3BXPA

Crystal structure of a putative carboxylesterase (lp_2923) from lactobacillus plantarum wcfs1 at 1.70 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
274
structure length
258
Chain Sequence
GMQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGDKYLNDQAAIWPQLALRWLQEQGLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative lipase/esterase
publication title Crystal structure of putative carboxylesterase (NP_786266.1) from Lactobacillus plantarum at 1.70 A resolution
rcsb
source organism Lactobacillus plantarum wcfs1
total genus 81
structure length 258
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bxpA00
5HF6A 2PSFA 2JIDA 2HM7A 4HRYA 3RLIA 2JEYA 4UBMA 4BVKA 2HADA 3UMJA 2WHRA 1F0PA 3STVA 4HAIA 3ZLUA 3RKSA 2ZYHA 2QTBA 2FJ0A 2ZSIA 4MQMA 4WFJA 4EY6A 3IUJA 1XZCA 4J0CA 3WZMA 4UFNA 4U2FA 1UKBA 4DM7A 1ORWA 3PICA 3PFCA 5DNUA 1CUXA 1WM1A 3KWFA 1WCYA 1XZFA 5LZ4A 2XUFA 1VXRA 1CR6A 3FLEA 1LPAB 3WKBA 4X90A 4H7DA 2WSLA 5ALWA 4BATA 4Q3KA 4AO6A 2FX5A 1AC5A 3RK4A 1QIDA 4CCYB 5JZSA 4X92A 3NUZA 1AX9A 4UBIA 3EF3A 5DJ5A 5JASA 1FFBA 2JF0A 5HK8A 2I3ZA 5ALQA 4Y2PA 2VT7A 4W1QA 1BN6A 1SFRA 5JALA 1FFCA 1JMYA 5AKZA 2CEKA 1O6FA 3C6XA 3BE8A 5K3FB 2WUGA 1U2EA 1YB6A 5K3BA 1UKAA 4FTWA 1ZI6A 4PF1A 1YCDA 4ZREA 3VDXA 3C5WP 4BB0A 1CUJA 3CCCA 3I28A 1VZ3A 3WL8A 1AUOA 4M0FA 4I3FA 2XUGA 2OAGA 2XDWA 3A70A 3WMRA 1JFRA 2WFLB 5JARA 3QVMA 3AJAA 4EY5A 1C7IA 2C5GA 2IIVA 3IDAA 3EQ8A 4CG2A 1VLQA 4CI9A 5DLPA 2RI6A 2H7XA 3AIMA 1CUDA 1QIFA 5D6OA 1DWOA 1GKKA 5AM1A 4BDTA 3OC0A 3WKCA 4LXHA 2PU5A 4E15A 5JAUA 3C87A 1EX9A 2Y6UA 3G9TA 5AK5A 3DEAA 3BDVA 4RGYA 4X6XA 1E8NA 3QPAA 5CRIA 3H2HA 1BE0A 4FNMA 4OB7A 4O08A 1G4HA 3E0XA 2G63A 2XLCA 3WL5A 5LKAA 3WL7A 1P0MA 3TEJA 5FRDA 3BXPA 4Q3LA 1QLWA 4CG1A 4CIBA 3QMMA 1CIJA 3SC2A 3W04A 4Z49A 3LLCA 1WB5A 3WL6A 5C81A 3ESBA 1ZIXA 4Q1VA 1RYYA 4W9RA 4LYEA 1YR2A 3U0VA 1XRPA 4KR0A 4GW3A 4KRXA 1ETHA 4AZ0A 5FDFA 1G66A 2ROQA 5ALNA 2RIPA 1EA5A 3MVEA 2QOEA 5J3JA 2O7RA 4X00A 1CUIA 2X8BA 5HZGA 4H77A 2J3DA 4QEKA 4OB6A 1CRLA 1BU8A 3BL8A 5T4HA 1J06A 1QTIA 1ZD2P 4UBKA 1GGVA 5ALEA 2VJBA 3KXPA 3D5EA 1BS9A 3GA7A 4KAAA 4B85A 5K3DA 1E8DA 3IBTA 3N0TA 4UHCA 1FFAA 5LLSA 1R3DA 4CCWA 4WFIA 1MNAA 5AK3A 2B61A 5EGNA 2VT6A 5HF5A 4BCBA 2QRUA 2BUBA 1ORVA 4N8DA 4X94A 1C4XA 1XQXA 3FSGA 2RONA 4PO3X 4Y9SA 3W9UA 1LPPA 2OCKA 4PV7A 2VA9A 4FKBA 3V1KA 4PQEA 2ORYA 3WK7A 4U2GA 1QO9A 4BRZA 4C01A 4E46A 2HA7A 3H17A 5E4JA 3ICVA 2DQZA 4J0IA 4X93A 5AK6A 5I9IA 5ESRA 1QIGA 2JBWA 3GZJA 5K3CA 2GYUA 2WIKA 2GYVA 2NW6A 5AK4A 4Y2JA 2J4FA 2CB9A 2WG0A 4C6HA 3ANTA 1BEEA 4AN0A 1GT6A 1DU4A 4G4JA 2WUFA 1EHYA 3QH4A 4QDOA 1CUYA 3S8YA 4A16A 4E14A 2Z8ZA 4MXDA 3KD2A 3WK6A 4GBGA 2XMCA 4W1PA 1Q84A 2O2HA 3O9MA 4ZWNA 2HA5A 2BJHA 4G8BA 5AOAA 1JJIA 4S0XA 1LZKA 2OAEA 5A6VA 2WJ6A 4Q34A 4QDXA 4AQDA 1CUUA 2PSHA 5AI8A 4ZXFA 2XUJA 1TK3A 3DL4A 3FOBA 3HC7A 4MWSA 5DTJA 5SYMA 1UZAA 2G4LA 3R0VA 3DOIA 1WPRA 2BCEA 1XRRA 4B80A 5ALYA 4Y2XA 3OG9A 3IULA 1JT2A 2YYSA 2PVSA 1JU3A 3LIPA 3PF8A 5HKBA 1E66A 3PUHA 4Y2TA 3H19A 1HDEA 2W6CX 4BZZA 4U2EA 3KSRA 1VA5A 2HL6A 4X6UA 1E3QA 1QO7A 3E3AA 3Q0TA 4IO0A 5ALHA 5T4BA 3WYNA 5JD6A 4JEIA 1P0IA 3KDAA 3H1BA 5A62A 1A8SA 1F8UA 5AO9A 5BWBA 2OCIA 3AUKA 4XVCA 3ZPXA 4L3WA 3FYTA 1CV2A 1QGED 3T52A 3FBWA 3G0BA 2Z8XA 2DHEA 2QUAA 5E4YA 1H23A 4D9JA 5C8ZA 3HRHA 3STUA 2PSJA 3DCNA 3WA7A 1VXOA 2VJDA 5LZ5A 1TQHA 3FCYA 2EDCA 1THGA 3IUMA 4GXNA 4GDMA 4BTLA 4K5QA 3IUQA 3V1MA 5HFNA 1PJAA 2ZVDA 3SK0A 3D4LA 4QDTA 2QS9A 3R3UA 2WHPB 2CZQA 5H3HA 2YXPX 3QMVA 4PSDA 1IUOA 2XQJA 1ISPA 2XUIA 2ACEA 4IH4A 3RM3A 4OCZA 3S2ZA 1AQLA 3W06A 3L1JA 4HVTA 1VZ2A 3PI6A 5C8VA 4AO8A 5HCUA 2OCLA 4YASA 4DSAA 5LZ9A 4DTCA 4ZV7A 3OTQA 5JD4A 5AH0A 3D2AA 2WTNA 3AFIA 3G0CA 3JW8A 2PSEA 3ZLVA 1U65A 2G5TA 2V96A 4F0JA 4UHBA 1W76A 3G9ZA 4EY8A 3R3XA 3D7RA 1T2NA 3MGAA 1N8SA 3BDIA 3V48A 3QMWA 4K6KA 5ALGA 4X7BA 1CUEA 5LIPA 1ZD4A 2WHQA 1N5RA 1IZ7A 3CN7A 1U8EA 3WZLA 5YASA 4AX4A 4QLOA 1H2YA 1PFQA 4Q82A 3ZI7A 4KJXA 4GI1A 4KE9A 1BROA 5E4TA 1JMKC 2AXEA 5FPPA 4OSEA 1QIKA 2OG1A 1FFDA 1G42A 5AM3A 4OYLA 2WIJA 4DLNA 2D5LA 1FSSA 1I6WA 4BCDA 2Q0XA 1USWA 5AKJA 1VKHA 1LPNA 3K2IA 3AIOA 4EHBA 5FXMA 1XZLA 3HYSA 2QM0A 2OLEA 2QXTA 4BAGA 5JZ9A 3N2ZB 2BGRA 3I1IA 1W4LA 4LIPD 4ITVA 4P92A 1XRQA 4BBZA 1ZGCA 4FOLA 4IH1A 5D3ZA 3WKEA 2H7CA 4U2BA 2GBGA 5AKGA 4FFVA 5JANA 1CPYA 4A23A 3UUFA 3I2JA 1Q0ZA 1S8OA 1LLFA 2HU5A 2V98A 2XUQA 3B3QA 2PX6A 3VVLA 3FLAA 5CBKA 4H7JA 4B6GA 3H2KA 4X95A 2WQZA 4LXIA 1YAJA 1EXWA 5AKIA 2XMZA 1HLGA 4I19A 1UK9A 1K6EA 3HZOA 2V97A 3EQ9A 4HS9A 4AMYA 1IUNA 1EDDA 4N8EA 1P0PA 4M0MA 1CUZA 1R4ZA 4L72A 4DNOA 2QXUA 1SCQA 1LPBB 3WQHA 4RPCA 2XUAA 3B5EA 4UBJA 5KWIA 2UZ0A 3V1NA 5JD5A 1Y37A 4DNQA 2WFMA 1MT3A 2R8BA 2Z5GA 5CT6A 4OPMA 3OURA 5ALIA 4JYPA 1M33A 4JNCA 4BVLA 2HA4A 3ED1A 3FYUA 4HZGA 3A6ZA 1R9NA 3DQZA 2D0DA 1QIJA 2ZJ7A 1NU6A 4AN1A 4QZVA 1Z68A 2HRRA 1TCBA 2GYWA 2HA2A 4G1FA 4X6YA 1Y7HA 4M0EA 4WY8A 4EY7A 5LYYA 5ALFA 5EHZA 5EIHA 3W9BA 5KBYA 5JZBA 1BCSA 5SYNA 3WWPA 4I4CA 4Y7DA 1BCRA 1JJBA 4NMWA 1R88A 1F6WA 4LHEA 4Y2QA 1TCAA 3HACA 1UWCA 4FBMA 3BJRA 2QKYA 4KYVA 3O9VA 3CN9A 2XMQA 