3GT4A

Structure of proteinase k with the magic triangle i3c
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The magic triangle goes MAD: experimental phasing with a bromine derivative
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords proteinase K
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3gt4A00
1ZVKA 1GNVA 3DYBA 4KG7A 3LPAA 1LW6E 3AJ9A 3DE4X 2SBTA 4DWWA 5FAXA 4BWGA 1DBIA 1SCBA 1AQNA 3DDZX 1TECE 1S2NA 1TM4E 1ST3A 2PWAA 2X8JA 3VV2A 2Z2XA 1PFGA 1T1GA 3DWEX 4MZDA 1Y3CE 1C9MA 1NDQA 1TM5E 4YN3A 2IY9A 2Z2ZA 3WIVA 3ZXXA 1BFKA 1S01A 1KE2A 1AH2A 3TI7A 1GNSA 5JMOA 4J94A 1AK9A 1CSEE 3VV3A 1GA4A 2DP4E 1AV7A 4LVOA 4NMXB 1KDYA 3DE6X 3EIFA 1BJRE 1SBCA 1SIBE 1Y48E 4OV6B 1BH6A 1AU9A 2G4VA 3LPDA 1CNMA 1SUDA 2WWTA 2HD4A 1SH7A 1GTG1 3DW1X 4H6WA 1TO2E 1WMFA 1Y3DE 4DJ5X 3SQOA 1PJ8A 2IXTA 1UBNA 1V5IA 2SECE 1T1EA 2W2QA 1Q5PA 2GKOA 2DUJA 1SIUA 1BFUA 1SN7A 1TO1E 2ZWPA 4ZOQI 1OYVA 3HJRA 1IAVA 2WUWE 3DE5X 1WMEA 3I30X 5I9SA 4AKSA 3DVQX 4WOBA 1BE6A 3I34X 3VYVA 5JXHA 2W2NA 4HX2A 2P4EA 5B1DA 1SUCA 1SBIA 1ZVJA 1YJBA 2ZRQA 3EDYA 3ZXYA 3SICE 5AMXA 3I2YX 4CFYA 3TECE 2WUVA 5AVJA 1GA6A 5AVKA 1SUEA 2SNIE 1Y4AE 3QTLA 4LVNA 5AQEA 1AVTA 2PRKA 3DE0X 1R6VA 4C3VA 5ARBA 4GI3A 1SPBS 1GT91 4OMDA 2XRMA 5CW1A 1KDZA 4FONA 3F7MA 1GCIA 3VTAA 4KPGA 1C9NA 3AJ8A 1GTJ1 1THMA 4NE7A 1WVMA 1TK2A 1SIOA 1R0RE 5FFNA 1EA7A 4H6VA 3UNXA 1SCNE 3VSBA 2PQ2A 1Y3BE 4Z2AA 2SICE 3DE3X 1R64A 1NDUA 1DUIA 3P5BA 3PTLA 3DE1X 1JEAA 1Y4DE 1XF1A 1C3LA 1SUPA 1TM7E 3CNQS 1HT3A 2ID8A 2PMWB 1MEEA 1V6CA 3EE6A 1A2QA 2TECE 4CG0A 5FBZA 4HVLA 1OYOA 2Z30A 3TI9A 1Y33E 5ARCA 2W2OA 1TM1E 3F7OA 1YJCA 3GT4A 3LXUX 5B1EA 2ST1A 1YJAA 2ID4A 2Z56A 4AKTA 5SICE 1KE1A 1SUAA 4I0WB 5ARDA 3A3PA 3WQBA 2Z2YA 3CO0S 1MPTA 3DVSX 1P7WA 3Q5GA 3D43A 3T41A 2HPZA 4H6XA 1OT5A 1PEKE 3BX1A 3I37X 1IC6A 1SVNA 1GTL1 1SBTA 1SCJA 3A3NA 3QFHA 4KB5A 4M1ZA 4OMCA 2E1PA 1SBNE 1SCDA 2WV7A 3AFGA 4NE9A 1YU6A 2V8BA 2W2PA 5JXJA 5JXIA 5K7SA 4DZTA 1TMGE 4CFZA 1Y9ZA 4WOCA 3WIUA 3GCXA 4B5LA 3L1KA 3OSZA 1GA1A 1SELA 3DW3X 3PRKE 3WHIA 4K8RB 1T1IA 1SBHA 1SCAA 1WSDA 2ZWOA 4C3UA 5JXGA 1Y1KE 3F49S 3DVRX 3LPCA 4RYDA 2B6NA 1NLUA 2W2MA 3BGOS 1P7VA 3H42B 1P8JA 3Q40A 4JP8A 2PWBA 1BE8A 3D9QX 1AF4A 2PKCA 1S02A 4ZARA 2QTWB 1Y3FE 3A3OA 1ST2A 3GCWA 3GT3A 1SUBA 2PYZA 1Y34E 1C9JA 1KDVA 3BPSA 1TM3E 3DE2X 2XTJA 3VHQA 1EGQA 2Z57A 3QMPA 2X8JB 1WMDA 3DE7X 2Z58A 1PTKA 2DQKA 1VSBA
chains in the Genus database with same CATH superfamily
2ZREA 3L0ZA 1XSEA 4HL6A 1MO6A 4BWGA 5CPFA 2NQ2C 3UMYA 1NUSA 1XA3A 4IOLA 4OSEA 1KNQA 1GTVA 1FP2A 4I1YA 1U8YA 3FH0A 3OLCX 4ZGGA 1ZK3A 4K3UA 1GQFA 1U3TA 4ZCPA 4B0PA 3QIAA 4I2VA 3NJ8A 2PRSA 1BDBA 3X1DA 3EEOA 3SHWA 4JC8A 2H4JA 4F85A 1ZRNA 4FKBA 2BGGA 3TLZA 1V5GA 1KIAA 2NYAA 2DBYA 3WNBA 2J7PA 5JS7A 3ASUA 2HHHB 3O9VA 2W98A 1YS7A 3ZWBA 4OB7A 2Q3DA 2Q9CA 4RMIA 4JXJA 3ZYZA 1IIRA 5JDCC 3OO0A 4CKZA 2ZVJA 1U2RA 1NTRA 3VR5H 4OMUA 3MQ2A 5EWLA 4QUEA 1RE0A 4F84A 2V54A 5CM9C 1BFUA 3FFBA 4EHBA 3URMA 1V95A 1B0AA 2A1TS 1H6BA 2YYYA 3UWMA 3RYCA 4DG5A 1HRDA 4J9UE 3PI7A 3KQNA 1P74A 1UZLA 1BE6A 5T4BA 4QU5A 5I7OA 1N92A 1SJ9A 2PLRA 2I87A 4IAOA 4PPYA 1KIFA 1TE2A 1J33A 4GGOA 2IU0A 3U60B 4YMWA 1GZDA 3FZNA 3PFIA 4GR4A 4C6SA 2M32A 3M4XA 1ZA2A 4DQUA 1A0OA 1D7OA 1FNBA 2NACA 2NX2A 2XA2A 5EXTA 4H59A 3RS4A 3VNBA 3DUWA 5DNYB 3OZXA 1I1HA 4D9EA 5E4FA 5TQ0A 3DDHA 2PBRA 3CUWA 3WL3A 5I8WA 1IZ0A 4MPPA 3KB1A 2GBCA 2DTXA 1UR5A 2J5RA 1R6BX 5K8IA 4BASA 3PLNA 3FRJA 1IY1A 3W5DA 3ZLJA 1GGVA 4TS1A 4TRRA 2UUCB 1A95A 2CEKA 5HFJA 3COSA 1PE0A 2PSHA 4XUCA 1SCKA 3A2KA 5EFOA 3AUKA 2UZ4A 1Q15A 3PPIA 4WFJA 4EEZA 1XRNA 1IEWA 1JR3E 1S8AA 2N42A 2P9GA 2EBUA 4IDDA 1W36D 3H11A 3QW4B 1OD6A 3RS8A 3O3MB 5PGMA 2Z56A 4EZIA 3W6UA 1SUAA 1GPJA 5DBGA 4OQFA 3RSCA 4BUCA 4F5EA 1M0TA 3ONWA 4PGFA 4HCJA 3E4DA 3FSEA 4OHYA 1GDTA 5KDLA 1AMNA 4KRXA 3BERA 4DARA 3ANSA 2AJ8A 1HDRA 2FYTA 2WRZA 4OIMA 3NHRA 2IEDA 4RAQA 4DILA 3FCUB 2ZTMA 3UO8B 4JHXA 1Q22A 1JQEA 1XZNA 2IHVA 4GLLA 3DZJA 3HGMA 4TV8A 5JQGA 4CQNA 1ADYA 5IUKC 3X3HA 1KSJA 4PNZA 2OKCA 4TGLA 4YFYA 3VR5A 5AW7A 2EX4A 5IHXA 2JFFA 3TX2A 1N5LA 2YN4A 1PZHA 4IO0A 5FP0A 3PHIA 1KOJA 3QLVA 1N5KA 3I6BA 5E4TA 1ZUIA 3CT4A 3HYLA 4YRSA 4DLWA 4KE9A 4GICA 4DXAA 2XQKA 1ZOPA 1K4KA 3BPSA 1F06A 1WO8A 5KYYA 4JNCA 4I66A 5GONB 4EKYA 3TSZA 2IT1A 2P7HA 2CXHA 2WWXA 4YJFA 1JBKA 1T5OA 4NDZA 1NGSA 1U9YA 3ROQA 3U1TA 2VXCA 3UPUA 5EVJA 1AQNA 3AR5A 2VQEB 5ALVA 2AOTB 4HBGA 5MGBA 2C8KA 1XLTC 3CURA 4ZXPA 3U4DA 2WHPB 1MAUA 2G0AA 2P5YA 3GAZA 4IH9A 3ZJ4A 3KT0A 3MERA 3NM5A 3TI7A 1WETA 4HWPA 3WLMA 3ZBUA 4MWSA 4CT0A 4EPVA 4UU7A 1JFLA 3LF1A 5DYNA 4ZJYA 4S2UA 3L7AA 1DAPA 3NBKA 1KRHA 4B8ZA 9LDTA 2G9UA 4D45A 4W9NA 1LBQA 4PHCA 1XRPA 4FW9A 2RGEA 8ADHA 2VCHA 3MINB 3JASA 3SF8B 4ZCTA 1KH2A 2H1OA 2ZJ5A 4Y18A 5E6UA 1GZ5A 3TDNA 4EO4A 1VHWA 4WUTA 2YZMA 3K1ZA 4AZ0B 3E9MA 1OZHA 1XMJA 4JOQA 3EQ6A 1HDZA 1Z12A 3EDOA 3VH1A 2I29A 5TGZA 3IVAA 3D81A 3L49A 4PW0A 4IEFB 4WBNF 5C80A 1JUDA 5LCXA 4LGYA 5LLSA 2XLCA 2IQIA 4JH0A 4LIPD 4MSUA 3EDQA 4F9EA 5LZ5A 4DJFC 1CY8A 1QIJA 2O20A 4JB0A 4ZALA 3ZH9B 1Z3IX 3IGFA 4GOJA 