3BXPA

Crystal structure of a putative carboxylesterase (lp_2923) from lactobacillus plantarum wcfs1 at 1.70 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
274
structure length
258
Chain Sequence
GMQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGDKYLNDQAAIWPQLALRWLQEQGLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipase/esterase
publication title Crystal structure of putative carboxylesterase (NP_786266.1) from Lactobacillus plantarum at 1.70 A resolution
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Hydrolase
total genus 81
structure length 258
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bxpA00
4M0FA 2GBCA 5A2GA 2D5LA 4I19A 1Y7IA 2C7BA 1HQDA 1N8SA 2XQFA 4Y7DA 1CEXA 2VJCA 1N1MA 3R41A 5CT5A 2BFNA 3HLKA 2YYSA 3LP5A 3IBTA 1TCBA 4UHEA 4HXFB 5HCUA 2RGUA 2EDCA 3WWEA 3D4LA 4LHEA 3IB3A 1CLEA 5CMLA 5T4BA 3VJKA 3B12A 1MO2A 3I6MA 5JIBA 2Y2VA 2XUKA 2JGJA 5FLKA 1QTRA 5AP9A 3WL6A 1CRLA 2ZJFA 4MXDA 2Z3WA 1DT3A 3T52A 3WKEA 1XLWA 3DEAA 2QVBA 1CPYA 3OPMA 2WHPB 3C6XA 1R3DA 3I2IA 4UBOA 2OLEA 3DS8A 5AKXA 2AJLI 2NW6A 5AM1A 3WIOA 3WWOA 2PL5A 5AOCA 1VXRA 2QR5A 4EB0A 4B7ZA 4FFWA 3H19A 4QDUA 4E14A 3UMJA 1QFSA 1ZD3A 3PF9A 2XUHA 2J4FA 4KAJA 4UBLA 2PPLA 4OSEA 4DM7A 4S0XA 1YASA 4X6XA 1PFQA 1I6WA 1QIFA 1DX4A 1FFAA 4J0IA 3QPCA 3EQ8A 1USWA 1UT6A 4DNQA 2PSHA 3A2LA 1A8SA 3D3NA 4Q05A 1MX1A 4RPCA 2ZSHA 1Y7HA 4Q1VA 1YS1X 3C70A 5LKRA 3V1KA 4X92A 1SOMA 1EK2A 3D0KA 2CZQA 4X00A 1CUYA 4PQEA 1UKBA 4OYYA 5ALSA 5JZ9A 5AM2A 4KJXA 3DCNA 4ZV9A 3R40A 1JJFA 4X97A 3C8HA 3G0DA 2EDAA 3A2MA 3H04A 2ZJ6A 1GKKA 2Y6UA 3G9TA 1LGYA 1P0IA 5JZBA 2X76A 4L0CA 1XLUA 4ETWA 4KAAA 3HSSA 1EXWA 4KR0A 3GUUA 1Q0RA 3C8DA 2FJ0A 1LBSA 3BIXA 4Q34A 5CURA 3L1JA 4FWBA 4H7HA 3D59A 4XJVA 3BF7A 2ZYIA 3I1IA 1GGVA 1WM1A 4QNNA 5ALLA 3M83A 1QONA 3O4IA 5DJ5A 2WFZA 5FPPA 2J4CA 4ITVA 4QDXA 3WLAA 1R4ZA 3L1HA 1VZ2A 4U2FA 4INZA 5LZ5A 2Y2UA 3UUEA 1XZGA 5AIAA 4Q3OA 1TK3A 4FOLA 2J3QA 4DGQA 1XRPA 2H9YA 5FKJA 3DOIA 3BDVA 2W22A 2BUBA 1R9MA 2B20A 4BBZA 2XMQA 3H2HA 1ODSA 3G0CA 2HFKA 1ACJA 4RE5A 5ALJA 2WKWA 5BV7A 5ALFA 1YCDA 1U2EA 4BTVA 2OCLA 2HRQA 4JEIA 1C4XA 1EDBA 2O2HA 4AO7A 4B83A 6YASA 4MYSA 2OQIA 3Q0TA 4NMWA 5ALXA 1M33A 1R50A 3R3XA 1ISPA 4ARBA 2DFPA 5LZ7A 5ALWA 3WKBA 1G5FA 1ZGCA 3AIMA 5FOQA 1ZI9A 5HF9A 2BJHA 1ZD5A 2GZSA 3IUMA 4YX9A 3DOHA 4G5XA 1CIJA 2XE4A 2CBGA 2XI4A 2HA0A 3LIIA 3AUKA 1EINA 5A71A 1CUSA 3B5EA 1GQSA 4EHBA 3OC0A 5AI9A 1YAHA 1CUCA 4QEKA 2QT9A 2I3DA 1UKCA 5C81A 1VA4A 4DIUA 3GELA 2VF2A 4B6GA 4CG3A 2PU5A 3HJUA 3W04A 3VVMA 4BRZA 5DNVA 1J07A 5HKBA 5AKKA 4PSCA 1TCAA 1U4NA 5HF5A 2XQJA 2VJBA 1WPRA 4TPKA 2C0QA 3RKSA 2ZYSA 5FDFA 2WUGA 2HA5A 3NUZA 1F8UA 3I2HA 1K8QA 4GI1A 5E2IA 3WQHA 2H7CA 2WUDA 1X2EA 3DKKA 3KWJA 4CCWA 2WTMA 3C6BA 1CUIA 1YSCA 4H7FA 4BE9A 2V96A 2OXEA 3WYNA 4X7BA 2HM7A 1FJ2A 5FXMA 5AKLA 1ZI6A 4QZVA 3AZOA 3VXKA 1CUGA 3DQZA 1LPNA 2OCKA 1YB7A 2QKYA 1TIBA 3OURA 5LZ9A 4BAUA 4W63A 5LYYA 2G4LA 2O2GA 4FBMA 3FAKA 2XMDA 4K6HA 4CCYA 4J0CA 3R3UA 5I8PA 5A62A 5FUMA 1U65A 1FFEA 3WIBA 5HKAA 2LIPA 4DSZA 2WG2A 4AZ3A 1CUHA 2V97A 5ISMA 2ROQA 3H2IA 4BAGA 1MAAA 4ZRDA 2XT0A 3I2GA 1L7QA 5JADA 3G02A 4W1RA 4WDQA 1GKLA 4DNOA 5DTIA 5AO9A 5ALTA 2ACEA 4J0JA 3RLIA 1T2NA 1Q83A 3RM3A 5DWDA 1JFRA 4FLMA 1FFCA 3R3YA 5CW2A 3ICVA 5AM5A 1EH5A 2WM2A 3LLCA 4UBIA 1LPOA 3C6ZA 3DYVA 4JYPA 4J03A 3KOOA 4PSDA 1QIMA 4N5IX 2HHAA 3M81A 4G4IA 5T4HA 1VE7A 2ACKA 4ZREA 3PFCA 2P8SA 4N5HX 1WB5A 2QM0A 5EIHA 2C0PA 1ZI8A 1LZLA 3O4HA 3C43A 3V9AA 3I2JA 1EI9A 3G7NA 2VSQA 5ALGA 7YASA 1MJ5A 2XLCA 1WHTA 5K3EA 5FP0A 4B82A 4HVTA 3CCCA 4F21A 3EQ7A 5ALKA 1BRTA 1VLQA 1UKAA 3WKDA 4MJ3A 4BVKA 4PO3X 3BDIA 4QWMA 2OQVA 4WDRA 2VATA 2OG1A 3WK4A 1YAJA 1AZWA 1GPLA 1QLWA 4ZXFA 3JWEA 1JKMA 3TEJA 1AC5A 1MNQA 3IDAA 1SCKA 1W75A 3FSGA 2C58A 4EY8A 4Y2JA 4Y2RA 5K3BA 5SYMA 3W9UA 3JYHA 3WL7A 2WILA 3G0IA 1O6FA 1O6GA 4G1FA 1AURA 5CXUA 5AM3A 2WU3A 4DMKA 1GPKA 1XZDA 3QBJA 3AFIA 1Q84A 4F5ZA 3AZPA 3QVMA 1FFBA 2Z8ZA 3BE8A 2C5GA 4WFKA 3PICA 3BXPA 2WG0A 1HBJA 3K6KA 4RNCA 4UHCA 3N0TA 1XZAA 2OCIA 3TJMA 4Y2XA 3CXUA 3U0VA 4X95A 1AUOA 2FJPA 3G8YA 3FWHA 2D0DA 1H22A 5EHXA 5FPQA 1EVQA 2Z8XA 5AOBA 4GEGA 4UHBA 1YA4A 1A8QA 2WHRA 5CBKA 4MQMA 2QMQA 2AJCA 5AKIA 3STUA 2DCMA 4Y2TA 5ALOA 4C88A 2FUKA 4GBGA 3DL4A 5IVKA 3TRDA 2JGKA 1UK8A 5KWJA 4ZV7A 2XUGA 2I03A 4J0GA 5ALHA 4WJLA 4BVJA 2WFMA 1CUEA 1JT2A 1LNSA 4LYEA 3STVA 1UOOA 2RI6A 3AZQA 1MX9A 2DQZA 2QS9A 3I28A 5AOAA 1XQXA 4U2BA 5H3HA 4CIBA 3IUJA 5HFNA 1LZKA 3GROA 1IZ8A 3IUNA 5JATA 3F8SA 4GLBA 3A70A 4AO8A 2HA4A 3STYA 2WUEA 2WU4A 5BOVA 4BAZA 5YASA 2EEPA 1MPXA 5LP1A 1EDEA 1F0PA 4UPDA 2WQZA 4AXBA 4CCYB 2ZYHA 3VVLA 1WOMA 1XROA 2Y1KA 1XRNA 1C7JA 2BUCA 3F97A 5AKZA 3UUFA 1H23A 4M0EA 3OTQA 5KBYA 4L9AA 5K3CA 4NS4A 2PSDA 3ED1A 4A16A 1B41A 3ZI7A 4AMZA 5AI5A 2PX6A 5CTAA 4EY7A 1THTA 4AB1A 4B80A 1J1IA 4HZGA 1ZIXA 3WA7A 2RHTA 4KRXA 3EBLA 4UUQA 1HDEA 3Q8WA 2VJAA 1WB4A 2RAUA 1QIHA 2HU5A 2X5XA 2JGIA 4K5QA 5E4YA 1XZMA 4MEBA 5ALDA 4B85A 3BJMA 1UOPA 3H2GA 4L3WA 1EB9A 4I4CA 1XRQA 1UFOA 4F60A 4HAIA 1IUPA 1UWCA 1JI3A 4IH9A 2JGEA 5ALUA 1A88A 3RARA 3WK7A 1W6RA 2HFJA 3ZWQA 3HACA 