1HY3A

Crystal structure of human estrogen sulfotransferase v269e mutant in the presence of paps
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
289
structure length
287
Chain Sequence
NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human estrogen sulfotransferase-PAPS complex: evidence for catalytic role of Ser137 in the sulfuryl transfer reaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords ESTROGEN SULFOTRANSFERASE
total genus 109
structure length 287
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1hy3A00
1Z83A 3VNUA 2ODEA 1VHTA 3OHMA 4KFRA 3CW2A 5AUNB 2JCSA 3U44B 2AWNA 3UMRA 3L43A 2G88A 4G01B 4W5HA 1PLJA 5EP1A 3VKHA 3EPJA 3U60B 1KDPA 1AS2A 2AR7A 5DI9A 2Z5FA 4KITB 4L4UA 3NBYC 3BGWA 3CB4A 1Q57A 1ZBDA 1ZCBA 3EIQA 2E87A 3CH4B 2A78A 1U94A 3SS8A 2GAAA 4EPXA 1KI7A 3CZQA 4ZKEA 1U0JA 4G5SA 2PT5A 4HAYA 3CWQA 4LSGA 3TH5A 4QBFA 4BFTA 1TPZA 3HR7A 4NKRA 4Q9LA 1U8ZA 2A2ZA 1KDRA 1E2PA 4TZ6A 2UVQA 3EZ7A 2O8CB 4D0GA 2JLUA 2HF9A 2OEPA 4MA4A 4JJKA 4WIAA 3BERA 3UMFA 3HPQA 3QPVA 2VTKA 3Q9LA 2WSSD 3MWKA 4MKFA 5FR2A 2W83A 1XPRA 5KPDA 2AXPA 1Y3AA 2JJ1D 2GF0A 1ZM4A 5JWOA 3CWZA 4P4TA 5TV2A 4QBHA 4TMVA 1G8PA 2JLWA 5EE0A 1TEXA 2J0VA 3CONA 4PTLA 1P3JA 1G6OA 5TMPA 2G1JA 2JLYA 2AL7A 3JZMA 1M74A 3W6NA 1FP7A 1HT2E 2P67A 4LPSA 3RS5A 2W6JA 2G83A 1JEEA 1YR9A 1D2NA 1OHHA 3IPXA 5CLLA 1MH1A 5GJVC 1SVSA 3ADDA 3EPLA 2ZQ5A 4DT1B 4LJ6A 1MRNA 1RYFA 2CCJA 3M4YA 2R62A 2BDTA 4QOSA 2F43A 3LW7A 2GCNA 5C46F 1GFIA 3NH6A 1E98A 4QFMA 1FTNA 2EVWX 4LHWA 5BQ5A 1NN1A 121PA 3L0PA 4EFMA 5JFGA 5JRZA 4NYJQ 5FPSA 3RS4A 2CVFA 4IHQA 4B74A 2QSZA 3K9LA 2W58A 1FZQA 1BH2A 1MABB 3RLFA 2O8EB 3BS4A 4P31A 5ANRB 5JRJA 1G21E 4JT2A 2I3BA 2B21A 2CNWD 3A1UA 2OAP1 4GT1A 4OK6A 4K81B 4B3DA 1ZVQA 3GJ4A 4EJSA 3J81k 1Z0KA 2WOJA 2QNRA 4B3CA 2EFEB 1BYUA 4Q4LA 4YMVA 5DHAA 3EC1A 3OIVA 4Q7JB 2J41A 1KI4A 2IUTA 3GJXC 1KMHA 4DLVA 4DT1A 4ZV4A 1WRBA 3DHWC 3ND9A 1E0AA 1R8SA 4Q4HB 1U99A 4CDGA 3WYAA 4IXNA 3RC3A 3U3OA 3U3JA 2YC4C 1U90A 1E9BA 1HEIA 3ASYA 1YZTA 1AGRA 2IF2A 2GZAA 2ZSDA 2XSZD 4L5BA 2ZUCA 3A1TA 1DAMA 3PG5A 2GJAA 4PPGA 3MJRA 1ZUIA 3A4NA 1M7HA 2ZJ5A 2ZJZA 2ZS8A 2XXAB 4U00A 1IXRC 3AVUA 1E9RA 2YVUA 4TT3A 4MDFA 2PMKA 3LVRE 1DVRA 1WBBA 1ZNZA 2PX3A 1G20E 2ZI6A 4EDHA 2PZEA 3SI7A 3DOEA 4ZDIA 2OCYC 3AB3A 1OH7A 4MITA 2WJGA 1HQYE 5B58C 2REOA 4IOJA 3B1ZA 1S2MA 5C1BA 5KSYA 3QF4B 5FTLA 4JLVA 1HV8A 1JJ7A 721PA 2A7QA 4FMCB 3P26A 4AKEA 1HTWA 3R8FA 3BJIC 4CEHA 2B7BA 3SNHA 3R7WA 1TQ4A 2VP6A 4NCJA 4M1KA 3TAUA 3ZVLA 1X8LA 2Q3MA 2D2FA 1R8QA 1GKUB 2ECKA 4WXRA 2ERYA 3IGFA 3REGA 1E1RD 2P0EA 2YJTD 3ADCA 4BECA 3SEAA 2IX3A 1CU1A 1EX6A 3ECCA 3HWSA 1MO4A 3LVQE 421PA 5JBQA 4TLCA 4LJAA 3NBXX 2BMFA 3DL0A 3ND8A 2QE7D 4IDNA 2CL0X 1T5IA 1YRBA 3LV8A 5IRCD 3X1DA 1R5BA 2OCAA 3NH9A 1Z22A 4JKIA 1XXHB 4QHYA 4HZUB 3IBGA 1S4QA 4TL9A 3ZZTA 1NVVR 4QXAA 4II7A 4ZIRA 1OFHA 1O87A 3AGPA 4CIDA 2ZXUA 3AP2A 3LXRA 4YMSA 1G4UR 3SJAA 3U61B 1E79D 4LHVA 2H7VA 2O8DA 1XWIA 2FMXA 4LJYA 2UZ3A 3ZVNA 2V9PA 1ZM3A 1LS6A 4KYIB 4V0OA 3PJRA 3UWKA 3S1AA 3BFXA 1VIYA 4HUQA 3PUYA 2H1LA 3MGCA 4MKGA 5J47A 2QP9X 4PC7A 3Q85A 4Z1MD 1CJMA 4DLWA 1VCMA 1NBME 2ZRCA 3RWMB 621PA 2MSCB 1E9CA 3JZAA 2ZI5A 3LXXA 3FKQA 1OFUX 4M1MA 1XZPA 4DUGD 3LDAA 4E5UA 1W48A 4NL4H 4Q1EA 1IY1A 1GL9B 1ZNXA 3Q8XB 4RD6A 1T8UA 1UADA 3VFDA 4IDPA 4RZ3A 4R2HA 3PEYA 1KJYA 1FUUA 4LBYA 4XSHA 1E0KA 3BC1A 3VKGA 3SHWA 1Z63A 2NPFA 1RC8A 2EFDB 3EC2A 1KI6A 2F9LA 4LBWA 4E22A 5B57C 3R7WB 5FBQB 4URZR 1ZP6A 1L4YA 4IOMA 4D6PA 1Z0IA 2GESA 2K5UA 4DC9A 4QGHA 4TTRA 3KQHA 1TADA 1II9A 2QPOA 4UKDA 4NONA 3U7HB 3B9QA 5M04A 3PCRB 1NG1A 2BMDA 3E70C 1A5TA 3WNCA 2QRZA 3K1JA 3SBEA 3L8ZA 1JQJC 3LBNA 1II8B 2A5FA 3H2YA 1GDDA 2V55B 3TQFA 3C7KA 3GFPA 3FKSD 4LK2A 2DFLA 4US2R 2O0HA 4AYXA 3GLHE 4IXMA 4OL0A 2MMCA 3IQXA 3BD9A 4KCGA 3IPYA 3AH8A 4MYCA 5J4VA 1F2UB 2C8VA 2W6IA 1XP8A 3CF0A 4KFTA 1GITA 3SBDA 4AD8A 4DLXA 5L3SA 3EX7C 4LYAA 5DIFA 4F4JA 4OQMA 2D74A 3SU8A 5HCNA 2ZJ2A 4MGYR 2CE2X 4QGGA 4C0KA 2VL7A 3KXKA 3THYA 2V4ZA 1FNNA 3CPJB 5FBLB 1LW7A 4AK9A 3H0KA 1N2CE 2R6GA 3EARA 1CJVC 4TQ9A 1WP9A 3IQWA 1OV4A 3IIMA 1JPNA 1E9EA 4NDZA 1KO8A 2TMKA 3RANA 3T1TA 3K0FB 5J4HA 3TE6A 1P4SA 1LS1A 1RIFA 1YZGA 2GXSA 5JSZA 5D3MB 3VR6A 5G3ZA 4EAQA 3KFXA 1VG8A 4KFSA 4R2IA 1TMKA 3EAQA 1RVDA 4Q4JB 1TTTA 2ZAMA 1G7CA 1XZQA 1YRAA 5KHOC 4JL5A 2YHSA 5CLQA 3BOSA 3A36A 4BFZA 1SVLA 1U81A 4M9SA 1UDXA 5KO2A 1SULA 2DHRA 5F98A 1NIPA 3B5JA 1U0LA 2ZU6A 4B6FA 2FZ4A 2IS1A 2ZRJA 1DG3A 2QP4A 3C5HA 2NGRA 4RVCA 3BIFA 4TYPA 4EQ6A 2ZREA 1FMJA 4JL8A 4RD3A 3RNLA 1IHUA 2VHCA 1N5IA 2VP4A 4L9WA 3ETLA 2ZJAA 5L3RA 5C4GB 3RS2A 1Q12A 4MH0R 2BMJA 2JAQA 4HB3A 3QKRB 2QMOA 4MGIR 4Q1BA 5BYKA 4DSOA 3FB4A 1Z6GA 5HE8A 1OIVA 2G0NA 2QN6A 4A0HA 1EK0A 1U8AA 4XWKA 1E79A 1L8QA 3VU9B 4PQYA 5AR1A 2ZRFA 2EWWA 1HT1E 2WSMA 5FFMA 4UJ5A 4ARZA 2C2HA 4D4MA 3TIFA 5EE5B 1NI3A 2FJUA 3ZS8A 4C0SA 4BFSA 1OH5A 1HH4A 1LFDB 3OIUA 1UFQA 3AP3A 4OHYA 3NG1A 1PLLA 2IYYA 3NWJA 3H86A 4GP6A 2FPKA 4B75A 5FBVB 2QBYB 2WKQA 3G5UA 1KY2A 1NJFA 1KO7A 4TYNA 4AG5A 4G5OA 1X1RA 1E4VA 2D2EA 2IYQA 4JS0A 4UXHA 3KUCA 1N6LA 2AX4A 4M4SA 4CT5A 