2FGKA

Crystal structure of the abc-cassette e631q mutant of hlyb with bound atp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
241
structure length
241
Chain Sequence
b'DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
molecule tags Transport protein
source organism Escherichia coli
publication title A structural analysis of asymmetry required for catalytic activity of an ABC-ATPase domain dimer.
pubmed doi rcsb
total genus 69
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fgkA00
4RFSB 2ZJYA 4RD2A 1Z0IA 4E03A 5B64A 4FMCB 2KSQA 1PUJA 1XTRA 2FZ4A 3ETLA 4PAMA 4UNPA 2CLDX 3WMGA 4QGGA 4ZCLA 3CX7A 4I1UA 3GPLA 1UBEA 1KI2A 5KSPA 1F5NA 2P6NA 3GJ5A 2GXQA 2QQ0A 4KO8A 4HDOB 5F9HA 4ILEA 5HZHA 1S3SA 3D31A 4Q9JA 2CL6X 4OK6A 1KMHA 1W47A 3EAQA 2IEZA 1SGWA 3MFYA 2ZVPX 3MAAC 4B3CA 1OFHA 3G5UA 2JA1A 3NH9A 1N5LA 4A4DA 2BBSA 4JVSB 2YJTD 2W0MA 1IN8A 1Z07A 3A1VA 3FHCB 5KDDA 4F93B 4MRPA 3T61A 1NIJA 2PJZA 4Q4LA 5BN3A 2IT1A 4IJMA 2J9RA 1P2VA 3A1SA 3ZGXA 3U6BA 1KK0A 4A8JC 4RFVA 4R71A 2NZJA 1ZM7A 2W6JD 5JRJA 2X1VA 1FFHA 1ZUHA 1AS2A 4HAUA 1XCMA 2QP3A 5CB8A 4D6PA 3EZ7A 3VHLB 4DDWA 2QBYA 3R9IA 5J4YA 3K53A 1UJ2A 1OE0A 1JR3D 2JLXA 5CK5A 2G3YA 1MABB 5DI9A 5EUQB 1NN0A 1W36B 3NEJA 4L9SA 1DAHA 1GL7A 4LJYA 1OIWA 2QPTA 4JLBA 5LD2B 1WP9A 2N1BA 1L7VC 2AL7A 4W5HA 3QKRB 4EKDA 4OHYA 1DBSA 4IEIA 3TH5A 1P6XA 3LBHA 2JLUA 3LY5A 3E5HA 3SN6A 4PC6A 5BQ5A 4RZ3A 2BJWA 1DG1G 2F3TA 1WE2A 4QM7A 4NYJR 3TQCA 1FMJA 5G3ZA 1Q3TA 3KKNA 2HLDD 2QMUA 4OQMA 4IDNA 1XP8A 1XPRA 1OXTA 3KJGA 4URUR 5B2ZA 5TXGA 3WYFA 4XOIA 4D0LB 1NJGA 4HAYA 1CR0A 2OCAA 4ARZB 3QXCA 3JZMA 5KNBA 2AFHE 4TQUS 4IDPA 4C30A 4FMDB 5JWHA 4CT5A 3VX3A 4W5WA 3GLHE 5ELXA 1KJWA 2CE2X 3CO5A 1IM2A 2ANCA 4MRSA 4A15A 3THWA 1PLJA 1S8FA 4D4JA 3MJHA 1G5TA 2QE7D 2WJJA 4BLPA 4BZQA 2R62A 2C9CA 1ONBA 1W2GA 4HZIA 3FKSD 1KK3A 1HT2E 2WSMA 4DEXA 1E9CA 4Q1FA 3WHLA 1HQCA 4LHZA 4NCIA 5L3RA 3VR4A 4ZI3A 4K46A 5K8IA 4TYWA 5EE0A 2IYUA 3QKSA 4HAXA 4F4CA 2OHFA 2QTFA 3MJRA 4XH9B 5JI2E 2ECKA 1N2CE 2ZYUX 3U3OA 3CB4A 1P5ZB 2OUKA 4AURA 3BE4A 3MSXA 3PVSA 3LBNA 4WXRA 3NKVA 1E6CA 2IYVA 4CT4B 1EXMA 3H0KA 1LF5A 2IXFA 4Q7JB 1U99A 3OE7A 1G3IA 2ZJ8A 2F43A 2ORWA 1VHTA 4HEJA 2GJ8A 4ZKDA 1P3JA 3QF4A 1P4SA 4UNSA 4CYMA 2OAP1 3SI7A 4AY2A 4EPVA 4JYBA 3X1YA 3U3KA 1E32A 1ZINA 3HU1A 4MKFA 4CEIB 3ND8A 2AR7A 2JJ1A 3TIFA 1R0ZA 2HCJB 2FPKA 2AD5A 2P6UA 5IT5A 3HR7A 2ODEA 4OHWA 5BYJA 3BH6A 1UPTA 3OAAA 5DH9A 4WIAA 3R7WB 5KNDA 1ZVQA 1ZU5A 4YMTA 2D74A 1GP2A 2A7QA 5AR1A 1OXXK 4IOJA 4I1OA 2FFBA 2GNOA 1FL9A 4QKQA 2QAGB 2WJVA 3K9HA 5EP4A 1XTSA 1UEIA 5JSZB 3GLFB 1NL3A 1G3UA 1GNPA 4C2UA 4HAVA 4IXMA 4N0EA 2A5DA 1P2SA 2FEMA 2AHOA 3P4XA 4XSGA 4PSAA 2QSYA 4C0QC 5CYOA 3A4LA 5DI3B 1C9KA 4EPWA 1OFUX 4JBWA 1VHLA 2VHCA 1EFRD 1SVWA 3MUFA 1ZIOA 5FFMA 2J3EA 3M6AA 1ZUNB 1RW4A 2J7KA 4ZKEA 3LXXA 3VR6A 4B6EA 2CLSA 2QT1A 1G41A 4UXHA 5ANRB 1RYHA 2H16A 1XRJA 3I1FA 4Q1DA 5FI0B 1KI3A 1JB1A 3QKTA 1AKEA 3B5JA 3GFPA 4HLUA 2OESA 2A5FA 3DM9B 1T5LA 5AJVB 2LKDA 1E2KA 4AKIA 1G8GA 1HH4A 5FUVA 3F5FA 1J8YF 1CIPA 4TQ9A 2OO7A 5LD2C 1P73A 2JJ2A 1Z6GA 3ZZTA 1GSIA 2QZ4A 1F6BA 3T5GA 4JJZA 1MO6A 3WYGA 2A9KA 3WNDA 3IIKA 3C16C 3GQBA 2ZRNA 3QVVA 1W0KA 4D82A 1VYTA 1I4DD 1YVDA 1DAFA 4PHFA 2R8RA 5EZ6B 5FOUA 3ASYA 1F2TA 1P9RA 3KTAB 2ZRAA 4FINA 1Q44A 1X1SA 1GNQA 1AGPA 1MRSA 3Q5EA 4DLUA 4WW0A 1XD9A 1Y63A 3SU8A 2HV8A 2GXUA 1E4VA 3KQNA 3H1TA 2GEDA 4BWYA 4C0HA 1Q22A 3AP3A 2BBOA 4MGYR 1G3RA 5FOVA 4R98A 4EFMA 1J90A 4AI6A 5IF9A 3DO6A 2G1JA 2UKDA 3EWSA 4A0FA 2GAAA 3A1UA 4LJ5A 1FW6A 1KY3A 2IC5A 5KUTA 1VIAA 3I8SA 2ZM5A 5EE5B 2E1RA 2ONKA 2BKUA 1M7BA 2OILA 3EIHA 1SVOA 5IK2A 3TJZA 1KTVA 2IL1A 1TU3A 2VYFA 4DWJA 2YZ2A 2EWVA 2X2FA 4XTRA 2ZS9A 3BJIC 1KO7A 2NGRA 3WRYC 3SYKA 1SXJE 2UZIR 4LYHA 5J4HA 3RVBA 1XEXA 4B34A 5K8UA 2J59A 2OFXA 2OSBA 4UJ3A 1HURA 2EQBA 1NVWQ 3V4FA 4U5XA 2VP2A 1NNEA 2MSCB 1G7SA 1TQ4A 5EP1A 3QPVA 2IWHA 2IS6A 3UK6A 4MQBA 3Q5DA 4B71A 4EPYA 3RC3A 5JMTA 4GZMA 5AJZA 1VPLA 3V9PA 5FL7A 2V55B 1XU4A 3SHFA 4DLWA 2YHSA 1J2JA 2WM9B 4HDQB 5DLQC 1UKVY 1RE0A 4ACAA 4BFVA 4C0AC 5FTKA 3FOZA 1Q1EA 2ZU0C 2G0TA 5DIFA 3VAAA 3CNLA 1G4UR 3SJZA 4AD8A 1SHZA 4QFMA 3GJ8A 2ZI9A 4CRWB 3PIRA 2HLDA 1P75A 3AF2A 2IYLD 3P27A 2EFHB 5KSYA 1FQJA 2CK3D 1SXJD 2ZJ2A 2XB2A 5LB2A 4JZKA 1XTKA 4MUBA 1ZM2A 2FPMA 1KDPA 2IYSA 1GAJA 2GJKA 4LPSA 121PA 2BWJA 4ZPXA 1TMKA 2CMKA 2IW3A 2NMVA 1YZKA 4XVQA 5UKDA 4DIEA 1Z8FA 2ZSDA 3CF0A 1OYYA 4Q1BA 5C2JB 3DMDA 3UXMA 4Q7LA 2WBLC 2ZJZA 4PZLA 5E7JA 4GFDA 5CLQA 3E2IA 4DBLC 4NPHA 1SVSA 1IN7A 1F3OA 4IOLA 4B3GA 1CJVC 4MKGA 4MUAA 1DOAA 2H8KA 5E3HA 4JLOA 4BLQA 1NMZA 2J0SA 1C4OA 1GTVA 2QBYB 5EE9A 1MR3F 2ZR0A 4I1VA 1RIFA 4KXFB 4KBFA 2QI9C 1H65A 2JLZA 2QT0A 5C46F 2GESA 1O3YA 2KBEA 2HF9A 1N6HA 1XXHA 1XZQA 3GJXC 1YRAA 5JS8A 4C0KA 1E2EA 1V43A 1ZD9A 5AUOB 1R0YA 3WNCA 5G41A 2GZAA 4Z54A 3T1QA 2GZHA 2JEOA 2J45A 2ZRFA 1G8YA 2QRZA 3SQWA 1AM4D 1UM8A 2A5YB 2ZRGA 1DAGA 1FNMA 3AGQA 3Q9LA 3AF1A 1ZD8A 2ZU6A 2VHJA 1LS6A 4PPQA 1TNDA 5DSZA 4GNKA 4KJZA 2O8EB 4S35A 3KTAA 4M1WA 5P21A 4GZLA 1OSNA 1KI4A 2A2ZA 1JALA 1H8HA 2HF8A 3CLVA 3QIAA 3ZVLA 4EUNA 3EA0A 2IX3A 4LJ9A 