4H7JA 1EX9A 5KREA 3C5WP 1BE0A 4LXHA 4AMYA 4TVKA 1NU6A 1E8MA 3FLBA 2YXPX 3H18A 3STWA 3MGAA 2GZRA 4H7KA 4X6UA 2R8BA 1QIGA 1P0PA 5J3JA 2WIFA 3DLTA 3HEAA 4HXGA 4UBJA 4K6GA 2QOEA 5JAHA 1T4MA 2FX5A 2HU8A 4QE3A 4LYDA 5C8VA 3FSGD 2OCGA 1IZ7A 4UBNA 4E11A 3G0BA 3BJRA 2BGNA 4AN1A 3ZV7A 2ZJ7A 5HF6A 1QOZA 3WJ1A 3ESBA 3M3DA 1VKHA 2Z5GA 3O9VA 4XWGA 2GYUA 5IVDA 3IUQA 4X85A 1VJ5A 4IHAA 4PSUA 4CG1A 1L7AA 1ZD4A 3FYUC 4FNMA 4B0PA 4Y2UA 2G5TA 3AIKA 2OGTA 3OOSA 1EB8A 1QO9A 4KE6A 1IVYA 2ZYRA 2X8BA 5CT8A 1DTEA 3HI4A 4P08A 5LZ8A 3W2TA 1GPNA 1DT5A 4IH4A 2PUHA 3HYSA 4G8DA 2DSNA 4HTAA 3WZLA 5ALRA 3FYUA 1OXMA 2PM8A 3QMVA 4CFSA 4KAFA 5IVHA 2VTVA 1XZEA 4EUSA 2GYWA 4X90A 5DNUA 3L1IA 2E3JA 5HK9A 4OU5A 4FDMA 1NU8A 4A5SA 4LXGA 5ESRA 2QTBA 2V9ZA 1J2EA 5IVIA 1HKHA 1W76A 4BZZA 3LIPA 1HL7A 4K2AA 5AKJA 3G0GA 5JYCA 1BROA 1XZBA 5EGNA 3FOBA 1JMYA 4W9RA 2XMRA 2B61A 5AKEA 4ARAA 5JD6A 2OPHA 4G9EA 5K3DA 3ZLTA 2WLSA 3C45A 2XUPA 5AI4A 2QXUA 4RE6A 1RWQA 3MUNA 3OM8A 3C5VA 1UK6A 3W05A 1ZGBA 2ORYA 3GA7A 1J06A 4E15A 3S2ZA 4H35A 3G9ZA 3N2ZB 2XUFA 1DX6A 4M0MA 3WK5A 2Z3ZA 2WTNA 4OCZA 3FLEA 4MQLA 4C4YA 5FRDA 5F4ZA 3MVEA 1TCCA 3OG9A 1BCRA 4B84A 1N5RA 4HRXA 5CH8A 4WY8A 5D6OA 3WL5A 1VZ3A 4AQDA 4HRYA 3ZLVA 4BRSA 3FVRA 4UBKA 1E89A 4P92A 2IITA 4X93A 4Y2PA 1A8UA 2K2QB 1ZOIA 2YASA 4EY4A 3KXPA 4KEAA 3FBWA 1QIJA 4W1PA 3KD2A 2AJDA 2XQIA 3F98A 2C4HA 4AN0A 3A6ZA 5HQ3A 1DWQA 2AJ8A 3ICWA 1ZD2P 2VT6A 4QLAA 1THGA 5CRIA 4UHDA 5ALVA 3S8YA 2QUBA 3WKCA 1XZKA 5CT9A 4WFJA 3B3QA 2JEYA 4Y2YA 1QIKA 3GFFA 4DMCA 4U2DA 2GBGA 2WIJA 4BTLA 1WB6A 2HA2A 1TRHA 1AKNA 4Q3KA 5EHQA 3KWFA 2VQ6A 1H2XA 5E4TA 2ZSIA 1K6EA 5AK5A 2XQKA 2XDWA 3ZPXA 5LZ4A 4EBBA 4KE9A 4G9GA 1PV1A 3C6YA 5DYWA 1U8EA 2WG1A 1H2YA 4O08A 5C7YA 3DJYA 4IQ4A 5T4FA 1MU0A 2YH2A 1VOTA 4E46A 5EIEA 1JJBA 2XMCA 3RK4A 1W1IA 5A7HA 4EA6A 2PSFA 2ES4A 4N8DA 5FV4A 4OB6A 4BP9A 5HK8A 2XUIA 2BCEA 4MWTA 4BVLA 1KU0A 1JJIA 4JUIA 3H1AA 1K5PA 2WIKA 4ROTA 4NZZA 2R11A 3PE6A 1QZ3A 4X91A 2OGSA 4DNFA 4XVCA 2W6CX 1E8DA 2UZ0A 2JF0A 3GBSA 4MEAA 4KYVA 3I1YA 4BATA 3FCXA 5AI6A 3W06A 5JALA 1UXOA 1XKTA 5IH7A 1ODCA 1W4LA 5EI5A 4P9NA 3FCYA 1P0MA 3TGLA 4BDTA 1SC9A 4J3JA 3FYUB 4J0HA 1UOQA 4UBMA 4WY5A 3YASA 4LXIA 1BU8A 3VJLA 3WWPA 1YR2A 1XZIA 5IKXA 1XQVA 1DWOA 1SFRA 1K63A 4GDMA 3K9BA 2VJDA 3I6ZA 1FFDA 5K3FA 1UZAA 5HFAA 1XRRA 2O2IA 4QA9A 5EHZA 4KACA 3HC7A 3K2IA 3O0DA 3WKAA 1E5TA 4CIAA 3FYTA 3R3ZA 3E1GA 3ANSA 5E4JA 5AM4A 3ZLUA 3EF3A 4C89A 1CQZA 1WCYA 4OB8A 1VE6A 1SCQA 4C4ZA 1BN6A 4EY6A 3QMWA 1JU3A 3IA2A 4K6KA 1XRMA 2HA6A 4JYMA 2VT7A 2OGZA 5CT6A 3QZUA 1ZJ4A 4FMPA 5I9IA 4FFVA 4XIIA 5K5EA 2PUJA 3PI6A 4YASA 2JIDA 3FLAA 4LIPD 3FNBA 4BC0A 4H18A 4GHWA 4Y2QA 5DNWA 3A2NA 2QRUA 3E4DA 3WMRA 4OU4A 4Z49A 3WZMA 4Y2VA 1CFJA 4GECA 4V2IA 5AKHA 4DYHA 5AJHA 3DD5A 3C87A 3O9MA 4J0KA 4I3FA 3H2JA 3G9XA 2AJBA 4MWSA 5BWCA 3BWXA 3CN7A 3DNMA 2XQGA 3DDUA 3AJAA 3HZOA 1BEZA 5BWBA 4PF1A 5T4EA 4DMFA 1NX9A 3WJ2A 5KWIA 1CUUA 2XMBA 4J0DA 3D2BA 4G4GA 4X3CA 1MT3A 5LZ2A 4C4XA 1ODTC 1B6GA 3H17A 4FTWA 3QYJA 5HQ3B 4W1SA 1XZCA 3AINA 5LLSA 3I2KA 3DKRA 5AH0A 4UFOA 4C01A 3H0CA 2HDWA 4BP8A 2HL6A 2HA3A 1XZFA 1R1DA 1G66A 4WCVA 4HXEB 4UHFA 4GXNA 4AO6A 2WJ4A 3GZJA 3JW8A 3O4GA 1R9NA 4H0CA 1LPAB 4JNCA 3SWWA 1UK9A 2QXTA 1QJ4A 3ESAA 1OILA 3MUOA 1CUXA 1EVEA 4QLOA 3HXKA 4HS9A 2HIHA 3F9CA 1HLGA 4GW3A 5AKYA 3O4JA 4DTCA 4IH1A 4X6YA 2WFLA 1IUOA 1CUWA 1GXSA 3QM1A 2I3ZA 3QPAA 1BEEA 5ALMA 3R3VA 5JD4A 4B0OA 3U1TA 1D07A 1E66A 4XX1A 1XLVA 1EA5A 1YB6A 2XUDA 4ZGBA 2G63A 1ZICA 2XMSA 1BCSA 1DQYA 5CT4A 1LPBB 3STTA 5LKAA 4OD0A 3R3WA 2O7RA 3E3AA 2CB9A 4B9EA 1DQZA 3R0VA 4BDSA 2XB6A 4DNPA 1ETHA 1XFDA 2QZPA 2VAXA 4JH0A 3QH4A 1UK7A 2QJWA 4ZI5A 1DINA 3X3HA 2B4KA 1QIDA 3V1NA 2XLBA 1ORVA 1RYYA 1CUJA 4QDOA 4AZ0A 2CMFA 5JARA 3HRHA 3WL8A 4FBLA 1Q0ZA 5ALZA 4YPVA 1LBTA 5ALIA 2RHWA 4F0JA 1IUNA 3EIOA 5ALNA 1DWPA 1R88A 4X94A 1S8OA 4B81A 1LPSA 4CI9A 1MTZA 4MYDA 2DHCA 4UFNA 1WHSA 2IX9A 5AI0A 2DQYA 4OB7A 3WK9A 2PBLA 1CUFA 2DHDA 1YS2X 4WFIA 1N5MA 4IO0A 1JMKC 1QE3A 5SYNA 3H2KA 5K3FB 4H7EA 5C8XA 1QFMA 3AIOA 1Z68A 3AILA 3G9UA 2WSLA 1MAHA 3VJMA 2I78A 5AICA 4Q3LA 5LIPA 4UFPA 5ALPA 5CXXA 2RIPA 5AK3A 3SK0A 1H2ZA 5K3AA 1MX5A 1XZHA 1CUVA 3NWOA 2BKLA 3IULA 1LLFA 4L72A 3WA6A 4BCDA 4OUKX 3WWCA 4FHZA 3O95A 2XUQA 4Y2SA 3DYIA 5CH3A 4BCBA 1G42A 2DR0A 2GBIA 4QWWA 1JU4A 2CEKA 4QDTA 1MNAA 2JBWA 3STXA 2Y6VA 5JAOA 4G8CA 3SX4A 1TKRA 1ORWA 1W52X 1X2BA 3ANTA 5DLPA 4NVRA 3WK8A 4B9AA 3LCRA 4KE8A 1XZLA 5JAUA 4ZWNA 4N8EA 1ZJ5A 1WPXA 3D5EA 3IURA 5JAPA 2PVSA 2XMZA 3IVMA 4AX4A 4DMHA 1L7RA 3V1MA 3VKFA 3D2CA 3E0XA 2VAVA 2JEZA 3M82A 4H7IA 5EIAA 2JGMA 3VISA 5AM0A 2AXEA 2JGFA 3PF8A 3SC2A 3HABA 4Y9SA 4CG2A 2HRRA 1TAHA 1CQWA 1MN6A 1VA5A 1E3QA 1PJAA 2XUOA 4TGLA 5AK6A 1QIIA 2BAGA 5D7BA 5A7GA 3QMMA 2PSEA 2VEOA 1YA8A 1EDDA 1GZ7A 1G4HA 4BB0A 4FLFA 1OCEA 3CCBA 2WUFA 2WHPA 5A6VA 5DTJA 3PFBA 1ZIYA 3DL7A 1A7UA 3FVTA 1XRLA 5ALEA 2O7VA 1CVLA 1XQWA 2VA9A 3ILSA 4EZIA 3I2FA 5AKGA 5HF8A 3QPDA 4J7AA 5DYTA 2V98A 1CV2A 2CKMA 5ALQA 5A7FA 2IIVA 3D2AA 4DSAA 1EHYA 2OAEA 4U2GA 2XUAA 1HPLA 2WFLB 4EY5A 3WI7A 3CN9A 2G5PA 1XQYA 5JASA 1BS9A 5AIBA 5ALYA 1F6WA 5JD5A 