3GT4A

Structure of proteinase k with the magic triangle i3c
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords proteinase K
publication title The magic triangle goes MAD: experimental phasing with a bromine derivative
pubmed doi rcsb
molecule tags Hydrolase
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3gt4A00
1NDQA 3EDYA 1SBCA 1T1GA 1OYVA 3VHQA 3I34X 4NE7A 3LPCA 3BGOS 4C3UA 1DUIA 1Y48E 2Z30A 1SUBA 2IY9A 4RYDA 3F7OA 1TECE 2PMWB 1WSDA 1WMDA 1BE6A 3PTLA 2X8JB 3P5BA 4H6VA 3VV3A 1P8JA 1S01A 4H6WA 3VYVA 1TO2E 3DE1X 4B5LA 1AK9A 1LW6E 3WQBA 5JXJA 1GA6A 1KDYA 1YJBA 3BPSA 3SQOA 1GA4A 1PEKE 2SBTA 5AVKA 2WV7A 3TI9A 4M1ZA 5SICE 4LVOA 2ST1A 1GNVA 3I2YX 3SICE 3WIUA 2ZRQA 3GCXA 2W2NA 5JMOA 2WUVA 4WOCA 1SIOA 2ZWPA 1SUEA 2ID8A 4BWGA 2IXTA 1GA1A 1EGQA 1WVMA 4OV6B 2SECE 1SIBE 3HJRA 1SUPA 2TECE 3CO0S 1CNMA 1YJAA 2Z57A 4J94A 3I37X 5FAXA 3QTLA 3PRKE 5ARDA 3A3NA 5AQEA 4ZOQI 1ST3A 3VV2A 4AKSA 3H42B 4Z2AA 4HX2A 1Y1KE 3DE5X 3OSZA 4KB5A 3LPAA 3GT3A 3DE0X 4FONA 1SUAA 1AU9A 2W2OA 1R64A 1UBNA 3DVQX 5JXIA 2G4VA 1ZVJA 3CNQS 1PTKA 1Y34E 3BX1A 1GTG1 3QMPA 4CFZA 3VSBA 3DE3X 1TK2A 2P4EA 3GT4A 1SCBA 4KG7A 1Y3DE 1BE8A 1SPBS 2DP4E 1XF1A 3T41A 2PWAA 3GCWA 3QFHA 2XRMA 1SBNE 3LXUX 2QTWB 3EE6A 1AVTA 2DQKA 3ZXYA 4AKTA 1BFKA 5ARBA 2W2MA 2WUWE 2Z58A 2HPZA 2PWBA 3DE2X 2Z56A 1IC6A 5K7SA 1BH6A 1DBIA 1BJRE 1GT91 4NE9A 3A3OA 1T1EA 1R0RE 4JP8A 3UNXA 1V6CA 5FBZA 3DE4X 4HVLA 1Q5PA 3VTAA 3TECE 3F49S 1PJ8A 3WIVA 2ZWOA 1C3LA 1AH2A 3WHIA 4NMXB 1TO1E 1TM7E 2HD4A 5JXGA 4ZARA 1C9JA 1KDVA 3ZXXA 4I0WB 2V8BA 1SH7A 1NLUA 4GI3A 1GTJ1 1GNSA 3D43A 1SVNA 1C9MA 1SBTA 3A3PA 1TM3E 3DW3X 5B1DA 1KE2A 1TMGE 1SIUA 1Y33E 4OMCA 1SBHA 1NDUA 1YJCA 3L1KA 3TI7A 1GTL1 4KPGA 1Y4AE 4OMDA 2PYZA 1PFGA 3DWEX 1SCNE 1SBIA 1TM4E 2Z2YA 2SICE 1OYOA 1S02A 1TM5E 1GCIA 1SCJA 1C9NA 1VSBA 3AFGA 1IAVA 1KDZA 1P7VA 4DZTA 2GKOA 1HT3A 5I9SA 1R6VA 1AF4A 3LPDA 1OT5A 1AV7A 1THMA 3DE6X 3DW1X 2WWTA 3I30X 1SN7A 5JXHA 1T1IA 1SCDA 2DUJA 2Z2XA 1SUCA 1WMFA 3DDZX 1BFUA 2XTJA 4DWWA 3AJ9A 1JEAA 5B1EA 2SNIE 4C3VA 3DVSX 2E1PA 2PRKA 1P7WA 1SELA 2W2PA 3AJ8A 4CFYA 4K8RB 1Y3BE 1ZVKA 4LVNA 4MZDA 1Y4DE 3DE7X 3EIFA 3Q40A 4CG0A 4DJ5X 1MEEA 1SUDA 3Q5GA 3D9QX 5AVJA 2ID4A 4WOBA 1ST2A 3F7MA 2PQ2A 1Y9ZA 1KE1A 5CW1A 1TM1E 1V5IA 4YN3A 1CSEE 2Z2ZA 5ARCA 1AQNA 5FFNA 1A2QA 1Y3CE 1EA7A 1YU6A 4H6XA 3DVRX 1SCAA 1WMEA 2B6NA 2W2QA 1MPTA 5AMXA 2X8JA 3DYBA 1Y3FE 1S2NA 2PKCA
chains in the Genus database with same CATH superfamily
1DTEA 1PNOA 1RQRA 4N3NA 4NY1A 2VHZA 2HBZA 3N7TA 4RQUA 1JL3A 3PEUA 5EMKA 3G49A 2AZMA 1NSFA 2E3JA 3GA5A 2OCLA 1YQEA 4JYCA 5J5CA 3ZCUA 1Q0TA 3NJ8A 2CNDA 3QG5A 4JXZA 1EWYA 1TUEA 2Q1WA 3HHPA 4FP9A 4P92A 4TLMB 2WWXA 4IL5A 3CVJA 2XI4A 2QP9X 1UC4B 1KQ3A 2GYUA 2Q8NA 2WMYA 3U4QA 2NU7A 2B34A 1X92A 2DSTA 3R5JA 4LXIA 4BAZA 4UJ5A 2Z83A 2AOWA 1Y4SA 3FDZB 3AUUA 2WF5A 3FPGA 5ITSA 2RHDA 1ECLA 2PKQO 4LHEA 5EWJB 4HWGA 1M8GA 1P9OA 1S01A 1XTUA 3D4LA 4X6YA 4XEHA 1XELA 4PXYA 1XXHE 4H17A 2Q27A 3ZD9A 1JEQB 5K8TA 4U7TB 2BUBA 3V7FA 1NSTA 3GAAA 4E31A 3RB8A 1HDYA 3EUFA 1KGSA 1O94A 5E1OA 1DJQA 4I9NA 1RBMA 3TB4A 3GP8A 4LXTA 3T3EA 1U5AA 1R1DA 1JR3D 1DEAA 3AY6A 5G40A 4L9RA 4D3XA 4X3CA 1W7AA 1Q1NA 2XVYA 4S05A 3EQ2A 1L5WA 4OBWA 5CLLA 4AJ2A 1DX9A 4MIKA 1Q15A 1EK5A 1G2IA 1DQPA 1U6IA 4RDHA 3FWZA 3HXQA 1YJBA 3PFKA 1E2KA 5HNKA 3T94A 1Z82A 4N5LA 3EA5A 3VR4D 3DZGA 3PKZA 1G4UR 1X6VA 4PGHA 1E9CA 4J0DA 2GWRA 3BGSA 2WSMA 3Q87B 4W1SA 5D5HA 3B85A 2AI1A 3ED1A 2PKRA 3M5PA 4L5IA 3O1HB 1KXZA 1TEVA 4MQ5A 1E18A 3R6GA 5D3QA 1WB9A 3FOZA 1UXJA 4I2NA 3DDCA 3GEPA 5BSEA 2HJWA 2P35A 4CEIB 2XBLA 5JS8A 1CQZA 1H65A 2DPMA 2R6JA 3SS9X 1NYRA 1QU2A 1ECGA 2WM9B 4YC7A 4S0XA 2DKOA 1V0JA 3PENA 3Q72A 1XKTA 3B2NA 3MJEA 3PGLA 4D3ZA 4D0NA 4MWGA 3OZFA 4TWBA 3TCXB 3LDHA 5IWCA 1J9GA 2OM6A 2R65A 2CNKA 3AOGA 3GPDG 4HGRA 4QGBA 5EKXA 3PDIA 4I1YA 1P31A 3UOGA 1R5BA 3OPVA 2R00C 5AM2A 1RE0A 1H2RS 5FBKA 4NJEB 2BFEA 3OIFA 5JZMA 3Q9SA 1ZOSA 2NNWB 4F72A 3NCTA 3L7OA 4UTXA 4OK3A 1YB6A 4EHFA 2R4QA 2CCKA 1E0AA 3NVKI 1UKYA 1K86A 2C8VA 2FMHA 3P9YA 3KE8A 5I9MA 3IUNA 1LPPA 1T8YA 1XRRA 1YRLA 3HJUA 4Y98A 3J81A 3WTBA 5EJIA 3EVFA 1P2BA 4UJ3A 1VGQA 2P6OA 5DN6D 4KQHA 4DR4B 2BSXA 1QIKA 3VR1A 2PLNA 3AUTA 4ENWA 1P6UA 1CJBA 4G6ZA 4PX9A 2VK8A 3KZOA 2JD2A 4FFVA 4JVMA 2FWAA 4EB6A 1AMUA 4JQCA 2ACVA 1W1WA 4IIBA 3MT8A 4WKOA 1KYZA 1XTBA 2HLPA 1TQHA 3G23A 2B3TA 3TQCA 3L06A 1QBGA 1X7ZA 4Q18A 4WPGA 3MGAA 4DA6A 4NCNA 2EBWA 1AG9A 1U7DA 4XGNA 3DONA 2XOXA 2OUIA 2HF8A 3TPZA 3ZC3A 2JHCA 2NGRA 1PT7A 2NW6A 3ZUGA 1ZNWA 2O2EA 3AB7A 2NVUA 2XNCA 4KN9S 3V4PB 5CITA 5THXA 4EPYA 1UM9B 3VSCA 1RYNA 2XNSA 1OXUA 3D8RA 3ORSA 2C77A 3T9BA 4IHJF 2C2YA 4B87A 5K99A 5CLJA 3CEMA 4QAJA 5HKBA 1F48A 5EAIA 3HCWA 3DBRA 1G21A 2IYPA 5KNCD 3V8NA 3G5LA 4C7OB 2VNKA 2YINC 4IJUA 1IZZA 1KY3A 4N39A 2XDQB 3OBIA 1A9QA 1RLMA 2C5GA 1QQ6A 3MJ4A 1V25A 1V8DA 1XQVA 4BV2A 3GMDA 2I29A 2XRFA 4ND1A 2A1IA 4MUEA 3WHKA 3WP1B 3L05A 2MCFA 3U7QA 1CQWA 4HQFA 5EINA 3GLIE 3PFGA 4PZDA 4ZYZA 3ZDDA 1FVFA 4KLAA 1GUFA 1WG8A 3K94A 2CMFA 4AP5A 1N3BA 1VI2A 3IUEA 3OQOA 4Z99A 3TXXA 4JIGA 3WFZA 