1NMYA 3FMOB 1KDOA 1UADA 1HT1E 4B2PA 2R44A 5EE3A 1NLYA 5FBVB 1XFAA 1Q1QA 2DFLA 1G8HA 2RGNC 4PPFA 4II7A 2ZIAA 1YU9A 2GCOA 3QOFA 2PMKA 2E87A 1GKYA 1NVVR 4MGKR 4WZAE 1EFCA 4W9MC 2ZYTX 3RSOA 3MGCA 1E9RA 3TAHA 1G1MA 4ASUD 1OH7A 2ZUCA 3IIJA 4URZR 3OZXA 4IFBA 2E9SA 1IXSB 4LCBA 2JLVA 4FMCF 3ICEA 4RZUA 2D06A 1W1WA 4QBGB 3GEHA 2ORIA 4F7WA 1HE1C 3D6TB 3K9LA 1SKYB 2FZLA 1BH2A 2XX3A 2WMOB 3SHWA 4QL3A 4DB2A 5FR2A 4NH0A 1K5GA 4G1UC 3KUDA 3TUZC 3FFBA 3IBYA 2DPXA 4IDOA 4R7ZA 3TLXA 3GJ6A 2AX4A 4IVQA 4BFUA 3B82A 3CX8A 1X3SA 3NWJA 4M1MA 3T15A 2GBLC 2B7BA 1KJZA 2PT5A 3FKQA 5JHHB 3UATA 2F3RA 2QGZA 2XITA 3AEZA 4GT1A 2XOKA 3BOSA 4XVUA 5HKKD 5C4MA 4JLDA 4DDUA 3M1IA 3ND9A 4Q4JA 3QXSA 5EUMA 5DYGA 2QGNA 1A1VA 1KZGB 4A82A 1Z47A 3SEAA 4Q9HA 1HA3A 2QORA 4XWOA 4AKHA 3AKCA 2IUTA 3O8CA 1LF0A 1BYIA 2REOA 4BEJA 2IYXA 1OT3A 4QM6A 2J5XA 1JBKA 3BXZA 3ZJYA 4FMDF 3SZRA 2Z0MA 3L43A 4Q1AA 4G5GA 3ZQ6A 3B1YA 1VECA 2F6RA 3T1VA 2H92A 1T0JB 1PVOA 4ZIRB 2JLYA 1OHHA 1F48A 4LRWA 3TSZA 4DSTA 1AJEA 2QAJA 2VP5A 1XMSA 2PLRA 2CJWB 2AN9A 2XJ4A 2O0HA 3X1XA 1WDTA 3GMTA 3PFIA 4PQRA 4AYWA 4D4MA 2OXCA 1E2LA 3B6EA 3OIWA 3RS7A 1TX4B 3K70D 1CR4A 2VA8A 1SXJB 3GLGA 1JNYA 1S4QA 4LJ6A 2HJGA 4G0NA 1W0JA 1TEXA 2OFOA 1HE8B 5FL3A 4QG7A 3LDAA 3LO5A 4Q5IA 1Z3IX 5AK0A 4PAQA 1GG2A 4YMUA 4MYCA 2XSZA 1II9A 2FX3A 4PQYA 3EPKA 2L0XA 2GCOB 4G5QA 5JJKA 2CNWD 4B75A 2VP9A 3FMPB 4DB4A 3ZVRA 1G20E 2P67A 1XTQA 2EWWA 2CCGA 4H9GA 4LK2A 4Q4HA 3UANA 2DHRA 2C5LA 4M22A 4PTLA 1GILA 4DUGD 4G5OA 5CM9C 5BWMA 2ZI5A 3ZZUA 5FL7D 1Z22A 1ZNYA 4UNQA 5J47A 1E2HA 3GEIA 2HJVA 3D7MA 1S96A 5BN4A 3FVQA 3V4RA 2O0JA 1UDXA 2GJAA 2FSFA 1KY2A 1ZRHA 1MOZA 4UJ5A 1T3LA 4O2RA 3CM0A 1VCOA 5H1YA 1P62B 1F60A 1N6RA 3EG5A 3QJYA 1G3MA 4IKEA 3B9QA 4QHTA 5FUYA 3C7KA 3RS4A 4IVPA 4IRUB 1P61B 5FOWA 4D25A 3PCRB 1WA5A 3L0IB 4XIGS 4TMVA 1J7KA 4K8OA 1AA9A 3K0CA 3QE0A 1NBME 4TMKA 2WOJA 2YOHA 4X8HA 3EPJA 2D3WA 5D3MB 4BE7B 3PJRA 3JVUA 3B1WA 4X8LA 2N42A 3RRZA 4XD7D 4Q9LA 4ZV4A 1YZLA 3Q72A 5FTJA 2GWHA 4RY2A 1GFIA 5F9FA 2FFQA 1J8MF 2A30A 2WICA 2BM0A 4OBEA 4B74A 4XWKA 2PJRA 4BPBA 2Q9AA 4MYUA 3PEVA 3U7FB 4DCTA 1CR1A 1GRRA 2B8WA 3EARA 1X8LA 3A1WA 2BV3A 1OH5A 1OYWA 3NBFA 2JLQA 4TT3A 2A5JA 4B3FX 2DB3A 1CJUC 5KU1A 1TU4A 2GHIA 3A37A 4TMZA 2PCJA 3U3RA 4TLAA 3R9WA 1AQUA 1M8PA 2IHYA 1IBRA 2PL3A 3B85A 2C98A 2QEQA 1D2EA 3LNCA 2GK7A 2RHDA 3VR3A 1UAAA 3RNLA 2V1UA 2OBNA 3SYLA 2Z5FA 1MO4A 4US0R 1QHXA 2LKCA 3TW8B 1G9XA 4PX9A 3R7WA 2RGNA 3CPHA 4RD1A 5F3WB 4WZBE 1TUIA 2IEYA 3N2EA 4GP7A 4G5RA 2IWRA 3C8UA 1E1QA 3QBVA 1G5RA 3AF3A 5LBIA 1VYUA 2TMKA 1P9WA 3Q8XB 3W90A 1KAOA 4OHVA 2VRWA 2GCNA 5KTYA 3AVQA 3QY0A 4FI3C 2BIFA 5SZIA 4URVR 4GDFA 5KSOA 2NO0A 3THYA 1XJCA 4ABYA 4ESVA 2ERXA 4N0DA 5H70A 4GP6A 4A0GA 4TLDA 4HAWA 1CJKC 1EG7A 2VF7A 2ODNA 1GL9B 1JI0A 3SJBA 4HUTA 2WSSA 2ZRDA 4YXWA 2XTMA 3AUXA 3EZ2A 4KLZA 3W6OA 2QM8A 2W6IA 1JXOA 4P4SB 1D2MA 4FW9A 3RC8A 4HB4A 4PPGA 4C4PA 5DN6A 3VR5A 2QMOA 4KVAA 1UKYA 2NO6A 1KDRA 1KO8A 1GDDA 4D80A 3U4QA 3ZYCA 3X2SA 3AP1A 2WJGA 2O8DB 3LW7A 4Q47A 4V0LA 1IJEA 2XB4A 4IOKA 2F1JA 2EW1A 1N0UA 4YDHB 1I2MA 2BEKA 2P5TB 4QGAA 1CU1A 1N6IA 4A1FA 2H1LA 1NY5A 2B7CA 3K0FA 2NOAA 3Q3JB 3QG5A 3A8TA 2RGGA 5DE3A 4LZZA 5IRCD 2ZS7A 5GJWC 1E0JA 2I1QA 4URXR 3ADBA 3MWLA 5JEDA 4Q66C 2D2EA 1Q0UA 1TADA 1UBGA 1W46A 3W5JA 3DMNA 2ZRIA 3U4QB 2VBCA 1TTTA 2DFTA 3DZDA 2ATVA 2XOKD 4Q7MB 1XBTA 3THOA 4A0RA 3QXXA 3GLHB 2GJ9A 3EC2A 4Q1EA 4I81A 1R0WA 4TSFA 2WJYA 1RC8A 1OXVA 1C1YA 1G21E 1P72A 1W4CA 2NO9A 2DFNA 2B92A 5A4JA 4Q21A 1QVAA 3WYAA 3OEEA 1E96A 4HZUB 1UF9A 4CEHB 2WAYA 3MD0A 1ZNWA 1VDZA 2N46A 3EC1A 3UWOA 1MKYA 4MDFA 1NY6A 1ZIPA 1G4AE 2G1KA 1LY1A 5CM8B 3IIMA 1RYFA 1E2IA 2J0QA 421PA 8OHMA 3B9PA 1F2TB 4TMTA 4O0MA 1CRQA 4Z1MD 4A9AA 1Z6YA 4BFSA 621PA 2QP4A 1QHSA 2ZSEA 3W8NA 4HYYA 1N6OA 4RCYA 3T1OA 4LV5B 2BMJA 3QVUA 5CJPA 1WMSA 3OFND 2RGCA 2P0EA 1CR2A 1X86B 3K0AA 4B32A 3I61A 3K9GA 1E69A 3QXJA 2DCUA 4US2R 2PX3A 2JAQA 3DM5A 3EXAA 1HV8A 3PUZA 1E2JA 3AVPA 2IS2A 4WAUA 1NVVQ 1TQDA 4MH0R 5SZJA 2EFEB 3CR8A 2WWXA 1XMIA 5FPSA 1GKIA 2XSZD 3HP1A 3VR2A 4RKEA 1D2NA 2CCJA 5EP3A 4M21A 1IY2A 2WAXA 5TVKA 3N5CA 2CNWA 3B78A 5B57C 3ZZ0A 2OFWA 3NIBA 3PUXA 1GL6A 2GA8A 3B1ZA 2XAUA 3SBEA 4EJSC 4FWTA 4EIWA 4QGHA 4FCVA 4ITRC 1TPZA 4E09A 1MABA 1CULC 3NH6A 3TGPA 4Q4AB 2FGKA 1XNJA 4RD4A 3ASZA 3NEYA 3HU2A 4NCKA 5CIWA 2C2HA 3ZIAD 1U90A 3K8YA 1XZPA 2QN6A 1FPMA 3PV0A 1FX0A 4C0SA 4KI0A 2NIPA 3GJ7A 4B2LA 2DWOA 2ZS8A 3U5ZB 1EFUA 2BKEA 3SJCA 2C04A 4EJSB 1Q12A 2O8FA 5BW8A 2YWFA 2DWQA 4NCHA 1S3GA 2ATXA 4D0NA 4TZ0A 5LDDC 3FB4A 1L4YA 4D2IA 3VKWA 4MRNA 3F0TA 2FH5B 3L8ZA 2IBMA 5AUQA 3K0FB 4U00A 5JRZA 3IHLA 3QKSB 1KSGA 4TLBA 3F8TA 4P4UA 5CYPA 4XD7A 3GLIB 1XMJA 4TWZA 2JDIA 2WKRA 5EQTA 2FE4A 1TQ6A 3BFVA 3IPXA 2QY9A 2VP0A 1M1YE 1MT0A 2ZYWX 3UMRA 2ODBA 3I4LA 4CEJB 2FGJA 4US1R 2AK3A 3AH8A 3SJAA 4CGZA 2QQEA 2XEXA 3KJIA 4ERNA 1N6PA 1W48A 2A3RA 2WIAA 4QHYA 3K1JA 1E3MA 4NHOA 1GRQA 1PLKA 2ZYVX 2EFDB 4NKRA 4MKHA 2GTPA 1Z5ZA 2GEVA 1VYVA 4HLDA 1VMAA 3KB1A 1FTNA 3BIFA 1KNXA 4BZXA 1SZPA 4PPNA 1WRBA 1BIFA 3BERA 1RRCA 3HU3A 2BMFA 3RYTC 5FTNA 1DADA 5EXXA 1US8B 4BFZA 2IS4A 