3GT4A

Structure of proteinase k with the magic triangle i3c
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords proteinase K
publication title The magic triangle goes MAD: experimental phasing with a bromine derivative
pubmed doi rcsb
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3gt4A00
4H6VA 3DW1X 4HVLA 2PWBA 1CNMA 1GNSA 1AK9A 2WV7A 1S2NA 3L1KA 2GKOA 2X8JA 2ST1A 1ZVJA 4Z2AA 1S02A 3DE1X 1GTG1 3BPSA 1TM3E 1SUCA 5ARCA 3BX1A 4ZARA 3TECE 1PTKA 4K8RB 1SPBS 1KDVA 1GTL1 1WVMA 1AVTA 1KDZA 4NE9A 2G4VA 2ID8A 2HPZA 1BJRE 2IXTA 3DDZX 2PWAA 2W2NA 3DE0X 2E1PA 5JMOA 1T1EA 1SBNE 1C3LA 1R0RE 5JXHA 4BWGA 1A2QA 3PRKE 3I37X 3I30X 4I0WB 5B1EA 3H42B 1PEKE 1MEEA 1HT3A 4CG0A 1AU9A 4ZOQI 4KPGA 2PQ2A 1PFGA 1BFKA 1ST2A 2SICE 2Z56A 4H6XA 1GTJ1 5SICE 4H6WA 1Y33E 1T1GA 4DZTA 1SBCA 2W2PA 1SUEA 2WWTA 1SH7A 1SCNE 1OYOA 1LW6E 4MZDA 4NMXB 2B6NA 2DUJA 3BGOS 4DWWA 3GT4A 2X8JB 2Z2XA 2SNIE 3F49S 4RYDA 1IAVA 1PJ8A 4B5LA 3QTLA 3TI9A 3A3PA 1ZVKA 4DJ5X 3WIUA 3GCWA 5ARBA 1GA6A 3UNXA 1VSBA 1YJAA 3P5BA 1TK2A 1SIOA 1R64A 4WOBA 1T1IA 4AKSA 1YJCA 1GNVA 1GCIA 4KB5A 5I9SA 1C9NA 1Y48E 3LPAA 1AV7A 2W2OA 1SCDA 3WQBA 3ZXXA 1AH2A 1WMEA 1Y1KE 1SUBA 1CSEE 2W2QA 1KDYA 5K7SA 2P4EA 1Q5PA 1C9MA 4WOCA 3QMPA 1BE8A 1Y9ZA 4FONA 3EDYA 4CFYA 1SUDA 1SIBE 3WIVA 1SN7A 1Y3FE 1NDQA 3VTAA 3Q40A 1GA4A 1P7VA 2ZRQA 1EA7A 1MPTA 3VV3A 1BE6A 2TECE 3DE2X 2DP4E 2ZWPA 2PYZA 1ST3A 2SBTA 1KE1A 1WMFA 5AVJA 4OV6B 2Z2YA 3CNQS 2ID4A 4AKTA 1SBIA 1IC6A 1BFUA 3DE5X 1Y3BE 4OMCA 1GT91 1SELA 2WUWE 1P8JA 2PRKA 1DUIA 1WMDA 1TM4E 2ZWOA 4J94A 1TM7E 3LPDA 3EE6A 1P7WA 3VYVA 2IY9A 1THMA 3DE6X 2Z30A 2QTWB 2XRMA 1YJBA 5AMXA 1Y3CE 1EGQA 3A3OA 4JP8A 5CW1A 1TO1E 1TECE 5JXGA 3PTLA 3LPCA 2Z2ZA 3I34X 3DVRX 3VV2A 1GA1A 3ZXYA 3DE7X 5FBZA 3DVSX 1YU6A 1WSDA 2WUVA 3F7MA 1AQNA 1SBHA 3GT3A 3OSZA 4LVOA 3T41A 3HJRA 1SUPA 5FFNA 1AF4A 3WHIA 1OYVA 1Y34E 1XF1A 3SQOA 5JXJA 4LVNA 3D9QX 3AJ9A 3F7OA 3EIFA 1SCJA 3TI7A 2PMWB 4M1ZA 1V5IA 1SVNA 1JEAA 1SUAA 3Q5GA 1TMGE 3GCXA 5ARDA 2W2MA 2V8BA 3I2YX 1TO2E 2DQKA 5FAXA 1OT5A 3DVQX 2XTJA 4GI3A 3DW3X 3CO0S 1TM1E 2SECE 3A3NA 1V6CA 1C9JA 1SCBA 2Z58A 1Y4DE 1BH6A 4KG7A 3SICE 1SCAA 3DWEX 3AJ8A 3DE4X 3D43A 3DE3X 1Y4AE 3QFHA 1NDUA 1Y3DE 4YN3A 1TM5E 3AFGA 1UBNA 5AVKA 1R6VA 4HX2A 4C3UA 2HD4A 3DYBA 5B1DA 4OMDA 1KE2A 4C3VA 3VSBA 4CFZA 1SBTA 1SIUA 1S01A 5AQEA 1NLUA 2Z57A 3LXUX 2PKCA 3VHQA 1DBIA 4NE7A 5JXIA
chains in the Genus database with same CATH superfamily
4YMLA 1OFUA 2JANA 4JBLA 4XEUA 1TDJA 4B6PA 1XA4A 2VAWA 2DPYA 2QD1A 2BFBB 5CLGA 3MJRA 1TLFA 3C7AA 3GB9A 3KJXA 4FSXA 4A7PA 4F6RB 3WGIA 3CVUA 1PR1A 3PKZA 2F1OA 4UVEA 1P81A 1XXLA 1K4KA 1USVA 3GNQA 2J4DA 2KSQA 1CDOA 4A0HA 1KEWA 5FI5A 1CR1A 1S2NA 5EZYA 4DLAA 3KDPA 3RRNA 2H5EA 1XRNA 5EWMB 1HL7A 1IY1A 2VUTA 3C45A 5DX8A 4CQLB 1C1XA 1FFXB 2XKBA 1U9IA 2P5UA 4IDNA 5FBKA 4Z2AA 3U19A 1K7EB 3COYA 2PXHA 1NT4A 2XKKA 2I8AA 1RJWA 2QN6A 3S1SA 3BPSA 5JD6A 3C3XA 4MWDA 4JYBA 1O3YA 4YT2A 1UXJA 3OF3A 1K06A 4Z4CA 2YR0A 2YVKA 3ZIAD 4UASA 4G2TA 3SXPA 3SX0A 3GGJA 3WWOA 3SF0A 3MTJA 4DQUA 1Y3HA 4Q47A 4ILEA 2B4AA 4D1YA 4RXMA 2GZHA 4G5GA 4JSYA 5EE3A 4B2PA 4U2DA 2JLUA 1CQIB 3DV9A 1Z7WA 4IDQA 3GDWA 2M6LA 2EIXA 5GZ6A 2JFOA 2PZJA 2W2TA 3IXMA 4PBTA 4QRHA 4YRFA 5K3DA 3IELA 2YVUA 3U3XA 3TECE 4U7JA 2QTVB 2ISCA 2X13A 3M5PA 5BVHB 4RD1A 2AOTB 3P32A 3FHOA 1A2KC 2CLLB 1NPYA 4CM9A 4NU6A 1IB6A 4G0NA 4JNCA 2G4VA 1TYZA 2ID8A 2VNSA 2WWIA 4UU7A 2B7CA 2FW1A 3T8YA 1XDZA 2CNBA 3IMGA 5B3AA 1YR2A 2GN6A 1KBOA 1A50B 1A97A 1C4WA 2HLPA 2OGSA 3AGQA 4X6YA 5F7ZA 1YFJA 2GN9A 3N1UA 1DRJA 4MPDA 3PI6A 4MCJA 1A2BA 5DN9A 3DEIA 3EPLA 3PX7A 1A7KA 3IPRA 4W99A 5LZ9A 4WTOA 1L4NA 3UB4A 3ZKAA 1J6UA 1NRXA 3OIGA 2P77A 2CZGA 4EI9A 4HLCA 3AIKA 3HV2A 4B3IA 2B1IA 3H04A 1BMQA 3ZH2A 1IXSB 4EI7A 1VRCA 2JCXA 3JYOA 4S12A 2P0AA 1PZMA 1PR2A 4HDQB 3MC1A 5A71A 2Q5JA 1KQNA 2XA1A 2Q6LA 3DQQA 5L40A 4IUYA 1QOQB 3RI3A 4CEIB 2PE5A 1JBKA 2ZPTX 4E3WA 1VBMA 1QIEA 3TLEA 3B5JA 4MUHA 1FE8A 4P93A 3K70D 2DFDA 1DPGA 1W49A 1ZDMA 4KC0A 1ZJ4A 1WXQA 1XTKA 2A2ZA 2RJNA 2XUKA 1N6OA 1CVIA 1M2FA 1C81A 3HHPA 5KPJA 1NKTA 4IIDA 2DT5A 1GQQA 2GPSA 2FPMA 3B89A 5KKNB 1PWHA 4H31A 3RGGA 5SY9A 3OZCA 1I01A 5IVKA 4UVHA 3L8ZA 3H4IA 1RWOA 2YCLA 1YS2X 4C7MA 2QI9F 1B8UA 4ENTA 3IV6A 3JQAA 4DR5B 4R1TA 2R48A 1QX4A 1SUWA 3P9XA 5TGDA 4C6SA 4BRZA 3ZZMA 4S1WA 1Q20A 3OWHA 1OIVA 1HM5A 2QD4A 5FWNA 2CKMA 4UUMA 3DMTA 1NF8A 3WIEA 4D4LA 1S7CA 5C3UA 1UL1X 2QZ9A 2JATA 4DRXB 4BUJA 3DFMA 3VNRA 3RO7A 3B6ZA 4JXKA 5BSRA 4QVIA 2FN9A 3AGPA 3LT4A 3SXUA 3WGLA 3QUAA 5LB2A 4PONA 3EDOA 3FMIA 3OWOA 5CX4A 2RIPA 2QG4A 1BS2A 1QP7A 3LQFA 4MUFA 2FZ4A 3DLIA 1E0JA 2O8FB 1XA0A 4B3TB 3WYFA 1NV8A 4N54A 1VSVA 2B2XA 2NO4A 3QEMA 3SZGA 3UOGA 3SJBA 3MOSA 4DLYA 4P08A 1RT9A 3BGSA 4WESB 5K9ZA 2AE2A 4NDNE 4BNDB 3EWAA 4O1MA 5LP1A 3ZJUA 2BF4A 4R31A 5E7IA 2AFIA 3L7YA 1IN7A 3QBJA 2DLNA 3K4QA 4FWIB 4IJMA 4NMXB 3ZNQA 3K9GA 4F4DA 1CZNA 4RMHA 4AT1A 2Z5GA 2F7SA 5KAMA 4KRFA 1MOQA 1S8NA 3TM4A 4YJFB 4DQLA 3GRPA 3QVOA 4PVCA 4CR7A 5JZOA 1E1DA 1PV1A 4LKOA 2C9BA 3RROA 2Q6TA 4M7RA 5DU2A 2NG1A 4YI5A 1CG6A 1YFZA 2HEGA 