3GT4A

Structure of proteinase k with the magic triangle i3c
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords proteinase K
publication title The magic triangle goes MAD: experimental phasing with a bromine derivative
pubmed doi rcsb
molecule tags Hydrolase
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3gt4A00
1MPTA 1TM1E 4C3UA 4NMXB 2B6NA 1TK2A 1Y3DE 3AJ8A 1TO2E 1WSDA 4AKTA 1GCIA 2WV7A 1DUIA 1SCNE 1AK9A 1C9NA 3F7OA 3BGOS 5JXHA 5FAXA 3DE7X 1TMGE 1SUPA 5B1EA 5FBZA 5JXIA 4JP8A 1Y9ZA 1SN7A 3SQOA 1YU6A 1THMA 3AJ9A 3DW3X 3DE0X 1CNMA 3PTLA 1ZVKA 1WMDA 3Q40A 2ZWPA 3DE4X 3GT4A 1Y3FE 3A3PA 3DE6X 1S02A 2E1PA 4B5LA 1AH2A 2GKOA 1PTKA 1SBIA 3OSZA 3GCXA 1VSBA 1P8JA 1Y34E 3QTLA 2W2MA 3I37X 3VV2A 5ARCA 3LXUX 4H6XA 1OYVA 3TI7A 1ST3A 4BWGA 1WMFA 3DVSX 2Z56A 3VTAA 1ZVJA 2PYZA 1PFGA 1R0RE 1AF4A 2DQKA 1TM5E 1T1EA 1P7VA 1GA6A 5JXJA 1TM4E 4CFZA 1SBNE 1GT91 4FONA 3WIUA 4M1ZA 1BE6A 1A2QA 1Y4AE 3LPDA 1IAVA 1SBCA 1Y3CE 2DP4E 2Z30A 2V8BA 2HPZA 3LPAA 3P5BA 2W2NA 3L1KA 3DE1X 3GT3A 3SICE 1BJRE 3GCWA 1SBHA 4ZOQI 2XRMA 1C3LA 5K7SA 1V5IA 1C9JA 4WOBA 4DZTA 2WUVA 4KG7A 4C3VA 2PRKA 2PMWB 3CNQS 4OMDA 2IY9A 3A3NA 4DJ5X 3H42B 1TM3E 1YJAA 4H6WA 3I34X 2Z2ZA 2SICE 3T41A 1GA1A 4RYDA 1OT5A 1LW6E 3UNXA 1GTG1 3LPCA 1TM7E 1V6CA 4YN3A 1HT3A 1Y4DE 1OYOA 3CO0S 2W2PA 2XTJA 2DUJA 1Y33E 1Y1KE 1SUEA 5AMXA 1KDVA 5B1DA 1UBNA 4LVNA 1GTJ1 1BH6A 2PQ2A 3I2YX 1KDYA 1S01A 1R6VA 2IXTA 5AQEA 1P7WA 1EGQA 5CW1A 1NDUA 1WMEA 5ARDA 1KDZA 4CFYA 3A3OA 3QFHA 4HVLA 1KE2A 1WVMA 2Z57A 3DVRX 1SUDA 1PJ8A 1R64A 2PWAA 4Z2AA 1BFUA 1TO1E 3BPSA 5FFNA 3VYVA 2ZRQA 4HX2A 2ZWOA 2ID4A 2X8JB 1SH7A 1EA7A 1SCJA 2W2QA 3PRKE 3WIVA 4KPGA 1GNVA 1SIOA 1YJCA 1SCDA 4CG0A 2WWTA 3EDYA 1GTL1 4I0WB 3DW1X 4KB5A 4WOCA 4J94A 2SNIE 2TECE 2G4VA 3DDZX 4DWWA 1T1GA 3D9QX 5AVKA 1SPBS 4MZDA 3EIFA 1SIUA 1KE1A 3QMPA 5I9SA 1ST2A 4ZARA 1DBIA 1SUAA 2Z2YA 1AU9A 1BE8A 1YJBA 1NDQA 1SBTA 1SCBA 1SELA 3D43A 3ZXXA 4OV6B 1MEEA 3Q5GA 1IC6A 2WUWE 4H6VA 3TECE 3WQBA 4NE9A 2HD4A 2PKCA 4GI3A 3WHIA 3VSBA 4OMCA 2ID8A 3DVQX 4LVOA 5ARBA 1GA4A 3BX1A 1BFKA 1SCAA 3DYBA 2PWBA 2X8JA 1SUBA 3EE6A 1XF1A 3DE3X 3DE2X 1JEAA 1Y48E 1SIBE 2QTWB 1C9MA 3F49S 2P4EA 3I30X 1PEKE 1CSEE 3ZXYA 4AKSA 1AV7A 3DWEX 3HJRA 1Q5PA 1TECE 1SUCA 2ST1A 3VHQA 1NLUA 3F7MA 1GNSA 2SBTA 1S2NA 5AVJA 3TI9A 3AFGA 2W2OA 5SICE 5JXGA 2Z2XA 4NE7A 1AQNA 1SVNA 3DE5X 3VV3A 1AVTA 2SECE 1Y3BE 2Z58A 1T1IA 4K8RB 5JMOA
chains in the Genus database with same CATH superfamily
1MPTA 3BDAA 3C85A 5G4LA 1LA2A 1PVOA 3I09A 3NONA 3W8EA 1SKYE 2RAPA 3GDWA 4FE7A 2FP4B 2ORVA 3BH6A 2HXYA 2R5NA 3MQ4A 3L7YA 4KZKA 4MYHA 4CF5A 4HZUB 1ML4A 3IMEA 1PVVA 1I3OA 3LCJA 1N33B 3IUBA 1YVPA 2QUIA 3ETHA 4M2LA 4ZMBA 1P2FA 2DPGA 3W2FA 2AFHB 3ET4A 4URWR 2YDXA 3NDPA 1GR0A 1T3GA 5LDDC 4QECA 2X9QA 4H31A 1LW7A 4LSWA 4P2BA 2NZWA 4U3JB 1M0SA 1R8XA 2PD6A 2IHUA 4R16A 1P2GA 4FIZA 5K0BA 2JFOA 2GZ1A 3W9YA 1QOZA 2F00A 3HGMA 5FL3A 4JI3B 3TSAA 5JAMA 5M34A 5F35A 2F4VB 1KZHA 3GIDA 3ROPA 3OJEA 3ZCVA 4WZAA 1S2DA 5EN4A 1VE9A 3B3FA 1ZMBA 3TL6A 1G7RA 4E5UA 4WN9A 1AS3A 4PLFA 4Z51A 4DW8A 2IKSA 2MSLA 3PUVA 4EG8A 1YRAA 2J32A 4TS9A 1E98A 1K86A 1M2EA 2WAXA 4PR0A 1YCGA 5E3HA 4MKZA 5CFNA 4Y0VA 5ALLA 1DBPA 4R1MA 2IPMA 3ROEA 3VPAA 4O4IF 3DMYA 4YXWA 5KYGA 1E9CA 3INGA 1VP3A 1NC3A 3FVVA 4PG8A 2VDJA 3DT9A 4QXOA 1M8GA 4OH7A 3RGWS 4F45A 2HNBA 1V95A 1BEUB 4E3ZA 1A69A 1F51E 4N0PA 5TQVA 2E82A 1NVEA 3E1SA 4MLPA 1BN6A 4X85A 3LL7A 5DOZA 4EZIA 2QUJA 2JI9A 3RARA 3EF0A 5JPDA 4KXUA 5FA6A 1VHQA 2VPZA 3D8SA 2QOEA 4FFSA 5EOVA 2YVKA 3K8QA 4KO1S 5DE3A 3LQ2A 5D8DA 1MRNA 2IVZA 5DEOA 2BFOA 5FBZA 3W79A 2KMLA 3NFRA 4TMXA 5F7XA 5D51S 2DU8A 2G70A 3AWDA 2CZGA 5JXIA 3EZYA 5I4CA 2I6GA 5J2UB 3T1QA 1PQUA 1NQOA 4WUVA 3WWDA 5BQFA 1NW4A 2WVAA 4TQAA 3KD3A 3SE7A 1T2CA 3WMRA 2X3UA 2RIPA 1SN7A 2F3TA 1JQKA 3L18A 5I7WA 3F90A 2NTYC 1UC9A 2Q4DA 1NLMA 2RC6A 3N2GA 3OZXA 1W25A 4H7EA 3F4LA 4L07A 4MPJA 1JAHA 1CNMA 2HGZA 4G1BA 1HZZA 5GZ1A 3QX3A 2OYRA 3LUBA 3D02A 1NWCA 1XZGA 2XEDA 4DG9A 1TVCA 1FFAA 2HSWA 3BXGA 5AH0A 4CUJA 5CUQA 1DZ3A 2J0SA 5FPYA 3QUBA 3Q40A 3R0VA 3PRJA 4DM3A 5C80A 3AR9A 5C4MA 4DR6B 5KX5B 1IN5A 1OW3B 1JFVA 2KJQA 3I23A 4IXDA 4Z0HO 4ETIA 4PRYA 4TTQA 3DV2A 4GBMA 4WGFA 1PSZA 3EDMA 2P9QA 4PZDA 1AKRA 2V4UA 2AN5A 3DNMA 3GJ8A 1JVSA 1U7DA 3HMQA 4YO8A 5BN3A 4UE6A 1DRKA 2NVBA 3L5KA 5K3FA 4B4OA 2JBWA 1P4AA 3P20A 3LC0A 2YBEA 1TL7C 3AUFA 4QE3A 2H18A 4V3CA 2ZRMA 3B6EA 4LFCB 4NU5A 3W2TA 2ZE8A 4AF7A 4H4EA 1RCFA 4GWGA 1H4SA 1ABFA 1MO2A 3RJTA 4OI0A 2O6LA 1P7YA 2ZB3A 1CXZA 2P27A 4KWTA 4CT0A 4HVCA 4DLAA 4Z8YA 2H16A 4OQXA 1VLVA 1NBWB 2D06A 1CY8A 2WM8A 3EMVA 3UJAA 3AVXA 3P0EA 4G5SA 2R0QC 2W2KB 2GFHA 3OLCX 4L76A 3QBTA 1TVEA 4BWGA 4N39A 4N5HX 1BDIA 2RGYA 1NQTA 2Z56A 3FAKA 4WQMA 3GPIA 4HK4A 1Z8HA 5FEMA 3UANA 3U3ZA 3UMBA 4EVRA 4CM9A 3FGZA 1RYYA 2EL7A 2YW2A 1IBCA 5D7BA 3RRBA 4MWTA 4EMSA 4GYWA 1T2NA 2FR1A 2Z43A 3KQTA 5G41A 2Y66A 2DQKA 3EFOA 4LC9A 1TX4B 3ZWQA 3BUSA 2IEGA 1E8NA 3IAAA 3U16A 4HWRA 4IOMA 3O47A 1MAUA 1VA5A 1XLUA 2E37A 2HT6A 2P1RA 3FGOA 3UBTA 1QJ4A 2QN2A 2BISA 4UMFA 1O9HA 1NGSA 3AVVA 4N6GA 