1OE0A 3AZPA 3TQRA 3IO5A 3BXPA 3BD7A 3HA3A 2O59A 1TVCA 2DECA 1PK7A 2GAAA 1T4CA 1RJEA 2PFSA 3H1TA 4ZZ0A 2OBNA 2R6CA 4COOA 3TEJA 4CKCA 4GM0A 4CNQA 2OO7A 3EGEA 1D2HA 3OICA 4ZOBA 1G7CA 1AN9A 2QPLA 4J03A 4MR8A 1B3RA 1A50B 4DM4A 2Y1KA 5AJWA 4EGAA 5BSEA 2IODA 1BFDA 2KLBA 3CTMA 2NT4A 3WDKA 4RCZA 5KPJA 2JAOA 1K2VN 3IEIA 1SB8A 1U3GA 2JJ2D 2PO5A 3KOOA 4M2LA 4WE3A 1M8PA 2C4UA 1CG6A 4QQKA 5D5QA 4ZI3A 5IEJA 4PCUA 4N18A 5CH3A 5HZKA 2RGRA 4XKJA 3FMFA 2GEFA 2XXBA 5AVRA 4I08A 2ROQA 2PYIA 2AFVA 4RJJA 3H4TA 4AKEA 1O9BA 4K3VA 1XC7A 4WOJA 4R5MA 2DH5A 1QFXA 1NR7A 2IFTA 3AETA 4OOEA 2R6DA 3USZA 2JEOA 1T29A 1DIRA 4Q7KA 3IUYA 3LT1A 3KSUA 3QVGA 3DCJA 2QXYA 3AKYA 3K70C 1E3TA 4D8YA 5FEMA 1X1RA 2GEDA 3GFVA 4QYWA 4XJSA 5G0TA 1E0JA 1VE5A 1Q14A 2D2XA 2W83A 3MTIA 1JA0A 2R7AA 3JATB 2I3AA 4YMVA 3U2QA 3BE8A 5LJIA 5AHXA 2WG2A 3X1MA 4C21A 2JFGA 4QQRA 4J0CA 4BE4A 4G0WA 3F6SA 5EUMA 3WSVA 4V2IA 4WL0A 3W5SA 2PKEA 4X00A 5KTOA 4D96A 3CONA 5KI6A 4WN9A 2Z6UA 4ZFNA 2FSSA 4TTJA 3DONA 2D5AA 4RPLA 1H4TA 1HOXA 3IE0A 3QYJA 4G23A 3WKCA 4BFYA 4BNDB 5IBQA 4RTMA 3WGIA 1SY7A 1J2UA 3V1NA 3BE4A 3O8OA 4DMRA 4LRYA 3PQFA 4ROTA 2B2XA 4C08A 3DCNA 3HLKA 1DRUA 1Z2DA 4D5EA 3Q7PA 2PVCA 4JNKA 2HHAA 2ZR0A 3AG5A 4B7ZA 3H9EO 2JCGA 3U49A 5HJ2A 1Z07A 2GFHA 2AG0A 1B16A 4F4HA 2NSJA 3ZOKA 5L6LB 1RABA 4NG5A 1QC5B 5G0UA 5ALRA 4WPGA 4DGQA 2F8TA 5FJIA 1V9CA 4DIEA 4L0QA 3T38A 3TQIA 1ZI8A 1N7HA 4RANA 2PZJA 3ZWKA 1IY0A 3GBPA 3S2UA 3K1AA 5CG2A 2JLCA 4JSTA 1UFRA 4FE3A 5CLHA 2I33A 3HPRA 4OGFA 3NYRA 3W8RA 1EWTA 4RGQA 1W5FA 4NJMB 5CR9A 1G7TA 4F46A 4YR9A 4JYZA 2BGUA 2O8FB 4ME6A 1A5SB 1NC1A 3FHJA 3BBLA 221PA 3NHYA 2BMEA 1UXIA 1SBYA 3QY0A 4Q4HB 1WB4A 3TQFA 2ECOA 1GGFA 1XZAA 3CCCA 3GQBA 1FP4B 4MUEA 1JHUA 1C0IA 1NYLA 5REQB 1LJUA 3NU1A 3QVOA 2YWFA 4UTNA 1YZLA 4RJLA 3K1JA 4WZBB 4L3OA 3WL4A 4EYKA 4L51A 4CLEA 2OCAA 2AMFA 2K87A 1CUXA 4BDSA 3ESDA 4DXHA 4ZJZA 1E5LA 3K53A 1N6KA 1G42A 2AOVA 3D5QA 3GNQA 4HWRA 4OJNA 3UMSA 4E4RA 3N74A 4RZSA 3K0FA 1N1DA 5AXDA 1E1RD 3WYCA 4F9FA 2MMGA 2XECA 4N8SA 2J07A 4WCFC 2HY7A 1OC4A 1RWOA 1QS0A 4HAVA 2VJCA 4PG8A 5CDHA 4LC1A 2BUBA 4FT4A 4HQFA 1PSZA 2J87A 1XYYA 4LY0A 1PYGA 1VRCA 2FX2A 2ZTVA 2WK1A 3DXXA 3QUBA 5B57C 1PWZA 3U7FB 5JNLA 1Y4UA 2OV8A 1OKKA 2WQZA 3OE4A 3MD0A 1E3QA 1HT3A 5ALOA 2QPOA 2YN2A 4CG0A 3EGXA 1BC5A 3MN1A 3PDIB 1G16A 1Q0UA 1SB9A 3VPDA 4BBPA 4DE5A 4ZI7A 2YNMA 4GP6A 5L3RA 4XVUA 1SZCA 2I2WA 1TAHA 3IAS1 3OLYA 1GNLA 2JEYA 1XP5A 4KLCA 1TKBA 3EHDA 4DCGA 3BTVA 5DP1A 1UXJA 3KUXA 2OFFA 4BNJA 2BM9A 2VDQB 3OBIA 2N47A 3CF2A 3MCUA 4CM6A 3WXBA 3RAEC 3F47A 1UDRA 4CIDA 5KTYA 3F90A 2QVYX 2F8MA 4ZVKA 3FZEA 4J0QA 2Z8XA 4ZO9A 5HZMA 3D7RA 2QDKA 3Q1LA 4LMAA 1OR8A 1QB7A 3QEKA 4QBIA 3CR7A 3HDTA 4XR4A 4DA6A 4Q7QA 2PGNA 2X22A 4R7ZA 5JS6A 3C85A 3CH6A 1VZ2A 1X1AA 3OWOA 4WXYB 5I7AA 5B6IA 4RS3A 1U3FA 4XYBA 3WLOA 5KTTA 4FYJA 2PWBA 3T1VA 1BE8A 1OXUA 1C29B 3LKBA 4UEKA 1XXLA 3DB2A 4MLZA 3UJNA 4GKKB 4NS4A 5HQTA 1JA1A 2F43A 2P2DA 4EDHA 3SQWA 4DLNA 1JR4A 3TR6A 4E12A 5K0JA 2GERA 1Q77A 3LJKA 4M7WA 2HCJB 1LPSA 4YAIA 1EVQA 1K27A 4OTZA 4YBRA 4AF7A 3E27A 2JH9A 3WGUA 3AHGA 3HB5X 1TK9A 3AKDA 3O95A 4JB2A 2C1ZA 1E8NA 1R18A 3OD5A 4JI8B 1U0HC 3DFKA 5CP8A 1FX0A 1PLLA 4X8HA 1QMGA 2BZ1A 2JFBA 3KOUA 3T1OA 2LRHA 2ODBA 3ULKA 4CUJA 4MS4B 3H5TA 4RJ2A 1ZU4A 4AZVA 2JCSA 1DJLA 2LKCA 4HRXA 2Z6VA 4OXXA 4WZZA 4P84A 4D4MA 4DCCA 3QOXA 6ABPA 2CHVA 2R0QC 4BUJA 3Q7RA 4UVDA 3DBVO 3R4VA 5ADVA 4KVZA 3NHAA 4KXWA 3GO4A 1FTWA 4Q05A 2WZBA 5DHQA 4E46A 4RMHA 1BX1A 3X44A 2ONYA 3CWZA 2DY0A 4JUFA 1A97A 3VSEA 1N0UA 1M1YB 1Q7BA 2NYVA 1PO7A 2GQ0A 1T8TA 2YS6A 3BZWA 3OCYA 4FMCF 3WK4A 5FADA 3T6KA 3N2KB 3NOQA 4EUNA 5I3ZA 1A82A 1RXEA 1VA5A 1CJTC 2CXOA 4XUEA 4OHOA 4ITVA 4UZSA 1F8XA 3S7ZA 2K4MA 4YNBA 1Z33A 4L28A 4RVNA 1EJ6A 2IBMA 4X61A 4X60A 1X14A 4JWTA 4NJEA 3HTXA 4PZEA 1FTYA 4CODB 1X7DA 4LY6A 2R8YA 3BS4A 5DNAA 1Z36A 1E9EA 4C30A 4QGSA 4LMBA 4LYFA 1K75A 2DZDA 1Q7EA 4YH1A 3DF7A 5FL7D 2ZBUA 1UDCA 2B5OA 3SICE 4Q7EA 2WM9B 2OZEA 3CPEA 2PBZA 3VPSA 1GIAA 2GEKA 3GJ3A 2P1ZA 2R85A 2OUIA 2R97A 3D59A 4UBKA 3F8SA 1OH6A 4IIUA 3T3MB 4DLSA 4FONA 1C2TA 1FYXA 2J7PD 2NUBA 3AJDA 1P5JA 1K86A 4LOLA 1SKBA 2Y1FA 3PE3A 1SO8A 1PR5A 2EC5A 2P6MA 3PD7A 3QUQA 3R7DA 1BS1A 4R8MA 1W581 1KRWA 1S1CA 1ZGHA 2PL1A 2FDRA 2G83A 2CJXA 4LKRA 2JH8A 5JPCA 3ZDCA 2G7MC 4KJXA 3UK1A 4U0KA 2CZCA 2QIPA 1DQNA 3GYGA 4H7FA 1M3SA 4HATA 3SHQA 3U80A 3W79A 3OZSA 1RLOA 1LTQA 1SQ0A 5BUSA 2QLLA 4CKCB 3GRFA 4DBZA 3ZHOA 2H17A 1H23A 3HB7A 4TWJA 5JMTA 3DA8A 3UENA 2ZWVA 3C4JA 1FZTA 5BVGB 1RWMA 4XGNA 5FI0B 5KS2A 5FBHA 5FWYB 3EOAI 1ZX1A 4FFRA 4WDQA 2P75A 1P5HA 1VCMA 1VYHA 2AI3A 3BL6A 3CV3A 3PFBA 3TWOA 5EEGA 1UMKA 2WM3A 1O94D 3LC1O 2DYKA 4MA5A 4TLBA 1R4NB 5JCXA 1IXYA 4L5CA 1OH8A 4J2TA 3N86A 1U9IA 2H4XA 3HCBA 3NJ4A 1KP3A 4JEMA 3VH4A 3GAAA 4WKBA 2A84A 2VXOA 2WYWA 1Z5WA 2ZROA 3HU3A 1CQJA 3VNRA 1O9GA 3REGA 2P8SA 4OH1A 3G8DA 3EPPA 3JPYA 1Q0PA 4F11A 1GCUA 1HTBA 2IP1A 4F92B 1K5DA 1N5MA 2FQXA 2AZMA 3WS7A 2D3TA 3TZ6A 1RRFA 1YTLA 1ADFA 1NJ8A 2PZFA 2RG7A 3C87A 1KMHB 3KCQA 3LY9A 4QOEA 4EA7A 4C2UA 3Q0TA 5M29A 1DKQA 4HVCA 4TT3D 1JAYA 