2FGKA

Crystal structure of the abc-cassette e631q mutant of hlyb with bound atp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
241
structure length
241
Chain Sequence
b'DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
publication title A structural analysis of asymmetry required for catalytic activity of an ABC-ATPase domain dimer.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 69
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fgkA00
4MKIA 1J8YF 2CMKA 3NEYA 1G20E 4M9XA 3EG5A 4TYNA 2O0HA 5LDDC 2IUSA 1UKYA 3AUXA 1NY5A 4DCUA 1KI2A 4HB3A 4DHEA 4EQ6A 1E0AA 1ZYUA 1NJGA 3N2IA 4JZKA 1R0XA 4Q7KA 1JXOA 2RH5A 2X1VA 3TE6A 4K8OA 5FOXA 4ZV4A 4A8JA 3EPHA 1CIPA 4OYHA 1JBKA 3PIRA 4H1VA 4M4SA 4D82A 1AN0A 3ZJYA 4B44A 2FSGA 1B23P 5DI3A 1TEXA 2AFHE 3HWSA 1DAFA 1QHNA 1FL9A 1N6NA 1T3SA 2BC9A 3I72A 2ZYWX 4RD6A 2P6UA 4JLMA 4C4PA 4GZLA 2H5EA 4HZUA 1FQJA 2G77B 4AY2A 1P5ZB 2JATA 4I99A 4ARZB 2WMOB 5FL3A 5EP1A 1YZKA 3PV0A 2ZSAA 2OCYC 3THWB 4NDZA 1FX0B 1GTVA 2QBYA 2PZGA 4TT3A 4A0GA 4E07A 3LD9A 4QKQA 5FBLB 3BFKA 3L0PA 3AP1A 1NKSA 1H65A 2H8KA 1UF9A 4LHZA 1L4UA 2J45A 2DFKB 4IVRA 2FSHA 1CJUC 1F3OA 4DLTA 3CO5A 3KXKA 3QXSA 4DSTA 1W7AA 2WKPA 2IBMA 4PQRA 4DBLC 3D3QA 5FOVA 5L8VA 2OESA 2W58A 1LY1A 2F1JA 3E5HA 1G7TA 3IKJA 3A1WA 2GF0A 2NQ2C 3FWYA 2ZAMA 3TVDA 1QHIA 1NLYA 1RVDA 3QSYA 3KJIA 4W5HA 2JAQA 3EA5A 4C0KA 2LWIA 1IXRC 3FMFA 1KK2A 3T35A 2P5SA 2UZIR 4ESHA 2VQSA 3HU2A 1CJVC 1MABA 1Q3HA 4OJKA 4EPYA 2QQ0A 2O8DB 1DG3A 4G5OA 3ASZA 2DCUA 5BYJA 3CLVA 3DMNA 4B3GA 5KPJA 2PX3A 2Q9AA 4TYPA 2CXXA 2QP9X 3AM1A 1ESNA 4HB2A 2MSDB 4EPRA 2WVJA 4A92A 1G3UA 3CZPA 3R7WA 4P3YA 2YWHA 3ZS8A 4HDQB 3WHLA 1WQ1R 2KWIA 3FHOA 4JVMA 4AKEA 4M1TA 2VHJA 1DEKA 5DYIA 3T1OA 3EX7C 1HQCA 2VH5R 2PEYA 2J46A 4PC7A 4G0NA 2P3SA 4XH9B 3CWZA 5AJXA 4D80A 1DAMA 4P4TA 2KBFA 2QG6A 4JSYA 3TRFA 2HCBA 1VECA 4QBGB 3I5XA 1OYWA 1QVAA 2IYSA 2WWHA 4JLOA 3U6BA 4D26A 5FPSA 1JI0A 3CX6A 1MV5A 4FWTA 2ORWA 1JR3E 4JLDA 3GMTA 3GLHB 1CR1A 3I92A 4ZCLA 1KMQA 3DZ8A 3GCGA 3QBVA 1SVOA 1YE8A 4KLZA 4BFSA 4TQUS 2ZAOA 3AEZA 4HYYA 2ZRCA 3WY9A 3I4LA 3N5CA 2WAXA 3MG9A 1E79D 4D6PA 2RGXA 1G8GA 4GNKA 2ODBA 3LLUA 1UPTA 3GJ8A 4Q4JB 3IHLA 4IOMA 4QGGA 1NNEA 1E1RA 1TQ6A 4ZKDA 1COWD 2BBOA 3KL4A 1G1MA 2P6RA 4B6EA 1U9IA 2O0KA 1KTVA 5J4HA 1NP6A 3A58B 1QG4A 1N0VC 4GMDA 1TQ2A 5FR1A 2MSEB 3AKDA 3TUIC 3WYGA 4UJ5A 2F1IA 3C14C 3PUZA 4OI4A 2F55A 1OIXA 3CRQA 1RE0A 2IXGA 2E9SA 3EWSA 3SC3A 2AL7A 2PEZA 2J7KA 4QBIA 4IXMA 1YRBA 4PHGA 2NO6A 1D9XA 4EPXA 2J87A 4WXRA 4V02A 1U2RA 2YNMA 1EWQA 4R2HA 1WE2A 4PPGA 1P6XA 2IF2A 4TLDA 1D2EA 4JL5A 4KJZA 3ADCA 4M9SA 5C2JB 1IN7A 1JR3A 4M1OA 3U7EB 1G8HA 4LX0A 3B1VA 3QF7A 1VYTA 1CRQA 1KI3A 3S1AB 5JWRA 1Z2AA 1OIVA 2D7DA 4C9BA 2VHTA 4IFBA 3SJZA 1E1QD 2OM2A 2GJSA 2WJIA 3BGWA 4UXIA 1CULC 2F1HA 1E96A 2VLIA 3MAAC 4XTRA 2DYKA 4NKRA 4QBFA 1WXQA 4Q9IA 3W5IA 3ZVMA 2R6FA 1II0A 1VDZA 1N6OA 2C5LA 5G40A 4ABYA 4Q9HA 5J4YA 4AURA 1A2KC 1ZJ6A 3IUYA 1MO5A 1VMAA 1KOFA 1SVIA 2V8OA 3NBXX 4UXHA 4C0BA 2R6AA 4D4MA 4DCTA 4NCIA 1ELOA 2J59A 3CRW1 3Q72A 2OLKA 1CR4A 2QMHA 1KMHA 1AKYA 1HT2E 1NMXA 2JDIA 3E1SA 3LBIA 3CPJB 5F3WB 5KNBA 1Z8FA 3O8BA 2IHBA 2XOKD 2ZYUX 3ZIAD 2J3EA 3V00A 3FFBA 4GMXA 1RRPA 3GLFE 3UPUA 5IK2D 3PITA 5FUWA 3RC8A 4HLDA 1O87A 2GILA 2J0UA 4IVPA 4DLVA 4RD4A 2N1BA 2IC5A 1XFAA 3NBYC 2W6JD 5CLLA 4KBGA 3W8RA 4OHVA 5KSYA 1F60A 1G5TA 2FWRA 2XITA 3B7GA 3MWYW 4BGDA 4B3XA 1FFHA 4B33A 3A8TA 4BZQA 1PUIA 1YKSA 4EUNA 5FL7D 1W36D 2JLXA 3PR1A 1IONA 1ZUIA 3Q7QA 4HLUC 2BHRA 3W6OA 2FZ4A 2ZS7A 2CK3A 4LWZA 3TBKA 1VG9B 4KFUA 2ECKA 5EXXA 2GEVA 3VU9B 4QFMA 3BK7A 5AJVB 3I61A 4Z51A 2OSBA 1T0JB 3SU8A 1E9EA 1N6IA 1XEFA 3C8UA 1KNQA 3ONWA 4URYR 3FB4A 4LHWA 5KYKA 2ZU0C 4YXWA 4DEYA 1OKKA 4LBZA 2REBA 2AX4A 4TZ6A 1QG2A 3R9XA 3ND9A 2QAJA 3DO6A 2GJAA 3GFPA 2WWWA 1UBFA 4DT1A 1II8B 1U81A 4JSTA 1UADA 2XJ4A 1KY2A 2OBMA 3MGCA 5AUQA 3GLFA 3THXB 1PZNA 5C4GB 2B8WA 2EFEB 2GCOA 4B34A 4URVR 3U60B 3RWOA 4LHYA 2OEPA 4IOJA 2G9NA 4G5QA 3BWDD 4HDCA 4V0MA 5FH9A 621PA 1F48A 1WA5A 1LFDB 1R5OA 1JQJC 1P60A 2ZR0A 2FEMA 2X2FA 3EZ6A 3A1SA 3B9PA 3O8CA 4QGHA 2OCPA 5G53C 4RZ3A 1DTSA 1LF0A 3OESA 4NCHA 1DO0A 1TU4A 3DL0A 4Q9JA 2H57A 4H9GA 5E7JA 1DG1G 4JL6A 1PUJA 3T12A 4B73A 521PA 2XSZA 2A30A 3RYTC 2O52A 1S0UA 3CB4A 1Z0DA 1Z63A 1Q12A 3THYB 2JJ1A 5KTYA 4AD8A 1VG0B 4DLSA 2JASA 1J8MF 3AF3A 4M1KA 4IDNA 1NBME 2WM9B 2EWVA 2ZR9A 2H17A 1Z5ZA 3TGPA 3R8CA 2FN4A 2ANCA 4BZXA 2BBSA 4NONA 2PLFA 2C78A 3SDZA 5SZIA 2FFQA 2ORIA 1TUIA 4KAXA 3VR5A 1XD9A 1W36B 5FBRB 3QJYA 1VCOA 3IEUA 4OHZA 3M1IA 3FGNA 2EWWA 5HKKA 3NBZC 4A1FA 1D8TA 2CBZA 4CT5A 4X8LA 3KQHA 2WWGA 1G6OA 1KY3A 1A82A 2F7SA 2QPAA 1W2GA 1KK0A 4V0LA 4LV6A 1XXHB 3KJGA 1OB2A 1VPLA 1ONBA 2V6IA 1IJEA 3I8SA 2XNDD 3QVVA 2QZ4A 4HAZA 2YWEA 5L3SA 1M74A 2V54A 3UANA 1ZVQA 5DI9A 2EU8A 2ZTSA 1NY6A 1KO4A 1QRAA 3B1XA 3H86A 3BXZA 2Z0MA 3MD0A 3Q5EA 4EAQA 4Z1MD 5JJIA 1G5RA 3B13B 3FKSD 3W5JA 4EFLA 1VG8A 4DT1B 3DMDA 2ZE8A 2FJUA 1PJRA 3CZQA 4C30A 2PZEA 4BFUA 2VSOA 2ZJ2A 4EJSC 4C2TA 2G0TA 1A4RA 3VR4A 4M9QA 4B3CA 1JEDA 1ZAKA 4DDTA 3KKQA 3ZDQA 3H2YA 3QENA 5TMPA 4E03A 1DAKA 2GZHA 