2IYRA 1SHZA 2JASA 1DPFA 2PX0A 1K6MA 4AKGA 4UQOA 4RY2A 4EPVA 1B0UA 3EASA 3H84A 2HXYA 2D7DA 3K0AB 2YWHA 2R44A 3U2QA 1VIAA 2HV8A 1VCIA 2NO6A 3QXXA 3UG6A 3TNFA 4BLPA 1OPXA 3KQNA 4PSAA 4LHZA 1GNQA 3VMFA 1OJLA 1RRPA 4TYWA 4A82A 4E07A 1N25A 5H1YA 2QM8A 5CJPA 2QE7A 1N6IA 2CLDX 4MUBA 4D4KA 2IF0A 1N6PA 4N1AA 2D06A 3MSXA 2YOHA 3QKTA 4H1VA 2QPTA 1W0KD 1ZM9A 1XTIA 2HLDD 2QT1A 2Q3FA 4BEBA 2IT1A 4YMTA 4OHWA 4UXJA 2EFHB 4US0R 4NCIA 1JXMA 2JLSA 1NLFA 3EPKA 5KTYA 3WBJA 3IIKA 2HT6A 2IHBA 3PFIA 3QKRA 4XVUA 5IT5A 4KHZA 2N46A 3W3AA 1OXUA 2QEQA 1R0WA 3KXLA 4WZ6A 2BOVA 3ZH9B 1EWQA 2OESA 2GVDC 4PHTA 3W3ZB 4URXR 2PJRA 4PO8A 4PHHA 2RMKA 4XTRA 4A8JA 2BM0A 4BLQA 3FWYA 1FFHA 1T3LA 3I8XA 3L0IB 1CRQA 4WVFA 5E95A 4ASUD 2JA1A 4OYHA 5DLQC 1YZQA 1CF4A 2XEXA 3AQ4A 3C14C 3A6PC 4A36A 4B48A 2JIZA 3C15C 1W36C 2OLJA 2GJKA 2REXB 3JVUA 5K8IA 3KX2A 2Z0MA 3K0CC 5KOYA 5TDHA 3RSOA 2ZE6A 2QAGA 4EPWA 3KTAA 1Z2CA 1NSFA 4A0FA 3TLXA 3K0EA 5JHGB 3U4QB 1X8KA 4HDQB 2JDIA 1N0UA 4EPTA 1YZLA 1DO2A 4G3XA 4RFSA 1TQDA 3RS0A 1KGDA 3RS3A 1Z6YA 5DYGA 2E1RA 3RYTC 4NMMA 4B33A 4FINA 1W4CA 3W5JA 3LH5A 4G5RA 4DSUA 4PO1A 3KKPA 2GZDA 3T61A 1Z6TA 1XEXB 2B8TA 4O2LA 1ZINA 2NMVA 2ZRGA 1AKYA 4L15A 2IWHA 2R8RA 2VRWA 4DSTA 1XEFA 2ZYUX 1F2UA 1OT3A 4M53A 1KNQA 3GLGE 1S96A 2PJZA 2ZJBA 3H1TA 4BASA 1D2EA 2G3YA 4TWZA 4XWAA 1IAQA 1TNDA 2ZJ8A 1W5SA 1TF2A 3FTQA 2GNOA 2ZYWX 4TTQA 5EXPA 3BRWD 2C77A 4TN1A 1GRQA 3C16C 1KK0A 3AGQA 2NO0A 1W0JD 3PXGA 3RABA 4B3FX 5CM8B 4JVLA 2QTHA 1P75A 2ONKA 1J2JA 2ZUBA 3GP8A 4AIIA 4L16A 3P4YA 2IK8A 1E99A 3FHCB 3ZDQA 1QG4A 4PFSA 4RD4A 4FIDA 1IONA 4JLBA 3CX8A 1HE1C 2DWOA 5BN4A 2IYXA 2O8BB 4A2WA 3UG7A 2QMHA 4ON9A 4PXAA 4E03A 1KI6B 2DBYA 1GSIA 1SKYE 1YZUA 4P33A 4GDFA 2RGNA 4HYYA 2RGNC 3OEED 2RGDA 1AM4D 1D6JA 1VYVA 2AK3A 2WWYA 4ESVA 4P4SA 2B92A 2CJWB 1ZC3A 3WMEA 2CEAA 4LCBA 1YR6A 5HKKD 4TL7A 2AKYA 2FFQA 4UNRA 4DEXA 2OILA 2FSIA 3E1SA 4HUTA 4JT4A 2FDCA 3Q7QA 1E2HA 3CPEA 1P9WA 2ERXA 5D3QA 1Q3HA 1OIWA 2QA5A 4JYCA 2QP3A 4OHXA 4HUQB 1UBCA 2VSOA 5CDFE 4D4JA 8OHMA 3UMSA 1ZMXA 4ERNA 5JECA 3KQUA 4GPTA 1OHHD 2OZEA 1XCPA 2GCOA 5HKKA 1X8JA 5JS7A 2WICA 1F60A 2Z83A 4MYTA 4IOLA 5FOVA 4TLBA 2YKGA 1Q3TA 1ESMA 221PA 4TL8A 4Q21A 1Z6AA 2ODNA 1A2KC 1GNPA 4QGFA 4TQUS 4JYBA 3V4RA 4KXFB 1LTQA 4BE7B 3BE4A 2FPLA 5AK0A 3I61A 1G19A 4IVRA 2GBLC 3WP0A 5A4JA 2P65A 4WAUA 4MRVA 2OE2A 4AC9A 1ZUNB 4NYJR 5IK2A 4AYWA 3EWSA 3VR3A 4DCSA 1COWD 3LX8A 5AUPB 1R6BX 1Q21A 1E0SA 3KZ1E 4PPFA 3IKJA 2X2FA 4LPKA 4RCYA 2RGBA 3A8TA 4Q02A 1DAKA 3X1ZA 2VO1A 4UJ3A 5EP2A 3RC8A 4CEHB 1YR7A 2FN4A 3LX5A 3DEFA 3NHAA 1AA9A 3QF4A 3RRNA 1JR3D 2ZETA 4JKYA 1EFHA 2FX3A 2XNDA 1M2OB 1F2TA 1E9SA 2HDNB 3QXSA 1SZPA 4Q9KA 3MWLA 3GLFA 4PR0A 1KYIA 2OUKA 1D5CA 3CUEF 3L0SA 4DLSA 3AKCA 1ZW6A 4TMKA 4TSFD 1N0VC 4P4UA 1TF7A 1CJTC 3NTUA 2BHRA 2V1XA 5KSOA 3REFA 2FSFA 2HEIA 4Q18A 5CB8A 1N6OA 4LX0A 4E09A 1KO5A 3TVTA 1FQKA 3M6AA 1OLOA 2QRNA 1G41A 3VAAA 2WPDA 2W0MA 4TLAA 2PL3A 2WKRA 4I1SA 4PZYA 2J5XA 2J7KA 4IDHA 2ORIA 3GQBA 4F93B 2REBA 1EXMA 3MG9A 1G3RA 3B6EA 4TMZA 4B2PA 1N6NA 1KI8A 1ZCAA 2CMKA 1OIXA 4ZO4A 2NG1A 3LW8A 2GKSA 4A15A 1AQYA 1AK2A 4MRSA 1YU9A 2XTMA 3QXHA 521PA 4U7DA 1SXJA 3B1YA 4Z51A 1MKYA 2RAPA 4DUGA 4LBVA 4EQ6B 4OHVA 4FMDF 2V8OA 3SFZA 3IDQA 4GBMA 1EX7A 1VYTA 3AVQA 4HI0E 1TF5A 5LPNA 4FI3C 4ITRC 5BYJA 3IEUA 2JEOA 2A5GA 2HLDA 3IHWA 1D8TA 2PZFA 1U8YA 1XB2A 3QENA 4AWXA 5A5GA 3GLFE 5H8WA 1QHSA 1MABA 2FG5A 1H65A 3DM9B 3I92A 4N0DA 2WJHA 5E3HA 1CJKC 4DKXA 1TEVA 1NVXQ 4PC2A 2IS6A 4YC7A 1KO1A 3K09C 3IO3A 5JSZB 1KSHA 2W6JD 3QNUA 2QGZA 1DAIA 3AKYA 1GILA 3D6TB 2CCGA 1EFRD 5SZKB 5BXQC 1KSGA 2AD5A 1R2QA 3U4QA 1Z28A 3PEUA 1R0XA 1RYHA 3NBFA 1SKQA 3DMNA 1U98A 2BC9A 3VNVA 1XD2B 1QHNA 1S3GA 1ZNWA 1K5DA 3LRPA 3Q72A 1DARA 2LWIA 4FW9A 3SR0A 4MRPA 3ICEA 2ZRPA 4QRHA 2ZE8A 4ZCLA 1N6HA 1OB5A 3GEHA 2NTYC 1UEJA 5JJIA 1W2HA 4GNKA 2BBWA 2BCJQ 3NIBA 1GKIA 3VR1A 3AVOA 4HEJA 1E9AA 4Q03A 1RZ3A 1GRRA 1UBFA 1W2GA 1P62B 4FCTA 4IW3B 4DLTA 2ZM5A 3EIEA 3K70C 1II8A 4M1TA 5BN3A 1E2GA 4TZ0A 1X86B 4US1R 2C78A 2C95A 3CIOA 3DKPA 3VQTA 2IA5A 3SZRA 3R9XA 2CE7A 3F3YA 3GLFB 4GP7A 4BEJA 3KL4A 2A3RA 2RB4A 4Q19A 1NN0A 3QI2A 5FPHA 2XAUA 4C0LA 1DEKA 2WIAA 1E94E 1J90A 3WP1B 1VDZA 3CNLA 5AJYA 2HCJB 5F2EA 3AKEA 5FR1A 1CLUA 1D9ZA 1W5TA 2XSZA 3AV0B 1JBKA 4MQBA 1IQPA 2LCFA 2VSXA 5HCIA 5L3QB 3B60A 1V5WA 2AK2A 4P0TA 2DY1A 2GBLA 4QBGB 5AJVB 4QKQA 4X8LA 2XJ9A 4V0MA 1E4YA 1KKLA 3THXA 3THXB 1JECA 5KNCA 1W36B 1ZNYA 3GJ6A 2PCLA 2O8FA 2C5LA 2ORVA 3OAAA 3WHLA 1E96A 1XF9A 1MO5A 4I4LA 3O8DA 4NCKA 3QKSB 4LBZA 3AF0A 5G40A 5LD2B 1R0YA 1NSTA 5TB5A 1M8PA 1XTKA 5EUMA 3HU2A 2QL6A 3KDSE 2R6FA 2DYKA 1AS0A 3HP1A 3SQWA 1JAHA 2FSHA 3EA5A 1E9DA 3BB4A 1NMYA 2Q0HA 3KFVA 1U2RA 4HSEA 2GTPA 2H92A 1CP2A 1HYQA 2WV9A 4Q1AA 4PAQA 1W4RA 1V43A 2HT1A 1TU4A 1XNJA 4ARZB 2FE4A 4I1OA 3T34A 3S1AB 3UANA 4JIMA 4DBLC 5EP3A 2GEUA 3QKUA 1PJRA 5TXGA 4DZZA 2ZVQX 1G17A 1XJCA 1Z5ZA 4H1UA 4KAXA 3A4LA 1MV5A 3IO5A 4LJ9A 2WKPA 1G5RA 4QM7A 2NQ2C 3QUSA 4URVR 1XXHA 1NKSA 4C0QC 2PBRA 2IYSA 2G6BA 2IEZA 1WCV1 5DI3A 2QAGC 4L9SA 3UKDA 2X8AA 1XTQA 3BXZA 4HAVA 4OI4A 1AQUA 1IJFA 4WZAE 