1FX0B 1SVKA 2AD1A 1IAQA 3REGA 1E1QD 2CVFA 3FMIA 2ASEA 4IHQA 3L0PA 2W58A 1SVIA 2OE2A 5FOSA 4A8JA 4TTRA 2YKGA 4POAA 2Y8EA 3ZQJA 4LJ8A 4F4JA 3QUSA 2O8FB 1YR8A 1E9BA 4LHVA 1NJFA 4X8OA 1IONA 1COWA 3NBYC 2BBWA 1VG9B 2YC2C 5CDFE 1GM5A 3VKGA 2ZPTX 4ON9A 4ZIRA 4LV8B 4JJKA 4LYJA 1W4BA 3RS5A 4QBFA 3B13B 4O25A 2B21A 2HUPA 2VLIA 1E2PA 4YXWD 5DI3A 2ZQ5A 2AXPA 4CEJA 2FG5A 2RH5A 1KI1A 1IN6A 1DTSA 5FUWA 4DDVA 1RJ9A 3LD9A 2ZJBA 3DVLA 5DN6D 3IEUA 3W6PA 3THXB 2Q3HA 4RJLA 2XZLA 2C03A 2FN4A 1E2NA 1YZTA 4BLSA 1T0HB 2J0UB 2RMKA 4C9BA 4ZCMA 1H8EA 1QZXA 4BGDA 3AVTA 3OIUA 3QKRA 5EXPA 4ZDKA 1VG0B 2R6FA 1YZNA 3U6KA 1N6NA 4B76A 1ANKA 2RCNA 4N1AA 4URWR 3N70A 1N0WA 1YZGA 2GDJA 3E1SA 4QJ5A 4TMWA 2RHMA 3KKOA 1G7RA 3GLFE 3RWMB 1VCMA 1JAIA 2C78A 1W5TA 1ZM3A 2ZETA 1W36C 4PR0A 1N3BA 2W2VA 1VG1A 3K70C 2QL6A 4LOAA 2HXYA 4JMPA 3TMKA 3RANA 3CH4B 4V02A 4TSFD 4M1YA 1SKYE 2F7SA 2OXRA 3REFA 2ZRLA 4RD0A 4Q18A 3WBJA 5FPKA 1UDWA 1PV4A 4TLCA 4JVNA 1WCV1 5KDOA 1XD2B 1EX6A 3CPEA 1E9EA 3EASA 5F2EA 3AVYA 1W2HA 4V0KA 4OI2A 1JR6A 1W4RA 4TYQA 4JLJA 2H5EA 2AWNA 5J4KA 4MKIA 4B43A 2ANBA 3VMFA 5JEEA 5CLLA 3TVDA 3EPHA 1OV4A 4QOSA 4Z1MA 3TUJC 4AG6A 2BMDA 2J7PD 5FOXA 1BS1A 4OQFA 1IOZA 4E22A 4MDEA 4LV6A 4DRZA 3AVVA 1YZUA 1LFDB 5G3YA 4RD6A 4KBGA 4KFUA 5AJWA 2IUUA 5J4VA 4TMXA 1ODFA 2R6GA 3C14C 3O8DA 4O2LA 5E4FA 1UKEA 3TAUA 2YWHA 3TR5A 3W3ZB 3LX5A 1TUEA 1XEXB 1KI8A 2D4HA 1E2MA 1NKSA 3KFVA 1RRFA 2IYWA 4JLPA 4V0ME 2QTHA 4BUJA 4LHWA 1UEJA 1TF5A 2GXAA 4KV9A 4YONB 4KFSA 3R8CA 2J87A 1MO5A 2R2AA 1KYIA 3O8BA 4KAXA 2XZPA 4L9WA 2OV2A 2JJ1D 4K81B 1G7CA 4MYHA 4A8JB 3EZ6A 3IQWA 2IHBA 4M2LA 1GRNA 2D7DA 3T06B 1US8A 1KI6B 3MRSA 1Q57A 1XX6A 3P20A 1ZM9A 3CZPA 4ZDIA 1UKZA 2ZSAA 2OCBA 3KX2A 1IJFA 1BO6A 1BMFD 1KO5A 4JBYA 5EE1A 3WHKA 2GAOA 2IA5A 3I3SR 4D4LA 2OAQ1 3QNUA 5FOTA 4ZI2A 3I5XA 4GOXA 1LW7A 1U9IA 3LLUA 2GILA 1GWNA 3X1ZA 5KYKA 4BLTA 2XZOA 3PEWA 1VCNA 2C9YA 2Q6TA 4M8NE 4DCSA 1EFRA 2DFKB 1ZC4A 3MWKA 4TL9A 3X1WA 1U98A 5KPJA 2ZRCA 1Q21A 3KL4A 2QTVB 4M0LA 5JS7A 4U02A 2JGNA 1BYUA 1M74A 3A1TA 4IW3B 4B6FA 3FDIA 3J81k 4TYPA 1AN0A 1NKTA 2OBMA 3HPQA 4W5JA 2VP4A 2H18A 4LPKA 3MWYW 1A2KC 3TBKA 2EFGA 4DSNA 4Q4AA 4WBSA 1OXSC 3MG9A 2EYUA 3H4MA 4HUQA 4UNNA 5DYIA 5FBLB 4GOKA 3EWAA 1F2UB 1Z29A 2O8BA 1A4RA 1GOTA 4WA7A 1G16A 2XNSA 1VCIA 4YLGA 2JCSA 3T1TA 1XJQA 1NN5A 2F9LA 3BK7A 4JIMA 1PUIA 4QBIA 5H68A 4QJ3A 1DVRA 1DARA 2FA9A 4RFSA 2FF7A 2YVUA 1I4LD 3AB3A 1DE0A 4M1KA 1XCPA 3B1XA 4QXAA 2QM7A 2Z83A 1YZQA 2JLRA 2ZAOA 3H86A 4BLRA 1CXZA 1Z6AA 1XXHE 4MA4A 1XEWY 3A4NA 1U0LA 4EQ6A 2ZI6A 2PMDA 1R10A 5F98A 3B8HA 3CRRA 4Q9KA 4BFWA 1P2UA 3C15C 1E94E 3NXSA 3TKLA 3VTKA 3NC1C 3ZS8A 1Z2AA 1XPUA 3PUYA 3PXGA 5JCZA 4DHEA 2QAGA 4A2WA 3BC1A 1NSTA 2AFIE 1COWD 4Q03A 4URYR 1M6NA 1M34E 1T3HA 1CTQA 2OM2A 4PO1A 5DO9A 4DIDA 4B48A 3K9NA 1S9DA 4NDZA 4JL5A 4RD3A 1ZM4A 2NPFA 4DKXA 2PBRA 3OIYA 3HR8A 5GJBA 1W4AA 2IK8A 1UBFA 3AV0B 3LXRA 3BFXA 4LWZA 2RKOA 3RRYA 1JAHA 1GZSA 2DBYA 3IHWA 2P6RA 1T9HA 1V5WA 1ZP6A 4A2QA 2LCFA 5IDVA 4OQNA 4JS0A 2QMEA 3NHAA 1E1RD 2BHRA 4Z8YA 4NMMA 2PT7A 2QPAA 1DO2A 4TN1A 3MLEA 4B2IA 1AZSC 521PA 4KYUA 5IHPA 4LDJA 5GVSA 4EDHA 4P0TA 1X1RA 2RB4A 4Y0AA 4AG5A 4JSYA 3KXKA 2BJVA 5GVRA 5KDLA 2IXGA 2QENA 4ZCIA 4BLOA 1DELA 1SHKA 4LBVA 3BH0A 4MYTA 5EXSA 3RDPA 3RABA 2HXSA 3V00A 5M04A 1SVLA 1J70A 1E2FA 2Z4RA 3ONWA 2R65A 1G8FA 2ZROA 1KI9A 2GKSA 4HZUA 1DEKA 3D3QA 4GBMA 3WP0A 4P4TA 3UPUA 2I4IA 5CJ2A 3THXA 2GBLA 1FP6A 1RVDA 4EPTA 4O3MA 5D3QA 1DPFA 1JEDA 1P9NA 5K8LA 3L8YA 3OIVA 5E7MA 2FJUA 4LBWA 4HLQB 5DISB 2KE5A 1HEIA 4Q02A 4Z51A 2CK3A 5J4LA 2IYRA 2YWGA 1SXJA 3GLGB 1KO1A 4MGZR 3KQHA 1B0UA 3PITA 1YHNA 3KQUA 3AKYA 4B47A 3W3AA 4TTPA 2YOFA 2RGEA 2X19A 2YOGA 3OHMA 3T12A 1W44A 1KKMA 2QUZA 3FGNA 2BVNA 4M9QA 4FCTA 4PC2A 3WP1B 3ZVMA 1FP7A 2XXAB 2IUSA 1KHTA 1M2OB 1JR3A 1VKJA 4KLNA 3U2QA 4ACBA 3QQ5A 3WMFA 4BFYA 4DXAA 1S1CA 1N6LA 2OCPA 5L3SA 1ETUA 2VP6A 4M4SA 3JZAA 4IFEA 2AWOA 4FMBB 1FMLA 2ZE5A 5FPTA 4LJ7A 3SDZA 2FNAA 4AK9A 1AS3A 2F55A 5JWRA 1DAKA 2FSHA 2HEIA 4DJTA 2OBLA 1NSFA 1NN3A 3EA5A 4TL6A 2OG2A 4QC2A 3CONA 1KNQA 5G40A 3UIEA 3W5IA 4TLEA 3IO5A 4GMDA 5AUNB 3C41J 4IXNA 3GJ4A 4A6PA 1QVRA 4DC9A 2NTYC 3MMPA 2EFCB 4DCVA 2WWHA 1TF7A 3IILA 4EQ6B 1A7JA 3UG6A 3SNHA 1EESA 2ZRKA 1H8HD 3SFZA 1R5BA 3AUYA 3CNOA 3AVXA 5A0FA 3NDPA 1DAIA 4FXPA 3SS8A 3GP8A 1U94A 5JI3E 3U60B 4Q19A 4Z8XA 1P2TA 1OH8A 4OK5A 2NQ2C 1FUKA 2P65A 4EPXA 3VHXA 2F1IA 1Z6XA 1FUUA 2K5UA 3P26A 2O8CB 4Y0VA 4A36A 2W83A 4NYJQ 3P4YA 3PENA 4I99A 1HTWA 1BMFA 3PEUA 3RRNA 2R6DA 4RCZA 5DGXA 4LGMA 5EJEA 3UMFA 1D5CA 1R8SA 1Y3AA 4LJ4A 3RS2A 4OKSA 2DYKA 2WPDD 1JEEA 4B33A 2BC9A 1CBUA 3GJ3A 2X2EA 2ZUDA 1BOFA 1DAEA 4DCNA 3FE2A 3P1JA 3BBPA 2PZEA 4TTQA 2YINC 2V54A 1KKLA 2Q9CA 5SZKB 3U3MA 1XTIA 3LH5A 3RHFA 1E0KA 5FPHA 1IQPA 4PANA 2QNRA 1IXRC 5HPYB 2HT1A 3L2OB 1J99A 3QENA 2IF0A 1QF9A 3BD9A 4H1UA 3B1VA 1XPOA 4GSYA 1G6OA 1VG8A 3U44B 4YQFA 3GCGA 3LA6A 5A5GA 2QMHA 4JLNA 4P31A 1R5NA 2ZRHA 4DLYA 3OAAD 2VSXA 4AC9A 3KQKA 3WXMA 2EYQA 5HKKA 2AKAB 2V3CC 3MCAA 1R4AA 3CRW1 1CKEA 1B23P 3KJEA 1T8TA 4BASA 2Z6VA 2J41A 5FBQB 2J0UA 2G83A 1XWIA 3FTQA 5KNCA 