3GT4A

Structure of proteinase k with the magic triangle i3c
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The magic triangle goes MAD: experimental phasing with a bromine derivative
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords proteinase K
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3gt4A00
1PFGA 1YJAA 3LPAA 3DE4X 5JXIA 4DWWA 1C9JA 1SBCA 1SN7A 3I37X 4H6XA 1YJCA 1EGQA 5ARBA 2V8BA 3F7OA 4AKTA 1DBIA 2Z2ZA 2Z58A 5I9SA 4ZOQI 1OT5A 3BGOS 3GT3A 1AH2A 1R6VA 1DUIA 2HPZA 2Z57A 4CG0A 1KE2A 3PRKE 3SICE 1OYOA 1Y4AE 1ZVJA 4J94A 3GCXA 4ZARA 1T1EA 1GT91 1WVMA 1OYVA 2QTWB 3DW1X 3P5BA 4H6WA 2PWBA 1SUCA 4B5LA 5B1EA 1GNVA 3I30X 3L1KA 1HT3A 1SCJA 1GTJ1 2IY9A 1GA4A 1GA6A 1T1IA 2P4EA 4JP8A 1NLUA 3TI9A 1CNMA 1TM1E 1SVNA 1TM5E 2ST1A 2WWTA 1BFUA 5AQEA 3VV3A 1Y48E 1BE8A 1SUPA 1MEEA 1AK9A 2SICE 3A3OA 3A3NA 1Y3BE 3DVQX 3F7MA 3I2YX 3I34X 1PTKA 5FFNA 4CFYA 1Y1KE 3BX1A 3CO0S 1SUAA 4I0WB 5JXJA 3EDYA 1BJRE 1SIBE 4GI3A 4M1ZA 1IAVA 1KE1A 2PWAA 3AFGA 2DQKA 3VHQA 2W2PA 3VV2A 2GKOA 1XF1A 1Y3FE 5SICE 1KDZA 2WUWE 4C3VA 3LXUX 2TECE 3PTLA 3SQOA 4AKSA 5AVJA 2PQ2A 1SCBA 1SBTA 3AJ8A 1TK2A 3DDZX 3DE3X 1AVTA 3DVSX 3DW3X 3T41A 1BH6A 1AV7A 5ARCA 3WIVA 1SCNE 2X8JA 3WQBA 4YN3A 1S2NA 3DE5X 1S01A 3EIFA 4FONA 4OV6B 1Y9ZA 3DE7X 1UBNA 2W2MA 2W2NA 1SBIA 3GT4A 3OSZA 1BE6A 2PYZA 2SNIE 4LVOA 2ZWOA 1Q5PA 1THMA 2DUJA 3QFHA 2ID4A 3A3PA 3UNXA 1C3LA 3ZXXA 1TM4E 3DE1X 3H42B 1SBHA 1Y3CE 1SUDA 5K7SA 2PMWB 1MPTA 1SCAA 2HD4A 2ZWPA 3BPSA 4HX2A 4NE9A 5CW1A 3Q40A 4BWGA 4WOBA 1WMEA 1P8JA 1NDQA 4KG7A 1LW6E 3DE0X 1TO2E 3DE2X 1SIUA 1PEKE 3WHIA 2XTJA 3HJRA 1YJBA 1Y34E 2IXTA 4NE7A 3VYVA 3D9QX 1V6CA 2G4VA 2W2QA 3F49S 4KPGA 4Z2AA 1EA7A 1ST3A 1TM3E 1Y3DE 1SPBS 4MZDA 5ARDA 2WUVA 1S02A 4WOCA 2ZRQA 3D43A 4NMXB 1P7VA 1GTL1 1Y33E 1SELA 3QTLA 4OMCA 1AQNA 1SUBA 3QMPA 4H6VA 2PRKA 2Z56A 1KDVA 3VSBA 3VTAA 4HVLA 1PJ8A 3DE6X 1AF4A 4OMDA 1WMFA 2B6NA 1GNSA 1IC6A 1R0RE 1GCIA 1A2QA 3WIUA 3CNQS 2E1PA 3LPCA 1SH7A 3TECE 2DP4E 1T1GA 1WMDA 5AMXA 1YU6A 1WSDA 5FAXA 1VSBA 1TO1E 2W2OA 1TECE 2XRMA 1KDYA 1AU9A 1GA1A 5JXHA 3LPDA 1ST2A 3ZXYA 3EE6A 5JMOA 3Q5GA 1R64A 5B1DA 1C9NA 1JEAA 4LVNA 3TI7A 5JXGA 1ZVKA 3DYBA 3DVRX 3AJ9A 2Z30A 4CFZA 1V5IA 4RYDA 2ID8A 2Z2YA 1GTG1 2WV7A 1CSEE 4C3UA 5FBZA 4DJ5X 1SCDA 4KB5A 1NDUA 2SBTA 2PKCA 1C9MA 1Y4DE 3DWEX 3GCWA 1P7WA 2Z2XA 1BFKA 1SUEA 1TMGE 2X8JB 1SIOA 4K8RB 4DZTA 5AVKA 2SECE 1TM7E 1SBNE
chains in the Genus database with same CATH superfamily
3GLTA 1RJDA 1Y1SA 2RKWA 1DT3A 5J47A 5DT2A 5K3OA 2BI8A 3DNFA 4NENB 2XH8A 5IBRA 4B7CA 4X7BA 3KSBC 3TEFA 4WKGA 3K2QA 5CLIA 2Q0HA 4WT7A 5AP9A 3MM4A 4DC9A 2CNDA 1QGZA 4DBZA 5FLXA 3RODA 1QHEA 1A9OA 2WJ6A 1WVIA 2IYLD 1E1YA 4H3KB 4Y2JA 1SR8A 1YQGA 4BLUA 4TWZA 3TSYA 5BV1A 3ZHCA 5BQ3A 5GZ1A 1C9YA 1Z39A 3AETA 3PD0A 2PMDA 2EBFX 3QMVA 4OHZA 1QYVA 2F00A 3CGGA 3EASA 3GEGA 5DHAA 5CBPB 1OB2A 1PCXA 4MP3A 4M22A 1X6VA 3NTQA 3CBQA 2W6CX 4EHLA 1IY0A 1J5EB 4QDOA 5IDYA 2D13A 3CO0S 2HA0A 2GM9A 4EMTA 3RUDA 4IIBA 3TR0A 1BA3A 2Y2VA 4WEOA 1H4TA 1UBHS 2XCLA 2YX1A 3KU1A 3PSAA 4G5XA 4GI3A 4HNAB 4ZQEA 5FCDA 3G2QA 2YDXA 1SC9A 4OMFG 4ZOBA 2NVUB 2BFOA 2QTTA 1LFDB 1O1YA 3KT6A 4TLDA 2P78A 3HA7A 3UKJA 4LF4B 3DOOA 1PL8A 1TRHA 3BXZA 1C3OA 4XSVA 3BN3A 2QD4A 2ZT7A 1F9AA 2AN9A 5A7FA 3DOFA 3ONNA 1P2FA 1EVIA 2GAFA 2I9PA 2NZYA 1ZU5A 1OC2A 2C20A 3P0IA 4G9BA 5CVJA 1HR0B 1PNRA 4V38A 5DH9A 1SUWA 1VHJA 3KR0A 1TTQB 2GO1A 2O3TA 4CCWA 5CA1B 4CLRA 5IH3A 4EITA 2CDAA 2PR2A 3TKAA 3INRA 4DV2B 2OMKA 1L5YA 2G25A 4YAGA 1JVSA 1XQWA 2VP2A 4MTCA 2NUPB 4PC7A 4GYJA 1A27A 1CUYA 4H4CA 5K2OA 2IEYA 2FPMA 3KXLA 2K2WA 3NJ4A 5GJVC 1OPRA 5JCJD 1NVTA 3TEMA 4AF7A 2B98A 4GE3A 4JBWA 2BFCB 2NPFA 4FKBA 3VPCA 1QMGA 1U0HC 1JG3A 1D1PA 3KTOA 3BWMA 4UU8A 1EBFA 2GN4A 4LZOA 2VJPA 4RD3A 5EWLA 4AX8A 4FHCA 3MCZA 1JDBC 2QK4A 4LK3A 2OGSA 2YWDA 3GLVA 4PBRA 2R6ZA 3OEED 3CLSC 4KUHA 1P1IA 8AT1A 1Y1TA 3BGSA 5AOAA 4EKGA 4O6VA 1YA8A 4HUQA 4TQUS 5K0EA 2PL3A 5E9JA 1I7SB 2E21A 4KYUA 4UDYX 2WWFA 2Q6IA 1N0WA 4E09A 4DLRA 5B2EA 2BUAA 2HMUA 5LA6B 3Q2OA 5F51A 2AOTA 3RC2A 5B7GA 5A5GA 3GRFA 4EO4A 4KTVE 2FQ1A 3UAOA 4LVNA 5EXDA 4NDZA 4EPYA 3TRJA 4PLVA 3C3YA 5GM1A 2IHUA 3HUEA 1CZOA 3C8DA 3FXAA 4FSXA 4GLBA 4DLKA 4LJRA 3SEZA 3MUOA 1X87A 2GVZC 4G86A 3I8OA 3GFPA 1VI5A 3IBFA 1WUJS 4G4GA 1KK0A 5COAA 3EYAA 3QEBZ 1HNZB 2CMDA 2QN7A 3MTEA 3C3WA 4BX0A 2ERXA 4CM5A 1WPXA 3M2TA 4V0MA 4BWFB 5CEEA 1G20E 5B2FA 1JIXA 1O0SA 1EK6A 1CUXA 4MA4A 1R6BX 3SE7A 4BVAA 5IT9A 1NLZA 2ATCA 4B3IA 1RNLA 3VC2A 2NGRA 4P92A 4EG8A 3BHMA 4ZARA 3VZSA 3ZWQA 5H3CA 4RKWA 3BQ9A 3EA4A 3H05A 5I9IA 4WVLA 3TTVA 1YDGA 3QWFA 1IM8A 2VDRB 3WLMA 3OF3A 5IKXA 1FLAA 4OXRA 2Q1XA 2JFUA 1W581 2Y6VA 4KE6A 2CXQA 5A1JA 4KBGA 5A5EA 5B1EA 1ZGHA 1A9PA 1D1SA 4OJNA 5KAPA 3UK1A 1K97A 2GBCA 2IEZA 3QPWA 3GNSA 2BH9A 4AL4A 4BNXA 1KIFA 3F5QA 1P1JA 1MA0A 4QWWA 1RBQA 1J06A 2H5LA 1T35A 3ITNA 3URMA 4ER5A 2DG2A 1RTTA 1DQNA 3IR7A 2HCTA 4FLEA 5EN4A 2J9ZB 2OILA 3VH4A 3DE3X 1OC4A 3DVSX 3Q85A 2HT1A 2MT9A 1AV7A 3V1TC 2QL7A 1DBVO 5CX1A 1YVRA 1AUQA 4RMHA 3SC2A 4XJVA 2XE4A 1HNNA 3ZJ4A 4PO3X 1YQ9A 2DM6A 3AILA 