4LI0A 2AKAB 3IUYA 1CS4C 1OF1A 4HATA 2O5VA 4HLCA 3ZIAD 5B64A 1SXJC 1NVVQ 4CZ2A 1EGAA 4DLUA 4JSTA 3NBZC 3ASZA 2VPPA 4JL6A 2YINC 3QG1A 4DB4A 1G7SA 4DSNA 1F5NA 3Q5EA 2FSGA 4CRWB 2BWJA 3HJNA 3N2EA 2HYDA 4DDTA 4FXPA 3LBHA 1ZJ6A 1RRFA 2HF8A 3F5FA 2VIIA 4RSGA 4M9XA 4D25A 2EFCB 3ZVRA 1J7KA 1OFIA 1BIFA 3FKSA 1R10A 2GRJA 5D3MA 3ADBA 2XTNA 2J0UA 3B85A 3K0FA 1EESA 1HY3A 4H9GA 1NIJA 2OG2A 3WMFA 3QSYA 2DB3A 5IK2D 1W7AA 3TW4A 3D31A 4CEJB 1LVGA 2GETA 3GD7A 2MSEB 3HU3A 1QVAA 2WMNB 1XEWX 3C4JA 2UZIR 1KZ7B 1OKKA 1GAJA 1ZD9A 2X19A 2ZI7A 5EQTA 4IFBA 4FWIB 1H8EA 2WPDD 5CYPA 1P2TA 1G9XA 3B1VA 2IYWA 4ACBA 1YVDA 2EU8A 2ANCA 4OJKA 1JAIA 3OF5A 1G64A 1P6XA 4M1OA 4A8JC 1YJ5A 2C96A 2NO9A 2V54A 5JI2E 1ZD8A 3I72A 3VR5A 4NE2A 3GJ3A 3V9PA 3FVQA 1RFLA 2ZRDA 3TK1A 2GZHA 2FEOA 2QAJA 5H70A 1SVKA 2OO7A 1WQ1R 1YZNA 2NZ8A 1DOAA 1EG7A 4WZBE 2D4HA 2V7QD 2CL7X 4KI0A 3X1XA 2D7CA 2F6RA 2WJIA 1ZM2A 1W44A 1QHXA 2GJ9A 2ZRHA 3QJYA 1RPZA 1WE2A 2HUPA 3VR4A 2WWHA 1F2TB 3W5IA 1KAOA 4EJSB 3QXCA 4Z1MA 3QE0A 1YE8A 1W0JA 4C0HA 4AURA 3U7GA 5DE3A 5JI3E 4YDSA 4EJSC 1PLKA 3DZDA 2WWWA 2KJQA 2PEYA 4XSGA 2RCNA 1ZRHA 1MO3A 3A1WA 2JLRA 1AKEA 1F6BA 3WMGA 4B3XA 1CIPA 3TVDA 1FPMA 1N5LA 1QZXA 2CVHA 3A1VA 1NY5A 1P60A 3PEVA 4PC3A 4R9UC 3JVVA 5FUYA 5JLJA 4LJ4A 5C2JB 4YMUA 3BK7A 2ZSEA 1AZTA 1M1YE 3KKOA 4A0RA 1MO6A 2JJ2D 1NLYA 1Z0DA 3FMFA 2ZI3A 3I5XA 4YLGA 3RVBA 1XEWY 4M9ZA 3CRW1 2DFNA 4A8JB 3TW8B 3TBKA 4B3GA 4Z8XA 2C04A 2OFOA 2G1KA 2F1HA 4JBYA 3OFNA 4NYIQ 3DVLA 3W9YA 4C9BA 2C9CA 1CXZA 1Z3IX 2E9SA 3PUXA 1CBUA 4LDJA 4NYIR 3OIWA 1Q0UA 2J59A 3FYHA 3W8NA 4A9AA 3IILA 2OHFA 2ZRAA 4Y0VA 1KOFA 2BIFA 3FOZA 3QQ5A 2LKCA 1EFRA 3CPHA 4LUCA 1JR3A 1G3UA 3CRMA 3X1YA 2ZAOA 4LYJA 1SVIA 3CRRA 3OE7D 4NPHA 1ZYUA 4WBSA 4MRRA 2WVJA 1AJEA 1JR6A 1P61B 3AVVA 4C7OB 1NBMD 3B9PA 3IHLA 2W2TA 4G5GA 1WF3A 1ZM7A 1G8HA 2A9KA 3GFOA 4Z8YA 4ASUA 4BLOA 4MGKR 2FFAA 3UXMA 2VH5R 4Q4AB 3KQLA 5HE9A 3W8RA 3N70A 3RWOA 4PAOA 3RDPA 3GEEA 1TQ6A 1NVWQ 1VKJA 2WSSA 4LV6A 5FH9A 1R5OA 1C9KA 2X2EA 4X8MA 2O8FB 4KFUA 5JS8A 4YXWA 1JJVA 1KO4A 4DCUA 2IWRA 1XD9A 1H8HD 5A0FA 4PQRA 1N5JA 4TL6A 1FOEB 2ODWA 4K46A 3EZ9A 4RJLA 4A6PA 1KY3A 4Q01A 4C0JA 2IS4A 3UATA 4W9MC 2FNAA 4DWJA 1GVNB 4AYTA 4MGZR 1SVOA 1NBMA 1LB1B 4RD1A 2NPIA 3MUFA 2KWIA 3EZFA 4GMXA 4NZYA 4XOIA 3WRYC 3GFTA 1CR2A 2KI5A 1QVRA 4MUAA 3CH5A 3CNOA 1XTSA 3WYGA 1DO0A 4TT3D 3VX3A 4HAUA 5J4YA 2V6JA 2ZEJA 1B23P 1GWNA 2YZ2A 1WMSA 1JEDA 2O52A 1QRAA 4P32A 2XZPA 3L82B 2EFGA 1J8MF 1UKVY 4XH9B 4LWZA 5DNYB 5EZ5A 3K0SA 4DJTA 1W0KA 3BWDD 2V3CC 4WXPA 3WNBA 3NKVA 2XXAA 2I1VB 2QPAA 3KQKA 1ELOA 3MLEA 5FTMA 1G7RA 4OI2A 1GRNA 1GUAA 5BW8A 2BBOA 3LWNA 4KO8A 2H57A 1K5GA 4FMCF 4Q48A 2SHKA 1FMLA 3TUIC 5FPKA 1FUKA 5JHHB 2J45A 1P7CA 2DFKB 1DELA 2F1RA 3NDPA 1VCOA 2OCBA 2P2LA 3I32A 1Q1BA 2J9RA 5FOTA 1KI1A 1EFUA 3QPUA 2BM1A 2N1BA 1DBSA 4URYR 4HDCA 2AN9A 4NP6A 3GCGA 4RFVA 5IF9A 2VHTA 4A6XA 3OE7A 4FD2A 1S1MA 5B30A 5CITA 3KJGA 4ESHA 4RFSB 1LV7A 2WIBA 2NIPA 4N3NA 1E1QA 5DGXA 3T5GA 2QU8A 4KVGA 2ZIAA 5L8VA 2F1JA 1N3BA 4D80A 1G16A 3B7GA 1S3SA 3A1SA 1IBRA 1L7VC 4HDOB 3X1WA 1LNZA 2IYTA 2KE5A 2OBLA 1GZSA 4OHZA 5ELXA 3T15A 5GVSA 1K8RA 3VKWA 1OXTA 1IN4A 4MRNA 3QVVA 4OKSA 5L3SB 4LJ7A 1S0UA 2QZ4A 2ZE5A 3KJIA 5E4FA 5K8LA 1XMIA 1VYUA 3RRYA 4R71A 1VMAA 2FWRA 1Q22A 2BVNA 3GLHB 3PV0A 2BCGY 1WB9A 1IN5A 5CK4A 4DCNA 2QT0A 4NYMQ 2QORA 1TAGA 3GLGA 3GJ0A 4B47A 5KU1A 4BWYA 4U5XA 3QXJA 3PEWA 3VHXA 4M22A 1N6KA 2A5DA 3D8BA 1XMJA 1DAEA 1IY2A 5SZIA 1KI3A 2JJ1A 4IKEA 2IYZA 4QJ5A 4GFDA 4ZI3A 3ZQJA 5EE3A 3ZJYA 5CK5A 1G18A 4FMDB 4D82A 1XCGB 3KUDA 4UNNA 4RCZA 3F8TA 3AVYA 1OYYA 1QHYA 4NHOA 1E32A 4KU4A 1E2DA 1IXSB 1DAFA 5SZJA 1Z6XA 3RHFA 3U6BA 1LF0A 4D0NA 5JJKA 1XDBA 3GMTA 2BBSA 2DWQA 2QUZA 3AF3A 4ZCIA 4GZLA 5GADl 3HYTA 4FWTA 3K70D 2DR3A 5J5CA 4HLUC 2VHUA 3CF6R 4URWR 2ZYTX 2H5EA 3NDBB 4GOXA 4FMBB 4QNMA 1KDTA 2ZRLA 1T3HA 4Q4AA 1T3SA 2PH1A 3N2IA 4CEIA 4KSCA 2VQSA 1OW3B 4Q1CA 4B73A 2ZRIA 3ZZ0A 1H8ED 4TTPA 1IOZA 2WOOA 2PLRA 2V6IA 3QPWA 4PSVA 2CLSA 1SXJE 1ESNA 2XNDD 2W6ID 4C7OA 2R6DA 1JB1A 1W47A 4XIGS 4HB2A 1EFTA 3T12A 4EPYA 2HCBA 3MFYA 4B35A 4PANA 1DADA 1NMZA 2VBCA 3VU9A 1NN5A 5KSPA 1BKDR 4N0EA 3ZIAA 2ORWA 5FUWA 4L8GA 3OAAD 2QY9A 3QBVA 2YWFA 1Z0AA 1COWA 3THWB 2J7PD 3U7EB 4OBEA 1NY6A 3H4MA 3THWA 1US8A 2LKDA 2QM7A 3QEJA 1KAGA 2YYZA 3MRSA 3LAWA 4BPBA 2CHVA 2IW3A 4F92B 1J70A 4A2QA 2WBLC 4JLKA 4JZKA 1G3IA 4BRUA 2GCOB 1MOZA 1P2VA 2FOLA 3KKMA 2QTFA 3L2OB 2DFTA 1FW6A 4XTCS 2IXGA 2Q21A 4QJ4A 3B78A 3R20A 4Q9HA 2PZGA 3K9NA 4PX9A 4A1FA 3OFND 3BFVA 2AWOA 2IYUA 3B2EA 4AY2A 4GOKA 1Q1EA 2P6NA 2ZROA 4KJZA 3GEIA 2ZPTX 4Q4JA 1G291 3AUYA 4GSYA 2CHQA 4HB0A 5F9FA 1FTSA 1GL6A 2R6AA 4LV8B 3FMOB 2GXQA 4F7WA 3AUXA 3BH0A 2W0SA 2R2AA 1KK1A 4JMPA 4P4SB 3D7MA 5JJLA 3PR1A 3K8YA 4YXWD 1BO6A 1UEIA 2ZANA 1TU3A 1WDTA 4QG7A 3KXIA 2ZSAA 2PLFA 4DB2A 4G0NA 1NMXA 3THYB 5DSZA 1BYIA 2IHYA 2O8BA 1CR0A 2Q3HA 5F9HA 2XZOA 3HR8A 5AWFC 2JLZA 2C9YA 4XD7A 1KMQA 3P4XA 4ACAA 2AD1A 2XOKD 4C30A 3X2SA 1XJQA 1Y63A 3GPLA 2C99A 5FBWB 1E69A 1QG2A 4IDOA 2NOAA 2ZRBA 3LQQA 4BUJA 3O8BA 5TVKA 4JLDA 4FCWA 3SJZA 4DLRA 3GLGB 2OBMA 3MWJA 4Q4HA 