 2X2EA 2VL7A 4FCVA 4C2UA 1G7CA 1UDWA 2K5UA 2HUPA 2ZIAA 2ZJ5A 2HF9A 4M9SA 1J99A 2BBWA 3X1ZA 5TVKA 2QMOA 2W6ID 2FGKA 3H4MA 2GILA 3UWOA 5HPYB 2GJ8A 3MD0A 4R9UC 2PCLA 1O87A 2ODEA 3TIFA 1UPTA 1E2KA 2GDJA 2CXXA 4KLNA 1KK3A 4DKXA 5KDDA 3N2EA 1Q44A 3VR1A 1U99A 4PR0A 2ZAOA 3AF4A 1ODFA 4HB0A 3V4FA 3CZQA 3BFKA 4PC3A 4PSVA 1RJ9B 1UJ2A 3GFOA 2RHDA 2JLUA 1XZQA 4Q4AA 1T4GA 2GCOB 1NLYA 2C5LA 3R9XA 2J0SA 1XNJA 3OEEA 2Z83A 3H84A 3RLFA 1WBBA 3DMNA 4U5XA 2XOKD 5HR5A 3U7FB 5F9HA 3OAAD 2JJ2D 4JS0A 4LPSA 3LBHA 4E07A 2ZJBA 2FOLA 2ZRCA 1HT1E 1Z0KA 3BORA 5H70A 4D4MA 1RYHA 1HURA 2R65A 3PXGA 4JL8A 1CRPA 4JLDA 4RFSB 1UDXA 5JHGB 4NU0A 2IS4A 2X1VA 3FMOB 3QKUA 2C98A 1NN1A 2FZ4A 4ZKEA 4BECA 4BLSA 3E70C 2RHMA 5B2ZA 1ZNXA 2J46A 1DELA 3PIRA 5BN3A 2P5SA 1NVVR 5G3YA 4DB4A 1II8B 3CWZA 3BJIC 3UKDA 1JI0A 4QGFA 3C5CA 1IJFA 4DIEA 5FI1B 3GLIB 5BYJA 1JAIA 2DPXA 1BS1A 3W6OA 3LQRA 1FFHA 4A2WA 2BEJA 3THWA 2JLRA 1TF2A 2IYSA 2ZE5A 1Y3AA 4C0LA 4NONA 4Q7KA 3HPQA 4OHYA 1F48A 5A4JA 4OJKA 1KOFA 1E69A 4L15A 3T1VA 3KQLA 2NZ8A 2VIIA 4P4UA 2WMOB 3T1OA 1SKQA 4Q4HB 3PUXA 4S2EA 5DI9A 1MKYA 3GJ4A 3FHOA 2F1RA 2D74A 2D4HA 1TX4B 5SZIA 5E4FA 2XEXA 3U7HB 2CDNA 2ZSDA 4RJLA 3Q9LA 4MRSA 1UBCA 1ZINA 4ESHA 5JSZA 1E6CA 4EPXA 3QE0A 1EESA 1ZC3A 3SDZA 3KJGA 5HCNA 4X8MA 3T34A 2Q9AA 3AGQA 3RS5A 3ZVLA 2PMKA 1P75A 3E1SA 3IEUA 3CRQA 1TEXA 4BZPA 3M0EA 4HDOB 4QGHA 4BFSA 4B73A 4LWZA 4MDFA 2FZLA 4LRWA 4L9WA 3EAQA 1L7VC 1CR0A 1SULA 1QHIA 1XEWX 3CH5A 1ZD8A 3LXXA 1KI6B 2QPOA 1EFHA 4ZI2A 3CLVA 3ZVMA 4NH0A 5KNBA 1RZ3A 1N6IA 2WJVA 4BE7B 1SVSA 3QG5A 2RMKA 4D25A 3G0HA 2PT7A 4ITRC 2DFNA 1SHZA 1RJ9A 2AFIE 4MGIR 3CPHA 1OXVA 2E1RA 5JJLA 4NYMR 2GCOA 4E5UA 1NJGA 1P2VA 3F8TA 2F1IA 3PUZA 4XVUA 1U81A 5FPHA 1VYTA 4OHWA 3WNCA 1NBMA 4PHTA 1US8B 4C0BA 4ZDKA 2Q3HA 3GLIE 2NO6A 4QBFA 1QHYA 4Q5IA 4FI3C 2FF7A 1NL3A 3RVBA 2R6FA 1Q1ZA 3SYNA 4JSYA 2ZRGA 2VSXA 2ZRPA 1Z6YA 4RFSA 1BMFA 3GJXC 1UEJA 4QJ4A 2O8BA 2A9KA 4BLTA 5BN4A 1DAEA 3DOFA 4US0R 4DSNA 2P3SA 3VMFA 1KI3A 1C9KA 3QVUA 4PANA 4HZUB 3PVSA 4JL6A 1II8A 2IWHA 2JIZD 1ZMXA 3G5UA 3KQHA 4LJYA 4R2HA 1WA5A 3GLIA 1QHHB 4KXFB 3K0FB 4IW3B 1GKYA 5A0FA 4TTQA 1H8EA 3LXRA 4QJ5A 2W6JA 4Q9JA 3T35A 3F5FA 1LTQA 2OLJA 2PLRA 4N0EA 3ZS9A 1GKIA 4MRRA 1PJRA 1W4RA 4S35A 2IUSA 2WICA 3HYTA 1E1QA 4JYCA 3WHLA 4DC9A 5DN6A 2GVDC 4WZAE 2WM9B 1V5WA 4RD3A 1M6NA 2F55A 1W36D 4Q4HA 1W4CA 1S96A 2I3BA 3OEHD 3FFBA 1CR4A 1J2JA 2JEOA 1GM5A 2C99A 3IDQA 3KXIA 4Q66C 3AUYA 2BBSA 1W44A 3C8UA 4AYXA 1EFRA 3EW9A 4L5BA 1UBFA 4Q7MB 3SI7A 1QZXA 1GZSA 3DHWC 3ZVRA 4B33A 1Z83A 4II7A 4NDZA 1E2PA 2VYFA 4IKEA 4ACAA 2XNDD 3GD7A 4XVQA 1JR3E 3UK6A 3OIUA 1E0JA 4TSFA 3OESA 4Q1FA 5HCIA 4CDGA 2REBA 2JLXA 2ZS7A 3LBNA 3AM1A 2H17A 3I73A 2V4ZA 2OBNA 4MH0R 2XB4A 3RSLA 4I99A 4A2PA 4FWIB 1E9CA 1KI6A 1LVGA 1W0KD 4AK9A 821PA 2WVJA 3QJYA 1IY1A 1ZVQA 4LI0A 3W3AA 1Z2CA 3A1VA 3U3RA 3ADBA 2WKPA 3IILA 2PCJA 4AG6A 3CNNA 3SFVA 4G3XA 5LDDC 4HLQB 2DY1A 4TT3A 1GRRA 1U0HC 2ZRJA 5AK0A 5EZ5A 4UJ5A 2GXAA 1QRAA 2WPDD 1OH7A 3LWNA 4G5QA 2EFGA 2RAPA 1A5TA 4RZ2A 1W0JD 3TR5A 1N6PA 2JJ8A 2QY9A 3L0IB 3KKPA 1SVIA 4W5HA 3B9PA 1US8A 3ZD6A 4GBMA 4HAVA 4QG7A 5FR1A 1UADA 4NYIQ 4XOIA 3AVUA 4UXHA 4C0JA 2W6IA 4Q9HA 1FNMA 2BCGY 1I4LD 1G16A 3BGWA 5DLQC 4NL4H 2AD1A 5GJWC 5FBQB 4QHTA 1K5GA 1XPOA 3Q7PA 2GESA 4CYMA 3QSYA 2FEMA 1WMSA 4B6FA 3SR0A 2CJWB 1KO1A 5JRJA 1D9XA 3I32A 4LV6A 2QSYA 3NHBA 1ZUHA 2R6GA 1B0UA 5CDFE 2FPMA 1HH4A 1N6NA 1QHHA 3K0FA 5G53C 2QP4A 