5DBEX 3VM6A 3QWBA 4WBNA 3FUVA 1J99A 3WS7A 4CV3A 3M89A 3PCXA 3CKYA 1PEDA 1HOXA 3AHDA 1EX7A 2IOFA 4O4LB 4PLFA 1KIFA 2EGGA 2OBLA 4JLSA 4WXHA 4CFZA 3U56A 4JDUA 5U4XA 3CV3A 5EQDA 2TMDA 4QPNA 2CD7A 3DKVA 3S0JA 3V7UA 4EFDA 3LHIA 3MBOA 2N9UA 1DOAA 2O3UA 2NTVA 4IIJB 1TI7A 2XB8A 5JCOA 2QZSA 3BWBA 1NV9A 4PX5A 2XE8A 4CR8A 5KTRA 4JBIA 5D2CA 3A9CA 1O97D 1BQEA 3RD5A 1Y1TA 1LF0A 4A1OA 1BE8A 1JR2A 4BJ3A 1ZCFA 3P9SA 3CF6R 4M1WA 4X7BA 5K4GA 1FSPA 1FZTA 1JKJB 3DNFA 1TUIA 4B3JA 5B1HA 4HDRB 4PZZA 1MEJA 1U04A 2JZNA 2GPWA 4FBLA 4BFYA 3NDBB 1HL3A 3K1JA 4EHHA 3ZKAA 5HKLA 4RK4A 1UPBA 2FDXA 4GI5A 1PS9A 3LDFA 4P0TA 1B93A 3OZRA 4N3AA 4DDKA 2DWPA 3B3QA 3N39C 3UJHA 4IKEA 1UF9A 3ESRA 2HH9A 5TGZA 1DU4A 3K0CA 4Q3NA 3W6PA 3TLGB 3CX3A 2BGLA 5D7BA 1XC7A 3G8DA 4D92A 4M7RA 4EEZA 1PFKA 2VRNA 2W2MA 1WULS 3T3MB 1LEHA 3JU3A 2VXOA 4PCVA 4NG4A 1DAIA 3PSHA 3TH5A 5KQGA 3SDZA 1Q0RA 3FSEA 4XYLA 2J1LA 1PGQA 2JBHA 4QJ5A 4TKZA 5I4CA 2PD3A 1OAOA 5BVGB 5C4GB 1J7KA 2FUEA 4E2XA 2HZ7A 2Q0SA 3PQCA 5A3QA 4ABTA 4PXSA 3QVGA 3WIEA 4JC4A 1KI3A 3DJYA 3SX4A 4OX9Y 3H9JA 4YA6A 3PD7A 4RV4A 2DWUA 4MYCA 1P77A 4LHSA 1GT91 4NMWA 4NR0A 4XD7D 2MU1A 3S70A 1T3LA 2O07A 4MPPA 3N86A 5HA5A 3QBVA 3L8YA 2VUUA 3UNXA 4ACBA 3CGWA 4ZFNA 3GA0A 3OQNA 1C3OB 1G66A 4YV0A 4KRXA 4GOXA 4UNPA 4MROA 5KNBA 2ZDQA 1XFDA 3PQDA 5C8YA 3E1SA 5B3KA 1CZUA 1O96A 2P11A 3OX2A 4Y18A 4YMSA 4PS1A 2IZOA 3NCHA 3BK7A 3C15C 2GEFA 3HKCA 4INPA 1K6IA 1AKRA 1MRNA 2H5LA 1NXXA 4RFLA 5KPJA 1PJ8A 4R1OA 4RKWA 4TMVA 4ZC8A 5BSVA 3RVOA 4YRAA 1SU6A 5DTQA 3WK4A 9GPBA 4JI4B 4RIGA 1V41E 1XB2A 3MVEA 1VBFA 4OG2A 2YUTA 1G8PA 2O4CA 5LOVB 2AFHE 3TINA 1R3UA 1FXWA 4H1HA 1RYZA 4AZ0A 4XR4A 1K3TA 1TO1E 4ZO6A 4P93A 5IJ0A 3O2JA 5LA6A 3Q15C 1XUOA 1WSWA 1EX1A 2Y05A 5I7WA 5KQPA 3BFXA 1PR9A 4MJ3A 4P4SA 3TMAA 4ECEA 4MZXA 2CLHB 1QYIA 2OZVA 2E2WA 1PEYA 2XTAA 4ZARA 3PVCA 5FLXA 1PL0A 4MSUA 1S1CA 4FDMA 1RW4A 4RX1A 4EI7A 4MQFB 4CQMD 1EQAA 4P2BA 3PQ4A 1TL7C 1CEYA 3GDHA 3I61A 1GKIA 1I4DD 1U2DA 3OPYI 3UYLA 4N7RA 4PW0A 3QGMA 4F96A 1S7CA 3FVVA 3LCRA 1LZLA 3NAMA 2OC4A 5CP8A 4GPEA 4RMHA 1NOJA 4UOZA 1GTJ1 3R74A 3EPKA 1SVSA 1V3VA 1E3IA 1LXCA 1Q1GA 2DBQA 5DNVA 2Z5LA 3E03A 4JT8A 421PA 2ZYSA 4XIYA 4RJ2A 3K70B 3FOCA 4LDAA 1MG5A 2O8FA 4I55B 3SVLA 3KTDA 1RCFA 1PG5A 1BCRB 1YR6A 3BDVA 3GO4A 3NFRA 3U5TA 1JU4A 4MV1A 3GH1A 3ZE1B 3OZIA 1M8KA 2AUNA 1Z62A 2H5IA 3PLNA 1DBWA 3QE2A 2ZYIA 4O2BF 1I7PA 2QGFA 3FUTA 1F60A 4M0DA 3RJ9A 4FCVA 3CR3C 2FK8A 4QXAA 5B4TA 3IXMA 5BQXA 4YHBA 2J7PD 4OXKA 2PGNA 3RSQA 3VPDA 3NTUA 4AZ3A 1NVBA 1P60A 3PNSA 1T4MA 3M2TA 4TMYA 4UASA 3TI7A 4N9WA 1NF3A 5BT9A 1VMKA 6LDHA 4F86A 4P7KA 1ZK4A 4GM0A 4OHXA 1QZXA 1E1LA 1PV1A 3CXUA 4FS8A 2A5JA 16PKA 5K3BA 3EH1A 3AETA 3I9NA 4V0KA 3I72A 1SBYA 5GWXA 2H1VA 1TJ4A 3HI4A 2PGXA 2OFXA 1HEYA 3OY7A 3OBBA 4F3RA 3ENWA 3QSYA 2H4FA 4KQJA 4EFLA 4OGLA 5H68A 3UO8B 4CV2A 1R4MB 3W2FA 5LFAA 1Q0SA 4LWQA 4QEZA 4QODA 2YXEA 3TSZA 3T54A 3KIPA 5EQFA 3K3PA 1OIWA 5IC6A 2UZAA 4EFMA 2E5WA 1I5RA 2QVYX 4K6CA 4AYTA 2WJ4A 1DBQA 1NP7A 3B8EA 4WKPA 2ZUEA 2JZCA 4QOJA 2GASA 5EIAA 1USGA 3AK4A 3FRJA 2M9MA 4IWXA 4LI0A 3O4IA 4LK3A 2HBQA 4WMLA 1RNLA 1I1HA 2OCDA 1NI4A 4ZT5A 1EK0A 5M04A 3PFNA 1KEEA 2A57A 1M7GA 3HCRA 3LVRE 1XMIA 3JAKB 3MINB 5K6AC 1P4HA 1WTCA 1VSBA 3ICVA 1GTVA 2XUZA 1BG6A 2ZSUA 4PR3A 5K0FA 2BDEA 3A7DA 2ZSIA 4RSGA 4RXUA 4OAPA 5EZYF 4WLOA 1ZUHA 5DLPA 1ZHHA 2NU9B 1H0SA 4QM6A 5JIBA 1R6VA 1US8B 1QJ4A 5IEBA 3MWDA 2JK0A 1AF4A 3U7HB 1U0JA 2A33A 3AZQA 3V4SA 5H59A 4AUNA 4RTJA 1JHYA 2ZPAA 4IR7A 3W7AA 5AKXA 2ONYA 1T9BA 1TU4A 4Y6GB 3LYHA 4FYPA 4M8SA 1KBQA 5DI3A 3M1IA 4L8WB 4IY1A 4ZHQB 2QR5A 3IKVA 2WUFA 3A4IA 3HFRA 4C3ZA 1QFXA 2DUJA 1N6LA 3I9V6 4KQ9A 2KJQA 2WPNA 2QE7D 3MIZA 3ZEAA 3G17A 1IUNA 2P6PA 1RXCA 5EIXA 4XVQA 2QORA 4RK0A 5JS2A 2G9ZA 1FIUA 3AJ9A 2X8BA 1N5OX 3G0OA 1W0KD 2JEYA 4Z51A 4AY6A 1PWYE 3VHLB 3ITEA 2FPGA 3KLOA 2YASA 4ZO8A 3WQSB 2D0IA 5EE9A 3RU9A 1C1XB 2ZGVA 3KEOA 3QBTA 4I8IA 3H5IA 2CXSA 3LI2A 2E6UX 3VSAA 3L93A 1RC8A 3Q3GE 4DARA 1Y9EA 2W00A 2PS9A 3C1UA 3EXG2 3A8TA 3GRCA 4GX0A 1P7CA 4KP7A 4Q7MB 3INGA 3RU7A 4NU6A 4C9BA 4H3SA 4NOMA 3X44A 1ULAA 5AOCA 2JRCA 5T3UA 2DR0A 2Q2OA 1L4MA 3NGMA 3PYXA 1E8NA 4M9ZA 5G0UA 4EUKA 1WHSB 2ZYRA 4KWCA 3GK3A 1ZUIA 1JBQA 1KOJA 2WJYA 4MVJF 1ZVKA 3QLUC 4LCEA 4WFJA 4DMFA 1C7JA 3LFTA 5IUNC 2IXGA 1X0VA 2H4YA 3CISA 1AUVA 3SX0A 3P7MA 3MJHA 1JHQA 5CFLA 3AVWA 3MWYW 4ES6A 4R6WA 1GKYA 1K89A 1J8QA 1LPAB 1FVXA 2B94A 3KBBA 3EB9A 4PAWA 4CG0A 4EUHA 2OMEA 3Q1KA 4GKBA 1X15A 4I5EA 4KMRA 4XQEA 4DIKA 2CJXA 1FYWA 2X8LA 3DO6A 3DWIA 4RD3A 1IH8A 5ECDA 3VO1A 5LQJA 1JALA 2J33A 1IEXA 4B81A 4Q3AA 1V11B 1QVRA 1NAHA 2GK3A 3RVKA 5JJ5A 1OREA 1XRLA 2BVNA 3IVXA 4RVHA 4ABYA 3B13B 4KBFA 1XD8A 3F7MA 3IS3A 4BN0A 2BTEA 5EHNA 5D01A 3UFBA 4LGYA 2ZI4A 2HU5A 5C7OO 1CF9A 2C7PA 2C3UA 1BXZA 3OPYB 3AF4A 4RA9A 1E2NA 5CW1A 3QVWA 1HWYA 4CMAA 2P77A 2PX3A 5HX7A 3QFFA 2R6GA 2HQBA 1W1UA 2FQXA 1OX4A 4HDCA 1TCVA 5JVDB 3KWLA 4MUIA 4XSVA 5K05A 1NMSA 2FE1A 5ILGA 1IBLB 2FI1A 1YS6A 4ID3A 1AZWA 1U3VA 4E09A 2BHSA 1GO2A 2H5EA 4LDRA 4L4SA 1G8SA 5JJLA 3MRVA 1UBMS 4AO6A 1Y1SA 2JL1A 3OIWA 1UQUA 