1HY3A

Crystal structure of human estrogen sulfotransferase v269e mutant in the presence of paps
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
289
structure length
287
Chain Sequence
NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTROGEN SULFOTRANSFERASE
publication title Crystal structure of the human estrogen sulfotransferase-PAPS complex: evidence for catalytic role of Ser137 in the sulfuryl transfer reaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 287
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1hy3A00
1WBDA 5JWHA 1Z28A 3W5JA 4IOLA 1FUKA 1O3YA 3KXKA 3IEVA 3QXSA 1OKKD 4BQSA 521PA 3LV8A 3NH9A 4NH0A 1KO7A 3F8TA 4JLKA 3ZVLA 2J1LA 2JA1A 2ZSDA 4GI7A 4N0EA 1E94E 1CIPA 3HPQA 1Z6XA 4EFNA 1BO6A 5J5CA 3K8YA 4B3BA 3X1ZA 4CF7A 4HAYA 2B7BA 4PHFA 2IYTA 2ZRNA 2RH5A 4AG6A 4GOXA 4Q1EA 4AKEA 4QL3A 1QHYA 1UFQA 3NBXX 2IYYA 1OIXA 3CBQA 4W7SA 4TYYA 1ZIOA 2CHGA 3D6TB 2CLDX 2FNAA 1I2DA 3NC0C 4GBMA 3CX6A 1Z06A 3C15C 3EASA 3K9GA 3NKVA 4Q1FA 4OHVA 1L4YA 1HT2E 1W7AA 3EZFA 4HAXA 4PPNA 5EP4A 3ZQ6A 2IYSA 5TDHA 3CPHA 2Q3MA 5CDFA 2IW3A 1TQ2A 2QM7A 1XBTA 1KJWA 1E4VA 1Q0UA 1YZUA 4MITA 2D7CA 1P2VA 5EUMA 1XXHB 4EPTA 3P4YA 2EWWA 4DUGA 1G18A 2HCBA 1HH4A 2ODEA 4Q7MB 3TQFA 4QHTA 3P1JA 2PMKA 1TNDA 4PQFA 4IFBA 1P4SA 4LYAA 2W83A 3R8FA 1PLKA 2NG1A 2FPKA 5DN6D 1Q3TA 3A6PC 1E1RA 3CRMA 3OAAD 3TSZA 3X2SA 1CR1A 1KNQA 4Q9LA 1JI0A 1ZU5A 2C5LA 3B9QA 4JSYA 3T35A 1UM8A 4B44A 1EESA 3GLFB 1TMKA 3ND9A 1DAIA 1E79D 5DIFA 2CE7A 5DHAA 2OESA 3IIKA 3T1OA 1N5LA 3P4XA 3MWKA 4Y0AA 4FI3C 4OL0A 2QN6A 1JJVA 3G82C 1KO4A 1GUAA 1TF7A 1G3MA 5FOTA 2YC2C 3H86A 2QORA 3CKLA 1E3MA 1E2KA 5GJCA 4A8JB 2AX4A 2W58A 2JDIA 2IT1A 3KKNA 4KSBA 1PLJA 1XPOA 1YZTA 1HUQA 4JLDA 5FR1A 3HU2A 2P6NA 2RHDA 4FWIB 3GFOA 5DHFA 4TYWA 1S0UA 2CL0X 1AQUA 3PUVA 4DDTA 4WBSA 4HUQA 1N6OA 2ZRGA 4DSNA 4RKFA 1EFTA 4LDJA 2XB4A 3Q3JB 3E70C 4P33A 4BECA 2R65A 4YXWD 3TVDA 1WP9A 1ZUNB 2KI5A 1J8YF 3A58B 3P32A 5LB4A 1NBME 2ECKA 3RS4A 2RGXA 1FMJA 1P6XA 2FGKA 3KQNA 4D4LA 3LRPA 4WXPA 1T5LA 2WJYA 1BIFA 1VG9B 4Z54A 1VG8A 2F55A 2D06A 3KKPA 3REGA 1NY5A 1C4OA 2XJ4A 2QAGC 2HDNB 1COWD 1MO3A 4YMWA 3TRFA 3WMFA 1FW6A 3AVVA 3U61B 1E1QD 2RGBA 2IS1A 4TTQA 3VU9A 1T9HA 5CYOA 2PLRA 2WV9A 3IHWA 4RZ2A 1SXJD 5HZHA 1XB2A 2G1KA 1R0XA 1I4LD 3OEED 2VRWA 1UKZA 1KI8A 4DCNA 3EG5A 3CNNA 1ELOA 1ZUIA 4D26A 2UKDA 2XEXA 3QNUA 5JCZA 4KBGA 2O8BA 3TLXA 4D0LB 4TMVA 2J9RA 1CJMA 1E2FA 121PA 2IUUA 1A2KC 1ZNZA 1CJTC 2NPIA 2MSDB 1N0UA 4EKDA 3PQCA 1RFLA 2KBFA 3CF6R 3Q85A 1G4AE 1YZLA 2CXXA 2KBEA 2I4IA 1XX6A 2QL6A 3MWLA 3U2QA 4NCHA 4C4PA 2QBYA 2H92A 3TMKA 1DAKA 4M2LA 2BM0A 2RHMA 2RAPA 2ZRKA 4HLDA 3BFKA 3QG1A 4B6EA 3DPUA 1OH5A 2P3SA 3OIVA 3IIMA 1QHSA 3VR5A 3BBPA 4WZ6A 2PEZA 2QQ0A 4UXHA 2J46A 2WAXA 2OCBA 3SOPA 2WWXA 3I8XA 4CIDA 4A0GA 2CL7X 4RD0A 1QHIA 4OI2A 1K6MA 3CONA 4TLAA 2A5JA 1W0KA 5KNCA 5TXGA 3ASYA 1S4QA 1OXVA 3FGNA 2HYIC 4DKXA 4LI0A 3BB3A 1GNQA 1KSJA 1EWRA 2GXUA 3FFBA 1SVMA 4NHOA 5KPJA 2IL1A 3I61A 1E2JA 2ZIAA 3QIAA 8OHMA 3LNCA 5KDOA 3GEEA 1F48A 3U3JA 1DAHA 3BB4A 5JCPA 3U7GA 2Q9AA 2NZ8A 1YRBA 2K5UA 4AC9A 2C8VA 2GAOA 5G3ZA 4C30A 2VF7A 3WYGA 3FKSA 5EP1A 4Q66C 2ZANA 2XGJA 1XJCA 1XCMA 1JR3D 4FIDA 3U3MA 4DSTA 3PVSA 3VHLB 1XDBA 3GMTA 2Z83A 5KSZA 4XH9B 2UZIR 3FE2A 4IOMA 5FL7A 2QT0A 4A36A 2JLVA 3IGFA 4IVPA 1NBMA 4B47A 4JBXA 5FUXA 3UMSA 3B85A 5K8LA 4ZO4A 3ZVRA 2IYUA 3LLMA 2W6ID 2F43B 1EG7A 2ZUCA 3AQ4A 2OHFA 4BEJA 1D5CA 5EXTA 3VX3A 4LX0A 4RD6A 2QAGB 1CJKC 4UXJA 3MG9A 3NHBA 1AJEA 4IEEA 5FTJA 5HR5A 4GNKA 1OJLA 3KKQA 1RRGA 1GILA 3K09A 5EXSA 3UIEA 4BZPA 3GJ3A 5FOUA 2G83A 4TWZA 1GRRA 1ZVQA 4JYBA 2D4HA 2BCJQ 4PHTA 2IEYA 1G17A 5KNDA 4TYPA 4B2PA 2VHTA 2A5YB 2ZR7A 1ZCBA 4JJKA 4I4LA 3TAHA 2ZJOA 1QBKC 2FA9A 3WYFA 4B3DA 3ZJYA 1NN0A 1D2MA 4TLBA 4G1UC 4AYXA 5BWMA 1OPXA 4QRHA 4DCUA 2A78A 3N2EA 3EZ9A 3I3SR 4DLSA 1R7RA 3GLGB 2QRNA 3IHLA 2OAP1 1MRNA 2PCJA 3JZAA 5JBQA 3TSWA 4PC1A 2GVZC 3QOFA 4LV6A 3AVWA 2WIBA 1EFHA 2MSEB 4GOKA 4KU4A 4PC3A 4N3NA 3QXJA 1YR6A 3IO3A 4R71A 2W2VA 2RB4A 3K0FA 4FMDF 2IS6A 2VHCA 4HB0A 2O8CB 1VCOA 1KMQA 1UBEA 3RANA 1AZTA 4M8NE 4J0QA 1Z22A 3WRXC 1E2LA 1E9SA 1G3QA 5AJWA 4DLYA 1G6HA 4XVUA 3OESA 4WZAE 2O52A 1M34E 2OLKA 2AXPA 1PVOA 3FOZA 2OLJA 2WICA 4URXR 5K8IA 2X77A 1ZNXA 3LQQA 5HKKD 2YVUA 5SZKB 5DI3B 2DY1A 2Z4SA 3UK6A 3IDQA 5KSYA 3LXXA 1G1MA 4AWXA 3MWJA 4BFTA 1G7RA 2RGDA 4B74A 2L0XA 3BAFA 4Q4HA 3J81k 3UWOA 2G9NA 4TL9A 4AIIA 5JFGA 2C9OA 2ZRLA 2XXAA 3ICQB 421PA 1DG1G 3B1YA 1G6OA 3FDIA 4U5XA 5EZ5A 2GEDA 2ONJA 4A0RA 2QU8A 3K9LA 1UBFA 4JMPA 2YWFA 3EZ7A 5HPYB 1S8FA 5FBQB 4MRNA 1XMJA 2OG2A 1WQ1R 5AJZA 3CUEF 3KXIA 1ZINA 2ZRMA 1CKEA 4AKGA 3C4JA 3MWYW 4YMSA 3IQWA 1M7GA 1JECA 5K8UA 1UF9A 1M1YE 3DOFA 3B6EA 1NG9A 3Q7PA 4FN5A 1B23P 3K9HA 5DISB 2GZAA 1GITA 1G3IA 4G0NA 3U44A 3BFVA 3U7EB 3FHOA 1DOAA 4JSTA 1ZM4A 3M4YA 5EE0A 3TKLA 2XJ9A 2ZRBA 1KDPA 5CB6A 4D6PA 3EW9A 4PPGA 2QMHA 4OI4A 3VR6A 1ZM2A 3ZH9B 3C14C 4BASA 3GFTA 2ZSBA 3NHAA 3C5HA 1VHLA 1XJ0A 1B0UA 2KE5A 4RZ3A 2XTNA 5A4JA 2GA8A 1RRPA 1Z6AA 3TAUA 3IO5A 3EWAA 3OEHD 1HT1E 1XEXA 2GZHA 3THWA 4PX9A 1WDTA 4P4TA 1E2HA 4PHGA 4IW3B 