4KVAA 1P9NA 1Z06A 4D82A 1HE1C 4TYPA 4C0KA 4G5OA 4NYJR 3CRW1 4QC2A 2KB0A 2XAUA 2ZI5A 2QE7A 4B2IA 1DAMA 1OXSC 3QXHA 1KAGA 4F4JA 1ZUNB 4MYUA 4DLUA 2GJAA 5EQTA 1DE0A 5D3MB 3T61A 2DFLA 4EIWA 4URYR 3ASZA 1P3JA 2IA5A 1E9BA 1OXUA 3MWKA 4V0MA 3V9PA 3QOFA 3SBEA 5CDFA 4DJTA 5JS7A 1Z5ZA 1RRPA 1XEXB 1JEEA 5EP3A 2R6AA 2ANCA 1SVLA 1OPXA 1XZPA 1NLZA 1G8HA 1QG2A 2QTFA 4YLGA 2ZUDA 5K8TA 2AN9A 1E2NA 3KQNA 2R8RA 3K0SA 5JEDA 3VR3A 3I62A 3IBGA 2ZYUX 4ON9A 1H8HD 4XSHA 1NN0A 2MSCB 1N6HA 1QHSA 2XZLA 1XMJA 3TMKA 4BLRA 2FG5A 5H8WA 5K8LA 3P32A 1XCMA 1VIAA 2ZXUA 1ZAKA 4BRUA 2ODNA 1YKSA 1E9SA 4IDNA 1DAGA 3A4MA 1IXZA 4Q47A 2REOA 4GMXA 1Q12A 3NC0C 2O52A 2VBCA 1R10A 3DDCA 4DLWA 1VTKA 1Z0JA 4NZYA 3Q5DA 1W2GA 1P2TA 3TUIC 4D2IA 1G5TA 1P7CA 2PZEA 3LD9A 1DS6A 1EFTA 4TTPA 4BEBA 1DG3A 1HTWA 3RRZA 4A15A 3VTKA 5E3HA 1KHTA 2HXSA 4YMSA 3ADKA 1EX6A 1IQPA 4L8GA 2PT5A 4Q21A 1T9HA 2WMNB 4PFSA 1GDDA 2P67A 2VHQA 1KJYA 2DWQA 2IF2A 3ICEA 4A6PA 1EX7A 1L4YA 1JJ7A 2VH5R 3BC1A 1XXHA 4LJ8A 3GPLA 2ZUCA 4ZDWA 2I4IA 3NKVA 5JWOA 2IW3A 1TQDA 1FQKA 3MRSA 3QKRB 5JWHA 3THXA 4HDCA 4RD6A 2CJWA 5TV2A 3TRFA 5AJXA 3QKSB 5AR1A 1VG0B 1WDTA 3LFUA 4ZPXA 4MITA 4B2LA 2N46A 4F7WA 1ZM3A 3P4YA 1T8UA 3TVDA 4GOJA 2CMKA 4US1R 2ZTSA 4TL8A 3TQCA 1JQJC 4PSKA 4D4JA 2HXYA 4AD8A 3JVUA 1R0XA 1XDBA 3FOZA 1CR2A 1E99A 1P9WA 5LD2C 2VO1A 1W4BA 2BBTA 4ZDJA 1XTQA 1E2EA 4CT4B 5GADl 2PEYA 4AG5A 2ZJ2A 3D8BA 1YR7A 2EYUA 3P20A 1M1YE 2IC5A 2AKAB 2GK6A 1KZ7B 1XEXA 3EZ9A 4JSTA 3UWKA 2V9PA 3K70D 4O2RA 1FP6A 4G01B 2JIZA 1VCMA 4IDOA 3K0CA 3VX4A 2VTKA 5EXPA 3T12A 3TE6A 4KO8A 1KO8A 4DB2A 1D2NA 1NIJA 4A8JB 4M1TA 3ONWA 5AJVB 2ORIA 2WAYA 4OHZA 4UNRA 4FIDA 1T5IA 4O2LA 1CU1A 1L4UA 2OXRA 4F4IA 1E0KA 1T3LA 3B5JA 4W9MC 1FX0A 2D2FA 4URVR 1YZKA 4B76A 5J4YA 1HUQA 5FL3A 3CRVA 4BLPA 3EPJA 2GCPA 3HU1A 2IXFA 3ZZUA 3QXCA 5C46F 1YE8A 5DYIA 3LY5A 2JATA 3CR7A 3PEYA 1LV7A 3EWSA 2A78A 2G83A 2A5YB 1BYUA 4JBYA 3AF1A 1DARA 4HUQB 1OFUX 2XNDA 2ZR7A 2F3TA 4PHGA 4PZLA 2DHRA 2NO0A 2H5EA 3EZFA 2BKUA 5FUWA 3RDPA 1U9IC 2IYTA 3EIEA 2Z43A 4DLZA 5E7IA 4A82A 1ZBDA 3EC1A 3I4LA 3U4QB 1JJVA 4E03A 2HDNB 1DTSA 1EG7A 2LWIA 4RCYA 3VKGA 2ZE6A 2IUUA 2OCYC 4MUBA 4D4KA 1G8FA 4G0NA 3QKRA 4TTRA 3ZQJA 2QUZA 1DADA 1MO3A 1EFCA 2B6HA 2WOJA 3IGFA 3FHCB 1W36C 4JLJA 3KXKA 2CVFA 2XXAB 3TQFA 2J45A 2NO1A 1Q1BA 4E22A 3RS4A 1SVOA 1W0JA 2F43B 2YYZA 1GG2A 2FE4A 3AF3A 3ASYA 3BE4A 3R8CA 4EQ6B 2VRWA 3LVQE 5G3ZA 1OKKD 1Z07A 5FPSA 2VSOA 4PC2A 4QRHA 1YZUA 3JZAA 2QP3A 1KTVA 5J5CA 2RGAA 3EC2A 4Y0VA 3AKEA 1A1VA 4XWAA 3EPLA 1MOZA 4F91B 1G18A 1CJVC 4DZZA 1D8TA 2V55B 1Z22A 3LA6A 4JVSB 4MGZR 4Q7LA 4EFMA 4GPTA 2NTYC 3W8NA 2VP6A 1KSJA 2JJ1A 3CF2A 4OBEA 1AKEA 2ZRAA 4B6EA 2VP9A 4KITB 4DLXA 4ZKDA 4HI0E 3GJ5A 4POAA 2OV2A 5JJIA 4Q1EA 1YZNA 1MV5A 2B92A 1U8YA 4TMXA 2C9OA 2ZEJA 2YWEA 4TQ9A 4TL7A 3QXSA 5GJVC 2IYZA 1P60A 4C4PA 3T1QA 2P6UA 4B3FX 4IDPA 4M4SA 2CE7A 2L0XA 3VKWA 4AYTA 4JLBA 4A8JA 2W2XA 5CJ2A 2YOHA 3K1JA 1J90A 1R5OA 4WA7A 3UG7A 4Q4LA 4DRZA 4ERNA 2QGZA 4HSEA 4XH9B 5TDHA 1E9AA 2MSDB 1T5LA 2IHYA 4WVFA 2GAOA 1AK2A 2QGNA 3KFXA 2ZR9A 2ZETA 5TB5A 1KY3A 4LJAA 3EWAA 1Q3HA 1GFIA 3VHXA 4LCBA 2P65A 5DYGA 1UBEA 1COWA 3LX5A 2WJYA 1ZUIA 3BK7A 1JPNA 3ZJYA 4DLVA 3K70B 2WJGA 1UKZA 2ZSAA 5FR2A 1XMVA 3FMFA 4GOKA 1E0SA 4M9XA 1AZTA 3K09A 1D5CA 4N3NA 1KYIA 3VR4A 3VR5A 4CW7A 4Z51A 3AP1A 1IOZA 1IAQA 2H8KA 1P72A 1XCPA 3OFND 5D3QA 3MWJA 5SZJA 5K8UA 4HUQA 3IIJA 1H8HA 1D9ZA 1YZQA 3MLEA 3QUSA 3ZYCA 