1HY3A

Crystal structure of human estrogen sulfotransferase v269e mutant in the presence of paps
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
289
structure length
287
Chain Sequence
NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ESTROGEN SULFOTRANSFERASE
publication title Crystal structure of the human estrogen sulfotransferase-PAPS complex: evidence for catalytic role of Ser137 in the sulfuryl transfer reaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 287
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1hy3A00
5LBIA 4TLBA 2FMXA 2GXAA 3QE0A 5SZHB 3NDBB 1DADA 1A7JA 1R10A 2KJQA 1CIPA 3UWKA 2FFHA 3BWDD 4ZCMA 1IBRA 1KY3A 4LGMA 4RD0A 1ETUA 4ERNA 3MWKA 4NCJA 4AYXA 3H0KA 1WBDA 1LB1B 4MYHA 2J87A 4I1VA 5DI9A 5FL7D 3V00A 1KMQA 5M04A 1NIJA 4PO9A 3QSYA 3FKSA 3LD9A 3CM0A 5CJ2A 1XMSA 1P9RA 4KCGA 1Z6YA 3MCAA 4R2HA 2FOLA 4PC2A 5F3WB 3PIRA 5JLJA 1F60A 2BM1A 4BUJA 2D74A 2KI5A 2REBA 3GLIB 2ZYVX 2BV3A 4EQ6B 3BORA 4L9SA 2XXAB 4G5GA 4QG7A 1SHZA 1FUKA 4Q18A 2R44A 3FMFA 5EZ6B 1VCNA 1AZSC 2KBFA 1LY1A 4HAWA 2WZQA 3L0OA 1UBCA 1D9ZA 2XJ9A 1HE8B 4AKGA 3KKOA 4GP6A 1G7TA 4P3YA 5EJEA 1FQJA 5A4JA 4LHZA 2ZSAA 3K70C 4KBGA 2A3RA 2IT1A 4QNRA 5KDDA 4MYUA 4GOJA 4AYWA 3I8XA 3VKHA 3EZ7A 4QHYA 3THOA 4LV8B 2QSYA 4HSEA 3IHWA 4D0LB 1QHNA 1N0UA 5AJZA 1N3BA 3MGCA 4MRRA 1Q3TA 2VP2A 1FOEB 3KDSE 5IK2A 5B58C 1Q57A 3U3JA 4LHYA 2OXCA 1KAOA 3EC1A 5FH9A 4QNMA 3RYTC 1S9HA 3IO3A 1C1YA 1VG0B 3CBQA 1KNQA 2ZAOA 5DE3A 1RPZA 1G5TA 2JLXA 3K09C 1HY3A 3PVSA 1P5ZB 4B6FA 4AI6A 3JZAA 3W5JA 1W47A 1KZGB 4OQFA 3VKWA 5SZJA 5JBQA 5EXSA 1TUEA 1MO4A 5FPTA 4DDTA 4DIEA 3LO5A 1GVNB 2RGAA 1JALA 5EP1A 1CXZA 2FV8A 4ITRC 2RHDA 1KSGA 2BHRA 2R6GA 4W9MC 3TUIC 4ABYA 4C30A 1BYIA 1OH7A 1N6PA 4BZPA 3KXLA 2ANCA 5JMTA 1AK2A 2OLJA 1DVRA 4HLDA 3TUJC 1Z6TA 3E2IA 3KTAA 5FTLA 3EC2A 4TQ9A 4AKIA 2IBMA 4HUQB 3B1XA 1IONA 1SULA 4N3NA 1DO0A 2ZI5A 1II8A 4TMZA 2D2FA 1XZPA 4P33A 5DI3B 3QENA 5EQTA 2QG6A 1OH5A 3ETLA 3C15C 1JJVA 1KKLA 2G0NA 4PC3A 3PEWA 1OH6A 5KYKA 4M21A 2IXFA 2A5DA 4Q4AB 2FEMA 3A8TA 1XX6A 2DHRA 4MQBA 3NEJA 1A1VA 1COWD 3LV8A 3VMFA 2QROA 2RGXA 2CK3A 5HCNA 4N1AA 3K0FA 2W00A 5IRCD 3R9WA 1XBTA 4U5XA 2BKEA 4D6PA 4GMXA 1KAGA 5ANRB 3LAWA 2W58A 4NCIA 4I1UA 1ZU5A 3BBPA 2O0JA 5FOUA 1BMFD 5HE8A 4ZDIA 1OKKA 1KO5A 3GJ0A 1TF2A 1BS1A 4DLZA 1RC8A 5F9HA 1TQDA 4PAMA 1LVGA 2AKYA 2ZS8A 4GRAA 2BMFA 3QF4B 3CR8A 4G1UC 4A0GA 4KBFA 4R71A 5JEDA 2FDCA 2AL7A 3K0AB 5DLQC 1PVOA 5TY0A 4MGYR 1IY2A 4Q7MB 5HZHA 1KJZA 2OSBA 2V6IA 3ZDQA 2PMDA 4CEJB 4HZIA 2FE4A 1ZM2A 3LQRA 4GT1A 1UKVY 3IIKA 1E3MA 3GLGE 1S4QA 1WF3A 4TQUS 3FHCB 2OG2A 1N2CE 1E2DA 3PUYA 1F48A 1L4UA 3GEIA 3KJGA 3Q8XB 5GVRA 1DE0A 1Q1ZA 1W0KA 5CYOA 4TYQA 3OIUA 1E98A 1TMKA 2F6RA 5HKKA 5AUOB 2ERXA 2PEZA 2XOKD 1M8PA 3SBDA 4QBGB 4U7DA 1J2JA 2BJVA 5FI1B 4DHEA 4ZV4A 4UXHA 5EE1A 3ZZ0A 3GLIA 4BRUA 4JT2A 3FMOB 3LWNA 4EIWA 1XJCA 4H1VA 3AF4A 2ATVA 3NH6A 3EIQA 4OYHA 2GF9A 2VQSA 1CJUC 1VMAA 2VP0A 1H8HA 1U9IC 4URXR 1W4CA 1G41A 3U7EB 2OESA 2ORVA 1KK3A 5UKDA 4JVMA 2IYWA 2QE7D 3SJCA 2WIAA 3CWQA 2ZS7A 1G8HA 2PLFA 2BOVA 4E03A 2NMVA 1XFAA 3HWSA 2DWQA 5J5CA 3CF2A 1CF4A 3FTQA 2Z6VA 2C2HA 2REOA 4JT4A 4EFNA 2ZE7A 2ZJ2A 3R8CA 2QL6A 2ERYA 4Q9IA 3BB1A 3EX7C 2W2TA 1ZUHA 2GXUA 4XJXA 1YRBA 3U7FB 5FPSA 4CIDA 1S8FA 8OHMA 3GLFB 4HZUA 3PITA 2OAP1 4JLAA 3SJZA 5FUYA 3REGA 3B7GA 4ZCLA 1XTKA 5FL7A 3L8YA 5L3QB 1K8RA 2V7QA 4URUR 2GJAA 3TR0A 1GNPA 1UBEA 4YMSA 2ZRIA 2PCLA 5HE9A 1XRJA 1SXJC 4RD3A 2JLVA 4PX9A 5HZKA 4CRWB 2FGKA 3AGPA 1DTSA 4I4LA 4LWZA 2GCPA 1N6IA 3RHFA 2DPXA 2GK7A 2B6HA 2ODNA 3ZH9B 3GQBA 3S1AB 2G1JA 4URWR 4LY6A 4DSNA 2IHYA 1GNQA 5J40A 1Z2AA 5P21A 5B30A 2NO7A 1Z8FA 5FR2A 1CBUA 2JLUA 4V0ME 3WMFA 3U5ZB 2OXRA 3VNUA 4RD2A 1G5RA 2JCSA 3LW7A 1E4YA 1NSTA 4URZR 4XWAA 1P60A 3DEFA 3LVRE 3TMKA 3VU9B 1XJ0A 3HYTA 3AUYA 4HUQA 4UJ5A 1FTNA 4M0LA 1CKEA 4MGIR 1OLOA 2OCAA 4IDOA 2XEXA 3CNNA 1CJKC 4B34A 4CGZA 5DI3A 4DEYA 1P61B 4HDQB 1HYQA 2QUZA 4YMVA 2IS6A 1QHSA 4M1OA 1YU9A 2HYDA 3GJ6A 1OHHD 4GZMA 4NE2A 1RRFA 4OL0A 4PQRA 2H92A 2RB4A 4EPVA 2R6AA 1XB2A 2QP9X 1NJFA 4Z8YA 1ZM3A 4C2TA 3CX7A 4MRSA 3VR2A 2WWIA 4ARZA 4B44A 5KOYA 4HAYA 1GDDA 1UKYA 2ZXUA 3FB4A 4BFTA 3I73A 4RSGA 2CCGA 2VP9A 3EPJA 3EPKA 1S1MA 2D7CA 3LXRA 1MH1A 5LB4A 5KO2A 5GJWC 1XNJA 3BJIC 1JEEA 3FWYA 2IWHA 1R8QA 2GJSA 1XJQA 1ZU4A 5TXGA 4A2QA 4MGKR 3KL4A 3MJHA 5B64A 2G6BA 3QF4A 3J81k 1KI6B 5LD2B 421PA 2EFDB 1UM8A 1OXSC 2CL6X 2ZRBA 3WHKA 1OXVA 2ZIAA 1G3IA 2FU5C 3HPQA 4Q5IA 4G3XA 4EUNA 1U98A 3QXJA 2IYZA 1GRRA 4MA4A 4CEJA 2EFGA 2FX3A 4JKYA 4X8OA 1G6HA 1QHIA 3RS7A 2GBLC 2D4HA 2YZ2A 1XD2B 4B2IA 4N0DA 1CJTC 3O8DA 1T3SA 3A6PC 2WJIA 1AZTA 4ACAA 2C77A 2PZFA 2C5LA 3W6NA 5BN3A 1DAKA 2WM9B 3FKQA 3BE4A 1IJEA 5IDVA 4KLNA 3PFIA 4A0HA 2REXB 1DEKA 5G3ZA 2ASEA 1COWA 1ZD1A 1ONBA 2RKOA 5CB6A 4DBLC 4V0NA 3O8RA 3DOEA 4L15A 3C41J 3EIEA 2F1IA 1JXOA 3BC1A 3I3SR 1UKEA 1WBBA 1BMFA 1SVKA 3LXXA 1LV7A 2N46A 2ZUDA 2ECKA 2IUUA 4GOXA 2CE7A 1Z6AA 4AYTA 5KNBA 1E96A 1MR3F 1Z6GA 4PXAA 1Z06A 2GZHA 1P7CA 4Q7LA 1Q20A 3VAAA 3WMEA 1KOFA 5FTJA 3ZVRA 1MOZA 2QP4A 1WRBA 3QXCA 5CM9C 2BKUA 2J3EA 4BFZA 3V9PA 