3KUCA 2CL0X 2ZRPA 1IY1A 3CRQA 2FEOA 3EZFA 2CBZA 1KIMA 3U61B 4B44A 2F1HA 5DHAA 4G3XA 3DKPA 3VR1A 2H17A 2VO1A 1KMQA 4I1SA 3EIEA 2ZI3A 1KOFA 3LQQA 2WVJA 1JJVA 2ZJ5A 2ORVA 4HB3A 1XD8A 2UZ3A 3BB1A 5AJXA 4IDQA 3ZH9B 2ZR9A 3BB4A 4JYCA 3VKHA 4QNRA 4A92A 4HDCA 4LC0A 4YMWA 2BEJA 2J0VA 4AKGA 4NZYA 5KOYA 1YJ5A 3SYNA 4OI1A 1T91A 4WOPA 4PC1A 3HPRA 2ZI7A 5AJYA 5KHOC 4CDGA 1QRAA 4UKDA 2JATA 2SHKA 1N25A 3QI2A 3RS3A 3PUWA 1NG9A 3DZ8A 2JIZA 1CLUA 2EVWX 4J0QA 1ZCAA 2DY1A 1W36D 4G01B 1NG1A 1ZJ6A 3NTUA 3H2YA 5KSZA 3DEFA 2W2TA 4JT4A 4MITA 4XVRA 3UMSA 3GLHA 1EX7A 5L3QA 3ECCA 2O8DA 2A5GA 1JQLB 1ZC3A 1RRGA 2CJWA 1G291 3Q7QA 5HZKA 1OH6A 1YRBA 3AKDA 4C2TA 3DOFA 3NBZC 3LLMA 1OPXA 2VIIA 1W0KD 4JLMA 4MGIR 1R2QA 3SOPA 1K5DA 2YWEA 1TAGA 1M7GA 5TARA 2JLSA 3TQFA 1D9XA 4UNRA 4NYMQ 3BORA 4IVRA 4QGFA 4DUGA 1E9DA 1RFLA 1T8UA 3VNVA 1G17A 2YYZA 4LJAA 1Z06A 3QXHA 3SR0A 4JSTA 3A4MA 1AIPA 1HYQA 4UXIA 1SVMA 1GITA 1NP6A 1ZD1A 1CS4C 3CNNA 3QF4B 4JL6A 2FWRA 2KBFA 4PSVA 3K70B 1CEEA 3QBTA 3K0AB 1OF1A 2ZE7A 3LWNA 4XJXA 4LYAA 3I62A 2OEPA 1U81A 2YNMA 1QBKC 1T5IA 1S2MA 1TQ2A 2IYYA 3VU9B 4C0JA 1DO0A 3KDSE 5IK2D 1E0SA 4QHSA 3S1AB 1WQ1R 4NTZA 2QU8A 1NMXA 3TK1A 4LSGA 2REXB 3SFVA 3FHTA 1II0A 3F3YA 4UXJA 3BFKA 2V7QD 3FFAA 3SC3A 3HYRA 4IOMA 2FU5C 3DL0A 5HR5A 2YV5A 2WWYA 1KI7A 4PO8A 1KAGA 1NBMD 1NF3A 5FI1B 4PC7A 3GLGE 3K0SA 1XJ0A 3IO3A 3IEVA 1OKKA 1QDEA 3IBGA 1EK0A 4LHXA 4A2PA 1Z2CA 1D8TA 3OEHA 4DT1A 3PR1A 4JLKA 3SE0A 2KB0A 3VU9A 4TT3D 4TL8A 3LFUA 5D3MA 1JXMA 3HDTA 1LVGA 5K8TA 2G6BA 3KXIA 1RKBA 1U8YA 3KKQA 1L2TA 3DOEA 1Q3HA 2VHTA 4EAQA 2PCLA 1VTKA 4CEIA 4BEBA 1E79D 2XGJA 3L0OA 1I2DA 4KSCA 2RAPA 1KMHB 1MH1A 3HYTA 4KYIB 3I72A 4GPTA 5HCNA 4OHZA 3T34A 3R20A 1RRPA 1Z0KA 1QHHA 2QSZA 1JPJA 1TL7C 2KJQA 2CHVA 4AIIA 4CF7A 1Q20A 2ONJA 2REBA 5TV2A 2P2LA 4RZ2A 4LI0A 1LB1B 3GLFA 821PA 3W34A 2HCBA 3RWOA 3T5DA 4RVCA 4JLVA 4Q48A 3IQXA 3I32A 2ZAMA 1IHUA 4N3NA 4HUQB 3BH7A 1QG4A 1E9FA 1XF9A 1JPNA 3CUEF 1E4YA 2WHXA 1N5KA 4HLUC 3TR0A 4KITB 3L0SA 4NYIR 2GETA 2D7CA 3FWYA 2WTUA 2MMCA 3U7HB 3AF4A 2CLCX 4HATA 5JFGA 5JSZA 3WMEA 2Z43A 1E2QA 2W6ID 3QF7A 3BRWD 1QHIA 1HY3A 1TEVA 2WPDA 4P4SA 1VIYA 4PZZA 3KKMA 4KSBA 2IYTA 3HWSA 221PA 3B2EA 1ZUIA 1XEWX 4JL8A 2PX0A 3VQTA 3TNFA 2Z4SA 2C96A 2XJ9A 4OJQA 2ZTSA 2C9OA 3B60A 3TVTA 1OIXA 3GLIE 1DAMA 1G7TA 2VHQA 1OLOA 4GOJA 4QRHA 3PG5A 2GCPA 4Q7KA 4D0GA 2NO7A 4KCGA 4U7DA 4GL2A 2VH5R 4ZDWA 4JVLA 1G5PA 4WVFA 4DLVA 4R2IA 3QEJA 1ESNA 4B3BA 2GVDC 4DLZA 2OLJA 1WXQA 2O5VA 3GLIA 1K8RA 4DCUA 1NRJB 2MMGA 1N5JA 2V9PA 4GMXA 2P5SA 2AXNA 2LWIA 4L5BA 2OZEA 3VFDA 1ZMXA 5EXTA 2FOLA 4V03A 3AGPA 3AF0A 4LC1A 2O0KA 3AVUA 1AS0A 2P3SA 1HQYE 3KJHA 4ASUA 3ADKA 2V1XA 3W6NA 3QEOA 3DPUA 2C77A 4G5SA 2BOVA 1RJ9B 1KO4A 4NCJA 5JCPA 2QROA 4L15A 1OFTA 4Q00A 3U44A 4P3YA 1FNNA 1D9ZA 4YDSA 1CJTC 2PZFA 1R5OA 4GRAA 3TW4A 3SQXA 1QG2A 4L4UA 4L8GA 4BRUA 5AWFC 2R9VA 4C3ZA 3RRMA 1NI3A 1ZU4A 1RPZA 2BCGY 1M7HA 5TY0A 3CWZA 3UKDA 5G53C 3NVAA 1X6VA 5EZ5A 2IYZA 2AKYA 1KK2A 4DLTA 4IEEA 2CE7A 2C95A 3M4YA 3CBQA 3CIOA 3PUVA 1K6MA 3C5HA 3OFNA 5J5CA 3U3JA 3ICQB 3WY9A 4I4LA 2I1VB 1KZ7B 2JJ8A 1E0AA 2JIZD 2HT6A 2VEDA 5LPNA 1AKYA 1GUAA 4OQXA 2YC4C 2OLKA 3BS4A 3ZD7A 4F92B 4BECA 6Q21A 2ZJOA 2ZITA 1YE8A 3UG7A 2R6CA 4DLSA 3LVRE 4ZO4A 2QRNA 1WBDA 3O47A 1R7RA 4AYXA 5FTLA 4NYMR 3PQCA 2QP9X 1ZYUA 1MV5A 2JASA 3RLFA 1AQYA 2C8VA 3CF6R 2F1RA 1BKDR 3T35A 3TE6A 4KFTA 5FTMA 3EPLA 2V6JA 1EFTA 3NDBB 2V8OA 3W9YA 4YMSA 4KODA 1FOEB 1E9AA 5JECA 2Q21A 4PC3A 4W7SA 1OHHD 1ZW6A 4MRVA 4ARZA 4F4IA 2ODWA 4DLRA 2NO1A 2Q3MA 3BWDD 4PO9A 1E9SA 5HE9A 1ZCBA 1OXUA 2MSEB 3CR7A 2WMNB 3W8RA 5C18A 2HYIC 2XXAA 2CDNA 4KFRA 3DDCA 4H1VA 4RSGA 1X8JA 1YR7A 4PHGA 1JJ7A 1LNZA 1Z0DA 3IUYA 4E5UA 4L16A 4TYNA 1G3QA 4HI0E 3E70C 5JZVA 4EPRA 1ZBDA 1L4UA 1YR9A 1Z28A 4F38A 1JECA 4QJ4A 2FFAA 1NLFA 3TUIC 4AKEA 5JHGB 2R6AA 1AK2A 2OT3B 3CW2A 5SZHB 1U8ZA 3R9XA 1A82A 3CKLA 4FN5A 1W0JD 4AWXA 2CEAA 2V4ZA 2IF2A 2V7QA 2GRJA 1R8QA 3DHWC 2FDCA 4V0OA 3BGWA 1N0VC 4DEYA 3EX7C 2FSIA 3I5YA 1R6BX 3UWKA 2GK6A 2O8CA 4M9SA 2CHGA 2QPOA 2JDID 1NBMA 4TYYA 1F2UA 1Q1ZA 4M1OA 1OKKD 5L3SB 4X8MA 1Z0FA 3OEHD 5J40A 4IDHA 4M1TA 2G9NA 5B58C 3K0EA 3TSOA 3NC0C 4HLCA 2D2FA 3AKEA 1Q1BA 2ZSFA 1NN1A 2VSFA 4EFNA 4JKIA 2Q0HA 1A5TA 4MRRA 3EZ9A 5AUPB 2VPPA 3JVVA 1ESMA 1XXHB 1KJYA 4BQSA 1EWRA 2XNDA 1XEFA 2DWPA 4EFLA 3U7EB 3KQLA 3FMFA 2KWIA 1Z0AA 2ZVQX 1E79A 4B35A 3QG1A 3ZD6A 2NZ8A 4LX0A 2B8TA 1A2BA 2QG6A 4PFSA 4RZXA 3CPJB 1RZ3A 1Z6TA 4LBZA 4YMVA 1OJLA 3KB2A 3QPWA 2ZUBA 2QA5A 2XTNA 3R8FA 4DLXA 1IN5A 2GVZC 3IKJA 1UBCA 2JLWA 2Q9BA 3S1AA 1CF4A 2IS1A 2XTZA 4PAOA 4B3DA 2ZANA 1GVNB 3K09C 1NVUQ 2BBTA 2PEZA 2WV9A 3MWJA 3G0HA 1JQJC 3THYB 3CZQA 4FIDA 4HAZA 1W5SA 5BXQC 2CL7X 5CK4A 1WBBA 4OK3A 4RKFA 3RS0A 4DT1B 5CB6A 2BCJQ 2HYDA 1T3SA 2RGDA 3K0CC 721PA 5C1BA 1PLLA 2ZE6A 2NG1A 3LV8A 2WWGA 4AYTA 2IXEA 1EGAA 4BFXA 1NVXQ 5CIQA 3TSWA 5JLJA 1U9IC 1T4GA 4FWIB 1H8ED 1XB2A 4A0HA 1R0XA 1IN4A 2ZJAA 4LUCA 1D6JA 4PSKA 2G77B 4D81A 3I92A 4XWAA 4CIDA 2GXSA 2W00A 3THWB 3CWQA 2FV8A 2VSOA 2IYQA 1PZNA 3NG1A 4C0LA 5CDFA 1KSHA 4DSUA 2H57A 3CRMA 1N5IA 3CRVA 4A6XA 3GFTA 3D8BA 1OIVA 