2GMWA 4YCMA 4O29A 2PLFA 1UOQA 4I5GA 1KJYA 2YMPA 1QRUA 4RTQA 5LQCA 3HDGA 2I4LA 3A3YA 1Y7IA 1KORA 4XE5A 2UXBB 4P0TA 4C7VA 2CHUA 5IAKA 1U0FA 1G9SA 3LRTA 4KVFA 3SR4A 1EFTA 2UYYA 3AJEA 2GQ0A 2F8SA 3AXSA 4KXMA 2YFHA 3JQDA 3TRFA 4Y8VA 5D6OA 2E4WA 4J2TA 2MYUA 4K05A 4WFJA 3TCKA 3ZW9A 3H1EA 4HAXA 2WD7A 3RHTA 5F98A 4CNBA 3H4MA 4HNQA 4AB1A 1KQFA 4P82A 4D99A 5KTNA 2XCTB 2VTBA 3NIBA 3QPAA 5JFTA 3N3AC 3G82C 4LYEA 4PZZA 1XQ9A 5CCEA 1JMYA 3FMGA 5D1NA 1ECCA 4E6PA 1YNSA 2HV9A 3DVLA 3FD8A 1Q84A 1W88B 3L7AA 4QBIA 1GNVA 1GCIA 2IXAA 5AHKA 1ZC4A 3DYIA 3U81A 5IJ9B 1ZD1A 3TLYA 5CA0F 2TYSB 4AO7A 5A5EA 4YAKA 1ZOSA 3FLBA 1JILA 1N3YA 5KYTA 1M2NA 4JH0A 2ZI3A 4C7OA 5K3AA 3IQWA 4HPJB 2D2FA 2YOGA 3BSYA 4PLVA 1FBNA 4CW7A 2E4VA 4R69A 1Z4NA 3DAPA 1DAFA 2LDXA 3RSZA 3U62A 4AZ0A 4MGEA 5K4HA 2I9KA 1WQ3A 1OR8A 4ECAA 2CSUA 3NORA 5CNMA 3RYIA 4J1QA 1V6SA 1U7ZA 1TQ2A 1X7WB 3ETLA 4RDXA 2ZYWX 1XVLA 4Z7NB 1A9RA 3Q0EA 1DX9A 4ZEMA 3K1AB 2X4LA 2FF7A 4BB6A 1F5NA 5AVSA 5L3SB 4LZPA 3LC1O 1X9HA 4HXGA 4Z8XA 1AA6A 1C9MA 4Q0MA 1EP2B 1G20B 4IJWA 3GLGB 4ZQIA 1JLKA 2HHLA 3HY4A 1WW8A 3N8DA 4K6MA 3SQLA 3OPMA 5FHQA 3FRIA 3IPAA 2VQ3A 3Q7PA 2AZDA 3CLSC 3H4TA 5DTJA 3VTAA 1XJ5A 2OGZA 1RJDA 4ZVQA 5SY4A 3PUHA 1RQ2A 3A2MA 4WKBA 1ZUHA 4UBOA 4ZEXA 1M34E 4DG9A 4TKLA 1BO6A 3WS7A 1TCBA 4OFWA 2ATCA 3UC5A 2GAJA 4WBNB 1XTQA 3Q6NA 4LJLA 4Z0TA 2XUIA 3WISA 4BB5A 3I1IA 4S24A 1WMFA 3F6RA 2Q27A 5L95A 1EK5A 2N47A 3A7DA 3TR5A 1ORWA 2I78A 1CUIA 2X1LA 4UUBA 3ZHQA 1BFUA 1UJ4A 4RZUA 4EPRA 4Y1EA 1JS1X 2CLHB 4RK5A 3SHQA 3K2BA 3TNJA 1WCV1 1BWRA 1HE3A 4X1OA 4FU0A 4Q1DA 2WD9A 5E95A 4D8UA 3PNKA 2WA2A 1WMDA 3WLSA 2OCGA 2OHGA 3PSAA 4RFVA 4D0RA 2XKAA 3K94A 4RLQA 2YFQA 3PXDA 4UZEA 1JPVA 1BYUA 5FL7D 4CMHA 1VJTA 4DA8A 1NQXA 3OICA 1KZGB 4IIUA 4UCFA 5GP1A 1NLFA 3UHPA 2GPAA 1RPTA 2HMSA 3BS4A 3O0TA 3EC7A 2XODA 1RI3A 3PQCA 4M9ZA 4RA9B 4QECA 3FSGA 4D6XA 5A5GA 1JFVA 4RPLA 2CJWB 2WKPA 4WOKA 3TSWA 2PJUA 1JIKA 1UEXC 1X13A 2BGKA 5CGZA 5DP1A 1GZ7A 2G09A 4RAOA 3II6X 4L4XA 1F5SA 1XALA 3L9WA 2Z30A 2QTWB 3HO6A 4FKBA 2IUUA 4F04A 2ON6A 3GUHA 3R2JA 2NO5A 2C58A 2VKTA 4EJ6A 3FE2A 2PJZA 3H2SA 3LP6A 2P35A 4KODA 1XXHB 2Q3DA 4O0LA 4B31A 3RV3A 4ERXA 1WDTA 3E2MA 3D59A 4YJHA 3I8XA 2V1XA 5ECWA 4EGSA 1T4CA 1SQ5A 1JDTA 3JATA 4OLBA 1EWKA 4A6XA 2J3IA 4BNXA 5KUTA 3RTBA 3X1JA 1QLHA 3KAQA 1RJ9B 4EKGA 4LXGA 4KYTA 1ZK0A 2J9ZB 5F35A 3WGQA 4RLHA 3ZHOA 1T29A 2YHAA 2B2NA 1ZRNA 1N5OX 1R0CA 2CUKA 1QC5B 3LBYA 1G98A 3S44A 3PTLA 3NX4A 4Y18A 4DRZA 3TQIA 1FLDA 3MSXA 2XRFA 3PS9A 3BL6A 3NNDA 5CU7A 4PG4A 4KNWA 5H0IA 2GBLC 3SVLA 1GYPA 3B6MA 2IUSA 3F2IA 3VV2A 1QRTA 1L0BA 2VTKA 4F71A 3C5EA 1RLOA 1DQYA 1ZL0A 1XVUA 2G83A 2O8BA 3PLRA 3ZV6A 2QD5A 1U5AA 1KEVA 1MO3A 1NKSA 1OBFO 3AK4A 4OP3A 5NULA 1I94B 1Z5UA 2UV8A 4KFRA 3R8XA 4P98A 1L8OA 3T4XA 2R6FA 5GTDA 1PJLA 3UFBA 4BAGA 4C88A 1TA4A 1NU8A 3IERA 4EDHA 2JLQA 3OCJA 4N5NA 3F67A 2NO7A 3M6UA 4W7SA 7MDHA 2I5PO 4M76B 1VMIA 3CZQA 1NXVA 3IHTA 3VZSA 2WMOB 2VRCA 3B6EA 3GEBA 4K6FA 3RVKA 5IVPA 1IPEA 1ODFA 2YDXA 1V3TA 1SCJA 2VJAA 3TZHA 3NT4A 1RI5A 2Q46A 1IN1A 5CB4B 2GK3A 1BMDA 3NJ4A 2C2GA 2DTDA 3FFWA 1IJKA 1N3LA 4O4HF 3DNFA 5C8YF 1QHSA 2PMCA 2QLTA 5KNBH 5EESA 2R1VB 1XWIA 5EC8A 3K6SA 1UDCA 3F5FA 2FETA 2IZZA 4QXOA 3VMFA 4RMJA 3ME5A 5CB6A 4HGYA 4GP9A 4ZKEA 1TO2E 2BELA 1XE3A 1FMJA 2EZTA 2WC1A 4JFAA 4LNAA 4OP1A 1DFGA 5C1PA 2GVDC 2FFJA 3PUWA 2BM1A 3QPDA 4JR0A 2P2ZA 1P4RA 3NRCA 3FHJA 1P74A 3T5DA 1OTXA 2B5OA 2QUKA 4EI2A 4YP9A 2ZRNA 1V1RA 4B32A 1UJMA 1JA0A 4M21A 3IB3A 4RV9A 4XIJA 1CY1A 1TM1E 3NH6A 1HE8B 3LQYA 1GOTA 1NI4A 4P2GA 4TL6A 2VG8A 1U3DA 5CG2A 3ZD7A 3O3CA 1N75A 1DG3A 4XWYA 1E79D 4QM6A 2IYSA 7MHTA 2R8RA 2JLRA 1U9YA 4Q16A 1BJTA 3QIAA 2H5JA 3P9RA 1HQDA 4Q3DA 4BY9E 3KSMA 3GRFA 3PNQA 1U6JA 1W1UA 4EW2A 3HACA 3RAEC 2R86A 3BMNA 4BECA 3RODA 1E99A 1EWYA 1KKMA 4HS4A 3JCZA 2QW8A 3U4QB 3Q7SA 2VL7A 3ABIA 1VPVA 1IBLB 1GJRA 2NZVG 2WM3A 4RJKA 4R9VA 5JAPA 1JIVA 1Y8AA 3EGDB 4ZOLF 2BSQA 1V9LA 1P0MA 1MAAA 1TQ8A 4M49A 2P7HA 4TTQA 1VPWA 5E9WA 3LT1A 4K2AA 3OTIA 3FB4A 2YV3A 3GDOA 1E3SA 3PWSA 2BHNA 3WKDA 4H3SA 1L5WA 2ILTA 3R1IA 1D5WA 3F74A 3GJZA 4MV4A 4YN3A 4BIMA 1E7QA 1TE2A 4M8IA 4ISBA 2JF0A 4RDCA 3DL7A 2IYYA 1AKVA 2FQXA 3DULA 2QS9A 5J1SB 1UBNA 3EK2A 3THXB 4B9EA 3GMIA 2ZZMA 2BAGA 2X0EA 3UWDA 3THYB 2JBWA 2WWVD 4C6TB 1A8QA 4FFDA 5CBKA 4XAQA 4EATA 2UU9B 1J7KA 5B4VA 5FH9A 2XDWA 4QU9A 5KEIA 3U5ZB 3F3KA 4MB2A 4OLJA 1KE2A 1VHDA 2VRWA 3K0KA 3CCFA 1IM8A 3Q2KA 3QF4A 4UVDA 1HFWA 1Z2OX 4R7TA 5CYFA 1N33B 1UUFA 3NJRA 4RKEA 2K87A 3K5HA 8ABPA 2V0GA 3QMMA 3A4IA 1SBTA 2EX1A 3ROMA 3L02A 2NGRA 2IIBA 3HBMA 4B35A 4BO5A 4BV2A 1HRKA 2PUFA 3WQQA 2I3BA 3OM9A 3REQB 3C8ZA 3NHZA 4H1UA 4BO7A 1Q57A 5BOSA 1EVKA 3P2OA 4TRJA 4IOLA 4F5YA 4I8IA 1K89A 5BW4A 4TMZA 1EJBA 4ARUA 3LUJA 1S2GA 1YD7A 2B92A 2WNHA 4HDCA 4H4DA 4IEFB 1J21A 4I9HA 1Q0QA 2FX2A 5AWFC 1PL7A 1LUAA 4Y9SA 2R8EA 2XZTA 3WB9A 4DIKA 4L8WB 2QLNA 1YOVB 2M9MA 2PUJA 3HCBA 4IAOA 4PXYA 2C3PA 4IRUB 2H4ZA 2FW0A 4YP0A 1C7IA 5CK5A 3TDMA 1I4DD 1AOXA 1E32A 4EBBA 4Z7QB 5F1KA 1W96A 1ZD3A 4HRXA 4PAMA 2WU8A 5EKUA 5FAKA 1LLUA 3GZTB 1UWCA 3MCTA 3OOEA 