1UMKA 3UXHA 2ZT7A 3KR2A 1DKOA 3ZUGA 1R15A 3ANYB 4PPYA 5E6RB 1SQ5A 4E5SA 1KMMA 3HDTA 4ZOLA 5B7NA 2QE7D 4IO0A 2E9SA 1Z4PX 4EGFA 1DDOA 4ABYA 2B1QA 5I9IA 1QIFA 4WJZA 3QY9A 2OLEA 1N5KA 2AW5A 3FUCA 1R5JA 4WK0B 4EI2A 3AXTA 1QHGA 2Q7OE 1MENA 1N3IA 2B98A 1GPDG 3JVVA 4RK5A 4UVGA 1L7QA 5K45A 1KJJA 2FN3A 2XV1A 4IIDA 3WIOA 3ICVA 3HLTA 3JALA 3ZCSA 2JIOA 3LV8A 1L5GB 4ARBA 2V8BA 4YAWA 4INOA 1QH0A 1TC1A 3PU6A 3AHDA 2AOTB 3HY3A 721PA 2J4CA 4KH1A 1AKQA 1NXSA 2BM9A 2YMQA 5AD1A 1LV7A 2I1WA 4LZJA 4OXNA 4F5EA 2EEZA 5H70A 4I1UA 3F8WA 3G82C 4P4LA 1M34E 3EC7A 1G0OA 4K1XA 4DKXA 3PWZA 2C5HA 3BFJA 3IAS6 4J0GA 3DZJA 2ZSAA 1W36B 2PL3A 2VYCA 3W8FA 1OPXA 3VNSA 4YRNA 3WKDA 4AU1A 1VHWA 3LM8A 3OE7A 1PGOA 1G5IA 3WGTA 1FZTA 2O4CA 2Y9PB 4AUEA 2EJUA 2H7YA 5F77A 1E96A 4UC0A 1NZDA 2A0UA 5BT8A 3EWNA 3LIPA 2OB2A 1EM8B 3RNLA 5IC6A 3SLRA 5KOHA 1ZD2P 3PZRA 4N40A 4B48A 1JH9A 1Y8ZA 1WL8A 4OATA 2Q3BA 4GE3A 2O8VA 2WT8A 5IF3A 3N9IA 3ZR4B 1PU2A 5F64A 2BGTA 2WUFA 2FEKA 1VL6A 3CF4A 3D6JA 2ZB2A 4OFZA 3GJXC 1MH1A 1DAKA 3FVTA 4Q7MB 4UNPA 5EWLA 1IPFA 1C30B 1OTYA 2PDAA 2WV9A 1KWKA 5IKXA 5JAZA 3KSZO 1VE3A 2A57A 3VVBA 5J2UF 2FSVC 4DIUA 3KYCB 1TM7E 1P91A 4D9MA 2YS6A 1E6WA 2HHAA 3CX8A 5DX8A 2G9QA 1GRQA 1UKEA 3MHPA 1V6SA 3BWYA 3HXKA 4II7A 2FZKA 2ZTVA 3I73A 4EM6A 4RF2A 3ZD8A 5LD2B 4X0EA 5T3YA 4GDFA 3OKFA 5EHIA 3ZWMA 1YS7A 2NT3A 3GYBA 3IUMA 4OQYA 4WLFA 1QZZA 5U1PA 1NVUQ 2B2CA 2EQBA 2VHYA 2DHRA 4IDHA 1KOGA 4F6RB 3BFXA 3DPUA 3K0HA 1NU8A 2BKUA 1MIOA 4KQ1A 5L4LA 2FE1A 4RV5A 2Q49A 1S01A 1YB4A 1KDYA 5FORA 5KHAA 1Y3AA 2IOFA 1R5OA 4V0QA 5H59A 2VNJA 4B71A 4G24A 5FWAA 5C8DA 1BOOA 4MVJA 4EQ6B 1ENPA 1JEQA 3RUIA 2VTBB 1I2AA 3C3YA 5CBKA 1T91A 2COUA 4XUDA 1NM5C 1NFQA 4AIRA 2RJNA 2UUPA 1WP9A 2AR9A 2DBRA 5J2TF 5K4AA 5C5IA 3B6JA 3FNBA 4PIVA 2C9BA 3DOJA 3IR7A 4PONA 4F11A 1EE1A 1SG6A 5DLPA 1Q16A 1UK7A 2ETVA 4N5LA 4RMGA 4NENA 2RBGA 1NVMB 1KE2A 1WUHS 3IP3A 3V8VA 5B58C 1O95A 1QH8B 3NETA 1HT0A 1UADA 1DT3A 1QTQA 3FNQA 3V8BA 3EIQA 1XZQA 5CYGA 4Q6BA 4XGQA 1L8LA 1OFHA 4QQ8A 2DCMA 2CFOA 2IW1A 2CW5A 1Q57A 3FUVA 5TF0A 3QXXA 4HVTA 3ANTA 4GOKA 1YFKA 5CVTA 8ATCA 3OF3A 3JSAA 3THXB 3NATA 2FPRA 1SHLA 4RGVA 2RCNA 5CT5A 4CW7A 2PLNA 2RB4A 3ZWWA 3D8TA 4FOLA 3B1ZA 2DAPA 3L05A 4FYVA 4PYNA 5IBCA 1AN9A 2GN0A 2VHZA 3JASA 2CDCA 2OPHA 2F1JA 3EBLA 1OLSB 4A8JB 4EGJA 1PR0A 1RLTA 3DWGA 5CEFA 2HNKA 2VXYA 1ISIA 1QYDA 3RRXA 1ADYA 2OZLA 4Q39A 3PEYA 4QUDA 2X0KA 1X6VA 1X7XA 4PYOA 5EMLA 4BBJA 5GY7A 2VF4X 4B4UA 1GUZA 3R3ZA 4PAMA 4YP0A 3D0OA 5HOQA 2ZXEA 1ACLA 2XNCA 1BA3A 2OBBA 1CS0B 4CM9D 2DLDA 4S3MA 5B1IA 3B36A 1REQA 4ZRMA 2BL4A 5M7EA 1LPAB 1D2GA 3G89A 4B87A 3I04M 3UW3A 3AW8A 4Z4CA 4HR7A 1G4AE 2TECE 2XQIA 2HTFA 4WNAA 1G42A 5I7UA 2G4VA 3K9QO 2NU7B 2JS7A 3EW9A 1IATA 2VF7A 5FPKA 1WP4A 2NPFA 1RJFA 3OZTA 1O96A 2NO1A 3P9QA 4NCHA 3EIFA 3PC8A 4LXHA 4RD4A 3ONDA 3STWA 5LR6A 2IP2A 4PGFA 3IP8A 1WQ4A 3MJCA 3TW4A 1K63A 1GLGA 1U81A 1C0IA 2C54A 2CLLB 3E22A 3PICA 3COPA 2C31A 4M37A 5DTRA 3RUHA 4DQUA 5I01A 3KFXA 1P1BA 3IB3A 1ZUWA 3LDUA 4YAJA 3VR4H 1XELA 1L5MA 2FWRA 1Z8NA 1I0LA 3DV0A 1E4VA 5U4QA 1II0A 1IZ0A 3ZZ1A 3Q88A 1TYDE 4H1TA 1ZXXA 2MU1A 4QT0A 3B3GA 3NHZA 5JRDS 3I2KA 4EY5A 2XZOA 4X64B 1UFKA 3I5XA 3R5TA 2CEKA 2XHZA 4IZHA 1NDQA 2L0XA 2ZXFA 5K3BA 1O8BA 4QJ4A 3B9RA 3ZXXA 3DQPA 1I1OA 1YBFA 5JUWA 4XWOA 4O0LA 1AXGA 1M6EX 5JYDA 3ELUA 4KUGA 3E4DA 1M1ZA 3KT6A 4GKAA 4ETNA 4F9FA 2YRXA 5ILOA 3AEQA 4NE9A 4NABA 1E3MA 4JR1A 1F8UA 2D4HA 2PKCA 4RY9A 2NO7A 1D9XA 4GYYA 2JLQA 4I5FA 2RKBA 1Q1EA 3VH1A 1FYXA 2VSXA 3W7VA 2AD1A 3A1VA 3NWBA 4QYMA 3G13A 1ISGA 1XTTA 1OZFA 3U37A 3IQGX 3DZCA 3GRCA 2PO5A 2ZTHA 2D3WA 4MH0R 1MORA 1W4BA 2QVBA 4M0CA 3SZUA 3WGJA 3BMCB 3LDGA 5G53C 4N7BA 4C01A 4BY9E 2YNMC 2AUMA 3L8EA 3MK31 3OE7D 2IBTA 2PKQO 2PIAA 3GFRA 3MQFA 4WWHA 4QSHA 1ULZA 4Y2JA 4DN6A 1KO4A 2IH4A 1JKFA 4X3OA 1C8VB 1XQWA 1XF1A 5DK4A 2NX2A 1APBA 3BXZA 3ZDCA 1Z6XA 1I9GA 2G04A 3KWLA 3KPVA 4AM8A 4JBGA 4Z54A 5BW6B 3W8RA 1LB1B 1WLSA 3LKVA 1NQAO 1UR5A 2H07A 4I46A 1XEXA 3VU0A 1W581 2R79A 1PGNA 4GOMD 4MV1A 4ZV7A 5BR7A 4DYHA 2IOYA 1EZ4A 2H31A 3SXUA 5LOVF 1Z88A 2YY7A 3I2FA 2BEUB 1M9NA 3ICEA 1WS6A 2JH3A 2FPOA 3R6LA 4FEYA 1ZK2A 1JHVA 2G88A 4WNYA 5ALJA 1L7AA 3HV2A 4OFWA 1G8FA 2V7VA 1DAEA 3JS5A 5TPZA 1U0BB 2VPPA 4U2GA 4Y7DA 1O57A 1SUFA 3C6ZA 4RANA 3DOIA 1TM2A 2KPOA 4HXEB 3RJZA 4DL9A 3EPHA 5IXJA 4LZNA 4QRDA 2CF6A 4AG6A 1G18A 3KFLA 4Z86A 5D01A 3RJ9A 1NQVA 3M3PA 1N2GA 1ZXBA 3RUDA 3RTGA 1XRMA 4HG2A 5KSZA 1NHGA 3EGXB 1UZUA 3GLVA 4J1TC 1JAYA 2P1DA 3JQDA 3COWA 1JX6A 4G0PA 4RKQA 2D59A 4MITA 3BJZA 2IW3A 1DDGA 5KSOA 4NU0A 1T9KA 2ZXUA 4ZK2A 3KOZA 2I1QA 1O6GA 4MVJD 1WBBA 1UM9B 1GDDA 5TDHA 2V7BA 4S0ZA 1IUOA 3JVIA 4RVSA 3R8FA 4KUEA 2JCBA 4PSVA 5JFTA 3I9FA 5KQMA 1U28C 3VPBA 1FDIA 3U17A 3GVHA 1JKMA 1U2SA 4OXXA 2HWWA 4QXMA 4RSHA 4JASB 1ODJA 1X77A 3A25A 1TPZA 4INPA 2WU4A 4OGGA 4Q9JA 4KIFA 1CC1S 2R1TA 3AYXB 4LXYA 4YUXA 5DHTA 3GQBA 4RC9A 4C5BA 1KJYA 2QLJA 3D7KA 2XOEA 3VH2A 1O95D 2QZJA 5I7VA 4ETMA 1PYDA 4HEHA 1D6NA 1E6LA 2E4ZA 4G3XA 4NWIA 1QHIA 4RTJA 5CB0A 2BTQA 3NBMA 1I7PA 1RYFA 2PGIA 4QDUA 3KKQA 2DPHA 3QELB 2Z04A 