5LB4A 2RGBA 2QAGC 2O8EA 1U0HC 1N6KA 5BYKA 3A6PC 3VNUA 2GF0A 2ZRMA 5KO2A 1O87A 1QHHB 2ZSBA 3KFXA 4M9XA 2D62A 1U8AA 3U7GA 2Q3FA 2ZRBA 4R2HA 4JBXA 4D26A 4NONA 1WF3A 1Z08A 2W0SA 4OI4A 2O8BB 4P33A 1FZQA 2WSSD 2W6JA 1CRPA 2BM1A 3AVOA 4CZ2A 5TMPA 4TZ6A 2WWWA 4BZPA 2VL7A 5TB5A 2V6IA 2B6HA 1S9HA 1T6NA 4LHYA 1UFQA 4OQLA 1OFIA 3KKPA 3IDQA 3GD7A 2F9MA 3ADDA 1G18A 2G88A 4TQAA 3BB3A 4ESHA 1E2DA 4WZ6A 4QBHA 1E99A 3FHOA 2X77A 4KHZA 5L3QB 5H8WA 3LX8A 1II8A 3M0EA 5HE8A 3QPUA 1U0JA 2WIBA 3KZ1E 3Q85A 4HB0A 2F43B 2J7PA 4V0MA 5EP2A 1CP2A 1G6HA 2VHUA 3P32A 4LBYA 4Q01A 4YC7A 1G8PA 3SBDA 3LBIA 4PXAA 2J46A 1MRNA 1FQKA 4UQOA 4WXPA 4F91B 1MO3A 5GADl 5HTKA 3VX4A 2RGXA 3I8XA 2WWFA 1GKUB 4NYIQ 1X8KA 2BDTA 5FR1A 5CITA 2DR3A 4R9UC 3IGFA 1SXJC 3HJNA 3BAFA 3OEED 1SQ5A 4M9ZA 1TF2A 3CX6A 2ERYA 3Q7PA 2G0NA 4D4KA 5DNYB 2RGAA 3KXLA 4PQFA 4B3XA 1KDTA 4JKYA 2EU8A 3LVQE 2NPIA 3O8RA 4NBSA 3RAPR 4C0BA 2OCYC 3ZLJA 4PZYA 4GI7A 5FBWB 3ZVNA 2VQSA 1OB2A 2QE7A 4HB2A 3NBXX 5GJCA 1KSFX 2VTKA 1L8QA 4P32A 4E07A 4Q4HB 1YQTA 2WJIA 4CEHA 1ZNXA 1YR6A 3FKSA 3ZS9A 1NLZA 4KU4A 4DDTA 5TDHA 2ZE8A 1QHNA 1KGDA 1EFHA 1XCGB 3LW8A 4NE2A 1W7AA 1E98A 3G82C 4OJKA 1KSJA 4Q4JB 2ZREA 1E2GA 2WKPA 4JLAA 2WJHA 5FUXA 5DHFA 5BN5A 1AGRA 4JT2A 1S1MA 5B30A 1KI6A 1LS1A 4OL0A 2PH1A 5L8VA 1SULA 3WBKA 3GJ0A 1ZNZA 2GZDA 3OE7D 4BFTA 4S2EA 2KI5A 1NIPA 1U2RA 2CHQA 5KPDA 4C7OA 3CF2A 2J1LA 2MSDB 4NCNA 4ZDJA 1XDBA 1AZTA 4M53A 4V0NA 3AM1A 5FBRB 2HDNB 2BMEA 4LYFA 2GF9A 4JVMA 3AP2A 4Q1CA 1IY0A 1PJRA 2VF8A 3IPYA 4PHTA 5JWOA 1G19A 3C4JA 2GEUA 3FPAA 3GEEA 2AK2A 4QNMA 3EW9A 3QKUA 4FCWA 1ELOA 2C99A 3A58B 4M1SA 5L3VA 3OESA 4DSOA 5JJLA 1GIAA 3I73A 1I4TD 1DS6A 2PEYA 3A36A 2ZI4A 3ZDQA 3LAWA 4OHXA 4TL7A 5FPYA 3AVWA 2H7VA 5JBQA 5JJIA 2GJSA 3N2IA 1KK1A 1P60A 2CVHA 4FD2A 4CW7A 3LQRA 4OI0A 3H84A 1FTSA 3ZIAA 4DVGA 2PZGA 2XNDD 2UVQA 4XSHA 5HCIA 2CXXA 1QHYA 3DKVA 1W49A 2FMXA 3RSLA 3K09A 3PEYA 4CVNA 3AQ4A 4BRWA 1LV7A 3C5CA 4NU0A 3QSYA 1SKQA 3OF5A 4EJSA 2A78A 2O52A 3B7GA 1XMVA 3X1DA 1XTJA 4NL4H 1DG3A 4DZZA 2I3BA 5GJVC 2ZXUA 4Q9IA 5E7IA 1QHGA 1WB9A 1IXZA 4C7OB 2CCKA 4HSEA 3TRFA 3CH5A 5FH9A 2PLFA 1P7CA 1G64A 1LTQA 4NP6A 1Z83A 1YKSA 3GFOA 1II8B 4LY6A 4KVGA 1JR3E 2FFHA 3LRPA 3L82B 2WZQA 1Z0JA 2ZEJA 4B73A 1HUQA 5E95A 1ZAKA 2WKQA 2ZRJA 3FYHA 5C4GB 1OB5A 2W2XA 1Z63A 1GNRA 3NHBA 4XTCS 3EIQA 2ZR7A 2X8AA 4PHHA 3ADCA 1OW3B 2FPLA 1S0UA 2JJ2D 1XD2A 4OYHA 2FSGA 2WOOA 1EWQA 3WRXC 3WNBA 1CJMA 2WWIA 1E1RA
chains in the Genus database with same CATH superfamily
1DLJA 1OJ7A 1SWWA 5LXTF 3PHIA 5IN4A 2JAOA 2WKWA 3PFKA 5AT1A 4ND7A 1K75A 1LD3A 1ECBA 3ETLA 1XTRA 3V4SA 4PAMA 4J4BA 1ZXXA 2RHBA 1NOKA 3BGDA 4QGGA 3V8MA 4I1UA 1SD5A 5CYGA 1EXNA 4B8ZA 1ST2A 4WZBB 1DRUA 4QQKA 1KI2A 2NU7B 3U1VA 2PJUA 2WU0A 1M6WA 4YCBA 2IEDA 3DEHA 4ZP1A 1XMOB 3NWEA 1F5NA 2AYXA 2GXQA 1FBNA 2QQ0A 2WUVA 1K3TA 4HDOB 4KO8A 4UD2A 3WMXA 4BCDA 2P2CA 3NR2A 2CL6X 2Z98A 1MUUA 4INAA 5AW7A 3FTFA 3IYLW 1SGWA 1AXGA 4DCJA 4UOZA 1PG0A 3ESQA 2ZVPX 4GNRA 1V5FA 4DDKA 3UQZA 4B3CA 3GBVA 1OFHA 2JA1A 1FA9A 3R3XA 2I3ZA 1N5LA 3CT6A 4A4DA 2JD2A 2IUEA 4JVSB 2YJTD 2W0MA 4OY3A 3UAZA 1Z73A 1JKJB 4FDAA 4MRPA 3VV3A 4II2A 4R2LA 2PJZA 1AK9A 3GCXA 3AHEA 4IJMA 2FEKA 2PL9A 3HC7A 2AG5A 2EGUA 3H99A 2J9RA 5KAPA 3A1SA 1TZCA 1CZLA 5JAZA 4FYPA 2J5BA 2NZJA 4XRRA 4R71A 2P8JA 5BQPA 2W6JD 4NULA 1JU4A 2PRYA 4N7BA 1FFHA 1X87A 2HWWA 2J9YB 2XMDA 4P34A 3RUAA 5A03A 3KJQA 3EGCA 1AS2A 3EXHA 4ZVOA 3PA8A 1XCMA 4K9QA 1FRQA 4TKVB 1JEOA 1BEZA 2JI7A 3VHLB 1WAMA 4DDWA 3IIIA 3L8FA 4J0JA 5BRNA 1JHRA 1E7WA 3RASA 3K53A 4W9RA 2JLXA 4ONEA 1QAQA 3OLQA 2XCRB 1RSZA 5BMVB 1EVIA 2OSVA 2IZ7A 3KDAA 3WJAA 4D57A 4Z7QB 3ZUGA 4TXNA 4IWNA 2OMEA 4I6GA 4NK4A 2OA0A 4QT4A 5JH7A 3HDGA 5JZBA 1KARA 4CIYA 2PRZA 2IITA 2QPTA 5LD2B 4NWIA 1WDLA 1VL2A 2N1BA 2B4AA 3U48A 4W5HA 5EYPA 3WLOA 1N2IA 5AW6A 1DBSA 1RM5A 2R8PA 4OAPA 3LBHA 2JLUA 5IYZF 1FSPA 3SQLA 5BQ5A 3GP5A 2O54A 3SDBA 3JCZA 3PXAA 1VL1A 2FF5A 4UW9A 1TRKA 1M66A 2FRVA 4XGQA 2FI1A 5DFAA 5G3ZA 2PLAA 3KKNA 1QV9A 4AUMA 1OGYA 1WSWA 2Q49A 3KYBA 4J0CA 4BX9A 1L8OA 2N9UA 4IDNA 5BNZA 1OXTA 3WWZA 3L3BA 1R9MA 4IPTA 3ILSA 1GPJA 1ZITA 4IHJF 1YFZA 3VYUB 2ZBRA 5THQA 2C61A 4ZQFA 1E6EA 4P7BA 1HK7A 2HLNA 4BKQA 1VBMA 3AWIA 3O7WA 3PUKA 5ALFA 3N2LA 2GJ4A 4IDPA 1AQNA 3O82A 2GZSA 4G1EB 5K3SA 3OM9A 4ETMA 5ELXA 1KJWA 2CE2X 3HFRA 2PUGA 3ZWCA 2BKLA 3H9GA 3BEOA 4MRSA 1YUBA 3KEOA 5INTA 1VIDA 2QE7D 3WIEA 1BVUA 1OLUB 3A3KA 3BL6A 3I1JA 3AHDA 3IVRA 3KYIB 4L4SA 5JBNA 3EOAI 1P0PA 2G04A 2Y0EA 3GT4A 4HZIA 1J1UA 1P6UA 3FKSD 1KK3A 1HT2E 4L4YA 4LDRA 3ABQB 5GWXA 1E9CA 4QXQA 3V97A 1JQ3A 1N77A 1F51E 1HQCA 1GYPA 1BD3A 3F2IA 2B35A 1JIUA 1PQPA 2IYUA 5KQRA 4HAXA 3Q0EA 1E6LA 4PYKA 2OHFA 3MJRA 5EZYA 3ZLBA 4EI8A 2AQHA 2IIPA 3AHFA 3ODGA 1I4OA 4LKOA 3E61A 3OJCA 3W4IA 3ABIA 1RLOA 2XYPA 3E9MA 1QTRA 4NK5A 1HNNA 3DBHA 1RT9A 4ZI7A 1XO1A 2HSJA 1WHTB 1EIWA 3AFOA 3H0KA 3UA3A 2IXFA 2JLAA 1VLQA 4JHLA 1U99A 4Q7JB 2VDNB 2WFMA 3OE7A 1NW9B 4KXYA 5CLJA 1UC5B 3ZLTA 2F43A 3MT0A 1N7JA 4MWTA 3WK8A 1L5HA 1FYWA 4HWGA 4K6OA 2ZPUA 3P0RA 4XDGA 3ZWNA 3QF4A 3P0FA 9ATCA 3BILA 2AR9A 3PRJA 3G3EA 4UNSA 1JG7A 1ZOOA 4MV5A 