3HKEB 2R3SA 3EQ2A 5CT4A 3AVWA 5JWOA 1QK5A 5GJVC 1DNPA 3PCXA 2FFQA 4CUKA 4YT8A 2JEOA 2YDYA 2MSCB 3DHWC 1MV5A 2CXTA 3QHPA 3TPCA 1GTG1 1WXGA 2YJTD 4OH1A 4G0UA 3HBAA 4OVKA 3S5JA 3O8BA 1B3RA 2QPLA 5IDWA 4P7GA 3VA7A 1FTQA 3H7IA 4GOMD 4IKPA 1AMUA 4TQ9A 2G8NA 3QLVC 2FPXA 2HCJB 4YMHA 5AVRA 3E2PA 1VLHA 4II2A 4QRDA 2RGWA 4X64B 4CBVA 3R6DA 3HKDB 3W90A 3H6KA 1KDVA 3AJRA 2OUKA 4XIIA 2EP8A 1WVMA 2XI4A 3MEQA 2PDAA 3ISTA 4JLJA 1F17A 2Q4BA 3EZNA 3E2IA 1YRLA 4I50F 3EVDA 1JLHA 4N12A 2JK0A 2PA0A 1D2MA 3Q8WA 5IABA 1ZD8A 4QJBA 4S1NA 4N48A 1RCFA 2JGRA 4LWQA 2QL9A 3VVMA 1J23A 4DJEC 2BTQA 3NDBB 9LDTA 3C1TA 2D2IA 2DUNA 2RKWA 3DE0X 4M1MA 4TV9F 4L9AA 4LXTA 5BNFA 3RHFA 4IUBS 2IYRA 1L5HB 2B3TA 5TDHA 1NAHA 4UBNA 5JMOA 1KS2A 3BGWA 5FI1B 3L92A 4RSGA 1HEUA 2VYFA 4PNZA 5DOVA 4PGFA 4F86A 3MHPA 1KZHA 2AOUA 3HR8A 5KX5B 2O19A 2X42A 3PXUA 3BFVA 2XUGA 1O03A 4PZUA 2OHOA 5BN3A 1A2QA 1D6NA 1VG1A 3MCUA 3KJNA 1ZKDA 3N2KB 3DO8A 3KOOA 3PRKE 4L15A 5IF9A 4HAUA 5JO9A 3WKEA 3AY6A 3WKAA 1TX4B 2P69A 1EXDA 4J0QA 4B80A 3NKLA 2C97A 3WMGA 3IR6A 1Q2UA 5HM6A 1UPBA 4C0LA 2ZAOA 1XCOA 2GTHA 1KO5A 2H1WA 1E7MA 1RR6A 3KKEA 5IXJA 3W8EA 5LP6F 1WLSA 1J39A 1MEEA 2O2CA 4HFJA 5IP5A 5A5VA 3WIDA 5BR4A 4RTPA 1SRQA 2AXEA 3ZBPA 1TTHA 1ZCZA 3RWBA 1NX6A 2RJ3A 4F4UA 2B99A 4R1UA 5AP9A 3OEED 4GEKA 3CJTA 1DJLA 1P4SA 3G9TA 4ESEA 1AU9A 2O3QA 3W0LB 4W1QA 3L05A 1RBYA 2ERXA 4QOEA 3RYFA 2V5UA 2AC7A 1R0WA 4ZOQI 1MH9A 4YQEA 4W8GA 1PFGA 1HORA 3OCCA 2H1SA 4FE7A 5EWLB 5EIEA 3K20A 4FLFA 2RHMA 3DDSA 1BXRA 3UFXA 1OGIA 2BEWB 2RB5A 1P2VA 2CZCA 2M2IA 2O06A 4TKVB 1NBMD 4UDNA 4URZR 2G5CA 4OM8A 5LJLA 5CNKA 3OM0A 3T52A 5CA0A 2ZT5A 4S05A 3TXYA 3SG0A 3ORQA 3D31A 2XMSA 4K46A 4RIEA 1M5UA 2AG8A 3F8TA 1P9WA 4US0R 1OU0A 4H1TA 4HTAA 2OAP1 1UQTA 2H1LA 2HCTA 3GT0A 1RXYA 2P0EA 3N7AA 3EXAA 4Y2HA 3AH8A 4QJ3A 4H7FA 1GKIA 2Q9AA 1K97A 3C48A 2V7VA 1E2BA 2BDTA 1UIMA 3N39C 4URFA 2B78A 1BIFA 1QGOA 3A28A 4FBMA 1HSOA 4YR9A 3KPVA 1J06A 1ML3A 5EZ6B 1KVTA 5B58C 2OV8A 2I29A 1KARA 3LOUA 1OYOA 5J4VA 3EN0A 3T7KA 5JCJD 1YH3A 1WNFA 3VI3B 5G53C 1KK1A 5HOQA 1VCMA 3L6BA 3WBFA 2G4CA 3KTAA 1PVDA 4MVJP 4PLFA 5BMVB 3ZV7A 3OJWA 1L7QA 3BCUA 4L5BA 2Y0EA 2VH5R 4P9NA 4Z8YA 4X54A 4CM4A 2HW8A 2OQRA 1P4JA 3L5KA 5HS6A 2J3EA 1YDGA 1RI2A 4HTFA 4RDIA 3FKSD 4PTZA 4IGEA 2JBAB 4K26A 2CV2A 2YZ7A 3PXCX 3IDZA 4RKYA 3S8YA 5DGHA 1K8XB 3ASVA 4AY5A 4Y2SA 3W5SA 4OJYA 3F46A 4CNQA 4BMZA 1D5CA 4KR7A 4OFZA 5CDFA 1ATZA 2WHEA 1BWSA 3ELBA 3T95A 3G2JA 2PL9A 1IULA 3GT7A 2QRZA 1RBMA 4NNOA 1CDEA 1MC5A 1SA0B 1W48A 1Y0BA 3D8SA 4PG5A 3GCWA 2ZJZA 3GJ6A 4HQLA 3A9RA 2GNPA 2OQIA 2WZDA 1T8PA 4FX5A 2P4SA 4OGGA 1FYWA 1N7HA 1QTIA 1O89A 2D3WA 2A1UB 3VC2A 1QIKA 2OZLB 2JASA 4JAVC 1T4MA 3LT5A 1NYQA 4UHJA 4EEZA 1P39A 4RL4A 1SD5A 5LP6C 4HNSA 2ORWA 2SHKA 4NENB 2HIHA 1Z5OA 2V4MA 3ZWWA 4E2YA 3AUAA 3V1LA 1CR4A 2PX6A 1XU9A 3EG9B 3MD0A 4AJ9A 4M0DA 1P3DA 4NABA 2ZT6A 1RHJA 3IHLA 3M1IA 5AKKA 3ZNPA 2VJQA 3FDJA 1X3SA 2CY0A 2EQBA 4NH4A 3RYHA 1RWNA 3FDIA 5HTOA 2A0KA 1LLQA 4F0JA 5A0TA 2ZR7A 3MCZA 3PPIA 2FY8A 2ILVA 1R88A 1K08A 4MS3A 1NM5A 4DQKA 3KCNA 2RHTA 3KUCA 5HW0A 2VF4X 4YCBA 3LFUA 1Z17A 4CUZA 2VPTA 1KYQA 4PV7A 4HAOA 2AS0A 4JC4A 4JBHA 4ZZ0A 1KYWA 1Q5PA 1TNDA 2RK6A 1BWPA 1D7OA 4WGFA 3CLTC 1A9OA 2QVZX 2BMVA 4CV0A 4FONA 2PBLA 4XFKA 4JT2A 2DWQA 4E5DA 5MF6A 4CRWB 1IL0A 3GJXC 4XCQA 4LOJA 1L7AA 3ZCPA 1SXJB 4S2UA 5BSUA 2EG5A 3GW8A 1NBEA 4E94A 3HEBA 2OXEA 4QOHA 1JHVA 3JD3A 4H16A 1C4KA 1DAGA 4BJ6A 3NYWA 3R3JA 1L4EA 2YS7A 4X93A 4AJHA 5JQGB 3OQMA 3LCCA 1Z16A 2R00C 2XD4A 2C9YA 1JH8A 2OD9A 3HXKA 3OD1A 3QWFA 5DGXA 4BEBA 3KEFA 1CS0A 4D42A 3FAZA 2FGKA 1XSEA 2J48A 3ECAA 2H1OA 3DE2X 2DP4E 1SXIA 1T35A 3DLAA 4U5XA 2C9DA 1XZIA 1GAXA 2VPZA 3D8TA 2WVJA 4MNTA 3PJEA 5FNVF 1TJ4A 3VYSB 4EHKA 4QNRA 2XGMA 3EVZA 4M7WA 4YDSA 3LDFA 3IA2A 2C4NA 1CVLA 1ZKMA 4KNVA 1WXXA 4XYMA 2J5XA 3U9SA 3ZOKA 1GUFA 1IUPA 1P33A 1ULBA 5ILGA 5H59A 4IMJB 5JXWA 4U6SA 4EL0A 3SVTA 4X62B 3DZCA 2SKEA 5B1HA 4DR4B 5IKMA 1ENYA 1VMDA 1XL0A 4QLAA 1SELA 5EUMA 1F3OA 1PKEA 5LMNB 3QTTA 3QHAA 3V8RA 1K3FA 3U49A 4OJMX 3EGVA 2YYSA 2K7FA 4I1VA 1L4BA 5HRUA 5FTNA 4EEKA 5EOVA 1L5LA 5LJIA 4DLBA 1C30A 1O94C 4YRZA 3MRXA 2GFIA 2EG9A 3TZQA 3A9TA 3R41A 2WA1A 2JGMA 4R05A 4BNYA 2HSWA 2NUAB 1J7JA 4BCDA 2I87A 4LXIA 2OP1A 5L51A 2QENA 3HLYA 1WCWA 1SM4A 3HUTA 1N8SA 1Y3IA 3IFSA 1JQEA 4D44A 5IJ0A 3I4CA 4ZQGA 1FJXA 4MQEB 4HUTA 1HR0B 4AF8A 5AW6A 5BSMA 1AKWA 2IY7A 2XAUA 4O4HA 5C8YA 1XCBA 1IOWA 1V39A 4E30A 3AY7A 3BD8A 4YDQA 2ZSKA 3U1VA 5JEDA 2FMXA 4HD8A 3HL0A 1FS5A 1CJTC 3W3AH 1W25A 2AWNA 3L4BC 2OLEA 3GDHA 4RABA 3TW8A 5IKEA 3IBTA 1XMQB 1A9PA 1EPUA 3OQJA 4CQNA 4BNZA 4QUJA 5EQDA 1CY6A 3ZHXA 2HTFA 1FQJA 1TVMA 2NVUB 3QXJA 2HA5A 3QFFA 4HZUA 5HRAA 3PQ3A 2V7WA 1QK4A 5G41A 4Q1AA 3B78A 2NT3A 1JPUA 2FE1A 2JEZA 2A78A 3EIOA 5D85A 5JS7A 2FSIA 3FUXA 3HFRA 1ADYA 3RJ5A 4UTXA 1P9NA 1R4MB 2E4UA 2QV7A 3ILSA 4XOIA 5KJ1A 1JR3A 1WTAA 3DE7X 5C35A 2MU1A 1BU5A 3B3JA 3EZ7A 1B1AA 3KT0A 3ORYA 2J9RA 5MN5A 5CD9A 1WRBA 1SKYE 2WKRA 3JR3A 2R6JA 3NTXA 3RARA 3GZNA 1INLA 4L6CA 3WLHA 1RP7A 1W59A 4BO1A 2H1FA 3JWEA 5C52B 3QLVA 1U1GA 