4RFSA 4BFXA 3LW8A 5DNYB 2OCBA 3KDSE 1NBMA 4LBVA 2JA1A 4AYXA 1Q44A 1WB9A 1E9FA 1UJ2A 3QKUA 2GJKA 2W2VA 1E94E 1TU3A 2R62A 2KJQA 3T1VA 3ZZ0A 3OE7D 1XWIA 1YR7A 4US2R 1OH6A 4V0NA 5AUPB 4Q21A 1CF4A 1S96A 1AM4D 1W0JD 2N46A 2WSSA 5GADl 1XNJA 4HAUA 1OSNA 5HCIA 5TB5A 1KI4A 5KNCA 1CRPA 4TYYA 4TTQA 1M1YE 3K0FB 4RCYA 3SN6A 4ZDJA 3ZYCA 4KITB 3AGPA 2MSCB 4D4LA 3SBDA 3EPLA 2J7PD 1FUUA 2HEIA 5P21A 1FP7A 4KCGA 2ZVPX 1G8PA 1E2DA 2ORVA 3KX2A 3BB3A 2VF8A 3GJ4A 4QL3A 2BCJQ 5KSPA 5L3QB 1NLFA 1VHLA 2QTHA 3KQNA 3TLXA 2W0SA 5FPHA 2GAOA 5J4KA 3QY0A 5IF9A 4HATA 3LNCA 3LW7A 2FE4A 1W44A 1TNDA 3CNOA 3D31A 1A2BA 4M1SA 3A36A 3SNHA 2V3CC 1G64A 3AQ4A 5AWFC 4ACBA 3A1UA 1O3YA 4HUQA 2BWJA 3TR5A 4U7DA 5AJWA 3W34A 2OBLA 1C1YA 4WBSA 5HCNA 3KTAA 5DN6D 2RAPA 3U4QB 1I2DA 1JPNA 4LUCA 5KDLA 1XX6A 1NKTA 2G83A 4LRWA 5TY0A 4RFVA 4WA7A 3X1XA 4MYUA 4GT1A 2FZLA 4MH0R 1IY1A 1VYUA 4R9UC 2CVFA 4WZAE 2ONJA 1GNRA 4QM6A 1U0LA 3F8TA 2ZI6A 1GUAA 4IDOA 2NG1A 3GLGE 4JBWA 3VNVA 3I3SR 3L0IB 2CEAA 1N5KA 2XTNA 1X1SA 1YR8A 2YJTD 2G1KA 1E2MA 4N1AA 4CZ2A 4URZR 3PXGA 1IN8A 3VHXA 4DCVA 1NIPA 3CM0A 2WPDD 3UWKA 5B57C 2WMNB 1MR3F 4L9SA 3AF1A 3PUXA 4LGMA 1DAEA 4RD0A 4TQ9A 1BIFA 3ADDA 1SVKA 2HV8A 4JYCA 4DUGD 5H1YA 2XAUA 2G0NA 1E4VA 5L3RA 5J47A 1AGRA 3L43A 3MWKA 4WXPA 4F38A 3B6EA 5C1BA 2I4IA 3SQWA 2BBWA 5EJEA 3WNBA 2YINC 1OFTA 3ETLA 3CH5A 4WAUA 2V9PA 4X8HA 1U90A 4IJMA 1QHSA 3LDAA 3VFDA 4B35A 1OLOA 2HXYA 4OQMA 4B3DA 5JHGB 1NVUQ 1RFLA 4C0QC 4NMMA 4M8NE 4QJ4A 3TSWA 2VYFA 1LNZA 3NBFA 3X1WA 4RD3A 1EFRD 2NZJA 3GEHA 4IEIA 5D3MB 4XOIA 3DZDA 1H8ED 4OK3A 1Z83A 5GVSA 1XMVA 1N0WA 3KXIA 2GK6A 3K9NA 1R8QA 2GXQA 5C4MA 2CLDX 4FIDA 1MT0A 4C7OB 2JEOA 1KKLA 2X2EA 1EWRA 1JR6A 1GG2A 4URWR 4DSNA 3GLGA 2ERXA 4KFRA 4Q4AA 2EYQA 3EZ7A 2WWIA 3I32A 5CM8B 3MWLA 1GKIA 2Q21A 4JS0A 4LJAA 4TMVA 5E95A 4B3FX 4AKHA 1ZM2A 2ZS8A 1P9NA 3U5ZB 3K0AB 2WICA 1S8FA 2F9MA 2AK2A 4TMKA 4LJ5A 5CB6A 1EFHA 4IW3B 1OT3A 4CEHA 4MITA 4TL8A 5H8WA 2QSZA 3K0CA 1US8B 4Q5IA 2ZEJA 1AK2A 2DWQA 2RCNA 3TH5A 1SXJD 4BLTA 1W48A 4LJYA 2A78A 1FTNA 4L8GA 4HSEA 3HR7A 1CEEA 2ZRJA 4Q19A 3TSOA 2GESA 1OHHA 4US1R 3CPHA 5A0FA 3OF5A 1E0KA 1KGDA 4YLGA 1IAQA 3FE2A 3U6KA 1SKQA 2ZIAA 2QTVB 3OEED 4KO8A 3QQ5A 5FOUA 3N70A 3TNFA 4A36A 1AQUA 1GILA 3TVTA 3EIQA 5GJCA 1SXJC 2AKYA 5KHOC 2C99A 3CR8A 4JLVA 1N6KA 5FTLA 2BM1A 2W6IA 3BE4A 2A2ZA 5FOSA 1U98A 5UKDA 3A4NA 3DEFA 2PL3A 4ERNA 3WNCA 1TTTA 1IHUA 1VCMA 2QE7A 1D2MA 1P7CA 1DELA 1W2HA 3E2IA 4AG5A 3QKRA 5K8TA 1T3HA 1Z08A 2A5JA 2GF9A 2RGEA 2ZJZA 1YHNA 4CGZA 4UNNA 5E3HA 3QKSA 3QKTA 2GNOA 4NTZA 5FUXA 1CXZA 4MRSA 2ZJ8A 5EP3A 3I1FA 5JWOA 1C9KA 3AVUA 3W3AA 1XJCA 4LV8B 2IYLD 2CLCX 2XJ9A 4LJ9A 4BPBA 4PAQA 2OT3B 4MA4A 1J99A 2B6HA 1I4LD 1GRNA 1XMSA 5ANRB 3X1DA 2AKAB 5CYPA 1EGAA 3VR6A 1P2SA 2ZE5A 1TADA 2XEXA 2RMKA 1KI7A 5BYKA 4KBFA 1LB1B 4BASA 4QHSA 2R65A 4CYMA 1LS6A 3B2EA 3KXLA 3REGA 2P6NA 4KLNA 2ONKA 3GLHE 4B74A 3TIFA 3K0SA 2GXSA 1W5TA 3OEHA 2UKDA 4BRUA 4NU0A 1W49A 5E4FA 3IO3A 2H92A 1JNYA 2ZI7A 5DO9A 2ZJOA 4AKIA 3OAAA 3DKPA 1FNNA 3GJXC 5EXSA 4L5BA 1N6RA 2PT5A 2JLQA 1E2NA 1DARA 2GA8A 2GHIA 1XPOA 1F2UB 1NN1A 2QPOA 2LKDA 5G3YA 4CEJB 1SXJB 4QNMA 4NBSA 2H7VA 2REXB 3AVQA 2D06A 2QP4A 1CTQA 4A8JC 2OUKA 1QHXA 2GCPA 4BE7B 1ZINA 1U94A 2IXEA 3NHAA 3RDPA 2FGKA 1N6HA 3PEUA 1J7KA 4Q4LA 1CR0A 2VL7A 1QHHB 4BFTA 4V0KA 1SKYB 4TT3D 5GJBA 2XXAA 3HJNA 4GP7A 2HF8A 2L0XA 4TLEA 2Z83A 1T6NA 2W00A 1HV8A 2EQBA 3CW2A 3RABA 2RB4A 4Q7MB 3FVQA 1LTQA 3OIYA 4POAA 3P32A 4CVNA 2EYUA 3C15C 5A4JA 4LBWA 5DE3A 2RGNA 3SJAA 3FKQA 3NIBA 4TMWA 4O2RA 4B43A 1G5PA 1HURA 4DIEA 2XB4A 3QEOA 4ZDWA 2QMUA 5DHFA 2IYXA 1Q22A 2RGCA 2GDJA 3WP0A 3C5HA 3UMSA 1VHTA 1HA3A 1LVGA 3B1ZA 1ZC3A 1M7HA 1OFHA 1E2FA 1R5BA 1VIAA 1WDTA 4PR0A 3LBHA 2KBEA 1DOAA 4PAOA 4DLXA 3RAPR 3O8RA 1KAOA 2GAAA 1OF1A 4XD7A 2J5XA 1GL6A 1T3LA 5GVRA 3EPKA 4OHXA 1YRAA 3AKCA 4DSUA 3DOEA 4IOLA 2FPKA 1CBUA 1KK1A 2QAGA 5CB8A 2BMFA 4R7ZA 2VP0A 1E98A 2R44A 1G17A 4IDHA 5HE9A 3BERA 3RWMB 3TAHA 4M0LA 2ZS9A 3CBQA 4EQ6B 2F3RA 3AVXA 3OIVA 3P26A 1XD2A 5JMTA 2WIAA 2IL1A 2D62A 3CPEA 3DM9B 1ZU5A 3Q85A 4F91B 4A8JB 3U2QA 4KODA 3VX4A 3R8FA 2J0QA 2E87A 4E22A 2D4HA 3QXHA 2C95A 3F3YA 4DZZA 4NL4H 1MO3A 1WP9A 4JLAA 4OL0A 4PAMA 2HLDA 5DI3B 5FOTA 4A4DA 3T5GA 4H1UA 5FTJA 5KUTA 2QENA 4HZUB 2YC2C 2GZDA 2Q3HA 4XTCS 1JB1A 1Q0UA 2I3BA 4LYHA 4TL7A 2GVZC 2V55B 1ESMA 4URUR 5DSZA 1EX7A 2C03A 1E2HA 2Z5FA 2YOFA 4OI1A 3IQXA 4LYFA 4BQSA 2ERYA 1T5LA 3IQWA 1X1RA 1Z07A 2QQEA 2YOGA 1G7RA 3JVUA 1KHTA 4LJ4A 3RVBA 2QBYB 1XJQA 3QPVA 4L9WA 4OBEA 1ZUNB 2FPMA 2C9CA 3WBJA 3GQBA 4C3ZA 3AGQA 4PSAA 2R8RA 3TK1A 1CP2A 1E1RD 4F4IA 1T9HA 3FPAA 3Q8XB 4RD1A 2ZU6A 4A2QA 3LX8A 1I4DD 4Y0AA 4BZPA 4BEJA 5FOWA 1TPZA 1XEWX 2PLRA 3FTQA 5JI3E 4RKFA 2O8EA 1AJEA 2O8CA 2CL6X 2VEDA 2BEJA 3U7HB 1G7SA 4E09A 5JEEA 1BMFA 3U44A 3SJCA 5EZ6B 4DLWA 3U7FB 3RS7A 4C0SA 4DLZA 1XMJA 4NCNA 1EX6A 1P2TA 1Z6YA 4GOKA 4O0MA 1XTSA 1QZXA 2YKGA 3B8HA 1E32A 1IBRA 5KDOA 5FTMA 3UMFA 1OXTA 1CU1A 2X19A 1U9IC 1YR6A 2EFCB 4BLSA 5JRJA 1MABB 2G88A 2BKEA 2VP4A 2BOVA 3A4LA 4JVSB 5KSZA 1KO7A 2HYIC 2WOOA 4PZZA 2ZSBA 3Q5DA 1KJZA 4IKEA 2DBYA 4FN5A 4WIAA 