1IN6A 4D4JA 4PO9A 3WP1B 3BWDD 1BMFA 4LJYA 1R10A 1Q1QA 2J5XA 2IC5A 1Q3HA 4HDOB 4URWR 1YR7A 4Z8YA 2QGZA 3H1TA 3R9IA 4B6FA 2GK6A 1KK0A 3RNLA 4NCKA 2GJ9A 1DAMA 1FX0B 1S2MA 2KJQA 2OT3B 5BN4A 2OM2A 2J0QA 1W0JA 2W2TA 1KI3A 4ARZA 4DLXA 3DKVA 4V03A 5FPTA 5GJVC 2FE4A 5F3WB 1D2NA 1G8FA 1P5ZB 1YZGA 2JASA 1XD2B 1GKIA 2ZUBA 3GJ7A 1XU4A 1Z2CA 1CR0A 4CEHB 2FFBA 3AKDA 4DVGA 3SYNA 621PA 4I1SA 1W4CA 3T15A 1P60A 3AUYA 4LWZA 1VDZA 4PAOA 1N6LA 2R6DA 1Z0IA 5DH9A 2O8EA 4E5UA 4B2LA 3VR4A 4JIMA 4AD8A 4G5GA 2NOAA 3H0KA 3ICEA 2RKOA 5IK2D 2EFGA 3PXGA 1HA3A 2P2LA 4QBFA 3HDTA 5KOYA 3KFVA 2O8FA 1OXTA 1R0ZA 1XMVA 3W5IA 4URUR 3NEJA 1P9RA 3B7GA 1NL3A 4L15A 4JZKA 3ADCA 3AP1A 5DI9A 4TL8A 2OO7A 1Q1BA 2J7PD 3LX8A 3NXSA 4NCIA 4XIGS 4EQ6A 2QSYA 1G5TA 2VP2A 1QG2A 2BMDA 2W0MA 5HCNA 5DSZA 1U8YA 1XTKA 1YJ5A 2QT1A 3REFA 3B9PA 3RRZA 2CMKA 4OQFA 2DR3A 4DT1B 4JLVA 5FI0B 1XD9A 1US8A 4ON9A 3TW8B 4I1OA 3R8CA 4M1OA 2ZE6A 4Z51A 1CJUC 3I4LA 5L3SA 4KFSA 2IYRA 1YRAA 1AS3A 3CRRA 4ASUA 1GWNA 4MRVA 4V02A 1ZNYA 3ZLJA 4Q00A 1OXSC 4LHVA 4PPQA 4QGAA 3K0EA 4OHXA 4YDHB 1EGAA 5FOXA 1JALA 2YYZA 3F0TA 4WW0A 3CPJB 3QY0A 1EX7A 1DS6A 1XTJA 2AFHE 2ZE7A 4B2IA 1F2TB 4BE7B 4UXIA 4B3CA 4ZDWA 2XNDD 4D0GA 1TU4A 5KU1A 2VP4A 1OYWA 1U9IA 4M9SA 2R62A 1MT0A 4MRPA 1UEIA 1X1RA 1GG2A 3EARA 1Q1EA 2XX3A 2ZTSA 3N70A 4Q9JA 3SC3A 3TVTA 4C2TA 4OK6A 1JBKA 2HLDA 1Q20A 2AL7A 3QVVA 1K8RA 1Z0JA 4C7OA 3MRSA 4Q4JA 4LPSA 3N2IA 1CRPA 1VCIA 2ORIA 4EJSA 4Q19A 4UNPA 3SJAA 3EWSA 4ESVA 1NNEA 3DHWC 2P67A 1G41A 2YC4C 4E07A 2YOGA 5L3QA 4Q9IA 5D3QA 4GP6A 4C0QC 2ZJ8A 2FH5B 2PT7A 3PEYA 4GT1A 4QFMA 1SVKA 3VX4A 2WWWA 3RAPR 1II0A 1TAGA 1A1VA 4GP7A 4Q1DA 3E5HA 1T3HA 4M0LA 2PCLA 1QF9A 4QJ5A 2JIZA 4JVSB 1XTIA 5AJYA 5FOVA 2EFDB 2QGNA 1M74A 3MUFA 1P62B 1TF2A 3BXZA 4PANA 2FU5C 2QI9C 4DLUA 4QOSA 4F38A 1ZD1A 4DSOA 2BEKA 4Q01A 3U3KA 4FINA 1WCV1 1E2GA 2FZLA 2OAQ1 1KYIA 1Z0AA 1ZNWA 3BB1A 5FPKA 2RGEA 4LHYA 2IHBA 4W9MC 1LFDB 2ZR9A 3HWSA 5JJLA 5TB5A 5LPNA 4UJ3A 1NVUQ 3AF2A 5HE9A 5UKDA 3LBIA 821PA 1R0WA 2IS2A 2TMKA 1SZPA 3FHCB 2LWIA 1KY3A 1Q21A 4LBYA 4M21A 4U02A 3WYAA 4IRUB 2QM8A 4KFTA 2F6RA 4MYHA 4Q7KA 4A82A 2GDJA 3KXLA 3SI7A 5EP3A 4JVNA 2QZ4A 1MKYA 4M9XA 5J4LA 1SXJE 1XEWX 2QE7A 2RGCA 4A6XA 1M7BA 2QNRA 2W0SA 4BRUA 1Z83A 3ZVMA 1G7SA 3ZZ0A 4LJ8A 3AVQA 2ZS7A 4QGFA 5EXXA 1E0SA 1IN8A 2DCUA 3H2YA 2JLZA 2P6RA 2XITA 3CRW1 5C18A 2UZ3A 3BERA 4M1TA 4G5RA 4IXMA 4PQRA 3CNOA 1HQCA 4HUTA 3UMRA 3LD9A 5FFMA 5FTNA 1MH1A 4Q48A 3C16C 2WJHA 1DG3A 2J0SA 2C98A 1KDTA 4TYQA 1RZ3A 2FPMA 2ZVQX 4HUQB 4QM6A 4AI6A 2F3TA 1Z3IX 2W6JD 2WM9B 1J99A 2QPAA 4HATA 4ACAA 4TZ6A 4HLUA 3K0CC 2C2HA 1XWIA 4L8GA 2I1VB 1IXZA 1QDEA 2JEOA 1IN7A 4P32A 2G6BA 4MKFA 4IDPA 1R8SA 4JLOA 1D9ZA 1H8HA 3KX2A 1G8HA 1O87A 1W2HA 2ZS8A 4BPBA 2DWOA 2FWRA 2PZEA 5HTKA 4TQUS 3T5DA 3KB1A 3OHMA 4LYJA 1GL6A 1UDXA 3X1WA 4HLQB 4XVRA 4JBYA 2CCKA 3R9WA 4R98A 5AWFC 4MGZR 5G53C 3T1TA 3THYA 1GP2A 2QSZA 3K09C 3LWNA 5CYPA 3VU9B 1CBUA 4DLVA 4XWAA 3GJ0A 4O0MA 2ZYVX 1EX6A 5EUQB 2IWHA 4I1VA 1U2RA 5CJ2A 2H16A 3EIQA 1N25A 3SS8A 1A7JA 1DAEA 1ZBDA 5K8TA 1JR3E 2OCPA 1P2TA 3WXMA 1GKUB 4B3XA 1EXMA 3BGWA 3K70B 1IY0A 4PC6A 2SHKA 2AFIE 1OB2A 3IPYA 4LRWA 1FTSA 2EFEB 2ZRFA 2IX3A 5P21A 4IOKA 1EFUA 1RKBA 3GD7A 3LW7A 1IXSB 3QE0A 3VFDA 4A15A 4HZIA 1DPFA 3I92A 2QBYB 1DO0A 1A5TA 4PZYA 1TTTA 1P3JA 2F9LA 3LXRA 4IDHA 4FMCB 4IDOA 4XD7D 1KZ7B 2WSSA 2FN4A 5CK5A 4QGHA 3ZGXA 3GLFE 4S2EA 6Q21A 3ZIAA 3QSYA 1W4AA 2GCNA 3B60A 2N46A 2IS4A 4PC2A 2P6UA 2R6GA 4PFSA 3D7MA 5B30A 4JLAA 2NO7A 1WBBA 2PJZA 4KFUA 2FF7A 2VP9A 1T8TA 1H8EA 1YR8A 4FXPA 1WRBA 3CRVA 2ZSAA 1XEWY 1NSFA 2IXFA 1N5KA 1J7KA 5FBRB 4B43A 1S9HA 2F3RA 2O0JA 4V0NA 2AK2A 5KTYA 2XOKA 3TGPA 2P5SA 1ZD8A 2NPFA 1VG0B 1XJQA 3GLHA 1W48A 3L0IB 4ERNA 3GCGA 2C99A 2J59A 3FKQA 1Z63A 3AVOA 2HCJB 3NTUA 2AKAB 3EX7C 1PV4A 3AVXA 3AUXA 2ZJAA 5JECA 1XXHE 1E9DA 5KO2A 4EPYA 4LHWA 3NBFA 4RD3A 1AK2A 5CJPA 1N3BA 2PEYA 1C1YA 2Z0MA 2GK7A 3X1YA 4TSFA 4A0HA 4E22A 3LAWA 1YQTA 1AA9A 4PHHA 3SN6A 1S1CA 5KDLA 3DOEA 4K46A 1OIWA 1UADA 4OQXA 2ZXUA 3PFIA 4BFUA 5DYIA 2GJ8A 1FP7A 2ZRCA 4JS0A 2ATVA 4AYTA 4XTCS 2VA8A 5DO9A 2OV2A 3I72A 4B75A 3CWZA 1M8PA 1J70A 4Y0VA 4EPRA 4HI0E 4BFSA 4POAA 3GFPA 3TW4A 3PV0A 1EFCA 2CNWA 1N6HA 5E7IA 4FMBB 2BVNA 5H1YA 4ZDKA 1XTSA 2WWHA 1N0WA 4TN1A 5FPSA 3FFAA 3TNFA 4R2IA 5AUQA 3VMFA 1KI9A 3SJCA 3LVRE 3CB4A 2QY9A 1E2EA 3DZDA 1AQYA 4UQOA 2MMGA 1ZP6A 3L8ZA 4CT4B 1OLOA 3QQ5A 2PZFA 3CO5A 2W00A 2XZOA 2D2EA 1NMXA 4NTZA 1Q12A 4Q03A 2ONKA 3SFZA 2GCPA 1E99A 4B33A 1GRQA 1JR3A 2GVDC 2E87A 2VHJA 4MGYR 2FFQA 1GAJA 1DO2A 3ZDQA 1VCMA 3A1TA 1D8TA 4R9UC 4P3YA 5H8WA 5E7MA 5B2ZA 3ZD7A 2ZRDA 4KFRA 1MO6A 3EA0A 2X2EA 2DWQA 4DUGD 2QP4A 1GL9B 1KMHA 4NBSA 1UAAA 3F3YA 1UEJA 2BBSA 2FFHA 1OYYA 2ATXA 2W6IA 4CRWB 3A1UA 2V55B 1E0KA 2IYLD 5AUNB 1E1RD 3K0FB 5JWRA 3SDZA 1NSTA 4Z1MA 2CCGA 3PUZA 4XSGA 4EDHA 5B64A 1DELA 4DRZA 1KJZA 1Z47A 1ZC3A 2N1BA 1MR3F 4GL2A 5JI3E 4MRSA 1CJVC 2GCOB 2RMKA 3B1VA 2H17A 2IA5A 5JS7A 2J3EA 3RS2A 5KSOA 1ZCAA 4MKIA 3PIRA 3AKYA 3IKJA 4NYIQ 1N6PA 2H57A 2JDID 4Q4HB 2I1QA 2YOHA 3GJXC 4OHYA 1CTQA 3DM9B 3KJEA 3QUSA 4OHWA 2XXAB 3T1QA 3ETLA 