3BL8A 4Q82A 4OPMA 1H2WA 2PU7A 3V1LA 4N8SA 1QO7A 3KDAA 2BUAA 4P93A 2JGLA 2WIDA 4BE4A 3F96A 2J3DA 4RGYA 2QUAA 4BC1A 5HZGA 1QGED 2H7YA 1XZJA 3QITA 4KRYA 2WJ6A 4YK7A 3PUHA 1QIEA 3NOXA 4PNZA 2GYVA 4BCCA 4U2EA 4FKBA 2WIGA 1BN7A 2HA7A 1TQHA 5JANA 3BF8A 3D7RA 4D9JA 2H1IA 1EK1A 4G4JA 1RP1A 3PDCA 4C6HA 5JZSA 1CUAA 2PSJA 2Q0XA 2H7XA 3ESCA 2OAGA 3ESDA 3H1BA 5D3KA 1KU6A 2HU7A 4OYLA 1CR6A 2GBFA 2WHQA 1E8NA 1GT6A 5EHNA 4U2CA 1CUZA 1LPPA 3F67A 2QJRA 5AHXA 3PUIA 3VDXA 4UHHA 1C7IA 1P0QA 2XUJA 3WWDA 1SCIA 4KE7A 4A23A 3P2MA 2BGRA 4LKOA 4PV7A 1FSSA 1DU4A 3V48A 2ZVDA 3WYDA 1VXOA 4H77A 2ONCA 3I6YA 3IIIA 1AMNA 4G8BA 4PW0A 5D3ZA 5EFZA 4H7DA 2CJPA 2RONA 4BYMA 3EQ9A 2PKYX 5DYYA 3LS2A 4GWLA 4BZWA 4DLNA 3WK6A 1CUDA 4QDZA 3KSRA 1Y37A 5AI8A 1CUBA 2B9VA 2DHEA 3BIWA 4W1QA 2HADA 1LPMA 2WJ3A 1AGYA 4FNGA 3NGMA 1F0NA 1AQLA 4X71A 1K4YA 5I7UA 1IMJA 1X70A 5CH5A 1KEZA 2CUTA 4C87A 3W9BA 1AX9A 2ECFA 5AK4A 1ACLA 1QTIA 3T4UA 1GQRA 2C5FA 1XKLA 2XMGA 4FLEA 5C8ZA
chains in the Genus database with same CATH superfamily
1YR8A 3EZ7A 4M0FA 4D96A 2I4TA 2D5LA 2Y71A 5F7XA 1MIHA 1N92A 3SLGA 1U8ZA 2P9FA 4ZC1A 4ZQEA 3WV4A 4Y7DA 1H9CA 4KLNA 1VLZA 4MV9A 3BHIA 3NM6B 4DSOA 4OYHA 3U60B 2OBBA 1GAJA 5U1PA 3DQQA 3PUWA 4Y1RB 2PUCA 3BWCA 4AKHA 2NZJA 2UXDB 3HWRA 3R41A 4PICA 2IX3A 3HKDA 3B6ZA 5CT5A 2YN0A 3A0RB 4R8SA 3RQSA 2Q27A 2ZOSA 1EVYA 1JHMA 2BFNA 2ZS9A 3CZCA 5E6UB 1P3Y1 4KVZA 4MV6A 2DF8A 3SN6A 1YJCA 4UHEA 2A1UB 1AA6A 4HXFB 1MV5A 3DFMA 3DDWA 3NWBA 1P44A 4K3UA 4C6SA 1EFRA 1XT6A 1JA9A 1USUA 3IUYA 2YL2A 3K53A 5EIWA 3T61A 4BVGA 4EDFA 5TPWB 3R9KA 1XAIA 5AHWA 1HLPA 2WJZB 3D4LA 3OEYA 4RETA 2FGKA 2DPMA 1CDEA 5CMLA 1ORDA 2FLKA 5T4BA 3DULA 4KQFA 1VLMA 4Q7QA 5HPYB 5DMXA 5E1DA 1KWKA 5JIBA 3DTNA 4I8IA 1TYDE 4D9NA 1Y6JA 3O8OB 1NATA 1FQWA 3PGVA 4XVHA 2JGJA 1OXVA 2XNHA 1YS7A 4PTZA 4C0JA 2SHKA 1V5GA 1ZD1A 3SS8A 4BN5A 1NRJB 1QTRA 4ZI7F 1ZU4A 3WL6A 1CF4A 2G82A 3HKEB 3A6HA 4D02A 5CB4B 4XW2A 4BNDB 1DT3A 2MDTA 3HM9A 3OQIA 1JYFA 1M2GA 3BM5A 3IAM1 1QVVA 1XLWA 2RHDA 4C4RA 1OZAA 1CPYA 4X65B 1Q92A 4MR9B 4KWTA 3V8PA 2I9KA 2BTOA 2QP3A 4J4HA 5TNXA 4FQ5A 3SMVA 4OK6A 3DS8A 1ZN7A 3ZIUA 3SR4A 1NUUA 2QT0A 3PD0A 4TN1A 3JQAA 4BNXA 1ZH4A 3RUCA 3N58A 4HI0E 4RVUA 1C0IA 2GCGA 3OJFA 4LGCA 1GARA 3OFJA 4LNHA 3GEMA 2PE5A 1B7GO 1FA9A 1J8DA 1GRCA 5BR1A 1Y1QA 3THWB 2AV6A 2X7HA 6AT1A 4MX8A 3QV1A 5M2QA 2W5UA 2A5YB 3R7BA 4YRFA 1E9BA 5E7IA 4KQHA 3HUFA 3KPYA 4B7ZA 3H1FA 2R1UA 3BXOA 3H19A 3NEPX 1EFPB 3TOCA 2FZLA 4YR7A 3WIEA 1LX6A 3NETA 4N03A 3KC2A 3QUSA 4OHWA 4YMUA 2QX9A 5JVDF 4F5EA 1A1VA 4YMVA 1GEGA 4OQQA 4W9MC 4EI8A 2W48A 4DDWA 1EX1A 2XY4A 1XA3A 4Z99A 1ATIA 3WDMA 4PXSA 4R81A 1EWTA 1H6DA 1NQ5A 2IGTA 2J30A 4D98A 2BHTA 3PL5A 4JCCA 3K0CC 1C30A 4QSMA 3UOWA 1KMCA 1X1DA 3O93A 1K7CA 3R5SA 1V47A 2P2LA 3E5MA 3NNNA 4PPQA 4L08A 2BFEA 4S0XA 3WX0A 4WZBB 3ZE7A 1I94B 1YASA 3W4JA 4EM6A 4X60A 2VOEA 3WBFA 3LT0A 1FCJA 6CHYA 1JHOA 4EECA 4BNTA 3PNVA 5C0OE 3OKFA 1QG6A 1F2TB 1PT6A 2VA8A 2QDXA 4YCBA 1M1NA 2ZJ3A 1DX4A 3AUUA 1BX1A 5LB4A 4RHCA 3CNLA 1G291 5KC9A 5EWLA 5JH7F 2Z6UA 1OYWA 2BMVA 1YO6A 1FQJA 3QYAA 4U6QA 1A8SA 5K8IA 1A5BB 1HT3A 5DLQC 4CGYA 4Y1GA 1XQ9A 5KTKA 3FM9A 3K92A 3GN1A 5JXGA 1LK5A 3M9LA 3AM1A 1FTSA 3N6RA 3SHVA 2PCLA 2OFPA 4EO4A 5TF4A 2HW8A 1NXXA 3MJVA 2V1XA 5DRTA 1N2CE 1QC5A 1MAVA 2AEMA 1P5HA 2GTHA 4Q1VA 4ZAXA 4AZWA 3LPDA 3FTEA 2I2BA 5HIMA 3V1KA 2RB5A 4X92A 1PG5A 2BH2A 1GV1A 2CZQA 3GLHB 3CQ9A 1E3MA 2IW1A 4JT8A 4PQEA 3T5CA 3PYLA 3QENA 4NE2A 3OAAA 4ZO6A 4JLSA 3FVVA 1AIPA 4ITUA 1MJNA 2MYTA 5JZ9A 1Z47A 5AVTA 4YRLA 4ZV9A 4WBNB 5FUWA 4PLCA 1S3GA 4XPZA 1KRXA 2GEUA 4WXRA 4TTSA 2M6KA 1JFFB 4A1OA 4D41A 1FNCA 1Y6GA 1GKKA 2Y6UA 3F5SA 2XBMA 2HX1A 4RZQA 4OOEA 1LF0A 1NI4B 1SPXA 5JZBA 5H9VA 1GCUA 1RXUA 1W59A 4BEBA 2ATCA 1KEUA 4S2EA 2HT1A 4L0CA 4RD0A 3V4OA 3BORA 1RQ2A 1WP4A 2UYHA 1F48A 1NLMA 3MWGA 3ZZ0A 1S3SA 4F86A 4AJHA 3HKCA 2ZK7A 1NF8A 2F3QA 3FNQA 3HSSA 2C57A 3LRXA 3LQ2A 5IFKA 4JBIA 4Q18A 1JXMA 2DWUA 1LVGA 1Y4SA 3E5HA 1OZHA 3K8YA 2Q07A 1XZ8A 3LPNA 2D74A 5IXJA 4KVAA 4GI7A 4WJZA 3C8DA 1JF8A 2VNJA 2AQ8A 1LVUA 2IPXA 1ZK3A 3ZLBA 4PNHA 4AJ9A 5CURA 1LC3A 3LNCA 3TW4A 3DXZA 1J39A 4FWBA 1MH9A 2BMAA 4H7HA 4ECAA 2X86A 1Y98A 4ZP1A 1DQNA 3UK0A 4FUTA 3T54A 3DP7A 2WRZA 2ZITA 3QWHA 4I5FA 1IZ0A 3R77A 4IDEA 4C4PA 5BRAA 4LC1A 5E7MA 1PV4A 5C9ZA 1GGVA 3BZUA 4BKPA 3X1WA 3L0CA 1WM1A 3BFVA 5ALLA 3PHLA 4MI3A 3TTYA 2YWJA 5REQB 1KSHA 1YJQA 4PG4A 2WFZA 2ODAA 3ZW8A 1ZJ6A 2BEVA 2XXAA 4XQCA 2UZ1A 4QDXA 1RHUA 3WLAA 3KQKA 2RAPA 2NSDA 5E38A 7MDHA 4TV9F 2HMTA 4ZTBA 4I1UA 4LVNA 4UE6A 5CDGA 2VEDA 2W8BA 1QHHB 4ZQFA 1US8A 1ELOA 3DFKA 1NUSA 3AFMA 4X5OA 1G4UR 1GLGA 1UZNA 2XOKD 3E27A 3GZTB 4N0EA 4TYNA 2J1LA 4LJ5A 2NU6B 2OHIA 5AIAA 5D01A 4PNPA 4O3FA 5DKFA 5K45A 3ZDFA 1LV7A 1L7XA 2H1LA 2VI5A 4YREA 1JEYA 2J3QA 4OK5A 1CR1A 3ABIA 3NIDB 2ZKLA 3O91A 4R5MA 1Q50A 4RVOA 3NPAA 1XP8A 2YWGA 3H5AA 1CJKC 3QTTA 3WBJA 5CLJA 1V4BA 3P0JA 3CX6A 3ZWAA 1IHDA 4CF3A 5BOSB 1IPFA 3BMNA 5CD1A 5AXCA 3ZV3A 3J81k 3CWCA 3T5GA 2XDAA 4UAGA 3N6XA 1B00A 1G63A 5ALJA 4YRJA 4ML3A 3BVPA 1D0SA 4C2BA 1YCDA 4EHFA 2OCLA 2NZ8A 1E63A 2HRQA 4F5WA 1II0A 1WP9A 4IV5A 2JFGA 