1XXHB 2C04A 2XB2A 4NCKA 2ZANA 3CH4B 1HT1E 3PUXA 2JATA 3GLFA 1VTKA 3KKMA 4TTQA 4DXAA 3DVLA 1WCV1 4H1UA 3SI7A 3IILA 3R9XA 1G16A 3NH9A 4Q9KA 1OFTA 3KJIA 5L3QA 1MO5A 3TQCA 2P6NA 2VSFA 3UG6A 1V5WA 1OXTA 2EQBA 5FUWA 3SJAA 2ZJAA 2WWWA 3ZS8A 2XOKA 3JZMA 2RMKA 3ADDA 2NO6A 3BH6A 3F0TA 1E69A 5FOXA 3ZVNA 4OQMA 4PZLA 1BIFA 4A6PA 4RCZA 1XF9A 3NWJA 4MRVA 3WXMA 1CR2A 2A5FA 4C4PA 1R0ZA 4LYHA 1P3JA 2VSXA 5EUMA 1QVRA 2GTPA 2BBWA 2D62A 3S1AA 2F3TA 5DHFA 2PEYA 1DG3A 1KDTA 2DWOA 1CP2A 1Z83A 3QG5A 4KU4A 2QI9C 4A8JC 1Q1QA 3WRXC 5DO9A 1JAIA 3N2IA 1N5KA 1D8TA 2Q3FA 4Q1DA 5C1BA 3O8CA 3U6KA 4DZZA 3KB1A 4IDNA 3NDPA 3KXKA 2QN6A 5H68A 2JLRA 4DB2A 3VU9A 1K5DA 3GJ3A 4UQOA 1XXHE 1OYWA 4KVGA 4Q1BA 4IKEA 1GKIA 1SQ5A 4QOSA 2QPAA 3ZLJA 1RRGA 4JJZA 2ZR9A 4NH0A 4PHHA 4XSGA 2ZJBA 3OE7D 3OZXA 4LV6A 1W4AA 2YHSA 2BCGY 2YINC 4M1SA 1AM4D 4Q1AA 2ZS9A 3DHWC 1R4AA 5FBVB 2EYUA 1GOTA 3THWB 3I61A 4QBIA 1EWQA 4ZIRB 1MABA 2V1UA 3Q72A 1HT2E 1TEVA 4KSCA 4ASUD 1T3HA 2QT1A 1Q1EA 1Q3HA 2AX4A 3NBXX 4WAUA 2OFXA 1GFIA 4XIGS 5TDHA 5AJXA 4EPYA 5IK2D 4I1OA 4JBYA 3TKLA 4AY2A 2X19A 3JVVA 1VG8A 1IM2A 3CF6R 3N70A 4Q19A 2CHVA 4UXJA 5EXTA 5SZIA 3U7GA 3EWSA 4XSHA 5FTNA 2GJ8A 1Z3IX 2Q9CA 4LYAA 4C0BA 1P72A 4QRHA 3BH7A 1T0JB 2QORA 5FI0B 2A2ZA 1OFUX 1F5NA 1E2FA 3FE2A 4RY2A 1CR4A 3I32A 4W5WA 2B7CA 3HR8A 5JFGA 3SU8A 4G5QA 4M8NE 1XPOA 3QXXA 3IUYA 3K9NA 2QZ4A 1JR3A 1Q0UA 1KI6A 2ANBA 1Z0KA 4AG6A 2I1VB 4BZXA 5AUPB 1SGWA 3L8ZA 3UXMA 4Q01A 2DFNA 2QAGC 4BEBA 4LHWA 2IS2A 4V0KA 4M22A 1AIPA 1S9DA 1XD2A 4AK9A 4PPNA 1GP2A 4NYMR 3B6EA 4B73A 5J4HA 3TAHA 3SZRA 1ZYUA 1OHHA 2AD1A 3IIMA 1FNNA 3ND9A 4HDOB 5K8IA 1Z0IA 1OJLA 4LHXA 5E4FA 1RRCA 3OESA 4IVRA 4MGZR 3Q7QA 3D3QA 4DRZA 2MMGA 3LQQA 221PA 4OQLA 1EWRA 2WTUA 4K8OA 1L8QA 1V43A 2Q9BA 5H8WA 1UBFA 4FMCB 4RCYA 2OBNA 4WXRA 3UMFA 1GKUB 4D4KA 5C46F 2QQEA 3UK6A 4PZZA 2UZ3A 1VG9B 1GSIA 2B8WA 2CLCX 2AXNA 3QVVA 4PPFA 2XTMA 4HB4A 1T6NA 2J0VA 2WOOA 4NYMQ 3T1QA 1VCMA 2DY1A 3TK1A 2ZRJA 1J8YF 3CRW1 4I1SA 2G9NA 1P4SA 4OI4A 2Z4SA 3A4LA 4A6XA 3AF1A 1IN6A 4PZYA 1XXHA 2R6CA 1D2EA 3X1ZA 3TSWA 4DDVA 5E3HA 4RZ2A 1YQTA 3D31A 4CYMA 4TTRA 1FP6A 4ZDKA 4RFVA 3BAFA 3IDQA 5AK0A 4ZKDA 1UF9A 2G3YA 1ESMA 3B60A 1TU3A 4IDQA 5FOWA 4D80A 1RVDA 2HYIC 1S3GA 1U2RA 2A7QA 3G82C 5E7IA 3U2QA 4MYTA 4AIIA 4JLPA 2YVUA 2JASA 3KB2A 2RGDA 4HYYA 3DKPA 4KODA 4KAXA 2HXSA 2ZROA 4B43A 1GRQA 4IEIA 4OHXA 2P6UA 1HV8A 2H57A 1W0KD 1ZM9A 3W8NA 2Z0MA 1CU1A 3AVPA 1CRQA 2FEOA 5CITA 3B2EA 4JBXA 4G5SA 3AKDA 5FFMA 4B3FX 1AJEA 2BM0A 4B3XA 1GIAA 1NKSA 1NVXQ 2QU8A 2YV5A 1YR6A 5AWFC 2ZVPX 2BBSA 4OHZA 5C2JB 4LBZA 2IW3A 3MWJA 1IY0A 3B85A 1U90A 1YZUA 3CZQA 3HU2A 5AJYA 3CRMA 4F4CA 2ZUCA 2C8VA 1MV5A 4ZKEA 3D8BA 2J0SA 2O52A 3IEVA 3T34A 5BWMA 4JYCA 2XX3A 1TADA 4LV5B 2BCJQ 4PO1A 4F92B 2B21A 1S0UA 2ZRFA 1JB1A 1QVAA 1CTQA 1U8ZA 4F38A 5DISB 4BGDA 3T06B 2JIZD 3LY5A 3GLHA 4ESVA 3THWA 3GP8A 3BGWA 4ZIRA 3K53A 1FFHA 2QAJA 4X8LA 1YE8A 5FOTA 1UEIA 1VYVA 3H1TA 5E7MA 3BK7A 5AR1A 5KPJA 4D82A 4JKIA 2OCYC 1AS3A 2IS4A 1WE2A 2GAAA 2ZAMA 3UWOA 1XMIA 4C0AC 1G6OA 2ZI9A 1JXMA 4YMUA 3A1SA 2V7QD 4G5OA 4Q1FA 2VBCA 3BD9A 4I99A 2W0MA 1X8LA 4IHQA 1OPXA 1DAHA 3MUFA 3RRZA 5FPKA 3G0HA 4EPXA 4BQSA 4LBVA 1E9AA 1X1SA 2OE2A 2VRWA 2QTHA 4WZ6A 5JWHA 5B57C 1NN5A 2ZSBA 2ZRNA 4C0KA 4Q1CA 1R0XA 3PEYA 4BFVA 2J1LA 3PUVA 3BH0A 1NMYA 4FMCF 4X8HA 3WYFA 3AVTA 1QHGA 3H2YA 4OHVA 3RABA 5JRJA 1ELOA 3PEVA 4LI0A 5FBRB 4V02A 4B3DA 4B35A 3DO6A 4FW9A 3MLEA 2VHJA 4QGGA 3ADBA 2VO1A 4KJZA 3OE7A 2KSQA 3K0CA 4MKFA 4LBWA 2PT5A 4TTPA 5J47A 1KK0A 3IBYA 1VYUA 3P27A 1W5SA 5TMPA 3QXSA 4ASUA 1G3RA 3C16C 4HZUB 4BFWA 1ZD8A 3MWYW 3HR7A 3UPUA 1AN0A 2VL7A 2XZOA 4QHTA 4EPRA 1CJVC 1GM5A 1DS6A 1UADA 4FMBB 2ZE6A 1HEIA 1RKBA 2V6JA 2RGBA 4HB3A 4JSTA 1QZXA 3K8YA 3KQLA 2EW1A 1I4DD 5JJLA 3QF7A 3GLIE 4A36A 4UNRA 3GFTA 4DC9A 4GBMA 5F9FA 3A4MA 2GAOA 2GHIA 2QNRA 1YJ5A 4KV9A 1GL9B 1FP7A 2W6ID 4DCNA 2NTYC 4Q47A 3WBKA 3VR4A 1NJGA 2TMKA 2JA1A 5IHPA 3AVQA 1I2MA 621PA 1E2EA 1ZBDA 2XTZA 4YQFA 2WVJA 1VECA 5EP2A 3BERA 5DYIA 2ATXA 4KHZA 3K1JA 2G88A 3LVQE 4F91B 4L8GA 1SVOA 1U81A 2YOFA 3IQWA 1TF5A 4KVAA 4EJSC 3DOFA 1D9XA 1G4UR 4IJMA 2ZE8A 4RFSB 1G8GA 4DVGA 3TW8B 4QJ3A 1UBGA 3UKDA 1P2TA 3U3MA 3R8FA 1FUUA 1PJRA 3M4YA 4KFUA 3B78A 4QJ4A 1J90A 1GITA 1YR9A 4ARZB 1QDEA 3DPUA 1PUJA 3QPVA 1P2VA 4M9XA 1H8ED 1CJMA 2IXEA 3PCRB 3EWAA 3L82B 4HI0E 2C98A 3C4JA 1W44A 4C2UA 1DG1G 2AWOA 3IGFA 3SYNA 4XWOA 1OW3B 1XTRA 3NHAA 1X8KA 1A5TA 3U4QB 2WMOB 2FSGA 1FPMA 4G0NA 2VA8A 4UNPA 4XVQA 5JSZB 4DKXA 2PZEA 2UVQA 4JZKA 1IJFA 2ORIA 2JJ1D 4GOKA 2IYXA 4KXFB 1GL7A 3U44A 3PG5A 3GPLA 1A4RA 2J5XA 3WY9A 3TW4A 1CR0A 4KLZA 4PQFA 4DLYA 1VHLA 4IFBA 3F5FA 2CEAA 3SQWA 1Q44A 2CNWD 1U0LA 2RGNC 2MSCB 3G5UA 3L0SA 4QXAA 4TLAA 5AJWA 1A2BA 4ZI3A 5JRZA 1X1RA 3EPHA 4M53A 1N0WA 4Q00A 3ZS9A 1MO6A 3SFZA 4KITB 4QC2A 2MMCA 4BE7B 3HYRA 1D6JA 1LF5A 2ZSEA 4QBHA 2WHXA 1DAEA 4QM6A 2J9RA 2QQ0A 2GZDA 5J4LA 3AB3A 1W4RA 4D25A 1M6NA 3KJHA 3K70D 5FPHA 2BIFA 3VNVA 4C0SA 3CH5A 4LJAA 4EFMA 1YHNA 1FW6A 3QKSB 1J99A 4LSGA 3EXAA 4PAOA 1G7RA 3TR5A 1JPJA 1U94A 4XVUA 5JS7A 3GD7A 2ZRPA 2NQ2C 1G21E 3JVUA 1SKYB 4Z8XA 