3AKDA 4M1SA 3U3MA 1YR8A 4CF7A 2P5SA 1KJWA 4QJ3A 5K8UA 3LO5A 2R6CA 1SHKA 3V00A 1G3QA 1UBEA 2ATXA 2HJVA 4CEJA 3DPUA 4TSFA 2GA8A 5JWHA 4IEIA 4DCVA 2FFBA 2KB0A 3KJEA 2FF7A 3A58B 1XPOA 2J0UB 3BBPA 3L0OA 5J4KA 6Q21A 5FTKA 1X3SA 1M6NA 4PZLA 3IEVA 4RZXA 3QY0A 3Q7PA 3DZ8A 2PMDA 4KYUA 4PC1A 2O8EA 4AI6A 3I62A 1CULC 5HPYB 2GILA 4V02A 4DDVA 3K0CA 5E7MA 5B2ZA 3C8UA 3TUJC 1SGWA 3SE0A 1QHGA 4BLSA 4JVMA 2VP2A 1RRCA 2C9OA 5FL7D 4I99A 3VTKA 4XVRA 4X8OA 4V0ME 2OFWA 1G3MA 1R0ZA 1XMVA 1SQ5A 1BOFA 3AEZA 5DI3B 1NNEA 3LLMA 4TMWA 1IXZA 3VR2A 2OFXA 2OXRA 1TUEA 1E2IA 4Q7MB 3A37A 4NTZA 4M9QA 3IIJA 1UAAA 4F38A 3E5HA 5FPTA 1QHHA 2A5JA 1OSNA 4JVSB 3SHFA 1FL9A 1KDOA 2ZJOA 5CM9C 1ZIOA 4B3BA 1JPJA 2BKEA 1I2MA 4EUNA 4W5JA 3FPAA 3BFKA 4JBWA 3WHKA 4MDEA 2RHDA 4PHGA 5HZKA 3AF4A 3ONWA 1KHTA 4A92A 3PUZA 4ZIRB 4QC2A 4O3MA 2P5TB 2GXUA 2ZVPX 2F3RA 4RZUA 1E2JA 2XOKA 4HZUA 1VCNA 1Z0FA 2BJWA 4DXAA 1U0HC 1Z08A 2JJ8A 2ZS7A 2ODBA 4OI1A 1PUIA 1UBGA 1NKTA 1XU4A 2Z4RA 5EXTA 3R9IA 5K8TA 5KPJA 5KYKA 4DDWA 2O8CA 2QENA 1S9HA 1OFTA 1CR1A 3MD0A 3IBYA 1ZUHA 4D0LB 1CRPA 4F4CA 3BH7A 1IN7A 2WAXA 1Q1QA 3MJHA 3CLVA 2FEMA 5HR5A 5FUVA 2CL6X 2WAYA 2ZS9A 2P6UA 2VLIA 4ABYA 4QNRA 1J99A 1Z06A 1IY0A 3FFAA 2RGXA 3VHLB 5L3QA 4D26A 2JATA 3DMDA 4RKEA 2V7QA 4EIWA 2QGNA 3WNDA 3GJ5A 4W5WA 4AG6A 1XXHE 1GL7A 4ZCMA 4DLYA 4TYQA 5GVRA 1O3YA 1XRJA 1NG9A 1YZKA 4K8OA 5G3YA 2CK3D 4Q66C 4BRWA 4PPQA 4KSBA 2GAOA 1IM2A 4B43A 2RGEA 4UNQA 2WM9B 2PEZA 4I1UA 3TSWA 2EWVA 1G4AE 4MYUA 3P32A 4QHSA 4DRZA 3SQXA 1HE8B 2GF9A 2W2VA 1NVUQ 1RJ9B 3MCAA 2D3WA 5CYOA 3SYKA 2AXNA 4LY6A 5P21A 3PUWA 1VHLA 4YONB 3NHBA 3M1IA 4C3ZA 1SVWA 2FU5C 2NO1A 4TQAA 1MT0A 5CIWA 4DIEA 1S9DA 3ADKA 1QHHB 2A5YB 1G7TA 4GOJA 4I1VA 1M34E 3ZGXA 2YOGA 2AFIE 4UNSA 5FTJA 1BS1A 2WMOB 1KMHB 2CXXA 2ZU0C 3SDZA 4B2IA 5C4MA 5HZHA 2W2XA 2JLXA 3ZQ6A 1HURA 3I8SA 3CBQA 1S8FA 3BAFA 4OQNA 3ZLJA 3WYFA 4ZDKA 2O0JA 3OZXA 4TMXA 2RGAA 2DWPA 1G1MA 1M7GA 4B76A 1I4TD 4RD0A 5J4LA 2GCPA 1OXVA 4QHTA 4CYMA 3FDIA 4M1WA 4NBSA 1PZNA 2CCKA 2CK3A 2VF7A 1EFCA 3ICQB 4U02A 1W36D 3MMPA 1JALA 2RHMA 4LOAA 2ZRKA 5LDDC 1VECA 5LB2A 4KODA 2QSYA 1G8YA 2IUSA 2OLKA 1SXJB 4D4LA 3LLUA 2DCUA 2WJJA 4M2LA 1RKBA 2VEDA 3OEHD 4DCTA 1LY1A 4J0QA 3E2IA 3A4MA 4JLNA 3WRXC 1ANKA 2GJ8A 1A82A 1E1RA 2FGJA 2YOFA 4HAXA 5LB4A 5BWMA 4BLRA 3GLIA 1BMFD 1D9XA 4M21A 3FMIA 2IUUA 5JZVA 4FCVA 3Q3JB 3SN6A 3FGNA 2B6HA 3CRQA 4IVQA 3TJZA 2QTVB 5E7JA 1A2BA 3SYNA 3KB2A 4A2PA 4UXIA 3PENA 4F91B 2Z4SA 1Z47A 1DAGA 2XB2A 3BB1A 1W46A 2I1QA 3UIEA 4QL3A 1ZC4A 2ZI9A 2AHOA 2ZI4A 3GLIB 2Q9AA 5DYIA 1A1VA 5KDOA 3CRVA 2EQBA 1C4OA 1IN6A 2HJGA 2IXFA 2NO7A 5UKDA 1XPUA 1I4LD 2OSBA 1Q1ZA 2VHJA 3NC1C 2PCJA 1HUQA 2F55A 4RZ2A 1WXQA 2R9VA 4LJ8A 1W4AA 5EP4A 4GL2A 4R7ZA 4LYHA 3CR8A 3LNCA 2ANBA 4PQFA 1P2UA 3U3RA 3EXAA 1YHNA 1CR4A 1R4AA 2CDNA 1I4DD 4JLPA 5JMTA 5LD2C 1QF9A 5JEDA 1H8HA 4LHXA 2JDID 5FI1B 2V1UA 2VF8A 2J46A 5EXXA 1E1QD 3EA0A 3OIYA 5FUXA 4OI0A 3FFBA 2H18A 5FPYA 1E2KA 4DDUA 4O2RA 3AVTA 5KDLA 1WA5A 2JIZD 4IFEA 5IDVA 3CZPA 4NCNA 2BJVA 5EE1A 1MR3F 2F3TA 2IC5A 5FI0B 1NRJB 5JEEA 4IOKA 2EYUA 1KKMA 3ZD6A 1JQLB 3AVXA 4JLAA 3LD9A 2J1LA 2WWGA 4DLZA 2A30A 3QIAA 5EE9A 4V0KA 1JXOA 3CM0A 1US8B 2JLQA 2AFHE 2YNMA 1L4UA 5F3WB 2KBEA 2ZSFA 1E2LA 3GJ7A 3TKLA 2IXEA 3CNNA 3RS7A 1W4BA 2ZTSA 3K9GA 4A4DA 2Y8EA 2D62A 4KLZA 2QG6A 3C5CA 2H16A 2F1IA 3M0EA 1G8GA 3LQRA 4W7SA 3K70B 1VG9B 3AM1A 1Z2AA 2CLCX 5JCPA 1U9IC 2O0KA 1HQCA 4M1YA 3PVSA 3QG5A 4JLJA 821PA 1SVMA 3R8CA 3G0HA 4JVNA 2G0TA 4AKIA 4R98A 3TQCA 3SFVA 4Q00A 1BMFA 5AUOB 1F48A 1W49A 2CBZA 2YWGA 1A4RA 4CEIB 2XZLA 3L8YA 4S2EA 4EFLA 1QDEA 4PZZA 4GI7A 1GKYA 4ZKDA 3B1XA 3QKSA 1DTSA 2OAQ1 4GRAA 3KJHA 2FZLA 3W90A 2L0XA 3T1QA 1PUJA 4Q9IA 4ZPXA 4Q1DA 3HPRA 4CGZA 2XTZA 3TAHA 3TSOA 1WBDA 1UM8A 3AVWA 1FX0A 2QMEA 2XB4A 3TSZA 1CKEA 1ZU4A 2ONJA 1E0JA 2FA9A 4BQSA 2XJ4A 4X8HA 1J8YF 1SXJD 1CTQA 1GM5A 1R7RA 2JLVA 2R65A 3PIRA 4MYHA 1YKSA 3P27A 3UPUA 3K9HA 3DKVA 4GMDA 3OEHA 4ZI2A 3SJBA 2G77B 2J3EA 5FL7A 1XTRA 1KI2A 2NZJA 4C2UA 3PITA 4IJMA 4YQFA 1NF3A 3QF7A 4JJZA 2X77A 2W00A 1T0JB 1KSJA 2XGJA 1ZD1A 1I2DA 2MMGA 2ZYVX 4HLQB 2ZE7A 4NCHA 4NYMR 4OQXA 4PAMA 2EYQA 4IDQA 4O0MA 1E2QA 4LGMA 4NH0A 2XITA 2BMEA 3TGPA 3QVUA 4GZMA 4LHYA 2G9NA 1YQTA 3G82C 1ONBA 3ZD7A 3CX7A 2QQ0A 1XCMA 1KZGB 4BFVA 4CT4B 4TLDA 5G53C 1N6RA 1OKKD 1G5PA 2WZQA 3SC3A 3FHTA 3NEYA 3WY9A 2H17A 5GJBA 3AF1A 3I73A 2RGCA 5SZHB 3N5CA 4ZDWA 1N5KA 3BB3A 1XD2A 3T5DA 1VG0B 1KK3A 3U5ZB 1N0WA 1A7JA 1PVOA 2DPXA 3BORA 3KB1A 3O8CA 4XD7D 1M7BA 3RSLA 1SKYB 2ZR7A 4KBGA 5J40A 3W6OA 1Q44A 2Z43A 3LFUA 2FFHA 4C0AC 3HU1A 2QROA 4HLDA 5EZ6B 2QQEA 2GJSA 4LZZA 2J0SA 4BZQA 2WJYA 2IL1A 4OQLA 4XWOA 1E3MA 4XVQA 2YC2C 4ZDJA 4WOPA 4OJQA 5CIQA 5DHFA 4TMTA 2VA8A 3FMPB 2WWIA 1GNRA 5KDDA 1T5LA 1DE0A 1Z8FA 3QBTA 3F0TA 3UWOA 1GP2A 1XFAA 2P3SA 4LC1A 2WTUA 4F4IA 2F43B 2IYVA 1C1YA 2ZR0A 3EIHA 3FHOA 1X6VA 1L2TA 5EXSA 3I3SR 1AN0A 1UPTA 2I4IA 5DH9A 5FL3A 5HTKA 4Z54A 2IYLD 1ETUA 2VP5A 4TYYA 1T6NA 3T35A 3HDTA 2VHQA 2Q6TA 5JWRA 2GHIA 3AVPA 4CW7A 4YMWA 3EW9A 2GWHA 3TR5A 2BKUA 1NP6A 3I1FA 1P73A 3CR7A 1E2EA 1OXXK 1RJ9A 3DOFA 1GOTA 5H68A 