5J4LA 1M8PA 3ND9A 2IYWA 2AK3A 3RABA 4BFVA 4AI6A 1NVXQ 1Z29A 1J70A 1KMHB 3CBQA 4YDHB 2GEUA 3PV0A 3U4QA 1SVWA 4L9SA 5M04A 2JLWA 5EXSA 1E79A 3KQUA 1Q1QA 2OO7A 1UKYA 4RCZA 4I1VA 1MRSA 1KDPA 2F3RA 2WJIA 4A36A 1NY5A 1U94A 2WWIA 1CJKC 2IEZA 4CIDA 2D3WA 2V1XA 1D6JA 2G3YA 1NKSA 2DFKB 1GNRA 2XXAA 1RFLA 3HPRA 2F43A 5EZ6B 4I1UA 2FPLA 5JMTA 4EQ6A 3NH6A 4G5SA 1P6XA 1FTNA 1C1YA 4P3YA 4ZCMA 5C4MA 2VP4A 1TQ4A 3K09C 3VR6A 3C5HA 5JWRA 4R2IA 1VPLA 3AP2A 1AIPA 2BJWA 4TL9A 4AKGA 1ZD9A 2AD5A 4B3CA 3R20A 5JBQA 1A7JA 4LBYA 2RKOA 3GQBA 4KODA 3QEJA 1PV4A 4JVNA 3FHTA 2R2AA 4MRPA 1IN8A 4QL3A 2HT6A 3LLMA 3WY9A 3MGCA 1ESMA 5LB2A 2D2EA 2OAQ1 3DOEA 2FH5B 2YHSA 1ZNZA 1FQJA 1KI2A 1VG8A 2A2ZA 3DL0A 3IQWA 4LHWA 3SYKA 5CITA 1ANKA 1CS4C 5FPKA 1QHNA 4KI0A 4OJQA 3I61A 4LC0A 2FJUA 1LS1A 3C4JA 4QGGA 3Q72A 3ZIAD 2BDTA 2VA8A 2J5XA 4AKHA 1KDRA 3DM9B 3OIYA 4YMUA 1TMKA 1XD8A 4R7ZA 4YMTA 4ESVA 3RC8A 3NIBA 2CK3D 2J7PD 4I1OA 2VF7A 4AY2A 4LOAA 3AEZA 2ZI4A 4XIGS 2HV8A 2JLQA 1N0WA 2P5TB 3CW2A 4M1OA 1NG9A 4XWOA 1PUIA 5IDVA 3W6PA 3TLXA 1R0YA 4YXWA 1K5DA 1G5PA 4NBSA 4KSBA 3K9HA 4R98A 2XB2A 4IRUB 1N2CE 1KO7A 4U02A 2OBMA 1G3RA 2QRNA 4OQNA 4MDEA 3C14C 3CONA 5JHHB 1G1MA 5L3RA 1GUAA 1G7RA 1GAJA 2GWHA 4MYCA 3KQKA 1KMHA 2H57A 1KNQA 3TNFA 1WXQA 3KUDA 1Q1EA 4V02A 4DHEA 3R9WA 2GEVA 4TMKA 5KSYA 4KU4A 2QT0A 3I5XA 4DDUA 2IYQA 3QBVA 4PPQA 1NVUQ 3B82A 5EUMA 1F6BA 2CLDX 1CJUC 3FKSA 4FD2A 1UKEA 4UNNA 1N3BA 2XITA 4NCJA 4OK3A 3TW8B 3THYB 4OI0A 1AA9A 1G9XA 2BWJA 2CL7X 2H1LA 1OSNA 2J87A 1W5TA 2A5GA 1R0WA 3KKMA 4I4LA 1E1RA 5EE3A 4P0TA 3K70C 1GL6A 3U6BA 2ZSFA 2EFDB 3BS4A 2P6NA 4B32A 4AKEA 3IQXA 3Q5EA 2QI9C 3HU2A 2Q3FA 1CBUA 4EUNA 3R8FA 3AVVA 3QPWA 3TAHA 2NG1A 4OHXA 4ZV4A 4GP7A 4JT2A 4MYTA 4M1MA 4RKEA 3WYFA 4B43A 2KJQA 2QQEA 3A1TA 1OYWA 4QNRA 3DPUA 5F2EA 2IT1A 3KUCA 3IPYA 1FPMA 3U3KA 3CPEA 1EWQA 2NO7A 4EFNA 2OCPA 4D26A 2WKQA 5JFGA 2PJZA 2ZU0C 3L82B 4IVQA 3SFZA 4DT1B 3KXLA 4BGDA 2WWFA 2I1VB 1KNXA 3A1UA 3K9LA 3UXMA 4BFXA 4PAMA 6Q21A 2Q21A 3B1WA 2Q9CA 2G1KA 1T0JB 5CIWA 4V0NA 2CNWA 4FXPA 4JLMA 5FL7D 1HYQA 2G0NA 1QF9A 1M34E 1OLOA 2R6CA 2ERYA 1UM8A 4A4DA 3RNLA 1E4YA 4B3GA 3AF2A 4DDWA 3CRMA 1QG4A 4URXR 3ETLA 3SJZA 4MKGA 5JRZA 2X19A 1LY1A 1N0UA 2VHUA 4NYMQ 1NMYA 1KAOA 1UFQA 4OL0A 2QSZA 1DO0A 1N0VC 2WIAA 3FKQA 3B8HA 2V7QA 4PXAA 4U00A 3V00A 2YOGA 3L2OB 1J8MF 5CK5A 5BQ5A 3WRXC 4M22A 3SYLA 3Q7QA 4Q9KA 1U98A 2BV3A 4HB3A 2GEDA 1CJTC 2ZI3A 2FU5C 2ZREA 3EIQA 1VECA 4HYYA 4Q48A 2OT3B 4BPBA 4M21A 2GXSA 5FPYA 4A0HA 3W8RA 2YINC 3B2EA 3WYGA 3VAAA 2IYXA 4W5WA 1GP2A 2KBEA 3I1FA 2JASA 4V0OA 2C04A 3R9IA 4TLAA 4DSOA 1VKJA 4YONB 1UEIA 3K0AB 1S3GA 1TU4A 4B75A 4LHYA
chains in the Genus database with same CATH superfamily
2UUCB 2VCYA 3CMCO 3PQCA 4YHBA 1EJ0A 1T2CA 2F1HA 3DJFA 2QRZA 5CM2Z 5FQOA 1G3IA 3WK5A 3WWDA 3AZOA 4NZNA 3TW8A 1SCNE 2ACVA 3T3DA 3GG2A 5LMUB 2ACWA 1T8WA 3ETEA 3DO5A 2CSXA 5JE8A 2NU7A 1LLFA 1K75A 2CYBA 3EVFA 2HMTA 5SICE 2OSBA 3PNQA 2A0KA 4FHCA 3IV9A 2V7TA 1ZGAA 5FOVA 1U9JA 3AEQA 1OXTA 3PFNA 1B2LA 3R75A 3TEFA 3UMFA 1P0FA 1NVAA 3B85A 4MUIA 3QBDA 3GP8A 1GGNA 1CEXA 1QUFA 1C9DB 3FRIA 2HRDA 3PXDA 1UDRA 2HMSA 1Z63A 1PWXA 3FUVA 1MIOB 2LCFA 2R7AA 4DPKA 3PLAE 4EQZA 4IJ6A 4J94A 5KWIA 5LBIA 1JSRA 1RMQA 5JSYA 4BNDB 3JAKB 2IS1A 3KU4A 4W5OA 5FTKA 3FWKA 1ZY2A 5E6UA 2HCFA 5GZ3A 4O08A 5TJ9A 1BDIA 2OCBA 1EYZA 1YB4A 2I7XA 2GM4A 1NJ1A 5J2UF 2O2GA 1BW9B 4MB2A 5ALFA 4LWOA 2JH8A 3W7VA 3GJ7A 5HKBA 5HM8A 3O8QB 