2ZUBA 4PC6A 1L4YA 2A78A 1MRNA 2ZEJA 1MRSA 2FA9A 2JIZA 4O2RA 4W7SA 5E7JA 3SHWA 1VIAA 4GNKA 4EDHA 5A5GA 4CF7A 3CPHA 1E0AA 1T91A 1UFQA 2OBMA 3I92A 2CXXA 1ZJ6A 4BRWA 2O0HA 3IBGA 5EE9A 4O3MA 4E07A 5CIWA 3AVOA 2GZAA 3QPWA 3QBVA 1II9A 1OV4A 3U60B 1TNDA 2L0XA 4JL6A 1PLLA 5DHAA 5AUQA 1JJ7A 2DFLA 1OIXA 1TL7C 1M2OB 2FH5B 4Z1MD 1W7AA 2OV2A 2QPOA 5TB5A 1KDRA 2WJYA 1FMLA 3AUXA 2YYZA 2WOJA 4IOJA 4P31A 3NG1A 1Z0FA 2EWVA 2WWGA 3RNLA 1Z22A 2R6FA 2VHQA 2Z83A 3ND8A 5FR1A 3EZ9A 1ZNWA 1T0HB 4JLDA 2MSEB 2KB0A 3ZIAD 3K70B 4C0LA 3BRWD 4HLUA 1BH2A 3RC3A 4M1MA 3EIHA 2OM2A 2FSIA 2GVZC 2A30A 1Z0JA 1NN1A 2OCBA 3I1FA 2V4ZA 4AKEA 1IN5A 1GL6A 4OKSA 4LC0A 1F6BA 2HXYA 1KI7A 1T3LA 5F98A 2Z5FA 1NY6A 2PJZA 3BFXA 1ANKA 3GJ8A 4CEHA 1Z5ZA 4TZ0A 1JR3D 1KSHA 1EESA 3W90A 1NNEA 1OXXK 5JWRA 2O8FB 3AF3A 2D7DA 4WW0A 1JPNA 4PC1A 4Q9JA 1TU4A 2IYTA 2PX3A 4FIDA 4PFSA 3ZYCA 1W2GA 1OYYA 3GLFE 4WA7A 4CW7A 2FFQA 2OUKA 5FBLB 4B6EA 4FI3C 4RFSA 2P65A 3DDCA 3T1OA 1KI8A 1VDZA 3H4MA 3TAUA 1IAQA 4DB4A 3GFPA 3TRFA 3KXIA 1D2NA 1YZGA 1MABB 2ZRCA 1P9WA 3SFVA 4ACBA 2VH5R 5FBQB 4BWYA 2AFIE 1XEWY 4BZQA 2IUSA 1EXMA 5JWOA 1EX6A 2OCPA 5BYJA 1W1WA 4ZDWA 2O8EB 1X3SA 1KMHB 4CT5A 3N2EA 3SJBA 5CIQA 3DL0A 4PR0A 4KSBA 3E5HA 2OLKA 4JVSB 2NGRA 2W6IA 2WKRA 2N1BA 5BN4A 3RVBA 4II7A 5K8LA 3FHTA 4PTLA 2IYUA 3U4QA 1ZNZA 2FZLA 1R7RA 1ZM7A 2XNDD 3WRYC 1Z0DA 2F9LA 3LH5A 5JSZA 5KNDA 1IN8A 1RW4A 1QBKC 1X6VA 1G7CA 1E2NA 3O47A 3AVVA 1NRJB 1T4GA 4IEEA 2JLSA 4YC7A 1E2HA 1UJ2A 4IXMA 2QT0A 2XJ4A 2NO1A 4OI1A 2WKPA 1S96A 4HLQB 4MUBA 2V8OA 3SYKA 1Z63A 3TUZC 2DB3A 2RCNA 2J0QA 3WMGA 1NBMD 1KIMA 1MKYA 1XEXB 1R8SA 4KYIB 3X1WA 3ICEA 4NPHA 3DM5A 121PA 4QGHA 1ZP6A 1W36D 2BMEA 3DKVA 3A1VA 5CLLA 3SEAA 5TVKA 1WDTA 4DUGA 2J41A 4BLSA 5K8TA 1H8EA 3OIYA 2ZTSA 4HB2A 4LX0A 4IOMA 3QKSA 3AQ4A 1N5LA 4LJ4A 1NLYA 1NKTA 2ZQ5A 4TLCA 4M1WA 5KSOA 1G3MA 4V03A 2H5EA 5B2ZA 4JVLA 2IWRA 2OILA 4BASA 1W0JD 3ZZTA 4F93B 1N6OA 4RZXA 2AKAB 1OE0A 1QHYA 1E4VA 2JJ1A 1OT3A 1IN7A 1JR3E 2DYKA 2HCBA 1ZC3A 2OBLA 2OAQ1 3BOSA 3X1YA 4YDSA 3FOZA 4C7OB 4C0QC 4BLPA 2ZYTX 3RS4A 1XCGB 1E2PA 4JLKA 4JLMA 4NCHA 2XB4A 2A5YB 2CLSA 1RFLA 3ZGXA 1ZCAA 5GADl 5JEEA 3QKTA 3BIFA 4FD2A 5CDFA 1JR6A 1SXJD 3VX3A 4IW3B 5CM8B 3FDIA 4DEXA 3RAPR 1KY2A 2CNWA 2EFHB 2O8DA 5JZVA 2IX3A 4D81A 4F7WA 1Y3AA 1BYUA 3SNHA 1W36B 3RDPA 2A5JA 2QM7A 1FZQA 1E2IA 3ZQ6A 2C9CA 1Q22A 3K9LA 2HCJB 4PSAA 1XPRA 4DJTA 3GEEA 3QEJA 1JQLB 1US8A 4FMDB 2GWHA 2PBRA 1YR8A 2ZU6A 1FMJA 4MH0R 2BDTA 3THYB 2D2EA 1TTTA 2P5TB 4Q7JB 2A9KA 3VQTA 3BXZA 1C9KA 1KKMA 1L2TA 3NBYC 1EK0A 5D3MB 1OF1A 1EX7A 2GILA 2DBYA 4HUTA 2HT1A 3EA0A 4JYBA 1E1RD 3IQXA 1EG7A 2RAPA 2WMNB 2O8FA 2ZM5A 4F4JA 2EYQA 2W6JA 4ZCIA 4FWIB 1CLUA 1O3YA 3UATA 4I81A 4DLTA 2RGCA 5EXPA 1SVLA 2R62A 4LBYA 4PHTA 1KTVA 4QHSA 3TBKA 1DELA 3K09A 4AURA 4DSUA 3FFAA 2XZLA 5IF9A 1HA3A 1SXJB 2PCJA 3B1WA 3QJYA 2HLDD 4Z1MA 3QBTA 2OHFA 3GLHB 4PPQA 1JAHA 2GCOB 4ZI2A 4TL7A 4DLSA 4A9AA 1E2LA 3LBHA 3AP1A 4YXWA 5HR5A 2B7BA 1WQ1R 1XD9A 5CJPA 2CL0X 4B2PA 3RWOA 2N42A 4JLNA 1KSFX 4KFSA 5FBWB 1J7KA 4GMDA 3ZIAA 3LLMA 2O8EA 3MSXA 1LS6A 1ZIOA 1KMHA 2F9MA 1TQ4A 3H84A 1NMZA 5E95A 5DN6D 3BFVA 2C03A 1WXQA 2IEYA 2F43B 2SHKA 2HDNB 2WAXA 1RJ9B 2IYLD 3L43A 2FWRA 5F2EA 3WHLA 1QG4A 3TE6A 1S2MA 3QI2A 4NONA 3CKLA 2P5SA 4FXPA 1XCPA 4NHOA 3MFYA 2QMHA 4P0TA 3PUWA 3OEED 3KUCA 3VX4A 2PT7A 3R9IA 2X2EA 2ZREA 1NVWQ 3DZDA 3LBIA 4OHYA 1W2HA 4JLBA 4M1TA 3OAAD 1IOZA 4TN1A 3MAAC 1EFCA 3FMPB 5HTKA 3P4YA 1E2KA 2IHBA 2O8BB 2PJRA 2NZ8A 1ESNA 2ZSDA 2J45A 2R6DA 3CRQA 4MKHA 1A82A 4BLQA 1UPTA 4NKRA 5KSZA 1Z6XA 1XEXA 2H18A 3CWZA 1FQKA 4MITA 1CS4C 5BYKA 1YZNA 2RHMA 1E1QD 3GLHE 4DCSA 4WOPA 4IOKA 2IYSA 4WVFA 4B32A 2R65A 3OIWA 4FCWA 4X8MA 1R0WA 2JAQA 4JL5A 2FG5A 2H8KA 4JLOA 2O5VA 5AUNB 1E9FA 2F1RA 4R2IA 2QSZA 1VCIA 2GDJA 1JQJC 3NKVA 4GFDA 4BFYA 5C18A 2NIPA 1SZPA 1VYTA 4TT3D 4G5RA 1G3UA 3A1WA 5CYPA 3WYAA 3LX5A 3REFA 1LS1A 3RS3A 4QBFA 4OK5A 1G18A 2E9SA 3B1ZA 3A36A 5JJIA 2PX0A 2YOHA 3W9YA 1HQCA 4LDJA 2XNDA 3KX2A 3Q9LA 3ZZUA 3DMNA 4TQAA 2WSSD 2D3WA 4URYR 4M9SA 4R9UC 3T5DA 4HLCA 4FWTA 2Q3HA 4W5HA 4DLRA 2WICA 3I5YA 1EGAA 4C7OA 2VEDA 4FMDF 1EFHA 2ZJZA 2JJ2D 2IF2A 3SQXA 1UDXA 3B82A 3OFND 3MMPA 1JECA 3TSZA 1TUIA 1U8AA 3A58B 1PLJA 3L2OB 5JECA 2ZRAA 1JBKA 1XTSA 4Q4JB 3V4FA 2ZRGA 1NBMA 5GVSA 2ZRMA 5G3YA 1QRAA 1UKZA 4BFXA 1U9IA 2XGJA 3ZQJA 1J8MF 4B75A 4DDWA 1TX4B 5TARA 3RS2A 3CW2A 1J70A 4BEJA 5H1YA 2WKQA 2AN9A 4Y0VA 4PANA 2BVNA 3CUEF 3KQNA 3I5XA 1Z07A 1CR1A 1E9BA 1XTJA 3R7WB 1M74A 4A0FA 1OFHA 3THYA 4GSYA 1OSNA 1YZQA 3C8UA 1T5LA 1Q21A 3CO5A 4MUAA 4WZAE 2AK2A 5D3MA 1IXSB 3AKCA 3M0EA 2J0UB 4AWXA 2CCJA 3QPUA 4NZYA 5C4MA 1Z47A 3FPAA 3NBZC 2J7PD 4J0QA 1W0JA 3GJ4A 4P4TA 4EPWA 2A5GA 1XTQA 3K9HA 4KFTA 3AEZA 2RGGA 1ZW6A 4IVQA 4ZO4A 3AF0A 3NEYA 3B13B 2FN4A 4US1R 1GNRA 3KQKA 1P73A 1FX0B 1KJWA 1U99A 1YZLA 4EPTA 2IYQA 1JEDA 3KKQA 4B74A 4JVNA 4MDFA 1SXJA 2GXQA 1TQ2A 4OHWA 3THXB 1XP8A 2EVWX 5GJCA 2R2AA 1NY5A 4PAQA 3GMTA 4DIDA 3U44B 4DLUA 1E0KA 4NDZA 2GCOA 1G20E 2VP5A 3VHLB 1ZD9A 4M4SA 1R2QA 2FFAA 3OF5A 1T5IA 1KI4A 3EARA 3LBNA 1NI3A 4OQNA 3RANA 3QNUA 2FZ4A 3EZ2A 1M1YE 1RZ3A 