2C5AA 2IA5A 4G09A 4MLPA 3O1JC 5H1YA 2HJ9A 4KFRA 1EFDN 4NBWA 1F8GA 4HRYA 2G3YA 1TU0A 1L5OA 2GBLA 2WHPB 1XXLA 2H1OA 1UKVY 5F4BA 1XLTC 4ITUA 5FOTA 1E66A 4JZKA 4YIKA 5HIIA 4HYEA 3UMSA 5A4DA 4JR2A 4O6VA 1JLLB 4IG4A 2QVGA 1KK1A 2JAUA 3KJIA 2IPXA 2WD7B 2NXJA 1V7CA 1EDEA 2BHTA 4UAUA 1OYVA 2I3DA 3IQZA 2XB2A 2SHKA 1V48A 4MV5A 2O3TA 1C7FA 1MFZA 1ZYUA 4KI7A 4LV8B 4CEJA 2ZYWX 4HJRA 1Q12A 3NWJA 4WW0A 3U60B 2PX5A 4HJXA 1IEWA 3A9UA 3FUCA 3ONEA 2FZ5A 4HSGA 5G3ZA 1YCFA 3VU9B 4MKGA 2D13A 3VC2A 3IAM6 1TECE 1GFZA 1ESMA 2WKSA 4URXR 5I48A 2BJHA 1JE1A 4QDTA 5LZ4A 1UXHA 1RS0A 3PI6A 2OGSA 4XPIB 4B73A 5CEFA 2RAUA 3UN1A 5DBIA 3JWGA 4AUKA 5BV8A 3AM3A 3ABSB 5T41A 3CIFA 1NN1A 1MVOA 4WZBE 1U81A 5D7NA 2EG9A 1AGRA 2IGTA 5BYJA 3IAAA 3VU3A 4DSNA 1YC2A 1J5XA 5K0ZA 1TQ2A 5D51S 2EP8A 1O8BA 2IW3A 1AS2A 4DRXB 2L19A 2OWEA 5FB3A 1KRXA 3ZHSA 2H8KA 4I6GA 4OHMA 2XZDA 4MULA 3WQBA 3S29A 1KSHA 3PHCA 4GH5A 1ZGBA 3CUTA 2BHRA 4NHOA 1B42A 4TSFA 1XF9A 3A1WA 1ZW1A 3OE7D 3IT0A 2H4HA 1NLYA 1Q6ZA 2ESRA 3ND7A 2HXSA 1YUNA 3LP6A 4JQOA 5BSKA 3RFVA 3GDOA 2NTYC 4IHQA 4L16A 1V9CA 3SKYA 4EB0A 4IHAA 1A9TA 1FFAA 4GUAA 4ZVSA 4NYMR 2GETA 4YMHA 4DIDA 1IRIA 2O5EA 1W2GA 3KUUA 4R1MA 2YZ7A 5JFGA 2J9FA 3E5MA 4HWOA 5I47A 2W2KA 2BRUC 2C59A 1KJ9A 5JAHA 3ITKA 2IXFA 3W4IA 3VTKA 4NVRA 3LUFA 5EIFA 4Y30A 1XZ8A 4RGQA 2BI8A 2G80A 1R5NA 3L6DA 1ZN2A 3M6WA 3WWZA 5EJ6A 3I28A 5CNJA 3B6EA 1BVRA 2X7XA 1U80A 4G2TA 4MLZA 2YTZA 5HP4A 5E1BA 3FX2A 3S2GA 5KVSA 1BW9A 1E4VA 1XHLA 2AN5A 3EMKA 4IIGA 2FEMA 4WA7A 2JCYA 3B6JA 1F2UA 2P3OA 3L40A 2P0EA 1YE8A 5C80A 1LPOA 2IV2X 4KXWA 4NENB 1UXGA 3ET5A 3EFHA 4YONB 4GR5A 1RR6A 2BFCB 1DWOA 2A58A 2G0AA 2QENA 2IUFA 3EZFA 4KLCA 2XZPA 1KOLA 3HS3A 2F3SA 2FUG6 2JFYA 2CUZA 3L7JA 3E3NA 5TF4A 4OI2A 4DJJA 1PZFA 4TPKA 5EIHA 4KI0A 2JIDA 3KOOA 3ME5A 4HNTA 1WU8A 3EN0A 2VDLB 3L0ZA 3ROZA 4I36A 1CUUA 2Q07A 5BP7A 4IDBA 4BTEA 1I3CA 3WYDA 3ZCQA 3KDPA 5BMOA 3P26A 4UDYX 2FPWA 1L3BA 1O6BA 1O6ZA 1J21A 3N05A 4AXXA 2JFOA 3D8TA 2V5AA 3FBTA 4EHKA 2GERA 4JB2A 1N7GA 4CN8A 2XCSB 1QQ7A 5KWIA 1QONA 1D2NA 1XAJA 2P4SA 3BHMA 3UWDA 3M4JA 4ROTA 1M10A 1JWAB 1O89A 1YXMA 2XCLA 4XM1A 4TS4A 5L3QA 4S24A 2IWRA 1T5BA 2X13A 3TZCA 1CUDA 1J49A 3P2YA 2J6HA 3GNQA 2BFFA 4KVGA 1WMAA 3KAQA 3D31A 4PU0A 3AO0B 5COQA 4B80A 3H17A 1JDSA 3O82A 2QRQA 5KJCA 2YQ5A 4IDEA 1QHGA 2FMTA 2Z6UA 2WSSA 3H0EA 5CVTA 2IW1A 3TNDA 1R9NA 3WK7A 4CLEA 2HF2A 3GMSA 3USES 2C0CA 1P5ZB 1SD1A 1Q20A 2GF2A 2JGRA 1YASA 3KUXA 2GAOA 5DWDA 1WXXA 1L4HA 3D4IA 1VCMA 5HDBB 4KYIB 4YAGA 3ZDBA 6NULA 2GCPA 4Y1EA 2IYWA 5CIYA 3EAGA 4OGWA 1YFLA 4GWGA 5KYUA 4OL9A 3BEDA 4QTXA 5A9TA 3RC1A 2IEIA 3NI2A 3BWEA 1T91A 3P0HA 5ALPA 4ZCQA 2G06A 2QW1A 3EIHA 2Z3ZA 3AEUA 2HA6A 4G4IA 4HSEA 1D2RA 3D8SA 5SZKB 5T6MA 2RB4A 1AU9A 4QUAA 4DEYA 3NX4A 5JAIA 1JWBB 1SC3A 1TF5A 4QQFA 3ES9A 1PZEA 4RM2A 5JNLA 1P0MA 1HUQA 4TLCA 3DFUA 5I3ZA 5G3YA 2PUBA 5CM2Z 1IXZA 5F52A 1EFRA 1YB7A 2EWWA 3FZQA 1BZYA 4OCZA 5EXXA 5HFJA 3OHSX 2RK4A 4HWRA 4JUAA 4L6AA 5JZSA 4CT0A 4LKRA 2WIFA 2JLZA 4RAOA 1GGHA 3EMVA 3ESYA 4YRBA 4FGJA 2M1ZA 4FNOA 1MC4A 1D1TA 4A10A 4MYTA 2QM0A 4O4IB 4BBZA 4E70A 4N76A 3SIRA 4JK3A 1Z0SA 3QH4A 2HJVA 5C7YA 5IKXA 1XJQA 2EKLA 2YDYA 3K8QA 3QVLA 1WSAA 4RVSA 4X1YB 1K68A 3KQYA 1WOYA 5F33A 5THQA 3GVCA 1LPSA 5DT2A 1QX3A 4ZRNA 3VKGA 4MUKA 2VBFA 4D46A 4DV1B 2ZAIA 3B9RA 4R5HA 3ADOA 2PUFA 4F46A 3NORA 4G56A 5AIBA 2R48A 1JNYA 1K8XB 4UBMA 3TQFA 3K9LA 1XO1A 2GPAA 4L07A 4LDPA 5ARBA 2JFGA 1IXKA 1O3YA 4MQFA 5B3AA 2XA1A 3AVPA 4O2AF 1SXJD 3V8VA 2CBXA 4A0QA 4R68A 2PWYA 5TX7A 3WGTA 721PA 4O0LA 2N47A 1TNDA 2QUJA 3QW2A 3TVYA 3VR5H 4OLBA 1GR1A 2WT8A 4QSHA 2CLFB 1ZLYA 3EGEA 3DSRA 3OSUA 4RH3A 1TPZA 1Z4OA 4J1TA 1VHWA 2M32A 3T9FA 4GLFA 1U8CB 4EDFA 1QTIA 1T4DA 4GYKA 1XRMA 4D7AA 5ALFA 2ZJ1A 3LT5A 4A15A 4UHKA 3GXBA 2HHCA 2YFYA 3K1ZA 4Q9HA 3V9PA 2ZIWB 1V7PC 2PZFA 3N2KA 4AG5A 3DE4X 2AYXA 2OAEA 1G9SA 1VBKA 1C3XA 3BIWA 5BN4B 5F98A 2Q4BA 1RM4A 1D2MA 4QNRA 2AFVA 1JTVA 5JS6A 2I34A 2ZI6A 2XD4A 5LIPA 1ZC3A 1Y37A 4DG5A 1YVRA 1T0JB 3LJKA 2ZWOA 1B0ZA 1CVRA 3OQHA 5JWHA 4FDAA 5FPHA 3S2SA 4F4UA 4JT4A 4LQ4A 4F4CA 1QDUA 2OB1A 1YQWA 5J2TA 3NATA 3KD3A 4YBZA 3PHGA 4LZOA 3FHLA 3DG9A 3SHWA 2H4WA 5AOBA 3RG8A 5BVHB 4DA4A 1VKZA 4R0NA 1JLRA 3NHLA 1EGMB 1W52X 5KYWB 3I09A 3WLQA 2AJTA 2FNAA 1OFGA 5KTSA 4HYTA 3IV7A 1KY2A 3FJ1A 2V3WA 3Q8WA 4XDZA 4D42A 4KLNA 5IT9A 4Q15A 5F64A 4CKEB 1OGJA 1DHRA 2O23A 4O1IA 4GKAA 1R0XA 4U6QA 2ZJOA 2K7ZA 4CLRB 4CMKA 1H8HA 1ZM2A 2XNJA 2J3DA 3ML1A 2RCYA 1E7QA 2VPPA 2CLEB 5M34A 1GWNA 5SYMA 3DLIA 3L2OB 3S2UA 1MO2A 2V8BA 1TE2A 4I4TB 3SZOA 4XD2A 4C03A 5C2JB 4BO4A 5HUHA 3B5IA 4DAOA 3AYXB 5A4IS 3BD9A 1S89A 2PD6A 4HNAA 1OXXK 4CCYB 3R0ZA 1T5HX 4MP3A 1ZO8A 1BDJA 4B76A 1SKAA 1J2RA 2KBEA 4AG3A 1XCPA 3O03A 1TM3E 3TDNA 3EZLA 3QEAZ 1N2CA 1WW3A 4KRYA 2RHCA 4ETNA 2CE7A 3GJ0A 4DVGA 2P5SA 1KI9A 2Z6AA 4OATA 4AW9A 1JE0A 1F51E 3GIDA 2WUDA 3M6MD 4YJFB 3JS5A 3WQRA 1H2YA 2GH1A 1ODLA 2ZU0C 4OMCA 4KKXB 4RV9A 3H11A 1M0EA 2HIAA 5LLDA 2XH8A 2JW5A 4PAOA 3I5AA 1OT3A 4CGZA 1SQ0A 1XHFA 4BFLA 1M8JA 2AC2A 4GBGA 1XVTA 4L3VA 3TZKA 2BP7B 2VHXA 5CHEA 3HLTA 1NG9A 1VE5A 