1HY3A

Crystal structure of human estrogen sulfotransferase v269e mutant in the presence of paps
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
289
structure length
287
Chain Sequence
b'NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTROGEN SULFOTRANSFERASE
publication title Crystal structure of the human estrogen sulfotransferase-PAPS complex: evidence for catalytic role of Ser137 in the sulfuryl transfer reaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 287
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1hy3A00
1CRQA 3TBKA 3IEVA 2ZE7A 1YZGA 2YHSA 3AEZA 2JDID 4U02A 1OW3B 1U99A 3NWJA 3C4JA 4A92A 3PEWA 2ZYTX 4QBHA 4D2IA 4C0AC 1XDBA 5KTYA 4GRAA 1KYIA 4HAVA 1W47A 4KLNA 2V3CC 2O8DB 1VDZA 3GLFE 1M1YE 3BERA 2R6AA 1Q3HA 4F4CA 3AUXA 2ZRPA 3V4FA 4KFUA 2O0JA 4C0JA 2I4IA 4KVGA 2BBTA 1EWQA 1OV4A 4U5XA 3KQKA 4OQFA 5C1BA 2J45A 1F6BA 2ANBA 4DIEA 1RW4A 4AG6A 1SXJB 2E1RA 3C14C 4M22A 1AIPA 4HEJA 4O2RA 3V4RA 1GILA 3L0PA 3LVRE 2WICA 4IDNA 4Q4HA 4TQ9A 3PXGA 4GDFA 1SQ5A 2G3YA 4A0GA 3LWNA 5L3QB 4OK5A 2V6JA 2QMEA 4LCBA 4RKFA 1TU4A 1WMSA 2D7CA 2OFXA 3U7EB 1R4AA 3ZZ0A 5D3MA 5DGXA 4B34A 3FHTA 1ZIOA 1KI8A 3FMOB 4HDCA 3VQTA 3AVTA 4ASUA 1YJ5A 4A2QA 4XTRA 4PFSA 2JGNA 2W58A 4B3CA 4JLOA 2ZJ2A 1GOTA 1S2MA 1Z29A 4B76A 1ZUHA 2ZRJA 4Q7KA 4EPTA 5FBWB 5F9HA 2IS2A 4CT4B 4DKXA 2XSZA 4DSNA 5G3YA 4D0GA 4DCNA 2CLCX 2C9CA 1GKUB 3ND9A 1JI0A 5JRZA 4M9XA 3GLIB 2QQEA 4FXPA 3I73A 3T61A 1YVDA 3I3SR 4K46A 3GD7A 2D3WA 5CIQA 3AKYA 2EU8A 2X77A 1HE8B 3CRRA 4ARZA 1EFUA 5HE8A 3U4QB 4DJTA 5EUMA 1NG9A 2DWOA 1W2GA 2G1JA 1XU4A 1W0JD 1XCMA 2REBA 3U5ZB 1I2DA 4IDOA 4YMVA 4ASUD 5GJVC 2BM1A 5HKKA 3QENA 1P4SA 1BMFD 1KI7A 1G5TA 1XBTA 3BB1A 4FINA 1SHKA 2KI5A 4M53A 4X8HA 5FH9A 2DBYA 3T15A 4RFSB 3A1WA 4M0LA 3ZS8A 1MV5A 3ICQB 3MWLA 3B9QA 5CYPA 3HP1A 3THXA 3WBKA 2RH5A 2QZ4A 4C0BA 2NZJA 4BASA 1AGPA 1T3SA 1TQ2A 3DDCA 4LWZA 1T5LA 4NYMQ 3LXXA 3ZLJA 4LJAA 4PTLA 4O3MA 4EJSA 2ZU0C 4QHYA 2W2TA 2VIIA 3R8FA 1H8ED 1F3OA 1EX7A 2J0UA 2GXSA 1G64A 2BIFA 1S9DA 3QXHA 4C9BA 5HPYB 3GLGE 1WBBA 4O2LA 2NTYC 3Q8XB 3D8BA 2FN4A 1A1VA 4EPRA 1COWD 1PJRA 2V8OA 1P75A 5KU1A 1ZNZA 5FPKA 5FI0B 2A5FA 1E4VA 5EQTA 2YYZA 3AVXA 1AZTA 1HT2E 1QHIA 2UVQA 3CF0A 3EPJA 1CJUC 2NIPA 4CIDA 3G82C 3KJEA 3NEJA 2KBEA 1CLUA 2WWXA 4EJSC 4RD1A 3RRZA 3GFOA 3CWQA 1G3RA 2P5TB 3X2SA 1KTVA 4A2WA 2RB4A 1RFLA 4DZZA 3E5HA 3I62A 3EZ2A 3V00A 4JLNA 3QI2A 3LW7A 4Q4JB 1T3LA 1WE2A 2H18A 2GF0A 2QSZA 3SHFA 1KAOA 1ZJ6A 1GDDA 5BW8A 3MJHA 4JLAA 1N6NA 1U2RA 2ZS7A 3R9WA 1L2TA 1O87A 4TYPA 1F2UA 2ZR9A 3L82B 4EFNA 4LJ6A 1XEXA 1TEXA 1R10A 4KO8A 4DEYA 4NYMR 5JECA 4L9WA 4UXIA 2CCGA 4Z8YA 2H17A 2IF0A 1UKVY 1MR3F 2P3SA 3OEED 3WRYC 4B2PA 3U7GA 3KQLA 1LF5A 4HYYA 1K6MA 1RIFA 1RZ3A 1G7SA 1XTSA 3W6NA 4M1SA 2P6RA 2VF7A 1Z0AA 3LD9A 1FP7A 4NH0A 4CYMA 2AK2A 5IK2A 4A0HA 1E9EA 3LQRA 1E2HA 4YC7A 1UEIA 4IVRA 1HH4A 1E1QD 2H16A 2W0SA 5CDFA 2IS1A 2ZRFA 5DN6A 2KSQA 3ZVNA 1HV8A 1YQTA 1J7KA 5J5CA 3REFA 3K70B 1KI3A 2Q9CA 1I4LD 1ESNA 4YMWA 4TMZA 1SKYE 1E2PA 2OZEA 2ONKA 1MABA 2FDCA 5EZ5A 5FL7D 4IDPA 5BYJA 2V55B 2B21A 1Z5ZA 4A6XA 2XZOA 3T5GA 5JJIA 2ERXA 1ZM2A 4C30A 2BKUA 3HWSA 1R6BX 2O0KA 3DOFA 2QM8A 2C95A 2PMDA 3GJ8A 4R9UC 4BFVA 4I1OA 4CF7A 4L15A 1QHGA 1FTNA 5LBIA 2VTKA 2HLDD 4RJLA 1HTWA 4JLBA 3LRPA 4UXHA 3RRNA 1XZQA 1N2CE 2Z43A 2YJTD 4BLRA 4PC7A 3ADCA 3IBYA 1JQJC 1UKZA 1Q12A 1DG3A 3OFND 3TE6A 4G1UC 1CR2A 1EWRA 1OF1A 1AJEA 4KYUA 221PA 2R62A 4JVNA 4XWAA 5FOTA 2IYUA 1P72A 1IM2A 4B73A 2A5JA 3KL4A 3PEUA 2WWGA 3RS4A 3OE7D 2J3EA 3QBVA 1FP6A 4Z54A 1IXZA 2FMXA 2VH5R 4D0LB 3S1AB 1I4DD 2IBMA 4EFMA 1Z28A 4B33A 3FKSA 4HAZA 4UNRA 5KNCA 1B23P 1ZM7A 4GZLA 1T91A 1E0AA 2QL6A 4IRUB 1MRSA 2XZPA 2CL7X 4PC3A 2NO9A 2P0EA 1AKYA 5K8LA 2XXAA 3T1OA 3KQUA 1IOZA 3PUYA 4KFTA 1D5CA 3QY0A 2ZRNA 3TR5A 2FSFA 1ZD1A 4LK2A 1VHTA 2F1IA 4I1VA 2PX0A 4HB2A 2FSGA 4JJZA 1FUUA 4OHZA 3L8ZA 1Z6TA 1PUIA 3BD9A 4KAXA 5JJLA 4B47A 1GM5A 3GLHE 2FU5C 2W2XA 3B1VA 4YMTA 2GZHA 3TUIC 4B35A 4G5SA 3VU9B 2XTNA 2PL3A 2WHXA 3AP3A 2WMOB 2RGAA 3AVUA 3CF6R 4GL2A 4P4SB 1VG9B 5KYKA 1MKYA 5DIFA 2VP0A 3PQCA 1OYWA 2Q3HA 5B58C 2OCAA 2FV8A 2RGGA 3T06B 4KBGA 1U98A 3EW9A 3NIBA 5C2JB 1XMSA 3EZ6A 2EYQA 2LKCA 4J0QA 1NKSA 2HYIC 2RGEA 4JLJA 3A1UA 1RPZA 2Z83A 4GP6A 4DIDA 2XOKD 2JLXA 5IF9A 2JLWA 2G83A 2ORWA 3TJZA 1RRCA 4BWYA 1Q0UA 2OHFA 1E2GA 1KNQA 2PT7A 1PLKA 2QENA 2WBLC 1XTRA 2IWHA 1SVIA 3TIFA 4BLTA 3NC1C 1N0WA 2WAXA 3BXZA 2ZJ5A 4KSBA 4QJ4A 4A0RA 2JJ1D 1VTKA 1EFRD 3I61A 2PT5A 1OKKA 1Q1ZA 3CNLA 3QUSA 3GFPA 4R71A 4UJ5A 2ZI4A 3QXJA 1KO1A 2VEDA 3PG5A 4HDQB 2XZLA 3I32A 1AQUA 3QQ5A 4AWXA 2DB3A 3IQWA 2B7BA 4MUAA 4TYQA 2YOHA 2P6NA 1DG1G 2FPLA 2IYQA 2GESA 2HCJB 3EASA 2A5DA 6Q21A 4XWOA 2WKPA 1FZQA 1G291 3A37A 4TQAA 4JKIA 1XD9A 2ZS9A 5DSZA 3BB3A 4NTZA 1SXJE 2O0HA 2CHGA 4KXFB 1J99A 1J8YF 1UBCA 3LY5A 2AKAB 1KK0A 4BQSA 4DDVA 4BGDA 2A5GA 1I4TD 1Z07A 5BWMA 1Z6YA 1W49A 2ZYUX 2WJHA 5FBQB 2WJVA 5SZKB 2AD5A 4PO8A 3B2EA 1Z8FA 5TMPA 1WRBA 2REOA 3Q5EA 3EARA 4FCWA 2IF2A 521PA 1N6LA 2QRZA 2ZITA 4C2UA 4NCKA 1XMIA 3B85A 1K5DA 2CK3D 1AS3A 4IDHA 5CM8B 3RC8A 1GL6A 1R0XA 3U7HB 4WXPA 