3D64A 3EZLA 3GZJA 4FPXA 1CLUA 2VHJA 2AHRA 4H1VA 3HNPA 4XRRA 1JG6A 4AJJA 1M6NA 2XVZA 5BRNA 2GNPA 4JL5A 1O77A 4HBZA 4UD6A 1WTCA 1SXPA 2I9KA 5EWMA 5E6UB 2IYWA 3AM5A 3IAM1 3AKCA 2ECFA 4YQZA 4FWBA 5HBGA 2ZJ5A 3TX6A 3A6HA 3X1DA 4F5WA 3IAFA 4GLJA 3IMCA 1V43A 4KL8S 4PVDA 5I7EA 4R98A 3HM9A 3SQWA 4M1YA 5E95A 3ECSA 4GZLA 2VR1A 1H2RS 2JAWA 3MMPA 4RGBA 3CVWA 4QBIA 2I8LA 1NBMA 1P81A 2QQGA 1BD3A 1LWOA 2CXHA 2QPLA 2XR1A 3Q7PA 5AUPB 3LX8A 1H3NA 3DT8A 3CSSA 4HO1X 5GONA 2QK4A 3VM6A 5EC8A 1KK0A 1I8TA 4HX5A 4QU8A 4MOWA 3Q8LA 2FJ0A 4LMPA 1PKXA 2ZIZA 2GAAA 4P3OA 4ERNA 3WLAA 1YU9A 2UZ1A 4RVDA 2HCRA 2QMOA 3C6BA 4NH0A 2V9CA 1OBCA 2GILA 5E2BA 4DSOA 1CJTC 2FKNA 3CT6A 5A04A 2ZSDA 2XSZA 1L0BA 3A2MA 3IMFA 2PGNA 3HC7A 4OKNA 4BMNA 1M10A 1P7CA 3H4MA 1FSGA 1SQGA 5KQPA 3K0CC 4AZ3B 4B4VA 5DXJA 4YRGA 2UZ4A 4X3PA 1VKNA 1ZI6A 1QLHA 3T7DA 3DBOB 2KLBA 2GX6A 3K1AA 2ZUUA 1N34B 2NV6A 3PLAE 3T0IA 2QAIA 4WE3A 3P9YA 4HRVA 5HCUA 4TUYB 2D62A 3MB8A 1GEGA 2VP3A 2FPGA 1T9BA 2D5LA 3WLJA 2EFCB 3L77A 4LW8A 3G9ZA 1E3QA 3H9BA 4OLFA 4R8VA 4CQLA 4I1PA 3F71A 1HDGO 1ZG3A 1AF7A 2OQ2A 2WD7A 1U3FA 1UAYA 2X1LA 4MYRA 2YS7A 3CR3C 3I0ZA 3UATA 3H16A 4BC1A 1S2IA 1VJ5A 1EFDN 2D3TA 4B6SA 1XQ6A 1QBKC 1HURA 4ZVKA 1LLCA 1QMGA 3UK2A 1ORDA 4D9CA 5LQKA 1AKYA 1PK9A 2WYIA 3K2QA 3TD9A 1KQPA 5DN6A 5LU8A 1PWHA 3JQFA 4RPGA 4RLFA 2X5NA 3ZBUA 1W5TA 2DECA 1DMRA 3B85A 3WICA 1PT5A 4RADA 5AW6A 3ND8A 1E3JA 1KC3A 2IDJA 3LKBA 4LX8A 1J5PA 2H2GA 4NMHA 1U0OC 3MJHA 1R6BX 2QRJA 1P2SA 4CI9A 4X20A 2Y1FA 2EP7A 4PXAA 1ZO8A 4HYYA 4P5PA 3M89A 4ZYWA 3BS4A 2E1PA 4PHFA 1TAQA 2UZ0A 4ILKA 1YIAA 5EPEA 1ZIDA 5DGTA 3GNTA 4QGBA 3KBBA 1W35A 5EEGA 2ES4A 1RYHA 4UU1A 4L22A 3SZMA 2C2XA 2EU8A 2XMGA 3HA7A 1Z5OA 1XMOB 4EITA 5AK0A 5K4HA 1FJ2A 4FBLA 2GJSA 4J07A 4KSYA 2F3SA 3PDUA 3TSZA 5EJ4A 5FF9A 1KP9A 3FLEA 2PVSA 4KXFB 2BKXA 2E6UX 2PL1A 3MMSA 3R9XA 4OB8A 1WB4A 3L1UA 4PSKA 1DDIA 1K7XB 1ZK4A 2PVCA 2QUBA 2P78A 3QYAA 3BIJA 4MKIA 4U1RA 4YUZA 3SFVA 1WKVA 4TV9F 2AI3A 2JHAA 3D2AA 3O1LA 2IXDA 2G6BA 3B9QA 2VUSA 4AIIA 3FCXA 4LXIA 4YMWA 4MUIA 1PT7A 1EG2A 3OMLA 2QN6A 2CJFA 4KR2A 1X7ZA 2WZDA 2AFVA 3QVWA 1WMFA 2FZ5A 4KYIB 3W8DA 3LPNA 4B0PA 5FEUA 4POAA 3Q9SA 2FMIA 5KWIA 3PHHA 5ICCA 2BFEB 3GEPA 1VI5A 2V6MA 4OIFA 3U3DA 5TPZD 1YA8A 2C4NA 1ADBA 3QIAA 2O3QA 5CURA 3AVWA 6LDHA 1THGA 1AF4A 2OBYA 1JUDA 1LQUA 2VF5X 3ELDA 3NTLA 1CZUA 1HKHA 3HFRA 3OZGA 5AKZA 4B4KA 4EUFA 4OB7A 2ODAA 1A9XA 3F2VA 1UDRA 4PO3X 1P80A 4YT4A 2VJYA 4CEJA 3UFXB 4YT2A 3TYXA 1MEOA 3MWEB 4G0OA 1H2HA 3PVZA 3GDGA 1XAHA 4MLDA 3VI3B 3WA6A 2GUWA 1ZVVA 2MINB 4D3YA 3NOVA 1YZNA 2VSFA 4U9UA 4I4NA 4Q1DA 4QOHA 6Q21A 4KW7A 2J8ZA 2JLCA 3OIYA 1NTOA 3PX7A 1FLAA 2BD0A 2YV1A 3K0SA 4Q3NA 2DQSA 3G0DA 1E1CA 4M60A 2OVBA 3KALA 7GPBA 4JUAA 1SNYA 1YNOA 1FEZA 3ELBA 1ZC4A 5A6SA 1DIRA 5EZ5A 1E77A 5CXSA 1L5HB 3P52A 1GCUA 1XD2B 1EK6A 3OQIB 4UUMA 4X63A 2CHEA 5C1DA 1ZM3A 2JCGA 1DLIA 1A8HA 3QE2A 1HEYA 2OLJA 4FJ2A 4G0ZA 1I2DA 2NV0A 1DEHA 2Z30A 3R23A 4M0KA 2HPZA 4AYTA 5C32A 1EXVA 3NGXA 1KRWA 4HB4A 3Q1LA 2P5YA 1DC4A 4QU0A 1MX9A 1ZK0A 4NHOA 1L8AA 4MGEA 2VH2A 2YJZA 3L1KA 4L0CA 4A8TA 3ILXA 4TRNA 5EMHA 1BW9B 2Y05A 4E4TA 1GTVA 2J7PA 1R7RA 1RKVA 1OC2A 3BD6A 3S2IA 3W5VA 2G9ZA 2M1XA 2A0WA 3JQGA 2BH9A 3NC0C 4RVOA 2OAP1 2HMAA 4HRXA 4IFBA 4DRXA 1VBMA 2VJKA 3CMCO 1YZLA 2IYSA 4S0XA 4L9AA 3E48A 1Z18A 2OHOA 4QJIA 4RX1A 1UBSB 4U9HS 5EG5A 2VKTA 5KPDA 3NHAA 1YAHA 3SCZA 3U40A 1JDPA 2DT8A 2Q3HA 1ZUNB 3UT5A 2VZ0A 5CG2A 1NPYA 2R1VA 4ID3A 4OXIA 1FVOA 2X3FA 4C3VA 1XZNA 1PS0A 1ISFA 4OMDA 1JMYA 1RYMA 4MDHA 3OJ0A 3WGYA 1RYBA 1O97D 3VZPA 4G1UC 5D3KA 4C05A 5KHLB 2D0PB 2X5JO 3PT9A 1ZKMA 3A28A 3H5NA 5CT9A 2JBAB 3EPKA 3LA6A 3G59A 4JQOA 1JGTA 3LSTA 2B4KA 3N70A 2ACEA 4AMBA 3S8MA 2VQEB 4NQZA 4TUYF 4H4DA 5DM4A 2CZCA 2PFKA 3OA2A 2TMKA 3ZE7A 4CV2A 1AB6A 2X5XA 2LWIA 4E4RA 4BBAA 4MUFA 1A4UA 1WSWA 3U7FB 1S4QA 3AB3A 2XSZD 4YMGA 2UXBB 1L3CA 2H2DA 3GRUA 4FNGA 2I9PA 3LGAA 3T5CA 3R74A 2JC3A 3RFUA 3QEMB 3K6SA 1ZFNA 4CN8A 1DJNA 1NLFA 3OE5A 4XIGS 1DJLA 1NFFA 1HZZC 1BMQA 2RARA 3DFMA 2IODA 3OWHA 1THZA 2I34A 1N2CB 4CMAA 4JEIA 4U8HA 4D0LB 2RHRA 2PEYA 1XVIA 3NHUA 4UHHA 1OUMA 2IX9A 4I8IA 2Q2VA 4A9AA 2QU7A 4H7KA 4N0DA 2A0XA 5FH9A 3BEOA 3K6JA 1JIQA 4RHEA 3U4GA 2IEYA 4C2BA 4DAEA 4BP3A 1NVXQ 2O06A 1GKIA 3ZY6A 3AF6A 1U6KA 4DLLA 2BGGA 4EHFA 3O84A 2BJVA 2P79A 2V7QA 3RTCA 4MRPA 4MA5A 1ADCA 4TN1A 3V80A 3L4SO 5BOVA 4LF5B 1H0KA 1L5SA 2YHIB 2ZDHA 4P84A 1HR0B 5DN6D 3T7JA 1RAHA 1D4FA 1OXVA 2BMVA 4Q00A 1NDUA 3W05A 2VRNA 3X1MA 2WKSA 3WB0A 2E5WA 1UXKA 3PA6A 1KDZA 2RAVA 2R5WA 2WWHA 4C1BA 2KBFA 1TB4A 5EVJA 5AHWA 3D6UA 5KDLA 2ERXA 3PQFA 5E9JA 1DWQA 4B3JA 1FJXA 4D57A 1SUDA 1ZX1A 1JA9A 1IZZA 1HXHA 1PJ8A 1V47A 1ZISA 1ZM4A 2OHGA 2XRFA 3CR7A 3BPSA 3DDWA 3G2IA 1E2PA 4MQEB 5FFNA 4DJTA 3VYVA 4IJKA 4FINA 4ZV4A 4DT1B 1IWPB 2ZI5A 4ZZ0A 3WLEA 3KKZA 1PEDA 2ZJ7A 4D0SA 1JSLA 2Q9UA 5EMMA 3EASA 2XCUA 2OYSA 1SCJA 3AQ4A 3K31A 1I1HA 4QPCA 1K6XA 1YZGA 2B94A 2FSUA 2XJ4A 4KDEA 1XZEA 5GP1A 4DQ0A 3RQSA 1GNVA 2Q5QA 1SIOA 4FDUA 4DS3A 3PWSA 4ZOAA 2WJYA 4EY7A 2PMBA 4DSNA 3W3AA 4KQFA 3QFFA 1S3SA 2ATIA 4QRIA 4XPIB 1UP4A 