1HY3A

Crystal structure of human estrogen sulfotransferase v269e mutant in the presence of paps
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
289
structure length
287
Chain Sequence
NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human estrogen sulfotransferase-PAPS complex: evidence for catalytic role of Ser137 in the sulfuryl transfer reaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords ESTROGEN SULFOTRANSFERASE
total genus 109
structure length 287
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1hy3A00
4US1R 2A2ZA 1GNRA 2AD5A 1P3JA 2KJQA 4Q1EA 2ZJ8A 3MRSA 3SBEA 4JLMA 4URVR 2QSYA 2DFLA 2J7PD 5JHHB 1L7VC 2QRNA 1GG2A 1Z0IA 2BJWA 4LV6A 3VKGA 3P4YA 1P75A 3UMRA 1H8HA 1XD9A 4G0NA 1FFHA 5D3MB 2NO0A 3KQKA 1JJ7A 4HB4A 4JZKA 3VQTA 1EFHA 3MFYA 4YC7A 2F3TA 3C5CA 1P7CA 3WYFA 3OIYA 1W36C 4L5BA 3GLGE 3AUYA 2ZRJA 3TMKA 3FE2A 5JLJA 4CEIB 1MR3F 2JJ1D 4W9MC 2VH5R 3QVUA 3H86A 4TT3A 4YDHB 2XSZD 4PZLA 3QPWA 3SDZA 4D2IA 3W3AA 3PR1A 1Z0FA 3LBHA 3EPJA 1AKYA 4EJSA 4NP6A 1W4BA 3QJYA 2YOGA 1DEKA 4OI1A 1NKTA 2DFKB 2C03A 1KSGA 4W5HA 4N1AA 4XWKA 3Q3JB 4OJKA 1ZM7A 3FYHA 4N0EA 3FKQA 2PJRA 1RVDA 4DB4A 4L15A 2PH1A 5JRZA 2GEVA 2IS4A 4BFUA 1ETUA 1S3GA 2ZSFA 2DYKA 2IYRA 4TLBA 5F98A 2V6IA 4U02A 2IX3A 3VNVA 2W83A 1L4YA 5JZVA 1J70A 1T8UA 2YC2C 3I72A 4PQYA 4FD2A 2BBOA 2WPDA 4Z8XA 1X8JA 1JEEA 4KBFA 2Q21A 3BIFA 2CL7X 4MRNA 4PO9A 4DUGD 2BWJA 2ZSBA 1NLFA 1OFIA 4DLSA 4P4SA 2FN4A 3BXZA 3EXAA 2CXXA 2AHOA 2ANBA 2I1QA 2WWYA 2G77B 3TGPA 4LJ6A 1VCMA 5F9FA 1NF3A 2CHGA 4GT1A 4JSYA 4O25A 5CYPA 3AM1A 3DVLA 3LX8A 4C0KA 3DKVA 1D9XA 1U0JA 2QQEA 1BMFD 1M7HA 3HJNA 3FKSA 3K9HA 2JLYA 4GOJA 4HAXA 3UG6A 2O8DA 4WAUA 4NMMA 1R5BA 3OIVA 3VNUA 1KDRA 2QBYA 2WSSA 3ND9A 1II8A 2ZE8A 1AZSC 1P2VA 3EAQA 5JWHA 1SKYB 2V1XA 1A5TA 2VEDA 3PFIA 1I2MA 4BPBA 2HYIC 2FDCA 2I3BA 3HU1A 2X2FA 2FNAA 3RWMB 5ANRB 4A8JB 3NH9A 3AQ4A 1XEWY 4RY2A 1YZNA 2EFHB 121PA 3TR5A 4CRWB 1KK3A 2Y8EA 5CJPA 3FWYA 4M4SA 4P0TA 5JEEA 1D2EA 4L16A 2ZJ5A 1KMHA 1NI3A 2V54A 1QHXA 2ODNA 4NONA 1Z83A 3SQXA 2XTZA 2XXAB 3N2EA 1N3BA 1J7KA 3PEUA 1G3UA 1U9IC 4TTRA 5EJEA 1ZNZA 4B3GA 3GEHA 2BHRA 4B33A 4OHYA 3OZXA 4FXPA 1OFHA 4DDUA 1CS4C 2C77A 4MYTA 3EA5A 1XTKA 5TXGA 3U4QB 2F1HA 4LCBA 4LOAA 5DGXA 1ZIOA 2Z83A 2H17A 1FNNA 4NYIR 4KLZA 2QPTA 5HTKA 2EFGA 2RHDA 3KB1A 4GPTA 2VSFA 3BFVA 4IFEA 1JR3E 1Z6YA 2ZJZA 1JECA 4D4JA 4AY2A 2ZRDA 3QENA 4MYCA 4PC6A 2IYLD 4R2HA 3ND8A 4TLAA 1YQTA 3NIBA 4V0OA 4RFVA 1OIXA 4AKEA 2H5EA 3WP0A 1P73A 2ZRGA 4HAUA 1ZM4A 5JWOA 4MRVA 3THYB 1N0WA 1RYFA 4TL8A 2ECKA 4GI7A 1D2MA 1R4AA 1HYQA 4PO1A 2WM9B 1PV4A 2XB4A 4GZMA 4LYHA 2QAJA 4PR0A 1G8PA 1GWNA 4AI6A 4M9ZA 2D4HA 2FEMA 2VIIA 3TSWA 4IDPA 5UKDA 1Q57A 4OI4A 5K8LA 1LVGA 4QJ4A 2IYUA 4A15A 4D25A 1VG9B 3AGPA 5L3QA 1AKEA 5J4KA 2WMOB 3SHFA 1QDEA 2OCYC 2PX0A 1XTJA 1R0ZA 3C14C 4PPNA 3Q5EA 2HEIA 4KCGA 4JLKA 4BFWA 4GSYA 1KI2A 4MYUA 1Z0JA 1E9DA 3G5UA 2J45A 4URWR 421PA 5FOTA 1JAHA 5H70A 3KX2A 3MJHA 2AX4A 2QQ0A 4B2LA 4IOLA 5AJYA 2IXFA 3VR1A 1IAQA 4G5OA 3IIMA 4HZIA 1OXUA 1QF9A 2R6AA 2YJTD 4UXJA 1LS1A 3BE4A 2OLKA 3OFND 1NIJA 1KYIA 4PC1A 3NBXX 3C5HA 2P67A 1KSFX 1M8PA 3BERA 4PC2A 2OBNA 3AP2A 3KTAA 4PAMA 3WYGA 4JVNA 4W5WA 1CLUA 4X8MA 1GL7A 2WJJA 4TN1A 4DSOA 3LDAA 3T5GA 4ZIRA 3AKDA 2D62A 1OXSC 3T34A 2FOLA 3EG5A 3B6EA 1F2UA 4EUNA 2DPXA 1CU1A 2R65A 4IFBA 2JIZD 3ZS9A 4V02A 4JLPA 1E2IA 3FMPB 3W6PA 3W9YA 2JLXA 3NHBA 3CKLA 1P61B 2CVHA 1EFCA 2BJVA 2UZ3A 4A9AA 5IT5A 1UBGA 2FPMA 2ZRLA 5JJKA 2J0UB 4DCNA 2ATXA 2EQBA 1P2TA 4CEHB 4HI0E 3FTQA 3CRVA 2QSZA 4A0FA 1K5GA 3H84A 3UIEA 4M1TA 4LV8B 2VQSA 3CF0A 1N6IA 3ASYA 4US0R 4G5SA 3U3MA 1WMSA 4C0AC 2Q9CA 5CYOA 1B23P 1NJFA 3I62A 1NY6A 1II9A 1SXJA 4P3YA 4QOSA 1E1QA 2YVUA 4Q4HA 3LVRE 1E2GA 3TSOA 3F0TA 1RW4A 3AVWA 3CIOA 2F1RA 3FDIA 2Q6TA 2XNDD 3BBPA 1NN3A 5AJWA 4OHWA 5GVRA 3QEJA 3V4RA 4ZCLA 3A1TA 4PHHA 3VKHA 1SVSA 2Z4RA 4CEIA 1BKDR 1VTKA 4IVRA 1YR7A 1KSJA 3ZVRA 2RKOA 2ORWA 4JMPA 3IDQA 3THXB 4CDGA 2QAGB 1FUUA 2ZE7A 3AF2A 3GLFA 1ANKA 1CP2A 4YLGA 2MSEB 3ZZ0A 3I5XA 1NVVR 2D2FA 3L82B 2BBSA 5F9HA 4Q5IA 4PPQA 1QG2A 1E2KA 3QKSA 3AH8A 4QBFA 2HF9A 1WF3A 5H1YA 5AUPB 3TLXA 4JJKA 4XJXA 4OKSA 1P9WA 1UBCA 2GCNA 2YHSA 3I92A 3TNFA 3CX8A 2N42A 3UWKA 2HF8A 4NL4H 5L3QB 3B85A 2NTYC 5CDFE 1QVAA 2V7QA 2RGNA 3E5HA 1L8QA 2HYDA 4QRHA 1LB1B 1NSFA 1M74A 1GRQA 5HPYB 2VSOA 4TLCA 3THYA 4BASA 3I3SR 2MSDB 3QBTA 2FZLA 3UKDA 4BLRA 2B92A 2VHCA 1NSTA 3E1SA 2IXEA 1OB2A 2GCOB 1MO6A 3IGFA 1YR8A 4QJ3A 1G8HA 4TQAA 4EJSC 2JDIA 1G21E 4RZUA 3KQNA 3ZD7A 1F48A 3U7GA 4HUQB 3WBJA 4PSKA 1G64A 221PA 5EZ6B 3T1QA 1UBEA 4CYMA 3RRMA 2YV5A 4A0HA 2XGJA 4MRSA 1S8FA 2Q9BA 4IOKA 2Z4SA 2QORA 4EFMA 1GKIA 2A5YB 1WBDA 1OYYA 1DAFA 1KDOA 4ACBA 5BN5A 1W44A 1FQKA 1T0JB 1KZ7B 2JASA 2FPKA 2JLZA 3BB3A 4DIEA 1F2TB 4DHEA 4KLNA 1FW6A 2BVNA 3CX6A 1UFQA 1CEEA 3IHLA 1OIVA 3JZAA 2BIFA 3RS5A 1LFDB 5FOVA 3CX7A 4B34A 5FOSA 1N5KA 3T5DA 1XJCA 3C4JA 3DM5A 2RGCA 5DISB 4GOXA 2BEJA 4BLPA 3A4LA 4CT5A 4OK6A 4JS0A 5GADl 1G7SA 5FBRB 5HKKA 1Y63A 2HJVA 1PUJA 2QY9A 4D81A 1DTSA 2ZRIA 4M1MA 2X19A 1UEIA 4EFLA 4FMDB 4S2EA 3HP1A 4D0GA 1NMZA 5EQTA 1WP9A 