1NN0A 1JR3D 2OE2A 4QHYA 4I1OA 2JJ8A 3B5JA 2RGBA 3MCAA 3GP8A 4GFDA 3R7WB 2QEQA 4JKIA 1K5DA 1JJVA 3UG7A 1E3MA 4M22A 1KI8A 1SVMA 2VSXA 3I5YA 1AS3A 2ZRBA 5HPYB 3VTKA 2QMEA 1GKUB 3EW9A 3EC1A 2XZOA 5CLQA 2IT1A 3HP1A 3BS4A 2KI5A 4R2IA 2J0SA 4A0HA 1L2TA 2B7CA 3EIHA 4TQAA 3VMFA 4ZI2A 1NLZA 1QHYA 1G7CA 1OXXK 2VSFA 5JWHA 3LAWA 3EA0A 1XCPA 4ZDKA 5KSOA 2RHDA 2HUPA 1S2MA 1NL3A 1UDXA 2NO0A 5EZ5A 4AYWA 2ZANA 4GSYA 1TEVA 2IYQA 2HJGA 2JDID 3QE0A 2GRJA 3QPWA 4MDEA 2FDCA 1F6BA 4TL9A 3Q7PA 4PQYA 4M1MA 1MO4A 2ODWA 2ZJBA 1XTJA 2PJRA 4OHWA 2A5FA 1A7JA 3LFUA 2Q0HA 3U3RA 4GPTA 2Q9CA 3KKPA 5H70A 3K8YA 1J90A 5SZKB 4FCVA 4XVUA 5TV2A 1P2UA 2WV9A 1ZW6A 3QXXA 3PG5A 2PCJA 1G16A 1XU4A 2QT1A 1AS2A 2OXCA 3C4JA 5C46F 5L3VA 1KYIA 2ANBA 4YMSA 1OFIA 1B0UA 2CNWA 4JMPA 1NG9A 4HLQB 1HUQA 4JVLA 1OH5A 4IDQA 4GRAA 4LK2A 1KAGA 3BAFA 2O5VA 2IEZA 4ZO4A 1KKMA 3AKYA 2ZRDA 1Z3IX 3CIOA 1U0JA 1G3IA 2QT0A 1H8HA 1ZUHA 4G5RA 1E2GA 3EZ9A 4LHVA 1A1VA 1AQYA 1G41A 1KI9A 3SEAA 5IRCD 4JL8A 4YXWD 2D7CA 4MRVA 5CJ2A 1OKKD 5EXPA 5JBQA 1ZU4A 1GRQA 4Q03A 4UNQA 2JJ2A 1W36C 3FMIA 3M4YA 3FFAA 4XSHA 4DWJA 4PC6A 1SVWA 1Z6GA 1ZNXA 4Q1FA 2JGNA 4XVRA 3SJBA 5CJPA 3EZFA 2ODNA 3U3KA 3QEJA 3AF0A 2ZJ5A 4J0QA 3TJZA 2OAP1 1NMZA 4YMWA 3SE0A 3RNLA 4B71A 3D6TB 5JFGA 5JCPA 4LBYA 4EIWA 2QROA 3GFOA 5KPDA 1KIMA 2QGNA 4LI0A 5FPYA 3B78A 1VTKA 4EKDA 4LJ8A 2VP2A 1N25A 4K46A 4PZYA 5K8LA 4P4SA 5AJZA 5J4LA 4UXJA 5GJWC 3ZS9A 4MYHA 3GJ5A 4RJLA 121PA 1KMHB 1Z0IA 1J2JA 2ZJAA 3BD9A 5DGXA 3RS2A 2ZRHA 2ZI5A 4O25A 2XSZD 1XTRA 1Y3AA 1Q21A 1R0YA 3W8NA 3A6PC 4AWXA 1KZGB 1ZP6A 2O8FA 2A5YB 2YVUA 2JJ1D 3VR1A 5A5GA 3ZD6A 2J0UB 4LPKA 1R2QA 1ANKA 1Z06A 1IXZA 2FF7A 2VP5A 3PFIA 1KSHA 4G3XA 4QHTA 4OHYA 1GNPA 4DCNA 1ZCBA 4O3MA 1AZSC 3QPUA 1G18A 4AI6A 1WCV1 3P1JA 4RD2A 4FMCF 1E99A 1E0SA 2ZE6A 2HDNB 1S3SA 1LV7A 4DLRA 1OFUX 2OLJA 4II7A 1X8KA 2IYTA 2ZRPA 4FMBB 5HKKD 2AD5A 3AF2A 4X8MA 4EPWA 4QC2A 2V6JA 2XNSA 1ZNZA 3GPLA 5E7MA 1WF3A 4I1VA 4TYWA 1YQTA 1BKDR 1E2JA 3IGFA 1Q1QA 3FDIA 4B2IA 1FOEB 5JI2E 3R9WA 1I2MA 1AIPA 1LW7A 3TAUA 1S9HA 2NOAA 5TARA 3L2OB 4GP6A 4JBXA 5SZJA 2QTFA 3G5UA 4UJ3A 3WHKA 2CE2X 1CS4C 1K5GA 1UDWA 1TMKA 1JALA 1P61B 2DR3A 1M8PA 1Q3TA 3P20A 3MWJA 1IN4A 5B64A 2PBRA 3AV0B 3T1TA 1KJWA 1Y63A 2ODEA 5F2EA 3VHLB 2ZI4A 3GLIE 4DDWA 1WBBA 1W47A 4L15A 2ZSDA 3WYFA 3GLFB 3SYLA 2GCOB 2R6CA 2YHSA 2ZSEA 2WWYA 1NBMD 2JIZA 5DLQC 2DY1A 3MMPA 3KUCA 3QNUA 2BBTA 2DHRA 5DISB 1E2EA 2BMEA 3OIUA 3CONA 3BB1A 3ND8A 4A6PA 4ILEA 3NXSA 1I4TD 5M04A 3VKWA 1P9RA 1XD8A 3IEVA 3CRVA 3EAQA 4PANA 4A2WA 2GBLA 3ZQJA 1R10A 1JQLB 4C0LA 4F93B 3IPYA 2WSSD 2VHQA 5JRZA 3LVRE 4IFEA 5J40A 4PHFA 4DIDA 3CNNA 4IOKA 1Z6AA 1UEJA 2ZREA 4NP6A 3O47A 2ZRLA 1UFQA 2ZE7A 3JZMA 1YR9A 3B82A 2HYDA 3AUYA 1OYYA 3SYKA 2YZ2A 2OV2A 3EZ2A 4QM7A 1IJFA 3J81k 3F5FA 1EFTA 3U61B 1ZM9A 2GK7A 2Q9BA 4NE2A 3NG1A 2WJVA 4G1UC 3TSZA 1K6MA 4OKSA 4DLYA 3LBNA 1Q1BA 2IYWA 3MJRA 4QRHA 4W9MC 3GLIA 2C8VA 2HF9A 1NVVR 4N0DA 1C4OA 3KQLA 4FW9A 5IT5A 2JLVA 4MQBA 2IYYA 4W5WA 1T4GA 1VYVA 1YZUA 2ZRGA 3MJHA 3RRMA 2QA5A 4L16A 3AVPA 3BFVA 1RRFA 3U3OA 2E1RA 3A1TA 4WZBE 5L3SB 3BORA 4OI0A 4HB0A 4PZLA 2TMKA 1G3RA 1N6LA 4MKHA 3DM5A 4AG6A 2Q3FA 3SI7A 1TF7A 1HQYE 1U99A 2B8TA 4LPSA 2OHFA 2BM0A 5AR1A 4LYAA 5B2ZA 1KI6A 3T61A 2NMVA 1RC8A 4GOXA 3KQUA 3SBEA 1NSFA 1OPXA 1M6NA 1R0WA 3O8DA 4TLAA 1V5WA 5KOYA 2PJZA 3BBPA 4CIDA 2FPLA 2OO7A 1E2IA 1OE0A 2NZ8A 4HI0E 1BS1A 1E6CA 2BKUA 4JVNA 4RFSB 1RIFA 1Z2CA 5CM9C 1RJ9A 2NO1A 3C5CA 1JJ7A 3PCRB 5D3QA 4MYTA 4NCKA 2AWOA 4FMCB 2NIPA 2XZLA 3F0TA 3AB3A 2C98A 1IM2A 3LXXA 5FTKA 4BFYA 4UQOA 1P75A 1A5TA 1HT1E 2F43A 1M34E 2QM8A 4I1UA 1GWNA 3IIMA 2J1LA 2GWHA 2OILA 1ZM4A 1DO2A 1MOZA 4KSCA 4LHXA 3PQCA 5JSZA 1E0JA 1L4YA 4G5GA 3WXMA 4D0NA 5EUMA 2R6DA 2Z4SA 1HH4A 3AP3A 2GVDC 3GD7A 4WVFA 2NPFA 4YDSA 2LKCA 2IWHA 1XEWY 3C7KA 3QG5A 4IDPA 1KDRA 4MDFA 2IUTA 1NN3A 3AVTA 3HYTA 2GXUA 4JJKA 1ZIOA 4Q7JB 4WOPA 1YZNA 4TTRA 2Z4RA 3AVWA 4Q4HA 2NTYC 4Q9LA 3X1ZA 4OQFA 4TYQA 3RLFA 4HAVA 1DS6A 4HUQB 4GI7A 1E2PA 4M9ZA 5LB2A 1SKYE 2PH1A 3K09A 4CEIA 3QXCA 3H1TA 3KTAB 3P4YA 5FUVA 4GL2A 2GCNA 3RRYA 4BLOA 2WSMA 3OIWA 821PA 1MH1A 5EE9A 2JLYA 3CRMA 4B75A 1E69A 5HR5A 5FPTA 3U7GA 4LC1A 3H0KA 1UKVY 3AH8A 4TLBA 2SHKA 4LZZA 1F2TA 3QIAA 2OBNA 1OHHD 4OJQA 2OXRA 4MKFA 4QGAA 2QGZA 1R6BX 4XJXA 5GJVC 1GKYA 1AA9A 2FSIA 1XB2A 2O0JA 3K0CC 2ZXUA 3NC1C 2IS6A 1DAGA 1TF5A 1Q1ZA 2QN6A 1GITA 3VAAA 4FI3C 5CDFE 1NG1A 2ZUDA 1GP2A 1HE1C 1W0KA 2IYUA 3B9QA 4GZMA 1G6HA 3AVVA 3SHFA 2W6ID 3K70D 3LO5A 4KFSA 5K8IA 3LQRA 3QI2A 2WAYA 2FNAA 2KE5A 3RS0A 5JHHB 3EASA 4HB4A 1KDOA 2QE7D 2W2XA 3IIKA 4ZIRA 2AXNA 1FZQA 1D6JA 1KNXA 2JLSA 4QOSA 1BYIA 2MMCA 2V7QA 4LC0A 4NZYA 3QBTA 3CF0A 3K9GA 4KSBA 1Q1EA 3TQFA 1WRBA 2VP9A 4ARZA 1JAHA 1YJ5A 4G01B 1IY2A 4WW0A 3LWNA 1VCIA 2F3TA 1YZGA 1Z0JA 4Q01A 3THWA 3A37A 1FX0A 4DLUA 5DHAA 1GRRA 2G6BA 1FNMA 3K70C 3ZZUA 1R5NA 4TWZA 3T5DA 4B47A 1JAIA 2G1JA 2R9VA 1SHZA 1E9SA 2F9LA 3RHFA 4DRZA 2I1QA 4JT2A 1U8YA 3VKHA 1FUKA 1ZD8A 4Q1AA 3GLGB 3HYRA 4Q4AB 2RGDA 1VCNA 4BLPA 3P4XA 4TSFA 3QF4A 2Q3MA 2FH5B 1N3BA 1Z29A 1P3JA 4QGFA 3OEHD 2JLWA 4TMTA 4TN1A 1N0UA 1KO1A 4WZ6A 