2H92A 3MWYW 3VX4A 2YVUA 1KOFA 5KSPA 3R9IA 2VHTA 2FGJA 2Y8EA 2V6IA 3UIEA 4B6EA 2OBNA 1QVRA 1OB5A 1Z06A 1IJEA 2ZRKA 2CJWA 1KY3A 1ZCAA 1ZMXA 4JSYA 3T35A 5KPDA 4TYWA 1OSNA 3RWMB 5JWOA 2JJ2A 2OAP1 1E9CA 1KZ7B 3MJRA 3WNBA 2PX3A 1U9IC 3NG1A 5DHFA 1A5TA 1E96A 3L8YA 4BFXA 2QE7D 3U7FB 3A8TA 4GZMA 5JMTA 1Q1BA 4LJ5A 3K0CA 3GLFA 4DBLC 2OCBA 4PO1A 4WZ6A 2IYVA 3TLXA 2Z5FA 1JXMA 3RVBA 4QJ5A 3PUXA 1VG0B 1KSFX 2I1VB 2D4HA 4CT5A 2ZRGA 5FTNA 2WWIA 1UADA 1N5KA 2QAGA 4FN5A 1VYUA 4U7DA 1J2JA 4ILEA 2C9OA 3WHKA 3LBHA 1R2QA 3E70C 2JJ2D 1MO3A 4D6PA 3LLMA 5L3VA 1XTJA 3QXCA 5C4MA 2FGKA 5FL3A 4Q9HA 2HUPA 1W36D 3K0CC 1MOZA 3LNCA 4EKDA 2JIZA 1G3QA 1C4OA 1E2DA 5EXTA 2B8WA 5CIWA 1R8QA 3IHWA 1K5GA 1EGAA 4TL8A 1OFIA 1PZNA 2QROA 4NMMA 5G3ZA 2YZ2A 1KO8A 3WXMA 4JKYA 1N6HA 2F6RA 4YXWA 3ETLA 3TQFA 4B48A 2ZSBA 4EPVA 2QRNA 2F43A 1BKDR 3BORA 3K0FA 4AYWA 2ECKA 3CWZA 3ZQ6A 4ACBA 1RE0A 1XTKA 5TB5A 1FX0A 1XEWX 4YMSA 1YZNA 1CS4C 5AUPB 1IHUA 3N5CA 3C5CA 5KNBA 2DR3A 2IT1A 4D82A 2WWYA 5JWHA 5DYGA 4M9QA 1UBEA 1SVMA 3UWOA 1HE1C 2FOLA 2WJYA 1OFHA 3CF2A 1AN0A 1WA5A 4C2TA 3QKUA 2CNWA 1TF5A 2GVDC 2VA8A 3KKOA 2I1QA 1OYYA 3SJBA 4XTCS 3TH5A 1WB9A 4R2HA 1JR3A 1H8HA 2G88A 3IBGA 3NBXX 4MRNA 4OBEA 1Q3TA 1W5TA 2E87A 2Z4SA 3AF3A 2IHYA 2BMEA 3FYHA 4JBXA 3V9PA 1W4RA 4IVPA 4YXWD 3ADDA 3PITA 4KCGA 4GOKA 4LBWA 3CRMA 1L7VC 5TXGA 1G16A 3GP8A 3UKDA 3GLGA 3MUFA 1YRAA 3SS8A 1DS6A 2VP2A 1SKYB 1Z22A 1KMHA 4EIWA 2ZI3A 4MYCA 3SBDA 4CEJB 1NJGA 1QHHA 4B6FA 1D2MA 2FEOA 3MRSA 5DE3A 3ZIAD 2ZRCA 1DEKA 2FSHA 5E95A 2P5SA 3H1TA 4WW0A 1IJFA 1DAFA 3O8RA 2NPFA 1TX4B 3W5IA 1XD8A 1X3SA 4Q21A 1JR3D 1H8HD 1FQKA 3OIVA 5KPJA 3ADBA 1R0ZA 1OXTA 2C04A 2Q9AA 4B71A 5FTLA 1XPOA 1QZXA 3C16C 2Z0MA 2J46A 4TL9A 3B78A 4LZZA 5DYIA 2YC2C 4V0NA 4QOSA 2CL6X 2YC4C 2ZE5A 3KQHA 5FPHA 3MG9A 4XOIA 1OPXA 5L3SB 1VCMA 1CJKC 2W2VA 3QNUA 2QPOA 2ORVA 3EZ9A 2B7CA 2FFBA 3QG1A 4GOXA 1OXUA 3TGPA 1ODFA 4I4LA 3SI7A 4XVUA 1AA9A 3T12A 3U44B 5HTKA 3H0KA 1L4UA 5HCIA 1X1RA 3CX6A 5HR5A 2VHQA 2YOGA 1YZTA 1FW6A 1XD2A 2B6HA 2FA9A 4M1MA 1H65A 5GADl 2ATXA 4EQ6A 4DUGA 3Q72A 2XTZA 1KI1A 2VP9A 1MO5A 2A7QA 4CEIB 1TQ4A 4HAWA 2YKGA 1A7JA 2HF9A 2HXYA 1E6CA 3HYRA 2HJGA 2WM9B 1S8FA 3CX7A 4FWIB 4A36A 4NCJA 4HI0E 1Q22A 2ZJ8A 3GLHB 4F4JA 4TT3D 1X8KA 4OQNA 3PUVA 4DHEA 2ZJBA 3CIOA 4OHWA 3SC3A 2ZUBA 3Q9LA 1JALA 5K8IA 3A1TA 1E79A 5EE3A 1IAQA 1TU3A 1VHLA 3IDQA 3U3RA 1HUQA 2EW1A 2GA8A 5KO2A 3R9XA 2NG1A 2AWNA 5LB4A 4DSOA 1Z63A 3DO6A 1RRGA 3FMPB 4QNMA 1YR9A 3BK7A 4NCNA 2FZ4A 1GSIA 2NO7A 4II7A 1ZD9A 1ZC3A 3AGQA 3QKSA 1E2FA 1XXHB 4DLTA 3MD0A 1W46A 1JECA 1U8ZA 3T34A 1G17A 3AF4A 3OIYA 1KAGA 1NN0A 5EJEA 3EIHA 1W7AA 3L43A 4DCVA 4QM7A 5F98A 3KFXA 1NN5A 2ZJYA 4Q1AA 2GBLC 3UATA 3H2YA 3CZQA 1G4AE 3KB2A 3WY9A 1CRPA 5JEEA 4G0NA 3Q85A 3EIQA 1E98A 4RFVA 3QKRA 4V03A 1BIFA 3Q5DA 3LBIA 3QJYA 4K81B 2J41A 4C0KA 4HB3A 1Q1QA 2VO1A 1JJVA 1NIJA 2NO0A 5HZKA 2VHJA 5G53C 4TZ0A 4ARZB 1KDPA 3T1QA 1E2NA 2OEPA 3U3JA 4JJKA 2HF8A 2KB0A 1UF9A 2RCNA 4Q1DA 1G8PA 1SZPA 1XJCA 3NBFA 3QF4B 5FOXA 2QGNA 1HY3A 1UBGA 1UPTA 5TDHA 3UWKA 2ATVA 4MKHA 3QXXA 4KVAA 5F2EA 4JVMA 2CCJA 2DFTA 4UNSA 1XPRA 1CXZA 4OHYA 2J7PD 3FGNA 1R0WA 4Z1MA 3LDAA 3BBPA 621PA 2JLRA 2ZJOA 4L8GA 3KTAA 4JMPA 3R7WB 2HYDA 2QG6A 1M7BA 3L0OA 1AGRA 2IC5A 2VP5A 1M34E 2FEMA 2G6BA 4RCZA 3WP1B 5J4VA 2RHDA 4OQLA 4OQMA 3RHFA 3AKDA 2J0VA 4ACAA 4GNKA 1DAGA 1E32A 3A4LA 1TNDA 4FMCB 4PPGA 4IFEA 4RCYA 4ZPXA 2FF7A 4YLGA 3EWAA 2NMVA 2QM7A 3UMSA 4DDTA 4DT1B 3TK1A 3MAAC 1CJVC 2GRJA 3QXSA 5LD2C 2QP4A 4M8NE 1HQCA 4BFYA 5FI1B 1ZD8A 3IIJA 1E0SA 2DHRA 1JJ7A 5AJZA 5AJWA 3SJCA 1KI6B 2GDJA 3QF7A 1X1SA 5FOSA 5UKDA 5CK4A 1OFUX 3FB4A 2CVFA 1E9SA 3KKMA 4WBSA 2A5YB 3NH6A 4TYNA 3OIWA 4PSKA 4C7OB 1F5NA 2RMKA 3QEOA 4IKEA 3RWOA 5JLJA 1KK3A 5AJXA 1VG1A 1EX6A 3OIUA 5L8VA 2QI9C 3KZ1E 4JL8A 3IIMA 4MGYR 4RKEA 4PZYA 4PHHA 4W5JA 1RRFA 3NXSA 3IEUA 3NTUA 1X6VA 3DEFA 4CGZA 2GJAA 4URYR 5CK5A 2WWFA 4RVCA 3P4XA 1RJ9B 4DCUA 4TLEA 5L3RA 1BO6A 1D2NA 1NVWQ 2XSZD 1NBME 1T4GA 4MRPA 4TWZA 4UXJA 1LS1A 2FX3A 4QHTA 1NNEA 2ZAMA 2WIAA 4BZPA 2IS6A 1VG8A 5FTJA 4IVQA 4IOKA 1VYVA 2UZIR 3RRYA 5JS7A 4ZKDA 4ZI2A 4TLCA 1MRNA 4TL7A 2EVWX 3MLEA 4HZIA 3FTQA 1SXJA 1NMYA 2QTFA 1E2EA 3LVQE 3QSYA 1X86B 1R0YA 1II0A 4G5OA 1VECA 4PPNA 4DSTA 5HKKD 3T1TA 1XB2A 2EFDB 1E94E 1G6OA 1P9WA 4W7SA 2WVJA 3HPRA 3SJZA 4MQBA 4HAYA 3F3YA 1LVGA 3P4YA 2NO6A 1UAAA 4OK3A 2OXCA 4QGFA 4TSFA 2A2ZA 5FOWA 1GL7A 3RS0A 2VL7A 2D74A 4LBZA 4HAUA 5SZJA 1UM8A 4LJ7A 3FPAA 2WTUA 2GZAA 3QE0A 4FMDF 1UEJA 1E1RA 4Q7JB 3BOSA 3GJ0A 1FMJA 2XNDA 1CJMA 2BCGY 1NL3A 1SXJC 2ZREA 2ZQ5A 3QKTA 3SYKA 4LI0A 1KIMA 3JZMA 3DHWC 4Q5IA 4F92B 5LPNA 1F48A 3GLIA 4H1UA 4WVFA 1I2MA 4X8OA 4LY6A 1N5JA 5J4HA 3RLFA 4CRWB 1EFHA 3TQCA 3EIEA 3LFUA 3BAFA 3THYB 1NVVR 2F9MA 2AFHE 2J0SA 5DI3A 3VKHA 1TL7C 2ZR7A 2R9VA 3K09A 2D62A 1B0UA 1NMZA 3CH4B 4Q18A 3D7MA 4X8LA 4D25A 4YDSA 5SZIA 2AWOA 3DM5A 4OQXA 2QSYA 4L4UA 2IUTA 4RFSA 1DOAA 1WP9A 4TMWA 4V0ME 3W5JA 3QPWA 3WP0A 2ZROA 1OHHA 2GXUA 1NN1A 1G5PA 2PLRA 4BPBA 3ZD6A 5FUXA 1OFTA 4ON9A 4RD4A 3KFVA 4MH0R 1XTIA 2CDNA 4DLSA 3B1ZA 3B1YA 2H8KA 5J4KA 1TMKA 4Q9IA 3A6PC 