4DDWA 3V4FA 4B3DA 2B21A 2O5VA 4DLYA 3RS7A 1VCIA 4AG6A 1JR3A 2Q0HA 4JBWA 1XEFA 3CPEA 4HB3A 4DLUA 1YKSA 1E9RA 3X1XA 2F43A 1G3IA 3NH6A 3T1VA 5JEDA 2GESA 3EPLA 3TH5A 1KIMA 3AB3A 3KKQA 1KZGB 1WXQA 3GLHA 3B2EA 5A5GA 1XMSA 4B71A 4OQMA 4PHGA 2CDNA 1OFUX 4PZZA 2YYZA 3TIFA 1VMAA 5KSYA 3GJ6A 1K6MA 5D3QA 3U6KA 1RIFA 2GEDA 3HYRA 2WIAA 5AWFC 4HB0A 1N5JA 2CJWB 4DLVA 2EWVA 1PLKA 4C9BA 1GRRA 5KHOC 4DCTA 3P4XA 1XPRA 3P1JA 1OFTA 1R0YA 3GFOA 3ZZTA 4DDVA 2HXSA 1KY3A 3QF4B 5JSZA 2W00A 2W0SA 1NKSA 3M1IA 2KSQA 3PJRA 1YZUA 1ZCAA 3HR7A 2BOVA 3QG5A 4D0NA 5A4JA 1Q3HA 1OV4A 1U99A 5GJBA 1E96A 1H8HD 4IVPA 5BWMA 2FMXA 4JKYA 3WNDA 4JLBA 1T3HA 3D6TB 3BB4A 1KI8A 1L2TA 2BM0A 5GJCA 1D5CA 3PEVA 1UAAA 3KKMA 4KFRA 5KYKA 4DLTA 3PQCA 1E2PA 2CEAA 4RZ2A 4KFUA 2IW3A 5DHFA 2BEKA 3NBFA 2WZQA 3LBIA 1IN7A 4EJSB 2AFIE 2FE4A 1XTSA 3KB2A 2JJ1A 1HH4A 4XSGA 3LRPA 4JLDA 4P4SB 3IBGA 3THOA 4YQFA 2FF7A 3GMTA 1Q1QA 1FPMA 4V0NA 3I73A 2OEPA 3K0FA 4Q4LA 2GCPA 4BUJA 1NIPA 1IY1A 4BFSA 1K5DA 3PCRB 3ZVMA 2A5FA 5TARA 5K8UA 3I61A 3M4YA 2FJUA 2B8TA 1LNZA 4XTRA 1WE2A 4NE2A 5AK0A 2QMUA 4ZDIA 3KJHA 5FH9A 2C9YA 2W2VA 4FCVA 4LK2A 5AUQA 3U5ZB 4QHSA 4ZIRB 1GL6A 2FV8A 1UKYA 1JJVA 3SYKA 4QHYA 5TDHA 3GLIE 4B2IA 4TZ0A 4K8OA 3U3JA 3U7HB 5JJLA 5EP4A 5G41A 2O8CA 2FGKA 5LB4A 2VP0A 2VF7A 5CIQA 4G3XA 5K8IA 2QU8A 2IYVA 3SC3A 5KNDA 3MGCA 3KZ1E 4XD7D 1KNXA 1ZC3A 3VR5A 2ATVA 1GZSA 2BCGY 5DO9A 2OFWA 2W0MA 2ZI3A 2P0EA 1TU3A 2DWPA 3AKEA 4ITRC 3M6AA 4MKIA 3O8DA 5B64A 1KK0A 5IHPA 5A0FA 1XJQA 4BRWA 3KQHA 3PG5A 1H65A 2D06A 1N5IA 2JLRA 1KK2A 4IJMA 4IXMA 1XJ0A 2DHRA 4QGHA 3K70B 2GXAA 3IPXA 1TPZA 2OZEA 2GNOA 1XCPA 1XF9A 1MABA 1MV5A 4A4DA 2PBRA 1RJ9A 3S1AA 1G7RA 3Q9LA 2HXYA 2JATA 3QY0A 2OE2A 2YNMA 1KO4A 1N6OA 2P6UA 3Q5DA 4TQUS 4EIWA 3W8NA 3CBQA 4WZ6A 3TUJC 1NLZA 2FSGA 2FFQA 1DE0A 3EPHA 1Z6AA 2A3RA 1PJRA 1KTVA 3PV0A 4B44A 1W48A 1JQJC 2JLUA 3QVVA 2N1BA 4Q48A 2IHYA 3I8XA 4URYR 3DOFA 2V1UA 1W4CA 5L8VA 2O0HA 3ZH9B 3HPQA 4DSNA 3K0SA 5JI2E 2IS2A 3KFVA 3LA6A 3VTKA 3ZIAA 3UMFA 4PHFA 4UKDA 3WY9A 3L0PA 1SXJC 4KI0A 2QT0A 2JJ8A 4ZPXA 1E94E 4TSFA 1TMKA 4O3MA 3K0AA 4A82A 3F5FA 2LKDA 4Q4JB 6Q21A 2IA5A 1C9KA 2ZRNA 2GCOA 3KUDA 5JCZA 4PANA 4OHXA 1FP7A 3WNBA 2GJKA 4KBGA 1CRPA 3EIQA 2P65A 2ODBA 1I4DD 1SXJE 4RCZA 3RAPR 3VR2A 1ZD1A 1OLOA 1NP6A 1IBRA 4A8JA 2JLWA 1R0WA 2AXNA 4GFDA 5KDOA 3RDPA 2O8EA 4AWXA 4BFTA 1XMVA 2JJ2D 2CNWA 2JA1A 2O52A 2ZE5A 4E03A 1VHTA 3GJ4A 3SZRA 2ZS7A 2F9MA 1E0JA 4IKEA 2AXPA 1HE8B 1T4GA 2ZJ2A 2GA8A 2ZYTX 1PLLA 1GKYA 1M34E 2OCAA 4JLOA 5FI1B 1S9HA 1R6BX 5FL7A 5GJVC 4ILEA 3RC3A 2QT1A 2JLVA 3IEVA 3T35A 4POAA 4YDSA 1KO5A 3W8RA 1R10A 4PAQA 4AD8A 3CPHA 1ZYUA 1UDWA 2AKAB 2EFEB 3T1TA 4L9WA 3L0SA 4WBSA 4IRUB 1SHZA 2OHFA 2R2AA 2VP6A 1TEVA 3R7WA 1VG0B 4C30A 5JCPA 1QHSA 1B0UA 3B1WA 4UNSA 1N6NA 1JXOA 2XTMA 1KI1A 2AFHE 2OCPA 3BB1A 1VYTA 3ETLA 3LFUA 4GRAA 5KUTA 5FBLB 4Q9KA 1UPTA 4DLRA 5FPYA 4TTQA 5C4MA 1ZC4A 4PAOA 3A1UA 8OHMA 2OAQ1 1XZQA 1G3MA 1IJEA 2ZEJA 3PEWA 4Q7JB 4B3FX 2C8VA 4OHZA 3A1WA 1ZNWA 3MWYW 4OK3A 1KI9A 1YZLA 1P72A 4TT3D 2XSZA 4JT4A 4TMKA 2IYQA 2BV3A 4JVMA 3TSZA 2FGJA 1N25A 1MO3A 2WWXA 5LBIA 2IWHA 2ZYUX 3OHMA 1F2UB 2ZRPA 2ZJYA 1MO5A 1VECA 2GRJA 4O2RA 1HURA 3IILA 1VHLA 4HDOB 4XTCS 3NKVA 1P9RA 3KXLA 4Q03A 1VPLA 2YWFA 4ZO4A 3UMSA 2REOA 2ZQ5A 1ZM2A 2ODWA 2QP4A 4PC7A 2MMCA 4GMXA 1J90A 2FH5B 1EFRA 1E32A 3GJXC 3I32A 4IOJA 1P4SA 1TQ6A 5IRCD 2JIZA 1E69A 1MO4A 4O0MA 3T1OA 1WB9A 2A7QA 3ZGXA 2MMGA 1TU4A 3GLHB 4R9UC 2F55A 1W47A 1UJ2A 3PUWA 1ZP6A 1CJMA 1AA9A 1KOFA 3IBYA 3K0CC 5KDDA 2IXGA 4RD4A 4A8JC 3NVAA 4Q02A 2E87A 2F1IA 2P5SA 4Y0VA 1SHKA 5DLQC 3DKPA 3CF2A 1KHTA 1KKLA 2CHVA 2RCNA 1BMFA 3SQWA 5E4FA 3QBVA 3DMNA 5KPJA 1EWRA 4JBYA 4Q9JA 5KNBA 3RANA 2QMEA 1JALA 5AR1A 3LNCA 2IYYA 5E7IA 4J0QA 2DCUA 2XNDA 1GDDA 4BFZA 2IK8A 4LSGA 1DG3A 1T5IA 1U8ZA 4MRPA 1Z2CA 1DAKA 1G3RA 1Z0KA 4OI2A 4I81A 1DAMA 2GDJA 4UJ5A 4ZCMA 2EFDB 2W2TA 4BLSA 4I99A 4KHZA 2ZAMA 4C0LA 2WSMA 3C8UA 5JS7A 3U4QA 3LD9A 4EPTA 5DYGA 2ZU0C 1MRNA 3AF3A 3H0KA 3GCGA 1VCNA 4DLZA 1ZMXA 4JLNA 5FPKA 4LJ8A 4Q9HA 1QG4A 1JBKA 3CZPA 3KL4A 2AK2A 2QGNA 4OHVA 4A0RA 1PVOA 2VSXA 5FBWB 1OXTA 4TL7A 3A6PC 2XXAA 3R9XA 1IN5A 4D0LB 1YVDA 2BMFA 4KODA 4LJ9A 1W7AA 1W46A 1R8QA 2KWIA 3AVUA 1AGRA 2PEYA 3K9LA 4KU4A 1ZINA 5HR5A 5DSZA 1CR1A 3SR0A 3BH7A 1BYIA 3GLGB 3FVQA 3Q7QA 1W36D 3CRMA 3EZ9A 1WBBA 2PJZA 1P2SA 2GBLA 1RE0A 1XU4A 4PSAA 4L4UA 2I4IA 2E9SA 5CIWA 2AD1A 3CO5A 3AVVA 1GUAA 4FCWA 1KMQA 4ESHA 5ELXA 3ZZUA 1KI3A 3RWOA 2G6BA 4XWOA 1F6BA 2H1LA 1N5LA 2PT7A 4IDNA 4LX0A 1QHNA 4BFVA 4EDHA 1MT0A 3VU9B 3JZMA 2QBYB 1GOTA 5G53C 5BQ5A 1NG9A 4F4IA 2FZ4A 2GJSA 2ZIAA 2ZRAA 4DRZA 5BW8A 3GP8A 3QG1A 2WJGA 2QA5A 2HCBA 5JMTA 3SS8A 1N6RA 4Q4AA 2R6CA 1W0JA 4MKGA 2GKSA 4HLCA 4RZXA 1A1VA 4IDQA 5J5CA 1IXRC 3ECCA 3E2IA 1OW3B 1YRAA 4GMDA 3QKRA 1E9BA 2C95A 4Q9IA 2V3CC 2ZR9A 3PIRA 2OG2A 1QZXA 1VCOA 2VRWA 3AF1A 2BMDA 2FG5A 2WWWA 3UG7A 1XTQA 5DI3A 2ZR7A 1YRBA 3ICQB 1GITA 1GL9B 4LI0A 4V0LA 1G8YA 1IONA 1G41A 1N6KA 2RGGA 4LBZA 1U8YA 2IL1A 2NOAA 4JBXA 5DN6A 5FPTA 3AP3A 1KI7A 4Q00A 5B2ZA 2FFBA 1IHUA 2QP9X 5HKKD 1S1CA 4GDFA 3KTAB 3RS0A 4A92A 3GPLA 