3KZ1E 2NO9A 4LBVA 1Y63A 3A1VA 2V6JA 2PX0A 3K53A 3KB2A 1Z8FA 4GMDA 1N2CE 4RFSA 1MABA 5IRCD 3NBZC 2C03A 1G8PA 1RRCA 1HURA 4QHYA 3EAQA 3SYKA 4F91B 2BV3A 3QKRA 2GF9A 4BLTA 4FW9A 5GVRA 3T34A 4C0JA 1NLFA 2R2AA 1KSHA 1GNPA 2O8DA 1HTWA 4QC2A 1I2MA 2VHUA 4OK3A 1G3RA 3O8DA 3TUJC 4BRWA 3CRQA 2FGJA 2G77B 3H4MA 4MKGA 3QXHA 221PA 1OHHA 4MGKR 3U44B 2BKEA 1GTVA 2NO1A 5TMPA 3QVUA 3QKTA 1TU3A 1OXUA 2GJSA 3QXXA 3TE6A 3TH5A 5CM9C 4BLRA 2A5GA 3QEJA 5BQ5A 3RC3A 3OIYA 1LV7A 1GIAA 1N6RA 4B34A 3LVQE 4TTPA 2V6IA 4DCTA 1LTQA 4NU0A 4AK9A 1C9KA 1G16A 3FMOB 3A1SA 3U4QA 1LS6A 1M6NA 1U9IC 1G8YA 2HXSA 4KVAA 3VR3A 2XB2A 2P5TB 1AIPA 5FR2A 3I62A 2HXYA 2A2ZA 2REXB 2YV5A 1XEXB 3L43A 5JRZA 3THWB 1SHZA 1U98A 1IXRC 3DDCA 4MQBA 721PA 3TQCA 4TL7A 1HE8B 3CM0A 1YZKA 3FYHA 5C46F 4EJSC 1JNYA 1GFIA 2R9VA 4WOPA 1KAGA 1KKMA 3K70D 1CR4A 3ZYCA 1E2NA 3M6AA 3UWKA 2GETA 1G5PA 4MUAA 3DM5A 4LZZA 4XTRA 2ZRJA 4L16A 1DEKA 3BOSA 3KKMA 3M0EA 3DMNA 2GESA 1E98A 4HAVA 2P65A 2Z43A 2J7KA 3C8UA 3EXAA 5FTKA 4ARZB 4V0ME 1P2UA 3UATA 1TF5A 3T1VA 3O8BA 3RSOA 1E9EA 1S1MA 1I4DD 1W44A 1JXOA 2OSBA 4LBWA 4D2IA 3GLIB 4LJ7A 3I32A 2EYQA 2IUSA 1KNXA 4LHXA 2QG6A 4F93B 1D6JA 2H8KA 1F60A 2HV8A 4YMTA 2O8EB 4HB4A 1XEFA 1W0KD 2IBMA 3RABA 4G5SA 1W36C 3CH4B 1GRNA 1R5OA 1Z5ZA 2OCAA 4D81A 1RPZA 3SR0A 4DB4A 1JEEA 4Q18A 1GZSA 5FUWA 4HLCA 3FWYA 3PCRB 2WKPA 4GOJA 3V9PA 5KYKA 4ZI2A 2E1RA 1VYTA 3GPLA 1Q22A 1R5BA 4HZUA 3PG5A 2QP9X 3U3RA 3LLUA 1VCNA 4EQ6B 1QHHA 2KWIA 3FKSD 3L82B 2BBOA 5TVKA 3TJZA 1L7VC 3U7FB 3OFNA 3RRYA 1XCPA 4BLQA 4BFZA 1SVOA 3BK7A 1P61B 4HB3A 3R7WA 1KI6A 3NEYA 1US8B 1NJFA 3VNUA 4PSVA 1CULC 1G4UR 4X8LA 4TLDA 5L3SB 4TMKA 5FL7D 4KCGA 4NDZA 1TL7C 2QAJA 2VLIA 1NBMD 2BJVA 3ND8A 3K0AA 5G40A 1TQ4A 1A4RA 1IBRA 3OE7A 2B8TA 1ZRHA 4KO8A 2H1LA 3CIOA 1X86B 3RLFA 4DEYA 2JJ1A 2QMOA 4Q5IA 4EPVA 2XZLA 1EFRA 2H7VA 1E0AA 2JATA 4Q1AA 2CBZA 3HU1A 4HLUC 2X19A 1VPLA 2A7QA 2CCJA 5ELXA 3MFYA 2RGAA 2QMEA 4B3FX 2FDCA 4ZCLA 1AM4D 1KI7A 2ZJZA 3AB3A 2YOFA 1UKEA 2RCNA 3FMIA 3JVVA 4KLNA 1RJ9A 2ZU0C 4QBHA 2JLQA 2OCYC 2ZU6A 3KJHA 4V0KA 2IK8A 4W5WA 5EZ6B 4DXAA 4D4MA 2Z4RA 3PEWA 3AKEA 4OBEA 4AURA 4C0SA 5F9HA 4C7OB 1P9NA 3QI2A 2GZDA 4URVR 4KV9A 4EJSB 5E4FA 3BE4A 4M4SA 1VIAA 2X8AA 1KSFX 4LJ4A 3RRNA 3CNLA 5JZVA 3DKPA 5L3QB 3X1DA 3ZZTA 1TX4B 3A1WA 2HT6A 2REBA 3WRYC 4LUCA 2DYKA 2ASEA 3FPAA 1R8QA 4K81B 3DEFA 4NMMA 3NIBA 4QG7A 4RVCA 1ODFA 3AKCA 4KXFB 4D80A 5IT5A 1UKYA 2CLCX 2F43A 3B13B 2PLFA 1XPUA 4II7A 3T61A 4A4DA 2ZI7A 4M1YA 4XSHA 1AGRA 2V7QA 3HU3A 3CX8A 3IPXA 3WHLA 5ANRB 4TMXA 3WBKA 5L3VA 4DZZA 4XOIA 5BW8A 4Q21A 3U7HB 1QHXA 2R44A 3ZS8A 4B73A 3AM1A 3L0PA 4GFDA 1YZNA 1V43A 1W36B 1KK2A 5BYJA 5HZKA 2WIAA 1G21E 3FTQA 1WF3A 4ABYA 1E2IA 1T91A 1FTNA 4LK2A 2X2FA 1G3UA 4LC1A 2LKCA 5D3MA 1V5WA 2WAYA 2C78A 4TQ9A 5KPDA 5AR1A 2BHRA 3P26A 5SZJA 2QA5A 4V0LA 2JLYA 2V4ZA 2CJWB 4M53A 1IJFA 1XFAA 5EE3A 3OF5A 2WVJA 4WVFA 1Q1ZA 2HUPA 2CVFA 4Q4AA 2QMUA 1VMAA 3S1AA 4OQNA 2OXRA 4DHEA 1ZM3A 1LNZA 1JR6A 3AGPA 4QJ4A 2BOVA 4TTRA 2JLRA 3QPUA 2LKDA 4NCJA 2IYWA 2ORVA 2HF9A 2WPDA 3GJ4A 3WBJA 2IHYA 1XP8A 1Z6TA 3ADKA 5JHGB 4Q1BA 1T8UA 2DB3A 3A4MA 1KIMA 2OILA 4NPHA 2BMJA 4YMVA 4TZ0A 2G0NA 3CWQA 3KL4A 4OQMA 2AWNA 2FV8A 1E6CA 2WWIA 4TT3A 4PAQA 5GVSA 1W47A 2OUKA 2GXQA 2C96A 1X8JA 1ZW6A 4BLSA 4PTLA 4QJ3A 4BEBA 4RJLA 3QBVA 1QHGA 1Z0KA 4JLPA 5AUOB 4ZKDA 2GXAA 3FVQA 4NE2A 2ZEJA 4IDQA 3HYTA 4TMTA 2YNMA 1VG1A 3JZMA 4R2HA 4E03A 1L2TA 2IYZA 5FOWA 1QZXA 1E32A 1U99A 5FOSA 3RVBA 1U0JA 3QF7A 2CK3A 3AF0A 1BMFD 2VP5A 1W4BA 5CLLA 2ZVPX 2PH1A 3IEUA 4KYIB 1DTSA 2GKSA 3D31A 2OBLA 3RSLA 4B76A 4F7WA 1NY6A 1F2UA 4BZQA 3THYB 2WJJA 4PQYA 2WKRA 1ETUA 4UNNA 2ZE8A 4PO1A 1W0JD 2AKYA 2AHOA 3VNVA 4HSEA 4JYCA 4ZDJA 4CEJA 2XSZA 3V00A 1W2GA 5JMTA 2ZROA 3BFXA 1S9DA 2VTKA 3AVPA 4QM7A 4HAWA 1KTVA 3I73A 4C0LA 1AKEA 5EQTA 3WHKA 4ZIRA 3G5UA 2QRZA 2N42A 2PX3A 2JGNA 3OZXA 4K8OA 2O5VA 4GPTA 3HPRA 4LJ5A 1G7TA 2ZSEA 1L8QA 3A37A 3LQRA 4CEIA 3RHFA 4RCYA 1M7HA 3EPLA 2F9MA 2QROA 4HAZA 4P4SA 1DE0A 2J41A 5L8VA 4A92A 4I81A 4HEJA 3M1IA 4FCVA 1H65A 1OFIA 4X8HA 4FMDB 5M04A 1VHTA 2Q3HA 2F1JA 1G8GA 1KO1A 3MJHA 1XRJA 3W9YA 4MUBA 4MYTA 5EP2A 3RDPA 4CYMA 4KJZA 2ODBA 4TMWA 1U8ZA 3FMFA 1XMSA 1OKKA 1TQ6A 1IJEA 1PUJA 2GILA 4LYFA 1ZIPA 5H68A 4F4CA 3A4LA 4YC7A 1RE0A 4XVQA 4DBLC 2CDNA 3WNCA 1J8MF 2EU8A 5JLJA 1NVXQ 2ZRHA 3RC8A 2ZYWX 3H84A 3SJZA 4YMUA 4W5HA 1IM2A 3O8RA 3R20A 1RYFA 3EA5A 1N6NA 2DBYA 1Z6YA 2Q6TA 1OE0A 2EYUA 3KFXA 3TBKA 1VECA 2WWFA 3GLHB 1SKYB 4ACBA 2JCSA 3DO6A 5DLQC 4ASUD 3EC1A 5CK4A 4A1FA 2IYXA 4DEXA 1NKTA 4QHSA 3IIJA 1HV8A 4EIWA 1X3SA 2CL6X 4RFVA 3KTAA 2CEAA 5EE9A 2FFAA 1KK1A 2HF8A 2BC9A 1J2JA 4EPXA 2GTPA 3PUWA 1NI3A 2ZRIA 5E7JA 1PLLA 1PUIA 1NVVQ 4DJTA 4HDQB 1RC8A 3B8HA 1KDRA 4URZR 5F98A 4RD1A 1XF9A 2CE2X 2VIIA 3A36A 4WZBE 4US2R 5LBIA 3KJGA 5J40A 1ZAKA 3Q72A 2IYVA 2QUZA 2G1JA 3SHWA 4BLOA 2W2XA 3AVUA 2VH5R 3WNBA 4MDEA 2CVHA 1E9AA 2IXEA 3AV0B 4NYIR 2HLDD 1ONBA 2YINC 3GP8A 5H70A 2ZI9A 2WWGA 4MYUA 4TL6A 1RRFA 4URYR 1AGPA 4IVRA 4N0DA 5DN6A 2VL7A 3OAAA 1W5SA 2QQEA 4L4UA 5FBVB 5LDDC 1KGDA 2IF2A 3QF4A 2FOLA 1TUIA 2FZ4A 3AH8A 1D2EA 1XD8A 