3LUGA 2E4WA 2ZETA 2ZREA 4GZ6A 5F33A 3RYIB 3QHPA 4ZZIA 1C7RA 3MN1A 1SXJC 5IAAA 1FU4A 4KQJA 2DOKA 1YGYA 1EDBA 1Y98A 2B99A 2FRDC 3CZMA 3Q3CA 4FC7A 1KP3A 4PZUA 5CW1A 3QYAA 1BYIA 1SCKA 4LOLA 5TXGA 3L0BA 1EX1A 3KHUA 3AIOA 1NNI1 4RE6A 2V9CA 4NG5A 1DJMA 2F59A 3M6AA 3K70C 4YBRA 3IRVA 4HXGA 4G2TA 1DAFA 1IYZA 1JR3A 4AK9A 4KGVA 2DUNA 3EH1A 3PCXA 1CUJA 2C7QA 5LN1A 4RK1A 1E60A 4HJRA 3QE4A 5B3LA 1GR1A 3MJVA 2XOKA 1DKRA 4PPQA 2VRCD 4ZPJA 3ZW7A 4C05A 2DBRA 4KX3A 4HTAA 4H17A 1OY1A 4IH4A 4DS3A 4RIHA 2WVAA 3WL4A 4LF7B 2ODEA 4MVJE 4WESB 521PA 4NDNE 3LE8A 1WZUA 1Y80A 4RQBA 4WJLA 1ZK1A 1U3UA 1O9HA 1X8KA 4PNEA 2RIPA 5FX2A 1ZRMA 2VJNA 3MEQA 2BFEB 4MWZA 4Y6RA 4NFYA 4CM4A 2JGNA 5BQXA 2BSQA 3K3PA 1SQGA 3FNHA 2ES4A 2WILA 3KSMA 4HLDA 2G04A 4H6XA 1VIDA 2IF2A 1FQJA 4MV4A 3PLRA 1B3RA 2GEBA 4KJZA 2CFCA 4O4LB 3R0XA 3F8SA 4QSMA 3GLGB 1SKQA 3AEXA 2XPCA 2QY9A 1AH2A 2BGWA 2WIBA 2VHYA 1Y3HA 1E0SA 1YQTA 4D6XA 2B7LA 2JCVA 3OFND 4X24A 4AWXA 1I9CA 3R3HA 4DB2A 1ENZA 2VDLB 3C6MA 2GN8A 3WGYA 1VJ5A 4PYOA 4EA7A 1Z2PX 1WVMA 1VHQA 4YS6A 4XVCA 1LZLA 2JI9A 5E0OA 3SQDA 4RVHA 3RVNA 5JDCC 2EYUA 3T12A 3KO8A 4Q93A 1IH8A 3S8MA 1CTQA 3BBLA 4HZUA 2IGBA 2FB9A 1AURA 3AHJA 3KFVA 3PXCX 1NG9A 2R2AA 2C07A 1NN3A 3VVMA 3WK5A 4LYEA 4Q18A 3MXOA 3BXOA 4IQ0A 4LZNA 5G0TA 4ZO8A 4Y6QA 2CVPA 1W4BA 1OI4A 2EGGA 3EQ2A 3FYSA 4WK4B 5K6TA 5TT0A 3P20A 3RUCA 4EJFA 3OP4A 2W6MA 3AR7A 4MA0A 2K5UA 1PWYE 4OLHA 5KQSA 4LRQA 1KRHA 3O0DA 2HTEA 5E8JA 5SICE 1Y3FE 5HGJA 1YQXA 4UEJA 2RAUA 1T8SA 3E18A 1OLUB 3BKWA 3BL5A 3NW9A 1QYCA 2DWCA 4C30A 3T3NA 1SMKA 5JI3E 3N2LA 3OIGA 1VLZA 4UHKA 1F8XA 4U8HA 5IC4A 5C80A 4MUAA 1B41A 2P77A 1YR1A 1T29A 1PGNA 4LN1A 3S6JA 3SM9A 1FJXA 1I24A 3B36A 2W2NA 1JDVA 4NYMR 4DV7B 2YWHA 4MLPA 2HAEA 2HSJA 3DP7A 2ZSFA 1WLYA 1GRVA 4HGOA 1OI7A 3QFHA 4FMDB 1PG5A 4JEUA 4JXKA 1NBIA 3A3PA 1C3LA 5TY0A 3H42B 4G0PA 4JYCA 3TZKA 1D2MA 4DSOA 3QPVA 2ASEA 4Q1BA 1Q0PA 4YPVA 5AW6A 1DRUA 1ETUA 1G38A 4F3RA 4XVRA 2FZCA 3CH5A 1V25A 5DW0A 1EUDB 1T1RA 4NFHA 4G5QA 3L18A 4IFTA 4E11A 1XZDA 1SC6A 2WFMA 5DULA 5TF4A 1Z68A 2FE4A 2F90A 4B48A 1GQQA 4LHVA 4G56A 2CE7A 3LNCA 4J90A 3ANLA 1OLSA 5DGIA 4M1WA 4YUVA 2HUNA 3LOQA 3CVWA 3X2SA 3Q8KA 2VUHB 1O77A 1ZSVA 4HDQB 2I91A 3THXA 1FDUA 3NT2A 5BW8A 3BWBA 5K8TA 2IYRA 3ZH2A 1RLUA 1QO7A 2PXAA 1COZA 1GNSA 2Z8YA 4JI2B 1FDOA 4YCBA 4L5BA 5JAMA 4DIKA 5JFGA 3R7WA 1XZGA 4FFLA 4KVFA 4BVLA 1MAUA 3OLWA 1GNLA 3MK31 3PUKA 4FNMA 1MORA 4RIEA 4PFSA 2AXQA 4NOMA 4ZEXA 2CLMB 4QEDA 1M1NA 5FA8A 4LA4A 1CUBA 3D8NA 4D9EA 1L5LA 1D6MA 2BHTA 4X44A 3TI7A 1ZW1A 4GI1A 1HE2A 4LQLA 1X7WB 3GMIA 2F43B 1XK7A 1CLUA 3RBZA 4HX9A 3LTNC 1WHTA 1I1OA 3IEIA 4R7GA 4CXMA 1WB9A 3ETCA 3IQIX 1JJBA 1PGQA 4QTZA 4CU2A 5AVVA 4P3YA 3VDRA 4ZHSA 4W8HA 4WK0B 4UU1A 1H0RA 2SKEA 5KNLA 3S1SA 2G1PA 3PNYA 3CVOA 1ZA1A 4P3PA 4D9MA 1XI2A 1TM7E 4O08A 3FCOA 2DYKA 3OF5A 5JNRA 5TGTA 4S1TA 1ORIA 2C31A 3G2JA 3S2SA 3FUTA 4FD3A 2OB1A 2E87A 4Y6SA 1L7EA 3C45A 5FT9A 3VNBA 3FMIA 4A23A 4A9AA 3OT1A 3QW4B 2ZT8A 1Y4AE 4MR8A 4MGKR 5J2UB 2W93A 4PW0A 3RKSA 3I5UA 1J2JA 2WJVA 4ZI7A 4RJIA 2PWBA 3H11A 4W82A 1DKLA 1MD9A 1L4NA 2Q29A 4E13A 4FE4A 4EUHA 2CT8A 2UUOA 4YYEA 5IZCC 1JMYA 2P8SA 4B79A 4HWOA 5DM2A 5AIBA 4GQIA 2AC4A 1OU4A 2Q5IA 3A3OA 1NVVR 1VG8A 1ZRSA 2DECA 4IHAA 2V3WA 3K0CC 2ZSEA 4Z86A 3Q7RA 3HG7A 2CNWA 2JDIA 3HKCA 4JR0A 4UXIA 5T5QA 4EGFA 1JZSA 3NHMA 1L4FA 4KXWA 1N77A 2C7BA 2PWAA 5EUCA 2CLHB 3QA3E 3S7ZA 3Q8LA 1RBZA 2FPUA 4MMZB 4D02A 1NVWQ 1CETA 4NJOA 3PFGA 2ET6A 5D3QA 1MABA 2GR9A 4KV7A 4KVAA 4OGGA 2OCGA 5DGTA 4F5ZA 3B3FA 1C50A 2R4UA 2DZDA 1T2UA 2E4AA 3N28A 1GRNA 3OWOA 4YRSA 4U2KA 3H17A 4TQ9A 2DTXA 2QLLA 3EQZA 5H4HA 3UTDA 3I62A 3M4XA 2X8LA 2IH2A 4TUYA 3E2IA 1REQA 2PRJA 4PYIA 4GLJA 5FB3A 3A11A 3ZVLA 2AEFA 1M0SA 2R1UA 5KTNA 2PT9A 3B48A 1GPWB 2IHBA 3LBIA 5FWAA 1YL6A 2Y8EA 4YJ3B 1EFRA 1FYXA 1KDOA 3IUJA 4R8VA 3SIWA 1HV8A 3TZ6A 1SXJD 2C7PA 4C4AA 5CDYA 2QVCA 3CEMA 4NE7A 1FJ2A 3RNLA 1CC1S 1Y3DE 4YH1A 1ZESA 3L8GA 4P83A 4GVLA 2VRBA 2WUVA 5IG2A 1I80A 4XPIA 5BNZA 1GVNB 1GTL1 3IO3A 2Q1TA 4XWTA 3ORSA 4G0MA 4BGUA 2JJYA 1GPH1 4ZO6A 3LNTA 3OY2A 2VHEA 2A9RA 3E3NA 3NANA 1KQNA 1H3NA 2HEIA 4NIMA 4BGEA 2HRZA 2YYYA 2J32A 4PZAA 2Q5FA 1EWYA 1YBHA 4EG6A 1W0CA 2DPMA 2OWEA 3OZIA 5E1DA 5BOSA 2AXPA 4QTTB 1Z18A 2DTDA 3FTQA 4U7GA 3RH0A 5LLDA 1A77A 3PEWA 3FMPB 4G36A 2NXNA 3OETA 1JHRA 3KAJA 2QGNA 3UH1A 3A1UA 1XC7A 1Q12A 5L6MB 1OJLA 1YZTA 1KL7A 1CFZA 3AJ9A 4NNPA 5DHUA 3D7KA 3G2OA 4IIJB 3WB2A 2AEMA 4L08A 1VGVA 1CF9A 1EUZA 2RHCA 4DRXB 2QN9A 4KQMA 4ZEWA 3RHZA 1EP1B 2PA0A 1L5FA 3T7KA 4PG4A 3NJ8A 3R7AA 3RIGA 3TJZA 4EGQA 3C15C 5JJKA 4P58A 3C8MA 1HE8B 1UMCA 2DY1A 3C5WP 2CXRA 3H04A 4Q4LA 1BWPA 5C52B 2QQFA 3ZXIA 1V35A 3ITDA 5LB4A 2BCEA 4LHXA 3W04A 2HK6A 4IQGA 1AGYA 1J1ZA 1U90A 2BM9A 5AVXA 4X62B 2Q6KA 4R8KA 5JAIA 2D1FA 3KB1A 3KXDA 4ZVKA 1OKKD 3AUSA 4EQ6B 4WOPA 1W0KA 2GZRA 2ZJ2A 3PUYA 3WGJA 3ZG6A 2VZEA 4B5LA 1V4VA 2ZUDA 5U1PA 3CEPB 3TLEA 2FOIA 2O05A 2P4EA 4JP8A 4M9QA 1KYXA 3JQCA 3Q12A 3LY8A 4I1PA 1C9KA 1U2PA 1Z0JA 3AERA 4B3DA 3E70C 2JIQA 1NWHA 2BDTA 5D6OA 3QXXA 3ZY6A 1QGAA 2GHQA 3V7NA 3UKDA 3P1JA 2J6IA 