4RD4A 4CE6A 4LZPA 4O4JB 5F4ZA 4JLAA 1D3AA 1XCOA 2EATA 1Q57A 1FYVA 4JT4A 1PZXA 5EJMA 4B3GA 4TUYF 2WAAA 2ZDHA 4QFCA 3TSWA 3I39X 5FPSA 1A7UA 2PLNA 4Y6LA 5A7FA 1VE3A 3G2KA 2WUFA 3WOHA 2ZAYA 4FUQA 3DFUA 3K9WA 2IEBA 4BV9A 4TYPA 3RVQA 2ZRJA 4I8IA 4IIHA 4B3HA 1V3TA 2TSYB 3RAJA 3TTXA 2YVAA 4BGDA 2AJTA 1GYPA 1CSEE 3C3DA 3DLCA 1A9PA 2D2EA 2CV1A 1XTQA 2QP4A 1HGXA 1ZIDA 3BKWA 3MWFA 3OTHA 4ZJUA 4UQLA 5L4NA 5GIPE 4WADA 4ZODA 2VRNA 4CGZA 5KAPA 1IHOA 2JJ1D 5BNFA 1GNRA 2B7CA 5BQPA 2PIAA 4G5YA 1AA9A 5ELMA 5B3LA 4EBBA 2WMOB 1C9YA 3R6WA 1SHJA 4H0FA 1WHSA 3QA3E 4YP0A 3GXBA 2ATIA 4Y2SA 2YL2A 1JHMA 2PT7A 3I4FA 3B8HA 1KI3A 1Y4ZA 3JZIA 3QFTA 4DA7A 1R50A 4E5UA 5J43A 4N48A 3G88A 2IHTA 3HJCA 5BNZA 2JLUA 4B3SB 4KQHA 4DLXA 1RPJA 1CFZA 4XWTA 5LZ7A 1SQSA 8OHMA 2YC2C 4L9SA 3O38A 3C6BA 1QCZA 1G4HA 1ODCA 3I45A 2IDJA 3O4GA 5BR8B 2DR2A 2E49A 2GFQA 4WNAA 4PSDA 1OPRA 2I67A 3AERB 4P4UA 1R7RA 1P1KA 2VOJA 2DHCA 3IQIX 3KHTA 3F71A 3I0NA 4HAXA 1KZ1A 5EQDA 1SIOA 4ER6A 4YUWA 1M5RA 1ZD5A 3A0UA 4CEHA 5MN4A 3HUFA 1B73A 1MLDA 1NFQA 2Y8EA 4DSUA 1TTTA 2FPPB 4MP3A 1ZU5A 1KFEB 1L7PA 1Z4NA 2JFQA 3U4QB 2W6QA 5EP3A 2VXYA 2WWRA 3C8DA 3L2OB 4LRXA 1XQWA 3L0IB 2VIIA 1M74A 1XNQB 1XNRB 2ZUSA 4C6TB 4E2WA 1ZLYA 2P8JA 1OYOA 2WKRA 4DY6A 4KHPB 2IDZA 3OM1A 1LS6A 5ICCA 2J9ZB 3LOQA 1N5IA 3UMRA 3X2SA 3EXFA 3GT4A 2PUGA 4BMSA 5M04A 4HNUA 4GW3A 1JR3A 4LZAA 2P67A 3IDQA 4HY3A 4NOKA 2AJCA 2JAHA 4Y1EA 5J63A 3S2FA 5IAJA 1V5EA 2FETA 2V8OA 5FNZA 3P2JA 5L6MB 4WY2A 3H4VA 4G4IA 2Q9UA 1AKEA 5HIIA 5BT8A 3LX8A 5K3SA 4F93B 5K0BA 1EVLA 1D4FA 1SZPA 2G9NA 2JGEA 4IR7A 1OMOA 3IP8A 2GF9A 1M54A 4FZ5A 4X45A 1HLFA 3GD7A 2AW5A 3OECA 4IM7A 5AVYA 5DK4A 4KSYA 4JI0B 1IEQA 2HREA 3H87A 2Q2OA 3L1KA 3ZU6A 4Z7JA 4PHTA 1RWNA 1E3LA 5CXQA 3QIVA 3WGYA 4QBFA 3IH5A 5AKJA 3AR8A 1XPOA 4O2BF 3AFMA 2FX3A 3B38A 4ZHQA 4OHRA 4KREA 3WP1B 5KTRA 1ZONA 1LLDA 1UMDA 4YP6A 4KK4A 2HO4A 1NJ6A 1PZMA 1C0KA 4X94A 4TKUB 4EQ6B 3UBTA 4E0BA 3O1LA 4DSOA 1JU3A 2HLNA 3KD2A 4I1IA 3PP8A 3UW1A 5BQOA 2PS0A 3N87A 4YPOA 5AW9A 5FFMA 3R9KA 1N6PA 2G07A 2RMKA 2XQJA 1UPFA 2IEIA 5DX1A 3W5BA 4IIBA 4ZU6X 1LWNA 3AHFA 4IOJA 3UW3A 3TW6A 4RA9B 1KYIA 2YJ5A 3L5KA 3IVCA 4NICA 1U98A 2RHWA 4P92A 3RT9A 4ALLA 5GZ3A 4FS3A 3SZMA 3IBSA 2HSJA 5KMGB 5FPYA 3R3VA 4LRWA 3B7WA 4UBMA 3RVBA 3FIJA 1DDOA 3X0DA 1W4RA 4OX9B 1EWVA 1GA4A 3UT0A 5H1YA 5JLAA 3SS9X 1JMYA 1ZK1A 3EUFA 3EXHC 2HD4A 3GEBA 2IY7A 1FMJA 1WJGA 3H7IA 4F4CA 2O2CA 3BILA 1J56A 4NYIR 4XWKA 4G6ZA 4X64B 1KEVA 4CM8B 3SZUA 2HEIA 4ISCA 1ZJWA 5EIBC 2BKVA 2JS7A 4PGAA 5JZBA 2DBVO 2HLPA 3DZDA 4QJIA 3VHLB 1ZH4A 1YULA 1WP4A 4OAPA 2C88A 1C3OB 2VAWA 5DCUA 3SBEA 4EOGA 1YBVA 1Z5PA 5IHPA 3NTLA 1QOPB 5CFZA 5G4LA 4RTJA 2M1ZA 3TAUA 4D57A 3B3JA 1WXDA 5TY0A 1I1NA 4MO9A 4C7XA 5J23A 4MDFA 5DNCA 5A0VA 4MWBA 2P9TA 2AF3C 9ABPA 1B1CA 2GEUA 2IRWA 1FJ2A 1SPBS 4Y2PA 5KQGA 4M1WA 3WX0A 3WRWA 4O2LA 2CL0X 4BO4A 4E2FA 4NE7A 4Z49A 3B1ZA 1MHPA 2BR4A 1SQFA 1EP9A 1L5HA 2ZDQA 3ZX4A 3ZY3A 1SEVA 3B60A 5IJAA 2CDAA 4BLRA 1YB4A 2O2SA 4BX2A 1V1MB 4D0LB 4UUBA 1W0JA 1GSOA 3MFQA 3KL2A 4ARBA 3SMQA 3RWMB 4AN4A 3G82C 3MPUA 4R8VA 4WERA 1WULS 2R86A 3H2ZA 3LT5A 3NBXX 4ERNA 2WNSA 2XZTA 4JJ6A 5HCUA 2UKDA 1ZAYA 1I13A 5JAMA 5EMNA 1QV7A 4C03A 4BTLA 2FWPA 1L0BA 1QHHA 3D8TA 4BVGA 4ALNA 3NBZC 5C4IA 3TFOA 2PSEA 1F4LA 3ZCSA 2VI5A 2QR2A 4U7HA 3SDSA 1VQ1A 2RJOA 1GGNA 1UT8A 3EW7A 3HSYA 4O4LF 3SR3A 1WUJS 2AHOA 3FKQA 4OQLA 1T91A 3A06A 2VPYA 1Y6FA 1J6UA 3R7BA 2VQSA 3JVIA 2J3MA 4IIDA 3PDCA 4OBEA 4Q4JB 3EY9A 5TJHA 2DHEA 2CDBA 4D99A 3FAZA 3FLAA 3U7QA 2J59A 3ZCTA 4AI6A 4B75A 1G1MA 2Y6VA 2EKBA 3GUHA 2EIHA 1JDSA 3C7KA 4ZMBA 1AF4A 1P3Y1 4O63O 3UAXA 1CF2O 5KUTA 2Z4SA 1E96A 4Y67A 1QFMA 3EYWA 2IP2A 2H4WA 2OHHA 3AIMA 3LQYA 4GGMX 4L7VA 4L4ZA 4M46A 1D6NA 3BXGA 3I4CA 4J3JA 3FHLA 1AMOA 2XZOA 3ANYB 3UXMA 1B2LA 3WK8A 3UY4A 1MV5A 2GB4A 3KVNA 1W19A 6GPBA 1QMPA 3OAAA 2B69A 5HXAA 2COUA 2JHCA 4EYEA 1ENZA 1FC0A 3DNMA 2ZRAA 3NVDA 3PYMA 3LBAA 1G7SA 1PYOA 4OJTA 4BEJA 2F55A 1CTQA 4UZEA 3R7LA 2W90A 1L5ZA 5BO5A 2P4UA 4YP5A 4ES6A 1PJCA 3VUFA 3DC7A 1FTQA 1OAAA 4LDJA 4M0EA 1H3FA 4EFMA 1WAMA 2QNIA 3BWCA 4KTTE 1BJKA 4LHEA 1IN7A 2C98A 3RK1A 4WBNA 3VFDA 4H3SA 5HF8A 4AMZA 1WXXA 4BRWA 4Z4QA 1EFRD 1C81A 3OF3A 2C3PA 4Q3AA 3B1WA 2BAGA 3UYLA 5CAEA 2X2PA 4J1TC 1Z0KA 2G09A 3FZYA 2AOUA 4FDVA 1PTJA 4TRNA 4XAQA 1ZIPA 1HL7A 1I4EB 3GRKA 3JQ9A 3G23A 1B8PA 4RTSA 3M49A 3VAYA 3A9CA 1II9A 1HQYE 2BGKA 3QX9A 2WSBA 5GIOE 3JWPA 5EIEA 1QO0A 2QTLA 4YUYA 3PRYA 3ZD6A 1LRLA 1S7GA 3SJUA 4QTTB 4CHTA 1WOYA 3SEZA 1F8YA 2OECA 4RPGA 1IQUA 3FSGA 4Q15A 5ILQA 2XAUA 1HLGA 2QMUA 2X42A 3WKDA 2Z08A 3LYUA 3PDUA 5AVJA 2ATEA 1BTOA 1L4BA 1B3BA 1WTCA 5AQEA 1BQ4A 4GZ6A 3DV9A 3DAHA 1WEKA 1Y7PA 4UNIA 1O0BA 1V96A 1PR4A 3TQHA 4R1SA 5FPPA 4BWYA 4CCYB 3KU1A 1Z0IA 4C5BA 1OZ0A 4M60A 4WKGA 4UDNA 2UVPA 4YQFA 3UJCA 5D1NA 1R4NA 3NIWA 3WDSA 3EEFA 3W2GA 2GCPA 4KFRA 4AY4A 4LYEA 1DUIA 1F3LA 5KVAA 3FNRA 2ZRDA 1EG7A 2UXCB 3G6KA 3IBCA 1FDIA 1T8RA 5T64A 4DMGA 3PICA 2IYSA 4E33A 1J5EB 5H3LA 1GSIA 3N0XA 4YWJA 3SMVA 3AERA 2IYNA 5ERYA 3UJ3X 1ZD2P 1ES9A 2HA3A 2OO3A 3ZHYA 1NLFA 2IP4A 3AHCA 2IUSA 