2QUZA 3ASYA 4V02A 1HT1E 2QMHA 4AC9A 5JRJA 3MGCA 4HLCA 5BXQC 4DXAA 3QIAA 2GHIA 3WYFA 4MGZR 3O8BA 4LHYA 1JXOA 5AJVB 1BYIA 4BFSA 1XRJA 4IEEA 3PFIA 4MRRA 2OILA 4RD2A 1VYTA 1QHNA 4PO9A 4LBYA 2DFNA 5DH9A 2OUKA 1S9HA 2GJKA 3K09C 1S1MA 4F7WA 1W4BA 1N25A 5GJBA 3I5YA 3C15C 3SZRA 3W6PA 1T6NA 3THWA 4AI6A 3PEVA 4BE7B 2ZUCA 4HB4A 3AF2A 1KKMA 3HU1A 3RSOA 3UG6A 2W6IA 2O8BA 1P9RA 2EFCB 2ONJA 3ZJYA 5KUTA 3AQ4A 3VR2A 5C4GB 1U90A 5JCZA 3AP1A 2BMFA 4KBFA 1M7HA 4OJKA 4Z8XA 1KI9A 2KWIA 4OHXA 2ZSEA 2YWGA 2QN6A 3FMIA 3TUZC 3OEHA 4HATA 4BFWA 1G1MA 4URUR 2RGDA 1Q44A 1GIAA 5CM9C 3WBJA 1CR0A 4Q1FA 4TMVA 4MKIA 3B82A 5IK2D 1LNZA 1N6KA 3SFZA 2JA1A 4RSGA 1ZVQA 1R5BA 5DN6D 1S3SA 4MDEA 4US2R 1UDXA 1II9A 2VPPA 1DAIA 1YRBA 3EA0A 1JNYA 1GUAA 2OM2A 2ZI9A 3H86A 4P32A 2ZVPX 1W4AA 5C18A 4LOAA 4PAMA 3VNUA 1G19A 2CLDX 2ZRMA 1WCV1 2JASA 4ZO4A 3CH5A 1WBDA 4RZXA 1JAHA 4B44A 4KFSA 3I72A 4DLZA 1NVUQ 1UKEA 2WKRA 1S4QA 4PC1A 2F55A 4Q02A 1OIVA 5DI9A 2QNRA 1Q21A 3QVVA 4NZYA 4TTRA 5FPSA 2ZM5A 1OE0A 1F2TB 2UZ3A 2NPIA 3QG5A 4IOMA 1XWIA 1IN4A 4WIAA 1TAGA 4DRZA 4Q48A 2P6UA 3IKJA 3OHMA 4D26A 1HQYE 4KJZA 3NH9A 2JJ8A 3IUYA 3ZVRA 2YNMA 3A36A 1IXSB 2PZGA 2RGBA 5AK0A 2ODWA 4Q01A 4TZ6A 2OG2A 4QKQA 2Q21A 5ELXA 1XJQA 3VTKA 5CYOA 3HU3A 4BFZA 3CNNA 1GITA 3CM0A 5AWFC 3VHXA 1FQJA 2FPMA 1JQLB 1IONA 1T0HB 3FKSD 3LX8A 2JLZA 1P9NA 1P2VA 4AY2A 4MGIR 1XXHE 2NOAA 4CDGA 1KY2A 4MITA 1YE8A 2A30A 4JLVA 4N3NA 4V0LA 3RRMA 3SDZA 1N0UA 5EP4A 3REGA 1LS6A 1NJFA 1HYQA 4F91B 1AZSC 2J7KA 2OO7A 2GZDA 1CF4A 1W2HA 3IO3A 2IUUA 4PQYA 5GJWC 1VCIA 1QBKC 4TYYA 1DVRA 3NBYC 1Z0FA 3K70C 4QG7A 5EP3A 1X8LA 1IY1A 1N6OA 2C78A 1R5OA 4JBWA 1K8RA 2PLFA 3QPVA 1EESA 3FFBA 3A4NA 3B5JA 3RS7A 5EE0A 3B13B 4O0MA 5JHHB 3SBEA 1GWNA 1GKYA 2IHBA 5BQ5A 4JZKA 1U0JA 3TSOA 1JPNA 4JT4A 4ZDWA 4JL6A 3PUZA 2F1HA 3S1AA 4ZCMA 2QP3A 4OI2A 4YMUA 2JLQA 1FNMA 2W83A 1W36B 2PMKA 3KUCA 1W5SA 2HEIA 5JI2E 2W6JA 3VR1A 5E4FA 4DLYA 2NGRA 4AKEA 4NDZA 1G3IA 4E03A 3IHLA 2ERYA 3DM9B 4P3YA 3VR4A 5CB8A 1CJTC 2BCJQ 1ZU5A 2F9LA 4RD6A 3VMFA 1ELOA 2IK8A 3ZGXA 2F1JA 5K8TA 3WRXC 2W00A 3TAHA 1G9XA 4R2IA 2OSBA 3NHAA 2O8FB 2EWWA 1GTVA 2QAGB 1CIPA 1U9IA 2ZTSA 3FWYA 4PR0A 3RSLA 3SE0A 3WNDA 1DBSA 3UMRA 2WSSA 2R2AA 1OKKD 4M1KA 3TRFA 2BEJA 4S2EA 4BLOA 3VU9A 1IN6A 2XITA 2ZSDA 2A3RA 1G6HA 4WXRA 4NKRA 2LCFA 1E2KA 2WJGA 4M4SA 4PXAA 1DAKA 3CRW1 3EAQA 4A0FA 1ZM9A 1YR8A 4MRVA 4URVR 2OT3B 3HYTA 2N42A 1OH6A 2BKEA 4BFUA 2QBYA 2ZRDA 3NHBA 1RC8A 5HE9A 2ZU6A 1CR1A 3BFXA 3DPUA 4HUQB 4QGHA 1Z0KA 3LBNA 1X8JA 4HDOB 1J8MF 4JL5A 4CEHB 1VCOA 4Q4AB 3EZFA 2X2EA 4LC0A 4P33A 1Z2AA 1NI3A 3KQNA 2C8VA 2DPXA 2ZR0A 3N2IA 4C0LA 2WJJA 3WMGA 2WSMA 2VLIA 2Z4RA 4NYIR 1XF9A 2C96A 1XMJA 1HA3A 3AVYA 1FNNA 3E1SA 3I1FA 2WV9A 1HURA 1W44A 2GVZC 2QTHA 1US8B 5E7IA 1A4RA 3KXKA 2GJSA 1P61B 2BJWA 4NP6A 4W5WA 1XCGB 2Q3FA 2OCPA 3KUDA 3K0AB 3IQXA 2GXAA 4URZR 3B1XA 2ZVQX 2BBOA 3NC0C 4LDJA 2HT1A 3ICEA 3OF5A 3K9GA 1ZW6A 5TVKA 3B8HA 2VYFA 2GCOB 3ZH9B 1Z6AA 4G5GA 1E2IA 5FPYA 3OAAA 1G21E 5GJCA 2ODNA 2ZAOA 3I8SA 5A0FA 4DLRA 5FBVB 1N6IA 4AYXA 3TSWA 1KHTA 3C8UA 3VR6A 1YZLA 4EPWA 1YZUA 4B32A 1Z0IA 4BZXA 2N46A 4PQFA 2O52A 5CB6A 4F93B 5CITA 4LHWA 1AQYA 5E7JA 2GK7A 3A1SA 1QHHB 2LWIA 3D31A 4US1R 4A8JB 4W9MC 5J47A 2IYRA 2OBMA 3RS5A 2Q9BA 2BMJA 4FD2A 1G41A 2BC9A 4FW9A 5BN3A 2F1RA 4Q7LA 2J0QA 2XTMA 4GMDA 2GILA 3NKVA 5DNYB 4IDQA 3AGPA 3LX5A 3I5XA 3UK6A 2EWVA 2RAPA 4E07A 2BWJA 1IY0A 1LB1B 1M7GA 4AYTA 4LYFA 4MKGA 2IS4A 2RGXA 1P73A 2JIZD 1YHNA 4JLMA 3LA6A 1JPJA 2QT1A 4DDUA 1DTSA 3BH0A 5J40A 1PLLA 3K9HA 1XJ0A 5CLLA 4A2PA 4C0SA 4OJQA 1DAMA 1NBMA 1Z47A 2PJZA 3LXRA 4I1SA 4B3FX 2ZIAA 4CZ2A 3K8YA 1JR6A 1GRQA 1SULA 3GJ3A 5BYKA 4L5BA 2QPAA 4DEXA 2X1VA 3SN6A 1MH1A 2QQ0A 1A82A 3AM1A 2WPDA 1EFCA 1WDTA 2AD1A 2IW3A 4JVLA 4LC1A 4B3DA 4O25A 5M04A 2IEZA 4B3XA 4FMBB 1GNQA 4A82A 3CRVA 1YR6A 5H1YA 4UKDA 1JB1A 3L0SA 4XH9B 2I3BA 1SVLA 3DKPA 5EUQB 3GJXC 4P4UA 2CNWD 4GPTA 3PVSA 4Q47A 3DOEA 4QFMA 3EC1A 2L0XA 5CJPA 5KDOA 4DVGA 4OI4A 1TUIA 4ZCIA 5KHOC 3TW4A 4Q03A 4F38A 4JVSB 2D7DA 1S0UA 1P5ZB 2QP9X 1CP2A 2C98A 4TMTA 3FDIA 3CPJB 1QHYA 5JJKA 2C9YA 4LJ8A 4HZUB 4XD7A 3IILA 4H9GA 2QTVB 1Z6GA 2FSIA 4IJMA 4PPFA 1FMLA 2MSDB 2G9NA 3B1WA 2IYZA 5J4LA 1E4YA 421PA 4LRWA 3ZZTA 3ND8A 1WQ1R 1W0KA 1QRAA 4UJ3A 2O8CB 2GJ9A 5G40A 4ZIRB 5EE1A 3Q3JB 4XSHA 2VP4A 4TLDA 1ZNYA 2R8RA 2YWHA 4BLSA 4EUNA 5JSZB 1NKTA 4KFRA 2PEZA 4Y0AA 4Q19A 4DDWA 3TR0A 2R44A 2B8TA 1VIYA 5A5GA 1Y63A 3TNFA 1M8PA 3M1IA 1QG4A 1E9BA 4N0EA 1DAHA 1AK2A 5H70A 1II8A 5D3QA 1KSGA 2WMNB 2ODEA 4E09A 1IY2A 5IT5A 4ERNA 2WWWA 3E2IA 5B30A 3FOZA 5HZHA 4PPQA 2OE2A 3RS2A 4A8JC 4ZDJA 1G3UA 2HCBA 721PA 1DPFA 5E7MA 5FUWA 5B57C 3WYGA 4D4JA 3CPEA 2GBLA 3EPHA 3W8NA 3ASZA 4NYJR 1R7RA 4QHSA 2O8EA 1DE0A 3ZYCA 4D4KA 3CO5A 2ZUDA 2LKDA 3N2EA 4L16A 3U3OA 3SQWA 3K0SA 1JAIA 1W1WA 4TLAA 3IIKA 2BV3A 2CE2X 4CEJA 2WKQA 4C4PA 3DZ8A 3FHOA 5IRCD 2OXRA 4XJXA 2REXB 3U61B 3VAAA 4Q4HB 2FE4A 3DMNA 2CXXA 1Q20A 2FH5B 1NVXQ 3W9YA 4RY2A 3BH6A 4DUGD 5B64A 3F8TA 4OKSA 1RYFA 4M21A 2G77B 2PH1A 3DMDA 5D3MB 4ZCLA 4MA4A 2RKOA 4QBFA 2MSCB 4PZLA 1ZINA 4BECA 2JDIA 2EFEB 4S35A 1LW7A 4AK9A 