4DG9A 4Y18A 9ABPA 1GPDG 2F4NA 2G07A 2AEMA 4CLRA 4JYBA 1H69A 5AOCA 4RTSA 5T5QA 5CYFA 1YQWA 1XK6A 1ONOA 2OMKA 3ND8A 2AR7A 4UDNA 1V25A 1ID1A 2FPKA 3LQ4A 3RFFA 1VJCA 2P6UA 1XMQB 1OB2A 3DEAA 1J2RA 3O4RA 3BHJA 3WYCA 3CKKA 5BYJA 3RSFA 5AI4A 1SKUA 1UPTA 3R7WB 3C3PA 5ISMA 5B1DA 4ZEXA 1OXXK 3JVDA 2X0DA 2FFBA 1FL9A 1XTBA 3P9NA 5E8JA 2B9VA 2QAGB 1TT7A 4JNCA 1XN1A 1UFRA 4XA8A 4X6LA 4YRZA 5C5CA 5GONF 1LJ8A 1V35A 3MS2A 5SY6A 2B1GA 3RK4A 5H82A 3HKDB 4IXMA 4MP8A 1L7BA 4ZU1X 1P2SA 2C9ZA 3JWPA 3UWDA 5BVHA 3ZU5A 2XE7A 1JG1A 1P45A 1UBRS 1LC0A 4D4IA 5ARBA 1OBCA 4L78A 5DHUA 2DWUA 3A4LA 1XDDA 2WIGA 1OI3A 4AP6A 2PZLA 5DI3B 4UCQA 3GN1A 3GLQA 4JI7B 3PQFA 4JBWA 4JBNA 3WQHA 3FCEA 2EZTA 2VHCA 3JRXA 1UMDA 4KQXA 3TOCA 3W9SA 4IS2A 5DNUA 3UB2A 1GPWB 4F2HA 5E4TA 2YV1A 4CGYA 3ZY3A 4RADA 4E33A 1ZUNB 2J7KA 4BP3A 2H1IA 3NHFA 3F9IA 4NOKA 3WRXA 4PF1A 1IBKB 4I4TA 3R3UA 5K09A 3T7DA 3BQNB 5ANRB 3I1FA 2OFPA 1JB1A 3QKTA 1HC7A 1W4ZA 2J9XB 2QZSA 4B3SB 4G81A 5JS2A 4EAAA 4M0CA 4YHBA 4MB0A 2BFCB 2X9GA 2ABWA 1HTTA 1E4OA 1DRVA 1XZFA 2APJA 2A5FA 2FHPA 2MDTA 3DT9A 3IXLA 4DA9A 2WP8J 2LKDA 2O2ZA 1AH2A 3GROA 4UVGA 3T4UA 5FUVA 1I32A 1KJ8A 1J8YF 1P0IA 1PWXA 3CJQA 4TQ9A 3TVYA 5LD2C 2JJ2A 3CV3A 1U31A 2P7IA 1AB6A 3VHXB 4XDYA 4DDMA 5H0IA 1QPBA 3G8BA 1GSIA 3W4KA 1PX0A 3IPCA 1MO6A 3CNEA 3WYGA 5KREA 3MUNA 3ANTA 3IIKA 3R0JA 1KWKA 3AUKA 3NHJA 4D82A 1YVDA 4KQIA 1PJTA 1DAFA 5LZ5A 3G2QA 4DJEC 2R8RA 3DO5A 4D3SA 4WKOA 1RRKA 5EZ6B 3EQ9A 1K2WA 1Z34A 2A9PA 3HXLA 3Q7IA 2ORED 2DT5A 3CLSC 1Z5PA 1XZCA 2K2QB 1EHIA 2XI4A 2Y0PA 4I46A 4EJ6A 3N86A 3Q5EA 1F38A 1Y63A 2I34A 2PKQP 4JA0A 4MQEA 3SZLA 4BJ3A 5HFAA 1E4VA 1YNSA 5IM4A 1JWLA 3R6WA 1XG5A 4F6CA 3KQNA 4BWYA 1XKQA 3AP3A 2Q4EA 1Z4PX 3K72B 3QUQA 4PFJA 4HMPA 4C0HA 4DRYA 1Q0PA 5FOVA 4WOBA 5KOJA 3T3NA 1W4LA 4DMCA 1PHPA 3MTDA 1YMQA 3OZIA 1G9SA 3LKDA 5E6SB 4FLMA 3CLKA 2FWIA 4FONA 4OKIA 2J5RA 3A1UA 1XQVA 4A0FA 2FW6A 2ZM5A 2ONKA 3A70A 2BKUA 2OILA 2CDCA 3EIHA 4LSWA 1OFUA 5IK2A 1F3LA 1LDNA 1OX5A 1TU3A 2E4WA 2XQGA 5CNMA 3DMFA 4YH1A 2YZ2A 1B1CA 5U1PA 6REQB 2DETA 4WUTA 1JHAA 3DL2A 1U1IA 2NGRA 2DX7A 1QGUB 1JR4A 2GWRA 2R7KA 3EOZA 1SXJE 1Z16A 1V3TA 4MVJA 3SYKA 4R2XA 3D7LA 1KQGA 4B34A 3A06A 3OTWA 1ADGA 1I2BA 2HA7A 2OSBA 4GMFA 1WZUA 2EQBA 3QLUA 1NVWQ 4X7RA 3V4FA 3PK0A 3WKEA 4BO4A 4UVEA 4CDRA 4DS3A 5HYVA 1MN6A 1MVNA 5EP1A 3TINA 4YJ3B 2IWHA 2XUGA 4XSVA 3BWXA 2FZWA 4EPYA 5CU7A 3RC3A 1ST3A 3PA6A 4KMMA 4RF2A 3TD2A 3ON5A 3PQ3A 5AJZA 6ADHA 3V9PA 1P81A 3G0DA 5FL7A 2V55B 5IXYA 5BT9A 5FKJA 3G6KA 1X80A 1H2YA 2VHEA 2YHSA 4HDQB 3T0IA 3SM3A 1RE0A 3LWBA 3E35A 5EHXA 3UUGA 3FOZA 2DY0A 2VTBA 2QLMA 3NAZA 1Q74A 1GQOA 1XA3A 5IS2A 2G71A 2A0WA 2CJFA 4ZALA 1UBOS 2PD3A 1ULUA 3V7YA 1YHZA 4R4JA 4RK1A 2UUBB 1AQLA 1YS7A 3MK31 5CH3A 4U2KA 2ZJ2A 3A7EA 3OZTA 4OA8A 1E1DA 2VNJA 2PFKA 3GOHA 4FVTA 4DV0B 2P0YA 1XTKA 4MUBA 5CFMA 1KDPA 3N2KB 3R2JA 5F5NA 4N01A 4AY5A 1TYZA 3NAQA 2BWJA 3OTIA 4ZPXA 3LM8A 3C6KA 4LXHA 3TN7A 3CUKA 5ITVA 1TM4E 1YNOA 5UKDA 1XZLA 2LDBA 3GUUA 5J2UB 1USIA 2ZSDA 4Q1BA 1DKRA 1QTIA 4DIEA 1JA9A 3CLRC 3RVJA 3RRBA 2EARA 2ZJZA 4PZLA 4JC0A 2ECFA 2VYVD 3Q2OA 5E7JA 2Q7OE 4DBLC 4YMHA 1EU1A 3GP3A 3AXSA 4NHEA 4CPDA 1V48A 2QG4A 1KXZA 1C4OA 1Y48E 3H2GA 1B76A 3ROTA 1D7AA 2CVOA 4KXFB 3O5AA 3NGLA 3V80A 3K32A 3QLVC 3SXUA 1PYGA 2QT0A 2C3OA 3CLTC 2GESA 4GRDA 4MJ7A 1Z38A 4PSCA 2EX0A 5ALJA 2WFZA 4C5BA 1M1ZA 1XXHA 1SCJA 1SUSA 2VEOA 3GJXC 1IULA 4H7DA 3VBCA 5JS8A 3B1JA 3CMMA 1V43A 4K40A 4BZZA 3EISA 2A9FA 4Z54A 5K4HA 3T1QA 3DXZA 2XUZA 1JJAA 2JEOA 3KZMA 1G8YA 2BFBA 2R6JA 5LZ4A 1UM8A 1LBTA 5P8WA 1DAGA 1FNMA 3Q9LA 4LI3X 3AF1A 3WLQA 5AW3A 4NAVA 5DSZA 4EY6A 1TNDA 1JHZA 5JVDB 2O8EB 3AX6A 4S35A 3ZQKA 4ER0A 5IVIA 5IDXA 2QW0X 1ZQ9A 1KH2A 1FVFA 1H5NA 2A2ZA 4FGKA 1H8HA 4GS5A 1Y4ZA 3TYXA 3COZA 1X1TA 2OO3A 1IJBA 2BL4A 3GHYA 2VZ8A 4IXTA 4FZ3A 1UADA 1HT1E 1ZGJA 3BSFA 3GN2A 2NU7A 5D5PA 3T94A 1NLYA 1QE0A 2R00C 3CR3C 3P9IA 2PKQO 4GD3Q 3LBYA 4TKLA 3RSGA 4AS3A 1UCFA 3AI7A 3RJ5A 5LP6A 4MV7A 4X95A 2PMKA 5EY5B 3T3EA 5TLSA 1FDOA 3BMCB 1R4ZA 1NVVR 3UFXB 4WZAE 1EZZA 1BCRA 1EFCA 4BRZA 3TCNA 3FDXA 2WILA 3AYZB 4IIBA 2VNAA 3D7SA 1E9RA 1G1MA 1M75A 2WF8A 4BIMA 2ZUCA 1R16A 4DIOA 2R8BA 4LCBA 3HXMA 1ADCA 3ICEA 1RYMA 1USVA 3ND7A 3ME5A 3MMZA 4RHFA 3V1LA 3IP9A 1C5KA 3A9UA 3D6TB 4ESOA 1MB2A 3TQTA 1BH2A 2FUG1 2O2SA 3DCJA 4K6FA 4A8HA 4QL3A 1JLLA 5DP1A 4UCFA 2WQ7A 4ZFNA 3I9OA 1Q5PA 4G1UC 1ZGCA 3KUDA 4ID3A 4BTEA 4JSRA 1LPMA 3FFBA 3IBYA 4KE7A 3X1JA 3W79A 2O7RA 5TGTA 1O2DA 4HWOA 4YP6A 2XIQA 3K6JA 3M70A 5G4LA 3WLIA 3FPFA 4LNAA 1ADYA 1J24A 1GTJ1 2Y68A 1YR1A 4BLWA 4UUPA 1VJGA 1GFSA 3KU1A 4R1NA 3WJ2A 2VH1A 1V1RB 2FMFA 4ZYUA 4YQZA 1FP2A 5FYDA 5FJJA 4KACA 5C4MA 4JLDA 3OOHA 2HA4A 2VN8A 5DYGA 2ZUEA 3G5LA 1YDMA 4WY8A 2C7PA 1KZGB 2ZYGA 1Z47A 3OUTA 4NEQA 5DU2A 4A82A 2XGOA 4PSUA 3A1DA 1L5MA 2YYYA 2QORA 2I4LA 4ME6A 4DCGA 4AQ7A 1WUYA 3AKCA 3M5CA 1CJBA 2IUTA 3NHLA 4G5XA 3O8CA 4GG1A 4LZWA 3V2HA 4M8SA 3KWLA 2REOA 2E0IA 1XJWA 2IYEA 3B48A 1OT3A 1NWHA 3TF5A 4LRTB 3E53A 3FPLA 1WD5A 3GRYA 3KAKA 4HQNA 4AF8A 3D64A 4FMDF 3WOHA 4CKCA 1GG5A 3D3JA 3VDXA 4CI0B 3L43A 2GLTA 1UJBA 4BPRA 5KSWB 2PT9A 