4L0DA 3PJEA 4AJLA 2YVQA 2HXYA 4N47A 1W59A 3V80A 3PHCA 3QK7A 3ONEA 2AW3A 2FEMA 3HCCA 2NZ8A 3F4KA 4QX6A 4H1VA 1BDMA 1EK5A 3M6XA 4I55B 5D85A 2GA8A 5LJLA 2B36A 1SCDA 2X58A 4NCIA 4YAEA 4S0XA 3CVXA 3OZIA 1HH4A 1L5KA 1UEIA 2NTEA 1MW9X 1WDLA 4XGKA 5ALTA 1X86B 5C37A 5IJXA 4P0QB 1Z18A 2FFHA 3SVZA 3LAWA 2IYZA 2ZIXA 3RSOA 1QFJA 1UJ4A 3IVXA 4O2BA 2JIZA 3I6MA 3M3HA 3OVMA 3OO1A 3Q2KA 4KVGA 1NZFA 1YKSA 2W2MA 4LWZA 5TXGA 3TLAA 2X9NA 1H6AA 4C4AA 4QBKA 1TJYA 2O5EA 4DN6A 2O0KA 3WLFA 3O2NA 2BH9A 3QLTA 4X1KA 3J7TA 1PEAA 1UAYA 3A9UA 2B2NA 4XLLA 2DT8A 3OE5A 3ZWQA 1JVSA 1V16B 3IA2A 1IYZA 3G5LA 1KDVA 1N78A 2HF7A 3H3JA 2B82A 4OBBA 2Q8NA 5COQA 1Z0UA 3VDMA 1NV8A 2WFLA 4WLNA 4M99A 3H9CA 1U3VA 2HMAA 3L6RA 4M1TA 3E84A 1RJFA 2X1LA 3IMCA 5CYFA 5F9FA 3L7IA 4JJKA 1XK7A 4LQDA 2FVXA 1QZXA 3CWCA 4ZCLA 3BH0A 2PCJA 3SHTA 4E7PA 1C8KA 4HAUA 3UIEA 1JV2B 2WU3A 4R7TA 4CMAA 5BV7A 4M0FA 5GAJA 1CP3A 4MW1A 5ALMA 1M1XB 2H2FA 3JZAA 4QT0A 5GZ6A 2GPJA 5D3MB 4BNIA 1TEZA 1G98A 5H81A 3N8HA 2IDKA 2WSLA 3B8EA 3OU7A 5AVOA 1BHO1 2GNAA 1DFIA 2VNKA 1QWOA 1JYEA 5ECWA 2R00C 4ZV9A 2BGMA 4FLFA 3CLTD 2HCRA 3VR4D 1GSHA 1OYWA 2YZNA 4YP7A 1T6ZA 2ZXEA 1RMQA 1BA3A 3UFBA 5FH9A 821PA 1KEWA 2VDOB 4AM8A 2XV1A 3DO5A 4TMWA 5KCMA 4PO8A 4E5PA 2E21A 2PMFA 3V32A 4WOBA 4PZAA 4UU1A 4B3XA 4HX2A 3AF6A 1G8SA 1MAWA 2PS9A 1QG0A 4L8FA 2ZIFA 1G20B 4I50F 3I6YA 2E87A 3DZIA 4IIJF 1U4NA 4KN5A 2C3UA 4E5DA 2AEFA 4MYRA 4D4JA 2WA2A 4MWEA 4WBXC 1P7PA 3ESCA 4MCAA 4QHYA 2QYSA 1G66A 2VP9A 4L1KA 4PC3A 5GM2A 4P0PB 3UFXA 3HWSA 2VYVA 1C50A 3FPBA 3EGDA 3NGMA 1TUIA 4I14A 3SBXA 5JSZB 2XRFA 1CKEA 3NWEA 4L5AA 4RWEA 2WJWA 4F8EA 4ANFA 4YDQA 1JIXA 1G5RA 1L5FA 4W63A 3OQVA 4ZDWA 1YHYA 4AWBA 3A11A 3ZY2A 3DKIA 3MCAA 4DCSA 1CHDA 5B58T 4HD8A 2HIMA 3E5RA 1SVWA 1NI4A 3OP1A 4BO7A 3NRJA 3ZI7A 2ETXA 4N41A 1BKYA 1NM5C 4U5XA 5F52A 3TZLA 2ERCA 1OAKA 1COZA 2W2OA 2KWIA 2G06A 3P9CA 2XWPA 1NAHA 3AL3A 3DDWA 3KJXA 3KVRA 3FPGA 3VR1A 4NZZA 3AVXA 3E03A 2PNJA 4Z5XA 5I3CA 3Q7SA 1J5XA 2HDNB 2G4CA 3CLUD 2P35A 4A3SA 1L4FA 2XUJA 4MGHA 2PWZA 3HXKA 1Y5LA 3OM9A 3DDNA 3GMSA 4Q82A 3HVUA 3RAPR 2LW7A 1SKYE 1G291 1ZI6A 4M6WB 4POAA 1HURA 3R3JA 2PPLA 4LSMA 3JRNA 3F74A 4RLQA 1GLGA 5ER9A 3ZD9A 3PGMA 4NYMR 4F3KA 2PUJA 3AINA 5TQ0B 3QMWA 1GG5A 4YRAA 4EO7A 3L4BC 5T3YA 2Q6KA 2PJRA 3GLIA 4GOMD 1MJHA 5GADl 1J07A 1O03A 2WNHA 4XQ0A 1JS1X 4UXJA 1KL7A 2XVYA 3WK6A 4BJ6A 3P71T 4UW9A 3HUDA 2ZU6A 4EVQA 3NETA 4NVRA 1KKUA 1ZIYA 5BWLA 3GVCA 1T1RA 1ADJA 3K71B 1PVOA 3ZCRA 4AJ4A 1N5OX 1H6CA 1XD8A 2JCXA 1WSAA 4CLRB 5KIAA 2OFWA 4UEQA 3CINA 3A4IA 1HDYA 1NVGA 3E9EA 2OD9A 2WWFA 3GEHA 3X1WA 3CHYA 4ACAA 3DBLA 1TADA 1JWBB 2CD7A 4G1EB 4QQFA 1H3EA 4EA6A 1A1SA 2ZTHA 1JXQA 1M2WA 2POCA 3OCUA 4ZT3A 3TRJA 3EMDA 2Z2XA 4PSAA 1XMPA 3IP6A 4EJSB 2DETA 2Q6LA 3DOUA 3TQOA 1F7UA 3E3MA 1G5FA 1SVSA 1PBTA 1BGWA 2P6NA 4IJUA 1EZ4A 1TMKA 2AD1A 4M9QA 1AK9A 5J40A 2ZJBA 3RTEA 3KJFA 3HDGA 4X8LA 1SKQA 5D84A 3AEQA 3K8ZA 3REQB 3PJGA 3H9BA 1W46A 2OCDA 1TJ4A 3HI4A 4YS6A 1G64A 2E5LB 2GASA 3TTUA 2H52A 5LQSA 3N2GB 4E70A 2SKEA 3WLRA 4RADA 5KX5F 3PNBA 1VMEA 2XMDA 4H7EA 4HAOA 4UMFA 2WU4A 4DV0B 2SECE 4NU5A 1NRXA 4LBYA 1LF5A 2NXJA 2PEZA 3ENWA 1GAWA 3L0BA 3U31A 5AM0A 1TXGA 2E4ZA 1D2RA 3VX3A 3NHWA 1FP7A 1NQVA 3QLJA 1XQVA 3FJOA 2UUPA 1KFCB 2ZJ4A 3IUNA 4WZAA 1NHGA 4NPCA 2QM7A 2XW6A 4G0QA 2WDPA 5CUQA 4ESHA 4C4ZA 4TRMA 5L4SA 4YQZA 3WY9A 3HU5A 2V7UA 1NQTA 2WDZA 3LKVA 3FGOA 3AUTA 3E1SA 2WHXA 3C45A 3GT7A 4POOA 3BIFA 3V4ZA 1DE0A 3H75A 2UZ0A 3WYEA 3ZS9A 4OLAA 1ZVMA 3MELA 4BMXA 4EPWA 2RGGA 3VTAA 5EJ2A 3W8DA 3PUYA 4NBTA 2I03A 2BTQB 4XWAA 2O8CB 4L4SA 1Z4KA 2QLFA 4JJ4A 5KHAA 3PQ4A 4DM7A 2AX4A 3RC7A 4BFWA 5C8ZA 3GLSA 3TB4A 2Z5GA 2ID9A 3AOEA 2GAFA 2VP0A 2VRBA 3FCSB 5DMHA 4AWAA 4E1AA 2DSTA 3JQ8B 1BROA 1BXRA 3SJ7A 1G3RA 3VYWA 3EE6A 3ZGNA 4DR3B 2HA5A 2EP7A 3DD5A 1ENOA 4HVLA 2H1RA 5KJEA 1WBJB 5JYDA 1NU6A 4EFLA 3OFND 3W5VA 4OHUA 4PWYA 4C0BA 4S1PA 4RVFA 4GRDA 1GAEO 4I5GA 1ZVVA 1ABBA 1IXZA 1IY8A 1KZ9A 2EG5A 3C5CA 1TYDE 1RZVA 1Z06A 2C2XA 4RF5A 3QG1A 5EUQB 1Q11A 3TLMA 4RNDB 1IN5A 1NVXQ 1X7YB 4IDBA 2AVDA 1AQIA 1HYQA 1E1DA 2ZI7A 1Z73A 5JDIC 3U0VA 2ONZA 5JQWA 4XJTA 2NMVA 4EFDA 2WLTA 5AHOA 1CUIA 1LK7A 4IQFA 1O5TA 2QX8A 2BJWA 2Z04A 1QYDA 2QP3A 3BTSA 3QVGB 3RU7A 3HFGA 3D1VA 3DHYA 4D6PA 5JALA 5CD1A 2O2IA 3IUBA 4W5HA 1SWWA 1TC1A 1EJBA 5BNIA 4F5ZA 1E89A 4LGVA 2V6MA 2BFNA 3OUUA 2I7TA 3SR0A 3FM9A 4A0FA 3KT8A 1R6DA 2HIGA 1YQUA 4MR8B 3K0CC 2GESA 2Z57A 3KCNA 3B48A 4QUGA 5JLJA 1FW8A 1QZZA 5EUCA 2D6FA 2YMPA 2ZI9A 3M6UA 2J9RA 2O6HA 4C0LA 1P7ZA 1SPXA 2A9RA 3V48A 2XCUA 4KXQA 4I50A 5AUNB 3AKCA 3L92A 4JFRA 3AI1A 4B9AA 2R7LA 4FEGA 2ZTLA 5REQA 4B6SA 1VLLA 1YS9A 1ZL2A 4DR1B 2UU9B 1OZGA 3HKCB 3QPAA 3KEMA 1B93A 1KARA 2P0EA 4KO1S 1MC1A 3TXAA 1J20A 1XCPA 2B0CA 2F48A 421PA 3IIJA 1UQTA 3RREA 4LZJA 5EP1A 2EGGA 2IGTA 1GFIA 2H0RA 2WVGA 7GPBA 2RI1A 3OJLA 1PGPA 1OFHA 1R88A 3PX2A 2VJOA 2FN7A 2WG1A 5TEWA 3TIXB 4G09A 3N8DA 4Q48A 3L4KA 1Y9AA 2BDTA 3PRJA 4M9ZA 4F4DA 1O6GA 3U3DA 4HGZA 2A0WA 1PJ8A 2GYVA 3BD9A 2AOXA 2GTIA 2OV3A 1I1OA 2RGNA 3DV0A 1FDSA 4D8VA 4D9IA 4Z4FA 1EK1A 4ADSG 2Z98A 