2Q62A 3S40A 2J5QA 1GZ6A 4CG0A 3AF1A 5BW4A 3DOEA 4XEHA 3OIDA 4IOKA 3DXFA 4HDKB 4Z7QB 1ZGZA 1X2BA 4JT2A 4RSRA 1I1QB 1YUMA 3OE1A 4EELA 4YCLA 3CN9A 1KI6A 1V8BA 3EXHB 3SKXA 1WXEA 4DQLA 4N76A 1TF5A 5FTLA 2XOKA 4ZT2A 2QTGA 3ICPA 5FNZA 4D02A 3DCNA 3SBEA 5LPNA 2X4IA 2UDPA 2B5OA 3DLBA 4FYJA 2IYXA 2ZDQA 1D2CA 3BEDA 3I9V6 1TYZA 1A95A 1RRKA 3V2GA 2GD1O 1Z12A 1A9QA 1JLLB 2EX0A 3MELA 4MZDA 3D3WA 1OWMA 1KYZA 4EK9A 2OCKA 1NU6A 3AR5A 4MINA 3V4ZA 1QYVA 5BSTA 5ABPA 1W4CA 5C0OE 3UMMA 4WDRA 1S96A 4S1WA 1G19A 3UG7A 4HH1A 7ADHA 4ZMSA 1IM5A 4M38A 1J07A 3MC1A 3I9OA 3L8MA 4WXYB 5JZ9A 5K0ZA 3DBLA 3E15A 2G5TA 3LRPA 1Z7YA 4AK9A 1L8QA 1MABB 5B5SA 5E3JA 3VNRA 3TDMA 1JEYA 3EUFA 4JV5B 1FXUA 3FPCA 1DEOA 1XLWA 3MTJA 4JUIA 4V0RA 2REQB 3D31A 1HO3A 1PBTA 1VGQA 3MAGA 4D3ZA 5A3JA 1SUWA 1LBHA 1MEEA 1RKQA 4OP3A 4DCVA 1YZQA 3K30A 3KKKA 2AOVA 4A4DA 3VC1A 1N2IA 3LT1A 3FZGA 3K7EA 4KO2S 4MTLA 4Z5XA 5AUNB 3X1XA 5KMGA 4MQBA 3WQBA 3TECE 3OT1B 3SIXA 2HD4A 1OMOA 2VP5A 1GGMA 2QRVA 3BCUA 3OQVA 2MYUA 2FQ1A 2SKDA 4FQ8A 5IM4F 3WIDA 2J7PD 3RTBA 2ID8A 3B6MA 3ENWA 1QX3A 3O8OB 1LWNA 4GRDA 4IIFA 4RPHA 3FX2A 1Z15A 1ORRA 4YR7A 2ATEA 1GA4A 3IPRA 5DM70 2O8EA 2DQZA 1ZH4A 2G0AA 1DWUA 3AY3A 3IVGA 2OGZA 1QGYA 4IUCS 1MB3A 2GXQA 3KJIA 4RA6B 3U44B 1XQVA 3PV0A 1Y1LA 4CVNA 1J33A 5EKSA 1J39A 4B3RB 1BQ3A 4KBFA 1C8KA 2PYIA 3NYIA 1W0CA 4OB6A 4G97A 5DXAA 5IASA 4PLCA 4H0CA 3AFHA 1X19A 4O4LA 4ZYUA 4L51A 3N2KB 5ALWA 5ES3A 4C4ZA 4UTVA 3OZIA 1IQ0A 3EVFA 1EP2B 3OY2A 1EVEA 1EAMA 1QQTA 2PZJA 4HDAA 4NEHB 3UK1A 1NRWA 2AX4A 2NPOA 4MVJI 3PLNA 1YASA 4PE5B 3SD7A 2C42A 4L5JA 2QQ0A 1WY7A 3K1JA 3VC2A 2NQ2C 5HM6A 3CH7A 4QATA 1Y8RB 1K8RA 2N3ZA 3JQQA 3EIOA 3KOXA 2BVNA 4UAVA 3UUWA 4AKIA 3KUCA 2P62A 4M9RA 2B8WA 1S9HA 4HLNA 4PM4A 1OJ7A 2HA5A 1D2EA 4XIFA 2G28A 4RMIA 4YPOA 1TECE 2R25B 3C5WP 5J59A 3PQ4A 2PWYA 3PF8A 4CMBA 4ZO7A 2QSJA 5TNXA 1P4RA 3J81k 4B3MB 1TA0A 1N6KA 1WU8A 5FHQA 1U9IA 2OFFA 4HB0A 2GNAA 2P9FA 4KGVA 2I71A 1A1VA 3ETLA 1JG2A 2I2AA 2JIZA 5FR1A 1JG4A 3O4HA 1N36B 3LLCA 1DKUA 3WS7A 1KJQA 5LXTB 5JJIA 2EBHX 1PS8A 2O5RA 2JLRA 2QVXX 4MI6A 3HKBB 3C7AA 1XNGA 4GXQA 4B3SB 5GJWC 1HT1E 1OIVA 2FRDA 2RHJA 2V7QD 3R0QA 4OK5A 3NCTA 5KNDA 2BTEA 1AXRA 2DT5A 4ISBA 1UMBB 5E4JA 4NMWA 4EPTA 1Y3BE 5AIAA 3IV9A 4KTVE 5HCNA 2WF8A 4TYQA 3GPCA 3QKRB 4YRMA 1DRVA 3QG5A 5BT9A 3R7FA 2QP3A 3B7GA 1A9SA 1W47A 3EN0A 2GN4A 3ZNPA 4EW3A 3FPHA 1JIVA 4Z4QA 4NCBA 4LZOA 3RBZA 1Q0UA 1F6DA 3NEYA 6ABPA 3O31A 1RJGA 2FLKA 3IRVA 1TTQB 4L9WA 3QOFA 4NCNA 4PC2A 4W99A 4F4CA 3EVNA 2RE8A 1G8PA 4P22A 4MJ3A 2X0EA 1KYQA 1TZCA 3WHLA 4AY4A 1RHRA 1TFRA 1XZFA 3ILHA 5BWLA 3LFTA 3EFHA 3E9YA 4YJGB 1DJOA 4AROA 4C89A 3HXOA 3KR0A 1U7UA 4N3CA 5FPSA 2EKLA 4CN9A 3VAZA 5KB3A 5HFNA 4N82A 2COEA 5JAUA 1GQSA 5ALKA 2GZMA 1M7HA 4GLOA 3R76A 3WGOA 3IUSA 1XMVA 1CJUC 1G20B 4AT1A 4ZXFA 3OZWA 3W5BA 3W3AD 2FWBA 3I01M 2HOQA 1XPOA 1U11A 2ZULA 4ZQIA 4K0RA 2X6TA 2ZTMA 3GUHA 2P40A 3R4CA 5G40A 3W1EA 2RHWA 3PPXA 4QBGB 5F78A 3BMQB 3PC8C 3Q7TA 1D09A 4WK6A 1UPFA 2QJTA 1NYQA 1U2RA 4PEVA 2QX9A 3RU9A 4DA6A 5HKKA 3GA5A 1K6MA 4PICA 4QD3A 5TPWB 4B3IA 4KFUA 4A8PA 3SC2B 2HSEA 5K3OA 2XOKD 2BUCA 3M6MD 4NEGA 3GARA 3IP7A 2H54A 4FOPA 4D9IA 5FAXA 3SVZA 1SHJA 2R6DA 5JJ5A 4HLUC 1S8NA 2W22A 1KYVA 3QU7A 3TLXA 1T5IA 2OR3A 2WFMA 1PZHA 3BXOA 5KYUB 4LYAA 1RM3A 3LQ4A 4L7QA 1VMKA 2GPAA 2XADA 4GO1A 2JKVA 4A73A 4IRUB 2C2ZA 3LMKA 1JF8A 4BN5A 1QGUB 1AHPA 2DPMA 2R8RA 2JARA 1N2XA 1VQ1A 1OIXA 1AOXA 2NO4A 2PZAA 2VZ8A 4P3KA 3ST7A 2O5EA 4D45A 5AM2A 2PV0A 1B8OA 1T5DX 2F9MA 3DYIA 5KYYB 4Q3LA 2VOJA 4LJSA 2QRZA 1CZKA 2X7JA 4P81A 2Y68A 3L9WA 1GYRA 5ICEA 5AM0A 2G82A 3F6BX 1Z4IA 3D1LA 3HCPA 3OJXA 2HSJA 5CYPA 2V9PA 4JP8A 3MT7A 1Y9ZA 3MMNA 4EF6A 3G0OA 4R68A 1D2HA 1WPXA 3QQPA 3C3WA 3PFGA 3VZQA 2O7RA 1UXOA 5AI5A 1J9EA 2IYLD 2O8FB 5A4AA 4Z4HA 1H2BA 3S3TA 2CE7A 3KFVA 1AHIA 2HWUA 4ARIA 3G2KA 3AUAA 1TZKA 4I50B 3LBNA 2HPAA 1IWOA 2DTDA 3P2KA 3SU8A 3G85A 4HJXA 2GESA 1K6IA 4MYSA 4MVXA 3ROMA 4JMLA 1FYFA 1L7XA 5JH7A 2ZSEA 3M0EA 4XPZA 2XMPA 4WL0A 4FYWA 3ZHVA 1SRRA 3IKJA 3GT4A 3U7HB 1LSJA 2IDZA 1JFTA 4ZT6A 1NAHA 1PFYA 3O21A 4YCNA 2V55B 4MDYA 2JJ1A 3LX6A 1DX4A 3IQDB 3TLAA 1JNXX 2E4XA 3ED1A 1GJRA 1R0WA 1CE8B 1CY1A 1I3CA 1NVAA 4MWGA 1I6LA 3RYFA 2LD4A 3VTKA 3ZE1B 1MJNA 1XHLA 2ADFA 3DDUA 3DQZA 3L8ZA 3LT0A 4Q24A 2QRNA 4C87A 1GHTA 1S2LA 3O2NA 2OMEA 3JQEA 1XMSA 2XVYA 1LNSA 1AQ6A 2GKGA 2GWHA 3LXXA 2PR2A 3OIVA 5FPPA 3EXFA 5B37A 1Y9EA 2I7XA 3LY8A 1ZHOA 1UANA 3AI7A 5HA5A 4U0JA 1HE4A 3FFAA 3QBJA 4LEIA 4AS1A 3ZE0B 1WZ2A 2H1RA 4FYYA 2FQXA 3LXUX 4K26A 4BFVA 2J3DA 3L6CA 4AY5A 1UQUA 1PNOA 3S2UA 3NNSA 2KM1A 2LKDA 1WLYA 2ARKA 3AP3A 4LJ9A 3TI7A 3UJBA 1BU8A 2G07A 2ONYA 5B1SA 1VCNA 1E99A 1UP7A 2FLVA 4BB0A 2BHTA 3SR4A 4TTAA 5LQJA 1SG9A 3BGIA 4RD2A 1RQXA 4LCJA 4TVBA 4ZVOA 4KPYA 4YWJA 1WKCA 2HREA 4JUFA 2HQSA 2O5VA 5C8YA 2ZLBA 3PXGA 3D4LA 3EMDA 3KZCA 2GEKA 1ZCZA 1EK5A 3C45A 3U81A 2PD4A 3Q0TA 5IDVA 2PRYA 1QKKA 3GLHE 4EG3A 4CTMA 1FYWA 3L0IB 4PLWA 3LDAA 5D6OA 3RF6A 4AS3A 3RK4A 3ROFA 4NOLA 1NMEA 3Q11A 2MYTA 2BEVA 2W11A 3TH5A 3R3VA 5H3LA 3RWOA 4X97A 5LDGA 2JIZD 4JI1B 3X2SA 