4A8JB 1Z29A 4DLXA 1NMXA 4K46A 2V54A 2HJGA 3CONA 4JS0A 1ZC4A 2GA8A 4HDCA 3CB4A 2F43A 4IFEA 1ZUNB 2O8CB 1E79D 2QENA 2ZJYA 4LYJA 1HTWA 1RJ9A 1OIWA 4TMVA 3PV0A 2ZRLA 3AV0B 3W3ZB 4AG5A 1KHTA 3AH8A 4HEJA 2G77B 1LF0A 1VHTA 2W2XA 1DARA 2J7KA 5GJVC 1AS2A 1E1RA 1NL3A 3SDZA 3E70C 1KI2A 4LJ8A 2WWHA 5KU1A 2DFTA 4HAUA 3C5CA 3IPYA 3QQ5A 2BEJA 3PENA 1NN0A 1LTQA 5TV2A 3PXGA 1OH8A 4WBSA 3W6PA 3I4LA 2O8BA 4Q9HA 3EAQA 3AKYA 2P2LA 3FGNA 3RRYA 3SN6A 3ECCA 2XTNA 4Z51A 1KJYA 5CK5A 1DAIA 4UXIA 2HLDA 3ADKA 4M2LA 1AQYA 2VHTA 6Q21A 2AD5A 2BMDA 3P32A 4DDUA 4GL2A 4BPBA 1SVMA 1E32A 1ODFA 1WA5A 1KZ7B 2BWJA 1HUQA 3U3RA 4Y0AA 5CB8A 1K5GA 4E5UA 1YZKA 1FL9A 2NPIA 1G9XA 1G3QA 1CRPA 3LDAA 3B1YA 1DOAA 3NIBA 4P32A 3RSOA 5DN6A 2C9OA 3ONWA 3OEHD 5FUVA 1D2MA 2HT6A 2VTKA 1G4AE 5DH9A 5BQ5A 1KYIA 1TAGA 2WWFA 4D4JA 4Q48A 5SZKB 2QAGB 3KQHA 3DMDA 1M7BA 3M6AA 1XEWX 2GBLA 1R5OA 1GUAA 1IHUA 2V3CC 4TMWA 1NIPA 1ZINA 2GVDC 3OEEA 3DZ8A 4YLGA 2FGJA 4PHFA 2YWHA 3OAAA 2VYFA 4F4IA 3MJRA 4IVPA 5BW8A 3NVAA 2V9PA 4KO8A 4Q03A 1QHHB 3RLFA 2ZPTX 3SS8A 3B8HA 4GI7A 1KI9A 4CEHB 1UEJA 3CPEA 2XAUA 4Q4JA 4HAZA 4JMPA 2ZVQX 4S2EA 2WJVA 4E09A 2VHCA 1L7VC 2YC2C 4Q02A 2AFHE 2K5UA 3TSOA 3X1XA 1M7GA 1E2JA 4ON9A 2CCKA 2OT3B 2JDID 1Z28A 1E1QA 1DPFA 3ICQB 5JS8A 2CLDX 5FPYA 3W5IA 3IIJA 1Z2CA 3FFBA 2XSZD 2PZGA 4FN5A 1SKQA 3KQUA 1H65A 1N0VC 3R7WA 1G64A 2Q0HA 1MT0A 1PUIA 3CR7A 2LWIA 3HJNA 5JCPA 1JI0A 4TT3A 1YVDA 4UNSA 4Q66C 2IA5A 3I8SA 3ZD6A 5HCIA 1E9EA 4ZPXA 3ZVLA 3MG9A 3U3OA 4TL6A 1KO4A 4XD7A 2FFBA 1E9DA 3FMIA 4DUGD 2J0UA 4LK2A 4XVRA 2C78A 2IXGA 1U8YA 2DWPA 2WPDD 3GLGB 2WSSA 3LRPA 3VHXA 2WJGA 1E94E 3EASA 2DCUA 5LD2C 2ONJA 4NTZA 4XWKA 3VR3A 2JJ2A 1UAAA 1FTSA 3TLXA 3PR1A 2CHQA 3CLVA 1FX0A 3OFNA 3NBFA 2ONKA 821PA 1D5CA 5JI3E 3UMSA 2D06A 4PSKA 2HF8A 2P3SA 2CE2X 4A15A 3IHLA 3THXA 2HF9A 4RKEA 2ZI7A 3SC3A 3T1TA 3A1UA 3LX8A 3PJRA 5G53C 1RE0A 4YMTA 4AC9A 3R20A 4ESHA 3O8BA 4TYPA 1KDPA 2Q6TA 5FUXA 1G7SA 1RRPA 1DAGA 4CVNA 4DCUA 3CZPA 2GRJA 5J4KA 4HATA 2JGNA 3PUZA 2OZEA 3P26A 2VP4A 3B5JA 4QGAA 4A8JA 4PO8A 1XTIA 3SOPA 3WBJA 3Q7PA 4B2LA 2Z4RA 3WNBA 4OQXA 2O8CA 2ZU0C 4JIMA 5JHHB 1TPZA 1KI1A 1LNZA 1NP6A 5GJBA 4XOIA 2J7PA 4LUCA 1W46A 4LJ7A 2FPMA 1SVWA 1YKSA 3UG7A 4QFMA 1AS0A 1N6HA 2KE5A 1NVVR 2BC9A 2WJJA 2Q9AA 4M9QA 2GNOA 2QRZA 3KUDA 1R6BX 3CRVA 2PMKA 2XITA 1BKDR 4EFLA 3CX6A 4B71A 2OO7A 2ZI4A 2KBEA 721PA 3SYLA 1GRNA 3Q85A 1A2KC 1NG1A 1C4OA 4PQYA 5AJVB 2NZJA 4C0HA 5KDOA 5EE0A 2ZR7A 1CEEA 2R8RA 2J59A 4EQ6A 2XXAA 2W6JD 3A1TA 3B9QA 1VIYA 3K0EA 3UIEA 4Z54A 4JBWA 1ZNYA 3X1DA 3TVDA 2WIBA 3GFOA 3T35A 3GCGA 4B3BA 5JCZA 1W36C 1XMJA 2B92A 1F3OA 5H70A 2I1QA 2KWIA 2QBYB 5CLQA 1NVVQ 5DSZA 2H17A 2WSMA 4URVR 2BJWA 2PL3A 1E0SA 3BB4A 3AGQA 4OJKA 4RD6A 2O8DB 2I4IA 4A82A 4WXPA 4C9BA 1GILA 1E79A 4DT1B 1X86B 2F1HA 1OIVA 3NXSA 2ZRHA 1NLZA 4YXWD 2QAGA 1EFUA 2W83A 2AXPA 1F2TB 5EP4A 1E0JA 4HAXA 2GEUA 4OI0A 2W0SA 4AD8A 4H9GA 1US8B 5FTKA 1R5NA 2FF7A 4HB0A 3LNCA 2J46A 3F3YA 2FSFA 2NO9A 5D3QA 3QEOA 2JLZA 1P9NA 4TMTA 4A0RA 1XU4A 2NO0A 1XEFA 1N6KA 3QXHA 2YWEA 4RZ3A 1GKYA 1M34E 2OFWA 4KI0A 1QHHA 4A2PA 4FCTA 2QM8A 1E9CA 4XTRA 4BECA 3I62A 3W3AA 3Q3JB 1I2DA 2JJ8A 1AKEA 1SKYE 5FTMA 1EFTA 5EUQB 4CT4B 4DLVA 2H7VA 3GJ7A 1DAFA 2ZE5A 3CNOA 4BFSA 4D0NA 4EKDA 2CBZA 4UJ3A 2G0TA 3HP1A 5FL3A 2DR3A 1W48A 2NG1A 2VF7A 4D0GA 2HUPA 5ELXA 2PH1A 1K6MA 5CDFE 2ZJ8A 4OK6A 3U6BA 1JNYA 2GXSA 4P4SB 4IDHA 4Q21A 2F55A 2IL1A 2QPTA 3AKEA 5KHOC 3OEHA 2BBTA 1Y63A 4N0EA 2YOGA 1SVSA 4LZZA 2ZRDA 3RWMB 4XTCS 1BO6A 1W49A 1RYFA 1N6LA 2VF8A 5LPNA 2QY9A 2X2FA 1KK2A 4UKDA 1AGPA 1Z08A 2GKSA 1E6CA 1P2SA 1TF7A 2X77A 4BLTA 2CVHA 1P75A 3GLGA 5IT5A 1N5IA 3OIVA 2VHUA 2X1VA 4LPKA 2GCNA 4M1YA 3PEUA 4TYWA 4MYCA 2E1RA 2VSOA 3A4NA 3MRSA 1PV4A 2HJVA 4OBEA 1Z0AA 2ZRKA 5KSYA 1KO1A 2LKDA 2VP6A 4NCNA 4Q4AA 2RH5A 3E1SA 4V0LA 2UZIR 4B3GA 1B23P 1KI3A 4EJSB 1XD8A 3QKRB 1F2UB 4G01B 4CZ2A 2WV9A 2IUTA 3H86A 3LFUA 4LYFA 4L4UA 4MRPA 1II0A 2QA5A 3K0CC 1DAMA 5LDDC 3GJXC 2IC5A 2JDIA 1GWNA 4B48A 3ZD7A 1NLFA 2OEPA 1GG2A 2GETA 1S1CA 5L3RA 4ZDJA 2YNMA 2YC4C 5KUTA 1HE1C 5KDLA 3D6TB 2XSZA 2RGEA 3SBEA 2IYVA 1P2UA 1TQ6A 2NOAA 1N25A 3GJ5A 4U00A 1HQYE 5L3SB 2WJHA 1XWIA 1T8TA 2GF0A 1E99A 1VPLA 2AHOA 3Q5DA 4LPSA 3K0AA 3KJEA 5BN5A 4WZBE 2CL7X 1UDWA 3B1VA 1LFDB 4Q4LA 1IY1A 4IDPA 2IS1A 2WPDA 1PZNA 2GJ9A 4RZUA 3RRNA 3EW9A 5G41A 4Q4HB 4QM7A 3UANA 3D7MA 2GEDA 1EFRD 1G17A 2R9VA 1P62B 2WAYA 1OB2A 5DYGA 1AA9A 5FOSA 4KFRA 1ZIPA 2QMUA 4US2R 2CHGA 4R7ZA 4QKQA 3T1VA 2IEZA 2C99A 3RS5A 1GZSA 1ZUIA 2CDNA 2QRNA 4DWJA 2X8AA 4GP7A 1AGRA 2ORWA 5EE3A 2E87A 4V0OA 3T15A 4S35A 1HURA 2F3RA 2HEIA 2C95A 3V4RA 3M1IA 2ODEA 3P1JA 3NC1C 1IN4A 5EZ5A 2GJKA 4TSFD 2UKDA 3ASYA 4LJ6A 3GEHA 2WBLC 4YDHB 2QBYA 2YWFA 4NL4H 4V0MA 4A92A 4NBSA 1GAJA 1ZMXA 4C0JA 1OXUA 2NPFA 1I4LD 2O0KA 4UNQA 5J4VA 2GEVA 4DT1A 3BFKA 4RD4A 2ZR0A 1YR7A 2QGZA 4D2IA 1FNMA 1F2TA 3RRMA 3WYGA 4TYNA 2ZJ5A 2HV8A 3FYHA 1AKYA 2DFKB 1NSFA 3QKUA 2JLWA 5BXQC 3T5GA 3TGPA 3TNFA 3NHBA 4LRWA 4QL3A 3T61A 1NVUQ 2ZI6A 2QMOA 4RVCA 4B47A 3KFVA 4TLEA 3VTKA 3KKPA 3U7HB 1TEXA 4OI2A 3AVYA 4NU0A 3W6OA 1WMSA 4JSYA 1KO7A 2IK8A 3C7KA 