1HY3A

Crystal structure of human estrogen sulfotransferase v269e mutant in the presence of paps
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
289
structure length
287
Chain Sequence
NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTROGEN SULFOTRANSFERASE
publication title Crystal structure of the human estrogen sulfotransferase-PAPS complex: evidence for catalytic role of Ser137 in the sulfuryl transfer reaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 287
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1hy3A00
3LXXA 2OCAA 3I8SA 2V55B 2XNDA 2JCSA 3GLGB 2UZ3A 1G5RA 1SXJD 3F8TA 2ZI4A 4QHYA 3W5JA 1QVAA 2OCBA 1LNZA 3L8ZA 1HYQA 4RY2A 5FTNA 1NSTA 2Q3FA 2RGNC 1HH4A 5SZIA 1M7BA 4DCUA 5FUVA 3I3SR 1IM2A 2PZEA 4GDFA 1GOTA 4MKIA 1T5LA 1YRAA 4LYHA 3THWA 4V0ME 2YNMA 2QTFA 1G16A 1EXMA 1FPMA 3QE0A 1HTWA 1G3MA 1R5NA 4IEIA 2AWOA 2ZE5A 1G8PA 2ZJBA 3A37A 1LV7A 1ZM2A 1TQ6A 2RGDA 4FMCB 4F4IA 4MITA 3HU2A 4BE7B 2XZLA 2ZRAA 4Z1MA 2EQBA 2ZTSA 3IBGA 2ZS8A 1XEXA 3GLFE 2J7PD 4MRNA 4LC0A 2ERXA 3EPJA 4DDVA 1E0KA 4WZAE 3UKDA 1QHNA 1OXUA 3RS7A 4BWYA 2IHYA 2XTNA 4X8MA 2ZUDA 4ZDJA 3W3ZB 2WAXA 2JDID 5AJZA 1U94A 4RD6A 4EKDA 1NLYA 3C8UA 2I1QA 4UXIA 5SZKB 2VHTA 3UWKA 1E2NA 3Q5EA 2B8WA 2ZROA 2GXQA 4QC2A 1CLUA 3D6TB 5G3ZA 4M9SA 1FTSA 4LY6A 1IJFA 1JEDA 2ATVA 2NQ2C 3FE2A 2YV5A 4RD0A 4Q9LA 5DHFA 4KXFB 1IJEA 1IQPA 2NO1A 5A4JA 1NKTA 2V54A 3N70A 2D2EA 2OSBA 4ZCLA 5BN4A 4JLKA 2BMEA 2J0UB 1RRCA 5JSZA 3GLIB 2QROA 4US1R 4M1OA 3ECCA 4DLRA 4DDWA 4HAXA 1T8UA 2DYKA 3CPEA 2DPXA 4RD1A 1PVOA 2AWNA 2WKQA 2HLDA 2CHVA 1A5TA 2OZEA 2JA1A 1PLJA 3RS3A 1F60A 3CX8A 4TL6A 2WAYA 4F4JA 4V0NA 3CBQA 3CRRA 2CVFA 5JS7A 3ZQJA 3CUEF 3DKPA 3Q7PA 3LH5A 4QJ3A 1G291 1CS4C 4AC9A 4URXR 3V00A 1XD9A 1YRBA 3WMEA 4NP6A 1KYIA 4DIDA 5CDFE 2BMFA 4DZZA 4G5RA 4JLVA 3MMPA 4UNSA 3QBVA 3QI2A 2DR3A 3AKEA 1UKZA 3H4MA 4WW0A 3U4QB 1US8A 3VTKA 3R8CA 3RLFA 1Q1EA 4FCTA 2JASA 3X1WA 1W5SA 4RFSB 3UMRA 3FMIA 4DEXA 1VYVA 3KTAB 4BFWA 2J7KA 2QQEA 1P61B 1RYFA 3BB1A 2MMGA 1E0AA 1UAAA 3DO6A 3UATA 4TQ9A 1NVXQ 5EP1A 2YC2C 3ADCA 2IS2A 2O8DA 3OIVA 1XTKA 3EA0A 2GJAA 3EPLA 4KVGA 1JJVA 2O8CA 1M74A 3ND9A 5CIQA 4P31A 2D7DA 1KI3A 2I4IA 3AP1A 1SXJA 2FOLA 1G3IA 3BFKA 4D80A 2GVDC 1G5PA 3AV0B 3IIKA 4M1SA 1YQTA 2FGJA 1W4AA 3V9PA 1XU4A 2ZU0C 3G5UA 2BM1A 4TMTA 4QG7A 4XIGS 1OYYA 2J46A 3CM0A 4HUQA 3C5HA 5GVSA 2ZYVX 3FHTA 1CR1A 2EFDB 2VF7A 3KZ1E 5AJYA 2PBRA 1CJVC 4NCHA 4RD2A 4UNRA 4A8JC 4FI3C 3VU9B 2BVNA 5IHPA 4WA7A 1ZNWA 2GJSA 5KNDA 3GPLA 1KI1A 3B1ZA 5B2ZA 1WQ1R 5J4HA 1HEIA 1KI6B 2J7PA 2YKGA 3I72A 1W7AA 4GOKA 5C4GB 4B6EA 4HLCA 1E2PA 2AR7A 3B1YA 4KFSA 1DBSA 3GEIA 2ZI5A 5F3WB 3MG9A 2BMDA 2JDIA 1II8B 3ZIAD 4TYNA 1AJEA 3IHLA 3VX3A 2O8EA 4R9UC 4A92A 4U7DA 3LAWA 2JJ1A 3J81k 4AK9A 1ZU5A 1E32A 3LQQA 3E2IA 2IA5A 2WWWA 2PZFA 3TUZC 2O0KA 3RWOA 2CE2X 1CRQA 3EWSA 4GT1A 2J41A 1BYUA 2P0EA 4JIMA 3DM9B 1W46A 5TB5A 3WHKA 1VKJA 3E1SA 4M4SA 2AFIE 3TJZA 3RABA 2ZRNA 4LYAA 4GBMA 2ZRFA 2HJGA 2QL6A 2ZE7A 4ILEA 5KO2A 2XTZA 2G0NA 4JVSB 1GWNA 2H1LA 4W5HA 3LO5A 2IHBA 3LVQE 4LGMA 5FBRB 1ZMXA 4EQ6A 5F9FA 2HXYA 1E79D 2D06A 1MABB 1HURA 3GLHA 3ZD7A 1G7SA 1YZNA 1IN5A 1E99A 1KNQA 1KSJA 4C30A 1NI3A 1W4RA 2F1JA 4YMTA 2H7VA 3THXB 1Z07A 3AF2A 5FTLA 2QP4A 4AG6A 3CR8A 4JVLA 2ZRKA 2QBYB 2MSEB 1D2NA 4LUCA 2IYLD 2UKDA 1E96A 2Q3MA 2MMCA 4EJSC 1N5LA 3PUZA 5GJWC 1GKYA 4QGGA 1BYIA 2V1XA 2OAP1 4F4CA 2O8FB 1XD2A 3N5CA 3CW2A 1E69A 1LTQA 2BJWA 1KOFA 1G18A 2BWJA 3RRZA 3VR5A 2CDNA 2GXUA 4V0OA 4ERNA 2WSMA 4EUNA 5JCZA 1SKQA 2ZRGA 1TADA 2EWVA 4UXHA 3GJXC 3DEFA 3GJ0A 5KDLA 3ADBA 2PX3A 3EZ7A 3BAFA 4CEIA 4MYCA 1RPZA 2CXXA 1Z6TA 3VNVA 3ZZ0A 4GMXA 4Q4LA 5E7IA 3AM1A 4NZYA 1Z06A 1E9SA 5DN6D 1Z28A 5LDDC 2O8BB 4I1SA 1RKBA 5HKKD 3QKSA 3B85A 2X2EA 2KB0A 4AKHA 4D4JA 3OEHD 5JLJA 3K0SA 1P4SA 1Q3TA 2DHRA 2OUKA 3QXHA 1IY1A 5DI3B 3AVPA 4ZIRB 2GBLA 1Z6XA 2DWQA 4E09A 3X1DA 2RGXA 3FPAA 1E6CA 1JEEA 5JBQA 3B78A 4A4DA 2FMXA 1ZAKA 1XMSA 4LPSA 1Z47A 2GWHA 2OBMA 3L2OB 2JATA 3SR0A 4RFSA 1DAHA 2FH5B 5DHAA 4L9SA 2W83A 3DHWC 3BD9A 5EQTA 4LV6A 4FMDB 3WY9A 2AXPA 5C18A 4B35A 3K53A 1VG8A 1SULA 2ANCA 2IL1A 3B8HA 2F9LA 4DSOA 3AH8A 2C9CA 3KXLA 2GAAA 3LLUA 1Z3IX 3B9QA 1Z8FA 2IYVA 3Q72A 5LD2C 2HYIC 4Q01A 3KUDA 4V0MA 2OCYC 4RVCA 3VHXA 4C0HA 2WSSD 1F2TB 1I4LD 1KO1A 2OCPA 1J2JA 1CJKC 3QF7A 4JT4A 1M7GA 1ZC4A 2ZR9A 3QBTA 4UNPA 4A2QA 1J8MF 4Q18A 3T1QA 3AVYA 5K8LA 4G5QA 3RAPR 1H8ED 3DMDA 1OT3A 3EWAA 1GIAA 4LYJA 1IN6A 2WWGA 1KK0A 4NONA 4A6XA 1OH7A 4CEJA 3GLFA 1EWQA 2RGGA 4TMVA 4O0MA 3EIQA 1KI4A 1L2TA 3CIOA 1PUIA 1MH1A 5KSOA 1XCPA 3L0IB 1JQJC 5CYPA 2HF8A 2G88A 2WWIA 4MKGA 2ONJA 2ECKA 1K5DA 4US2R 2H17A 4DLTA 3AKDA 3R20A 1XTRA 5E95A 4LWZA 3EXAA 4PTLA 4RKFA 2IT1A 2W00A 2ZAOA 2VP2A 4FCWA 1AZSC 3TVTA 1MT0A 5J4YA 4WXPA 4Q7MB 3I5YA 3CZPA 1GVNB 4OHVA 4Q1CA 5C1BA 4PQYA 4F93B 3THYA 2C5LA 3OESA 2BV3A 4B75A 1W36C 1G3RA 1PZNA 1KZ7B 4I4LA 5FOTA 3TSWA 5J4LA 4NYIR 2B8TA 2VYFA 5C4MA 2WV9A 3L82B 4QRHA 3NC1C 3Q8XB 1E79A 4BFZA 4MKHA 2GJ9A 3IEUA 4HZIA 2J0SA 2VTKA 2Z4SA 4KSBA 3KFVA 4Q9HA 2QQ0A 3N2EA 2YWHA 4B33A 3FGNA 1KI8A 2ZRDA 4GFDA 4GZMA 4ARZB 1OSNA 