2AKYA 2IP2A 5HE9A 5LQAA 4DPMA 5H70A 2FWAA 3K9CA 3S7ZA 2WHYA 3HBJA 1J0BA 3KDPA 4RK0A 1FLVA 2VPQA 2OVFA 1VG1A 2WU8A 3MBKA 7GPBA 2BKUA 1U90A 2BKEA 3ODPA 4MYSA 2OG2A 4NXNB 3L07A 5EL0A 4LRUA 1IUKA 4C7JA 3AXTA 5DISB 3AR3A 4IR7A 1ISPA 1LLUA 1V7ZA 1O95A 2ZRLA 2YIJA 5ALWA 2CJWA 1GKIA 4EHDA 1BS2A 3ZDDA 2PIAA 1GPJA 2POQX 2REXB 4LX8A 4NZNA 2FWMX 2DBQA 5DFAA 2MSDB 4MYUA 1B8NA 2GZSA 1KK0A 3IUMA 4BQOA 3OM9A 5TS3A 4ZZ1A 1Y9JA 1YCGA 1QWOA 3C8ZA 3PXAA 3OOJA 3SI7A 1JU9A 2XT9A 1R5NA 5ABPA 4DSTA 2QGZA 2JK0A 3KJNA 1XWWA 2HA0A 1JPJA 1IOWA 3QVSA 3ROQA 5CXQA 1FFSA 4FFSA 2IS2A 4CVNA 1EINA 2ZBUA 4LJ6A 1L5KA 3RANA 5C7OO 4IIHA 1PEYA 1TMGE 3KQLA 2D6FA 2YINC 1LSJA 1HFKA 4GF5A 3ZCSA 4ARCA 2WKSA 4YGYA 5EJMA 4BMSA 3VI3B 4BE7B 4D81A 2KB0A 3U7IA 4JN6B 2XAAA 3BTSA 2RGWA 1FL9A 4O3MA 5ER6A 2QZ4A 4JP3A 4TTPA 1JXAA 2Q5CA 3O75A 1W0KD 4DIUA 1JN0A 2VF2A 4G37A 4CG3A 2HIGA 821PA 1ISFA 3HDHA 1L1EA 2DUMA 3KZ1E 2ZW9A 4Q9LA 4KR7A 1T0HB 1D9XA 4JKOA 4EMTA 3GK3A 2ZJ0A 4FZ5A 4K1XA 1LY1A 1NSFA 2YYZA 3NFYA 4TS1A 4CRWB 4PHCA 1G41A 3IIEA 2ZB3A 3AWIA 1MT0A 3KLPX 2YZ7A 2Z95A 4H4DA 4RGVA 2HOQA 1U80A 2C77A 2N0SA 2WK1A 3ELUA 1LSOA 3INRA 1FNBA 1L9XA 4LSZA 4NRDA 4C0QC 1PK7A 4FBGA 3W6UA 3SY8A 1KR2A 4PZUA 2D0OB 1X77A 3AH8A 4WN3A 4GYKA 3FKSA 8LDHA 1MLDA 2HSJA 4Z53A 4TPKA 4QPZA 3N0RA 4G23A 1Z75A 3NEYA 2GNAA 4XXHA 5ENZA 2VHUA 5EGSA 2A9OA 4R7ZA 2GO1A 1A4XA 4AG3A 3OQIB 2HA5A 3CJQA 1F8UA 2QAIA 4N3GA 4ZKEA 2PWBA 1GM5A 3ETLA 3QLVA 2HC9A 3W4KA 4AZTA 3EA0A 1G3MA 2KYRA 4CBVA 4F4CA 3VDMA 3E7DA 1U1FA 4NC9A 4KO3S 1VPLA 4CCWA 3C6BA 4MVJD 2C9CA 3LO5A 1YSCA 1QYXA 3JQAB 4BX0A 3F6RA 2FDCA 1E6EA 4QFCA 2P5UA 1U11A 1N8TA 1BH6A 2E4VA 2V96A 3HCNA 4I55A 1MEEA 3K0FA 5DXAA 3RFVA 1YRQA 4KIJA 2I0FA 1ZH8A 1XAHA 4MICA 3C3DA 5FXMA 1AZSC 3Q5DA 1ZBDA 1URPA 1ZSYA 2X9VA 3L8DA 4QZVA 2BGMA 1CUGA 3NHBA 3ZW9A 3Q3EA 2XYGA 3T99A 2ZR9A 1IC6A 1QFZA 2YRFA 1WVMA 1YB7A 1NPYA 3JQBC 1UBCA 3QJ5A 1HNWB 2Q5IA 3RROA 1TIBA 1ZK2A 2IXFA 1Y6QA 4J4BA 1VMKA 2IYNA 2RBEA 3AF2A 4RK5A 4BAUA 5LQNA 2H2WA 4FX5A 3RG2A 1JPNA 4D7AA 3PPXA 1NJSA 1U7WA 2E37A 4R84A 5IC5A 3MS7A 3WRWA 4CXMA 3KV1A 1JKJA 2XMDA 1NV9A 1VG8A 3HHEA 2QPTA 4CCYA 4HVCA 1DBIA 2QJTA 2MYUA 3IT2A 1W5AA 4ER5A 4XSGA 5I8PA 1Q7TA 1M1YE 2BFEB 2Z2JA 2ZETA 5FUMA 2VQDA 1BFUA 3B1ZA 4EFLA 1U65A 4Y6SA 3JQFC 4OATA 5JDIC 3HJRA 3ZVNA 2LIPA 1FK8A 3HU2A 2WG2A 3VPHA 2I2AA 2B9EA 2PKXA 5F21A 1HNNA 4FCVA 3RWOA 4GYYA 3VR5D 4AZ3A 3WYAA 4C0KA 2HD4A 2NT4A 2VRCD 1MAAA 5CA0B 5DM4A 1W36B 5HIAA 3DA8A 2BN4A 2ZRGA 1OHHA 5EWLB 5E95A 1L7QA 3L0DA 5B6PA 4BU1A 5HUQA 4DB2A 1KJJA 2JASA 3MCTA 3RFXA 5JADA 2EBHX 1NKTA 1AMOA 1IEQA 5DTIA 5AO9A 4HUJA 2PGAA 3O1HB 3QA3E 5ALTA 4P6VF 1B16A 4PQGA 3OTGA 4Z4HA 1Z4PX 3KP1A 4QICA 3RAGA 1Q83A 1AHHA 3RM3A 3TPFA 2BHLA 3SHOA 4B79A 1JAHA 4IKOA 3NP9A 5AVWA 2D2FA 1FFCA 2PUDA 5JS1A 1QC5B 1W9HA 2G1KA 2KE5A 2QD1A 4I9UA 3ZS8A 4HYYA 3Q1KA 5I9MA 2WM2A 1RM4A 3LLCA 3DR3A 3OF2A 3CSDA 1W93A 1PJQA 2CL6X 3GGPA 3QFSA 3TVYA 1I33A 3O8NA 3Q8LA 4BFXA 1GZ5A 3AHEA 3NCTA 4AUNA 2H63A 2QMHA 2Q3DA 4PSDA 1QIMA 2OK8A 2HJVA 4N5IX 2NZYA 3HWSA 4KGXA 2WNSA 4KH0A 3DPSA 3SQXA 1ILWA 4WLNA 2L19A 3N1UA 4M7OA 1QTQA 1WEHA 1ZJZA 2B5WA 3F6SA 4RHUA 1DRVA 5T4HA 3JS5A 1VE7A 2QD5A 4QASA 3QW4B 4IJMA 4K87A 1MOQA 1VCIA 2P8SA 4N5HX 3PYMA 4EJSA 4L95C 2QUJA 3N8IA 2GK7A 1ZI8A 2ISQA 3E8SA 3OA0A 2IOFA 3PWTA 4I5GA 4WKCA 3L77A 2F1HA 3O4HA 2E6UX 3HCRA 3V9AA 3HY3A 2ZRNA 4TM8A 3RS3A 3UW3A 3R24A 1JQAA 4P4LA 3HKCB 2EHDA 2YJ4A 3P9KA 4BX2A 3CUWA 3HB1A 5DSXA 1EP1B 4BFSA 4M9ZA 5BMVF 3ORSA 1VBMA 4KO1S 1SZDA 3UMBA 3OO1A 3PVSA 4ZICA 4K81B 3NM4A 4B82A 4AUKA 3CZQA 5F5LA 1JG1A 3QOWA 3I0MA 2DYKA 1M2OA 1DPGA 3PRJA 1EP9A 4GPEA 4CIVA 2NQ2C 1GUBA 4F4IA 1JFSA 2BF4A 2EP8A 3CCCA 3QPUA 4F21A 3EQ7A 3WKDA 3RYFA 1L7BA 1OX5A 4N3CA 4DQDA 1XELA 1DVRA 4BVKA 3UAGA 3PNLA 3UTDA 4C21A 5CDSA 3VRHA 3VC2A 4BMOB 3T7TA 4LYFA 4KOEC 3H8JA 4HTFA 1GDDA 2GESA 4WDRA 4P83A 3P0RA 2VATA 3VR6A 2CVPA 4EHLA 3IIJA 1WMBA 2BHRA 2ERCA 3IDOA 4UQLA 1P2DA 5K8VA 1EIWA 1ICIA 4K6FA 1AZWA 4KVFA 4Y9DA 1XZNA 4K46A 5G0SA 3WWZA 2P6MA 5B6JA 1DCMA 3PQCA 4TVBA 1E1NA 3UG7A 4ZKDA 2XXAB 1SD5A 2BEVB 1D1TA 3NWEA 1RQGA 4XWWA 1V39A 2UZ1B 4RX1A 2FSIA 2JJQA 1HE1C 2Y0EA 2CHFA 3IC5A 2MJLA 4S1VA 5FTLA 1HLDA 1PCXA 2IBTA 2Y1GA 2D13A 2ZBGA 3U44A 1V7CA 4N9WA 4HYQA 1OI4A 4EKYA 1US8B 2RHOA 2D8MA 3S68A 1ADCA 2EATA 1YQ9A 2GNPA 1W75A 1GZDA 2CV0A 1DXQA 4FS8A 4HQLA 1JSRA 3FSGA 4GOJA 4PYRA 1XDZA 1FYFA 2C58A 3UMRA 1FP4A 3WISA 3PA8A 1E1CA 4K8OA 3PLNA 4Y2RA 1KGDA 4QC2A 4I1OA 4N41A 3OT5A 5FLEX 2HMAA 1QKJA 2OZLA 1NRIA 1NG9A 4DA7A 5J2UA 1Y8RB 1VC2A 2C3UA 5CNJA 1FLAA 3G0IA 3ROXA 1FE8A 4A10A 2X19A 5A2QA 1PFVA 1BMFD 1PK9A 2F64A 2Q9BA 2YBDA 3BMNB 4G1FA 4XR4A 1AUQA 4RK4A 5EEHA 2GJKA 1K5GA 4WLOA 1GRNA 1UFQA 3L82B 3ZG6A 4JYBA 4LSWA 4BFYA 4EPRA 1NKVA 5JAMA 1NW3A 3VX4A 4KRFA 3ONEA 3F3MA 3GD7A 5DIFA 4R9SA 2QHXA 2IWRA 2OYCA 4PGMA 3FOEC 1GPUA 3BHMA 4GG1A 3K09C 4FK8A 2PRIA 3HP1A 5I7OA 2RGEA 2Z1DA 2Z4TA 3REQA 5C46F 3PHGA 1OU4A 4QGFA 2D1FA 1PRYA 3HDTA 4GLOA 4ND4A 3AEXA 2GD2A 2QAGA 4XQ0A 4BNMA 4NBKA 3NAQA 4EOGA 5LA6F 1SUEA 3NV9A 3BE8A 5J4YA 3GRYA 1DFHA 4PC3A 4CV0A 3BXPA 4KO8A 3TLCA 