4ZV9A 3GUVA 1EDDA 1R12A 5CNJA 3T3DA 1L5RA 1T0JB 4ZIRB 1PVOA 4NEGA 3IAEA 4LRWA 4QICA 5CT9A 2DUWA 2EQ5A 1ISJA 5EHZA 2WYVA 1AJEA 2AQIA 3MTAA 4UU0A 2X5KO 2VJPA 3O4IA 1UPXA 2PO5A 4LXGA 5DM1A 3RS8A 2CJWB 4DM4A 4U8GA 2YS6A 4JUBA 1V9LA 2AN9A 5ALEA 5E7QA 1E3LA 4MPPA 1WDTA 1IU9A 1ODJA 2O4CA 1X2EA 2WTNA 3ETHA 3QW2A 4ND1A 5B1IA 3ZZNA 1Z4QA 5IASA 4AYWA 3E6AA 3GFQA 1V1MB 2H4YA 4DF3A 1PZMA 3PGKA 2ZYIA 4WDRA 2QV0A 5YASA 1AE1A 2HSEA 2WHYA 3DD5A 1SXJB 4HXFB 1B14A 1WMAA 3S2IA 3TLYA 1XWWA 3C6QA 3GLGA 1JNYA 3T3GA 2UXBB 4KR3A 4OSOA 4CF5A 5IABA 1CUDA 1FC0A 4LJ6A 5F1YA 3L7DA 4MP6A 2WU1A 3ZKWB 2EAUA 3ICWA 3ELBA 3L5OA 3EXEA 3P9KA 3LDAA 1L1RA 3LO5A 2XQJA 5AK0A 4WBXC 4CF3A 3STWA 4M83A 3E9DA 3RVMA 1L1QA 1KC3A 1RAGA 4NV1A 4WERA 2G40A 2H48A 3MBKA 2CNWD 4MDYA 3W4JA 4OQZA 4AN1A 4BTVA 7YASA 4FDMA 4ZYZA 3REQA 1Z4OA 4IMRA 2DHRA 3UANA 4M22A 2PANA 1ZK4A 2PWPA 2Q0SA 2VPTA 3CW9A 1XVUA 5CM9C 4DUGD 2BGWA 1FRZA 1Z22A 2AMYA 2VJAA 5FL7D 1JJIA 3RNOA 4M1QA 2HJVA 1B6SA 2GI4A 1S96A 3LSTA 3P9SA 1QFZA 1U2ZA 1KP9A 5KWVA 1A4UA 4FDVA 4MV6A 4F8YA 4O2RA 4H31A 1VCOA 5H1YA 5F51A 3EG5A 4BLVA 3QVGB 2QTZA 2Z3ZA 4DJJA 4E70A 2BF4A 3C7KA 1BD4A 3CSUA 5CNIA 1UBTS 5D1HA 2XYHA 4MIEA 1TCCA 1ZFNA 4N54A 4IHKA 4M76B 2J4FA 1QK5A 5TSDA 1VKNA 3TXXA 2WMDA 2YHBA 3L0IB 4N5NA 4W4TA 1RRMA 2C94A 3JATB 3MINA 4TMVA 1G6Q1 4TKUB 5E6RA 3RAEC 2PG3A 4H3KB 4ZVKA 3IAM1 3QE0A 3JYLA 2IZZA 5JMWA 2WSIA 2D3WA 1T25A 3HB5X 2RGYA 3RE1A 1R6UA 2ZDQA 5EN4A 4BE7B 3PJRA 3ZX5A 3B1WA 3AEQA 4EY5A 4I8DA 1UBJS 3B3QA 4B2YA 1G66A 4LSMA 4XD7D 4ZV4A 3MHTA 1CUHA 1DQRA 1Y8RB 1GFIA 2GWHA 3LGAA 2FFQA 1J8MF 1UWCA 2G72A 2II6A 4HN2A 2A30A 3ETGA 3SP1A 5A3VA 4MYUA 1A72A 3IOBA 3JRWA 3P97A 4TKMA 3ZXUB 3EARA 4P98A 1GPLA 1X8LA 2NZUG 4U7TB 4QELA 2A5JA 5AXAA 4B3FX 2QZJA 2DB3A 1UPFA 1CJUC 3LCVB 4DDHA 3U3RA 3A37A 5LIRA 1Z5GA 2HBZA 4TLAA 3RSCA 1H2RS 4YT2A 4R40A 3R9WA 1YS6A 3R9XB 2ZUFA 2OHXA 3B85A 2BAGA 4DLKA 2RBEA 3EQ8A 5K5EA 3VR3A 3OD5A 1UAAA 2V1UA 4QE3A 3RNLA 2CDAA 4Y1RA 2Z5FA 2WYHA 2JI8A 3VU3A 3L07A 3HVJA 4DYVA 1G9XA 3I4FA 4PX9A 3L8CA 2AV6A 1DDIA 4JJ8A 1FNBA 3OC6A 4PXSA 3V3KA 5F3WB 5L7TA 1TUIA 3FCXA 2IEYA 3O8LA 3Q7SA 4GP7A 2W2LD 1HO3A 3C8UA 3CGWA 3GT3A 4KX5A 4XQEA 2IWRA 5HQTA 1ZBQA 3PLAE 4LNUB 3ZJ5A 3C24A 1BXKA 5BPHA 1QWOA 2NXCA 4RE6A 4BHTA 1H4SA 2AJDA 3GUZA 1P9WA 3PNOA 3Q8XB 4RH0A 1XC7A 1KAOA 3HCPA 2FE1A 2HCRA 2VRWA 5FQOA 5IUKC 1L7XA 2BIFA 2XDAA 2F4VB 4KPYA 3D6NB 2YV3A 1P0CA 3ICVA 4IV0A 4YAOA 3OLCX 3EUAA 1LFAA 1LLFA 4N0DA 2PGAA 4A0GA 4EABA 1ES9A 1H3NA 2V7PA 4C4TA 1DBIA 4F5YA 2W8ZA 5JO9A 3JR3A 3FCUB 4J16C 4NU8X 2ODNA 3ABRB 3DDWA 3E5NA 3DBRA 5DYYA 3RV3A 4YAKA 1EYZA 5BWOA 1EVLA 4JDPA 3ZZ1A 2QM8A 3L9WA 1VFPA 4BU0A 4F06A 3RC8A 3IP1A 3JAWA 1BXGB 1CEYA 3A11A 1EBFA 1N3LA 2GM5A 2JGDB 4HB4A 4JROA 5ENVA 1R0BA 4YUXA 1T34A 3V48A 1KO8A 4WINA 1BZYA 2QE6A 1A77A 2YWXA 4BV8A 1PV2A 3PXCX 5B1EA 4XGIA 4Y2XA 2E48A 3HO8A 4NBWA 3EXEB 4IOKA 4XKJA 2F1JA 1PNVA 1J06A 4GXQA 3D02A 4P3OA 4UTVA 3CTPA 3L7MA 2QX7A 4AF7A 2K2WA 3BCRA 3KO8A 1LRKA 2DPGA 5DTEA 3UKJA 3BBLA 4YFYA 3QVWA 2I7CA 4H3HB 4OL9A 3YASA 1CZUA 1GQRA 2NOAA 3MRVA 2E21A 1KEEA 3QG5A 3UJNA 4L9AA 5IRCD 2JLBA 4EHFA 3BXFA 2DE0X 1E0JA 2I1QA 4WSOA 1RHQA 3H5NA 3MWLA 3PFBA 5B58T 3VR4H 1H6BA 3CZRA 5JEDA 1USKA 1FZTA 3R5HA 4YRBA 3MOIA 2JGRA 1T2CA 4DV2B 1QGED 2VBCA 1TTTA 3DZDA 4YFVA 5JSYA 2ATVA 4A0RA 4TV9A 4ZEWA 4OVKA 2GNPA 4IZIA 1K4KA 1S7GA 4LJKA 4QZVA 3EC2A 4Q1EA 2P9FA 2Q1YA 1ZAYA 1B6RA 4E15A 1C1YA 4WEOA 1PV1A 1AKMA 1Y5NA 1QVAA 3WYAA 4NZNA 3OEEA 2KM1A 2QZZA 3GW8A 4XVCA 4RGYA 3IUPA 2F8MA 1P33A 1V7ZA 1MC4A 1JGTA 1Z15A 1I7NA 3DR3A 4ZD6A 3UWOA 3ZC3A 3CF4G 4N6OA 1NY6A 5CAEA 4RKWA 2X41A 16PKA 1O6CA 2IQ5A 3WKDA 1M2JA 3P71T 2O0MA 4TTVA 2OAEA 1S8AA 1DJPA 2W6MA 1OZ0A 3NTRA 2J0QA 4MWDA 5IDYA 4FYYA 1UM9B 3LTEA 3DC7A 2CUKA 2YY7A 1Y4SA 4L74A 2OZLB 3L46A 2ATCA 1J6UA 2O2DA 4KSYA 4DNFA 4Z1MD 2YHIB 5KS2A 1CR6A 1ORTA 1SOVA 1WVIA 1CRZA 1Z6YA 2W37A 2WHPA 1V37A 1UFVA 5B6PA 1UZMA 2KMLA 3IAAA 3QVMA 2ZSEA 4FNAA 4QECA 3RM3A 3N59A 2WKSA 1TK3A 3N0XA 5AVJA 3SX0A 3W8NA 4CKBB 4BNUA 1VP9A 2X7HA 3ZHSA 1XNHA 5GP1A 4BV3A 1N2XA 1QVVA 4QUEA 4XAQA 3UJ8A 4DCMA 3K9GA 1E69A 3I61A 1AKUA 5TS3A 1CDDA 2VWQA 4FZ5A 2PX3A 3PGXA 3AZOA 1E2JA 2IS2A 3O8OA 2EX4A 3EQ2A 4LIPD 1BXZA 1LBEA 3ETEA 1M1XB 1OZFA 4MH0R 5SZJA 5BR1A 3ZR4B 5CFPA 3VDMA 3CR8A 1IZ7A 4QUGA 4YASA 4L2IA 1UWVA 2WWXA 1YR2A 1GSHA 1ORHA 2A9JA 5FPSA 1D0SA 1XN4A 3HKCA 3KT0A 1KYVA 2XSZD 1U28C 4I14A 1JT2A 1KEWA 3JZFA 4QU9A 4P6VF 4RXTA 4C3OB 4ENVA 2ZZKA 3SZMA 2WAXA 3O94A 1YB5A 2J4CA 5K8CA 1K8XB 2IPNA 5C8YB 3NKLA 5B57C 1JDNA 1MTZA 5A62A 1C41A 1EZ1A 2ACWA 2LIPA 5EXEA 1L7MA 1XJ5A 3B1ZA 3ZLUA 3E3OA 4EDFA 4R31A 4FCVA 3T4XA 4ZHQB 1OLSA 1MABA 3B1KA 3LC0A 1JBEA 4KREA 1U5CA 3NH6A 2NU8B 4EKNB 3Q1KA 2FGKA 4FSHA 4G8BA 4CLXA 1KFBB 3NEYA 4IBOA 1WCXA 2EZ8A 1IK6A 4NCKA 3ZGOA 2V4UA 1X15A 4OHPA 2LRHA 3TNDA 1XZPA 2IGTA 2QN6A 4GO1A 4DQKA 5GOZA 5A9RA 3P94A 2DLDA 2BELA 1YR3A 1KH1A 4KI0A 4MVXA 1CDZA 2DWOA 1FP1D 2UVDA 3WWPA 2X14A 3SJCA 2B61A 4G0QA 2H08A 5DKFA 3W6ZA 1Y9ZA 4EJSB 5KYXB 3GLKA 4YEDA 5DEOA 3RFUA 4TZ0A 4LRYA 5DWVA 1NF2A 3FB4A 3O3OB 4Q82A 2WFLB 1JEQA 