1Z22A 2ZJ5A 3HU1A 2D74A 2OFXA 2R8RA 3NHAA 1ZNYA 3BGWA 1NVWQ 1A2BA 4AI6A 2AHOA 4UQOA 1XTSA 1N6NA 3CO5A 4M9ZA 4Q9KA 4NYIQ 2FN4A 3AVOA 1OXVA 4DLWA 5A5GA 3SYNA 3PEYA 1EFUA 1KHTA 3BFVA 4Q21A 2V9PA 1E4VA 2HT1A 5JI3E 1NVUQ 2J0VA 3TW4A 1KK3A 5CDFA 4LI0A 4JL5A 4O2RA 2VHCA 3B82A 2B7BA 1S8FA 1B0UA 1AZTA 5DN6A 5HTKA 4KITB 5KPJA 3VAAA 2QENA 3IHWA 4BUJA 1G8HA 2CLDX 2ZU6A 1SHZA 5HKKA 3N2IA 5JWOA 1GILA 3BB4A 1G3QA 4AKGA 1G6OA 4JL6A 2ZJZA 2B6HA 3OEHA 2B21A 4IRUB 1EK0A 1DAEA 4PZZA 4I1OA 4A9AA 4D4LA 3A36A 4BZPA 3A58B 4QHTA 1S9DA 1G4AE 4Q4HA 2FSFA 3A6PC 4G5SA 3QPUA 2WIAA 2PLFA 3DOEA 1OB2A 2C9YA 4EPXA 3NH9A 3TNFA 4ZCMA 1XXHE 1JR6A 4DWJA 4MDEA 3EW9A 4HI0E 2IEYA 2CL0X 2PMDA 4AYXA 1KJZA 1UDWA 2W6ID 3QSYA 1L7VC 3R7WA 2OAQ1 4TZ6A 5AWFC 3I8XA 2XEXA 4KV9A 4PPNA 4FIDA 2G3YA 4Q7LA 3RC8A 1NN1A 3K9GA 1DARA 1AS0A 4R2HA 1HT2E 2WSSA 2BOVA 2QA5A 3K0CA 1TTTA 2NZJA 2XJ9A 2OXRA 4LHWA 3TUJC 3SNHA 2AD5A 2C77A 5FUXA 3PEWA 1UM8A 1DG3A 1H8EA 3O47A 4PR0A 2DWOA 3I32A 3EC2A 1P62B 4Y0VA 4DJTA 5D3QA 3MRSA 4TLDA 3REGA 2DBYA 4CGZA 2ZSDA 1JB1A 4AIIA 3W6NA 1NL3A 5JWRA 2ZJ2A 4KBFA 4OK3A 3K9HA 2EU8A 1G7RA 1HA3A 2G77B 4Q9IA 5DH9A 1ZM3A 2ZJ8A 1AQUA 2HJVA 4RD3A 2KJQA 3AVXA 3U7FB 3BH6A 4XH9B 1XJCA 4M22A 1OH6A 2WTUA 1XTJA 2X1VA 4OL0A 5AJXA 3KL4A 4NKRA 2ZM5A 1J70A 1L4UA 2ODEA 2QE7D 2O52A 4ESVA 2ZITA 3THWB 4PQRA 1JAHA 3SI7A 2C2HA 1KI7A 1ZBDA 3EZFA 3T12A 4GOXA 1VMAA 3T06B 1Q20A 2O0JA 2JLRA 4TTQA 3W8NA 4LPKA 5CITA 4QOSA 2F3TA 3ZVLA 4D2IA 3T34A 3MD0A 4BRWA 4CRWB 1XEXB 2RKOA 2IS4A 2QGZA 4BFTA 2GRJA 2A3RA 2KI5A 2PZGA 1D2MA 3AKCA 4BFYA 4B43A 2H8KA 1R5OA 1E2IA 2CBZA 1ZM7A 5FBWB 3RVBA 3PV0A 2XJ4A 4KO8A 1S3SA 3IO5A 4PAQA 2FEMA 4AYTA 4BLRA 4KI0A 2FFQA 3MWLA 2OO7A 3P27A 3TLXA 3QKRA 2G9NA 5KOYA 2FFAA 1GL6A 2BBOA 2GKSA 1RRGA 3A4MA 4D0LB 4Q4JA 3MJHA 4DLYA 2IYRA 3OF5A 4QBIA 1E9DA 1A2KC 3I62A 2UVQA 1S96A 1N6OA 2XB2A 3U61B 2YINC 2J0QA 4Y0AA 1WF3A 4LYFA 5IK2D 1GNRA 5FTJA 4CT4B 5JSZB 1P6XA 3Q9LA 4HAWA 4WOPA 3OHMA 2V7QD 3TIFA 4NH0A 4EIWA 4D82A 1E2FA 1AGPA 1UF9A 4DCTA 4RJLA 3HR8A 1FW6A 1XDBA 2KBEA 2RGEA 3KQNA 2ZYTX 1NSFA 4XWAA 2ZETA 4H9GA 1E2HA 2CJWA 4K46A 3ETLA 1BMFD 1M8PA 4ASUA 2A5GA 2GVZC 1IXSB 1WB9A 2W6IA 1Y3AA 5HE9A 2NO0A 3KB2A 3B6EA 3PENA 4HB2A 3RRMA 2VPPA 5G40A 1TQDA 4ZDKA 3NBYC 2WWXA 1OKKD 4O3MA 3QVUA 5FUWA 3QUSA 3B2EA 4JLAA 3EIEA 2V8OA 3IEVA 2ZJOA 2IYTA 1YR7A 2GAOA 5AR1A 5IRCD 1T6NA 3RSOA 3W5IA 1GSIA 4P4UA 2FZLA 3VHLB 4PSAA 2W2XA 3WP0A 5L3RA 5C46F 4Q1DA 1MRNA 2QAGA 3LLMA 4DXAA 1P3JA 2PH1A 1X8LA 3FB4A 2AKAB 2AL7A 3NKVA 3B1WA 2O8CB 1W4BA 2FEOA 1TU3A 4DT1A 3EX7C 2XAUA 4CF7A 4Q00A 1NIJA 1SXJB 4OJKA 3MGCA 1ZW6A 3I73A 5BN3A 3Q3JB 3SEAA 3VR1A 4C2TA 4N0DA 3IUYA 4NTZA 1KY3A 2R2AA 4HAVA 4XVUA 2ZREA 4JJKA 3WYGA 1TX4B 2OEPA 2QE7A 4HUQB 3KJIA 3NC0C 5FL7D 4D25A 3QQ5A 3OIUA 1CEEA 2REXB 4PC2A 4TLCA 5EUQB 3LA6A 4JLDA 4PPGA 2PLRA 3H1TA 2Q9AA 1FP6A 4QBGB 1SZPA 1TNDA 1KO7A 2BCGY 1NG1A 2YC4C 3BERA 3RRNA 5GJBA 4B71A 4V02A 3H0KA 2F43A 3DDCA 4JVMA 1OXSC 1ZM4A 2OV2A 1CRPA 2EWWA 3H2YA 3BJIC 3U3MA 3KXIA 1A4RA 1NMXA 4Q7JB 3NXSA 2QMUA 1F5NA 3S1AA 4TYWA 1O87A 2OHFA 2BBWA 3A1SA 2O8EB 4MGIR 4QL3A 1KDOA 1TL7C 1CKEA 2QMEA 3WRXC 4LJ5A 1A1VA 2PCLA 2ZRLA 5DLQC 1TUIA 1KKMA 3BE4A 3L8YA 2IC5A 4Q1EA 2ORIA 4FWIB 3WNBA 3W9YA 3WYFA 4N3NA 1NKSA 4HAZA 5FL3A 1UFQA 4IW3B 4DSNA 3T1OA 4OQLA 4PSKA 2QSYA 1II0A 1E2DA 1NF3A 1JR3E 2PEYA 4LBYA 4D6PA 4IOLA 2WWYA 1DOAA 3CPHA 4Q19A 5IK2A 2PT5A 4G5OA 3RHFA 1P75A 1Q21A 2V7QA 4LHYA 5CJPA 3RNLA 4HAUA 4EQ6B 2H92A 2A5FA 3U7HB 3GLHB 3R8FA 2RGBA 3AF4A 1G64A 3GEHA 1PV4A 4ZKEA 2GZHA 2DCUA 4ON9A 2CHGA 2JJ1D 4Q7KA 5TARA 4B74A 4GSYA 1Z0DA 2F1RA 4B6FA 2O0HA 2NOAA 1BMFA 3IBYA 4UNNA 3FVQA 1KSGA 3BFXA 1E1RA 5B64A 3AVQA 3MWYW 3QPWA 1XRJA 4C0QC 2NO9A 421PA 1OH8A 1ZVQA 2ZVQX 1XD2B 1KI2A 3CH4B 2ZANA 2R6CA 4JMPA 1OKKA 1W2HA 4OI2A 3GFOA 3UWOA 3B13B 4BLQA 1QG4A 4GPTA 2R9VA 5CB8A 5KSZA 1E3MA 4Q4AA 1QG2A 3SJZA 1CR4A 1EG7A 1QVRA 4NE2A 4QGAA 2QSZA 3CF0A 2SHKA 3ZD6A 3GP8A 5CK4A 5FPSA 5CM8B 3D7MA 4CEIB 5BYJA 2RMKA 3BXZA 4EPYA 1W48A 3W8RA 4C9BA 4Q1FA 4JBXA 3MUFA 2EFCB 1U99A 2HYDA 2O5VA 3HWSA 4ZKDA 3VMFA 1ANKA 1O3YA 3QKSB 2X2FA 1UBGA 4JBYA 2ZSFA 4M0LA 1VTKA 2PT7A 4MRVA 1ZYUA 1Z0FA 2ZRHA 4NCKA 1KMHA 1YR9A 2C99A 3WNDA 3VR6A 4BRUA 3QY0A 2D4HA 5KTYA 3F5FA 1X6VA 1OIWA 3BS4A 1CTQA 2GESA 2RGCA 4LX0A 1C9KA 1VPLA 1UEJA 5EE5B 2WKPA 2J45A 4JKIA 1ZNXA 3UMFA 3PEVA 1UKYA 4TSFA 2FFHA 4XSGA 5BQ5A 5FL7A 3UK6A 1CU1A 1RRPA 3V4FA 5LBIA 4A6PA 5EZ5A 1QHGA 2WMOB 3PVSA 5FI1B 5KYKA 4GL2A 3AGPA 5CJ2A 4P4SA 2V6IA 2R62A 4M1KA 4TTRA 2IUUA 1QZXA 5KDOA 1Q0UA 1XPOA 2Z5FA 3LV8A 1D2EA 1EFRD 1U8ZA 3E70C 1N6LA 3D8BA 3CPJB 4NL4H 1VECA 1I2MA 4JLPA 2ASEA 3UG6A 5HR5A 4FMDF 4BFUA 1TPZA 3TK1A 4URYR 1DG1G 4JSYA 4PC1A 4G1UC 5JHHB 1U0LA 4RZ2A 3IO3A 4PZLA 1ZIOA 2AD1A 2CEAA 3L0SA 4CEJB 1ZD1A 2VQSA 4WXRA 1DAGA 3GLFB 2XGJA 2C96A 2QEQA 1OPXA 1MO3A 1U9IA 5EXTA 1B23P 3T1TA 1WBBA 4C0JA 4NBSA 4DKXA 2HCBA 1ODFA 2YWGA 1Z5ZA 3QKUA 4JKYA 3O8DA 3TQCA 4LDJA 2VP4A 1HUQA 3IDQA 3DM5A 2WJGA 4PXAA 2Z43A 3I92A 2P3SA 3V4RA 2QPAA 3EZ2A 4XSHA 5BXQC 4MKFA 2ZSEA 2V4ZA 4R2IA 3KQLA 4LJYA 5DO9A 5F2EA 3LBHA 3TAUA 