4ZEMA 5HQTA 2QGNA 3I9JA 3EBOA 4Y9TA 2PSSA 1RJDA 2V03A 1WXFA 5JC1A 3CW9A 3L49A 5LZ4A 1ZI8A 5ER9A 5AJTA 3QNMA 521PA 4DQXA 1NAIA 3CRZA 1UEXC 4IMIB 5LZ5A 2GXUA 4DXDA 4NU6A 1ORIA 4AWXA 2QM3A 5CJJA 3RNOA 3LPDA 5KNDD 3KKLA 3A58B 4L16A 4G81A 2XB6A 3CS3A 3Q7QA 4AULA 2IF2A 4ZDWA 1R4MB 4MWZA 3UM9A 5IJ0B 2R68A 2J6HA 4TROA 5F5LA 4YMTA 2DEUA 2VAMA 1HL7A 2AOUA 3EXEB 1PR2A 2ZSJA 4P3YA 2ZJ6A 3FZQA 1CFJA 3RYHB 5IEBA 5CNIA 3P5BA 3GLSA 3FDXA 2IE0A 3QU4A 2P9JA 1YCDA 3GFPA 2WP8J 4UUPA 5EA2A 3BXEA 3VJKA 4BNGA 4DBVO 3M2TA 4X54A 5B64A 1Z6AA 3DE1X 4GEGA 2DX7A 2PSDA 3GOQA 1D2RA 1IBRA 2H9YA 4BX9A 5JOQA 4DEVA 3NAGA 3QWFA 4BMSA 5HP4A 4PCUA 4JK3A 1CUSA 3BKXA 3PDCA 1WEHA 1JT2A 3FWHA 4ZOQI 3WLKX 4Y1EA 1C3LA 5EE5B 4LJYA 1DV1A 1JTEA 3CZAA 5JZOA 2J0QA 2GHTA 1N6HA 1C9JA 1CDEA 2NZ2A 3GRFA 4ZVPA 4E07A 4WOBA 2Q9CA 2QLNA 5LMNB 1MT3A 4A10A 4CKWA 1GPJA 4ZO6A 4MCHA 4RWEA 4Y6LA 4LVUA 3IOEA 4M89A 2VT6A 2YUTA 3M6LA 5FJIA 2PRKA 3LJKA 4OH1A 3CBGA 1Z3CA 4N0MA 4HNUA 2OM2A 2D2VA 2XIQA 4EG5A 1RAAA 2FK8A 4Q3DA 1NSFA 1KY5A 4KRYA 4QG7A 4L4ZA 1JWLA 1N1DA 2W6ZA 3ZU3A 5LP6C 3OTHA 2IH2A 3Q0EA 1WTAA 3PEUA 3M3DA 1AQLA 4R9NA 4E5KA 1VRWA 3D2LA 3OWOA 5K5EA 1KTIA 4NF2A 5HKKD 3NRJA 4AMVA 4X6UA 3CUUA 3OPQA 3WK6A 3GFVA 4DIEA 4INZA 3ZGLA 4F97A 2OHXA 3QU2A 5LLTA 2CBGA 5F2OA 4DREA 2CMFA 3QA9A 2CDBA 2Y2VA 4L15A 2ANCA 4DCOA 2JH9A 4NZMA 1V6CA 3CLHA 3QX7A 4KNWA 2RGAA 1GCAA 4R8KA 3F2IA 5CA1B 4KMRA 3JQRA 1MT0A 3NALA 1U3WA 3GUVA 3HBMA 3KLPX 3THRA 2H4JA 3T7TA 1M0TA 1ISRA 2J4DA 2QJRA 4Q3EA 2H63A 1HM5A 2ZBPA 2E3JA 3I9MA 3Q98A 4N7RA 4OU5A 1MR3F 1X87A 3JQFC 4JC0A 2WAMA 3RLFA 3NYRA 5KQGA 2WJPA 2BPOA 3OX2A 4NFYA 5BYKA 1Q7TA 1K08A 2NYVA 3H0KA 4RMHA 3RVNA 2I3BA 4GPBA 4UHKA 2H06A 3HZRA 2ACKA 3PFWO 2A5YB 2I3GA 5H81A 3QGMA 4E32A 4X8MA 3RO7A 4LK3A 3ZHQA 2VLIA 4FKBA 3ZCTA 4BNDB 1GAQA 1JALA 3FIJA 4D9NA 1YK0A 2IVFA 3CVXA 1KU0A 3BZWA 3OPYA 4K9KA 4KC0A 1H93A 1MO4A 1S1MA 1YS2X 3K15A 4LYEA 2Q3EA 1WDWB 3EB9A 3HL0A 1V7PC 4OJYA 5CW1A 1NKSA 3ZLBA 3HB1A 3ELYA 4GGOA 5F5NA 1GL3A 3SR3A 1I0ZA 1TQ8A 2XUIA 5KHOC 4KUHA 4ISCA 4Q4AB 3X3HA 3CFYA 1MX1A 2VWHA 3DT6A 3LO5A 4HPWA 3FDZA 3JATA 4N3AA 4IEFB 5T4FA 2Z57A 3B6KA 2GSDA 2BMJA 3H0EA 3V6LA 5AW8A 1K98A 4H15A 4JHXA 5IHPA 2Q4EA 4HAUA 2VP9A 2JJ1D 4KN8A 3QX9A 5FULA 4EB3A 4US1R 3LSYA 1YR2A 3EAFA 3AVOA 3UTCA 2A5GA 4KHZA 2D1FA 3AR2A 3SEQA 3ITDA 3Q85A 2VPTA 2HKIA 1HPLA 2PS3A 4DC9A 2OP0A 2WHYA 3I6BA 4J0HA 2O50A 1RZ3A 3HRHA 3QPDA 3DMTA 1UJ5A 3GJ6A 4XB1A 3PTAA 3LQQA 3PQDA 4NZ9A 4OXRA 2IS2A 1U0FA 1JSRA 2FPMA 4IS3A 1MZPA 5F3WB 1L7EA 4CKZA 2PPVA 1CJKC 3CLSD 4MR9A 3UWOA 2YHSA 4OYHA 4KQHA 3SJUA 5EIWA 2ODTX 5K8LA 2PH5A 3TJMA 5C4IA 1I24A 1OWLA 4QXQA 2ZJYA 2GLXA 3WBJA 2JLAA 3RBXA 4ZAGA 3KQUA 1T9ZA 4HTFA 2G76A 4UUOA 3EDYA 2NIPA 4QPJC 3OLZA 3I9LA 3RVSA 4ER0A 3KYDB 1EQUA 1RPZA 1GXSA 5D6NA 5D7NA 4MEJA 1OH6A 4N41A 4G5FA 4S1NA 2ZUWA 3H0CA 1Z5ZA 3LCRA 2JNWA 4KB5A 3WTBA 1V26A 4DF3A 3MF4A 1OFUA 1SA0B 2AB0A 1XQ1A 2XUAA 5ER6A 4BNJA 2CYCA 5JROA 1BMDA 2A1IA 1DELA 1WIWA 2L82A 3A10A 3D9QX 1MC8A 1YO6A 4NAHA 3D3NA 4Q66C 4MQ4A 1E0AA 3I5UA 1SIUA 1SKYB 2P6NA 4JLNA 3SQNA 3AO0B 2QS9A 5FOTA 3UJNA 3DUFA 3VR5A 3MWKA 2KHZA 4L5AA 2FUEA 4E5NA 5SYAA 2IP1A 2EJWA 3JYQA 1DO8A 4H2DA 4RK4A 3TCNA 3VZSA 4PNZA 1IXZA 3UHPA 2C5GA 5BSMA 1X80B 4L95C 1W19A 2AKAB 2CHUA 4HRAA 1YOVA 2RHMA 5DF1A 1YMUA 3TNLA 4XVUA 4DR7B 2NYRA 1OFUX 4GLBA 1A5AB 4UEOA 1U0LA 1AQUA 3BCRA 1G55A 2DBYA 3GMDA 1EE9A 4NMLA 4MRAA 4QODA 1P2DA 3TAHA 4TL7A 3IVXA 1VSUA 1MTZA 5DYNA 2BSAA 5IYZA 2ZVQX 2VSYA 4JSTA 1O6FA 3LVRE 1Z3IX 3L4KA 5LUAA 1PQPA 2GFIA 2CLMB 4IFTA 2V45A 3QRWA 4QNRA 3J80A 4Y6PA 4W8GA 1FP4A 2HI0A 3QH4A 1XP5A 4DBLE 5CFQA 5JNSA 3SS7X 4QFMA 5BVGA 4RIIA 1Z75A 3UWKA 3JAMA 2QYOA 2QI9C 4NCIA 1ES9A 2P67A 1KQNA 1GSIA 2VJLA 3QWHA 3OU6A 2DLNA 4PFKA 3FWKA 5GJBA 2E89A 4N12A 3T5BA 4G1CA 1XDUA 1V48A 4Y6RA 5TQ0B 1O9GA 3H8JA 2BGUA 3CWQA 1ORVA 3MCVA 4JS0A 4LYJA 4WK2B 3U1TA 4D9GA 3UVEA 4LNUA 4AXXA 2NP6A 1NX9A 5L6LB 4RJIA 3OP4A 3SGLA 4B35A 3AF0A 3LUPA 4CRWB 4EA8A 4ZJPA 3OFKA 4FFPA 3H2HA 4HMPA 4S2UA 1I4EB 5CA1F 1Y48E 5AKJA 2XKJE 5JAQA 1LX6A 4X7RA 1B1CA 1JSCA 3KSAC 3BBLA 4RV4A 4D99A 3FG9A 1K89A 1N6PA 1Z82A 1ZIXA 3WP1B 4BKOA 1EFPB 2QAJA 4LRQA 4E30A 5D5QA 1C7ZA 2XWJI 3QOXA 3QW2A 5AXAA 2DY0A 4CKEB 3EZ2A 1TQ2A 1J7JA 2OSVA 4R8RA 4Q4LA 3LDFA 2VK8A 4CDNA 1RVDA 4DDHA 4HDRA 5D3QA 4YI3A 4WW0A 2C83A 2HRQA 4EFDA 1DQRA 3DFIA 1MCZA 1XVVA 1IG3A 1TA4A 1I80A 2RGCA 2Y93A 1G21A 3PFKA 2A78A 3FH0A 5KQSA 1IVSA 2IEAA 3BJIC 4HZUA 1IHYA 3ZVLA 1XHEA 3N2YA 1QAQA 4K9MA 1V8FA 1V11B 2CXTA 5I7AA 2J9FA 1IY0A 4HWSA 5BR4A 4DMCA 3IODA 5HJ5A 3ESDA 2AFHA 2QRPA 1P5RA 1Z39A 1VL1A 3O4FA 2ZITA 2Q9BA 3UJPA 5AVTA 1JEJA 3CNOA 4HEJA 2RMKA 1L4MA 1BRTA 2CNWA 1YQDA 1X1RA 3ERCA 1CUEA 1IMOA 2AX3A 4G5XA 3R9IA 2ZVPX 4RJTA 1ZC3A 2HL6A 3BB4A 1LC0A 1Q77A 5DU2A 2P6OA 2DPYA 5J40A 4C0SA 4URHA 1J90A 1QYXA 4WK4B 4BVLA 2FVYA 2PM8A 2Q6IA 1G3MA 5FUMA 4HAYA 4ZVQA 2O3UA 3LZ6A 4L50A 5BMVB 4PYLA 4ZQEA 1NVTA 5FWYB 4TKUA 2R96A 3GJTA 2RI1A 4MUGA 1R3UA 1XDZA 1MLDA 3CXUA 4M53A 5DOVA 1JU9A 3NYQA 1KFEB 3REFA 1SWVA 4D97A 1QV6A 2Q6KA 3KQQA 5JMOA 