3FCSB 4BKQA 4ZIRA 3LYLA 5LB2A 4TLAA 5AW8A 2JHFA 2RHJA 2EKLA 4J7CA 1GGMA 1NN0A 4OIFA 4OHYA 3GPIA 4B47A 4CF4A 3K0AB 2P5TB 1NPTO 2BUBA 3DMHA 2XE8A 3SQOA 1HK7A 1AX9A 1WV1A 2HLDD 2ZDQA 3DDZX 5EP3A 3RO7A 4MR9B 4Q3KA 1FFAA 3KB2A 1OX4A 1D7AA 1Z2CA 3FDJA 4N5DA 4CTKA 5C8VA 3P0HA 3O3MB 3PHHA 2PKEA 2AUTA 2CCKA 4US1R 5JS2A 2AFVA 1KA9H 4BX2A 4XEUA 1N9ZA 2WJWA 1RWQA 4ERXA 1Q5PA 3B1VA 4X94A 3T35A 4Q7QA 7REQA 1FPMA 3IC5A 2ID4A 4FC6A 1XIVA 2EJVA 4GOXA 1CNEA 5DBOA 2PKRA 1P2UA 1T3ZA 1V9LA 1DZ3A 4O2AF 3IXLA 1MEJA 3UY4A 2HM7A 1YQEA 3D7MA 3UC5A 4JAVC 4PQEA 2X76A 1ZXBA 4HAUA 1VHWA 4U7WA 5HZMA 4DMUB 1TM3E 3ZE8A 5IJAA 3WYAA 3D0RA 3UAZA 1U8EA 3LWDA 4LBZA 3X1MA 4PZZA 4XPZA 2A3NA 1V7QA 4N01A 1VRCA 2R25B 4BMYA 4ZYZA 1DBQA 2BSXA 1EVYA 5KVSA 4L74A 5HUJA 1IZ9A 1KEPA 4B3JA 4LW8A 2O4UX 2ISSD 4DDUA 1NKTA 1CUFA 2WINI 4DSAA 2PWYA 1WZEA 2HMWA 2W2LD 3IA2A 1RM3A 1JNXX 2PXCA 3SIPA 3R77A 1XHEA 3K0FA 2O8CB 4Y9TA 1QFXA 2X2PA 5DN6D 3ND9A 4OOFA 2E6UX 1IULA 4G0YA 4Q37A 3Q8XB 1BE1A 3OOSA 4HDNA 4FUQA 4F4IA 1L5GB 1GU1A 1T9GR 4L16A 3GWZA 5JVDB 4BNYA 1OLOA 4ZAGA 2YS7A 4GP6A 1P61B 3V1KA 4H1TA 4D5GA 2IYPA 4F3TA 1H0HA 2G67A 1Z6QA 2OHJA 3A4NA 5KWEA 5J2UF 4GKJB 4X93A 2ZWMA 5IDXA 4W99A 3JWIA 2DXIA 4F2DA 3IJEB 5HUHA 1RRCA 3GROA 3STXA 1N2GA 1XWWA 3T3OA 5EKSA 2O2GA 1DDGA 1UF9A 1BWRA 3B8EA 4CQMD 2KSQA 1EJ6A 2VH1A 2KJQA 3O92A 5ALDA 3I1JA 1X7DA 3FCEA 4G5FA 3DNPA 1UBKS 4HN9A 3UV3A 3KEFA 5DM60 4BN5A 4UNQA 4Z1OA 4MQFA 3MF4A 4UBIA 1QQAA 3WSVA 5TJHA 1E92A 1LUAA 1MHTA 2Z43A 4HLUA 5L7YA 3W78A 4NMWA 3QELB 3FMGA 3GIWA 4L5AA 4QM6A 2E3JA 4UBNA 2X14A 2PD4A 2IWRA 4MWGA 3MGBA 1BYUA 2AVDA 1Z4LA 3FYCA 1GPYA 2YMPA 3AEQB 5H83A 4JELA 5A5VA 5F3RA 3GFGA 2VXOA 1A5SB 1L1QA 4N1AA 4D3DA 5LMUB 1TA9A 2Z1DA 3ISVA 2PUHA 2ONYA 4PZCA 4EABA 5J2TB 2EJCA 2Z5LA 3H4TA 3I05A 4WUTA 3JQ8A 5A0FA 2HK7A 4I9NA 4TSRA 1LVHA 2OZLA 2ZJ6A 4KRFA 1KGSA 1XMIA 1L4EA 1SNYA 4YRKA 1CDEA 4G89A 3SBEA 3U44B 1R00A 2O2ZA 2JD0A 1B7GO 1CUZA 1XF1A 4I19A 4HN4B 1M66A 3QVGB 3VH1A 3MGKA 3G2IA 1JKJB 2PPVA 4M21A 4KLZA 4MJ7A 4MX8A 1EFUA 4QDXA 4ACAA 4BRZA 3ZHUA 3IMGA 3B1WA 3OE7A 4DDWA 1YXMA 2BBSA 3KKNA 3ANNA 3WFIA 1N9KA 4H1HA 4KHZA 2HBYA 4X7MA 1LDGA 3R6WA 1SBIA 3KOOA 3FSGD 4FS8A 1I6WA 2O8BA 1U2DA 1NP3A 1Z88A 1MQ8B 4DMKA 3ZWWA 3DF9A 1M6EX 3LJKA 5FBRB 5EJ6A 2VOEA 3NP9A 3AVTA 3I9LA 2Y6UA 4DREA 4HY3A 3KZNA 3LT4A 2O8FA 5AUQA 4JQSA 1QZTA 1THTA 4K6MA 3A28A 4CKCA 4O5OA 2F1JA 1BAPA 1SIUA 4I08A 1P6XA 4BO5A 4DG8A 1QFMA 1ECLA 3EXFB 2IXTA 3R8XA 2FPGA 1IEXA 2ORIA 4ROSA 5IDVA 3WLTA 2LXNA 5E3JA 3PBKA 3M4NA 4F21A 3QTLA 1SELA 3B5JA 1P19A 3KRTA 4FI3C 2LCIA 2BCGY 3H9BA 2DE0X 5EHZA 1D2HA 2QQGA 5HILA 4Z9FA 5JMWA 4ARBA 2GCOB 1HDGO 1QV6A 2COEA 4OAPA 3QX7A 3V46A 2J9YB 4ICIA 4KNWA 4RF5A 4QE3A 3FJ1A 3RIHA 3CCBA 1FQKA 3ESRA 1XEWY 4RPIA 1HSOA 1P9RA 2AUMA 2WT9A 2BTEA 2BRUA 4FYKA 4HAIA 1RLMA 5CTJA 4JHLA 1IY9A 4KQ1A 3S70A 5MN4A 1E1RD 3VTZA 4QFCA 2DQ4A 2QPLA 2B5WA 1E69A 3ZQ4A 1F2UB 1GFZA 2FWAA 1N5OX 1QANA 2BKLA 2MMGA 4H1VA 4FJ1A 4IHJB 5AM0A 5ES3A 3TF5A 1JFTA 4AJ1A 4MR8B 4OBXA 3B5EA 1GTVA 2ZRFA 1MG5A 4U5XA 1QTNA 3G2HA 3TLCA 4JQYA 1IZ8A 1DWUA 1HDEA 3GDWA 1D2AA 2WMOB 4MHTA 1AT1A 3PNOA 4LJ6A 5BSKA 1F8FA 2AG6A 5IW8A 5KU7A 4BE9A 3U0VA 1T2DA 5KVQA 3ANYB 3GVPA 3G5AA 2CNWD 1N6HA 4YT2A 4KOEC 3FCYA 1LK7A 2JA1A 2VBCA 1E9AA 1FFDA 2RHBA 2WF7A 3AXSA 3EISA 3F8WA 3HKCB 1OBCA 3BIJA 3FVRA 1K75A 3PPYA 4ZCMA 2EIXA 1DV2A 4F4JA 1L7PA 2FZEA 2B78A 4GH5A 3GJ3A 5IXSA 1JQAA 3T7SA 2CL0X 3IB6A 4ND8B 1VBFA 1B6SA 1VIVA 1Y6JA 3K9NA 5C9ZA 3OZBA 3WAGA 1IL0A 3ZIUA 1V39A 3OO1A 5AK4A 1GUDA 3SHVA 3TVYA 1B8PA 1PUJA 1HBJA 4IIDA 4C29A 4G4SO 5LDDC 3A7DA 3L7LA 3C3KA 5IAKA 3UAVA 3CFYA 4G0ZA 5C4IA 2KHZA 4UW9A 3PQ3A 2P69A 2V45A 4DT1A 3DMPA 5KIAA 1U2DC 5LYJA 5WRFA 4BKPA 3BRWA 4URXR 5SV2A 1I7PA 2IUTA 1EHIA 1KI3A 1SXJA 2P0EA 3E9ZA 4OHPA 1M72A 5E0KB 5HM8A 1E63A 2AE2A 4J49A 4KDCA 4E6PA 1E32A 2C42A 2AXEA 5E3IA 3V9PA 3QYPA 4ZK6A 1QP7A 2O5VA 3SYKA 4DCUA 5KUTA 2VDPB 3DBIA 4B83A 3HPRA 1N2CE 4B6OA 4ZP1A 2OP0A 4X1KA 4H1WA 4P53A 4DNQA 1WKBA 2VC2B 3QLVA 5TQ0B 1W4RA 3GG2A 1C4XA 3DYVA 2C5AA 3H7IA 4JC0A 1HTBA 4LXIA 5LL6P 1QHGA 4MVJD 1QNLA 3E61A 4LGCA 2PVSA 4K88A 1ECPA 1UDWA 1RXYA 5CP8A 1UMKA 3MPUA 5FLEX 3MAGA 4JJGA 1CHDA 4EA9A 1ZN7A 3GPLA 3ZDAA 2CXOA 3Q40A 3T5PA 5BT8A 3P9QA 1IHUA 4JFAA 1IWBB 3BXEA 1EDEA 1U0EA 3FHCB 3IP3A 2JFGA 3PITA 2A33A 2VKTA 2WRZA 3N87A 2CWDA 4XEHA 3F71A 1M0WA 2Z2KA 4Z8YA 3VH3A 2GAOA 4JOQA 2BH2A 2IOHA 2XXJA 3IV7A 2I5PO 4MVXA 1KYVA 4NICA 3LVBA 5L4LA 2FPKA 3AR8A 4DPMA 3F8TA 4HFRA 4KXVA 3F3MA 3ESZA 3TVDA 2VP5A 3QFTA 3A1NA 3GLHA 4ZT2A 2X5JO 5DLQC 3UQZA 5AW4A 3QPCA 2JFVA 2Q0XA 1W19A 3KXKA 2ZI9A 3FBWA 3FYDA 5EQTA 1RI3A 2H16A 4RNCA 4EW1A 2PUBA 4TPKA 1EDOA 4HB0A 5A7GA 3N2GB 1BQ4A 2C0PA 4QECA 4L4ZA 2BHSA 2C92A 3BHNA 3TW8A 1W87A 2D0DA 1ESMA 3BTUA 4N9WA 5TPZA 2GTIA 4MS1B 4D3SA 4WFKA 3I01M 5BO5A 4GX2A 3V2HA 3WLAA 4LSMA 13PKA 1CEQA 1YC2A 4H3VA 3CJQA 5AW1A 4DAOA 4KEAA 1BGVA 4WY5A 3WVNA 2I9KA 3BDAA 5L95A 1W0KD 2X0NA 4I2VA 3U7HB 1BU5A 2GD6A 2IPOA 4BVKA 2IWHA 2F62A 2CWWA 3VNUA 1CW2B 2IYUA 4IHQA 3VNRA 4CIXA 1T25A 5KBYA 1N6RA 4OHOA 