1D8TA 3THYB 4DLSA 4NCJA 4IHQA 2NGRA 1YZKA 1I4TD 4OI0A 3DPUA 3NBXX 3K9NA 3OE7D 5J4KA 3PEUA 1D5CA 4B3FX 4G5GA 1MV5A 2FF7A 3I5XA 1JR3D 1YZGA 1D6JA 3TGPA 1DPFA 3RRYA 3O8BA 4P0TA 5TXGA 1G17A 4PPQA 1YHNA 2P65A 1IHUA 1HQYE 2QRNA 4XOIA 2NO6A 2C8VA 4I81A 4E03A 3AVVA 2PCJA 2IXGA 2QM8A 4LJ7A 2VHQA 3QG1A 2E9SA 3RS4A 2E87A 2J5XA 1VYTA 2XZOA 5AUQA 3U6BA 4LJ8A 3OEED 3RYTC 3F0TA 2EFGA 1NN3A 3ADDA 3ZVRA 4EFNA 3HDTA 2BIFA 4R98A 3JVVA 2A5JA 2BC9A 4OI4A 1VCIA 1Z6GA 4JLOA 1SKYE 2IS6A 2FZ4A 3VR2A 5JRJA 3AP2A 2FNAA 3MJRA 3QG5A 1ZD8A 3BC1A 4OHYA 3HU3A 4POAA 4UXJA 2VBCA 2ORVA 2PEZA 2X77A 121PA 3CRW1 4QGHA 2GDJA 3BB3A 4W7SA 3TSZA 3NDPA 1Z2CA 1Z6AA 2F9MA 4MRRA 1FX0A 2ZUCA 4OHZA 1FMJA 1KJWA 2VRWA 1PUJA 4HLUC 2A5DA 1U90A 1J8YF 3NH6A 4Q4HB 3D3QA 2OBLA 3PUXA 4US0R 1G41A 2IXEA 1N0VC 1TQ2A 4MRSA 1P2UA 2AX4A 2W2VA 4RSGA 4LRWA 1T3LA 2FSIA 2XZPA 3AF1A 3SC3A 3IIMA 4B3XA 2VEDA 4KVAA 4AKIA 5EXPA 1J7KA 1G21E 1EWRA 3R7WB 3O8CA 2RHMA 4OQMA 4TT3D 2A78A 3LBNA 4RD4A 1Y63A 4B3GA 1GNQA 1P9WA 3KKOA 3F3YA 4M8NE 5FUYA 1EFRA 2WJYA 1LS6A 3GCGA 1RJ9A 1T91A 2H18A 1JBKA 1JPJA 2WVJA 3UPUA 4NPHA 821PA 1ELOA 4IXNA 1VCMA 2BCJQ 1R2QA 2REBA 1FTNA 5D3MA 5GJCA 2P67A 1FQKA 1Q44A 5JMTA 2GNOA 4DSUA 3QOFA 3CX6A 2V6JA 4B32A 2ZS7A 2YWEA 4S35A 3K0FA 1KO5A 2QP3A 1ETUA 3BH7A 2JLVA 4JT2A 1DO0A 4ZO4A 1NJGA 3NBFA 5AUOB 1P9RA 4HLQB 1NY6A 3QKTA 4LV5B 4RZ3A 2D2FA 4GI7A 4X8OA 4DEYA 2ZSBA 1V5WA 1P9NA 1AS3A 2VP9A 2WOJA 5FR2A 2YJTD 1IBRA 3LW8A 5B57C 5HZKA 3SJBA 1OH5A 5HZHA 1EFCA 2CVHA 1E2KA 1OIVA 5J5CA 2AXNA 3ZVNA 8OHMA 4C2UA 3K9LA 4KBGA 2OESA 4NHOA 3OE7A 1IOZA 3SHWA 1QF9A 1SVIA 1R0YA 1Z2AA 1FZQA 1ZNZA 1LB1B 4PHTA 1JR3A 521PA 1OFHA 2X8AA 4TYYA 1E2QA 1XNJA 2IUSA 1X1SA 2QG6A 1XZQA 2FPLA 3DZDA 1OF1A 4L4UA 2R6AA 2EW1A 2GA8A 1P60A 2RGNA 4M9XA 4IKEA 5EE3A 5FPKA 5KU1A 2CE7A 3K1JA 3QXSA 3AF3A 3TW8B 4TYQA 4YMUA 1HE1C 2ZI7A 1N6IA 3CF2A 1KSHA 4BFXA 3TKLA 2W58A 2PL3A 5FH9A 5JRZA 4DB4A 2OG2A 4TL7A 2F6RA 3OEEA 4QM6A 2A2ZA 1MO5A 2QPOA 3AP3A 4KFRA 3QKRB 4KU4A 5TMPA 2C9OA 1YVDA 3SU8A 3KKPA 3AUXA 3WYAA 1JJ7A 2WZQA 4Q4JB 3A4LA 2ZE6A 3EIHA 1GNPA 3MAAC 1UPTA 2CNWD 2NIPA 3HP1A 4OHXA 4B2PA 2PMKA 1UBFA 2IYZA 4IDNA 3RS2A 4BFVA 1YE8A 5EE0A 1IN4A 3DZ8A 4QXAA 3PITA 1P73A 1X1RA 1H65A 4U00A 3LX8A 3CRVA 2WIBA 3OZXA 3G0HA 4N0EA 1E9BA 3T61A 2QAJA 5KNCA 2ZYWX 1WXQA 3BRWD 3HYRA 2JLUA 1XPUA 5FOWA 2VL7A 3P4XA 5L3SA 5FBVB 2A30A 3U3KA 3K8YA 4PO9A 5JEEA 3REFA 4QM7A 3FWYA 1SVKA 1FP7A 1E94E 3KKNA 4PHHA 3ZH9B 2CJWB 3A1TA 1KNXA 5JJLA 4EPTA 3RC3A 2QUZA 1KK1A 2BBSA 4PFSA 1NRJB 4ACBA 4TT3A 1N5IA 2OXCA 4IDOA 4A0RA 1DTSA 4Q48A 4OYHA 3QXJA 4HEJA 4WZBE 4Q1AA 5K8UA 4GMDA 2XOKD 4PQFA 4YMVA 1N0UA 5E7JA 4E22A 1A7JA 1UBEA 2OT3B 3ZGXA 4OK5A 1LF0A 1MR3F 4M1MA 1G7TA 3FHCB 4BFSA 4R71A 2ZXUA 1R8QA 3IILA 5JECA 4A1FA 1XTIA 2QAGB 4J0QA 1N25A 3FFAA 3CB4A 3OFND 2DB3A 4LSGA 1CIPA 5M04A 2Z0MA 4NDZA 2WOOA 4ASUD 1GP2A 4DT1B 2AFHE 2Z4RA 5IDVA 5KUTA 1WCV1 1S2MA 4F92B 1P2VA 1ZM9A 4A2PA 5L3QA 1VDZA 1T9HA 4URVR 2AN9A 4LHVA 1G7CA 3FMOB 5J4VA 1YZLA 1WRBA 2FPMA 3HYTA 1MO6A 3TUIC 3UMSA 3IIJA 4CVNA 3SQWA 4WBSA 4E07A 4TL9A 1GFIA 3B9PA 4D0NA 1NN5A 4P33A 4NMMA 4P4TA 1CJMA 3QF4A 4WIAA 1X86B 4DIEA 4RZUA 3U44A 1JPNA 4AURA 1NJFA 2GCOA 1E0SA 2ODWA 1E98A 3ZZUA 3KKQA 4YMWA 4DBLC 3VFDA 3SOPA 5LB2A 2F43B 3T15A 3LDAA 2CMKA 4LV8B 3C15C 3NDBB 3GJ7A 5IT5A 2F1IA 4EAQA 3S1AB 2CL6X 1A82A 4MH0R 2IW3A 1W44A 4X8HA 1LF5A 4WZ6A 2P2LA 2WBLC 3WNCA 3ZDQA 5SZJA 2YHSA 2ZIAA 3PR1A 4HATA 3PG5A 1SXJC 3FYHA 2QT0A 3TR0A 1CULC 4IFEA 4A8JA 1GL7A 3P20A 4CT5A 1TEXA 2ORWA 4H1UA 2AK2A 2B7CA 2BM0A 2CNWA 2ZI3A 1EFTA 1IN7A 1K6MA 1UEIA 2CLCX 2JJ2D 1N5KA 2DWPA 4M21A 1XF9A 1W0JD 3MWJA 3FMPB 1N6KA 2VP6A 4HB0A 4DLZA 1VG0B 2EFEB 1U0HC 1NP6A 1XZPA 1C4OA 2VSXA 3CLVA 3GJ6A 4IDQA 2RHDA 4AWXA 5ELXA 4CW7A 3K0AA 4ZDIA 3RWMB 4OI1A 4URZR 2P5SA 4LOAA 2ZI9A 4GRAA 4BLOA 4JJZA 1M7HA 2QMOA 5EZ6B 1GDDA 5BWMA 1WE2A 2KWIA 1G1MA 3ONWA 1JALA 3CZQA 4KJZA 4BASA 1UADA 1WDTA 2GILA 2JLYA 1P2TA 3SS8A 1R0XA 4FWTA 1XXHB 2C95A 1BOFA 3HJNA 4JLNA 4Q4AB 1ZCBA 3LW7A 3GJ5A 2GJ8A 1YKSA 3SBDA 4K8OA 2XOKA 1WBDA 2BEKA 4GP7A 4DUGD 2QU8A 4XWOA 1XMIA 2WJVA 1JXMA 1KMQA 2LCFA 5H8WA 3CH5A 3CX7A 4JVNA 5JEDA 3NG1A 1Q57A 2ZRCA 4CEHB 2QPTA 3KQUA 4HYYA 5FR1A 1QHHA 2HCJB 1KSFX 1F6BA 1N3BA 1SVOA 3GLGE 3OFNA 1E2LA 1FFHA 4GOJA 4EJSA 3NVAA 1Z63A 5AUPB 3LFUA 3PQCA 5DNYB 1E9RA 1KMHB 4JS0A 2XX3A 4L9WA 4BPBA 1E9FA 1UDXA 3KFXA 5TVKA 1E1RD 3QEJA 3WMGA 3X1XA 4OQNA 1HV8A 3DMNA 1OIXA 4MGZR 2DFLA 4ZI3A 3LRPA 3CWZA 3U5ZB 2EYQA 3K09A 1F2UA 3QJYA 1R5BA 2UZIR 4L5BA 1RW4A 3I1FA 4P4SB 2QRZA 4RZXA 4II7A 3DL0A 4YXWD 1G8YA 5FBLB 3CF6R 2ZS9A 4M2LA 2ZR7A 4ZV4A 2R6DA 4Q03A 4KLNA 5F9HA 3AVTA 4LBVA 1EFHA 4JL8A 4KCGA 5AJVB 1XMJA 2WPDD 2FG5A 3ZS9A 4A0HA 4MYUA 4TQUS 4TN1A 4DLVA 5JCPA 1VYUA 1E9AA 3Q7QA 4AD8A 4OK6A 4QHSA 3ICQB 4ZI2A 1OFUX 3NTUA 4Q9JA 3K70B 4AG5A 3AEZA 1GTVA 4KAXA 2ZJYA 4KLZA 2IEZA 4TSFD 4A0FA 4NYJR 4NU0A 1D9ZA 1G4UR 2E1RA 2GBLC 4TZ0A 2CLSA 1X8JA 4MUBA 4MYTA 1AQYA 1T3HA 2NO7A 2OE2A 3R9WA 3FKQA 3SYKA 1DADA 1U81A 1X3SA 4GNKA 3FFBA 1FUUA 3X1YA 3X1ZA 2JJ2A 3PXGA 2P6UA 4G3XA 1W49A 5DE3A 3GLIE 3WRYC 