5JAOA 2HDWA 3DYVA 3A2LA 2VATA 3GFFA 1TAHA 3DJYA 1WHSA 2WJ3A 1YA4A 1WB4A 2JGLA 3AILA 4DNFA 1UK8A 1TCCA 3X3HA 3STWA 3WYDA 4OB8A 1B6GA 4KE8A 5HQ3A 3DDUA 3OM8A 3M3DA 1DT5A 2WG2A 4OD0A 5AM4A 1B41A 3PDCA 1QIMA 1XZDA 3PF9A 3C70A 5HF8A 5CT5A 5BWCA 3FVRA 1VE6A 5HFAA 1CUSA 3KOOA 2XUHA 1VOTA 3HJUA 2Y6VA 2RHTA 1XZIA 4H7EA 4BVJA 4MJ3A 5ISMA 3E4DA 4A5SA 1K63A 1YB7A 4L0CA 5BV7A 1XZKA 4C4XA 2W22A 4KE6A 4BAZA 1A88A 1TRHA 4BZWA 1IZ8A 1ZI9A 3G9XA 4LYDA 2C0PA 1DTEA 5AIBA 3DS8A 4ZI5A 2O2IA 3ESCA 2XT0A 4C4YA 3I6ZA 2BKLA 3AINA 5JIBA 1MX5A 1GZ7A 1BRTA 1XZEA 3HXKA 3K6KA 3VJLA 2HA6A 5CH8A 1EK1A 2H7YA 4DMCA 3AZPA 5A7FA 4AXBA 4B7ZA 1GQRA 2B9VA 1OCEA 2VSQA 2CBGA 5T4FA 4CFSA 2HHAA 1DX6A 5ALKA 4TVKA 4WDRA 4J0GA 3OOSA 1QZ3A 2ZYIA 1JI3A 2CUTA 4UBOA 1SCKA 1OILA 2ZSHA 1ACLA 4N5IX 3WIBA 4G8DA 1MTZA 1H2WA 1JU4A 5ALJA 5I8PA 4X3CA 2I03A 1DINA 1MPXA 4UHHA 4C87A 4DYHA 3IUNA 5ALMA 1THTA 1DQYA 4B82A 4J0JA 3H2JA 4EBBA 2J3QA 4PSCA 1QONA 5IVIA 1BEZA 4ETWA 1E5TA 1Y7IA 3DLTA 5IH7A 4QLAA 1N5MA 1UOPA 4WY5A 3LS2A 5ALXA 1L7AA 2OQIA 5K3AA 2O2GA 4BC1A 5FUMA 3G7NA 7YASA 1UKCA 3G8YA 1HKHA 3Q8WA 3DD5A 3ICWA 3D2BA 4IH9A 1XLVA 2AJBA 4H35A 3WWEA 5D7BA 5A7HA 5LP1A 1UK6A 4FLFA 3H0CA 4KAJA 1X2EA 5FV4A 6YASA 3C6YA 5AI6A 3QPDA 1DX4A 2XMBA 4FLEA 2JGJA 3WLAA 5ALVA 3T4UA 1XRLA 4LXGA 1CFJA 1K5PA 1GXSA 2Y1KA 2VQ6A 1QFSA 3BF8A 2ES4A 5AICA 4QDZA 4MEAA 4E11A 3DOHA 5LZ8A 2OGTA 1QOZA 4LKOA 4BP8A 2DHDA 5AKHA 3MUNA 2LIPA 2RAUA 1G5FA 2WFZA 1K4YA 1ACJA 4L9AA 4G9EA 1XZBA 3ZLTA 1ZJ5A 3FSGD 3OPMA 4H7HA 2ONCA 1AGYA 3C45A 2XUDA 3QBJA 5CTAA 4EA6A 2VEOA 1J07A 3DYIA 2Y2VA 5KREA 3IB3A 4FNGA 4QWWA 2VJAA 4WCVA 3D2CA 1ZGBA 1QIIA 5CXUA 1MN6A 2WG1A 1KU6A 1EDEA 4QNNA 3U1TA 2XE4A 3AIKA 4OU4A 3ESAA 1MO2A 1QIEA 1Q0RA 4B9AA 5BOVA 2H9YA 1XLWA 4DNPA 1XQVA 2WUDA 2ECFA 2XMDA 3C6ZA 2XUPA 1XZAA 2BFNA 2XQIA 3JYHA 5A71A 2QUBA 5I7UA 4EB0A 4J7AA 2WU4A 5EHQA 3PUIA 2C7BA 3STYA 4FWBA 2V9ZA 1OXMA 4Y2SA 1FJ2A 5AKXA 2PU7A 3NGMA 4OU5A 4KE7A 1IUPA 4P93A 1XQWA 4MQLA 1ZD3A 3PFBA 4GHWA 1ZICA 5CH3A 1EK2A 3JWEA 4B84A 2XLBA 2JEZA 3O4JA 5FKJA 3DL7A 1A8QA 3QZUA 2WJ4A 3ESDA 1MJ5A 3V9AA 5JAHA 3WKDA 4XJVA 3EIOA 1D07A 2JGMA 4K6HA 1KU0A 4UHDA 1EB8A 1XROA 5JADA 3R3VA 4HXGA 4G4IA 3AZQA 4V2IA 4AZ3A 4G8CA 1ZJ4A 2HA0A 5IVKA 1HL7A 3R3WA 3GROA 2DR0A 4UBLA 5IKXA 3F67A 4BE9A 5LZ7A 3VJKA 4H7KA 1FFEA 4K2AA 1J2EA 4P9NA 5AI9A 2FJPA 3CXUA 1RWQA 5DYYA 3AZOA 4ZRDA 1HBJA 3L1IA 4ZV9A 3TGLA 4NVRA 3IURA 4J0HA 2BAGA 2WIFA 1WB6A 2OQVA 1WOMA 1E8MA 3FCXA 2WM2A 1EB9A 4HXFB 4BYMA 3HLKA 5EIEA 3I2HA 4JH0A 2XI4A 3G02A 3A2NA 2BGNA 1VE7A 1LBTA 3G9UA 3D0KA 1W1IA 4EY4A 5JAPA 4FMPA 1L7QA 4G4GA 3K9BA 5FLKA 4W63A 2H1IA 1XZGA 3I2IA 2VAXA 4OYYA 3ZV7A 3HSSA 2OXEA 1RP1A 1MAAA 3WK8A 2QVBA 4J0KA 3I2FA 3HEAA 1JKMA 5IVDA 2HA3A 3MUOA 4AB1A 1DQZA 2EEPA 3FYUB 3G0IA 1SC9A 1UFOA 4B0PA 1ODCA 1CQWA 4W1SA 3M83A 4PSUA 1UK7A 4H7IA 3GUUA 4MYDA 3QPCA 3W2TA 2HU8A 3H2IA 4J3JA 5HK9A 1TIBA 1H2XA 4DMHA 4UBNA 2R11A 4FDMA 1XFDA 3VKFA 2JGIA 2XMSA 5JATA 3ANSA 3IIIA 2VF2A 1GQSA 2AJ8A 1NU8A 3B12A 2WIDA 4IQ4A 1IVYA 3ZWQA 4BAUA 5CXXA 4RNCA 3O0DA 1MAHA 4EUSA 2AJDA 4CCYA 4PW0A 1DT3A 1UXOA 2C58A 3BIXA 4MEBA 5C7YA 4X85A 5AI5A 3GELA 4C4ZA 1ZI8A 3VJMA 5DTIA 5F4ZA 3IA2A 4W1RA 5AOCA 3UUEA 1QJ4A 2PUJA 1YS2X 5ALUA 2RGUA 1CUBA 3O4HA 1BN7A 1LGYA 2ZYSA 5AM5A 3WI7A 4FLMA 2HFJA 4RE6A 3WK5A 5HQ3B 3M81A 3FWHA 1VJ5A 5K3FA 5K5EA 4DMKA 1ZOIA 4DSZA 5DNWA 1HPLA 2VJCA 4FBLA 1ZIYA 2CKMA 1EI9A 5CH5A 1CUHA 2C5FA 5E2IA 1XRMA 4CIAA 4TPKA 4UFOA 1VA4A 4H0CA 5HF9A 4GLBA 4YX9A 5D3KA 4U2CA 4H18A 1ZD5A 3VVMA 1UOQA 2WFLA 1LZLA 1R9MA 2CMFA 4QE3A 4FFWA 1T4MA 3HABA 4QDUA 2PBLA 5CT4A 2HFKA 4Y2RA 4BDSA 3I2KA 4JUIA 5ALSA 4TGLA 1XZMA 4KEAA 4ARBA 2AJLI 5EHNA 3E1GA 4UFPA 4K6GA 1AMNA 5ALLA 3QITA 4BE4A 5DYWA 3I6MA 4DGQA 2CJPA 5AHXA 4B83A 3ILSA 4CG3A 1CUAA 2OGZA 5ALOA 5AM2A 3R3YA 5EIAA 1WPXA 3CCBA 2ACKA 2B20A 4FHZA 3I6YA 1XLUA 5HKAA 5C8XA 4XX1A 3O4GA 1XQYA 4PNZA 4Q05A 3O95A 2ZYRA 4KAFA 1O6GA 2YH2A 3TJMA 3NOXA 1W6RA 2GZSA 2GBCA 5EHXA 1GPKA 5A7GA 1CUGA 1U4NA 4BRSA 1WHTA 2XB6A 2VTVA 1AZWA 1EVQA 5AJHA 1EDBA 5AI4A 2PUHA 5AKLA 1NX9A 3WA6A 2K2QB 1GPLA 2I3DA 1CVLA 4WDQA 3F96A 1CUWA 4MYSA 1EVEA 2ZJFA 5LZ2A 1ODTC 3VISA 1LPMA 2GZRA 5K3EA 1XRNA 4F21A 3QYJA 3WJ2A 2OCGA 2OGSA 1L7RA 2YASA 3F98A 3C43A 3BIWA 4UHFA 3WJ1A 3PE6A 1A8UA 5JYCA 2IITA 3QM1A 3VXKA 4EZIA 3WKAA 4INZA 4OUKX 2X5XA 2BUCA 3NWOA 1UOOA 2BUAA 2QJWA 1XZHA 2DCMA 2JGEA 2XMGA 4GWLA 4XIIA 3R3ZA 1SOMA 1IMJA 2XMRA 4UHEA 1EINA 3BJMA 3G0GA 3R41A 4YK7A 4Y2YA 4XWGA 4IHAA 4AO7A 1Q83A 2AJCA 5AKKA 4N5HX 3WK9A 2WUEA 4BP9A 3I1YA 2OPHA 4B81A 5FPQA 2Y2UA 5EI5A 2DQYA 3RARA 3HI4A 1LNSA 4X97A 4Y2VA 4BC0A 5CMLA 4RE5A 4JYMA 2XUOA 3C6BA 5ALTA 1UT6A 3EBLA 4KRYA 4WJLA 2PSDA 2QZPA 3D59A 1W75A 2C4HA 4BCCA 4QA9A 3H1AA 2J4CA 3YASA 4DIUA 4NZZA 5DWDA 2QR5A 5AOBA 2G5PA 3GBSA 2PM8A 1YSCA 4Q3OA 3H04A 2XUKA 2WILA 1P0QA 1CUFA 2VAVA 2C0QA 2XQKA 4ROTA 2DHCA 3R40A 5ALDA 2P8SA 3O4IA 1CLEA 2QJRA 1W52X 1LPOA 3SX4A 1YAHA 4Y2UA 1R50A 1LBSA 1N1MA 4P08A 5DNVA 2FUKA 1XZJA 4G5XA 4HXEB 1YASA 3M82A 3WWDA 3DKKA 4UUQA 4QWMA 1DWPA 4J03A 3F97A 1QTRA 2WTMA 4HRXA 1QFMA 5ALPA 2DSNA 4H7FA 