2Q9CA 4M0LA 4V0NA 3T1OA 3I5YA 5DN6A 3HYRA 2BBTA 2FPMA 5FOWA 4LRWA 1XD8A 3UK6A 1FX0B 5FTNA 3RRZA 3TRFA 2RH5A 3OEEA 4PO9A 5AUQA 3MWYW 1VG1A 3K0AA 5KUTA 3CKLA 1GG2A 4Q9JA 2YWEA 1IJEA 3T06B 3U3KA 3BH6A 4V0LA 5DISB 1KTVA 1FNMA 3K53A 4BZXA 1E6CA 4XJXA 5EUQB 2QBYA 1P9RA 3THOA 2OCPA 3Q5DA 5JCZA 1DG1G 3EPHA 1KJZA 4QM6A 1VTKA 2UKDA 1ODFA 3PQCA 5TY0A 1LF5A 2VP0A 1NL3A 4Q47A 3LBIA 1S1CA 2F7SA 4Y0AA 4IRUB 3R9WA 4ILEA 3B8HA 1AIPA 1ZAKA 2GDJA 3EZ2A 3NVAA 3W6PA 4B6EA 4LC0A 4TLEA 1MRSA 4HAZA 3ZS9A 2VSFA 3GJ8A 1T4GA 2WHXA 2YV5A 4I81A 4FN5A 4HB4A 3U44A 4C2TA 1UKYA 3KKNA 5CJ2A 3AP1A 4BZPA 1RE0A 2F9MA 1G8FA 3P20A 4O25A 3DM5A 1U9IA 3RRMA 2OT3B 1FP6A 3OESA 4BGDA 5GJWC 5CDFA 2VP9A 4G5QA 4JLOA 2WJVA 1CJUC 3EWAA 5E7IA 2OXCA 3TUZC 4Q7KA 2GXAA 2J7PA 1TL7C 3GLIE 1KK2A 1NJGA 2FV8A 4JLMA 2OV2A 2ZITA 2VYFA 4A0GA 1XX6A 3NXSA 4UNPA 5FBRB 1P72A 2IBMA 1T8TA 4URUR 2ZRMA 3W34A 1OH6A 1NN3A 2CHGA 3LA6A 4M8NE 1KIMA 5BN5A 3FE2A 1UF9A 2N42A 4BFUA 4IEEA 4HLUA 2HXSA 1ZIPA 4Q1FA 1Z07A 3AF2A 1AZSC 4OK5A 1E2NA 4CVNA 4EPRA 4BFWA 2Q9BA 4WA7A 4JSYA 1II0A 4C4PA 1KSFX 2CJWA 2XX3A 1E9FA 3T1VA 3TR0A 2ZR9A 2WWFA 3P1JA 4KLNA 2BEJA 1TUIA 3U6KA 1EWRA 1JI0A 4PHFA 4C0BA 2OM2A 1OYWA 1XMSA 2BV3A 4DEYA 4RD2A 1KNXA 1P5ZB 1TQ2A 3B1WA 4DIDA 4LYFA 1UDWA 2FH5B 4WW0A 2GEVA 1G6HA 3NC0C 4QBIA 3O47A 2ZJYA 4OK3A 1F3OA 2IEYA 1VPLA 3B13B 3MAAC 4B32A 5AJZA 4DHEA 1OB2A 3VX4A 3U7FB 2BEKA 4OQFA 1DS6A 2B8WA 3CO5A 2J87A 3PUVA 1HA3A 3CX6A 4KVAA 4YDHB 3RAPR 1QBKC 3SYLA 1AS3A 2CNWA 1IN8A 1DAHA 3QEOA 2EW1A 5AJWA 4G1UC 2XNSA 4D81A 3TMKA 2PT7A 1X1SA 2P6RA 2FGKA 2WWXA 3GLHA 1R5NA 1KI9A 4BFXA 1UKEA 5C18A 1E2MA 4MKIA 1Z0JA 4QGAA 1FQJA 1T91A 3WXMA 4B34A 4AKHA 1OXSC 2Z6VA 3QOFA 2X1VA 3CF2A 1XJ0A 2ASEA 4BFYA 2ZUDA 4POAA 4EFNA 1ZU5A 1XEXA 1P2SA 2IS2A 4B2LA 4Q7LA 1P9NA 2J0QA 4NU0A 2OBNA 4RKFA 5DN6D 2H8KA 4V03A 2QMUA 5FOUA 1UKZA 5FOXA 5GJCA 2RGGA 3WBKA 4B71A 3EG5A 4Q5IA 3LY5A 1QHIA 2GK6A 3C41J 4MKHA 2ZRNA 4D2IA 2KSQA 1AGPA 1NLZA 3EZ6A 1E2FA 1Z29A 1T9HA 5DO9A 1OH8A 3SJCA 1CEEA 3KKQA 1JNYA 4JBXA 2KBFA 4LV5B 4PPNA 1D2MA 4LJ5A 3I4LA 5FOSA 3O8RA 5KSZA 2RKOA 1W1WA 4P3YA 3KTAB 2QAGB 3ZVMA 2JGNA 1GTVA 4HAWA 4KV9A 4BLTA 4S35A 1PV4A 5EJEA 3V4FA 2ZSBA 5TARA 5G41A 5CB6A 5KNBA 4KBFA 2MSDB 4B44A 3DO6A 4EKDA 2HYIC 2GK7A 3K09A 4HZIA 5L3VA 5LBIA 5IHPA 1TX4B 2JJ2A 1T0HB 4IVPA 4PSKA 2B7CA 2C03A 3ZYCA 3B82A 3ZZUA 5AJXA 1RW4A 1RRGA 2GEDA 3DDCA 2O8DB 3D3QA 1GIAA 1UJ2A 4PC6A 5KNDA 3SOPA 1Q20A 4DVGA 1XTJA 1G5TA 2QI9C 1XBTA 1OE0A 1JR3E 2GVZC 3NEJA 2C98A 2ATVA
chains in the Genus database with same CATH superfamily
3IXMA 4JOBA 4HGPA 2XUIA 3VNUA 1VHTA 1SC9A 4R51A 3RVJA 5AUNB 2JCSA 2RHJA 3VC3A 4JJ6A 4BKUA 2APJA 1OAAA 3RODA 4LY0A 3G7UA 3MSCA 1YMVA 2DFDA 3FDFA 3KVRA 3VKHA 3OOWA 3EPJA 5MN5A 1R0SA 2AR7A 1UPUA 2C0QA 2JC3A 1J21A 4N0PA 4KITB 5AK5A 3NBYC 3BGWA 3CB4A 1JILA 1ZCBA 3EQZA 3HTXA 3EIQA 2Z1MA 2ESRA 5DX8A 2D0DA 3CLSD 3CH4B 3MJTA 2C5SA 4ZCPA 2O7VA 4JI3B 3SS8A 1BN6A 1XL0A 3RTGA 1M6HA 2BFDB 2GAAA 4EPXA 3CZQA 4G5SA 4UU8A 4XRRA 4MI9A 2PT5A 4HAYA 4LSGA 2YHUA 3DMTA 4UZSA 4QBFA 4CL2A 2PSFA 3KM0A 1M1NA 1WXWA 4MI6A 5C8ZA 1OX4A 1JMKC 4QO8A 2PLWA 1DV1A 1E2PA 3BQMB 5T4HA 3WRWA 2CDCA 3NBMA 4I4TF 4H3VA 3EZ7A 4FZVA 4N5LA 2YN2A 3ORSA 4KE7A 2XZTA 2JLUA 4MA4A 1OLSA 3V1UA 4JJKA 4IVNA 3K1ZA 3TO5A 5A4AA 3BERA 3ZQKA 3UMFA 4IYJA 3B6ZA 3AY0A 4IRXA 4HYTA 3W7AA 2H2HA 3Q9LA 2QRKA 1A5SB 2PXXA 5FYDA 1RBMA 2VVTA 4CTNA 2ZJ3A 3CWZA 4P4TA 5TV2A 5I7EA 1PTJA 2ILTA 4OKIA 4MRAA 4HDAA 4BFLA 3I09A 1SBZA 2VZ8A 1UBLS 1K06A 5I6DA 1GSAA 3VU3A 1CRLA 4HRVA 4IH4A 4UOQA 4X20A 3ELDA 2B36A 5AVTA 1P3JA 1ZKDA 5DK4A 2JBAA 1ORDA 3LDGA 1FRVA 2WTNA 3MTIA 5DBGA 3ZYZA 4WXHA 3HI4A 2C42A 2YBDA 3Q8MA 3IT3A 3JD2A 4G4GA 5A04A 4W8HA 4DG5A 3BQ9A 3OIGA 4KMMA 4LPSA 2G83A 4UDYX 3FG9A 1JEEA 2PGLA 4K6MA 1QONA 1JFLA 5J2UB 2PWZA 5GJVC 1OBFO 1P31A 3NHWA 3PQ5A 3G2IA 4D0RA 4BC1A 1SCNE 4I8DA 5CA0A 2F43A 2JW5A 2P9YA 1RU3A 1E98A 2D5IA 1FTNA 4XM2A 2DWUA 5BQ5A 2VZLA 3UOAB 4A91A 2J5BA 3QMVA 1X1BA 4EFMA 3M5PA 5JRZA 1QC5A 5LDGA 5FPSA 4B74A 2I78A 3GUZA 1YC2A 2QSZA 4OFXA 4MXDA 1YS6A 3C3BA 3K9LA 3DDZX 5CNMA 2W58A 3H2HA 2PGJA 3R7SA 4UFPA 5IASA 4EHNA 1MABB 3RLFA 1ZI8A 3WGJA 1RI3A 1IZ9A 1U8CB 3LQ1A 4M0KA 5H9WA 5ANRB 2OYCA 2O3TA 4J43A 5JRJA 2OO5C 4YCSA 3TCXB 1XRPA 1G21E 2I3BA 5BOSA 3PWKA 3A1UA 4B3DA 3D7NA 2ZCVA 3NVMB 3HI6A 3MS2A 1EA5A 3L4SO 4X63A 2ZQYA 2WOJA 2QNRA 3C1UA 4Q4LA 1BYUA 3VZQA 3FRIA 1T2CA 4M89A 3OIVA 3CCBA 4LRSB 1KI4A 1NNSA 3VA7A 5BVHA 1LPNA 1H0SA 1W34A 1CB7A 1W96A 2XLBA 2HKIA 3L8MA 5A05A 1KP3A 4O6VA 1PD0A 2B34A 3BYZA 3KDAA 5A62A 1ZL0A 2VF2A 1E0AA 5KNCD 4CDGA 1U99A 3GGJA 4D3YA 2PXAA 3UYKA 4BMZA 3GMIA 1TIKA 2B8EA 2XRZA 4NAUA 3I28A 5C32A 1U8FO 1YZTA 3RADC 1AGRA 2IF2A 2GZAA 4LSWA 2OXIA 4JI6B 4AG3A 1EVKA 4PW0A 4B4VA 1UXHA 3O8QB 1YH3A 4J4TA 2F3SA 1H42A 2P9JA 4EI7A 3H83A 1M7HA 5AXCA 3LY9A 1U2SA 2ZS8A 3RKUA 5I9MA 4U00A 2CB0A 4CKCB 1Z13A 2YVUA 3OBBA 4TT3A 2VH1A 3A10A 3ONVA 1DVRA 2YWRA 2P78A 5HFJA 2TYSB 1Y1LA 3RVOA 2ZI6A 2QW0X 3WOVA 3ROQA 2A0KA 2PMWB 1BS9A 2JAHA 2PZEA 4YI3A 2QTWB 4GP9A 4JYAB 4CUJA 5HF8A 1OH7A 4MITA 3IUSA 4MJ3A 5EJGA 