1ISMA 4Q93A 4D9MA 3OCWA 3X1KA 1Q1QA 3BGDA 4PC7A 4RAQA 5IXJA 1PVVA 3KK0A 1Y4AE 4AS2A 1TGYA 3CH5A 2CY0A 3EVEA 2JARA 4MIEA 4PCLA 4B3IA 4X95A 4ESEA 3OF2A 5BOVA 1JMKC 3RJTA 5JNVA 1KDRA 1XALA 3JQAD 2EOAA 2QMYA 4XUCA 3KZMA 4IH1A 1KJIA 3OECA 4AUEA 5BW8A 8ADHA 2GOYA 5ILOA 2VJCA 2WMNB 3B6ZA 2BMWA 3I6MA 4IO0A 2YBEA 2FQ1A 4N6OA 4BBPA 4COKA 5TQVA 1BEUB 2WIKA 1OYOA 1JLKA 2HRBA 2YC4C 3KQKA 1V2GA 4L5JA 1RZ3A 1SULA 4W9RA 3D0OA 4DMGA 5B36A 4BX9A 1Z0AA 1R74A 2P2ZA 1R6DA 2LIPA 4D9IA 1N2EA 2QTAA 2HQSA 3LYLA 1ZRHA 4IFEA 4LECA 2X0EA 5I7HA 1R6XA 3CMMA 3F5MA 2A3NA 3UV6A 3JARA 1S2IA 2IL1A 2PR7A 3UXHA 1PSZA 1XEXA 3DTVD 1YSCA 3Q8LA 1VLZA 2CL6X 3LUKA 2YXLA 3QNWA 4OBXA 1X7HA 3F7TA 1NC1A 1OTXA 3Q12A 5CA1A 1Z74A 1SOVA 1WTAA 1XZGA 4WFKA 5ALWA 4UULA 3FYHA 5AVQA 5KX5B 1SCUA 3E9QA 3QY9A 1EVJA 1V2HE 3SJAA 3UCEA 2QROA 4W4TA 4DUYB 3ZWQA 1MT3A 2FFHA 3PDUA 3HMQA 2YZKA 3AUYA 2JLXA 1AUXA 1Q7EA 2FFAA 3IPXA 4ALJA 3IV6A 4XYMA 1VP3A 3O4FA 1ATZA 5JYCA 5HJEA 1LLQA 1U4NA 2EKZA 3ESQA 4TZTA 4ZCTA 1NR5A 2R8OA 3HO1A 2IHJA 2Z8YM 2LCFA 4B85A 5JAOA 4WX2B 1FOEB 4HXEB 4Q7LA 1GTMA 1DFIA 1U0GA 1XXHB 4GSKA 3I62A 1B0AA 5AKIA 2NSHA 3FWHA 3DULA 1UMBA 4HAWA 2IUYA 2CJFA 2QLJA 5DLQC 4FYHA 2BGGA 4BXOA 2WLSA 4QXMA 4ZI7F 2Q3EA 1FPQA 4PSAA 2OD7A 4G4SO 3KALA 3S2EA 5B3LA 3LUPA 221PA 3BFVA 3VAZA 1ZLXA 1E9AA 2BFMA 1ML4A 1P1JA 3N07A 3VRHA 5EJ8A 4JASB 4RMJA 1VKRA 3MB5A 2F8LA 2AWOA 2BZ0A 2GRAA 3BB4A 3RIGA 2D2VA 1WDWB 2XLBA 4LJSA 2YN4A 4E1AA 3GBSA 3GFBA 5EPOA 1FDSA 2MYTA 1JG2A 5DISB 2ODTX 4ZVPA 1TW3A 2CLIB 1A5SB 4ZVUA 2H7XA 1QHFA 4F1KA 1ZBQA 2GCNA 1XQWA 1JPVA 1NKSA 5GJVC 4KGXA 4CTNA 2ZWIA 2ZS7A 4Q7KA 5CX4A 2AG6A 1J0AA 3NT4A 3QBJA 4TL8A 3P2OA 2E85A 1U6JA 2IELA 3BE5A 4IDPA 4BEVA 1WL8A 5T6BA 3OY2A 1GV1A 2H7YA 2X4LA 3H3JA 3QA9A 5DLYA 5B7QA 3ABRB 1D7OA 4N54A 1ST2A 3DV0B 1Q1ZA 3ASUA 2H0RA 3EGCA 4MKRA 4TS1A 5AH0A 1OU4A 4D45A 4EG7A 3N8IA 2DT5A 3CVYA 4D5GA 3BWMA 4OLJA 1GFSA 4ZQHA 3HKDA 2PXAA 3FF4A 1F5NA 3HCPA 1NF2A 1VG8A 2QZ9A 3ETLA 5CDSA 1V5IA 2LXNA 4I9GA 3RC8A 1WXQA 4E08A 3UPDA 4TN5A 4CKWB 4EA6A 4EJSC 4F3CA 2LDXA 2V7EA 1XOIA 4L2IB 2I67A 4FKBA 3WSVA 2X76A 4KGDA 4B3GA 3DJFA 4Q0MA 4MQEA 4CIXA 4QDXA 1FRZA 3KQPA 4LSMA 5SY4A 2G70A 4EHJA 1JIXA 3G02A 5HZGA 4HQ0A 4QNMA 2ZT5A 3ROEA 1G8YA 4UTVA 2HPVA 3COVA 1A2QA 3L7NA 4QBFA 3KJQA 1ONSA 1EA7A 2DJIA 3MTQA 3N6RA 1V45E 1PSDA 2IE8A 2O0JA 1C9YA 3RANA 3ZD7A 4JX9A 2PZAA 3VU0A 2CXNA 4TTAA 2PVSA 3LY8A 1Q14A 4O2BB 2JIPA 3TOZA 1GAEO 3UV7A 5LIRA 3NHKA 3IJPA 2VIIA 1OC2A 3C4VA 4NONA 5A5VA 2ZI7A 5EUCA 4UVGA 2B30A 5BV0A 1J56A 2CNWA 2AEJA 3U16A 3MCVA 5KYGA 1ENOA 3VHXB 4CI9A 1HYHA 2BGRA 3WGGA 2NPIA 3OIYA 1LDYA 3ORHA 2WJHA 3LA6A 3ZIUA 2XT9A 3TR5A 1NA5A 1SGWA 4WOKA 5F78A 3M4YA 3LPCA 4MARA 2QJTA 4C3UA 4MIYA 4TSRA 1DELA 1DT3A 3L0DA 4LYEA 2X19A 3JWHA 3S2FA 2IY9A 3DMDA 3P2JA 3H87A 1FFHA 2DPGA 5H02A 5DYTA 2HBRA 1UP4A 1XN4A 1I01A 2YNMD 3CUVA 4Y8VA 5HZMA 3NETA 4O02B 2UZ0A 1J7JA 1WMDA 1WSDA 2B8WA 2HA5A 1DINA 1Y89A 2TSYB 5EMHA 1NC3A 2CL0X 1U0TA 4G0PA 4JJ8A 3RK0A 3ZNNA 4LY0A 1LK7A 3VYVA 5IAOA 2XUKA 3ABQB 3PYMA 2A0YA 4B5LA 2RHOA 3HB7A 5LUAA 5A6SB 3GLIB 1ES9A 1H23A 3BILA 2H1FA 3NHFA 2V7TA 1BIFA 2C61A 1QIGA 4HMPA 1U8AA 1VE3A 2DX7A 1JXAA 3RVSA 5TQ2A 3IKMB 4F5YA 1IN8A 1I1OA 2X0IA 3P0EA 3T12A 3EX7C 1VL5A 1KC3A 3N8KA 2GPSA 2EZ4A 4PO8A 2E1RA 1ZIXA 2QE6A 1K4MA 3O6VA 4PSUA 4QE3A 3KPUA 3TLYA 5JS7A 3LLUA 1JAYA 1QR2A 4AL4A 3UBTA 4E5DA 2QV7A 2FRVA 1NW5A 2IEGA 1DRUA 4A3SA 4BNXA 2WV7A 1O77A 1RI1A 1UJCA 4II3A 1Z7BA 1D0IA 1OVMA 3EEFA 4GMKA 3V80A 2Q9UA 2ZR7A 4MPDA 2MSNA 2ZYGA 3DT8A 1CPYA 4PHHA 1M83A 3A9RA 4EY3A 1ZGJA 3HACA 3V8RA 2B7BA 2J32A 3AQIA 3JVVA 4G81A 4Z86A 2IP4A 1I94B 3GCXA 1X1EA 2RBKA 3T0GA 4H0FA 1UZLA 4AKEA 1NL3A 2AW5A 3DBHA 3OJOA 4PZAA 2NZXA 5B7PA 5IK2D 2FPIB 2IX3A 1Q7GA 3R9XA 2GVDC 1FQKA 3PK0A 3P0RA 3QLTA 2IDKA 3OU2A 4TXNA 2PR2A 5AW2A 2Q4TA 3LQKA 5IDVA 5TDHA 4W1QA 2JBWA 2CJYA 1GRCA 1HXHA 2YN0A 3KOMA 1MH9A 1OHHD 3A4VA 4N6GA 4XDYA 1NUPA 4JLBA 3NIWA 1LV7A 3AFIA 1KQOA 1OIXA 2FEOA 2I99A 1TFRA 2JAQA 3LWBA 3LG2A 4NABA 1VPLA 1CCWA 4RPHA 1COZA 1EK2A 3W8DA 3G8CA 3ICOA 2WYWA 1U7HA 3IEMA 3W2HA 1M34A 3HXOA 3DMRA 1F2VA 2UVPB 3NR2A 1GXSB 3D1LA 3IV9A 2O0HA 1NRXA 3RREA 3QNUA 2W4MA 5L3SB 3HA2A 2JC3A 1F12A 1ODSA 3W8NA 3TLEA 2BBOA 1JU9A 3LY7A 5YASA 3RVQA 3OIGA 5E7MA 2KX7A 3O3NB 2CHEA 4BNUA 4YUYA 1HE1C 1S3GA 5DM2A 1UAAA 1HK7A 3M7IA 4OI1A 4QOHA 1M2KA 1XIVA 4HH4A 4ARCA 2NP7A 2DOKA 3RKRA 1O6FA 4H6PA 1K0FA 2OHOA 3NIGB 3RS2A 4JLPA 4UEWA 3VO8A 4YRSA 5C31A 1FSSA 3E48A 1IYZA 4JJIA 5FWYA 6CHYA 1K8ZB 1P7PA 4M6WA 1D6JA 3NUZA 5FV7A 5KCZA 3QOWA 4N7BA 4PO9A 4BQNA 1VCNA 3IEKA 2BGJA 2HMYB 5JY1A 1Z7EA 3O84A 2QMHA 4RS4A 1H22A 2GZ2A 4WFIA 3ZOKA 1Y9DA 5DHTA 1TTQB 1JILA 3Q7RA 4ZTZB 1CXZA 4Z2AA 5CB6A 2Q1SA 1E2UA 3AJDA 3EF1A 1L3CA 3G0HA 3G9TA 1PFYA 5CB4B 1YL7A 3Q3EA 3T4PA 1HKUA 1OYWA 1VSTA 2Y6VA 3GLHA 2WWHA 3C7CB 2P9FA 3GN2A 3I4CA 4FONA 1RLIA 2BM9A 3IQIX 3U3ZA 5LM3A 3L0BA 3OMWA 1RCTE 3H9GA 4L6CA 1EP3B 3PF8A 3USZA 2DZDA 4C89A 2IVFA 4E0BA 2GZSA 3PIDA 1WA5A 4I1UA 4CR6A 4GPBA 4BNDA 2WKQA 5C53B 3VFDA 3JQGA 4D2IA 2W6OA 2G4VA 3NM4A 1MUUA 