4W9RA 3WL3A 4Z9XA 1Y1TA 3A9SA 1K6EA 4GMDA 5AOCA 2Q1XA 2QI9F 3WQBA 1GJRA 1Z0ZA 2WRZA 4L0CA 4MQEB 3KDAA 4A73A 1ZKDA 1Y6RA 1X9IA 1ZD1A 1Z0AA 2YJ3A 1ISJA 4OHUA 2XE6A 2O0KA 1KI9A 3CH7A 4HNGA 3JQFC 1GKUB 2IITA 3DO6A 2ICAA 4E30A 3JYPA 5CM9C 5KKAA 5KVAA 4JP2A 2P1DA 2JAHA 4XQCA 3L07A 2GZHA 3RF6A 1E9EA 2O0HA 3S1AB 3VU3A 5TGZA 2Y0PA 2IV7A 3WL6A 1P19A 4QREA 4EHNA 2ORWA 1R0KA 2BFNA 1QS0A 3EDQA 1RXYA 1LTKA 1GAXA 2ZWPA 1KEWA 4AF6A 2I6XA 3W4IA 1YZHA 4KMOA 1R0BA 3H7AA 3NDRA 4NEHB 4ZQCB 3PUHA 1X1TA 4IHJA 3A1NA 2R2GA 3X0DA 2X4LA 1FFAA 4REOA 2X5KO 2GCNA 4GR9A 5IKXA 5EUQB 1H65A 3ZQKA 5KTRA 5C3UA 3TUZC 2HU8A 4BUJA 3DGFC 3LPLA 3QVGA 3BAFA 5AVKA 5CD9A 1R6UA 1L6RA 3ANNA 2Q6OA 4KSCA 3C3EA 1OYYA 5DZSA 1FLDA 1XZDA 3HM2A 4FIZA 3FCSB 4UAVA 2XOKA 1XKXA 4XGQA 4DSUA 4YV0A 4Y2PA 2ODAA 3AETB 3H0KA 2ZUBA 3CLRD 2MYTA 3HCAA 3K0AA 4HWPA 4IUDS 4LYAA 4PHHA 3RC3A 4B3BA 5A2QA 2W6NA 2GO1A 1R4AA 4WA8A 1H3NA 5FUYA 3DD1A 4AJ2A 1C3OB 4ZO8A 1IY9A 3WMEA 7REQB 2IQ5A 3LDAA 3PGJA 1O96A 3LVFO 3W8EA 3L9WA 4NP6A 3RIMA 1IY8A 4HNVA 2EGGA 4AZ3B 1JBQA 1ZITA 1EQUA 4AJLA 2ZKIA 3KALA 4Y7CA 4B4DA 4U7DA 3DMPA 4HEHA 1VLQA 1ILEA 4M1YA 1H2BA 2NTNA 3DF7A 4FFBB 1Q7CA 4NE7A 1YVRA 2NUPB 2WJ4A 3HJGA 5GVSA 3PNYA 5ALNA 4ZO4A 5A3QA 2GTIA 5JNRA 2GMWA 1GZ5A 5GGXA 1NSFA 2EW1A 4GIBA 2I5PO 1TLFA 3O47A 4AJ4A 3TLGB 4JROA 3ZGNA 5HZHA 1VG1A 2AVDA 2I76A 1P1KA 5HILA 3FZQA 2A14A 1PR4A 1T6NA 4EI9A 4DV4B 4D0SA 2VPZA 4S04A 1UFVA 4AJ1A 1OGYA 1IIRA 2CXTA 4ZAWA 2DPMA 3CE9A 5KX5A 1J5XA 3PX3A 2QTVA 1FFWA 2P68A 3W5CA 1LB1B 1JLSA 1UKCA 3BMOA 4TLMB 4YECA 2OD7A 4AJHA 4ZCSA 1K7YA 3FPJA 2XH8A 4E5PA 1N6KA 5HYVA 2C1XA 2CFCA 5L45A 1GL3A 5AUOB 3ZDAA 3KKNA 3L4SO 4HWTA 5TSDA 3C8HA 1Z82A 4IV5A 1R8YA 1CXZA 2GZDA 3O8OA 4PIPA 3IHLA 4CDRA 3V34A 2IYRA 3KWLA 3ZWXA 4Q9LA 4K81B 4WX2B 3W5UA 1JSZA 4B5LA 4DV7B 2WNIA 2G7MC 1YB2A 2FWRA 1ZJ5A 3G8DA 5JRDS 2QUKA 1RP7A 3KU1A 2JNWA 4MI6A 3NTQA 1ADCA 2DCUA 1TZJA 2BMFA 3ZGXA 5TE9A 4DDKA 1PT7A 5H7XA 3U9SA 1G8YA 4RSHA 4V0LA 4KR7A 1H0RA 3CUSA 3DMTA 2FEWB 3KQQA 1IEQA 1NLMA 2UVPA 4RPIA 2LBPA 4PQGA 3IP5A 2F6RA 4FFDA 3O8CA 5M3BA 3H13A 3LIPA 3UAWA 2VPQA 1SHUX 3RAGA 1Q50A 4QUGA 1KJWA 2Q2VA 1NQ5A 3IAXA 1WPXA 2HHLA 2HRQA 2R751 3B7PA 1ZNWA 2PGAA 2V03A 3BOSA 2JZCA 1CULC 4MS3A 2EX0A 2FHPA 2ZE8A 4NICA 1S3SA 1Z16A 4DIDA 4M55A 1G3MA 2AN3A 4U2FA 1KL7A 5M34A 4P54A 4AX8A 2VA9A 5AI6A 1ELOA 5JI2E 5TQ2A 3AFIA 4GI1A 2O1WA 5EE1A 4YUXA 5E8JA 2EL7A 4ZGWA 2RGRA 3P0RA 4BTEA 2ONJA 2O2CA 2VHVA 1NDQA 2O20A 3E5MA 2UYOA 4MLDA 2J5BA 2HIGA 3Q4GA 1G9SA 3QU4A 1NX9A 1UWCA 3DKRA 2X0IA 4IRXA 4NENA 2O8BA 2DQKA 3DKIA 1JEAA 1L6IA 2GO7A 2YXBA 4CLEA 1PJCA 1REQA 3BRWD 1E18A 2O1XA 1EH5A 2WOOA 3M70A 5CVUA 2V65A 4QFMA 5CLHA 1PT8A 1X7YA 4HNAB 3LF2A 3TSCA 3G5LA 4H1HA 3GNTA 1OVGA 3H1FA 3E3LA 4YWJA 1TGVA 4BEVA 2PBRA 5JTTA 3DV0B 4V0QA 1XZIA 5D3MA 4C3OB 2JFXA 1CC1S 4NLLA 4WFIA 4XDZA 3FBTA 2XXJA 4BUZA 3B89A 2Z1NA 1FP2A 3OIVA 2FLKA 2GEFA 5BUZA 3DKVA 5CDUA 3AOGA 1B26A 4RZXA 3DMTC 3ZLVA 2CE2X 3FZNA 2CD7A 5F1YA 1CUJA 4NR0A 1AH2A 1I3OA 2ETXA 3BRCA 4FONA 1S2LA 1XVVA 5CA0A 4AROA 5C8ZA 3OKFA 1FUYB 3GCXA 5JFTA 2BGJA 3G17A 3MCTA 3N28A 4B6OA 3VOSA 3B1YA 4F4DA 3KXPA 1GOTA 2HBYA 1G41A 4NS1A 1M5UA 2N3ZA 4HH4A 4LNHA 121PA 5CYGA 5MN5A 1ZM2A 5FWXA 2FDRA 3L05A 2I6UA 3WNZA 4DIKA 4AIIA 3CA8A 4C3ZA 421PA 1B15A 1RLUA 2NU6A 3UCEA 1CQZA 4UFOA 2OV8A 4RIIA 3WK8A 2N42A 2KLHA 4JC0A 2WF6A 1VYUA 2D1RA 3EEOA 3L7NA 3GGJA 1M1YA 1GT6A 2ZK7A 3DAOA 4P82A 