5AJWA 2JEOA 1XEFA 3WP1B 1WMSA 3RDPA 4LC1A 3ZYCA 3QXCA 1W0JA 1QDEA 4A82A 2EFHB 4XWKA 3LXRA 2C98A 1VHTA 2QGNA 1AKYA 1UKEA 5FOXA 2NPFA 4NYJQ 1DAFA 3CONA 2IWRA 4EPRA 4ESHA 2D3WA 1XX6A 1J90A 1QRAA 3ASYA 4V03A 3K70D 4LJAA 2Z6VA 4EFMA 3NIBA 2ANBA 1K5GA 3ASZA 4D4KA 2VSOA 4HAYA 2CCJA 4C7OA 2KE5A 3SJCA 3U3RA 4HZUA 1KI9A 5JHGB 4QNRA 4LCBA 2HEIA 2F1HA 1G19A 1ZRHA 3VKGA 1NG9A 1TEVA 3CNLA 1RIFA 1G5TA 4IOKA 4BLTA 3ZZTA 4I1VA 4MQBA 1GZSA 4B76A 1FQJA 1OV4A 4UJ5A 2IWHA 2FX3A 4ZPXA 3TRFA 4LJ4A 2FA9A 1SGWA 3AKYA 4TMWA 4DC9A 1G3UA 3AB3A 2X19A 2ZRMA 1QHXA 4FN5A 4IVRA 2R44A 4PAOA 2YOFA 4OHWA 2PJZA 1WP9A 4DUGA 4I1UA 4P32A 3RSLA 2NPIA 1YR8A 4TLBA 4O25A 1GITA 1U2RA 3SJAA 4D81A 5K8TA 5KDDA 4Z54A 5C2JB 2WWFA 4EPVA 3R9IA 1TUEA 4MGYR 4E5UA 2C04A 1Z0KA 2XNSA 2IYYA 1FX0B 1R4AA 2WHXA 2W0MA 1AIPA 1VCOA 3FMFA 1KDRA 4KYUA 4MRPA 1P7CA 4F91B 3LQRA 3H84A 1T3SA 3T1VA 2YWFA 1DEKA 3SFVA 1XXHA 5FPHA 3PIRA 3T5GA 2QMHA 4JLMA 4C0BA 4DCSA 3B1VA 2N1BA 1HY3A 1E0JA 4NCNA 1BH2A 2VIIA 1Z6YA 3IQWA 2ZEJA 4ZDWA 4D0GA 5KNBA 3BWDD 1S1CA 5FBQB 1Z0IA 2NZ8A 2WJIA 1L4YA 1SHKA 2QTHA 2CK3D 4CEHA 4YXWA 3X2SA 1E9CA 5CLLA 4LK2A 3AUYA 4Q02A 4CIDA 2VA8A 1VCNA 3B7GA 1RJ9B 4PHGA 3GMTA 4CDGA 5E7MA 5FOUA 3I61A 1G9XA 1KGDA 2ODNA 2WPDA 3EAQA 3OAAA 2IUTA 3PFIA 5AUNB 1RVDA 1U0JA 3JZAA 1H8HD 4L16A 5D3MB 3W6PA 4BEJA 3KJHA 1ONBA 3LX5A 1OXTA 4R7ZA 5GADl 3GD7A 2G6BA 3K0FB 5LPNA 2BJVA 2XXAA 2JGNA 3RS0A 1XJ0A 1TF5A 2GZDA 4KFTA 4QJ4A 5FOSA 2JLXA 4ITRC 4B3BA 2YOHA 2IF2A 2VF8A 3QENA 2ZPTX 1Z83A 1AS2A 4YLGA 1AM4D 3WMFA 3GJ4A 5JZVA 1BS1A 3U7GA 4FCVA 3VNUA 2HF9A 5JJIA 1XMVA 2IYQA 4EDHA 3TVDA 1YJ5A 4JYCA 2AK3A 1COWD 5TV2A 3O8RA 3SYLA 3TSOA 4MYHA 4B3CA 2J9RA 2D7CA 1DAIA 4JLBA 1Z08A 2A9KA 4MDFA 2GXAA 1S0UA 4QFMA 1IONA 2K5UA 2VO1A 1SVLA 2WJJA 2ZUBA 4A36A 5SZHB 1VIAA 4L8GA 3SN6A 2HT6A 3K0CC 1Q12A 1P2SA 4PAMA 1LFDB 2OFWA 5EE1A 3PUVA 2AKYA 4C4PA 1Q22A 4HDOB 5K8IA 4PSVA 4DRZA 1OYWA 2H57A 2QORA 1ZUIA 3IPYA 1M2OB 2R6FA 2ZE8A 3CNNA 1E1QD 3VR3A 2C03A 5HCIA 4XD7D 2PJRA 2MSDB 1M1YE 4I99A 3SZRA 1E9EA 2W6JD 1VIYA 5DISB 2FWRA 2QZ4A 2OLKA 3CKLA 5HCNA 4JSTA 1CJTC 1IY2A 2JIZD 3C14C 3GJ3A 4C0AC 4Q5IA 3C4JA 4PO8A 4TMZA 5J40A 5KSYA 3PUYA 1HE8B 1F48A 3GFTA 4Q1BA 1TF7A 1Q1ZA 4V0LA 2WMNB 3NHBA 4DCVA 4M1YA 1MO4A 1PLLA 3K0EA 1N2CE 5G53C 1IXRC 2QM7A 2JJ8A 4BQSA 3KB1A 5G41A 3FHOA 5L3SB 4TQAA 3GLGA 2NG1A 3B1XA 1FOEB 3HR7A 1IN8A 4QBFA 1NBME 4TMKA 1OHHD 2IXFA 2A5YB 3BBPA 3EARA 3WXMA 2OLJA 4X8LA 5J47A 2QTVB 1JI0A 2XITA 4QKQA 4M1WA 5AK0A 5H70A 4BLSA 1PJRA 2JLSA 3VQTA 2CK3A 1HQCA 2ATXA 4JYBA 5BN5A 4B47A 2R6GA 2WKRA 4URWR 3EZ6A 4YDSA 4PC3A 3L43A 2FV8A 4HLDA 4W5JA 5CK5A 1P72A 2VSFA 2NMVA 3T35A 5CIWA 3HPQA 1YZTA 3ZQ6A 1KAOA 1W0KD 1H8HA 2ZRPA 4A2WA 4YQFA 3OIYA 3BK7A 5FOVA 3UIEA 4TTPA 2J59A 1NMZA 3P26A 2Z83A 1D9XA 1M34E 4K81B 4TLEA 1FNMA 2L0XA 2C78A 1GKIA 2B92A 4UJ3A 1ZP6A 4UNQA 2Q9BA 4U02A 2ZAMA 1QBKC 1XCGB 3TMKA 4IFBA 2BKEA 4QNMA 4W5WA 5L3QB 3EZ9A 1CP2A 4IJMA 4TYPA 3P32A 2ZVPX 1UJ2A 1COWA 2CL7X 5DYIA 2XTMA 3C7KA 4TLAA 3U44B 3QF4B 2LKDA 3P1JA 2J0UA 2BMJA 4PO1A 1ZU4A 1W2GA 3U2QA 1VG1A 3K09C 3GLIA 1RFLA 3C16C 2GCOB 2G1KA 1RYHA 2GETA 2OBNA 4TWZA 1MOZA 2ZRJA 2VLIA 4H1VA 5H68A 5KPDA 1BIFA 4B44A 1GRRA 3BORA 2JAQA 1ESMA 5G3YA 1XEWX 2GF9A 3FTQA 1PLKA 5IF9A 3VKHA 2GZAA 2ODBA 2REOA 4DVGA 2J3EA 4UKDA 2WICA 2P6RA 3PCRB 2H5EA 2QAGC 4TMXA 1AKEA 3TBKA 3VR4A 4D26A 4WAUA 2CHQA 1XTQA 1E1QA 4FINA 4QJ5A 3SFZA 4DLXA 1GRNA 4XD7A 3LY5A 1DO2A 5CB6A 2BHRA 4L15A 4OJQA 1K8RA 1LY1A 2XSZD 1YR6A 2W6JA 3GFPA 3IPXA 1XPRA 4M1TA 4A0GA 2FDCA 1WA5A 5DIFA 3U4QA 4HB3A 4HDQB 1J99A 4A8JB 5JI2E 2Q9CA 2JIZA 1YZUA 2IYUA 1OW3B 1UBCA 2ONKA 4IVPA 1TMKA 2A7QA 3KTAA 1FL9A 2F3RA 3KJGA 2DFNA 2IYXA 5BW8A 4YMSA 1LS1A 2F55A 1CBUA 4KSCA 1IY0A 3EASA 3EG5A 1JECA 1GL9B 4PC7A 4B34A 4O2LA 1KO8A 3M1IA 1SKYB 2RB4A 2WJHA 2WM9B 3AQ4A 4M9QA 1ESNA 4QBHA 2G0TA 2W0SA 3U7EB 3K0AB 3M0EA 4Q66C 4OQXA 5A0FA 3TQFA 3EPKA 1OHHA 1R10A 1TAGA 2EVWX 3RANA 2VP5A 6Q21A 1IXZA 1KDPA 1S9HA 3ZIAA 3KXKA 1GG2A 3WHLA 3FOZA 1NN0A 4B2LA 1GKUB 1VG9B 2GTPA 2RGAA 3KKMA 4MUAA 3TR5A 1OFTA 4BZQA 1KDTA 1NBMD 1RZ3A 4FXPA 1X8KA 3LWNA 4OKSA 3L0PA 3GEEA 3VX4A 2KSQA 3W34A 1VHLA 4U5XA 4WVFA 1NLFA 2DFTA 3VU9A 1M6NA 1OB5A 3NEYA 1SVSA 1KJYA 4YC7A 2Q6TA 2F7SA 1I2DA 1LVGA 1T5IA 5B58C 1ZD9A 1KI6A 3QXXA 3U6KA 5HE8A 4G01B 1Q1QA 4PX9A 2VH5R 3CRMA 1AA9A 1W0KA 1QHHB 5E4FA 1N5JA 1C1YA 4A15A 1KAGA 2OFOA 4Z8YA 4EJSB 4DDUA 1UKVY 2XB4A 1II8A 4MGKR 4HUTA 2P6NA 4QGFA 3CRQA 1BKDR 1ZUNB 3KUCA 5TY0A 3UXMA 5UKDA 3U60B 1GRQA 1ZJ6A 4IDPA 4JZKA 4NYMR 3W3AA 2HXSA 1ZINA 3JVUA 4CZ2A 4B3DA 1FMLA 1XEWY 1F2UB 1QHSA 3MLEA 3NBZC 1XCMA 1QHYA 1Z0JA 1SVMA 4LJ9A 2GEVA 4PHFA 1U8AA 1OXXK 4YDHB 4C3ZA 3M6AA 1T8TA 1CJUC 4F38A 2CCKA 3JZMA 1N6HA 3AGQA 1U8YA 5JS8A 3LVRE 4IXMA 1T4GA 3QIAA 4LHZA 4BZXA 4OBEA 2IK8A 4NYMQ 1ZC3A 2WWHA 1NLZA 1XBTA 5JWHA 3UANA 2KBFA 2G1JA 1MABA 2FU5C 5EP2A 2FGKA 3THXA 3PJRA 3MCAA 2MSCB 4RFVA 3SDZA 2QBYA 221PA 3T5DA 4ABYA 4AY2A 1EGAA 3DVLA 5TDHA 1E4YA 3C5CA 4IOMA 4XTCS 4C0SA 4TL8A 1W1WA 3SE0A 5L3VA 2GK6A 1MKYA 1G20E 5DSZA 3SQXA 4YONB 2O8FA 2QY9A 1W4CA 2XSZA 4LBWA 5DI9A 1CXZA 