2X77A 4WW0A 5IK2A 3NEYA 1FTNA 3BGWA 4BFXA 4CVNA 2GXUA 4FI3C 3U6BA 4C4PA 1X8KA 4C0HA 2QP3A 1AM4D 4CEHA 2QEQA 5FOXA 4O2LA 1D2NA 4Q1CA 4LC1A 4NCJA 4S35A 2F9LA 3GEEA 5SZIA 5DI3B 4U7DA 1JR3D 5FI0B 4YMUA 4MKHA 4Z54A 3HYTA 5M04A 2G0NA 3MG9A 1YHNA 1JPNA 1YJ5A 2A30A 3ZLJA 4C2TA 3LY5A 4RFSA 4G5RA 4LBWA 4V0KA 2ZI9A 4M53A 3A1SA 1COWA 1E2MA 1OH8A 2JEOA 1GP2A 1GRNA 2J1LA 1SVIA 5HZHA 3RNLA 4YMTA 4R98A 3VR4A 1DPFA 4WXRA 1FX0B 3CWZA 1IOZA 1SVMA 2PX3A 5KSZA 4ZI3A 2G1JA 4JL5A 2QG6A 2WBLC 4XSHA 2YWGA 1HE1C 3AVTA 3VR6A 2Z5FA 3W6OA 1E1RD 4ZI2A 3KUCA 4H1UA 3UANA 2ZVQX 5DNYB 4URZR 4LWZA 2AL7A 2ERXA 2A9KA 2G83A 2J3EA 3K1JA 5TVKA 3CNNA 4B2PA 3GJ8A 4D80A 1JNYA 1GSIA 1QBKC 1SXJD 3EA0A 3EASA 4NYIQ 2I1VB 3OIUA 4IVQA 4LHXA 3SE0A 3OEHA 4NZYA 3KKNA 1CIPA 2GXQA 2QNRA 4BZQA 2GF9A 3GEIA 3QIAA 1YU9A 1UKZA 1E9FA 4M1SA 3TQFA 1ZNYA 2ZRMA 4K46A 1QHHA 4OQLA 2D3WA 3CONA 4ZDJA 4WIAA 5DH9A 5CK5A 1HUQA 3LXRA 2CCGA 2J59A 1HEIA 1E4VA 4LYJA 1ZUNB 4ON9A 2IYWA 4Q7LA 4H1VA 1XNJA 2L0XA 3L2OB 1MH1A 5J40A 5KPDA 5FFMA 4ZDWA 5EE0A 1O87A 1RRPA 1OPXA 1TQDA 4HAWA 3HU2A 1CTQA 3FPAA 1HQYE 1P2UA 2QUZA 1KNQA 3UK6A 3NDPA 3Q7PA 4AKGA 1T3LA 4BWYA 1OKKD 4FMBB 3RYTC 1UEJA 3FOZA 3O8CA 3LW8A 2VL7A 4U00A 2N46A 5CM8B 2PL3A 5CJ2A 1V5WA 1U0LA 3DL0A 4DVGA 4XD7A 5HE9A 3VMFA 2GAAA 1NMXA 1I4TD 2V7QD 1JAIA 3GJ5A 3EPKA 3U7FB 2XNSA 1NBMA 5FTNA 2YZ2A 4TYNA 5CITA 5KTYA 3DMDA 1CR0A 3SYLA 1QHYA 2ASEA 5JRJA 1EXMA 3QKTA 4DCVA 3GQBA 4LJ7A 1A2BA 2XB2A 3JVVA 4FCTA 3Q85A 2DY1A 1U94A 4YMVA 5FR1A 5FR2A 4NKRA 3EZ6A 2G0TA 2BKEA 3PEYA 4TL6A 5TB5A 2D7CA 2WWHA 4TMZA 3MSXA 1NG1A 1E0AA 1LTQA 1IY2A 1OYWA 2VP2A 5JI3E 1RRFA 1G5TA 2WVJA 1UM8A 3B5JA 3IPYA 2PZEA 4X8OA 3LW7A 2CBZA 2C2HA 3QE0A 3HPRA 1U8AA 2OFOA 3AVQA 3FMFA 2RGBA 2WJYA 1J99A 1NRJB 3W6NA 1I2DA 4TYPA 5FTKA 1XCMA 1IN8A 1W0KA 3B7GA 2J7KA 1G5PA 4ARZA 2GEUA 2ZPTX 4QFMA 2DWQA 2F6RA 3O8RA 1DELA 2W6JA 3KQLA 2H18A 1LW7A 2PZGA 4BLTA 1G6HA 1X3SA 3QXSA 2JLSA 4TWZA 3ZVNA 2NG1A 1JB1A 1NN1A 2BMJA 1P9NA 2HJGA 4NCKA 5E7MA 1H8ED 1Z47A 2A5JA 3FMOB 5CLQA 5HE8A 3SYNA 3R9IA 5EXPA 2RHMA 3A37A 3L0OA 3SBDA 1Z29A 5L3SB 1XD2A 4DT1B 4LHYA 1G4UR 2CK3A 2O8FA 3THWA 2REBA 2GK6A 3W90A 5EE3A 1FUKA 3TUZC 5FUXA 5L3SA 3T12A 1C4OA 3R7WB 4CW7A 1A2KC 4GBMA 3WYAA 4W5JA 3BH6A 4EPWA 1DAGA 1Z3IX 3DHWC 1WQ1R 2IYZA 3EARA 3CB4A 4FMDF 1N6PA 4NCHA 5L3RA 1Z8FA 2WAYA 5EE5B 4C0BA 2D2EA 1G17A 4BFYA 1VKJA 2IYSA 3IQXA 4KVGA 1SVOA 5B57C 3N5CA 5KDLA 4AKIA 4LHVA 4CF7A 2Q9AA 3LVQE 1MKYA 2PMDA 2J0QA 3TJZA 1E2FA 2VHUA 1A7JA 1KDTA 2W6IA 1W49A 3PITA 5EE9A 4Q7KA 2XOKA 3WMFA 3U61B 1D6JA 2O8FB 5H68A 1IN6A 3VKWA 1UDXA 1J2JA 1KK1A 3TW4A 4CZ2A 4FINA 2B8WA 2EU8A 2GAOA 4Q1FA 4CIDA 4Q1AA 3HDTA 4HEJA 4EQ6A 2F43B 4GP7A 3RS4A 2AWOA 3W34A 1D9ZA 1NBME 1FL9A 2GBLC 3LWNA 3H2YA 2E1RA 2VYFA 1S1MA 3R8CA 4II7A 4LY6A 1JQLB 2UKDA 2OXRA 4IDOA 4BLOA 5C4GB 1X1SA 2ZI4A 5D3MA 3QUSA 2WWGA 4QHTA 1X86B 4F4JA 1AS0A 3RS2A 4OQFA 4HDCA 5C1BA 1X6VA 2YINC 4EPVA 4TLEA 3CF6R 4PX9A 4TMTA 4HAZA 3REFA 4A6XA 2ODEA 4F93B 4D26A 2EW1A 4AG5A 4XVRA 2ZRFA 2RB4A 4A0GA 2IEYA 4PHTA 4US2R 4UNQA 3SJBA 1U0HC 3K0AB 4N0DA 4WVFA 3QKRB 4PPGA 2XAUA 2YWEA 3B78A 4MITA 2VLIA 2PT5A 2YWHA 3K09C 3VX3A 3QNUA 4TMWA 4C0QC 4DXAA 2KBEA 1CJKC 1XX6A 3BH0A 4FW9A 4RZ3A 1YR6A 3DEFA 2WTUA 4Y0AA 1GILA 1G20E 2PLFA 2RGAA 3C41J 1AK2A 4LZZA 1G18A 3SFVA 3MAAC 2V4ZA 4B75A 5CM9C 5DIFA 1EFRD 4P31A 3MWJA 1N2CE 1QHGA 2IYTA 2KB0A 1XMIA 2KI5A 2OLJA 2WHXA 2ZITA 4XWAA 4DIDA 3LQQA 3VX4A 1TF7A 2O0KA 4FIDA 2DFTA 3M0EA 5J4VA 4OQXA 1DO0A 3MCAA 4X8LA 4ABYA 3AGQA 4ZKEA 3FGNA 4P33A 4Q21A 2CL0X 1TADA 4HATA 4IEIA 1OT3A 2NO1A 2ZTSA 1T9HA 4QGFA 3LLMA 4PQRA 1FOEB 2P2LA 1W36B 4XOIA 1Z08A 2J41A 4M8NE 4Q7MB 2AK3A 1DAIA 1XXHE 4B43A 1NN0A 1T0HB 2HLDD 4G01B 4LRWA 3EZFA 4AC9A 4B32A 3X1YA 5LD2C 2AN9A 2GHIA 2GVZC 2H7VA 3N70A 1HTWA 2R8RA 1M6NA 4F91B 1G6OA 4TZ6A 5J4HA 2JAQA 2IUTA 3LXXA 4ASUD 2XTNA 2GJ8A 1E99A 1M7GA 1VYUA 3KFXA 1W2HA 3GLHE 1XEXA 4M1WA 4ZV4A 3QPVA 1XEWX 1Z6XA 2RGXA 2F3RA 1VIAA 2VTKA 4HZUB 1QHIA 1OH5A 4WXPA 2QM8A 3BORA 1TUEA 2BBWA 1GM5A 1S2MA 2ZETA 1L4UA 1DBSA 3ZIAD 2H92A 3VHXA 1OHHA 1R2QA 1ZNXA 3FFBA 4NDZA 5EP3A 4PQFA 1Q21A 5BYKA 1ESNA 1FP6A 1GKUB 1NVXQ 4HSEA 4KITB 1FZQA 2VPPA 4B48A 5KOYA 4C7OB 1IM2A 3ONWA 5GJWC 1SGWA 1U98A 5CB8A 2YOFA 2IS6A 2HT6A 3KJEA 5G3YA 1AQYA 5F2EA 1SXJB 4DKXA 2QE7A 4EAQA 1M1YE 5BN4A 1CKEA 4QC2A 3EC2A 4LGMA 4JKIA 1J8YF 1HQCA 3SI7A 2FSIA 3B1XA 4GL2A 1U9IA 5L3VA 2BKUA 3GJ0A 2ZS9A 2JJ2A 4LHZA 4D82A 1CJVC 2ZANA 2W2XA 4NYJQ 2B7CA 4JSTA 1M7BA 3AVOA 3ZYCA 4FWTA 3B1ZA 3OAAA 4RD6A 3A36A 3SU8A 4MRRA 2BDTA 3IHWA 3BOSA 4QM7A 1LF0A 4URXR 4DCSA 1LS6A 1EX6A 4URUR 4E09A 4L8GA 2WWIA 2UZIR 4GOKA 2H57A 4PXAA 1FNMA 1CJTC 1YZTA 1E0KA 3EZ7A 4B3XA 2WJIA 3EC1A 4B74A 2RGEA 1P6XA 2OFXA 3K70C 3NDBB 2ZS8A 3RHFA 1OXVA 4FN5A 2VO1A 4PC3A 4TTPA 4YXWD 2GXSA 3HU3A 1OB5A 3L43A 2IT1A 3X1ZA 2OBMA 3UXMA 2R6GA 4M9XA 1S3SA 3DZDA 5DN6D 1CJUC 3PUYA 2BMEA 4LJYA 1E79A 4NPHA 1G4AE 2HDNB 5AUNB 1IY0A 2J0UA 1U81A 5JS8A 3A4NA 2Z0MA 3BJIC 3GLGA 1TL7C 2J0VA 3O8BA 2QN6A 1VYVA 1Z5ZA 4CGZA 4MA4A 1DG1G 2F7SA 1SULA 2ZRBA 4DBLC 1XTRA 1AQUA 3GLIA 5BYJA 3TQCA 4W7SA 