4Z0NA 5F9FA 3WI7A 5JU6A 1T8PA 2LWIA 4A0FA 3QUTA 5GY7A 3QMPA 4IJWA 3VTZA 3UCXA 2I54A 1KZ6A 4WA8A 5IZCA 3WAGA 2VPIA 3MS7A 5AW5A 3NYWA 4QRHA 2E5LB 1XTJA 3UICA 2BFPA 2HJHA 3GJYA 5CVUA 2VSNA 2P75A 4O4LF 3VMMA 2XAAA 1Z08A 5KI6A 5KOYA 2X5NA 4CMGA 1Q0HA 2YHIA 3O1LA 1E1DA 4OXQA 4CF5A 3CW9A 2BMJA 1K7FB 5J4LA 3SR4A 5HM8A 2BFOA 2PG3A 1PYGA 5TARA 5FV4A 3HBAA 3INYA 4IXMA 1V16B 3GRAA 4IIJF 3ZZNA 1HZJA 5A6VA 3GUYA 4NNOA 4G8CA 1N1GA 3SSAA 3UQZA 1IJEA 1D8AA 2TRSB 3UAOA 4A5OA 3UAXA 5CBPB 2NVOA 5JCJA 5KSZA 3U1BA 3FGZA 4LE0A 5BN1A 1QIMA 1XA3A 1EJ2A 5BOSB 3WWOA 2YW9A 2Q99A 2J87A 5JDCC 4AKHA 2DCUA 3MLBA 4KAFA 4RJKA 4RY9A 3UB4A 2FK7A 2ZP1A 3G9XA 1G7SA 1N4DA 1GGNA 5EFOA 4W6QA 1SB8A 1XZCA 4IF6A 4JLWA 1EJ0A 1J9EA 3OOWA 4B9EA 1AO3A 2ENWA 2AD5A 2PJDA 4QLAA 3FGOA 4UVHA 4M8KA 5AHXA 2JLUA 2R751 2VXCA 1USVA 3B3GA 1PQUA 2W6MA 3RKSA 2AN3A 2I1WA 3K5PA 3T52A 3DBOB 4LZWA 2QTVA 3G0CA 3HDQA 1IUPA 2NX2A 1R27A 4LOAA 3U3MA 4EPVA 5CJPA 3IVCA 4I66A 2Z56A 2VPZA 3FIJA 1IC6A 3AHHA 3K0FB 3WL6A 4JJ6A 3ZE8A 1GPMA 1YQGA 1HLDA 3BAFA 5DM1A 2W8BB 3JCZA 4NE9A 3UMVA 3DMYA 1R18A 4WY5A 3SZLA 1ZPDA 2C9MA 3DLPX 3V4FA 5TS2A 3I01A 4G63A 5EJGA 2ZBDA 1U2RA 2VYND 2R7LA 1GUYA 4JKYA 4BN5A 2O8EA 1X7YB 1QB8A 2VDRB 2F6RA 3ITNA 4HS4A 3LY5A 1KVSA 2Y0EA 5E0KB 4DIBA 1DC8A 4ASUA 1OB5A 1XEWY 3GQVA 3HCFA 3QKIA 2KS6A 1LBEA 2P78A 5ALEA 4J0KA 5DULA 2CLKB 2XQKA 1NN0A 2BFNA 1UWVA 3Q8XB 3EEYA 1Y5RA 4GKKB 3G0IA 3M3PA 2JKVA 1S2DA 1IPFA 2Q9CA 3FPBA 3WRXC 4DLXA 4U7FA 2QMZA 4QEKA 3DLCA 2UXCB 2FN4A 2GESA 4OAOA 4K9LA 3WL7A 4YWJA 3U40A 1CP3A 5CH5A 2AF4C 3Q7SA 4F4HA 4YDQA 3MYYA 1SZJG 1SAYA 3QPVA 4U00A 1XHEA 3WGNA 1ANKA 1P18A 3AHIA 4P5EA 5DBOA 2HRZA 3I39X 1D5WA 1O95A 1TZBA 1QOZA 3FBGA 5CDGA 5KINB 3H1BA 5LOVF 4MWEA 2DB3A 2BISA 3ZDCA 5DXAA 3PYLA 1GIAA 1ZI9A 3JZIA 3D3WA 2DAPA 4D4GA 1SU8A 4HLQB 5B7GA 1H9BA 2VWHA 2QR3A 4WN9A 4OHBA 5FOUA 1JKXA 1LV8A 1TADA 1ZU5A 2C95A 4RDCA 3JTMA 4TT3A 4JBNA 4LJ8A 2PKYX 2JANA 1NG1A 2QRKA 2R4UA 3QKWA 2H2HA 3BWDD 1ZK0A 2DHRA 5DU2A 6PFKA 4DV5B 2R6AA 1T4CB 4R4JA 5EIWA 1Q3KA 1UBJS 1XCGB 2YZ2A 3RWMB 4PO1A 4D97A 4ETMA 1QUEA 2DH6A 2O48X 4OA8A 4PC1A 3W8RA 1HZZC 3FCYA 4Q3BA 1M66A 3W5BA 3JD1A 3SM9A 5JSYA 4MAFA 4F3NA 1L4NA 4B9AA 2O0LA 2QBYA 3I6IA 1DXOA 1X1DA 4Y67A 4F11A 4RIEA 4BHTA 2O0MA 1XVAA 4I55F 5IMBA 2X41A 1HDZA 1JZTA 2IIBA 4FJ0A 4ENTA 2DWCA 4EFKA 3E7PA 1CY0A 5C1PA 2PH3A 5FOXA 5TC4A 4NJMA 4P84A 4QPCA 1DAEA 1QQBA 3CLKA 4LWPA 2BCGY 5E8RA 4R8RA 7REQA 1DG1G 3H1PA 1P3DA 2A5LA 2VP2A 1RAHA 1SWWA 2R1TA 3WRWA 1OXVA 3WK9A 5BQ5A 3TFWA 3TIFA 1BVYF 1Y8CA 1FB5A 1CNFA 2ZJZA 3BS4A 4NZYA 3WV4A 1U6KA 2XUQA 2JCSA 2Z2JA 2A7QA 5ERYA 2YVAA 3BH6A 3RSHA 3DWEX 3TQIA 4BNZA 4BUCA 4D6PA 1L1FA 5JCOC 3O8CA 1A9PA 3DYIA 3TQQA 1NVKA 2FDRA 4KFCA 1I9GA 1DZIA 1Z7GA 2CV2A 3X1MA 4QOIA 4FSHA 4ER0A 1DV2A 1L4GA 1T36B 2CFCA 2F3RA 2IU3A 3QYAA 3G85A 4WNCA 2QLFA 3HRKA 4GYWA 4E5PA 4ZCRA 2B5OA 1HQYE 2EFEB 3GJXC 4JOCA 4AJNA 2Y1LA 2B7CA 4UZSA 3ZZ0A 2VDPB 1N5LA 2VCYA 4KDCA 3H1TA 3IP6A 4A0GA 5LXTA 4V1CI 1YOBA 5ULLA 1F8UA 1DS6A 4R41A 4EP1A 1ORIA 2XSZD 1BTOA 2A0KA 3NEYA 6REQA 4Z9AA 1H1DA 1EDZA 4JGGA 2P65A 1RZRD 5HTKA 4DZTA 1JEEA 4EWLA 1UXIA 1TKRA 2XMZA 1SC6A 3PC8A 1G19A 1DPGA 4LPSA 4PLYA 3PTAA 2XCQA 1A69A 5C0OE 1W8DA 4EMUA 1XLVA 2ISSD 1AV7A 3VR0A 3C3JA 1K08A 4HDNA 3S2IA 1VKNA 3SEQA 1DKNA 2W2XA 4U5QA 4KO1S 4HLCA 3JD4A 4KFUA 5T4FA 3SR0A 4CM8B 4J3NA 5KTMA 1R6BX 2R6HA 2LTAA 5AXDA 4DV6B 1I5EA 1ZNZA 4BTLA 3A04A 2PWPA 2FXVA 3P0IA 4C2TA 3ICPA 3FY4A 4ZPJA 3UT5B 3GYGA 1GPLA 1XKXA 5EN4A 3I9KA 4ZHQF 2J3KA 1GPKA 4WZBB 1R4ZA 1WCXA 3D6VA 5SYAA 3IULA 3THYB 4MR8A 3KQHA 2RGWA 2A0XA 5FP0A 1U8UA 4RF4A 1OZGA 3E9CA 2RGCA 4BX8A 1Y63A 5KJ6A 4OXXA 4X71A 3JWJA 5L9AA 5JJKA 4HHEA 5KU7A 2ILVA 2Y1DA 4ENQA 1R2QA 2OV2A 3ABZA 4JI8B 1GJRA 3K6SB 3BERA 2Q5FA 4J7XA 4KDEA 2YZNA 1ZJ6A 2FUCA 5G0WA 3V5NA 3H5RA 3QVTA 1KAEA 2PCJA 4YR9A 2GDJA 2G40A 4URYR 1J2UA 5GP1A 3V6LA 5T4BA 2JFHA 1HE2A 4ETIA 3YASA 4AMYA 3Q6MA 5CB0A 3E7FA 4OB8A 4Q6WA 4MZDA 3H05A 2O8CB 3N8HA 3ADDA 3BCHA 2OAQ1 1FFSA 2IQ5A 3C6YA 2FN8A 1AQUA 1EUDA 1T10A 3HXKA 5C7IO 2FEXA 4QYMA 4M0KA 3CBQA 3CEJA 1MRZA 5FIUA 2QD5A 4N1AA 1ZM9A 4ZXFA 2CXHA 1BQ4A 1EMDA 4Q3EA 4PLZA 3NC0C 3AR3A 3HJNA 1THZA 1NVUQ 3NVDA 2PQ2A 5AQ1A 3RAGA 1E9SA 2CHGA 2NUPB 1AZSC 2IF0A 4NPHA 3AHCA 3OLWA 2WW8A 3R41A 4HS9A 5GM1A 1N5MA 4GT1A 5BN5B 4AULA 5J2UA 1QUFA 2GEUA 2GBCA 4HV4A 1YDMA 5JLAA 3M2PA 5LP6A 1P3Y1 1GL7A 4R2XA 5HF6A 1DQRA 5FNVF 1DPFA 3HL0A 3GEBA 4ZALA 4X7RA 5DTMA 5EJMA 2O8VA 4MB2A 1VSVA 4V3BA 4N0QA 3A1SA 2PM8A 4RY2A 4UCFA 2JIBA 4LRQA 3R20A 4QYXA 4BAGA 5JVDF 4M0FA 4MGHA 3PP8A 4JWKA 3IQFA 2A0FA 4ZOAA 1UOEA 4BGDA 3UVEA 1SCAA 1SWVA 2W2QA 1BC5A 2PSFA 4NOKA 4W82A 3TQRA 5LWQA 1B8OA 1V8PA 2X9GA 5FL3A 3ZW7A 5IBCA 10MHA 2OHJA 3QIVA 2IYOA 3OF3A 4PC6A 1RQLA 1JHUA 2X9QA 3A6LA 1NI5A 1H42A 2ZTUA 3L8CA 2BF7A 2NADA 3TZLA 5K0CA 3KSRA 5B1IA 1AKQA 2ZRHA 3PRHA 4JDPA 2FSPA 4YCAA 1L4UA 3M0EA 1FTQA 2DUMA 4TKLA 3TRDA 3KVRA 5IEJA 3EPJA 1MLDA 1YT5A 1MIOB 4CF4A 3LDGA 3HFGA 3IILA 5CYOA 3WMRA 5A5GA 3D7SA 5AVUA 4KRFA 2GFQA 1NVFA 4Z0HO 3L77A 4MRSA 5H80A 1W87A 2EYQA 1V96A 