5B1DA

Crystal structure of proteinase k from engyodontium album
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Crystal structure of proteinase K from Engyodontium album
rcsb
source organism Engyodontium album
molecule tags Hydrolase
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5b1dA00
5ARDA 1SBIA 1TMGE 3DE5X 2ST1A 3DVSX 1WVMA 1KE2A 3WHIA 3BPSA 3GCXA 4OMCA 1KDZA 2PYZA 3DE0X 4Z2AA 3ZXXA 1R6VA 3LPCA 3EDYA 2B6NA 1GTJ1 2G4VA 3Q5GA 1OYVA 4C3UA 4HVLA 1SVNA 4NE9A 4J94A 3AFGA 1AF4A 1TO1E 2WUVA 1SIOA 2WWTA 2DP4E 1HT3A 3UNXA 1TK2A 1BE6A 1GNVA 4HX2A 3ZXYA 1GTG1 3D43A 5FFNA 2WUWE 1TM7E 4KPGA 5JXIA 3BX1A 2ZWPA 1MPTA 1TM1E 4K8RB 2TECE 3DE6X 1NDQA 5JXHA 3VHQA 3EE6A 5JMOA 3WQBA 1WSDA 3Q40A 1BFKA 1YJBA 4CFZA 1PTKA 5B1DA 5AVKA 3DE4X 4OV6B 1NLUA 1SUBA 3DE1X 3DE2X 1IC6A 3F49S 1TM4E 3DVRX 3DW1X 1SBTA 5FBZA 1SH7A 2X8JA 1ZVKA 1THMA 3DWEX 1AK9A 1Y33E 2SNIE 2PWBA 1GTL1 5FAXA 5CW1A 2QTWB 4AKTA 1DUIA 2P4EA 3A3PA 3D9QX 4MZDA 4CFYA 4GI3A 1T1IA 2IY9A 4CG0A 5K7SA 1GA1A 3I30X 3HJRA 1XF1A 2SECE 2X8JB 1SUEA 4M1ZA 1C9NA 1Y1KE 1S01A 1C9JA 1Y3BE 4I0WB 1P7WA 2Z57A 3A3NA 2GKOA 3DDZX 3I34X 4BWGA 3AJ8A 1GT91 3PRKE 4OMDA 1C3LA 1A2QA 2XTJA 2W2NA 1SIUA 1TM3E 2V8BA 3P5BA 4NMXB 1V5IA 1BFUA 2W2MA 1S2NA 5B1EA 1Y9ZA 5SICE 1SBHA 5ARBA 4FONA 1Q5PA 1GA4A 1ZVJA 3TI7A 1SCDA 4H6WA 1MEEA 2W2QA 3QFHA 3EIFA 3BGOS 2SBTA 1Y34E 2Z2XA 1R64A 1SCJA 2Z56A 3VSBA 2WV7A 1CNMA 2PQ2A 3SICE 2PKCA 1VSBA 1AQNA 3F7OA 1TM5E 4RYDA 1KE1A 1AV7A 2ID4A 1WMDA 1SUPA 4H6VA 1SBCA 4LVNA 1SUCA 1SIBE 1AVTA 1S02A 2Z2YA 3F7MA 1LW6E 2Z58A 2ZRQA 3LPAA 5ARCA 2E1PA 3DW3X 4DZTA 3CO0S 1SCAA 3DE3X 4WOBA 3SQOA 3PTLA 4AKSA 4ZOQI 1BJRE 5AMXA 1Y3DE 1NDUA 3TECE 1YU6A 2SICE 3I37X 1UBNA 1EA7A 3DYBA 1T1EA 3GCWA 1SELA 1YJCA 1TECE 4JP8A 1SUAA 1SCNE 3WIUA 5AVJA 3GT3A 1YJAA 1SN7A 2HD4A 5JXJA 3AJ9A 1KDVA 4LVOA 3TI9A 4C3VA 3DE7X 4KG7A 3QMPA 1JEAA 2PMWB 1Y3FE 1ST3A 5I9SA 3VV3A 1IAVA 1Y3CE 3LXUX 3T41A 1AU9A 4H6XA 2DQKA 2Z30A 1BE8A 1SUDA 1Y48E 1DBIA 1P8JA 3VTAA 2Z2ZA 2XRMA 1P7VA 1C9MA 4KB5A 1T1GA 3WIVA 3CNQS 4DJ5X 3DVQX 1PEKE 2W2PA 2ZWOA 3H42B 3GT4A 1OT5A 4B5LA 1ST2A 1PFGA 1EGQA 2HPZA 1V6CA 1TO2E 1BH6A 1WMEA 2PRKA 1AH2A 1GCIA 5JXGA 2ID8A 3QTLA 3VV2A 2W2OA 3VYVA 2IXTA 3A3OA 1Y4DE 3I2YX 2DUJA 1GNSA 1KDYA 1OYOA 4WOCA 1WMFA 2PWAA 1SCBA 1SBNE 1R0RE 1Y4AE 4YN3A 1GA6A 3LPDA 4DWWA 1CSEE 4ZARA 3L1KA 5AQEA 4NE7A 3OSZA 1SPBS 1PJ8A
chains in the Genus database with same CATH superfamily
1MQ8B 1S2GA 4GLLA 1JUDA 1Y9DA 2FTKE 4HSEA 3VC3A 3HO1A 1OI2A 4CNQA 1Z4KA 3EW9A 4XVQA 2RJNA 3T3DA 4DANA 3GJSA 2BGGA 2PZ8A 3STUA 5JPDA 4DIBA 1DZIA 4DLXA 1XC7A 4J1TC 4EL5A 1CHDA 5J59A 2NTJA 3L05A 3U80A 3PXXA 3QW4B 4QUAA 4RFSA 4CLHA 2QN2A 3KUKA 4E4YA 4EI7A 5LXTA 3E3NA 1X2BA 4WADA 5DN9A 5LNK6 3GCXA 1ENZA 2VYNA 1ODFA 2ZBPA 5F3WB 1RAHA 1Z4NA 4RH1A 3PL5A 1FNMA 1E6UA 2PYZA 1K68A 1E94E 1X3LA 2GPSA 3TVDA 1L4UA 2RH4A 1UBOS 5BWMA 1UR5A 3RC1A 3VC1A 4UD2A 2HRQA 3REGA 2WU3A 1CYDA 1II8B 1VP3A 3LPCA 3K6JA 4YUVA 2VHJA 2PRJA 2V3CC 3LBYA 4FFLA 4JBGA 4O08A 4JBIA 3EZNA 5HE8A 4MPTA 3QKWA 1YZLA 1V3UA 3HCBA 3OSUA 4TQUS 5C8VA 2P3LA 4PPFA 3R09A 2F3TA 2GEFA 2QLBA 3DAYA 4J94A 2AH5A 1QGED 1RWVA 1MAHA 3PGXA 2X1MA 2PLRA 3ANSA 2HSGA 3R5HA 2BGWA 2JIBA 2QP9X 3GLGB 4LRTB 3EXHB 2C5GA 3A11A 4WLNA 4YMWA 3D81A 2GBCA 2HXSA 4D8WA 3RYCA 2F00A 2HX1A 3R5JA 4AURA 1SKUA 4M76B 2AUNA 2TRSB 1E9FA 2EEZA 4G5RA 2CXUA 3MIZA 4HN2A 2BPOA 5HUJA 4AF8A 1E2QA 2J08A 4L28A 4HX2A 3RFVA 2E4YA 2EFJA 2FRDC 4JDPA 1HXHA 1S3FA 3Q8MA 2HF2A 3U0BA 5FOUA 1C7ZA 4J07A 4ZGBA 5HZKA 4EY4A 4TV9A 1EEHA 1B8OA 3CE6A 3DZDA 1KL7A 3ZV3A 4YP1A 4ND8B 5IXYA 4GICA 4BMPB 4K9OA 1ZZGA 2DX7A 1TD1A 3IPYA 4BO8A 4XA8A 5JIBA 1HYGA 3RSQA 3TYXA 2G9ZA 4LNAA 2BEWA 2GOYA 3ESAA 4LDQA 2DR0A 3ND6A 5IDQA 1I13A 2O8DB 3N6RA 3HPQA 3ZG6A 3VR2D 3O7MA 2OAP1 5DBEX 1V4BA 4TYQA 2XECA 4RTQA 1HE5A 3OTHA 2KLHA 3FPCA 1LFAA 2RH9B 5I7VA 4DJDC 1EM8A 4U1RA 5C0OE 1JQDA 4O5OA 4QU5A 1X7DA 2J3MA 3S2EA 3GDFA 3KQLA 2ZAYA 1YMUA 2GQ0A 3MCVA 3ND9A 4A15A 1GSHA 3PUZA 3SFZA 1JLLB 5L3QA 1Q57A 4G2NA 4NESA 4RO0A 2WUDA 2CNNA 4X1IB 3AZPA 1DV1A 4CQNA 2Q49A 1BFKA 1XFAA 3FXAA 1OGIA 1FXWF 4MO9A 3CM0A 4ZIRB 5A7HA 3L82B 2FPUA 5B3JA 3J7TA 2GN9A 2ZRAA 2A4KA 4L0CA 4RPCA 5AKGA 1BWQA 2P11A 2JVIA 1GKKA 1C9DB 2QSYA 2XYRA 3DE1X 2PUFA 4IFBA 2QY9A 2HJSA 5KCMA 4FOLA 3QXSA 4FU0A 1PR4A 2HV8A 2Q1TA 2WAAA 4HFNA 5G3YA 5KCZA 1UPTA 2OGTA 3UT5A 3IALA 3OIFA 1T4CB 4QEKA 3GJ7A 1T9GR 1LLUA 2PL9A 2QQFA 3HABA 3MW8A 1RBMA 3PR1A 3AR3A 4PICA 3KQVA 5JQGB 5U4QA 4NZNA 4OQPA 3M4XA 3WGQA 3HNPA 1QB8A 4CTJA 1XDGA 2LGJA 3MILA 4EYKA 2IXAA 1JR3A 4HH0A 1ILEA 2HA5A 3KD3A 1BS9A 4BNDB 1KRHA 3FWZA 3Q9LA 1UJ6A 3GZJA 3T7TA 1J99A 4OMUA 4LGCA 4PNEA 2ZI4A 3ZE8A 4BMXA 3OKPA 1PFWA 3EGIA 3TL3A 2H2IA 3UF0A 4DR6B 4KXNA 3SR3A 1DHTA 2W6PA 3VJLA 1E58A 3ZHYA 1NPDA 1PJ2A 1ZCZA 2A9JA 4F4CA 3NHRA 3OCWA 3PXAA 3EXIA 3N5KA 4BRSA 2Y71A 1KJZA 1SHKA 2VNHA 2YWJA 4EW3A 1RIFA 1DUIA 1NP3A 1TADA 2NU6B 4WLEA 4YAKA 4QIHA 3CZQA 2NZJA 3CRW1 3LT5A 3QPBA 3U4HA 1Z9BA 5I01A 4CLOB 1YL5A 2G7ZA 2WKPA 3EVBA 1Z2NX 2VZ0A 1B26A 3KEMA 3E0XA 2YZGA 2NU8A 2ZRGA 