1SA0B 1TZCA 4YXWD 4G09A 4GGOA 1YDWA 1NMQA 1E8DA 2FI1A 3ZY2A 3V34A 4NS1A 2B5OA 2IX9A 3E9EA 4UM9B 2QD2A 2IV7A 4ZV4A 4ZZ0A 3H83A 3JQ7A 3PX3A 2AZMA 4KDRA 4M1YA 2QN8A 1LPMA 1RMQA 2W2VA 1JAXA 3PQ2A 1AA6A 3B82A 3G7UA 4UHCA 4JJFA 2CNKA 2XA2A 4L9SA 3WNVA 3PC8C 5CFRA 5IM5A 1VHLA 4UUQA 4H7KA 5I47A 5A0VA 4GLFA 1K0UA 1O54A 2EG5A 1BQEA 2NQTA 4R16A 1YZLA 1ZNZA 1CIPA 4RK0A 1IB0A 4Z1MD 1NRXA 5K3AA 2QTMA 2WKPA 3SFTA 5FUMA 3PQEA 3SVZA 2PYDA 3MJTA 1JHAA 1BN6A 4YREA 1GA4A 3PDIB 1VDMA 3H16A 1USKA 4H7IA 2VI5A 3GO4A 3I2HA 2LGJA 2OGZA 1X8JA 2Y1FA 3VV3A 2JIOA 2B61A 2ZJZA 3CVJA 4UAVA 1QO9A 5H70A 3N0XA 4IMJB 3M3DA 1EZZA 1I1NA 3SS9X 4CETA 4RV9A 3RQIA 2Y1EA 4JLWA 4YP6A 1HO3A 2UVQA 5FL7D 5HW0A 5CFOA 3A27A 3ETGA 3NS7A 1ISJA 4B8WA 3KKMA 4I55B 2CKDA 5CNJA 4LJYA 5JARA 5JAOA 3G1WA 5LOVF 3IHLA 1I30A 2Q9UA 4JMLA 4KCGA 2NAFA 2UUBB 3MWLA 3DUFB 3WQRA 4C03A 1RXEA 2QPTA 4PRKA 1BROA 3PLNA 4R31A 4NU0A 2CEKA 4POAA 5EJIA 3VZDA 1LDMA 3ROXA 1XP5A 1E61A 1N6OA 4TKVB 3T54A 4WLOA 4C4ZA 1W1WA 3CWZA 3M6MD 2EKDA 3D2LA 8LDHA 1XKTA 4N5MA 3JWHA 3NDPA 2NXWA 3LP5A 5CK5A 4UD2A 4JYZA 5LXTA 4Q00A 4XRRA 1PJCA 5AVTA 4OI0A 2IRWA 1DG3A 1LBEA 2QUBA 1AIPA 2VDQB 4J0EA 1XMJA 4PGMA 2CCGA 3WGHA 3Q2KA 4FQ8A 3SZMA 5IT0A 5DN6A 1EX9A 1Y9AA 1R3DA 2VT3A 1NXQA 4EGCB 2PZFA 2YVQA 4DR1B 3NPAA 1Y6QA 5JHGB 2C9OA 3D59A 1FSPA 2QKYA 1T9AA 4RTOA 3S5UA 4NBRA 1QV7A 3VZQA 3IBGA 5AW3A 2JJ1A 3PKJA 3CUUA 2ZKIA 2QS9A 4IR7A 1ID8A 2V7EA 3I1FA 4UULA 4Q7MB 3ZGNA 4ZDJA 4MEAA 5JD5A 1RWWA 2WKSA 4OF4A 4XVQA 1N2SA 3E5MA 2HLPA 1O87A 5JBIA 5ERGB 2XVZA 1V43A 1R0RE 5BSMA 1YK1A 1OR8A 2H57A 3ET4A 3RTEA 2HA3A 2GTHA 3GJ0A 4ASUD 4DA0A 5B3JC 5IAOA 3HDHA 5T4EA 5DNCA 3A2KA 1VLQA 3DLAA 3RSHA 1MJNA 1VSBA 3QQPA 1ISIA 2IK8A 4UXHA 3RVQA 3VBCA 2XCQA 3JVUA 3PPWA 5DHTA 3UB4A 4X65B 3KKLA 4QDUA 4OFWA 3IB3A 4DXAA 1XPRA 3G9ZA 1SZJG 3AOEC 4YRGA 2NZWA 2DH6A 1DIAA 2E4XA 2YWRA 4MGEA 3I32A 4OHUA 4TUYF 4MHSA 1B0ZA 1QH1B 1PR0A 4WD3A 3HCDA 3AHCA 3KQKA 3LKVA 1ECCA 1I10A 4NV3A 4JP3A 4Y1RB 3CZPA 4LE2A 4OFBA 2IEAA 3GEBA 3RK0A 5DNYB 3FNRA 1F7VA 4PYRA 2BFDA 3E5RA 4BZQA 3CRMA 1B23P 3NYRA 4QTYA 3MFYA 2BKEA 3JQFC 2FPLA 4F91B 1YJCA 3PUWA 4L2IA 4Q4JA 4NZZA 4IUYA 2HLHA 4R6XA 5GZ3A 4QUKA 1FX1A 3GLIB 1SVWA 3IPAA 4GKVA 4M8LA 1CU1A 3JQ8B 3NEAA 1XRQA 2I8LA 5DBIA 1JXOA 2NV0A 2VRNA 5FBKA 3QOFA 3HGTA 4JIGA 4AO8A 3KD2A 3KJGA 4PLWA 5CXXA 1KP9A 4MQEB 1DIRA 5H5JA 1N8KA 4TTIA 2FEAA 1R5BA 1XPJA 3BG5A 3D8HA 2Z5FA 3MOGA 4QBIA 4LHYA 2ESRA 3Q3JB 1O96B 1C7EA 1KZGB 1NP6A 1VDZA 1T1IA 4W5HA 5EWMB 3GYGA 1BHO1 1ORRA 3FFAA 2VDJA 3SS7X 2C8KA 3V8VA 2VTBB 2SICE 2ZT5A 2X0RA 3IP8A 3BVPA 4MDHA 4AZ3A 4D82A 4DV5B 5K3SA 4KMMA 3WO1A 1JLMA 5AM4A 3UENA 4UM8B 2GEFA 1H1DA 4IO1A 5LCXA 4PBTA 3EQ8A 2C4MA 2VHCA 2XKJE 3U80A 1E4YA 2BJHA 1SVSA 1DKOA 4C0HA 3W5JA 4M1SA 1Z56C 2ZIUB 1KDRA 1MX5A 3HBLA 5ICCA 5BV7A 2HMVA 2GWRA 1X80B 2Q3LA 3RLIA 1JLRA 3DW3X 3GGGA 4Z7NB 1H2AS 2R3SA 5IMSA 2H2GA 2JI6A 4Y2QA 4WERA 2HN9A 3KAQA 4KDFA 3WLIA 5LKAA 2YWGA 1L4HA 2GBPA 3D6NB 2JAOA 3LHDA 4X97A 2QR5A 1BVRA 5BN3B 2XF2A 2SNIE 2AX3A 1ACMA 1G98A 4LCJA 3SC2B 3SJZA 3LZDA 3UF0A 5HQTA 2WKWA 5LNK6 1OAAA 3E05A 3L84A 3NLLA 1CP2A 3GWGA 1UZAA 4DFDA 1XLUA 3B1FA 3AX6A 3Q7TA 2EZ8A 1LNQA 4TLEA 5K0CA 5IVIA 2OXTA 1Z25A 3AIIA 1XE3A 5DM0A 2HNAA 4AZVA 1Q22A 1XG5A 4KZKA 4L51A 1F6WA 1P8JA 3AZOA 4R8LA 4EHNA 4IZHA 2V7XA 2NPOA 4IICA 1KQGA 1TU4A 1KWGA 3OJWA 4LXTA 1YMQA 1VLLA 1EUCA 5EMNA 4AN0A 5G4KA 4YPOA 1OVMA 2X0IA 2OPHA 2JAPA 4ZYXA 4TVKA 5JMTA 4IHJA 1O03A 3EXEA 1ZH4A 4YV2A 1AKVA 5LUAA 3DAFA 3ZHVA 5JQWA 1PG2A 2R8YA 3DCNA 3SLRA 4AZSA 4EPWA 3VKVA 5JEEA 3OIDA 4ER0A 3RAFC 1J1UA 1LB1B 2XMBA 3FIJA 2ACWA 1I7DA 3O7WA 1NZDA 1Q1GA 1V8PA 3F6YA 2RGNC 3U3RA 2XE7A 4EUEA 4BO9A 3Q0IA 4PX5A 1FQWA 3SAJA 3N0WA 3HBNA 4YQZA 4EEKA 3A10A 1DEHA 1EB9A 1SRRA 4LGMA 2C5GA 4IQ8A 2Q5CA 1ATZA 1CJMA 1YRHA 2P1DA 5JMOA 4O4HB 1ZUNB 3KWJA 5KS2A 2I8CA 3T0IA 4MVJP 4CLEA 4J2HA 1QHNA 1N5RA 4EKEA 1SAYA 1SOUA 2PJUA 3RS0A 1Y37A 1UM9B 3QOYA 2XUAA 2PT7A 1XYYA 2H4FA 2XUOA 3H4MA 4TOIA 2HY7A 2ZB8A 3STWA 2F8TA 5AD1A 2OXCA 3L0IB 4MUGA 1QS0A 1E9BA 1UC8A 2VWGA 3HJNA 3TH5A 1RRFA 2Z2XA 3CMMA 4LTDA 4M7OA 4BVBA 1SKMA 2JGJA 2LRHA 2PVCA 3CZAA 3OIUA 1ZZGA 2NT3A 4PGGA 1I3NA 5IJ0B 1N1EA 1U8UA 2BFDB 2RDMA 2OV1A 3EIWA 3GT0A 4BO3A 3IAS1 3FZEA 1HQCA 2XVMA 4IGFA 1U3GA 1VRWA 2JD1A 5AFSA 2OORC 3JZIA 1N1DA 3L43A 4F5YA 3I5MA 3SYRA 1O6BA 1ZXLA 3VTKA 2BL4A 1CB0A 2CJPA 3FHTA 3AW8A 1RCFA 2W8ZA 2G0NA 1V11B 2YQZA 2DU8A 5E1BA 1OVGA 3EFHA 3K05A 5HF6A 4TTQA 3CHYA 4PO8A 2PMEA 1UINA 2XUFA 1PK9A 2P2LA 4HB4A 4YBZA 1R0YA 4BECA 3SDSA 4EKDA 3ZV4A 3MWDB 4IYJA 4WXYB 1QP8A 1G8SA 1JYSA 2DKNA 2VYVA 1Q77A 2Q6LA 4GGMX 1X8LA 4GU5A 4HBZA 4LUCA 4WPGA 2WBLC 5C5DA 1WE2A 2CXXA 3UVEA 1E20A 2I4RA 2XHEA 1IN8A 1P5RA 1SU4A 4L27A 4Q3AA 2I2AA 5GOTA 3TSZA 2VLBA 3H0KA 4DIEA 2P9QA 2NUAA 2RMKA 4CEIA 3S5JA 1RHRA 3F2IA 1L1FA 1PJAA 4BYGA 2FK7A 4TXLA 3WBFA 3OEHA 3EXIA 3LXUX 5ERYA 5LC1A 2J6HA 4GW3A 1CIJA 3GGSA 3QKUA 1G66A 1UC5B 2DWPA 2HSZA 3M6WA 3K5WA 3MVEA 2A3RA 2PH3A 4MICA 3AR5A 5CK4A 2NTYC 2PL5A 2QBYA 1EBBA 1YUNA 1LDBA 1MC8A 3MPOA 5IJ0A 5BSFA 5J4VA 