3WBKA 1E9AA 3AP2A 4KVGA 3AVOA 5IDVA 3OAAD 1ETUA 1HYQA 2GJ9A 4S35A 1ZIPA 5CDFA 1UAAA 4CEHB 1NVVQ 1P73A 4JYBA 4M1YA 2FFBA 2K5UA 4DXAA 4B32A 2BJWA 1OJLA 1UBGA 1AGPA 421PA 4ESVA 1ZM7A 1NI3A 1ZD1A 5CK5A 3ZH9B 2CCKA 2GXAA 4ASUA 4O2LA 3ZQ6A 5AUOB 2O8DA 2WZQA 1ODFA 3ICEA 3OZXA 4HUTA 2OFXA 1XZPA 3KJEA 3OFNA 1T91A 2XTMA 3M6AA 3BFXA 4ZKEA 3FYHA 1OH7A 5DIFA 1RYFA 2OCAA 2ZJYA 5CK4A 1U8AA 3M0EA 4HZIA 4NYMR 2ZSFA 3NWJA 3CH4B 1KSGA 4CRWB 5FPKA 4I1SA 3DHWC 5FI0B 2N42A 2C77A 1MRSA 4XWKA 4D0GA 4UNRA 3K70B 4ZIRB 4FWIB 3TUJC 1DPFA 2IYVA 3W9YA 3QXJA 2IXFA 1EG7A 2FEOA 1XCMA 4DC9A 4D2IA 1ZRHA 1E2LA 3QKRB 2EFDB 4MRPA 1PLKA 2ZUCA 2OG2A 2CVHA 3GJ7A 4DDUA 1WMSA 1ZNYA 3ADBA 5CYOA 4FMDF 3QKSB 3GLHA 3GJ3A 4YC7A 1P9WA 4XD7D 2RGNC 1TX4B 1OV4A 4HDOB 3GFTA 5EE5B 2WJHA 1L8QA 3I62A 4DJTA 2CL0X 4EFNA 2XB2A 2OZEA 3RANA 4C0JA 2QP3A 3NEJA 4PSVA 2VA8A 1Z6TA 4Q4JA 2BMJA 3EWAA 1W1WA 1T5IA 5EE1A 4F4JA 3UG6A 5BW8A 3QF4B 4YONB 1YU9A 3SS8A 1ZD9A 4DKXA 3CX7A 1VG1A 4LOAA 5B30A 2C9OA 2ZUBA 4X8OA 1G21E 1MRNA 1T0HB 5AJYA 1PLJA 2BDTA 3DOFA 3QUSA 4BFWA 4G5SA 4BRWA 2PT7A 2QAGC 3SZRA 1WBDA 3K9LA 2HLDD 1XEXA 3GJ0A 2ATXA 2WJGA 3WYAA 1TQDA 3PEYA 3KJHA 2QPTA 2P65A 1M7GA 3P27A 1UBCA 2YOHA 4DVGA 5FTNA 4QXAA 1YZQA 1QHGA 1GVNB 3G82C 4ZPXA 1N5LA 3MFYA 2NO7A 2QU8A 3SQXA 5ELXA 2ZRNA 2XXAB 1CKEA 2D2FA 5JJKA 3PJRA 3S1AA 4XWAA 1NN5A 1G9XA 3I73A 4PC1A 4NYIR 2B92A 1IN6A 2HT6A 4Z8YA 3TR0A 1GOTA 721PA 4BLQA 4Q48A 4PC2A 1Z0AA 5BWMA 3LQQA 4NCJA 3I8XA 3ICQB 3U3MA 3W6NA 3VQTA 1R0ZA 4D0LB 3HU3A 3FHCB 1YZLA 1ZMXA 5FBWB 5EP4A 3B1YA 3LVQE 1GL7A 1BMFD 1S1CA 2B7BA 2G3YA 5FFMA 4D25A 4XIGS 5JZVA 3PUVA 4B48A 4MRRA 4XVQA 1DE0A 2QRNA 2ZI9A 5EP2A 2I1VB 4LYJA 2EVWX 5G3ZA 2MMGA 3RSOA 3HU1A 5LPNA 4OQXA 2GKSA 5LD2C 2ZRFA 4FCTA 4EPVA 1U0HC 4Z54A 2AXPA 2IW3A 2XX3A 2IA5A 1UEIA 1N5JA 3AKEA 2ZM5A 2Q6TA 3CR7A 2QAGB 3TMKA 2FOLA 1E79A 1G4AE 5AUNB 4OK6A 4Y0VA 2ZYTX 3IIJA 3QVUA 2DFLA 4MKGA 1GSIA 1DAHA 1X8JA 3DPUA 1S3GA 2IYRA 4MGZR 1COWA 3NH6A 1XD2B 2H18A 2RKOA 4RZ2A 4ZI3A 1ZNWA 3HR8A 4LDJA 3SR0A 2VIIA 3SFZA 3TW4A 4NYJR 2CHGA 1OIWA 4PFSA 1UKZA 1RKBA 221PA 1XEXB 4FD2A 2BEKA 3SYNA 1FMLA 3L82B 3H84A 1XZQA 2NPIA 2GEUA 3CNLA 2WBLC 3CRRA 4XWOA 3R20A 4RKEA 1XPRA 3ADKA 4RVCA 5E7IA 5LB4A 2VHCA 1GFIA 2YWGA 5FBQB 3JVVA 4Q1DA 4ZCIA 4NH0A 6Q21A 1NIJA 1V43A 4RZUA 1ZC4A 3VR3A 3V4RA 2PMKA 2VBCA 3NDPA 1TAGA 2FG5A 1ZM3A 2W83A 3VU9A 4FMDB 4C0AC 4CDGA 4OQLA 2AFIE 3UWOA 2Z43A 2AN9A 4KXFB 1UM8A 2ZETA 5JEDA 4P4UA 4UNPA 1NRJB 2ZRKA 1EFUA 3L0SA 3BIFA 2IYZA 1VKJA 2A3RA 2VP6A 4PQFA 3T15A 4XSGA 4Q02A 1QBKC 3B1WA 2QNRA 4PO8A 3ECCA 4TMZA 2ZQ5A 1NVWQ 1T8TA 1P72A 4NYMQ 1OXVA 3DVLA 3E70C 1II8A 1E1QA 3L0OA 2BIFA 3RS5A 5LD2B 3DKVA 3BRWD 2FX3A 5SZHB 5TXGA 4AC9A 3THXA 2X8AA 2CDNA 3C41J 1XJ0A 3PUWA 4OQNA 5FBVB 2W0MA 4ZDIA 2ZRMA 4Q66C 2O8EB 1XXHE 2O8CB 2H16A 4CF7A 4MGKR 4UKDA 1AKEA 4Z8XA 5EE0A 4AIIA 1OH8A 4ZCMA 4DB2A 4YMUA 2B21A 5F9HA 3U44B 1KZ7B 2DFTA 1YZTA 1W4AA 1P2VA 1TUEA 2CNWD 4JLNA 4TMXA 4US0R 1K8RA 3TKLA 3OHMA 2H1LA 2QORA 5JS7A 1X8LA 4RCZA 4CW7A 3LLMA 1GDDA 4D81A 2KSQA 1X6VA 2XGJA 2DWPA 5DYGA 1N6PA 2CK3D 4EFMA 3AF4A 1Z6XA 1X86B 3D8BA 2DWOA 1H8HD 3LA6A 2IS1A 1Z0FA 1KJYA 2C96A 2XOKA 4HAWA 4HLUA 4KFTA 3UMRA 3ZIAA 1G4UR 2J0VA 4V0ME 5IK2A 3RC3A 4E5UA 3THYA 1E2KA 4TTPA 2AR7A 3K0EA 1BOFA 1QDEA 5EXTA 2CHVA 2JJ2D 2QL6A 2P67A 2X77A 2W6JA 2WWXA 4CT4B 3LX5A 2HXSA 4JIMA 1W4CA 3BJIC 4B6FA 2QI9C 3VR2A 3BB4A 4A15A 3NTUA 2QUZA 2VF7A 1CJTC 3EXAA 5FL7A 2A5DA 3IO5A 2FA9A 4W7SA 1MO6A 3IHWA 1IQPA 1SHKA 2D2EA 2DFNA 2WJJA 3BH6A 1CLUA 5BN3A 3RSLA 3SFVA 4I4LA 5AK0A 1KI1A 1KSJA 1XXHA 2IS4A 4N3NA 4OK5A 4AKGA 2OAQ1 1NF3A 2QSYA 3IBYA 1YVDA 2AWNA 4HAXA 4M21A 2V1UA 3CF2A 5EUQB 4URXR 2DB3A 1S9DA 3VX3A 3IPXA 5CITA 1HEIA 3EC2A 3UK6A 3CWQA 1HTWA 2AD1A 4IXNA 3B85A 3KFXA 3FOZA 5F98A 2YC4C 1UBEA 3QOFA 3FHTA 2NGRA 1RW4A 5FI1B 1Z22A 4N0EA 2CCGA 3MLEA 2CLSA 3THOA 3BOSA 1CJMA 3ZVNA 3X2SA 4NYIQ 3RRZA 4LJ6A 4IRUB 1N2CE 4JJZA 3SHWA 3LV8A 8OHMA 1E9BA 1S4QA 4QJ3A 1G8FA 2NO9A 2QRZA 1W5SA 3FMOB 4YQFA 1D9ZA 1VIYA 1Z47A 1MKYA 4QBHA 4QNRA 1CJKC 3NHBA 4UNSA 4LY6A 3V4FA 3L8YA 3LXRA 5B58C 3LH5A 5J4VA 4JBYA 2EW1A 2F6RA 5K8UA 2XZPA 3HPRA 3IILA 4BUJA 1D5CA 2RHMA 4IVQA 1DBSA 5BN4A 1QF9A 4U5XA 3VKGA 4GDFA 2IX3A 4PPFA 3W3ZB 2FGJA 4NHOA 2VHUA 1FW6A 1II9A 3K0FA 5IHPA 1W4RA 3BC1A 4M2LA 3WNDA 3ZGXA 4DB4A 3ZLJA 3CUEF 1XF9A 2J9RA 2IS2A 4RSGA 3PEVA 1KO5A 1GAJA 4JLPA 1KK3A 5KO2A 4IEEA 4B76A 1OXUA 1G3MA 2P5TB 3W90A 4FCWA 5L3QA 2PZFA 3CX8A 3T06B 4NYJQ 2KB0A 1IXSB 3T34A 4PX9A 3CF6R 1Z0KA 4A82A 4TLCA 2JIZD 2IUUA 3NDBB 1GIAA 4ON9A 4JLJA 3LRPA 4EJSA 4MYCA 3U4QA 4P33A 2XNDA 1SQ5A 1JXMA 4P32A 3GEIA 1P4SA 3HPQA 4P4SB 4QJ5A 1PLLA 4HEJA 4U02A 3RRNA 4HAYA 1BO6A 2A7QA 5BQ5A 4Z1MA 1KO8A 1JECA 1XRJA 4PO9A 2UZ3A 2YWFA 3NKVA 1XTIA 2WKQA 1XTKA 3FKSA 3REFA 4KU4A 2O8FB 3U3JA 3BH0A 3FMPB 1GZSA 1E9DA 5HZKA 1XBTA 1IOZA 1G8YA 2J41A 3TW8B 1AS0A 1IY0A 4PO1A 4BFVA 1FTSA 3D7MA 5G41A 4MGIR 2IHYA 2GBLC 1RZ3A 2W2TA 5KDDA 1R7RA 3ASYA 2AK3A 2F1RA 1E9CA 3KKMA 3WRYC 2AHOA 4TZ0A 2FU5C 3K53A 4GBMA 5EE3A 2FMXA 4K81B 1E9RA 3KUDA 1X3SA 1E2QA 1TF2A 3OE7A 5JJLA 1DADA 