4RKEA 2HV8A 4EFLA 2R65A 1KZGB 1W5TA 1YZQA 2G83A 3AF0A 2J87A 5LD2B 3A1UA 2VP0A 2GEUA 4PPFA 1DVRA 2QNRA 1KO4A 2D62A 3KJEA 1JXOA 2IYSA 4LBZA 1S4QA 2GHIA 3QEOA 5DYGA 4HSEA 2JLZA 1QHIA 2O8BA 1F3OA 3ZJYA 1N6PA 4BEBA 1BO6A 3BH0A 3FKSD 721PA 2BEJA 1HT1E 2YOGA 2YZ2A 2W2TA 5EXXA 3KX2A 3ND8A 1DELA 1XWIA 5DI3A 1FUKA 1AK2A 1SVWA 1XFAA 4ZIRA 2OILA 4GP6A 3H86A 3L0OA 5EP4A 5ANRB 5EUMA 1DS6A 3W90A 4C7OB 3KDSE 1Z0AA 1OLOA 3G82C 1XJQA 4HZUB 2GXSA 2DFKB 1XP8A 1KTVA 3SBEA 1S1MA 4KHZA 2QT1A 1EX6A 1XD8A 1E2JA 1G6HA 3FDIA 3MWKA 5B30A 2FSGA 1W47A 4BGDA 1NBMA 2BBTA 3K70C 1E2MA 2J1LA 2IBMA 3BIFA 4FD2A 1U9IC 3KQKA 4B48A 4FMBB 1W36B 1FNNA 1JQLB 5EE9A 1NNEA 4MA4A 2HUPA 1DAMA 3TH5A 3TAHA 5L8VA 2ZQ5A 4G0NA 1R0WA 5JJKA 3QVVA 1S3GA 1F2TA 5DGXA 1RC8A 4ZCIA 4V0KA 4EPWA 3GJ8A 2RAPA 4DHEA 1Q1BA 3EPHA 1U98A 4ACAA 4S2EA 3W6OA 1DE0A 1OFIA 5GJVC 3IQXA 1R7RA 3PUWA 4BLPA 1SXJE 3LNCA 5EP3A 2IYWA 2CCGA 5F98A 5CYOA 4JLJA 1MRSA 2RH5A 4RCZA 2XNDD 4PC6A 4P3YA 3IKJA 2P5TB 4RCYA 3IGFA 1CR0A 2Y8EA 1W36D 1NY5A 4IDHA 4PANA 5E3HA 2QI9C 2FPKA 1N6RA 4Z8XA 2ZJAA 4FMCF 4KFUA 5KSPA 3BOSA 3KQHA 3ZVMA 2GK7A 4IOJA 1XB2A 4AKEA 4DDTA 2FE4A 3LBIA 2IX3A 5H1YA 5CM9C 2LKCA 1NVVR 2GJKA 2VHUA 1T0JB 2LWIA 3A4NA 3DOFA 5FI0B 5FTKA 3A1WA 3U3OA 4HLUA 1SQ5A 4Z51A 2H16A 2ZRIA 1EESA 1KKLA 2OM2A 4IEEA 2FJUA 4B73A 3ADKA 2N42A 4XVRA 1OJLA 5CLQA 1RRFA 4Z1MD 4B2IA 1CF4A 3QNUA 1OE0A 3QPVA 5FPTA 3E5HA 1NMYA 5FPYA 3AVWA 2I1VB 3D31A 2ZR0A 3RS5A 4DCNA 4IVQA 1EX7A 2YYZA 4Q47A 1AN0A 4ARZA 4DB2A 2YVUA 2ZRBA 3GQBA 1AGRA 1Z29A 2QN6A 5HPYB 4NCIA 3CWQA 1NVVQ 2GCPA 5BYKA 3B60A 1N0WA 2XXAB 1KK2A 4M53A 3ZS8A 1E2GA 4C0KA 1GAJA 1LW7A 5GVRA 1GUAA 3AVUA 4BECA 4DLUA 3VKWA 3WBJA 1ZCAA 1E2EA 1JNYA 2JLWA 4XTRA 2Q3HA 3P4YA 3EC1A 4GZLA 3A8TA 4XVQA 1II9A 5KHOC 1T0HB 2Q21A 5EJEA 2GEDA 2RCNA 4W9MC 3NWJA 4D4MA 3ZLJA 1G8GA 1IAQA 4LJ6A 5P21A 1JAIA 5FFMA 3SHFA 3ICEA 2ERYA 1V43A 1US8B 3GLHE 1KIMA 3OAAD 4HDCA 2V3CC 3HPRA 3OIWA 3I4LA 3MFYA 4CYMA 3CR7A 5JFGA 3FKSA 4KYIB 1TF2A 2FSHA 2ZYUX 3NEJA 4DSTA 621PA 2GF0A 3MSXA 4AYWA 2NTYC 2BKUA 2HLDD 2JLQA 1I4DD 3WBKA 1KY2A 1ZIPA 4N1AA 2V1UA 2O8DB 2EYUA 3C41J 3Q85A 2GCNA 1CR2A 2FFBA 2TMKA 2HDNB 2ZSAA 4OQFA 4PZYA 2N46A 3R9XA 1GM5A 4KODA 2Q0HA 4HB4A 1R8SA 2I3BA 2QP9X 3EA5A 3B5JA 1L8QA 2IF0A 3DKVA 5EXSA 1RE0A 4FW9A 5FTMA 2IS1A 1R0ZA 5LB4A 2ZI6A 1YU9A 3UG7A 4C0LA 3THOA 3TE6A 1P5ZB 3Q5DA 4F7WA 1R6BX 4JBWA 2PX0A 4LHXA 3LD9A 1NIPA 1TU4A 1TQ4A 3M4YA 4URUR 2DY1A 4XJXA 1G8FA 1Q3HA 3A1VA 2VHJA 4LZZA 3U3JA 1DAKA 3CNOA 2BDTA 1ZUHA
chains in the Genus database with same CATH superfamily
3LXXA 4R2JA 2Z2YA 2XNDA 2PV0A 3OFVA 3B3GA 1YMUA 1JTVA 4C7MA 3BXOA 1J1IA 4CDRA 4EVSA 3GBVA 3F8TA 3TFOA 3CT6A 1JWAB 1LNZA 3GG9A 3BE6A 3KVYA 4HDSA 3UW1A 4DRYA 1J00A 1ZGBA 2RGNC 1M7BA 3PC8C 2G5TA 5DU2A 4MS4A 5B2FA 3EHDA 1IM2A 2PXCA 3CS3A 1IYZA 5KIAA 3BJMA 3HV0A 4YFYA 3TMAA 1ULZA 1FSGA 1TM4E 3LWZA 4JGGA 1PQ4A 4LYHA 4V0ME 2OC9A 3WIEA 4G1CA 5THQA 3KYCA 4N48A 4WMLA 5BN5B 1BWPA 1KP3A 1GGMA 1G3MA 1R5NA 3OJXA 4BV2A 2VRBA 3TM4A 1N1GA 3H1BA 4QECA 1EDZA 4XGRA 2LNDA 3A37A 1LV7A 1ZEMA 3PQ8A 4DFDA 1J5XA 1I9CA 3IRVA 1Y98A 3O4GA 4PGAA 1C0IA 1W25A 2EQBA 2ZTSA 4Z1MA 3WHPA 1WZIA 1KZYC 2C1XA 4ILKA 4I6JA 2PLNA 1LQTA 1SKUA 2FY8A 2J7PD 2VPIA 4GKKB 4GS5A 3WLFA 4E5SA 4H4DA 4WZAE 1ODJA 1OXUA 1LH0A 1KYQA 3D8SA 3NRCA 4IZHA 5K0BA 4TTJA 2WAXA 3FAZA 3I9V1 4RD6A 4W8OA 1WKVA 2I1QA 3FOBA 5SZKB 4JC5A 5DTMA 3NHJA 3TLKA 5KVCA 3OJCA 1UKAA 3MT9A 5AMXA 2ZBQA 3FTDA 3CVYA 1YI8A 3MK31 5A9SB 1QUFA 1TUGA 2V4MA 4KUGA 3TTYA 4AX8A 1CLUA 4Y1RA 5JNLA 2G9ZA 4E30A 1I2AA 2YY6A 4XZ3A 2XCSB 1JEDA 2NQ2C 4RD0A 1X38A 4JR0A 1VE3A 5JTTA 2NO1A 4O6VA 3TKAA 2WHQA 4IQGA 4BX9A 1SHUX 4QEZA 4BTVA 3G7NA 2BMEA 1NQOA 2J0UB 4JLKA 1N5MA 4LRSB 5D84A 5JSZA 2D1YA 3QLUC 1PWHA 2XXBA 4US1R 1CVIA 4JUFA 3ECCA 4DLRA 2DYKA 3LUPA 4X62B 2DPXA 1W4ZA 4BKPA 5IPFA 3Q11A 2WKQA 2J4DA 3DF7A 1S8AA 2HLDA 2OMKA 2CHVA 5BR1A 4RULA 2RGRA 2JGMA 4OQ4A 3WGJA 2RH9B 1BCSA 1PLJA 2B5VA 1PTJA 5I5EA 2VWPA 1F60A 1Q7CA 1G63A 3CX8A 2I78A 3WLRA 4F4JA 4YPOA 1TCBA 4YUYA 2R6R1 4YJFB 3T94A 2C7PA 4X24A 3IQFA 5JS7A 3CUEF 1YMVA 3RTCA 4B4KA 1AY0A 3GJRA 3PEFA 1EQ2A 2FEXA 3N3AC 1P5HA 4IIJB 3WZMA 4AC9A 4C2BA 2ZKLA 4ZHQF 3H2SA 3V2UA 4URXR 1XD9A 3WMEA 2H1RA 1KYIA 2GM5A 3N0WA 4NP6A 2VQ3A 1W5AA 3LOPA 2BMFA 3QY9A 3ODGA 4G5RA 5EPOA 4EGSA 5BSRA 3UJCA 5GIPE 1K7FB 1GN8A 4UNSA 1KETA 3O1LA 3QI2A 3EGIA 1MHPA 3U4QB 2TSYB 4XPIB 4EHLA 1MT3A 3PKZA 1W5SA 3U7JA 2WP0A 1VYVA 2YS6A 4AX4A 1OUMA 2IP1A 1NUHA 3BJEA 2J7KA 3D0QA 4UMFA 3S70A 1RYFA 2CXTA 3AK4A 3B48A 3A04A 1USKA 1E0AA 1JVSA 3LTEA 3BA1A 3N0RA 1QRSA 1NVXQ 1G0NA 3ADCA 2IS2A 4FI3F 2O8DA 5CFQA 1RM0A 3H7AA 2R8YA 4QOHA 3EPLA 1JJVA 1PFGA 2WJZB 2O1EA 4TSRA 5CXXA 1BG6A 1M74A 3ZUGA 4P31A 4F9EA 2HBYA 3FVRA 4RIFA 4JD5A 5LIRA 1SXJA 3BMCA 4TOIA 1G3IA 2Y77A 1GJRA 2GVDC 4ZCQA 4D80A 4YRGA 4M1SA 4OU5A 3C4QA 4R5HA 1I80A 2FGJA 3V9PA 4MINA 4BWVA 2ZU0C 1U5AA 5HXAA 4XCVA 3WMXA 4UU7A 3MMZA 1OBFO 2VZ8A 3JSXA 2O2HA 3ZDEA 2XMDA 3VR4H 4EB3A 2DLCX 4R7TA 1GNLA 3C5HA 3F73A 3FHTA 1MQ8B 3ZV4A 1LDYA 4EF4A 4ZJZA 4ZYYA 3V1KA 1QH8B 3KPYA 1ZA2A 2PT9A 1QVWA 