3FJYA 1QG2A 1ECBA 4DV1B 2C97A 2WOOA 3AH8A 1JG4A 3C5HA 1P0FA 1SBHA 5AI0A 2RJNA 4QYIB 1L7AA 4ZT7A 5SY9A 1F0KA 4J7AA 2TS1A 3GA0A 3EPRA 2G6BA 2Q1UA 2F4NA 2CYBA 3TFOA 1Z34A 3S99A 4JUDX 4LCEA 4MUBA 1E9EA 1PR9A 1O5OA 3K2EA 2QRJA 3CRNA 3JD3A 4MW9A 4UPVA 4XUEA 3RRFA 4Y2TA 4BVEA 5B4TA 5JALA 1NAIA 4P36A 4PG6A 3KSAC 2X42A 4BV2A 3PNMA 4KACA 2GI4A 5G53C 4AP6A 1Y6RA 3AF5A 4MQUA 3KX2A 1LCIA 1FMLA 5C8DA 5DNWA 2ZUUA 4UM5A 2NYUA 3LSTA 1ZS9A 4JR1A 5E7MA 4C0KA 1K9VF 4DJFC 3EPHA 1NM5A 2E4UA 1Q17A 3D0OA 5IARA 4O1MA 3EZ7A 1DIBA 5D87A 4G5RA 1VA4A 4TS4A 2NAPA 3PEFA 4FR2A 1AZSC 5CYFA 3W5CA 4R5HA 1NQUA 4DYHA 1IUOA 1L8OA 1UBTS 1ZRNA 1G8FA 2WJ4A 2MMCA 3DDOA 1TDJA 2HBZA 1DC3A 2IDMA 2BEUB 1G9TA 1QYIA 1XQ9A 2GZAA 3EAGA 3RS8A 4ZMRA 2RBGA 2LDBA 3BXFA 3LRTA 4R2IA 3GNLA 2ORVA 4PIVA 3VA7A 2Q2OA 4MH0R 2FPRA 3IVRA 4GUDA 5TC4A 1O95A 2V0NA 1GL7A 1XVIA 4LRWA 1E2EA 1H6AA 1IXKA 3Q87B 4FIZA 1FF9A 3RU7A 3THYA 3F7NA 4FFVA 3RK1A 1UQTA 4BFYA 4FTWA 2GPAA 2G8LA 1L4YA 3BMXA 4XIGS 5EHQA 4HRYA 3SE0A 1MH1A 3LBAA 4QPNA 4U0KA 4R3WA 1HYBA 3C3BA 3KYBA 3V80A 2D1RA 2ZUSA 5BR7A 3KS9A 3ENZA 3FNIA 2FOXA 2RGCA 1K63A 2BFAA 5EMKA 5CDHA 5TS2A 4B74A 1QHIA 3LBYA 3ES9A 3KSRA 3PNQA 5AXAA 4B9EA 5DM70 1J0EA 2R1VA 1DTSA 1YVPA 2VHZA 1SXHA 4TS3A 3QFCA 4WKCA 3WGOA 4H7EA 3FR7A 1TVEA 1QRUA 4MW0A 1GD1O 3B6KA 3NM4A 3ENNA 4K9NA 3ROPA 5LXTB 2D1QA 2HXYA 3ABOB 1J0BA 2AL7A 5GVRA 1JFSA 4TLLB 2FWBA 5E1OA 2HUPA 2PSFA 3UGJA 4YONB 1R2QA 4RZQA 4ER3A 3HVRA 1XNRB 2H7VA 4BO7A 1E1MA 3ODGA 4MCHA 1N5DA 5E2AA 4CV2A 2BVNA 3DJFA 4LDZA 5JLAA 3QU4A 1Y1KE 5JS1A 1DIHA 3VYWA 2I29A 3C39A 1XZ8A 3IVMA 4Z0NA 3B12A 3C7AA 3NHAA 3ZDZB 5FQOA 2Q28A 2ZSDA 4LI3X 4TMWA 2HGSA 1RI1A 1U4OA 3DP9A 1SO8A 5ITVA 4RBNA 4D8VA 1V8BA 3NETA 2JGAA 4I14A 2LVBA 1VJ1A 4Q7KA 1RACA 2OKCA 4GDMA 4KRGA 2Z2IA 2QM8A 4W6QA 4BV8A 1SQ0A 1VE1A 4BMSA 3RK4A 2AMLA 2XXAB 3QUBA 1PSWA 4UNPA 4TXJA 1ZITA 2J3MA 4IFEA 4Z7JA 1RIFA 3G5TA 2WJGA 4I3GA 1REQB 5JNVA 1Q0HA 3CZQA 5U4XA 2FGKA 2ZRNA 4PHFA 4DXDA 4ZO9A 5LXTF 4XWGA 3EVEA 2QRQA 2P41A 2GZSA 4B6GA 1R5OA 4GXRA 3U2QA 2JGDA 3U6KA 1WB6A 2P91A 3INTA 2PSHA 2C2ZA 1G21A 2ETVA 3H6KA 1TW2A 5JAHA 4PYKA 5K3CA 2I22A 1XJWA 4JI5B 4UHBA 2QLMA 5FWDA 1ZMTA 2WQ6A 3H0CA 1MEOA 3RVDA 2QRZA 3EVGA 2QRKA 4GR5A 4IKOA 4OQFA 3LSYA 2GYYA 4HDKB 4UHJA 4B0OA 4B3HA 4BFLA 4IHKA 3F5DA 5B58T 3J81A 2FW0A 1VKZA 2J30A 1PJ8A 2WG0A 3HV0A 3VO2A 2PRSA 2VPIA 4KO2S 4PAOA 2PUEA 1DO8A 2NZ8A 2INGX 3A3YA 1T1GA 4RYLA 8ATCA 3PE4A 4QDTA 5B12A 1XXHB 3CLHA 3VNAA 3MCVA 1JQDA 4DWJA 5EMHA 3I53A 1G8PA 2ILVA 3BSWA 4MO2A 1K5PA 4OPMA 3DQZA 1V5FA 1P4SA 1Z5GA 2J4FA 4HG2A 3RARA 4WFQA 5K45A 4RF3A 3RFFA 1ZAYA 1O9GA 2L82A 2I3AA 3CT6A 1J8DA 3NPMA 1R9GA 1RYEA 2WJJA 4KK3A 1H8HD 5KHOC 3K9WA 6CHYA 2XCIA 3HDTA 3O84A 3C4VA 2NTVA 3IQZA 2WV7A 2YIVX 1H93A 4TYWA 3TOZA 4PYQA 4DTCA 5AI8A 3AEKA 3AHFA 2DFLA 2NX2A 3K0KA 3L6CA 1EINA 3U62A 1L7RA 3U09A 3UUWA 5CDFA 1RXWA 1CEYA 1Z07A 1E4EA 3MJEA 5HCUA 3FUUA 2TMGA 2A59A 2Z2ZA 2J5XA 4LHSA 2WTAA 1GG5A 4YJ2B 1T6YA 2Z9DA 4Q4AA 4ZT3A 5PNTA 2CK3A 1IN5A 1TZ2A 3SY8A 1MO3A 2JW5A 3O2SB 2FAXA 3NTRA 1KI2A 3EAFA 3DTTA 4IDQA 4Z9BA 1OA0A 4HDSA 5CHEA 3P0RA 5DT9A 3AFOA 2AG8A 4MW2A 2JLVA 3FETA 2IYNA 2YIDA 4FFNA 4FN4A 4IIGA 4PXYA 1IXZA 3B7WA 3KTFA 4N8DA 5HIMA 2BDEA 3QU7A 4S1OA 1YE8A 2BEKA 3AR9A 3NAMA 1J0XO 3TSCA 2XWBF 1JDJA 4JBGA 4EJSA 1TYZA 4F3CA 4FINA 3F6SA 3OPMA 5BSEA 1Z9BA 4OK3A 1BNCA 4XM0A 5ALHA 1T0HB 2JH9A 3G49A 1JHDA 3FPKA 3FKSD 2ZS8A 3HJBA 4RDHA 5G40A 2LW7A 5B37A 5FL3A 1NQTA 1RLIA 1TD9A 2RBKA 2B94A 1L5KA 5JW6A 1X1CA 1M6VA 1SIBE 1NR5A 1GQFA 1YNOA 1KTVA 1IN6A 1PL6A 2VA9A 3K8OE 1KIAA 3N7AA 3R3ZA 4FYPA 5EGSA 2C7OA 5CT4A 1D2NA 1UJ6A 4UREA 1UMDB 1UC9A 4ZGWA 1G7RA 3NUGA 3TQQA 4DLXA 3HCNA 3TOVA 2B9EA 1STOA 4FFSA 4XYBA 3GGJA 1MAVA 3LU1A 6REQB 3OA0A 3KU4A 4YR9A 5CEFA 2D0PB 5GJCA 4QLAA 1GKYA 4OA8A 4OU4A 3G17A 2QYTA 3BK2A 2CL6X 4HZIA 2PBFA 1YZVA 4CUZA 2I4IA 1F2VA 4YEDA 4KXNA 4MV5A 2OFFA 4GRDA 4LTNA 2HF9A 3C8ZA 5K7SA 1CE8A 1YR2A 3E9RA 2DPXA 2OFOA 3F96A 2QUKA 4O4IA 5LVAA 3O82A 2BMAA 3CXUA 4RA6B 2C03A 5F7ZA 1J1IA 3GCZA 1SU8A 1CRZA 5AICA 1UKYA 4Z99A 4G5GA 3ZNOA 3C3AA 3CN7A 3E9DA 2VWHA 1RRPA 2Q5OA 3HU1A 3RW9A 4NMMA 5C8ZA 5CB0A 2AMJA 3D8BA 3K70D 1FFCA 3ITEA 4HKTA 4DF3A 1CEEA 4KREA 3U5TA 1J8YF 3QU2A 4JEIA 2QJTA 3IP6A 4M9SA 2PGJA 3ZY5A 4N3GA 4XWYA 1P2GA 1ZSNA 2CLCX 4BNIA 4YUXA 4PAGA 3EY9A 4XIIA 3W90A 2JLYA 2O06A 2A8YA 3LFTA 4UDNA 1ZKDA 5BWBA 2JHPA 4MWBA 3VI4B 1UEJA 5KKCA 3AINA 4TYPA 1H6CA 1MG0A 2XQFA 4FMPA 4IF6A 2CFRA 1DC8A 1XMSA 3DEYX 1OXTA 2YS6A 3ZJ5A 3DZIA 4IOLA 2CB0A 1Z4JA 2HADA 3AESA 3LA6A 2NZ2A 4IAOA 1BZYA 2A0KA 3VR0A 3DBRB 2FZ4A 2A5FA 3U31A 3VZBA 4EDFA 4EAAA 4BIIA 5JRZA 1AMUA 1HE1C 3LUDA 1DOAA 3PUZA 4RSHA 2GRAA 1VJRA 5FRDA 3FPCA 1O4WA 4MPTA 2OGWA 3DAOA 3A6FA 2QI9F 5DM1A 3FSEA 1DUSA 1TAQA 4B9AA 5T67A 4IPTA 2QQEA 3N76A 4BJ6A 4R8SA 4S05A 1T3LA 5DI9A 4W5JA 4DM3A 3SYLA 4BFTA 2HC9A 1RE0A 4M88A 2ZTSA 4P9NA 4Y2RA 1EP3B 1E2NA 4FCTA 4REQB 3K9BA 3ASZA 4Q6WA 4RZUA 1KKLA 4WKNA 3RPEA 2P9JA 1DBIA 1RPAA 1YDHA 1IZ7A 1KU6A 2WWGA 3B9BA 3I2IA 2H08A 4ZZ1A 3AONB 4H7FA 2OO3A 1LNSA 4GR9A 4L6IA 