4X91A 1GPNA 1HQDA 3FYUC 4DMFA 1X70A 2RHWA 1XKTA 2QT9A 1J1IA 2DFPA 5T4EA 3A2MA 1CUVA 1ODSA 1H2ZA 1PV1A 5FOQA 2E3JA 3C8HA 3I2GA 5AI0A 1EH5A 2Z3ZA 1A7UA 1LPSA 4G9GA 5A2GA 1XKLA 4C88A 5FP0A 5LKRA 3P2MA 5AIAA 1QIHA 3C8DA 2HIHA 4C89A 4ZGBA 3LCRA 2WKWA 4HTAA 5AKYA 4GECA 3W05A 3DNMA 3BWXA 2PPLA 1JJFA 2HU7A 2PKYX 3DKRA 3WIOA 4U2DA 2JGKA 4KACA 3LIIA 1KEZA 3FNBA 3WK4A 2QMQA 1YS1X 5DYTA 4NS4A 1C7JA 4YPVA 5EFZA 2HRQA 3D3NA 5AP9A 4WFKA 4MWTA 3WWCA 2O7VA 3EQ7A 3FLBA 1GKLA 4B0OA 5CT8A 4F60A 4GEGA 3SWWA 2EDAA 2WIGA 3C5VA 1AURA 2X76A 3L1HA 4F5ZA 3FAKA 3H2GA 3V1LA 1QE3A 3BF7A 1MU0A 1SCIA 2PL5A 3F9CA 5AKEA 5KWJA 3LP5A 1MX9A 5CT9A 2B4KA 2IX9A 3WWOA 1YA8A 2XQFA 3F8SA 2WLSA 5ALRA 4B9EA 1MX1A 3KWJA 3IVMA 5CW2A 2I78A 1H22A 5AM0A 2GBFA 2ZJ6A 1X2BA 5IVHA 3FVTA 2WU3A 1F0NA 2WHPA 1TKRA 3STTA 3STXA 3TRDA 2Z3WA 1CUCA 2XQGA 5CURA 3G0DA 3H18A 1K8QA 1R1DA 1CQZA 5ALZA 1CEXA 1AKNA 4X71A 4AMZA 4UPDA 1E89A 2JGFA 4J0DA 4BTVA 4ARAA 1DWQA 4N8SA 1MNQA 2GBIA
chains in the Genus database with same CATH superfamily
5J5AA 3FNRA 4BEJA 2K7FA 1T5TA 4UM5A 4EHKA 2J41A 3DMTC 4EB3A 1Z74A 3DE2X 1DBVO 1Z34A 5C8YF 2HM7A 3FGOA 4H4CA 2ZR8A 1KAMA 3RLIA 2JB9A 2JEYA 1IJFA 5LVAA 1FU8A 4IUDS 2HADA 2F4NA 3ZLJA 3LCUA 1J2TA 3O8QA 5K4AA 3GUHA 3G79A 4MUJA 3STVA 3ZLUA 4WH0A 1G60A 4LECA 5KJEA 2YJZA 5DN6D 1XA4A 2C1XA 2QX6A 1P9NA 2XRYA 2NO1A 3KP1A 4YUAA 1SCAA 2RK6A 4BHTA 4CDRA 5JY6A 2ZSIA 2J3JA 2ZBRA 4JITA 4M1OA 4TWZA 2F1IA 4WFJA 4GL4A 4EY6A 2P2DA 3AWDA 5FPYA 3P0FA 3KKEA 1RVDA 1H69A 2X4LA 4J0CA 2JCSA 1TW3A 1JPJA 3BAFA 3G85A 5KDOA 2FFQA 1E59A 1XDGA 5TT0A 1DAOA 2W00A 3QOXA 4BASA 3EPRA 3OWHA 3EIHA 3Q5GA 3KLNA 4OK5A 4URZR 3K1AB 3MK31 1UKBA 3ILYA 4DM7A 4OXIA 5CDFA 3PPIA 1NQUA 3BICA 2FSVA 3U7IA 1NOIA 2DULA 2EJBA 5DWVA 4EJSC 2VDRB 4WCFC 3PFCA 4L0QA 2F8LA 3EXIA 1HWYA 4JJ7A 3IUBA 2HF8A 4PLGA 2Q1YA 2P75A 3ICQB 3P1JA 1E1KA 4E5UA 5BWMA 2ZM5A 5LZ4A 5DI3A 2LRHA 1WETA 2PWYA 1CR6A 1CVIA 5EJ4A 2BLLA 4RPLA 1NM5C 2BIFA 1H9CA 3EVTA 1PT7A 2HK8A 3OLXA 4FFPA 4MTCA 4Q9AA 4DEVA 3EX7C 1O5OA 4JBHA 4WESA 4PXYA 2WSLA 4LRYA 2O48X 1RU3A 4AO6A 1QHXA 1AC5A 3GGOA 3I1FA 3FKSA 4KYTA 2QLMA 1BO6A 2W8BA 3OCYA 5IH3A 3WHIA 1FYEA 2OG2A 3HUDA 1HTTA 4RY8A 3K8ZA 3KV1A 1IEXA 2JFFA 4B44A 1QIDA 5JZSA 1QUFA 3NWEA 4OAQA 3EF3A 2FMFA 2CCKA 2BTOA 4XIJA 5JASA 3EDQA 4TS3A 4D56A 1FFBA 2WD8A 3MRSA 4FFBA 5BSGA 3K20A 2HJRA 4WOJA 4B74A 1JA0A 2WY2D 1I0IA 4Q3DA 1HI9A 5ALQA 3UNXA 1A9RA 2WJPA 1D5WA 4LYGA 2VT7A 2FU5C 3HBFA 4MJXA 4Y2PA 4Z1OA 2O8FA 2HRCA 4MS3B 3LHFA 4X54A 2HIMA 2B99A 3RS5A 4BNYA 2EIXA 2RGYA 1OWMA 3OIUA 4QREA 5CBPB 1DKPA 4LRWA 2AQ8A 2OHJA 3E9CA 1BYIA 1QPGA 2ECQA 3GDWA 5DPMA 1Z0JA 4OX9B 4CEJA 4LQCA 4YT8A 4O4HB 2R7MA 1COWA 4YIKA 1YH3A 3DR5A 1FDWA 3DEFA 3FRIA 1VKZA 5ELMA 3ZDXB 4HDRB 5EQFA 3TB4A 2IEGA 3LLMA 1LWOA 5BR7A 5I7HA 2WUGA 1FW8A 4BNHA 3GLGB 1FOEB 1VL1A 2O0MA 3E8SA 4ZYLA 2ZRFA 1CRWG 1DKQA 5JWOA 2D54A 1RXEA 2IYQA 1VMAA 4R41A 2CLSA 4MV9A 4FDTA 2GN8A 2IH4A 1V2GA 4KQEA 1T9DA 3A1EA 2N9UA 2IYWA 1VG1A 3CLTC 1X7DA 1O57A 1V11A 3L9WA 4TMTA 4X8LA 4LC0A 3ZZ0A 2QRKA 2ZRAA 2QTRA 3N2KA 3EGDB 1RFGE 5T3UA 4EKDA 3VDXA 4PX2A 4IJ6A 3R09A 1CKEA 4GMFA 5IASA 2BP7A 3L82B 3I76A 4IYJA 1VRCA 4BB0A 2W2PA 1A2BA 4G1CA 4EB8A 2V7QA 4A6PA 2V1XA 1M0SA 3V4ZA 4OG2A 3FCEA 4HUQB 4NMMA 2J3LA 5L7YA 3UJBA 4Q7QA 5HG0A 2C3UA 7ABPA 1AQ6A 1QOPB 3THRA 1U1FA 3X1JA 5JV5A 4FVTA 1CK4A 1TZ2A 1VCHA 4OO3A 2GMWA 4OXYA 3RTAA 2OAGA 1OE0A 3BZWA 1AHPA 1SKQA 2QM3A 3CZ5A 1OAOC 3T41A 5BN4B 2P1ZA 1FYVA 5CIWA 3E1KA 1JFRA 4HWTA 3RIHA 5DM0A 3KAPA 1XO1A 3ICPA 4GGOA 1NP7A 4EY5A 4G1BA 1PS8A 1J20A 1AKWA 2GPAA 5F1OA 1B2RA 4LYFA 2XKJE 3B85A 4BRWA 3ZDAA 3IDAA 2QMEA 3A3YA 2NWQA 1VMDA 1LK0A 2O3RA 4XTCS 2V4ZA 3EZ6A 1H2FA 3OQVA 4BE7B 2XOKA 6NULA 3SLGA 5I7SA 2XCTB 1SVIA 1WXEA 1NJ8A 4KR3A 1U9IC 1TIPA 1Y8QB 2Q29A 2ANCA 3O92A 3UY4A 1OWLA 4A8TA 4DLBA 3OC6A 1VLQA 3MAGA 2BSAA 2KBEA 4IKEA 4N7JA 2D1FA 3LTNC 5AVUA 1AGXA 3OT5A 3RAEC 3H6KA 3LPCA 4MUEA 5B37A 2O14A 2WFAA 1DC6A 4AUNA 1R15A 3D6JA 2AK3A 3F5DA 1JU9A 3GEMA 1UMCB 4BMCA 2FUG1 2I67A 3SCZA 1DWOA 1C2TA 1Q7EA 1DXOA 2R25B 3DV9A 3KSMA 4YI5A 5A0FA 2O7NA 2F64A 4KUEA 5AM1A 1HZZA 5AJVB 3L7DA 5KWSA 3LJKA 4HRVA 3ACDA 2QTZA 3CX7A 3Q7QA 1AKUA 4RCVA 1W94A 1E2HA 3N3AC 4GVXA 4E15A 3OY7A 2IBMA 5J4VA 3INNA 4DPKA 4PVCA 2NZXA 3CURA 1GAEO 1N5IA 1OPRA 3K1YA 1H4QA 4WN9B 2PHZA 2Z08A 4ZCRA 4LJAA 3HR8A 5J4KA 3M6UA 4B79A 3ETGA 3PTAA 4UMEA 2CXRA 2WU1A 2B8JA 3MB8A 1CU1A 3NHUA 3GXBA 4OHVA 4UUPA 1P2BA 3K6JA 3OVMA 3W1WA 1A9XA 4MICA 1X19A 4URWR 3GNLA 2QEQA 5LQUA 2OLKA 1ZS9A 2TSYB 3PUVA 1H93A 4IG4A 1E8NA 2J7PA 2J5BA 1IN8A 2TMKA 3GX1A 2O8CB 3KIPA 1JHRA 5KYTA 2HJHA 3O9ZA 3U26A 2QP4A 5JW6A 5LR6A 5U4XA 2XRMA 2ZIXA 1PV2A 2NUAB 1A9ZA 4CL3A 3QEKA 3CX6A 1AXRA 3AQ4A 3AEKB 3A36A 1RQRA 3WL7A 4BFTA 4HPWA 1GN9A 5AW5A 3RFVA 4AD8A 4XUEA 5KIAA 1Y1QA 1FCJA 2XV1A 5FRDA 3WDMA 1WUYA 3AY7A 4Q3LA 3UUGA 4FDUA 4P4TA 3ZOZA 2EFJA 2LUOA 2GPBA 1HC7A 1ECBA 2VAMA 3GFSA 4LHVA 4MV8A 4U5QA 3CO0S 4WOCA 4PCAA 4ZO7A 1UKYA 3TRHA 3GB9A 1ZR4A 1QRUA 5IHPA 1T9KA 3QMMA 3UMGA 1OTXA 2F8SA 2Z4SA 4FC7A 1D6MA 2SBTA 4QJ5A 4IMPA 3W04A 2FGJA 2VBCA 5DBOA 4A6DA 5JSYA 2P67A 