4JXZA 3OO1A 3BEOA 1CJVC 3K0HA 5K0GA 2FVXA 2FMKA 1CUUA 4RD2A 4EUEA 4UNRA 2IPOA 3VU9B 1ACMA 3ANTA 4WA7A 2Q5IA 1NMSA 2GJSA 3CUYA 5D5PA 4MUEA 1DJQA 2YQ5A 1AKMA 1J25A 1BZYA 3S8EA 1PZEA 4IO1A 2HFKA 1HEIA 4AJOA 4J4HA 5BPHA 1RLUA 1ZGJA 3I72A 4GOKA 1PSWA 3GT4A 2FR1A 4HLCA 1XT6A 5TSDA 3B1YA 4B6EA 4BVAA 2EZTA 5J43A 3HCAA 3M89A 2BD0A 4S2UA 2BR5A 1II8B 1QB8A 3ZIAD 2X8JB 2HPVA 3B51X 3GG2A 4JBIA 5C5IA 4GKAA 4ARUA 4R2MA 3KPUA 3GFQA 4RORA 5KTNA 4QEDA 2HF7A 2ZFUA 2C9MA 2VNHA 3HJHA 4R3WA 3R7AA 4W6QA 3AR3A 5I7UA 2QN8A 1DIBA 3EWSA 3G0CA 1ZK2A 2XCTB 1CUAA 1BYUA 1U9YA 3DM9B 3JQFA 5I8PA 2VSYA 2OO3A 1OYVA 4YWHA 1KEVA 3AW8A 2X6RA 3PRHA 1UK7A 2LW7A 2FZKA 2VRCA 1MJFA 4R5MA 5DYNA 3U0BA 1MOQA 1U2DA 1O2DA 4IBOA 4EECA 4N3BA 4AMBA 2ZRNA 1O6BA 3I05A 5ALNA 5TMEA 2ZE7A 2DH6A 2QX7A 1AHHA 2SNIE 3CEMA 3R4VA 1Q91A 2H1LA 4P7BA 2C9DA 1Z6PA 3LO5A 3BK2A 3LVQE 1EVYA 5FBRB 1UMDA 5CAEB 3WSWA 3LVBA 2HXYA 5EHQA 4EQ6A 1GYQA 3LCUA 1BHJA 4PNPA 2D06A 3RIMA 4BJ5A 5LNK6 4YY3B 1YZNA 3ZD7A 3ENNA 1E99A 4C30A 2XB6A 3MIZA 1U9ZA 3VO1A 1UJ5A 1VKZA 3BTSA 1Z68A 3OCZA 4V2UA 5JJCA 2NUAB 1BGVA 3THXB 3OHSX 1PYDA 3CR8A 4JVLA 4CI0B 2ZT7A 4RH1A 2HJSA 1VA5A 3EUFA 3EZYA 2NXWA 1X1EA 1ZZGA 3E8SA 4TUYB 1DQYA 5PGMA 1ZNQO 1PT9A 3VYTB 4EJSC 3JQPA 2WA1A 3L7YA 3LGAA 2HRZA 1NNI1 4ZCTA 4DR2B 2ZBPA 4F4CA 4YRJA 4P08A 5F12A 1XD2A 4NZNA 2PQ2A 4I0WB 3MWDA 1CC1S 1G18A 1KOFA 1L4BA 1Y33E 4DIFA 3JWPA 3RRZA 1T1JA 5D7NA 5IH3A 4V0OA 4ERNA 5LQAA 4S1WA 3HY6A 3IT2A 1PYGA 1EXVA 2I34A 1QOQB 1SKQA 2PWBA 2X1MA 3OIDA 4IJVA 4YJ2F 4QATA 3GJXC 5KNLA 3ADBA 4CTJA 1TKCA 1GNVA 2PX3A 4X0EA 2Y0BA 1E8NA 3UJ6A 3FAKA 1LKZA 2CLIB 1CUEA 5MDHA 1KEPA 4Q4LA 5HS4A 1S2NA 5KTTA 1Z06A 1WEHA 5DN6D 1J5PA 1G2QA 3PC7A 3BGDA 3GUYA 1IZ9A 3ISVA 3PUHA 5K3SA 5HKKD 1N2SA 4P1ZA 3AILA 2X2EA 4KK3A 4D4JA 2QSUA 4AZ0B 1D7OA 3BKWA 1RYMA 2DHRA 2GTIA 3RCBA 2OUKA 1IY1A 3D3WB 5DI3B 4CM9D 4JUBA 2BFDA 3PFBA 5EIBD 2D2VA 3F6PA 3IXLA 3UB4A 1R50A 2DWQA 3SF8B 1ODKA 3BCRA 4NEQA 1N34B 4TV8B 3T7CA 3FPAA 3OJOA 3WL6A 3GH3A 4DJ5X 5IVDA 1PG2A 3A9CA 4MUGA 1WSWA 4UVGA 1ZAKA 5G02A 3PHIA 1TM5E 2ID4A 2FR8A 3L2OB 3M5DA 1MJ5A 1QP8A 1FDUA 5ECDA 4L9SA 2W83A 5IWAB 2WUVA 3SZUA 5T41A 5F76A 4LV6A 2AW5A 1BRTA 1UCFA 2AXPA 4XX0B 4DY6A 1MB4A 3TBHA 1UMBA 1P4RA 2AN1A 2FDRA 2GAAA 2O3JA 4D9JA 4RWZA 5AW3A 4BMOB 1C41A 3KUDA 4V0MA 5EWJB 4RVCA 4PLVA 1KO1A 4E5DA 3KR1A 1YVEI 3W9UA 1X92A 3JWGA 2ZUUA 3LQYA 3QF7A 3V80A 4W6ZA 3TX6A 1ZC4A 1DFHA 3PL1A 2I9KA 3OM1A 4N01A 4YA6A 3AVYA 5K8LA 4YREA 3RAPR 3A3KA 1Q17A 5HF8A 4A6XA 4WBNB 4NONA 3BL6A 1OV6A 2ZJ4A 1FXSA 4Z3DA 4O0MA 4DR5B 1L2TA 4HH4A 2ZJ0A 3CIOA 1PUIA 4UEJA 1L1FA 1MH1A 2X1HA 1N8TA 4WZAA 1ORWA 4P22A 5F77A 1JQJC 1ECLA 2P2CA 3PGLA 3BIOA 5KAPA 3OD5A 5KTKA 3PSAA 3R23A 4JOCA 4R69A 2ONJA 5D85A 1EVQA 1M34B 5DN9A 5HRCA 4RTSA 3B52X 3TJMA 5A04A 4TTIA 2YX1A 3AKDA 5E95A 2H1SA 4RKFA 4EI8A 2BF4A 4X85A 2W00A 2ON6A 3TRJA 1UWLA 2NYAA 5U9CA 1B7GO 3V8NA 3UK0A 3QZUA 2XR1A 2I22A 2OENG 1Z7BA 1T1GA 1QO7A 1DEOA 2W2PA 1GVNB 1KEUA 3CZPA 1RAHA 3NJ4A 1O8BA 3O74A 5C1BA 3C98A 3RK4A 1UFVA 3OESA 2WP8J 3WKCA 5BUCA 1PL0A 2JIMA 5JSKA 1DRUA 1NXSA 2JGRA 1FRFS 3F7OA 4XB6B 3ZE8A 5J4LA 3AKZA 4EYGA 2VYFA 1NLMA 3L82B 4K9NA 4CV1A 4JGIA 1I94B 4YR9A 5LC1A 1PW7A 3QE9Y 2GJ9A 3HKCA 1Z13A 3ZWYA 2O1WA 4L8WB 2VTKA 2Z4SA 1E3WB 5DTEA 1M2FA 1XO1A 3KFVA 5JS6A 4B33A 4CL3A 1LPBB 2HB6A 3FGNA 1SIWA 2ZRDA 4GZMA 3G6KA 2IYPA 3O2QB 5LSAA 4ZO9A 2ZDHA 4ZOEA 3GDWA 4LFCB 2OFXA 5ALXA 1G1AA 1VCHA 2KMLA 3PWSA 5CLIA 2WM8A 3VU0A 1N7HA 3CO5A 3F6RA 3H05A 3LP5A 4I55B 2XMBA 1BH6A 1BXRA 1J22A 4G8JA 2QZZA 4DLWA 4F21A 3PNLA 3W5AA 3PEYA 2NU9A 1EFUA 4I9UA 5EKUA 3BFVA 4JB3A 4Q21A 2FMTA 2J0VA 3MBOA 4LI0A 1OROA 3OOWA 5I01A 3USES 3FHLA 1J0CA 1O0SA 4TWIA 4M0FA 5EKDA 4EQZA 5JMOA 3PYXA 5B7GA 1NA5A 3OZTA 4PEVA 4F3RA 1M75A 4BN0A 1ID8A 4P36A 3NOQA 5GY7A 1B0UA 3SEFA 4YCCA 3CE9A 5I9BA 5KPJA 3IHWA 3WZ2A 4DWWA 1JFFA 1E6MA 3TOZA 3DJFA 3N2IA 3WB0A 5LP6F 3VV3A 1G3QA 4KVFA 4RVUA 3M9XA 4WPGA 4IRUB 4F3YA 3A36A 3D7LA 3JVDA 2CB9A 3ZHSA 6REQA 1BVYF 1ENZA 3DEHA 4BZPA 4YAIA 5ITZB 1A1SA 1PEKE 4O33A 2PXHA 3A6PC 1B8OA 2XYGA 3OQVA 5FWNA 1ZHFA 2AQIA 4KXXA 1NU6A 2BKXA 2I3GA 3QUTA 4TLMB 4PSDA 1DMSA 2PVPA 2VLBA 4L0MA 4ZCMA 3D8UA 5IUNC 4KXMA 3R9XB 3OLCX 3EW9A 1JEAA 4J6FA 4HI0E 1H5NA 3MHPA 4RYDA 5IMBA 1ND5A 2P78A 3FOAA 2Q3BA 1K3UB 4WLVA 4F1WA 4GWKA 2Q2WA 2PMDA 4J76A 1E1KA 5KYTA 2X8BA 1CJCA 4NZMA 2RGWA 5A4DA 3QSYA 4ZV7A 3R7WA 2OAQ1 3F98A 2I91A 3QUAA 1Z33A 4PPNA 1JXAA 3FLAA 3ORQA 3UKJA 3BE5A 1G2IA 1Y9JA 3ESBA 4Q7LA 4YAJA 5E4YA 4G1EB 1NVEA 1SUFA 5DX1A 3K9GA 4UMDA 2PKCA 1REQB 4HADA 2O48X 2WSSA 2BOVA 2HUNA 2I7CA 4WX2B 3K0CA 3D4OA 2X4GA 2XJ9A 1QGYA 3Q2IA 4DVJA 4UHHA 5J1SB 3HABA 3TUJC 4F1KA 3SNHA 3M2PA 5K8JB 2C9ZA 1EPUA 1PBTA 1XZCA 1QGDA 5FUXA 4EOGA 4MROA 4RY0A 2VFAA 4CM1A 3UK2A 3AHCA 1JFSA 3NAMA 2DWOA 1IMJA 4DJTA 2P0AA 3ZQKA 4J9VA 3MRSA 3REGA 1JVBA 2DUNA 4N7MA 4P3OA 2DBYA 3IYLW 3IVMA 1P74A 2QX8A 3NM5A 6ADHA 3P0HA 4Q3LA 3FPJA 4MUKA 1EHIA 1Z0UA 3GK3A 3H2IA 3PVCA 3W6NA 4GR5A 1K2VN 3OEWA 5LYJB 1QE0A 1SQ6A 3GJTA 3K9HA 4JR1A 4Q9IA 2BGNA 1JEQB 2FUG6 3QUQA 3Q8WA 1ZM3A 3H6KA 3QVSA 4P4GA 2Z9BA 