2O07A 2K6GA 1QHEA 2CJWB 1PX2A 1UXJA 1E0AA 1RBYA 3VH1A 1AGPA 1IEXA 3FCAA 5AMXA 3ZXXA 1W88B 2O3TA 2XYQA 3EXG1 5GMOA 1XZAA 1DRJA 5AESA 2OCIA 5F4BA 1J7KA 4R0MA 1GGKA 1MORA 1T2FA 3IDFA 3ZGXA 3F7NA 2PX0A 1X1CA 1YIOA 3CLSC 4ZJPA 2O7NA 3QA9A 2GARA 5IAAA 3V8RA 2V4ZA 2QNRA 1IN4A 1U7TA 1IN6A 2JIQA 2QUZA 3A1CA 3T35A 4IOMA 4NH4A 3QIAA 1ZQ1A 2OP1A 3ZV6A 3DZJA 4JBWA 3P0IA 1FSPA 3A4TA 4GEGA 4Y67A 1NUHA 1MB4A 1WLYA 3KQNA 4BNJA 2CXQA 1YA4A 3NC0C 3CVUA 3WLFA 3KTDA 1WTAA 4IG4A 4ALMA 3TKYA 3DCJA 1TU4A 2V7PA 3B2NA 3L43A 5DGHA 4ALIA 4B4VA 1A69A 4CM4A 4YIKA 2XDQA 4E07A 2AJCA 3KSAC 1H4VB 1USKA 2XGMA 5AKIA 1ZUIA 2DCMA 3AU8A 2WZQA 2NTVA 3LVQE 2YC2C 2FUKA 5DNEA 5IVKA 2J0EA 3MAGA 3NCHA 4IG9A 1A5TA 2R4QA 2UZ3A 2XSZD 2ZE5A 3TX6A 5CEFA 1R12A 2ANCA 5FEMA 1JBEA 2O8FA 1MXFA 5DX8A 3TZCA 2VZLA 4J0GA 2FCRA 3A37A 1ZD9A 2FQYA 2A0YA 2D4HA 1J97A 4IX9A 3PC6A 1I1HA 4WJLA 1XKXA 2J6HA 3PFGA 4MR8A 1POXA 2XZPA 1CC1S 2YMPA 1PP4A 3OZTA 4FE7A 2IV3A 4BVJA 4DR6B 4KG7A 4O5OA 5ERXA 3BFKA 4ND1A 2HYIC 4DV7B 1CUEA 1MO3A 1GYQA 1LNSA 2Y67A 5D86A 4OHYA 3M5PA 2LUOA 2QX8A 1H2RS 3AHFA 1OX6A 2P2NA 3OC6A 1UOOA 2RI6A 4DR5B 3NHFA 1MX9A 4U9HS 3GWGA 4TLEA 3K94A 3LFUA 1BMDA 1XTUA 3PA6A 2JLSA 3I28A 4G0PA 5AOAA 1NFQA 1BDIA 1XQXA 4U2BA 3I9MA 3RJ9A 2JIOA 5JCPA 3QMPA 2GVZC 4TWZA 3PHJA 1ZMRA 4I55B 5IUKC 4C9BA 1TA4A 2EBUA 1T6ZA 3K0FB 1YU9A 3EZGA 4HWPA 4Z9YA 1O1YA 4C3ZA 5E3HA 1IZ8A 2CD7A 3IUNA 3KUXA 2PKCA 4IMPA 5ITVA 1NG1A 5JATA 4D4LA 4GT1A 4R9RA 3A70A 5F3WB 2VHCA 4AO8A 3LSTA 2NACA 3LQRA 4G85A 3U0BA 2VWPA 3STYA 1T3TA 2FSVA 1O6BA 2F00A 1WULS 2O2YA 5G4LA 4R2JA 3VZQA 3ZJUA 5IVPA 3RK1A 2WABA 4NY1A 4ZCSA 3IMFA 3F4LA 3Q6NA 3HJCA 4LZAA 4K8RB 4EHIA 1AS3A 1OI2A 1JKJB 2XUZA 2PLNA 4BWFB 5CHEA 4CCYB 3OD5A 4L5AA 4ER6A 1YDHA 2A4MA 1WOMA 1ZS9A 2VCEA 2Y1KA 4UNNA 4DJEC 4WLEA 4ZGGA 1TECE 4MVJA 1OAKA 5TQ2A 3QFFA 4YRRA 1PNVA 1RI1A 1TT5A 4YP0A 4FCWA 3AY0A 3P20A 1LBQA 1TC2A 2BUCA 2GPSA 4MUMA 5AKZA 3VKHA 4BO5A 1XCOA 2OHFA 4AZ3B 1XMVA 5DYIA 4EP1A 1MGPA 4L9AA 5LN1A 2PSDA 4JITA 4UJ5A 3RC2A 1DC8A 2AD5A 4BVAA 1B41A 2FN9A 4BGIA 4EZEA 9MHTA 2BEJA 1I7DA 4Z4CA 4ECEA 2PX6A 3LX4A 1WF3A 2JCGA 3SHWA 1L5QA 3UZUA 4N3NA 3MTGA 1E6UA 3K31A 2YNMD 2A2ZA 4B80A 3A10A 4HZGA 4YP5A 4KRXA 4F4JA 2RHGB 3R0JA 1NBWB 3EBLA 3ZCRA 1ZWKA 3WQRA 3VQTA 3KEOA 4YIHA 1EWVA 2FQWA 4CLEA 1HNXB 5AJUA 4ZAZA 2G8LA 5KEIA 4ZIRA 5BW4A 2BMEA 3AJ9A 5HM8A 4ES6A 1GPMA 2GM5A 2VH5R 1WB4A 1W4AA 2IOFK 3KB1A 3W1VA 2I1LA 4XPIA 2OSBA 4N5DA 1PJ3A 3DUFA 4M0PA 5KKCA 2BHNA 3C15C 1RQLA 2X3YA 1N34B 4Q5IA 3NW9A 5LD2B 2E5WA 3LUDA 3PGJA 4QFMA 4JWKA 1KSGA 1SUDA 3RYTC 4BQPA 3E4CA 1XZMA 4UDNA 3KKKA 1N5DA 1A2BA 2V45A 3LHSA 2VRCA 2JEOA 4KZKA 3TSWA 5LR6A 1UOPA 1XZPA 3H2GA 3EE6A 4IHJB 3HGTA 2H17A 1EB9A 4GZMA 1KI7A 3T5AA 2I91A 1X1QA 1N6IA 1T2CA 4EW1A 2BVNA 5KU1A 4HAIA 1IUPA 1MOPA 2OV6A 2QMEA 2NZVG 1IBLB 2QUHA 4LE0A 3RVBA 4G5YA 2H11A 4MZXA 2TRSB 2V7EA 2VXYA 4OQEA 5LBTA 3QXCA 4BFWA 3L6CA 1VIDA 4IH9A 4CL0A 1XD2A 5ALUA 3RARA 3ZQ4A 1W6RA 1TA0A 2X1MA 3V4RA 1QORA 1M6EX 3E61A 4H7JA 5FOTA 4ZVTA 1CU1A 3CEHA 3UK1A 3LWDA 1KI3A 1L8LA 4ZU6X 1SU6A 5T41A 1HRKA 1TZCA 1GYPA 1YULA 1YZYA 4LXHA 1IOZA 2JFBA 5E9QA 1RWPA 1H1LA 2H2AA 3U31A 4NEGA 1NU6A 5L45A 3BUSA 3QELA 1SC4A 2D2XA 1CF9A 5KYWA 3HDYA 1E3LA 2YXPX 4V3BA 3CUEF 3C85A 1KK3A 4BNYA 4F06A 4XWOA 1Y6RA 3RYFB 2A5JA 1IXYA 3AVTA 2B98A 3KAKA 3C5HA 5IWCA 1AE1A 2IDZA 4IXNA 4ARIA 3AO0B 5IHPA 4D5EA 3LCJA 3UXHA 2OUIA 3PFWO 3I5MA 3JD1A 4MS4A 4LY9A 2JLRA 1NUAA 4CM5A 4P4TA 4BQIA 1FW6A 3C3BA 3NHUA 4HTFB 2NXEA 3DLTA 3HEAA 2GFHA 2BE9A 2B8EA 4K6GA 4NZMA 2CLCX 3SIXA 3F1KA 4ZU3A 3BZBA 5JAHA 2FX5A 1EFHA 3K9WA 4X24A 4IMJB 3TDKA 3F8WA 4ESOA 3DVQX 1DIOB 3F6BX 5TT1A 4V0OA 4LYDA 1KARA 4JT2A 3D5TA 3VYWA 1U1EA 3AI7A 1ZBQA 3DXXA 3OE4A 3AETA 1SBQA 3BB3A 4F96A 2HK6A 2GO7A 2J3LA 4JB2A 2XB9A 3BJRA 4LDZA 2OO5A 4LE2A 2CLEB 4URHA 5CVEA 1R3UA 3U39A 5MN4A 5B7PA 4N0QA 3LOUA 3O73A 3ZV7A 1PJZA 4YO8A 3TUZC 3NU1A 2ZJ7A 1FP4B 1NT2A 1E1CB 1N8KA 4K9QA 4MWDA 1D7OA 5HF6A 4I9HA 1QVAA 4E08A 4UEQA 1SHUX 5PGMA 1U9ZA 4XCVA 1UDAA 2OZLB 3ESBA 3M5DA 3SJBA 2QVYX 3GRUA 3MMNA 4D9KA 5MFZA 2RMKA 4JYCA 3V97A 3M3DA 4J2OA 1CT9A 1YXMA 3Q72A 3EGWA 2I3AA 4MVJG 4NCHA 1SRRA 2YV2A 3K35A 3K1TA 2VS1A 4ERNA 2YYYA 1NW5A 1NBHA 4QPDA 2ISSD 3QQPA 4KPYA 4XWGA 2OCBA 1EX7A 1HYBA 5TC4A 1N0WA 4IXTA 3MS2A 1YU6A 1RJDA 1VJ0A 4Y6OA 1DQPA 3INGA 4R1LA 4GX0A 3E3NA 4MHOA 5K6AC 4K6CA 4LJYA 2P30A 2Q3BA 3COPA 1TXGA 2HCJB 3LLUA 4X85A 3C3MA 3B51X 2QAGB 4IHAA 2DUUA 1UP7A 3T1TA 1E6LA 4D8UA 3PIRA 3QXHA 2OY0A 2P9GA 2EP7A 1SBZA 2AUNA 1P4AA 4FR5A 3VNRA 2XT6A 3R7WA 1XJQA 3B8HA 3NHAA 2BTQB 4NIMA 1L7AA 1ZD4A 4PPYA 3FYUC 4FNMA 4MW6A 4Y2UA 3TW6A 2G5TA 4B0PA 1E2QA 3UMYA 2WJYA 3CX4A 4MI1A 3E9ZA 1FC0A 3GP3A 2C5HA 3AJRA 4KJZA 1P61B 1XYVA 1G59A 2DFLA 4HDMA 4KE6A 4ZQBA 1DX9A 3F6YA 3WV5A 4AJPA 5KWVA 2NPOA 2ZQYA 2HIMA 4S35A 3QTLA 1K3FA 1B0ZA 2IPNA 3KZCA 4P08A 1CVRA 2VQ3A 2RHHA 1BWSA 2Y77A 4RH1A 1U3GA 2NO4A 3GDWA 5DGDA 2YDXA 1SOAA 4DLKA 3F8TA 1K4MA 1VGRA 2UXCB 1MC4A 1RRCA 2FTKE 1IRXA 4MV0A 5KVVA 2ZJBA 3WZLA 1YK0A 1J2JA 5ALRA 2FF7A 1OXMA 4R1OA 1U7HA 4KMMA 4OXIA 4NCNA 4Q9IA 4Z86A 5IZCC 1GL6A 1DRKA 