2BFDB 4G3XA 2BP7A 2PYDA 2HB6A 4YAEA 5AKZA 4ZU1X 4GC9A 4ZOLA 5JEEA 2ZM6B 3F8SA 2BFNA 4ETNA 5KHAA 3WLKX 2DVMA 2DCMA 3FSRA 2PTHA 2V9ZA 3D8BA 1ZICA 2FSFA 4OYYA 2FPWA 3D6AA 3ZGXA 1VKRA 4TSFA 2HT6A 1FNMA 1XMXA 4P54A 4E22A 3AM5A 4RPIA 1FA9A 4TWRA 5CA1F 5IHPA 3S8EA 5E1OA 5LZ2A 4F56A 1AE1A 5AUPB 2C95A 4Z4HA 3N0TA 4GYYA 1Y6GA 5BNTA 2OECA 2FEPA 3RS5A 1ICEA 3OPXA 3MMSA 1UDAA 4BFCA 5BYAA 2CMDA 3PFCA 3E4CA 1JHQA 4FYPA 2FQQA 3BRSA 3AVVA 3PUKA 1V4NA 1H85A 1RQXA 4QAQA 2HBRA 2HDHA 2HHHB 2G1JA 3JZDA 5FPQA 3EXEA 3O84A 2ZRHA 4GOKA 2HR1A 4OJQA 1F4LA 3SYTA 4JI3B 1T0HB 3V9PA 4LJYA 1C9YA 5THKA 4XYLA 1KHHA 5TGZA 4UTVA 2FG5A 1ZRSA 3E81A 2XLBA 1ONNA 4ZVUA 4V0MA 2Y99A 1E2GA 1RXCA 1FFGA 2W48A 3MXOA 1DDGA 3QPWA 1NIJA 4GECA 4KI7A 1PJ4A 2ZUUA 4OHKA 4S0XA 4DY6A 1VPEA 5BSFA 5SY6A 2QRGA 3RHZA 3TL6A 3ZQ6A 3J7TA 5AUNB 3DLHA 4KN8A 4HLUC 2VHZA 2JCYA 4DABA 1BHSA 3Q9UA 5BV1A 4DA9A 2X3UA 3TGWA 4MB6A 3SLKA 1Z18A 3NBQA 4L76A 4R1OA 3V1KA 1REQB 2VHWA 2RKBA 3WMXA 4D45A 4ZANA 3Q3CA 1SVIA 2V58A 1I36A 1SCAA 1KR5A 5KSZA 2HSZA 4DCGA 3HZRA 2CC2A 4I1SA 3G8BA 4MVJD 3RQIA 2VBGA 4F1WA 1ZCFA 4AF7A 1EM8A 5DNVA 1GQOA 3EQ8A 4IH4A 1QNFA 5CVEA 2GRAA 3NTQA 1L5MA 1A1SA 3STUA 1SQ6A 3GRKA 4YLEA 4OYLA 3QPVA 3C7CB 5EAIA 1FW8A 2VHUA 2YWDA 4R51A 3WGHA 3WI7A 3N53A 3E15A 1BEUB 1Y3DE 2APJA 1HDCA 1G8SA 3DDWA 4ZQEA 1DO8A 1HY3A 1FFAA 1U8AA 4ALMA 3EAGA 4P0QB 2HLDD 1E2JA 1G60A 5FCDA 2A33A 1Z0UA 4C1NA 4KXFB 3UK7A 2PT9A 2BEUB 3EEOA 13PKA 1E2DA 1OWNA 2AMLA 1PK9A 5A03A 3HSYA 1X0VA 4JJ6A 4DLKA 1XP5A 1EFRA 3DVAA 2ZE7A 3OD5A 2AKEA 1ZA2A 1YIDA 4WN9B 4HWTA 3QPBA 3DNPA 4C3VA 2V54A 1I7NA 3NHJA 1ZUWA 1P1IA 2XNJA 3BB1A 3BAZA 2ZZNA 2KM1A 1E5TA 1YOBA 2EIHA 2JIDA 2D8MA 2OG1A 3HJNA 3OPYB 1EVEA 4P2BA 5L4NA 4M0PA 3VVLA 3W77A 4TZ6A 1EA5A 1AXEA 5CBPA 2WKQA 4XDZA 2AE1A 4HUQB 2JNWA 3H17A 4QUAA 4YUVA 2BF7A 4I50A 3SEFA 3WQHA 4G84A 2O8DB 1W8DA 2HSEA 4V0NA 2VSNA 3PFBA 2QROA 3DMRA 1DIOB 4OAQA 2QX7A 1XAJA 3G2KA 3IIMA 4TXJA 3R0JA 2GYWA 4U8HA 4JYZA 1ZD5A 3L1VA 4LNUA 5DCYA 3HA3A 4TV9A 5KI6A 3UUWA 4RSHA 5K2MA 1KI7A 3EQZA 4WXYB 1FSFA 1M2JA 4ZT4A 3NEYA 4R1NA 4FZRA 1EDBA 4NTZA 2HO5A 3VKUA 1FMCA 5EHIA 4ZJUA 2BJHA 2RGEA 4D4HA 3RG2A 3S2UA 4C29A 3NVMB 2EKQA 5K0TA 2J3LA 1QG6A 3A6HA 2X1MA 3AC0A 1HLFA 5LLSA 5DK4A 1MTOA 3SC6A 3KYDA 3K5IA 3RS2A 3TS1A 1Z39A 2K7ZA 2D5IA 2ST1A 4L16A 2XNDA 1HG1A 4WEOA 3VHLB 2NU9A 2IZ7A 1AKMA 5SV2A 1C4OA 1PR4A 2WU1A 4UNNA 4BQOA 1JE1A 3TDKA 3MWEA 1WCYA 2XT0A 4LRTB 1TM3E 4F3YA 1QH8B 5LP6A 4X63A 4LV6A 1M2GA 1WD7A 3FOBA 3IDQA 2X0FA 1CZUA 4DXDA 2Q6OA 1SXHA 1M6VB 3MT0A 2E4AA 1T3ZA 4DEYA 1EQUA 1YQGA 2XXAA 2OGUA 4UOZA 3RT9A 1ZR4A 2P2YA 4GC5A 3H5VA 2LCFA 1A04A 5HUHA 1YNOA 3FR7A 3CIFA 3JQCA 4KE6A 1I24A 2IOFK 3GGPA 1TIBA 3TIXB 1E64A 3M4NA 4UPDA 4H7HA 1FCJA 3PKJA 5D86A 5EYPA 3ZI7A 4DZRA 5C1OA 3UJPA 1AB6A 4MUXA 5HPYB 2V65A 1LDEA 2WJWA 4PO9A 3TQTA 3ZJ4A 4BZPA 3G0CA 2PKQP 1JLRA 2VSYA 3GXBA 1O77A 2PAFA 3IVCA 4L2IB 2P9QA 2H54A 2WIDA 2G71A 2OQ2A 2GKSA 4KLNA 4B2IA 1ZM7A 1ODTC 4X44A 2EP7A 3VNUA 5TVGA 3D7KA 1NR1A 1NY5A 3LC2O 5EMKA 2N3ZA 4D9IA 4BJHB 5JOQA 4MO2A 1MW9X 4UQOA 2Q41A 2H2WA 3TL2A 4PC6A 1PGOA 4CM8B 4NXNB 1RWQA 2VF5X 1GXSA 1C80A 1KA9H 3MTEA 1EE1A 3PC8C 4WLEA 1H6CA 3L8YA 3OE4A 2E5LB 1CF4A 3T9DA 1VKHA 3KDSE 1B1CA 1N36B 4C43A 4QL3A 3SBEA 5FWAA 5I7WA 5KYXA 3D3JA 3OHSX 3TTYA 4ALJA 3R6TA 3QVMA 2JGLA 3T7CA 4LX0A 1SURA 1MVLA 1RYMA 1YTLA 1D2GA 1T5TA 2R66A 2ZPUA 3FCCA 3GDGA 4C5AA 1JHRA 4DCUA 2C42A 4RVUA 4R8MA 3UH0A 3WWCA 4AN0A 2IH4A 1OV4A 3EVEA 1LPMA 1CY4A 1YR1A 1QAQA 1QIDA 1IQPA 2MSKA 2NUTB 3GP5A 1YFKA 4Q1CA 5B1EA 1N2CB 3ZQ4A 4HWKA 1PG5A 2QQEA 4BMXA 4DLRA 2JH3A 1TEVA 1DGQA 5KKCA 3GJ5A 4RY2A 4FPXA 4G4IA 4IFIA 2PZKA 2VTVA 3OO1A 2BFEA 4OK5A 1I2DA 2Y1OA 4LWPA 1CHDA 3URMA 2VNHA 2OO5A 3F9CA 3N75A 2B1JA 1XFAA 3DB2A 4KSCA 3O4GA 5KVVA 1WETA 2GWHA 2NO1A 5H4HA 1YE3A 2C5HA 2J30A 1BVRA 3UH1A 3BORA 1K3TA 2ZUTA 2ODTX 1O9GA 2BE7A 1SCUA 3EMDA 2VPQA 3ABQB 4OHBA 3DBVO 2SICE 5CD1A 3DBRB 2YS6A 3D6VA 4M87A 2FN3A 4LYYA 3ZWXA 3F4KA 3IAM6 4MA0A 3BOSA 4ZV9A 3NHUA 3RIMA 1II8B 1MNQA 3LSYA 1SUSA 5CJ2A 5TXGA 1UBKS 3R7BA 1ILWA 5LOVF 1Z25A 4AG5A 4XTRA 5AESA 1BDMA 4REQB 3HRIA 4CMJA 1HTWA 5AW0A 3DZJA 3JU3A 5A7HA 4AJEA 1DEHA 1WZ2A 1R3UA 1UXOA 3KUDA 5DW3A 4DXAA 3F1KA 3FDZB 3DTVB 1T13A 1B8NA 1XMVA 1XLUA 1TJNA 3L4BA 4J0JA 3BK2A 3NNSA 5F3DA 2N42A 1ZONA 4KGVA 4A6PA 5AVYA 1NMXA 5AIAA 4YUWA 1EXMA 3EQ9A 3IAAA 3PBKA 4XUDA 5DBFA 3ZXUB 3EARA 1FQKA 4AW9A 3DWFA 1E9VA 1LD3A 5ANRB 7REQA 5KTRA 2A67A 4XUEA 1QG2A 4TKUA 2D5BA 4XPZA 3K0SA 1Q7EA 2G08A 1LEHA 2QT1A 2XDQA 2Y1CA 3E0QA 3KAKA 1V2HE 4KACA 4PC7A 4R0VA 4ZJPA 3JYPA 3X3HA 3MHTA 2VK2A 2CFIA 1TW3A 3ZDYB 5FV4A 4GLBA 1LV7A 4C2AA 2POCA 1QG0A 3QHQA 1SWVA 2H52A 4PSCA 3CUVA 1EIWA 2YV5A 1Q0ZA 2H9IA 2I7XA 3F5DA 4PYRA 4WK6A 4I4LA 5CFLA 4YJKA 3KLPX 1FX1A 1GQ2A 2ORVA 4CI0B 3O03A 3HP1A 3VDQA 3F49S 3T3IA 1NBME 3CNNA 4U7HA 2F3QA 4B5LA 1I3CA 2OK8A 4IRXA 3LLCA 1MQ9A 3OP1A 4OAOA 2RGGA 4HQRA 1E58A 2E18A 4UBKA 3TI9A 3KEGA 3QELA 1JJAA 1PD1A 3CWQA 4AKGA 5FNVA 4TLLB 4BQNA 3DTNA 3C3KA 3ZD9A 2JD0A 1OFIA 2Q4RA 1F8UA 5MHTA 4D96A 2FP4A 3MM4A 