1RWXA 3T7AA 4JY7A 3PEVA 4YRPA 4QQRA 4PPFA 4K2AA 3B70A 4DUPA 5JMWA 2PUDA 4KRFA 1PNVA 2FHSA 1EESA 3U7QB 3BTVA 3GOHA 1TRKA 3I6YA 1VKJA 1RMQA 3H2SA 2FSSA 3I6IA 5C1PA 3TTXA 3G49A 3HO8A 2Y6VA 4AC9A 2SHKA 1YS6A 3GHYA 3AUKA 1A27A 3IIEA 2QT1A 3SZGA 5C8ZA 3N8DA 1MKYA 2GT1A 2HLPA 1B14A 3VTZA 5EZYF 5JHHB 1G8HA 1W5FA 2EARA 1JDNA 2WJIA 1WSDA 1YMVA 3GLQA 4Q1AA 4UCWA 3WLFA 5IEJA 1DFGA 4WNIA 3S29A 1IAQA 4CLHA 1YTLA 4IXWA 2A9QA 2GBFA 4PZCA 2QMYA 4R7ZA 3ZIAA 4AJIA 5MDHA 4CLDA 4XSGA 2GHRA 4F46A 4TYWA 4MVJM 3PNMA 3SQXA 3DKVA 1S2MA 1ESMA 1WVGA 3EEQA 1CUIA 1YDHA 3QUTA 1XBTA 3VKFA 1A7AA 2QTCA 5B4TA 5JSUA 1R0ZA 5HZKA 1DPFA 3AZPA 2QX4A 4RBNA 5EKXA 3RC9A 1Z0SA 1TJNA 5TQJA 2F1KA 1QVZA 4B7XA 1OBHA 1P0MA 1EVQA 4X7PA 3BGOS 3L8GA 4MWDA 1DAHA 3QFRA 3PFNA 3NC4A 3L0BA 4H3SA 4M0MA 2D2IA 3OT5A 3W2HA 4B6PA 5KX5A 1BMFA 2YYZA 2C96A 3FLBA 4X94A 1MJFA 3UC9A 3K6RA 4L5IA 1TAUA 1RHJA 3EQ8A 4XE5A 1KGDA 5FUWA 4LXXA 4I08A 3IIIA 1W5AA 3JQAB 5CHYA 1QGOA 1CR1A 5K0TA 3BA6A 1E63A 3VR5D 4O8CA 3UJCA 1PJSA 2XEXA 1M34B 1NJ5A 1VYUA 2YVAA 4NECA 2XBMA 1UDCA 4K28A 3ZZUA 4EJSC 1JKJB 4KMMA 1XP8A 3G2MA 5DV9A 2AVNA 4PSDA 1VCIA 1XAIA 1KH2A 2AI2A 1DKNA 2FETA 3R5FA 5ECWA 3WYFA 4BO0A 3UGJA 4HT3B 4C06A 1EJ2A 4I1IA 4IIUA 3ROKA 1P4HA 1QGDA 3AG6A 4H7DA 1D5CA 2K6GA 4KQ9A 3GLRA 3KTDA 3IIMA 4FKZA 5DJ5A 1PDVA 1E3EA 1AY0A 4ITVA 4YV0A 4JXJA 3R24A 3UJ9A 2W2KA 2AN1A 4IJWA 4QYWA 5A1JA 1KQFA 2Z2JA 3TOVA 5AIBA 1KEKA 2ZYHA 2H7CA 2DHDA 3QMMA 2X8WA 4WEQA 4A0GA 5BWCA 2ZRJA 3N87A 1OB5A 3B7WA 5B3AA 1UJMA 1N0UA 1EK0A 2C04A 4B9EA 4MJXA 2GM4A 4V0NA 4CIXA 2C4WA 1A77A 2GDJA 1Y3FE 2AZDA 2NXWA 4MWBA 2XQJA 2VDQB 4JXXA 4RDHA 3V4VB 1RTTA 4C7MA 2AMYA 3N8HA 1C80A 2ZRNA 4I4LA 1M0EA 3I2IA 4HX9A 2CLCX 3O0TA 2O8BB 4EHJA 4TXJA 5EIXA 1P1CA 3O93A 4K6KA 4MCJA 3OO1A 1XRRA 6REQB 1DXHA 1PQWA 1K97A 2DZDA 4IDOA 4DCTA 5G0SA 5HW0A 1WZNA 4JC4A 3E84A 4CF3A 1U8EA 4AY3A 1C7QA 1SGWA 1EA5A 3K8YA 1X38A 2OLKA 4FCTA 4R40A 4DKJA 1TEZA 3NBYC 3ZWDA 1DKQA 3RAJA 3U7EB 5IUJC 3JQPA 3I1FA 3AUYA 1KI2A 1Y34E 1CVIA 4NIMA 4I3HA 3UA4A 4BFUA 3TB4A 1ZBDA 2EFYA 1JDVA 1Y5NA 4GIBA 4LSGA 3A6KA 1W44A 5BO5A 1DRUA 3S5UA 3PJRA 4IYRA 1U9IC 1N6NA 4IDEA 2FA9A 2AF4C 3T5GA 4GOND 5DI3B 1MAAA 4JLMA 3C8DA 4LOHA 2Q0HA 4BO9A 3ML1A 3T35A 1LNZA 2I54A 4R2HA 2GO7A 3GFSA 1NXVA 1FL9A 2P3SA 2N0SA 1ZVJA 3L6BA 5BPFA 3GCDA 1IZ7A 1XT6A 4RTOA 2B0CA 2AOTA 3ND6A 1QQ5A 5I48A 4CIAA 1TW3A 3L43A 2AYYA 4UDNA 4F7DA 4X93A 3AP1A 2FRDC 5HF6A 3O2SB 3D4PA 5CX1A 4LJ4A 3MRXA 2TSYB 2PUEA 3A6GA 2IUTA 2R66A 4A92A 1PJ4A 2C0PA 2VDKB 4LYHA 1P7VA 5COAA 4BZPA 1VGRA 2CD7A 2QB5A 4MV8A 4FNOA 1R0BA 3GBPA 4YGXB 5ALPA 1J9ZA 2HA2A 1X86B 2FWMX 3F3YA 2V0CA 2JGLA 2X4LA 5CW2A 4OUKX 3O26A 4MEAA 3BN3A 2FWAA 3DF7A 1E3WA 1QXSA 1TEVA 2CNWD 3DKPA 4H7HA 1QMPA 2BI8A 2Z83A 1XKXA 1C0KA 4RVCA 2BBWA 2ZTSA 4B6FA 3JD4A 4PX3A 4LQCA 2F4NA 4EX7A 1EM8A 1K5DA 2ZI4A 3WG9A 1A2QA 4MS4A 4Q82A 2WJZB 2WVJA 2OCYC 3JWPA 3RCBA 2C88A 1TZMA 2ILVA 3FYUB 3WJ1A 4XLZA 5LB4A 1OKKA 2DM6A 4FW9A 4QNNA 1RHQA 4BO4A 3H4IA 4QYSA 2CV0A 3GA0A 1GGVA 1G6Q1 1N1GA 2X3YA 1C30A 3BHMA 3L4BA 4LXUA 4YLGA 5D1HA 5SYNA 2AMJA 3TW8A 3MUFA 1TC2A 4JVOA 5AI6A 2V54A 4PYKA 3GJRA 2ZG6A 3NV7A 3GWZA 3I52A 2BAGA 1A2OA 3EZGA 3L7BA 5B36A 3ITEA 4MS1B 2W6NA 1SOVA 4HGZA 3VHRA 2O8DB 1GZ3A 1H22A 1FDVA 2P7HA 4QSMA 3UYLA 4ACBA 2GEVA 4NG5A 4PC6A 3U1BA 1GAEO 4QVIA 2G9VA 5IABA 5K8JB 3SF0A 3NAQA 1QV7A 2G8LA 4YONB 3X1ZA 4MW0A 1WW8A 4JYMA 4KWIA 4O2AB 1NT2A 4UTXA 4C4RA 4DMRA 4XWKA 2O54A 2V0NA 1YQTA 2V97A 4CG1A 4K2HA 3C3EA 3WO1A 1NASA 3BJEA 3IDSA 4BKUA 4XGKA 3VSCA 3QVKA 5COQA 4F6RA 2WUVA 2QTZA 1X94A 2VJMB 3UH1A 1T9HA 4UZFA 3HXPA 5L7YA 5LBUA 3ZIAD 2CV2A 1A5SB 3FR7A 4PG4A 4DANA 3UQZA 3NM5A 4UM7A 4ZU3A 2V5AA 3NIGB 4I55F 4TTPA 3DMHA 4LWPA 2OO7A 1J8QA 2PEZA 5DWQA 2RSLA 4D43A 5JW6A 2PX6A 3CM0A 1E7QA 2EBUA 2J9GA 3PUKA 5E0OA 2ECPA 1RR6A 1A8UA 1CYEA 2SICE 3U7IA 4CFZA 3CX3A 2QVGA 1SCKA 5C3MA 3MMZA 4ZI7B 2OV1A 5IPFA 1MZVA 1RM5A 1R0LA 5FUVA 5CGZA 3VPGA 5K6AC 3VMFA 1M2KA 4FILA 5E7JA 1BMFD 2QUKA 4OAQA 1G9SA 1C9KA 4YY3B 4AJ1A 1AUVA 1EJ0A 4I4IA 2D7JA 4CG2A 4NBSA 3FCSB 2OOKA 5EGSA 2HQBA 4BTVA 4YQEA 5JO9A 2RDMA 4LC1A 3VR6A 5C1OA 5CRIA 1P77A 3CO0S 2P3LA 1M54A 4LY9A 1N3BA 4PZZA 3THXA 4MPDA 2CLIB 3NORA 1KHHA 4Q1VA 2CLFB 4GNKA 2PN1A 5AMXA 4KIUA 4C0AC 5JI3E 1IEWA 1GO2A 3U0BA 4JQZA 1PL8A 3G68A 2GPNA 2ZJZA 3VYWA 1WKBA 3E7FA 2XCQA 3IEXA 1GAXA 2MSNA 4HH3C 1NPTO 5EJAA 1J20A 2VSNA 1LRKA 3HYNA 4GZ5A 4BO5A 3A6LA 1KSGA 2YV5A 2G25A 3T3DA 1ETUA 1EGQA 1CERA 3JW8A 1A2KC 3OHSX 2A8YA 1V35A 1GZ5A 4QICA 4QXAA 3TLMA 5B7QA 1QF6A 4J0CA 3IOCA 2DTEA 1RXYA 1I4WA 2H48A 4PF1A 3SE0A 2O1SA 3M6WA 3SMVA 1HE5A 3HZZA 2FPWA 1DJPA 3IC5A 1P1IA 2CYBA 3KB6A 3L7MA 4B6JA 1QU2A 3WGKA 1ZOSA 1DAIA 1XYVA 2BZ0A 1J06A 2EW8A 2ZYSA 1DUSA 5A4MS 4NNOA 1F2TB 5BW8A 4MKFA 9ATCA 1BKYA 4HN4B 4JN6B 4QVGA 2HU7A 5I3CA 3AONB 1BFUA 1TO1E 5GOTA 3I62A 1FP7A 2DULA 4WECA 5DX1A 1XTSA 2MR6A 3M81A 4C6TA 5AW7A 3Q8WA 3VPSA 4WH0A 1QO7A 2F3UA 1JILA 4RULA 2F8MA 1I14A 4OBWA 4TKVB 3TVTA 4AJ9A 4Q9IA 2LUOA 3PRKE 3QEAZ 1DT5A 2FRXA 1QORA 1YHZA 3JQ9A 3UPDA 1Z38A 3O82A 4UE2A 1P6XA 2OCXA 