2ZJ2A 2J0UA 3GQBA 4LV5B 3ZZUA 2R6AA 5E3HA 2WOOA 4WIAA 1OW3B 2WJVA 1E79A 3FB4A 1FMLA 3LDAA 2VSOA 2H5EA 4Q7JB 2FG5A 1LVGA 4BLPA 4PPFA 3VR2A 3PENA 3I1FA 2XZPA 4V0OA 3O8CA 3I8SA 1LF0A 4BGDA 2BBWA 3ADBA 2YZ2A 3CLVA 4D25A 1E9RA 1AS2A 2BKUA 4RY2A 1J90A 1XTRA 4KODA 1KO8A 3AF1A 2WMNB 2FEOA 3PEUA 3L0OA 3KQUA 3QKSA 2EVWX 2IUTA 3QPVA 1W36D 4LJ9A 5G41A 2ZI3A 1SGWA 4BWYA 2O8BB 1KMHB 4PSAA 1KJYA 5SZIA 4H1VA 3W6PA 4KYUA 3SQXA 2EWVA 4YXWA 2D74A 3W6OA 5J4HA 1X8LA 4IJMA 4NCNA 5A5GA 4Q7LA 3B1ZA 3QXCA 5J4KA 1P2SA 1OFHA 1KK3A 1NRJB 1ZYUA 5C4GB 4O2RA 2ORWA 3EPKA 2V3CC 4L5BA 2J45A 3MAAC 5JRJA 3W34A 1NKSA 1NMYA 2QE7D 2DFNA 3EC2A 2ZJBA 4MDFA 1IN4A 2A30A 3QPWA 3Q7QA 4OK5A 1COWA 4PAMA 1E1QA 2C04A 2QENA 3UPUA 3NG1A 1P7CA 2IYQA 1SHKA 3CZQA 4X8MA 3SZRA 1OH6A 1T4GA 1SXJA 2EFHB 3KDSE 2VBCA 3GJ8A 3GEHA 3OEEA 3TUZC 3RS7A 1G64A 1TPZA 1QHNA 4CZ2A 5TARA 4RFSB 1MABB 1YE8A 1K5DA 3PITA 5BXQC 2Q9CA 4DWJA 4ESHA 2F1HA 2BMEA 4NYJQ 2NO6A 4US0R 4BFWA 3EPJA 3UANA 2GXSA 5E95A 4BUJA 5BN3A 4A9AA 3QKRB 3AVYA 1CEEA 1RYHA 2WZQA 1FNNA 2ZETA 2O8DB 4GMXA 4G5OA 2ZAMA 1G291 1KZGB 1T3LA 1H8HD 2Y8EA 1KI2A 4YLGA 4LPKA 3B82A 1KY2A 4ZDIA 1W46A 2JJ2D 1BYIA 3DL0A 3ASZA 2GRJA 4D0NA 1EK0A 3D3QA 3AVTA 1KHTA 1P75A 4JJZA 5DYGA 3LH5A 5DNYB 3THXA 4AY2A 5EE1A 4ZV4A 1ZD9A 2DFKB 3U4QB 1FNMA 4M1MA 4HDCA 1II8A 4EUNA 1SVLA 3WP0A 2ZI4A 3OIUA 4DDWA 1NN5A 1U0HC 1F6BA 1U8AA 3GEIA 1E9CA 3AP2A 3V4FA 1G7CA 4DLTA 5KDDA 1TQDA 1JQLB 1ZJ6A 2ZSFA 3QENA 1WB9A 5JSZA 2ZI6A 4C0BA 1LS1A 4NYMQ 2ZR0A 2VQSA 3BIFA 1T0JB 3BS4A 4H1UA 1FP6A 3R9XA 2CLSA 2ZPTX 3F5FA 1G19A 4ITRC 2D3WA 2VEDA 2YWHA 1A2BA 2RGNA 3BH6A 3KUDA 4JKIA 4M9ZA 2FPLA 1PZNA 2D62A 2ZQ5A 5FPHA 2GAAA 1OH7A 2HT1A 2WJGA 3QBTA 1L4UA 2YJTD 4MRRA 1OT3A 4DB2A 2B6HA 3B1WA 5J4YA 1JAHA 1N5IA 3JVUA 4OJKA 5L3RA 2F7SA 3UKDA 3VTKA 2AD5A 2V9PA 1JPJA 2GBLA 1KDOA 2Q9BA 2WSSD 4WXRA 3ZIAD 4IKEA 4EAQA 4NP6A 3T06B 1U90A 5AJVB 3U60B 1JXMA 4M9QA 5CIQA 1YHNA 2PMDA 1XNJA 3ZVNA 1H8ED 3VKWA 2ZE5A 4DLRA 5FUYA 1FPMA 2ZI5A 1R5NA 1GL7A 3RS3A 2X1VA 2VSFA 4NKRA 3U6BA 2WWYA 5B57C 2OFXA 2WHXA 4E09A 5FH9A 2C9YA 2VSXA 4HAUA 3NDBB 3PUXA 2XOKD 2OFOA 4JLMA 4JT4A 4P0TA 3BJIC 1Z0DA 1Z6GA 3TIFA 3OIWA 3W3AA 3W8RA 5KHOC 4D4KA 2DHRA 2FSHA 1U81A 3D8BA 5G3YA 2VHQA 1FQJA 4P4UA 2G3YA 1NIPA 4O2LA 1NF3A 4HZUB 3BC1A 3KKOA 2Q21A 3SEAA 1IONA 1QHHB 2G0TA 2QTHA 3K0SA 2V1UA 4XWKA 5CITA 4G5QA 2BBTA 2F1RA 2HJGA 3AP3A 3RWMB 4LSGA 3R7WB 4CDGA 1KI6B 1XZPA 2ANBA 2ZRPA 1X1SA 4OI1A 4TSFD 2VF8A 5CIWA 1FFHA 1T0HB 1WA5A 5TY0A 1XXHA 1QVAA 2PL3A 4IXNA 3E1SA 4JLNA 4CW7A 3MMPA 2WSMA 4M1SA 3I5XA 3K0AB 1OIVA 4ZI3A 2UVQA 4KLZA 4IEIA 5AJXA 4CGZA 4DLZA 2H18A 4R7ZA 4WAUA 4RCZA 4BFVA 1Z2AA 3VKHA 1YR9A 5GJBA 1R0YA 3C7KA 2CNWD 4D82A 1ESNA 3P27A 4F92B 1UDWA 2VYFA 4LBZA 2YWGA 4A2QA 2VPPA 5CM8B 3GLFA 2XTMA 3AEZA 3LO5A 1LY1A 1GDDA 1N6KA 1JEDA 1UKVY 1DVRA 5JJIA 1X6VA 2KB0A 1RJ9B 1VYUA 3NBYC 4MA4A 5HKKA 5AUPB 4EFLA 3VR1A 2GEVA 4M1WA 1JB1A 1W5TA 2VP0A 1QRAA 4C0HA 3V4RA 4QGGA 4A8JA 3CW2A 1GNRA 4O3MA 1ZUHA 2ZITA 1DBSA 1JPNA 2XNSA 1CF4A 1KI4A 4ZPXA 2FSIA 3K0CA 1DADA 1IY2A 2IEZA 2NIPA 1VYVA 1LF5A 4BFXA 1M2OB 5DGXA 4JLJA 4G3XA 3P20A 4Q47A 2VP6A 2C95A 1N0VC 1RIFA 3IBGA 4C0KA 4JVLA 1MRSA 4RKEA 2XTZA 3CX7A 3CR7A 1TUEA 4HYYA 2WBLC 4KBFA 2OXCA 4DC9A 4Z1MD 3DMDA 1SVSA 1QVRA 2QP3A 4FD2A 1OH8A 5F9FA 1AKYA 5KNBA 3HR7A 2NMVA 2P0EA 3MSXA 4LY6A 1SKQA 3Q5DA 2A5FA 1G20E 3TUIC 1R2QA 3AF3A 1Q57A 2NQ2C 1W1WA 4B48A 2FSGA 2RGGA 4A2PA 1JJ7A 3Q8XB 4Q1CA 4C0AC 2BIFA 5GJWC 3BRWD 3ZQJA 3DVLA 1BS1A 3CF0A 4DCSA 3IQXA 2EQBA 4EFMA 5C1BA 5D3MB 3BD9A 4MYCA 4LYHA 3A8TA 3ECCA 3W90A 3MGCA 1OSNA 3ADDA 4A2WA 1CU1A 5TV2A 2ZM5A 2G88A 2O0KA 1HEIA 3OEHA 4C2UA 1NN1A 3HP1A 3SBEA 2PJRA 4Q4AB 2O8FB 3C5CA 3S1AB 5IDVA 3MLEA 3UG7A 4MKHA 4PR0A 1KKLA 4M1KA 4I99A 4DSUA 1XPRA 3K9NA 2FJUA 3CR8A 3KUCA 3LBNA 1Z07A 5C4MA 4RZUA 3GLGE 1ZMXA 1MO4A 3L0SA 4JL6A 3WNDA 3KQKA 1IAQA 3GLIE 2DFLA 3VQTA 1X8KA 4PSKA 4CT5A 1YVDA 5JJKA 1LW7A 2NGRA 1UBCA 4OKSA 1OFTA 1OHHD 2NO0A 2ZRAA 1TADA 3LA6A 4DIEA 2GCOA 4LJ6A 4C9BA 2YWEA 5C2JB 1E9FA 4MGIR 5EXPA 1KO5A 3RYTC 4U00A 2VO1A 1OB5A 3IUYA 4XWOA 1Q44A 1BKDR 2AR7A 5FI1B 4TYNA 3MJRA 1ZM9A 4TLEA 3G0HA 3NDPA 2ZYUX 5IK2A 4US1R 4Q9KA 4DIDA 3SQWA 2V8OA 1N6IA 2J87A 2ODNA 2IWRA 2C77A 4QXAA 4RZXA 4DDVA 5LB2A 1I4TD 1NIJA 1S96A 3MCAA 1FZQA 5KSPA 1GOTA 3I5YA 2J7PA 4I1UA 1F2UB 2DFTA 2JLSA 2HJVA 2QPOA 4DCVA 4M22A 2AK3A 1F3OA 1U0LA 1QG4A 4IOJA 4Q4JB 4CVNA 1AS0A 4IHQA 3VHXA 1E69A 1NVVR 3SHFA 2ZUDA 3L2OB 2QPTA 4IDNA 2PZGA 3UMFA 3TSOA 3VAAA 1SVIA 2D2FA 4CEJB 5CB8A 5JEDA 1WXQA 4FWTA 3U5ZB 1E0JA 3KJIA 2XAUA 1ANKA 4ZKEA 2BMFA 2QEQA 4JLBA 2WTUA 2B92A 2Q3FA 2ANCA 1MOZA 1NP6A 4LV8B 4ZIRB 1XZQA 2BJWA 3W6NA 4DDUA 2FSFA 1DAFA 4KITB 1BH2A 2GEUA 2Z5FA 4V0MA 4B35A 1II9A 1IY1A 4JVMA 3SE0A 1W49A 4CEIB 3TR0A 5LD2C 3SU8A 1UJ2A 2DPXA 1KOFA 1CRQA 3SBDA 2QAGA 3LX5A 4KAXA 1E2PA 4P4SB 2OFWA 1SULA 2GJKA 2WJIA 4NL4H 4LHZA 4MH0R 5FUVA 4L9WA 3FMPB 1GSIA 4F4JA 2XNDA 1KSGA 4WA7A 1E2DA 3O47A 1XCGB 1OXXK 2CHQA 4JL8A 2A5DA 3FHTA 1E9BA 1U94A 4IVQA 4GZLA 4UKDA 1CR2A 4OJQA 5CLQA 4NZYA 1RW4A 2MSCB 2GWHA 4JT2A 2GJAA 4AKIA 1NMZA 2F1IA 