1DO0A 1ZXBA 2WJPA 3KOYA 4FZ3A 5HIKA 2DPLA 2HWUA 3H19A 1CQPA 1BE6A 3R44A 4UHCA 5EKSA 4TTSA 1CUSA 3CGGA 5GJBA 4ZJYA 4NYIQ 3AG6A 4X65B 1XU4A 2PS3A 1W9HA 3GLRA 3PC3A 3VZBA 2QRGA 1O94D 3BMCA 2F1RA 3C8MA 5CVJA 4R1QA 4X54A 1QVVA 4HY3A 3IAHA 1WUYA 3OPXA 2EG5A 4US0R 3TSAA 3MNFA 3H9BA 3DD5A 2WQ7A 4V1CB 2R00A 5AVOA 3ZWNA 2XCIA 1COWA 2C7QA 1BXKA 4HK4A 2WKRA 2ADFA 3JSAA 4S1NA 4XWAA 2YKGA 1II0A 1PL8A 1MABB 4MRMB 1QSGA 4S35A 2OV6A 1NPYA 4XDHA 3UXEA 2BFBA 4UBJA 1A9SA 2H57A 1RI3A 2SBTA 2TS1A 1VYTA 3QXXA 4TMXA 2OD2A 4TLDA 4DLPA 2GZHA 3EWIA 4IMPA 5HF5A 5HJ5A 2Y67A 5JNRA 3HM9A 3P52A 2J67A 4AS1A 1YR2A 2FPKA 4FU0A 4RIFA 4P3XA 5DYWA 3RLFA 5AHOA 3ZH9B 2C4KA 2DFNA 5FQOA 4EQZA 3D2LA 4CT5A 3TZHA 3IP8A 4C4TA 1G6HA 1QAQA 2AXQA 1D0VA 2IHUA 2XMRA 4FBMA 4IDOA 4OYHA 2ZRLA 3HCNA 5EYPA 2BFWA 5FTMA 2RH5A 3RSCA 5ALOA 5A3JA 4L8VA 1KTIA 3W1VA 1YQTA 1V6AA 2BEWB 4FSXA 3UY4A 1ZQ9A 4Q00A 2BH2A 1JG7A 4GEKA 1Q84A 5JCPA 3BCSA 3DM5A 3K9CA 4UCWA 4I9UA 3HU2A 3MC1A 1N8KA 2IYSA 3QKTA 4DCUA 2OPBA 3O4JA 4CMBA 3FLBA 2HUNA 2KI5A 2BGWA 3T3GA 5IT5A 3TSCA 2DT8A 2IIVA 3D3QA 1OR8A 2WF9A 5ALTA 5H3CA 3UXYA 4COOA 4D0GA 5C37A 1OH5A 2F8SA 1Z2CA 3X43A 3D5TA 5CDFA 3SKVA 4F71A 2XXJA 4QYIB 4HAOA 5GAJA 4YV7A 4JCCA 1QTNA 4U02A 4KZKA 4U2FA 1L5ZA 1U3DA 2N1BA 2FLKA 2Q5IA 2WABA 3MJTA 5F1YA 2VNHA 2XZOA 2AXNA 4BX3A 3EG5A 2AF3C 3BJRA 4LV6A 4L78A 1VTKA 4D8TA 4D9FA 4TT8A 1XL0A 1FDVA 1FNDA 2C0PA 4NOLA 4P53A 1WKVA 4TZKA 2YWRA 2WAYA 3T7CA 1H5QA 3D54D 3V7WA 5GIPE 4HB0A 2EIHA 2Q5JA 1Z6PA 4Y3UA 3TSOA 4E5KA 3DVAA 4UTPA 2ZYHA 2FSSA 2P3SA 4JOSA 2J4CA 2EL7A 1P0QA 3A6ZA 5BQFA 5A04A 4H18A 2JI4A 4FW8A 2XNHA 1RWXA 1XQ9A 2LGJA 1IQ0A 2E49A 1G3MA 1KC1A 1N3IA 1TAGA 3FKQA 2XV1A 3LWZA 2ZB3A 4GL4A 1JT2A 3B53X 4KQKA 4YQEA 2R0QC 1CY4A 1EP9A 1Q57A 2QRZA 3H8VA 2A88A 4H1UA 5IWAB 3EBPA 3R0QA 4P22A 4JOQA 4WDQA 5HHTA 1KPIA 2F1IA 4DPKA 1T2NA 2AT1A 1TPYA 2CVPA 2NZVG 3NT5A 4PTYA 4RKQA 1AGYA 3NC1C 3PI7A 5FULA 2XYVA 1PV2A 3VV2A 5ITVA 2H16A 2B36A 5I7OA 2VCHA 3RWOA 1HT0A 2GYYA 1MQSA 3DE5X 4XVRA 2J0SA 4LSZA 1Q44A 2CK3A 3OUUA 4IDGA 1NVXQ 3I2GA 5DN9A 2AGVA 2D2IA 2IXEA 4JBGA 2R7AA 3M6AA 1RACA 3K8ZA 2ZDGA 2VH1A 3T1QA 1RJ9B 2SKDA 4YEDA 2DEUA 2C7VA 3M49A 3BMOB 1T3ZA 2QAGC 3H1AA 2QMQA 3MRSA 3QA3E 3ZHBA 4AZ0B 1E2IA 2WWGA 3EVCA 3D3EA 4LJ4A 1T5SA 1JHZA 5CCEA 5FPYA 1IIBA 1NW7A 2CBGA 1X3SA 3VDXA 5AVVA 3ASYA 2Y2UA 1G63A 2AVDA 3P32A 1BE1A 3UMBA 3EQ7A 1G3RA 5CT8A 1MX9A 2Q3DA 4CQLB 1A4IA 2HXGA 2PLAA 4Q4AA 3SC4A 4BMZA 3VDRA 4PZYA 1N2JA 1JTFA 3JAMA 4D4JA 3HR7A 3RBZA 1QMGA 1YULA 1ADBA 4AQDA 5IYZA 3TYXA 3P97A 1TK2A 2P4EA 1UXOA 3RUCA 5E3HA 3WLIA 1O8CA 5E8JA 3ILYA 2R79A 1RXEA 1Z2AA 2ZBGA 3WP0A 4I5FA 2P9EA 3BE6A 3FSRA 2GPTA 4CLHA 4DC0A 2XWBF 4RNDB 3VYTB 5K4HA 1EIZA 2BE7A 3V8PA 3MXOA 2YVUA 3GEMA 1M2JA 5E6RB 5ECWA 1ZUNA 5BUSA 1JKIA 1WZIA 4OF4A 5KYYB 3IKTA 4Z8XA 1RIIA 1W8IA 1VI5A 1M6NA 4IX9A 4J7CA 3SKXA 4YAIA 2J6CA 1LCIA 1FU7A 2XA9A 3Q9NA 4O4IF 4B3DA 4PN7A 1RHUA 1X42A 3MUNA 2W8ZA 2VTBB 1JLSA 1RD4A 2VHEA 4G41A 2FW8A 2B69A 2P9GA 4MQUA 4XUGB 4FB4A 1G9XA 3OVMA 5FPSA 4Y0NA 4ALIA 3BXFA 4NDNE 5E0OA 4MUYA 1QGUB 1ZIYA 2OCKA 2WFZA 4P3OA 5DRTA 1LLUA 4KXMA 2JZOA 2Q2NA 1I2BA 3DNMA 3E81A 5AO9A 2G9RA 3ESDA 4FPXA 2PH7A 3PHBE 1P5FA 4QBIA 3ESBA 4XCXA 4XOUA 1DLIA 4D3DA 3OJXA 1N7HA 2DFTA 4GGOA 4ILEA 3RW9A 3ELYA 4F85A 2YJ4A 3STXA 1PO7A 2HCRA 4YHHB 4ZO7A 3IEVA 1TM2A 2OL4A 5TQ0A 3L7DA 2GCIA 2AG1A 2OT3B 3B5EA 4NZ9A 4F6RA 4D4LA 1S3FA 1U7UA 3DT9A 3PHJA 2E18A 4M2LA 2Q7XA 1DV1A 3E8SA 1Y8RA 4RY0A 4E21A 4GSLA 1DJNA 5BUCA 1T1EA 4KQXA 5KNBD 2H51A 2PX4A 1QIEA 4C1NA 5J4HA 2F55A 3UKDA 1BA2A 5CX1B 1VIMA 4C0AC 5GIOE 5CVVA 1SC1A 2IK8A 4HVLA 4Q16A 2XQFA 4I3FA 1K0UA 1ZSNA 4D9EA 4QDOA 1Q5PA 4FGSA 4X7MA 3ZW9A 2XQJA 2LCIA 3HYTA 1X9IA 5JBQA 2QN8A 4AJIA 3OZSA 1NBHA 4RPGA 2EJTA 1CUCA 3F49S 3ZYCA 4LZNA 1ULUA 4D9JA 4GZ5A 3S7ZA 2C0QA 3ECCA 3AEQB 4EO7A 2D1QA 3K5IA 2XDAA 2C2ZA 4OUDB 3ODGA 4KNYA 3LT4A 4K87A 1R5OA 3QJYA 6ABPA 1NURA 1V3QE 1EZ4A 3PXDA 1XPUA 1Z39A 5BWNA 3C8HA 3IQGX 3HJFA 1MPXA 1JAIA 1N25A 3MJDA 5DW0A 5GM2A 5M5BA 3OQPA 4KO4S 1MC1A 1Z2OX 4D98A 5L7TA 1UBRS 9ATCA 3L7CA 1QZTA 1G5PA 1R8JA 1G2PA 1S7GA 1T2DA 4JLVA 2B1IA 2EJCA 2J5BA 4O4JA 4BQOA 1HDIA 3EEOA 4TLLB 2JKYA 5IANA 1EFCA 1GZHB 2QRUA 2XWPA 4KU4A 5DGTA 2B5VA 3RVRA 1IN1A 2IYVA 3A9VA 4CL0A 1NLFA 3S8MA 1WF6A 3DL7A 2GPBA 4RSMA 2IPMA 1Q11A 2PH5A 4XWTA 2MR5A 2PNFA 5JMWA 2ZCVA 2ZJBA 2FW6A 1BOOA 1SH7A 2QYOA 3OQMA 3MERA 3LKBA 1JP7A 2ZS8A 7MDHA 3QX3A 4R8SA 4TWJA 3SC6A 1XLWA 4JCOA 1SBTA 5IUJC 5DX1A 4CLXA 1RQ2A 1ZVVA 4BVLA 2N42A 4HXYA 1L5GB 3NHMA 3H5VA 3KV3O 4L22A 5T5QA 3V1NA 2ZW9A 1E1RA 3F9CA 2EW2A 4TQGA 4DJAA 5ICFA 5E95A 3TVDA 4C4RA 1J25A 5IJXA 1NIJA 1G55A 3AJEA 2C42A 4JODA 3S4YA 3V4LA 4E22A 1TLTA 5KCMA 2QSUA 3WL8A 1UMCA 2VZ9A 3LQ2A 3HQ4O 1QYVA 1L7OA 1J0BA 4ZHSA 1G98A 3BTUA 6AT1A 1F0PA 3L1KA 3U49A 2C4UA 3GUVA 2GVNA 4MDFA 1M1YE 3IUBA 1KQNA 3ZKWA 4BE4A 5K6AA 1DEHA 1IQUA 1UJ6A 3G7SA 3NM5A 1BVUA 4J07A 3DHNA 2ACWA 4M0EA 1M3SA 1EH5A 5LB4A 2PH1A 3IALA 3AONB 1E7YA 1L3IA 4BQFA 3EZGA 4W63A 3ICCA 4LE2A 2V03A 2XECA 1E6WA 1HDEA 1Q19A 1R7RA 4RTQA 1WX1A 4DB4A 