4XB2A 3R7LA 1P0CA 3UEOA 2DPHA 3OQNA 4QXQA 4CM4B 4AP5A 4IMRA 3IPAA 3K6RA 4GOOD 1FSZA 1EK6A 1GG2A 2ZATA 2VXOA 3Q0EA 4X64B 3VU9A 4AZVA 1NA5A 4EUSA 1D1PA 4YCCA 3HV2A 3NUGA 4W7SA 3OU7A 3GLIA 3BULA 2EZ8A 4MARA 2CSUA 4BJ6A 3L1IA 5LXTA 4MV8A 2E3JA 4Z2YA 1Y63A 5C8YA 4LXXA 1R6AA 2XCIA 4UATA 3HM2A 1A8HA 1MO5A 3W8RA 1U2DC 1WDTA 2PKWA 2QN6A 1PNOA 4GX2A 4M98A 2FLVA 4LXGA 1U2PA 2DY0A 3ADDA 4ONEA 2FUNB 2V9ZA 2FDXA 4XUCA 4DLLA 2JFQA 3LXUX 4EB8A 4MR8B 1ZKMA 2RGAA 1MRNA 2J7PD 1Q1ZA 5IVIA 2JBHA 1T5BA 1ID1A 4COOA 2PUTA 2F8MA 4W5JA 3TF5A 3LIPA 3R5FA 5JYCA 2CXHA 4EH1A 1HSZA 1XZBA 3K7EA 1NHGA 1IXKA 1P74A 1QZUA 3HG7A 4JMPA 1B14A 5EGNA 2VDVE 4OQLA 1Q1EA 5B57C 3VKUA 4TZ6A 3AEYA 3CHYA 4NBSA 3NVDA 3ZJVA 2IYWA 4HMQA 4GQIA 2XOXA 2YV3A 2O2CA 4GXRA 3PPVA 4LOKA 5EMJA 3V4VB 1SOUA 4G9EA 3WNVA 5C1DA 5FI1B 1X19A 1TM1E 4IDBA 1CRQA 3SHQA 3ZLTA 4DA4A 3TL6A 4NCBA 2GF9A 6GPBA 3V6LA 1BRMA 3QUQA 1PZEA 2YQ4A 2DBZA 2XSZA 1XMXA 3GUZA 2PLAA 5KOYA 5C53B 4RTPA 5A4FS 2AW5A 1XD8A 3QF7A 5AI4A 3UMVA 4LY0A 4D4MA 2R85A 2QXUA 5G0WA 5H3CA 2PSSA 4D6PA 1N1GA 4W5WA 4B3GA 4D5GA 3MUNA 3M4NA 2DHQA 2ZI5A 3PUVA 2I1VB 1AKMA 1UK6A 1WUTA 3AUTA 1YI1A 4R68A 4UNPA 3V8EA 2XBUA 5LNK6 2Y9PB 3RUFA 2M32A 2LIVA 3WO1A 1R64A 1S02A 1ZGBA 3TNLA 3C8MA 2WSSD 5C5IA 1HK7A 3N28A 1J6UA 3ZU5A 5AQEA 1UM9A 2JGDA 1IN5A 1FSFA 1V41E 4CDNA 4HSGA 4KSCA 4I50A 5SY9A 3G9ZA 4MWGA 3OZDA 2Q7DA 2HDNB 2H4HA 1DX6A 3QUBA 4MUGA 1RD4A 4MHSA 4WAUA 2FW7A 1VKZA 1Y3FE 5TQ2B 1RQPA 2QLFA 3RYHA 4GAEA 4L57A 2A1TR 3JZDA 5DBIA 3KKMA 1TT5B 4DS3A 5IMSA 4C4YA 5JQWA 3DMGA 1FBNA 4Q37A 4QGHA 1BCRA 2OZVA 3EVNA 4JXJA 2AE1A 3PSAA 4IF6A 5IANA 1GGJA 3QE2A 4YCDA 1L8AA 2Q1UA 3V8BA 3BJIC 2P6OA 2IH5A 3DE4X 5KCMA 1KAEA 1N5RA 4HRXA 2XIQA 4II3A 5JWHA 2I67A 5A4KA 5BQ5A 5DCLA 1KZ4A 4I4TA 5B37A 3OQVA 4JJIA 2GXSA 3ZLVA 3DAFA 1WBJB 2YIMA 1ZPDA 2QU8A 1WKCA 3OQHA 4P92A 3JATA 4HYTA 4E7OA 3KVNA 5BSKA 2H59A 3N3AC 2FEMA 2M6LA 1PHPA 4LE1A 2M2IA 1D4FA 3TLXA 1ZZEA 2G06A 2I6GA 3PXEA 4RD6A 4ZIRB 2RE8A 1HA3A 2K2QB 1OFVA 1ZH2A 4HATA 5CNIA 5DO9A 5KVSA 3UNXA 3KXPA 4QLBA 1IZZA 4KEAA 1LRKA 2A5FA 4XPIB 2JHPA 3Q0IA 4L5BA 1SUBA 4G5GA 1GUAA 1CYEA 4B3MB 2WT4A 4QHTA 5FJIA 4ZD6A 2AJDA 2I4LA 1R5JA 3UXYA 1A77A 3W6OA 3JQPA 4UEKA 1ESNA 5FI5A 4MUAA 4DA8A 2NO9A 5LYJA 4DPKA 3GRZA 3KQTA 2XX3A 1P29A 1C9EA 1TCUA 3CKYA 3MWJA 1L5OA 3FR8A 5ED0A 3GJ4A 1PNRA 4QLAA 4F9EA 1TM4E 1QDEA 2O05A 5ALVA 2Q4RA 3S8YA 2QUBA 3A9CA 5I7WA 3TLZA 1KS2A 1ZOPA 3TLEA 4WFJA 3KKLA 2WI8A 3F5MA 3H9BA 4UEOA 1DZ3A 2JI6A 1XD2B 4QARA 2GEDA 2JJMA 2WKQA 3AM5A 3BGDA 4CLHA 3OX3A 4EG4A 2I66A 1P1CA 3GJZA 1NULA 1G21A 1YJ5A 1RYDA 1VDZA 4CM7A 2PQ6A 3SMQA 3NHZA 3N2NA 3G1TA 2E0IA 1H1LB 3T7KA 1XCJA 4U2DA 1RADA 3IQFA 2UZIR 2CEAA 2GBGA 1PGQA 3P0HA 2Q5EA 3QELB 4YO7A 1WB6A 3ORHA 3WVNA 1ODFA 2Z9BA 1YI8A 3HA5A 1SVLA 3JVIA 1EUZA 3FBTA 4B46A 4F46A 1Z4MA 2I65A 2XF2A 3T38A 3VSBA 3EUFA 4KN8A 1JTVA 4NYJR 2HF8A 5BT8A 2VDWA 2MSLA 3DMTA 1ULTA 4O4JF 3EFHA 3H11A 5HNKA 4WVFA 2TMYA 1E2HA 2VQ6A 4IIJF 1LV8A 1WV1A 4MS4B 3WP0A 4L4RA 4RMHA 1FX0A 4TQUS 3A3OA 5DHTA 3GIDA 5GY7A 4J3NA 5G2OA 2DSTA 3V3KA 1SZCA 2GZAA 4TLLB 4Z9AA 3ZPXA 3MT9A 1TUBA 1V8FA 5LZ4A 2VDNB 3M5WA 3NIGB 5GQSA 3QBDA 5ILQA 4N3AA 3V7FA 2AXPA 2WV9A 1LI7A 2R6ZA 5IBPA 4MA0A 4HAVA 9LDBA 1E2NA 4I5EA 1GZ3A 2AMFA 4WH0A 4BLPA 4CHGA 2VTBB 4F2GA 1ESEA 4MVWA 3U9SA 4LMPA 3ED5A 3TTWA 4G1MB 4F4FA 1DKUA 2HPVA 1EXDA 4XVQA 3HHPA 2C1XA 2GJ9A 3AETB 2EG9A 3DJYA 4CQNA 1O9HA 3KX2A 1UMBA 1P3JA 2B36A 3QU2A 1C0KA 1MW9X 5EIEA 3KEMA 1M1XB 3L04A 1XU9A 1Q3TA 3SJAA 3AF1A 3HXPA 3MWEA 4FGSA 4EA6A 1D1QA 3VO8A 2D3TA 3W6PA 4A6PA 1M6WA 1PJ8A 1AM4D 3LWBA 4RZUA 2HZBA 2Y1DA 1FRNA 1ULBA 1DGQA 1I0ZA 5HOQA 3B1YA 1FVFA 2AZDA 2Q9CA 3PG5A 4LA4A 3ZDZB 3RC7A 5FV4A 1HYHA 2HJSA 4WESA 3H5LA 3PJGA 1YE8A 2Q29A 2V6BA 4ZYXA 2XA2A 1CJUC 2JC3A 3OHPA 3TQRA 1QYIA 2RGBA 2ZPUA 5FAXA 2WWIA 2XUIA 5CBPA 2X0NA 1NVGA 1ZO8A 1I36A 3ZDQA 1XAGA 3ABRB 4WGGA 3K6SA 4G97A 4N5NA 2AG5A 1OVGA 3H1AA 3IRUA 1PJCA 3KL2A 3A4MA 4JUIA 1S3IA 4JLJA 1PTKA 2NOAA 4ROTA 2QTNA 3VR4D 3L0PA 4BO8A 3HCCA 1CIVA 3FNIA 4CKWB 1KBOA 1UKEA 2H54A 2JCXA 3FMOB 4QUBA 3ECAA 1W25A 4D2IA 4U0JA 2RHLA 1BHO1 4NV3A 3O0TA 1PJBA 2CF6A 5DIZA 3ZDYB 5E1BA 5ADWA 3IHKA 2IYPA 1E8DA 3NO4A 3H9EO 2PKQO 3HCWA 4MEAA 4OHOA 4RQTA 1TF2A 4XLZA 3R7WB 4DEXA 2F67A 1ZVJA 2Q0HA 4WVLA 3EHDA 5AFSA 4YRQA 2LTAA 3EMKA 4HSEA 2Z43A 3PBKA 3GWZA 4TMWA 3EAQA 3OY7A 5BWMA 4AFNA 3KALA 5JALA 2HLDA 4O2AF 1XKTA 3NAMA 4HDMB 4MTCA 1XI2A 4EKDA 4OHBA 2O2XA 1TUIA 5SICE 2IE8A 5EI5A 1U3VA 2O06A 1T9AA 3BK2A 3GPIA 4F85A 4G1UC 3SKVA 3EISA 4XM0A 5DPMA 3D7KA 2V7GA 2H00A 3DBRA 4GGPA 4IJQA 4EATA 2X6RA 2IP1A 1SC9A 2QBYA 1W7AA 1KR5A 4TKVA 3NDRA 1G5QA 1C0EA 3PFIA 3VYVA 2RGNC 1HZZA 1UOQA 1JQ5A 1QWSA 5ICCA 1LKZA 3MT8A 1KVTA 3DT8A 3JQRA 1GRVA 2H2HA 5IDXA 3QU4A 4LXIA 1SXJD 3DR5A 3PHIA 4OSPA 4XDYA 2F8SA 2W2OA 1NOIA 2P9TA 1KHHA 3F0TA 4WA8A 3WIVA 1XZIA 3VU9B 4E7PA 1XVUA 1Y7TA 4KX5A 1QF6A 3GLIB 2GGSA 4QUGA 1Q1QA 2CT8A 4E51A 1XMQB 4G5SA 4MUIA 5C34B 2IUSA 4UMFA 3LWNA 1KPIA 2JI4A 2XADA 3K9BA 4HHEA 3SJ7A 5JR3A 1IBCA 1RZRD 3G82C 3PXCX 4RH0A 1D6NA 1A8PA 2AC7A 3H6HA 2LP4Y 2AF4C 5HRAA 4MKFA 1DEHA 