3HCOA 1ZA1A 4RD3A 1WZCA 2I2CA 4GX0A 3ZX5A 1XJCA 4M22A 3HLYA 1OH6A 4M0EA 5DM4A 3DMTA 4GPIB 4F12A 1M76A 3KL4A 1FJXA 2D8AA 2O2DA 1XZIA 1J70A 1L4UA 2G4CA 2ODEA 3LXMA 5C8VA 5JDIA 1RXWA 3H5IA 3K9CA 2ZITA 2I7DA 4YUAA 1OR8A 1Q84A 2PX6A 1D1PA 2PA0A 4UW9A 1MCZA 3AUAA 3DAHA 4HNHA 4MS3A 5BSGA 5HOQA 2P3QA 3OICA 3U6KA 3F2VA 4GOXA 3NHUA 1E5XA 1BWRA 2XV1A 3ESAA 1R0CA 1KRWA 4JX8A 2DTEA 1X9IA 2ICAA 3W8NA 3NVDA 2W4IA 1QK4A 3IXQA 4HQLA 5IEBA 3ME5A 2VJLA 2FZVA 1M54A 4D74A 1XEXB 2GN4A 3ICWA 2O3SA 3L6UA 4JQOA 3T7DA 1RE1A 5ALGA 2A3RA 3BMOB 1AC5A 1PR4A 3AKCA 2XGOA 2CW5A 3H3XA 4UDNA 3E82A 4MB2A 1PV1A 5ECWA 3TW8A 4CKCA 2H8KA 5ALQA 1J2YA 1R5OA 1L4MA 1M66A 4B5KA 1FJGB 4CCSA 2HTFA 3OOEA 4WDRA 4PAQA 4RVSA 1ZUD1 3C1OA 2BHTA 2E4VA 3MD9A 1K1EA 4YCSA 3D4PA 1S3IA 4BL5A 5BWMA 5KOYA 2Z58A 2Q07A 1R6VA 5LQRA 4ID3A 4KNVA 3WKBA 2KLHA 2FPGA 2Q9UA 4WADA 4RESA 4WEQA 3EDMA 5HFAA 3OF5A 4FB4A 4RTRA 3VO8A 4QBIA 4DY4A 2XVXA 1XVTA 1GZ5A 4YT4A 3I62A 1ESZA 3DH0A 2JFQA 3D0OA 1GFSA 1MVNA 1OAAA 1WF3A 5BN4B 3RH0A 2VCHA 3WXBA 4X20A 4JXXA 4CT4B 1MGOA 3ORRA 2O2YA 1TUBB 3GZNB 3Q9LA 4AJ1A 4BIMA 4C22A 3AG6A 3NPMA 1JLLB 4D82A 1E2FA 4OPMA 5ERXA 5K0JA 5GZ3A 4Y6SA 1BN7A 2OCDA 3LK7A 3M83A 4RK1A 1H1LB 5BSFA 3PCXA 3MJDA 2YWXA 4G1MB 2KBEA 2OXEA 2PJUA 1TVCA 3AY0A 4J4BA 1NSFA 2B9EA 1QSGA 2XHEA 1E2HA 2ZETA 4WINA 2RD2A 4K46A 3ETLA 4L9AA 5AKLA 1EU1A 2OOSA 1HI9A 3JASA 5L7YA 2XBMA 4KHPB 2A5GA 2ZGVA 1W76A 1X7DA 2QG4A 2W6IA 3H83A 5HQTA 2VPPA 4W8HA 1W30A 1C30A 3F3MA 1TW2A 1JA1A 2WWXA 4KIGA 1OKKD 2VJAA 3DOOA 3VZCA 4ARCA 3CPSA 1ZXLA 1HC7A 5HA5A 3EIEA 2CNOA 1W93A 2V8OA 1YS4A 2ZJOA 5T5QA 4C21A 1U7ZA 3HO8A 3NHPA 4O2AF 4EVIA 5IRCD 3B9RA 5CDYA 3RSOA 1NV8A 4L76A 2PG3A 2ODTX 5BYBA 4BCBA 4U5QA 3BWVA 3VSBA 4QOFA 3HRHA 2FZLA 3VGJA 3VHLB 5JH7A 3HDHA 2I6XA 3AEKA 5L3RA 4F56A 4NR0A 4R1UA 1VPWA 1FLNA 5AVOA 2PSFA 1GUBA 5HBGA 2V98A 2PH1A 3M1LA 3LQFA 4RGYA 4MUFA 2AL7A 4QYIA 3B1WA 3S28A 5IXSA 1W4BA 2FEOA 4B0PA 3TJRA 4Z7QB 1S7GA 1IG3A 3FROA 3GUHA 2UXCB 3V1YA 3T7RA 3MGCA 1ZW6A 2OV6A 3I73A 2J32A 5BN3A 3IP9A 3U09A 1J0EA 2FEKA 1A50B 2BTEA 3SEAA 1Y37A 3VISA 2HD4A 4F1JA 1JT9A 4UCFA 3WGHA 3DLBA 2PUFA 2JARA 3W06A 4EA9A 1CK4A 4DHWA 3C3YA 2QE7A 3R3JA 4HUQB 4DMKA 3QMWA 1TM7E 2HH9A 4PVCA 1GPBA 1DX4A 3DHYA 5E1BA 3MWEA 1C8BA 1F0NA 3A26A 3GA0A 4GI1A 4JA2A 4PC2A 4PNZA 4XFDA 1M6YA 2ZK7A 4F4UA 2C7BA 2PLRA 2PH3A 1FP6A 2KW5A 1TW3A 1SZPA 1Y1LA 3B8EA 3C2QA 3FZNA 2I3DA 2HA4A 2ZIFA 3T9FA 1K92A 3RRNA 4POOA 1P91A 4X7MA 2F43A 5H81A 1Y4AE 1BXGB 1OFVA 4JVMA 3LQKA 3GX1A 4R4JA 2EWWA 3H2YA 1KXZA 3BJIC 3KXIA 5EHIA 3U3MA 3ZE7A 1YJQA 1ZL2A 2WT9A 1RJGA 1GZ7A 1NMXA 4I1IA 5CLFA 1DPGA 3N76A 1I3KA 3S1AA 4TZKA 1IUOA 1RI4A 2BBWA 2HO5A 3A1SA 4OFZA 1EKXA 2O8EB 3KOWA 3NO4A 1JHMA 4UOZA 2F1OA 2BGUA 2FFRA 4UE3S 1CKEA 5D00A 1GRCA 4AF8A 4LJ5A 4UBKA 4KDEA 3AJ9A 4YCMA 2QD5A 4GOMD 3GRPA 1J9EA 2X0RA 1SB8A 4N3AA 1UJMA 4BP9A 5JJBA 3Q9UA 5EIEA 4D9MA 1JH9A 4Q1EA 3AZQA 4OJYA 4RA9A 3YASA 2FQQA 5B12A 1O6GA 4ZYXA 3WNBA 1W85B 1YQ9A 1D04A 4UAGA 1L7OA 3RTGA 1KYTA 3UJDA 4EAAA 4HAZA 4IV0A 4DSNA 3INTA 5M7EA 2YJ6A 1DJPA 1II0A 4BMZA 1NF3A 2XCOA 2WYVA 4P98A 1C7EA 2PEYA 4S1PA 1FLAA 4IOLA 2WY2D 4CLDA 3CPHA 1EUDB 2C4WA 3FSJX 1P75A 1R8JA 3A14A 3G17A 1T34A 2VF4X 3LXUX 4BC0A 1DU4A 3KELA 1V9CA 4KIUA 3Q3IA 4OUDA 2H7CA 3FDFA 3IAAA 1HSZA 4A6DA 3H1FA 4ZV9A 2H92A 1WZ2A 3CCFA 3U7HB 4NJEB 3EVTA 3GLHB 2Y93A 2RGBA 3DLIA 3N2GB 1G64A 1M0SA 2E7ZA 3ASVA 3GEGA 3BMNA 2CXUA 3GEHA 4WLFA 2GZHA 3WLQA 4ZI7A 3N7AA 5L9AA 3LY7A 4LECA 1A2QA 1DQPA 3DDWA 2JFNA 3I8OA 1YS7A 1RXSA 1Z0DA 3CLTD 3K5WA 4EGFA 2IUYA 4CG3A 1DIAA 3IBYA 3C6ZA 4LEIA 1G20A 2V74B 2YW2A 1JFLA 3BFXA 3GOHA 3IQEA 4C0QC 2NO9A 9GPBA 1OH8A 1ZVQA 3L1VA 1JA9A 4ZVUA 1KI2A 3E84A 2R6CA 4HJXA 4V24A 3Q7TA 2CUKA 3W4IA 4OLAA 5CB8A 1P2GA 2R9VA 2DPMA 4Q4AA 4PG4A 5EVJA 5IAEA 3SJZA 3A6LA 1M8JA 2OTCA 3PPYA 3SSNA 1QRUA 1O1YA 3FCUB 3WAKA 4BX3A 3UBTA 5BO5A 4PY2A 3OMXA 4PCAA 5CM8B 3D7MA 4HQFA 1W2WB 2WG1A 2Y68A 2VOJA 2WAAA 4HNRA 5E2BA 2PX5A 3W8RA 3VR2D 3D2LA 2HU2A 2UVPB 3HWSA 1U99A 2HYDA 4CG1A 5SYAA 3F5MA 3FZQA 1ANKA 1WF6A 3ZU5A 2GZSA 3QKSB 2Q2NA 4YQEA 1OMOA 3AUTA 2PT7A 3EGOA 4CETA 4NCKA 4NBLA 1EVLA 1TTPB 1KMHA 4YRLA 4F0JA 1YR9A 1L5SA 2VWHA 2QW8A 4FGZA 4P8RA 4RQBA 3STTA 3TGLA 2EARA 3NVKI 2C1ZA 4NQRA 3LFTA 1OBOA 4YRCA 1EFPA 2L2QA 1ZN7A 4MQEA 2VDLB 4MLCA 4J2TA 3E7FA 3H6HA 1V1RA 3V1MA 4YEDA 2HRDA 1UWCA 1NVGA 2H4WA 4Y2GA 1P5FA 5EE5B 2WKPA 5FORA 2F17A 2VYND 3DUFB 4JKIA 3AIMA 1F1JA 2QD3A 4ZD6A 2RH4A 3R3VA 3UT0A 1NGSA 2XOXA 1I6MA 3QELB 4R8RA 5KYKA 4QXQA 4DDVA 1FYVA 2H9YA 3E53A 3WRWA 4FPXA 2B36A 3VR5H 1Z82A 2W6PA 1XC7A 4TTRA 1Q0UA 3OQMA 2Z5FA 3CLRC 3L4KA 3C3CA 3O9MA 3MTQA 4TV9B 1VDMA 1U8ZA 1GG8A 1KFEB 4BPRA 1UBRS 2RAVA 2WF9A 4NL4H 1N4AA 4DMHA 2A14A 2PD3A 4MPRA 4HNAB 1DT3A 4BFUA 1TPZA 1W87A 3TK1A 4EEZA 3IT0A 4KMSA 5E1MA 3DXXA 2C4VA 4BO7A 5BXYA 3QLVC 2EEPA 3WL7A 4G1UC 2QW0X 4JB2A 3N0TA 1ZQ9A 1PTKA 4M89A 4OIMA 3IO3A 1FLDA 1U3UA 1ZIOA 3N8DA 4YRTA 3VAYA 4L0CA 4QSMA 3GLFB 2XH8A 2VXCA 5JXWA 3C3PA 1O9GA 5EXTA 1E7WA 1I6LA 3RNOA 3BSSA 1U8UA 1KH3A 1NT2A 3PQ4A 1VL0A 3WTBA 4Y3UA 3TQCA 1VP9A 2AI3A 2FPWA 