4P4UA 1OJLA 5JWRA 3SEAA 1Z07A 1BS1A 1OF1A 4C2UA 3U7EB 2C04A 1UADA 1FTSA 2QI9C 3CRW1 5EP1A 3I4LA 3U3OA 2FA9A 4TQ9A 4JL6A 4UQOA 3OEED 4DEYA 2YKGA 2NIPA 1AGPA 1AS3A 3CRRA 1G5RA 3MLEA 2A5GA 1E9CA 1ZCBA 4M1KA 4JVLA 1T91A 1E4YA 5GVSA 1KI4A 1VG8A 2JCSA 3MD0A 3B1VA 1YE8A 5HCIA 3RSLA 3I5YA 4H9GA 3PENA 4HUQA 4KSBA 4QNMA 1X8LA 3WMEA 2EFCB 4P32A 4HYYA 4E5UA 2XZOA 3CRQA 3FMIA 4M9QA 4DDTA 3RVBA 1DARA 1WRBA 3B9QA 4HZUA 1ZRHA 5TV2A 3L8YA 1GFIA 1KI6B 1US8A 3WRYC 2GF0A 1GNQA 4IW3B 5EXTA 2GZHA 4DC9A 4YMSA 5C18A 4Q19A 1CR2A 2J7PA 3ADKA 2JLQA 2ZVPX 3K8YA 4MDEA 4B47A 1O3YA 3UATA 3PUZA 4M9SA 1T8TA 3OEHD 3P27A 2DWOA 1ONBA 2NO7A 2QROA 2NO6A 3OESA 1DVRA 2QL6A 2G9NA 3NBYC 3WHKA 3SNHA 4WOPA 4EPYA 3D7MA 2ZR0A 1XTIA 1Q1EA 5CK4A 4RD2A 1XXHA 5B58C 1E2NA 3CWQA 4NYMQ 1TQ4A 1IN4A 4JLVA 5DE3A 3BD9A 3CPJB 2WKPA 3QKSB 2B7BA 2QAGA 1QHHB 5FUYA 3W5IA 4F38A 2GTPA 2GWHA 3LAWA 2C9CA 3TUIC 3GLIB 4RD3A 1CR4A 5HCNA 3MWLA 5KO2A 4DSUA 2ZJBA 5FPSA 1OXXK 3QXXA 3ZJYA 3IQWA 1RZ3A 3K0CA 4UNNA 3RLFA 1KJYA 2ZRHA 1LF5A 1OKKA 3VHLB 3FHOA 1CRQA 1FMJA 4B6EA 1F60A 2GK7A 5FOWA 3RRZA 3R8FA 4QBIA 3DM9B 3KJGA 3IEUA 1G16A 4PSVA 4JLJA 3AVXA 1QRAA 3A1VA 1KAOA 4M21A 4WZBE 1Y3AA 1Z22A 1ELOA 2ZI5A 3P26A 5DHAA 4U5XA 3B13B 2WPDD 4LYAA 4UXHA 3QEOA 1BH2A 4KYIB 1EGAA 4IOMA 4EQ6B 1R7RA 1BO6A 1XFAA 4OI0A 4DEXA 1N6HA 1Q20A 2OSBA 2WWFA 3T06B 1RKBA 4MGIR 2RAPA 1EK0A 1ZM9A 3QF4A 5JSZB 1G8FA 3FKSD 2WICA 3NXSA 1IJFA 1SQ5A 2RGNC 3SN6A 4TYYA 1HV8A 1W0JD 4Q9LA 2QRZA 4RKEA 5G40A 4ZDKA 4RSGA 3K0FB 1ZW6A 2LWIA 3KXKA 3OE7A 1M2OB 2YC4C 1NVWQ 621PA 2WKRA 1PZNA 4A2QA 4LJAA 3GLFE 3ADDA 3QPUA 4DJTA 4CEJB 2V8OA 3I1FA 1E2LA 3TVTA 3AVYA 1XD2B 3W3ZB 3X1WA 2W6JD 5AUOB 4HDQB 4DLWA 2CVFA 1ZBDA 5EE1A 3BWDD 4LYFA 4JIMA 2AWNA 2BCJQ 3K0EA 4UNPA 2RH5A 1P5ZB 4R71A 3QKUA 4JT2A 3WXMA 1KO8A 4NCNA 2JGNA 2J5XA 1SKYE 1UKVY 4JJZA 3J81k 5CDFA 4OK5A 3IKJA 3FFAA 1N6LA 2WOJA 4MYHA 3Q8XB 2CK3D 1DAEA 1VDZA 4NBSA 5IK2D 3KXIA 3RC8A 4Z1MA 2EYQA 4B3CA 4Q4JA 3GJ7A 2ANCA 3VAAA 5HZKA 4L9SA 4LBYA 1N0VC 2CHQA 1V43A 4LBVA 1W5TA 3K9NA 2UVQA 4N3NA 4Q01A 5TY0A 3RRYA 1ZIPA 2HUPA 2VF8A 5DI9A 4KYUA 5EZ5A 2Q3MA 2PCJA 1FQJA 2IEZA 3AEZA 4V0MA 2FSHA 4ARZB 4AURA 3EIHA 4FMCB 4KFSA 5SZJA 3WP1B 2DBYA 2QTFA 1EX7A 3FHCB 3R9WA 2QAGC 5FBQB 1TTTA 1E3MA 2XITA 5FOUA 1XPOA 1R0XA 2RMKA 4HAVA 5JHGB 1MOZA 4KO8A 2NZJA 3K70D 1CF4A 2R62A 3WMGA 1Z0DA 4OYHA 4ZCIA 1COWD 2CCKA 2CLCX 1ZD8A 4Z51A 2OCBA 1T3SA 4GZLA 1Q1BA 2GJ9A 2R6FA 3CLVA 3TR0A 4YMWA 4DLXA 1HT2E 4MDFA 4I1SA 4P4TA 2W6ID 3V9PA 3NWJA 1P62B 4HB2A 1F3OA 3D8BA 3CR7A 3NG1A 2WJVA 3KKOA 1PLJA 4BGDA 5AJXA 1RJ9B 2FPLA 2NPIA 1Z6TA 1MABB 3H1TA 4XVUA 1US8B 4KSCA 3LH5A 3AUXA 4IXNA 1KGDA 1GVNB 4M2LA 1Z2AA 1E1RA 3TAUA 1Z0AA 4GNKA 2BBTA 1RC8A 2WV9A 3EWSA 1R8SA 1TF2A 1DOAA 4NHOA 1TNDA 3PUVA 3KQUA 1KJZA 1S9DA 2J87A 5IF9A 4XH9B 1XXHB 2O8BB 1UBFA 3RRNA 3A8TA 2PCLA 1A4RA 1I4LD 3QXHA 1GIAA 5EUMA 2CMKA 4ACAA 2BC9A 4V03A 4DCUA 3F8TA 2NMVA 1NMYA 3TW8B 3U44B 2ZJOA 4LPKA 4HLUC 4M1YA 3G0HA 4KFTA 1OH7A 2O8BA 2ZRCA 4QXAA 5AJZA 2O8CB 3IO5A 2V9PA 4NYMR 1MRSA 3NBZC 1KMHB 2GVDC 1KO7A 1AS2A 3GFTA 2R6DA 1E9EA 3N2IA 2WIBA 3DZ8A 2ZI7A 3V00A 2QMOA 5J4LA 1HA3A 2IBMA 2ZXUA 4BEJA 3BFXA 3OFNA 3S1AB 1Q22A 1ZM3A 4Z8YA 4F92B 3EW9A 3GLFB 521PA 3TVDA 2EVWX 3REGA 1J8MF 4Q1BA 4M22A 2CE7A 3MMPA 3HWSA 1U90A 3D3QA 4Q66C 4GP6A 5EUQB 1YZGA 5F3WB 1AZTA 4HAYA 4IEEA 4LPSA 2ORVA 1XCGB 4BE7B 4M1OA 4NCIA 3SHWA 2PEZA 1S4QA 1BIFA 3AF4A 3W5JA 4E22A 4RJLA 1II8B 1NBMD 3P20A 5JFGA 1GNPA 1G9XA 4CEJA 4MGZR 4Q4HB 4I1OA 4DUGA 3AKYA 2C9OA 1G7TA 4MQBA 4BEBA 3FHTA 1K8RA 1NNEA 1JXMA 1SVKA 3KDSE 2P5TB 2REXB 2ZSAA 1SVWA 3AKCA 2MSCB 3R20A 2ORIA 3BS4A 4D4LA 2TMKA 2ZSEA 1N0UA 2CL6X 4TYWA 1T5LA 4RFSB 2FX3A 2HLDA 2PMKA 1WA5A 2ZYWX 2P6RA 1NL3A 2WSSD 2IF2A 1NJGA 2QTVB 1FMLA 2OXCA 2C98A 5LD2B 4CT4B 3CNOA 4ASUA 4HLQB 2NZ8A 4QKQA 1YZKA 4F4CA 2AR7A 1E2DA 1ZUIA 1W0KD 4AK9A 3AF0A 5DYIA 4BZXA 4F7WA 3THWB 2XX3A 4C0JA 4MH0R 1TUIA 1S0UA 5SZKB 4DZZA 3EX7C 4RD0A 2ZJAA 1T6NA 1E2JA 4YONB 2ZROA 3B9PA 4D4KA 1JEDA 4G5QA 1Q1ZA 3NC1C 5FTLA 3MWKA 3CZQA 2D7DA 1H8EA 1NVUQ 3ZS8A 4TLDA 4WZAE 3IIKA 3RS3A 5EXSA 4C0SA 3ZD6A 2HT1A 2IUUA 4MKFA 2XJ9A 4TL9A 3DOEA 1LV7A 3CH5A 4Q47A 1HY3A 2P6NA 4QJ5A 1RYHA 1OE0A 3ZQJA 2X2EA 2GETA 2K5UA 2NGRA 5B30A 5JBQA 3QF7A 4BQSA 1DADA 3TKLA 2FEOA 3H4MA 1KKMA 4HLUA 3SFZA 2QM7A 2RGDA 1S96A 3DPUA 5FPHA 3EWAA 5KU1A 2QGZA 5FUVA 1A82A 3EZ2A 3P32A 5TMPA 2VBCA 2NQ2C 4RD1A 4A1FA 1R5OA 4QL3A 2GZDA 2QENA 1W4AA 5EP2A 2H16A 1ZU4A 3U2QA 4EKDA 3FB4A 3AVPA 2WKQA 3QOFA 3SJZA 3UWOA 4AYXA 2SHKA 3IUYA 1KJWA 1XPUA 3LLUA 2LKCA 2P3SA 1EG7A 1F2TA 1UKEA 2NPFA 5IDVA 2FWRA 1KY2A 2GJAA 3L0IB 4KAXA 1Z6GA 5KSOA 2XOKD 5AJVB 3Q72A 4NU0A 5E95A 3X1DA 2QPAA 2ONJA 3JVUA 2J46A 4KXFB 4QG7A 3SJAA 4JYCA 3KKPA 4PPFA 2X1VA 2WAXA 1Q44A 2R9VA 2HV8A 3TBKA 3RABA 3ADBA 1XEXB 1E2QA 1VG1A 5KSPA 2OV2A 2VHQA 4QGAA 3WNCA 3CR8A 4MUBA 4LC0A 1XMJA 1IXZA 5J4YA 1P60A 2ZU6A 5CB6A 3LX5A 3CNLA 1ZD9A 4Q4AB 1E6CA 2EYUA 4OJQA 4AYTA 2VP4A 3KJIA 5JJIA 2ZUDA 1AN0A 1TX4B 2IF0A 1LY1A 4JYBA 2W58A 5C2JB 3U44A 1R5NA 2Q3FA 2WMNB 2XZLA 3NEJA 4D4MA 1CXZA 2G3YA 4LV5B 4AKHA 