4X66B 3ZIUA 3MK31 2QQGA 4FLEA 3OC6A 2RGGA 1EJ2A 5ELMA 5KI6A 3Q12A 3WFZA 3OE5A 4FE7A 3U3XA 5HF6A 3E7PA 5DTQA 2XKJE 4XEHA 4P4SB 2X8WA 3NGLA 5F2OA 3AV3A 3H9QA 4F9GA 2Q8NA 3P5SA 4JL6A 1NMEA 3BWBA 4O2BF 3TX6A 4F6LA 2BZGA 1XMJA 2MJLA 5LZ9A 2REXB 1I7QB 1QTNA 3G1TA 5KX5B 1H42A 1X7YA 2XOXA 1IQPA 1F6DA 2PWZA 4DV0B 1SXJD 1WQ1R 3DBLB 5K03A 2XQFA 3CLVA 2IUEA 5EMHA 3PDCA 4M1ZA 4O1MA 4F5EA 1RR6A 1AN0A 1OHHD 5HTKA 1G5QA 2OBYA 1PJSA 3ENQA 4DC1A 4F5WA 2J3KA 2XQVA 2ZG6A 2HPHA 4MXDA 1BFDA 5FNVA 3UEOA 4X92A 2X5JO 1CUHA 4O0MA 1JFVA 2J5XA 3GIWA 2HRZA 4U39A 5F9FA 4ER0A 4EWLA 4LDNA 3OX1A 3ZI7A 3TWOA 1ZWLA 4GP7A 5LQMA 3UBTA 1ZOIA 1CIVA 2BKVA 2IYFA 2IDJA 3N2IA 4YCDA 4FX2A 4PFSA 4UU0A 5D51S 1AY0A 3ZWBA 3RSCA 3RAFC 1YTUA 4IJMA 3AOEA 4B6EA 2XZLA 1B8UA 3K16A 2JASA 3ZCXA 1K06A 4R5HA 3JAKB 4GI7A 1JIJA 1N8KA 4OIFA 3U7QA 1UZUA 3RSFA 1UKVY 2W2NA 1V43A 1KU0A 4DRZA 5LDHA 4JXXA 4NF2A 3PNQA 4RESA 3O83A 1Z47A 4Y67A 5AIAA 3M6AA 5AOBA 4CETA 5HXAA 5LQAA 3A0UA 3H5IA 4JI0B 1XVTA 3VSCA 1R9MA 4LZPA 5E1MA 1UK9A 5K8VA 3AVTA 3CH5A 4RDHA 4K05A 1U5AA 1ZN9A 1KAOA 3RKRA 3TOXA 3QUCA 3A1EA 3JASA 3QQPA 2YN2A 2P5YA 1L3IA 1AKNA 1BOFA 3C8UA 3GELA 2Q3LA 3IBFA 3K53A 5AKXA 4DLVA 2VYQA 3TJZA 1T9KA 1V8DA 1U1IA 3ZBQA 3OJLA 1JR3E 2P4UA 3E2PA 2Y9MB 4EYSA 4KSBA 4QM7A 3NMUF 3A6KA 3VPAA 1LU9A 5GONA 5J2TA 4HLNA 1P2BA 1ZM9A 1JA1A 3RRBA 5DNCA 3CC8A 1I01A 2GRAA 4RMGA 1Q0TA 1Y5RA 3IODA 3P97A 5AVWA 1Z0SA 1Y63A 2WF9A 4QTZA 1U3TA 4GKJB 4AG6A 4HNSA 5JZSA 3I9FA 4FB4A 4DABA 4ZTBA 3H2IA 2IIQA 2L17A 4WGFA 2Y1WA 2JIOA 3H5WA 2F8MA 3BGOS 5AKKA 3RS0A 3SE7A 7MDHA 5H82A 3DM5A 5FPSA 3RLIA 1E6WA 1VHJA 2CMDA 1TQ4A 1TW3A 2HZ7A 2PQ0A 2Z2XA 1M2GA 3CSUA 1P2GA 3R3YA 1I1HA 3QVMA 4EGQA 2BC9A 4G4GA 4HMQA 4DUZB 3OQ6A 3JD1A 3VAZA 1ZIDA 5C8YB 4YH1A 1W85B 3WOHA 2IKQA 3L9WA 4BNIA 4UTRA 1E2GA 4XLZA 1HTTA 3AR8A 4YQEA 3LUFA 2V7TA 4CHTA 1L5HB 1Z4JA 2IGTA 2AWOA 2WNIA 3LVFO 2Y66A 4XM0A 5IVKA 4LI3X 1EI9A 3VPBA 2PU7A 1EFRD 1SVLA 2JGIA 2HB6A 4M9QA 4MMXB 3SM9A 1SUCA 5CB4A 2VRCD 3G9XA 5A4JA 3QNWA 5EI5A 3AWDA 1HFKA 3QKSA 4NEGA 4BVHA 1R0LA 3I9KA 3DT9A 4AJJA 3FNFA 1M8FA 3BEOA 3MJFA 1GN9A 2B0JA 1VXOA 4IDHA 3FOCA 4JVMA 4QBKA 5F5NA 2VNIA 1R6BX 5JD6A 3H16A 5SY4A 1SM4A 1SUFA 3AH8A 3HB4X 2GPJA 4LAFA 3UMFA 4BL5A 1KOGA 3M3DA 3QXXA 4GR9A 1YQQA 5DOZA 1N2OA 2OE2A 2H51A 3IXLA 2C59A 2JD2A 3SC4A 2GYVA 3I92A 5FTMA 2EXXA 2VEOA 4BV9A 5KJCA 4FCVA 3GFBA 1NW7A 2WZDA 4Q3DA 4UREA 1G291 4AQDA 1DIGA 1F0PA 2G17A 4ARBA 3UGJA 5AHWA 3DCJA 4S3MA 5U1PA 2IZ1A 3PTLA 2UUCB 1IY8A 1FLAA 3ADPA 4LZLA 4BMCA 1I80A 2Q5QA 1UIMA 2B30A 2NZXA 2LPMA 4WECA 3TQTA 1NL3A 2WYIA 2XLBA 1GZDA 3IEXA 3PPWA 3Q98A 5DIZA 4F6RA 2RBKA 4M83A 5AK5A 1J0EA 4DWOA 1I4DD 3FDZA 4WQMA 2AYYA 2X8AA 5AKYA 1CZHA 1YU6A 4DIOA 3V2GA 4QXRA 1LY1A 3K4PA 5AK0A 2PDAA 3QP9A 4BGDA 2NYRA 1FNSA 3DCIA 3G5MA 1FTSA 3ITDA 3GJXC 3IIEA 4S0XA 4NCIA 4Y0VA 5C5CA 3AVWA 2EP5A 3V4LA 3CN7A 1NKSA 2OSVA 1ACMA 2CHVA 1VE7A 4QXAA 2VAPA 5EUBA 5CLFA 2AMFA 3VMFA 3NTVA 5DTRA 3TBFA 4ZYXA 3O91A 4MUNA 3WBFA 3P2MA 4UBLA 2I3AA 4ZQCB 1NW3A 3DG9A 2CNOA 2YOHA 2ZWVA 3RCBA 3TL6A 3FYUB 4BQIA 4ZU3A 2SKDA 3LX4A 3HP7A 3WNDA 4CKXA 1JDJA 3AJRA 4ITVA 1EQAA 5FPTA 3BRWD 1M1YA 1C3EA 2DEUA 1ATIA 1QHHA 3USCS 1UDCA 2G70A 1EVJA 2PGAA 3RO7A 3VU9B 4DR7B 3Q7EA 4PLGA 3V7WA 1IN1A 3LVRE 1LDMA 4ASUA 1E3LA 1GU1A 1F14A 5DHRA 4DY6A 3E9ZA 3WYAA 1E6EA 3WGGA 3I3OA 1OX5A 4UVGA 4BGIA 2E49A 2QZZA 1V48A 4FYXA 4MICA 3RSSA 4C89A 5A4DA 5CVTA 1IOWA 1GZSA 3AEKB 3SC3A 1N5KA 5DTIA 2BSQA 4F3YA 2W58A 1TIBA 2BY4A 3VJMA 4F4UA 4CM1A 4JJIA 1ABBA 2W98A 2OBLA 3LWZA 2L82A 5I9SA 3A26A 3SNKA 4D4GA 4F84A 2GF2A 3V4ZA 1Q1QA 1BDIA 5FORA 3NTOA 4YS6A 5EAIA 4F2HA 3RYFB 5K2OA 3I52A 2QM8A 3LXUX 4DV4B 2FZ4A 3IV7A 3KDAA 1VHDA 4GYWA 4JROA 4UNQA 1Z5VA 3L0SA 1IU9A 1CQZA 4WXMA 3W78A 4DLAA 4AU1A 4YCBA 3BN3A 5GIOE 5F1OA 1G21B 4EZIA 5IVPA 3M89A 5ALRA 1WX1A 4CMAA 3IB6A 2A4MA 1HDIA 4MVWA 3PLRA 4BEVA 1EXVA 1VKZA 3VKUA 3KAQA 2VJLA 3Q9UA 5IWCA 5E95A 3ZI4A 4KX5A 2NVOA 4MLDA 2JJ1A 1DXYA 4I1IA 1H6AA 4K86A 4IIEA 1FVXA 3I5UA 4X1KB 1TX4B 1Z38A 3AINA 3AQIA 3ZHUA 1GPUA 4BLQA 4DR4B 1DC6A 3WLKX 3HKEA 4IMJB 3EH2A 4CKEB 3OFND 3ANNA 4HUQB 4YXWA 3FLMA 4ZWNA 4AJOA 2XDWA 4B7CA 1OT5A 5IABA 3HB5X 5AP9A 1Z62A 3RRNA 1E62A 2D7JA 3KZVA 4H60A 3R24A 1KWKA 5F98A 4WN9B 3QU7A 1I6LA 4HQFA 1WCIA 2HPZA 4QYWA 1IOLA 3EN0A 3N2LA 4TOIA 4XFJA 1VE1A 4DV2B 3A32A 4PC1A 3TK1A 4NI5A 3C6XA 5LP6B 4ZEVA 1VOTA 2CLMB 3I61A 1YE8A 1QC5B 2AC7A 4O33A 5D6OA 1I7SB 1OBCA 3NKVA 1Z4PX 5JNUA 1A9XB 5K3OA 1HORA 2P30A 2JZCA 3WGLA 2A1UB 2VDWA 3A06A 4OQDA 3EW7A 3LUPA 1UBJS 2NSLA 5EHZA 1JKXA 4TMTA 1KI1A 2IHYA 1NOKA 4X8HA 3PNBA 1M1NB 3LFTA 1GARA 3U16A 4W1SA 1YFZA 3KR9A 3WK7A 3KDSE 4J3NA 3NFYA 5FV4A 3DTVB 1SCBA 2Y0EA 1PZEA 1UZMA 1RLIA 1SBZA 1WTAA 2EYQA 1TEXA 3F5SA 3R0JA 4KGXA 2GCPA 3ZWYA 3ZBTA 4QDJA 1JPUA 2BJWA 3V4SA 2WSSD 1M1YE 2JGKA 2PKRA 2WBLC 2VTBA 5IYZB 3AF4A 3TMYA 1CPYA 2XQIA 4CCAA 4QL3A 3H87A 3U09A 2O3TA 2Q9CA 3CF2A 5EHXA 1S1MA 2Q5OA 1G8MA 3GNQA 2JAHA 2FPKA 2ZXEA 3FMIA 3CF4A 1P5RA 1HDCA 3UYKA 1J5XA 2CNWD 3CV3A 4PCAA 4KFTA 5JHGB 2B4AA 3JTMA 5CT6A 3VO2A 2XXAA 