4I1YA 4LDJA 3FMVA 5FYDA 1CQIA 4RPIA 1HUQA 3ZJ4A 1PT6A 3TOXA 4G0VA 3V4RA 5AKXA 4FSHA 4XSHA 4MKFA 1FK8A 2IIVA 5L4SA 3HDJA 5HCUA 4X3PA 3TCNA 2JVKA 3LBHA 3NT5A 3R0VA 1D8TA 4RE6A 1VJCA 2HQSA 1CQJA 1GNSA 4IHQA 1YZKA 4NXNB 4OI0A 2JVJA 2Z8ZA 3OE7D 4NRDA 3SXJA 5LUBA 2PU5A 3IKLA 4B3FX 1MV5A 1CUFA 5HKBA 1PR1A 2FXIA 1L5FA 1YZGA 3L6EA 1WU8A 3ESQA 3WWDA 3WV4A 4UTNA 1NF8A 1RNLA 4GI2A 1ADFA 1URPA 4H6PA 5TXGA 3IX7A 1G17A 1MOPA 1QDLB 4PGMA 3RBAA 1ZJZA 4Q39A 4LQ4A 2I87A 5AVKA 2HA3A 3WKDA 2OPBA 2QRNA 2XVAA 4ESOA 2C8VA 1V48A 1K88A 3Q87B 2DHQA 3D7KA 2Z30A 4LJ7A 3AONB 1V8BA 2UZAA 3E7XA 3QG1A 4KNYA 1KVRA 5TQ2B 3WJAA 1ODTC 2J5XA 4AZTA 5EJ4A 3IOYA 5AUQA 2XIJA 2FWIA 3JW8A 3M6MD 5FNVA 1H42A 4FFRA 5EA2A 1UBNA 3OEED 2TMGA 4AZ3B 3UWPA 3CURA 4DA8A 3F0TA 3WGLA 1DRJA 1YC5A 4DNOA 2RHOA 4JI3B 3E6AA 4RHCA 2H31A 4Q3KA 3ZVRA 3L5KA 4MAMA 1KOJA 1DDGA 1RYNA 1UBHS 1VRWA 2RHCA 4R98A 5DM1A 3ZGVA 2R66A 3JVVA 2BC9A 4OI4A 3MCUA 3BXXA 2IS6A 2FZ4A 4FUTA 5CPFA 2ONZA 3QG5A 4IRXA 1ZD8A 1UBSB 2GVNA 2B83A 3EVCA 2XDQA 3BFPA 1GPAA 4POAA 1B6RA 5E6SA 2VBCA 2PEZA 1Y7HA 2VKTA 3CRW1 2GDJA 3BB3A 2FDXA 2FW8A 3KT6A 3NDPA 4IGFA 1Z6AA 1J42A 3PB3A 5K7SA 5KYYB 1FX0A 4ENVA 2IDMA 2ZTHA 3H9EO 1XA0A 1S7CA 2A5DA 4HLUC 3GMSA 1U90A 2OWEA 1H0HA 3E35A 3SCZA 1MG5A 2QSJA 3VPAA 3WWOA 1QFXA 1Z5WA 4K6HA 5CIYA 2WVHA 2OBLA 1YBFA 5IC6A 5BWBA 2RHHA 7YASA 4QFBA 1NZFA 2FYTA 2GN8A 1N0VC 2RONA 3OU7A 4HH1A 4R54A 2XYHA 5GMOA 4D3ZA 2G5PA 4FMPA 3OCVA 3F3SA 2J3HA 2AMJA 1MA0A 2AX4A 2Y9MB 1M2VA 1RU3A 2GDZA 5B7QA 2ZIUB 2GBIA 2RHBA 3SC3A 8ADHA 3JQ8A 1SPXA 4CMIB 3LCVB 5EJ5A 2WABA 1JAZA 5EXPA 1G21E 4RKYA 2D8MA 4QYMA 2AOTB 1L5LA 1ZI8A 1CUWA 1EWRA 1QYRA 5EKTA 4CHTA 4BXOA 4AJEA 4Z4HA 1X7XA 4EHKA 1Y63A 2JS7A 4R8LA 3MIIA 1MJHA 1L8LA 1R0RE 4L1KA 3A28A 3G3EA 4KH1A 1OTXA 4M8NE 5F5NA 4TS1A 1EFRA 3RYFA 1UWVA 5BSKA 2PX8A 3CXRA 4IH9A 3RVQA 1LS6A 2JK0A 3VJMA 2QJTA 2WVJA 1B8PA 5FT9A 1GAEO 1VCMA 2XQFA 3KEQA 3N53A 3EK2A 1FTNA 5JMTA 4FK8A 5JS2A 4MLZA 4A7PA 3HA7A 3OJLA 2EV9A 2IY9A 2ZS7A 1O94D 2YWEA 3PCTA 3R75A 1D0SA 1YC2A 4S35A 3BH7A 2QP3A 2JLVA 1DO0A 1WMBA 1JLSA 1T4CB 1NJGA 3WQHA 5J2UF 1AF4A 1DINA 1OI2A 1V9LA 1B00A 1N3LA 4R1TA 2IEBA 2QN1A 5BRNA 4CCWA 1F0PA 1AQNA 2PUHA 2Q2QA 1C4XA 4LV5B 4RZ3A 2H11A 2HZBA 2R25B 2WQ7A 2O7NA 3WLNA 4GZ6A 1FFDA 2PZ8A 1E2UA 1V5WA 2ZSBA 1AS3A 3C7TA 3CCBA 3N2KA 5CH3A 3R7FA 3AXTA 1O0CA 1P9LA 4EATA 3SIRA 1JVNA 5B57C 3CBGA 2AC2A 3D1LA 1M83A 5BNTA 3OX2A 4R1MA 1E2KA 3R5SA 1FJ2A 2Z3VA 3F6EX 2AXNA 4M7PA 4UBIA 2JZNA 3VNQA 5KQSA 4C2UA 2W90A 4KBGA 1V11B 2OESA 4NHOA 1IOZA 1MB3A 1Q7RA 3O8NA 5K03A 4UFPA 2JI6A 1Z2AA 1C1XA 2TMDA 1ZNZA 4KG7A 2OQ2A 5LXTF 1DTWB 1LB1B 1O4WA 1O9HA 3L06A 3PPWA 3GT3A 1MB0A 4NOKA 2VTBA 3X2EA 1OFHA 4AMVA 5JTUA 1E2QA 1XNJA 4RA6B 3N87A 3EQ2A 5DCWA 3A05A 2FPLA 4L78A 1HBJA 4B7CA 4XIYA 1EGQA 3LRXA 1CEXA 4ALIA 3DTVB 5C53B 5HP4A 4M9XA 3KUKA 3GU3A 1RJDA 1UMCA 3PFWO 4TYQA 4CKZA 3DOUA 2Q6LA 1M2OA 1N6IA 1U8CB 4PW0A 2O5RA 4PF1A 3I9OA 2W58A 5CX1A 5FH9A 3VKVA 1GPLA 2OG2A 4TL7A 2F4NA 1E5VA 4LYDA 5LIPA 3ND7A 4PGFA 1CY4A 1EDOA 2J85A 2IZ6A 1AKQA 3GLQA 3H5TA 5TE9A 3O4RA 3JQ7A 1E3DA 4GBED 3PUKA 1JJ7A 4LXIA 2WZQA 4TRMA 3STVA 3FPEA 4EG5A 2R47A 2IV7A 1QRDA 4DIUA 4IDNA 4O1HA 5CA0A 2FX5A 3RS2A 4BFVA 3OWOA 1MHTA 2P1DA 4CIXA 4ZOBA 1YE8A 2WR8A 5EE0A 3DZ8A 2XF8A 2JFYA 4WN9B 1IEVA 1P73A 4ZYTA 4FYMA 4PG6A 5IUKC 1FVFA 2OBBA 2OOKA 3ND6A 2RDMA 3OFKA 1ND6A 4R83A 5CR9A 4E4TA 3KSAC 2WHPA 2YRXA 1VFNA 1CVLA 3OZXA 3UAZA 3G0HA 4YROA 5G4KA 2W71A 3U31A 3SQLA 4BAUA 4J4TA 3WGUA 1XN1A 1UK8A 3BZBA 4Y0NA 3TI9A 4EUSA 5K6TA 3ICVA 4IDBA 1QOZA 3WG9A 1OBVA 2RG7A 4HRXA 2ZAIA 5KVQA 1ISGA 5FBVB 3MTEA 2A30A 3OKPA 4IJUA 4PO9A 3REFA 3FWYA 2A8YA 4HSGA 4QD3A 3W7BA 4HDMB 1C7IA 1E94E 3KKNA 3GN2A 5FULA 3ZH9B 5CTJA 2DUJA 3IP1A 2QTVA 5JJLA 1RLOA 4R51A 1J06A 1OU0A 4FKBA 3RC3A 1Z36A 4KR9A 1NRJB 5ALWA 1YGYA 3PHLA 2I4NA 1BW9A 3LHIA 2UXBB 4MWSA 4A0RA 2W5UA 2R8ZA 1DTSA 4Q48A 1SZJG 4ZTBA 3L46A 2HX1A 2BTOA 3NWPA 1Q77A 3OG9A 5TJ9A 5DJ5A 3U13A 1BEZA 4WERA 4Q1AA 3V1TC 1YUBA 5J2TB 2EERA 3KSBC 1N0UA 1Y9DA 3CX4A 2EL7A 3NIDB 2DUWA 1A7JA 1F4PA 3DWIA 4GKBA 1UBEA 2BUCA 2OT3B 3WR5A 2G9VA 5K0EA 1UM9B 4F3TA 1ILEA 4BFSA 4R71A 2ZXUA 2I03A 5JECA 3ACDA 4ETWA 5LOVB 1J49A 3JQQA 3T3GA 2WTXA 5A6SA 3FFAA 4ZEVA 2FZWA 2AOUA 4D8UA 1P33A 2WUGA 2WIKA 1CIPA 3AY7A 5H02A 1A7KA 4JELA 4YQZA 4OXQA 4LXUA 1GP2A 3HU5A 4OSOA 4DT1B 5IDVA 2VJNA 1Z4MA 2C54A 2A6PA 2E3JA 2YHIA 1S2MA 3IT3A 4INOA 2O0LA 4XSVA 1KE1A 4CTMA 4F92B 1T3TA 4WK0B 1NMQA 4LHVA 5HUJA 1G7CA 3ZZNA 1YZLA 3E27A 3HYTA 1B41A 1R9NA 3W5UA 2GMWA 2CNKA 4X3CA 3IIJA 1ABFA 2Z09A 1Y3HA 4MMZB 3ZV5A 4CVNA 1ZIXA 1YZFA 2C7OA 5SYMA 1N2GA 3HC7A 3GMIA 1NN5A 4J8PA 4P33A 2R1VB 5CD1A 1SC1A 1YRWA 3Q1LA 2XE4A 2WYHA 4P7GA 3Q15C 1ZVKA 2ZSJA 5E4JA 3UMBA 1HYGA 1NJFA 1SWVA 3LYHA 4ADSG 3DCIA 1T5OA 4YMWA 1QH9A 1QK5A 3KU4A 5K0NA 3T15A 2Z4TA 4YMIA 3GGPA 3HMQA 3RADC 3WSTA 2CMKA 3HN6A 1K4YA 3GVCA 4RLFA 4DOMA 3C15C 2JAHA 5IT5A 3M9LA 2F1IA 2A1TR 3GGDA 1ST3A 1YNSA 2YFYA 1MXHA 3OE5A 4RVDA 4ZA2A 1U7OA 1I8TA 2VBFA 2CL6X 1GUZA 2Z98A 3L01A 1A82A 1BFKA 4GLJA 4MH0R 4W1RA 3VOTA 4DJEC 1W44A 3IURA 1RQGA