1Y42X 2QN2A 1J1UA 3OLWA 4BBAA 5KYKA 2DQ4A 2Q1TA 1BMFD 1TI7A 2WFAA 2J09A 2OZPA 2VJOA 2YIMA 5KNCH 1EE9A 3FPCA 1DV1A 2PK3A 2PSFA 4H0NA 1GV1A 5I9SA 5JNLA 1R8SA 2ZB3A 4ACAA 3AR7A 4WUTA 2GKGA 2IUFA 1P1BA 3C14C 3FUWA 3PVCA 4FUQA 1CLEA 1HYGA 5B7GA 1M33A 4Z1MA 3RBZA 3LPAA 4IMIB 3CT6A 3EZFA 2A30A 1F6WA 5JNTA 2IPMA 3AR6A 1L4YA 3F71A 1NFRA 5G02A 5JIBA 1E59A 1N0HA 5DGIA 5EGNA 3T0IA 3WGVA 2YH2A 2ZM5A 4EAQA 2NO9A 4IINA 1RACA 4P53A 1XYGA 5IMBA 3DLBA 4JLUA 1QIGA 2W2KA 4YCSA 4DV1B 2QN1A 2WYIA 1GO2A 2WIAA 3BFJA 3S99A 4RZ3A 4U0KA 1IRIA 1U0GA 4N7JA 1AS3A 3IPCA 2XYPA 5DTQA 4CI9A 4Y3UA 5K2OA 1ZA1A 4N8SA 4LHSA 1Y9ZA 2FMFA 2YJ6A 1RHQA 3PCRB 1C7FA 4DMFA 4ZJYA 3V7UA 1CJSA 5HRCA 1XAHA 2R44A 1WS6A 3FMFA 3ID6C 3NTUA 4WZBB 3ZGZA 4OG2A 1NOKA 2BD0A 1OXVA 2YMQA 4ITRC 3ZOZA 1CQXA 1X8KA 3P0FA 4KXYA 5FRDA 4TUYF 4I6JA 3I5YA 2H7VA 2A5JA 1H93A 2C07A 2VYND 2YVQA 2ZB7A 1PQUA 3JQ9A 3IP1A 2O0KA 1UC5B 1MPTA 3BTVA 3NV7A 4MV8A 3WOHA 1Y7PA 5E8RA 4XA8A 4UBMA 1RWXA 4L4YA 5E6UB 3OBIA 3S0JA 3B1FA 4PSAA 4HAIA 1C8LA 4CPDA 4WXEA 3FNHA 3ZCVA 5NLLA 4B3JA 3HDHA 1RRCA 2DHQA 1RXIA 1CTQA 3UMGA 4NOLA 2JFYA 5K01A 4F97A 6PFKA 4EHBA 1IC6A 1U8FO 4GI1A 5U9CA 3BGDA 2R87A 4H7IA 3VOSA 1YFLA 3NTLA 4QREA 3GMDA 5FPSA 4PF1A 2BBSA 4G36A 1OKKD 4BO6A 1EXVA 4MULA 4IPTA 1VPLA 4J49A 4A8HA 4Q4AB 1DRVA 1H42A 4Z4QA 4RF5A 3IMEA 3E9EA 3GLHB 2QORA 3H13A 1DS6A 1RJFA 3VZRA 1Y8RB 3WL5A 3I4FA 1HRDA 1TU4A 2GJ4A 2JB9A 3AWDA 4XM1A 1ZN8A 4Z99A 3NFRA 3VSAA 1NN1A 5LD2C 3M33A 2ZIXA 1Q74A 1WV1A 3EW9A 2EV9A 4NESA 5CA1A 4EOGA 4TKMA 1UBLS 1LRJA 4UPEA 1RJEA 2ABWA 1A4XA 2BGJA 1I3OA 2OGTA 3AEUA 4RHXA 4LC9A 4N40A 1N2IA 2NLOA 1QOZA 1UMBB 2GM9A 3DE6X 3C0KA 3LWDA 4BN0A 1SVMA 1I1NA 4EUKA 4ADSG 1PZHA 2C5EA 3PQ6A 1Q1ZA 4QVKA 4HDRB 3FPFA 1I4EB 2JJ2D 3G5LA 4IDHA 2YZMA 5ADHA 5ES3A 2WHQA 1Z4MA 3T4PA 2XSZA 3WQRA 5HMMA 2XMGA 3DEZA 3R74A 4EKNB 4WDRA 1YQDA 3DBLB 4LK2A 2F43A 2HJGA 1Z4QA 2WAOA 3CTPA 1KIFA 1RI4A 1UKAA 1W0CA 4FS8A 4C4RA 4ZV4A 5M5BA 1PR5A 3MTDA 2RGUA 4L5AA 3UGTA 4BB0A 4IIBA 4NU8X 1WABA 1MB3A 2FEOA 2FYTA 2IE8A 3T5MA 2ZBGA 2QJWA 3PUYA 4OA8A 2NXWA 4Q3BA 3IV9A 3S7TA 5JTUA 4B6SA 4H77A 1ABEA 1CUYA 4QYMA 5EVJA 5FI0B 5GWXA 1P2DA 1G3MA 1QG4A 1GV0A 1PQWA 1D4FA 1GZ3A 1IN6A 4Y0AA 1F2DA 1NVMB 2Y9PB 3SEQA 3E48A 3NO4A 4K03A 4B6JA 4RTRA 3KKLA 4EF5A 1WMBA 2JFBA 2V96A 5T8KC 3FTNA 3PIDA 4ZT7A 3RU2A 2JAWA 3PC7A 1KYVA 3TKYA 2Q4EA 4C21A 3R7WA 4LDAA 5I6DA 1J24A 1ML4A 2DX7A 2QNIA 5IEJA 2A9KA 2NYRA 1RWWA 2DQSA 2P62A 3V1NA 2YIVX 3TUJC 4O0MA 4DTIA 1AQNA 2ZSJA 4JUIA 1RSZA 3DTTA 5E3HA 4TMWA 3KJEA 1C7EA 4XR9A 4F2HA 1DKOA 2YYAA 3MPUA 4I7EA 1FVOA 3LWZA 4JFRA 3RFVA 4JLKA 4P5EA 2LUOA 3E22A 5IAGA 4AZVA 2V98A 2REBA 3BKWA 1KOJA 3REFA 2I34A 1HURA 1PT8A 3PJGA 3ZX4A 4DLXA 4YMGA 1NJ5A 2W6QA 3D8NA 5F2KA 3HY6A 5DO9A 4E08A 5LQDA 4BFLA 1X42A 3D9QX 4UE3S 3NC1C 4NZPA 3O95A 3FZNA 2JFGA 2YN0A 5I9IA 3FOZA 4JQZA 1CYEA 1JBEA 4D0SA 1L1QA 2PLAA 3TI7A 3HZZA 1BOFA 5T3YA 3CUWA 2J6BA 3PHGA 4WHMA 4JDPA 4XCVA 3GLFA 2MINA 2OY0A 2OENG 5ECGC 2WG2A 3H0KA 4FQ5A 1J2YA 4MRVA 1J99A 3P0JA 1MAUA 4YFVA 4P1ZA 1YULA 2EYUA 2W2MA 4PRKA 4OQDA 3RUPA 1V5FA 1QVAA 2ACWA 2FX5A 2J07A 3VC3A 3AVTA 3Q3IA 4KWIA 3AP1A 5C1DA 1EWRA 4OL0A 1NVXQ 2FMKA 3GG9A 4DCSA 2GHQA 5AM1A 5KMGB 1J20A 4H7DA 3EFEA 2NYAA 1MEOA 5BSGA 3AU9A 2DMRA 1MFZA 3ADKA 3CLHA 3P9PA 2E87A 1UJBA 4O8ZA 3DWIA 1XUOA 3KQMA 1G42A 1ECGA 3QW4B 1OBVA 4DW8A 5EXXA 5FR1A 4HGRA 3I3SR 5CEJA 3CH5A 4LRQA 5GADl 3JVEA 3GL9A 4ND2A 1U7DA 1KPGA 4BVBA 4DREA 3HWSA 2CV1A 3SFTA 5AJTA 5DE3A 2WSLA 1J1IA 4MUGA 3O21A 4L9WA 2QUBA 3QW2A 1R0SA 3E18A 4P7FA 2FPPA 4MQ4A 1L5OA 2FRDC 4HB3A 3KTOA 4M0KA 4RFLA 2BV3A 4RFSA 5CCBA 2H57A 4NONA 3GK3A 1A7JA 4KITB 1U02A 1Y81A 3ETJA 2W70A 3VYRB 4CIAA 3ABRB 1BXZA 4Q48A 2I4NA 3HZOA 1WZUA 1EE2A 1U0JA 3E03A 3SD7A 4PLPA 2WLTA 1GG9A 1U90A 1OFGA 2OR3A 3WYEA 4CM3A 3SE7A 2VYCA 2R47A 4FJ2A 4WLFA 4ZT3A 1AKTA 5A2GA 4PBSA 1UMKA 2DC1A 5HWSA 3IXLA 4CKWB 3MBIA 1SU4A 2C9CA 1SVLA 4RZSA 5HYVA 4OI1A 4NCNA 2H07A 1D0VA 3DMNA 1S5PA 4E4YA 1YT5A 3DFIA 3W8DA 1CS4C 2EJWA 1VOTA 2AH5A 5LZ5A 2AJ8A 3OJXA 4EJSB 4YCLA 5KTMA 4GL2A 4IWXA 1RPNA 4LXXA 2J0UA 3SYRA 4DIEA 3F6PA 1FSPA 3TR6A 4QUDA 2OBBA 4XCXA 1IQ0A 1SBQA 3L93A 2HYDA 1RQGA 1U2DA 3G79A 3P5SA 3CZMA 4LY6A 1FSSA 5K3SA 3H3XA 4B6GA 4GOOD 5HSGA 3TGLA 4FEAA 4AKHA 1PWXA 3J81A 1GG5A 2EATA 4LW8A 4LZAA 5FV7A 4INOA 4EIWA 3CA8A 4J1NA 3FTFA 1KSHA 1P5JA 3RIHA 3RSOA 1DE0A 2VDRB 5DX1A 5B4TA 5DCLA 1MOPA 2Z57A 4Y6LA 4MIOA 1XI2A 1NV9A 3FFAA 1KQOA 4TQGA 4MVJE 3I61A 4ZAZA 2VUSA 4RXUA 1JKMA 3FNRA 1UZAA 2IBMA 2XNHA 1RW4A 1SJ9A 3TUIC 1A95A 3OLXA 3QLEA 5CHEA 2JFWA 2WW8A 3HTXA 4F8JA 1AN9A 1TB4A 3A0UA 2BKLA 1GRVA 2GEJA 1H6BA 4UAJA 5KSWB 3ED5A 3NWEA 5B7QA 3OUTA 3HC7A 5ICCA 3CVYA 4F46A 3FROA 2WD7B 1UBJS 2WV7A 2Y3IA 4G56A 4OBXA 4HJRA 3F1LA 3B7PA 2EBWA 2C88A 2FPUA 3MINA 2ZI6A 4FMDB 4OHWA 4AUMA 4JLOA 2FUG1 4HGPA 3O7MA 1K7CA 3B52X 3R77A 1CLUA 4MWOA 4A8JA 1V25A 3X1WA 3BGVA 3TQFA 1V7QA 3KV3O 3FTDA 4J4HA 1S02A 2JIZD 4C14A 5CH5A 1EWQA 2DH6A 2FUEA 1LGYA 2M6RA 3FWHA 3LKDA 3BDAA 1VE3A 3CEHA 3PP8A 2PFKA 2G0NA 3QK7A 4CMEC 2ZYHA 4R71A 3PYMA 3MAGA 