1VIYA 3OFND 1CP2A 4ZCMA 4Q9HA 1Z0FA 5EJEA 2Z6VA 2JLUA 1JQJC 2BCGY 4G01B 4GDFA 3RS5A 1R6BX 2MMCA 4X8OA 2I3BA 3B5JA 1WE2A 4KVGA 3RS0A 1BOFA 4LGMA 2OZEA 4UNRA 5JWOA 1VTKA 3GLGA 4GSYA 2R6FA 3T12A 3MD0A 2YHSA 1SXJC 3SFVA 3GLIA 1ZC4A 1W4RA 4FCWA 2J0VA 1AN0A 1P73A 3OE7D 4GRAA 2ZJ5A 3LY5A 5FPYA 1DAGA 2FMXA 2R8RA 2JJ1D 2V54A 3KTAB 3PJRA 5FBWB 2HEIA 4FMCF 4PO8A 1EFRD 3LW8A 5A0FA 5J4VA 4AG5A 1T3SA 2O8CA 1K5GA 5AK0A 3THOA 5BYKA 5B58C 3N5CA 4PZZA 4O25A 1NJGA 5SZHB 1YKSA 5HCIA 1JAIA 3TK1A 3EIHA 1IN5A 3A4NA 3CH5A 1VKJA 4IFEA 2ZJYA 2ZAOA 1HE1C 3HR8A 4Z8XA 2OEPA 1S3SA 2B21A 1PJRA 5DI3A 2WMOB 2YKGA 1T5IA 1EWQA 4LJAA 4JKYA 5DE3A 1XTQA 2LCFA 4HB2A 3VKGA 1IOZA 3SJBA 2QTFA 3QF4B 4RD4A 3RWOA 2BWJA 4QBIA 2GHIA 3SYLA 2J0UB 4A6PA 2JJ8A 1FL9A 1TEXA 3WMGA 2IXGA 4NYJR 3BH0A 1NN3A 3EZ6A 1CXZA 1YU9A 2A3RA 3QJYA 4P31A 2PT5A 1CS4C 4LC0A 3AF4A 4B3GA 4FCTA 1ESMA 4GZMA 4PZLA 5FTMA 2V1XA 4QNMA 3PUYA 1KI1A 1DARA 2V7QD 1NVWQ 3U6KA 1FUUA 3ONWA 1OF1A 1OV4A 4XJXA 3SNHA 2OBNA 2RGNC 5KUTA 5HE8A 1T6NA 1TEVA 3C41J 1SQ5A 3QKSB 5LD2B 4U7DA 4UNSA 1A82A 1HQYE 2W6JA 1N5JA 2WOJA 2BM1A 3IBYA 2FX3A 1ZU4A 4L9SA 2OE2A 4OQLA 1ZM7A 2GBLC 1UBGA 4BFYA 4DLWA 1UPTA 3HYRA 4TMZA 1YZQA 3B1XA 3TR5A 1E96A 1HYQA 2ERYA 4JL5A 4KI0A 1GVNB 2ZS9A 1G5RA 3E2IA 2O0HA 4NYMR 4Q4LA 1P72A 2A9KA 3HJNA 3NWJA 2EW1A 2AD1A 2QTVB 3NVAA 4TLCA 2EFCB 4QNRA 3T5GA 3CPEA 4F4IA 4ZCIA 1NLZA 3GJ5A 3EPHA 4UJ5A 4EPWA 4AYWA 3ZS9A 1MO5A 2BEJA 2JAQA 3EZ2A 4JBWA 5JS8A 2WPDD 4H9GA 4KHZA 1HY3A 3Q9LA 1Y3AA 1FX0A 2B8WA 4LOAA 1BYUA 4A0FA 1SXJB 3LBHA 3K70C 2REOA 4YQFA 3LFUA 3UXMA 5BN5A 3B78A 2AXNA 4OYHA 1XD2A 3W3ZB 3NH6A 1NG1A 4TT3D 2NZJA 3W8NA 5CDFE 4CEHA 3X1XA 3U3OA 3EIEA 4KSCA 1XMIA 3GJ6A 1OFUX 3BH7A 1Z29A 3PEVA 4BZXA 2PBRA 2AWOA 1IHUA 3AGQA 4YONB 2WKQA 4PXAA 4PC7A 5JHHB 3B2EA 1Z08A 2C9CA 1WMSA 3RRMA 3QKUA 4TQAA 2CJWA 2DWPA 2E9SA 5J47A 2IF0A 4XD7A 1CLUA 2CK3D 1FOEB 4OI0A 4Q02A 4ILEA 4RSGA 3WY9A 2GNOA 4UNQA 1E2QA 4RD2A 2GF0A 3THXB 1FQKA 3GLHE 1MV5A 1SKYE 2ZREA 2B7CA 1II8B 2HYDA 4NONA 2JLXA 3PR1A 2R6CA 1AZSC 1D9XA 1NLYA 1S3GA 2AN9A 3Q5EA 1LB1B 3QEOA 4DT1A 4C3ZA 5FTLA 4AKHA 1GKYA 5F2EA 5FL3A 5JSZB 2CHVA 4S35A 2BDTA 2XSZD 4N1AA 2NTYC 3CZPA 4A8JC 1R4AA 1SVWA 3WMEA 5EE5B 5JEEA 4W5JA 4QKQA 1KAOA 2ERXA 3K1JA 3BORA 4YDSA 3IILA 3UG6A 5GADl 5IHPA 3DZ8A 4OHZA 4B71A 3KQHA 1P9WA 4LCBA 4B32A 2KSQA 5IF9A 3CF2A 2FEMA 3ZD6A 1G9XA 3L8YA 2OBMA 2JIZD 2Q0HA 1RVDA 3NC1C 5JI2E 3KQLA 2JLWA 5FBLB 2ODWA 1F2TA 2ZYTX 1GM5A 2D7DA 1E4YA 2JJ2A 1IQPA 1E2MA 4QBGB 3QG5A 1F5NA
chains in the Genus database with same CATH superfamily
4E15A 3H5OA 2A8YA 1WBDA 1VBFA 3DDOA 1R6XA 3PZBA 1NW5A 4N3AA 4OGGA 3REOA 3Q5GA 5CVVA 3WSVA 3FNHA 1ZJYA 3EXIA 4BQSA 3O9MA 5TMDA 3LV8A 4AN1A 5DWQA 3DQQA 1RXSA 1A9XB 2B25A 2C2ZA 3F8TA 4IKOA 3ZVLA 4D4KA 4EUFA 4N48A 1BEUB 2J1LA 2VT2A 2WM2A 3EPPA 5G0WA 2DBZA 4AKHA 3LK6A 4LZWA 2RAFA 2VPWA 4B7UA 4YMHA 1NLMA 4CF7A 4HAYA 2X0EA 4AY5A 3U4CA 3BUSA 2RH5A 4GOXA 2HSJA 1U2PA 3DVAA 3L3BA 3RIYA 4ARVA 5CEFA 5HS6A 2AEFA 3NBXX 3W06A 1GFZA 4XEUA 3ZY3A 1IUOA 5A2GA 1N5RA 3W1EA 4HYQA 4FFRA 5LLSA 5A4KA 4DJAA 1I13A 1ZIOA 3D6TB 4PLTA 2PL9A 3ZCXA 2P9FA 2ODTX 3P0RA 5HKAA 2W2LA 3CZRA 4OHVA 3T38A 4BMXA 1VIDA 4II3A 3WWYA 2OSVA 5TDHA 2FJPA 2XWBF 3WWEA 3DBLB 2IDKA 2PUVA 1XBTA 4YRSA 4PINA 1QIHA 3PWZA 4KEAA 1Q0UA 1YZUA 1BJTA 4X20B 4N01A 1PN3A 1SVNA 1C0IA 4NFSA 5EUMA 1B6SA 1G8SA 3OPMA 5FFNA 2OYRA 4IH1A 4CL3A 3R0QA 1G18A 1Y8RB 2B0JA 2J3MA 3CC8A 4Q7MB 3TQFA 3VZCA 4LAFA 2PTHA 4MW7A 4PZ9A 2E5WA 1MJGM 1IPFA 5DN6D 2HLNA 1Q3TA 1A9ZA 5HEKA 3OAAD 2DG2A 4XJVA 1PNOA 1N7JA 4ISBA 1LNQA 4AWBA 4QICA 4AZWA 5KCZA 1JI0A 1OYVA 1ZU5A 5I45A 3CT4A 1N8TA 1QB7A 3OF3A 5C32A 3JR3A 1R0RE 3OQPA 5PGMA 5JH7B 1W1UA 4NECA 4TKVB 5DHAA 4MYDA 3IIKA 4J7XA 2VHZA 1LPOA 3UYKA 3VR2D 3MWKA 1BGVA 4MQEA 4Y0AA 3ZWWA 1FVHA 3NIFB 5FORA 1BXGA 5HM6A 1JJVA 2XYVA 4S04A 5FOTA 2XYHA 4B0PA 5K6TA 3H86A 2QORA 3K2QA 1E92A 2NZ2A 3ESYA 3KE8A 1IHXA 5DDIP 5H59A 3EZGA 4I5DA 3D81A 2IT1A 2A9JA 3H2KA 3KKNA 2ZR8A 5CHYA 5JCXA 3KEOA 1H23A 2EXXA 3FRIA 3RVSA 2WF5A 1EXVA 1PS0A 1RIIA 3GFOA 1NR1A 3CPSA 1F1JA 2FWNA 3O90A 4QRIA 4Y7DA 4TYWA 4U9UA 3ZWPA 3P52A 2D1QA 4GYKA 1ML3A 2J9ZB 1WR8A 1Z73A 4FYVA 1KEEB 5A7FA 1PZGA 4CCYB 1R5JA 1RMYA 1LH0A 3KQQA 1BHQ1 5CR9A 2GEJA 1Y4DE 2VZ8A 3ICWA 3M2PA 3TVDA 1WP9A 2JBWA 4D56A 2CJXA 1ZUNB 3AIKA 5ILOA 2KI5A 2YDXA 3FETA 3LA8A 3A58B 4E5MA 3HABA 3RS4A 2JVIA 3HKDB 3NBQA 4M87A 1TQHA 3E8SA 4C0WA 4D4LA 3LRPA 5KJ1A 4WBNB 4CETA 1VG8A 2D06A 1WBJB 3AESA 5KCMA 3O3CA 3DZCA 1JDSA 4W9RA 3AEYA 5CVCA 4C78A 1ECGA 2HDNB 1MO3A 2C7GA 4I4TA 1FW6A 4ZANA 1QGED 5AVYA 1ICEA 4IIJA 5I9TA 5DLPA 2RGBA 2RGYA 1PCXA 2W6CX 4W5RA 1RWNA 1ZMBA 3ROMA 1U5AA 1OLXA 1NJ8A 4EGCB 2CZCA 1MNAA 2WV9A 3IA7A 4RZ2A 4NMWA 5HZHA 3EVCA 1XB2A 2G1KA 4NX2A 1R0XA 3OEED 5AW0A 1WLSA 1AXRA 2VRWA 2ZUUA 5DBFA 4DA6A 1XQ1A 1KI8A 5JAPA 4CKXA 4DCNA 2XMGA 3LCMA 5ARDA 5F23A 2EL7A 2WYWA 4GLBA 4JQSA 5HGXA 3S2UA 5KVCA 1EHYA 2OQRA 1I0LA 3OQOA 4MYSA 2XEXA 3FLBA 3QNUA 4JUCA 5CT5A 5A04A 2O8BA 1H2YA 1B93A 2J9RA 2NZUG 3KZCA 1CIJA 3WL3A 1V48A 1JKJB 1E2FA 4BC0A 2IBSA 1VKOA 2OV3A 3PEEA 1VQ1A 