4HB0A 2PJRA 5C46F 1ZUIA 4E22A 4A15A 2VSXA 3C41J 3J81k 4AD8A 1RRPA 1E79D 3AP2A 3EG5A 2VHUA 5L3SA 1O3YA 4ZDIA 4NU0A 3MWJA 4A9AA 3M6AA 2JLUA 5AUOB 1T8TA 5FUYA 1GVNB 2GEVA 3DVLA 2GNOA 1P7CA 2OBLA 3BJIC 1XNJA 2JLVA 2ZRLA 2AXPA 1OXVA 3CR8A 2IXFA 2PEYA 4XIGS 2FFAA 3BWDD 2YWFA 1W48A 3GMTA 2ZI7A 4CEIA 2DFKB 4UQOA 3THXB 2FZLA 1BOFA 4HUTA 1L4YA 1ETUA 1KJYA 2GTPA 2VHCA 4PZZA 5IHPA 1DADA 3GLHA 4QC2A 2AKYA 4D4LA 2R6CA 4PAQA 1XFAA 4OK6A 4W5HA 4EJSB 2CHQA 1TADA 5J4YA 3ZZUA 4C3ZA 3KXIA 3X1ZA 2EYUA 3UANA 2WOJA 5ANRB 2OLKA 5FR1A 2J0UB 2FPKA 3W8RA 4DLXA 2JAQA 1RKBA 3B9PA 3B7GA 1J70A 2IA5A 2AX4A 1NP6A 3KJHA 1XXHA 2QA5A 4PAOA 2XAUA 3KX2A 2XJ4A 1ESMA 2KBFA 4B3BA 3EPLA 2OLJA 1ANKA 4JIMA 4FCTA 2F3TA 5EZ6B 2QORA 4GFDA 3SHWA 3KKPA 2ZXUA 1OXXK 1JEDA 1W0JA 4QXAA 3GJ7A 4XVRA 3NVAA 5G41A 5JHGB 1P2SA 1WXQA 4Z1MD 3GPLA 3L0IB 1BMFA 2C2HA 4FIDA 1IN8A 2H1LA 5KSOA 1KDTA 4JBYA 5KDLA 2HDNB 3WMFA 3DL0A 3CBQA 2IXGA 2R65A 4N1AA 4P4TA 3LH5A 4QBIA 3ZVMA 3CX8A 4AURA 4MUBA 1XZPA 2PZEA 3QVUA 1UDWA 4G3XA 5B2ZA 2ZE6A 4WAUA 1ZM3A 1Z6XA 1M6NA 3AB3A 4G01B 1CULC 5JWRA 1VPLA 2CHVA 3NDPA 3TUJC 1DARA 4WOPA 4I1UA 4PQRA 2G0TA 8OHMA 121PA 3BB4A 4OYHA 1NVVQ 4IHQA 1H8EA 4EPXA 2Q3MA 1AKEA 1IXRC 1LY1A 1RVDA 1CTQA 2GKSA 2XB4A 3DKVA 2O8DA 1IQPA 1F2UB 5TV2A 3QOFA 1TF7A 5DI3B 3QF4A 1XEXB 4AIIA 1S3GA 4CW7A 2FJUA 1COWA 1NG1A 4MGKR 5P21A 1E0JA 2OCYC 2OAQ1 2YINC 4K8OA 4BEJA 1FPMA 1NN3A 3WHLA 3AVWA 3VNVA 4AKIA 4LYHA 2CE7A 1Q1EA 4OI0A 3F5FA 1P60A 4CVNA 3X1YA 4E5UA 4TN1A 3W34A 1NLZA 1NSTA 4EPYA 5DHAA 4DLVA 5EXXA 3HR8A 1JR3E 2WIBA 3BFKA 5EE9A 3R7WA 4ZKEA 4D4MA 3EXAA 1NMXA 4XVQA 2ZEJA 5L3QA 1G5RA 3PCRB 4M1OA 2JCSA 1UFQA 4V0KA 2BOVA 5A4JA 3VFDA 1LFDB 1KGDA 2ZRAA 2V7QA 5FOUA 1SKQA 1PLJA 3PUWA 1U8AA 1LTQA 3GJ4A 4YDHB 1KJZA 2AFIE 2AL7A 4DT1A 2R6DA 3THWB 1MABB 5BN4A 2O8BB 2JLYA 1G7TA 2GEUA 4UNNA 3TSZA 1OH7A 2SHKA 1NF3A 2QMUA 1SXJD 3BC1A 1G18A 1SGWA 4KITB 1KI6A 3O47A 3IPXA 3GQBA 2BHRA 2C03A 2PZFA 1NRJB 3B60A 4MDFA 3U60B 2V1UA 3SR0A 4C0HA 1LV7A 3KXLA 3U4QA 2V54A 3OEEA 2N1BA 4C7OA 3R8CA 2V1XA 3LO5A 1YZKA 4LJ9A 1GNPA 4LBVA 5EP2A 3RDPA 3U3MA 3CONA 1G4UR 3EX7C 2V7QD 2ZE8A 3BIFA 4TSFD 3LW8A 3AVVA 2AK3A 4DSUA 1KNXA 1GNRA 4IW3B 2ZYWX 2AXNA 1E1QA 1V5WA 1E1RD 1WF3A 1RJ9A 1R5NA 5SZHB 4C0QC 3EA5A 2GAAA 2XNDD 1CU1A 2IYXA 4LJYA 4LV5B 4KSCA 3P1JA 1UBFA 3TW8B 5KSYA 3HR7A 3TMKA 1RYHA 1AM4D 4BRWA 5FTMA 1KDOA 4B43A 2QMOA 2VBCA 5JFGA 1OB2A 5FL7A 4LV8B 2GCPA 4QGAA 1PUJA 3OZXA 2IYWA 3UMFA 4GOJA 3BFVA 3GJ6A 2J5XA 2XXAB 4HAXA 1U81A 2FNAA 2G1KA 4IOJA 2R6FA 2GEDA 2IYLD 4IEIA 1G8YA 1GKIA 1ZAKA 4LPSA 3AVPA 2XX3A 5FBLB 3X1DA 3TKLA 1GAJA 2HLDA 4KI0A 1Z83A 2C99A 1KO4A 2D06A 1OHHD 3DZDA 4Z51A 3MCAA 3BGWA 2A78A 3FHCB 3I4LA 3H4MA 4PANA 4M1YA 3SOPA 1V43A 3C5HA 3OFNA 1E9AA 4HLUA 2TMKA 1KSHA 3WMEA 1Q57A 3HPQA 4XSGA 4AKGA 2WWHA 2FG5A 3VKWA 2OESA 5FUVA 4ITRC 4EAQA 3OE7A 4QM6A 1M2OB 3A4MA 3PJRA 2QEQA 3CR7A 2WJIA 5LB2A 4Q4JA 3PENA 4EDHA 1U0HC 3O8CA 5IDVA 4MYTA 5BN5A 1SVKA 2P2LA 3FVQA 1P2TA 2NZ8A 3A58B 4MYUA 4D0NA 2BBSA 3CKLA 2W6ID 3Q7QA 5EXSA 4DC9A 4Q9JA 5AR1A 4ESHA 3THYA 4Q66C 5KOYA 1HEIA 3WNCA 1KKLA 3NEYA 4G5QA 4Q1CA 1ZBDA 2D2EA 4JLKA 4HLUC 3OEHD 1M74A 3AF0A 4GBMA 1ZUNB 3ZQJA 4BEBA 1LF0A 3BS4A 2ZI6A 4DCTA 4KODA 5JBQA 1EFTA 3CNOA 5FBRB 1D9ZA 1OH5A 2WOOA 4RD3A 2AHOA 4FWTA 1IBRA 2QAJA 2GWHA 4HLDA 3FKQA 4TQUS 4A4DA 4KU4A 2DY1A 2DCUA 1VIAA 2PBRA 4P31A 1D2EA 2UKDA 2CMKA 4A6PA 3AKEA 4LSGA 2NO1A 2CLSA 4BLPA 3SNHA 4ZI3A 3ECCA 1FFHA 4M1WA 4TTQA 2XOKA 1VMAA 2FWRA 1G8FA 3THOA 4NHOA 1FOEB 1ZP6A 2IYYA 2ZSAA 4URWR 1XPUA 4B75A 1QHXA 3CUEF 2GJ8A 2C5LA 5AJYA 1E9DA 1KK1A 1MO6A 2Q0HA 3AV0B 4HLQB 2JJ1A 5AUQA 3MMPA 3NBZC 1EFRA 3GEHA 3LV8A 4V0OA 3GFTA 1QG2A 4BRUA 1TQ6A 1KZGB 1C1YA 3FE2A 3H84A 1Z0DA 2BM0A 2IWRA 1D8TA 5KSZA 1GRNA 4H1VA 2X8AA 4KV9A 1ZYUA 3D6TB 2DFLA 4RZ2A 3K70D 2QBYB 2CJWB 1E2MA 4M9SA 1YZQA 1OLOA 1D6JA 2ZRBA 3EC2A 4JYBA 4KLZA 4UNQA 5AUNB 1N5LA 3ADKA 1NLYA 3W3ZB 4DB4A 3RAPR 3WYAA 1ZNWA 4NYIQ 5FOVA 4LX0A 1ZRHA 4LYAA 3UG7A 2RHMA 3QBTA 1TPZA 4XWKA 2Q6TA 3GLFB 2MSEB 4DB2A 4R98A 4US0R 4ZV4A 2RGCA 3MFYA 2MMCA 3ZS9A 1F2TA 3HU2A 1TF2A 3TVTA 4EFLA 1TUEA 2ZRIA 4TLBA 2VRWA 4G5RA 1G8GA 1GFIA 3B6EA 1SVSA 1XEWY 2CK3A 2F3RA 4Y0VA 3KB1A 4JYCA 3AVOA 3PR1A 2ZRHA 1BS1A 1FTSA 3RC3A 1KK2A 3KJIA 2EFGA 2JLSA 1PV4A 1R8SA 4F4IA 3VHLB 3AVQA 1IN5A 2B92A 3EZ7A 2XJ9A 4P4SA 1DO2A 1Y3AA 4HSEA 4AG5A 1OJLA 4JS0A 2W6JD 5JCPA 2QU8A 2G0NA 4P0TA 3CB4A 1G8HA 2ODBA 4TMKA 5F3WB 4PX9A 2QE7A 1NSFA 2J1LA 1NY5A 1YU9A 3U2QA 5KDDA 1ZU4A 1P3JA 2BDTA 3P32A 5DO9A 3O8DA 1AS0A 1E9RA 1GZSA 2ANCA 2F43B 3K0FB 2R6GA 2WSSD 1Z08A 4ABYA 4I99A 3RYTC 1KSJA 4FMDB 5FTKA 1FX0B 1DO0A 2QPTA 4Q4LA 2CBZA 3SQXA 4WA7A 2F7SA 1SHZA 1OIXA 4NPHA 4JLDA 1P6XA 1S96A 1QVAA 4LHVA 2VP6A 2GAOA 4MYHA 2OFOA 4NBSA 5DISB 3UXMA 4BZQA 3GLIE 1E2JA 3K53A 1UKYA 2A9KA 3RABA 3P20A 4LUCA 4ESVA 4POAA 1YR7A 3GCGA 1VCNA 2EQBA 5HCNA 4OHVA 3ZD7A 1ZC4A 4BUJA 3KKNA 1XX6A 4MKFA 1E0KA 4Q7MB 2XGJA 3R20A 1UJ2A 2HV8A 1QHSA 2YOFA 1E2LA 1GG2A 4DLUA 4M1TA 3IO5A 3N70A 3G5UA 2J9RA 1VKJA 5TARA 3X1XA 1FUKA 1N6RA 3IPYA 4RD0A 3NDBB 1IN7A 2VSOA 2GF9A 3KJGA 5FFMA 5K8UA 