1XPUA 1KSJA 1T8UA 5CK4A 3RSLA 4XH9B 1SHKA 3MWLA 2C9YA 1G8PA 4CEIB 1NG9A 1VG1A 1E2QA 2XZPA 4AKHA 1XZQA 2G1KA 4JLJA 3WNCA 3FKSD 3NTUA 2QMEA 1X8JA 3C5HA 4LC1A 1KO8A 4MKIA 2V1XA 4TL8A 2QE7A 3BS4A 2B8TA 2FSHA 4P4SA 5A0FA 2CJWB 1WP9A 2LKCA 2ZSFA 3EZ6A 5L3VA 1NBME 1DO2A 3VFDA 2P67A 2H1LA 4BLRA 3KFXA 1ZCBA 1M7HA 2Q3MA 3FHOA 1QF9A 2GK6A 3IPXA 1LW7A 4W5JA 5DIFA 2EFEB 2YJTD 1R5BA 3EG5A 4WIAA 4DSOA 5K8UA 1G5PA 4K81B 4LJYA 1U0JA 4NMMA 3QY0A 1R0YA 1N6NA 2ODWA 2QGNA 3VR5A 4Q1EA 3CF0A 4JJKA 4A2WA 4MDEA 3AVXA 2G83A 4JLVA 1IQPA 1W4BA 4TYYA 3X2SA 4GZLA 2LCFA 2VIIA 3AVWA 4EJSA 4TMKA 3QKRA 3RS0A 1F2UA 4BFUA 4BLOA 3OHMA 4LJ5A 1G8YA 3CIOA 5EE5B 4IOLA 3U61B 3EPLA 5KNCA 1ZNXA 4US0R 3TQFA 1KNXA 4B33A 1BOFA 4YMWA 3ZVMA 2FNAA 3F8TA 4CDGA 4DSTA 2XNSA 3LLUA 4POAA 1G19A 2YKGA 1SXJE 2V55B 4DCTA 1SVIA 1P6XA 4HAVA 5L3SA 2ZJOA 5JI2E 2AWNA 2JEOA 4IXNA 3HU1A 1E9SA 3T12A 3QUSA 3C14C 4L5BA 4C3ZA 4GPTA 1NF3A 2QTFA 2ZITA 4IRUB 3AM1A 2PLRA 2F7SA 2IF0A 4L9WA 1E2MA 3CPJB 4GDFA 4PC7A 4Q7KA 4Q4HA 3IEUA 1AQUA 1RIFA 4E22A 4HLUC 2AR7A 3L0PA 3QG1A 5EXXA 3ZJYA 5LB2A 4DLWA 4XD7D 3AVUA 2WWXA 5FOVA 4QJ5A 3MD0A 1YRAA 1VCOA 4OK3A 1ZRHA 1IXRC 1B0UA 3SHFA 3CRRA 5KTYA 3FVQA 3A37A 4A1FA 4M1KA 2W2VA 1VKJA 4FCVA 2RGNA 2CVFA 4YONB 521PA 4D26A 4PSVA 2Q21A 3K9GA 1MO3A 2FJUA 2BEKA 3KKNA 2ODBA 4MRNA 2ZYWX 3TH5A 3CX8A 1XCMA 4ILEA 3QIAA 1N5JA 2AK3A 2ZI3A 3I72A 1HH4A 3WP0A 2Y8EA 2CK3D 3AP3A 3RC8A 2MSDB 3AF2A 4OJQA 4QGFA 1OB5A 4PPGA 4R98A 3W8RA 3ADCA 2FPKA 4PHGA 3BB3A 1W5TA 3CNLA 3EA5A 4KYUA 5HPYB 3HDTA 3AP2A 1I4TD 2ZYUX 5G40A 1QG2A 5C4GB 1Q12A 3Q5EA 2IYRA 1E9RA 2VLIA 1XMVA 3P20A 1OKKD 3QVUA 1RYHA 3IKJA 1NN3A 1IXZA 4O0MA 4LOAA 3HPRA 3QOFA 4NP6A 2Z43A 2C96A 4O2LA 5DNYB 2QP3A 3VR1A 4U02A 2EWWA 1EFRA 1KK1A 2CMKA 2ZETA 4FINA 3EZFA 1DBSA 1OFIA 4RJLA 3WNDA 5KPDA 3KTAB 4MKGA 3TJZA 2GESA 1PLKA 4A4DA 4LCBA 2F1JA 1WB9A 3WP1B 2WWYA 5EP3A 1T9HA 4D4MA 1ZVQA 3HU3A 3LA6A 3PQCA 2BMJA 4NYJR 1Q1BA 1GTVA 1II8B 3B9PA 3N5CA 5KSPA 4RD1A 4DCVA 4O25A 4CEIA 4TWZA 2EU8A 3SR0A 2EFCB 2JLQA 1YZTA 4Q9LA 2I3BA 3K0SA 1XDBA 4NYIR 1QHXA 3TIFA 2H16A 4L16A 3LW8A 1S3SA 5DGXA 1O87A 2OFOA 4M9ZA 3TVTA 4TSFA 4LHVA 1G291 3DM9B 5HKKD 2IYYA 2P6RA 4EAQA 2FPLA 3IO5A 1G8FA 1KDOA 1ZM4A 4JL8A 5JJKA 3L0IB 4LJ9A 4TL9A 2JLYA 3SE0A 2CJWA 4UNNA 3W34A 3VR6A 3K0FB 2QTVB 3P4XA 5JHGB 4RKFA 3VKGA 4P4UA 3ASZA 4TMXA 2VPPA 1H8HD 1KGDA 2BBOA 3KZ1E 4D4LA 1CULC 3U3KA 1ZAKA 5J4YA 5L8VA 2YWGA 4NYJQ 2P0EA 3NC0C 4B3CA 1U0HC 3UMRA 1E2GA 1N6RA 1G1MA 4NYIQ 4B76A 4TLDA 4TZ6A 2QEQA
chains in the Genus database with same CATH superfamily
2OLEA 4TLBA 3QUQA 4ZMBA 1QVVA 2QU7A 4TKUB 4NBWA 1CIPA 2QK4A 4MYDA 1ND6A 1CS0A 1LI4A 2W2PA 4D74A 5FUMA 1IDOA 2I7CA 1XGKA 4UEOA 1KY3A 3IPLA 1LRLA 3WS7A 1X7XB 1NZFA 4RZQA 1SUWA 1LPSA 4EB6B 4GAEA 3PRJA 1VKNA 3BHMA 3PFNA 4ISCA 3QLEA 5M04A 4F04A 3AKZA 5KMGB 2JHFA 1G9SA 1GO2A 1XMSA 1NYTA 4LXGA 5KI6A 2AXEA 3L6UA 4ZZ0A 3EVBA 4PC2A 1E3JA 4AP6A 5F3WB 1KP3A 5JLJA 4JYAB 4F06A 1X9IA 3LWBA 4OXXA 2REBA 3GLIB 1GG8A 3FI9A 4BX2A 1UQRA 5JVDF 1O5IA 3K1AA 1YULA 3DWFA 3L8MA 3P0HA 1KP9A 3FMFA 1DWQA 3ZUPA 2EEZA 3VJKA 3TFQA 4HAWA 4G24A 1PQUA 1UBCA 5DRYA 2FZKA 4PF1A 1KJ9A 4ER6A 3C3WA 4O0LA 2UYCA 4CKWA 4AKGA 3PFBA 5AKLA 5J2UB 5REQB 4GP6A 2WYUA 2Q7OE 5IAEA 4Y6SA 2GPWA 3GRVA 1EVLA 1K98A 2C29D 3SXUA 5CB0A 2GBCA 4K03A 5I51A 1JFSA 2QHXA 2A3RA 4DMKA 4B6JA 3WWCA 4MYUA 3KWJA 4L4SA 3SXJA 4GOJA 4C05A 3JQ8B 1KE1A 5DBFA 3EXHC 3K73O 2QQ5A 3FBWA 4MIOA 2GI4A 4C76A 1QE5A 4G8JA 4MS4A 4EGAA 3KD2A 1N3BA 3MGCA 2VP2A 3ZBPA 2FVYA 3OCUA 3ZPXA 3UC9A 1Q57A 2C82A 4R8KA 3U3JA 3HI6A 1KAOA 3EC1A 3IEKA 4XYEA 4ZO9A 1YRYE 1R12A 4GOOD 5ELLA 2P9ZA 2ECFA 3L7LA 2HJRA 3IAAA 4J3JA 1QC5A 4Z7NB 3LX6A 2QVYX 3ET4A 1S7GA 2G9ZA 3FUVA 2BL4A 4IUDS 3HSYA 1RBMA 3IDSA 2Z57A 3K09C 2EEPA 3VR2D 1XMOB 4JBHA 1C9DB 4TMFA 3GGGA 4HDNB 2I99A 3ZX5A 5CTJA 4CM7A 2PA0A 3BQ9A 4WXEA 5CXSA 5BVHB 2SNIE 1QGYA 5EZSA 4NR0A 5SZJA 4JNKA 3H2SA 4DIEA 4RETA 3N0VA 2WT9A 5AXCA 1JEQA 1GVNB 2X8LA 3L1VA 3N2GA 1Q15A 1U8FO 1YS2X 4FGLA 3P8ZA 4IG9A 2EJWA 1CXZA 2HMVA 4ITRC 4B4DA 4BEWA 4CQNA 1C41A 3GQBB 3G7SA 3ZGOA 1IOVA 3T3DA 3LUDA 1EK2A 5TT0A 3CZ9A 4TXJA 2QLLA 2ZATA 2GFIA 4OA5A 4POOA 1OH7A 4OSEA 1OT5A 4OV6B 1U2DC 2J9ZB 5EHGA 3RRBA 1AK2A 1PL7A 2GQ0A 3H16A 4YAKA 3TZHA 4HLDA 2L18A 5AI8A 5EWLB 1Z6TA 4BTVA 1EDEA 1C8KA 1NXOA 3KDAA 3TXXA 5EMNA 3R7BA 2RAFA 1QJ4A 1ZKDA 1SMKA 1JHDA 3K6KA 1DO0A 1Y1SA 2X9LA 3OQVA 4MS3B 1MCZA 5EWJA 5BUCA 5EINA 1XZPA 1PYGA 5EQTA 1DZ3A 4O08A 3LC7O 4G67A 1KC1A 3UUGA 3EGDA 3G9TA 8GPBA 1KZ1A 5IJWA 4OU4A 2F67A 1GA6A 1TQ8A 3ETLA 4KUEA 3BHIA 3VV2A 5FORA 1JJVA 2G0NA 3EVCA 5DX1A 3KKEA 5LJIA 3K70D 2E1PA 2C7BA 3MQ2A 3OQIB 1JZSA 3IEXA 1SUDA 2IHVA 2CNOA 3OM8A 1EPUA 5AXBA 1JSLA 1U02A 2C3PA 2H2GA 1OXKB 5DCWA 3HJTA 4HFNA 2CWWA 1XQXA 2RGXA 3G9QA 1BHJA 4IP0A 3LDFA 4HWGA 4KVFA 3C8DA 4RTMA 2W00A 4LHSA 1JDNA 1OA0A 3DO5A 5L95A 5DHSA 1BVUA 1G6KA 1VSUA 4NY1A 3NHMA 2AG8A 2RGWA 4UMVA 2XYPA 1Q95A 5ANRB 4O59O 1HE5A 4EX6A 1ZU5A 4ZJUA 3CVYA 5FOUA 5TPZA 5HJ7A 1W73A 3GJ0A 1DRWA 5DTQA 3ZHXA 4EUKA 1TF2A 2J3HA 3SVTA 2FPUA 3H5NA 2R5FA 4LE2A 5F5LA 3Q9SA 1RC8A 