1YC2A 2Q2VA 1CJTC 5IAOA 2XWJI 3KT8A 1I30A 1N0UA 1ZH2A 1D3AA 3FWZA 3PQCA 4EKDA 1RFLA 3CF6R 3U09A 1YZLA 3ZV3A 2I4RA 1X70A 4C4PA 1CS0A 2QJFA 4P3XA 3P4UA 4ZAVA 4UMFA 2RHMA 2QRVA 1HL7A 3UQYS 4H3HB 4PWZA 3FJOA 2YYSA 3QG1A 3OJ0A 5K7SA 3BBPA 1YRQA 3V32A 4DRYA 4DPKA 2O7SA 3SX0A 4Q0MA 3RS9A 4Z4IA 2V5AA 2OCBA 4CIDA 4QOGA 5CB4B 2W2PA 1FFCA 5J63A 3A3YA 1ECBA 2QRMA 4HGYA 1G42A 1JLMA 4KW7A 4M9UA 2A5JA 4UQPA 1C3VA 2R6HA 3NTOA 3W79A 5KNCA 1RD4A 2HO5A 2VH2A 2Q5LA 1WXFA 3NATA 1RRKA 3LWDA 4KWTA 4BBZA 4DKXA 3IPLA 1Y6RA 1O9GA 3BB3A 5HK8A 1GNQA 4MULA 2HKIA 4OFBA 4W7HA 1Q92A 4NHOA 5HRUA 1ZJWA 4XYLA 2FEWB 3DKRA 3OQJA 3QW2A 1M6VB 4B87A 4X61A 3OMXA 4KOAA 2ZLBA 3S5UA 3GJTA 2HHLA 2OYSA 2VKTA 1YBHA 1ONPA 4AT1A 1H5NA 1AQJA 2VJBA 3T7EA 3WQRA 4ENVA 2NZ8A 4AC9A 4G37A 4ND7A 3RVMA 2A1IA 1NFRA 2YN2A 4I2NA 3HJHA 1SK9A 5J2UA 3WYGA 2HMUA 1THMA 2C8KA 2W6ZA 3L8HA 5EP1A 1RZRD 2GN9A 3GGGA 5C1IA 1YSCA 1P2GA 2BSQA 1RRVA 1XJCA 1OREA 1JR3D 1XCMA 1ZN7A 3RPEA 3ED1A 1IXKA 1T8WA 4RKWA 3DHNA 4KAAA 3H3XA 3DAOA 4PWYA 4QXPA 3VHLB 1FNBA 5KJEA 1K4KA 1TGYA 3L7CA 1XDBA 3GMTA 3WO1A 4FHZA 2JEYA 2FTKE 2OBYA 2PS3A 4XH9B 2QT0A 1BN6A 2CUZA 2ZTMA 4YCLA 2JLVA 3C1OA 4B47A 1TM5E 2I29A 3ZLTA 2AE1A 3B85A 3OZAA 3UWSA 4G81A 2IZOA 1L4MA 2ZUCA 1XG5A 3CHYA 3QH4A 5FJJA 5EXTA 2YN0A 4DTCA 1QIMA 3L6DA 5MHTA 2I22A 5CB0A 3QX9A 1TT5B 2CC2A 5B36A 4YP0A 3RIEA 1VLMA 1LWNA 2ECFA 3W2HA 5IM4F 2ID9A 2IOFA 3ZWXA 1YCHA 5C8YB 3O2QB 3OHSX 5HR5A 3JQ9C 3TLMA 4M49A 3CUUA 3RYFA 4EMTA 5FOUA 3CVWA 5IDXA 4ZOEA 3OY2A 1KEZA 2M98A 2D4HA 3RTBA 3GIDA 3IX7A 2IEYA 4IG4A 5C3MA 2XBUA 3K6KA 2BFFB 5CRIA 1S89A 1FIUA 3L93A 2H48A 4I3HA 2PWAA 1ID1A 1KH3A 3TAHA 2H4HA 5F3RA 4N9QA 4RPLA 2NO4A 5HGJA 5JATA 1NBOA 5LXTB 3FX2A 3EYWA 1GUDA 2WTBA 2ZGVA 4G1UC 3V48A 3RAJA 4AYXA 5BWMA 2A78A 1KIFA 4DLSA 3I3SR 4EHJA 3UWDA 3E9ZA 1EVQA 1HDIA 2OAP1 2VYNA 4DPMA 3GCXA 5LVAA 1ZK3A 16PKA 2YHUA 2BY4A 3GARA 5D51S 3AVWA 4REQB 5A3VA 4P9NA 3LBAA 1EFHA 2W2NA 1JIQA 2GBCA 4YLEA 1JEQB 4EHAA 4N3NA 4U7TB 1G8MA 1CVLA 3MCZA 1Q91A 4AQYB 3LDUA 4R71A 2FVXA 5CEEA 2XCIA 4PLFA 5IBCA 2JIDA 2NVOA 2X3FA 8ATCA 2W42A 4HB0A 2IS6A 4P92A 2O8CB 2PWBA 3HR4A 3K5PA 2IPLA 3L8FA 3MOIA 1L7DA 3VNRA 4HTAA 2DR2A 3MJ4A 4Y2JA 1LJUA 4WZAE 2OLKA 2RHJA 3K1ZA 3HJTA 3I2YX 4L8FA 4YROA 1M2KA 2WHYA 5FRDA 1J9GA 1DCKA 2IHTA 2YVUA 3AMVA 5I4KA 3FCXA 4DBVO 5KSYA 2QYOA 2XUFA 2YHIB 2HWXA 3LXXA 1XZNA 4AWXA 2RGDA 2Y1DA 4YAGA 5JMPA 1MQSA 4KKVA 2G9NA 4AIIA 1C0PA 2C9OA 2JHCA 4C6TA 3GPIA 2ACEA 3B6MA 2LP4Y 4P34A 3B1YA 2YN4A 4X7MA 1AKNA 3D3KA 2B0CA 4EVSA 3QTBA 2GEDA 3PCXA 2PBZA 2FRXA 2OAGA 2QU8A 4JMPA 2ONJA 1GQ2A 4A0RA 4RQUA 3C4VA 4Z7OB 5KYWA 5HPYB 3G0OA 1ZIDA 1S6YA 2W8BB 4ZHSA 1WQ1R 5AJZA 3TLKA 4J43A 3FPBA 2F1OA 4NNOA 2C1EA 2VUSA 1GY8A 1V11B 1XHEA 3C4JA 3GVCA 4I55F 3WJ7A 5SYNA 1O95A 1E20A 2O59A 2GD0A 1QMGA 4Y1RB 5FWDA 1U0GA 5K3BA 1USGA 4YP6A 4EB3A 4CCAA 1GQRA 1U3GA 1J0DA 2WYOA 3HLYA 2PUBA 2VPZA 3H7IA 3K9HA 5LC1A 2FJ0A 1WLYA 2GZAA 5CDGA 4WECA 1RYYA 3PJGA 4TROA 1Y7PA 3M6MD 4DG8A 2IHNA 2O4UX 2KLHA 1OAAA 1Q74A 1QO7A 2NSJA 2RHRA 2HMWA 3A2MA 3BFVA 3FHOA 3Q6MA 3U7EB 2CFSA 1W4LA 5EE0A 2EW2A 3LC7O 4B3IA 3K0HA 3DMYA 5A05A 1TTPB 2JFZA 2P3LA 2AS0A 2I67A 2G17A 4FDMA 4G07A 1N2XA 4HWKA 3SBXA 4B84A 4DN6A 1Y4SA 2XWQA 1RJGA 2AF4C 2FMFA 3DEKA 3PGVA 1YFZA 4WNIA 1P45A 3O4RA 5BP7A 3U39A 2VT7A 3NHAA 3L07A 3C5HA 1ZBQA 3ZH2A 1CUCA 3T1NA 4DR2B 4RZ3A 5IYZA 1G1AA 4FYMA 5A4JA 1Y82A 2Q1UA 3EWAA 4R8KA 3JASA 1N32B 4BATA 1XEXA 1G5QA 2GZHA 4I1IA 3PQDA 2QW0X 1WDTA 4P4TA 2P41A 1IN6A 3R7AA 5FPPA 3WP1B 3IODA 1BMFA 2OCGA 3GFQA 3KSAC 1EFKA 1OLSA 3PNMA 4LOKA 4M8LA 1D2AA 3AFOA 4HDOB 4COOA 3H1TA 5G0UA 4YRDA 1SUBA 4QTUB 3LPNA 5EHGA 3ZV7A 4DG5A 4PY2A 2H06A 4U3JB 4KTTE 4RYLA 2HJHA 3OFSA 7REQA 3FZEA 2OT3B 1GPH1 4CM8A 3F3SA 1QDUA 1K06A 3H8VA 3M2TA 4GVPA 4I4NA 4M1ZA 3S8YA 5BN5B 1K7EB 2HDWA 1KQPA 5FPTA 1UPAA 4FLFA 1P5ZB 3QE0A 1YZGA 4CHGA 1XD2B 1GKIA 1SBZA 3GJ7A 4CEHB 1YE3A 1U7ZA 3A3OA 5HJ7A 1W4CA 1TM1E 3FCUB 2VDNB 1BC5A 3AUYA 3RT7A 2H1VA 1YZHA 4QUIA 2CUKA 2JPDA 1N6LA 2R6DA 5DH9A 5EINA 4BCCA 2O8EA 3PDWA 2P62A 5DMHA 2P9ZA 3ES9A 3P5SA 3PIDA 1SK8A 3ICPA 2O3QA 5B2EA 2K2WA 4B2LA 5JAMA 3F2IA 4G5GA 1E7WA 3DVRX 4HNHA 3Q2IA 4Y2SA 2JNWA 2RKOA 5IK2D 2PJUA 1WX1A 1A27A 4AF7A 3NUGA 4GOLD 2AQKA 4MJ3A 4QBFA 1C9DB 3SG0A 3KFVA 1C1XB 3D0QA 1OXTA 1R0ZA 1XMVA 1DMSA 3DNFA 3I2FA 3KBBA 3NEJA 1NW4A 1E64A 1P9RA 3B7GA 1NL3A 1N1DA 4EATA 5K05A 4JZKA 4DIOA 3F6RA 1TKRA 1ODKA 4NOKA 3H9JA 4FYKA 2ATCA 5CGZA 2J7PD 4L57A 3PUJA 4R2MA 4MUEA 4XEHA 1WCXA 4W9NA 4MV6A 1B2LA 1L6IA 2VP2A 3FB1A 3OT1B 1OBCA 2BMDA 2W0MA 4H0CA 1XTKA 5DSZA 4XLLA 5HCNA 3JRWA 3C85A 4HNVA 4PVDA 1J39A 3V2IA 4JB0A 5AW8A 5JCJA 3GZ4A 4N54A 2ZBRA 3N2NA 4PU0A 3RVOA 4GH5A 4QUHA 2G82A 2PFKA 1ODTC 3PXDA 4GX0A 3T9EA 5L3SA 4XW2A 3QFFA 3RK4A 1YRAA 3G8CA 3PSHA 4FVTA 3B7WA 4K9SA 1T1RA 3CRRA 2GN6A 2JAPA 1GWNA 4V02A 3HO1A 2FOIA 1ZNYA 4FKZA 3S6JA 4Q00A 3D3JA 4H59A 4WI1A 3K0EA 3K9QO 4N9WA 5FOXA 5BSRA 2HZ7A 1D03A 1NDQA 2YYZA 3HKCB 3QY0A 4ZQFA 3ETCA 3NASA 2ZE7A 3CLTD 4UU1A 4UM5A 2HGSA 1EFPB 1DXYA 4W8HA 1F2TB 2W6MA 3TN7A 3V7YA 4BO2A 2ZATA 2XUGA 1PZFA 3RYHB 1ECCA 