1RPAA 2REOA 4RTOA 3B1ZA 1KTIA 1VBFA 1S2MA 4UC0A 3G9XA 4YBZA 3M81A 2QLLA 2FPWA 4AKEA 5CA1A 5JY6A 4ZU3A 2IDKA 4TKZA 4OFZA 3HEBA 2B7BA 2BUBA 4WN9A 2VPXA 4MQ4A 3SNHA 3TAUA 1XN4A 5B7GA 3QI7A 2Q3MA 2F8SA 1VMKA 3IDOA 1R9NA 1QIIA 5DNEA 1RMTA 2ECKA 3DE5X 4WXRA 4K6GA 3REGA 4HMOA 4FC6A 4M9RA 3F9CA 2B5OA 4HQFA 1I36A 3EXHB 2L69A 2Q6LA 3IUBA 4BECA 2IX3A 3JXEA 3FY4A 3ECCA 5GOZA 1L5SA 4KX5A 5JBQA 3PXXA 4FFSA 4TLCA 3QA9A 2NNLD 4LJAA 1SH7A 5DM4A 4DV6B 2PT6A 4C5BA 3RU9A 4UMEA 3R3ZA 2ZQZA 1SM4A 5ED0A 4IDNA 1EB9A 3D3WA 3UM9A 3PUHA 3P2JA 1NF8A 5H83A 5IRCD 4PM4A 3NH9A 4OPMA 2JGLA 3CTMA 4QHYA 4TL9A 1S4QA 5AI4A 1NVVR 4NEQA 3GFSA 5F4BA 3V7NA 1MO2A 1U9CA 4JQZA 5KVAA 2BEUA 2A94A 4CR7A 4TXHA 4IDGA 3AP2A 3AOEA 3HP7A 4IKPA 4D45A 4LNAA 5K8CA 2FMXA 4M0MA 4LJYA 2IVFA 4TV9F 2V9PA 3LSTA 4KYIB 4OQDA 2R1ZA 3LMKA 2VWGA 1LI5A 3CN9A 3DCYA 3NIFB 2WHYA 2XAAA 1UZAA 4KOAA 1AE1A 1VIYA 3ZN2A 1LEHA 3V8PA 2I34A 1UK6A 3M70A 5KYVA 1Z5NA 2G1PA 2QP9X 5B4TA 3H5WA 1GEEA 2Q4OA 4TM7A 4I50B 4C03A 1K63A 1NBME 2WD7B 4UHHA 1XMOB 1ORTA 2NXJA 2ZRCA 3D59A 4KKVA 2R2GA 3G8AA 4DL9A 5KOIA 1IEQA 4YRNA 621PA 1GKKA 1BDHA 1GPJA 1MHTA 3FKQA 4K9KA 4N12A 2GCIA 2D5BA 3JQFC 4QFCA 2A67A 4C7XA 1BFUA 3AILA 4NF2A 3RFVA 4CMJA 3JYNA 4P3OA 4L95C 4N41A 2REQB 1RPTA 1KJYA 1BA3A 2BCEA 1IB6A 4XSHA 4CKWA 4R1TA 1WETA 4LXGA 5BSUA 1Z63A 2NPFA 4UDOA 1D4OA 1Z2PX 2EFDB 5FWXB 4Y2GA 3IYLW 1XMXA 4LBWA 4YV0A 2JPDA 5B57C 2CNDA 1PNQA 5I5GA 3P5BA 5TR9A 5FBQB 4URZR 2WHQA 2YWJA 4MPJA 4BGIA 1T8WA 1ZP6A 5A1JA 5IF3A 5IKXA 1Z0IA 2GESA 4DC9A 1ZMOA 3JAKB 4TTRA 3RVRA 1JVBA 4KR9A 2OORC 3KHTA 2O5CA 2X0NA 1II9A 4BO1A 3M6VA 2CUNA 5EWJA 2QPOA 2RE8A 1ADFA 3U7HB 1GU0A 4J16C 3PKIA 2QB5A 4BNYA 2C2BA 3ZJTA 1O8BA 3KK0A 1PO7A 1A5TA 5DNAA 1DU4A 2R8EA 1QYCA 2HB6A 1K3UB 2CSXA 4GKKB 4WQMA 1EFDN 3K1JA 2ZP1A 4FOPA 4B5KA 2O7RA 3WKCA 3F2IA 2X0IA 5M5BA 1NBHA 4B82A 5AK6A 4ER5A 4MRMA 4WK0B 3RYFB 2RJOA 5ALQA 4M6WA 3SG0A 2G63A 2DRIA 3BD9A 1RMYA 4QLOA 3VJLA 4KCGA 2FVXA 2BEWA 3MGGA 4R54A 4JP5A 2NUBA 5J4VA 1AUQA 3UICA 4MI3A 1LSOA 2W6IA 1XP8A 1QK3A 4ZMSA 1GITA 2XCIA 5EIEA 2PWBA 2VYNA 4OHBA 5K0SA 2IXAA 4TXNA 2WJWA 1XAJA 4Y6SA 2QVCA 1MVNA 5I3ZA 4C0KA 1O8CA 1F8XA 1RYBA 4EAAA 3FTNA 3KXKA 1V71A 4RL4A 3CPJB 3DKKA 4AK9A 3H8WA 1HOTA 1LSJA 1J97A 1Q7GA 2ODQA 2R6GA 4FYVA 4MUFA 1C9YA 4TQ9A 2OLEA 4ZYTA 5SY4A 5JMOA 1AN9A 4MULA 3VRHA 4F9GA 3IIMA 1Y1PA 1QORA 2CMDA 3ZDXB 5BSRA 3T1TA 5J4HA 2XA1A 1C3OA 1QVWA 2FK7A 4QT0A 5FD8A 4WADA 5K8JB 1EVIA 1QKKA 2FZWA 3VR6A 3KFXA 2BKVA 2Q1TA 4RA6A 1TMKA 4IQ4A 2H1HA 3K9BA 3PWSA 3E1GA 1Z39A 1MRZA 4Q4JB 5ALWA 1RLOA 5EMHA 4ZVQA 1J39A 3T6KA 2OXEA 4JYZA 1GZ7A 2PLAA 1G7CA 1XZQA 3N2ZB 5AVJA 2C00A 2WW8A 4FCCA 3KETA 3VU1A 5CT8A 3KLMX 1W93A 3COVA 3ID6C 2YYSA 3Q7EA 4GS5A 4PRKA 4EGJA 1SULA 3S6JA 4JUBA 4N9WA 5FF9A 2JIMA 1RQNA 1FP4A 2Z95A 3VDRA 1EM8B 1Q16A 5JZBA 1DG3A 4TYPA 2NGRA 3M2PA 3BIFA 5JNUA 2QRPA 4LXHA 2P77A 3GUCA 2VP4A 4L9WA 5EJIA 2CMGA 2AYXA 3ETLA 3GOQA 1Q12A 4G25A 5GQSA 4C08A 1F12A 4PGHA 3L0BA 5DGTA 2Z4TA 4EWLA 4GKVA 1NZDA 3A6HA 4D9FA 3ANXA 4WE3A 3FB4A 1OIVA 3H05A 2JFNA 3O4FA 3BTSA 4DDMA 1I51A 3DDSA 1SFRA 4QUBA 1L8QA 4XWKA 2B0CA 4MGEA 4PQYA 2ZWPA 1BQEA 2ZRFA 2EWWA 2JFOA 5IAGA 2ZTUA 2RGUA 3RHSA 1HT1E 4CMAA 2WSMA 2JFBA 3HCPA 1G9TA 3UOWA 5K03A 4UUMA 3TG8A 3GX1A 4YO8A 2NYAA 2LR0A 1NI3A 3ZS8A 1CDOA 2YFQA 3G0DA 1RXWA 1HH4A 3DE7X 4W9NC 2IHNA 4PFKA 4Q82A 3AP3A 3TFWA 2GM9A 3ILHA 4LAFA 3HUFA 1ZUWA 1POWA 1R9JA 1SBCA 1Z0SA 2IYYA 3RVKA 3ZUGA 4V1CA 1RXSA 5AVWA 1LLFA 2FPKA 4D57A 4OO3A 4C6HA 3IQGX 4S0XA 5BY2A 2WKQA 5HBRA 1KO7A 1W1IA 4AG5A 3ZBUA 1E4VA 1MFZA 1SUPA 1U3VA 1FDOA 2HWWA 1KIFA 3BK2A 3KUCA 4M4SA 1JVSA 4CT5A 4YJFB 3ON5A 2IYRA 3NFYA 1DPFA 4KNWA 1W85A 3ESCA 4AZ0A 2J33A 4O1MA 4EPVA 1IUPA 4P7BA 2D7DA 4JXZA 3M4ZA 4GQAA 1HDGO 2PSSA 3FGPA 3W1WA 4EB6A 1WHSB 3G0HA 2EP8A 4BLPA 3TG2A 3OZWA 1FXWA 3PFBA 3TCNA 4P93A 4PSAA 1Z18A 4DVJA 1V3QE 1UOEA 4KQIA 2P8SA 3I76A 4E12A 1QGUA 5AW3A 1OJLA 3AX6A 1RRPA 4ARIA 4TYWA 2WQ6A 4A82A 3MF4A 4AN0A 1WCIA 1C30A 1I2ZA 1SC1A 2COUA 4OXRA 1XZCA 2PTGA 16PKA 1N7HA 2HRQA 2V5AA 3UKJA 4N1AA 3MSXA 1FP1D 3IKMB 4M60A 3T7KA 3TPFA 4EARA 1E8MA 1REQA 2QPTA 1E1CB 2NUTA 3LUDA 2CJFA 2QT1A 4MQEA 4UEKA 2Q3FA 1HDOA 5LCXA 4LWPA 4ZQIA 4EGCB 1N7JA 2EFHB 2IE8A 4US0R 4NCIA 2PNJA 4HS9A 1JXMA 2JLSA 2R8OA 1ONPA 4OHFA 3RIYA 1GAWA 1WXDA 1BKSB 3BAZA 4LMAA 2B1RA 2L17A 3IIKA 2HT6A 1B73A 3PFIA 3UJHA 2P6PA 3AI7A 3O4VA 5JDIC 1HE4A 4OAQA 3FPCA 3HXPA 3ZU2A 2ZVJA 2BOVA 4AT1A 2C7RA 2GVDC 3N59A 2EIXA 1QHEA 3T3PB 1A9YA 1FTGA 4KO1S 4IR7A 1YONA 2AKEA 1IBCA 4JB8A 1FFHA 5KNBH 2ORED 3IDSA 3L0IB 3FNFA 4YROA 4KSYA 2BFCB 4OYHA 2WJAA 1L5WA 3C14C 1X7ZB 5IC6A 1J8VA 2JIZA 5EHZA 4KXYA 4QXOA 4GQBA 4NZZA 1E4OA 4TLMB 3JVUA 3CUVA 3KX2A 4MW1A 5BNWA 1QYDA 3ILYA 3K0CC 3RSOA 2Z2KA 2CMHA 2V74B 1HZZA 1NSFA 2VJMA 3TLXA 1YF3A 2VPIA 4OQQA 4AS3A 3QFRA 3PVZA 2V3WA 2HO4A 1N0UA 1NUPA 4A1OA 4EPTA 4ALLA 4YUAA 1PW7A 1OJ7A 2B30A 3BM5A 4K0RA 4HUJA 1YZLA 5FPPA 3JD0A 4RFSA 1O6CA 4NK4A 3RUDA 4EVQA 2GBCA 3N7AA 2AOUB 2E1RA 3Q98A 4QDZA 3R76A 4NMMA 3EDYA 3OOSA 4FINA 3TL3A 1LBTA 1NU6A 3DE0X 2VNHA 1YV9A 3G2KA 2I6GA 3ZDFA 1DNPA 