3RUHA 3HADA 1L3CA 3LK6A 2NO7A 4KWEA 1X1TA 4Q9HA 4G24A 4W5HA 4LMRA 2VS1A 3MCZA 3MERA 3DTVA 4W9RA 4LYEA 4AP6A 1U6IA 2FWNA 1U7HA 3F1KA 4QL3A 1LVHA 2PGIA 4Y6RA 1Z5WA 4W5WA 4F4DA 5KMGB 4L9RA 5T6MA 1NMSA 1Q0PA 3CNOA 4P35A 4QC2A 4YRKA 1KGSA 2DPHA 2C03A 3T5DA 4RK1A 3V3TA 2CVFA 5CD9A 5FDFA 1G66A 2ROQA 1Q1NA 3Q12A 5M29A 2AFIB 4COKA 5TIIA 4D9EA 2RIPA 3KKKA 3ZU2A 4JI1B 4BKUA 1CJUC 3KT6A 4LN1A 1QCYA 3N39C 1FRNA 1GUDA 3C6KA 3MVEA 4PLTA 2Z4TA 1XK7A 4GSYA 5C7IO 4TYNA 2DERA 3A1SA 3ZIAD 1U90A 5F77A 4DCSA 4NLLA 2JASA 4X00A 2AC4A 3NHSA 1YVPA 2EYQA 1ESDA 1CW2B 4RHXA 3R9XA 1DO8A 2Y76A 4K9MA 3RKRA 4YRAA 2CN1A 4FFMA 3O2QB 3B2QA 4NNJA 4QEKA 1PZXA 4YWHA 2RHBA 1QK4A 1AM4D 3IMKA 5FT9A 5T4HA 2JFQA 2AI1A 3ETCA 4XFJA 3TFOA 4UBKA 2A9PA 1S2MA 3ABSB 3MMPA 2VYQA 4LY9A 3NPAA 3RUIA 5E1OA 2VJBA 4RFVA 3CRRA 5C32A 1DPFA 2P9BA 4L7QA 3HCWA 4KWHA 3EXG2 3DTYA 2CD7A 3HSYA 3GBPA 1KBQA 1C5KA 1SR8A 1B6RA 5HZMA 2Z83A 4B85A 1ILEA 5G0UA 1AIPA 5K3DA 1AGNA 2YIJA 3VPSA 1RM4A 4ND5A 2LV8A 5KVSA 1QZZA 5K8JB 4TV8F 3OU2A 1FP1D 3SIRA 1DIAA 1GSIA 2XF2A 1C1XB 1TJ3A 3TI7A 3VU9B 2WVGA 1FFAA 2IH2A 1RPJA 2O8DB 4ZDJA 4PE5B 5EGNA 2RJ3A 3PQ3A 4M0KA 2JVJA 3A27A 1P2TA 1OV4A 3GR6A 3NHBA 3IT1A 4I9NA 2GHQA 3RI3A 3IPCA 3LY7A 4TL8A 5E8JA 4ZARA 3C8UA 4CODB 1Q1EA 4N8DA 4X94A 4O4HF 3WO0A 2QL9A 4TKVA 2JLWA 1U2RA 1UC4B 3NHPA 4EEXA 3AM1A 1RBYA 3ZTYA 1XXHB 2IYFA 1NF9A 3FSGA 1S9HA 3H97A 4MVJF 4B8YA 3RC7A 4IO1A 3V1UA 5ESWA 3ROGA 3PSAA 3ZD9A 3BQNB 1PR9A 2JIPA 2OCKA 1W88A 4CM9A 1TGVA 1FS4A 3DOOA 5B36A 1Y98A 1GQQA 3SDSA 1TCUA 3LO5A 4X62B 4CJXA 4RM3A 5H80A 5HKKD 4BNZA 3I8OA 4KBFA 4ZVLA 4E3WA 3CO5A 3CKLA 3RSOA 1QO9A 3FJOA 3PC2A 1R5OA 4E46A 1R4NA 3MGBA 4GOJA 1ZY2A 3BWDD 1O97C 3EA5A 3Q7TA 3SM3A 4X6LA 5E4JA 3KJEA 1GZSA 4X93A 1CJBA 4ZQCB 5AK6A 3ZWYA 2YY6A 3PWKA 4NQRA 1P5FA 3FN4A 5ESRA 2G7MC 3GL9A 4MDYA 3G1UA 4TTJA 3WB2A 3WRVA 2I8AA 2IWHA 4D7AA 3LWZA 1J25A 2JFPA 3OPQA 1QG2A 4HMQA 2CFOA 2Y4NA 3V8PA 2OB2A 2WIKA 2GPTA 2VJMA 4R05A 1T1GA 4LRSB 2VDVE 1PD1A 2V65A 5DASA 4MS4B 4U00A 3QQPA 1TYCA 3ZZNA 3EC7A 3NDIA 3THXB 1AGPA 2QR2A 2NV0A 3JWIA 3AHIA 3ZXSA 4NK5A 1SIOA 5F5NA 4MYUA 2IXBA 3R3SA 3ANTA 4I5EA 3R7SA 5CIQA 4G63A 1DU4A 4DG8A 3QEMB 1SCUA 2WUFA 3HO8A 3MGGA 4EOGA 2BCJQ 2VHCA 4QDOA 1MFPA 4QYWA 4OHRA 2W2KA 5FD8A 1WNTA 5JXWA 3OZAA 5TJ9A 2QP3A 2ZT7A 1Z6ZA 2VIIA 1BDHA 1GNRA 5A9RA 4GSLA 3WGGA 4DL9A 4LW8A 2Z8ZA 4E14A 3F74A 2BHTA 2IPAB 1VHQA 1TX4B 3O83A 4GMHA 4S0ZA 5JQGB 2GM4A 2HN9A 4LDPA 3EWIA 1HDYA 1L5GB 5M7EA 4L28A 1MJGM 1YIAA 4AECA 3THYA 2BEUB 2JKVA 4LI3X 5DFAA 3EF0A 3P0HA 3U4CA 1IHUA 4H6VA 3K9LA 3O9MA 4C07A 1P3JA 4B7UA 1QZUA 3AEZA 1OGYA 3KV3O 1PX2A 4M3NA 3A2KA 2HA5A 4DZRA 1WBDA 3M3DA 1AKRA 1Z2EA 1YFLA 1ISRA 5AOAA 3L93A 5TMPA 3OLYA 4I50A 2EFDB 3HDVA 3WRYC 1NDHA 2FF5A 2PBRA 5DCLA 3VDNB 2O3JA 2Q62A 2JJYA 4JGGA 3G13A 1NZDA 1QWOA 3SQWA 2AIRA 1XAJA 2EZ4A 1R6BX 3ICCA 4L8YA 4QDXA 4JQOA 4DCOA 3B70A 4HB4A 1XTKA 2P78A 2PSHA 3MCAA 4JA2A 3DL4A 1B15A 2FR0A 3FOBA 1SBYA 1Z8DA 4Y6OA 5GONF 1RYMA 1NE7A 1DX9A 5F2KA 2G4LA 4BNJA 1FU4A 5BP7A 5BMVB 1ZRSA 2A57A 4A2CA 1JF8A 4UPEA 2UVPB 1QOQB 2W58A 1N3YA 5FPSA 2VPPA 1E6EA 3CZQA 4FI3F 4B80A 1QLJA 2HCRA 4KMOA 1H65A 3EISA 3KAJA 4R8MA 1WZNA 3DMPA 5KTRA 4HGPA 3ICEA 3DB1A 2YV1A 3PF8A 3NBMA 5HKBA 3W4KA 3K31A 1UM9B 2Y1DA 4PZCA 5DULA 4GOKA 1QB7A 1WMBA 2AW3A 5F23A 2VTBB 1OYVA 2WZDA 1NNEA 1VHJA 4BQQA 4Z9YA 3GEEA 3DZFA 3KSRA 4FEYA 5HILA 5IBRA 1E9SA 2Y4OA 4TQ9A 4TROA 4AJNA 3ZDFA 2A86A 4RSRA 4X6UA 3D43A 5A9TA 3QW4B 9LDTA 5I6DA 3WYNA 4IO0A 3TNFA 3LUHA 4Z7NB 1C3XA 2I8CA 4RPJA 1E9RA 4HYQA 5KVAA 1N6LA 5JD6A 1PK8A 5ADHA 4JEIA 4LWQA 1DO0A 1P0IA 1O89A 3I23A 1PT8A 5ENDA 1RPTA 3K0FB 4HVLA 1N7GA 4FYJA 5C2JB 5A62A 3IEMA 1F8UA 5AO9A 4RA6A 2O8CA 3M5CA 4CQMB 3TPFA 3ZPXA 1C2YA 5F51A 5EJ5A 2IYRA 1P9WA 4JYCA 4XLZA 5TT1A 5JS1A 1I1QB 4RMHA 4RVHA 1Z5PA 1Y3HA 1Y6ZA 2C2MA 2ECKA 3WMGA 4UASA 2C9BA 1BWQA 1DEXA 4QXQA 1QH1A 1ML3A 1EAMA 2QW0X 3PVSA 2G8NA 2Q1SA 3PC6A 3Q41A 2WM3A 1IBSA 1W93A 3LRPA 2J9FA 3HRHA 3QF7A 3STUA 4BQIA 1JKXA 2Y1FA 3DCNA 1WEKA 3NQ41 1T5DX 2EP8A 4KN9S 5ER6A 3VZSA 2RGXA 1E1DA 1LCIA 2PNJA 3DEKA 4MCHA 1E77A 2JKZA 3KCQA 4TMVA 2WYOA 2BKEA 4IQFA 4PWZA 3W3ZB 2EFYA 2W7TA 4IKPA 5EHIA 1SBZA 4COOA 4ZYTA 2IUUA 2WV9A 1EK6A 4RANA 3WBFA 4GKVA 5TLSA 2RKWA 4ZCQA 2GEJA 3UJHA 1XTSA 3P4YA 4ZV4A 1J22A 3NNDA 2Z09A 3PJEA 5F33A 2ZB8A 1PJAA 2FG5A 1QAOA 2GZMA 2PKWA 1DFGA 2PX2A 2ZVDA 3L4EA 4Q1CA 4RABA 4A82A 5BR4A 1Z2PX 1GTZA 2WHPB 4N5NA 2EERA 5DX1A 5IFKA 4XPIB 3VRHA 1TECE 2O3UA 1S3SA 2XDAA 2YXPX 1QHGA 3PQFA 1NN0A 4YAEA 4CMCA 1RRGA 1EK5A 1E6KA 4KRGA 5GM1A 4UU7A 3R7DA 2JG3A 2OK7A 2HTFA 4ZU1X 3M4ZA 3IE1A 5B3JC 1IY2A 4RJTA 4MS1A 2VCYA 5EPOA 1F5SA 4G56A 1NQWA 2VBGA 3IQIX 2B8NA 1NBMA 1TGYA 2Z95A 3LKVA 4IH4A 4RHFA 2YHIA 3CCFA 4Y6QA 4HSEA 4D9KA 1AQLA 4UCWA 4E7PA 4JFRA 1N7HA 3V46A 3ZHBA 2JGRA 2HKIA 1I3KA 3SXUB 4E70A 2R6ZA 3KDPA 4WHMA 4OHYA 4AO8A 2NNWB 4GUAA 1XVIA 1WP4A 4QASA 4WADA 3RADC 4C0AC 4B2IA 3H9EO 1Z62A 1TT5B 2YWBA 5LZ9A 4R2JA 2RHCA 3F47A 3R5TA 3RVDA 2PAAA 3GLRA 4P3KA 1BS2A 3LYLA 1P17A 2AOUB 3DV0A 1PSDA 1Z8HA 1J9ZA 3ZDEA 1VLZA 3A6DA 3HS3A 1RYNA 1OAAA 4CQLB 4F5EA 3NKVA 