3OHPA 2XXBA 4MRNA 1XAIA 2FH5B 2HNBA 1D1QA 5AUQA 3UH1A 2OGZA 3K0FB 4U00A 1C3XA 3IHLA 1MT3A 1TYCA 3QKSB 1KSGA 5JRZA 3PS9A 2BGUA 2EGHA 2V7BA 1KU6A 1ZVKA 4PEVA 5EQTA 1NUSA 4JVOA 2WIJA 1TQ6A 2DHQA 3P2YA 3R3JA 2BFWA 1MT0A 1ZIDA 1OI2A 1N57A 4IGIA 4KE6A 2XA9A 4US1R 2AK3A 2KS6A 4O59O 2DM6A 2XEXA 4IIJF 4QSMA 4PYOA 1MAWA 2LR0A 2A3RA 1UBLS 2PVSA 5HOEA 4NHOA 1TEZA 1GRQA 3NFRA 1VSTA 2EFDB 3LO8A 4UPEA 3I4CA 2PWAA 1KKUA 5B3LA 4PIMA 5CXSA 4FR2A 2GTPA 5HFJA 1TIKA 4V3BA 4HLDA 5CB4B 3BHNA 2K87A 3A0RB 2EBHX 5HBRA 3INTA 3OQ6A 1L5NA 4MR8B 4AIRA 4PPNA 4RQAA 5CCXA 2VT7A 2FQWA 3HU3A 3CS3A 3RSQA 1EHYA 1E3JA 2VDRB 2OYSA 1I1QB 2WTBA 5ALMA 4KIJA 4BFZA 1M83A 2BCEA 2AD1A 4RENA 5KX5F 1RXYA 2A58A 2JFNA 3BICA 3IX7A 4YBRA 2CVFA 1OWOA 3DL4A 3G2KA 3WICA 1M5UA 3EUFA 3C98A 1SVIA 3F67A 3LJKA 2RG7A 4H6XA 1IRXA 2WD7A 3HLKA 4OLHA 4A8JA 5AD1A 3OQBA 3HJFA 5KAMA 4PYLA 4LJ8A 5THXA 1E9BA 4TWRA 1ORDA 2CLOB 4JNKA 1NJFA 4BOYA 4X8OA 1IONA 1P9OA 1COWA 1U1FA 2NTJA 2VNSA 4JLSA 1KE2A 4WXYB 2V9ZA 2BBWA 5CDFE 1SU6A 3LXMA 2Z1NA 1DIOB 2EZ4A 4GQBA 5H83A 3K7EA 4IDEA 1V11A 1W4BA 4EP1A 3B12A 4PE5B 4ZT6A 2ZJ0A 4CKEA 5C81A 4S3MA 3ER8A 1H2FA 4Q9NA 3TKYA 3GCWA 1ETHA 1LK7A 2A9QA 3F6EX 4EHAA 2AXPA 1ONSA 4CEJA 4ZRNA 3DDOA 1PT9A 5IN5A 2ZJBA 1IHPA 3C6YA 3IEUA 1X7DA 4HS4A 4O4HF 4YY3B 4V38A 2XGMA 2XZLA 1NQ5A 4ZCMA 1E2NA 1YZTA 4BP9A 1VLVA 1WEHA 5EIWA 1L1EA 1VP3A 4KWCA 3ELDA 2JFWA 1S2NA 4FD3A 2I4OA 5K1ZA 3VHQA 3WGJA 2VQFB 3OIUA 2MT9A 1OOEA 5BSTA 3UT5B 1CZKA 1FRNA 3U5TA 4GX5A 4RCVA 2D1SA 3G0BA 2CN1A 2YJ5A 2BKXA 4NF2A 4YN3A 4DR7B 3HA5A 1UP7A 1XYYA 4NNOA 4Z4QA 4GVLA 1HZZA 1L5ZA 1ZN7A 1WW3A 2WU8A 1GXSB 1LNQA 3AW8A 2BD0A 3E1SA 3MOSA 3U7RA 5FULA 1THTA 3SVZA 1N33B 2RHMA 4RIEA 4BGEA 1XRPA 2QLTA 3ZWMA 3VSCA 2A1IA 4KRYA 4BVJA 2C78A 3HV0A 3FLBA 2ZETA 2FAXA 1J1IA 1D4AA 4PR0A 1L5LA 1UK9A 2C7QA 5LYJA 2W2VA 1E5VA 3NM6B 4LOAA 4F2DA 4MA0A 2Y93A 1AGYA 5ALPA 1G0NA 4V02A 3UT5A 1ZJ5A 1RP7A 3M6IA 4LCJA 1Y3FE 1Z7YA 4RD0A 2V6FA 5IZCA 1SIOA 3PWZA 5TS2A 3WBJA 1MVOA 3QVKA 2I2DA 3CKYA 4TLCA 3BQ9A 1WCV1 3PTLA 1Y9JA 2D54A 3K8ZA 1PQUA 1SXIA 2ZYRA 4HVTA 3WRYA 1W73A 3E9RA 4GLOA 7ADHA 2R1TB 1EX6A 1AB5A 4C21A 4UUMA 3KNZA 5CHEA 3EASA 4GSKA 4HH1A 3EFEA 3TM4A 3S44A 4LMPA 2H85A 5B37A 2G76A 1W4RA 2G82A 4S1OA 5ENDA 4AZWA 2O9JA 1EFVB 2H5EA 4QAJA 4MKIA 1HFKA 2ANBA 3W5SA 3T5TA 1ECGA 2WWTA 4F3RA 3EPHA 1I24A 4V2IA 4QOSA 2VPWA 3KQQA 5EJ7A 3WKCA 2GN2A 1BS1A 2BUBA 3EVTA 1IOZA 1F5SA 4M87A 4GP9A 4ZJZA 1L5GB 1YB6A 2AW3A 4H4EA 3CBGA 5FWDA 4BO8A 1E3EA 2FLWA 5HZMA 5J4VA 1DC5A 3MB5A 4Y2VA 1IB6A 2ZIXB 1LBSA 2BFEB 2OAGA 3C14C 4JN6B 4O2LA 5AO9A 1U6KA 1PTJA 3RGWS 4DLBA 3C2QA 4HGOA 3IVCA 3R5SA 2QX6A 4ECEA 1TUEA 2MYPA 4RZQA 4GI3A 3ZTWA 2WC1A 5EI5A 2IYWA 2PL5A 3K5PA 3EGDA 3X44A 5I51A 4IIJA 4EH1A 2ZM6B 1UEJA 1TF5A 4MGEA 5CVDA 1ATZA 3DYVA 4Q7EA 5EKDA 4C87A 2GXAA 4K6MA 4JH0A 3R8CA 3NLLA 4E1AA 5E9WA 5AW1A 4ARCA 2P30A 3O8BA 5LLDA 1GCOA 3TLEA 3U31A 4CDNA 3R40A 2PUEA 2WA1A 1K63A 4MYHA 3VVCA 3ZE2B 1KWGA 2F8TA 4AJPA 4Z9BA 1GRNA 3OA2A 3T06B 3UICA 2H0AA 4EZBA 3JVEA 1I7SB 3W7VA 4UXHA 3P20A 1ZM9A 1HNXB 2WWRA 4RSMA 4AB1A 4MV4A 5FD8A 3KT3A 3LUGA 1SC9A 1L5SA 3KX2A 1IJFA 4HWRA 4Y2QA 4JBYA 5E0KB 5HGJA 4EGCB 5KYUB 4O1MA 2BTQA 1XALA 1Q2XA 4IF4A 1B0ZA 1AXEA 3LQFA 2OAQ1 1U80A 5AXBA 5B36A 5AIBA 1P3DA 4ZI2A 1X9GA 4QASA 3AQIA 1ZD5A 3OQOA 4N76A 3RVDA 4CQJA 1P74A 4BQQA 5JADA 4OJMX 5B6IA 1O9HA 3D1LA 2GILA 3OT5A 2CYBA 3VNSA 2D8MA 4U6NA 4DCSA 1EFRA 3AM4A 2EJWA 2TYSB 2C4UA 4U1RA 2DFKB 2WQZA 4TL9A 5FIUA 2O5RA 1U98A 1P1IA 5JD3A 5KPJA 3F97A 3KL4A 4ZQCB 1EEXB 2V74B 3NM5A 4M0LA 4TX1A 4KXUA 4YO7A 3S7TA 5JS7A 2IHNA 1M74A 3R0XA 2X0JA 2XZTA 2OBMA 3GJSA 4BVAA 4Z9AA 4DCCA 2VP4A 2H18A 4LPKA 4DQLA 2YVAA 2QXTA 4Y2UA 1E2BA 3TBKA 4ZHQA 3MSCA 1V26A 2F59A 1Y4AE 2J31A 5LMZA 1D07A 1KS9A 4DSNA 3P2KA 3EF3A 4I08A 4LJLA 1OXSC 3MG9A 4Q4AA 4DNQA 2OKGA 2I1LA 1W59A 2PGDA 4C43A 3KB8A 2UZAA 3LVBA 1QGDA 1F2UB 4YRQA 4BS9A 2XNSA 1VCIA 1WX1A 4YLGA 5F76A 1AO0A 1XJQA 1Z4LA 2OXEA 4MWEA 4BMYA 1R8JA 3A10A 3KYDA 4R8RA 2K7ZA 1VPEA 4QBIA 1W85B 4QJ3A 1DARA 1MQSA 2J33A 3E9CA 2FF7A 2HNAA 1QV7A 2YVUA 2Y99A 4I5IA 5DGIA 4B6QA 4HDNA 4X7MA 2FQQA 2Y66A 4M1KA 3V5NA 1RQ7A 4O4IB 3B1XA 4HEA6 1LUAA 3UJBA 3LY8A 2DKOA 1YZQA 2EW2A 1E3IA 4BLRA 4WN3A 4XI9A 2FWAA 1LV8A 5DIZA 1UK8A 4B79A 1DT5A 2HHLA 3CRRA 1MDBA 3NXSA 1Z0ZA 4IH4A 2Q5HA 3KHTA 2J5KA 2VI5A 3UJHA 1OAAA 3HFJA 3LUPA 3LX4A 4A2WA 3AL3A 2HA3A 3JQRA 4UQLA 3FXAA 3SD7A 1UDBA 2FQYA 4KQMA 4CLEA 4PO1A 4NFHA 3FDZA 4IEFB 4B48A 4I36A 1KVRA 1G21A 3GEMA 5GJBA 1W4AA 2IK8A 3LXRA 4LWZA 2AFHA 3P0IA 1CUCA 4EYGA 1GZSA 4ZYVA 2X8WA 5A06A 1C30A 1M2HA 4GHWA 2P6RA 1XA0A 1KQOA 4A2QA 1YBAA 2GYYA 5EPUA 1CUSA 2CNLA 3OSZA 4QU5A 4BBPA 5KJFA 5IDVA 3L7NA 3NHAA 4J2TA 1EMDA 1SUBA 1PJ3A 4AY4A 4GH5A 3SS7X 2PT7A 1DO2A 4TN1A 1DWQA 5CEFA 1ECLA 3V6LA 4UBNA 1JIIA 2HFJA 3BE5A 1AZSC 1IWBB 1TT5A 2JGLA 2JGIA 4RDXA 5KTSA 4LDJA 1JVBA 2BZ0A 4MR8A 2RB4A 3QM1A 3CQ9A 4W1QA 1BDJA 3K8QA 2XUQA 5DT9A 1RAIA 4BLOA 1DELA 2OENG 2PWYA 3VTFA 1UBSB 4XGKA 1KTIA 3RDPA 1OUMA 3RABA 3ZCXA 3V7WA 4BATA 4UPVA 1D4FA 4EYKA 4H1TA 3JV7A 2Q8NA 5CDHA 3ONWA 4KLRA 2C4WA 4H2DA 2CY0A