1KC3A 2VP4A 3U80A 3V7NA 4Z4FA 2VQ3A 3D7SA 3GL9A 1MT0A 4WGFA 4X95A 1GG2A 3EARA 4YALA 4C0XA 2BGLA 5JVDA 4LW8A 2Z5VA 1Y0BA 3WHPA 5HHTA 4C2TA 3GOQA 1P2FA 4ZEVA 3TLAA 4P7KA 3IBCA 1Q20A 2AL7A 3C3YA 1CQPA 3BMCB 1K8RA 3HGQA 3IC5A 3LL7A 4Q4JA 3SXUB 4XDZA 1YRYE 3RKSA 2PG3A 1QX3A 2CVQA 2BZ0A 1EDZA 1ARZA 1T4DA 4DA9A 2AXEA 2F4NA 1G41A 3BTOA 3KT0A 4E07A 2XUHA 2YOGA 4FK8A 4X3CA 5HA5A 1Q77A 2ZYAA 1U28A 1R6AA 1YIOA 3RUCA 2WB2A 2FMHA 3MWDB 4MR9A 2X3UA 4C0QC 3WDMA 4CL0A 5GP1A 4EENA 4YRTA 3PHCA 2PHZA 2VJAA 3H9EO 4F5WA 3KT6A 1SVKA 3FFWA 4L3OA 3RLIA 2MINA 1Q0ZA 4WL0A 2BLNA 4FPXA 4ZVPA 1DL5A 3L9WA 1YQGA 4FUQA 1RAAA 1T3HA 4QREA 1HQKA 3JQRA 4XB6B 3V8RA 1SBIA 1BOOA 3PLRA 3PZRA 2PCLA 5B4UA 1QF9A 2G63A 3TDNA 3BMNA 3F6SA 3OOSA 4AKTA 4U9HS 4GRDA 1ECJA 4HQKA 1XQYA 2G7MC 3SKXA 2OP1A 3FBGA 1C14A 6CHYA 1Z38A 5F1KA 5JW6A 1I9CA 1L7MA 1PGQA 4PZCA 4DSOA 3JQ7A 3I09A 4MR7A 4FSXA 4Q01A 1WCV1 2FCRA 2NSHA 2OAQ1 3DYBA 3BB1A 3PXXA 4IJ5A 3RIXA 3VAYA 4W9MC 1XA4A 5H9VA 1K92A 1Y33E 2HRZA 1IHPA 1I7QB 3IAHA 4NZNA 2DJ5A 2BCEA 2YXNA 3NKLA 2I91A 1Z7BA 1NURA 3ORSA 3LBIA 4NR0A 1UOOA 3I0ZA 1ATZA 3A6JA 2LWIA 4NDNE 4QPPA 4LBYA 3WYAA 2OOSA 4Q7KA 2F6RA 1PT7A 2ZVDA 3CEMA 3EXG1 3TIXB 5GONF 4LQLA 1XZLA 4BNXA 2ZTHA 4JVNA 4CIBA 1B76A 4NABA 1D6NA 1K08A 1UK9A 2GLUA 2WWRA 1PHRA 4JGGA 4XLTA 3S1LA 1GT6A 3PE3A 2W0SA 2PQMA 1YS6A 3KAPA 4K9PA 4YECA 5FQOA 1Z5OA 1G7SA 4GBGA 1KVUA 2JAXA 3GGOA 1TMYA 1QYRA 3AVQA 4DLLA 1PR2A 1GTMA 1HE3A 2SKEA 5EXXA 2DCUA 5E1MA 2EKQA 1GSOA 2GJ4A 3H2YA 3JQGA 3KJXA 3PPXA 4Y6PA 5SYAA 1RI3A 4XM2A 5REQA 2ZAYA 3SR4A 4F5DA 2P6RA 3LUDA 3GUZA 5C18A 1J1IA 2PZLA 3AFIA 3PFBA 4YCNA 3H5AA 2HCRA 4HUTA 3TRKA 1JLKA 1XROA 1UC9A 4QVKA 5T3YA 3L7OA 1QM5A 3PHGA 2ZVQX 4HUQB 3OOWA 2C2BA 1TA9A 4XYMA 4ZCRA 2F3TA 3Q7IA 1VL6A 2QPAA 3ZV6A 4ACAA 4HLUA 3OF2A 2DUMA 4UUNA 1QZUA 2MOKA 3A6FA 3ROEA 4FYHA 1WABA 4NI5A 4W4TA 4WXYB 4Z9YA 3NOOA 4MKFA 1N2BA 2J67A 3WLHA 3U16A 5COBA 1FFDA 1R8SA 4YRGA 1H8HA 2V59A 1ZK2A 1G8HA 1MX9A 2ZS8A 1HL3A 3N3BC 3ETDA 3KP1A 3GV0A 3RUHA 4C05A 5B6PA 1ENOA 5HTKA 2FZWA 4TQUS 2IYPA 2BMAA 3T5DA 3UH0A 4Z3OA 2OXEA 3BXFA 3E27A 1GL6A 4BN0A 2JG3A 1Z4LA 3LGAA 4U6SA 2WV7A 1SOWA 1Z4OA 2WEKA 1TZ2A 3GA5A 4XVRA 3ZI4A 3GWZA 2A67A 2J5BA 3R9WA 4G0ZA 2PD6A 3GDFA 2IUFA 3JZDA 3Q87B 4IUDS 2P2DA 3CZ5A 4O4HB 1I7NA 4R83A 3WGKA 3WA7A 1EVZA 1X7WB 4MLDA 3T1TA 4BBAA 5LR6A 3V8EA 7MHTA 2QSZA 3LWNA 1WPRA 3VU9B 1FTYA 3HB7A 4E5PA 1YD7A 4XWAA 3GC6A 5BVHB 3A25A 3TFQA 3G2KA 5BR4A 1SUEA 3WAJA 5CCDA 1Q16A 1CDDA 3RG8A 2NZVG 4I1VA 1U2RA 1EP2B 3FNGA 4U2GA 1SA0B 3EIQA 3AVTA 4QYTA 5EJGA 3SS8A 3UUEA 1RBYA 2C1ZA 2OCPA 5KHLB 1P2TA 2E5LB 1GKUB 5A7HA 4B3XA 1P2DA 3CNBA 2DSTA 2PT9A 1W96A 4YRKA 4RC9A 2SHKA 1SXGA 1CQJA 2VZEA 4G4GA 2A9RA 1U6KA 1XA3A 3F67A 3HB1A 1J23A 4I8XA 5KINB 1NC1A 2IX3A 2X76A 4Z2AA 4A15A 3O5AA 4HSGA 1JKFA 4HZIA 3GF4A 2QBYB 3OY7A 1IMJA 5D00A 4TKMA 3I5UA 4Y9RA 1L5VA 1A5TA 3HVJA 1UMDA 2ZOSA 3LY7A 3HTXA 3G0GA 4X64B 5IUNC 3IULA 3KCQA 2Y1KA 3HV2A 4ZAYA 5CA0B 1JMVA 4X1YA 6Q21A 1QP8A 2J6BA 4P2GA 4B82A 2GS9A 2IS4A 4PC2A 2JHAA 3NRCA 1QE5A 4C03A 5I6DA 2P6UA 4E7PA 3AB7A 3CW8X 1I7LA 3ECSA 2QG4A 4JLAA 3BKWA 1XU9A 2L17A 1YR3A 4WLFA 4IHJA 1YR8A 1RLUA 5KTMA 1XMXA 3UMJA 1B42A 2EV9A 2IIBA 4GKKB 1A9RA 3IV6A 3UXEA 4HXGA 4NBVA 1D8AA 1UJMA 2IXFA 1N5KA 2H29A 3DTVB 1HYHA 2F3RA 1P4GA 4K6OA 1KFJB 4DRXB 1G2OA 3TGPA 3DCNA 3MC1A 3QOXA 1A96A 1MAAA 4IRXA 1C4XA 4K40A 2G72A 2NPFA 1VG0B 1NI4A 4FKMA 4QTTB 1W48A 3OLZA 4KE8A 2W2KA 3OQIB 3UZUA 3WLIA 2C99A 3EHDA 4XGNA 4KGZA 3WLKX 2GUWA 2JGEA 2FZVA 2D1SA 3NTUA 3INYA 4TXMA 1F7VA 3KSZO 5FAXA 1V7QA 5JO9A 4TXLA 3A6HA 1KU6A 3CX3A 3WSWA 3EX7C 3SMVA 4F85A 2ZXEA 4KC0A 2KHZA 2GK4A 5KO2A 3CTMA 3ILXA 4L08A 4RV9A 3NBFA 3P9SA 1BTOA 4K2AA 4QDTA 5KYTA 1AK2A 3B38A 3AEKA 2XNKA 2GGSA 2XNCA 1WHTA 2VNHA 4HADA 1C1YA 2ZQZA 3DVSX 1QFJA 1DB3A 2FEKA 2GK7A 1O95C 4V3BA 1C7ZA 3X1YA 1SOUA 1M0SA 4DILA 4XWWA 3LAWA 3MHTA 3RSHA 2FUCA 2ID7A 5EIAA 1GPUA 3PRKE 3SN6A 2AZMA 3OX1A 1W88A 5KDLA 1DI0A 3QWBA 4EL5A 1QOPB 2GR9A 2I7VA 4EELA 1EM8B 2GJ8A 4YQYA 4AYTA 4CR7A 1B2RA 2VQDA 5G4LA 2VA8A 5TQ2A 4BV3A 4FR0A 4EA8A 3CWZA 1M8PA 1J70A 4PAGA 3OIFA 3BG5A 3FUXA 3I4CA 4A1OA 4DMFA 4EPRA 5B7NA 1M67A 3K6JA 3UMYA 3C6XA 5DLEA 1Y3BE 2QXYA 3PV0A 1ZOOA 1IBSA 4EUKA 1UBRS 3SOZA 1NW8A 5H1YA 1VLLA 1XTSA 5DYNA 2WWHA 1DUVG 1XDZA 2R5FA 4HX5A 3FFAA 3PF8A 4R2IA 5AUQA 1KI9A 3STUA 1SXPA 1NMQA 1A50B 3PC8A 2QR5A 1XQWA 4O4JA 4DSZA 1P0MA 5DWVA 3UH1A 4E14A 1U8CB 3G59A 4RL4A 1GPYA 3WGHA 1ZP6A 2R4TA 3SC6A 1SQFA 5ALOA 3W04A 4FONA 1A97A 5FTWA 4KOEC 5IEBA 3ASVA 3LGSA 2YICA 1IEXA 4Q03A 1N3YA 1FS4A 2A0UA 4Y98A 1GTZA 3E53A 1ORTA 2ONKA 3OQBA 3BXEA 3DS8A 5TF4A 3SS7X 5EIBC 3FBTA 4KVGA 4DNXA 2Y0BA 4LYYA 2E87A 4NBUA 1BDMA 2VHJA 4U7HA 5A71A 5PNTA 1EIZA 3SICE 1IZ8A 5HDQA 3VDXA 4CCWA 3RRXA 4GVLA 1B0PA 4NK4A 1RXYA 5DMXA 3WC4A 4R9UC 5E1DA 5IDYA 4XB2A 4CI9A 1USUA 5B2ZA 1L9XA 1ORWA 2GPYA 4KFRA 4UFPA 3EA0A 2RHLA 4DUGD 3OZUA 1KMHA 2L2QA 2ZYSA 3ESDA 3PSAA 5I7RA 4DR5B 5EWJB 3QE9Y 2EGUA 3GBPA 4H4CA 3VV3A 2P5YA 2FFHA 2W6IA 3MGAA 3UW3A 3MBKA 1VE9A 3LQYA 2B4YA 3VOBA 2PWZA 2ZIWB 4QUAA 4AS1A 3OZVA 1IEVA 