1NY5A 5EXXA 5FBVB 2OM2A 4RVCA 1D8TA 1WDTA 4KVAA 4A2WA 1KI6A 4X8HA 4BRUA 2C99A 2ZYVX 3CUEF 4XVQA 3TAHA 3SOPA 2IYXA 4I1UA 2DFNA 4JL8A 5KNCA 5K8TA 1TF5A 2XZPA 4QBGB 4Q1DA 2A78A 2KE5A 1XDBA 3LV8A 1TEXA 1ZVQA 4LHWA 3U3KA 4DB2A 1XWIA 3QXCA 1G19A 3OEEA 4EPRA 1ZAKA 1JPJA 2CLSA 4A6PA 3ZQ6A 4BLQA 2C78A 1KAGA 2FFAA 2ZREA 4NTZA 4KJZA 1DS6A 1XZPA 5CLLA 3B60A 4TMXA 1C1YA 3DO6A 5LPNA 4B76A 1XP8A 3OF5A 1DO2A 2R44A 4B6FA 2OT3B 2FU5C 1RRCA 1UF9A 3QI2A 4BZPA 5BN3A 1Z28A 2XJ4A 1EESA 1W4RA 3MJRA 2IC5A 3AV0B 3ICEA 4KV9A 2A5DA 2ZE6A 1QVRA 3E70C 4I1VA 3PXGA 2O8DB 3T15A 2FSFA 4V0ME 2GILA 1OH6A 4NYJR 1X1RA 4EFNA 1NN5A 1FX0A 2Z6VA 3ZDQA 2ONKA 3F3YA 3I8SA 1E0SA 4TMVA 2OAP1 2ZRKA 4R2IA 3THXA 4B35A 2G1KA 4UJ3A 1BYUA 1NLYA 1KDPA 3A4MA 2ZUBA 1Q0UA 3K09A 1E1QD 1ZU5A 4MGYR 3SJCA 2PLRA 3A58B 1II0A 2F1JA 4EPXA 1TAGA 1XD8A 4OBEA 2VP5A 3EIEA 2ZAOA 3K53A 3IIJA 4I4LA 4RKFA 4AIIA 2C96A 2VHJA 3WHLA 4NH0A 4LUCA 3ADCA 2VA8A 1CULC 3C7KA 4RCYA 4HLDA 2OBLA 3U3RA 3PVSA 1Q3TA 1WCV1 2EWWA 4QM6A 3DDCA 1ZUHA 4PZYA 5E3HA 4UNRA 2DB3A 2CLDX 5LDDC 3NTUA 2LCFA 1W1WA 2X8AA 3CW2A 3WBKA 3L8ZA 4FWIB 3TK1A 4A36A 4FMCF 2IS1A 1OHHD 1ESMA 4OQNA 3BK7A 4G5GA 3NHAA 2DR3A 4QGGA 5FUWA 3U60B 3UPUA 1ZJ6A 3IO3A 3OIWA 3GFPA 4AYWA 3ZVLA 2V55B 2QE7D 4LJ4A 1E2HA 3B1YA 3O47A 2OUKA 3LO5A 4IDHA 4UXIA 4B3BA 4Q18A 4JVSB 4C3ZA 1OIWA 2CJWA 4XIGS 1G7CA 5LB2A 2IWRA 2QPOA 2C5LA 2NO9A 1PUIA 1VIYA 2JDID 1XRJA 4A2PA 3VFDA 4DT1A 2B6HA 2H8KA 1G291 2ZUCA 3OAAD 4PO8A 1EFUA 2O0JA 3RSOA 4D6PA 2OILA 1G8GA 2WJHA 2VHTA 5FTMA 5FTJA 2ZSDA 1DAHA 1RFLA 3LBNA 4LDJA 2AKYA 1NVVQ 2J9RA 3LQRA 2GZAA 1KO1A 3WRXC 5C46F 3C15C 5G3ZA 1XBTA 4C7OA 3ASZA 1OSNA 3C16C 2FFHA 4PTLA 3OE7D 4M0LA 4ZKDA 1GAJA 2WOOA 5H8WA 1JR6A 4ESVA 2QMHA 1JI0A 1YZQA 4B73A 2O8EB 4E07A 2QZ4A 2IUSA 1AJEA 1ODFA 4BECA 3NC0C 4YXWA 4TYQA 2ZI6A 5SZHB 2V6JA 3CH4B 3X2SA 1F5NA 4PFSA 3VR3A 2G88A 1Z63A 2J0SA 3QXJA 4R7ZA 3QSYA 3CM0A 2OO7A 3K9GA 1XB2A 3D31A 3HR8A 1E79D 3MUFA 1EFTA 1E98A 821PA 4MUAA 5FL3A 5P21A 3VU9A 2HCJB 4G1UC 4MGKR 4TSFD 3TE6A 3TRFA 1E9AA 4QBHA 5E7JA 1Q12A 2QTHA 1SZPA 4Z1MD 2D74A 3BC1A 1IXSB 2CE2X 3G82C 4QNRA 5JECA 1E2EA 1KSHA 2PZFA 1HT1E 1GTVA 3BRWD 4DWJA 5BXQC 4ERNA 5J47A 4WA7A 2YOHA 2BM1A 4K81B 4JLAA 1W5SA 2CNWD 4HUTA 3AP1A 1W2GA 2ERYA 3B82A 4LJ5A 2CCJA 1IQPA 1E9SA 1G1MA 4OL0A 721PA 1EWQA 1SVLA 3QQ5A 1RRGA 1RPZA 5FL7D 3BFKA 3GJ3A 2IHBA 3PUXA 2XEXA 4IHQA 1Z06A 1TQ2A 3GD7A 1AIPA 1YR9A 2ZM5A 2KBFA 1CBUA 1SKQA 1U2RA 2OESA 1BOFA 2VP9A 2Z43A 3T61A 2Q3HA 4DSTA 3B8HA 1G3QA 3BAFA
chains in the Genus database with same CATH superfamily
1PF7E 1W8IA 1E62A 1GNRA 2A2ZA 2AD5A 3HVHA 2B83A 4R9NA 2ETXA 4KOEC 2YMQA 3U62A 4FKMA 3ZV5A 2ZJ8A 5A1TA 1DQZA 3SQDA 4URVR 2QSYA 4B6GA 1GGMA 3EVDA 2WG0A 1JJAA 1RYZA 3B3AA 3I2FA 5JHHB 1NPDA 2FWIA 2V9CA 5IW8A 1Z0IA 4LV6A 1EVEA 1IOLA 4H7HA 4HPJB 4IIUA 3MQ4A 1PV2A 4YALA 2VH1A 1H8HA 5IANA 2X76A 3NHUA 1NJ8A 4XM0A 2RJNA 2SBTA 4COKA 3UJ7A 2G9QA 4JI4B 3ABIA 2H06A 1C8LA 1JJ7A 3BDIA 5JT1A 3R23A 1DWOA 1FDRA 5NLLA 3MFYA 4XZ3A 1GPBA 4YC7A 5EWMB 4W5NA 1NXPA 2P6MA 4B7XA 4KXMA 1W36C 2VHZA 4CEIB 3FE2A 4EX7A 2HA3A 3C1TA 4WFQA 2VH5R 4CGYA 4W9MC 3H86A 3E6AA 5TPWA 3W4IA 3R7DA 3E9ZA 2XSZD 4R8VA 2XIQA 3RJTA 4Q3LA 4KW7A 2AMFA 4GRIA 3RJZA 3SDZA 2OXFA 4IJKA 4BJHB 5DM60 4J1NA 2CLHB 3JQGB 2JCYA 3IUBA 3PR1A 4JB8A 3B52X 3RVNA 4QXMA 1W4BA 1JFRA 3QJYA 1H1DA 1P6QA 2COKA 2YOGA 3BXGA 3C1UA 4CKBB 4OI1A 3KVVA 3E5MA 2DFKB 4MSUA 3QPBA 5H3LA 4GLJA 2C03A 4M1QA 3HB9A 1YE3A 1O96B 2HO5A 2PWYA 1SQ6A 3O8OB 3U4AA 1V11B 4FYJA 3N6VA 4KQ1A 4OJNA 1NTOA 1RVDA 4CLOA 3N2NA 2WA2A 5DU2A 4TWBA 4BFUA 2ZSFA 4E08A 2DYKA 3ZDFA 5F98A 4U02A 5IPFA 3I52A 4M1EA 3RSQA 1J8FA 4CMIA 1T8UA 1ZQ1A 3JQ7B 1T9CA 4P83A 3T5CA 5EJ8A 1ZL0A 3VNSA 1JEEA 1I6KA 5FDFA 3IXLA 3DL2A 4PXSA 4IJUA 5EUCA 3CLUD 1C9MA 1YU6A 1EUDA 4A2CA 1M5TA 2AHOA 1OZAA 2CXXA 2XT0A 4ER3A 2WWYA 2G77B 1Y6FA 3HFGA 1KP3A 3HDGA 4S1VA 4GT1A 1QC5A 4OHKA 2NU7B 4WK2B 1L7BA 4Z1OA 2O2JA 3LX8A 4KRFA 1DTEA 3DKVA 4GR9A 1D9XA 3QYPA 1BXGB 1L5VA 1QUEA 3UG6A 4NMMA 3UXYA 1W25A 1R5BA 3OIVA 3LTEA 1V8PA 3VNUA 4YJFA 1RTTA 3BXEA 1GA4A 1UFOA 2J08A 2QYHA 2WHYA 2ZE8A 1X42A 3O0TA 2DC1A 4KBYA 4K9QA 4WVLA 2M6KA 5JWHA 1SKYB 2YNMD 3PTZA 3URKA 3WYDA 2V1XA 4OJYA 2EX0A 4BKMA 5KWSA 2NT4A 1M0TA 1DKRA 4JA2A 3HJAA 4D8YA 4MLDA 4A8JB 1O1YA 2XNKA 4M0CA 4RF3A 1WEHA 3W1EA 3AEYA 2A0WA 3U0VA 4RY2A 121PA 4NBWA 1TUBB 2OD7A 2IELA 2Y8EA 4PO3X 2ZB7A 4RXMA 5JEEA 4JWTA 1QQ7A 1A4UA 4N8SA 4NONA 2V7BA 2YS7A 1MAVA 1Z83A 3F7MA 3OCZA 3AR8A 4PU0A 3OCJA 3BGSA 3WVNA 2XXAB 4L5CA 1XSEA 2R6ZA 4WY2A 1N3BA 1TC1A 1J7KA 3JASB 2HBZA 1U9IC 2ID9A 3JS5A 3EFOA 1QIJA 4GYYA 4MW5A 3RFXA 1M54A 3GEHA 3PCTA 1PZHA 3UJBA 3RUIA 4B33A 2I6FA 1EAYA 3MJEA 2YFQA 3OCVA 3EDOA 2BFOA 4NZNA 1A3CA 4LJRA 1K9VF 1Z82A 2ADOA 4GP9A 4YCDA 2WB2A 2GBIA 4EHAA 2NQ8A 1GPMA 5AM0A 4DA4A 5DGXA 2F90A 4FWBA 3VR2D 3OZAA 1RM0A 1JPVA 4NYIR 4KUGA 1E6KA 1U4SA 5F1KA 2EFGA 2NSLA 2FSPA 1T2UA 4IQ4A 5A4FS 4IFEA 5EHQA 1LDYA 3A04A 5KJEA 2IHVA 4ODIA 4D4JA 3TDMA 1OAAA 4AY2A 2ZRDA 4TV9B 1K2WA 2IYLD 1Q2XA 1PZMA 4DLLA 4QQNA 1YQTA 1JQAA 1VPVA 2AFHB 3OIFA 3PKZA 3R1IA 4ZO8A 