3LH5A 1NBOA 5KQLA 3NX4A 3KXDA 4ENRA 1JEOA 1XEXB 3QEMA 2JLAA 2W2LD 3GHYA 1K9SA 1W52X 3QLUA 5ALKA 4DSTA 1IG0A 3NOXA 1XEFA 5JC1A 1SOVA 2QXTA 3NXKA 5GMOA 1GU1A 4OBBA 3SHTA 2BI8A 4EA8A 3ZHVA 1D2EA 4KH1A 3ACBA 1U0SY 4ZK2A 4HBGA 4UPVA 4EG3A 2ZJ8A 1UPCA 3LUJA 1GGNA 1WPXA 2PM8A 1EA7A 1ES9A 1Y4AE 2R8ZA 1P18A 4U2KA 2G76A 3R5XA 3ZUPA 3BRWD 3PNPA 1SR8A 4RNCA 3C16C 4P3NA 3PXGA 4ZT7A 3TXXA 5CM8B 4JVLA 3HXKA 1R4MB 3GP8A 2NVUB 1M8JA 4AIIA 5EJ5A 4BQOA 1Z8NA 3WAGA 3I01A 4CDNA 3F71A 1GNSA 1WY5A 3R7BA 3ZDQA 2H2FA 3CRZA 1EAYA 2P4HX 1IONA 4II2A 3PRYA 1J09A 3CX8A 4E2FA 4F2PA 2WHEA 2VYVD 3ELUA 2VDVE 1BCSB 1NMEA 5ENZA 2QMHA 5KI6A 4ZN6A 4P7JA 2Y6VA 4ON9A 2XBMA 5LC1A 2JEYA 3F6CA 4MKZA 4RBNA 2Y0PA 4KBYA 4RMIA 4TTTS 3L4JA 1SKYE 3LWDA 1TI7A 3WDKA 3L7CA 5CP8A 4BWFB 2RGNC 3U26A 1EB8A 1WXXA 1VYVA 3H7IA 5B1HA 3V42A 2XKBA 3E3MA 1KOLA 3VR4D 2Y4OA 1Z4LA 2CJWB 4I5DA 4HNUA 5KMGB 2FR8C 1EFAA 2UV8A 2CEAA 1KEKA 3VOAA 3UBMA 1HDZA 2D0OB 1SXPA 3K0KA 1QKIA 3IDZA 4F60A 1QZ3A 4P38A 4BNWA 1JJFA 4R2KA 3D6FA 2HBYA 3QU7A 4I9UA 5EAIA 3ZV3A 3Q7QA 4C87A 2JIQA 3AI2A 4ZHQF 2PQ0A 5ADHA 5KOHB 3L1UA 2F8TA 2ERXA 1EE2A 2FG7C 4S3MA 2QW1A 4GW3A 3WLTA 4ZYVA 5BUSA 3BZUA 2IQ5A 2QP3A 4OHXA 3DEAA 5IDWA 2YXDA 3MFQA 2R8YA 2IPMA 2W2MA 5DB4A 5CDFE 1EGVB 1XTZA 8OHMA 2AEEA 1HYHA 1I4WA 2H1FA 3O0TA 2GFQA 3OOEA 4GPTA 4NLLA 3EHDA 1OHHD 2FJPA 1XCPA 2OZEA 3LLSA 4ER0A 1T1IA 1U5BB 5AVXA 5JS7A 1IRXA 3JCZA 5AVZA 3S70A 5ARBA 3EC7A 4JLSA 4LXXA 4YBRA 4G9GA 4DV4B 3KKZA 2RIPA 2YKGA 5G0WA 1Q3TA 5KQGA 2V59A 3F6PA 3HB7A 3LHDA 5LSAA 1AURA 4E7OA 2IOFK 2BE7A 4O4IA 1A2KC 1ZOLA 4JI5B 3HEMA 4QGFA 2G71A 2HTEA 4TQUS 1B6RA 3GC6A 4R01A 1P8AA 4WZBB 1AKMA 1ETHA 1SHTX 3ELWA 3BE4A 2AFIB 1BXGA 1XYGA 4AMYA 1DX4A 1R6AA 1VP3A 2FMTA 1CQIB 4CKXA 4DY6A 5A4JA 5CXXA 1N2IA 4ZZIA 4BJHB 1B0PA 1ZK1A 4FGWA 4RE6A 4BJ5A 5BUCA 1PZHA 2AC2A 2A86A 4Z7OB 1T35A 2EKZA 2C4HA 3I1JA 3LX8A 3FCXA 3Q8LA 1E0SA 3CG0A 1WU7A 2OA0A 3IKJA 2C20A 1YDGA 1UC9A 4EABA 3HRKA 4DR4B 1I5RA 4Q02A 2NWQA 3X1ZA 5IXYA 1PZXA 1RLJA 1YR7A 3FWZA 5E2BA 3LQKA 5F7JA 1NATA 3STUA 4CETA 3LGXA 3LDHA 3SKXA 4JKYA 1SPBS 2XNDA 4HQLA 1M2OB 3FVVA 3TWOA 1F2TA 1ISGA 4P53A 4RPKA 3A6JA 4Q9KA 3R0XA 3U31A 4F86A 4L6CA 2OUKA 2XKAA 1D5CA 1PK9A 2W71A 1QNFA 3G2NA 4NBUA 5FTWA 3EQ9A 3WNZA 4TSFD 2RHGB 5CPBA 1N0VC 3D0RA 4ZMRA 4YHHB 2ZB4A 3P5SA 1UDCA 3NTUA 4YCAA 5MGNA 4KR7A 4YJ3A 3A9VA 5ICCA 5K3DA 1L7RA 5F3DA 4LX0A 3UA4A 1KO5A 2VN8A 4IJ5A 2PRSA 3M6AA 2VQEB 4X1YB 2W0MA 4TLAA 4WN3A 4K7JA 4N54A 2PL3A 2WKRA 4I1SA 4PZYA 2J5XA 4I5EA 1EQAA 3BTUA 4EJ6A 1XR3A 1EXMA 4FYIA 1RVV1 2ZT7A 3BSSA 3OTGA 5T41A 4JBNA 3OLZA 4ZOBA 1N6NA 2H5LA 2P27A 1AB5A 4BJ1A 1IMJA 4DNPA 2WQZA 2UYYA 3LW8A 3BXPA 1AQYA 4KRYA 1K68A 5LXTA 3QXHA 3DE4X 3F5MA 521PA 1TTPB 1SXJA 3EXHC 3FDZA 1DJNA 5IH3A 4Z51A 5ICGA 3V80A 2PX6A 4FMDF 2V8OA 3SFZA 3NP9A 1AMNA 1F20A 2Q3JA 5JZSA 1FS5A 1VYTA 2P1RA 3EFOB 4UUBA 4YDRA 4F4FA 8LDHA 4ZT2A 1Q6ZA 1CVLA 2JEOA 2PTHA 3DPIA 3WI7A 1RWVA 1U65A 2ZSKA 3ZXUB 3I42A 1FXUA 2YRWA 4RANA 2PZFA 3W2HA 2G08A 3ZE2B 1A50B 1O6BA 3GVXA 10MHA 3HXTA 3OFSA 4H18A 1JIKA 5LZ7A 1JHYA 1CYEA 3WKBA 3CRNA 3DM9B 4C04A 5EUBA 4OY3A 1LRLA 2TS1A 3I92A 4N0DA 3LQ2A 2N1MA 2WJHA 3AUFA 4J4HA 3LVFO 5K4AA 2WWTA 4BP1A 1E7QA 5E3HA 1MDFA 1UJCA 1WU8A 2WHRA 4EY6A 1KSHA 4G1VA 4PLYA 3AF6A 1SCIA 1J8QA 1IYZA 1NYRA 2CCGA 2OK7A 5SZKB 3D4IA 1ONNA 4H7EA 4CQJA 1WMBA 2AD5A 1R2QA 3G9ZA 1C9JA 4J75A 3H8JA 3HQ4O 3ND7A 1DKQA 2GEFA 4FDTA 1DKNA 1SKQA 4QECA 4EA7A 2F1OA 2BC9A 1XD2B 3WIDA 3VSCA 3I5MA 1VA5A 3LPAA 1K5DA 2JI8A 2XGSA 3JQRA 3NB0A 4P3PA 3SR0A 3VTZA 4C2AA 4F6CA 3BF7A 3F6RA 4KDRA 4CM9D 3DYVA 5ALYA 1NFRA 2GN1A 2ZRPA 3TRKA 1GNTA 1WULS 1B0ZA 4ZCLA 1TKCA 3HSKA 4NV3A 4Q9NA 4R5HA 5F77A 5HKAA 3GEHA 3DMGA 4J91A 1OB5A 4I9NA 5HKOA 1Q92A 5KOJB 1W2HA 3ACDA 3H9JA 1LDNA 2ABWA 2C2KA 4XPIA 5EJFA 3AVOA 3AUAA 1E9AA 1VE1A 4X71A 4HDNA 1RZ3A 2ZJ1A 3SDSA 5IJAA 5JUWA 2JFVA 1P62B 1LDMA 2JI6A 4AW9A 3PEFA 4FP9A 5MF6A 3EIEA 1II8A 1DBIA 4JX8A 4M1TA 1J2EA 5BN3A 4ZOLB 5JSKA 3E8XA 3JAWB 2QIPA 1JIJA 2MSWA 2HK9A 3CIOA 3DKPA 2W2KA 2R00A 1E4EB 2O2HA 5K3FB 1QGDA 4X3OA 3PUJA 4DCCA 4G6ZA 3WGTA 2Y1EA 1DKMA 3G79A 1CS0A 2ID9A 3QI2A 5GIPE 2CLFB 1E94E 1ARZA 1J90A 5AJYA 1N4DA 4NJEA 3WP1B 2HCJB 5CX1B 4CLHA 4MVJF 5CA0F 3AKEA 3QNMA 1CLUA 1U6IA 1WTCA 4MQBA 1IQPA 2WVHA 5KVCA 3B60A 2XCRB 2BZ0A 4IFIA 4PZ9A 1ISMA 1N9GB 1BMQA 1KZ1A 2GBLA 2O7SA 4GI5A 4BQNA 2XJ9A 4YWHA 5CEJA 1G8AA 5KNCA 2F4VB 2PYDA 3GJ6A 1BVUA 2AF4C 1OOEA 1EDDA 5FP0A 4I0WB 1N2HA 2B3TA 2C5LA 4OA5A 1XVAA 3MUEA 1MO5A 2DPGA 3O8DA 3ITKA 4NJEB 3JASB 4WDQA 3ABRB 1OI4A 3S2FA 4LBZA 4S0ZA 4DXHA 3GG2A 1O95A 3WO0A 3PXAA 2KYRA 1NSTA 3N53A 3N2GA 1M8PA 1XTKA 2DWCA 5EUMA 3U48A 1A72A 2Y76A 2WT8A 4NZOA 5E3JA 2R6FA 2X9LA 3UZUA 1Z6QA 3LPDA 3EA5A 4UM9B 3KFVA 4WEQA 1IH8A 5G0SA 2YXLA 5JDIA 1HYQA 1P17A 4GX2A 4INZA 2XNKA 2PQ6A 5J5VA 3MA0A 1TU4A 2OGTA 4FBLA 4KZKA 5FO1A 5TF4A 1OVGA 3T34A 2PL1A 4XR9A 4RENA 4B9AA 4DBLC 3IBSA 3HFSA 4O29A 4Q05A 5IAJA 3V1LA 2IHTA 1Z5ZA 4ZVUA 4UD6A 4KAXA 3UC9A 2EJBA 2P3LA 4LJ9A 1OI3A 1KY5A 3R2JA 5JASA 4K9SA 2RAVA 1W5AA 2WKPA 3IP7A 3A3NA 3A04A 4B6PA 4QM7A 1BEUB 1M10A 