1BRTA 4KKVA 3OZEA 2P78A 1OWNA 4LWPA 1YK0A 1E9DA 4G67A 4MV9A 3IQXA 3W9BA 3KEQA 3MS2A 5HKKD 4RVGA 4BFTA 5TPWB 1IVNA 2IV2X 2J0SA 2VBGA 1LK0A 4JYMA 2A9VA 3NDIA 4NV3A 3BPSA 3K9GA 2HRDA 3FHCB 3ROZA 4RDXA 5JYBA 3PR3A 1WB9A 1QAQA 1FDVA 1M0WA 3JZIA 2AT1A 5REQB 4BFCA 5DU2A 5I51A 1P3DA 2NO6A 5ALSA 3HCEA 1H65A 1ZCAA 1R0KA 1KDZA 5ABPA 4WKCA 1OGJA 4V1CA 1DS6A 3KYBA 1T6BY 2EDCA 1JHVA 2WYWA 2ZZMA 2D2IA 3DE0X 4JJFA 2Q0QA 3BCUA 3WGKA 4S05A 2F4VB 2QS9A 2D7CA 1ZONA 3ABQB 4BVAA 3AP2A 4QU0A 2B6NA 2JI7A 4OUDA 1E60A 1Q16A 3B7GA 3OF5A 4KE8A 4ZT5A 3UKOA 1K8QA 4PX2A 2H17A 3OM8A 4MV4A 1ZJYA 4BP8A 3KUCA 1LLDA 2ZE5A 3LUKA 4KWIA 1ORIA 2VNAA 3O9ZA 4JK3A 4S2UA 2CLHB 4EECA 2R5WA 1WXIA 1QOQB 2PXCA 2DQZA 2H0AA 4OQMA 1LZKA 2RB5A 1I7DA 3GIDA 1N6KA 4WKPA 3Q3EA 3RUPA 1QIKA 4IOMA 2ONJA 5SZKB 4ESOA 1HDRA 4MS1B 3CEPB 3PNOA 3EVZA 4TS9A 5U4XA 4ND1A 1PNVA 3BA1A 5JCJA 2BFOA 3FTCA 1F2VA 1DBPA 2OCDA 3QXGA 4G41A 4JQOA 2YHBA 4E11A 4W5QA 1FFGA 4YREA 4E1BA 3GARA 4ZC8A 1RP7A 4P4NA 3ZNQA 1BE6A 1XLUA 3E8MA 1DXHA 1CZRA 3WLSA 1QV6A 2BL4A 1QBKC 4BVBA 2EQ5A 4HYQA 4E94A 2AHRA 2Q3MA 4FHCA 4DBZA 4XWWA 1XLTC 1A5AB 4OLJA 1V2GA 2HYIC 3GJYA 1CJTC 3T7CA 1ZIXA 3NR2A 3M4YA 1L4MA 3T4UA 5IULC 4FNGA 4KDRA 5KTSA 1JSXA 4C0XA 1NQ5A 2X76A 3E9DA 1OLXB 1XXHB 3IKJA 5CLGA 1H2AS 1R10A 5KPJA 4ZOCA 1P7CA 4MCIA 2FSFA 4IZHA 5ISMA 4TTAA 3DEZA 1WXWA 1F5NA 4I4IA 2XXJA 1X0XA 3HBAA 3GLKA 3TRIA 1R4MB 3TW8A 1PNQA 3HA2A 4PO1A 4ME6A 4QHYA 3EE6A 4WT7A 3UXEA 2AK2A 4JMPA 3VNSA 2A1IA 3AGPA 3UFXB 3B78A 1FFWA 4OQEA 5I8PA 1XXLA 1N5DA 1U31A 1DAIA 3DZFA 5JRJA 2YN4A 2WI8A 2E48A 1AC5A 1T0IA 1NVWQ 1UEJA 2E5WA 2QE6A 2ZETA 3FPLA 3GEDA 4FSXA 1JQAA 4IO0A 4Q3EA 3TLAA 1YNSA 3T1OA 3TNJA 3PNVA 3TTUA 5LJLA 2C1ZA 3F46A 2PMFA 4OV6B 1VKNA 5ESDA 1XALA 2Q41A 3JQRA 3L8MA 4FMPA 4TUYA 2E37A 4ZZ2A 1Z12A 5EIBD 5CVDA 1ONBA 3PX7A 3RADC 1H1TA 1H94A 1KOJA 4FFBB 3CMMA 4JASB 4PYNA 3WX0A 3EC7A 1QF7A 2QNIA 5JH7F 3DO5A 2B8WA 2CJXA 2E0IA 3A58B 4CQLA 4KN9S 3V5NA 1JECA 4PZYA 3RU3A 1DBWA 4IPTA 1Z39A 2AFHE 3IPRA 5FKJA 3WSVA 1W36C 3E8XA 4R01A 1CVLA 6YASA 5EJ8A 1V4VA 3TD2A 4IHJF 5AW7A 5HQ3A 1NNLA 4EH1A 4RY0A 1GZUA 5AVUA 5D3ZA 1PFKA 4UPEA 2MDTA 4DVGA 3LDAA 4F7WA 3JWJA 1RRCA 3QFSA 3RFCA 2YXPX 5EKXA 1MKYA 1JFTA 1T4DA 2CNKA 4FZ3A 5FAXA 4HZGA 1Q22A 4U7FA 4QG3A 1LSOA 3D02A 2EOAA 4PSDA 3P9ZA 3GRAA 1R9JA 4MVJD 5AUNB 2QTWB 3GL9A 4MRRA 5IBPA 2DHQA 2XMZA 3Q3VA 5DRTA 5LWQA 3V6MA 3DLTA 3ZW8A 4FN4A 2GPBA 1C4XA 1OLSA 2P7HA 4NVRA 3G0GA 3VNUA 3NZEA 3ZW9A 4PHFA 3OPXA 4HG2A 2LCFA 3FNRA 1IM2A 1G6OA 2V6JA 1RI3A 3H2HA 3K5HA 5CYOA 2ZYRA 5FTWA 3HI4A 4RTSA 1HR0B 3V8VA 3CZ9A 1CF4A 3AEUA 1PT6A 4B46A 2O2JA 4M55A 1RXSA 3MQFA 1QP8A 4XUCA 5FOVA 2C4TA 2BKEA 1XI2A 3I4FA 3WK5A 1ONSA 3RTCA 5MN4A 1Q19A 4B6RA 2FPRA 3PRJA 2PAAA 2DTDA 4XJXA 4EENA 2WSBA 1M76A 4I3HA 4EX7A 3GJ0A 3PYMA 4H7DA 2VJYA 3DTYA 3CW9A 4X95A 2HHAA 3AFIA 1DUVG 4W99A 4BO7A 2GLTA 3PNPA 4KMRA 2AR7A 1XQVA 5ALEA 4R5MA 4AMZA 4DW8A 1X7ZB 3M34A 4HS4A 1N2GA 4R81A 3ROKA 1XF9A 2Z57A 1GDTA 3ISTA 4ZYZA 3RVDA 3ZDZB 3D8BA 2C3MA 3GU3A 1FYWA 5CITA 1USIA 3D2BA 2Q0SA 3EYAA 3W8FA 2RGUA 1PDVA 1N3LA 1W88A 1CUWA 1GTVA 2IEDA 2RK4A 2VP3A 2XE7A 3OH8A 4JC8A 2CBXA 1BEZA 3VR5A 3ZWMA 1HFEL 1UAGA 3BD8A 4NBKA 5TX7A 3VU0A 3I1FA 1CNFA 5ADUS 1FQKA 2CL5A 2QTHA 2VA9A 4MHTA 2FPSA 4WFIA 1JDUA 4ZYUA 1JHZA 2OENG 3UVEA 4K03A 3DJFA 1H3FA 5EMLA 4BLUA 1YS7A 3GQBB 3PV0A 4JI3B 3O1JC 2VQDA 3D64A 5DULA 3ITKA 3ZGXA 4P7BA 2ZJ2A 3UPTA 5TQ2A 4ER7A 3R0VA 4A2WA 1RWQA 5K6AA 4HRXA 3IDSA 2JL1A 1PWZA 2QRVB 4Q34A 4TLCA 4YV0A 1F0KA 4CPDA 3OESA 4FBLA 4PANA 4QARA 1KDPA 4Y2TA 3VR5H 5JZVA 1I10A 4I50B 5KTPA 3GN2A 1BN6A 1DC5A 2BVNA 4FLMA 2HAEA 2Z0MA 4I08A 4EPTA 1KGDA 4FMDB 3W5UA 2D1FA 4N6GA 4TLAA 2NAPA 5F12A 3FPEA 1NLZA 3GR6A 1KHTA 3PQDA 3II6X 3W8EA 4GNKA 1T6ZA 1B16A 4G0ZA 3T3HA 4LV8B 2O4CA 4CDMA 4F60A 1ZI8A 1TLTA 3U17A 3RWBA 2H00A 3ETCA 4TGLA 3BHJA 2ZYUX 3BIFA 5EE5B 1NV8A 3MUEA 2X6QA 3BFKA 4FYMA 3WAGA 5LDGA 5TV2A 3W5DA 3ZQKA 3TI7A 2VAVA 1CRZA 4F4IA 3M4NA 3I09A 4O4JB 3ZHBA 4H6WA 4LA4A 3T7AA 4OXYA 2D62A 3RT1A 3O38A 6ADHA 3F8WA 3R5KA 3DHWC 3JQ9A 3MHPA 2PUAA 4TYYA 4YJ3B 1L7MA 3R3ZA 3V4VB 1F1BA 3O8QB 1U0NA 2WLTA 2BMEA 3QLTA 5K9ZA 5K0EA 4MYCA 3BYZA 5KYNA 3TNFA 4I4LA 2H6EA 3FHLA 1ECLA 2UZ1A 4YYZA 1JYEA 1SCJA 3NHZA 4GKVA 1G7RA 3M6XA 5FPHA 5CGQB 1DTWB 3OZFA 1AGYA 1HL7A 4DA9A 2IK8A 4F46A 2DETA 1ZJJA 2II6A 2PKCA 2ZAIA 2FDRA 1BQ4A 4LF6B 4E07A 4M7WA 1ZAKA 4YRLA 1GUYA 4D02A 4N3NA 1KEVA 4GH5A 1KI2A 1O96A 2RH8A 1AXEA 2LVBA 3I72A 3K8QA 3MA0A 1Y8QA 2OUKA 3N74A 2QRZA 5EP4A 2ATXA 1LLCA 1F6WA 3HJHA 3MXOA 4OP1A 4FHZA 4R8VA 5TMBA 4E5SA 1H8ED 1B8PA 3G8YA 1GYRA 2OY0A 2MSDB 4DBLC 3K92A 1EG2A 1SIBE 3DMRA 3KWLA 3BGVA 3O2QB 4HDNA 4C6HA 3DBHA 4AQYB 4RK4A 3COPA 2HQ1A 2A30A 2AG1A 3L41A 2DBYA 5A5EA 4U7GA 4IQ0A 4P35A 5CVVA 1X7XB 3WYDA 4BDTA 3FZGA 3AHDA 2CF6A 3EY9A 4AT1A 4R84A 3BGWA 3ZK7A 3GOQA 1WXXA 4UMFA 4G1BA 1NBMD 2ADFA 3GNTA 4GDFA 5IAAA 1YB1A 4X5OA 5LQCA 5G4KB 2HCRA 3G0IA 4NYMR 4UCQA 4DMLA 1HYQA 3FHJA 3LBIA 1J8MF 4N6OA 1A2BA 1NBIA 2W8BA 1DIHA 3DMFA 2QTMA 3MTAA 4UC0A 2EZUA 5DYIA 1BJKA 3SQOA 2P62A 2C29D 3PYLA 