2UAGA 5J3JA 2ONJA 2G5PA 3C2QA 1BA2A 1AGNA 1U0HC 3HYCA 4IM7A 3AM4A 4MICA 5AKLA 3NXSA 3SJCA 5KDDA 1OGYA 4OBEA 4TKZA 2ID7A 3MWJA 4HB3A 4B81A 5ITWA 2WWTA 1YDGA 2CHGA 3H05A 4GG1A 1EGAA 4PXYA 5JMPA 1E7WA 4D9FA 4ZCIA 3LK6A 3SJZA 3CUSA 1U9ZA 1EP3B 1P9OA 3HDGA 3EUAA 4V0ME 5CA0F 2GYYA 3AHHA 4AN1A 2JCVA 3FVRA 3M6XA 4NYJQ 4OA8A 3QHQA 1USUA 2MMCA 4N7MA 1QO9A 4ME6A 4ZIRB 1L5KA 3U4DA 4X62B 3PUXA 4KLAA 5K0SA 2X5KO 1H1LB 2GZAA 3GGOA 2G4LA 2ZRHA 2VPYA 3OIWA 2P75A 4ZVLA 4AZSA 4DWWA 5C37A 2B8TA 1YTUA 3TZBA 5JJKA 1SPBS 1NX6A 1W36D 3F6SA 3EGVA 4HWOA 4PU0A 5CLLA 3CLTD 3DAOA 1NMYA 4KQMA 2C07A 3SN6A 2E5LB 1B23P 4BQEA 5K2OA 4IZIA 1X7GA 2I55A 1E9RA 3QKWA 4U5XA 1BHO1 5JNVA 2X4GA 1HTWA 2WLSA 3BWCA 2IQIA 1C7EA 4YALA 4ALJA 4CG3A 5JWOA 5EGNA 2IHBA 3K05A 1NQ5A 3OZVA 4A3SA 3J81A 1NXTA 3DYVA 4UNQA 3R7LA 5ICSA 3BK7A 5JXWA 2IU4A 4EG0A 1AU9A 1NV9A 4IAOA 1F0NA 1NSTA 2WNSA 4E5DA 1G38A 1OKKD 2JCXA 3O2JA 1CR6A 4H3HB 4J49A 1ZN2A 2LR0A 2GAFA 4RDIA 1MO6A 4BNIA 4D8YA 2C2OA 1EWKA 1W96A 1KMHB 5IJZA 1E7SA 4YWHA 2PAAA 3IELA 3LC7O 5LZ8A 3TAXA 1GU1A 2OD2A 3DAYA 4DCMA 4QJ3A 3JPYA 4MLZA 5FBHA 2G7MC 3E0XA 3GO4A 4XZ3A 4C4SA 2FG7C 4PFJA 2EJCA 4ND7A 4TS4A 2ZYDA 2P3OA 3L7NA 1E9AA 1QVRA 5IWCA 1RI2A 2FG6C 2JLZA 1PV1A 1EDEA 2I2XB 3KJGA 1HRKA 3LT4A 4K6OA 1IY2A 4IG4A 4MYDA 2SKEA 1UKAA 2IOFK 4C4AA 5JYBA 3D2CA 2F8SA 5IM5A 3ZH9B 2PXAA 4K05A 1IQUA 1XWFA 4MIYA 3EGXA 3CWZA 3NAZA 4BQOA 1EGHA 5CH8A 1BH2A 4G5HA 4NFHA 2DC1A 2M9MA 1TQ4A 4X7BA 2JLBA 2IYQA 3TZ6A 1UIRA 2O9JA 3NT2A 1P9LA 5IN4A 1QQ7A 4GBGA 3WKBA 3RC1A 1R10A 2HBQA 1XDWA 2LTAA 2AR7A 4DADA 1UM9A 3BWXA 3R5KA 2O2ZA 4BO6A 1NBAA 2Q45A 3PXXA 3R3HA 3F49S 3QSYA 2O2SA 4JLPA 1YBMA 2ZE5A 3ONEA 4ENWA 5DYGA 5IAKA 3OPYI 1TJPB 3AH8A 1R37A 1GYPA 1WSAA 2HQRA 2QPAA 4TLLB 1I7QB 1ODFA 2N75A 3K9CA 3LXMA 3KYJB 4DCUA 3JD1A 3FCYA 3RWBA 3KUUA 1YE5A 2NADA 4ZOCA 1G59A 1K68A 2EZUA 1UPBA 1C1DB 4GQBA 1A5TA 2IXAA 4K88A 3WA7A 3TNYA 1Z0IA 2JA2A 2PTHA 2YIMA 3NIBA 1OLOA 4IPTA 3SG0A 2ZRGA 5FB3A 3WLNA 3ZHRA 3OTGA 2H2AA 5PNTA 1LRLA 1EFKA 3W6ZA 5L4SA 1MXFA 2YFKA 1K3TA 3G7SA 1NLUA 1NXWA 4FQ5A 4WCFC 5H0IA 3U9LA 1NNSA 4KIWA 4MROA 3VR6D 1Q21A 3QELA 4RFSA 2CJWB 3WKCA 3KUXA 1Q91A 1PFWA 4J7XA 1C50A 2VTEA 4P54A 2PUVA 3GRRA 1QYCA 3CNNA 4HDOB 1W59A 3EARA 2UU9B 4HQFA 2NUAB 4DV2B 5FP0A 4PXSA 2C7OA 3F74A 5E6UA 2XB2A 4IDFA 3LP5A 2F9FA 3CW2A 4L0MA 1K4YA 2JFPA 3CC8A 4LF8B 2J5RA 3N2GB 1MG0A 1K5HA 2CCGA 3T1NA 3G2QA 4HPXB 4GPIB 4WT7A 4MWCA 3AUJB 5U9CA 2CDRA 4F3CA 1RW4A 3DE5X 3H4VA 1SHZA 3L1VA 3QLJA 3KU4A 1L4KA 4N5MA 3RRYA 1GRNA 1U2GA 2I78A 1G21E 4QDTA 4R1QA 5H8WA 4ZEVA 3FW1A 2P5UA 4OHZA 2JLSA 3E8XA 3TXYA 3DMTC 4YASA 1KH1A 1NYRA 2Z5GA 4JU8A 1WB5A 2NO9A 1X1SA 3GD7A 1M1YB 1IONA 3P2IA 3W5CA 3LZDA 2FP3A 2QRQA 4DUZB 1U1DA 3HCOA 4PVCA 2W6IA 2IPLA 3KV3O 4A7PA 1NLYA 1UCFA 5FBKA 5ECGC 4EKDA 4H27A 4CTOA 1BE1A 2XTZA 2C5EA 1Y0BA 4EEZA 1T6XA 1T1RA 3EH2A 3ME5A 4Q9LA 5LYJB 4TZ0A 2V6IA 4IIJB 4HFRA 3WWZA 1TVKB 3NO4A 5GM2A 1ZEJA 4TXLA 3LBHA 1XQ9A 1UMDB 2QRMA 1D5WA 1RZVA 1NXOA 2AJLI 2BMEA 2GVZC 3CX6A 5GGYA 2GZRA 1G5TA 4MW7A 4F3RA 5JYEA 3JR3A 2GN6A 3NTXA 2FFQA 2JPDA 1U7WA 1WUJS 1H42A 4WZZA 4GGMX 3KETA 3EPJA 2J33A 3QPVA 1E1LA 1IJKA 2XB4A 2D5AA 4I7EA 4RHFA 5ADWA 1JXMA 1FVHA 1ZK3A 1NJFA 2TRSB 5F1KA 4C1NA 1YDFA 1AMNA 1QJCA 4M9SA 4J9UE 1DNPA 3WOHA 3H1GA 1FS5A 2Q6VA 2QW8A 3N59A 2PQ6A 3OC0A 2EJVA 5H1YA 4ZKDA 3MGCA 1SCNE 1EP1B 3KZKA 1WDTA 2MSKA 3L6DA 3LTNC 3TQHA 2VXBA 4BLWA 3AIMA 3HRIA 4JU9A 5BMOA 3KLNA 4UVHA 2ONZA 3BG5A 1NNEA 1YQGA 2IXFA 4XJVA 1E3TA 4PAGA 4XB2A 1L1QA 3EFOB 2OK7A 4NXMB 3GAMA 2PLWA 4LZAA 3WGMA 1CF4A 3F47A 4A0SA 3KNZA 4XDGA 1BKDR 2AR0A 2PGLA 1P0IA 4D56A 4G9EA 5ICFA 5ISMA 1SC3A 3NFYA 4WCVA 4FFBA 3UMCA 2AMFA 4IV5A 5E9WA 3BVPA 3BB1A 3H65A 3ZBPA 5TQ2B 1U0EA 3IO5A 5EMNA 2C2YA 5CYFA 4ZJZA 3I1JA 1FTNA 3ZBTA 1JTVA 4GM1A 5J58A 4ALIA 1YIOA 1L4UA 1YZUA 1FUUA 2DUWA 2RK6A 4ML3A 4Z4GA 1I6WA 4F9GA 4H35A 4YC7A 2FTKE 3LLSA 3TLKA 4I1SA 2DBQA 4LRSB 4G63A 2RCYA 5CCXA 2IYYA 4J91A 3E9RA 5ILGA 1QFYA 1RBQA 1KVRA 1HC7A 5JAHA 4MGKR 1V16B 4J3JA 5A5GA 1YZVA 3FPBA 3F67A 3OJOA 1FSZA 1BZYA 3JALB 2JGKA 4MO2A 5CH3A 3UKJA 3ZNNA 4DDUA 5KVQA 3HU3A 1MAHA 3KDSE 3DL2A 2QD5A 1Y7HA 1T6YA 2BFEA 2GK6A 2NSJA 4P08A 4Q1EA 2G1AA 3ZGNA 1BTOA 3URMA 2GOYA 1KEWA 2QROA 3RC8A 2VYQA 1KK3A 5HGXA 5GWXA 3SDSA 1YUNA 1YQXA 3BZUA 1CZNA 1GNQA 4ALNA 3SX2A 1QHYA 1S02A 3FCUB 1SUIA 4GQIA 4NBKA 4EUKA 4Q1BA 5F76A 1QKIA 1WULS 2GPYA 2I4NA 4N8SA 2V1UA 3KEGA 5F12A 2C5FA 3MWEA 4FYPA 4GGPA 3UHFA 2JHGA 2QP4A 4I66A 1WQ3A 4DLPA 3M2PA 5KI6A 4PIMA 4TXNA 3TBHA 3M9LA 1SBIA 3ISJA 4AS2A 2QYTA 4B80A 3U1VA 3C1AA 4F4HA 3ENVA 1WCXA 2C4KA 2OQIA 2FW0A 5SZJA 4BWVA 2PJDA 1E8DA 3URKA 1GG5A 3PNVA 4BMOB 4YP6A 4RAQA 4ZGWA 2XECA 5AVZA 1CUHA 3KC2A 1RADA 3ABRB 3ZYCA 4K9NA 3E23A 4MGIR 2V6GA 5EWLB 4RTKA 2A4MA 3OQIA 3FFWA 3KXIA 3K2EA 5AKEA 1OYWA 2AG1A 4LPSA 5FTJA 3C3BA 4C0XA 3IA2A 2PL9A 4BO1A 1GEEA 3CH4B 3G6KA 2XF8A 4NRDA 3VTAA 1ZSNA 4ND4A 5AW9A 3I5YA 2NP7A 2N46A 2PA3A 1PFGA 4RTLA 3N5KA 4FYXA 3H8VA 4OSOA 2CXOA 3L7AA 2XYGA 4QOIA 5FOUA 1K27A 2VFAA 1ABEA 1MH9A 1WNTA 1VCOA 1XVUA 2V96A 3QQ5A 