1G21B 2VT2A 4D9JA 5F9HA 1U63A 3VOTA 1LBIA 4D97A 1LVGA 3DNFA 3BSWA 3N05A 2I03A 3AW8A 3HO6A 4HPWA 4YAUA 3K5WA 1Y7TA 3OT1A 4KQWA 1YE3A 3CLHA 4EZEA 2EW2A 1OZFA 3K0AB 3IT1A 3QWAA 4XI9A 3TPFA 2Q49A 1MX5A 4U7WA 3S2ZA 2GSWA 3UM9A 3WOHA 3WQSB 2NV2B 1UEXC 2XGMA 3PJFA 5IPFA 3FZGA 1IY2A 2QD1A 1FDVA 1K75A 2G04A 4NPAA 2OY0A 4RTNA 4DV7B 4HZIA 2Y2UA 4EHDA 1UZLA 4RU1A 3G3EA 3GCZA 3D8RA 1GG9A 3IIKA 1U8EA 1L5HA 4YCCA 5F35A 2DQYA 5KOJA 4U6NA 1Y8RB 3FHCB 2D5AA 2A84A 2OG2A 5J2UF 1N2CE 1BN6A 1H2AS 1E6WA 1PJZA 3KOMA 3PUYA 4UULA 2NO5A 4ZAZA 3LZ6A 5GOZA 3IJPA 1QU3A 4J2HA 4W1SA 5EOVA 3LTEA 3SJ7A 2F6RA 1EGVB 4MDHA 5AUOB 3CO0S 4NAHA 1VMKA 5HQ3A 5JSUA 3ORHA 1CUZA 3D59A 4CG0A 4RJIA 2QLTA 5AKEA 1L6IA 4ZQGA 3I52A 4UXHA 4I8DA 4Y67A 1QOPB 4I4TB 4H1VA 1ZKMA 4LQ4A 4OYRA 3NH6A 1W9HA 1XCLA 2CB0A 3EIQA 2R66A 5EI5A 4L8VA 1ODLA 5LLSA 2VQSA 1CJUC 1VMAA 3DBVO 3FYUC 4GWKA 4U2FA 4EEKA 4FOTA 5LWQA 1OY1A 4IDCA 4URXR 2IZZA 4ZV9A 3TX6A 4YJKA 1NJ1A 1FFDA 2JGJA 2ORVA 3CJTA 2BN4A 3ENKA 1JYEA 3CWQA 1WNTA 1HYGA 2GZRA 4R1QA 2PLFA 5F9MA 2QRVA 3QVXA 4MR7B 1YFLA 4KI7A 1GPNA 2P40A 1JGTA 4DA4A 4PG7A 5J5CA 4UOZA 2GO7A 2DCMA 2P6OA 4JT4A 4K05A 2FX5A 5L3ZA 4EFNA 5I7EA 2XCSB 2ZE7A 3ZE1B 3REQA 4FHGA 3ENVA 1EB8A 3R8CA 2ERYA 3HUUA 4Q9IA 1CDZA 1MOQA 1MXHA 2W2TA 3W79A 2YFYA 4YCLA 2GXUA 3SHTA 3J80A 3EX7C 3VYWA 1UK6A 4JCOA 3SMQA 5CDGA 5FPSA 4D57A 3S2FA 1K6EA 3GLFB 3GUUA 5J2TA 5KYXA 1I7QB 2JG3A 3PXXA 1KZ4A 1XTKA 3JYPA 3CLSC 5CPFA 5FL7A 1F14A 7ADHA 3L8YA 2NXWA 5L3QB 1TRHA 3DTYA 1G8MA 1TQHA 3O21A 3L07A 4IRXA 4TVBA 5KJCA 3FLEA 4WVLA 3R0XA 4L4RA 3TQOA 5K05A 4B45A 2KYRA 2UZAA 4URUR 1TUGA 1KBOA 3Q8KA 2VF5X 1UBEA 2RI0A 4W9NA 4YMSA 2ZRIA 1NJSA 1XU7A 4RLFA 3V8BA 2DPYA 1XRJA 4GLLA 2PYDA 2W2MA 2YHIB 4PHCA 4F12A 2GD6A 5F73A 4PX9A 1ZLYA 2H1FA 1R4MA 5SYAA 5KNCD 2H08A 2F3PA 4E2XA 3JQAA 2QYTA 3CG4A 1OBCA 4BO3A 2DPXA 3C3DA 3DCJA 4UTOA 5CFZA 1X3LA 3D3EA 1AT1A 1VL6A 2B6HA 2ODNA 4J07A 2VJMB 3G2LA 4U0KA 4URWR 1ECGA 2CSUA 3M6UA 4PCLA 4L3WA 1QK3A 1DDIA 5DHTA 5F1OA 1GNQA 1JV2B 3DLBA 4JBGA 4B4OA 1XNRB 1TTPB 3IMCA 3RW9A 4V0ME 3WMFA 5EIAA 4D6YA 5DNAA 5DGCA 3WNQA 2PWPA 4F45A 1YUNA 2EFJA 4MPRA 4E3WA 1D2GA 4JROA 1NSTA 4A2CA 2VFAA 4EBFA 5IG2A 1Y89A 5A4AA 3AUYA 3ZWDA 4U0JA 4JSRA 2P4SA 4B7CA 1MTOA 2J08A 4M0LA 5LMZA 1L5OA 4MP3A 1DXOA 2OCAA 3PSHA 3IB3A 2FR1A 2DKOA 4PZAA 3OX3A 1KYVA 5G0TA 3X2FA 1P61B 4HDQB 4MVCA 4ND7A 2A0KA 5EJAA 2NSHA 1S2GA 1DJQA 2CD9A 3I76A 1KH1A 4GZMA 3OF3A 4M7WA 1C0IA 2W5UA 5DW3A 4BUZA 2ZJFA 4QIHA 2R6AA 1A9XA 1UWLA 1YGYA 3EFHA 1PL0A 1TKRA 1BKYA 1NJFA 5KWEA 2O59A 4J6EA 3L4BA 1QP4A 4PLPA 4Z8YA 1JG3A 3B3AA 3PXAA 1CUJA 2WWIA 1C80A 3CMCO 4LQCA 3AETB 3AY3A 3PICA 4TKMA 4V24A 1CFZA 1Q7CA 4AZ0A 1VHQA 2R8PA 3CPSA 3FB4A 3MJFA 3O31A 2A9OA 3PB3A 2VQ3A 4K0RA 4LWOA 4BFTA 1CDDA 4EG8A 2AC4A 2JK0A 2MINB 5C80A 3EPKA 3WKDA 2D7CA 3A6KA 3LXRA 3RODA 1EDBA 1HOXA 1M8JA 1V3QE 3HA3A 4B82A 3I9JA 4TGLA 1OZHA 4XGIA 1APBA 3FWYA 3EGVA 1R8QA 1T1IA 1ZU4A 4X9XA 4MUIA 2RHGB 1RXSA 2NWQA 3PT9A 4E13A 3MJHA 2ON6A 3OHPA 4R1OA 5EIBC 1C3EA 5JR3A 2BI4A 3F74A 1K8ZB 2OXEA 1OXSC 1UMDB 1M2NA 2BGIA 2G7ZA 2VF2A 2ZRBA 2ZIAA 3HPQA 5AOBA 5BWOA 1YR1A 2ZWOA 2D2VA 3ZCPA 3L0ZA 3OTWA 1PZMA 4BE9A 3DMFA 4MA4A 2FX3A 1G6HA 1QHIA 3RS7A 5IN4A 3N2YA 4RYLA 5CHYA 4B2IA 1ZWKA 4LZLA 4GKJB 1CJTC 3TO5A 4ZGBA 3O8DA 2GCGA 3ROEA 1AZTA 3KV3O 1K5PA 3O8NA 2PZFA 4RMIA 6REQA 1V39A 5HQTA 4ZVTA 1NF2A 1UFRA 1SCJA 1GFSA 1WKBA 1ATIA 3PFIA 5LQUA 1T8YA 2C3MA 2LIVA 4LXHA 1DEKA 1EG2A 5G3ZA 1DBWA 3R3ZA 5K3BA 2ECQA 1COWA 4LFCB 4XM1A 3U62A 1G38A 4DHWA 1ONBA 5I4KA 2P4UA 2RKOA 2A14A 3RTGA 5AVOA 1KWKA 2HMWA 3EY9A 3EC7A 1OU4A 1PWZA 2WF8A 3D4IA 3QHPA 2NVUB 3WKEA 3HCEA 1Q50A 3RVLA 1PGPA 1F38A 4L15A 3C41J 2F1IA 1JXOA 3I5MA 5IKPA 1PQYA 1WBBA 5GONF 2FZVA 3LXXA 1OTYA 2X6RA 3E9EA 2PXXA 1HG1A 3D7LA 1Q84A 6CHYA 5G4LA 2CE7A 5HF9A 4AYTA 5TRTA 1Q17A 1I0LA 1N9ZA 1Z06A 2JW5A 3AI7A 4NQRA 4W4TA 1P7CA 3VAAA 1Q20A 1GYQA 4OXKA 2UUCB 5D01A 2RHJA 2I0FA 2QP4A 2C5BA 5CM9C 3TXYA 1P5JA 2C04A 3ZWNA 2SCUA 2W4MA 1ZJZA 3AHCA 1NQ5A 2B69A 1NE7A 3BSFA 2P2NA 2D8MA 3PUXA 3RAJA 2BKAA 1VTKA 2XWQA 4UVEA 4DR1B 3KKMA 1TK9A 3AM4A 3DVLA 3FTFA 1MZVA 1ZD2P 2JB9A 4MAAA 3HYLA 1G16A 2RI6A 3NH9A 4RHFA 3ZCRA 3N8KA 3T0FA 3L4KA 1MO5A 2HK7A 1L4BA 1VLLA 3RRFA 3UG6A 4BX9A 5A9SB 5FUWA 1N9GB 1MV8A 2ZJAA 3BSSA 4XWGA 3ERCA 2XOKA 3JZMA 4OHBA 4BU1A 4DDKA 3MN1A 1N4DA 5FOXA 1BXGB 4L7VA 4OQMA 4Q3CA 1QQAA 4RCZA 4TTAA 4OQDA 4RVSA 1U4SA 4RM2A 2A9PA 3BXGA 4MRVA 1MC4A 4OMDA 3AU8A 4D9FA 2A5FA 4R1SA 2Q41A 3G89A 1R0ZA 3FOCA 1BMTA 2HQOA 5ESRA 1P3JA 1ZL0A 4G0WA 1Y4ZA 3ZDCA 2C7GA 3IMKA 1G0NA 1QS0A 2GTPA 2BBWA 5ENVA 1YFKA 2F3TA 1DG3A 2DWOA 2IPAB 2P62A 5FCDA 5KNDH 2QI9C 3OQNA 2OKGA 2HMSA 1QO0A 5C37A 2BI8A 1RR6A 1D8TA 3P4UA 4Q1DA 5D5PA 3O8CA 3U6KA 1N33B 3VYSB 4EATA 1PNTA 3KXKA 2HLPA 2JLRA 4HEHA 4LX8A 4RESA 4Z9FA 2HR1A 1V4VA 2MOKA 3GJ3A 5DHUA 4X92A 5JSFA 1RBZA 1XXHE 5KNCH 4KVGA 4L73A 1M66A 2QZZA 4IKEA 3ZWXA 2B36A 4MQ4A 2VJYA 1SQ5A 4JC5A 3UUEA 3AB8A 1DHRA 4ZT2A 3ELDA 3LLCA 4WDQA 4NH0A 5LNK1 3OE7D 3OMXA 5DF1A 4LV6A 2W98A 3BWMA 3WAGA 1ZH4A 4Q1AA 2O2YA 2R25B 1GOTA 2PBFA 4QBIA 4XQCA 2FHPA 