3RD5A 1BVYF 3K0FB 1T4CB 5JWRA 3PDIA 1CIVA 3T7KA 4QAJA 1A1SA 2BFPA 4INAA 4ZO8A 3PUZA 4Z1MA 4F3NA 3PR3A 3NDRA 5A9SA 1A5AB 3QVLA 4G9EA 1EGQA 4DRZA 1KJZA 1OC4A 1Z47A 5IAJA 2WG2A 3OQNA 5EMKA 3SZMA 4BHTA 1Y7IA 4IHAA 1CJVC 1XALA 3P0EA 4OHCA 3RTGA 3BJRA 4DQLA 3I9KA 2O4CA 4JI0B 2YMQA 4MVJF 3MYYA 3BRWA 3H19A 4TX1A 2J3EA 4EAAA 5KSOA 1ZCAA 4A0QA 2DXIA 2Y1GA 2CXTA 5LA6B 2RH4A 3PIRA 3WK6A 4JKOA 3O1HB 1N6PA 4BJ6A 3QP9A 1XDSA 4IKPA 2ZCUA 2YOHA 4YAIA 2R8PA 2VBGA 3DOIA 1DBVO 1ZUD1 3KJEA 2M6SA 1QSGA 2QZZA 1E8MA 1LK5A 1HKUA 2VVTA 3G89A 4KQWA 4LBVA 3T1QA 2OK7A 2WZDA 1BKSB 1JH8A 4W9NC 2PX0A 3K53A 3ROZA 1N2CE 1W9MA 4RACA 4Z4GA 4GLFA 2HX1A 2D0OB 1XIVA 5AFSA 4R1UA 4CLOA 1G0NA 2XCUA 3EFOB 4QHYA 4LN1A 1G6KA 4GPAA 3L79A 3HEAA 2BV3A 4YRRA 5TE9A 3GCDA 1W85A 4B85A 4M1EA 2P35A 4ZYUA 1NE2A 4FT2A 2GO1A 2R2AA 3LKVA 2HF2A 3M83A 3TTTA 5I8WA 4YHHB 3JTEA 2O8DA 1LZKA 5FV7A 1G3RA 3MWEB 3O8DA 3ZTTA 4BRWA 1XRNA 3GLKA 4CL2A 2SNIE 2G77B 3QXHA 1OHHA 3U44B 5AKLA 3EF1A 5TMPA 4N18A 4D9BA 2VJLA 3QKTA 5BORA 3WL8A 2A5GA 2Y99A 5AO9A 3E9MA 1Y6FA 3MINB 3OIYA 4NFLA 1QPGA 4LXHA 4B34A 3R5JA 3KD3A 5IH3A 4TTPA 1FFEA 4DCTA 1LTQA 1X94A 2XQIA 4NU0A 1NOIA 2FZCA 3OZDA 1G16A 2CJPA 2ZJFA 3FPKA 1LS6A 2H5JA 2J0EA 5EZYF 2ZIFA 1QO9A 1M6NA 1TJ3A 4P81A 5G4KA 4ZTBA 3WGLA 3LRTA 3R7FA 3E23A 4BMCA 1RC0A 2MSNA 5TGTA 1NXXA 1AIPA 4IDDA 3JQ8B 4F96A 2REXB 2WHQA 2HFJA 3L43A 1SKUA 1AB5A 2J48A 1PWHA 3KOOA 3LLSA 4KQIA 1SHZA 2D00A 3DDCA 4RVHA 3N86A 4MQBA 1CJSA 2JGMA 1RAGA 3CKMA 3NIGB 3TQCA 2O3UA 721PA 3EEIA 1BHJA 1IDOA 1YZKA 3FYHA 5F7XA 1IB6A 2JFNA 2R9VA 4CCYA 1JHPA 1KAGA 3UK0A 4IS2A 4UW9A 4EGSA 5JASA 4GECA 3KHSA 2V7XA 2BTQB 1S01A 4G6ZA 2POCA 4HPWA 3UWKA 3ZDEA 1G5PA 2AA3A 4D9FA 5LQCA 3HACA 3UOWA 1DEKA 1T15A 2GESA 1E59A 1DOHA 3EIXA 4IMJB 4AMGA 1UKAA 5BN4B 2IUYA 1V41E 2O3RA 3TMAA 4ARZB 4DV0B 4BXOB 1IC6A 1VPWA 5I7FA 4JQCA 5AVRA 3O8BA 4QQKA 3PQFA 1U7DA 2XHEA 1S1MA 1SU8A 4L28A 3GT3A 1EJBA 4LMBA 4RTQA 4CMHA 4ZN6A 2RC5A 4X7BA 1O96B 2HFKA 2VSQA 3UAXA 5BV1A 4B6OA 4EH1A 4LBWA 1I1NA 4HDKA 2EEZA 3GJYA 1C29B 1PJSA 2QMYA 4J0JA 3I32A 2CFOA 4LJ7A 2EYQA 2IUSA 3DLCA 4NJEB 4QULA 3HN6A 4UHJA 4F84A 4PG8A 4LHXA 2QF7A 3D8RA 2QG6A 3IDAA 4BIMA 5JRDS 4CM3A 2ZCJA 1DBIA 3VR0A 4WY2A 4XE5A 3CMCO 2QTGA 1OFGA 3DC2A 5ALSA 3RABA 3TNYA 2PLNA 3EQ6A 3CH4B 1M34B 2OCAA 3L6RA 3FVRA 1XK7A 1F0NA 1ZGHA 2Z4TA 3G9TA 4O1MA 2Z6AA 3TQSA 2ECPA 4KDCA 3W1WA 3CXUA 1FFXB 1FMCA 4GOJA 3DDWA 3LUJA 3V9PA 5KYKA 1A9SA 3HB4X 4V3CA 3PQ4A 1VYTA 1HOTA 3IS3A 2CXOA 4L0MA 2C29D 3CURA 3PG5A 5LP6F 2HQ1A 3U3RA 3DAPA 1P77A 1M8FA 3LP8A 1JKJA 1PJCA 3KVNA 4FGZA 2G36A 2PH3A 2W48A 1CZUA 3CH6A 1FYFA 3FKSD 3L7BA 1BMTA 1PO7A 4PLWA 4WCFA 3U7FB 1U80A 1N2CA 1VJ0A 3ULKA 5NULA 1XCPA 2OHXA 4BLQA 5AW7A 4BFZA 1QF6A 3BK7A 2OY0A 3L8DA 4HB3A 3TSYA 1FJGB 4D5EA 2DOKA 2EKDA 1N4AA 3LSYA 4LS3A 5BSHA 1G4UR 2V5UA 1D4FA 4YUVA 3AFMA 4YPVA 5I5EA 1H9CA 4J4HA 1OGYA 4TMKA 5EWMB 2IY7A 5FL7D 2C4NA 4NDZA 4JFAA 2QAJA 4EY8A 4F12A 4IIHA 4O1IA 1NBMD 1WDKA 4FW8A 1GCOA 2A4KA 5CB4A 1VM6A 1O5IA 4RJ2A 4D9KA 4LNAA 4U2KA 5DCYA 2NXJA 3SM3A 3P45A 2B8TA 1Y6JA 1HETA 1ZRHA 2IDJA 1HDXA 1X86B 3U4IA 3G8BA 4TVKA 5F2KA 3RLFA 4BVJA 5JFOA 2JGAA 3N8DA 3ZHQA 5CMLA 2X5KO 2XKKA 2H7VA 3DL4A 4I9NA 4JASB 2JATA 2VSYA 4WEQA 3LDFA 2V58A 4HLUC 2ACVA 1BX3A 3DP9A 5ALIA 4JI3B 1DQRA 1Y1KE 3SKYA 4EX6A 2CCJA 4GI2A 3MFYA 2A1UB 2QMEA 1EWVA 5E9WA 4ZCLA 3M9LA 1GGEA 4BLVA 2ZJZA 4D99A 1SM4A 1Y1LA 2GAIA 2XOXA 3AB3A 4H3SA 1P1IA 5ALYA 2EBHX 4M86A 3ZZ1A 3QUTA 1TIKA 3JVVA 5B1HA 4LF5B 1IN1A 3HDGA 3GNLA 4KLNA 4MUXA 1DIHA 5DW3A 1ZPDA 3KJHA 5JARA 4DNQA 4IZ6A 5BNFA 4BJ5A 1CQIA 4JA2A 3PEWA 4A6EA 2P0AA 2Q2NA 3IA2A 4AURA 5CLFA 1G66A 3LF2A 3QI2A 4DDMA 2OCLA 4URVR 2HWKA 3IAM6 4A10A 3Q3CA 3N53A 3L7JA 1GA4A 1VXOA 3RRNA 2FZKA 2WINI 4MS1B 3S8EA 3G49A 4N0MA 3O4VA 3NWBA 2M1ZA 4I8DA 5FHRA 3ZZTA 3AEQB 3A1WA 1X39A 3PGKA 3OPYA 1JEJA 3CVYA 2FWPA 1JIJA 2EZTA 1TQ8A 1R8QA 4CKBA 3GDHA 3DEFA 4Q3CA 3NIBA 2AJDA 4QG7A 5F73A 5THXA 3F74A 3AKCA 1YGPA 4MW5A 3UPDA 4D80A 5LOVF 2JIQA 5K6AC 2P8SA 4GLLA 2XMDA 4G5HA 4II7A 3HB0A 4KO3S 1MC1A 1GPBA 2ADMA 5C34B 3HU3A 5HF6A 3PICA 3WHLA 1H6CA 3ICOA 4GS5A 3R3ZA 4R8RA 1BA3A 4LVOA 3K8QA 1WTCA 3MPOA 5DX8A 4A73A 2R44A 4IIYA 4KE7A 2R8XA 1JUDA 2PZ8A 1W36B 1Y9JA 1Z34A 3SY8A 4MS3B 5ENVA 1HMPA 3VDQA 2YVLA 4O4IF 3W0LB 1KFKB 2Y67A 1RXIA 4OXIA 4LK2A 1N1GA 4O8ZA 5EJ8A 4BNTA 5EKXA 4H6PA 1QWOA 2J6IA 2J6CA 5D3MA 1T9GR 1V5WA 3HVUA 3HBMA 1GQSA 5AVTA 3HGMA 4IWXA 1R3UA 1NF2A 4RGQA 2ALJA 2Z1NA 4FDLA 4RZIA 5AR1A 2BHRA 3TW0A 5I7HA 2QA5A 5BUZA 2F67A 3PXEA 4V0LA 1UJCA 3WLJA 1QX4A 4M53A 1IJFA 1XFAA 2WVJA 1KDZA 1Q1ZA 3R5HA 2X6TA 3HYCA 4K1LA 3S1AA 1XHLA 1EDEA 6ABPA 2V7BA 3D6AA 4JBHA 1LNZA 5E6UB 1JR6A 4RK6A 2MIIA 4QJ4A 3IESA 4REQA 4IGAA 1VSVA 1XELA 3O1JC 4KIWA 1YOBA 1K2VN 5I9NA 2IYWA 3WOHA 4AZ0A 4H7KA 1MB9A 1I24A 3WBJA 2IHYA 3L7YA 5MDHA 4C4RA 4PX2A 2BGMA 3FMGA 4X60A 1A7KA 1H85A 1P5JA 2W98A 1J07A 3DV0A 3CUYA 2OAEA 3FPGA 4DMLA 1L4LA 1PR3A 3PHBE 1WSWA 2OILA 3ROKA 2HDHA 2G0NA 4JJIA 3LUFA 4QLOA 3KL4A 1QCCA 2FV8A 2WWIA 4OHOA 5E6RB 3JQAD 1QAMA 3VHQA 4MR8A 1OMOA 5GVSA 5LZ9A 2C96A 3JWIA 3HO8A 4PTLA