3TIVA 5FLXA 1O57A 1WSDA 4X84A 4DHWA 1E6KA 3M9XA 3B6KA 4HGPA 3SEFA 4LRXA 4PZEA 4JI6B 5JXIA 1BQ3A 1ENOA 4CIAA 3HADA 2RK4A 4FW8A 3DVLA 1QMGA 3Q9LA 1INLA 3OIWA 2FZEA 4Z3DA 3U3ZA 1GAQA 4P38A 1K2WA 4L73A 3L92A 3LQFA 3P2JA 5E4JA 5ECGC 3DHYA 5TGDA 2Q45A 2X0DA 4QTUB 3ZLUA 2P1ZA 5JJBA 5DCYA 3PUKA 3BRCA 1CQZA 1Q1NA 1WUKS 1XNQB 4U39A 1LFAA 1QXSA 3KT8A 1H42A 1KY3A 4REQA 1Q44A 4BO3A 1TJNA 4L0MA 2VQFB 1JR6A 1BN6A 3HKBA 4EY6A 1XXHA 3NBUA 5GONF 3EDOA 1JU3A 2OOKA 4A3SA 2FR8A 2BFPA 3VKVA 4CF4A 3EZFA 2AE2A 2A67A 3L7JA 4MVXA 4FMBB 4AN4A 4DA0A 3WOVA 2VT7A 2QTVB 2KSQA 2OYRA 5BURA 1I2MA 2AMVA 3USCS 4JOCA 4J1TC 5ICMA 1EWYA 5TGTA 3QZUA 3IE1A 1ZJ4A 2HBQA 4N0PA 4FMPA 3D6TB 4M1EA 3WGOA 4IXWA 5K5EA 3EGDA 2N75A 1P39A 4LZWA 3GVPA 4RMJA 3F3YA 2CDRA 2IYEA 3ZQ6A 2CLDX 1M34A 3UJ8A 1JW9B 7MHTA 3OETA 4ZCPA 3DEHA 4RANA 1T5LA 1KVSA 3GRFA 4RDCA 3RV4A 1UM9B 2JGDB 4B5KA 1B73A 3EFBA 3H9UA 3FLAA 3AUFA 3HCDA 3GRCA 4I50B 3FNBA 1F2UA 3M9WA 1P2VA 1A76A 1G1AA 3GG2A 4A1FA 4OM8A 3ZZMA 1T0PA 2DJIA 3K5PA 4A0FA 4BBAA 2OBMA 4Z54A 3NAGA 4RKFA 5DM0A 2QVLA 5DI3A 4U7TB 3RYHB 4E70A 1QGZA 4JJKA 1IULA 3WMRA 3ZGZA 4DXHA 2C4VA 2FN3A 1QR2A 1SVUA 2J08A 4WXHA 3E1SA 1Z7EA 3CU5A 1BCRB 4LSGA 4Y2VA 5HZMA 1K8YB 4Z0TA 2C9YA 4GQAA 4JVSB 2Q2QA 3GRAA 5AKHA 3IYLW 1Z36A 3SC2B 1Y80A 4HDKA 3ROZA 4DYHA 3C87A 1Z5OA 1CIPA 3H2JA 5KNDH 4I4TB 3MLEA 1T8PA 1SB8A 1WDKA 3GFBA 1KVRA 5A5EA 3H42B 2PV0A 4GE0A 1CRPA 1FOEB 1H8HD 4MWSA 1KDTA 3JATB 2PY6A 1A72A 4L7VA 4R1NA 1MQ8B 4PHGA 5CB4F 3EUAA 1L7PA 3M6FA 3DDUA 5INTA 3ZY6A 2IS1A 2HHJA 4RCZA 5JJCA 2YS7A 5G40A 4YLYA 2AN5A 5KO2A 4G0UA 3V8NA 1P3DA 2IZ7A 4PF1A 2LCIA 4WNYA 2VBFA 1JBKA 3N39C 1VL5A 5FOXA 4YCAA 3SIWA 4DMFA 1P45A 4HOYA 4I7EA 4LVCA 4XDZA 5KWIA 3D2BA 1EUQA 4MI6A 2P2YA 4JI1B 1VM6A 3SSMA 1ND5A 2ZIEA 5M34A 2PH1A 1CW2B 4GWKA 4KUGA 1TYCA 5FL7D 4C4XA 4RVCA 4S1WA 2ISCA 1B6GA 4YAFA 3H17A 3RUAA 3QYJA 4JJZA 2G1UA 4ZVOA 1HDOA 2BLLA 4MKIA 1HQCA 3JQGA 4PN7A 3Q11A 5CG2A 1BE1A 1ISRA 2O8CA 3UXEA 4WZAE 1AK2A 3L49A 4X3PA 3JU3A 3RSSA 3TTXA 3ZDBA 2VTDA 4QGBA 4UZFA 1CP2A 1E9EA 1X7XA 1MAWA 2HYDA 3I2KA 3LBHA 3DKRA 3RFFA 5F5XA 5AVJA 3THSA 1E7MA 2Q8QA 2VPWA 1JDSA 3ENZA 3H1EA 2HV8A 4FKMA 5KOJA 2JAXA 4PAGA 4IQGA 1VJRA 3DZBA 5JTTA 3T41A 3ECCA 3BEDA 3PFFA 1BVYF 1XZFA 4H1UA 4HWTA 3UCFA 3PS9A 2GKSA 1F0YA 1G21B 3BD7A 3GV0A 5DV9A 1RWWA 2HI0A 4UZEA 4ALJA 3KB8A 3I04M 2YWRA 2WJ4A 3G7UA 3INYA 4KQ6A 1WU8A 3T7JA 4ALKA 1R9NA 4EJ0A 4JNCA 2OCAA 3PUYA 3TD2A 3U62A 5CTJA 2ASEA 4DQ0A 1PBNA 4RF2A 5H3LA 5L4NA 3OZEA 1QJ4A 4IIYA 1DO2A 3TZHA 4WOBA 1KP3A 2X0EA 2BM8A 3THRA 1FYEA 2IKQA 4S04A 2ZULA 1PZGA 3K3PA 2P7HA 4QLOA 2R47A 3HCPA 3I4LA 4CM3A 3MTAA 2VDWB 2C8VA 1IG0A 4EJFA 3K0BA 2FFBA 3H11B 5L4SA 3JQCA 3RYIA 2HMSA 3RRBA 2AVNA 2J9GA 4OKNA 4ABTA 4EGCB 4GL4A 2CLKB 3EVTA 1FX0B 3FPKA 4Q4AA 1CF2O 3VUEA 1N2SA 4EPVA 3D64A 1XP5A 3DOJA 1R8XA 5EMNA 4GUDA 3TI9A 2C4WA 2QN8A 4ZI3A 2W6OA 1HLGA 4F5DA 1QDLB 4UM5A 5HTKA 4GRDA 1TUBB 4GW3A 4UU1A 1KZHA 5IKMA 3FJOA 4QXOA 2WD8A 4QGSA 3MYRA 1W4RA 1GXSA 1Y9AA 2QI9F 4JAVC 2NO0A 3MAAC 3RFUA 1QRUA 1Q15A 3QPAA 4AU1A 2IIQA 1I3MA 2KMLA 3IOYA 4US1R 3RFCA 1GEEA 1IEWA 3KZVA 3R3VA 3RK0A 3UWDA 5JD4A 3HUUA 3NOVA 4HGYA 3OJ0A 1NL3A 2IYRA 1N6RA 3K70D 3D6HA 4DZZA 4XIGS 1UMBB 4R6XA 4B3HA 2ZRBA 2Y1OA 5EESA 5H68A 3DB1A 4HNGA 3TH5A 3EW9A 3UKDA 3ZY4A 1B4DA 4B6SA 1FMCA 2Q2OA 5JZOA 2M1XA 1A04A 2CZGA 2WSIA 1YQTA 4L3OA 4ZOQI 5H81A 4WBNF 5AVVA 5I5EA 1YKSA 2XMSA 1DQYA 3N86A 5CT4A 2YBEA 2J41A 3OZWA 5IBQA 1NW8A 4AW9A 1F4LA 4V24A 1ZOSA 3EOAI 4V38A 4ZAGA 2O7RA 2WMNB 4WESB 3ONWA 4P7BA 3QLUC 2R6CA 1Z56C 1OF1A 2FFQA 3HXLA 4RVHA 2HGSA 4EYOA 2C4UA 3KWLA 5CBPB 4XYLA 3R0VA 1GN8A 1DJMA 4EB6A 5DHSA 3K6SB 1RE1A 3I37X 4NX2A 5GPBA 2O54A 3P4YA 4DNPA 3U56A 3LU1A 1WIWA 1XFDA 4ZEXA 4E5PA 1OMOA 1CQXA 3BFPA 1KO1A 3O8CA 1LF5A 1X14A 4R71A 2VAXA 1FF9A 4LC9A 1QV6A 1VYVA 1XJWA 1Z4JA 5JFOA 1CY2A 1MFZA 2B5VA 4ENUA 1Q1BA 2EV9A 2EWWA 1LTQA 2WIBA 3THXA 1RM5A 3IDZA 4J7CA 4DZTA 5H5JA 1Q0TA 3TDNA 1G5PA 1RYYA 1G9SA 1NM5A 1YD7A 1HEYA 1YNSA 3ABZA 4QDOA 3Q9NA 4AZ0A 5E6SA 2CMFA 3IA7A 3ONFA 1RYEA 5BSWA 1JLLA 5EUQB 1LH0A 2ATVA 3HFSA 1XTRA 3I9KA 3B8EA 1RLIA 3QVLA 1ZW6A 1FUYB 3HB7A 3R3SA 2FMFA 1R88A 4FGKA 1SEPA 2CUZA 3WADA 4DM4A 3UUWA 1SQFA 1WD7A 1LPSA 2AKEA 121PA 4M46A 3EAFA 1ECFA 4BQSA 2BKAA 2NX2A 2OM6A 5IC6A 4FFLA 3Q7RA 4UFNA 2EARA 4HNSA 1S6YA 4YEDA 3DBRB 2V54A 3ZGYA 2TMKA 3CRRA 5FA6A 4WKBA 3RVQA 1T8SA 5EJ4A 5JO0A 3ZY2A 2QBYB 4J4TA 4TQAA 5DXJA 2AX4A 4DV2B 4EA8A 2V0GA 1WVGA 4JC4A 1FYVA 1RAFA 3D7NA 4WN9A 1JE1A 3O9ZA 2GYYA 1GG8A 1CUFA 3A4IA 4Q7JB 4RM2A 1UQRA 4E33A 2C78A 1NNI1 4LDRA 5IBCA 4Q9JA 3MJHA 4KH1A 2AFHE 1XPOA 2FMKA 1VBFA 4JLVA 4KQCA 4ZC8A 4RD2A 1HC7A 2O3UA 2VO1A 3CLHA 4IO0A 1Z5WA 1FRZA 4Q1CA 4FX2A 5KDOA 1GCAA 1R0WA 2QRQA 4R1SA 5DTRA 1WBBA 1U1CA 1ZL0A 1QPBA 2P1RA 1X7GA 4H7EA 1TJ4A 1ZR4A 1NMXA 1YHNA 1PLLA 2OWEA 3D4OA 3CUKA 3CB2A 1IM8A 2V7TA 4JI7B 2OMEA 5HIIA 2ZREA 3AILA 4BFCA 4WLFA 4LHVA 2O0JA 4NJEA 2FG6C 4DT1A 3A32A 3THOA 1MAHA 1OXTA 1QB8A 4MRNA 3W2EA 2XGOA 3JAMA 1HE5A 1Q6ZA 1FTGA 1Z28A 2MMGA 3HBLA 1EGMB 3OZRA 4DLPA 4FD2A 4OAOA 4PIMA 3ECSA 1HEUA 4RY8A 4N6NA 1F1JA 4LN1A 1C9NA 