5FPKA 3G0OA 4UTOA 2DTDA 2JI7A 3CEMA 4OHPA 5E1OA 5A4JA 5JANA 2HF9A 3KSAC 3CISA 4Y1RB 3EVNA 5J59A 4F04A 2OV4A 4Q0MA 3HR4A 4JB8A 3AI2A 4K81B 5E6SA 4WN9B 4B40A 1TRKA 4B4UA 4INAA 2FUNB 1E7WA 2R8EA 1VKNA 3HCNA 4N3CA 1R6AA 2MT9A 3ABOB 1ZXBA 3TMKA 4E2YA 4BNDA 4F2WA 1SOAA 1UP6A 2CLMB 1GL3A 1W47A 5T4EA 1A72A 3ILYA 4IZIA 2GD6A 1JF8A 1QR6A 3SZRA 3LCUA 4FK8A 4KGVA 2HDWA 4D46A 5TQ2B 5CJJA 2ZUFA 2VF5X 1WVMA 1UDAA 2C2HA 3FF1A 2PUVA 3EZ9A 3K70D 3KLMX 1VIDA 4FNOA 2BRUC 1HUQA 1Z75A 3TNYA 1X87A 3VISA 3DLHA 1V4NA 1YWGO 2WT8A 3K8OE 3QI7A 4IHAA 1ZICA 2V7TA 1XF1A 1J1IA 1TYBE 4IFEA 1RHUA 3NH6A 4UOQA 1UJCA 4GLBA 4E1BA 1U63A 2O2YA 5CIYA 5AXBA 3BCSA 3D4BA 1U6JA 4MR7B 2C57A 2WU1A 5BSHA 2BI4A 1RRMA 4N82A 1G4UR 4LJAA 3TUJC 1SCUB 1DKRA 1SVMA 1N7IA 3BRSA 3K96A 3LCRA 4RGVA 5FA6A 4LXYA 3TPCA 1KGSA 2QAIA 4R8LA 3V4LA 4DLYA 2IA5A 2W6JD 3QE3A 5D3QA 3B12A 4EF4A 4EHLA 4ZI7B 3VKGA 1UDBA 3DZHA 1IC6A 1FA9A 2W43A 3KZNA 1SCJA 3EIQA 3Q6IA 4LYHA 5IP5A 3RKUA 5CJ2A 4JX8A 1RC0A 4OU5A 5GQSA 4C7VA 1H2FA 5K7SA 4BZWA 4DZTA 3UUWA 2Y0EA 4CFZA 3WNQA 1P2DA 3AIOA 1X39A 3ORQA 3G5MA 3QXCA 1T3TA 1N6RA 4GM1A 3PVZA 4P86A 3WK9A 2VTDA 4FKZA 4MOWA 6REQA 3W2IA 1KXJA 1I3NA 4YT2A 3V42A 4QOGA 1E2QA 1EPUA 2PL9A 4N39A 4BN5A 3MM4A 6Q21A 3VYUB 3VZRA 1UKCA 4BAZA 1FUUA 1QYWA 3VJRA 5KWJA 3TGLA 1I94B 3QG5A 2FWIA 4I5EA 1VI5A 3H3FA 4LCJA 1IK6A 2XGMA 4JSRA 4ZVMA 4ZZ3A 1VLMA 3OCVA 2BEVB 2CE2X 3S40A 4JQSA 4LYJA 5IEBA 1OHHD 2VH1A 5DJ5A 1DOHA 3ROFA 5ES4B 1KVTA 4AJ1A 1EFCA 3RFFA 3CLTC 4DWWA 1V11A 5C9ZA 1O9HA 1C7FA 1X13A 3DHNA 3H2JA 1QZUA 3VV2A 5K0CA 2OCYC 2CLEB 3EZGA 3FF4A 3MCWA 1UZMA 4FOOA 4M8SA 3IELA 4EHKA 2EFGA 2IJGX 2ZJ8A 4LOHA 1AQLA 1RI3A 1DV1A 1KE2A 2XKJE 4UD6A 1BU5A 4CF3A 1ZBDA 3D3NA 1EX1A 4ZOLF 5LMUB 3BXXA 1XDGA 3K09A 4LDRA 4HH1A 2UYGA 1NQAO 1Y48E 2BEJA 3VRHA 2AKYA 3KV1A 1CUJA 1WXHA 4IMPA 2XTNA 4DCMA 4OLBA 3WXMA 4YDSA 1JU4A 2CXQA 2ZB2A 1EFPB 2MCFA 2EP5A 3NALA 3D2AA 3ESXA 3DL4A 4PLHA 4XARA 3ZLVA 4BHTA 4F8YA 1L7XA 2FN3A 2GCGA 3JX9A 4MUHA 4YFVA 2XDAA 1EJ0A 1DAIA 4QIHA 4TMXA 4YMSA 2ZW9A 2F1RA 3OQJA 4WQMA 4W5QA 3BHMA 3AY0A 3H86A 4L27A 4IVPA 4RKWA 2QRZA 3I73A 4JLMA 4TUYA 3N2KA 4BYMA 4IIJA 3D6JA 3IESA 4KH0A 2SCUA 4WFKA 2IYXA 3V46A 3D6TB 2Z9DA 1GR0A 1T2NA 1JPJA 3ZD8A 3NANA 1TQ6A 3L84A 4RV5A 1E6UA 2QJFA 3HMKA 2J3DA 4E4YA 2AK3A 1DQPA 5BMOA 4DUGD 5KTPA 1NWHA 1U8FO 2GZHA 5DYWA 2NVUA 3K4HA 1E7MA 1HDIA 2VG8A 4TYWA 4DLUA 1XLWA 4PX9A 1JZSA 3ENVA 1MW8X 4Y2UA 3M89A 1E66A 1NSYA 3A1CA 3EVZA 4NH0A 3VU8A 3UJPA 1XRQA 3WKEA 4YRMA 5JNTA 2FJUA 4PLCA 3ICOA 3DVLA 2JFZA 4X3CA 2NT3A 3FGPA 1ULHA 1I7LA 2NW6A 2XMQA 1XV5A 5D01A 1O08A 2Y68A 1A71A 1GOTA 3Q5EA 3P94A 3KSMA 1GZVA 3RF7A 3SAJA 1KBOA 1Z4OA 3DAOA 3K94A 4ZCRA 2O3JA 2WAMA 1J90A 4KPUB 3QKWA 4BNLA 3AOEC 3K0SA 3Q9UA 5F1OA 2HZBA 2H5IA 2X5OA 1H6DA 5DASA 3DQZA 2G77B 1J0CA 1M2OB 3RR2A 3TQTA 1MABB 4JC5A 4GC5A 2OB2A 5FOWA 3BAZA 4XVRA 4EMTA 5IK2A 3JWHA 5B5SA 3TOSA 1XLVA 2HSWA 3GQVA 1KMHA 3BHNA 4IH1A 4TRJA 2FSGA 3QRWA 4HWOA 4OF4A 1P6XA 3GN2A 4CQJA 3OZDA 4P4LA 1YU9A 1T43A 4FHCA 4UVIA 4R2LA 3IEKA 1DSSG 3L82B 4Q19A 3RAFC 1W2HA 2PX8A 4YP9A 1V26A 3FWPA 3QPDA 1OWNA 4X84A 3S5UA 2VPQA 4DL9A 3U26A 1E4EA 3OC0A 2OL4A 3KTAB 4R5HA 3QPCA 4D56A 4E4TA 2AFIB 3UJDA 4XFKA 3QQPA 4M1EA 3FBTA 4BKMA 2Q1SA 4DW8A 2B98A 5CG1A 3I61A 1GD1O 2ZITA 3FYCA 3A6ZA 2SKDA 5JO9A 1CQJB 5LVAA 2XTMA 4DR7B 4LFAB 4ZT6A 4QEZA 2H7CA 4C4OA 3K0BA 2BDEA 4C22A 1U1IA 1Y1QA 2Z4RA 1TEXA 2D5BA 2ZUUA 3ILVA 4TX1A 2YXNA 2A5JA 1K3TA 1GPKA 3KZ1E 4B0OA 1MAHA 4MUFA 4RWZA 3W5HA 3CEPB 2WB2A 3N70A 1HMPA 1OZFA 3Q9SA 4NYJR 1IULA 1I32A 3Q0EA 3IBGA 4OP3A 3UVEA 4E6EA 1NG1A 2OD7A 3L1HA 2P2YA 4IZHA 4R81A 3DZBA 5EKDA 2JJ2A 5C18A 4YCNA 2WMDA 3AI7A 4XUDA 1NMXA 3HCDA 5A2GA 4GHWA 4Q4DA 5EPOA 3EGVA 4MW6A 1Y5IA 4RVDA 4W99A 1Z6TA 2RHDA 1OVMA 1ZMBA 2CN1A 3ROEA 1NXSA 2FW9A 4JUDX 2YHBA 1KAMA 3AP3A 3AG6A 1QONA 1KO1A 4YHHB 1A9QA 1UODA 2QUBA 3HNPA 1EHCA 1MO3A 2RAFA 3DEAA 3OTGA 3NIBA 3UWOA 1EH5A 2PFGA 1UM9A 2H1CA 3VPXA 1UJ6A 5HP4A 4EVIA 5EERA 2L18A 1ZOSA 4MJ7A 1V8ZA 1VMAA 3VBEA 2EJVA 3MD9A 4HAZA 4MVWA 5SYNA 2WJAA 2NXNA 1WHSB 3WGZA 1Z5OA 5GMOA 1R5BA 3HJTA 2CHGA 1R4AA 1OX6A 2ZYTX 1YVDA 3PEWA 1CF9A 1ZC3A 2WU0A 1JN0A 3LLMA 1NF9A 3QJ5A 1L7VC 2Y0CA 3IMFA 3R5TA 5ARBA 5GV8A 3CKYA 1GCIA 1XR3A 4CQMB 1JIKA 4CYMA 1Q1QA 5CVUA 3LA6A 5IUNC 1UMCB 1EEHA 1JG1A 4M54A 4ZGWA 1ORWA 4WNAB 3F8WA 3KO8A 3VM6A 4FMDB 3RJZA 9GPBA 1UKVY 4KRFA 3M1IA 1C9DB 3NFRA 16PKA 2R87A 3L8ZA 4ETMA 5JARA 3V4RA 4OA5A 5JAIA 3E3AA 2D5IA 4YT4A 5CX1A 2TECE 5LWQA 1B23P 5KREA 3HVIA 4RHTA 1R5NA 1XMVA 3ECAA 2OA0A 2BPOA 2EV9A 2PUHA 2PJDA 3ANTA 4Y9SA 2YS7A 4Z99A 1RRCA 4L6CA 2G7ZA 5HIAA 4BNNA 3H9JA 3AY3A 3QKIA 4ZI2A 5HGXA 5JY1A 2J9FA 4A0QA 4S1VA 1ICEA 2D2VA 4FDAA 3RC9A 3RQSA 4EY5A 1XVVA 3HY3A 4OVKA 1QOZA 2GUWA 5G40A 2W11A 2O52A 4LJ8A 3MWJA 2FMHA 1DXYA 4GECA 4EY4A 3AYXB 3RUAA 3ZEAA 2BKLA 1A7JA 2RJNA 3DCIA 1GU7A 1JQJC 2WSIA 2Q5JA 3FZQA 4FZRA 3I5UA 4G4SP 3AUAA 4OXKA 1UOOA 4A16A 4YRBA 5GOTA 5K03A 2QN3A 2DPLA 4P08A 1QH9A 1NA5A 3G0GA 3PC4A 1OTHA 4LJ9A 1J4AA 5FOXA 2MIIA 5HJ5A 2XBLA 2HCTA 1DOAA 4H9GA 1MVNA 1CNFA 1X2BA 