4B6FA 1Z7YA 1Q15A 3LM8A 1WY5A 2WTNA 1ESEA 3B3AA 3AFIA 3JW8A 4MWZA 1RWOA 4XDYA 3ZU3A 2H11A 1A72A 1B8UA 2SCUB 4WXMA 1JZQA 2V9PA 3K1TA 4U6SA 4BQFA 2V96A 2MINA 1Z47A 1FK8A 1LV8A 2JD2A 3A4IA 3EY9A 3EW7A 3GRPA 3ITDA 1DLJA 2J08A 4RGVA 1BHSA 1G20B 4FT2A 3EFOA 5JQWA 2F62A 2M2IA 3MOSA 4EY8A 2ZUEA 3EXFB 4WA8A 1M1UA 1NVTA 2AG8A 1T2NA 3D7RA 3CTMA 4FHFA 3LSYA 4MLCA 4MQFB 1P2FA 3VAYA 3MGAA 3AIIA 1C80A 1XTZA 4EUEA 8ATCA 2UYGA 2L82A 3V48A 3T5PA 3DLCA 3VR2A 1CB7A 4AG3A 4HZUB 3LQ4A 1DFIA 3HGTA 1A7JA 1RMQA 3TAHA 5CA0B 4MR7A 2EZUA 3FA2A 4QNMA 2HRZA 1JLSA 2VP0A 2WHQA 4YHHB 3V7YA 5HJEA 3PC8A 3B9PA 1N5RA 3EG9B 3SEAA 2VL7A 4JFAA 4D8VA 3W5VA 1SXHA 1S2OA 3WJ7A 4IJWA 1NJ5A 1B2LA 1T8PA 2VHUA 4PYKA 1IHDA 4IGAA 2WUVA 4I46A 2WOOA 3VR6H 2CL0X 1JEYA 3BRQA 2AF3C 2RHGB 1YZKA 3ECSA 3G89A 4ND7A 2FSGA 5E1MA 2QYSA 4F9GA 1LUAA 4JUFA 5BPFA 4Q82A 4UUMA 5DISB 2IEZA 3G5MA 5KDDA 2QPLA 1O7JA 2QDKA 3IBGA 4ZI2A 3ZWCA 1DJQA 2B3DA 1SUCA 1H6BA 3ONVA 4YJDA 1V8ZA 5C34B 2OG1A 2ENWA 3H8SA 5AM3A 3LOPA 4OYLA 2HPAA 4XARA 1YZVA 4ZOBA 1H6AA 4HWSA 1A5TA 4QJIA 4UEOA 1NSYA 2OO5C 1FRVA 1RRFA 1PVVA 1LRKA 4BZQA 1CZOA 3FR7A 4ZJYA 3JQ9A 4E4RA 3FSRA 2WR8A 3ZGLA 2G70A 3H87A 1W9MA 2DCUA 3HUUA 3JYOA 3WBKA 4DQXA 1O08A 4JKOA 5EAIA 4DDHA 1E9FA 1MB2A 5JMTA 5KHOC 5EIBC 1P7WA 1AK1A 5H9WA 2V6FA 3AEUB 2QM0A 1YR7A 4M0PA 4E12A 2AW5A 1YB4A 1M2KA 4BAGA 1FJHA 1FRZA 5J1TB 2Q8PA 2BGRA 3AHEA 1Z8NA 3K8YA 2R8RA 4LIPD 4QOEA 1NQAO 2ZANA 4ITVA 4P92A 4RDCA 3V1TC 5A5DA 2SNIE 3FWNA 3OCCA 5H16A 4FYWA 4AP9A 2P6MA 2JKYA 3IAUA 4OHXA 3REQA 3S8MA 3GGJA 3HJGA 2GWRA 5KVCA 2IS4A 3A10A 5D3ZA 5BMVF 3MN1A 2WTAA 3CEHA 3ISVA 4LFCB 1NUQA 2FMUA 1M54A 5F5XA 5LP6A 5BPHA 3M2PA 1KERA 1XDWA 5A9SB 1BSVA 3VI3B 1SXJB 1KMCA 4IFEA 2C7RA 5JJIA 5KYWB 1F9EA 3G5LA 2H1FA 4N4AA 2PEZA 2NO0A 2Y9PB 2ZAIA 1OR8A 1BHQ1 2JHFA 2QLTA 3C7TA 1QE5A 2BONA 3I2JA 5EJMA 5KHAA 1L4BA 1G8HA 1M34B 1RTTA 3CR8A 1LQTA 4G86A 1AHHA 2QM7A 3DOUA 2R7KA 4PGHA 4C20A 4JLOA 2PX6A 3UWOA 1QKKA 2NX2A 4URHA 4K26A 1XCMA 1U11A 3GJYA 3F1LA 4KW7A 4YAGA 1KJNA 2FWPA 2PTGA 5HHTA 1RE1A 5HSGA 1RC0A 1HLGA 1SGWA 3EARA 3NUQA 2ZPAA 2A88A 2R4TA 1QG4A 4R98A 5KNDH 2ZUBA 3AG5A 1K6EA 3HZOA 1OT5A 2ZSFA 4BX0A 4RIGA 4BQPA 2FG7C 4YNBA 3S6JA 4BN0A 4AMYA 4FB5A 2CKDA 2X77A 1D1PA 1EDDA 5DHPA 5JPCA 4TLLB 1P0PA 5G0TA 4M0MA 3USZA 2QZSA 2JGAA 4P81A 4L72A 5EXEA 2I7CA 4DNOA 4D5GA 1XPRA 3SC4A 5EMLA 3D02A 1IPHA 4HTFA 1SCQA 1HQCA 3AF5A 3WQHA 3TFQA 3CE9A 4V38A 4Y6GB 4ZXPA 3B5EA 4XCVA 3V4SA 3GMDA 3WP0A 5JHHB 2YWXA 3GAAA 1I4LD 1E2JA 3PNYA 2UYCA 4UBJA 1IHOA 5I3ZA 5THQA 4KOAA 4LDRA 2UZ0A 2PMBA 2WMNB 5KKCA 3UCXA 1MQAA 3A6KA 4W82A 4K9RA 1ZJ6A 4BMPB 5T8KA 3UJ9A 1YDMA 5EJ6A 5C1PA 3QXJA 4O1HA 3AF3A 3HXLA 3TOCA 3SBOA 1E9VA 4CMIB 2DY1A 1M8PA 3AL3A 3PHBE 2IXDA 4CLDA 1SUDA 4KI7A 1UBNA 2WPDD 2ZI4A 1L4HA 4HGYA 1E2MA 5FJJA 3QQ5A 4PQFA 1MW9X 3C97A 2XRZA 4IXDA 4JNCA 3SQMA 2BFBB 3ED1A 3MFQA 3ST7A 2P2CA 3KQYA 5LB2A 3T3HA 3PUKA 1VJTA 1Y5NA 3K94A 1QYCA 3LTEA 1BQ3A 3HU3A 1GU7A 3TZHA 1EIWA 2A8YA 2H3HA 3DQZA 2D0DA 3DVQX 4PZDA 1Z28A 5C5CA 3KUKA 5F9MA 5ULLA 5KQSA 1ECCA 1EUCA 1T36A 2V3VA 4ZAVA 2I3BA 4TV8A 1F2TB 1C29B 2V8OA 2FGKA 1NU6A 2G1PA 1A76A 1SKUA 3R6GA 1NVUQ 2OBNA 1MT0A 3LW8A 2B1QA 3AVOA 4WKNA 2HRRA 3E7DA 2GYWA 1RAEA 4FNAA 3V8MA 1CFZA 1ABFA 2A58A 1GPMA 3JQCA 3SE0A 1NV8A 3TMYA 4MV6A 3ZNNA 4YRZA 1ZNZA 4TT3A 3H0EA 2VPTA 1SQSA 4FXOA 1B8OA 5DEIA 3WLPA 1F60A 1NTOA 3NFRA 2QSJA 1N92A 4PAOA 5IFLA 4IOMA 1K68A 5HDQA 1NT2A 3MRXA 3W9BA 4MR9A 2X0FA 5CB6A 2RHRA 4DZTA 2JZNA 4PO1A 1AQUA 1GNQA 5SYNA 5EL0A 3IQEA 1K0FA 1T9HA 2C2GA 4GX5A 1EUZA 4JHXA 2GO7A 1ZUHA 3AXSA 3SC2B 1FP6A 3W8RA 2VH5R 3EZYA 1JMVA 221PA 2PXCA 1C0IA 2FEWB 4J90A 5SZKB 4LHEA 2ZIUB 1I5OA 1P9OA 4NU6A 3C14C 3N70A 4A6XA 1TCAA 2J31A 3HACA 4UXIA 2VKQA 1M1YB 3RS8A 1IQPA 2WV7A 3ETEA 3ZH2A 3U7QA 3I9KA 3LG2A 3FDZA 3ONWA 3OD1A 4YMLA 3U3KA 1GSOA 2ZT5A 3LDGA 3S55A 1QAQA 5BNTA 1TMGE 1KKLA 2EG5A 5FOUA 4Q3AA 3QFSA 3O9VA 1VYTA 3ADDA 1K8XB 1KI3A 1O95A 4BO7A 2WYIA 1UR5A 2IH5A 4KGXA 4B3FX 4MLDA 5DTRA 2O3SA 2Q45A 3DYVA 2UDPA 3VKHA 4H9GA 3GFFA 5JCOA 2J3KA 3OZFA 3GMSA 1TAHA 3I34X 3D1JA 1PFWA 3TZEA 1EXNA 2X9QA 1B76A 5BNIA 1W36D 1WB4A 2JGLA 3NT2A 1BGVA 1T4CB 1DAKA 2G1JA 5FBKA 3ZDZB 3EGWA 3HXOA 1CBUA 1QH8A 2BZ0A 2VDNB 1YI0A 5D5HA 3SHVA 5EVJA 3U4AA 3TLMA 4X65B 3WYDA 5K7SA 1XTUA 4MDEA 3G3EA 2EG9A 1G7SA 3L7KA 1Y1PA 2C8VA 4KE8A 3KBBA 4MV3A 4D41A 3FNFA 4MV4A 4F3RA 3OM8A 2FSIA 2O8BA 4EJFA 2IYAA 1C7ZA 2B25A 1P6XA 1DT5A 2H4FA 4O5OA 1J49A 1ZFNA 5AM4A 4A10A 3H11A 3R77A 4GH5A 4E13A 2I6GA 1XDUA 1R6VA 4IMJB 1MF7A 2ZYVX 3D6TB 1QIMA 4C05A 3PF9A 3H0KA 3U6BA 1I7PA 3ZDYB 2H0AA 2HX1A 3HRKA 1QCCA 1VE6A 2JCXA 3P9RA 1RWBA 4MB6A 2VYFA 2OGWA 3HB5X 5F7OA 3KOOA 3NWPA 5K0EA 1L4LA 1K5DA 1KZ4A 2QR3A 4ROSA 4KCGA 2YVAA 5TS2A 2G67A 4BOYA 1K1EA 1JAHA 1KHTA 1SXJD 4ECAA 2Y77A 1FW6A 3M6VA 3U3RA 2J3EA 4G9BA 2JZCA 4TLBA 1W1UA 5FHRA 1Y81A 1W96A 3KXKA 1PZHA 4BVJA 3HO6A 2BHSA 2V5VA 1JN0A 2JAOA 4RNDB 4JEUA 3KR1A 1YZFA 4KIWA 4PHCA 4JI3B 1UXJA 3LUKA 2QVYX 1XCLA 3T5CA 1YB7A 2XXJA 4A5SA 5AQ1A 1RLTA 3HCFA 5HYVA 1L8QA 1OTHA 1MO5A 4FFLA 4MVJP 1B1CA 2I22A 2D4AA 3EMBA 4FS8A 1NLFA 4LVUA 