1KFJB 1H2EA 1ZI9A 1N0HA 3A1SA 3OZSA 3C6ZA 4KI0A 2AR0A 1L3BA 4JSYA 4PC7A 5E6UB 1R4NA 3UOWA 1HFWA 3HU3A 2C97A 1ZCFA 2WSYB 2W4QA 3GMIA 3ZZ1A 4C7JA 3MBIA 3Q41A 3JD3A 1TF5A 3HEBA 1DNPA 2W6OA 4ZOQI 3AWIA 3QWFA 3RRFA 2ATVA 4MR8B 4X3PA 3NBUA 4J90A 1NR7A 3F98A 1UOOA 3FWNA 1NVTA 1U3VA 2OB1A 2WC1A 4NBVA 5FUWA 3IOYA 5E3JA 2B34A 1CUXA 3CH4B 3KXLA 3NIBA 5AXDA 3ZEIA 3AY3A 1NN5A 1R4AA 2H4HA 3HJNA 3QV1A 2A1TR 3DO6A 3ZS9A 2AN3A 4N03A 3NDBB 2W6QA 3BZUA 4HH1A 1PRYA 2I54A 4J91A 4ZZ1A 3QELB 5AIBA 2R4UA 1JHDA 2R9VA 2YWCA 4RF3A 4OBBA 1NASA 5IZ4A 1J8FA 5T7BA 4EB6A 1E0KA 3OZ7A 4YRQA 4FDLA 4Y2QA 4G1FA 1E0DA 4DSNA 4R05A 3IEKA 2XB6A 4BAUA 2YV5A 1XD2B 2OCIA 2HJVA 5BUQA 4OQYA 4QVKA 1W8DA 2P5SA 3SVTA 4C06A 2BYTA 2AI1A 3P9IA 4R8LA 2XGOA 4D0GA 1T2UA 1V16B 1V1MB 2R86A 3QLVA 4A03A 4J0HA 1HPLA 2Q1SA 2YZ7A 2WWXA 3IUJA 2IW1A 2OFPA 1HT1E 2Y6UA 3WRYC 1DEHA 1DAPA 2YZ2A 2EGGA 1EDOA 3EG9B 3VM6A 3U56A 3FMPB 3H11A 4YRDA 1J39A 1GWNA 1NW4A 2X7HA 4HLUA 5EGNA 2YFQA 4WL0A 1TA4A 1JEAA 1ZGHA 3LT2A 1IXYA 2GZ1A 1MVOA 4EMTA 4HY3A 4DV3B 1TL7C 2G1UA 1P1CA 1P0FA 1ZXXA 5EZYA 1BXRB 1DINA 2GBLA 5KYVA 2V7QA 4WZAE 5A71A 1T24A 4IRUB 1EFCA 2ACWA 1GNLA 4RJKA 5GINE 3F78A 4GWGA 4DIKA 1L6IA 4A2QA 3N2GB 2R97A 4N8SA 3RVPA 4YRIA 4O4IA 4YO7A 1EX6A 1A8SA 4U6NA 5GM1A 1A4XA 1N6RA 4WY5A 3I8SA 1E1LA 1RU3A 2PJDA 3MRTA 1JEJA 1EQ2A 2JCXA 3EYWA 3COJA 1FRVA 3B53X 3AVPA 1G8JA 4RMNA 3SYRA 4N3AA 1P8JA 2XMGA 4MQUA 4DLZA 1YQEA 4ZKDA 2FGKA 2MU1A 1L5NA 3OBIA 2JAOA 3RDPA 1VYVA 3DKVA 4YI5A 5AW1A 1ZAYA 5JRZA 1O57A 1B2RA 4Q3OA 2M6KA 3NBYC 3NAGA 4D0RA 4XDGA 5HF8A 4OLFA 3B7PA 1MC8A 3HBFA 1HNNA 2PSDA 3C3DA 4LMBA 4XOUA 1I94B 3L8YA 4R1PA 4LCJA 1P18A 2FEXA 1XNGA 2QMOA 2QP3A 4PZUA 4YWJA 4AZVA 1GPAA 1UK8A 2XVXA 4RPHA 3EEOA 1UKEA 2BZ1A 2WE8A 3T0IA 5AKJA 2B3TA 3GVHA 3MJSA 3GP3A 4DYVA 3IR5A 1ZC3A 1JHPA 2QTAA 1CQPA 4GPBA 2J07A 3Q7PA 3QG1A 1BH6A 3T38A 3NB0A 3V8BA 2JGEA 1KZYC 3OPQA 3GZTB 3SZGA 3K09C 1DRVA 3EGCA 5BN5B 4MR7A 4EO4A 4OP3A 3H3FA 3SF8B 3DTNA 4LMAA 2YWXA 4PQRA 4O1IA 4TLLB 5IDYA 3VYVA 5DX8A 4DDKA 1T5SA 1HQYE 5K0JA 3NIGB 4FGWA 4NZOA 3DWFA 4HAVA 3VUFA 3V3KA 3K20A 3DD1A 4BNKA 1WQ3A 3V4OA 2CB0A 5EMKA 3OOHA 2DUJA 3KFXA 1EFPB 1ECJA 3SLKA 4DIEA 2EWMA 2ZB2A 2ET6A 4K8OA 1NIPA 4MROA 2FXVA 3ZCUA 2OLJA 1KERA 3HCFA 1FS6A 1K7YA 1MOPA 1NE7A 1QONA 2RAPA 2NUAA 1RFGE 4XJTA 3PUKA 2VPTA 3A25A 1JQLB 1N6OA 1SC9A 3FLEA 3RKUA 2Q4BA 4RTPA 3KUDA 2PHZA 5KYUA 1IHPA 1QIJA 4NPCA 3QWBA 3RQIA 1ZICA 1Q1ZA 2AA3A 3L1KA 4LKOA 1Q1EA 4F8JA 2IQIA 3LA6A 4XDYA 1W2HA 4MV5A 4KRXA 3G88A 3SYLA 3AV0B 5THKA 1SC1A 2ZRNA 3GLSA 1X0VA 1ZNYA 3OQJA 3OX2A 4NK4A 3TQFA 1E18A 2NW6A 4BPBA 2QG9A 2QUIA 5ARDA 4D44A 1K86A 2B9VA 2J7PA 2WHQA 4UOEA 3N2KA 3QBJA 9ABPA 2VH2A 4O0LA 3TTTA 3OM0A 4ABTA 3HTXA 2R6FA 4AS1A 3GMDA 1N5LA 1JDZA 2FRXA 2HLPA 1Q95A 2QD1A 3HLTA 4KQ6A 3LIPA 4HMPA 1PS8A 5EZ6B 4DMFA 3PQCA 4GO1A 1PAUA 2D1YA 3PTZA 5DM0A 5AVRA 4W5RA 4RVFA 2JKYA 2C2WA 3HI6A 1DP4A 3NBKA 3X1YA 2SCUB 4R2KA 1W581 4J6FA 3LLUA 1C1HA 2AR9A 4OMCA 4YAUA 3QX7A 4JYAB 3GT0A 3L4BA 1LV7A 3DTVD 2CJWB 4GBGA 3DP9A 3EIOA 3VR6D 1CZLA 4CM9D 1NRIA 1L5OA 3RVQA 3PGLA 1RXYA 1WS6A 4FEGA 1Q6YA 4IIBA 1XLVA 1UWVA 1WR8A 4PRKA 5T6MA 1IZZA 3GA5A 2NO9A 3DV0B 1SZDA 1Y4UA 4WZBB 4X3CA 2CLSA 5FJIA 1N2HA 3T8YA 1FVHA 2IPXA 2OHVA 4L5CA 3V4RA 4FQ8A 2IYXA 4EGFA 4DQXA 3AB8A 4MA4A 3U1VA 4HFJA 1W1UA 1AHHA 1H6DA 1QO0A 5DZSA 1QGZA 4YASA 4XGIA 5ECDA 3TSCA 4Q9AA 4NCHA 2RHJA 3KS9A 3U49A 3FRHA 1HUQA 3TBKA 3WE7A 3KO8A 4OQ4A 1AF4A 2YCLA 3K0AA 2Z08A 2JHAA 2F3QA 1E1KA 3OMWA 4NRDA 3B1ZA 1JJ7A 3FKJA 5EHQA 4EYQA 4FE3A 5JFGA 1AD2A 4PXSA 2LW7A 3MLBA 1R37A 4X63A 3ZE6A 3WDSA 4MW9A 4AYTA 4EPVA 2EZ4A 4E32A 3U6KA 1DC8A 1VJGA 1Z0DA 5A05A 4W5OA 3NDJA 3FY4A 2C9MA 2F1HA 3TOSA 1UJ4A 2VRNA 3RC8A 3OEHD 1VL1A 4ISBA 2IZZA 1MTZA 3H1GA 4Z7JA 3KK0A 3BCHA 3EZGA 3TJRA 4MJ3A 4D56A 5EIXA 2VF2A 2E4UA 1JZQA 3E23A 3O0DA 4L0DA 4ZHSA 4Z4QA 2WNHA 1JE0A 1OFVA 5JQGF 3HADA 4CBVA 3MTIA 2XODA 2XCLA 5IH7A 1G2QA 4N48A 5EXPA 1QIGA 2NO0A 2CMFA 6LDHA 2ETXA 2E87A 3COWA 1XL0A 1SEPA 1X6VA 3SR4A 4YJFA 5KBYA 5DI3B 4TYNA 3HA3A 4B6OA 4ER6A 3SJCA 4AMUA 2M32A 3IO3A 3MINA 4BJ5A 5L51A 2J59A 1IJEA 3L04A 1WDWB 3KKPA 1MD9A 1T3SA 4NKRA 1RM0A 1NFFA 4TL9A 5LBUA 2ZYVX 4ZO4A 5KUTA 3U4AA 3AYZB 3GRVA 4BYMA 4TMWA 3RJTA 4W9NA 4GM1A 3RU2A 1NG1A 1YJBA 1K5PA 2M1XA 3C3AA 3NPAA 3NDPA 2QZJA 2OXIA 2IL1A 4GOLD 3G2OA 1K6XA 2AJDA 1ZJZA 3TN7A 2W71A 3RYIB 3OZTA 2MSNA 1KJJA 3N2EA 3VNBA 4KQCA 4BO9A 2A9FA 4CMKA 4Q02A 1U65A 2JZNA 3COYA 3I2KA 3KJXA 4LPKA 2R1ZA 2WOOA 3AFHA 4MB2A 1ESEA 1P29A 4O59O 3LX5A 1QU3A 2F43A 2XNDD 3IAAA 3JWIA 2J4FA 1MB3A 4OYLA 1ZCJA 1Y6GA 1CR4A 1W76A 4YRJA 3HJUA 2XIQA 1P4HA 1UIRA 4R31A 4AS2A 1I1OA 2KS6A 1U1EA 8OHMA 4BTEA 1V11B 1EWYA 3DBVO 2WJPA 3HBMA 4G8CA 1CZUA 3K9QO 4MR9B 3HB7A 4RZIA 5KX5F 4PINA 5D85A 3E1SA 3WYBA 5LQNA 3OPYB 5E1DA 3IIIA 4YCJA 3ZHZA 1ZK2A 1UT8A 4LOHA 3EEBA 1DWQA 2PRIA 4K9RA 4KYVA 4DMUB 3FVQA 4H2DA 1QG6A 5F23A 3HU2A 2X0EA 5K3AA 1MRZA 3D0RA 1U2GC 3T7EA 1NN3A 3FUXA 3KQQA 5C46F 5B7PA 2J6CA 1K4KA 2I7VA 3ROMA 2DUMA 3W5SA 4GVLA 2YS7A 4PSVA 3G82C 5CYGA 2Y1KA 5DBIA 4KIGA 