2ZXEA 1YRBA 2CXSA 2IZ6A 2JLAA 1W94A 2RIPA 3PQ4A 3QKSB 4OAQA 4REQB 4NI5A 2CFOA 3HKBB 1MX5A 1XXHB 5CR9A 5LCXA 3UHPA 1WU7A 1XZHA 3KTAA 3IULA 1JZSA 4Y18A 2Z1MA 1CQPA 3WWCA 3NRJA 3RNOA 4IQFA 5ILOA 5DX1A 1PQWA 3O95A 4K9LA 1C8VB 1HQYE 4N5MA 4DXAA 1G42A 2DR0A 2GBIA 2JVIA 2Z83A 2WP0A 1GUFA 2LKCA 3DC2A 1A4RA 1THZA 3BPSA 1Z6PA 1SVMA 2P9EA 4QDTA 3QI2A 3U6BA 2PUGA 1MNAA 4BVEA 3LUAA 3CM0A 1MO4A 3FPJA 1EWQA 1N9ZA 3EGDB 3JV7A 4MGYR 2OXIA 2A78A 4URZR 3L18A 2BFMA 3COYA 3QYFA 5CGZA 1M0SA 1M34B 5D85A 5DSZA 4DKXA 2AX3A 3LVBA 4G8CA 1TKRA 5IUJC 2J3HA 1ECJA 3BKXA 4A2WA 2ZTSA 2VYVA 3VPDA 4NENA 4DV4B 3V7WA 5D51S 3GYGA 4HNHA 4IEFB 2Q3LA 3OZVA 4WXMA 4C78A 1F2UB 1ZOLA 3COVA 2R8OA 5F2EA 5F2OA 1M74A 3CG4A 1OFIA 2ZUSA 1Z37A 4M89A 1JIXA 5DLPA 4MHTA 4KFRA 5DI3B 3W2HA 4BNGA 1JP7A 3R7NA 3LCRA 2X4IA 4BP1A 1XZLA 1KI8A 1OI3A 4MUNA 4JYAB 2H1CA 5JCOA 1JFTA 4JI8B 5AW3A 5CG1A 2H5IA 2RI0A 2QXYA 3KZXA 3PJEA 4N8EA 3DWEX 2AR7A 1ZJ5A 1WPXA 4HDKB 3IOBA 2XVXA 1HZJA 1NNUA 1C0LA 2XA1A 3O2SB 3VOSA 2YWFA 3DHVA 5THQA 1DZIA 4DLBA 2EIHA 3I76A 3WRYC 3LTNC 4MVJE 4RD4A 3KS9A 3SQOA 1M0EA 3K6JA 3KEQA 1OH6A 1ZAKA 1ADBA 1G9TA 5G3ZA 1L7RA 4XTRA 2QENA 3INTA 5EINA 3V1MA 4OMCA 4KYUA 1BXRA 3LQKA 4H7IA 5JJIA 2IELA 3FMPB 3CWQA 3HB5X 4Q9NA 3PC8C 3S8MA 4LHZA 4Y9RA 2HB6A 4GVXA 3PF8A 3GJXC 1W35A 1RU3A 3RSCA 4TOIA 1XVIA 3DBVO 2OCPA 1SH7A 2AT1A 3DMNA 3HABA 4TYPA 1AQJA 5IKOA 2HRRA 2FPGA 2Q4DA 1EFCA 1TAHA 3R6LA 1RPZA 1CQWA 4FINA 1E3QA 3T4XA 3JQGB 3EHEA 4EO9A 5C8DA 2O8CB 2UDPA 2ZSFA 2BAGA 2F9MA 5D7BA 4FYKA 3PJRA 3K2BA 1OR8A 2PSEA 4LI0A 3VOBA 2FE1A 1CDOA 4YONB 3HWWA 1JSXA 1JH8A 1H8HA 1GZ7A 1G4HA 1CHDA 1A9TA 5JAQA 3ZWPA 1UAGA 1OCEA 3ZCPA 3CCBA 1X94A 2WJIA 5KOJB 2CL5A 4GC5A 2JD0A 1NOJA 4KQMA 2R1ZA 2ZI7A 5A6VA 1H2BA 4NJOA 4P84A 5CVUA 4YDQA 1L4BA 1KFKB 3LAWA 1ZIYA 3B70A 4U3JA 3HVRA 3GZNA 3KKPA 4IO1A 4S3MA 1NC3A 3RRZA 1IJBA 4E09A 2O19A 1P33A 2AG8A 3GJ0A 4N01A 3LXMA 2Q49A 5I45A 5IASA 4YJ2A 3VO1A 5AW9A 5HS4A 2Z2XA 4JOSA 3JYQA 4WNCA 4JIMA 1Z06A 1JIVA 3GMIA 4JX8A 3UPDA 3P9NA 4Z9BA 1YA6A 4LOIA 2EL9A 2WDZA 1CVLA 2DWOA 3K20A 1FQKA 2YIVX 4CNQA 4GR9A 1MDBA 2QRZA 4EZIA 2Q4EA 1TJ3A 3TO5A 3P9CA 2ON6A 1M67A 3ZVLA 1VCHA 1A2QA 3C98A 3NATA 4NK5A 4A92A 4YMWA 3NNSA 3K1AB 3OX4A 4JGBA 4FYJA 1R0RE 2OBYA 5EQJB 5CA0F 2ODQA 2GI4A 2WNHA 3RYIB 2HWXA 2XXBA 1G6Q1 2V98A 4JLKA 1YH3A 4J76A 4BVBA 2HK9A 2Y76A 3G5MA 2Y9MB 3VTZA 3ZHRA 2BF7A 3GA5A 4Q4AB 3VKGA 2R62A 1QCDA 2BFBA 4TLCA 4AG6A 3BRWD 3FNEA 5D1NA 4I5IA 1EHYA 4QQ8A 4R01A 4D99A 3G8DA 3H5TA 2OAEA 4C3UA 1L4HA 3ZWNA 3Q2KA 4MJXA 2V3CC 3BXXA 4EY5A 5JRJA 1QFYA 3S70A 4FXPA 1QUEA 2QX7A 2QNBA 4KIUA 3WI7A 1GXSB 2GZ2A 3AF5A 4R40A 3NDBB 2Q9AA 1C2YA 3OEHD 3CG0A 2NGRA 3DFZA 3ONVA 3BHJA 1BS9A 5NULA 1KFBB 2QI9C 2RG7A 4MS1A 5JASA 4HS4A 3EJ6A 2FSPA 1RYBA 3VR2D 3U49A 1OLOA 4KQXA 4TXMA 1HDIA 1N2ZA 2QQFA 2XEDA 5IAKA 2IBSA 1GY8A 4Q82A 2MSWA 3LX6A 4CLDA 3S6JA 3WY9A 4TS9A 2I1WA 5KTTA 4IX1A 3AI1A 1IXRC 2HMVA 3L8CA 1FX1A 3IILA 1NW4A 1YBFA 5EJAA 3K71B 2QL6A 3WTCA 1OXXK 1C3LA 3A27A 3KDAA 1RWNA 3PGA1 4P93A 1DC5A 5DGTA 3KJQA 3FZGA 4RA9A 1W5SA 3IUBA 4FYHA 3M89A 4GMHA 2WJAA 1GL9B 1QUFA 2IUFA 3TSCA 4YB8A 2C8LA 3Q5EA 3L2OB 2CK3D 5EQFA 3L6OO 3ANLA 1M2KA 4EB6B 4AKSA 2IW3A 3L6DA 1E6MA 1HWYA 1VBNA 2QM7A 2QUAA 3KD3A 3QUAA 3B9PA 3ASUA 2ZG6A 5JCJA 4BX3A 3S1AA 1CZHA 4W5RA 1GILA 5EUBA 2WJ6A 1IEVA 2G8NA 2W2LA 2GEFA 1Q7CA 3L84A 4IEIA 1PGOA 2DLDA 2QV0A 2PBFA 1RI3A 1IQRA 1JHPA 2VJOA 4BCCA 3ZU2A 3THXB 3HO8A 3PX7A 1SVIA 3M4JA 4RJKA 2ONKA 3I4CA 4QIHA 5M3BA 3RR2A 1M8FA 2DFNA 3QKWA 1XRSB 2EQ5A 4OHCA 3WFJA 4AZ0B 1Z38A 3W8EA 3WRXC 4D9HA 3LHFA 5DX0A 1B23P 2HA7A 4HWSA 2YWXA 3ODGA 1JLLB 4KIWA 4ZANA 3UJ6A 1YB4A 4LV5B 4G9BA 4H4CA 1CLUA 4HX9A 3EQ6A 5TQ0A 3ZC3A 1QP7A 1JXQA 1J8MF 2VJKA 1MQAA 2ETXA 1ZUNA 3O94A 4HF7A 4D9JA 4I1VA 4EDHA 1T15A 4OIFA 3AOEA 5P21A 1Y42X 2BMDA 1E2UA 4PG6A 1XTJA 1CUAA 1QGDA 1OA1A 1SMKA 2Q0XA 1OUMA 3FJ1A 3B53X 2EEZA 1E1RD 3ESCA 1DDGA 4UCQA 4DIDA 2WA2A 3CZ9A 1Z8FA 3ESDA 3ZHYA 2PFSA 3LE8A 3MTQA 3A1DA 1KU6A 3LYUA 4V0RA 2BP7A 3UFBA 4YRTA 2A9PA 1VSTA 4WN9B 5CPFA 1ZINA 5G1PA 1P1IA 1E8NA 1KE1A 2I2WA 4AJ4A 5JJLA 3VSAA 2PZEA 3GHYA 2NUBA 4NK4A 1ULAA 1U5AA 2X6QA 4NOJA 5T67A 5FPSA 3OCXA 4DJJA 1WZEA 2Q5JA 2QJRA 3FNFA 4P53A 2E1RA 2Y4OA 1HDZA 5AHXA 1KOLA 4D42A 1NJ1A 5DP2A 3VDXA 4UHHA 4YQEA 2XA9A 1C7IA 2GD0A 3ADCA 1DAIA 4P8RA 1AKQA 5KYNA 5FT9A 1SCIA 3IELA 4ZOBA 3TXAA 3DOOA 3P2MA 2WB4A 4LV8B 4DDKA 2ADFA 2OPBA 1K8ZB 1NSTA 2JKYA 4MPJA 4Y6RA 1S01A 2JFWA 4N39A 1KO7A 2YZMA 2FK7A 5ED4A 2TS1A 1N2BA 1DRWA 3AVWA 3A11A 2NG1A 4YCSA 2C2WA 2UUOA 4H77A 4NJEB 3RFTA 2ZRHA 4DT1B 2RG1A 1ISGA 3CZ5A 3IIIA 1S8AA 4G8BA 4D4IA 4QAQA 5B1HA 2EX0A 5CDFE 1Q0UA 1A95A 1O94D 2P6UA 3RVRA 1VSBA 4UM8B 3RJTA 3TUIC 4A0HA 5G3YA 3A9WA 3SP1A 4RKYA 4K6OA 1EM6A 1W5TA 3TNJA 2YJGA 3W2GA 2CVHA 4A0SA 3VVCA 4MDEA 2CYAA 4MAFA 3KSRA 1NUTA 2O2EA 4ZQCB 3KTAB 4K3VA 3EZLA 5EZ6B 3TZBA 1CUBA 1A9XA 2X14A 3BQMB 4QO8A 4TQ9A 1LB1B 2PVCA 4YJKA 9GPBA 4JJ4A 1LPMA 2H16A 1DJQA 4OJYA 3O31A 1D2EA 2OR3A 4ENQA 4RQAA 3DEKA 4BIMA 1J42A 3SBXA 3NGMA 2IS6A 1F0NA 1XTKA 2PBZA 4BNVA 4X71A 4XWTA 5BW5A 1DOZA 1RJEA 1JLRA 1R66A 2PUWA