5KNDA 5KU1A 2Y8EA 1S1MA 3MRSA 2A9KA 1W0JA 3IBGA 4GOJA 5EQTA 3DDCA 3TUZC 5F9FA 4P0TA 1TQ4A 2UVQA 4U00A 2C04A 4Q9KA 1XP8A 4B3BA 4F92B 2CHQA 3ZD7A 1SZPA 3Q9LA 1KSFX 3KFVA 4LV5B 3ZVRA 5D3MA 4MRNA 2D74A 1SGWA 2GEDA 4DSOA 4V03A 4KYUA 1OB5A 2JLRA 4BWYA 1EESA 2CE7A 1LF5A 1OXSC 2J7PA 4C7OA 3WRXC 2IK8A 2YV5A 5H68A 1FP6A 1LS1A 2IEYA 1W4BA 4M53A 4LJ7A 1P62B 2ASEA 3PUYA 2ZYVX 4D4JA 3NVAA 4C2UA 4Q00A 3K0AA 3NH9A 4YDHB 4EJSB 4DDVA 1RRCA 3V9PA 1BH2A 1HE8B 1HY3A 4PPQA 3VNUA 5CIQA 5DN6A 5BN5A 2BMDA 3WP1B 4HLCA 1US8A 2Z6VA 5TDHA 3R9IA 2ZITA 3TQCA 1M2OB 1JPJA 2VRWA 3LY5A 1QVRA 2P2LA 2CJWA 1RYHA 2ZRAA 4KI0A 3UXMA 2CL7X 2O8BA 2RGGA 1G3QA 4M1WA 2HT1A 2BCGY 1L7VC 2EFGA 5HZHA 3GJ6A 3QG1A 4FINA 1R8SA 2V1XA 4S2EA 4JLBA 5JECA 2GETA 4Q47A 4AK9A 3ZZTA 2WTUA 1DAIA 4R98A 2RGAA 3NC0C 5JCZA 2WPDA 4QG7A 2R2AA 3KB1A 3ZVLA 3A1VA 1R4AA 1SVSA 2OFWA 4RZXA 2ZPTX 1EXMA 2WKRA 4IHQA 3PEWA 3W6PA 4DUGA 4F4CA 5J5CA 4DCSA 2IWRA 3RS4A 1ZBDA 2WIBA 4PSKA 1OW3B 1RRGA 1SXJE 4BFZA 5CIWA 2P0EA 1W46A 5TVKA 3GLIB 4RY2A 4PHHA 4DEXA 4R71A 2PX0A 3KB2A 3BH7A 2GJ8A 2FV8A 1M7BA 2D3WA 4LSGA 1SULA 1PVOA 1NVXQ 4BLRA 1Z28A 1XTQA 3KKOA 3A4MA 2V4ZA 1XCGB 3WMEA 4MGYR 4P31A 4A0FA 2ATVA 4MUAA 4B2PA 4YMVA 4NPHA 2JLUA 1Q57A 2WHXA 3EIEA 4KHZA 2QM7A 1XPUA 4Q1CA 4Q1EA 1EFRA 4AYTA 1KDTA 1H8EA 4PC3A 4LCBA 2WWFA 1KI6B 2QMOA 5HE8A 3K09C 3C16C 4FXPA 1PV4A 2ZI3A 3K9HA 5FUYA 2HJVA 3GEEA 4D4KA 2VPPA 4Q18A 2FFHA 2GTPA 1XMIA 3PVSA 1EK0A 4YMTA 2REOA 4A2PA 4B2LA 2C2HA 2WOJA 1W0KD 1RJ9B 2WJYA 2ZROA 4BEBA 1NSTA 2IF0A 3UKDA 1Q20A 2A5GA 1IN5A 1XDBA 2FSFA 2VO1A 3RS3A 1E4YA 4I81A 4TL6A 3HDTA 4JT4A 3JZAA 2CJWB 1F2UA 1F5NA 2F43B 2OFOA 2V7QD 3K1JA 4CEJA 1SXJA 3IDQA 4A9AA 2GZAA 2O8BB 2C9YA 5FR2A 1EFCA 2ZRIA 1DVRA 4V0OA 2BJVA 5DH9A 1FQKA 3B60A 4JLKA 3X1YA 1U8ZA 4W5JA 3UIEA 4BECA 5JSZB 3AVYA 5C18A 4F7WA 1QHHA 2BV3A 4PXAA 2PMDA 2EFHB 2PCLA 2ZVQX 4KVAA 1J70A 2HCJB 1GNQA 1T8UA 1UKEA 2LCFA 2XTZA 3OEEA 1GM5A 3G0HA 1JEEA 3WMFA 2R6GA 1CR2A 3KKNA 1D2NA 4OI2A 1KDPA 3T1QA 1G19A 1TL7C 4PPNA 3KQKA 2ZR7A 5HTKA 1NJFA 3MUFA 4L4UA 1NMYA 4JKYA 1GL9B 2QY9A 3WMGA 1ZCAA 4TSFD 1SVLA 5BXQC 4ACAA 4PTLA 4Q4HB 2FFAA 3SOPA 2JCSA 1AZTA 2CCJA 4A0RA 1G291 1FPMA 3CKLA 4PHTA 3EPJA 3Q3JB 5LBIA 4Q7LA 2YYZA 4CEIB 2JLZA 3N2EA 2BVNA 2DPXA 4KYIB 3UATA 4C0HA 4EPTA 5JS8A 1FMJA 3PENA 4A6XA 4ASUD 3EARA 4MUBA 4KV9A 1N5IA 3MSXA 1RPZA 2VTKA 1BYUA 3KZ1E 4EDHA 1F2TB 3L8ZA 3OFND 5JLJA 4Q1BA 4ITRC 3H4MA
chains in the Genus database with same CATH superfamily
4MKIA 3G2MA 2CMKA 3JQBC 1V11A 1W8DA 4QUDA 4AMZA 1M6WA 1R0BA 1SVNA 2FG7C 3DL7A 3VSDA 3AUXA 3P9KA 4YRBA 5JS1A 3GLUA 1HQKA 3L7BA 5JSQA 1TVKA 1E0AA 5JTUA 4G1EB 4B87A 2PXAA 3A2NA 2DFPA 2VPIA 1INLA 1WTCA 3NHUA 2CFRA 4JZKA 4Q7KA 3KQMA 3F8SA 4E4RA 2RH5A 1BXGB 2X1VA 3CINA 3ISVA 4K8OA 5FOXA 2PU5A 3EPHA 1T0PA 3LVBA 3A0UA 1EFVB 1CQIA 1ZISA 2MYNA 1KQGA 4MVJP 1AN0A 3B6ZA 3KT0A 4TV8F 3MRXA 3OSZA 2W2KB 4XR9A 5FF9A 2R1UA 3KTOA 3O91A 2FSGA 2J9ZB 3WLMA 1B23P 2E6KA 2IZ0A 1H69A 1TEXA 4JJEA 3UCXA 4UC0A 1DAFA 1QHNA 1CPYA 1N6NA 1HTBA 2VQ6A 3DMRA 2P6UA 3CZ4A 1FP4B 2NSDA 2BGKA 1JZQA 4OQPA 4RMGA 5FQOA 1SVUA 4ALMA 3DWEX 4AAYA 4EHLA 5JANA 1ZY2A 1FQJA 4A2CA 3SQDA 4AY2A 4MYDA 1BX1A 4HPXB 1P7YA 1U2PA 2J6HA 3KQYA 2XUGA 1EKXA 2WMOB 5EP1A 1ISMA 1YZKA 2WPNA 3PNMA 1FLVA 4YIHA 1B26A 2JFWA 3THWB 1THZA 1WB6A 1A9QA 2Y6UA 5JZOA 1TZMA 3QUCA 1KARA 4Y2JA 2EZTA 1GTVA 2QBYA 4V1CI 3TCNA 4A0GA 4FR2A 2HMTA 3I5UA 3L0PA 4C07A 4CIBA 3V1NA 1U6IA 3MQFA 3ZWVA 5H80A 2P30A 2DFKB 3ABZA 1WSBA 5HJ7A 5I5EA 1KS9A 1F3OA 4DSTA 3QXSA 1JG3A 2WKPA 3ZIUA 4BEVA 1M5RA 4X64B 2EP5A 4JD5A 5CH3A 4O1HA 1LY1A 2IZ1A 3F5SA 3FKJA 3IPRA 4CCYA 5TR9A 1PYDA 3AHIA 4H7DA 1EFPA 2ZYIA 3UA4A 2Z09A 1D04A 3V32A 1I10A 2XMBA 2ZAMA 4GF5A 1HE2A 1RVDA 1R8JA 1VC2A 3KJIA 3ZUPA 5B2FA 1U7XA 5AW8A 3OOYA 3QMMA 3FIUA 2VSQA 1LLQA 5U4QA 1NQOA 5JAPA 1PR5A 5GGXA 2FI1A 3AESA 2RBGA 3SG0A 5F35A 5BNWA 1T9DA 1YHZA 4ALIA 2XGSA 5AI0A 1CJVC 1MABA 1M8FA 4N7MA 5AO9A 1R6DA 1DG3A 4G5OA 5BYJA 1ECJA 2YIDA 1WXXA 3DMNA 1WL8A 2E82A 4IY1A 4B82A 3GWGA 4AZWA 5BUSA 3RUFA 2Q9AA 4F5WA 1CUXA 4DIBA 1IWOA 5E9JA 3R09A 1XPJA 1L5YA 1YL6A 1ECFA 3H17A 4N6OA 5KWJA 2EGHA 1KZHA 4EPRA 1P5JA 5K03A 5JDIA 5AW7A 3CZPA 3E1GA 3R7WA 4P3YA 1Y1LA 4I50A 5KYTA 4AKEA 4OREX 3R7DA 1TYZA 1R4NB 4KP7A 2VH5R 1V6CA 2HC9A 2J46A 2G5GX 4KXXA 3S40A 4FFDA 3GUUA 3G89A 4G0NA 5AJXA 3R7NA 2PXXA 1DAMA 1DC3A 1GTG1 1SHLA 3H42B 1W29A 5CXXA 1C3EA 2QG6A 3F97A 3PSHA 4TRMA 1V4BA 2K6GA 4FU0A 1J5PA 1X9IA 2CLFB 4KKXB 3TRFA 3OPYB 3EK2A 3TPFA 3MTEA 2PZ8A 4QBGB 5BOSB 2XHEA 5A4FS 4EI8A 1PHRA 2XLCA 4JLOA 4Q82A 4JI1B 3U6BA 4FWTA 4D26A 4Z0TA 2CV1A 4ZOLB 4CDMA 5C5CA 1XALA 1KMQA 2NO4A 3B8EA 3PCTA 4GYWA 3STHA 4OUDB 5DNUA 4MQ6A 5JXGA 2WYWA 4MS4B 3L7NA 2M9MA 1UXGA 3OWOA 2OHIA 2VBFA 3MG9A 1IZ8A 1E79D 3DW1X 4UCWA 1VMKA 4AQ7A 4UUOA 3UGJA 3UF0A 3P9PA 3OMWA 3S7TA 3LLUA 1ISFA 3PDHA 2FMIA 1XZMA 4M37A 2I4OA 4LSWA 4XFDA 5BR8B 1COWD 2KLBA 3DE7X 3H2IA 4PG4A 5IG2A 2P6RA 3LC1O 3B3QA 4B6EA 1E6MA 1K0FA 2O0KA 1KTVA 1JGTA 1P44A 3EE6A 3HHEA 3I9JA 3NEPX 4FR0A 1NUAA 4GPAA 1PR2A 2AEEA 2JBWA 3VSAA 2WD7A 3C5WP 3GA0A 4L6IA 1EK1A 1YQQA 