3CKLA 2O8EA 3T0FA 4XEUA 2LKDA 3Q7IA 2NTYC 5F21A 2I80A 2GFQA 2AMYA 1KXZA 2WWWA 4A92A 1S8FA 1QAMA 1N3IA 3U7EB 4D6XA 1C1YA 1K75A 5E6SA 1XZCA 3LHFA 5GGXA 3HBLA 2BLNA 5EE1A 2J87A 1E2DA 1R88A 1N7GA 4L4XA 3SC6A 4LRUA 1BD3A 3PF9A 2NZYA 4D3FA 4UDOA 4CM5A 4IQ8A 2VK4A 2WK1A 3RGGA 1DEXA 1BX0A 2WUFA 4G5QA 4HWTA 3KL4A 4IINA 1BWRA 1CDOA 4U5QA 4Y2SA 1RMYA 4JJ8A 5CJJA 1Q74A 5CK4A 1X1AA 4MCJA 4R9UC 3E2IA 1GGKA 1WB6A 5H9VA 3FGNA 3GH1A 2XA9A 1KEPA 2GN8A 3AO0B 3LF1A 1X13A 4IUDS 3KQUA 1I24A 2QJWA 3EFOA 4H7HA 5EIFA 1JNYA 1ORTA 1IRXA 3CUUA 1LD3A 2ZTLA 3I34X 3JVVA 2OBFA 1EFKA 1FA9A 1VB3A 2IU3A 4LX0A 3PI6A 4TRRA 5I7FA 3TQOA 1SHLA 1U2ZA 2ZWIA 4TRJA 1V7QA 1DKUA 1QFZA 2G4CA 5BUSA 1SBYA 3L4KA 3PHIA 3Q8XB 2QVZX 5CDFE 5F2NA 1D4ZA 4B3CA 1A2QA 1GGEA 3GK3A 3U31A 1A97A 2Z8YA 1GQ2A 3GH3A 4GECA 1H3EA 1XZLA 1Z0IA 2OD9A 2XYHA 3ZTYA 4H7JA 1VECA 4ZQIA 3VKHA 2C8LA 1NVKA 4CODB 1Z08A 4KR6A 1PW7A 5CT5A 4RFSB 2DERA 3NTRA 2C3YA 3CLTD 1EUQA 2ZWMA 4DAOA 4Q12A 1Z75A 1AZTA 4XWKA 1AUQA 4PBTA 5LMUB 3FFWA 2HDHA 4FEAA 5CA0A 3JVEA 3WQQA 4DT1B 3TOVA 7REQA 4RTKA 2W2MA 5BVGA 3L0BA 2KI5A 3ICWA 3N8IA 4EDHA 4YHHB 3QA9A 4QDOA 3PD1A 2FFQA 4BC0A 3CH6A 5EMJA 3U0VA 3C3PA 3KTFA 4LHWA 4X64B 1W75A 1PNOA 4Q18A 1N5MA 5EKSA 4DGSA 5A1JA 3AHFA 4MLPA 3T9BA 4U7HA 3GUYA 2WHRA 4LYJA 3CG4A 5DBOA 1NI3A 4IEFB 3KZMA 4EVQA 4QUJA 5G40A 4IX9A 5ALKA 3LWNA 1VG0B 2BMDA 4QBTA 3OPVA 2NP7A 3KG2A 1LQTA 4Z3KA 5GMOA 1KC1A 1NVAA 2O5EA 3EXFA 3UMYA 2HQOA 3QFHA 3EIFA 1TE2A 5F35A 4KXLA 2O5CA 2XCQA 4DBVO 1KJNA 2I22A 3GWZA 3TGWA 8ATCA 5G0WA 4ETMA 1FIUA 2YH2A 5SZJA 4EW2A 3G2JA 1VKOA 2I6GA 2HU8A 2WDZA 1CNMA 1B0ZA 3C2QA 2ZU0C 3QEOA 2IUFA 3SICE 1C9YA 3KR1A 1XAHA 2B83A 3PDUA 2C3UA 4LNHA 1MO5A 3I5YA 3JQFC 1O97D 4KLNA 1KE1A 3U6BA 2BEWB 2PZMA 3LT0A 1K2VN 2JCGA 3UGQA 1TVMA 2YFKA 3O84A 4KIWA 4JA0A 1HOTA 4B6QA 4D98A 2Q0HA 1QGDA 2VQ3A 4GF5A 5IUNC 1NQWA 3WO0A 1U8EA 4H6VA 2FN4A 4IDGA 4BE9A 1OT3A 5C2JB 1Z4QA 4P8RA 4QLOA 2C2BA 2QORA 3IKTA 1JT2A 1FUYB 2IH2A 4PZAA 1NYRA 3H8SA 5KDLA 1G5PA 1T0HB 2HM7A 2CWDA 3LRTA 3STHA 4RHXA 3RUIA 3FIUA 4A0GA 1BGVA 3IVGA 4WI1A 4KO3S 4M99A 2NV6A 3LGXA 3PHGA 2AKAB 1C4KA 4YRTA 1JJIA 2QUAA 5D3MA 2FKNA 4E7PA 3KLNA 1XKTA 1TO6A 1R15A 3R3UA 4LUCA 3OU7A 4CLDA 3KYDA 1PLLA 2AG8A 1TUBA 5HG0A 1ZGGA 3HZZA 4IXMA 1AZLA 4HX9A 4X9XA 2FSVA 1TZMA 3I9V1 5KTKA 4UVHA 2XT6A 3BE6A 1FMFA 3UW1A 4E30A 5CAEB 1BKYA 1S9DA 2O3UA 3BSWA 3WL4A 2FYTA 4NBUA 4U2FA 4EEXA 4IDAA 5HCIA 5KOJB 1LLFA 4MTCA 1OAAA 3UAGA 4E5NA 1FVFA 2OBMA 2QJOA 4CKZA 1VHQA 2DJ5A 5TDHA 3OKCA 3TCXB 5JCZA 2W6ID 1IEXA 1MOQA 1YR9A 2CXXA 1ULHA 3DOOA 1OU0A 1DBSA 1Z68A 4HB4A 2JLSA 1CFZA 1P4JA 2NTVA 4JODA 3M5CA 4DJAA 4YT5A 1Z56C 1FX0A 4YGYA 1Q0UA 4TS4A 3TX2A 2Z1MA 4NS4A 1C1XA 4E6EA 4CQMA 1QHSA 1Z83A 3GCWA 1AM4D 1ZA1A 4O4LA 4P9NA 5BSWA 3X1ZA 3UPUA 2GZ3A 3NONA 1Q0QA 4UHJA 1I4OA 2IE8A 4D9KA 1CUEA 3AC0A 3PE4A 3U2QA 2GPNA 4NR0A 1CERA 3MJRA 2YJ3A 4JKYA 1DPFA 2WKQA 4K5QA 1DFIA 5AHKA 3RUEA 3A27A 1NI4A 4KK3A 4PAMA 1VL6A 1J7JA 1RPTA 5CM8B 4DY4A 2I8CA 1U0GA 2O1XA 4GT1A 4KUEA 5FHRA 1JHXA 4F9TA 1IN6A 4LF5B 4L8GA 4LY6A 2ZS7A 3LOQA 4YALA 1CS4C 2QD5A 4GYJA 4J29A 2JI6A 2WVGA 4YFYA 5MN6A 4AXXA 4BCDA 4JBNA 4Q3AA 4JB2A 1A9OA 3L43A 1RCFA 5AM0A 1TRHA 1VRVA 1YZNA 3IUPA 5D1NA 4X62B 4O8CA 4Q9LA 1KDVA 5IPFA 2K2QB 2XNKA 4LE0A 1YQ9A 1RAIA 5F5XA 1ABFA 1FP1D 1J0BA 4HN4B 2ZBGA 5IAGA 4PGMA 3BD7A 1XZHA 5HOEA 4R2JA 1VSQA 4F9EA 3I0NA 1N6HA 1SOAA 1U90A 4C4SA 1QAOA 1R18A 4BEWA 5C53B 2EJVA 5G0SA 3L0YA 4JVOA 1ZESA 3HUEA 4UCWA 2PMEA 2VBCA 3NUZA 3GEGA 1DGQA 3PQ3A 1EWTA 1B7GO 1J2RA 1P31A 3HEMA 3JQ7B 4JP5A 2Q4TA 4P4LA 2WMOB 3KSMA 5FOTA 4MV1A 1DC7A 5ETJA 1LPAB 1NFRA 2LCQA 3PBKA 2JJ8A 3B36A 3LIIA 4I6GA 3DOCA 4V3CA 4BCCA 2EFDB 2XD4A 4D7AA 5KOHA 1Z0ZA 2F67A 5LP6F 5IKXA 5CBPA 3SZRA 5IASA 3WAKA 5E3HA 2HFJA 1Y3AA 1SUWA 3PFNA 2OHXA 4E46A 4NECA 3KU4A 1CVRA 4LE1A 3TSWA 3TSZA 5G0UA 1SUDA 2UXCB 4PXAA 5ALZA 1CJCA 2OQVA 3UMBA 2CNDA 3I23A 2GN4A 2PTHA 3W5AA 4OHFA 1GG2A 1CQXA 2GHTA 3NVDA 1DTEA 1O94D 1P7VA 1QMPA 1QLJA 1YZHA 1B41A 2FEWB 3KXPA 1BSVA 4MGZR 1QPZA 1ESMA 5E9WA 1HDXA 4WCFC 3VDXA 5HUHA 1QRDA 2I1VB 1L4NA 3OHPA 2OCAA 1EX7A 1JKJA 1XU7A 2ZJZA 2E82A 2PBZA 5KQRA 4JLMA 1NUUA 4RY9A 3C3YA 5M2QA 2ZUSA 4UM8B 2P0AA 1ZW6A 4MV8A 3SC2A 4AY5A 1G5HA 3H7IA 4OXXA 3RVBA 2J3EA 3L07A 2R8OA 3L7BA 2EVWX 5D84A 4BOYA 1V6CA 1XVIA 3NOVA 4J03A 4IF4A 1H4TA 5AI4A 5G1PA 5J2UA 1WD5A 4DXAA 4PYKA 3KWJA 1SQ6A 3OC0A 3QTLA 2YTZA 3PHBE 1SB8A 3GD5A 4EHHA 5KQSA 2WWYA 1VHLA 2Z8YM 5HSGA 3PPIA 4OYRA 1TW2A 5KJFA 3D6JA 4QJ5A 1GRQA 2DVMA 1BEUB 3PX2A 4RAQA 2PNJA 4LIPD 2I4IA 3GJ3A 4MKHA 4BV3A 5A3RA 4MDEA 2AOTA 1XRLA 2PS0A 5H3HA 3KYCA 4N41A 4UEQA 3ZHXA 3I8OA 2P6RA 2R11A 2O05A 3H8WA 3X3HA 1NQAO 4QQRA 4KNWA 4XUGB 5LOVA 2K87A 2VDKB 2WIFA 4GPZA 4EKDA 2GUWA 3Q3JB 1SZJG 2O2GA 1JXOA 1R0RE 1GQYA 1UJ2A 2AV6A 4MP3A 3D6VA 3CH7A 2YMLA 4LISA 4UHCA 2XWJI 2F9FA 1P73A 5ENDA 6REQB 3HXPA 2G77B 1KS9A 2A0KA 1EUCA 1RSZA 3L6CA 3P32A 4NPHA 5KYXA 1X7WA 1POXA 2J5QA 1U6KA 1GUFA 2QG4A 1PV2A 5FD8A 3IQEA 1QH8B 2F8TA 4HAOA 2FPGA 3K9BA 1C5KA 1L5YA 1JSCA 1AUXA 2DWUA 4UM7A 4F6CA 1Y4ZA 3RB8A 3UXHA 