2I55A 2PIAA 1YRQA 1ML4A 2GMWA 3C1UA 3R3XA 3TXAA 3F4KA 5K1ZA 1N25A 5TQ2B 3UB2A 3UCFA 5JQGF 1EX7A 3BMQA 2HSDA 3O83A 3T7CA 4A2WA 1OXBB 4LYGA 3SQNA 3DEIA 2BC9A 1U0TA 4EVSA 3NVMB 1PJSA 4TRRA 2ZBPA 4EAQA 2BM1A 1UQUA 4ENVA 4Z0TA 2HEGA 5G0VA 4LX8A 1FNCA 4C5AA 4BVJA 1D1TA 3O8QB 4HDMA 4ZRNA 4QTUB 1JAIA 1FX0A 2AG5A 3I52A 1E6LA 1RWXA 4JUIA 2VDMB 3LQ1A 1SCIA 5FPHA 4LV6A 2JANA 3AY6A 3FCXA 3R0ZA 5I7HA 1MVLA 2O2YA 1K5HA 1GG9A 2QTAA 4IDFA 5D3MA 2YV1A 4V0LA 5CH8A 1H2HA 4TLCA 2IP1A 1NV9A 3CUTA 3RGWS 1YB4A 1DPFA 2H5IA 5TDHA 4KR0A 4NG4A 5FEUA 1J90A 1G1AA 1RYFA 1A76A 4FDAA 4ZTUB 3AI1A 3LKDA 5ERXA 3BF7A 1TCAA 4KK4A 2DB3A 4DRXA 1NYTA 5JD3A 1GIAA 3O31A 3FVTA 1BCRA 3U81A 3UCEA 4ZAFA 3WNCA 3DUWA 1GDTA 2ALJA 1XTBA 1JLSA 2H3HA 3D8RA 3LY9A 3S2YA 3MTJA 2HJ9A 1OWLA 3C43A 1TQ2A 3DEHA 1WDWB 3G7SA 3A4TA 3FRHA 2DUUA 4DMCA 2XT0A 4G07A 4QNNA 3OPYI 4U8GA 3RS2A 2WLTA 3I9JA 1PNTA 1RMYA 3GHYA 5D01A 1X1DA 3SHTA 4RELA 3EZNA 5KYNA 3A3KA 1QTQA 1IUKA 5L9AA 5NULA 2YDYA 4NCIA 2F9LA 4AUMA 1U81A 2EERA 1RHKA 4BOYA 3U9SA 5EJ8A 5A6SA 4ZRDA 4B32A 4X00A 2ISCA 3PHBE 3R3YA 4IS3A 1F1BA 4WESA 2D0IA 2HREA 4A2QA 4YP9A 2C61A 1T2FA 1L5SA 2UUCB 4JYPA 5HQ3B 1Y6FA 3A6PC 3D4PA 1A2QA 1T10A 4GOMD 2J59A 4H4DA 4TTAA 5KNDA 2P68A 5CVUA 1ZI6A 1U2TA 4TTPA 5ANRB 2D5LA 3MSCA 2YVUA 3V8RA 3WMRA 1NNSA 1T8YA 2GRUA 2QQ5A 4KLAA 4RO0A 5A9SB 4CMEA 1M1YE 2FCRA 2H0QA 3MLAA 4LEIA 1QRSA 2ZPUA 1UJ2A 4B73A 4I4LA 1DJPA 1KNQA 1Y8CA 3SQWA 1H2YA 2AWOA 5DO9A 2JLRA 3KEQA 1QIHA 5H59A 1M9NA 2QT1A 4TTTS 2I2CA 3ML1A 1CDZA 5C1BA 3KC2A 1U99A 1MQ9A 3FPEA 3JD2A 3SHWA 1I2DA 1RZRA 3UJ8A 2JATA 4D4JA 3D3QA 5DRTA 4CL2A 1F8YA 5AI9A 3IURA 2C3YA 3LVQE 1O94A 4B81A 4LDQA 4YR7A 4LS3A 4DR2B 3KQPA 4FOSA 1GO2A 4M9RA 4XB1A 4HX5A 1WHSA 3I37X 5AK6A 1VGQA 3LFUA 3VPGA 1JHVA 5J4KA 4KL8S 2ZU6A 4RHYA 5KQPA 1U1FA 2J9FB 2XBLA 3QUTA 2Y1KA 2RC5A 1T24A 2Q5LA 1GOTA 2GPBA 4J2TA 1CUUA 3MLBA 4P86A 3DMFA 2VRWA 1XALA 1MB4A 2Z8ZA 4QYTA 5EA2A 2GYWA 1JU9A 4DMFA 1L1RA 1XKLA 3U1TA 3A1WA 3OJFA 4CKBA 4GWLA 4RJLA 1G8MA 4LNUB 5AVZA 1RYBA 1MOQA 1U1GA 2ZE6A 2VQEB 2G7MC 2XYQA 4FQ7A 3FNBA 2UZ1A 4A6DA 3N2EA 4HQ0A 2FN9A 4KH0A 4YJHA 3AJDA 4JP5A 5T8KA 3SZOA 3W9SA 4D3ZA 3AVXA 5GIOE 2UXBB 2RI0A 3I8SA 4J1TA 3L4BC 1AB6A 1QR6A 4M9CA 3FH0A 1PQ4A 5JROA 3LY7A 3NVAA 4H31A 1JG6A 1K4MA 3L7BA 3WKCA 4CN8A 4ERNA 1SKBA 1N2CA 4FKZA 4ETNA 3GJSA 4HN2A 4FFPA 4MB6A 1VCIA 2QQ0A 1TK2A 1U6IA 1Z08A 3TYXA 3LHSA 2CHQA 2HA2A 2L19A 4P3OA 4KQ2A 2ZUTA 2Z04A 4W7HA 3WIVA 4J9VA 1I36A 4EG3A 1NXTA 2LCQA 1NSFA 3N8NA 4PG8A 1KTIA 1W4LA 1H9AA 4WZBE 4C4YA 2AV6A 1JAZA 1TADA 3QF4B 2FMFA 4HMPA 3VU3A 4CQLB 3EIEA 3WWZA 2DQSA 2FDCA 5L3QA 2D3WA 1TM4E 2IPNA 1QG6A 2JGMA 4FMDF 2WLSA 1WDLA 3KOWA 3DZ8A 3NALA 3K0CA 3MRTA 4FDUA 3W2TA 4EKIA 2ZI4A 2E2WA 5EJ7A 2Z3WA 2OHHA 3AM5A 4WA7A 3AOEA 3EK2A 1IUPA 1V8OA 3NOXA 2PGLA 4MCAA 4M8SA 1G0NA 3AERB 4V24A 4CODB 3HJGA 3H2IA 1FMCA 1XJQA 1V47A 1OHHD 1B16A 3GLKA 2YXPX 4DGQA 2UZ1B 2FSGA 3WJAA 1ZBDA 3HY6A 4GLOA 1A5AB 2C4NA 3IKJA 1AF4A 4LY9A 3RLFA 2FRVA 3H99A 4RANA 4MYDA 2DPYA 3NM6B 3QLVC 4P4TA 3ANXA 4UBJA 5JG7A 2FJPA 3UMYA 3WYNA 2ZRJA 2PYIA 5DXFA 4DKXA 2DEUA 5FAXA 2YUTA 2W90A 4DQLA 1DJQA 1G4HA 1Q95A 1Q57A 3QVSA 5IVDA 5I7OA 1R0KA 2R6CA 4INJA 5J40A 4AAYA 3U1VA 5EJ9A 2AR7A 3KIPA 4GRIA 3SQLA 5I8WA 1SXJE 1WW8A 1JNYA 3O95A 3KPUA 3W1EA 3IUYA 1TLLA 2A30A 3ORQA 4DV4B 1AQIA 3RU3A 4K9DA 3ZD6A 1SBQA 2PUTA 4HDSB 5D3ZA 5C37A 3F1LA 3QF4A 4EHHA 4HNVA 4ZVVA 1PV4A 3VZRA 2WZQA 1M3SA 2G06A 1TMYA 3O1IC 4KKXB 1BHJA 3GUZA 1VL8A 3TQFA 1K8XB 3T9BA 3BJIC 4QPJC 1VMDA 5CDSA 3D5TA 1X3LA 4N49A 3BWYA 1L3IA 1LBQA 3HB9A 4Y6OA 4NL4H 3IHKA 3WSTA 1PYGA 4S04A 4G97A 3CLUD 3A4IA 2BKUA 1GVHA 4JJEA 1E3IA 4OXNA 2YYZA 4DYVA 5EC8A 3WK9A 4B6JA 4GP9A 2PGDA 2YVKA 3SP1A 4A7PA 4HNTA 3D2CA 5C46F 1T5HX 4G85A 4YJFA 4ESHA 4JI4B 1KAOA 1JHOA 4RH1A 1VG9B 3CUWA 1I8TA 3GBVA 4LNUA 4N5IX 2QP9X 4PM4A 5DGDA 2P7HA 4L5YA 1H1TA 5TMBA 4KODA 1PW7A 3V7UA 1PR3A 1KOLA 3I2YX 3CNHA 4CTNA 4RH0A 1QCCA 2EDCA 3O2JA 1I2CA 4YJHB 1SUAA 1U0OC 1W4CA 5AOBA 1CUAA 1JSXA 3TTUA 4AX4A 4BMVA 2HA4A 3KYDB 5LM3A 4QRDA 1MTOA 4DQUA 2IYXA 1OAOA 1E3SA 4ARIA 4D8YA 2Q4EA 1PHPA 1Z4QA 3GCDA 2VSQA 1GPUA 1QFJA 1HRDA 2JFHA 4RMNA 3KVVA 1SVLA 1FUIA 2R8OA 5CMLA 5EQFA 1YL7A 3CZRA 2B3TA 3H6HA 3LPMA 5BVHA 4KITB 1EWQA 1Q7GA 3SI7A 3LDFA 3KWFA 3O03A 4KX5A 4M36A 5BSTA 3RT1A 4DLTA 1EDDA 1KZ7B 4TT3D 1MOZA 2V65A 2YCBA 3SYNA 4MRPA 5IJWA 5KKNB 4I8IA 1PS8A 1T36B 4R9RA 1LDNA 4L57A 2FQYA 2B69A 2W43A 4NYMQ 1JHQA 2G0AA 3PGLA 1XMPA 1Y8ZA 3SKYA 3V9AA 4B75A 1SUFA 2BFPA 1M2OB 2C1ZA 3MT0A 4IQFA 4G65A 2V58A 4L07A 4G4IA 4L8WB 4RDXA 1GFIA 2XRFA 2Q8NA 1THZA 3DXYA 1GSOA 4JT4A 1H5QA 2QW0X 1KEUA 2F8MA 2P2CA 4C0WA 2WM9B 5K6AA 5DZSA 3RS9A 1ZKMA 1P75A 5AVOA 1VCHA 3B6IA 3N9IA 1G60A 1M2FA 1U2EA 2YQ5A 3GJ7A 1XZKA 3SC3A 5CBPA 4IRMA 5LU9A 1I3OA 5HK8A 3PKZA 2WJ3A 4XVHA 5A04A 1B26A 1LNZA 4FEGA 3GLFB 4B71A 3Q11A 1C41A 4YUZA 4NV0A 7ABPA 1ZCZA 2F9FA 2QA5A 1RM4A 3IIEA 1BVYF 1P7PA 3NOOA 4HZUB 1D03A 1W1IA 4IBOA 4XYLA 2YXBA 4G1EB 3UMFA 1LLDA 2DUWA 4LE0A 5F12A 5JATA 3GJRA 1UOEA 2PBLA 1R4MB 1KMCA 5DM4A 1JEAA 5F76A 3S2FA 3MTAA 