4C4XA 3TIXB 5DX8A 3GYGA 2MYPA 4JQZA 1VMKA 1A88A 1R18A 1TRHA 1PR4A 3QY0A 5KTMA 3IR7A 4HBGA 1Y5RA 2C0PA 1T5SA 2P2SA 2VJOA 1B14A 1DTEA 3HDJA 1ITZA 3LAWA 4ZAXA 3OJFA 4D9NA 4CT5A 5AIBA 2Q50A 2TRSB 5GONA 4G0YA 5B6PA 1QQ7A 3TSOA 4OGKA 3TL3A 4ZI5A 3UWDA 2NZJA 3IQDB 4DZZA 2WDZA 3BWMA 3IYLW 1S02A 4KAXA 4E09A 1P45A 1R00A 2NSYA 3L0OA 3ESCA 3EOZA 3LV8A 3HEBA 1G38A 3CLHA 1XZNA 3I6ZA 5K4HA 1G5QA 3WSVA 3GPLA 2GF9A 4EARA 1HFEL 3AINA 1AE1A 3C3WA 4G0XA 2IIBA 4KFUA 2JA2A 1QXSA 1ODKA 4CM5A 3OOJA 2IOFK 2XXAA 4C4PA 1RCUA 1NI4A 3VH1A 3HCNA 5FCDA 2JFOA 4YRSA 5LCXA 3IKTA 4LJ6A 3K6KA 4WZBB 5HE9A 3A4MA 1QFYA 1U2GC 5FFFA 2VYVD 4JA0A 2OKCA 4C9BA 4MCJA 1X0VA 3DE7X 1OA0A 1V7CA 2FFAA 1XMJA 2VK8A 1RABA 4GO1A 4EF5A 5A7FA 5AVYA 1SVNA 1GQRA 2B9VA 4NE2A 2Q8QA 2VSQA 5T4FA 5CCXA 2YL2A 4OOFA 2OUIA 2PE5A 3OIVA 2EC5A 4OBBA 2AKAB 5G1OA 3UMBA 2GH1A 3DHYA 3D1LA 1BNCA 2HHAA 3BGIA 3TK1A 5EJ9A 2FA9A 1NZJA 2PZKA 1LRJA 2ZAOA 3A4VA 4FEEA 4KNVA 4KBYA 5ALKA 5JSUA 4WDRA 2QIOA 2VUIB 2YHBA 1ETUA 4OI2A 3OOSA 5FWAA 1DQSA 4JLPA 2ZXUA 1G7RA 1QZ3A 4BLRA 2ZYWX 5BN3B 4TT8A 1JI3A 1P39A 4L0DA 4C43A 2QZJA 4MYHA 1K3FA 1SCKA 2CWWA 1UADA 2IYYA 2ZSHA 3GZTB 4L0MA 1OFVA 4R54A 3T9AA 1L6IA 4MP6A 3R5KA 4HPXB 3SYTA 1HA3A 3MQ4A 3VBEA 1YKGA 3VNAA 1IJEA 3NC0C 4UATA 1PJSA 4EHFA 2AOXA 3VZDA 1MHTA 1JTVA 3L8EA 1WSDA 1PNOA 4OM7A 3MWDB 4LZOA 3ZGNA 2ZRHA 4QQ8A 4W99A 1OXBB 1V9CA 2FWRA 4WGFA 1G9TA 4X64B 4DRYA 5AUNB 1DINA 2QTLA 4EM6A 2HNBA 4HWRA 2IF2A 4HSGA 4EABA 1XMVA 2FDRA 5ALMA 1THTA 4B82A 5B4VA 1FQWA 3OJXA 4D92A 5LQNA 2ZWOA 4KQXA 1XCPA 2WUWE 4YI3A 3PWTA 3RQSA 4NYJQ 2HLDA 4GR4A 3TRFA 4EELA 4LDAA 2JAQA 1OFGA 4K0RA 4O3FA 4IIJB 3NMUF 3BSWA 1IN1A 3HA2A 3FWZA 3LXXA 4BLPA 3DLIA 4PSCA 5HUHA 4JU8A 2OTCA 3GEPA 1U1DA 1ULSA 2GAJA 3CZ9A 4MKIA 4F5DA 5EMNA 1NVVR 2ID8A 1EJ6A 1YZTA 5I48A 1G0NA 3B51X 1Y7IA 3FGNA 1GZ3A 4Q1FA 3LKBA 4QLAA 3SC3A 2ID4A 3R24A 4NBLA 1HDGO 1NY5A 4YAFA 2GRJA 3ASYA 3N9IA 2NTYC 3WYCA 1H6DA 1QC5A 2JJ2D 3IQHX 3PQ7A 1MC5A 1JFFB 2PXHA 1L4EA 1D04A 3R7WA 1L7AA 1BMDA 5B2FA 2X42A 1G1MA 3GPBA 4IFTA 5JWHA 2ZSAA 3OZTA 1G55A 1CC1S 1UFQA 3ORYA 5D8DA 3SBXA 3TH5A 3LX6A 3TUZC 4ZEMA 2O8NA 1KPHA 3HJCA 3L0YA 3Q8WA 1EFRA 1YS7A 4IHJB 4QRDA 1WCWA 2X22A 2XTMA 3ICWA 3VNBA 1BRMA 4P4GA 3H8VA 5DHTA 5LA6B 5C3UA 4HQOA 3KOZA 3K2QA 1XLVA 4IH9A 4M22A 1BZYA 1M8KA 1X39A 1OSNA 4MAMA 3I2YX 1PZGA 4RDHA 5BNFA 3UW3A 3ZNPA 5JMOA 1NC3A 1V8BA 1Y42X 2B1RA 1F2UA 4L4UA 2VPXA 4QGSA 4YDQA 3T54A 5B12A 4XGRA 5LP1A 2I99A 3V4PB 2VZ0A 4RIIA 3RRXA 5FLXA 3F8WA 3U7GA 4LZJA 4GQBA 2C78A 2FRXA 4ZYXA 4RF3A 3L7NA 4NOLA 1EUDB 4JQYA 5JC1A 2VP6A 1ZOOA 5AI6A 5CDUA 2WNIA 2GWHA 4R01A 1YB2A 1MAUA 4QHSA 3TXAA 3ZY6A 5LMZA 2AFHE 1IOZA 1DX4A 2HMUA 2I4NA 3I3OA 4OAOA 4FLEA 3B1KA 2JGJA 4I4NA 3UG6A 5KNCD 3GIDA 1MEOA 5ALVA 4G97A 1KDOA 3IESA 3P4UA 3T4UA 3D7NA 3GGGA 3IOYA 4ERNA 1AKQA 4GWKA 4J2HA 4LXGA 5AVJA 1NV9A 3KQUA 1H0KA 1W5BA 3OHSX 4NJEB 1RYBA 1BE8A 5KC8A 1EEHA 2QZ9A 2VQ6A 3FD8A 1SXJC 3C7KA 2WJHA 4Y1FA 1IWOA 1UMDA 3T3EA 1HDIA 4A1FA 1BEUB 3CSDA 4H2DA 5FUYA 4ZRNA 1LK7A 3DOHA 5LZ8A 2VSOA 1TYZA 3DT6A 1UZLA 3P2KA 4X1KB 2FHPA 2WA2A 3DKIA 3I92A 3JVDA 1E6UA 4LE2A 1KOLA 3MUNA 4R83A 5IKPA 2LIPA 2H1OA 2ZJYA 3KPJA 2RAUA 1R0ZA 5F21A 2VOJA 3PXDA 4DQVA 2WFZA 1K4YA 1UAGA 3IMEA 3BB4A 4YWJA 4CM4B 1T4GA 1PN3A 3OQIB 1QK3A 1UPFA 1FA9A 1UT8A 3NTOA 2A14A 3D3WB 4G2TA 3T4XA 4RV9A 3QI2A 3C74A 4EH1A 4V3CA 2JBHA 5DGIA 5K1ZA 1N0VC 4K05A 3EYWA 1WP9A 1QRDA 4O4LF 1AGYA 2XUDA 1JQLB 4LDJA 5EKUA 5I9MA 1Y5IA 2J3MA 1ZNXA 3C6QA 3EODA 5CTAA 1XDZA 1AU9A 1VSUA 1DAHA 2G9UA 3P8ZA 4JJGA 4RC9A 5JS2A 2IJGX 4FDLA 3A04A 4H1VA 4X20B 5B4UA 2XB4A 4KYIB 1J07A 3G5UA 2P5SA 2C29D 3GN2A 3NDPA 3V4RA 1EFPA 1NVBA 2JI9A 2BEUA 2Q3MA 2DC1A 4G85A 5EKTA 1JLKA 4HS4A 4BNMA 1VLHA 4TYWA 2HJSA 2VJAA 1VJGA 3QK7A 5GZ6A 1S5PA 4B71A 1H8EA 5KTSA 4N48A 3HP7A 4KREA 1QIIA 4QHTA 2X15A 1Z35A 1NZFA 2WG1A 1A1SA 3PHIA 3ZWOA 4DR4B 5E6RB 5JNVA 2J0UA 4FC6A 4EJ6A 4RCZA 3M33A 3I9JA 1SUBA 1PL7A 2IDKA 4E5KA 4TM7A 1NUHA 4HHEA 5FBVB 1N8KA 2E21A 2PNFA 2OUKA 1D0SA 2JFZA 2OZEA 2W6IA 3AY0A 3KT0A 3ROZA 4DV7B 3KK0A 1JXAA 1MO2A 2GK6A 2PT6A 5EWMB 3EUEA 3OTHA 4ZGGA 1XDBA 4CQJA 4HMOA 1OX6A 2QJOA 1LK5A 5BOVA 4E0BA 4HUTA 4F4FA 2XCRB 1V6AA 2WUDA 3COVA 1ZHFA 3A6HA 1FQJA 1KARA 1IE3A 2NGRA 3PGXA 4Z1MD 1SVOA 1TLLA 2BGMA 3PFHA 4PLCA 3OE1A 2XUPA 4P5DA 1PK7A 3R3JA 1QORA 3EVBA 3R1IA 2IXGA 1H4SA 4QBTA 3ZTWA 2CJXA 1DQRA 2CMHA 2QUBA 2RGGA 3GK3A 2G9ZA 2IIQA 1CE8B 2V0NA 3CR3C 3IIKA 4PRKA 1U7ZA 4EB0A 2VJQA 3KQKA 3Q2KA 3L84A 4J7AA 3HYLA 4ODIA 1M2JA 2R6JA 1Z36A 3ORSA 4OI1A 1EFDN 1N78A 3QIAA 4LX0A 3VNQA 2C7BA 1MMFB 2V5AA 2VHWA 1WZCA 2V9ZA 4FWBA 4CW7A 3R3HA 4URXR 2BFFA 2FSPA 2WD7A 3I8SA 3QFRA 4EYEA 2YZ2A 1D5CA 1U94A 3THOA 2QLLA 1FQKA 1RJGA 3AFOA 2ZSJA 3PGLA 4WLVA 4DA7A 4MITA 1XDSA 2E1RA 5HJ2A 1J42A 1K9SA 1MRSA 4ABTA 3KWLA 1SVWA 1WUKS 2ZE7A 4MGEA 4EBFA 3R0ZA 3DGFC 4JX9A 4NATA 1G8MA 3VUEA 1XCBA 2WKPA 3DE6X 3I05A 2X5KO 2HQOA 1YJBA 1BG6A 4GM1A 4QYMA 2RI0A 4P93A 4YN3A 2O54A 2GAIA 4ZICA 1T29A 3IMCA 4WD3A 1ZD3A 3TSYA 3ZXXA 3QLUC 1TC1A 4HDQB 2PYIA 4KIGA 3WIEA 2WAOA 1YKSA 4OK6A 5FI1B 2KLHA 2ZVPX 2DQSA 2BR3A 3P32A 5FIUA 1NW7A 