1TA0A 2VSYA 2WC1A 1XXHA 2EKQA 2FPIA 1QAMA 5MDHA 3W5HA 2PBRA 4DA4A 1BVHA 2O7NA 4NJMA 3NPMA 1JS1X 5KQRA 1RDFA 1WCV1 1YAHA 3FCCA 4EY7A 4BO9A 5IUKC 2I8AA 2BLLA 3VDMA 5LMNB 4CTKA 1BQ4A 2R47A 5K5EA 4TVBA 1XTQA 1QV9A 1AQUA 3HVUA 2V7GA 3IUEA 4YRKA 4HLCA 1CS4C 3R5SA 4Y2XA 5IAAA 2I03A 2RHHA 5B64A 5K20A 4P5EA 1EGAA 3FA2A 1DJPA 1K5PA 1JR4A 5TPWA 3WE7A 1B00A 2P90A 5ALLA 1IXKA 2YZGA 2EKDA 4DSNA 2FSGA 2CLKB 3K4QA 4JEUA 5CUQA 3BXXA 4CRWB 3L77A 3UFBA 4DDTA 3HCEA 4FXPA 3AEKB 3Q2IA 1UZMA 2E7ZA 4D25A 2UVPA 4ZI7F 1RXCA 1BIFA 2PBFA 1Z4KA 3MMXA 3OJXA 1C9DB 1X2EA 5D3MA 2CXQA 1JQ5A 3T1HB 4KDEA 3AU9A 1IC6A 4U9IS 4A6DA 4JROA 3K0FA 3EFOA 1PZMA 4HGOA 3SR3A 1RZRA 3V8QA 3TW4A 4MW0A 2IXDA 1RXUA 3GD7A 3IAS1 2UYQA 2VPTA 1QVAA 2G09A 4RQAA 4JWKA 2WMNB 5ICSA 4KNYA 1XEWX 3C4JA 4ZXPA 1OKKA 1YHYA 1GAJA 2X19A 4RV4A 5EQTA 3TZEA 9LDTA 3D1LA 1UDRA 5F52A 3JQ9C 4Z0NA 3B1VA 4LEIA 5F73A 5I3CA 2BTQA 1SKBA 4FXOA 1YDEA 1JGTA 1J6UA 1OLXA 2VDKB 1JAIA 1FP2A 3IPCA 3QGMA 4OJKA 3A26A 1L5LA 4AM8A 2GPBA 2YN4A 1YJ5A 2W90A 2FKAA 5P8WA 2NO9A 4WY2A 2V9CA 1QFZA 1GPNA 5JI2E 1A0OA 1ZD8A 3NVKI 5CG1A 3QMWA 1LD3A 3GJ3A 1WB4A 2RSLA 1LPPA 2ZRQA 4NMLA 3TK1A 2FEOA 1WQ1R 4GBED 4BB5A 1DOAA 1EG7A 4WZBE 3AK4A 5JISA 1HQKA 3FSEA 3H1GA 3MBIA 3R5JA 1Z68A 2HJRA 3K4HA 1FUYB 4Y9RA 3QKWA 2WJIA 4HNAA 3E58A 2CUTA 1MZPA 3QJYA 2ASVA 3DTVA 1WE2A 1WF6A 4JP3A 1I0LA 2YMLA 2HUPA 3R5HA 4RUKA 4ZWNA 2FUEA 3VR4A 4EJSB 5E4TA 1IBMB 2GPTA 1K1EA 4G26A 1F3LA 5DM0A 2NP7A 2Q5JA 2RHWA 2X1MA 5DE3A 3NCHA 1HFEL 3GP5A 3H5AA 3OJOA 1V3TA 3TM4A 3TIXB 1DBVO 3W5DA 2BHNA 4H0CA 2UUAB 2POCA 1JLMA 2IYPA 1EAMA 2WWWA 3PDUA 2PEYA 5FJJA 5BSGA 3MWGA 3RTBA 2RCNA 3HNRA 1MO3A 4AJIA 2JLRA 1RYMA 2DX7A 2QZZA 4J3JA 4PIVA 5K51A 5LZ9A 3Q1LA 3IJEB 4IX1A 1ONSA 3TVDA 2CVHA 2IVZA 1N1MA 3A1VA 4FDMA 3IBCA 3OJCA 4QOFA 3JVVA 3VYTB 4ZQEA 2J67A 2O50A 5BW4A 1Z16A 2ZSEA 3P0HA 1M1YE 1YS4A 4E1VA 3SSAA 4DMUB 3VVBA 1ZCFA 1DHRA 4J0HA 4RACA 5FI5A 3DWFA 5L6MB 1Z56C 2ZBRA 3TW8B 4YVFA 3TBKA 1K3FA 4G23A 2XMCA 2K7FA 4B3GA 1I1QB 4GUDA 1X92A 4UBLA 2DFPA 1K7YA 2WYVA 1S8OA 3PUIA 4JITA 5J2UA 2C9CA 1C81A 4I9HA 1Z3IX 2E9SA 1ULAA 1CBUA 3DOHA 4O63O 3C48A 2WE7A 4N65A 3WQHA 4C4RA 2P9QA 2ZRAA 3O94A 4NWIA 1AHNA 3ESRA 1F51E 3FTPA 1G5IA 1X9GA 3ABQB 4W6ZA 4GAEA 1E5VA 4EUNA 3V1YA 5CM2Z 5F3RA 3HDGA 1PEKE 3X1YA 4S24A 5FUQA 2VJCA 4Q3AA 1W29A 3CRRA 2I0FA 4GD3Q 3TOXA 4NPHA 1FF9A 1B3RA 4XQCA 5JCOC 3FMVA 3T95A 3UK0A 2JD0A 1AJEA 4L6IA 1P61B 2I66A 1WUIS 1NBMD 1HRDA 1T5DX 3FBGA 3KLOA 2X9VA 4HBZA 3D0OA 2GEBA 1VHWA 4MV6A 4ERNA 2FR0A 2JZNA 1WF3A 3I2HA 1G8HA 4QDKA 3ZDYB 4ASUA 4QDUA 4MGKR 2ON6A 1D4FA 2PUCA 1RTTA 1IULA 2FFAA 4HDSB 3KQLA 1WIWA 3C6XA 1YR1A 4CL8A 2ODAA 1X7WA 3N70A 1ITZA 4HN2A 2N0SA 3RDPA 3EMBA 1NVWQ 2XCUA 3IAXA 2Q5EA 1M0SA 5FH9A 5KYYA 4J1TA 1R5OA 1O9BA 4X8MA 4DQLA 4J0DA 2C94A 1KO4A 1NW3A 2ZT8A 1GPDG 3FVTA 5A6SB 3BICA 2PD4A 4MQUA 5A0FA 5CFOA 1IZYA 1FOEB 1JUDA 2ODWA 4UMVA 4GLJA 1NOJA 1YA6A 1KY3A 4UM8B 2SNIE 1WMFA 4M8KA 4WLOA 5U4XA 3S2YA 1SVOA 2FK8A 4EH1A 2NPIA 3GNLA 2KWIA 2VHVA 3MUFA 3AETB 3WIBA 3PC6A 2GLUA 3F73A 5F7OA 1CR2A 3SK0A 4CMEA 2VH2A 2Y0DA 3EDMA 1QVRA 3LWBA 3CH5A 4XUEA 2CYCA 1ZH2A 1FNDA 1XTSA 1CT9A 3P9PA 4LXUA 1ECPA 5JSYA 5K3FA 3UJBA 4CI0B 4DNOA 3DV0A 1WMSA 1U8EA 1Y8AA 2O52A 5IYZA 3W5CA 2XZPA 3AU8A 4FVTA 4M88A 5ARCA 2EFGA 1J8MF 4R81A 5DNYB 4DJTA 3M9XA 3HCCA 4WXPA 3GUVA 4GO1A 4BMOB 3NKVA 4HDNB 1SCBA 2I1VB 1R0BA 3MLEA 3EPPA 4D46A 2NSJA 4OI2A 3NBQA 4DYVA 5BW8A 3D2CA 4KO8A 5C7IO 3G68A 4UVGA 3OCVA 3OWHA 2J45A 4WY8A 1NJ1A 1X42A 4LF4B 4F5WA 2YZMA 1O57A 3EVCA 3I32A 1E6EA 3SS9X 3D3JA 2BH2A 4GIBA 3QP9A 2Z08A 4HDCA 4URYR 1E6KA 2AN9A 4NP6A 3W9BA 4AU1A 2H1OA 5B7QA 5L9AA 2PZBA 3PHIA 2VHTA 5CX4A 1SCAA 4FD2A 1S1MA 2JLBA 2Q4RA 1DQZA 5B30A 4OXKA 2KQUA 2W6NA 3WDLA 5T4EA 4G5XA 3FIUA 3II6X 3M1YA 2G0AA 4TS1A 5E8RA 4MS3A 1HE3A 2O14A 2O6LA 2VJLA 2ZIAA 1BKYA 3QRWA 2DPMA 4C14A 1BW9B 1N3BA 3UMCA 5CITA 3TPCA 1HG0A 2L2QA 1X2BA 2V0NA 2JHAA 2YQ4A 3D6NB 1YVPA 5JCXA 1L7VC 1WAMA 4BMXA 2XRMA 4DJ5X 2WV7A 2IYTA 2J30A 5ALEA 3G6WA 1GZSA 1I6MA 2HDHA 1DQRA 2Q4EA 2ZJ0A 4C7VA 3C6MA 3BT7A 1GARA 2C59A 2CMFA 1LCIA 1QIMA 5DYYA 1SCUB 1SIUA 3HGMA 1SUCA 2GAFA 4K9NA 3DEYX 3KJIA 5KHAA 3H2SA 2CLIB 5K8LA 4U39A 3JPYA 1VYUA 2PKRA 3RRYA 4R71A 3QFTA 3U62A 3V4SA 1BCRB 1HFWA 4MVXA 3U9TA 1ND6A 2BVNA 3KPWA 2DTDA 3GT4A 4IUYA 4XUCA 4E5SA 1WB9A 4Q3CA 3ZE9A 1IN5A 1RQGA 4DCNA 1C4XA 2QT0A 3KOZA 2WTMA 2QJFA 4KWTA 4FILA 5LQSA 1YIOA 2QORA 3GAZA 3IR7A 4U2DA 1JP7A 4U7WA 4BMVA 1Z36A 4G36A 4U5XA 3ANNA 1KQ3A 2BZ1A 3OIFA 1N6KA 2A5DA 3D8BA 3EOBI 2OB2A 2QRJA 3EMDA 4LRQA 2UUCB 1XN1A 3QVTA 1KI3A 4MEJA 5FAKA 3GEDA 2JJ1A 1YS1X 3UAVA 1QP8A 1VA4A 1X7XB 3KKLA 5EE3A 3G17A 4X7RA 4HRAA 4ZAWA 3DTVD 3PHHA 3EPRA 4X1KA 2X4IA 3C2QA 4O5AA 1PK7A 5I9IA 2J6HA 4UNNA 3GBVA 3F8TA 2X15A 3RTDA 2H1RA 4P2GA 4ITVA 1JKFA 1J0CA 4M49A 2WF8A 4KU4A 1NLUA 5TPZD 1IXSB 1I2AA 4HD8A 3WHIA 1SVNA 2QNBA 2FW7A 1M5RA 2ZSJA 2QAIA 3H13A 3U6BA 3IUNA 2PUFA 1XDBA 2AJBA 5B1SA 4C4YA 1AF7A 2BBSA 4K9PA 4ZCIA 5AXAA 3P4UA 1JHMA 4MAAA 1FRNA 5DOVA 5GADl 3DWEX 2PK3A 5J5CA 1R74A 1NUTA 2VSQA 8AT1A 5I7UA 1AQJA 3HM9A 3OJLA 3JZDA