4YQFA 3EPRA 3V7UA 1XTQA 4BQNA 3E3LA 3SS9X 3TZKA 4HDOB 4LJSA 4EB0A 3E7WA 5FL7A 3ZYZA 4EAQA 5CB4B 3DDCA 3KZNA 3QJYA 1GKYA 2PL1A 5DWDA 1ELOA 4XYLA 1GTRA 3QKSB 4HATA 5F64A 3JAWA 4RHUA 1QGYA 3PYXA 4YC7A 4A0SA 4A8JA 5IM4F 1E4EA 1SU7A 2YJZA 1XMSA 1R27A 3LGAA 3T7IA 1Y7HA 4JP2A 4XYMA 2OQ2A 3M1IA 4KIJA 1A7UA 1Z06A 2LKCA 5HFNA 4X84A 5T8KC 1PZNA 5B6IA 3U4QA 1P45A 1XZFA 4MNTA 2QTNA 3IJEB 4QUIA 5BUZA 4BY9E 2VL7A 2QW8A 1Z88A 3GA7A 4YCMA 5AQ1A 1RM5A 2XWSA 1M6VA 3EDYA 1NOIA 5IT4A 1PL0A 2H5IA 4DBLE 4EJ2A 3LQRA 4KDEA 2IOHA 2VAXA 3OCJA 4C7KA 4E5KA 4QYSA 1UWKA 1ODLA 4C6RA 2Q5HA 2ZP1A 3BULA 2IEIA 3GRRA 4JI6B 2HO4A 1XE3A 4AN1A 3BD6A 5E7JA 2D4HA 1Q1BA 3B6EA 1YBHA 2RGWA 1Q11A 1E1CB 2VOJA 3HSSA 4HGZA 3KT6A 4N12A 2BFFA 1A50B 2FHSA 5EVCA 3OP4A 1XYYA 2ZB4A 3LPNA 2RBEA 3EQ2A 4G26A 4XPIA 4MEJA 3DB1A 1PJQA 3FDZB 3N9IA 3X1DA 4ACBA 3ROPA 4JC4A 5EJ4A 1DKQA 1NPTO 3FCSB 4YK7A 1YASA 1MB4A 1VE9A 3H6KA 3I05A 1W4RA 3IH5A 2Q07A 4HZIA 1KI8A 2XT0A 4LV6A 3ZJ5A 3PXEA 3IOMA 2JHPA 2UZ0A 2BF4A 3CCBA 4FDAA 5F3RA 3SEAA 3EPJA 1KSHA 2XLCA 2NXCA 2OV4A 2GJ8A 2PYDA 3L6DA 3Q8WA 3CZAA 1T13A 5TY0A 2XZTA 4OJNA 2GJSA 2DHCA 3ICCA 5CTJA 4TTPA 2HHHB 4YMTA 4HDMB 1E20A 4DA6A 1E7SA 1LI5A 1LJUA 3EVEA 1BZYA 1WXHA 3EH1A 4XFKA 2H1HA 5DWQA 1YDGA 4BYGA 3KVVA 1CQJA 4IDFA 4PFJA 2YR0A 1CR6A 3QBVA 5EXTA 1XA0A 2H4XA 5IVIA 4NG5A 3SU8A 4HDKB 2O0KA 4H15A 2XOKD 5JAHA 3JD2A 4RM3A 4GI1A 4EF5A 5IT9A 2VSXA 4L8FA 1PTJA 1U8XX 1KXJA 2POQX 1KBZA 1ZU5A 2RH5A 4Q15A 1DRJA 4QFDA 2NO4A 2CHUA 1U2PA 3G1UA 4AN0A 2NADA 4FR2A 2JDIA 4JUAA 2V6MA 4S1NA 4P3XA 4EO9A 3WLLA 2UYCA 1U11A 3RW9A 2V7XA 1CU1A 5EZSA 1NJ8A 3Q40A 2HU7A 2O54A 3H5AA 1VE3A 2JFWA 4WZZA 4OSEA 5EINA 3R3SA 1WBDA 4D9HA 3EGDA 4CF7A 2CL7X 1DJMA 1IL0A 1GLVA 1U2SA 2WE7A 1WDLA 5EGSA 1GDHA 1REQA 3QM1A 2O2ZA 2J0VA 3DXFA 4OKSA 1ODKA 3O94A 4YUWA 2WFLA 3L46A 3KJIA 4ENUA 1NX6A 4UHBA 4WH0A 1F2TB 1ZR2A 2VJCA 5LDDC 1A5BB 4TZ6A 4Q5IA 3RABA 3FHTA 4WOPA 3IVAA 1KMHB 2QPAA 3GY0A 3OUUA 3RS9A 4D4LA 2BHSA 1ZHFA 1DOAA 1WZ2A 2BGIA 4OKIA 1DFHA 3VFDA 4FIZA 1K1EA 1Z0KA 3HE3A 1TYDE 2VP5A 2PT9A 1NC3A 1ULBA 2RCYA 3N7AA 5T4BA 1T34A 4URXR 2DLCX 3EZ6A 1V96A 1XROA 2WYUA 1VIAA 4R69A 1IJKA 3WLEA 1ISFA 1GTL1 2PX0A 3BF8A 3NVAA 4MQ6A 2QZ9A 1J25A 2OK8A 3CX8A 4BP9A 3COZA 5MF6A 3EXEB 2F59A 3HKEB 3H5NA 3OAAA 1XKXA 3NOOA 4M86A 2EL7A 4N49A 3ROFA 5CJPA 1CIPA 2I2XB 3GOHA 3I01A 2O57A 1KEZA 4CM8B 4DEYA 1P91A 1SKYE 3E03A 4OJQA 4ZT4A 1LQ2A 2OCYC 3RBVA 2HSWA 2F3SA 3RLFA 3SIWA 1WCIB 1OOEA 1T8WA 2C1EA 2E4AA 2F2TA 3G9UA 2P2LA 3PT9A 5F76A 3TO5A 2V0GA 3RASA 5JDCA 3I9MA 2D5AA 1O08A 3LT4A 4KO1S 3GROA 3KTOA 4L0QA 4YJGB 2C00A 4RK7A 3UJ3X 1JTEA 1W5SA 1Q1NA 1PYGA 3ZHTA 4QGFA 1CJSA 1P39A 1NV9A 5B58T 5JDIA 3NDRA 3G9TA 1YOVA 4EVIA 4HI0E 2DKOA 2VWQA 4KLCA 4WPGA 4DMGA 2OO7A 3QX8A 2Z95A 3FOWA 1HFJA 4NC9A 1EEXB 3EBOA 3MMNA 1GNPA 5B1YA 2RE8A 3SBEA 1TJYA 3BJIC 3QI7A 4LNUB 1IQRA 4QLAA 4WNYA 2X4GA 5IXJA 1ZQ9A 1TQ8A 4I50F 1FDWA 2I33A 3G2MA 4UXHA 1ECPA 2R5FA 3EEIA 4DCCA 2XEXA 1HLDA 3P9XA 1AK1A 2NLOA 5F78A 2HMUA 3B1YA 1DJNA 2JFVA 5HDQA 1X15A 1IEVA 3PKJA 1ZMTA 1XRQA 2IXFA 1O0CA 1RJEA 1Z6TA 2PV7A 2A0XA 3SHTA 2GS9A 1CR0A 3OZVA 3JQBC 4OI1A 4IICA 3B60A 1K66A 1QXSA 2DQSA 3BWEA 1E89A 2W6NA 3MOIA 1PJRA 3GEPA 3TZLA 1LF5A 4G0VA 2CVHA 4QUDA 1WHSA 4M89A 1EZ4A 2A5LA 2JGDA 2AB0A 3HO6A 4L9AA 3DVAA 4PTZA 2CXQA 4Q4HB 1KPHA 4FDUA 2C2YA 1G98A 4O4JF 1SVKA 4P83A 1JAIA 2DUWA 2QNRA 1XPOA 1OZ0A 2R44A 1NVEA 1ORDA 5ALMA 1DQZA 1GOTA 3ILYA 3P2EA 3L8CA 4MWBA 3ZVLA 4YJ3F 4ETNA 1E63A 5CA1A 3FJ1A 3GHHA 4OI4A 4MPDA 4ZAXA 4ZKEA 3W34A 4URVR 4FN5A 3W8RA 2B4TO 1OWOA 1SQFA 3GQVA 1F12A 4AUNA 3P2YA 2RHDA 1W93A 3E3OA 3CKMA 3NI2A 2WU4A 3EEFA 4JHLA 3ZK9A 1XZDA 2QJFA 5HYVA 4CF6A 1I2BA 3GRKA 4J7UA 4V1CB 1EMDA 3HXTA 1DMSA 1N5OX 1S7CA 1K88A 1T43A 2H5LA 4RPIA 2PZAA 1R0WA 4IL5A 2VFAA 5DEIA 3RBAA 2HJGA 4ED9A 4OH7A 5L3RA 1KZ9A 4EFDA 3OQNA 1BAPA 5JAQA 1EESA 3ZZMA 3AKCA 2ORED 3U9LA 5EIWA 2XV1A 1QYDA 3KQNA 1FQOA 1OTHA 1GFWA 4MYTA 3KKNA 4URUR 3ZW7A 3GXOA 4BS9A 4HVAA 3HVIA 1EUYA 2WB2A 2J4CA 5EJ9A 1RXEA 2MINB 5FOWA 1RPAA 3S5UA 4XM2A 2QVLA 4AULA 1N5IA 2QSJA 2AOUA 3UB2A 4UQLA 4HQLA 2C3PA 1M2VA 5J43A 1A88A 2VP9A 4JFRA 4PGAA 4F11A 4CEIB 4OXNA 2W37A 4G1MB 5I4BA 1ZZEA 3GJRA 4YRNA 3HPRA 4DDWA 3RIMA 1Y34E 2CK3A 1B0AA 4X60A 5G1NA 4KTVE 2PZKA 1JDBC 4O4HB 4DLRA 1JJVA 2QPLA 4Y30A 4CV3A 5IJ9A 1SXQA 2FR8C 1DHRA 4B82A 4F45A 2VUHB 1A8PA 4H0CA 4KNYA 2VNJA 2J8ZA 2FN8A 3JARA 5AO9A 821PA 1G3UA 3JD0A 1S96A 3WGUA 2QP4A 1TM5E 2F4NA 4JCOA 4WD3A 1UJMA 3GLUA 2OCBA 4PPGA 4AECA 2DBQA 2XCOA 1Z7BA 1YE5A 3ONDA 2D5CA 2Q6LA 4M0LA 4YAOA 1LSUA 3RUCA 1NIJA 1U98A 2J9XB 1DU4A 3DNPA 3UHOA 3LXXA 2IP2A 3QVXA 5A3JA 2NUTA 5I4KA 1N4DA 2OORC 1TGYA 1QE5A 3TW8B 5A9SA 5JNSA 4BLSA 4BB6A 1NTRA 2C04A 2R00C 3ZU3A 1IHOA 1FFSA 3BA6A 3VI3B 3ELWA 3A6JA 1T5LA 2V4ZA 4Q93A 1K9VF 3BVPA 5H4HA 2NT4A 1FJGB 2YZMA 1WBBA 1IK4A 1FMLA 1H1LA 3AIMA 2VBIA 3CUWA 4CV0A 2X9NA 3LP6A 4PYLA 4ZU6X 4UNNA 2MMGA 3FF1A 3C4QA 3CO0S 4LDRA 4R9SA 3OETA 4HGRA 1QQAA 3VYUB 2GPYA 2R5NA 1NMXA 2AXQA 3QLJA 4YAJA 1RI2A 2CSUA 4N18A 5TPZA 1YBVA 1QP4A 1VG9B 5DBHX 