1YB5A 5BXYA 3A4YA 3N2NA 2LE0A 1TU3A 3SBDA 2VF2A 1GEEA 1KJ9A 1X7ZA 4O6VA 2ZUVA 4I81A 1IZ9A 2B4TO 1D9ZA 4ZIRA 4XIFA 1JJVA 2HLDD 4RHYA 1PL0A 2E4UA 3ZOZA 1U0SY 1YB1A 3HUUA 3O4VA 3PFGA 3D7MA 2PIDA 4LXGA 3OTWA 1BWPA 3M6AA 4FYIA 5E0KB 5BRAA 1DI0A 4Z6KA 2HA4A 4MTLA 3KAJA 4XJVA 2O5VA 5LU9A 2FDCA 1TD9A 2A0XA 1YCHA 3IQXA 2QF7A 3PUIA 3SJBA 2XUIA 3D31A 1RXWA 4V24A 4HRAA 2EFEB 4GU5A 4XDHA 1CJBA 4WGFA 4IKOA 3LFTA 1EUDB 3K9LA 3T3DA 4NNOA 3VDXA 3MCTA 5AO9A 2AR0A 4FGJA 3G0IA 2PVSA 4RLFA 1OBHA 1DBPA 4D4IA 4NL4H 1T8UA 2GO7A 4R2KA 1F20A 4UM8B 3EPKA 1F5NA 2I0FA 3JQAD 4HXEB 1RJ9B 1BOFA 1SC1A 1YHNA 1W1WA 4EI9A 2P62A 1YOBA 2QL5A 1EK2A 3V2UA 5BQ3A 5AW8A 5A1JA 4I9NA 1IDOA 3IC5A 3OOSA 2OBLA 4MKFA 3AFNA 4HZUA 3PCXA 1P6QA 3F46A 3L8CA 3NBUA 3ZDAA 3L6DA 4TYNA 3DMRA 4C01A 3MMSA 2RI6A 3FDFA 4EUFA 5C34B 3ZDRA 3FHOA 3KR2A 3VYVA 4BO2A 4C4TA 4GMHA 4HMOA 4J4TA 4C0HA 4QU9A 2VJLA 1SCUA 4CTMA 5JFOA 2DJIA 4O4HA 2HU8A 3Q88A 4CL0A 4O3FA 2JGFA 1X74A 2QG9A 3JAWA 3KFXA 3OEHA 3ZLBA 3R6GA 5FUQA 2XQGA 2ZJ6A 4G07A 1D9XA 1ENPA 3ASZA 1VMIA 1ILEA 3FY4A 3GFOA 4XQGA 3ZCQA 3O74A 4NBUA 3NGXA 5DHTA 1BO6A 1UBRS 3FNBA 3WTCA 1Q1NA 3GEDA 4L02A 1BKSB 1RS0A 5P8WA 2QVGA 3S7TA 1ISGA 3KZOA 2ZSJA 1S89A 1J8DA 4L4RA 1QHFA 2VUIB 2GHRA 1S3SA 3GBVA 4JLWA 2C9BA 2Q0XA 3ROXA 1Y4SA 2WZDA 5ICGA 1OCEA 1R0XA 1UBEA 1XI2A 3HN2A 3VMFA 1LNZA 4AO7A 3OT4A 1N34B 2ANBA 3LHIA 4MS1B 1SD1A 1Y82A 1RXYA 3KXLA 4I9FA 5A6SB 4DG8A 1TO6A 2A33A 5IMBA 1Z25A 1T5SA 3FAKA 1V8DA 4IRMA 1F48A 2E4XA 1PJ3A 3IMGA 1B0PA 3F1KA 1XGKA 3OKPA 3FRIA 1WD5A 2C97A 2AN9A 2Q5QA 4O08A 3EBOA 1H42A 2EX0A 3I53A 3JQAB 1UBGA 4GEGA 1FTSA 4CVNA 4FYHA 2QXTA 4EW3A 5I9TA 1X1EA 3LVFO 1DDGA 2VDRB 2ZYSA 3P2YA 3S4YA 4HEA6 4IDPA 2PAAA 5ALHA 4BE9A 3HV0A 1ONPA 4LXTA 3ZW7A 1U7TA 3CLRC 3K5PA 1AJEA 2HQBA 3TH5A 3D9QX 1M2GA 1DL5A 1P2TA 2HDHA 3F97A 2I22A 3LY8A 2NSDA 3WWDA 1FNDA 4K9DA 1HKHA 5A1TA 2OTCA 2VHJA 1JTEA 3BRQA 4UNRA 2JRLA 1O5OA 4MMZB 1JRLA 4QQ8A 3KEOA 5E95A 1MEJA 1EFPA 4XOIA 1QQ6A 1LSJA 4L9RA 2JBHA 5AM2A 4PHHA 2H48A 3VI4B 1NAIA 1RKXA 2ZSFA 4P7FA 4NWIA 1G3UA 3HVJA 2PBLA 1I4OA 5DPMA 1HZZC 1PV1A 2AOTA 4MZDA 2VYCA 1NVBA 4KUEA 2R8ZA 3FG9A 1LDMA 3M4ZA 2BFBA 2AA3A 3IP9A 1B8NA 1V3UA 2G5CA 3UWDA 5LQCA 3QYAA 3UMCA 4JQOA 3OEED 4V2UA 3KEFA 5ALXA 2QQEA 3GY0A 2CE7A 3SEAA 5LUBA 3VBCA 2NZJA 1D0VA 4NBRA 5DMXA 4XA8A 1CR2A 3R3WA 3JRWA 2H4YA 2EDAA 3EG5A 3WB2A 3DW1X 2C3YA 3ZBQA 3PQCA 2XCTB 1T0IA 1PNOA 2VPIA 2PMDA 2PZGA 2C92A 4HDKB 5D5HA 4J76A 3K6RA 1RPAA 1XXHA 3HZOA 1SVIA 4NCKA 4W1RA 1XCLA 4E5MA 3U5TA 3AKZA 2D7JA 1WCIB 2VF7A 1YDHA 5KVQA 2OCXA 1QQBA 2PGDA 2KBFA 1QVVA 1XVAA 5CM8B 3JYLA 2Q21A 4DV7B 4M0UA 2HYIC 3C74A 3SOZA 1SBIA 3DOJA 4DB2A 1U04A 2WYHA 1Q1BA 4FXOA 4OQZA 1UC8A 1U7XA 3D5TA 2D5CA 4TLAA 2X0FA 1EQUA 1FVHA 4L2IA 4K0RA 1R6VA 1JQKA 2G5GX 2VDWB 3MT7A 1B6RA 1OHHA 1AM4D 1D1QA 2GK6A 3HNRA 4FFSA 4UEJA 1OZAA 2P2LA 2PQ2A 3IT2A 3LV8A 3PB3A 1E1KA 2AMYA 1I6LA 2QUHA 4NMHA 4QTXA 4DAEA 1T2CA 2CFSA 2QJTA 2CJPA 5JPDA 2JIMA 1P17A 2FDXA 4NENB 2C82A 4QULA 4BXOB 1I4LD 1P75A 4JA2A 4YCCA 4QPDA 1NRJB 1O6ZA 1ZJ4A 4MCJA 4AP5A 1ONNA 4DDWA 2QT1A 4AMVA 3E70C 4BWFB 4AG5A 4RTQA 4D3YA 3IR5A 5EJGA 5B30A 3ANNA 4INPA 2H18A 3M4JA 3WMRA 3AETB 4FHGA 1CDOA 4FYXA 2BYTA 1SIWA 1J1ZA 2HPZA 4UUAA 2M6KA 5LP6A 1TF2A 2YIVX 1L1RA 2QT0A 4L95C 3I9NA 1XTSA 4RYLA 3FWHA 1OAOA 4YCJA 3RBZA 1P2VA 1OI7A 2DX7A 2WNIA 1EM8B 2JKYA 1G6KA 3VGPA 3ST7A 4CHGA 4IHQA 1PP4A 3ZWMA 2CMFA 4Q1FA 4ZI7F 4CEJB 1GWNA 2Q3JA 3O83A 3OQHA 2IGBA 3H2BA 3LP6A 1JP7A 2AN5A 3JTMA 3TG8A 3BGSA 4NV0A 5TARA 4FHDA 3BIJA 2JD0A 1NVKA 2JAXA 3I1YA 3OLZA 4MUMA 5ALSA 4B17A 4B83A 2X23A 2HI0A 3DMNA 1GL7A 3UMVA 4BB9A 2WUDA 2YH2A 5KVVA 4P2BA 4MVCA 4CQMA 3GJYA 3HPQA 4Q21A 3O8OB 3BEOA 1ECGA 5AKZA 3NP7A 2P3OA 2WWHA 3KJHA 4QHTA 2PAFA 2BC9A 4XIGS 4AU1A 2CNKA 2ZT8A 3P2OA 5GOZA 4BAGA 2X4IA 4B3JA 1ULTA 1M2KA 4ZVUA 3U4AA 2GJAA 2X7XA 2HKIA 1PLKA 2B3DA 3BG5A 2OXIA 2E85A 621PA 2CNBA 3D54D 3DTNA 3JYQA 3LCCA 5F73A 4ZT2A 1HBJA 5IAGA 1BFKA 1JNYA 2FJ0A 2EKQA 3QVMA 1Q50A 1E1NA 1F5SA 1FFCA 2NO7A 4P35A 1MG5A 3DDUA 4AJHA 1J0EA 4F5DA 4UCFA 5HR5A 2AEJA 4LOAA 1XAJA 4L50A 2AXNA 1VGRA 2QTNA 3B7GA 4MW5A 3ZYCA 5EE1A 3L8HA 4ILEA 4WZAE 1AKVA 2VDNB 3K2BA 5HRAA 1AB6A 5JH7B 4OM8A 1D2NA 1GGMA 4D9CA 1L5WA 1H0SA 2FW6A 3MCVA 4TSRA 2GKOA 1ANKA 3GQBB 4NJMA 3FSGD 3TSCA 4IS3A 4ZYVA 2R79A 1SM4A 3V55A 5FO0A 5L9AA 5ICFA 1WBBA 3R6DA 2JAWA 1DBSA 2QNRA 5FTJA 4BO6A 2BHNA 4MKHA 2PUBA 5LM3A 3QLEA 4HN4B 3WNVA 5KTNA 1PVVA 2C9YA 1P73A 1NI4B 2CHEA 1RJ9A 3CPJB 1NXQA 4G1CA 4UPVA 2CFRA 1U2QA 2JD2A 4N7RA 2V65A 4GFDA 1QO0D 1NF3A 4N5DA 1THZA 5DLEA 5A05A 1ZD3A 1TQ2A 2C0CA 3KQOA 4N3GA 4AUEA 4BFTA 2ZCUA 2ZBRA 5GTDA 1DC8A 3U7GA 3CLSC 5ICSA 4JROA 3L4SO 1E32A 3FNQA 5EZSA 3RAGA 4M9CA 4CU2A 1Y3BE 5C1IA 5IC4A 1LLCA 3KAKA 5AI4A 1XDDA 4WJLA 5KNBD 3UICA 1BG6A 1XCMA 3BGDA 4BPBA 3DZCA 3JAWB 3KKMA 1EUDA 3C6ZA 3JR7A 3VR3A 2HBRA 4JU8A 5EJ7A 1PV4A 3HYRA 3W2HA 2HA7A 1KO5A 4H7DA 5SICE 1SWVA 2G6BA 2VWPA 4OG2A 5AQ1A 1WBDA 2CY0A 2WWIA 3HDHA 5EMLA 3BFKA 3FNEA 3ZZUA 4QNMA 3WKBA 1IN6A 5CRIA 3JQGA 4G85A 3NCHA 4I4LA 5JEDA 1RYDA 3MAAC 1Z7GA 