2IBSA 4AY5A 2XNDD 4KPFC 1DJLA 1MFPA 2W98A 2ZCUA 3HYNA 4HH3C 4M55A 5DHPA 5IFKA 1P4AA 4DYVA 2QT9A 4TN1A 3AM4A 4NZOA 3FHTA 1SCNE 3H2ZA 3HCDA 4I9HA 1ND6A 2ZRJA 4AURA 2DKFA 4NEGA 3HEBA 2CV0A 5HGXA 2KW5A 2Z2YA 3B9PA 3EGDB 1F6WA 3FYCA 4MX8A 1V1RA 4R9RA 2VHWA 2WTMA 4AFNA 3EYAA 5JC1A 1XZNA 2XCUA 1QJCA 2FMUA 3KR9A 2DG2A 4HBGA 1KDPA 5ALMA 2O8BA 3IDOA 4KW7A 1HI9A 4A0RA 4BRUA 2OAP1 4M9QA 4REMA 1GYQA 1SHZA 3P4XA 3PT9A 1SCJA 4ZVTA 4A7PA 5BSHA 4OHWA 2BEJA 2VAPA 4UDXX 1SM4A 1XZAA 4RVFA 2VPTA 3AKYA 5G4KA 3REGA 1QHSA 1T3SA 3FCEA 3WFJA 1MF7A 1PJ2A 1Y80A 3ZOZA 4NU5A 5AT1A 1CYEA 4JUCA 5KOJA 4JLAA 5IAEA 1NY6A 1QGED 2Z3VA 4MTLA 3QLUA 5DGIA 1N2IA 3GFFA 3WNVA 1GT6A 2MJLA 5AFSA 2QB5A 5JD4A 3WGIA 5BSMA 4TV9B 3W2TA 4D9BA 1ZSYA 4G89A 3FCCA 4PSVA 1TT5B 1YQ9A 3DMPA 4IICA 3ZHTA 4BMSA 5ER9A 5KX5F 1BD3A 3VGPA 5ES3A 1U1IA 3OT4A 4IW3B 3I0MA 3AUXA 1ZOOA 1JDBB 3TLXA 2HSWA 3CSDA 4YQZA 3W1EA 4C2BA 4XIJA 4DEVA 2WA1A 3RYFA 1Z2PX 3UJNA 3RGWS 1LVHA 1EWVA 4O08A 3EVTA 3F2IA 4UATA 2YWGA 2IDJA 4XSGA 3WWDA 2I2FA 4CLOA 1XU7A 2ZBPA 1XD9A 4UVDA 3LZDA 3AFNA 2BGNA 1N0UA 1AKYA 4O4HA 1Z73A 1V1JA 2JPDA 1O5IA 3MSXA 4RV5A 2NQ8A 2E4ZA 4CI0B 2O6LA 3JYOA 4PYIA 4KFSA 1GILA 4BB5A 2ISCA 3UOAB 4MJ7A 1RDFA 1D9ZA 5CA0F 4FZRA 2Q7OE 1GGVA 1NMQA 2JF0A 2IZ7A 2QL7A 3A1NA 3GZ4A 4ZZ2A 4CFYA 3HB9A 1XYVA 1JQLB 2CGEA 1B73A 3E18A 1T6ZA 1TRHA 3E9DA 4K9RA 4PPFA 4WGGA 2XY4A 4LF4B 2HZBA 1A88A 1QO9A 4PZCA 1FJHA 3GVPA 3NV9A 3HNOA 2ZFUA 1W44A 1XKQA 3W0LB 3SX2A 4JT9A 1Z0JA 4W5TA 1SUDA 2W2VA 1E1NA 4NBLA 4MW4A 2DHQA 3CLSD 5HF8A 1ORWA 3FTEA 5AJWA 2OLJA 3BFKA 3MTAA 3MM4A 1XLTA 1WUHS 3ZQKA 3B60A 3ZGYA 3RU2A 4LOIA 4LY3A 4F5DA 5KWVA 2EHJA 2Q3CA 3OO0A 1OLSB 3HLYA 4RPKA 4UEKA 4B09A 5EVJA 5KOHA 4UNRA 2RC5A 4QUBA 4ND8A 4IZHA 2IBTA 1JZSA 4A2QA 1N2CE 3UHFA 1ECJA 2C9DA 4OQLA 3X0DA 3OQ1A 2CDRA 4R7GA 2VZEA 1VJGA 1KA9H 3WADA 2RGBA 5TSDA 2I2BA 4K8OA 5E2BA 1CSEE 1KY4A 3OETA 2Z2ZA 3I1JA 4Y2TA 7YASA 4C0WA 4EQ6A 2UXDB 4PLCA 1B6GA 3SSOA 3DBIA 2HC9A 3DKIA 1KAGA 3B8HA 3N75A 4RD2A 4RLSA 1L4BA 2B4KA 4R51A 4HWPA 1VPDA 1WXFA 2ZJ6A 4YAJA 1FYEA 3UWKA 1YACA 5K0GA 4L5YA 4LSGA 5EPEA 4Z0PA 1ABBA 4KMSA 3PS9A 3CUSA 2G82A 4I50A 3EJWA 3QWIA 3K09C 4MKZA 5D87A 5D3MB 1ZD8A 1AHIA 2X2FA 3VU1A 5JH7A 1A9OA 3HBLA 1M5UA 3F6EX 4B17A 4CCSA 5EZYA 2BEUB 2ZETA 1Y4UA 2X8JA 5CCXA 3IP5A 3OLXA 5FPKA 2GXUA 1EFLA 1WJGA 1S4MA 5LC1A 1MO5A 1KFKB 2HQOA 2P41A 3FRIA 1UDCA 1GQFA 1BKYA 2UYYA 2YWFA 2AOUB 2FLVA 3F8TA 4JNCA 4MB6A 3V00A 2E89A 1A98A 2I9PA 3DH0A 3LPMA 3RC7A 3TOXA 3GBPA 1Z8DA 2COUA 4FJ1A 4R81A 2XUIA 1G5TA 3M81A 2D5AA 3T9AA 1ZS9A 4YAEA 3VNVA 2LE0A 3I45A 1YVPA 3BT7A 1ARZA 1GZDA 1TAQA 3HP7A 3F3MA 1RP1A 3NS7A 4FNGA 3FH0A 4KIWA 4LW8A 4C0HA 3GGCA 3EGVA 1OFUX 4ZAGA 3OLCX 2YV5A 4GPTA 2BRUA 1UBFA 1WLSA 2HU7A 3P5BA 3O8QA 2D54A 5KJ1A 2IPAB 3CB4A 1ZCAA 4QRIA 1X3LA 4E1BA 4Q9JA 3AQ4A 4GVPA 3DKKA 3UJBA 3KYCA 4RF2A 2IH2A 2H1CA 1USIA 2F1KA 5DNWA 5JEDA 2RHBA 5H7XA 4D4IA 4F9GA 1MHPA 1W0JA 4TSFD 3TCKA 2ZSJA 1OGYA 1UOOA 2G1JA 4ZEMA 4GOKA 3BBLA 1LBIA 1T9DA 3PIIA 4MVJA 2Y0BA 1NJGA 4P33A 2HBYA 4X1KA 1HL7A 1Z4MA 2NU7B 3THXA 1PLKA 2XLCA 2I4TA 3ZJ5A 1R4NB 4KX5A 3IFSA 1I80A 1PEKE 1JB9A 1G7TA 2GNAA 2H2WA 3AV0B 3PNYA 2H9YA 4OJNA 5AVKA 2ZUTA 3VYWA 4YV2A 1KAHA 3FFBA 2YYAA 5CXQA 2ZEJA 3HLKA 4KQ6A 2FW1A 5DCUA 4BC1A 4EW2A 3OTGA 3AF2A 1MB0A 2E4AA 2JEOA 3BRWA 4J8PA 2Q2QA 2W11A 4N82A 5EP3A 4CTOA 2ZT6A 3DGEC 2H1WA 2ZOSA 4UU0A 5TT0A 5GZ1A 4URFA 5KNDH 5EFZA 1LNQA 1V8ZA 2X1VA 1K7EB 1Z7YA 1X77A 3LQRA 4OJMX 2F9LA 4ZT6A 3UAWA 2VSYA 2QUIA 5JMOA 1K9SA 4TV8A 4XARA 4XIFA 3FDXA 2IBMA 1CEXA 4H15A 1ECPA 4GX2A 3D0QA 2NU6A 4QT0A 1LX7A 3KYIB 4FYWA 1FDRA 2G04A 3GARA 4MUXA 3WTCA 1OCEA 4YAUA 1HKHA 3DZKA 4R1TA 4G4JA 1D04A 1RKVA 1XT6A 4GU5A 4I08A 4D56A 4AY2A 3Q9UA 5AJXA 1BGVA 1WKBA 3EDMA 2HMSA 4MS1B 3H16A 1ISRA 1FEZA 1GNPA 1PVDA 5CXSA 2A9PA 4DABA 4WWHA 4B31A 2GD6A 1QIJA 3AI7A 4L4XA 1DKQA 1AF7A 3G1TA 4S0ZA 3VJKA 3WLKX 3TGLA 2YRXA 3GUHA 4MPJA 2VFAA 3AP1A 3OZGA 4FDVA 3N0TA 2SECE 4JLKA 2YHBA 3SLRA 3LVFO 3KR0A 3KJHA 1P9LA 1Y3AA 3KVYA 1N5DA 3ZWYA 4RVCA 1MHTA 4K3VA 1SUWA 3CRNA 4JEMA 1CY7A 5C3MA 5IP5A 4JU8A 4EPWA 2BKUA 1YDWA 3A70A 1ZZEA 2QTLA 3HVHA 3PDIB 2AI3A 4M1QA 2O1SA 2OSVA 3OG9A 4EKEA 2JH9A 2VJNA 1K8QA 1PDOA 2C31A 3B78A 5TVKA 3W77A 3KLPX 4BGVA 1GQRA 3V48A 3T38A 2CF5A 3IX7A 4QD3A 1E3WA 1CUXA 4IGIA 2GTHA 2A78A 5FA5A 1U9JA 1V5WA 1NXPA 4G1EB 3PL1A 4RKFA 4EARA 3E8MA 4XVUA 1F0NA 3DAHA 3SQXA 4TTVA 1L9KA 4EG5A 2FN3A 2PS1A 2WSSD 3K9GA 2R68A 4RXMA 2E82A 3FVWA 3I2IA 1GV0A 4EB8A 1EM8B 2AHRA 4IV0A 2Y9PB 1AQ6A 1U0FA 2P7IA 1V4NA 3P4YA 3O74A 4AZVA 2HV8A 5ALXA 3VSDA 4CQMA 4DCPA 3DPIA 2RSLA 4LJYA 4EB6B 4F21A 4DMHA 2A6PA 3R7AA 2ZSFA 2PSDA 3C1TA 2OYSA 5CT5A 1X8XA 1Z47A 2CHQA 2OKCA 2WT4A 2VP5A 5F2OA 1GLNA 3EDQA 1Z0ZA 1ZU4A 1H2ZA 1MJ5A 1X7ZB 2BLNA 2OFOA 3CZRA 3AVXA 1NTOA 5CD9A 5E4JA 1KJZA 2VDUE 3DE0X 4ZVLA 4CU2A 3U3OA 1Q95A 3MILA 5JNUA 4BVGA 1HLFA 1N6RA 3DEZA 3NHAA 5ECYA 2XUDA 5CB4F 1K9VF 5HVNA 1F2TA 1F3OA 1YZVA 1QGOA 1ZEJA 2R4TA 3D81A 1ABFA 3EIUA 2O7VA 3SXUB 3QXGA 5K3EA 3BMQB 1JHAA 2NTNA 2W2OA 3HDYA 4LJAA 4XRRA 4FDUA 3Q7QA 1UKAA 