1LDEA 5K0ZA 3BE8A 3DEYX 3WP0A 2YY5A 3EYWA 2ZRGA 3RQSA 5ADWA 1G5HA 3DNMA 1N0WA 3GB9A 4WKGA 3VGPA 3RYFB 2PZAA 3IBCA 3HE3A 1ZHOA 3DW3X 3VYUB 4P0PB 3PL1A 4AULA 2R6JA 3TI7A 1AU9A 1J0CA 2G28A 4DQUA 1M1ZA 2JGDA 3HJBA 1NE2A 1Z2NX 4PR0A 3VU8A 1GGKA 2ZBPA 1E4OA 2FEMA 5JUWA 1THZA 5D86A 3RK4A 2VIIA 2AB0A 2PR7A 5UKDA 4TTTS 4MUGA 5FIUA 4OX9Y 1LVGA 1W88A 1XCOA 4QJ4A 2C82A 1SNYA 2IYUA 3VO2A 4D25A 2EG9A 3AGPA 1JHVA 1EGHA 3R7AA 1O9HA 2W6CX 6REQA 5JDIC 4EG8A 1IG0A 2G9UA 1C3OA 5D8DA 4FB4A 1B2LA 2FRXA 3BHJA 4BNDB 2DQKA 4RV5A 2EHJA 3GQVA 3WOVA 3DFIA 7GPBA 1PTJA 4OXQA 1Z4NA 3IVCA 3C14C 5B4TA 3CVVA 3FB1A 4QUBA 4KCGA 5CNKA 4DIUA 4I46A 1KJJA 2CDAA 4E2ZA 4GSYA 3T9CA 2KQUA 3WSTA 2J45A 1M34A 4JEMA 6NULA 5FOTA 1JQ3A 3KTDA 1MN6A 4ZAGA 3ZGYA 4HEHA 2QTRA 3TW0A 2A1UB 3D0KA 3QVWA 4IOLA 5M29A 3VR1A 1IAQA 4G5OA 1UUFA 3IIMA 1DFGA 4HZIA 1OXUA 4YP6A 5FO0A 1OD6A 1DCMA 3QEKA 1USVA 1QIFA 1UPAA 2Z04A 4KEAA 2F00A 2IW1A 3X2FA 3BE4A 1G21A 4RYDA 3SQLA 3CE6A 4JA0A 10MHA 2MHCA 4MR9A 1JBQA 1NIJA 5GGXA 3SLGA 1F8YA 4PC1A 3LZ6A 5MHTA 3C5HA 1MG0A 4FOOA 2XDAA 4K2AA 1V2GA 2XLBA 4R7TA 5JD5A 3BMQB 1XDDA 2OBNA 1UBUS 3KTAA 4ZV9A 1KDVA 3RTAA 2H1FA 3WB1A 4LC9A 3ZXXA 3PC2A 4ZGBA 1UBLS 1SQFA 5J58A 1CLUA 1QBGA 4X8MA 4ER6A 1VE6A 3BMXA 3EFHA 3NJRA 3SDSA 4ZIRA 2XODA 1CLEA 3DJYA 3IERA 2RCYA 3T34A 3O8QA 3DEIA 4OAQA 4ARIA 2Z08A 3OFSA 3RLIA 2ZBEA 5KYYB 1X19A 2COUA 2M1ZA 2NNWB 2OORA 4C76A 3QPDA 3X43A 2O59A 4DILA 3FOFC 3W6PA 1E2IA 1KJ8A 3A6ZA 4RNDB 3W9YA 1EQAA 1S3IA 2J3DA 1N77A 3C4VA 3CKLA 4YRJA 2BJVA 2UZ3A 4UFPA 5IT5A 1J97A 1K5HA 2ZRLA 3GAFA 4D98A 1RYEA 1TD1A 2EQBA 1UP7A 1MQ8B 3O8QB 4DARA 3FTQA 4DAOA 3IEKA 3VZCA 3VDMA 4A0FA 2HU7A 2AS0A 3EOAI 4ZTBA 4YCJA 3UIEA 4OXRA 3HUFA 4C4RA 1TW3A 4F3YA 2R751 2VQSA 3CF0A 4Z99A 3IQHX 1I0IA 3CMMA 4WK0B 4Q34A 1WMSA 5HIJA 4EW1A 2O0MA 1C9EA 1E60A 2Q9CA 1W85A 3OO0A 1YASA 2P9TA 4PYIA 1NJFA 1NY6A 2IYFA 4RVFA 1II9A 1SXJA 4P3YA 2JS7A 4PS1A 1IRIA 3ZG6A 3UAGA 1K7SN 2MTBA 3TFOA 3HXOA 3KV1A 3F0TA 1T2NA 3MUEA 1I3KA 2JRLA 1UMCB 1XMPA 4FN4A 4N39A 2Q6TA 2Z09A 1NN3A 3MXOA 2PGIA 4FQ7A 5AW8A 2HDWA 4OHWA 5GVRA 4G4GA 4Z0TA 3Q6NA 3A1TA 1RHQA 4YAEA 3GGJA 1N2OA 1H6BA 1XKLA 5LQKA 3HBAA 2XYHA 3MD9A 4IVRA 4P93A 5AK6A 5I7WA 3VH1A 2B8EA 2RKOA 2ORWA 1SJ9A 2PLAA 2JK0A 4X7PA 3LUKA 2WF6A 4JB3A 3DMGA 3E15A 3OUTA 4LYDA 3AF2A 3HCDA 1DJPA 1W9HA 1Y5IA 4FC7A 1PNOA 4AL4A 1VSUA 3EGEA 5JE8A 1J49A 2J32A 5BRAA 5F9HA 3IQZA 4IV0A 2FOXA 3AH8A 2PUJA 4QBFA 2V97A 4TKMA 4B7CA 3E2PA 4BV9A 1WF3A 5AUPB 3WAJA 5KEIA 1CUJA 4KIGA 3VZPA 1Z45A 4JJKA 3G85A 3BD7A 4QECA 3G3EA 2GFHA 3I92A 4G1EB 2N42A 3M6UA 3FUVA 3K1YA 1K3TA 2HF8A 1ZPDA 1I51A 1XHLA 5CM2Z 3B85A 3DE4X 5CDFE 5L3QB 1E5XA 5CX4A 4BV2A 2ET6A 5GIOE 2AMVA 1Z4QA 2VZ0A 3B8EA 1L8QA 1USWA 3D5QA 7MHTA 2FQWA 1ADYA 4QRHA 4DJFC 4WCFB 1T9ZA 3F2IA 3FETA 3OTWA 1LB1B 4I9UA 3ENWA 5BN3B 3UJ8A 1M74A 1GRQA 4KYTA 2VSOA 5GQSA 4LOKA 5CHYA 5BWLA 3OJFA 2B92A 2VHCA 2YR0A 3RIMA 2Z9CA 5CXQA 1HR0B 4PLZA 2C7GA 2BSXA 2GCOB 2VT3A 3C97A 3E9QA 3FPLA 4UUQA 1IQUA 5AKGA 4QJ3A 4G1MB 3C1AA 4TQAA 3WOHA 5GAJA 4EJSC 3ZV3A 2C2ZA 1SBNE 2OGWA 1I6WA 3PWTA 1UXJA 2X5XA 4PGGA 4ER7A 2PKCA 3G0GA 3M1YA 4GX2A 2UUBB 4WA8A 3TM5A 3ZD7A 3RSSA 1KVUA 5LD2B 3T1QA 1H0KA 3DAPA 1PBTA 1WV1A 3U49A 2GQ0A 4CYMA 3TNYA 1P4RA 3EYAA 1KYYA 1LK0A 3V2UA 3ENNA 1SKAA 5KQMA 1ONNA 3RC2A 1WBDA 4A8TA 4X3PA 1W44A 4GBED 1AUXA 1FQKA 1M1UA 4ED9A 4Z4CA 2FPKA 2OR3A 5HUHA 3L02A 2YW2A 4L5AA 1F2TB 3WIEA 3ZIDA 4C4ZA 4D42A 4KLNA 1CUHA 2R4TA 3MTQA 4DMLA 1QYIA 2L69A 3R6WA 3VUEA 3IHLA 4Z4EA 1EEXB 3OQOA 2X1MA 9ATCA 5FT9A 1F9AA 2DQYA 1N5KA 4YBZA 1RWWA 3C4JA 4LA4A 3IE0A 2V4UA 4Y1GA 1DDIA 2G5PA 2RGCA 3HCWA 3W5UA 2BEJA 3HYLA 1QGYA 1GXSA 3P71T 3AERA 2C2GA 4IIJB 4EUEA 1P91A 4MWBA 5IJ0B 2YYAA 2AI2A 4KP7A 3REQA 4BQEA 1P2GA 1AD2A 2HSJA 3PRKE 3AOEC 4M1MA 3GZ4A 4QUIA 4UBIA 2E48A 1L8LA 5AKLA 3T7CA 4DA6A 4E2WA 4EFLA 4FMDB 2HCFA 2X3FA 2R6HA 4HDRA 2IYNA 5TT0A 4D0GA 5AVXA 3NNDA 1Y7IA 5F12A 3TKYA 1DXQA 3ISTA 4J4HA 1WKCA 4KYVA 3QUQA 4J16A 3L6BA 4DLYA 3JQDA 3RS7A 1WEKA 4BO1A 1RIIA 1ZUD1 4AG6A 2C7OA 5KBYA 2Q0HA 4DUGA 1P4JA 2F8LA 4JBWA 3CPEA 1YKSA 1RADA 1LZKA 4FGUA 1EP2B 1UM9A 2A9VA 2FDXA 2HU8A 3EGDA 3N2YA 3AB3A 2DUJA 1QWOA 2XMGA 2WM8A 3B2EA 4NOKA 4QJIA 5BOSB 5DNCA 3FBWA 4MX8A 4LNAA 4YP0A 5DIZA 2P79A 4DJEC 3UBTA 4B71A 1QKKA 2CVQA 2DTXA 3GP3A 1PL0A 4M9UA 5JS1A 1SBZA 1VMAA 3BXPA 2RHBA 3D7NA 2YX1A 1TEHA 1H0HA 2VDLB 3ENKA 1NVEA 2YL2A 5D3QA 2EJTA 3V3TA 3TKAA 2QD3A 4HB0A 4NFYA 1JHZA 3UPDA 1MOPA 2EWVA 4DLVA 4UTPA 2GZMA 5E4TA 5G4LA 3ZK9A 3ITDA 3TTUA 4KR7A 2OCIA 3P4XA 4YPOA 2M98A 2FYTA 1OFTA 2OKCA 2B1QA 2FQXA 1WHTB 3WLFA 1H9BA 4UOZA 2VT6A 5A3QA 2ALJA 1JKIA 2B4RO 1PL7A 2PGNA 4RL6A 3QF4B 4H3VA 3GK3A 2W00A 4AX8A 2W0SA 5JY1A 4RTPA 4DV6B 2GPJA 4QZVA 2KMLA 1TMOA 2KSQA 1YZUA 1U6IA 3EH1A 3FLEA 1BVYF 4LZPA 5E9JA 4WOBA 1PGJA 4RKWA 2AMYA 2DUWA 4U4AA 3QG5A 1Q3HA 4JFAA 1QGED 1AXGA 1OPRA 1U99A 2HMUA 1TZBA 4IVPA 3TFWA 4QT4A 1H2EA 1C8VB 5A3VA 3BRSA 4JLBA 2AF3C 1KI8A 2HBQA 3BJZA 4LQCA 2DJIA 4U9UA 2P2GA 5KYKA 4DLTA 3M9LA 1Z13A 1M75A 2CEAA 2IW3A 1S3FA 5DHFA 3NBFA 2P27A 2WZQA 1W8DA 2AOTA 2OBXA 3LUFA 3O4RA 1H94A 