4OCZA 2R44A 4FN4A 2J41A 3NANA 4GT1A 2HDHA 1ZGBA 1RWOA 1N25A 2GZHA 4MIEA 1U8XX 1P1HA 4EB6B 4GVPA 5F52A 4E51A 2DHQA 2Z3VA 3CF0A 4BMXA 4BVBA 4EG4A 2JIPA 4D4GA 4HDSA 1ZH2A 4FGKA 5JU6A 4TMVA 3A4NA 4LV8B 4UBOA 1NTRA 2ZANA 2BHNA 4ABTA 2WAAA 2VHUA 1JMKC 2FYTA 2CXQA 3TPCA 1ID8A 2FW6A 4OQZA 1F0PA 2JFGA 1JEQB 3RM3A 1SKUA 1J70A 3AESA 5BOSB 1OFIA 5CAEB 3RUAA 5AXDA 2MSEB 4J90A 3DMRA 1KAOA 3G79A 1XXHE 2EYUA 1L5NA 2GAJA 1OH7A 2FE4A 3U3JA 3ZHZA 4IH1A 1JLSA 2JBAA 1ZGGA 2X14A 4UCQA 4ZEXA 2EFEB 2V7UA 1TD1A 2EGGA 3TGWA 1XPUA 3M6VA 1KJ9A 3HKDA 3NUGA 3PUZA 2E6KA 3TRJA 2XA2A 3P94A 3SFZA 2ZAIA 1J1ZA 3QHPA 1E2NA 2HO4A 1EWRA 3BOSA 4TRRA 2XT6A 4PAQA 4AO7A 4D44A 3TSCA 2CV1A 5HKAA 2W6ID 1AK2A 1O5IA 1KA9H 3RPEA 3THSA 5DM0A 3RVBA 2AHOA 4JQYA 4O2BB 1YAJA 4CETA 3GT3A 5JBNA 3DBVO 3OX4A 1DX6A 1LLDA 3UJ7A 2QTAA 1Z5VA 1BIFA 1NSYA 1NVDA 1ESNA 3E1GA 2JAUA 5B1YA 1CRLA 1G3IA 1YR9A 5CB4A 2E2WA 2IOQA 4H16A 1L5OA 4D4HA 1N2CA 2C8JA 1DXOA 2NUBA 3HEAA 5DGXA 5G4KB 4QXPA 3N8IA 5B2EA 3D0RA 3IT2A 1H4TA 4B76A 5FUQA 4CLOA 3I0NA 4GNRA 4DUYB 1IBKB 1ONNA 1E2DA 2QGFA 1RMTA 3EQZA 3AERA 4MV3A 2QSYA 1NUQA 1PL7A 1GNPA 4BV9A 3IRUA 2D4AA 3MT8A 3UV7A 2PMWB 1Y9JA 2OZLB 3HNOA 1ECBA 5FOVA 1DL5A 4DJ5X 1E2BA 1U0NA 1X7XB 1T5TA 4YDQA 1L4BA 4ZOLF 3CN7A 4LNAA 5EMKA 5EZ6B 3RSGA 1VGVA 2YHIA 4LKOA 1C3VA 4ZC8A 4DE5A 2BKAA 3SZRA 5AM1A 2QXYA 1R27A 6CHYA 3ZQJA 4QWMA 3SJBA 1HDRA 1T26A 1OT5A 2F1OA 4YPVA 2BFNA 2Q2QA 2FMXA 3H84A 3CEAA 5GJCA 4WFJA 4EMTA 4S12A 5JD4A 5I9NA 1KETA 3COJA 1Z36A 1O96B 1UT8A 5E4TA 5JNTA 3LPMA 1BVRA 2DFKB 4LJ5A 3SJ7A 1FDUA 1EWTA 1X9HA 4IGKA 1MN6A 2OOSA 4UPVA 3UICA 4L3VA 4DT1A 5JYCA 4UHBA 3E0QA 5BYBA 4X61A 1YR1A 2EG5A 3RASA 2UZAA 4MMZB 1Z0ZA 1ZJWA 1VMAA 1WABA 4NYIQ 5H02A 1ISPA 2OBFA 5CBPB 5TR9A 1NQXA 2C58A 2QTRA 3TNFA 3V7FA 2Y9MB 4AWBA 3UO8B 1LI5A 1XZJA 4NH4A 4AY2A 5AI9A 1HY3A 1Q0RA 1A82A 3ABSB 2IXTA 3HUUA 3VQTA 1NOKA 2XTMA 3NOOA 2VBCA 3I12A 4Y1GA 4BPRA 1OAKA 3CLRC 3DXXA 2IGBA 4PYJA 3IEIA 3PQ3A 3TTYA 3NV9A 1ZN8A 4OMUA 1Z6GA 3I6MA 4G37A 3T1VA 2OXTA 1PR4A 1ZESA 1WHSA 2ZSBA 3WJ2A 2A1TR 2IS1A 4KNYA 4LA4A 3DMFA 4CXMA 3BFVA 2Y0EA 1K7CA 2DVMA 1DIBA 4N3BA 4L5BA 3EXHA 1H05A 1RYEA 3GLFA 4BFLA 3K0FB 5CJ2A 2ZJOA 3RDPA 4EI7A 3WB1A 1GILA 2JGJA 2VCEA 2XDAA 1BXGB 1J0DA 3O3NB 3L41A 4OUDB 2YH2A 3V7UA 5BR8B 1XD9A 3FPKA 4C08A 1GL6A 1PWEA 2VVTA 1T43A 3EVDA 2I0FA 3NHMA 3VPDA 1ULHA 3QUCA 2Y1CA 2W58A 5BQOA 2B30A 2H4XA 1JLLA 2XYVA 5JDCA 3DZDA 3IAM6 5DSTA 1S6YA 3W3AH 2GPWA 4BMPB 1WVIA 2X2OA 1TTHA 1TKAA 5KCZA 3EZNA 2QMUA 1V5EA 2IE8A 4RCZA 5ERGB 3QFCA 8ADHA 2EZ4A 3MBOA 4YH1A 1FTGA 4ZCMA 1KKMA 3COYA 1JN0A 1HZJA 1O6BA 3MJFA 1YJCA 3W3ZB 1CUWA 3PFFA 4N1AA 1T6NA 2WUDA 1E0KA 5TMDA 4C7JA 1MABA 3ITKA 4NAUA 3D54D 3COVA 4R9SA 3SXUB 3H75A 3ZQ6A 2GEDA 3WWCA 4I81A 2C9MA 3P4UA 3V8QA 5ELMA 2AOWA 2VTVA 5JD3A 1W36C 2REQA 4LOIA 3CLTC 1GTSA 3WGQA 3M4YA 3B82A 1Q17A 1JPUA 4PWYA 1FX0B 1BDMA 2O1EA 4Y2UA 1G6KA 4MVJF 1GKYA 4JI6B 3OT1A 3UWPA 3LGSA 3NHKA 3NVMB 3PD1A 4L57A 4B6RA 1KZ1A 1XD8A 4IMPA 4EI9A 2MWMA 5ALDA 4QJ5A 1NN5A 3O8OA 1QTRA 3SWWA 4CDGA 3R5XA 4IRXA 4PZ0A 1BHSA 4X1YA 4E2XA 1F9EA 4C7KA 5JC8A 1AM4D 1VMEA 1FC0A 3TMKA 3ZLTA 2BRUA 3KZXA 4I4CA 2J3EA 3I72A 3PE4A 4RA6A 5TGZA 4EG1A 3L4BC 1DQNA 2X2FA 3U44A 3Q8XB 1WZEA 3DDNA 2QA5A 4JLAA 1N78A 3U39A 3II6X 3QITA 4PZYA 1H3EA 1NUSA 2YY6A 3DQQA 2LW7A 3ILVA 1VZ2A 1YVRA 4CLRB 4W6ZA 1C9DB 3UPTA 3DHWC 1H1DA 3BWMA 2A67A 5FIUA 2DWCA 1NR5A 4GP9A 4D9EA 2V4MA 4L9RA 4QU5A 3IUNA 4P38A 4X00A 1X8LA 1LLFA 2IYRA 2WSBA 2YTZA 5GOZA 5LD2C 5EHGA 1SHUX 3E2MA 2R1TB 2Y4NA 4MWEA 3L3BA 4IIEA 1VLMA 3GQBB 1H6AA 1XWWA 4RJ2A 1UAAA 1N2JA 3HK2A 3N2EA 1PW7A 5JJCA 1Y8RA 2IELA 2Q41A 2YCBA 2WUWE 3PC4A 3EZ9A 1SC4A 2ZAGA 3RAGA 1KR2A 2HY7A 4XJSA 2BTQB 3HS3A 3AX6A 3OETA 1L7RA 5DFAA 3R75A 4F3YA 3HJCA 3VSBA 5CFLA 1JDZA 4D5EA 2PSEA 4BFSA 2ZIXA 1RABA 4RXTA 4HUTA 2IITA 4BNKA 3OU7A 4GU5A 2ZREA 2A5JA 3LKZA 3MCAA 4KZPA 1N2EA 3RBAA 2IIQA 4E94A 3K5HA 4DLXA 1LLUA 3DYBA 1P3Y1 1BXRB 3B2EA 1S7GA 3NDJA 4UPDA 2GBGA 1I1NA 2EV9A 3J7AC 4JX8A 1RI3A 1JLRA 1K8QA 3EE6A 4R0VA 4TV8A 3RIEA 3DE3X 5LXTA 4OX9Y 1PQ4A 3T94A 4NCJA 1EIWA 1CJMA 1DBVO 3HKBA 4IJUA 1MVNA 3H9UA 4RNDB 1U4SA 2XX3A 1H2YA 1KVQA 2PH7A 2C61A 4EW2A 1KKUA 1C9MA 1BX1A 2B61A 4HVAA 4NKRA 1ZLYA 4EJ6A 1UMBA 3FMIA 2HO5A 3GDHA 1U2ZA 1JEDA 1K5GA 3LUAA 2WIAA 4P53A 1C0PA 2UZ1B 1N2SA 4KXNA 3ZV4A 5ENDA 8LDHA 1HYGA 1A71A 2R00A 4HNRA 2VQSA 1RQGA 1ZHHA 2XODA 3JZMA 2BBSA 3QKRA 1CQWA 3ORRA 4G26A 4OHPA 4N5NA 4QUBA 2EQAA 1U02A 3HR8A 3PGA1 4RHTA 5DWVA 4Z9FA 1N0IA 4UBKA 5T4EA 4TLBA 4P4UA 1DFIA 1DO2A 3M83A 3OX1A 1JWBB 2P3QA 4G8CA 4MCIA 4F96A 3A8TA 3BIFA 2ZJAA 5HX7A 1R2QA 1KEPA 3T4XA 4AUKA 1G7CA 3YASA 3BXXA 1R16A 1AC5A 3BHNA 2FF5A 3C74A 4NPCA 1S9DA 3G5UA 5DTMA 2PL5A 5HS6A 1KGSA 3R6TA 4Q7QA 5A03A 5AICA 5DGIA 3DP7A 1HNNA 3KQVA 3JSXA 3O95A 3OAAA 4RELA 2F6RA 5FO1A 3RK1A 4DPLA 5KNDH 2A9KA 4AKGA 2FPGB 1O5TA 4PZUA 2HT1A 3OIUA 4OEHA 3GFTA 1KQOA 3SLGA 1CY7A 1P45A 5KJ6A 3IBYA 2XWSA 3D81A 4FZVA 1G20A 3GJZA 1N92A 3IUJA 3Q6MA 4DCJA 3ABQB 5DTJA 5SICE 5EPOA 5LQRA 1FNNA 1G2QA 3I8SA 5F9HA 3U19A 1SVNA 1E3LA 2JJQA