3M4YA 3FMFA 3C7KA 4FMCF 4LHXA 3GLGB 5CJ2A 3BH7A 1KO7A 2O8FA 1OIWA 5DLQC 5H8WA 1QF9A 1KMHB 5FPTA 1ZCBA 1XMVA 4GP7A 4PC2A 3AH8A 3SJAA 2OFWA 5CLQA 4TMXA 2BEKA 2BJVA 2QGZA 4QL3A 1DAEA 3CW2A 5EP1A 3T5DA 3X1WA 1W36C 4Q1EA 2X2FA 3AKCA 5CDFE 2Z6VA 1JBKA 4NONA 3BRWD 2ZJZA 4DWJA 1CBUA 4Q00A 1BH2A 2FFQA 2ZS8A 3GEEA 2H7VA 4FCVA 5EXPA 3SEAA 2DYKA 2W0MA 2ZI5A 3SYLA 1D9XA 3EWSA 2MMGA 1T9HA 2GETA 4GT1A 1EG7A 4HUQA 4JLPA 1FL9A 3OAAD 2IYSA 4Q4AA 4B2IA 4CEHA 1EK0A 1ONBA 2V9PA 5JEDA 2BBWA 4R7ZA 4ZDKA 5LDDC 2QAGC 2QY9A 1E3MA 2PCJA 1OXSC 2H5EA 1F60A 2P67A 4FI3C 1YKSA 4GSYA 1N0VC 4X8MA 3RANA 3SYNA 1GL9B 1JEEA 3TVDA 4DCSA 5KNDA 2ZETA 3PIRA 5TY0A 4LJ4A 2CEAA 2BVNA 3HDTA 2VF8A 1U0LA 1E2QA 1E99A 1MT0A 3MSXA 3IGFA 4WZAE 1KI4A 2RGNA 4TL6A 4NE2A 2CL0X 2ZSFA 4WZBE 2IEYA 3JZAA 2H57A 2ZANA 2HJVA 1KDRA 1TTTA 2HXSA 1US8A 1KO5A 3MWKA 3VX3A 3ZIAA 3QPUA 3KKQA 4B2LA 3K0AA 4B3GA 1XD2B 4GMXA 4LYJA 4BLQA 1CKEA 1KI2A 3LAWA 4LGMA 3M0EA 1II8B 4EQ6B 4RZUA 3T1VA 3AF1A 3P26A 4D80A 3K0EA 2GCOA 3CZPA 2J59A 1NIPA 1N6PA 3K1JA 1N3BA 3F0TA 5GVSA 1XTQA 1GP2A 1N5IA 3KDSE 4OI1A 3U6BA 4NYJQ 4M9ZA 2CCKA 3I92A 3W6OA 1CEEA 4D81A 2WZQA 2HT6A 2RGNC 4QRHA 1NBMD 1P2UA 1DELA 1L8QA 1T5IA 1KJWA 2O8EB 3GEIA 3ZDQA 3D3QA 3FFAA 1U8YA 4IFBA 4Q1BA 2X19A 1G7CA 2ORIA 5E3HA 3QKSB 2WPDD 4A8JA 3K9LA 3SU8A 4JT2A 1GRRA 2IL1A 1A2BA 4PSAA 3CLVA 2XEXA 4PHTA 4PHGA 3PEYA 2XNSA 3BE4A 1OH8A 2ASEA 4Q9KA 1J90A 2KJQA 3A1VA 1XP8A 2GCNA 5JZVA 2PCLA 1SVOA 4QGGA 1SVWA 5EE5B 4BFTA 1TEVA 3GJ5A 3ONWA 4IXMA 5GVRA 3ZVLA 3UPUA 1EXMA 4V0MA 3SFVA 2O5VA 3W3AA 3QEJA 3U6KA 2KE5A 1XEFA 2AN9A 3HJNA 4YQFA 2J87A 3QKRB 4L9SA 4PHFA 4TT3A 3CRQA 3VR5A 2ZPTX 1ZIPA 1MO4A 4RZ3A 2OV2A 4XD7D 1U94A 1T3HA 2YWEA 1P62B 2FFHA 5JI3E 3G0HA 1C9KA 2GXQA 2K5UA 3Q7PA 4N0DA 1W0KD 3TAUA 1XCPA 1NY6A 3LQQA 2EFHB 2V4ZA 1T0JB 2AR7A 5H68A 1W4CA 3VKGA 4PSVA 2WAYA 5LD2B 1BYUA 2DWQA 4LPKA 4M2LA 2QT0A 4IXNA 2XB2A 3I8XA 4PC6A 3RNLA 4Q9LA 4QBGB 4NCIA 2D2FA 1A2KC 2IXEA 4TTPA 1G7RA 3P27A 1E9FA 1Z3IX 4NCHA 3AUYA 3U3KA 3KTAB 2GK6A 1TQDA 4YONB 2ZJAA 2YV5A 4OL0A 4KHZA 1G20E 2JEOA 1NLFA 2C77A 4A1FA 1QDEA 3JVVA 3OESA 3K9NA 1ZM4A 4B74A 4IOLA 4DLWA 4KYIB 1ZNXA 4LHZA 2ZYVX 2IX3A 4MRSA 2IUSA 1OT3A 3RS3A 2P65A 1KMQA 2E9SA 2CVHA 4HZUA 5JS8A 1PVOA 4QNRA 2IYTA 1E69A 4NL4H 3VR3A 1S1CA 4U00A 4JSTA 3LLUA 4QJ3A 1Z0JA 5F9FA 1AS2A 821PA 2O8CA 1CR4A 4UNPA 4ZIRA 3PV0A 3CPHA 4LV6A 4URXR 4GI7A 5JSZA 3U44A 2VSFA 1T8UA 3EPKA 2VQSA 3W90A 1Z2CA 3L2OB 3JVUA 1G3MA 2BMDA 2J7PA 2NQ2C 4AKHA 4I81A 2DWPA 2JATA 5FR2A
chains in the Genus database with same CATH superfamily
2NVBA 3WKCA 1H2FA 1CRQA 2Q29A 5DXFA 3MGBA 2EDAA 2ZE7A 4B80A 2BYTA 2YHSA 3AEZA 4JP3A 3EEBA 3JQRA 5LU8A 1BDMA 1UBOS 1OW3B 3NWJA 1C1XA 4A92A 3J80A 4C0AC 3H9BA 2C42A 4X45A 4GRAA 1CSEE 3VH4A 5ICGA 2V3CC 3ZH2A 3CEJA 2O8DB 2ZIFA 1X7YA 4CTNA 1T0IA 2QVZX 3FOCA 1T4DA 1JX6A 5HRUA 1V2HE 3RYIA 4CR8A 3T3IA 4KQFA 1JQ5A 4QBKA 4C0JA 5C5DA 1EWQA 1ZD3A 3IR5A 5JY6A 3KQKA 1CDZA 5IUKC 2ODAA 4DIEA 1RW4A 4P9NA 1A69A 4EAAA 1IB0A 2E1RA 4NF2A 3PEFA 4HEJA 1XTBA 1L5VA 1GILA 2A1UB 4M88A 3L0PA 3JZIA 3DJYA 3LUBA 3P0JA 4TV8A 4IDNA 5IUNC 4C05A 1S2GA 2G3YA 3T3OA 1RI3A 3K3PA 5EIAA 1OOEA 2V6JA 2QMEA 3PC2A 4BO4A 1XYYA 2HEGA 1W94A 3A10A 4RGYA 4B34A 2VRCD 5P8WA 1YFLA 4MJLA 4KPUA 1DLJA 3RUFA 4X1YA 4XTRA 4ZAWA 4E30A 4EB3A 3NQ41 2JGNA 1R00A 4HC4A 4UAJA 4JI7B 1GOTA 3IHTA 2ECFA 4IYRA 3RTGA 1HI9A 1T2VA 4FR2A 5BV7A 5F9HA 2FAXA 4F5YA 2C57A 2HV9A 3MTIA 4PLWA 2M9MA 4DSNA 4CMIB 4DCNA 3KRTA 2CLCX 3ND9A 3NTOA 5JQWA 4KXMA 1UOPA 3OKFA 2QQEA 1VL2A 2I4OA 4I5GA 2QBYB 2O4CA 3I73A 3NYRA 2JS7A 2D3WA 5CIQA 4H3SA 3UENA 1B0ZA 2X77A 4JITA 4B46A 1HE8B 2BDUA 4I1IA 5DBEX 1TA4A 1IU9A 4ZO7A 1EFUA 5F1YA 2OD2A 1ORVA 4BXOB 1UPUA 1TT5B 2AQHA 4EW6A 3RSGA 1K0FA 4M36A 5TQ0B 1J8QA 4BQRA 1XU4A 4BGIA 3VKFA 1I2DA 4IIBA 1Z2EA 3CLSD 4KTTE 4F3RA 1GEGA 1Y8QB 4IKOA 4IDOA 2VDRB 4NQRA 5C0OE 1PHRA 5GJVC 4GU5A 4WTOA 3QENA 1P4SA 4FINA 1RWWA 3BB1A 4IZHA 4LOKA 4M53A 1SHKA 2H5LA 3DEIA 2I8LA 4XGNA 2DBYA 4UU0A 4RFSB 3TGWA 3UOWA 2KW5A 2AEMA 1VL1A 3TZ6A 5GZ1A 3OZCA 2GZ3A 2OB2A 3MWLA 3RWBA 4CLRB 3THXA 3HP1A 2WUFA 1C3VA 2TSYB 5LQJA 3L93A 1IY8A 1ADJA 1SUCA 2QK4A 2QZ4A 1VBNA 2Y2VA 3VTAA 4JGIA 2XHEA 3IUBA 4IQ4A 5FF9A 1T3SA 2V7XA 4R8LA 3AUTA 4OAPA 1BA2A 4Y2QA 1F51E 3ZLJA 4XIFA 4LJAA 5H7XA 2GM4A 3WYDA 2ZU0C 4QHYA 3ECAA 4C21A 4CKCA 4W8HA 3WR5A 1CG6A 3TTTA 4L2IB 1KIFA 5B12A 4MLCA 1Y1QA 3I64A 2LDBA 1GUYA 3DFUA 4YRTA 1S9DA 1QGUB 1B1AA 2JAWA 3QUBA 1IYZA 4HHEA 5D85A 3MJDA 4O2LA 4RIHA 2NTYC 3UAWA 3DBHA 1WW3A 2HU2A 1I6MA 1T9KA 2W2MA 1NBHA 3MIZA 2JGIA 5FI3A 1UMKA 2V8OA 3M3DA 3E58A 4IDDA 4OHOA 5JPIA 4FBGA 1QYDA 3TDMA 4MQEA 4OXQA 3AIMA 3QV1A 3RKRA 1NR5A 1FFGA 1FVHA 3HB9A 4UNIA 3B38A 4MV9A 3HL0A 4YP5A 3E22A 4XFDA 1YA4A 3CF0A 1CR6A 2N1MA 1U65A 5I9SA 4JXKA 2NIPA 4XSVA 2A9PA 2OV4A 3KHSA 3KJEA 1TXGA 3Q4GA 3U16A 3GFOA 4MR8B 5JZOA 3EBLA 2XNKA 1E1YA 2JAUA 2Y0EA 1JZSA 3EZ2A 3V00A 3RVRA 2V4MA 4E6EA 3QI2A 5JOQA 1RXWA 5DX8A 4FBLA 1KIAA 1VFPA 2QR2A 3UVEA 1D1QA 4IO1A 1L3BA 1C9NA 1JF8A 1T0PA 3C70A 3D54D 3ZNNA 5BW8A 1DKQA 2E4AA 4B83A 1SZJG 4JLAA 3C85A 4YIHA 4OSPA 