4ER3A 3PLAE 1JL3A 4H0NA 3AL0C 1HKUA 1CJKC 1YGYA 2P8JA 2WU0A 3EY4A 4NFSA 5CUQA 6ADHA 3O4JA 1W59A 4W4TA 1B26A 1QCZA 3DL7A 4K7JA 1TL7C 1FTSA 4K9PA 4EUFA 2NTVA 1WABA 1NYRA 1UWKA 2XW6A 4KX5A 3QZUA 3EA4A 3DNPA 1U8CB 1LNQA 1EGHA 1VRWA 2XWBF 2ZIFA 3IEUA 3IUEA 4G0VA 1W4BA 1E99A 1HK7A 1MJ5A 5A4IS 3WR5A 1G2QA 2PD4A 3ZV7A 4IIJF 4YJ3B 3WKDA 1ULHA 3H9QA 3DBLB 3OE4A 4NENA 2XA9A 1Y1SA 3G1WA 4ZCLA 3C3PA 4ZO6A 3IUYA 3KJXA 1D07A 1V2HE 1X7XB 2IYZA 1Q21A 2ZCVA 3AEQA 3LY9A 5ITZB 3VYRB 2W43A 3G8AA 1BMFA 1N8TA 4B6SA 3AUSA 4GZ5A 4Y8VA 3EXHA 1V3VA 2HA0A 2BZ1A 4CLEA 3D5TA 2BGJA 1T0JB 5EE3A 1GTL1 1G291 2WU8A 1CNEA 1OIXA 4LXXA 5J43A 4UCXA 3MAJA 4EGFA 1O58A 3F67A 3RS9A 1DC4A 2I76A 3ZEIA 4TSKA 2BMAA 4FX2A 3F73A 3OEED 4JCOA 2RSLA 4IHJF 1ODFA 2RGNA 3L7LA 2ADFA 5TS3A 2EX1A 4HNGA 5LA6F 2FJPA 3ROKA 5FH9A 3R6DA 2DGDA 1VSQA 2YHAA 5AVQA 3OCJA 1GUFA 3M3HA 1PI3A 3TTTA 4U9HS 2F9MA 3A7EA 5HCNA 1JDUA 3PL5A 3TQHA 3CX4A 4ZV9A 3CINA 1LDNA 3B48A 3UT6A 1M5UA 4PPNA 1PJTA 2BVNA 3HJAA 4Z4QA 3KB1A 3MD9A 1C1HA 2J6BA 2O6HA 4IL5A 2AF4C 1WB6A 2IPLA 1B00A 3NHWA 3DDHA 3U4IA 2EJVA 2QYOA 4C6SA 3DHEA 2WT4A 4GBMA 3F3MA 3ZBPA 2PGNA 3KLBA 4KQFA 1C0LA 1GT91 3QKSA 3VOAA 4C3ZA 1EB9A 3LQKA 1TAGA 4HXFB 5C80A 4GKJB 4RZHA 2V0CA 2AD5A 2B2CA 2DSTA 4WLFA 4GMGA 4UOQA 3Q98A 2WJVA 3UMVA 1HNXB 1VBMA 3AF4A 4QICA 4EHAA 5C37A 4DG9A 2BR4A 2EP7A 1YCHA 3AEXA 2VCEA 3ZWNA 5I7WA 1USGA 4JH0A 3CF6R 3CVVA 3A2NA 3OHMA 3VR6D 4DQDA 1NURA 3QU9A 3GLIB 1BXZA 4MHOA 1CZLA 4X45A 4BNUA 4FMPA 5KO2A 1MJGA 1L7QA 3AUTA 3PQ8A 2QVLA 2XTZA 3NYQA 3EGOA 3PT9A 1L4YA 4PEVA 3VKVA 1SC4A 2WHEA 4OYYA 1GG9A 1PJQA 1XVTA 4JEHA 1RZ3A 4Q00A 3V97A 5F73A 1YQGA 1RP1A 4C22A 3TGPA 1HQYE 4DV6B 1RIFA 1UJNA 4LGMA 3W5AA 2W6JA 1NG1A 3EEBA 3WK8A 2YY7A 3ZW8A 5B2EA 1C3OA 4L73A 3VGJA 5JCJD 4KQMA 4ILKA 4HFJA 2YMLA 3P9KA 4PONA 2Z2YA 4RY9A 1NJ6A 4UDXX 5C18A 2HJWA 5JC8A 5C53B 2PRYA 1NULA 2ZIZA 3AVQA 3LQ1A 4AJOA 3KG2A 4B5LA 1JW9B 2EEPA 3FYUB 1EWVA 4AN1A 4KNYA 1G5TA 1UL1X 3GT3A 4J7CA 5B58T 5KVVA 1N77A 3L9XA 1B93A 2EFEB 3PB3A 1F9AA 2FH5B 1F14A 3KQHA 1IXRC 2R8ZA 1X7WA 2HV9A 3FBGA 1TYDE 2IU6A 2VXCA 4PSUA 4QFBA 3BMOB 4BLVA 2H2IA 1XN4A 3GUUA 3S3TA 2VQEB 4URFA 4GDFA 4J3JA 3OWXA 3JASB 1QQTA 1T8RA 3OFNA 2YMMA 2XPCA 3Q7PA 4B33A 1TXGA 4UBNA 2R11A 2PX0A 1C3LA 5FL7D 2ZWMA 1FDUA 3ZK9A 3BRSA 1KEKA 1GQFA 2XMSA 1FSZA 2YW2A 4AY2A 3RSZA 3DCYA 4AY3A 3IIIA 3KJFA 5DGCA 4QOFA 3VOBA 4LK2A 2B35A 1WSBA 3N3BC 3H4VA 4BVBA 4DKXA 3SLKA 1BCSB 1GQSA 1WD5A 1US8A 1ZU4A 5GOTA 2FKAA 3NATA 2B69A 3GJ6A 3LZCA 1MOZA 4MI3A 3ZEAA 3KR2A 1I9GA 3CF4G 3CJRA 5TE9A 1IVYA 1VBKA 4JJFA 2P7IA 3G49A 2XSZA 5IABA 2JGNA 4RNCA 1RJFA 4FOSA 4O29A 1QMPA 3HGMA 4GC5A 3RWMB 5JSZB 4Q39A 4WXYB 2WQ6A 4RVUA 1A8PA 1Z56C 4LHXA 3UTCA 4E5YA 3DMRA 3C1OA 1BA3A 3G2PA 2ET6A 4KQ1A 5F1KA 4CCYA 1ZM4A 1DT3A 2C95A 2VRCD 1QCDA 2ZS7A 3M4XA 3ZDRA 1G5PA 2Q5LA 4DUPA 3QVWA 5EJ8A 1NA5A 3L8FA 4ZVSA 4C4ZA 4I6GA 5FORA 4XB2A 4FW8A 4J49A 5ER9A 3UCEA 4IXNA 4AUMA 5F7XA 2PRIA 5EMJA 1GLNA 2EZ8A 1CRQA 5REQA 1O87A 1DC5A 3KR0A 4RK5A 3RSSA 1QJ4A 3IOMA 1RLJA 4OMFG 4TTRA 4TN1A 5TQJA 3O8BA 4ZAWA 4F2HA 3PGJA 1NXPA 3CVYA 4DC9A 1ZOSA 3QVSA 3ZI0A 3CKKA 3AFHA 3GPCA 5DM60 1WHSB 2AZDA 2RGUA 3H84A 2IEAA 4JP3A 4RD6A 3SMQA 3W7VA 1H0SA 5KQGA 4NBKA 3OMLA 2G7ZA 2VUUA 4BWVA 5LDGA 3DV2A 3RIYA 4WKCA 2YWCA 1JA1A 3MJCA 5H8WA 2B5OA 2JAPA 1X1RA 4EWLA 2PV7A 5E2BA 1SU4A 4TXNA 3WI7A 3TKLA 3DAPA 4KUHA 1WUHS 3WK5A 2OYSA 3ORHA 4M1SA 1U6KA 1VPVA 4D4KA 4RGBA 1DLIA 5HQ3B 4KR6A 2EWMA 1TA0A 3VR3D 1UDWA 5K3FA 3AERA 4OLHA 1U8FO 1XTQA 3ME5A 1UT5A 2D0PB 2G28A 4AJ2A 1GCOA 5DYIA 3U9SA 3WB0A 2H06A 3CX8A 4DY4A 1FY2A 4BNXA 5JFGA 3GHYA 4FBLA 4IJKA 2B4QA 1W581 1A77A 1ZIYA 2CKMA 3G82C 4HDKA 5CH5A 2C77A 3QKWA 2NU6B 1TADA 3IP8A 1JYEA 3QIVA 1KR5A 3GLQA 1RHUA 1U3GA 1FSGA 3JQ8A 1SQ0A 3KC2A 4IDCA 2IW3A 3TQCA 5JBNA 1E2NA 4O59O 5CYPA 5KJ6A 1MQSA 4CIAA 2QTTA 3VH4A 3CU5A 5HGXA 4LF8B 2C0CA 4HNRA 2YBDA 4HQRA 3O4VA 4YJ3F 4XGNA 5A05A 1RLIA 1C7EA 3L4BC 4HDSB 1YHNA 3AK4A 5HW0A 1AT1A 1Y89A 4H0CA 4A92A 2F48A 1G2IA 3FGZA 2ZB2A 3SJZA 1MFZA 4YX9A 5I7EA 1PBTA 4U2CA 1YUNA 1ZD5A 4F2WA 1A4XA 3I39X 2Y92A 1KS9A 1WPGA 1ZU5A 4IIVA 5EHGA 5IC6A 5DIFA 2R1VA 1JEAA 4F38A 1S3GA 3BC1A 1LZLA 1E3EA 2Q1WA 1ZLYA 2WJWA 3LWNA 3S29A 5CLHA 1H8HD 3WLLA 4QE3A 3GJ4A 4LF4B 2E4UA 3OT4A 2HLNA 1UKEA 1BTOA 2AOWA 3HABA 1UAYA 3Q3JB 4YXWA 4DADA 4LYHA 1U0LA 3BD8A 3RDPA 1QGDA 2BEVA 2IPOA 2O2CA 2QL6A 2HFKA 4J1TA 1OQAA 4XCQA 4Y2RA 2UVDA 3I2KA 5E8RA 2WSMA 4JBYA 4BDSA 2CVHA 1SKYE 2Q2NA 1XTBA 3C3YA 2HGZA 1XZMA 1J2RA 2GVDC 4TGLA 3X1ZA 4J3NA 5EEHA 3VQTA 2HQ1A 2BR5A 2COKA 1DJMA 1RQ7A 2QNIA 5FOWA 2H1HA 5IAOA 5ALLA 1KP9A 2CBZA 3I6IA 3RSFA 2XWQA 4UOEA 2TMGA 4E32A 3HFJA 4G5GA 1C4OA 5TY0A 4LEIA 3K2EA 1ZVQA 1TPYA 2BGLA 3FPKA 2H92A 3ZGXA 3ZBUA 1TTPB 1RAIA 4N82A 4Q3EA 4B83A 1VGQA 4CG3A 3R9IA 4DPLA 4M99A 1EM8A 4PNEA 3GRKA 1I0LA 3UAOA 4D44A 4TZTA 4NK4A 1V5IA 1RAAA 2DTEA 4D2IA 3L6OO 3WGKA 3IBSA 3UJ8A 1U28A 2WWXA 5HKAA 1VLVA 4DTIA 1D4FA 3EQZA 2O9JA 4JVLA 3PXUA 3SR0A 4CEHB 3USES 1GZHB 4JT9A 1EHCA 4URYR 2TECE 2J5KA 1SUPA 2ZYRA 2PRSA 3KOMA 3P2IA 4K03A 3HUFA 4KAFA 2QP9X 1O6GA 1MO6A 1UC9A 2B0CA 3B1WA 