4ECEA 2GHIA 4G0OA 3O9ZA 2EJCA 2UZ4A 3EZLA 1IXSB 1QB7A 3FRHA 3I04A 3ZIUA 3OIDA 4IQGA 3EX7C 1NYLA 2YC2C 3OEHA 4DR7B 3I37X 1DTEA 1YL5A 2ZJ8A 3NVKI 2JGIA 4TLCA 3CN7A 5G02A 1BOFA 1K8YB 3C24A 3T5BA 2RHRA 3VU9A 1HL3A 4G8DA 4IUBS 3RAEC 1W19A 1ONBA 5KYKA 3N2NA 4DNQA 2XDQA 2WTBA 2DT8A 3CT6A 4OEHA 3EGDA 3H18A 5BSMA 3WIOA 5I4IA 4LC1A 5FPTA 4EHFA 3GRYA 1ECPA 4HNQA 4OLHA 3PQ7A 3NS7A 1UMKA 2NM0A 3QMWA 4JI1B 4OFZA 3OM8A 4TYWA 1NQTA 4ETWA 1Q0HA 3F3MA 4UTVA 3VOBA 2GK7A 4LX0A 4XQEA 1DC4A 2L17A 2A0XA 1C2TA 1MA0A 3HR8A 1H1DA 2QLLA 4OOEA 3VYVA 3M6LA 2GD1O 4LAFA 2VWGA 4HDRB 4RNDB 3V80A 2CLSA 1SPXA 1W48A 3FCXA 4DSAA 3O21A 2VKTA 2WD9A 3TFWA 3EIWA 3KJIA 5BURA 4L95C 1RHQA 1ISMA 3WBBA 1P0PA 2CEKA 4JFAA 4TXJA 4QVIA 2ZLBA 4Q1AA 2NU9B 2DGDA 3P0HA 1HQCA 2AUNA 4KKXB 2Q6TA 2GPJA 2PAAA 3L3BA 4BDSA 4ECAA 1X8KA 3AVTA 2W48A 4DR6B 3FW1A 1OAOC 3H16A 2DBZA 2X13A 5JDIA 5JAUA 1EAYA 1QX3A 2JB9A 2SCUA 4MV7A 2IU6A 3UWDA 2OQ2A 3LH5A 3NXSA 3EG9B 2ZUVA 2HH9A 3HB5X 3NEJA 3PEVA 2WM3A 1MJNA 3MWLA 3MOIA 3SHFA 4YAKA 4GBGA 4D9MA 3W77A 1Z7WA 1NULA 1SXGA 2X7XA 3K1ZA 1TJ4A 2CT8A 4L75A 1JKXA 3W6NA 5JEEA 1YVDA 1DIHA 1PJAA 5ERXA 1M8JA 2ZSKA 1PKEA 4UQLA 1Y7TA 1TLLA 1R5NA 4LZZA 1EVLA 4UHEA 3AF6A 2ZYVX 3NANA 4FHZA 5J1TB 2QTAA 5JAMA 3JPWA 3RC1A 2QA5A 2QMYA 4R2JA 3S2FA 2VSFA 4DHWA 2R4QA 1JIIA 5CDYA 3IXMA 1XTBA 4MRMB 2XT9A 3RS0A 4L4XA 3L02A 3RK0A 3T3GA 4I55A 1CJBA 5JU6A 1N6OA 2BKVA 1O57A 2TRSB 2P3QA 4IHQA 1N1EA 2XE7A 1IUKA 1JILA 4I4CA 1A0OA 1VZ3A 4D42A 3GGPA 3WX0A 5CM8B 4BLVA 4L2IA 3I5UA 4UTRA 1ZL0A 1XHEA 1MB9A 4MVJI 3DQQA 4RS3A 4PZDA 3A4LA 4JBHA 1NOJA 1TF5A 4N9QA 1LEHA 2VEDA 2XCLA 2XUKA 2R62A 2YN4A 1WE2A 5JS8A 3OJWA 1KZGB 4GT1A 2Y0DA 1Z5WA 4IKOA 3J81A 4TQUS 2UUAB 3HKEB 3SQWA 1HETA 3S2EA 5K0JA 1CY1A 2FW1A 1R4NB 5KREA 4P4LA 1JSLA 1Z4LA 2FR0A 3QEMB 1EK0A 1OAKA 2CBXA 2X6QA 4CMEA 3IVXA 5KTSA 2YBEA 3FUTA 4JA0A 5EOVA 3HR4A 1PLKA 3FDJA 2AQHA 3QI2A 1B6TA 1PEKE 3ZLJA 3E5HA 3BFVA 3C1TA 3O1LA 1UKAA 1WMDA 1DC5A 2H7YA 2J85A 3ED5A 1FA9A 2RGNC 3AKYA 3HKCB 2HBRA 2CXUA 3AIIA 1Q7EA 3ZG6A 2W4QA 4DM3A 2AKEA 3KWFA 1JN0A 2AX4A 1K6IA 3UUFA 1CJSA 3EUWA 5LQRA 1UBLS 1V43A 2PXAA 4YRIA 1H8ED 3A9VA 4JELA 3BBPA 2PX6A 3V4OA 5JCOA 5CLFA 1NASA 1HYHA 1MVOA 1QR6A 4I9UA 3EBPA 2ZUEA 3CZRA 2ZIXB 4DCNA 1T91A 1TO1E 4TXMA 4LPKA 5DN6D 2XJ9A 4KQHA 2EFCB 1RPNA 4LHEA 5EXTA 4XR9A 5I3ZA 3G88A 3FDFA 4KE6A 4PG6A 1IY0A 5C5CA 2V7UA 1YR1A 4YRQA 2FPGB 3WRVA 3DS8A 3L01A 1IPHA 5KVSA 3PC8A 4JT4A 4LQ4A 1P31A 3LSTA 1J9EA 3SGLA 1GN9A 1NFQA 3PPWA 1DJLA 5BSRA 3X1XA 3ID6C 1AGRA 5AW9A 3R0IA 1G291 3ZCVA 1U7ZA 3TW4A 5B12A 1QLJA 1JDJA 1U7TA 1H2WA 1PNTA 2B82A 4WOPA 4NE2A 4F06A 2I2FA 5A4MS 1ADGA 3A9TA 3IUSA 3PZBA 1X1RA 3MUEA 4G1EB 1T1SA 4M1WA 5COAA 4CMEC 3BE6A 2ZIGA 4HR7A 1Y9DA 5GMOA 4BZQA 3DXYA 4BNHA 3W9UA 3S7TA 1E77A 4FEAA 2WTMA 1YQTA 3FUWA 5REQA 1RWBA 1NMZA 2NQ8A 3UHFA 2OGUA 1C3XA 3DZBA 3W9BA 3UH1A 5IFLA 3CBGA 2LD4A 1N5IA 1ORDA 3OFKA 1CVIA 3PQ8A 4IIJF 4BNZA 3ZBQA 2IPXA 4J75A 1RQNA 4RMHA 4NJEB 5J59A 2Z09A 2PZ8A 2AMJA 5JCOC 4K8OA 2X3YA 5CVTA 3DOOA 1CLUA 3A4IA 1YGPA 1G1AA 2P27A 1O94A 3LAWA 2W71A 1WSAA 1PQPA 1EAMA 2CDAA 2YJGA 2Z1DA 3HB0A 4PZYA 3VKUA 2A1UB 2E2WA 1N6LA 4J7CA 2REXB 1H3EA 4OBWA 4QNMA 1LI5A 4EY6A 3N2ZB 2F9MA 1DO2A 2NPIA 2AL7A 3IO3A 2P2LA 1GPH1 2NVBA 4HVTA 3I76A 2A9JA 1OGIA 3FVWA 1XRJA 4KNYA 1R50A 2ZS9A 3H9BA 3ZH2A 4F96A 2OP1A 2FN4A 1YRLA 2XUZA 4X1IA 4G6ZA 3GLFB 4CBVA 4XTCS 4L0DA 2WD7B 3IUPA 2ZSHA 4LYFA 3G6WA 