1U8AA 2WFZA 1K6MA 2XHZA 3DC2A 1XU9A 3GFPA 5IT4A 2Q9BA 1YQGA 5HS6A 4P4SB 4CM4B 1BGVA 3OZBA 3PVSA 1TI7A 1RZRD 3N8KA 1AG9A 3FKSA 4PZ9A 4R01A 1N25A 4XM2A 2C0QA 1I7NA 2HA2A 2ZRIA 3TIVA 4NPHA 4N12A 4E32A 4KVAA 2IDMA 3WA7A 2DWPA 3MJDA 1O6FA 4AWXA 2ZAGA 5BQXA 5DYTA 1YZFA 1DQZA 1CJSA 1JEJA 4D98A 2YQ4A 4RHXA 5BVHB 5HZGA 1W6RA 1RI5A 3DFZA 3EA4A 3L8FA 3RFXA 1E1YA 2IIBA 4PGHA 5DISB 5FWDA 3ICVA 3WBKA 3VO8A 4IV8A 4DV2B 2A14A 3JZMA 2YJZA 3H2YA 4M1SA 4MKIA 2D00A 1N3YA 2FR8A 3CRQA 1QHNA 3V33A 3HXPA 3ZV3A 4HZUB 2DTEA 1KJ8A 3GHHA 2HPHA 2N3ZA 5JVDF 2YWCA 1W93A 3WJ2A 5KOHB 3D6MA 4FDTA 4LZLA 4D9BA 5DGIA 2H7XA 4LEIA 4PAWA 4D7AA 2GDJA 4KIGA 5AW4A 3D8SA 1T8SA 1UPUA 5C2JB 1PS0A 3MBOA 5E6RB 4AROA 3A0RB 2AC7A 3L07A 4NU8X 1X1DA 4OGLA 1LFAA 2IW1A 5CYPA 1J2TA 2QIOA 2W6MA 3RKRA 1D7AA 5HMLA 3UJAA 5FWNA 4M0DA 2QX6A 4INZA 1QHIA 3S1SA 2B1JA 3W1VA 4F9GA 2X41A 4DNPA 2A5FA 3RADC 4A6XA 1TJNA 1RYYA 1E4OA 2Q3BA 5SZIA 1NY6A 4F45A 5JH7F 4QUAA 3FYUC 2XWSA 2DHRA 4YRDA 3KXIA 1BWRA 3GLIB 3F5QA 2QAGC 2YXLA 1M6WA 5FBKA 2XUQA 5I9SA 1YJXA 4PLVA 2V6JA 2CF5A 1OX4A 1F2TB 2WKQA 4F5WA 4WZBE 4NJEB 1NNUA 1US8A 4UREA 4XJXA 1EFVA 1I5EA 1XRSB 3KB2A 4P32A 5FB3A 5JUWA 3F67A 3IQFA 3LC7O 4HDKA 1FYDA 4WZAB 1KVSA 4WZ6A 2O7SA 2WJ3A 4IDOA 4CV3A 3U4QA 4GI3A 1A8UA 1JEYA 4BNKA 3L7YA 2OBXA 1TPZA 4OXYA 2YW2A 4MJLA 2ZRLA 2RKBA 3EWIA 3IAS6 1EA7A 1DUSA 2MINB 3TE6A 4EUHA 3VDRA 3AEQB 3JQAA 4CG3A 1W25A 3FOBA 4L5BA 4TN5A 3DT9A 4BMPB 4DSTA 3HJFA 2J41A 2XADA 4BRSA 5IASA 4GOXA 2VP6A 4JLVA 5A5GA 5FOVA 4IILA 5IT9A 2R2GA 2IH4A 3FWYA 5JY6A 1U80A 1NW3A 3G7SA 1PNRA 2C59A 3O82A 1Z0JA 4QYXA 1THTA 1W0KA 5GPBA 2C7QA 2QX9A 4E6PA 3SNHA 4RO0A 2VHWA 1JDPA 1L4HA 2FB9A 2JGRA 1VMDA 2PFKA 3T4PA 3LGSA 4EPXA 1YDWA 2XLBA 4V38A 4JB3A 4D43A 4KX5A 5F33A 2P5SA 2VKTA 1AUVA 2C2BA 2CXRA 3EFHA 3MMZA 1QKIA 4LJ7A 5FOUA 4V02A 5THKA 4IGEA 1XUOA 5AKIA 1JEOA 1M0WA 3A2NA 3R5XA 1NUUA 1Z2EA 3TX6A 3BQMB 1RSZA 3LC0A 4OSPA 4JJEA 3WLSA 5EIBD 5IKEA 2XT6A 4FN5A 4MVJH 1CERA 3C1UA 2MTBA 4C4SA 2C7OA 1VHDA 4N49A 4RACA 4O1MA 4PAQA 1CR4A 2XMSA 3DW3X 2O4UX 4I6EA 5E2IA 3VKWA 3A8TA 5K9ZA 2WIDA 2WUGA 2QTGA 5FUMA 5IZ4A 3H8JA 3PX3A 1TA0A 5FBLB 1T6NA 1Z6QA 2PKCA 4ZWNA 4PM4A 3ASVA 4MWTA 2BTQA 2J6IA 2O8CA 2HUPA 3HA2A 4UASA 2GBGA 4A8JB 1OILA 1ZNWA 1NQOA 2M2IA 3BDVA 1Q20A 3WOVA 3L9XA 4G5HA 3FYDA 3MS2A 4O4JA 1DC7A 4QDJA 1AO0A 2AQIA 3DBRB 3IP3A 4H7KA 5JJBA 4CLOB 1XTVA 2DERA 3EVEA 2ZRFA 3H84A 5DM1A 1T4MA 2D3WA 2SBTA 3MWDA 4ALKA 4DKXA 5KWEA 3GEPA 4JKYA 3PFWO 2RHGB 1C8BA 1Z7YA 1KAHA 1RYHA 3IX7A 3OHPA 2A7XA 4QREA 5FWXB 2QD5A 4ND4A 1JSCA 3TRKA 4DAOA 5K0ZA 5CDUA 2G6TA 3K6JA 5CD9A 2JFOA 2RCYA 3T3IA 1QZ3A 3PGVA 4AYTA 1Y8CA 4J0FA 5JD3A 1C7RA 5FPHA 2X1HA 1D1SA 1WP9A 1RHMA 4IH4A 3DBHA 3SZGA 1N32B 4DNQA 5IAAA 3KBBA 4B4OA 2JGKA 3GH1A 2ICAA 4OHVA 2BHTA 1P1CA 3PVCA 3JD2A 1KI6B 3W8EA 5INTA 5IG2A 1XDUA 4QTYA 3N8GA 2CMHA 1P5FA 3B51X 2I6SA 3HKBA 5C7IO 5CPBA 1JSLA 1F6DA 3FOAA 4AL4A 5TV2A 2IITA 4DNOA 2NPOA 3TIFA 3IT1A 4ZZIA 4GNKA 3RQIA 4A8PA 1BN7A 1X1QA 2CNWA 2GPTA 4FFBB 3FI0A 3W8FA 1GTZA 2C5EA 5TLSA 3PRHA 3QEBZ 3GVXA 3COZA 2I6FA 5CLQA 3QEMA 5CCBA 2FEPA 5CEJA 5AVUA 1FVFA 2WYIA 1RQ7A 1WEHA 3IQEA 3ZQKA 3FRHA 4TMTA 4TT3A 3INTA 2B4KA 1I2BA 2ZRPA 4N3AA 4KE6A 5HFNA 1J9GA 2BE7A 2XPCA 3MJRA 4NMMA 1X0XA 3EQ7A 2FLKA 2OSBA 4OJKA 4BLWA 5K20A 5JO0A 3D7KA 1P3DA 3OF5A 4NF2A 3COJA 1KZ6A 1T9CA 2BGTA 4FNGA 3F2VA 2QGFA 1D6MA 4JDPA 1XZPA 4MEJA 2XJ4A 5IVDA 3UHPA 1VHTA 2XD4A 3ANLA 4QG3A 3FLBA 1DKPA 1U0LA 1V7QA 3ETLA 1PJTA 4JOBA 1A2QA 3GGJA 4UNNA 5CX4A 1ZGGA 2QRMA 3B6EA 5EXPA 3WLHA 4LAFA 5ILGA 1CR6A 4PZPA 2V7QA 3EZ2A 2PQMA 5EN4A 2GEVA 2ID4A 4H2DA 3PS9A 2JNWA 1OJLA 1E7SA 1M6VA 2Q0SA 1D8TA 3A4LA 3BXZA 3JQBA 4MR7A 3MXOA 4H7PA 1Z39A 4PX2A 1E2NA 2QQGA 3F9CA 1CFJA 4J90A 1QQ7A 4B76A 1M1UA 3U6BA 2RH4A 1XKTA 1E2BA 2WWWA 1VG0B 1MV8A 1Q7CA 4FYWA 4CM9D 3KWFA 3KETA 1CK4A 1G4AE 4PEVA 5CK4A 5CBKA 3VKHA 4ZXFA 2I7CA 2HGSA 5EPUA 3RUIA 3HYCA 4CKEA 2XR1A 4TVSA 4WXEA 2FW8A 4UUMA 1H2XA 5DM0A 3OSZA 2XNKA 3OA2A 1AKMA 1K6EA 4PX5A 2YZGA 3QE9Y 5HE8A 3ZK9A 4QO7A 1FBTA 2J31A 2IZ1A 2PWPA 4V0OA 3P26A 4TV9A 4LZZA 4E07A 4EAQA 3EGIA 4ZGBA 1YK1A 4P3NA 1KEEA 3NOOA 1ZAKA 6REQB 3QFSA 1PWXA 1QCYA 3LS2A 4PLWA 4DA9A 5LMNB 5B12A 4YRGA 2Z1DA 3BF8A 3NHZA 1P1HA 2ECQA 3A1TA 3BGIA 2NV0A 3JVDA 5DNVA 3THSA 3WISA 1VKRA 3C8ZA 2GR9A 2QYOA 3UT5A 1IUKA 1E8DA 1YGPA 3TSAA 4DCPA 1ZR4A 1N0WA 2QSJA 3KR0A 4KO8A 2OGSA 4CMGA 5BVHA 6YASA 4ZQGA 1CUUA 1V11B 1YSCA 1PNVA 2AC2A 2BCGY 3CUTA 2ORYA 3D0RA 2PGAA 4PIPA 4TTPA 4RHEA 2YWHA 1TCVA 4MKGA 1EFAA 3L40A 1CDDA 4G1BA 4EZEA 1GADO 5AM5A 4Q9JA 1GUDA 4X1YA 3ESRA 4XVCA 3C7TA 2IZ6A 2HR1A 4QPNA 3I9V6 1KEKA 1ZGZA 3ZHVA 2QVZX 4D26A 1JALA 2A9QA 3ICWA 2PKWA 1JECA 2VCYA 2ZRKA 3GIDA 3CSSA 3MIZA 4BMYA 4E5NA 3SKVA 3G5TA 1P1IA 1V8FA 3UMBA 2JK0A 1VFNA 1R27A 1G8YA 1EQAA 4CM8A 1USGA 5TPWA 1I14A 2BEVA 3QSGA 4RJTA 4OD0A 2QI9C 1KTIA 3R4CA 1XMXA 3I9KA 2XXAA 1D1PA 1V6SA 2PU7A 4RXUA 3MMNA 1FP6A 4EIWA 5CVTA 2H2DA 5FX2A 1RQGA 2FF7A 1P0QA 2NUTB 5DLYA 2AN3A 2V0CA 3BXHA 1Q1ZA 3DXYA 5B2EA 5K4AA 3EUWA 2I3ZA 1X7WA 4MICA 4Z0NA 5KNCA 3IP5A 3DM5A 