3DL0A 3O74A 1W9HA 1WULS 2N42A 4JQCA 4C5BA 3NGLA 3SHQA 3U4QA 1XHLA 1VQ1A 1S8FA 5FNVB 1M8FA 2AN9A 3I5UA 4WNAB 4QDJA 5TGTA 3TCNA 5IRCD 4NNOA 5EZYB 1FDSA 2CV2A 1CUGA 2JDID 2EKQA 3LUFA 4IEFB 4UM7A 1KEEA 1K8ZB 3DA8A 1WHTA 1I2BA 1TO1E 1KFKB 2XB6A 4M7OA 2BFPA 4YRQA 4BRSA 5HCIA 3VZCA 4YJGB 1XEXA 4RLFA 5HOEA 4YP0A 4PSAA 1L7EA 2Q4EA 2LKCA 2OK8A 4BN4A 2K2QB 1GPLA 2NAPA 4RA9B 2Q9BA 3NAZA 3F96A 4WSOA 4B6PA 3NAQA 4WUVA 1E0AA 3M5WA 2JIRA 2O5VA 2N0SA 4P3PA 1A97A 1ODTC 3DTTA 5HUJA 3UAZA 4KLNA 1LPMA 4NJOA 3M89A 4NZOA 5KSWB 2VOEA 3EHDA 1N5OX 1OC2A 1DEAA 2FWAA 2JW5A 5H81A 1UXGA 1XRNA 4KKXB 1QO0D 3LSTA 1PV4A 2O50A 1DNPA 1DKLA 2LW7A 3LUJA 4O4LA 4MI9A 4QRHA 2OGSA 4JI8B 3GMIA 3FPHA 1L7RA 2CLEB 1SBQA 2FW6A 2YYZA 4ZRMA 2Q6TA 1DG3A 3OAAA 2OFXA 2WPNA 1XOIA 4JBLA 3ZDQA 5C52B 5LC1A 2IW1A 3DW3X 1PUIA 3LFTA 5FOVA 5DX0A 1PLJA 3WTCA 5JPIA 4NQZA 2IITA 3CG0A 3EPKA 3ZWMA 4EZIA 3IPYA 1OHHD 4JNKA 1U8XX 3A6GA 3PYMA 2OBBA 4HLQB 1DEKA 2O57A 4INZA 2ZJ8A 3L7IA 4JLJA 4L8FA 1UMKA 2IEDA 4O33A 1LSJA 4ILEA 4YJHA 4EJSA 3NWOA 1UOOA 2BUAA 2QJWA 4OXKA 4WCFA 1XZHA 2DCMA 1LW7A 1A9SA 2Y71A 2E89A 2QORA 5FR1A 1CVRA 2XVAA 4R2HA 3IJ5A 4K1XA 2JGEA 1H2RS 2XMGA 2JD1A 2HHHB 5B3AA 2A5JA 2P40A 1ULAA 2XMRA 3CT4A 4UHEA 3RVKA 5L45A 2AK2A 2GZHA 1NVMB 5SICE 3ZKWB 1R0RE 1U7WA 4YK7A 5TSDA 2QV7A 1V3QE 2WF5A 3RYHA 3QVJA 3ZBQA 4PG8A 4CG0A 5BRJA 2QNBA 4TUYB 3D6MA 1CQPA 3DAFA 2H2AA 5IMBA 1Q83A 3D8BA 5FAKA 4FCTA 5LSAA 1OLSB 3VU1A 4BO9A 1VLJA 3SEQA 2WUEA 3IE2A 4JENA 1GPBA 4U7TB 3ROPA 1L7DA 2L0XA 2WT9A 3P9ZA 4MVWA 3RNLA 4ALMA 3L07A 4I08A 4KXLA 1GAQA 3WOVA 3LF2A 5K0BA 2FMTA 4KVGA 4DR3B 3RARA 1O96A 2DQYA 3MWJA 3SN6A 3NOQA 2QRZA 1LNSA 2OORC 1D2AA 1KMQA 5I45A 1Z12A 4Y2VA 2DH6A 1RZRD 2Z6AA 2VWQA 1HOXA 5CMLA 4Z0PA 1M2FA 3T3NA 4WXEA 3O6VA 3T35A 3PD7A 1ZZEA 5BNWA 2OD7A 1B8NA 3GVIA 3QLVC 4W8OA 4F06A 121PA 1YNSA 1ZEJA 1GWNA 1UBTS 2PSDA 2PT9A 3ELDA 4HD8A 4RVSA 2QZPA 5B7GA 3CZCA 4CKZA 1RJWA 1K98A 5LWHA 4MB0A 1L5ZA 2YDYA 5T57A 1E0KA 1YJ8A 4CLXA 1W0KD 2BFWA 2X1MA 2C2YA 3H1AA 3A9TA 2XTNA 4Y0NA 1GTSA 4EVQA 2G17A 4XIGS 3RD5A 4D6PA 5DWDA 4O4IB 4D6YA 5ICSA 3F3SA 2ZJ0A 4RTOA 3QVOA 4EPXA 3AC0A 4Z7JA 1D4OA 5IK2A 4D98A 1VI6A 4N6OA 3QU2A 1P0QA 3AFGA 1CUFA 2ZVJA 5DMHA 3VR1A 1K3TA 2C0QA 3RROA 4DLKA 4FQ7A 1FTYA 4M60A 3QFHA 3UK0A 5ILGA 5JXIA 1WCV1 2GBLC 3R40A 4P86A 5DWQA 2BI4A 1J8VA 3O4IA 2WEKA 1CLEA 5D85A 1W52X 1EE9A 1ZGHA 3QEOA 4DBZA 4LOKA 4DHEA 4HLUA 4GXRA 1GA6A 3NEAA 3NKLA 3LZ6A 1BVUA 4OP1A 4IM7A 3S1SA 1LBSA 1WTCA 4P08A 3PDIB 3EGVA 1FMTA 4L5YA 3VYVA 4EPVA 2FZEA 3LGAA 4PLPA 4DWWA 7MHTA 4MW2A 1G8SA 3DGEC 4IVRA 4REQA 1OAOA 5A3VA 2O20A 2BFDB 3M82A 5GVRA 4ASUD 1F2DA 1QF9A 4EHDA 2A9FA 3DKKA 1YONA 2I1VB 2BF7A 4QBGB 4M55A 1MIOA 1NN1A 4ZAFA 4V03A 4MYTA 2C57A 4EG3A 4QWMA 4GI3A 3QOYA 1QTRA 1ZINA 2G88A 4HRXA 4ZT3A 4DXHA 4MGIR 3QVKA 5ALPA 1IHYA 4Q9JA 4URVR 1FFXA 2ONZA 3LNCA 1NRIA 5DN9A 1U9IA 4K9QA 4ITUA 1FFWA 2FWBA 3DJFA 1PEAA 4LV6A 4XOIA 3OF3A 3PR3A 1ZITA 1C30B 1J0EA 1YQUA 3BORA 3P2EA 4P34A 3FYUC 4S2UA 1DHTA 2WHXA 4DMFA 2H16A 1X70A 3RLFA 3ZHCA 4PZ9A 5K03A 4IGIA 4REMA 5HNKA 4L6AA 2QT9A 3AR7A 4KV9A 3RWOA 1XZPA 4D3XA 5LA6A 4JLBA 3RRJA 2FZVA 5AUPB 3ZHQA 3TCKA 3A2MA 2VEDA 3PL1A 4CTOA 3QX3A 1CUVA 2AMLA 3VM6A 5BQ3A 2P2NA 2ODQA 4K3UA 2PH5A 4X7MA 1HYEA 2IDJA 2HQSA 2IYSA 1HLPA 4P4LA 3AWIA 3TSWA 2J6IA 1EH5A 5E2AA 4BKRA 1RJ9A 1WG8A 5KOHB 2Z3ZA 2PUGA 1GPUA 1I10A 3COJA 3SZOA 5G02A 2WJGA 4EZEA 1AS2A 4AZTA 1X86B 3MUEA 2IT1A 3NDJA 3J81A 1PJZA 3ZR4B 5DBIA 4X63A 3Q72A 3OX2A 1QYVA 4Q93A 3DOEA 3WG9A 4KTVE 5LKRA 3WLJA 1MHPA 2WKRA 3OCWA 3L6CA 2FW7A 1JEQB 3MPUA 1PJ3A 2O1EA 1AUQA 4ZO4A 5DN6A 5EZYF 3GJ0A 2ZJZA 1RXCA 2XGMA 3AM5A 4UVIA 4C6TB 3ZS9A 3CEMA 2A7XA 3MTJA 1QSGA 1HNWB 3X1DA 2JRCA 1CZUA 1Y33E 3W05A 2R0QC 1ZVMA 3G8DA 3NHLA 3DNMA 4RWEA 3BWXA 3JD2A 5EZSA 4KO3S 1TPZA 2Z56A 4AS3A 3A6FA 1LX6A 5GGYA 3ADBA 1F6BA 5T7BA 2VJPA 4PHTA 1KL7A 3X1XA 1O5TA 4PAQA 4NYMQ 1X87A 4H17A 2Y0CA 4QVKA 2GKSA 2H63A 4AZVA 2I4MA 2B78A 3WK4A 2J0VA 1NXVA 2QMQA 1Z2DA 3CF4A 4PYIA 5FOSA 3ROFA 3FUVA 4NS4A 1NBOA 3U3OA 3K8OE 2IS1A 2REQA 1MUUA 4WZAB 4JKIA 2Q4RA 3K0AB 5EIXA 5TDHA 3IT2A 3IV6A 2ONJA 1SQ6A 4DMUB 2PO5A 3IGFA 5CXQA 3EVFA 1BH2A 1QDLB 3IHTA 4WFKA 3B82A 5THKA 3RVQA 1VLLA 1USIA 3I9MA 3OT1B 1GCGA 2NUPB 5E1DA 2G83A 5HS6A 1P7VA 3HHEA 4JI2B 1AK9A 1P75A 4UM8B 3TQSA 4KQGA 3VZBA 4F60A 1NR5A 4IG9A 2OZLB 3LBHA 4JR0A 2AMFA 1D09A 3IOCA 4G3XA 2H0RA 3Q1LA 3NHYA 2Z6VA 2X8JB 1Z63A 5E95A 4L16A 1AURA 3RSGA 3C6MA 2BJVA 1JDSA 3FAKA 2AI3A 4YFVA 3V1LA 4F04A 3ENQA 1ZSYA 1QE3A 2R8EA 1MU0A 4WK6A 2PL5A 3ASZA 2A5GA 3EZ9A 4FOOA 4LSWA 5AKEA 3OM0A 4JXKA 4WN3A 1MX9A 1UWVA 2B4KA 3F6BX 1G98A 3KQWA 1YA8A 2DU8A 2XQFA 2W37A 4YXFA 2WYHA 4J76A 1NLYA 2H00A 3F8SA 1UC5B 2Z5VA 5L3QA 3FETA 1XD9A 3B1VA 4NG4A 5EXXA 4B9EA 1V4VA 1OH5A 4CPDA 4EFKA 3EOAI 7REQA 1Y3AA 1D6JA 3KTOA 4G26A 4BWFB 1Y6FA 1IN5A 3KWJA 1E3LA 3FIJA 4EPYA 5MFPA 1P2VA 1U2PA 4YIHA 5CW2A 1W1WA 3MLEA 4JASB 3HJTA 4BQSA 2GDZA 5IWCA 1YJQA 2FPUA 1KBZA 2E4YA 4TUYF 5HX7A 3F2VA 4IYRA 1QUEA 4LJRA 4Y1GA 4I14A 3D31A 3H5WA 2WU3A 1JLLB 1FBNA 3P9SA 1ZNWA 1X80A 4D3SA 2XHZA 4YVFA 1SOVA 3STXA 3TRDA 1EFLA