3PE4A 2O6LA 3HZRA 4PM4A 3ZTYA 4WKCA 4D57A 2F1IA 4ZAVA 2DQYA 5EHQA 2BEVA 3JQ9C 1OIXA 2B69A 4MJ3A 1RAIA 5LLTA 2IXGA 2E9SA 3SC3A 1W34A 4FK8A 2AL7A 5A4KA 4X90A 3VUEA 1AC5A 3E2PA 3C3WA 2D1YA 1UMKA 4XIJA 1D9XA 4MR8B 2Z2JA 1HZZC 1I6LA 1VE9A 2O50A 4DBVO 4KN6A 4CI9A 4G0YA 3QW2A 4FS3A 1GGVA 3D6UA 1HG1A 4R2HA 1AXEA 1XZJA 2C5BA 1IHPA 3PI7A 4UVGA 2A88A 2ZW9A 1OZGA 4KPGA 4WLOA 4CR7A 3ADCA 1JR3A 1G8HA 4K6GA 5EJ6A 2OQRA 5IKOA 3TPCA 5EHZA 1VYTA 1K3UB 3JWJA 3IR5A 1Z2AA 2BHLA 4FPXA 2WJPA 2IZZA 2WF8A 4R4JA 3TM4A 2ZTHA 1UC4B 1BRTA 4BP1A 1NLUA 3OT5A 2WWTA 1CVIA 2X42A 1CULC 3KZCA 5DNWA 4R2JA 3VO9A 1E3DA 5D5PA 2CLIB 4NVRA 3O2SB 3UMJA 3W2IA 2BGIA 2DYKA 3COJA 3LPDA 3CISA 3NGMA 3UNXA 4F6RA 1XP5A 1ORWA 3DBIA 3BD6A 2R6FA 4FDVA 4K9PA 4O4LB 2C5LA 1N6OA 1VGVA 1JDNA 1G21B 2W98A 3D0OA 1AQJA 1BN7A 5J4YA 4CQMD 1FP2A 1ZJ6A 4B3FX 1MO5A 1REQB 1VMAA 2VVTA 4DQ0A 2H4JA 3AQIA 4GM1A 1LLUA 1IQRA 3JY6A 2PQ6A 4ZT4A 2PHZA 4P86A 2QYOA 4QZVA 5HM8A 2OLKA 3UEOA 3F96A 2X4LA 3WICA 1ZA1A 3E1SA 3RVRA 4ZJUA 2FLKA 1ZLXA 1RXIA 3LBIA 3CPJB 3RF6A 2NXJA 5AI9A 1TM5E 2IHBA 4MEAA 5TMBA 3EJ6A 2RH9B 4JQCA 3JQFA 4RQBA 1RRPA 1TC1A 2CJFA 3WMXA 3UPUA 1P31A 3HDGA 3TSYA 2ZFUA 3EGXB 5FUWA 5IYZF 2Z9CA 3DP9A 2J0UA 1XAGA 4HDRA 5AT1A 5HFJA 4L4XA 2N1BA 1GGFA 2CUKA 3AETB 1JHVA 1MORA 3RJ9A 4EY7A 3NBYC 2FMFA 2W6JD 4K40A 1M6VB 5CLLA 3IV9A 1Q7EA 1YBAA 4DLNA 4FYIA 3N53A 4NBLA 4OHVA 1H05A 4C4ZA 3S1SA 1F60A 4RPHA 1DOZA 2R5WA 5HG0A 3MWYW 1ICIA 4BPRA 1PUIA 2E3JA 4OO3A 3V1MA 2GN2A 5AM0A 4DIOA 1K7XB 2JLXA 2H1IA 1CY2A 3ZHQA 1D1PA 2GPJA 4OP3A 1RBMA 3CCBA 3SC2B 1J25A 3BE6A 3PF9A 5HDQA 2ETVA 3AUFA 4PIVA 5JNWA 1FYVA 4LWZA 2JF0A 2HLNA 4FFMA 3TBKA 5FOQA 4KFUA 1QK5A 2L18A 3HVJA 3MJTA 2C4TA 2GEVA 2I2XB 3NAZA 3QWFA 2GM4A 1JLLB 3UCFA 4WT7A 1U1DA 1TT7A 3URMA 2YQ5A 3GAAA 4BBZA 1EI9A 2OSBA 4IKPA 2FLVA 2GUWA 4P53A 3HWWA 4R9SA 2PX5A 1ZQ9A 2JIOA 1KNQA 2E4ZA 3KJFA 1QKKA 5KYKA 4LHWA 1SBCA 2ZU0C 1JTFA 2G25A 2NACA 5LZ8A 1OKKA 4W1PA 1CRWG 2WHEA 2DVMA 2REBA 4RMNA 3HB1A 13PKA 1N2OA 1QIFA 3DO6A 3HB9A 4YJHA 4XWYA 3H9JA 2O7SA 3LU1A 3GFPA 2WWWA 3NM4A 4KIGA 1SR8A 3S68A 3AM5A 1U81A 2II6A 2C7BA 4RMJA 2WVHA 2XJ4A 2HA0A 2OBMA 3OFJA 3SCZA 3V6MA 3GLFA 4B34A 1L3IA 3U60B 3E9CA 1YS4A 2I0FA 3D54D 1WLYA 2WFZA 4EDFA 5FWAA 4ZOQI 2WQ7A 4G5QA 4HDCA 4UM9D 4MVJG 1Q15A 1R5OA 5CHYA 1I3KA 2PGOA 3VI4B 2PUDA 1JHDA 2FX2A 4D42A 2I7DA 1QWOA 4W8OA 2YBDA 5K3SA 3ZY3A 1WW2A 2IHKA 1G63A 1YB6A 2OCPA 2QZJA 3DAGA 4V24A 4GG1A 3I9KA 1I3NA 3EHDA 3OESA 3QWAA 2IH5A 2DWUA 3URKA 1ISPA 4Q9JA 1SO8A 2WFLB 3H5IA 1JXQA 1QAOA 4H9GA 2BTQB 5D85A 2FZCA 2O2JA 2WG2A 4G5XA 4WJKB 4AJHA 5JAOA 4MV8A 2SCUA 1Z75A 3E8SA 1V9CA 1C9MA 2A30A 4KQXA 5HZKA 2O52A 2OC9A 2A9PA 4GSKA 4HYEA 2Y27A 2HHLA 4ZARA 3JQAB 1Z63A 3L7OA 3MHPA 2OMKA 3RIXA 2H2AA 5KTYA 5K0NA 4PNPA 4M1KA 5F5LA 3E22A 2OORA 1NYTA 1I3LA 1RLMA 3OTIA 4NBVA 2ZR9A 3T0GA 2H17A 5A9TA 3R8CA 2FN4A 1GG8A 1DBWA 1H2BA 3H0EA 1HDGO 2FFQA 1YUBA 3VR5A 1PTJA 1YWGO 1I5OA 3FAZA 1TTPB 1GTJ1 1ZJ5A 2WFAA 3GN2A 3QJYA 5T4BA 1A7AA 2HNAA 3IEUA 3M1IA 2Y4NA 4YACA 5LC1A 1JYFA 1L4HA 4HH4A 2P91A 3NBZC 4A1FA 5LXTB 2WWGA 2A35A 1EUCA 3VYWA 4EF5A 1G6OA 3EUWA 5IZCA 1FBTA 4LV6A 3HCPA 5GM2A 2R751 1EM8B 2V6IA 3OFVA 4D8WA 4IUBS 4MUXA 4HAZA 2YWEA 5L3SA 3IDZA 1PGQA 3EVGA 5E6RA 2PGLA 2VYVD 1M74A 3D8TA 4JR1A 4GMKA 3VM6A 2ZDGA 1MAUA 4L4RA 2EU8A 3Q5EA 3B1XA 3MD0A 3TLGB 3A1DA 3R3SA 3BXZA 4Z1MD 1JIIA 3VTFA 3BZBA 2IVFA 2FE1A 4WA8A 2JVIA 2ZWIA 3B13B 2PN1A 3FKSD 1AKQA 4FYMA 4EFLA 4IX9A 1D4FA 1GPH1 4O8CA 4XGKA 5B36A 2VBIA 2ZE8A 4N9QA 1PJRA 4EJSC 2I33A 4DUPA 1EJ0A 2FWAA 3DOHA 5AFSA 1JEDA 1OBFO 2GLTA 3IULA 4CNQA 2CFCA 4UHKA 9LDBA 1FDTA 4HS4A 1OYOA 2DJ5A 3RC7A 4NENA 3I6BA 4QULA 3PPWA 3P94A 3OQOA 2IUYA 1HO3A 2V9ZA 4RNDB 3FUVA 5TF4A 2O7RA 3G2JA 3ROQA 1YC2A 1NBMA 3FYCA 3ITKA 4E5YA 5DM60 1I94B 2JH9A 3IR7A 1J0XO 2CWWA 2W8BA 1ZRNA 3ZYZA 1O58A 1U7WA 1Q44A 1QGED 3QFFA 3GFVA 2VLBA 4G0PA 2FQXA 1FF9A 1GEEA 2E4VA 4OQEA 3WRYA 2QVGA 4US2R 4DNXA 4DA4A 1OH6A 4V0NA 1RKQA 4REMA 4E30A 1HE3A 1T9AA 2GYWA 2WSSA 1DFHA 5GADl 1MN6A 2A9QA 5TB5A 1CRPA 2V3VA 3IUBA 5KNCA 1D6MA 1BS2A 1LSUA 5BSMA 4DSAA 3D8UA 1Z62A 1GAEO 1XZAA 3P9RA 4MIKA 5CYFA 3GDOA 3UENA 3K0FB 2VDWA 3H2JA 4KITB 1P0IA 3DPIA 4ER7A 2MSCB 4D4LA 2Q62A 5DW3A 3L8MA 3SBDA 2ZYDA 5K3EA 1QGYA 1R64A 2JH8A 3B6MA 3EPLA 5KYYA 1OY1A 4KCGA 1JG1A 3CYFA 2VF8A 3GJ4A 1RT9A 3MTBA 1XQXA 2N47A 5T8KC 1CZRA 1EINA 4RVOA 5L3QB 3PVZA 1NLFA 1VHLA 5ELMA 1ZVMA 2GAOA 5CYGA 3DKRA 3S2YA 1JDTA 1JDBB 1SUBA 1YS6A 3LW7A 1RABA 2Z2KA 1VPTA 3OM0A 3CNOA 3D31A 4J0FA 4RSHA 5JDCC 3A36A 4XX0B 4KKVA 3G2LA 3G5AA 4HUQA 2PSDA 2WT9A 3FRHA 3K4QA 4K9KA 2NZUG 5AJWA 4ZEXA 4PG8A 4WBSA 2B6NA 5DN6D 1GPNA 2D0PB 3U4QB 5G0WA 1N5MA 4L74A 4LRWA 2E4XA 2OHOA 3ETGA 4MCJA 4RFVA 2NUAA 4WA7A 5KJ1A 2ZTMA 2Q46A 4I14A 4MPTA 4MYUA 1RLUA 3DTTA 4MH0R 3DUFA 2H11A 3NOVA 2FPPB 4GOMD 1TJ3A 1VYUA 4YGYA 3CT4A 3BXPA 3FR7A 4XWGA 1V1MA 3GCDA 5GIPE 1WMEA 3GLGE 3QX8A 2QLNA 5SYMA 3BRQA 2CEAA 3BIXA 1RRVA 3TDNA 3BXXA 2WE7A 3JQGB 2NLOA 2CMDA 2VP3A 4N7BA 5CIYA 3DZKA 4N1AA 4DR2B 4CZ2A 1LPNA 1YL7A 3PXGA 1Y5NA 4EUSA 4MS1B 5A6VA 1QGUB 5M7EA 1NIPA 3FGOA 2WPDD 