3PBKA 4UVIA 3KP1A 3UB3A 1DEXA 1NRJB 4DCSA 4UTPA 3D6MA 3ZOKA 5JYEA 2YKGA 1WDKA 3Q2OA 3AW9A 3ED1A 2VJMA 3T9FA 1F6DA 2YUTA 1O9GA 4HNHA 2FMTA 1UBKS 2WTAA 2WWHA 3MILA 1EP3B 2WSMA 3V7FA 4ZJZA 2AZ4A 3Q7SA 1FXUA 3PXBA 2EAUA 1FDOA 2ECFA 5HE9A 3DZGA 1NNLA 3P9SA 4QUHA 4C29A 5K8JB 5ALWA 1R1DA 4MUGA 4DLYA 1VL6A 3V6LA 2VCHA 5BUSA 5L53A 1YL7A 4ARVA 1BU5A 1VMKA 1ZCZA 2E7ZA 2RK3A 1VGRA 3SYRA 3LNCA 5IKMA 5K5EA 4M0KA 1T15A 1Z38A 4E94A 1Z3IX 2ZJZA 4Q12A 5CLQA 4RHFA 4BZZA 4W5RA 4TWJA 1Y33E 3HJFA 1VHWA 2VXOA 3Q3JB 3O94A 2GLTA 3SS7X 1RAIA 2NXEA 1E96A 1X0VA 5LQAA 4LRTB 4DJ5X 3QF4A 1J24A 1VE3A 1M7GA 1WG8A 3UNXA 1QRTA 2GSDA 4XGRA 3ITDA 3JARB 4IF6A 4HC4A 3GV0A 3RUHA 3QI7A 2Z5VA 1RZRD 1RM3A 2AI1A 4JITA 2A9OA 2QTLA 3AZPA 3IDOA 3MSXA 4QU9A 5KHLB 4Z0PA 3P94A 2Y9PB 1FDVA 2JFYA 1QDEA 4CZ2A 5JNWA 2MSWA 1Q7RA 1ZOLA 3DFKA 3DULA 1IPEA 3G5TA 1XDSA 3IXQA 4JNCA 4IBOA 4QDKA 2UKDA 2A5DA 3HFJA 1P62B 4UU0A 5AKGA 5LB4A 2BVNA 3D8NA 4E4YA 3E1KA 4JLUA 3PFIA 5DSTA 3DEKA 3ROTA 4C7VA 5ARDA 1B00A 2FUEA 4OP2A 3MTQA 4ZI3A 3O0DA 2XR1A 3GA5A 4O25A 3MCWA 3RBAA 5IRCD 4E6EA 5BUQA 3A37A 2X40A 1PGPA 1DC6A 3D3KA 2CLCX 2FY8A 2X0NA 3QA3E 4GXRA 3HXQA 4DV0B 4F4CA 3DT8A 2ROQA 3MINA 1KBQA 1QONA 2OYRA 1NRWA 2WSSA 4Y2XA 2CWWA 1TQ2A 4KN5A 2AOTB 2Q3EA 2R11A 4XWKA 2WG0A 4H7KA 3TQOA 1U5BA 3DYIA 4EHAA 2WF7A 3KQTA 1CD5A 1SOVA 1NLFA 1NQAO 1ETUA 1P61B 2JIMA 2Q45A 2VPWA 2Z57A 2O8EA 1UXHA 1G7TA 2H1IA 5D00A 3KFLA 1AJEA 5J4KA 1GZ4A 1R9MA 2FW0A 2D5LA 4D9GA 1UPUA 3F3KA 4YJFB 4EHHA 5IX8A 1M2OB 2CEAA 1C3LA 4F85A 1AKRA 1RJWA 2C8KA 2G7ZA 3OSUA 3M6FA 4BRWA 6PFKA 5KSPA 4KTVE 2WWXA 1VSUA 4UKDA 5KSOA 4N54A 2A0YA 3HU5A 3S40A 3UUEA 3A2LA 1Y8QA 3HA2A 5IZCA 2F1JA 4AKIA 2DH6A 3ETNA 4D74A 5A62A 1MTOA 1USGA 4P8RA 1MW9X 3ANTA 5I48A 3IODA 1XPUA 4AULA 1JZQA 4FYVA 2PKQP 2G77B 3RM3A 1DBSA 1KI4A 2FFBA 2WHYA 3EY9A 4BN5A 5AJHA 2W2LD 2H85A 1I3KA 2WU3A 3ER6A 2PR2A 3NRBA 4TWIA 1M2NA 2AOXA 2J31A 1S2DA 1KDVA 4EPTA 1JFLA 4RVOA 3O4FA 5I7AA 5HZGA 4CM5A 4REQB 3R9KA 4IZOA 2XQIA 4WCVA 1JKIA 2AS0A 3COJA 2HJ9A 4GGOA 1F6WA 2MCFA 3SS8A 3SSOA 3K9FC 1XJWA 2CVHA 2R8BA 4DANA 5AK3A 2IXAA 4LCEA 1PNRA 1K8RA 2W98A 4JU8A 3U7IA 5C2JB 3H7IA 3UAXA 5CB6A 3RHFA 1FMFA 5D6NA 1SD1A 4PLGA 2PWPA 4IIHA 1YAJA 4FR5A 4M46A 5H16A 4CUKA 1EXDA 1W46A 2ZT8A 3UTDA 5LKRA 3L4BA 2AN1A 1WP4A 1XTKA 4CEHA 5EWMA 1KJ9A 4TQAA 2NT3A 1SXJA 3D81A 1C9JA 2EKDA 4DBVO 3AU8A 4YMWA 3LOUA 2QBYA 2HEGA 1KI7A 3OTQA 4FW9A 2ZM5A 4WBNB 2EKZA 1E58A 2DOKA 5A4FS 4RKRA 4ZVMA 1Z47A 5JT1A 3NHWA 4YRDA 4MSUA 4ZAZA 2R5FA 5ALRA 1F8GA 4O4IB 1J0EA 1DWPA 2HQSA 3BBLA 1ZKMA 2C4VA 4CDMA 1H9CA 4L16A 1KKLA 2CXSA 5I4BA 2B8WA 5CAEB 3EBLA 2OOSA 3VHQA 1S8FA 1D4ZA 3LQ4A 4EFKA 2ZOSA 3PA8A 2B21A 1PEAA 4GRAA 4IFIA 3RYCB 1U2GA 4JNKA 5CD1A 4WLEA 6ABPA 4N41A 3FPLA 3RYIA 5ICGA 3M3PA 5DCWA 2JFZA 2J5RA 2WFLA 1O8CA 2GXUA 3LUKA 5LWQA 3GUYA 4QOHA 5JZBA 1GPUA 1ZC4A 4MGHA 4YJ3B 3WLFA 1QIHA 1WUYA 2FSGA 2Z9CA 4X1KA 1QC5B 4BNJA 1YS2X 3GLUA 5BW8A 4NNOA 2C2GA 3JQGA 3PDCA 4WRRA 1PQ4A 5GONB 5AKEA 1WDMA 1K98A 4WLNA 1AHIA 2YV5A 3L4BC 1SUPA 2G4CA 4OA8A 3W9YA 1RHJA 1XF1A 1SXJC 3HO6A 4QJ3A 4KYIB 1WSWA 4KQFA 3SAJA 1G6HA 2C4TA 2ZTUA 5DHAA 4XFJA 2PZFA 3BSFA 4HKTA 5F3DA 1DEKA 2EF1A 4UM7A 1J6UA 3IKJA 1WNTA 5FUXA 1HSZA 4LYHA 2H2AA 4J1TC 1X7WB 2CCKA 1GVNB 2OHFA 3C7KA 4DIFA 5MN4A 1HR0B 2OMKA 1C4XA 5CPBA 3ZDRA 2J9RA 3COVA 4JOSA 2DR2A 3CM0A 4XTRA 4ZHSA 1I6LA 1DCMA 2AF4C 3E05A 4DBLC 5FAKA 2AZXA 4DRXB 3KTOA 1HK7A 4NCIA 