4G0MA 4KBFA 4L8LA 4QDOA 4QYTA 3G59A 4IWNA 3E3NA 4PNPA 4Q3BA 1FU7A 1XYGA 1F2TA 1FQOA 4W8OA 4A23A 1OTYA 1PWYE 3R0ZA 4M1QA 3RNLA 5DGTA 1RAHA 4OSOA 10MHA 2P5UA 3JWJA 1DC3A 2DWUA 2VQ6A 1TUGA 3QHAA 4LMRA 1IQPA 3T3EA 5A0TA 4E14A 1JE0A 1JYSA 1ZM9A 2XZPA 2FF5A 4XSHA 1UC9A 3EB9A 5L51A 2V6BA 3IT3A 4H18A 5JG7A 1AZLA 1YKFA 2NTJA 4X6LA 4JLOA 1JPVA 4ZICA 1AX9A 2YRXA 1LLFA 4GS5A 2VSNA 2RCNA 2JG3A 2OMEA 4HXFB 4MUYA 3V97A 3LDAA 2SCUB 2A0KA 4U0JA 2HWYA 4UKDA 1ADBA 1QGYA 3MBIA 3A3NA 4R83A 5TDHA 1U2TA 1WCXA 3OURA 1H9CA 4QXPA 5FDFA 3SQDA 4YMLA 4DDVA 4OQXA 4MPJA 3JSAA 2V6IA 4H35A 4MEAA 3JASB 3TVTA 1LV8A 5F1YA 2WYUA 4BFSA 1V3QE 4HJXA 1SUWA 1E1CB 1IBCA 1XRRA 2A78A 1A9RA 1G9TA 1Y1KE 2PX2A 1EVKA 1HE8B 3CY6A 1K88A 3K92A 1Y3AA 4FBMA 2OC9A 3FUCA 2PUCA 1FFWA 2SHKA 4JVLA 2HQSA 4IGKA 1CIPA 4RZUA 3JQ7B 4MW4A 1YL5A 2BKEA 3F6RA 1F0KA 3H17A 2H1WA 4ASUA 4E08A 3KPJA 5BN5A 3ZVRA 4MPDA 3D4PA 5JS2A 4W9NC 4Z4EA 1K7SN 2ZBEA 1RYBA 4HLNA 3W3ZB 4C0AC 4MAAA 3UNXA 4TZ0A 2FPOA 1N5DA 3I9V1 5NULA 2AYZA 3OUZA 1MABA 4H1WA 4B3MB 2VK4A 3NBFA 2FGJA 1TIBA 1FFGA 1TT7A 5IDWA 3ISVA 1VOTA 2H2HA 3A1SA 1LI5A 2GARA 5KNCH 2FAXA 3OZTA 4R2JA 2CL6X 2ZJAA 2V0GA 2FRDC 1JJ7A 1Y81A 4Q01A 4YV0A 3INYA 1QK4A 3GRRA 2XHEA 2H4FA 2NZXA 4EHNA 4QGHA 5CLIA 1CE8B 1L2TA 2ETVA 4IMIB 1E9CA 1BU8A 4Z0PA 2EX1A 1K08A 5JWOA 2CFCA 2O8BB 5DGXA 1JXOA 1NN0A 4MV0A 3FR7A 3LBYA 4IX9A 4A5OA 3SQOA 4FB4A 3QENA 2MYNA 2Q8PA 1P0PA 1QO9A 1CU1A 2GLUA 2UVDA 2PH3A 3OLQA 1PKEA 4HQ0A 2W6CX 1OYVA 2FPIB 2LTAA 2JIPA 3NKFA 5COAA 1XZFA 2OP1A 2QAJA 4YUAA 1G8KA 3T3NA 1IXSB 2GVDC 4KYUA 4QD3A 1XA0A 3PUVA 1GTRA 2FZ5A 1ARZA 2CJYA 4C4XA 1Z38A 1VBFA 4KFUA 4XEUA 5L40A 2O0JA 1DRWA 3IOEA 3P20A 4M9RA 4V0ME 3IL2A 3N2IA 4R6XA 4R9SA 4H6PA 2OXCA 4LV5B 4RM2A 4NDAA 1WUIS 2PRZA 5E2BA 4M86A 2QTAA 4ZRNA 1BHSA 3U62A 2C20A 3ZV5A 3QBJA 1V2HE 2QHXA 2WINI 2C2ZA 3H13A 3TAXA 4GX0A 3JATA 4CDMA 2X9QA 1K66A 5JCOC 2C00A 3AILA 1ID1A 5HFAA 3ZW9A 2ZP1A 4KN9S 4RVUA 4TLDA 2HSDA 4DREA 3EWSA 3MF4A 1CEQA 3VSCA 4PCVA 3VU9A 3E9QA 3RW9A 2QL7A 3DP9A 1FEZA 4UE6A 4YRPA 4NH4A 3AR3A 1GN9A 2RGAA 2RI0A 5BW6B 1OXXK 5IDYA 1VTKA 2B92A 2OCGA 8GPBA 2VLIA 3H5AA 4EKGA 1RHKA 1XEWX 3ZDQA 3QWIA 2QZSA 5IANA 3JD4A 1ESDA 3N8IA 3T99A 2VUUA 1QRDA 3V7UA 1O94C 4ZV4A 4P4GA 1M1NA 2CLIB 4KP7A 1ZIOA 3CLHA 3EODA 2DKOA 5HKBA 5KC9A 3GLGA 4RS4A 4W6ZA 4KBGA 2W0SA 4JI7B 3WFIA 3H65A 2O1EA 4IKPA 3FVRA 1XRMA 2I2BA 2NSHA 2RGUA 3VPGA 4QSMA 4D82A 1GRVA 2JLSA 5K05A 5BMVB 1JW9B 2WF8A 3HB1A 1Z56C 4LS3A 1OLUB 1HF3A 3CUSA 4RMJA 2ID7A 5AKEA 5MN5A 5CDFA 1FSGA 1K68A 5AVSA 1V1JA 4B2PA 3RROA 3ZGZA 4E13A 4HNRA 4JLUA 3ZHXA 4BMNA 3PKJA 4KQ9A 5JDCA 2HSGA 4HF7A 1JSZA 4V03A 4YLGA 5T5QA 2X7JA 5LKAA 2VQFB 1ND5A 1RLTA 2ZRBA 2X8JB 3CNBA 1BDJA 4MYTA 4O8CA 1X7ZB 3CKLA 4E2ZA 2XYQA 2PL5A 4HUTA 5DXFA 3QVUA 4I3FA 4MW9A 5LPNA 1T2DA 4MR9B 2H1SA 5KNDA 4MRNA 1I7QB 5KKAA 2R4QA 1ECFA 1KQPA 1PUJA 3OCZA 1C9KA 1N2SA 1IOZA 3ZZTA 1I2ZA 2H5JA 4D9GA 3MWLA 4FE7A 2B99A 2XNHA 5KZMB 3EXEB 3S28A 4EF6A 2VL7A 1Y9EA 4PLTA 4AZ3A 1ZNYA 3UT5B 1PJQA 2R6AA 4NMLA 3MUFA 4OK5A 3UV6A 3WC4A 4BLTA 1N2OA 2PA0A 4DJJA 1RAGA 2FK7A 4ZI5A 4MTCA 1GVNB 1OXKB 2ZSBA 4UNPA 3H7AA 3HBFA 1GEGA 5K0SA 3SYNA 3KTOA 4DEVA 2XCSB 1R0CA 5JZOA 2C5SA 1XPJA 1I01A 2YZ2A 3LI2A 5DVZA 2XKBA 3BWXA 3NC0C 4MVJE 3ZV7A 4QJ4A 2D1YA 1NDHA 1ZPDA 4RA6A 4GNRA 4I1RA 1GITA 1TYZA 4L07A 4ZVSA 4BFUA 1R4MA 3MOGA 3S70A 1GPNA 1PDOA 3MCZA 1SQGA 2EZUA 5EQJB 2YOGA 3QVVA 5JMWA 1H1LA 3A05A 5C52B 3I2GA 1NJFA 1TZKA 2A67A 3CLUC 3CX8A 5KVSA 4IP0A 1AZSC 2DCMA 3ND6A 2BF4A 1EFLA 5HS4A 4OQYA 1DU4A 3PFKA 4CT5A 2ZJOA 5E0OA 2PD3A 4BQNA 4N7JA 1K89A 3H5VA 1D2CA 3GFBA 3ZVNA 3IDZA 4V3BA 4BQPA 1SAYA 2BEKA 2P9QA 2C7PA 3GEGA 3P9PA 3FTNA 4RGBA 5TNXA 2VPZA 1WPXA 3PDHA 4Z2AA 2INGX 1IZ8A 1NDUA 3WKAA 3DE1X 2JA1A 3JU3A 1H9AA 3FGNA 5MFPA 4GSLA 5ELXA 4JUIA 1KQNA 1L8LA 1U6KA 2QORA 2VHXA 1PNTA 1YIDA 2FMIA 4MITA 4MQ4A 4HYEA 4TQ9A 5FBZA 3P45A 1VBKA 2BT4A 2I7VA 2WICA 2X8BA 3AEKB 3BQNB 4GI7A 2G28A 4K8OA 1DP4A 1XD2A 3KSRA 1BS2A 2RHTA 2WAOA 4CMEC 4CG1A 2BTOA 2PMEA 1W36B 5EOVA 1I6KA 1QR2A 5I8ZA 1N8TA 3GMDA 4PE5B 3RRZA 1ZHHA 2OLJA 5THXA 1J2JA 2MU1A 1VSTA 2OBYA 3BJMA 4Q1AA 2C4HA 2DHDA 4RSGA 3TVYA 3AF2A 4C05A 2PPVA 2I80A 5KSZA 2NXCA 4IDGA 4Q6BA 4ZO8A 3LTNC 2FFQA 1NBMA 4QDUA 3ZZ1A 2DBQA 2HV8A 1XZEA 1UBCA 1GLVA 1TVKA 1ZUD1 3DVAB 1X70A 5ANRB 3BGOS 4ARZB 1VCIA 3RBVA 4GRIA 2DM6A 4CDRA 1H65A 1SBZA 1S2OA 2XF2A 3L3BA 2L42A 3LZ6A 3A1EA 2FPXA 4ITRC 4DB4A 2GJ4A 2ZZMA 3QFRA 3DFIA 1X9IA 3QGMA 3R3ZA 5HTOA 2GHTA 1KJWA 3ABIA 1EB9A 2FHSA 1MO5A 4GUDA 3T9AA 4NEGA 4KWHA 3KKPA 1PD1A 2FRXA 3MLEA 3SYMA 2HH9A 2QW0X 3DPSA 2RGYA 2YVUA 2ADFA 1CJMA 3OY2A 1PQUA 3A1WA 4R0VA 4YRLA 5TPWB 1NUHA 1EQ2A 2FXIA 4Q7MB 1ULAA 4ZAXA 1I0IA 3KVVA 3UMJA 4YJ2F 1M8FA 1RQXA 2EKLA 4LJ6A 3VNAA 4Q16A 1V4VA 3FKJA 5LZ8A 4BP3A 4CIVA 1Z8NA 3BMQA 3N75A 4FHFA 5KDOA 3ZZMA 4C0KA 3PPWA 5I7HA 2J48A 5EE9A 1SC3A 4FR2A 1Z74A 3CRZA 3G6WA 2W5UA 4JQZA 4UVHA 5A9TA 4B35A 3ZHQA 3L04A 1Z83A 3SJAA 2PD6A 1LFDB 3REQA 3GPBA 3LNCA 1U6IA 1Y9JA 1ETHA 3PXXA 4MI9A 3I62A 1AS3A 4IDCA 3H19A 5C46F 2Q41A 4B1FA 5HKOA 2FY8A 4TXLA