4BHTA 2WVJA 1SG6A 3EXG2 3GJ6A 3IQWA 3KVYA 3SF8A 2DULA 2OWDA 2YW2A 3BSYA 3PNKA 4ND4A 3UMJA 4AYTA 3STHA 4PAWA 2JCBA 2VYFA 2V7BA 3A6DA 1KO8A 1TVKA 4UCFA 4Y7DA 2A5GA 4GLLA 4UJ5A 3TCKA 4BFXA 3DLHA 2LIPA 5HF5A 3CRZA 4ANFA 3EWNA 1M74A 4KU4A 2AYYA 2ZRMA 5FFMA 3O93A 3QVLA 5CCBA 4O2AA 4XX0B 2HJSA 1VZ2A 4E2XA 1PFGA 3L8DA 3NXSA 3L6UA 5HKBA 2PHZA 3G23A 3VSDA 5C7IO 3EPJA 2VP6A 2QMHA 5EIEA 1T8WA 3EVBA 3O7MA 4ZOQI 3OZXA 3DCYA 2J33A 1G3MA 3D6UA 3USES 1T5IA 2CXPA 3SSOA 4A0QA 1B0PA 1G8JA 1YZKA 4DSUA 1E7MA 2W4MA 3ZS8A 1ZIXA 2IHYA 3NHBA 2B4AA 3OHPA 4HYQA 1U5AA 3P96A 3RRBA 5A4KA 5B55A 1S8NA 2PX2A 5KVAA 4CI9A 1Y3IA 2XCSB 3CH6A 1K66A 4HO1X 2QVXX 4Y2GA 3R24A 1ZGAA 2QXUA 3HLYA 4JEHA 4K6CA 1BXGB 3JR7A 2HYIC 1NLUA 1SM4A 3QGMA 3UT5B 1QIMA 3OA2A 3DTVD 3EFEA 5AKEA 4MA5A 5CXUA 2WYHA 1EI9A 2H1RA 3NR2A 3PYLA 3TLGA 2WI8A 1F0PA 1I7LA 3Q7QA 3CUVA 3TRDA 2F8LA 4NX2A 2E85A 3A9UA 3NIGB 4JR2A 3WLEA 5E38A 3T3EA 4IXNA 2ZR0A 4IIFA 4N7MA 4UE2A 3NXKA 4FZ3A 3Q1KA 3AGQA 1KO4A 3LUBA 3JASB 1V5WA 3ULKA 4L95C 3YASA 1DC6A 1C7ZA 3FPGA 3R41A 1YE5A 1Y4ZA 2HWXA 4J9UE 5FUXA 1QS0B 1DQRA 3UMSA 5JNSA 1FJHA 3DZDA 2BR5A 2W4IA 3C7DB 3H97A 3QWHA 3UW1A 3PJEA 5DF1A 4JV5B 3N0RA 4G9EA 2VPXA 3IGFA 5F3DA 2VF4X 2C98A 5AM5A 3KEOA 2VNKA 1IE3A 1QGDA 3ZI0A 2IUYA 1L8LA 3ICQB 2WIKA 4M7PA 3TB6A 3OZDA 1MOSA 1WSWA 2G08A 2UAGA 2V9PA 4WY2A 3M5PA 1U65A 3TAHA 2CL5A 4IIJF 1E62A 5JSKA 4ND1A 1HKUA 2TMYA 4PYNA 4AJ4A 3BF8A 3IA7A 3EGEA 3BXGA 2PEZA 1EFVA 1XCMA 3JARA 1JHZA 1EUQA 3K6RA 4AMYA 3WO0A 4UHDA 3OLZA 4ZCSA 4F56A 1EVJA 4MGZR 3OH8A 4WCDA 4WFIA 3FOFC 4FM9A 1Q20A 3QVGA 2RAPA 4FP9A 4IOJA 4MEBA 1PGOA 3L92A 2QJWA 2YY6A 4DG9A 5F2NA 2WFLB 3CCCA 4U1RA 1PT9A 5BPFA 3EEFA 3QVUA 4MW5A 2BFMA 1E79D 3MD0A 4WN9B 1WDMA 4KSBA 3VO1A 4C43A 4TVBA 2RH9B 4OU5A 5E2BA 4C6TA 1M7GA 3IDZA 3OY7A 3F98A 4S0XA 4NCKA 3EEBA 3K0SA 1GL6A 3DZHA 4DLBA 2IZ6A 5AH0A 2H17A 2ZXEA 2IEDA 1U9JA 1UP7A 2JKYA 3NVDA 3OX1A 4IVRA 3WR5A 3W3AD 4UZEA 4DBLE 2FWNA 4LTMA 1LQ2A 1RP1A 3TTYA 3VJLA 1NF8A 1JTVA 1QQ7A 4JGGA 3VGJA 4DPLA 1DEKA 4FI3F 1HLGA 2EHDA 3R74A 4AURA 4OY3A 5CX1B 5FHQA 4AT1A 3MWYW 1HDYA 3EODA 4WBXC 1NQAO 5LUBA 3OPYB 1FZQA 2QLJA 2FMUA 3G9UA 3H4VA 4ITUA 4OTZA 4E70A 4QQKA 3GBPA 1XTIA 4HLQB 4O0LA 2OMEA 4WW0A 5F1YA 2PQMA 1UIMA 2V55B 1GGEA 4BFWA 2H6EA 3L7AA 4J0IA 1U2RA 2HO4A 1FJGB 1IN1A 4UBLA 3TEJA 2ATIA 2ZB2A 1L8AA 3DBLA 1E98A 1W47A 4P81A 4TMXA 4D81A 3GAMA 3P2IA 1F2UA 3PZBA 1A1VA 1UXIA 1TZJA 4K9PA 2P3SA 1C1HA 1JQBA 1KFCB 2OCIA 4D46A 3EBPA 4D74A 5AOVA 3QEMA 3RDPA 2ZBGA 3D81A 1CZNA 1MFPA 2P2SA 3RG8A 3BGVA 1N2XA 2GM5A 5IYZB 1RQPA 3M6VA 2HU2A 2H9AA 2JB9A 3D6AA 4GSLA 2TSYB 1NBEA 4FHDA 3U7IA 4ZN6A 3NBUA 1I0LA 3WA7A 1WZ2A 3ZEIA 4QUDA 1SHLA 5IM4A 3JWJA 3B9QA 4X60A 2TYSB 4P2BA 2XTAA 4K6FA 1WUHS 4OG2A 1Y7IA 2W6NA 3ZCPA 2QZ9A 4DE5A 4EX6A 5JOQA 1ZJ6A 1T8TA 5ALUA 1JLLA 3NM5A 2DQKA 5BWCA 2JCGA 5H02A 2BFBB 5G0SA 1M7HA 3VGPA 1ULHA 4IRUB 4JBLA 1D0SA 3OOEA 4L1KA 1ISGA 3N5KA 1ZJ5A 4LMBA 1W48A 5JAQA 3UMRA 2DPLA 2GUWA 1P9WA 3QF7A 4OHMA 4UTXA 4C06A 2IP2A 3JAWB 1HORA 2HDWA 3L0OA 3RKRA 2H1VA 3FNEA 3HUUA 1MAWA 2VJYA 2ZJAA 2R44A 1LDYA 1PV2A 3QHQA 2B1IA 2QENA 2J5BA 4WXMA 5LMZA 3ZV5A 3RIXA 3A58B 1KAEA 4L6CA 3GEHA 1V48A 3F47A 2QVBA 3HNRA 2WQ7A 3ROZA 3ZE7A 4XWKA 4HAWA 4N3CA 1IONA 4FHGA 1A96A 2FFJA 1X7GA 1IEQA 1G3RA 2GPWA 2O3JA 3IXQA 4CF6A 4F12A 4QZVA 3X2EA 4Z2AA 2E49A 1T13A 4F72A 4XAQA 4P34A 3X44A 2C5EA 3BIFA 2FLWA 2O52A 4DCJA 2FP4B 2UZ4A 1P7VA 1B43A 1FP4B 4FSHA 3HHEA 4DIFA 2RB4A 2C9YA 1A5TA 5KPJA 3N2YA 3RR2A 3FZGA 1YOVB 3TOSA 4A5SA 1XZHA 3Q5EA 1BSVA 2A7XA 5DGHA 3V55A 4P54A 4L50A 5IUNC 1SCUB 2JF0A 3AM4A 1T43A 2Y92A 5I01A 4CT4B 1ECJA 3AHIA 4XLTA 1RJWA 1TVMA 1RQ2A 3I0MA 5F4BA 4EI9A 3A1SA 1CFJA 2AZXA 4O2BB 1FW8A 1SFRA 2V03A 2WTMA 1X38A 2P9GA 2OD9A 2P1RA 4KZPA 5EIFA 3FGZA 2VBIA 1KPIA 4Z5XA 5EIWA 5D86A 1K98A 4H60A 5A5DA 4TQGA 3EJ6A 3NTUA 1O5TA 3GNTA 4LBVA 4M8KA 2F3RA 1HL3A 2IZZA 3THYB 2R8ZA 3N70A 1TE2A 4RD4A 1IM5A 2PDAA 2RK4A 3IJPA 2ZJBA 2ZR8A 4MAFA 1Y8QB 2VAWA 4HSEA 3ICPA 4WLFA 4P38A 3TMKA 2RAFA 2WW8A 3NRCA 4ILKA 4X45A 2AN3A 3SR3A 1DAHA 1JGTA 3PDHA 4XDYA 3LYUA 4BCDA 3TLYA 3I6IA 2YMQA 1LPNA 3K8ZA 4MUEA 1GXSA 5CG1A 1BW9A 2AF3C 3IKMB 3TQOA 2M6KA 1SXGA 2AS0A 2FA9A 4ZXPA 3S8EA 3P5BA 4L28A 3IP7A 3TIFA 3UJPA 1R6XA 1HT3A 2CUKA 1HYGA 1KHTA 4FFOA 3M6FA 3ZLJA 3Q41A 5H3HA 1XHFA 4HUJA 1DG9A 5EXEA 3QEOA 1OIVA 3RC8A 2FVYA 1CJUC 3HU2A 3LFHA 5AKXA 1ESDA 1GLVA 3GEPA 1W5SA 3ESDA 1E58A 4U63A 2JGRA 1ONBA 1VFPA 3D02A 3ZZUA 3PHCA 4KSYA 3QBVA 3HSYA 3HS3A 2EARA 1WB4A 2D1YA 4GX5A 2GKOA 4Q3DA 4BO8A 4C0QC 3ZV7A 5DASA 4WXHA 3L1IA 1KI6B 2X19A 1JS1X 3DVAA 4XB2A 2CMGA 1CQIA 4MJ3A 1PUIA 3AEKB 1N33B 5C4MA 2WZCA 4ZI3A 2N42A 2QL6A 3N7TA 1WXFA 4JYMA 3LX5A 5CB6A 1RYZA 4AIRA 1IUNA 1U3TA 2IP4A 2IUSA 3RYFB 3SM3A 1JEYA 5DP2A 2P4QA 2PNFA 1FSZA 1YRAA 1THMA 1WPGA 5EZSA 5JMPA 1P5JA 3LD9A 3LPLA 3VPXA 3WLHA 4EYSA 3THWB 1J0DA 2A57A 4UVIA 1QDLB 3WAKA 1QO0D 3H3XA 3L0YA 1QK4A 1WWKA 4EB6B 3HXLA 3N8GA 2ATEA 4FDVA 1SOWA 1YA6A 2BHRA 5GY7A 1SD2A 2OUKA 3FGNA 3JS5A 5DYGA 4D44A 3OAAD 3HYTA 1O4VA 4DM4A 1ZUWA 3CIOA 4LXQA 1A7JA 1W6RA 