1TZCA 2A59A 4O2AA 4PQFA 5M34A 3RRYA 2BP7B 3EFEA 4B9EA 1AHPA 2Y67A 1QE0A 3TTXA 4R2WA 1KU6A 1JG1A 4Z9BA 1D2GA 3A4NA 4BC1A 1HZZA 1VLHA 3AHIA 5AHOA 2HHLA 2PMKA 5FBRB 5KMGA 3BCSA 4BNNA 3OF3A 2IC5A 5TMPA 1M72A 3ITEA 1SQSA 4U7DA 3RJMA 4B73A 1YS4A 4KCGA 3NRCA 4Q9NA 3AHGA 2QR2A 3JQCA 3DWIA 2AK3A 2FPMA 4XE5A 1K5GA 3OICA 1V8PA 3TTWA 4TYWA 3A04A 3CR8A 3QU2A 1YGYA 4MRVA 3UAYA 1C0KA 1T1EA 2WF7A 2VVTA 1CR2A 1LFDB 1PBTA 1I9GA 1VLQA 4CW7A 2PO5A 3SXJA 1TECE 3JQQA 4NMMA 4IUYA 4OQNA 1YZUA 3NNNA 5EEHA 3HKBA 2FKAA 3P0IA 2VCEA 4JJ6A 4YRRA 5FL3A 4UBOA 3UBMA 4E4RA 4EYEA 3L7MA 4F3NA 1XU4A 1E6MA 4JBXA 2FMKA 1E3DA 5EJFA 5KNBH 4GQAA 1E77A 5JEDA 1J9GA 2HNAA 1Z7EA 3DB2A 4XVRA 2BRUC 3KVYA 3PKIA 4ZEOA 3WL8A 4JJGA 1DKMA 3TSYA 2VJMA 1GZ4A 1UPAA 5KHOC 4FQ7A 2AL7A 1WKVA 3A10A 1OH7A 4MI1A 1M5TA 2QYOA 4Z4EA 4I9NA 3USZA 1YRLA 4LYFA 3AJ9A 3KKEA 4FWIB 4HJRA 3VO8A 5EJ7A 3H7AA 5H68A 2PUGA 2JKVA 4HQ6A 4MW6A 3GAFA 3VX3A 3HNOA 2NOAA 2XGSA 3VHXB 4A1FA 4B79A 1JR3D 5TGTA 1PZXA 1VLJA 4JV5B 1WMSA 1YGPA 2PKEA 4HOYA 1EDBA 4JR2A 3MEQA 4NJEA 1O95C 3VSAA 2OC4A 3I01M 2WR8A 3L7OA 5IN4A 1C30A 1R9GA 4O02B 3O4HA 3OJWA 4PAOA 4XASA 5DYWA 1V9CA 1E7MA 1WMAA 3CHYA 4LXTA 2OVFA 1M7GA 1YB4A 3GPCA 5F2EA 1Y3CE 3ZPXA 2Z04A 4BU0A 1K0FA 2G82A 3HKCB 3MWDA 4K9SA 4X00A 3G8BA 1C3JA 2RHOA 4UTOA 3JU3A 2C8KA 5CD1A 4DARA 2GEVA 4Q1AA 1DEAA 2HUNA 3TZCA 4QGHA 1W88B 4LY9A 4W8HA 1GPDG 1Z3CA 1OBVA 2LD4A 1Y48E 1XA3A 1N92A 1QJ4A 2BGKA 2G5TA 2GNPA 2LZ0A 2R8BA 2TMKA 3DSRA 2DQYA 4FNMA 4PS0A 4CIBA 2VT7A 4EGAA 3UMJA 1T26A 4X0EA 3S40A 2HWUA 3C43A 4RUKA 3CPHA 1L8LA 4P2BA 3ROXA 1YKFA 2I91A 3Q3GE 3UKJA 1FTWA 2ISQA 4N39A 4LF7B 5CDGA 3CNQS 4WK4B 2FETA 3WLJA 4HEA6 3WRXC 3HBNA 1PCXA 4X6UA 5TQ2B 2Q9UA 3C85A 3DVQX 5FOXA 1ACLA 3PIRA 5MN5A 4FGUA 2G9RA 3JYHA 5K8TA 3BB4A 4IUBS 4KPUB 1W1IA 2IYZA 3RTDA 3NHJA 3PC8C 4WCFB 1IZYA 1N0UA 2YX1A 3PB3A 3TZ6A 2HWWA 1UZNA 2GD2A 1EFVB 4J4TA 4RZ3A 2J0QA 5TT0A 3MFQA 2RJOA 2VXYA 5AKEA 3H9CA 1F38A 2V54A 1ZM4A 3KHTA 4KFRA 5JXGA 2CVPA 1Z6PA 3CZ5A 4G1UC 3K2IA 5JRDS 3VOBA 1TEZA 1WJGA 3R9IA 3BXFA 4FKZA 4BB5A 5HS6A 1GTSA 2QL7A 2XIJA 3FSEA 2G40A 1U5CA 2YNMC 3GEHA 5CFLA 1PYOA 3ZNOA 4WJLA 1PJ4A 4Z8YA 1Q1GA 2PLFA 2ZRDA 4GGMX 3GEEA 1D4OA 3LD9A 1NF9A 4KQEA 4LGYA 2W2LA 1ZLXA 3TKLA 4CL2A 2H1VA 3GJTA 2BH2A 2JLQA 4TM7A 1YO6A 3AFOA 4MMYB 4IIJB 1AE1A 1O5TA 2PIAA 1UBMS 1IONA 1T0BA 4L2IB 5HFAA 3SF0A 1KZ4A 2A14A 3VKFA 4AO7A 4D57A 3WBJA 5E7QA 4Q05A 1RHQA 1ULTA 3F4KA 2H54A 5H81A 4AYWA 1C3OA 5LD2B 3A7DA 3CW2A 4B3HA 2UZ1B 1XT6A 1XKQA 3NYIA 2X2PA 2R87A 4M8IA 1MX9A 3O03A 1HY3A 1RQGA 4I1VA 5ELLA 4XYBA 2CXPA 3GA0A 3DKPA 4PC3A 2I6QA 5CFPA 4GXQA 1MZPA 4IGAA 4LXYA 2F9LA 3ERCA 1KOFA 2XQKA 5CVUA 1OI3A 2C61A 1THGA 1ZH2A 2Q3JA 1QPGA 3A6LA 1T15A 2IIBA 5BR1A 3MWEB 3WDLA 4PLPA 1O96B 4R2HA 2ZTMA 2CDCA 3UMGA 1E5QA 5B12A 5EJ6A 2DPXA 3G59A 5K5EA 5MGNA 3AF5A 4J9VA 2ZTSA 3IXMA 3MSCA 1BU8A 1DPGA 3IIKA 3P19A 1EK2A 2AGVA 4G8DA 3UCXA 1JSZA 4BQSA 1PR3A 1ZH4A 3ICPA 4M0EA 3EZFA 3CEHA 1CUIA 1YA8A 4J1QA 3KR2A 4G01B 2A5DA 4XR9A 3WB1A 1MGPA 1EX1A 2JAWA 1ZUNA 2DMRA 2Q9BA 1RQRA 3RAPR 1TJ4A 4IO1A 1U28C 4TYMA 2XRZA 3LLMA 2BI7A 2Q4DA 1WE2A 3QVTA 1FB5A 4PV7A 2WJIA 3SXPA 1ADGA 2FZEA 4IFEA 4KVGA 1SCIA 5CVCA 5I9NA 1PUXA 3CUSA 2ZI6A 4HDRA 1ACJA 3LL4A 4TL7A 5AVSA 3A1FA 5EWLA 5HILA 2YV4A 4EI8A 2X6TA 5BW6B 1NG9A 4HVLA 3EWAA 3C1OA 5JCPA 1XDZA 2BMFA 4B33A 2OMEA 3K0CC 4AKGA 3D1LA 1BQEA 3LQ2A 4L4RA 1HM5A 3TDMA 1R4NB 1Z18A 1IY0A 4E2ZA 3M6LA 2JB9A 2WSLA 2Z9BA 4MKZA 2H52A 1DWUA 2JLCA 3GUUA 5IHPA 5CRIA 4NCXA 4MKXA 2P2CA 3JQEA 2DSNA 4GOMD 2X7JA 4U9UA 1Z5GA 3U3OA 1HT3A 1MABA 2BONA 2YIMA 1PV4A 5IC4A 2PFSA 4D41A 1JYFA 2NQ2C 2RCNA 4G56A 5MDHA 2EC5A 2XYPA 4RIIA 3DT6A 2ZAOA 3X2EA 5FFNA 5BXQC 1M2NA 4C5BA 1X77A 3OM9A 1FU4A 1XP8A 4HQ0A 4NNPA 3S5JA 4P0PB 1X86B 3VZQA 4ALKA 1DKOA 2IV3A 4BUZA 3AESA 2I1LA 3DZJA 5KS2A 1M74A 1IY2A 3VPFA 3H5VA 1ULZA 4D8TA 2BKAA 1QHIA 4WEQA 3D8TA 4OUKX 5IZCC 3WK9A 2P4HX 3MSXA 4I1OA 1NXOA 4QTYA 1RYEA 3VAAA 4YCAA 2I6TA 3KCNA 4UUPA 3W7AA 4E13A 2E18A 1B6TA 3ZWQA 2OD2A 2HIGA 3DMNA 1P8AA 3VHQA 2ZYSA 4MAAA 1TTTA 3JYQA 4AJNA 3D4NA 1AKTA 5JS2A 4J43A 4M38A 4Q21A 5CXSA 1L5LA 2YXLA 3DV2A 5F1YA 2QVBA 3WKDA 4J7XA 5DLEA 1Y7TA 2A7QA 4QG7A 2Y05A 5AI8A 1IHXA 1KHHA 2Q3EA 3D5EA 5JSQA 5DCWA 1F7UA 1A69A 2AEMA 1I2DA 3DR5A 2QENA 3KRTA 4HLQB 4P32A 3E9RA 2O8BB 5LZ7A 3BL6A 4PG8A 4TS1A 1FFEA 1RC0A 3F49S 1MT3A 1CF9A 3GAZA 4FFVA 4O4IB 1TM4E 3UUWA 1T8SA 2B8TA 2D1RA 1PWYE 1V45E 4U8HA 3SBXA 2HLDD 3GBVA 4PYJA 5DHPA 4B2LA 4CDGA 1RQ7A 1T9HA 4M6WA 3WMGA 2X8JA 1PD0A 1S9HA 4EQ6A 1T25A 1SA0A 2PUWA 1BS2A 1LVUA 2R6JA 4FHDA 2PCLA 1ECCA 2C96A 1YRHA 3HMQA 1SCUA 1KJQA 3L79A 2I2BA 4MQLA 5F4BA 2FE4A 3KNZA 4MIOA 4ASUD 3GBSA 4MVJI 4CKYA 1QQ6A 2RAVA 3CUKA 2BFBB 4QOIA 3H4TA 5CW1A 5EP2A 1O77A 3KYIB 4OAPA 2YMQA 3IP6A 1RNLA 4UEJA 4G5HA 3QEMA 5K0GA 5LZ8A 4FNAA 4EG4A 4M2LA 1SURA 2AI3A 2P9FA 3LZDA 4LFBB 3A3PA 1VPTA 1V5EA 3D7RA 2CCKA 1KFBB 1HGXA 2DJIA 3V1MA 4DLKA 3E9CA 2JIZA 4BE4A 5IANA 4OM7A 1KOLA 3L7IA 5DPMA 2IPMA 4DC9A 4DJTA 4LF4B 4RPGA 1ZRSA 3U44B 2DKFA 4HNRA 2YN0A 3CXUA 1MV5A 1PFQA 3JALA 4QYTA 