3PQDA 4PEVA 1IATA 4GMFA 4RAQA 2HMWA 4NR0A 4MARA 2J1LA 4Y30A 5TLSA 3AILA 1RVDA 4FGKA 3D1JA 2ZB2A 3DZDA 4I81A 2GAIA 3DAGA 3PFGA 3D0KA 3K8QA 4EYKA 4YRLA 2PMFA 2IXDA 4J16A 2IYXA 2IZ5A 4ZARA 3RYIB 2OYRA 4JJ8A 3KELA 3QM1A 2WE7A 2FWIA 5DJ5A 1YZYA 3G0GA 2F8LA 4YRQA 5EJ4A 2HIAA 3QH4A 3O2QB 4FYMA 5E7MA 5F5XA 1PP4A 2FRXA 4LJ6A 2NXJA 4PFKA 4D3YA 1AKYA 3K9HA 2PSJA 1Y4UA 4FE3A 1JHAA 1OF1A 3K7EA 4JUCA 1G6KA 4EQZA 2CMFA 1NBOA 2X3FA 3DMFA 2BEJA 1ISIA 2FPGA 4W7HA 1JA9A 4X60A 4ZOBA 4XRRA 4MWZA 3QBVA 3QX3A 4PYIA 4V3BA 2GN2A 1D2CA 5EJEA 4PLGA 1T9GS 3E3NA 3IT2A 1UJ5A 2VEDA 1J2JA 1V48A 5LOVA 4UVIA 1T0IA 4O33A 4EARA 1ZX1A 3NUQA 2WTBA 3DXYA 2YINC 4P92A 3I62A 4XASA 1QF7A 3YASA 5LVAA 3GARA 3RUEA 2KBEA 3COVA 4L4SA 2ZJ4A 3FTCA 3UQZA 1I0LA 2C59A 4HDSB 1FNNA 4HNRA 3ENWA 3WRWA 4FDTA 1FTGA 5AVUA 4HNUA 3D2LA 4IFBA 3H9JA 2DSTA 5HXAA 3WL8A 3NHWA 5AIBA 1T2EA 4KDFA 1RMTA 1Z13A 2AFHB 5BSKA 4QT0A 5BSWA 5J23A 4NOKA 1I2BA 1ZNZA 2WJJA 2FQYA 4W6QA 1M6YA 3WYAA 2E6KA 2PZFA 2XOKD 3MUFA 4ZV7A 2GVNA 2VYQA 3LQKA 3BCSA 4KKXB 5JC8A 1N34B 4J76A 1T4DA 3U3MA 4MUKA 2Q1YA 4NE2A 2ZBDA 3CLUC 1RZRD 2WTAA 3AU8A 3IMKA 3TZKA 2D59A 4NS4A 4IOJA 1UJ6A 5M04A 5C46F 1QUEA 1JDPA 4JB0A 5KNDD 3HXMA 4Z54A 1RP1A 1V16A 2MT9A 2YZGA 1KMCA 1D4OA 2JVIA 4FZVA 5T7BA 3IOCA 4FSHA 2MIIA 3O9MA 1C0LA 4GQBA 4C2TA 5I7AA 4XWTA 1NUTA 1RPZA 1J8DA 4J9UE 3UK6A 2OYSA 2C77A 3BSSA 3D6MA 3NVDA 3HVUA 2YMMA 4Q3EA 1FQOA 5LD2B 3IAFA 1ZXXA 3W9BA 3BA1A 4PPQA 1U5BB 4FFLA 3PUZA 121PA 1ODLA 3ICQB 3H5IA 4E1AA 2YV1A 5G3YA 5JTTA 1F6BA 2GD2A 4MITA 1EUDB 4OHZA 1MXHA 2YWBA 3BREA 1ZNWA 2EKZA 3GDFA 4WD3A 4Q9JA 1EJ0A 4QEKA 1YZKA 2GBFA 3DEAA 3NWBA 3PXEA 4CMAA 4EQ6A 4ZHQF 4MLCA 1T4CB 3MGBA 2YIDA 4KGZA 5AJUA 1PF7E 1SK9A 2AV6A 2GTPA 5JANA 3RWMB 4DQVA 4Q4JA 4QARA 4FINA 1JYFA 5JAHA 2NU6A 3O2NA 3RNLA 1FC0A 4OF4A 1KKUA 4H6PA 2WWTA 3VPDA 4BZWA 3JZAA 4RZHA 3L18A 5BN4A 5FPKA 4AAYA 3LTNC 1ZH6A 4PX2A 3SDSA 1N7GA 1SZCA 5BWLA 1GPMA 3WG9A 4C07A 1P1KA 2VJBA 5ERYA 3A2KA 3VC7A 2DBRA 4NJMA 1URPA 2CF6A 3CW9A 5K0LA 1E1QD 3RS8A 4YXWA 4CIVA 4LHXA 5T8KA 2QZPA 4UUPA 2NP6A 3B1JA 1KERA 2IU3A 1U81A 2YZ2A 3K0AB 2CWDA 2R97A 1XTRA 4QICA 4QQRA 5AJXA 2OZVA 2FAXA 3B5IA 4J03A 4JLSA 4FDUA 3UXEA 2ZATA 5B7PA 3FUUA 3ND6A 1KYZA 1GAQA 3BWDD 2BY4A 4FGLA 1ESCA 4TUYA 4TT3D 2DPXA 2OEPA 4ZVLA 2J46A 1U5CA 1IAVA 1PJ8A 1V0JA 5IKPA 3K0CC 1Z2EA 4JXJA 4KRYA 1KNQA 1NNSA 2ZDQA 3VU9B 4A2WA 1I7QB 3AUUA 1Q1GA 2ZS8A 4YHBA 3PGLA 3BH6A 4LEIA 4NOJA 4QODA 4UEOA 4O63O 3SSMA 2UZ4A 2V6JA 4GYJA 2X4DA 4Q3CA 3AETB 5KJEA 4N5HX 4J6FA 4CODB 1DCTA 2UUCB 4Q4LA 2WF9A 3GBSA 3P2EA 2I3DA 1NVWQ 4KYUA 4PG7A 1YJAA 2RGXA 1QGUB 4NG4A 4BNLA 3A1VA 1SIOA 2X5KO 2C92A 3FF1A 4QC2A 4XPIB 2DFNA 5B1IA 3RIXA 2P6UA 3CG0A 3KNZA 4RVCA 3LC0A 4PHFA 3GZJA 1UK7A 3OKFA 3FYHA 3I2GA 5AW5A 3K6SB 1CRPA 4HVTA 5DBIA 1SXPA 3T3OA 4AX8A 1YZVA 1TD9A 3L0DA 2RAPA 2CEAA 1O4WA 3P96A 4RJLA 2Q7OE 3GP8A 4Q12A 3ZHBA 4JXXA 4PIVA 4ZQCB 5T5QA 2PZGA 2C2OA 2OBYA 3ABSB 4PRYA 5FUYA 3NDRA 1DLJA 4BVLA 2VA9A 2O59A 4MUYA 1SUBA 1U4NA 2OK7A 5LKRA 4GPAA 2FW6A 2FSHA 1WHTB 4WY2A 3N2EA 5JJIA 2GUWA 1EB9A 2RAVA 3TPFA 5HJ5A 3PGKA 1SXJD 4HWPA 3SBDA 4ZC1A 5IT9A 1DIBA 1KEZA 2G80A 4TWJA 1KETA 3B2EA 3QVKA 5G1PA 4CTOA 5K6TA 5K6RA 2O8EA 4IUDS 3IULA 4YGYA 2KLBA 2PUDA 5K4AA 4BKRA 4G0ZA 1GR0A 2Q5EA 1UXGA 3EDCA 5FOUA 3G0OA 4L73A 5DSTA 4YWHA 3SP1A 2V9CA 2B21A 3FFBA 3F6SA 1SU7A 3FPHA 3BCHA 2BBOA 4G2NA 4E51A 4UVGA 2V7EA 3PZBA 4ALNA 3O31A 3BERA 4C4TA 1YB2A 1KOFA 1LJLA 3C97A 4BUCA 3BMOB 1SVKA 3EEIA 4FQ8A 2P4UA 2ZYVX 2PUVA 2VYVA 2WYWA 4XM2A 2QSZA 4KVZA 4MYTA 5EHQA 1Z26A 4PYJA 3EWNA 4DMKA 4KW7A 2C3OA 4CLXA 3EEBA 5IAAA 1UFVA 1AZLA 4OGLA 3STVA 1WOMA 1QVVA 1DINA 2QTLA 5U1PA 4B4DA 4BX9A 2GB4A 1P6XA 1UMDA 2JCBA 2FOIA 3BH7A 3GELA 4OU5A 4Q7MB 4LE1A 4GMGA 4EKEA 5HBGA 4C0JA 2O8CA 2HUNA 2CVFA 1ICIA 5DNAA 1U3WA 1QS0A 3LLUA 2EDCA 1G20E 2IZ0A 1U2GA 1L6RA 3GLGE 2P2GA 3NLLA 2J6IA 2C31A 1NYTA 4NPAA 5LQUA 4DNOA 1KZ1A 2QMEA 5B7NA 1DXOA 1K8QA 1Q7BA 4CM6A 1ZGJA 4Z4EA 1U3TA 3ZZ0A 4D41A 1TUBA 5L45A 2X0JA 3QVTA 3L6RA 4R8SA 1A77A 3KUXA 1Y8ZA 5KVQA 3MYYA 3W5IA 2ZWOA 4QOSA 2MYNA 4NU5A 2KX7A 3LPDA 4D80A 3W6ZA 2QRMA 3NBYC 5IH7A 4AECA 4JLAA 5TQ2B 4E32A 2IWHA 4QVGA 1NNUA 1XZKA 2OMEA 3C5CA 4HRVA 4C89A 2IYEA 1QAOA 3W3AA 3V33A 3V4ZA 3FTEA 5K8UA 1CW2B 1VLMA 3ZW7A 4XYBA 4GYWA 2J6CA 1NSFA 3LE8A 1YKFA 3T5BA 3X2SA 4DDUA 4LCJA 3PCTA 4Q1EA 2PXXA 3FWNA 3LK7A 1XZQA 1GVHA 1NSYA 3CURA 3L01A 1R8JA 2GDJA 3E3LA 1FK8A 2ZB4A 3WWYA 3ZHCA 4B6EA 5BPHA 2RI0A 4HATA 2IEZA 2A9VA 2M32A 1BMTA 5AM3A 5KYUB 3SJUA 4NPCA 4B6RA 4JBXA 4CCYA 1NXSA 2ZUCA 4GI2A 4Z6KA 4ZD6A 5E8JA 2GEFA 1E2KA 2DBZA 1G2OA 3WC4A 4BNMA 2GCPA 1PWZA 1OOEA 4AMVA 5A4MS 3FKJA 4MWGA 5LYYA 5P21A 2XVZA 1H6DA 2Y0PA 1UPFA 3NASA 3ZCSA 1EGQA 3N8NA 1TCUA 4MR7B 4EUFA 4YMVA 4V1CA 5K8IA 3CN7A 4XVRA 4XTCS 4KPYA 2P9BA 2JIPA 5AXAA 4CF3A 3EVNA 3F4BA 5ALMA 4QT4A 1HBJA 3PHJA 1CUWA 3M1LA 3AUJB 3VOTA 3SQMA 1C8KA 4CKXA 3CWZA 3HXTA 1QKJA 3MF4A 4QDOA 4RVNA 1KMQA 3OE7A 2GZDA 1J0XO 1G3RA 1OE0A 1QGYA 2FK7A 2XTNA 4CMEA 3EXG1 3MCAA 2FR8C 1R4NA 2ZG6A 4BMSA 3I5XA 3EJ6A 4URWR 4YVFA 1V7CA 