2IBMA 1D8TA 5D00A 3S27A 1KRWA 3CQ9A 4LKRA 2Q0QA 3FZNA 1RQNA 3P52A 3PWSA 2CJYA 4DCMA 2O54A 4BATA 3MWDA 4NAVA 1MJGA 2OCKA 3CM0A 4HQLA 3A31A 1IC6A 5BMVA 2K4MA 3DFUA 1XVLA 2I2WA 2KBFA 3GJYA 4N48A 1QBGA 2D00A 3HLTA 4GZ3A 3KT3A 3RUIA 4CMJA 1UCFA 2HPAA 2ERCA 2X6TA 1RKBA 2H4ZA 1QR2A 2C83A 5HBRA 4YUYA 1AV6A 1AQ6A 3K9QO 3WQSB 1YWGO 3E35A 5J43A 2WM2A 3PR2B 2D06A 3PGVA 2FFHA 2V4UA 2NLOA 3CY6A 5K4HA 2V4ZA 2VF2A 2ZBDA 5EZ6B 3HM2A 4CL0A 1BCSA 4D0SA 2IPAB 2VPYA 2MSNA 3IAXA 4GGPA 4WSOA 4NC9A 4A15A 1CUEA 3Q1LA 3K35A 4OGWA 4BMNA 3ECAA 3R7FA 5C35A 5FWYA 4PIPA 1WW2A 4A0GA 3USCS 4DSZA 4D4LA 4WFJA 4YGXB 1GAXA 4KIWA 5JCOA 3OEEA 4KE9A 1DX9A 4PPGA 3RCBA 2OK7A 5B6JA 4E0BA 1U1EA 5BWNA 1NG1A 1WOYA 3KJQA 2XQJA 2GPTA 5JXIA 5KOHA 4MJLA 4E5SA 2HHLA 4C4OA 1EGQA 4DQKA 4JODA 5FP0A 4B4DA 4EATA 5HZHA 2OESA 3QLUA 3EC7A 1KOFA 1QE3A 2VWQA 1SUIA 3CA8A 4LE1A 2Z57A 2A1TS 2BMFA 2O8VA 5DBEX 4BMCA 4F5WA 1AD2A 6YASA 5EUMA 1I94B 1QTRA 4A0RA 1UXKA 2QW8A 1BE0A 5EE9A 2OAQ1 4IJQA 4KFSA 2G09A 3ND8A 4QRHA 2FFBA 1X77A 5B1IA 2WD7A 5G2OA 1NW4A 5P8WA 1ZGBA 4ZI7F 1PFKA 2HMTA 5AKKA 4EW2A 3F5SA 3KJNA 4EFNA 1EFAA 4MKGA 5DX8A 5B5SA 1X7XA 1IOZA 3DC7A 1LZKA 3K1AB 3P2KA 3U61B 5ELXA 4UU7A 5FI3A 1MX3A 4QO8A 1Z0IA 3JVIA 2KX7A 1PX2A 4WDQA 2A88A 2HKIA 3B1KA 1MU0A 2CVQA 2V8OA 3DBHB 1EFRD 1QJ4A 3FSRA 4FEEA 4PSCA 5DHRA 2X15A 2RFLA 4ACBA 2WWHA 4UDOA 3ABQB 3RHTA 2WIJA 1OH6A 3D1VA 1EFVB 2VCEA 1OU0A 2OD7A 2VSFA 2V6BA 2ZYSA 4M1QA 3COYA 4MQEA 4O2AB 2QWXA 4EMSA 4ARZA 1PR1A 3A04A 4RLFA 1QDUA 3N07A 1CR1A 3PQFA 4LKOA 4Q3OA 3W8DA 4LZAA 4BLOA 1X42A 3KWLA 1LS1A 2IEBA 1GNQA 1E79A 4YGYA 5AT1A 3KCQA 4PLFA 4JI3B 3B51X 2YY7A 2OZPA 2OKGA 4DLUA 2PQ6A 4I8XA 3GRPA 4C6RA 5F64A 1R15A 3A1TA 5DI3A 2IU4A 1W2WB 3OD1A 3ZDXB 5KTPA 5HIIA 2P90A 1OX5A 3A37A 5HR5A 4J6EA 2CLKB 4QXMA 4GBED 1K3FA 2QTLA 3ORFA 1GUBA 2HD4A 3W2IA 1CXZA 1G3QA 3AQIA 2JHAA 3FF1A 5DW3A 4LMPA 1EHCA 4GM4A 1UM8A 3QSYA 1J4AA 5G02A 3FYUB 1R6AA 3I72A 1W59A 4FQ5A 1A98A 1OLUA 2CLDX 2EFJA 3SMQA 4XLLA 4WOCA 1W49A 4TWAA 4P4SB 4HWTA 3O8QA 2FOLA 2CXUA 3NGXA 3IE1A 5BRAA 3DBOB 1H69A 1M73E 2C8LA 2G76A 1WM1A 3BL6A 4E12A 4YV1A 1W34A 3DBHA 1RXVA 4M0UA 3RVMA 2QE7A 3VMFA 4BZZA 2R6HA 2OSBA 1Q19A 1WV0A 1FNBA 3I2KA 1UBEA 2A1IA 2XTNA 1K7SN 5JCOC 2PMCA 4M7WA 1PJTA 1KK1A 4YAKA 3GRVA 2POCA 2J3LA 3GH3A 3U7EB 3HCRA 1G20B 3UA3A 4XDHA 4V2IA 5BW5A 3H87A 3PI7A 1IU9A 4NYJQ 3HCPA 4NZYA 2IYQA 2I3DA 1E9CA 4PQYA 1X2EA 4TYNA 1WRBA 1S4QA 2GLUA 3H8VA 1XGKA 1Q1QA 4TM8A 2PSSA 1CSEE 1XTUA 1N2JA 1C1XA 1JR3D 3WK4A 1G16A 3ZUPA 2F8SA 4P0QB 1TA4A 4HWPA 4L72A 1IHDA 4LMAA 1V96A 3ZDQA 7REQB 3Q8MA 4A8TA 2LZ0A 2PFSA 3UAYA 3COWA 5ICMA 2G1UA 3LPAA 2BBTA 3HRKA 3MTDA 2FN7A 3AC0A 1Y1RA 2VRCA 3NTLA 4CDMA 4ENWA 1R8SA 3RFUA 1EK0A 2NV2B 3ZDEA 2HFJA 2IQIA 1OT5A 3N2KA 4LXYA 5CR9A 5A4MS 5MFPA 2YOGA 1FIUA 2QNIA 3I9MA 3LLSA 2E4VA 3T4UA 2ZCJA 2OCBA 4OQYA 1X1TA 1LC0A 4KGXA 1GNPA 1T9BA 2Q62A 4OQ4A 2HLDA 4QC2A 3MW8A 2P11A 5J5VA 4H7HA 4P84A 4EMUA 1RI4A 2O3QA 4IFBA 1ZDMA 2HSWA 3D3EA 3VPSA 4AP5A 3SXUB 5KNCA 1A0OA 4IDBA 4MINA 4PSDA 4OXIA 4M1OA 5EPOA 2F55A 2ZSBA 3KHKA 4PNHA 4UQLA 1IJFA 3UWMA 3LVFO 4IIUA 4CFYA 5ECGC 2WWRA 1E6KA 3SJ7A 4RMIA 4HDMB 5FPTA 3MNFA 1N5MA 1OSNA 5BMVF 3ZVRA 5IM4F 3TOCA 3BEDA 1XEXB 1VPTA 3NNNA 3CNOA 5K3FB 1UAGA 4OGFA 1KSGA 1JDNA 1UFRA 5MGBA 4JJZA 3E15A 1NHWA 2XZTA 1S2LA 3FWNA 2IXFA 3M9LA 2XZPA 5IBPA 2Y76A 5KNDH 3CUEF 1NATA 1XNQB 4PYMA 1W5TA 3M4ZA 3ABSB 5FTKA 5ALJA 3MWGA 3OHMA 4E51A 1U0RA 2BJVA 2XNCA 3Q0TA 3NX4A 1E2UA 4I1IA 3PHGA 1Z06A 4QHSA 2J6CA 3DEJA 3FOCA 3O1JC 3R40A 4MRAA 5DI3B 1Q3TA 1CBUA 4ZT5A 1B0UA 2PH5A 2B36A 5EZYB 4AKIA 4HNSA 3U13A 5AW7A 4PSUA 3QKWA 3M3PA 1LK5A 1QKIA 3IOMA 3IAHA 4FUTA 3STVA 4NCJA 1VSTA 4MUKA 3JWPA 3ZEAA 2FH5B 1OI2A 4KQEA 1F48A 4DUYB 1CZKA 2VF8A 4IIEA 3NHRA 2JZCA 4JGIA 2WB2A 2FW7A 3WZMA 4NJEA 3CG0A 4CLHA 4DGSA 2Z5GA 5KYWB 4JYAB 5FWNA 3RUHA 4B3CA 1OT3A 2W11A 2I2XB 1F17A 1ORDA 2UYOA 2VNSA 4J1SA 3VOBA 2DPHA 9LDBA 3JZMA 4R84A 2Y67A 4U7DA 1QK3A 3R7SA 1P44A 3FMOB 1EQ2A 4M3NA 3DDHA 3G0BA 4GR4A 2I78A 1N2OA 1P2DA 2PZLA 4D7AA 1XYGA 4Q21A 2GUGA 5GV8A 1SU7A 3MCUA 4MKFA 2MYPA 1WQ4A 3PFKA 1UPBA 3DMYA 3D6HA 1TZKA 3LPDA 1JDTA 1E9FA 2CLFB 1GZHB 3HYCA 1XZNA 4AROA 1T5LA 1WQ1R 5FPPA 2ZWAA 1IHXA 1US8A 3T7RA 5FNZA 4B4UA 1Q2UA 1D6JA 1XN1A 2FMXA 1J8QA 3DDCA 2P1ZA 4QGHA 2I1WA 1FSGA 2EZUA 1E1NA 3N86A 5ETJA 2V7QD 5GJWC 1ZIPA 4XTRA 3RSCA 4NATA 3SDBA 3DLPX 3VR5H 1MT3A 1XZJA 3DTYA 4W7SA 4YP5A 4CLOA 3N3BC 4RESA 3NB0A 3A06A 2IXGA 3BGDA 3SIRA 1I3MA 1YFJA 2JK1A 2M6SA 2XKBA 4X1IA 4TRNA 3VVBA 3FUVA 2WIDA 2BOVA 4DDVA 2WVHA 2Z3VA 4ML3A 4OXKA 3G9XA 4LRTB 4AKEA 1W8DA 5EHGA 1FMFA 2Z58A 2KPOA 3AJEA 5D2CA 5DK6A 1KQFA 1EFCA 1T8PA 3ELUA 2EEZA 4D9FA 4KHPB 3C7TA 3IKLA 4DLSA 1LI5A 1V5EA 3CX6A 3NHYA 4HCJA 5F1KA 4ECEA 1X1QA 2JK0A 3C74A 3ZNPA 4YAIA 1P1HA 1NJ1A 1OXKB 2HCBA 2WE8A 3IMCA 4IDGA 4K9RA 4BNGA 1NI4A 4WAUA 4XCVA 2A9JA 3SR0A 4MV6A 1T2AA 3Q6MA 4CWAA 1GGJA 4EJ0A 1H2XA 1XLVA 3E9NA 1BE8A 1NYQA 1SUPA 3EVAA 4LXUA 3L3BA 1ZPDA 4S0ZA 3B6ZA 5E6UB 5J63A 1UT6A 3ETDA 4UBKA 2VSXA 2PFGA 2RGDA 3VX4A 1TKRA 2OXRA 2ZTLA 2QU8A 4M76B