3A05A 4UW9A 1LQUA 2QL5A 5CGQB 2HHHB 5B57C 1V4NA 2WM8A 3ZV7A 3VJRA 2DPYA 4L9SA 3GWZA 1F8GA 3IPAA 1BIFA 1E7WA 3E9QA 1W94A 1SVKA 3IA2A 3I9V6 1RYMA 3MMZA 4KW7A 4WV3A 4E5SA 4DUGD 5H1YA 1L4FA 3N7AA 3PGMA 3R3UA 5L3RA 1AGRA 2QVYX 1FNDA 3L43A 3LT5A 3C3JA 3IV6A 3DCJA 4F38A 1P2BA 3X1JA 3KCQA 4AXBA 1J4AA 1NOJA 2BBWA 1T9ZA 1I14A 4QYIA 2GR9A 2QRMA 2YINC 1W5EA 3WNBA 1OFTA 4C7MA 4GW3A 2KHZA 1EDDA 4XYLA 1U90A 3MT0A 2P8SA 3NAQA 3PHHA 4ROTA 3WLRA 1JG2A 3LGXA 4QLAA 3TOVA 3X1MA 2G7ZA 4PZPA 1EWYA 1T6XA 2CXHA 1T8SA 4AS3A 4FFVA 4M8NE 5IFLA 3KXDA 1QQ7A 3TSWA 3NBFA 2ZATA 3X1WA 4RD3A 3ZD9A 3W5CA 4REQA 3DVSX 2XDQB 3L6EA 4OK3A 3JD4A 4BRZA 1XMVA 1N0WA 3A3NA 4ZALA 2GK6A 5GVSA 5J2TB 2QYTA 2LXNA 3JYPA 2V6BA 4IYJA 4C7OB 5LDHA 2JEOA 3K2IA 1YBMA 2X2EA 3EQ2A 5BSKA 3RSFA 4URWR 2ZTUA 2DR2A 1H0HA 3QY9A 1SG6A 4G8CA 3OY2A 2VDUE 3EEFA 3I32A 1KEKA 1N78A 4U8HA 1GKIA 4JS0A 5ICEA 3ANXA 3N2GB 3N05A 1YVRA 4KAAA 1ZM2A 4R1MA 2A33A 2ZS8A 3ZHVA 4UQLA 3LCRA 3M5WA 4AJPA 1P9NA 3ZGVA 3FYSA 3K0AB 4EF4A 4JX8A 3L7AA 4WOJA 3GGOA 4AUEA 2ZJFA 1FDSA 3Q0EA 1J5XA 3EDMA 3LQYA 1EFHA 3F98A 3P71T 1SIWA 3PHJA 4IW3B 4MITA 2C5FA 5LP6F 4NDNE 3T9FA 1JU3A 4FHZA 4E5PA 3FYUB 4TUYB 2JKVA 3ZXUB 5H8WA 3BWBA 1AK2A 2VFAA 3R41A 4BLTA 3OUUA 1SB8A 3INGA 1W48A 3OETA 1BEEA 1FTNA 1DTWB 2PTHA 3B70A 2C1EA 4G84A 3TO5A 1E4EA 4YDRA 1E92A 2ZRJA 4V3CA 2YXDA 2C7VA 2OXTA 4Q19A 3ZWQA 1I7PA 2Q6OA 2GESA 2Z95A 5THKA 4QNNA 1OHHA 5CA0B 5IJ0B 1KYYA 3OF5A 5JS2A 5T7BA 3RGGA 2EGUA 2HCFA 3ANSA 1OI3A 2HSZA 1WETA 1VZ3A 1CYEA 3BZWA 2CN1A 2QTVB 1PSDA 3OEED 4KO8A 3N70A 2GPSA 4BTLA 4PCVA 2ZCJA 3RAEC 4A36A 3H11B 1GILA 4G07A 4AU1A 2XMRA 4BXOA 3VDQA 3IKLA 3WK5A 1P1HA 3A9VA 2GK3A 4JEIA 5HUHA 5T41A 2PXHA 1G5IA 3RVLA 5KHOC 4QE3A 3ISJA 4NFLA 4B8WA 2RH8A 4WQMA 4L6CA 4V3BA 4WN9A 1NQTA 3NVMB 2W6IA 4HDNB 1RPNA 3OOHA 5HDBB 5JMPA 3K6SB 1E7YA 5FOSA 2ZUEA 4MROA 3V34A 4RA6B 5UKDA 4ERNA 5FP0A 1L7MA 4Q37A 4E7PA 3RO7A 5JAIA 2WZBA 1FSFA 4AJOA 3OHSX 5AW2A 1DELA 3G2NA 4AG5A 2J5BA 2P2CA 3WLLA 3QKRA 2UUOA 1W1IA 1Z08A 4NZMA 1Q0TA 1M1NB 3K3PA 5I47A 2ZJZA 3ETEA 5DVZA 5E3HA 1UPXA 4IIFA 3F2IA 2GZMA 4ZT6A 4P92A 3ODGA 4NZ9A 1YB2A 1QH8A 1CXZA 2HWUA 2H6EA 3I1FA 5TX7A 4CQJA 1E6UA 2IU4A 1N9KA 4NPCA 2FPGB 1SQGA 2WF9A 2VJDA 2IYLD 4LV8B 5F9MA 4LJ9A 5DCYA 2FUG1 4BPBA 3AUKA 3C43A 1TEHA 1XRLA 1M1ZA 4WEOA 5DEIA 1PN3A 5ANRB 2AKAB 3GA5A 5EZSA 3X1DA 3VDMA 5CYPA 1T4MA 1EGAA 1JG7A 2WU0A 4L4SA 1P2SA 3LG2A 3OE4A 1BE1A 2C92A 2BGRA 4JXKA 5JD6A 1LB1B 3V8PA 1U4NA 1LS6A 2I3AA 3TTXA 3OT1B 4KLNA 1WQ3A 4BB6A 5I7RA 3GLHE 3K0SA 4MJ7A 2F1KA 4YRLA 1U0SY 4A3SA 3GJSA 2OFPA 4P5DA 3P4UA 4D9GA 4MWGA 4UM7A 2R96A 1T35A 4CMCA 5BV1A 1BD3A 1VHQA 4A10A 3OAAA 5JH7F 3TZ6A 2R7LA 3GJXC 4J2OA 4S1VA 5C1OA 2JLQA 1RI4A 1DKMA 1KQ3A 1QFYA 2GA8A 1DARA 1O9BA 5HYVA 1EXNA 5D5HA 3JQ8B 1RM4A 3N0WA 5G3YA 3JYHA 2NV6A 1SXJB 2QHXA 3U49A 1KETA 2H7VA 3C85A 4O4HA 3W9SA 4DV3B 5JV5A 2D06A 3G0DA 2HD4A 2Z8YM 1CTQA 3ITEA 5DBHX 3NBUA 1YB1A 3B6JA 4YRIA 3D2LA 4BE7B 2YV1A 4QQKA 3RYFA 3G0OA 1CR0A 3R3HA 1KZYC 1VJ1A 4BZWA 4V1CB 1DJMA 1SKYB 4DA7A 4EG1A 4R1SA 1DT3A 4BO6A 2XXAA 3I6MA 4NMXB 4NFYA 2JLCA 3ZWDA 2GM9A 4PG6A 3CW2A 4KE8A 4PN7A 3F1LA 1ZICA 3OG9A 4POAA 2M6SA 2SBTA 3P32A 4EA7A 2EYUA 3I37X 4EYOA 1EVIA 4KYVA 2RGNA 3LQKA 3SJAA 3FKQA 4P54A 4FUTA 1VBKA 2O59A 4YYZA 2F8LA 3JVEA 3MB5A 3V7FA 1BRMA 1P91A 3IOMA 1Q22A 1XRMA 4Q6BA 5IF3A 5JNTA 2ZULA 4J49A 4YPVA 4F1WA 2Z3VA 3M4XA 1HA3A 3B1ZA 3DNFA 4TRRA 4LF5B 5HWSA 3EG9B 4RHXA 3CLUD 5AM5A 3VPAA 1CJBA 1XN1A 3L4EA 1DOAA 4DNPA 4LHSA 2ZYAA 1Y8AA 1U0NA 3PTLA 5EJ9A 3EVAA 1QIDA 1KAOA 3H1PA 3NTLA 5KKNB 1DKUA 3RU2A 1CQXA 2J5XA 4J0GA 4XD7A 5IEBA 5M5BA 3EPKA 3DLTA 1YRAA 4HWTA 3RARA 1TVCA 1PNVA 3UN1A 4OPMA 4IOLA 3WJ2A 1V3TA 1M10A 1NW8A 1G17A 3IMFA 1DJPA 4BWVA 3CKYA 3D2AA 5F2OA 3LRXA 5IWCA 4RK0A 1E61A 1P5FA 4Y6SA 2PVPA 3GAMA 1H0SA 3O5AA 4UHFA 2BFNA 3CLUC 3DVAB 4FN4A 2BY4A 4JP8A 4ND7A 5DEOA 1VDMA 3AI3A 1OV6A 4N7RA 2NVOA 1A5ZA 1ITZA 2HADA 1C9NA 2Z1MA 3SX2A 4FJ2A 2JCYA 3S2SA 3VH4A 1PWYE 3FCAA 2WM3A 3U2QA 3HJTA 3D3NA 1S2LA 4FZ3A 1ZMRA 4KODA 3VX4A 2J48A 3FNQA 3G1TA 5HILA 2YMPA 3F4BA 1K68A 2A1UB 2QW8A 3F3YA 4I4TF 3UHJA 2CLHB 4NL4H 1MO3A 4JLAA 1P1BA 4EHIA 3IMGA 3O31A 4MARA 2HLDA 4PAMA 3V33A 4OTZA 3GUVA 2BZSA 3MAJA 4EITA 3AEKA 4POOA 2FW7A 1JSLA 2KM1A 2QZ9A 2Z30A 1HDEA 4KXQA 5E6UA 3WB2A 2QENA 5JDIC 3EZYA 4L5IA 1C1XB 4JBIA 5DGIA 2VI5A 3ZBQA 3GRUA 4OJYA 2Q3HA 4XTCS 1Q0UA 4LYHA 4HQNA 3O7MA 4TL7A 4Y2PA 1SUDA 3CVXA 1ZD5A 4K26A 5DK4A 2YXNA 3QKIA 1P7ZA 1NUSA 2XF2A 1E2HA 3OKAA 2YOFA 4L9RA 2JEYA 2SKEA 3IQXA 4LYFA 2RI6A 4A23A 3DFFA 4G1MB 2HRBA 1W93A 4WXYB 4Y6RA 4BQSA 1Z07A 5SYNA 1G7RA 3AIOA 3T3DA 2MHCA 3CBGA 4L9WA 3FRJA 3I2GA 2J9XB 1Z7WA 2C9CA 4I2NA 5DLYA 3MCZA 5L45A 4DQKA 1PZEA 1XIVA 1DCMA 2AOXA 2WHYA 2QX8A 4KQHA 2CFOA 4PSAA 3PGXA 4HH1A 3TK1A 9ATCA 1EZ4A 3NWBA 3Q8XB 3LK7A 3FB1A 1W52X 3LX8A 3AY0A 3P9QA 4IIDA 4YLYA 3B52X 1CE8B 4BEJA 1PQPA 1MVLA 2PLRA 4RKFA 4Z7QB 2ZQYA 4WASA 1N4AA 2VEDA 1E1DA 1G7SA 2FVYA 1YGPA 3M3PA 5JEEA 1VE1A 3BPSA 1EHYA 3EIWA 3BWMA 2Q4TA 1NI4A 1XMJA 3DNMA 4NCNA 1EX6A 1P2TA 4S0ZA 2EFJA 3VYTB 3GEDA 2Q1UA 4OHFA 2YKGA 4KN9S 