1U2RA 1D3AA 4RF3A 1F2UA 3HS3A 4LJ6A 1DUVG 1NMQA 3IP7A 2ZIXA 4DEYA 2H4JA 1O8BA 3GWGA 3DP9A 1IHPA 1H2AS 4L9WA 4Z9BA 4UXIA 2YRWA 1TDJA 4BB0A 1BCRB 1MX9A 4Z8YA 2H1VA 3NHPA 2ZULA 1VI6A 1WW8A 5LIPA 2CMHA 5KAMA 4BFLA 4GC9A 1IWBB 4UZSA 3IBSA 1OZ0A 4WLUA 1LBSA 4OHRA 4J16C 2P6RA 4PZDA 2VF7A 1UT8A 4Q12A 3HEMA 3PNYA 4MRAA 3A0UA 4JOSA 4NH0A 4JCCA 2XOEA 2AK2A 3HRKA 3JQ7A 1E3WB 1KY5A 5IK2A 3FTFA 3JU3A 3P0FA 3DE2X 1HH4A 4DPKA 4ZP1A 5FWYB 2C31A 1C9EA 1XTVA 4TS1A 2C4VA 3S40A 1YQTA 1SHJA 3W06A 5K3EA 5KYYA 3REFA 3DE7X 3L8FA 1KI3A 1EP3B 2Q9CA 5AIAA 1U2EA 4BCBA 4YMWA 4TMZA 2WHPB 3HBJA 5AKGA 2ONKA 3LUKA 1CYDA 1MABA 4AJPA 3BXXA 1QC5B 2PD3A 4NX2A 5BYJA 5KTKA 4W7HA 2B21A 4WLNA 4PX5A 3MJ4A 5COAA 3BA6A 4YCAA 1ZM2A 3V8VA 1R0KA 2BKUA 4WK0B 3BWVA 3CUTA 1PK7A 6ABPA 3MPUA 1DTEA 3QA9A 7MDHA 3GJ8A 1OU4A 2E4WA 1OLXB 1TKAA 3ZIDA 5LBIA 1RWKA 1LPPA 2VTKA 5LUBA 4HRYA 4UEQA 5C5IA 1GPMA 2HLDD 3RC9A 2G7ZA 2WQ6A 3ZKWB 2PJDA 3WO1A 3V8EA 2FW9A 5GM2A 1T5OA 1W6RA 2YJTD 4BLRA 2C20A 1HWYA 4K6OA 1VL8A 4FOTA 4YRGA 1JQJC 1GY8A 1P1BA 3TLGA 2RH4A 2VWHA 4P3OA 4A16A 3OFND 2WWVD 4N0QA 1EWRA 3K30A 4TKUA 1OF1A 3H1GA 5FYDA 2VA9A 3ZI4A 3AR3A 4R0NA 3D2AA 3OZUA 5FOTA 1UKAA 4H60A 1IM2A 3RJ9A 4B73A 3EVZA 3FCEA 5LQRA 1PZFA 3C43A 3KL4A 3MTAA 1K75A 3F67A 3PEUA 4NEHB 4RVSA 1XZDA 2J3EA 1FP6A 4PZPA 3STVA 2XA1A 3BTVA 3INRA 4D0LB 4FOOA 3DOCA 3QY9A 3FX2A 4ZTZB 2CNNA 2IBMA 2OXFA 4FOPA 4EFMA 3OHSX 4OHBA 4RUKA 3D8HA 4B33A 2WM3A 1B23P 1ZM7A 4BUCA 1N8NA 4E4YA 5B2FA 4ZZ2A 3ELUA 2HZ7A 4PC3A 5EL0A 1XYGA 2C5BA 5K8LA 3QMVA 3WGLA 5ELMA 4ZGGA 4PEVA 4UE3S 1PGOA 2NZVG 3PUYA 4KFTA 3QY0A 3TOZA 4PBTA 3AM4A 2PSSA 5D00A 2F1IA 3OP1A 1XZJA 4BBJA 4U2GA 2C92A 5FLYA 2I6SA 4ZI5A 5A9TA 3DLAA 4WCDA 3BD9A 2DTDA 3P97A 5DX0A 1WXXA 3CLTC 3EWNA 1BDIA 3OT1A 1EJ2A 2F8LA 2R7MA 1QO0D 3TUIC 4NJMB 2B5OA 2WUEA 3INNA 4MV1A 2XTNA 4YFVA 5CX1A 1E5QA 4MPDA 4TWBA 2ZT6A 2RGAA 3AVUA 3KO8A 4TM8A 1NTRA 2Z3WA 3GAFA 1SC6A 4YCDA 2ZIVB 3WFZA 5BYAA 3EUEA 5DIFA 1C3XA 2QB5A 1OYWA 5BXQC 2C3OA 1A8QA 3VYRB 2RGGA 4URFA 3T06B 1U98A 3NIBA 5C2JB 4WNAA 1O6CA 1U1EA 3C8DA 4TUYF 4Z9XA 5CDUA 5AVWA 2EYQA 2JCBA 3OP4A 1NKSA 3T0FA 5ICCA 4I2VA 4JLJA 3G49A 3DOIA 3KOOA 2FPRA 2ZRQA 4BP1A 1VLQA 2XOKD 4BBZA 1C9DB 2BHSA 1RRCA 5BQPA 4DQLA 1CQWA 3RVQA 1DRVA 2ENUA 1TJPB 4YJ3A 4RK0A 2OHFA 1E2GA 3FN4A 5T4FA 2WBLC 4HR7A 2DOKA 3HTXA 4NG5A 1DOHA 2XYVA 1T15A 2W8BA 1UOOA 3ONEA 1NDUA 3NC1C 2WAXA 3AEXA 3TRHA 3PGKA 2V0GA 2I7CA 1X2EA 2JJ1D 1GTZA 1CUBA 1VTKA 1EFRD 4DQVA 3VV2A 1ZDMA 2H2AA 2PT5A 1OKKA 1VLHA 1UP7A 1ZW1A 1Y5IA 3GFPA 2JFYA 3MGGA 3QUSA 2I54A 4I7EA 4KE9A 5BMVF 4LF7B 5FA8A 5IJ0B 1X9HA 4KUGA 1DTWA 3PG5A 4O2AA 3VZBA 3WE7A 2G8NA 2KX7A 3JYOA 5AKIA 3C7TA 3ZJUA 1WTAA 1WKBA 1V7PC 2QX7A 2B7BA 3IQWA 1JZTA 3GVCA 5KYXB 1SD1A 5DBIA 5KOIA 3EASA 2GESA 1C7QA 2XCQA 2C61A 2A5DA 2DSNA 2VDWA 3PC8C 1LLCA 3RJ5A 6Q21A 1DWOA 3I6MA 1CQJA 1G291 3A37A 1NP7A 1UP4A 2PS0A 4JKIA 1OZAA 4YUAA 3BCUA 2ZS9A 3VVCA 2VUHB 4Z4CA 3RJTA 2I4NA 2NTVA 4NTZA 1VJCA 5EYPB 4XRGA 3LY5A 2I34A 1KK0A 1NC1A 5F12A 1Q0SA 1EGVB 5BW5A 2FFJA 1WB5A 1C3EA 3BRSA 4ZU6X 4CCSA 5AW4A 5F64A 5EOVA 2JIPA 4BVFA 2DF8A 4BGDA 2FQ1A 1Z6YA 2ZYUX 2ZDQA 2WJHA 5FBQB 2HWYA 3C4QA 1O97D 1ZITA 3R3XA 2AD5A 3B2EA 2EIHA 1L9KA 1ZEJA 2F48A 5HF6A 2COKA 4H3HB 2IF2A 2O06A 1HQKA 3SEZA 3AX6A 2QRZA 2ZITA 2D4AA 3NM6B 4EHNA 4CIYA 1GL6A 1H1TA 1YBHA 3JALA 3WWDA 2WINI 2QVYX 5KSPA 1GAEO 1ADBA 1UANA 3UIEA 3KB6A 4OLFA 1SB9A 2A0YA 4B1FA 4E5KA 4UM9B 1J2YA 2WNIA 1IJEA 2ZRKA 2CJWA 1PJZA 3EBPA 2NZWA 4FYMA 1FP4B 2PV7A 3VSDA 1HZJA 4C87A 3KHTA 3LKBA 2G36A 3NYIA 1HF3A 1BVYF 4TYWA 4HEQA 3RWMB 5JWOA 1Q5PA 3DG9A 1P4AA 5ICEA 2FPGA 1RQNA 2PX3A 1SG0A 2GTIA 4BNGA 4GEGA 5FYQA 5HQ3B 1WS6A 3EG9A 4BAUA 4BFXA 2EDCA 5TGZA 2QE7D 3IDAA 4L28A 3A8TA 5B3LA 4GZMA 3U7FB 3NHRA 5BQXA 5L9AA 2CLMB 4C14A 3GLFA 1RMQA 3OA0A 5B53A 4DBLC 1KBZA 2H4HA 3DTTA 4YASA 4PO1A 3A6FA 1SBYA 2VRNA 3E9QA 3ZLVA 4EECA 2QJRA 1L8LA 5AO9A 5C8XA 1JXMA 3WA7A 5DX1A 3R5SA 4M6WA 2XVZA 1KSFX 3TBHA 3U4MA 2QY6A 2QXYA 2W6QA 5DYYA 4KR9A 2D4HA 1LC0A 4C1NA 1S6YA 3PFWO 4IKPA 4DA7A 3NHKA 3N87A 2QAGA 4D8TA 2FN9A 3ZCSA 1EVKA 1OREA 4PIVA 4AIRA 1I80A 1VYUA 3W5DA 4U7DA 4ZYVA 1IBMB 3RG8A 3LBHA 1JPUA 4G65A 4TSRA 4DMCA 1AHHA 2JJ2D 3TLAA 3NORA 2YCBA 2OQRA 2B37A 1SOVA 2IITA 3QX9A 1TCCA 3TF5A 2GN1A 3GP3A 1WG8A 2FGKA 4Q9HA 4QOEA 4D5GA 4MW7A 4YO8A 1I2CA 2PBZA 1PJSA 4QDKA 3D3NA 4RXTA 5EINA 1R88A 2BUAA 4LW8A 2EL7A 4JC8A 2JIZA 1IHXA 5EXTA 2P3QA 3MIIA 1TE2A 2B8WA 5I9IA 3I2HA 3I42A 5CIWA 3USCS 2CW5A 3IIEA 1ZGJA 1V1MA 3MAJA 3ZN2A 5I8PA 2F3SA 1Q0QA 1PZNA 3WICA 2QROA 4JU9A 1V8FA 2I65A 2I8AA 4I14A 1AF4A 2F6RA 4BP9A 4YXWA 2LDXA 3A31A 1OGJA 3TQFA 2Z3ZA 4QELA 5ENDA 2ZSBA 4GYYA 4UCQA 4ZVNA 4B48A 1TC2A 4EPVA 4E08A 4DCMA 2EL9A 2HRZA 2EKBA 4NABA 4GPZA 4Y98A 4AYWA 1C41A 2DBQA 1K0UA 3VPCA 3D6FA 4MS1A 4MO9A 2HCTA 2GFHA 2R8OA 2ZOSA 3N8IA 5FA5A 1YZNA 4QODA 5AUPB 4WKCA 2BGIA 4H15A 3WWPA 1KORA 3HVKA 3LPNA 4IZ6A 4RNCA 4D82A 1NW5A 1HT0A 4ITVA 3X43A 5ALTA 3O8OB 4IL5A 1MLDA 4C2TA 2JGLA 3KJNA 1OXBB 4A03A 3PQ7A 2VA8A 1TF5A 1D7OA 1N2GA 5GTDA 1OYYA 4DLAA 3HA2A 1WB9A 4FP9A 1JR3A 1H8HA 2G88A 3GX1A 