3CUEF 1ZIPA 1KMNA 3TLGA 3VR1A 3WXBA 3U5TA 1KO1A 4JEHA 1JZSA 3Q5DA 5HZGA 4MINA 1SK8A 1ZOLA 1D6NA 3MGBA 1L0BA 2P9QA 1SK9A 3LWBA 4WESA 3UHPA 4QD3A 2QHXA 2PKYX 1K08A 2ADMA 4A7PA 2B1RA 5ALLA 3OFSA 4D46A 1Y8CA 3MWFA 4LRSB 5FPKA 5BP7A 3QE9Y 1WUYA 4C03A 3DMHA 4CCWA 4NFYA 4GMHA 1LV8A 2H3EA 3D3JA 4CCYA 1KP2A 1CY0A 4KYIB 3A1TA 3K6KA 3SP1A 2VP0A 1X1BA 3ICEA 2CJFA 2JEOA 1VDMA 4UVDA 1QSGA 2WTAA 5FAKA 5DFAA 4MAFA 4EHIA 1RBZA 4I0WB 3AZOA 4IVQA 4PR3A 1IXRC 3BWVA 2JK1A 3WGHA 2HT1A 2ECFA 4YFVA 3CRQA 4L3WA 5DGCA 4BO4A 3TDNA 1E5TA 2QMHA 1DTSA 1W0JA 3I76A 5LB2A 5HF9A 5BW4A 2QAGC 4YAWA 4BKMA 2WG0A 5SZHB 1R9NA 4TQ9A 4V02A 2NO5A 4RZXA 3AW8A 1J0XO 3EAFA 3JSAA 4JGGA 1IAQA 3IQZA 5LLDA 2VWGA 2GD1O 3BMOA 5E4FA 5DNEA 3DKKA 3H5RA 2OGUA 5LIRA 2ZSJA 3V8QA 2L2QA 1TKAA 3B5JA 4MIYA 3T9CA 3CLHA 1JFSA 1UXHA 2OO5A 3M8KA 1VJ1A 3WKCA 1EVQA 2J3JA 2R2AA 1YULA 4QTXA 4RK6A 4CEJA 4RGVA 4YAEA 1Y5LA 3CJRA 3O4RA 4N76A 4K6GA 3D3WA 1SOMA 1N6PA 4PLWA 4P82A 2QR3A 2Z43A 4FMBB 5IW8A 1GJRA 5B58C 1Q1AA 4M88A 4YRKA 2YIVX 3IAS1 4DLWA 2R7KA 2FX5A 4M9SA 1JEDA 1ULSA 4ZHQA 3JQPA 2PGIA 3FTDA 3VZRA 3VC2A 3GMSA 4BPRA 1CYEA 1U9IC 3K0FB 3H0EA 3TTVA 5LUBA 1UXKA 1VE6A 1G63A 3M0EA 4URFA 3P7MA 4NQZA 1GA4A 1WXEA 3OZCA 3OJOA 3WA6A 3IO5A 5BURA 3NYQA 1S3IA 3I8XA 4KFCA 4W9MC 2ALJA 4CXMA 3K0AB 1DX9A 4UASA 3UB3A 1WCWA 4CMEC 1U0TA 3FX2A 1M2OA 4KPFC 2DQ4A 2JARA 1DQNA 3A4YA 1ZGCA 3ESYA 2JJ2D 3FNGA 5DHTA 1I30A 3GLHA 4YP0A 5D87A 4DAEA 3BD9A 2OZEA 4Z54A 3AVXA 1FXUA 4BXOB 3VX4A 4Q82A 1FUKA 2C5LA 3O4IA 4JOCA 3RARA 3TGLA 1ID8A 2LUOA 5AUOB 5JASA 1KMMA 3AP1A 3KT0A 4HT3B 4MGKR 2IZ7A 3LUDA 2PCJA 2X1LA 3QEJA 5JATA 3HR7A 1J20A 3HYRA 5KU1A 1ZD4A 1ISHA 2B0CA 4NG4A 4JI4B 3BT7A 1BCRB 3S2ZA 1NJSA 1VSBA 2JLBA 4JXKA 3VYRB 1QU2A 5E2AA 1F3OA 4OK5A 4RYDA 4TVKA 2YYSA 1JDBB 2HGSA 4UUNA 2C07A 3B5IA 3FAZA 3PS9A 3DF7A 3DYVA 4WCDA 4HBZA 1Y6ZA 3RFTA 1RPJA 1R3DA 3WB2A 1FS4A 3ZNPA 4D5GA 5JD4A 3ONVA 5JEEA 4HEJA 2P6MA 3ZD9A 3H9UA 1ZJ6A 3E05A 2ZTVA 3GFTA 3MJCA 5C34B 4F3KA 3GWGA 3THWB 1DX6A 5LNK1 1AO0A 4AY4A 3BGSA 4HNQA 4MYDA 2XQJA 2D54A 2WHPB 2X0RA 5JCJD 2BEJA 3W90A 4QE3A 4F2DA 1OMOA 2G0TA 3HZHA 2ZUEA 2YZKA 1XEWY 1CDZA 3EF0A 3R0QA 2AW3A 3TQCA 4PO3X 4G23A 2HU2A 3M5PA 4X20A 1OCEA 2EJUA 3AOGA 3HJCA 4MI6A 4TT3A 4WLUA 4DZTA 4TM8A 2I2DA 3AKDA 5LP1A 4CFSA 1N0IA 4EIWA 3QF4B 2F62A 3ICVA 5FBQB 2D8AA 4G65A 1TRKA 6AT1A 1T5BA 5LYJF 5A4AA 1AMOA 3RE1A 4HDCA 4RXTA 5JAUA 2IYOA 3K6SA 1ZD8A 4QAQA 1ICEA 1Z34A 2X0IA 3RSHA 1YAHA 1FNNA 2WIBA 2PLWA 4YNBA 1P3JA 2PA3A 3PKZA 1F20A 5EUMA 1TT5A 4KQFA 3P9NA 2W6ZA 5IWAB 3L3BA 1Z6AA 4U6QA 4G9GA 3GUHA 4RANA 1NXTA 5C5IA 5JCOC 1K4MA 1W5AA 2CXNA 3VPGA 1KVSA 3UWSA 5FO1A 2I4MA 2ODBA 3ZVMA 1CY7A 1EE1A 1PT7A 1B0UA 1LPPA 3L7NA 4IKOA 3F6PA 2I87A 1G8FA 3JX9A 3MJDA 3LPLA 4GRDA 3ZN2A 1ZKDA 1AQLA 2WFMA 1W5TA 4MW4A 1X80B 2VKQA 4K9KA 1JN0A 1UFVA 2IYVA 5JSKA 5BSMA 4JMLA 3RAJA 5L7TA 2BMWA 1B00A 3GG9A 5K3BA 2D0PB 4H77A 4OFZA 5M3BA 2V5AA 3LFUA 3WWCA 4AWXA 4YAIA 3K9HA 1QS0A 4OTZA 4D4HA 1RADA 4C0HA 1CUZA 5LBIA 3FOEC 3CE9A 3UMRA 1BWPA 3TE7A 5JZMA 2H1FA 3MUFA 4U8GA 3ZQ4A 4BX8A 3HU1A 4JEIA 3IHTA 1YZYA 2NVUA 3EXG1 1G3QA 1YJAA 3ZOZA 4D9IA 2BTOA 3LE8A 5KSZA 5LMCA 2FQQA 4I7EA 5HIKA 2YQZA 3GLHE 4YV2A 1WPXA 1CP2A 1N6NA 2OYSA 2WMNB 2FSHA 3UWDA 3D8SA 3RGWS 5HK9A 2WU8A 4XQEA 1QIFA 2GBPA 2RHBA 5H3LA 3B1KA 1QCDA 3PFIA 5AW6A 2RBGA 4BQOA 2AX3A 4YDSA 2QOEA 3N2YA 3NTXA 2ZJ6A 2QMEA 1GTMA 2P7IA 5BT9A 2IUUA 2RC5A 1AB6A 4ILEA 4EFNA 4AS3A 1UEIA 2IHUA 2K2WA 4G5XA 2GASA 4TSFA 4D4MA 1WB5A 1KK1A 3BWMA 3RUDA 3RVOA 3TKAA 3U3ZA 4DCOA 1WF3A 2ANCA 2REQB 1T29A 3I2IA 1ZBDA 4W82A 4EARA 5A4FS 3TLEA 2Q7XA 2G08A 4A0FA 3WGNA 3T41A 3IE2A 3T7KA 2QW1A 1MN6A 4FP9A 5TF0A 1GQFA 1F17A 1UUFA 1VI6A 3KV3O 4DCJA 1U2DC 3H4MA 3OEEA 5AXAA 2FOXA 2Z30A 1J07A 2KSQA 2P69A 3FG9A 4HDSA 4LVCA 5JO9A 2XUGA 1FFCA 1Z5NA 1DE0A 1R5BA 2FUCA 1NE2A 2HRBA 4LJ6A 1HE1C 4TWJA 1FFAA 5KAMA 5ICCA 5KYWA 2XHZA 2OXCA 3PSHA 2OBBA 1RRPA 1V7CA 3F4LA 5BNTA 5KB3A 1RQPA 2KYRA 4V0OA 3WSTA 5JSUA 5DNWA 1LBSA 1GR0A 1Q21A 2VF5X 3DR3A 4QYIA 2XPCA 2ZBEA 4YLGA 3HUTA 2FF5A 1E9SA 3S1LA 2Z8ZA 3G5AA 1CVIA 4FDTA 2JBAA 4NXMB 3RRMA 1DKNA 3M4JA 4X1YA 2J9FA 4Z4IA 4K9QA 3C5VA 5CFQA 2OL4A 1ULAA 2IY8A 2WJGA 1GT6A 5I7OA 5J3JA 4JR1A 2QBYA 2YIDA 2OECA 3L8ZA 1KA9H 3MMZA 2QDXA 5CA0B 1ESCA 7REQB 2Z2IA 3TQQA 2R96A 1OIVA 2RI1A 4RA9A 4E08A 3D6UA 5EXXA 1NW9B 2C94A 3I9LA 3JSXA 1DT3A 1XQ9A 2FDXA 3LECA 1HDZA 4R7GA 4PU0A 4IJVA 3DZIA 2JLRA 1OFIA 5K3SA 4PQYA 1KRWA 1P4RA 4NDAA 3UB4A 1O87A 2W2KA 4DJFC 1IBSA 2R2GA 1OX4A 2WF8A 4OXIA 4QNRA 1UK6A 3EMDA 3VR5D 1SXJC 5H1YA 3MWLA 2ZBRA 1M8PA 2G0NA 2Z6VA 3A3OA 3AT1A 4DWJA 4NICA 1VL2A 2FG5A 3MC1A 4RJIA 3DMTA 3ZHOA 5HKBA 2GM4A 3ZHRA 1OYOA 1OBHA 4JT4A 2R62A 4FEEA 2CC2A 4BX0A 2FEAA 3SCZA 3UJHA 2R1VA 2VUIB 2P9ZA 4FR5A 1G2PA 1JRLA 1EJBA 1N2CA 3EXFB 1I1NA 1LQUA 3BB3A 1WZEA 4RY8A 4DLYA 7MHTA 1THZA 3CRNA 4EA9A 4M7RA 4OKNA 4HB3A 16PKA 1R8JA 4WOJA 2DFDA 1KMIY 2JVKA 1VFNA 3DEFA 5AJUA 4MOWA 4ND6A 1XFDA 3RC3A 4LHVA 4L50A 4GX1A 2FJ0A 5K6AC 5BUCA 2ZIEA 4XDZA 5EYPB 3DMPA 1QZTA 2ZS8A 4PAQA 2WPDD 2NV2B 3UK7A 3NEAA</