4TWRA 4FW8A 2VC2B 4UDXX 4EJSB 2FE4A 2ZAGA 1PJ4A 5DK4A 1K8YB 2R87A 1HH4A 1X92A 4JLDA 3PA8A 4P4SB 3GMTA 4GRDA 4F2HA 3DQQA 4IHJA 1BH6A 3LRXA 4FDLA 4FFMA 3DDWA 3I73A 2HREA 2VYND 3CU5A 1K5DA 1EZ1A 4RNCA 1RQNA 3ZVMA 2A5FA 4QOIA 3DVAB 5K3DA 2ZBQA 4QXOA 4EABA 3AHHA 2LV8A 2B8TA 3PK0A 3Q6MA 5DTEA 4XTRA 1WE2A 1FBTA 2JGFA 2QMUA 4NE2A 2QYTA 4LGYA 2VDWA 4YRMA 3AR9A 1EUCB 1BKSB 5CGZA 4ZIRB 3HB5X 2IUFA 4N5DA 1EA5A 4JDUA 4NESA 3WGJA 3GLIE 1JW9B 2PSSA 3LYLA 3O3OB 3VBEA 3KDPA 5C5IA 1YUMA 5EG5A 2O8CA 2UVPA 1KYQA 5CIQA 5K8IA 2QU8A 1GRCA 1YVUA 3DZIA 2BTOA 4UATA 4XD7D 1Q50A 1QVVA 5U4XA 3AOEA 3BPSA 5ES4B 5GTDA 2HD4A 16PKA 1QSGA 1DUVG 1YZFA 3DO5A 3NONA 5DO9A 4YWJA 2OFWA 2PQ2A 2P0EA 3EGDB 2DWPA 2HQSA 1OC4A 4ITRC 4JX8A 4MKIA 2CNOA 1V8DA 4NENA 1QGUA 2ZB3A 4H60A 1XJQA 4UDYX 4DR6B 4ER5A 1BWSA 1YL7A 3ABOB 2D06A 1TQ8A 2WQZA 2H9YA 5EAIA 1V1RA 1N5IA 1M2JA 1KK2A 1WQ4A 3W5CA 3FVTA 5CBPB 5GGYA 4JLWA 3H2HA 2GXAA 3ICEA 2A0KA 1TPZA 3EVEA 4HDRB 1A76A 3TLBA 1DUSA 1OTXA 2RFLA 1CT9A 1RI4A 1D3AA 2H2DA 4ZCPA 3C3YA 1RJ9A 4JGBA 2OGTA 4GMKA 2GRAA 3LZCA 4X3OA 4H15A 5DBFA 5A6SA 4JUIA 3ER6A 2E4UA 3AFMA 1XROA 1PL8A 3D0QA 4G65A 5KJCA 4FZ3A 3I9FA 3CBQA 2QL5A 4CMEC 4TRNA 5C5DA 4TZTA 4BBPA 3CG4A 1MOSA 1Z8HA 5DNDA 5AVZA 1R8JA 3Q1LA 2QG9A 4EK9A 5M5BA 1TIBA 1Z6AA 2A3RA 4J1QA 4QOGA 4CKWA 1Z5GA 2C7RA 3L7AA 3U37A 1ABEA 2C57A 4ZVTA 4GGPA 1P9LA 3UA3A 1MEEA 1U7XA 3QVVA 1GTRA 3FGOA 4Q48A 1RZRA 1P81A 2V1UA 2B0JA 4DSNA 3F6EX 3IPRA 4L02A 3ZIAA 3VTKA 3UMFA 4PHFA 3V97A 4ZPXA 2JJ8A 4BU0A 2W6NA 4YV1A 3HYNA 4TSFA 1TMKA 2IOYA 3WB0A 3K0AA 4A82A 1X9IA 3OM9A 2F3SA 3F5FA 1KDZA 3T99A 1U0TA 3CQ9A 6Q21A 2ZRNA 5JCZA 5BOVA 4MS4B 1QU2A 4ZAZA 4PANA 2CUKA 5C31A 5DASA 4CBVA 3GCXA 2GJKA 2QD1A 3D6FA 2ODBA 5KAPA 1F6DA 2D5AA 2JIQA 4BGIA 4I1PA 3RAPR 1ZD1A 2IPXA 1NP6A 1TK2A 2IHZA 1YBFA 2REQB 3DTYA 3M6FA 4UCFA 5I7EA 2Q1SA 2QLNA 4B45A 5BSHA 3BCUA 1G98A 5IBQA 1WKVA 4HNAA 4DJAA 5A3RA 4IBOA 3AEQA 4JR1A 2ZE5A 2JA1A 3LCRA 2JEYA 1ZEJA 3GJ4A 4E94A 3SZRA 2M32A 2FR1A 1E0JA 1OU0A 5EHGA 3NYQA 1KR2A 4B3SB 2GA8A 4MZDA 1QGAA 5DBIA 3IP1A 1S9HA 4UVIA 1R6BX 2A86A 2EBFX 4ILEA 2QT1A 1WDWB 3IEVA 3JQQA 4B9AA 3T35A 4YDSA 2QKYA 5ADUS 1DRKA 1IC6A 2XGGA 4FE3A 3E9NA 2IPOA 1ZYUA 3DBHB 3DVQX 4MYRA 5CBKA 3I83A 4J7XA 5K2MA 3ZU5A 2Q3DA 4UE2A 4ENUA 1DO8A 1Y4SA 3FSEA 4HX2A 3SZ3A 2EFEB 2YDYA 4UFOA 3GC6A 2G0AA 4BZZA 4GVPA 3T1TA 2CUNA 3DHVA 5IYZA 1R50A 1Y3FE 4Q3EA 4HNVA 1THMA 4YV0A 1UZUA 3QELB 2OHFA 1V11A 2R2AA 3AI7A 4BNUA 4ENTA 3KBBA 4BNTA 4LYYA 1JR4A 1VG0B 2NO5A 3R3VA 1VQ1A 3L77A 5DEOA 4PZ9A 1XZDA 3AR5A 5H4HA 3WIDA 5F2NA 5JCPA 1PO7A 1QHSA 4UNSA 5CIYA 3EF1A 2AFVA 2FPGB 2IVFA 2XTMA 3EGWA 4HXGA 4P5PA 4CIAA 2O3UA 3N58A 2ZDQA 4K28A 1GA1A 4TLMB 5FKJA 1BHSA 5T8KC 4PAOA 8OHMA 2C0PA 4RTOA 2VAMA 4G89A 2IYOA 1G3MA 3GUVA 1OBCA 2QJFA 4WL0A 3KZVA 2AEMA 1EP1B 2DPHA 2E21A 2AH5A 3HHPA 3PEWA 2BTQA 4NR0A 5AOCA 4J9UE 1RKXA 1YRHA 5FP0A 3D81A 1VP9A 3ZGVA 5HSGA 3B12A 3OTOB 2BGWA 5KKCA 2XSZA 1M2OA 1RAGA 4B2YA 4D1YA 2P2YA 1KERA 3BQMB 3GIWA 3USCS 2IYQA 4LKOA 4M99A 1HFJA 3OQ1A 5T5QA 4JHLA 3ZHYA 2FGJA 4I8DA 1D09A 2AN4A 1G60A 4I1RA 4QD3A 1GZ4A 3QELA 3EUWA 2TS1A 3CBGA 1IHDA 2C42A 1JWAB 3PWZA 2OZPA 5AKZA 1OAOA 2Z5GA 5FNVB 4OBBA 1YWGO 2GRJA 1W93A 3DV0B 4O2RA 4UPVA 2HNAA 3WL5A 1CIJA 4BIMA 2RHJA 4EO9A 1VHLA 1GZ6A 1Z26A 2PZJA 2ZUFA 4Q03A 1VPLA 3KQOA 4ZO4A 5CB4A 3LO8A 2ODWA 1RHKA 1U8EA 1XZKA 2MMCA 3D0OA 1NVFA 3PR3A 2QZ9A 3BUSA 2GLUA 4GMXA 3GJXC 3TLMA 4CDRA 3OQJA 2XUGA 3WLHA 4CM8B 2JIZA 1YJQA 3OCCA 5IRCD 4QOHA 3GLTA 1ZXXA 3DE6X 1A8HA 1ZMRA 2F55A 4X41A 1UJ2A 1EK5A 3A6JA 1GUYA 3CX4A 4JNCA 1CJMA 1KOFA 3K0CC 4ZI7F 2OHHA 2XT6A 1D03A 4O8ZA 4RD4A 1DX4A 2Q4OA 4HDAA 4RC9A 3V8MA 4MV1A 2JJQA 4TV8A 3NVAA 2I4RA 4EEKA 4RORA 5CT5A 3UENA 3G02A 2AQKA 2P5SA 3QFFA 4O4JA 1RKUA 5DLQC 3W7BA 2VRBA 4ENVA 3Q12A 1QIIA 3HV0A 1H2AS 2J3HA 2Q28A 1NW5A 4O02B 3TEFA 1M66A 5KNBA 2IU3A 3RANA 3T7JA 4DPLA 2VPXA 4F46A 4JV5B 3ACBA 2FVXA 2NV0A 2Q2WA 3KP1A 5JZSA 3RT1A 3BTVA 2IK8A 3OZTA 4LSGA 4FBGA 1XZNA 1DG3A 1IBCA 1PZGA 1U8ZA 4MRPA 3DE7X 1Z2CA 1DAKA 3MYRA 1NYTA 4CF6A 1G3RA 1Z0KA 4OI2A 3JYLA 3U17A 5EJ9A 4HTFA 1ADGA 4XFJA 4YCAA 2DQZA 4ZCMA 3N2KA 3CZRA 1DCKA 2GLXA 2QVXX 2WSMA 3C8UA 3LT2A 4KO1S 1AUVA 3LD9A 3FTFA 5DYGA 3FHJA 5BR1A 3AF3A 4MINA 4OU5A 3IESA 2GSWA 4O63O 3OOYA 3PE4A 2Y4NA 3T38A 4JJ6A 2H4WA 4H0NA 2H2HA 5FPKA 2QW0X 4Q9HA 1MVLA 3KM0A 3NUQA 4ZO9A 1XLTA 5CFZA 3CZPA 2QGNA 5HILA 3VPBA 1B8NA 2DOKA 1PVOA 3RJ9A 4KL8S 2VSXA 1G6Q1 3C45A 3CLSD 5FBWB 1YZHA 5HIMA 4YRKA 5HYVA 2P4HX 2XWPA 3TQOA 4MPDA 1R8QA 4RQAA 4R1LA 4RGBA 4WUTA 2PEYA 1NAIA 2A7XA 2WINI 2OB2A 3L7LA 2UZ1A 1TYBE 5DSZA 5KCZA 1CR1A 2I6SA 4UC0A 2NVWA 3FVQA 3Q7QA 3CRMA 1JQ5A 2HLHA 2FCAA 3D1VA 1NHWA 2GBLA 4H0CA 1RE0A 4B8ZA 4E0BA 2OKGA 2ZYAA 3A6KA 3U80A 2O8NA 4LTNA 4LXGA 1QZUA 5JAIA 4WBNB 1BCSB 5FD8A 1XJWA 3E7PA 5LP6B 3EJ6A 1YUBA 4PNEA 4FDAA 1F6BA 3E9DA 4IDNA 1NVDA 4BFVA 4EDHA 1QHNA 4BVFA 2B98A 5BWNA 3KWMA 4FIZA 4E4RA 2QBYB 4ZYXA 4UBMA 1AO3A 1PGNA 3ESBA 5G53C 1C9JA 4F4IA 5K0CA 1P9OA 1IVSA 3LHSA 3WA6A 2HCBA 4W5TA 2H2WA 3SS8A 3H7IA 1RABA 4F3KA 2V7UA 2XUZA 1W0JA 4ALLA 4HLCA 1I2ZA 