3HVIA 1GTSA 4C7OB 4LX8A 2B37A 1U2GC 3AL0C 4Y6GB 1CUZA 3R3UA 2PPVA 4L6AA 3AR5A 1AK1A 3PNLA 4QOIA 3HN6A 3TTSA 5E7MA 1SB8A 4FMCF 5LP6F 2BMEA 2AZDA 4IFEA 4R40A 3IJRA 2YWHA 4BRSA 3PR1A 3ZS8A 2JJYA 1ZMRA 4DCTA 2V9CA 2Q41A 4LKRA 1IFXA 1D8AA 1D7OA 3AM3A 3S2YA 3WAGA 4ZOLF 5FT9A 5G41A 3GLHB 4BLOA 3T5DA 5I51A 3OEYA 2GPWA 5AK4A 4G26A 2JANA 4QXQA 3VSBA 3B20A 4QNNA 2VZLA 2BFEA 5FB3A 4XM0A 4Q1CA 4TKMA 4YUYA 5HKOA 2R4UA 1NDUA 1TPYA 3IUYA 4OMUA 5ILQA 3WGZA 1U3GA 3ZCRA 4BNKA 1NRXA 4LYEA 1T3SA 2KI5A 3L7IA 3PQEA 1OJLA 3SEZA 3SU8A 1SVNA 5H9WA 1JS1X 3FJOA 1KEVA 4TMFA 1L5SA 5H3CA 5I9TA 1FYWA 1WW3A 2HJVA 1J06A 1JIVA 3LVRE 4JX8A 1CLEA 1MC4A 4M0PA 2CCJA 3D8HA 1OLXA 2D59A 5FWYB 5DM60 4IFBA 1XXHB 2C03A 2B30A 1M2KA 1OI2A 3UAYA 3UHOA 2YCBA 4GOND 2CVOA 2VTEA 1W76A 1U2SA 3HP1A 1JR2A 3DBRA 3NTLA 1O6FA 4FN4A 2JJ1D 4K6OA 1JV2B 3HZZA 4M1KA 4BKUA 1SVUA 1AKVA 5LPNA 4BB9A 2VUSA 3IOYA 1HNNA 1WMFA 3G0OA 1PK8A 2C2HA 3QBTA 4BX0A 3KYIB 5KTPA 2OM2A 4KR0A 4JZKA 5SV2A 1CS0A 4BQSA 5DE3A 1SHKA 2PQMA 1Q84A 3P52A 3IPRA 2X77A 2VT7A 4ALIA 1LDMA 2WJZB 3GLGE 2VHTA 4A0QA 3I2YX 1AO0A 1GN8A 1WXEA 4UC0A 4JEIA 4IIEA 4YAUA 1WM1A 2B0CA 3W7AA 2SNIE 1ZN2A 5HGJA 1LDNA 1OXXK 2QV7A 3AR8A 4RY0A 1OWLA 4JMPA 3AEUB 1CUCA 4I50A 4DSZA 4RTOA 1RQGA 2HZBA 1PL7A 1MIOA 3MTDA 2NX2A 1OZGA 3SFTA 3WIDA 3IC5A 2DPGA 2FKNA 1YI1A 3QTBA 1OXBB 3K9WA 3W2GA 1GQSA 4DWJA 3TR6A 4PTLA 1FL9A 5I8ZA 1BFUA 3NHUA 2IUEA 1DC7A 1COWD 1SU6A 4JI3B 2XUIA 3DDOA 1BHSA 2EC5A 2IXGA 1W1IA 3C85A 5DNWA 2PK3A 3PICA 5DW0A 2JIRA 1IMJA 2OHVA 3THOA 3K2BA 4CTOA 3AG5A 4LKOA 3U7RA 1EP1B 4MGYR 4DYHA 3T41A 4NBLA 1DBIA 3HCBA 5ICSA 4IJMA 3KE8A 4MQBA 3WJAA 1CUWA 1PT5A 2PX2A 4KUGA 5TR9A 3TIIA 4E5NA 3BB3A 3GBPA 2NSDA 2EYQA 4MQEA 4YJHA 1Q7TA 4TYYA 2CJFA 3F7OA 2XMPA 1RZUA 2G8LA 2ZYDA 1UMDB 1V4VA 3WK9A 3QP9A 3CINA 1L5KA 3AHEA 4ILEA 5DI3B 1E79D 2GEJA 1CP3A 4KPFC 2ONZA 5JAPA 2ZIZA 1E7MA 1N8TA 4M8KA 3WISA 3IT1A 1ZGHA 3PDIB 2EQBA 2OG2A 1XA3A 2DHEA 2Z9DA 1QHGA 2Y1XA 5A5GA 1N1MA 1YDEA 3HYCA 3ZYZA 2FK7A 1GAWA 1W9MA 4TPKA 1B3BA 1BXRB 1E2HA 1W5BA 3D4OA 4PZEA 1P9RA 4R5HA 4YUAA 5CFLA 2GJKA 3O74A 2ADOA 4TTSA 4YJ2B 4NOLA 2R6R1 3N6RA 4P83A 2G4VA 1ONPA 4JBWA 5GIOE 3ZU3A 3ODPA 1YS4A 2QAGA 4KXQA 4H7FA 4Z9YA 1VCOA 3CU5A 3GFTA 3A6GA 4RIFA 4ENPA 1Q7GA 1DXQA 2NTVA 3CCCA 4KV9A 2NP7A 2A30A 3FYDA 3GCGA 3DKKA 1Z56C 1TEZA 2F1KA 4J3NA 2BFPA 1GZ3A 1RCTE 3GFVA 3D31A 5LLDA 3EXFB 5FLEX 4PU0A 1D0VA 1CIPA 3UB4A 4DDHA 3OT4A 2WJJA 3QITA 1AGPA 1GLGA 1ZQ1A 2C00A 2E4UA 3K4HA 1U1IA 1KSHA 3PNMA 1KRWA 2QPAA 2V5AA 3OLYA 5AM3A 5GM2A 2D13A 1EFUA 1CTQA 2IZ0A 2IP2A 5DB4A 5ICCA 1BXGA 1GSAA 1PGNA 2Z0MA 4R4JA 2WWYA 3CF6R 1XD2B 1HY3A 2J3IA 1MGPA 2BL4A 4QGBA 4HUTA 2DERA 2ESRA 5FOXA 3B60A 1RS0A 2C7VA 1O9BA 3FTPA 4P9NA 3WGGA 4N5NA 2KS6A 1X87A 1JG2A 1U1GA 3GJ6A 1G64A 4W5JA 4AZ3A 3INGA 3KL2A 1U1DA 4K05A 4BV3A 2IP1A 3G7UA 5EFZA 4MIOA 4Q34A 2G9QA 2PMDA 4MW9A 4X6LA 4B87A 2YIMA 2BC9A 4CV2A 2ZITA 1JEQB 3F6BX 4GO1A 4NKRA 3IO5A 1I80A 1GWNA 2EEZA 2R1UA 1Q11A 1ZJ4A 4NFLA 3R8XA 1VE5A 4YT4A 4HAIA 2QAGC 5EQFA 5EUBA 3RIEA 4JI4B 3RWMB 1KIMA 4JQSA 4AQ7A 4BYMA 4RADA 4A8PA 3WRWA 4DLKA 4YVFA 5BOSB 1S0UA 4J0JA 3ZBUA 5JH7F 1SVKA 4MVJP 3KYDA 2PUFA 3S0JA 4TMYA 1EFPA 2XYQA 4WLUA 1ZISA 1OWOA 4IIUA 1SIUA 4TWZA 4EX6A 1K08A 3U7QA 1LI7A 2WF9A 2CUTA 2R96A 1DEHA 2YRXA 3FM9A 3PQ6A 3SC2A 2BSAA 3QX7A 5BVHA 2FEXA 2WAMA 4OQYA 4B83A 1I6KA 3EZ2A 1SIOA 2VPTA 2NZUG 2VHCA 1G0OA 5TY0A 1FJHA 3DG9A 4YQFA 2GKGA 