1XXHE 2EFHB 3BJMA 1X2BA 2ZRIA 3F0TA 2QYOA 3EVTA 1FDRA 2Q07A 3A6GA 1IDOA 2VNAA 1ZK3A 3ANMA 1CZRA 4O25A 1JMKC 4NH0A 3R7DA 2IYZA 3IKTA 2R84A 2D74A 1ZRMA 3TM5A 2JRLA 3I2KA 3HI4A 2GF2A 2QSJA 2IHVA 4HN4B 3HJRA 3IV7A 5EIFA 2QMQA 5FFNA 3PNOA 4PIMA 4CCAA 1Z4OA 2FUNB 2OA0A 1NN5A 4AULA 3EIUA 4DUPA 4X1YA 3O38A 3MCWA 2A88A 4HT3B 2ZJYA 5TMPA 1WXWA 4HSEA 2GNAA 2PL3A 3VFDA 1MW8X 2ZUEA 2AW3A 2Q9BA 1I33A 2GJ9A 2W6NA 3C5WP 3AQIA 3DQZA 1GUYA 3ROFA 2H0AA 3VR2A 5HIAA 3A8TA 4OLAA 3RKUA 3KVOA 3O4VA 1SBYA 2VLIA 4M1ZA 3A4LA 2ZJOA 1RDFA 3HB9A 1WHSA 3WP1B 3ZG6A 3K71B 2JD2A 1J0CA 2V6FA 1Q3TA 3L4KA 1T6ZA 4IHJB 3X2EA 4CM7A 3Q5GA 3O3OB 4J0FA 4TWZA 3ZNNA 3CZRA 1KDTA 4MKZA 4HEQA 2BEVB 2X15A 2JFUA 3AF6A 2I4RA 2VJLA 4ND1A 2V8BA 2Q5CA 3OFND 2C4UA 2LE0A 2F62A 1DAOA 4HDMB 4OBWA 1H2FA 5DNWA 5H16A 4RF3A 3U5TA 5FAXA 5BN3B 4U2KA 1Z4KA 3DMHA 4YY3B 1I0ZA 4DR3B 3ABZA 1QTQA 1VZ3A 4QKQA 2IODA 3JAWA 1S4MA 1NXPA 3DVQX 4I3FA 2WM8A 1RXEA 3CRNA 2Q3FA 3IQGX 3OA0A 4QD3A 3T9AA 1Z74A 5B3JC 3CNLA 3T5AA 5DNYB 2B30A 3ABOB 3HBFA 2R65A 3PPVA 3A4NA 4ZO8A 2XUDA 4XGIA 3VO8A 1IBSA 4QIHA 5KNLA 2XEXA 2RSLA 1D6SA 3LECA 2DM6A 4UATA 3BXZA 4B82A 1CFZA 2XITA 1UP6A 4KG7A 1XRSB 2EERA 2E48A 1I6WA 4XFJA 2EXXA 1FP4A 2IYVA 3E7XA 3GUVA 2PRZA 3EX7C 5FX2A 4ND8B 3HXLA 4WK0B 3RYFB 2EAUA 4I3HA 4NEGA 1E9AA 1PUJA 2A5YB 3GVHA 1L6IA 3DE4X 1OYWA 1LDGA 3Q2IA 5GOZA 2ETXA 4CLOA 3DCIA 3EGCA 1LVHA 3ZV4A 3VR5H 4QPDA 4TLAA 5KOJA 5I7OA 3I39X 1BXRB 1Q1EA 1FNDA 1MN6A 3UYLA 2VCEA 3BJEA 3QFHA 4NLLA 2DR3A 2FQWA 4JBNA 4O08A 1NDUA 3BYZA 1ZPDA 5K09A 3RS0A 5CA0B 1C3VA 1YXMA 1M3SA 4X1KB 5HKBA 2VH2A 1WBDA 2XXBA 1VLJA 4DQDA 2D2VA 4TYMA 5JPDA 3ETHA 4HX2A 4X97A 1PE0A 2XRYA 3S2GA 4DM4A 1O54A 3SDZA 4ZVTA 3SZ3A 2FHPA 1L3IA 5F3WB 1TYEB 3H65A 2J0QA 4EHLA 1N6KA 3O4JA 3DD1A 3DUFB 1BGWA 4AJIA 1N5IA 4L9RA 2C3YA 2Y27A 5HIJA 4DBVO 1JFSA 2FA9A 3T1TA 3A1SA 2FJUA 2N1BA 3QENA 2R1UA 3JALB 4MW7A 2K2WA 4A03A 2R85A 3SHVA 3PEYA 3WSTA 4XB2A 1HFKA 1MAHA 5CG1A 1T43A 3QQ5A 5H7XA 1ZAYA 4MRMB 2BZGA 1OB5A 4C6RA 2FJ0A 1SKQA 2ZJ1A 4LGCA 3QVLA 2AVDA 4MVJG 2XUZA 5JAIA 1M7GA 1F2TA 4CM4B 4L9SA 1KJ8A 3GRUA 1ADGA 3MAAC 3UJ7A 5FEUA 2PFGA 3QGMA 5IS2A 4ZZ1A 3P4XA 1N6PA 2R1TA 4EG4A 3RU3A 1VE1A 2AEMA 2H16A 2H2IA 2OLJA 2XQKA 3A06A 3I9OA 4FYIA 4GX0A 1Q0RA 3C43A 3JQBA 3CLVA 2O5RA 3MSCA 4XQGA 1W9HA 2A7XA 4H6VA 4D6PA 5I45A 2HDWA 1TMKA 3DZIA 3OH8A 1QCDA 2OFFA 5ADVA 2BFPA 1M76A 3ZHYA 4DVGA 1ID1A 4FHDA 4IFEA 2PRYA 2I1WA 2XX3A 3KB1A 5K51A 5DWVA 4DGQA 4EB6A 1SG6A 1V3UA 5IJWA 3MERA 2YZNA 4LV5B 5J2TF 2Q6IA 2XD9A 5EJ9A 1CE8B 1PDWA 4K9RA 3VDNB 3GEGA 2GKOA 4ZVKA 5KHLB 4LRYA 1BNCA 3N2NA 2W11A 3ZWDA 5BW6B 2GETA 3WRXC 3AL2A 4BQEA 3G7UA 3BFPA 1QB7A 2LW7A 3MLEA 1BKYA 2BBTA 3G3EA 2HRCA 2L19A 4FUTA 3DE1X 4HPWA 2NU7B 4KQMA 1A7UA 3U7JA 4R8KA 4OQLA 1F06A 1WUYA 4MVCA 1B7GO 5DMHA 5TPZD 2VDLB 1E1NA 2ZR9A 1RJGA 1E2QA 1Y5MA 4A3SA 3GA7A 1I4WA 3I9KA 5E9JA 1UAAA 1OZFA 4P3NA 2ZXEA 2QN7A 3R20A 1M67A 1KBQA 3FZYA 2QTHA 2R8OA 4LV8B 3IQIX 4MS3B 4FGUA 3FPGA 1KEEA 5JAZA 3CLTD 1UXIA 3GRZA 5CURA 3EVGA 1R74A 2E0IA 3N74A 5F9MA 2CE7A 4BMNA 1XD8A 4DHWA 2JLWA 1AZWA 1LC3A 1O95A 2H2GA 1GUZA 3DV0A 8ADHA 2IELA 1BH2A 1MRZA 3I76A 4FXOA 4JI7B 3ZDEA 3O8QB 4FOLA 1ZWLA 1U7UA 2OBFA 1BS9A 2HA6A 3KHTA 4DSZA 5GAJA 4EG0A 1H69A 1FDIA 1GNTA 4M0LA 2HPZA 4JOCA 3HEMA 4EPYA 3L7CA 4B5KA 5DN6D 2J0VA 1OB2A 4ZHQA 3IP3A 5IH3A 1M1YA 2X6RA 2XQJA 3RF6A 1M34A 2D1YA 1RYDA 3FPKA 2QIOA 2Z83A 4IS2A 4CZ2A 4JL5A 4CLRA 4TYWA 4PZLA 2BHSA 2RH4A 3CBQA 4UFOA 4DIDA 3O1JC 1G17A 4A15A 3PFIA 2AI1A 4LF6B 1CS0B 1NUSA 1P6UA 2PVCA 4JEUA 1QDUA 5D7BA 5KWVA 2SCUB 4TS4A 3L8CA 5BN5A 4CG2A 3F3MA 3INTA 4XUGB 5D6NA 2JS7A 4W5HA 3T7RA 2P9ZA 2PZAA 4LHVA 2D62A 2HAEA 2TS1A 5C1IA 4BO2A 4CU2A 1IBKB 1R9NA 4O6VA 5FBQB 3DL2A 4EVQA 3PX2A 4LQ4A 3R8FA 3DFUA 4D3SA 1E63A 1GNQA 5HKAA 1MAVA 1LLDA 5CVJA 1F14A 3RVJA 2NMVA 2X7HA 1O94D 3M7IA 3PX3A 5GQSA 1VYTA 3W8NA 3U39A 5K0EA 1VDZA 2CL6X 1FL9A 2ZJ2A 3CWCA 3SIWA 1FSZA 1ACMA 3V34A 3AHIA 4OHXA 4QXQA 4BLQA 4EKIA 4X92A 5DEIA 3BBPA 3L6CA 5HK9A 4RMIA 3HNRA 3KKMA 1T8WA 3BL8A 5T3UA 3TSAA 3ITKA 5DHQA 2HRZA 1CQJA 2Q9UA 3QFTA 5DW0A 1XTJA 5F4ZA 1W2HA 4IZ6A 2BGNA 5B5SA 4L08A 1DAPA 2XE6A 2A9FA 4YJ2F 2HJ9A 5JUWA 4BGVA 3BJRA 4G1FA 2JVKA 5EVCA 1YTUA 2J45A 5JSHA 1D2HA 5CLHA 4KBYA 4IDBA 1QJCA 4X1IB 6REQA 1TYDE 1XV5A 3DTVD 3NDJA 4L0DA 1K6EA 3AUYA 2EKBA 4TYYA 4FXPA 2W4MA 5JZMA 1CEEA 3ONFA 1JWAB 4OXNA 4QO8A 4A82A 1N0VC 1ND6A 4IH1A 3K70C 4QLBA 2CCGA 2F17A 1XZNA 3PQFA 1JDNA 4DY4A 7YASA 4UE6A 1LPNA 4UDYX 1CUEA 5CTAA 3SNHA 2QRHA 3TW8B 3U4AA 1K27A 1XLVA 2Y6VA 4Q4HB 3V8EA 4CKEB 2XDAA 5C53B 2F59A 2JA1A 4ZCQA 1JG1A 5IDXA 1O6CA 3D7SA 1QQ7A 1ABBA 1OYYA 3CKYA 1NZFA 4KIUA 3B6IA 7ADHA 1UK9A 1HOXA 3ONVA 2CDRA 1XEAA 2RC5A 3OMXA 4WMLA 3U0VA 1W8IA 5DULA 2YY7A 3PR2B 1EVJA 2EFGA 3PD0A 5EJGA 2ECKA 4L5YA 1L7RA 1DBRA 2P6NA 3HVJA 4Y9UA 2XZLA 2ZQYA 3I9LA 2XJ4A 4M8KA 1R66A 1HLDA 1D2AA 1ZOIA 4Y9TA 3G89A 5DNCA 3DA8A 1F9AA 1LV8A 3E82A 2FR8A 1H2ZA 1DWOA 5ECYA 1J9EA 1RU3A 3GZNB 1E69A 1C1YA 2JAQA 4LJ9A 4LJAA 1DKMA 3WJ2A 2BP7B 1V2GA 5KNCA 1ZN2A 2QSYA 3A1DA 1NONA 4WNYA 1K68A 