1QVZA 4IDQA 1A97A 5B6PA 1ORHA 4PLCA 5ALVA 3E2IA 4LDAA 4DKJA 2O8BA 1D0VA 1E9BA 3MT7A 4Q9IA 1JHPA 3K5HA 1TZJA 5DHSA 4BNGA 5IC4A 2JFGA 3PIRA 4I2NA 2YXEA 1T6XA 1TE2A 4BX8A 1IXYA 1ZA1A 3R3UA 4GS5A 4O4LA 3UG7A 1JLLB 1N5MA 4Y1RB 3TLEA 3ZHUA 1GITA 4TXMA 4HMQA 3M4ZA 4PQGA 1FNSA 2R6R1 5FNVA 1IONA 1QYDA 2AOXA 3HWX1 4DCJA 1LLCA 3EOBI 2H9IA 4CV3A 3DAHA 2NYAA 2GB4A 2H1CA 1FLAA 3I2HA 5DN6A 3MSCA 3AP3A 1KI7A 2RIPA 1KF0A 5HKKD 2HDHA 3GCZA 1S1CA 3KTAB 3P9SA 1J0DA 2RHGB 5B6IA 2X77A 4WW0A 4XXHA 1VI6A 3FZEA 4G1FA 5IK2A 4M87A 3T52A 4HX9A 4G63A 4P7BA 4EECA 2OG1A 2GXUA 4FI3C 4BC0A 1NQXA 4J2HA 3I42A 1GVHA 3O4VA 2QP3A 5DRTA 4UVDA 5LMUB 1ZH8A 5B4VA 1GFWA 4CEHA 1D07A 4AF8A 4TRJA 4LZAA 3FR7A 4LC1A 1SY7A 3AFGA 2F9LA 3GEEA 3HKCB 2FUNB 4Y1EA 3OPXA 3D0RA 4JEHA 2P4SA 3VZBA 4MQ6A 5I9IA 1Y3HA 2G0NA 4H2DA 1P7WA 1Y3IA 3RBVA 2Y2VA 2A30A 2ADFA 5FA8A 1R0RE 2BHNA 2H2FA 2P4QA 4L75A 5K1ZA 5HRCA 2VOJA 4LBWA 2PUDA 3EGXA 3GVCA 3QVGB 3JQ7A 4K6GA 2A9FA 4AJ1A 5BV1A 2R1VA 3WLPA 2QSJA 4UBOA 3QSGA 5BMVA 1XZFA 4X5OA 3DOJA 3UB2A 1ISJA 4F6CA 1GP2A 1QP4A 1C3OB 4ME6A 4ARCA 2QLTA 3Q6IA 2RHLA 4AJ2A 5JSUA 4KKVA 2HLNA 1B76A 4R98A 3RNLA 4D9BA 3JD4A 3VR4A 1PR2A 1ORVA 4BO8A 1RBZA 4WXRA 1FX0B 2PMCA 3CWZA 3LP6A 3NX4A 5K6AA 1IOZA 1P5HA 5FQNA 3ORSA 2G1JA 2I7XA 5LXTA 2CYBA 3OOJA 3BICA 1CUVA 3RTEA 3QVSA 1Z4PX 1BE6A 3IOYA 1DKMA 4LE1A 3LT5A 4YT5A 1I7SB 4H1UA 2VJMB 2Z8XA 4R1TA 2ZVQX 4QOJA 3K1JA 3GVPA 4MXDA 1GSIA 1SXJD 3RTGA 2I1VB 2VXYA 3D7SA 1KBOA 3OEHA 4FYHA 4NZYA 3KKNA 2G5TA 3ME5A 1QIGA 2QNRA 3NHFA 2PMEA 4BZQA 1Q0SA 3E8XA 5JSKA 4G4SO 2ZRMA 3D4LA 3JQ9A 2PD6A 4OQLA 4HNQA 2XF8A 5IZCA 1J1UA 3WZ2A 4PSUA 3ZU3A 4EMSA 3LWBA 3IAM6 1RBYA 1ZXLA 5D2CA 4JC8A 5HM8A 2RK4A 3T4XA 2OSVA 1PV1A 2J59A 4LYJA 4Q7LA 1ZUNB 4N9QA 4NEQA 3MEQA 4H1VA 1XNJA 2L0XA 1KQNA 3CFYA 4R9VA 3SKYA 5MGNA 3L2OB 1MH1A 1V3UA 4RENA 5FFMA 4RSHA 4ZDWA 1E3JA 2NP7A 2YIMA 1O4VA 4X84A 1OPXA 3DEZA 3H13A 4HAWA 4Y6SA 4DREA 3WDMA 3T7SA 4YUZA 4UTVA 2TSYB 4JC5A 1BQ4A 1P2UA 3QWIA 4LQDA 1LWOA 3UK6A 3KOMA 1GQRA 2B34A 4R6XA 4MA5A 4UE6A 3R4CA 1JN0A 3NDPA 4AVYA 1JIUA 4AKGA 2CUZA 1T3LA 2X4LA 4BWYA 1OKKD 2ATCA 4FMBB 3LW8A 3PB3A 2CNNA 3OQHA 5HGJA 2N46A 3AUAA 3GGCA 5CJ2A 2A59A 2W2KB 1SBTA 5IHXA 2ZSIA 3ZHCA 2Q2OA 4D9CA 5CLIA 3DLAA 1M5UA 1U65A 1Z4JA 3KAPA 4HHEA 4K40A 5IFKA 1F7UA 1H85A 1OLSA 2YZ2A 4M7RA 5G4KA 1NQTA 3HCRA 1CR0A 5DX0A 4O5AA 5E6UB 1YAHA 5EHNA 1EXMA 4KNVA 3UAYA 5THXA 1WDLA 4IDGA 4BVBA 2FKAA 4AF7A 3GQBA 2PG3A 5BSVA 4MV3A 4YUXA 1GGFA 5SYNA 3D6JA 1U94A 2HPZA 3DTTA 1JZTA 3QV1A 4NKRA 3EZ6A 4EMBA 1U7PA 3EXHA 3TLGA 2UDPA 2FETA 4BX3A 1FFGA 4AO7A 4AP5A 3B38A 4C89A 3V3KA 2O54A 1OYWA 2PWBA 2VP2A 1URPA 3BEOA 4YJ2F 2PNJA 2WVJA 4Z7JA 1WR8A 2LW7A 3SKVA 5AM4A 4X8OA 2L18A 1H9CA 3WJ7A 3FNRA 1U8AA 1SR8A 2OFOA 3FMFA 1Z25A 2WJYA 4AP6A 4LXUA 1NRJB 5CLJA 3QXGA 3K0BA 1E1LA 4OCZA 1PBNA 1XCMA 1Z2DA 1IN8A 3FI0A 5CXSA 1B00A 4ARZA 4ISBA 4QYSA 1DKQA 1SOUA 1WHSA 3GA5A 2HUNA 3D5EA 4OFXA 3VHQA 5JOQA 1DQRA 4G5XA 2XZTA 5LP6C 2W6JA 3KQLA 3QY9A 3NT5A 3QNMA 3UK2A 4RDCA 3BREA 1X3SA 5L9AA 3NHWA 3PSAA 1UKCA 4FYVA 3RC7A 1XL1A 5JQGA 1P9NA 1RLTA 4JFRA 1Z47A 3FMOB 2A5JA 5CPFA 4E88A 4I55F 2MWMA 4IJVA 2GEFA 3HO8A 2RHMA 4HLNA 3H18A 2N9UA 2P9FA 3L0OA 3NTVA 1Z29A 3ZV6A 2NV2B 2BEWB 2YJNA 4LHYA 2HX1A 4KGZA 2ECFA 3NBAA 1DEAA 4CKBA 1YOVB 5JD4A 1FRFS 3OO1A 3MOGA 4MWZA 3TZCA 1FU7A 2BZSA 2GERA 5F35A 2REBA 2GK6A 2H9AA 4FHDA 5GWXA 4UTXA 5DTIA 2O1SA 2YY6A 2PNFA 5JPDA 3T12A 1J9EA 5D7BA 3KVNA 1VJ0A 4QXRA 3K2QA 3BQNB 4CG0A 1YMQA 2NUTA 1SZDA 2J4DA 5TIIA 1YC2A 1EXDA 4ZVRA 1WMBA 1D4ZA 3BH6A 4EPWA 4B8WA 5F3WB 2IYZA 3HJUA 5L3RA 2GZ1A 5LDGA 5DNAA 1ZOOA 4TS4A 4TM7A 1Z62A 1M6VB 4N18A 3UA4A 1G55A 3JYHA 1T2CA 3OFKA 1RJEA 1YKGA 1YBHA 2AXQA 4MS3A 1V0JA 2INGX 5AHKA 5B57C 3N5CA 5A2QA 4RHCA 2ZIXA 1JHRA 1MKYA 3L8CA 1EINA 4GM1A 4GW3A 2J0QA 4MK4A 1E2FA 3TTWA 1W29A 2EZ4A 5EE9A 3N3AC 1W49A 3R3JA 4DM4A 4EHNA 3EAFA 3N0TA 4YFVA 1QAQA 1SCKA 4F7DA 1J2JA 2RC5A 5EWLB 2G1PA 3WLEA 1J8QA 4WRRA 1E8NA 1Y4DE 4CIDA 4MVJD 1MQSA 1UL1X 4HEJA 3C3CA 4O33A 4X6XA 3T1YB 4BXOA 4ZWNA 4PAGA 1YDHA 3RS4A 1D9ZA 3TD6A 3W34A 3W7VA 4UTNA 3IT1A 3LWNA 1O8BA 1YFJA 3RTDA 5JZOA 1QAMA 2CFRA 4Q6BA 1JQLB 2M1XA 4P1ZA 1Z2OX 3QUCA 4ZQCB 4ZT4A 3LC0A 1T9KA 3SQOA 1OU4A 2GR9A 3T3NA 4PIMA 4BLOA 3R6TA 4OKIA 3RAJA 3FYUA 1A9XA 2H29A 3G13A 1NVMB 3IALA 1C7ZA 4JNKA 1SIBE 3B7WA 3EISA 4ETIA 3QW4B 4QFCA 4F4JA 4B4OA 3HM9A 1QS0B 2HSZA 1E7QA 4AUMA 4C1BA 4OA8A 3ZDBA 1X6VA 2YINC 1DLJA 3MTBA 2XCIA 3H1FA 3PRJA 5ALZA 5FEMA 3VYRB 5DKFA 5IKXA 4HYEA 4F84A 2VXOA 4PNHA 3UAXA 1DFIA 3IULA 3RRJA 3BZUA 4BNHA 4CEJA 1Z7EA 2NZ2A 2R8OA 3LXMA 3K16A 3KYJB 1JEYA 2HSWA 4UNQA 3SEZA 3FWPA 4LVNA 1EGQA 1U0HC 1VA4A 5HZHA 3UUEA 4WVFA 2F8TA 4PPGA 3UHFA 3ZHZA 2YWEA 4V1CI 4EG3A 3IV9A 1JAXA 1MC5A 4W63A 3K09C 1VE3A 2PT5A 4KQ9A 1EFVB 1H4VB 3VZQA 4ALIA 1IUOA 5DM2A 4M98A 5ECGC 3VX3A 4AKSA 4RZ3A 1X7XA 4PG8A 1G0NA 3A27A 1YR6A 1Q0ZA 1XAGA 2OHJA 3AG6A 3M1LA 2XYRA 4Z7NB 5JADA 5LP6A 1Y1LA 1G20E 4WK4B 2I34A 1NV8A 2HADA 3MPUA 3KVRA 2I91A 3MCWA 3KKZA 4Q16A 5C7LO 1JHDA 4MRMA 4DOMA 1AK2A 1RZVA 4G07A 1WS6A 2YUIA 3K5WA 1T2AA 4LZZA 4OD0A 3STVA