1E2UA 3AHJA 3IBGA 1U4OA 1W5TA 2E87A 3NBXX 4MRNA 5AVVA 3AG5A 3GOHA 4R1QA 3TZHA 1W4RA 2YYYA 5IKOA 1EUCB 3A14A 4BOYA 9ATCA 3ADDA 1PJAA 2YHIA 3CRMA 1T36B 4NEQA 3RS9A 1BX1A 1Y8RB 2R11A 3HJBA 3D6JA 3DMGA 3KSZO 4JYPA 5LYYA 3KSDO 4OA8A 3ZTTA 1JT2A 4RYDA 1AKMA 3VC1A 4DA0A 4IIEA 5JNVA 2DRIA 1PFUA 4DNQA 4ME6A 1DS6A 1XU7A 3CLUD 1Z22A 2O6LA 5IDWA 1BE8A 1KMHA 1S02A 2X14A 1GCOA 3PD1A 3D0QA 4EIWA 1BEUB 1NW8A 1FUYB 1T24A 4DQDA 1JDPA 1RBQA 4C2BA 3R7DA 1JAXA 2FEOA 3KSUA 1VKZA 5CJJA 5DE3A 3ZIAD 2XMDA 3VJKA 1EDOA 1PFKA 4WW0A 4L7QA 2NV0A 3O8RA 4ARCA 1FVFA 3F98A 2B69A 3JPYA 3L4BC 4J8PA 2JEZA 5KQRA 4RULA 1FQKA 3RC2A 3OIVA 4OHMA 3E9MA 3L77A 3W1WA 2QLJA 3ADBA 1R0ZA 1OXTA 2C04A 1ZQ9A 4B71A 3T52A 2Z0MA 4KQKA 4IX9A 5KBYA 4LZZA 3DTNA 4EW2A 2YC2C 3NVDA 4RL4A 2BGJA 2HHHB 4LNAA 5BRAA 1IEWA 2YC4C 3OQPA 4MYTA 4JD5A 5I9MA 1YC2A 5L3SB 3EPLA 3AERA 1E1KA 2GNPA 2Z5GA 2QXTA 3ABOB 4JAVC 3EZ9A 3F3KA 4IP0A 4MZDA 2J5RA 2FW6A 3L5KA 2X9VA 3FGOA 4JUIA 3TGPA 1ODFA 4J0KA 3SI7A 1GNLA 3LT2A 3G17A 5HTKA 1Q7TA 2G5CA 5A02A 5DWDA 3ENWA 1GQYA 1R9NA 3R7LA 2Q1SA 2WTAA 1X1RA 4MYSA 2VHYA 5IVIA 3RC7A 3VGJA 1CYEA 1ZHFA 4TUYB 5HR5A 2YOGA 1FW6A 2F17A 1JVBA 4QSHA 1SUFA 3T3GA 1HE3A 2E82A 2GN8A 4OQZA 3TS1A 3IE1A 3AJRA 3ED5A 2ZR8A 4WXYB 4TXLA 4EQ6A 5DWVA 2YHBA 1FU8A 2YUTA 4X93A 1VXOA 2VP9A 2XTZA 4C6SA 1T6ZA 2IVFA 3N0WA 1NXWA 2J0EA 1TQ4A 1XHFA 4IDEA 1A7JA 5DTEA 2VBFA 5TR9A 4BQPA 2J09A 2C9BA 3E5MA 3GZJA 4PLVA 3PUVA 3R5TA 2DUNA 4DHEA 4OHWA 2ZUBA 4E2ZA 2QIPA 4HX2A 4MWOA 5GADl 3ZXSA 1E79A 2AG1A 1VHLA 5EE3A 3IDQA 1JG4A 3MW8A 4A8TA 2GA8A 4CLRA 3R9XA 1XTZA 4YH1A 3TMAA 2NG1A 5I8WA 2C0PA 3DO6A 1WMAA 4JOCA 4QUKA 4Y6PA 5AOCA 1EK6A 1YR9A 4LYEA 1MB9A 5EIFA 1ENOA 3H2HA 3VOSA 3EN0A 4UZEA 4II7A 1QKKA 1I5EA 1NE7A 1ZC3A 3AR8A 1QFXA 3M1LA 3P7MA 3TE7A 3MD0A 1OWOA 3FYUA 3T34A 3RCBA 4NH4A 1RM5A 2AOUB 5ALXA 3AF4A 3DWFA 3OIYA 1KAGA 5GZ3A 1R6TA 4QM7A 3FCAA 1EJ0A 3MK31 4RV5A 1MIHA 1NN5A 2C4NA 1A50B 4UFOA 5CVDA 2ZBDA 4Q1AA 4BTLA 2ZZNA 4HWKA 4XKJA 2P90A 4PS0A 1FB5A 2XYGA 1QRUA 2DLDA 4LKRA 3ZWBA 3HJHA 4CDRA 3KB2A 4ALNA 3WY9A 4J9VA 5JEEA 1CRPA 2OGSA 2PFGA 1L5NA 4HNAA 1UBMS 4F2HA 2Q41A 3QKRA 1QZTA 2FSVA 1JJAA 3PXEA 1TFUA 2WDZA 3VZSA 4K81B 2J41A 1WPXA 2Z3VA 5AJTA 2JLZA 2O2SA 1JHXA 1JJVA 2XBUA 4MVJE 3VR3D 5HZKA 4ARZB 2XZTA 3I58A 4PAGA 5I7HA 5EKUA 4LJSA 3T1YB 2OEPA 3F3MA 1CE8A 3FCYA 1JDTA 1G8PA 3PWTA 2AZXA 1DQSA 5FOXA 2QGNA 1KVSA 3AYXB 3HCOA 4R1NA 2BFEA 2F3PA 5JCJA 1AHPA 3M4JA 2ATVA 1N1DA 2H0QA 4MKHA 1WBJB 3BQNB 3MT9A 1DINA 1MAAA 4JENA 4ZRMA 5LM3A 3GDHA 4UNSA 3WKBA 1XPRA 3CF4G 1CXZA 3TNJA 2J7PD 5JNTA 4Z1MA 1J4AA 4FFMA 4L4SA 5GQSA 3W77A 4BATA 1PZXA 2JLRA 3FMGA 4L8GA 3KTAA 1VLZA 4Y2JA 3AY0A 3RIGA 1AGRA 4BKUA 4W7IA 1FFCA 2H9IA 5JUWA 4Q05A 1UMDA 3KR1A 2G6BA 3WP1B 4GX1A 2QW1A 3MELA 4GOMD 4OQLA 2JCXA 2PFKA 3AC0A 4OQMA 1XCJA 5FQOA 3VDNB 3TJRA 3MJVA 3LFTA 1DAGA 2AG0A 4FMCB 4H6XA 1U9ZA 3PPIA 1E8MA 4NE9A 4OHCA 2EZ9A 4PPGA 4RCYA 1C0KA 2BGMA 2CY0A 3KD3A 4W82A 4ZU1X 4YJGB 1X38A 3WGOA 4DDTA 4V1CA 4DV0B 4EHFA 3FGPA 3UJ9A 1XWWA 5EMJA 5K45A 4M8NE 1HQCA 5BN4B 2ZTVA 4BFYA 5FI1B 2X5OA 1JLLA 3ZXYA 3TI9A 3WL5A 4XWTA 3MAGA 2C5EA 2QUBA 2G4LA 3TG8A 2GDJA 1E6WA 3ESQA 2BP7A 3KEMA 4ZEVA 2PUAA 5MDHA 1FRFS 4RM3A 4KG7A 4DDKA 1Y5NA 2OORC 1WUJS 2CVFA 3ZHYA 5JY1A 3EQ7A 4WBSA 3KKMA 1NULA 3L46A 1P0QA 2YR0A 1RSZA 1ZLXA 5DV9A 1F5NA 2RMKA 2Y99A 4IKEA 4DM4A 1FFXB 2F8MA 3OIUA 2JHGA 4GLFA 4Q3EA 5AQ1A 3IMFA 5CH3A 4OVKA 5I7RA 3KZ1E 1QP8A 2BI7A 3ER6A 3IIMA 5C7IO 3UKJA 4B2YA 4PHHA 1MO2A 1RRFA 2NXNA 3PVCA 3IEUA 4CGZA 3DEFA 3U7JA 4KXVA 3H2IA 3CNQS 5J2UB 1U4SA 5TPZA 2Q4TA 1YZVA 4ZO9A 3PDIB 3KKEA 1DFGA 3DMPA 2XSZD 4HX9A 4L8LA 4YAKA 1T4GA 4PX3A 3C98A 1L5GB 4FKBA 2QM3A 4LN1A 3WBFA 4KLCA 4MQFA 2BMAA 3ZWAA 4PPYA 3T9BA 4ZKDA 1VC2A 1YT5A 3GJZA 3NIDB 5IW8A 4ZI2A 1VPEA 2IP1A 5HBRA 4PG5A 2EVWX 1QS0B 1FF9A 4UVGA 4FYYA 2ZTUA 3FTQA 2H2GA 4UHKA 4ARSA 1T3TA 1SQ0A 1DIBA 3BMCB 4AECA 1Z33A 2D5CA 4C89A 4E1BA 5C1DA 1U5CA 5JE8A 3QSYA 1VLLA 1E61A 1UFRA 2FEKA 3U4IA 1II0A 1YNSA 4NNOA 4XX0B 3T1TA 4ZT7A 2X0DA 5K9ZA 4N7MA 4KNVA 4W7SA 1M9NA 1GAQA 1FBNA 2IJGX 2WHQA 3FWKA 1EIZA 1ZX1A 2HIAA 2V8BA 4HAYA 3W5SA 3D02A 1UAAA 1Q16A 3HI4A 5EMHA 1EQUA 4CIAA 1HO3A 4QGFA 2UAGA 5CHYA 1GL7A 3U37A 1Y89A 2D74A 3HI6A 1ZIYA 3HZHA 2ETXA 3PNBA 4HAUA 4MUEA 1IZ9A 3FPAA 2WTUA 2OCIA 4WFKA 1UEJA 5EXEA 1E1RA 3PC6A 4Q7JB 2O0LA 1FMJA 3CZMA 4V39A 3N28A 4PSCA 4LVOA 1NL3A 4CMAA 2ZQ5A 3QKTA 2EQAA 3D81A 4JR2A 4ZOQI 2NSYA 1XLWA 3JZMA 3DHWC 4Q5IA 2LCQA 3UCFA 4PRKA 2VK1A 4H08A 2VJDA 2JFVA 2OSVA 2X6RA 3CUWA 4ZAVA 1ZGCA 3NHUA 5BN5B 2OC4A 3AG6A 1AN9A 3EGXB 3HBFA 1N5RA 5EERA 4AXXA 1PE0A 3IAS1 3S2YA 4A1OA 1EFHA 4IMPA 4OQ4A 1P74A 4FFNA 2E89A 2ZUTA 5BT9A 2C7OA 3OT4A 2F9MA 3R0XA 2J0SA 4LHEA 5DI3A 3WGKA 1SBZA 2ZR7A 4UU8A 1R8XA 3RYFA 4D25A 4X8LA 2H51A 4KIWA 4QIHA 2ZIGA 1Y34E 2M6RA 3V32A 4J1QA 5GIPE 4ZALA 1PF7E 3P9PA 1F7UA 3UXEA 4AJ9A 1W29A 1WP9A 4V0ME 1VE7A 1TYCA 4LK3A 2IEAA 1WV0A 3W5JA 2IYEA 3EDOA 3PF9A 3ZWNA 1QU3A 1G5PA 3IDOA 1KMMA 1OFTA 4E11A 4ON9A 1H3EA 1YO6A 1AMUA 1G2IA 1XTIA 2FJPA 3LT1A 1VHJA 5BR8B 2H8KA 2PKYX 4MP8A 1MTZA 1TK2A 4AULA 5J23A 