2ZGVA 3BXEA 3KWJA 4GOJA 3ZCUA 3V4FA 1X8LA 1B00A 2D8AA 2WPDD 1OH8A 1PYOA 1G7CA 3G2LA 4OJTA 3RADC 2W8BA 1PGJA 4ER3A 1GKYA 3IPYA 1UPAA 4QQ8A 5E1DA 1I3MA 5KIAA 2C4MA 4MKGA 1KAEA 2ZBQA 3L7JA 4KXXA 4KWCA 2LZ0A 4NYJR 4BLPA 4P4GA 5TPWB 3V7FA 3T3NA 2QEQA 1ESMA 4V1CI 2QMZA 2F9MA 3G8CA 4BKMA 1IEQA 3HNOA 3BIOA 1OAOC 4C76A 1N7IA 1PYDA 2QE7A 2NPOA 1DTEA 2HLHA 2X2PA 5J2UF 2JCSA 3X1KA 2XUQA 3CXRA 3LUBA 2GN8A 3S4YA 3UG7A 4DJAA 4EGAA 4BO4A 5HZHA 1E6EA 5ICEA 3AL3A 3IMFA 3M4ZA 3EXEB 4LPSA 4D82A 1YACA 3NRBA 3OX3A 3JAKB 1KY2A 3GEIA 1MO5A 2IKQA 3SS9X 3ZVLA 1J0EA 3MS7A 3FHTA 3H9QA 3HEAA 1KI8A 4MW4A 3G0DA 2YWCA 1XF9A 4ESOA 3UMBA 2NU8B 2YV4A 3JVUA 1Y1LA 1CSEE 4DUZB 5DNUA 5GZ3A 4MKXA 3VZCA 1TUEA 3ENKA 3FRHA 4DDWA 4HLNA 1PJZA 3N2LA 5CVDA 3ZYCA 1ZXLA 1EIZA 3HUUA 4G37A 4IOMA 4OXXA 3AHEA 5FNZA 2WHYA 1AF7A 2FSVC 2YOHA 4GBJA 1XHEA 1N5DA 1RYZA 4GH5A 1IRXA 3T34A 2Z9CA 3RGWS 3GD7A 3FRJA 2B8NA 3OQIB 3PTAA 4QUHA 3H9UA 2RBEA 5IDVA 1GGKA 1W0KD 3VR0A 4YT4A 1H8HA 3B6JA 4F11A 3RC8A 3DLPX 2YVAA 5BUSA 3R7AA 2CLFB 1Y5RA 2V7TA 5JRJA 1EINA 4I5IA 1EM8B 4RS4A 4M46A 3KSRA 1OUMA 1C9DB 2A92A 5HTKA 4DWOA 8OHMA 3JZIA 1USWA 3ST7A 4HEJA 3GGOA 1IVYA 4BMCA 5HKKA 5LMUB 3K2IA 5I9MA 1GZSA 3DP9A 4QYIA 3FVVA 1X3LA 3MT9A 4UHFA 1IG0A 1OWOA 3A04A 5DGCA 2R8BA 3KQPA 4AYWA 1FRZA 2HWWA 1CIJA 5DCUA 2DFKB 3CZAA 1FUYB 1L4FA 1RRGA 1WKVA 2PM8A 1Q91A 3KD2A 3QWIA 1BZYA 4TXHA 3HJBA 4M1WA 2IH2A 1R5OA 4W5OA 3P7MA 2ZI7A 4Q4DA 4U3JB 3VHXB 1XFDA 4V39A 4PO3X 3KFXA 5HCNA 1V3VA 4A8PA 3DVAB 1LWNA 5TNXA 1MTZA 3UK1A 2BKAA 1SXJE 4E7PA 2XCQA 3KZOA 2FMHA 3Q10A 1JTVA 5CT5A 3RIYA 5EHXA 3A4TA 5KYNA 2BYTA 4N65A 4AL4A 3NHFA 2XWPA 2YJZA 3B5EA 1RXUA 3OX1A 4V0OA 3H16A 2OVFA 2BUCA 5IT5A 5LU8A 1TGVA 2DKFA 1MC4A 5CB8A 3CKKA 4G5OA 3F78A 4URYR 1W85A 4KPUA 2EL9A 4F96A 2ZUBA 1KK3A 4WFQA 3T1HB 2QLFA 4FILA 5JLJA 4U9UA 2FI1A 4M98A 3EMKA 3G1WA 4I4TB 4FB4A 3GPBA 2VQFB 4GWLA 1G59A 4LNUB 1SFRA 5C3MA 2E55A 1M6NA 5F52A 1BX0A 1M8GA 4ME6A 3GRAA 5J3JA 3U3KA 2XB2A 1XNJA 1N32B 4TM7A 2JAUA 1A5SB 4YJ3B 1FX0A 2YJNA 3N0WA 2PKQO 1MABA 3WLAA 1GPDG 3ENZA 4M0UA 1J25A 4MICA 2X0IA 1Y3CE 1Y9EA 1C3OA 2JAXA 5HGJA 2XZOA 1X1QA 3UWKA 3LKZA 3NTVA 1QPZA 1TGYA 1RWPA 4BGIA 3P0IA 4X8MA 2C0PA 1WZNA 3A3OA 4FNAA 1YQTA 1LPBB 4UUNA 2AK2A 3MIIA 1ZM3A 2CFTA 1OCEA 5CW1A 3NVKI 2BCGY 2X41A 3UG6A 4KLAA 2ODQA 2PGAA 4HF7A 4YBZA 3CEPB 4BO3A 1FDVA 2J9FB 2PX3A 1ADFA 3TYXA 3MNFA 2HXGA 2B94A 1P0QA 3LPCA 2WTXA 3DEHA 2Y66A 4RK6A 3HU2A 1KWGA 3P94A 3DVRX 3F90A 1GA1A 1FXSA 1P4HA 1XZAA 2I22A 3S68A 1C50A 3DVSX 4GD3Q 2VF8A 4ZFNA 3IOYA 3PIRA 1VLZA 4JENA 2XXAB 2O6HA 4UHCA 2R5NA 1KPHA 2H59A 2HDNB 3FPLA 2WUVA 3F7MA 1AS2A 4ND6A 5F3RA 4V0QA 4BMVA 1BCSA 2HMVA 4AU1A 1E66A 2F55A 3FCUB 3T41A 3KR2A 4G4SP 5C18A 4W1RA 4ZYYA 1JEQA 1GSAA 1NVVR 1FDTA 2DKOA 4BVHA 2A8YA 3QUTA 4DJTA 1H5UA 4FEEA 2Q2WA 5EYPB 4DEXA 5L3QA 2VS1A 3L3BA 1RYHA 3CEMA 3IVRA 4HI0E 3KPUA 4D2IA 1JZTA 1NPDA 4II7A 1I1HA 2QAGC 4JY7A 3GO4A 2WTMA 3LHDA 4ND3A 5JXJA 3AJ9A 1YMVA 3ICCA 3CV3A 4EAAA 4HEA6 1G6HA 1UT5A 2JGJA 3M9XA 3Q8XB 1V1MA 3OZDA 3WXMA 3ZPXA 4POAA 3E23A 4CTNA 1NDHA 3K2EA 5FPTA 4TQUS 1OWLA 3IEVA 4TGLA 1UM9B 2C83A 3WDKA 4BNTA 2IU0A 5JJKA 2JCGA 1ESZA 4DAEA 1TCVA 1SQFA 3HM2A 2OFXA 4UEJA 4UD6A 3L0SA 3EC2A 1GXSB 1JI3A 2C5SA 3ZIAA 4BGDA 5CXSA 1C4XA 3R6LA 1XTIA 2GI4A 1CB7A 3TRDA 3KEOA 3BE8A 3NOQA 1LS6A 2VPYA 1A69A 3Q6IA 1X1SA 3U48A 3ZTWA 3L04A 4KPEC 4ZCMA 1ILEA 5A4JA 3BJIC 1C8VB 4EK9A 2JG3A 4JA2A 1CJKC 1NNLA 1CUXA 1YQWA 3OOSA 4GI3A 4ENVA 2B9EA 1U0SY 1L1EA 2Q2OA 3GPIA 4KE8A 4IVNA 1WSWA 2SECE 4X94A 5LBUA 2AN9A 3MCVA 3USES 1SRRA 1E89A 4Y0VA 1HPLA 4D3FA 2P67A 3AVYA 4P4SB 4QPZA 4L8LA 5B30A 2BFEB 1BH6A 2GAOA 4YMTA 2WAMA 3UAXA 4MCAA 3SYKA 1NE2A 2CNOA 4HGZA 5F77A 3R5KA 5DI9A 2NYVA 5AM2A 3AHFA 1N9GA 5BMOA 2AHOA 5JCOC 4F4JA 4OLHA 3L82B 2ACVA 4X6UA 4EPWA 421PA 5IDYA 1NUHA 5J2TA 2EGGA 1A3CA 5A04A 3KEQA 2RHHA 3LRXA 1FOEB 1GZ6A 1VJGA 1XMSA 3HI6A 3G17A 4GOXA 4H1HA 4ZDWA 1I9CA 1RCTE 4NCKA 3VNSA 1DCMA 5E6SB 4BLUA 3RAFC 2GPBA 2AK3A 2IEGA 3KYCB 4OGKA 4CKCA 1I13A 1MC1A 2Q5IA 3QNWA 4A0GA 5BSHA 5CYPA 3KQHA 3H9EO 4ESVA 1F2UA 5AJHA 4Q03A 3MJTA 1D0SA 5AW8A 1ACLA 1I7SB 4PGMA 5HNKA 4G01B 1IOZA 1RD4A 4K40A 4RETA 4GT1A 3GAMA 4AF6A 1EX1A 1HE1C 3C15C 3OU7A 2FLKA 1GCGA 3I2FA 3UTDA 3H2YA 1U7OA 4Q6WA 4ARBA 3VDXA 3WMFA 4PZAA 2AVNA 2CMKA 3CEAA 4CMIA 1T10A 1P3JA 3UATA 4F1JA 5JNUA 5FUBA 2ZRBA 3N2GA 1OZAA 1IHOA 3QE2A 1ZZGA 1XEXB 3JV7A 3IX7A 4EFNA 2P5SA 3FYUC 4U63A 1CUUA 1SD1A 3RRZA 3UHOA 1Y6FA 1GTZA 5I5EA 4ZWNA 3RK1A 2WFLB 2I9PA 3GJ0A 1WCXA 4UMDA 3AEQA 4MRAA 4JVMA 1VA5A 2D0PB 4H17A 3CKLA 4Q9IA 4LOAA 1PS8A 2YW2A 2HFJA 4P4TA 1JG6A 4UEWA 4RD0A 1FFWA 4FFNA 4RTNA 1CCWA 2R68A 4XLZA 2H7YA 1LTKA 1T3LA 3H8SA 5HDBB 5JWRA 1LI5A 1XLTC 1KU6A 2WIKA 4Y6GB 3CNEA 1RRPA 4R1LA 2PX2A 4HDAA 3DW1X 1Q77A 3CW8X 4LRXA 2X4GA 5I3ZA 1BVHA 1J33A 1RWKA 4NAUA 5L3RA 3E9CA 5HX7A 1Q1AA 1AGXA 1YVRA 4KIFA 4RGQA 3EUAA 3QELB 2EDAA 2R2GA 4WA7A 2QTNA 5FNVB 4YWJA 5ITZA 5AJZA 1M1ZA 4Z4FA 3EUFA 1GPJA 3O8CA 1G7RA 4RVFA 2X8JA 4REOA 5FTLA 1KZ6A 4DMGA 5KPDA 3FGZA 1YDEA 1TAHA 3WYBA 4ZIRA 1R9JA 2Y2UA 3NYRA