3FY4A 3D3KA 2R6R1 2VR1A 3DEKA 3H87A 1HT2E 1IEVA 1CQZA 4JUFA 5KYWB 2AR0A 2OFXA 1GFIA 4XIGS 1U2GC 2JFQA 5EUCA 4EPYA 5IK2D 4M9UA 5MFZA 3HWRA 3ENZA 4JBYA 2X19A 5SZIA 3CF6R 2H1VA 2OUIA 5EXTA 2P9FA 2DUMA 4MV9A 2WWTA 2V3VA 3V4SA 3FVRA 2GJ8A 2RK4A 3FF1A 5BQPA 1JHZA 1J5EB 1KQPA 1EQUA 1YA8A 2VJNA 4FFRA 4GO1A 5FI0B 2VPWA 4BB6A 1OFUX 4E5SA 4EW1A 1B8VA 1E2FA 2DULA 1Z4PX 3FE2A 4QO8A 4RY2A 3W8EA 1D6NA 4MRAA 1EUYA 3I32A 2B7CA 2CFOA 2ZVDA 1GAQA 3VYVA 3BMOB 3PPWA 4S05A 1XPOA 3UENA 2BEVB 2FLWA 1VPVA 3VPBA 3VC2A 3KLMX 3DE2X 2ANBA 1Z0KA 1YA4A 3LM8A 4GPAA 4HX2A 3SIXA 1CV2A 2B4TO 4Y2JA 1L7DA 1SGWA 3BL6A 3UXMA 3OCXA 4XQGA 2JHGA 3VH1A 3T5CA 4QU0A 1CSEE 2GLUA 3MB8A 3OA0A 3V4LA 2Q1XA 1U9JA 1OWNA 3S6JA 1XD2A 4B73A 1J2TA 2XB6A 1GP2A 5T6MA 3D5QA 2AW3A 3TAHA 1GVHA 2ZYHA 3BHNA 2QRGA 3IIMA 1KETA 2A1UA 1SOAA 2VJOA 4IVRA 5B7PA 4H7EA 3ST7A 4K86A 1ULAA 1EB9A 3H8WA 3Q7QA 4V38A 5CBPB 4DJDC 3D3QA 2WP8J 3LQQA 221PA 2GWRA 3Q2OA 5AW0A 1PEYA 2Q9BA 4G25A 2OKCA 5H8WA 2OBNA 4BO6A 1T5OA 4D4KA 2OHXA 1F4PA 2OHHA 2QQEA 5C46F 1XZMA 1RD4A 1VSQA 1QHEA 1VG9B 1SU6A 3OU2A 1E20A 3COZA 1QMGA 3R6LA 1FB5A 2XTMA 3OQ6A 1NATA 2J0VA 1HMYA 2FPIA 4MR9A 3C1AA 3OC0A 1VCMA 2DY1A 2VTVA 3O8OB 4K9LA 1EH5A 3H2ZA 5IM5A 3TK1A 3UN1A 2QN8A 3SDSA 4A91A 4DYVA 2JFXA 1P4SA 1WZNA 4ZV7A 1YAHA 3C8MA 4A6XA 4NJMA 3KZOA 4KGDA 1VGVA 2R6CA 5DNCA 1H1DA 4NQZA 5DYNA 3X1ZA 3ANMA 1I3KA 2HD4A 1W59A 3KJQA 1WUJS 4MWDA 1ZN2A 3WGLA 1GTZA 4TWRA 1USUA 4TTRA 1Y7PA 4OD0A 2P30A 4ZDKA 3OZGA 1JYSA 3IDQA 5AK0A 2G3YA 3WL3A 3R4VA 2EKZA 4CBVA 1G20B 4B5KA 4D80A 1BVRA 4Y2YA 3EH2A 3I0MA 5DBEX 1GDHA 3NM6B 3QLUA 5C8ZA 4WERA 5DPMA 4DVJA 3R23A 3GDHA 4FHDA 5ECGC 3LFTA 2YS7A 5B3JA 3AHEA 3WKAA 2HXSA 4CI9A 2WM8A 1MD9A 1E7WA 1WD7A 4OAOA 1MQ9A 4B43A 4IEIA 2VHXA 3OE4A 2HK6A 4ZI7F 2H1CA 3EGOA 1ZM9A 1CDEA 3IQZA 4A5SA 2C0PA 1KDYA 4G8CA 4CLRA 2C2YA 4RMGA 3DGFC 1CRQA 1KPIA 1TT7A 2ONZA 3B2EA 4OGGA 3UK1A 4JBXA 5CW2A 3AKDA 1YCFA 3RU7A 5FFMA 3TTSA 5B5SA 3C3BA 1KF0A 2XCQA 4FHEA 1T4BA 1BE0A 3HV0A 4X1KA 3UBTA 4ZQIA 2A6PA 1HDZA 1GYRA 1HFJA 1P31A 2G5PA 4F4CA 4QXOA 3RHTA 3R77A 3OQOA 3D8BA 2X76A 1CUHA 3ADPA 2PIAA 3IEVA 5BWMA 4X65B 2X7XA 3E9DA 3GGOA 2EBHX 4LV5B 2BCJQ 1GPDG 4PO1A 2B21A 1JB1A 1QVAA 2VNIA 1YL5A 1U8ZA 3OTHA 4YRAA 1A88A 4F38A 5DASA 3T06B 1VOTA 1UBJS 4F96A 4FE4A 4RVDA 5KWSA 1GGFA 2WK1A 1ZDMA 3GP8A 5JSQA 4ZIRA 1VA4A 3H42B 3K53A 3WGHA 2I6GA 1Q16A 1KOLA 4OHKA 3FTCA 1L8LA 3FLMA 3BDAA 1G8JA 3BK7A 3KU1A 1JSRA 1PFGA 5AKYA 3KJXA 2PANA 3AIIA 1SU7A 1SXPA 3JARA 3FXAA 4JKIA 3ZV5A 3MLAA 2IS4A 2RH9B 3LT5A 4FGUA 3PU6A 4Y1FA 4QATA 4C0AC 4RTJA 2V7PA 2ZI9A 4G0XA 4LF9B 4YPVA 3L02A 3A1SA 4PZCA 1G6Q1 1YC5A 2AMLA 1IWOA 2W0MA 2XUJA 3GLTA 1OPXA 1O97C 2XOEA 1Q1NA 3NHKA 1CY0A 3B36A 2ONCA 4LBVA 1E9AA 2VRWA 3WO1A 4C0KA 2O2IA 4G1EB 1BGXT 2O3RA 3DEIA 3DD1A 4OKNA 3ZV4A 1LBHA 4G4SO 2ZSUA 3U0BA 5HJ5A 4ZT5A 1H6CA 4O4LF 3WYFA 2OZLB 1QHGA 5JRJA 2JH9A 3L0BA 3PEVA 4LI0A 1O9HA 5FBRB 1JJFA 4B35A 1F6DA 2JFGA 2CLEB 2JF0A 3QVMA 4PZDA 4RBNA 3TJMA 4CQMA 4GX0A 2BUCA 3CGWA 2AG0A 5I3ZA 2P69A 4JR0A 3RO7A 3RRXA 2PAFA 3S44A 3GAFA 4MKFA 1UM9A 3MS7A 4XPZA 3M89A 1A8IA 1V41E 1PTJA 3JAKA 1KVQA 2XPCA 3HKBB 5EMJA 4KBYA 5J47A 2PKQP 1VYUA 2X0IA 3KALA 3IFSA 1W5SA 3NJ8A 3P27A 2WUWE 4CTMA 1XDSA 4UHFA 4MV7A 2CW5A 4I55B 1QTQA 1HEUA 3GLSA 4E0BA 4CQJA 3PXCX 2IU6A 2WUFA 4BFWA 4ES6A 2NT4A 1ZD8A 2JCYA 5LQMA 3SX4A 3HR7A 3UPUA 2W2LA 3L8EA 4EPRA 4R0MA 1GM5A 1DKUA 4K28A 2A8YA 1DS6A 1FVFA 1UADA 1W75A 2R4UA 3AYZB 1R0CA 3DBRB 3SF8B 5CLGA 2FW7A 1F8YA 4EF5A 5KOIA 2P0AA 3BD6A 1KQGA 4XRRA 4HB3A 5L7YA 3M1AA 3QWBA 1M6YA 1A97A 3DWGA 3PD1A 3K8YA 3IHTA 1A96A 2EW1A 3FNIA 3KPYA 1I4DD 3LT2A 1E3EA 2P8JA 2YJNA 4QOHA 1EP3B 3VNQA 4GBMA 2VXBA 4CMKA 1VMIA 3V7NA 4A6DA 3FBGA 1IU9A 2GHIA 4OQQA 3WLKX 3EPPA 1YZ3A 1GL9B 1FP7A 2VDJA 4DCNA 5JWOA 2IDJA 3VR4A 2C9BA 2IFTA 1N0HA 4IHJB 4HYTA 2JA1A 1EHCA 4LIPD 1QHFA 3K7EA 4QICA 1ZK2A 2UZ1A 1T24A 1ZBDA 4RHYA 5J1TB 1ZVJA 1VECA 5EP2A 1E7MA 1LSJA 1CEYA 1C3OA 2ODQA 3E4DA 4XQ0A 3C3EA 2W7TA 4PYJA 4ZQEA 5A06A 2FXIA 2G88A 4H7IA 5B3AA 3SICE 1DX4A 2YOFA 2Q5QA 2Q6KA 1QK4A 3OLQA 3AZQA 1TI7A 1HDGO 4LFAB 4MINA 4PBTA 2WYWA 3DOFA 1QH9A 5AXAA 1WXXA 1YS6A 3U37A 4EEXA 3JR3A 4XLZA 2ZE8A 1I2ZA 2BD0A 3ODGA 4J7CA 4C6SA 4ROTA 4DVGA 3TW8B 5HKLA 1P2TA 2ZDHA 4U7JA 3R7FA 5AXDA 2HMTA 3CVWA 2O3TA 1MPTA 3JYNA 3B78A 1EHYA 4ARZB 1QDEA 3INGA 3ZI4A 3DDHA 5CJJA 1P2VA 3UWSA 1XXLA 2B5VA 3UQYS 2V7EA 3A6GA 4BJ5A 4ZTBA 3A9TA 3SFTA 3L82B 2NU9B 1W44A 4C2UA 1YB6A 4TKVA 2JFPA 1ZQ9A 2H7CA 3F98A 4PNPA 3DKIA 4JX9A 2C4WA 2W6MA 3W8FA 1A5TA 2QUIA 5G0UA 1YRQA 2ZZMA 3IBTA 5EAIA 1M8FA 4G0NA 4Q0MA 1AUVA 1HFEL 3CX3A 3BX1A 3QNMA 1HRKA 2PZEA 3FPFA 4CN8A 5CG2A 3W5DA 1NF8A 5CEJA 3FFWA 4KXFB 4KGVA 3U44A 1Z5OA 3IE1A 1A8SA 4PQEA 4XPIA 5FEMA 4BIIA 1Q7RA 3TW4A 2O54A 5TJHA 5F1YA 1PYOA 5EFOA 1WXDA 1JKIA 5KVVA 4TWBA 5JCXA 2ZIUB 4IFBA 4ZOEA 3CLRD 3URMA 5K01A 1Q44A 1HDYA 2I66A 4NVRA 4KO2S 3GYBA 3SPXA 2CNWD 3ZK9A 5JZMA 2RGNC 1ZRSA 3HQ4O 4OB7A 3L0SA 5AJWA 3RC2A 3VPGA 1A2BA 3A1NA 5B6IA 1ZK0A 1KJJA 3GOHA 3DDWA 1I32A 1MO6A 1ODIA 4W8GA 3OLVA 4ZVSA 2HXGA 1J5XA 4Z9BA 3TOZA 4BQNA 2PZJA 