3UMYA 4V02A 4HFNA 5JRJA 4LRUA 4O4LA 4XUDA 2IZZA 4U7TB 2D13A 4GC5A 4C4OA 1DWUA 4C4TA 4TGLA 4DCOA 3AZOA 1DC3A 3MCTA 3O8BA 4MR7B 5AJVB 1BYIA 1XRJA 4JROA 1LDNA 3WB1A 2IH2A 5DYNA 1X7XB 5DH9A 5CNJA 3H4VA 1LK5A 1S4MA 1S1MA 3ZUGA 5GJBA 1N25A 2OP1A 2XYHA 1UXGA 1T6NA 3EFOA 3NT5A 1C9MA 4NY1A 1DFHA 3THWA 4AI6A 3GP5A 3LIPA 1TM7E 2VDMB 2C59A 3HU1A 3E48A 3NGXA 4J76A 2QV7A 3ZQKA 4MUHA 1LRJA 4U2CA 4WNIA 3UGTA 3VR2A 5FUMA 4U3JA 1U90A 5KX5F 3B5IA 3AP1A 4KIFA 4QBTA 4Y67A 4ZQIA 4BNDA 5BSEA 3EYWA 4KBFA 5JARA 4EB0A 2FF5A 2WNSA 1KI9A 3TD6A 1MDBA 4OHXA 5KMGB 1JILA 3TLMA 1PR0A 3TUZC 3KFLA 4HATA 4BFWA 3DMFA 1PJ2A 2DU8A 2A8YA 4LYDA 3WBJA 1A7UA 1CR0A 4Q1FA 3DR3A 4RPKA 4RMGA 4WGFA 5BWCA 2XGGA 2Z8YM 3IT3A 2WJ3A 3B82A 2OCGA 4G4JA 1N6KA 4MKIA 2AC4A 1IOVA 4NJEA 1IUOA 4HQLA 5L53A 3C0KA 5DN6D 1S3SA 2AF4C 3NEAA 5JAUA 4MDEA 4HGOA 3QU9A 4L02A 3MCWA 5EJFA 1N8TA 1K27A 1SU7A 4CM8B 2VPPA 4I1YA 1YS1X 4XASA 5ALJA 3AL3A 5E3IA 3TKYA 2Q7DA 3LPMA 4B4OA 5B5SA 1QMPA 2HU7A 4GLLA 5JDCC 2OM2A 1H5QA 2PT9A 4ER3A 1QAOA 3HA7A 3TW8A 3ZR4B 3WMXA 2XQIA 3AO0B 1N2EA 4IIGA 4GR9A 3VNUA 5DM60 2R7KA 2ZRMA 4PGGA 1Z4OA 2BTOA 5H0IA 4FEGA 4ZO4A 2HQSA 4LQLA 2CZQA 3MWEB 1WZCA 2O1XA 3INYA 3DOUA 4JI5B 4HDKA 2Q7XA 2WU4A 4J0CA 3VC3A 3I72A 4DLZA 2YY5A 4GZ5A 5JD6A 4A8HA 1DUSA 4ZCQA 1SBCA 2VDNB 2WKRA 2FZEA 3KV1A 2RDMA 3KPWA 4IDGA 4LYGA 4R05A 2OXTA 2DPGA 3A9TA 4UHFA 4HQKA 4NZYA 1J7JA 4MNTA 1F2TB 4F5EA 3RF6A 2WYIA 1QIKA 1XWIA 2WF6A 3DPIA 3O73A 4HWSA 4ZOEA 5DBHX 2I78A 1QQ5A 1GN9A 2P6UA 3H9UA 4MVJP 4Q48A 4X9XA 2FRVA 1QH1B 3U1VA 5L51A 1HQYE 4E5VA 3HCNA 1SUBA 2R66A 2OFFA 3JAWB 2YJZA 1IXSB 4P53A 3CLTD 5AK0A 3V2HA 3FNRA 4LY0A 4Q01A 3NFRA 3UV7A 1ONPA 1XJQA 3WQBA 1L4KA 3SVLA 3RKUA 1LLDA 3EXG2 4BFZA 3PLAE 4EA6A 4WCFA 2QKYA 5KNCD 4OG2A 1JU3A 4FKMA 4RETA 5LMZA 3GGGA 1AXEA 1ZL0A 4AY5A 1MIOB 3JVEA 1B73A 5A7HA 4D3XA 1NRXA 3UB2A 4RK1A 2Q0QA 4KO4S 4KGZA 1N2OA 2FXIA 3LCVB 4V0LA 1YE8A 3DDZX 1P44A 1ZY2A 2XCOA 2YXDA 4CLEA 5JXIA 2ZB8A 4R16A 3MTBA 3V42A 3M6IA 1P1JA 3GVPA 1R6VA 2J7KA 1RRMA 4PLCA 1FK8A 1M6VA 1E92A 2GZDA 1W2HA 2OO7A 4MVJG 4AQDA 4PQYA 3DC2A 2YXBA 3FY4A 1XQ1A 1DVRA 3NBYC 2P1DA 2W2OA 1O95C 4KRYA 1F3LA 3E6AA 5FO0A 5DNVA 4W9NC 1ZUNA 3OH8A 3HBAA 5T5QA 4OBBA 1CB0A 3NWEA 5LP1A 2EKPA 3A4NA 3IAXA 3MS4A 3PYMA 5EE0A 5JHHB 5CB0A 1OBFO 2DERA 3LMKA 3SBEA 5TRTA 2RG7A 1ORIA 3HDGA 4JWTA 4LZNA 3IQZA 4O4HA 4JL6A 5IUJC 1E4EA 2F1HA 2VHZA 4UVIA 4D41A 4ZCMA 5B7QA 3MHPA 1A0OA 2JLQA 1C2TA 1R12A 1MU0A 2W83A 3E8SA 2Y71A 2VT3A 2PMKA 4J7AA 4M76B 3KVVA 4N48A 5B1EA 3VPHA 2F00A 2HWXA 4G56A 3I9KA 1NJ6A 4NFSA 4D8VA 4B4DA 5JDIA 4RTRA 4DLYA 4JV5B 4X91A 4AKEA 1UK6A 1G3IA 3AYZB 1T10A 3IHLA 1WKVA 4NDZA 5CB8A 2YJGA 4P36A 4X6UA 5AKJA 2NYVA 1R9GA 3AUAA 1JMKC 5BSTA 2XE4A 3CT6A 3GBPA 4RD6A 1HDOA 1ELOA 1MEJA 1SUEA 3L0CA 4AVYA 1TEZA 1YUNA 1G9XA 1E7WA 1TD9A 2OKCA 3NHAA 1CUVA 2PR7A 3GRFA 3N0XA 4PR0A 4PYKA 3WNDA 4CTMA 3M82A 3UMRA 2GD1O 5IVPA 4IHJB 3TRFA 2G07A 2JFZA 4AZVA 5C3MA 4RIEA 1E1CB 1O89A 1IN6A 3OFSA 4OXNA 2BLLA 3DOOA 4XPZA 3VU9A 3ZHRA 4CFYA 4ECEA 1H6CA 2KS6A 3D7NA 3WQSB 3U1BA 4NKRA 1U2ZA 4NPCA 2I4TA 4FGJA 1QWSA 1R3DA 1E2KA 1OZHA 2KPOA 2WJGA 1T8PA 2XWJI 1DAKA 2H08A 3CRW1 5J9FA 5T67A 4LWPA 3GUYA 4MRVA 3VHRA 4EY5A 4A5SA 2AZTA 3M6FA 1PBTA 5F52A 4C5CA 4QUEA 4BFUA 4XW2A 4EA7A 1U3TA 1U3FA 4LDPA 3TRKA 3FR7A 4QPCA 1X8JA 4EVQA 3HCPA 4BX2A 1RMYA 1VCOA 4F12A 3DFMA 2FQQA 3H6HA 2O2HA 5AK3A 2QZ9A 3RGWS 1UWCA 4H4EA 2Z9DA 2CD7A 1Z2AA 3HSSA 2HJWA 1OFUA 4P86A 3F90A 3FH0A 3LGSA 1K3FA 2M6SA 1YR3A 1WY5A 3DH0A 2JJQA 5IARA 4EYQA 4BO1A 1XF9A 3AVYA 5AK6A 3D6AA 2WPNA 1FNNA 3CX3A 1BXGA 2QN8A 1KOGA 1W44A 4NARA 3V8BA 1ZZGA 2GJSA 3H1AA 1ULAA 4PNZA 1ZCJA 1M8JA 4M99A 4DZRA 5EGSA 3SMVA 2VK2A 2Q3FA 1M2VB 2VJLA 3K0AB 3IQXA 2A59A 3LUCA 3MC1A 5THXA 3CCBA 3R8XA 2D1FA 3B1XA 2BBOA 4Z4FA 1PQWA 4UBMA 4W1RA 3P0RA 4I9HA 1Z8DA 1F9AA 4XAQA 4BYMA 5IM4F 1O9BA 2GCOB 3ZH9B 5EC8A 2CFRA 4L72A 3PHLA 2E0IA 4D4HA 3RUDA 4CDNA 3IUSA 1M34A 1Y7TA 3OAAA 1G21E 5FWNA 5KNDH 2H1OA 4JZYA 4M0UA 2O7VA 4XEHA 1V5IA 5A0FA 1DXHA 4OXYA 2VVTA 3CS3A 3BMOA 3DVAA 4Z99A 1Z12A 4REQA 1WPRA 3C8UA 4XJVA 2PGLA 1A4UA 1BGVA 4NCAA 1IBSA 4EPWA 1YZUA 3UOGA 2QOEA 1Z0IA 1TYZA 2N46A 4B32A 4ENUA 1MVNA 1Y1TA 3DXXA 1K1EA 3RNOA 4EHKA 4QJBA 2GLUA 5CB6A 1H2WA 2X8WA 1AQYA 5KJ6A 3G02A 5KNLA 4O4JA 3R24A 2W6NA 4EGCB 2NT4A 2UUOA 3OIDA 2R8BA 2G09A 1CPYA 1XQYA 4US1R 4KR2A 1BXKA 4W9MC 3QFHA 4CKEB 3QVGB 4KJXA 2IYRA 1EWVA 2OBMA 3RS5A 2BMJA 4CF5A 1G41A 3NM5A 5A05A 4EYKA 4RDIA 3KR2A 5EJ7A 2WP0A 3Q9UA 3D7LA 4LEIA 2GILA 3VU8A 1TC1A 3DCNA 3NKVA 4V2UA 4EOGA 1G2PA 1UFVA 3AGPA 2WJ6A 1L5HB 2EWVA 2RAPA 4E07A 2ID4A 4KKVA 5E38A 4DYHA 4E15A 3BWMA 2CVOA 1BOOA 3MB5A 3MJTA 1J21A 1HLFA 2SICE 4LYFA 4MKGA 2IS4A 1OFGA 3LWZA 3GRVA 3I9OA 3N8NA 4D5EA 1GRVA 3N2YA 4I36A 5EY5B 3A04A 1X1DA 1W85B 2W90A 1V8BA 5L3ZA 5J40A 3I0NA 3HXOA 1WF6A 1XJ0A 2P6MA 4OJQA 4XIYA 1Z47A 2JI4A 3L07A 4QXQA 4B4WA 2AFVA 3LQ2A 2HMAA 4I1SA 1V8PA 2WG1A 3DS8A 3K8YA 2AT1A 1Q2XA 4MEAA 3O7MA 3SGLA 3ORSA 3IJ5A 1QM5A 2QPAA 3KNZA 4CLOA 2X1VA 3L3BA 5J1TB 3ZTYA 4YQZA 1MH1A 4AICA 2QQ0A 5HF9A 3TTVA 2F2TA 1WDTA 3FVWA 3I39X 3PRHA