2OBXA 2BR5A 1GUZA 2YWDA 3F5DA 3IAUA 5GONB 2OXTA 3RVJA 1UDWA 1GSHA 2FPMA 4KYVA 3SEAA 5GV8A 1ZVJA 3I64A 1YO6A 4HQLA 2AUMA 3DBRB 3QX9A 4KXYA 3AGQA 1H1LA 1JYSA 1BWSA 1GNQA 3K0HA 4JXKA 5AK0A 1DAFA 4L6IA 4ER3A 2V3CC 4LIPD 2H2DA 4JEHA 3FVTA 1WU7A 5ALKA 1JPUA 2H8GA 4NPCA 4Q7QA 1VXRA 1ZK1A 3SJCA 2QL9A 1WB5A 2CDBA 1G8FA 3CRW1 3M4ZA 1UBLS 1LBQA 1Y3DE 4YRDA 4ICIA 3QTBA 1C30A 2AXEA 1TVEA 3GGDA 4TM7A 3UMRA 5IZ4A 1NAIA 2XITA 1RM5A 3BMNA 2GJSA 3HEMA 2WM2A 4CV0A 5ALRA 3AM5A 3P9KA 2GZDA 2XQGA 3O83A 5HMLA 4LRXA 4Q19A 3K4HA 5LNK1 4Z9XA 4IO1A 4N40A 1OLUA 3OEYA 2QZZA 5B1SA 1I36A 1RCUA 1OX6A 1WUTA 2IYFA 2LKCA 4RVOA 1EE9A 3RFFA 3Q6IA 3QU7A 1AY0A 4DMMA 3OM9A 2FWJA 4HOYA 1CP2A 2EBHX 3GFTA 1Q7BA 2VQSA 5DRYA 3VU8A 3WGUA 4CG3A 4YXFA 3U1TA 1OB2A 2NZUG 5GADl 2HTFA 3DXFA 2JIRA 3N2ZB 4Z4CA 1H0KA 4MR9A 3EZ2A 5FWXB 2DMRA 4IQFA 4KCGA 4KDFA 1O1YA 1DC5A 3C3AA 4WNAA 4ZJUA 2YJ3A 5DYGA 4NECA 3QE3A 2JIZA 1F9EA 4BUZA 4JQYA 4PQEA 3CBGA 1YHZA 5F51A 4ZIRA 3A05A 3BA1A 1FMCA 4RC9A 3RC2A 3SYNA 3F0TA 2VDJA 4K46A 1JPNA 1KVQA 4ZU3A 3JASB 3AY3A 1SQSA 4MV0A 1HTTA 1BJRE 4CKXA 5EG5A 1EE2A 2QZPA 1D6SA 4TWAA 3QG1A 5F9HA 4MVJG 2HYIC 3ZBQA 2D0DA 2GT1A 3T0IA 3CONA 4FYKA 3FW1A 1KJ8A 2FN9A 3V1UA 4BMPB 1RBYA 5JCZA 3R7SA 2MWMA 1Z6XA 3AWDA 4Y2GA 2R86A 3RRBA 3ER6A 4CQJA 3EY9A 2L82A 4DLBA 1Z22A 2ZUVA 4DW8A 4YJ3B 2V7GA 3QU2A 4JMLA 5F4ZA 3NTOA 3R3YA 1XRJA 4D41A 1V47A 2JLCA 1TZKA 4HL6A 2YXBA 1M34E 3ISJA 1YZKA 4XX1A 4OJQA 4XIIA 3VMFA 3ZGOA 3G5AA 3NDIA 3KWMA 3RGGA 4ALNA 3HM2A 4ERXA 3DUFB 2D74A 1RYFA 3IR5A 5L4NA 1QFJA 1HE4A 2O5CA 1LPMA 1JR4A 4FR0A 3PGMA 4L3OA 1EHIA 5AKHA 1XVUA 4JFRA 2JGLA 3W78A 5KPDA 1N0IA 1KR5A 1N2SA 1RHMA 3CNNA 2NSLA 4RPIA 2EKPA 2YWEA 5KVAA 3R4CA 4L5AA 4LYGA 4PRZA 1E2QA 3PWZA 5H16A 5C8YB 1X7GA 1M2OA 1O96B 4HFRA 2WHQA 5CEEA 1F4PA 4ALLA 5DBFA 3HKCB 3ETJA 4D8YA 1NXTA 3EH2A 3SFTA 2REXB 4B45A 3GZTB 2OP1A 3T4UA 3BM5A 1NF9A 3IQDB 2V7PA 4M0UA 3QXHA 2IWHA 5LQDA 4YMIA 4R54A 4UBKA 3SZ3A 3RRYA 1JXMA 4B3CA 3CNBA 5CDUA 4RTPA 2PUVA 3OZVA 4TRMA 4NL4H 2QX8A 4ZRMA 4B6JA 1M1NA 5KHAA 4ITRC 1OV6A 1Q6YA 4ISBA 4DAEA 2HWKA 4BLWA 4X8HA 1JEJA 1BMQA 2G67A 3EXIA 3QF4A 4TTRA 2WIAA 2I4LA 4ZQCB 5TGDA 4HNUA 1W48A 5IJ0B 4K9NA 5LA6B 4KLRA 3AHEA 4HNSA 1KL7A 4ZK2A 4OREX 3RVLA 3DEFA 3LPLA 3W90A 4B5KA 5CIQA 4P4SB 2GK6A 2FB9A 2HYDA 4HEA6 1NQAO 4UPVA 1WKCA 3DDOA 3A1EA 4PGGA 4ZQBA 3RBAA 2NMVA 5T8KC 1FP7A 4KACA 3V1YA 1TDJA 3BXHA 1QIIA 4CF6A 1VLLA 4EY5A 1SKQA 4WLNA 3RQSA 4CQNA 2FHSA 4H7HA 3QVMA 2EF1A 3QKRA 3RU3A 2QTMA 5K8IA 1FYFA 4C6SA 4EA9A 3WYCA 1YS4A 2H1SA 4IZIA 5IM4A 1O6CA 4NBRA 3TLJA 5JRJA 2OCPA 3DAPA 3HV0A 1CQIA 1F1JA 3D4OA 3N2IA 1W59A 4QJIA 3R76A 3UH0A 3QHPA 1I4OA 2ZBQA 5MN6A 3VPAA 2GCOA 1WOMA 4L08A 4NFYA 4D3FA 1UK7A 1AMOA 3IP3A 5IRCD 4GOOD 3Q5EA 4M4SA 4CN9A 4IJKA 2I3BA 4MVCA 2PYZA 3AVQA 2XJ4A 3L04A 3N3AC 2OP0A 3LS2A 4GLOA 4C4ZA 4BECA 2PX8A 1E79A 4URWR 4BO0A 1RRMA 4BVFA 2Y2VA 3UT0A 5EZSA 1YOVA 1PL6A 2Q6LA 4KKVA 3H6GA 1Y81A 4R9SA 1KQGA 4QWWA 2R6FA 2E4XA 2QA5A 1H5NA 3LZCA 4M9UA 4WKGA 4UM9B 1T4GA 1TEXA 2VWQA 1UPCA 4UXHA 3T34A 3INNA 4Q1FA 3HUTA 2Q2VA 1P74A 4AIRA 4J1NA 3KQOA 1Z07A 4RD1A 2LCQA 2ZAMA 1KTVA 1PJBA 3L0CA 3AETB 2ZRBA 4TRRA 4JJ7A 1PLLA 1VYVA 1LFDB 1XMVA 3H6KA 1L7RA 5G1OA 1HYEA 4F3TA 1P7VA 2ZYUX 2WU3A 2EWVA 2VI5A 3EGXA 4CL3A 3H7AA 3C0KA 1UJ5A 3R6LA 1V4BA 4UHFA 5FTNA 2Y3IA 3WG9A 3DQQA 2OZLB 4BO1A 3AG5A 2ALJA 5CNMA 1NLZA 5E7JA 1T13A 4Y2JA 3K72B 1PT8A 2FYTA 2FZ4A 3AMVA 3LP8A 1KQPA 5ESXA 4B7UA 1W49A 3A27A 4W8GA 1MORA 1SVWA 5AI6A 2I4NA 1USUA 2FZGA 3NWBA 4IVPA 3NOOA 4AKIA 2AS0A 4AQ7A 1L6RA 1QE3A 3OE7A 4JUFA 4U2CA 1AS0A 3EXFA 1NI4B 2X0DA 1KEEB 2HDOA 4BEBA 3E82A 5L3RA 2JDIA 1BFUA 1U90A 5FORA 4DDMA 4U7DA 3G0GA 3KXPA 3MWGA 1J07A 1JEAA 1R0SA 4IJVA 1BJTA 4TUYA 4DCVA 1EBBA 1I3NA 1Z56C 3H5OA 3SZMA 3ZDRA 3UZUA 1VIDA 5G0SA 4CNBA 3A2LA 3II6X 2WOOA 2F43A 3MWDB 4K1LA 3KE9A 1JEDA 5IN5A 3MCZA 3N5KA 3GI1A 3SU8A 4V0SA 3GUUA 2ERYA 3MT7A 1O9BA 3RV4A 2WBLC 3DBLA 3T3IA 4DCGA 1TYEB 3K1AA 1B15A 3H13A 5KWSA 5MHTA 2XXAB 1TYDE 5DI3B 2JNWA 1Q3HA 2MIIA 2MT9A 3BJMA 1Y3HA 2WIDA 3HYCA 3JQFC 3KCQA 4O25A 3V55A 5IJ9A 1YDGA 1ZD2P 3P96A 2OPHA 1G1AA 3CZ9A 2X6RA 5DSTA 3MGGA 4EJSA 4A26A 2P62A 4E5VA 1E1QA 3LD9A 3PPXA 3SBEA 1XVVA 4M37A 4UVEA 3STHA 4BNKA 4M1SA 4EKNB 3RUIA 2NUAB 2FPGB 1OV4A 4IDFA 1V1MB 1P6QA 1EFPA 4RFVA 4DJ5X 4EDHA 2PA0A 4R3WA 1Z0IA 2IXDA 2R6R1 2C4MA 5HOEA 1N3YA 5G4LA 4K9OA 3CR7A 3SWWA 2DLDA 4RQTA 1SEVA 2GM9A 4YRZA 5CBKA 4W1RA 1WV1A 2B8NA 2X8AA 2UZ3A 5JQGB 1X14A 4K81B 1PVOA 4OXYA 4W5JA 3WMEA 4KSCA 3M6XA 5HXAA 4AI6A 4F1WA 1JDUA 5CURA 4XOIA 2C00A 2ZM6B 4R7ZA 4ARIA 4Y1GA 3QXCA 3M82A 4FKZA 4RVNA 2IOFK 4G1MB 4X6XA 1M6HA 4P38A 4BKPA 1KP2A 3FLEA 3IGFA 3IERA 3BQMB 5C35A 2JLSA 2WJ6A 3LDAA 2KQUA 4UEQA 4HFJA 1VHJA 1X1QA 3JTEA 4HVAA 4R1UA 3ZX4A 2FFRA 3KQLA 1VGRA 3PEVA 3QMWA 1WBJB 2FWBA 2YCBA 4V2IA 3Q9LA 3RBVA 2GA8A 3SYTA 3ZEIA 1NT4A 3ACCA 5DNUA 1EA5A 3MIIA 5DGXA 1NNI1 4Q66C 3SXJA 4YRLA 1KZ4A 2WSBA 5ETJA 2BN4A 3F5SA 1K2VN 2LV8A 4IUCS 5DNAA 1OKKA 1UBKS 2YW2A 3A0RB 5F35A 2CNWD 5ALSA 2IH4A 1A71A 1Y1RA 4ZP1A 5DHFA 1MENA 1A2KC 1X19A 4RA9