1PK8A 4M38A 3HZZA 4TV9F 1HG0A 3EVTA 5LVAA 1T4DA 1X1TA 1MBZA 2F4NA 1UP4A 2WHXA 2ZSEA 3Q7EA 1MG5A 1Y5RA 1NBOA 1UBOS 2IUFA 3PC7A 5J4LA 3KJHA 3QMPA 3CG0A 5ADVA 2VJCA 5FPHA 4YUYA 3BXOA 3COVA 3EXIB 4HDRA 1OASA 5CURA 4G2TA 5D86A 5CEFA 4YMLA 1J99A 4YBZA 3RT7A 4WBNF 1B16A 2FWMX 5KQRA 1O96B 5M3BA 2AVNA 4PAOA 1VJGA 5E2IA 1JG2A 2IVZA 4QUDA 1J0XO 3GD7A 1RYYA 1PR4A 4F60A 4DPKA 2DKFA 2DSNA 4B85A 1G2QA 1TC2A 2WJ4A 5SY9A 1C1DB 1VPEA 1H4SA 1I2BA 2FA9A 4L0QA 4O2RA 4EG4A 2PV0A 2JGRA 3B6KA 3MRTA 1Y5NA 4RE5A 3CPHA 4ZWNA 3S3TA 2YVAA 2OBMA 1UFQA 1ZI8A 2PFSA 4IDFA 4DMLA 1NXVA 4ZCQA 4YUWA 2ZYSA 3ZYZA 2A59A 5EE9A 1PUXA 3IBGA 4P53A 2PQ6A 4BRWA 4O3MA 2VK4A 4BMSA 1JU9A 3CH6A 1MB2A 3AVOA 1OV6A 3NZEA 2GZAA 2X0RA 1K3TA 3QPWA 1M6WA 3QBVA 4XIIA 4MI9A 1HL7A 3PHLA 4KMOA 1GTMA 1RJFA 3OZWA 3U56A 1OIXA 1TL7C 4PX3A 3DMHA 1ZFNA 4J75A 1V8FA 5DNDA 4Z1MD 2QPOA 3GR6A 2VJBA 2WJYA 1PQ4A 1FCJA 4J43A 5HIKA 1ZSNA 4C2AA 4GX1A 2WOJA 4IOJA 3NG1A 2JJQA 1YNSA 1N92A 2Z56A 2YN4A 3WBFA 4WXHA 2WWGA 2R6FA 2A9JA 2Z83A 2ZSKA 1B26A 2XUZA 3AJRA 4M36A 4PGMA 5FR1A 3VO2A 2MSEB 2HJ9A 2JGIA 2KB0A 3LHSA 5E3JA 1YI0A 5ALSA 4CKBB 3RSQA 3G5MA 1C9MA 4G37A 3K70B 1ZH6A 3K1ZA 3NM4A 4YLYA 4RLSA 1BH2A 3GNQA 4MV0A 4P7FA 2Z2JA 3JQ6A 1RLUA 2OM2A 3G6WA 2FSIA 2A30A 2YN0A 1U2SA 2R1UA 3FPCA 4NFHA 1GL6A 1RXYA 1GARA 2BFCA 3QPBA 4GEKA 1SBIA 3CRZA 2YWXA 4M86A 1PWYE 1FW8A 1NY6A 2QYOA 4X7RA 4ZQBA 5GGYA 4F2HA 4E46A 1MP0A 1JR3D 1KSHA 3X1JA 3ZWAA 2JAOA 2C2BA 4ALKA 4AW9A 5KYYA 1YDMA 5B53A 1NNEA 2D7DA 3JS5A 1TVMA 4PC1A 5LXTB 4Q9JA 2R60A 5HA5A 3T54A 4MVWA 4C2BA 1UPBA 2GD0A 4QEKA 4WY8A 4HNTA 4K9KA 3FCXA 3QUTA 2CYAA 3GDGA 3L5KA 1W34A 4RVNA 3RBZA 1YHZA 3UXYA 1KMIY 4WA7A 1PDVA 2B1RA 4D41A 5HS6A 2VYQA 4B6EA 5F4BA 1P77A 3OJ0A 4IVNA 1EFAA 1KI8A 1VDZA 1GU0A 1JQDA 1IAQA 3HKCA 3GFPA 4IIUA 3TAUA 3TRFA 3ZW7A 1L5QA 2D0OB 4RCVA 4C4TA 5KX5F 2AOWA 1EX1A 1NONA 4FPXA 1DB3A 4OHYA 1NNUA 2TSYB 4ACBA 5A7GA 4BWYA 4ZVNA 4JI1B 2AFIE 4PLZA 3G2PA 1LQ2A 3IXQA 1WKCA 5BYJA 5ITWA 1W1WA 1I9CA 1WCXA 3HDJA 3HHPA 2PSDA 1KMHB 2GOYA 3AY7A 4N7BA 1CVRA 3R6WA 3N2EA 4HDMB 3SJBA 4CT5A 2ZIGA 1JG7A 3U9TA 2X8BA 2RK3A 4JEMA 3RUHA 4IF6A 4JVSB 4DY4A 1SIWA 1OGIA 1PFWA 3LCVB 3FHTA 2IYUA 4WESB 5L45A 2QW8A 3KQMA 3U4QA 4NE9A 2Y1EA 2EDAA 3P2YA 2FZLA 3RVRA 2AYZA 3WRYC 4E15A 4D4HA 2F9LA 2HCTA 4FONA 1SQ6A 2PXAA 1RW4A 1GSHA 3G8CA 5LZ8A 4DTCA 4F97A 1MJHA 1X6VA 1G7CA 3CSUA 3D0KA 5BT8A 2BGWA 3O47A 2Y4NA 1NRJB 3RYHB 4YRFA 2HSEA 5E0OA 1Y6ZA 2PSFA 4WKNA 1T35A 3F9CA 2QSJA 3N0WA 4IXMA 5ALMA 4OI1A 3QI7A 2GBPA 1MVNA 2HWXA 4OAPA 4BNVA 2WF5A 3M6MD 2FTKE 2V8OA 3O7MA 3SLGA 3SYKA 4J2TA 1D4ZA 2RCNA 5E1DA 4AWBA 3RIYA 4Z4QA 2HU7A 2PBZA 2WQZA 1QFMA 3MD9A 4K6CA 2D00A 5EJ8A 3I2HA 3MGAA 3QELB 4TTJA 3GGJA 5D6NA 5H59A 4AP9A 4BCCA 4B83A 3X1WA 3ICEA 3DM5A 1C7JA 5JYDA 4QGHA 1AO0A 2CZCA 3GROA 3TNYA 4K9DA 1J20A 1O6ZA 3L4EA 1IBKB 1DUSA 5LIPA 5CA1A 1SEPA 4BLSA 1ZJWA 2FMIA 5K8TA 4CODB 4JELA 1KIAA 1I6KA 3Q4GA 4K8RB 2EQAA 1ISFA 2ZTSA 2XNJA 3IIIA 5MFPA 1F8FA 1NYLA 4X1IB 4IOMA 4BYMA 1FDWA 3QKSA 1UAGA 5LYJB 4UM9D 1KZ9A 3EJ6A 1N5LA 2H29A 4LGYA 4JZYA 1NKTA 2VDWB 4GLOA 4M1WA 3TDMA 5KSOA 3W3AH 4V03A 2WC1A 2P9JA 1YMQA 1V2GA 3VDRA 4D9BA 3MEQA 2IWRA 5AIBA 1B41A 4M49A 1OXMA 4C4SA 1Y3HA 3DOIA 1W0JD 3ZZTA 2JS7A 5A7FA 5B7NA 1OE0A 1E4VA 3DDUA 1XRRA 2JJ1A 1OT3A 3KPWA 3OLZA 2C54A 2DYKA 4U3JB 4NF2A 5D84A 3QJYA 4YAFA 5EWMB 2DBVO 5FFNA 4YDSA 2UVPA 4F5ZA 4C0QC 1RQNA 3RS4A 1Y7HA 4D8YA 3PGMA 3TOXA 1E2PA 1H6BA 2OBYA 4M37A 5HILA 2JD1A 1Q7GA 2XB4A 4NCHA 1RFLA 3GFVA 3FUTA 3N6VA 3PQ5A 5GADl 1GTRA 5HGXA 1HSZA 3SQLA 4C22A 2AOTA 2X9QA 3T4UA 1SQSA 2IE0A 1M2OA 3QBJA 3MSCA 3IB6A 1XL0A 3OX4A 3ZDBA 2JKZA 4IZHA 5JZVA 1ZLXA 3DMPA 1UIMA 2JK1A 1QIMA 2EATA 1ZH0A 2V58A 2AOUA 3RDPA 4YHHB 3R0IA 2K2WA 1U1CA 2C94A 3IRVA 1IPFA 2WA2A 3Q0IA 1ZSVA 3HJRA 2GCIA 5KQGA 1DJNA 1X1BA 4MV4A 5ICFA 2BHTA 3R3VA 3CEJA 2XTAA 4HQFA 1JQLB 2AOVA 2GWHA 2D5CA 1YR8A 2AQKA 2DFPA 1FMJA 2DZDA 3RYCB 2D5IA 1NURA 3CX4A 2IV7A 5IYZA 1HDIA 2LNDA 4UM9B 4G4GA 4MA0A 1TTTA 2P5TB 3EXHA 4PSDA 2DERA 2ZCVA 3T4PA 2O3SA 1KKMA 1L2TA 4LMRA 1ZR4A 2O2DA 1OF1A 3H5OA 4G0OA 1UZNA 2DBYA 2OMKA 1IAVA 4QT0A 4TVSA 2CV2A 2HT1A 2MJLA 4EYQA 2CT8A 2EERA 1ZCZA 2FR8C 2R1TB 3L1KA 4GMGA 4JYBA 5B3KA 5KYUB 2RAPA 2IEGA 2C88A 4I46A 4O5AA 4ZOLA 4D6XA 1E60A 5ALGA 3GEGA 3QEAZ 2LDXA 3GA5A 3GV0A 4RACA 5EHZA 2G70A 1PWHA 3Q3VA 4OB8A 2OC4A 3II6X 4EECA 1O3YA 2AQ8A 4NULA 3FBTA 5IULC 1Q0SA 2RGCA 4FFNA 4YO8A 3ZZMA 1SVLA 5HIIA 4UBKA 1KTVA 1E3TA 3A1FA 3K4QA 3GT3A 1FDSA 4PGAA 1QIGA 3TBKA 3ZGZA 2XIQA 3K09A 2ESRA 2V97A 3FFAA 2QZJA 4LHEA 2GUWA 2QTLA 1SUAA 1UMBB 2FN7A 4XD2A 2PCJA 3ISJA 3B70A 4PZ9A 4D9IA 3QBTA 1LDNA 4ZVUA 2OVFA 3KSAC 1U0FA 2GCOB 4ZI2A 5IVHA 3MK31 4OFWA 3PPYA 4U7GA 5A4FS 5BYAA 1ODJA 3VR0A 4YXWA 3E27A 3H11A 2B7BA 4N3BA 1MVOA 1W29A 1WQ3A 3EXFA 3ABQB 3H0CA 1IJBA 4KFSA 4K6HA 4Y2HA 2AZMA 3CLUC 1UODA 2VDUE 1U2DA 3E61A 3ZH2A 2Y6VA 1Z5PA 1H0HA 1ZO8A 1TQ4A 2XDQA 1NMZA 4RPLA 4BNYA 4ENVA 3BFVA 2SHKA 3D2BA 1CHDA 1E18A 2HDNB 4FNOA 4HTAA 3VAYA 3QHQA 3L43A 2IYLD 4U7FA 4BQOA 1A72A 3B2QA 4P1ZA 5F2EA 3V1YA 4E1BA 4EHJA 5JY1A 3QI2A 4PZUA 5E9JA 4OHUA