4WNAB 3NHZA 2XB6A 2ZROA 3D4LA 1X8JA 2ZYWX 5KBYA 3JALA 3MC1A 2WHQA 3R7AA 4XYGA 3EQZA 1UBUS 1V5EA 3RRFA 3MFYA 5IC5A 2OBYA 4PPGA 3C8DA 3WP0A 4F6RB 4XPIA 2IHNA 4YLYA 2Y6VA 3M6VA 4UXJA 4GDFA 4LV8B 3WRYC 5EJ6A 4BO6A 1SWWA 3I0MA 1T1RA 1YZ3A 5FTNA 3ITEA 1GVHA 1PFKA 1YL6A 1HMYA 2ZRIA 3AV0B 4QO7A 4EBBA 1RRKA 2AHRA 3R3SA 1MJ5A 1H0SA 1ZH0A 2H7VA 3CHYA 3I23A 4GVPA 1QGUA 1TIPA 3IEVA 2GF9A 3RC9A 1GXSA 3ZWBA 2XBLA 3GZJA 1KXZA 4OP1A 1DKOA 5CB4A 5EJMA 4EYGA 3Q8XB 4B0PA 4M6WA 5E4YA 3GLTA 1Q20A 2NYAA 2P6RA 1OIXA 1IVNA 5DTQA 4H6PA 5LSAA 1XTSA 4FNMA 5CT8A 1N9ZA 1HFJA 4ZZIA 1OASA 3DOCA 4O59O 4WERA 3O8DA 3LW7A 4MICA 2ZRMA 4LVOA 1CF4A 4PHFA 1XI2A 1GCOA 2YN2A 3EZ7A 5ALTA 2XGMA 3OQHA 1O7JA 2QTMA 3K0CC 3QXJA 2XUQA 3R5KA 2CBZA 4GMFA 5JECA 4B4WA 2PWAA 4TS9A 4QRDA 1KEPA 5JVDF 3F67A 3BWBA 3LT5A 1QO7A 3DZ8A 4I2VA 1TM7E 2OHIA 1N3IA 1A2KC 2XZPA 4J1NA 4BMSA 1KMQA 2ZYAA 3GRVA 4X5OA 3DVAB 5F51A 1T4MA 1F5SA 1XTVA 4OM7A 4N40A 1OMOA 4YAGA 5F23A 2P78A 1NBEA 2BHSA 3WLAA 4C7XA 2GEBA 3MYYA 1MVNA 1V5IA 3I01A 1JBKA 4QDTA 3UV3A 4US2R 1WABA 4P4TA 2BE7A 2A7QA 2FF5A 2RGYA 4AUKA 5L7TA 5K2OA 1E2FA 1TF7A 3CRZA 4MAAA 3H65A 3KHUA 5FTMA 3TTWA 4FGKA 1ID1A 1MNQA 4RZIA 1OFGA 4LV5B 5H9VA 2CNWD 2G40A 5M7EA 1J9ZA 2FFHA 3QFCA 5AKIA 1Z18A 1EHIA 4C6HA 1SZDA 2AK2A 5J1SB 3FETA 3LWDA 4D6PA 3LX8A 3BPSA 4NG5A 1SZJG 1JHOA 4BV8A 2QQ0A 3KZKA 1UOEA 4PC6A 3K3PA 5AQEA 3O75A 3V8EA 5E2AA 2H48A 1OJ7A 1QIIA 2ZJYA 1KKMA 2Y3IA 4GUAA 4J43A 4YC7A 2XKJE 1HE3A 1M67A 4YA6A 2B7BA 1CUIA 1LV8A 4TL6A 4AC9A 3AJDA 4Z2AA 4W5NA 5BYKA 3V8QA 1GUYA 1LDYA 1RLJA 4YN3A 2V7QD 3ZIDA 2ATCA 2G0AA 1T5SA 3EOBI 1H0HA 1MT0A 3FGOA 3P7MA 2ZSUA 3RB8A 3LCMA 3WL7A 4JFRA 3HU3A 3ZW8A 1FUIA 4AECA 4LFCB 5JSQA 1VGQA 2HF7A 3D7SA 1XRNA 3CLSD 4FQ8A 3MVEA 1KO5A 4B74A 2OFWA 1D7AA 2CSUA 2QUBA 3E4DA 1AS3A 1JQ5A 4Q00A 2Y67A 4ZI7B 1P1CA 2J3MA 2B69A 2ZRKA 1EFKA 1FP4A 4DIBA 3SZUA 3IS3A 1DFIA 1YONA 1YRBA 3DNFA 4LECA 2OQVA 4YUWA 1WRBA 5JLJA 2OE2A 3OZUA 5B58T 2ERCA 3WA6A 4NQZA 1G20B 2YS6A 4GKBA 3TTYA 4DA7A 1AZSC 2MINB 4M38A 4FGSA 1E1QD 3U62A 2YXLA 3EIOA 4WDQA 3UAGA 3H2GA 1JEOA 4RJIA 1IM8A 1PTJA 3A58B 1IZZA 4H31A 4EMBA 1Q0PA 3UANA 3WSWA 1A76A 5DNYB 4IXTA 3GRAA 1Y7LA 4FM9A 2W90A 1RRCA 2WU1A 4OREX 2CL6X 5AK6A 1CDEA 4ZQHA 4RTLA 5FLXA 1X0XA 1QZZA 2XVAA 5CNMA 3RVRA 1SQFA 1ZCAA 4C4ZA 3ZE1B 2I3DA 4PCAA 1GKKA 2JCBA 2W4IA 3PFFA 3ROPA 1BIFA 3VX3A 5A6VA 3THWB 1JR6A 4A8JC 4AO6A 1RFGE 1WF3A 3GEHA 2FEKA 2FPXA 2O0JA 4TSFD 3F9IA 4UQOA 1F1JA 2JAXA 1VHTA 2FETA 4CL3A 3C15C 3AY3A 3KYCA 2FQQA 4Q1BA 4ZT6A 4RTKA 1KZ9A 3QNUA 1HDCA 5G40A 1PSZA 2EZTA 3CVOA 4WXRA 4Q15A 3H11A 3OUTA 5KSWB 3W6ZA 3VO1A 4BP1A 4Q19A 4CQLB 4PICA 4LJ6A 2R1TA 1L0BA 2Q29A 4MRMA 1GPAA 4PONA 4TLDA 2JAQA 1X7XB 4OH7A 5AW6A 1GITA 1LVUA 5CLLA 1TCAA 5AHOA 5JSZB 2ZVQX 1Z88A 1N7IA 4XXHA 5CH5A 5FH9A 3T0FA 1EJ6A 1NQVA 1G8KA 2WWGA 1MG5A 2A35A 1BH6A 2IEGA 3KPVA 2ZATA 3PUIA 3QKWA 4E3WA 3BRWA 1CE8A 5AKLA 1ZOSA 2QRGA 3WO0A 1G7CA 1QGAA 4J3JA 3UV7A 1W88A 4WKCA 3LZDA 3GRKA 4C4SA 1WXFA 1B8NA 3IV7A 2HF9A 4M9SA 4DMRA 4X66B 3AUUA 1J99A 4FVTA 3HKEA 1CFJA 4X7BA 5TVKA 1S2GA 2W6ID 3G2NA 2D5IA 3H4MA 4JR0A 1R4NA 4F5ZA 2Q4RA 4L76A 1PRYA 4DG8A 3V8VA 1NF8A 2XIQA 3WLJA 2GJ8A 3OY2A 4R9UC 4A0SA 5COBA 3K1YA 3UYKA 4BV2A 3GUZA 1FSGA 2W7TA 5A9SB 1E2KA 2ZWIA 3R5XA 4DKXA 2BGIA 4L5AA 5C32A 3N2EA 3AR4A 1CF2O 2C4UA 3QFHA 4PR0A 3PWSA 4LMBA 1NYQA 3B12A 4H18A 3RR2A 1NKVA 3B48A 2BM9A 4HB0A 4JHXA 1IK6A 2JFWA 3CZQA 4PC3A