4MUGA 2B30A 1BCSB 1YR6A 4E11A 5ALYA 5JRJA 4IVNA 5HIKA 4PZAA 5HRUA 1N5OX 2VP4A 2C42A 4JVSB 1UXHA 1UP7A 1J5EB 3ANTA 3S44A 3AHJA 4G8BA 4BGEA 4FN5A 4I4NA 1NN0A 4GZ6A 1JR3D 4KXVA 5EIBD 5TNXA 2MSWA 3SKVA 3SHTA 1YCFA 3QVJA 3B5JA 3WQSB 4N5MA 4LSZA 4YX9A 4GOND 1QRSA 5JNRA 5K6AA 4JKIA 3E23A 4H3KB 1JR2A 4ZV9A 4JXZA 1JJVA 4P3OA 4U5QA 2OV6A 3ROKA 4M7PA 3RR2A 5M2QA 3ONEA 2NUTA 3MCUA 1WNTA 3KG2A 3TM5A 4R9NA 1VMEA 2FMUA 4QJIA 1KI8A 1NJ8A 2MINB 2W6NA 3TKYA 1DMSA 2HHCA 1ODCA 3EAFA 3SZOA 3CGGA 5DBIA 3VTKA 2IU6A 2W48A 2ZJ1A 4BLPA 4DGQA 1ZJWA 4I9GA 2XZOA 5LYJF 4BNGA 2IT1A 3HP1A 3QVKA 4GLOA 5EIBC 3BS4A 3SC4A 4C04A 1L2TA 1QRDA 3D3EA 1GT6A 2Y1LA 5LXTF 4ZI2A 2BEUA 3OZ7A 1FMFA 5AKIA 1HYGA 1MU0A 1OXXK 2VSFA 5DGDA 5JAQA 4X20B 3ZCPA 5B3KA 1A9RA 2J9FA 2QM0A 5I4KA 1UDXA 3U40A 4AYWA 3EHEA 2BDEA 4GSYA 5DX8A 3EBLA 3ZDBA 3GLVA 3AB8A 3K5PA 4H4DA 4K0RA 2FDCA 1KRHA 1GNLA 2ST1A 3PHIA 4E1AA 1JFRA 3R0QA 2P62A 4M1MA 2Q1XA 2ZJBA 4GR4A 3GZNB 1EX1A 1RYEA 3A1EA 3F6CA 4MIYA 4OHWA 1W96A 3DHVA 3B48A 4MQMA 4JI5B 1T1IA 4CMEA 1S02A 3ZN2A 3U3RA 5H70A 1VJCA 4GX5A 1UFKA 3PKIA 5TV2A 1R3UA 3ET4A 2C94A 1G16A 1I2ZA 1NXSA 2QT1A 2OXCA 2LTAA 1I8TA 3IE2A 3F2VA 4MWCA 2JI8A 4KQFA 1B1AA 2ANBA 4ZGGA 2IBSA 1APBA 4YMSA 3R8XA 3L84A 3CW8X 1NG9A 2DWCA 3JQFC 4MKRA 3DBHB 1HUQA 3BKXA 4IDQA 1H5QA 4GRAA 4H6VA 4FGJA 2R25B 1PFQA 2QN9A 4Y67A 3TRKA 5LMCA 4N03A 1MQAA 3IR6A 4O1MA 1FRVA 3TCKA 2IEZA 3D4IA 3TN7A 1KKMA 1RP7A 5EJ4A 3OCCA 1Z16A 5CDTA 5IJ9A 1IBSA 3N3AC 4FYVA 2IXTA 2MIIA 1BTOA 3DDHA 3UAXA 2Q3DA 3RV4A 1YACA 3OE5A 4LHVA 2I62A 5KQGA 1ZD3A 3WI7A 5IRCD 1ZMBA 1TJ5A 2D7CA 5CJ2A 3B1JA 1OKKD 2CV2A 3H13A 1Q1GA 3AR7A 1F9AA 1KVUA 4HMQA 2VOEA 4Q03A 1SCJA 1W36C 2DPHA 5DLDA 2WHRA 2PAAA 4FDUA 1SVWA 1O95A 1PFUA 1ZNXA 1E64A 4UUNA 3AEYA 2JGNA 3UJPA 1FLNA 3KSMA 3DEYX 4MR7A 5ALPA 1XAHA 2G72A 3LIPA 2X0RA 4GPIB 3CE6A 3LHIA 3TJZA 1SY7A 1NP3A 4YMWA 2BL4A 2RK3A 3OO0A 4DQLA 1W2WB 1H6BA 2NXEA 4JGBA 4LBYA 4MWBA 4RTNA 5C1PA 1CUHA 1SU4A 4BAUA 4HDKA 3IUQA 1SCUA 1H5NA 5JCOC 4NRDA 1S3FA 1RPTA 2P6OA 2QGNA 2AEJA 2AN1A 2NVWA 2DE0X 2X40A 4LI0A 5IVIA 3OZCA 5IT0A 2HRRA 2NXWA 1J33A 2FPRA 3PFGA 1N25A 5K3FA 2IYPA 5K8LA 2D54A 4U7WA 4M9CA 4UXJA 4DMUB 3GH3A 3STWA 5K0SA 5CVTA 3G9ZA 3WL5A 1FXUA 3BD9A 3F49S 4MVXA 4RWZA 3RS2A 3K8OE 2CNDA 2ZRHA 4QA9A 5L3ZA 4O25A 3UQZA 3GG9A 3WL6A 2XKKA 3IP7A 3V6LA 1R0YA 2C2KA 1U9ZA 3W8NA 1LA2A 3A6PC 5A6SB 1KZGB 2O8FA 2R00A 3TLMA 2FHSA 5B12A 2GEJA 2NN3C 3C6BA 2Y1CA 4AKTA 5JCXA 3A9CA 5CX4A 1ANKA 2FF7A 2VP5A 3PFIA 4G3XA 4DV7B 1U8TA 2A0UA 3L8GA 2I9KA 4OG2A 3TW8A 2ZB3A 5HF8A 3TIXB 4F97A 3RFXA 2Y66A 3IA7A 5AVTA 1NM5A 2VDRB 4YV0A 2AH5A 3V1KA 4AP5A 3GJTA 1E3WA 1WCV1 2F64A 4Y1GA 1A9OA 4EG4A 1SOUA 4EG6A 4G0UA 4JR2A 4FMCF 3VR5D 1TYDE 1E99A 1E0SA 3PCXA 4ZANA 4YRMA 4DKJA 4MTLA 3ZWCA 4M7RA 1X8KA 2PX2A 5ES3A 2PBFA 2O1SA 2ZTLA 3H3XA 2QUAA 3AF2A 3SD7A 1H0RA 5IT4A 1AH2A 5CB0A 4RK5A 1C9DB 5E7MA 3KVOA 3NI2A 2OORC 3IP3A 1G2QA 2TRSB 3PNQA 1V41E 3HJRA 3A6LA 2DMRA 2Y2VA 4B2IA 5JI2E 4RAOA 3VOTA 1I2MA 2XTAA 4FS8A 4E33A 3R9WA 1S9HA 1JTEA 4QDOA 4GP6A 4MK4A 3IL2A 3G5UA 4UJ3A 4QXOA 1PTJC 1CS4C 1UDWA 1K9VF 2IYOA 5IAKA 5K3CA 3HABA 4HN9A 2XWJI 5ETJA 2GAIA 2IRWA 1P61B 1JLMA 1Q3TA 1LCIA 2K7ZA 5FXMA 3P20A 4G89A 2COUA 4FEAA 5J2TF 4BU1A 5IZCC 2PBRA 2VKTA 3AV0B 1KJWA 4OMDA 4P3XA 3VHLB 4AMYA 3O8QB 1WBBA 1W47A 2UYGA 1O77A 2WFMA 4MB0A 2ZSDA 2EARA 2Q5FA 2X7XA 3BSFA 2HMUA 2HIAA 3GPDG 1Z9BA 3WYFA 2ZSEA 3PKJA 3CWCA 3RJTA 2CXSA 3VNSA 1L4MA 5B1SA 2I4MA 1NBMD 4HK4A 5CNIA 2R87A 1PJTA 2Z98A 3EB9A 4ZYZA 1E2EA 1HSOA 1NNI1 2BMEA 3OIUA 3ND8A 1Z8HA 4A6PA 1GSOA 4ILEA 3OQIB 3NXSA 3UWMA 3U7QA 3MD9A 3I39X 4E2ZA 1P4JA 3O26A 1DKQA 2YJNA 1FX1A 3DFKA 3ZQJA 4PW0A 2A92A 4C0LA 5LWHA 4F93B 4DC0A 4BNJA 5A4DA 2FDRA 2WSSD 2EKBA 3MEQA 1AF4A 5JRZA 3X43A 1JILA 2DU8A 5J40A 4PHFA 3KAPA 4INZA 4DIDA 4TZKA 5KNCD 3CNNA 4PINA 4M1QA 4WHMA 5EIFA 3RT1A 3O47A 4ZEWA 5CDGA 2XCTB 2HDHA 3JCZA 2ZE7A 4U9UA 2HSJA 4YVFA 3CEAA 4Y6OA 4D9KA 1E59A 3L07A 3V48A 4KZKA 5LQCA 2JGJA 4QM7A 3SNKA 1IJFA 4MVJA 5A5DA 1N4DA 3I09A 3IRUA 3U61B 2E7ZA 3GP3A 1ZM9A 1XRPA 1QRUA 2V5AA 2GK7A 8LDHA 3OC6A 5IDQA 4HWRA 2HGZA 4TS4A 3LKZA 3L8FA 3KSDO 4X1IA 3VOAA 3GLQA 1H4VB 2P5YA 3LHDA 4XQ9A 4OKSA 1P9LA 2IYWA 3VU8A 4PCLA 3GLIA 4N0DA 2YXBA 4BVLA 2Z6UA 5L7YA 4Y2TA 1M54A 2JIPA 3TLCA 4C76A 5HXAA 4WNAA 1VYVA 2WK1A 5F52A 4NBWA 2QA5A 3AVPA 1RRFA 4MOWA 2Z6AA 2JFYA 4WZBE 4YCDA 2QL9A 4OI0A 2IP4A 1BKYA 1ZVJA 3L6DA 3ORFA 2TMKA 1UBTS 1C30B 1G3RA 1GTL1 4MKHA 5D84A 5LNK6 2WMYA 4RPCA 3B2QA 2FUNB 3RQSA 2B8TA 5FBZA 5FUMA 1K63A 4HDAA 3OPXA 5AHXA 2O48X 2ZBDA 5GOZA 4LYAA 2PRIA 3M4JA 5C7IO 1XL0A 2Q50A 1RC8A 3D6AA 4JNKA 4LNAA 5CX1B 1NSFA 2JCGA 1M6NA 1R0WA 4M54A 3TD9A 2MJLA 5A3RA 3PQ8A 4HQOA 4UM8B 5KOYA 1DRKA 1XZHA 2C82A 5HIIA 4JR0A 4CIDA 2AQKA 1PCXA 5D1HA 3P9YA 4DGSA 3JV7A 1N7GA 2BKUA 2WLTA 1V45E 1NE2A 1RIFA 4QTXA 1VLLA 4RFSB 5AI4A 1TVMA 4R8RA 5HCUA 1JJ7A 2COEA 3PCRB 5D3QA 3HQ4O 4I9HA 4M86A 4NCKA 2XZLA 1I6WA 3F0TA 4UTOA 2C98A 3LXXA 5FTKA 5HIJA 1G59A 1EHCA 1LC0A 3ZKWA 4N8EA 4Q3DA 4B6OA 1XUOA 2F43A 1M34E 3EGEA 2Q6LA 5C1IA 4I1UA 1SU6A 3JD2A 3LQ1A 1M33A 4P4NA 5DTEA