1HNNA

Crystal structure of human pnmt complexed with sk&f 29661 and adohcy(sah)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
261
structure length
261
Chain Sequence
b'AVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHENYLETHANOLAMINE N-METHYLTRANSFERASE
publication title Getting the adrenaline going: crystal structure of the adrenaline-synthesizing enzyme PNMT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2000-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1hnnA00
3O7WA 4L7VA 1YF3A 3NDIA 1SVUA 4P7JA 4X63A 3OU6A 2N47A 5C9ZA 4DM3A 3OZSA 5GP1A 5E9WA 2VDVE 3TOSA 3PLAE 4QDJA 3TFWA 2O06A 3HA7A 4RTSA 1NKVA 3TM4A 2GS9A 2KW5A 3R3HA 3LCCA 3EMBA 3UJAA 4C04A 1WY7A 3HCCA 2G72A 3HCFA 4CTJA 1JG4A 1I9GA 3UJ8A 1IY9A 2Q41A 3M6UA 4E30A 2AR0A 1O9HA 4Y30A 1KYZA 1U2ZA 3HVKA 3BT7A 2DULA 5EIFA 2PVCA 2BM9A 3HCDA 3UWPA 1SKMA 2FHPA 2IIPA 3QOWA 4MWZA 2IBTA 2GA9A 3M70A 4PYOA 3AXTA 1G8AA 4JXJA 3ER8A 2AOXA 4QQKA 4RTLA 1AV6A 3REOA 1M6YA 5DT2A 4AZVA 1FP1D 3GRVA 5DSXA 2YXEA 3TKYA 3EGVA 1G6Q1 1HNNA 3IEIA 1AF7A 4C4AA 3KR1A 3BUSA 2FYTA 2A14A 2PX4A 3KPVA 1VLMA 1XJ5A 2IH5A 3KPUA 5DM4A 2VZ9A 2IPXA 3M33A 3T7SA 2VS1A 5E9QA 1PJZA 3BWCA 1JG1A 3X0DA 3CVOA 4QPPA 3P2EA 5G02A 4PNEA 2CKDA 4FT2A 2YX1A 3DR5A 4GOOD 1FPQA 2AOWA 4M7RA 5H02A 1R18A 1NW7A 2HR1A 4PCAA 4KDCA 4RTRA 4U7TB 2O0LA 4OA5A 4A6DA 5GIOE 3EVFA 5DTQA 1VP9A 5FADA 1L1EA 4FR0A 2PXAA 1VQ1A 1VL5A 5LQNA 3NVKI 3I5UA 4R6XA 3NJRA 4MQ4A 5LQUA 2HNKA 4K6MA 4YMHA 5DM2A 5LR6A 1UFKA 4F86A 4CXMA 3HCAA 4GF5A 2P40A 3UJDA 3P9NA 4QDKA 5CVJA 3A26A 3FYCA 1RJEA 4P7KA 4E2YA 5EZQA 4RV9A 3B5IA 3G8AA 2HWKA 4R6WA 1XDUA 3LCUA 2NXEA 3E23A 1XVAA 3ELWA 3LDUA 3EMDA 1AQIA 5CVVA 3BGDA 4B17A 5JUWA 2QYOA 2ZULA 3P9KA 3HCEA 5K01A 5EIWA 3E8SA 2IDKA 4C06A 9MHTA 1L9KA 1MHTA 1YUBA 2HMYB 1KPHA 2P41A 2Z6UA 4E2WA 5EGSA 4UOEA 5ICGA 1QANA 3KQSA 2OXTA 3ELUA 5K0EA 1INLA 1XTPA 4U7PB 2ZVJA 3LECA 4KW7A 4DCMA 5KQSA 2AVNA 3FPJA 3TM5A 1M6EX 1WXXA 3MQ2A 3OE5A 5EHIA 2IGTA 3E05A 4EKIA 4EVIA 2YQZA 2ZW9A 4PYKA 2P8JA 4GQBA 3P8ZA 5DPMA 2NYUA 4ATNA 2ZCJA 5DSTA 5DTMA 2OBFA 2QE6A 3TMAA 4NECA 5KVAA 5KYGA 1FJXA 1SQFA 3O4FA 5DM0A 2PY6A 2NNWB 1O54A 2ZBRA 1BHJA 3HVJA 3I64A 4RVFA 5DRTA 3RIEA 4POOA 1FBNA 3KPJA 4MTLA 5DX1A 2ZZNA 1EAMA 2ZIFA 2GH1A 5E8RA 4BP1A 1X1DA 3HVHA 2NP6A 4E2ZA 4AZTA 3GRUA 2E5WA 3EVZA 2C7QA 1DCTA 2V7EA 4RTNA 5FQNA 5DM1A 2Z6AA 3EVDA 3HNRA 3ORHA 3DXXA 3T7TA 3PFHA 3EVAA 1XXLA 1N7JA 4OBXA 2O05A 4M36A 4X60A 3GIWA 3S68A 2YXDA 5DWQA 5HIIA 1JTFA 1NBHA 2ONZA 4BLVA 2PX2A 2B3TA 3UA4A 5LSAA 1N2XA 1RJGA 4KDRA 5T6BA 1JR4A 1Z3CA 2GB4A 4FS8A 3A7EA 2UYHA 3MB5A 2R3SA 1G8SA 5FUBA 2XVAA 2H11A 3EVCA 4ZTBA 3WSTA 5IKMA 2PX5A 5EOVA 1YZ3A 1YFJA 5K0NA 2QRVB 1JQDA 3FPGA 3CCFA 4XCXA 2PKWA 2NXNA 3I53A 3Q87B 2AS0A 1QZZA 4PINA 2AN4A 5CCBA 3HTXA 2LD4A 4M38A 4HRAA 3VC2A 2WA1A 4OX9Y 3HA3A 2OY0A 4CWAA 2P35A 4HTFB 2Y1WA 1ZKDA 4R8SA 3GU3A 1EQAA 5E9JA 1NBIA 3EEOA 3BXOA 3DXYA 3P9CA 3IYLW 4RWZA 2PWPA 2FK8A 4PYJA 5EEGA 5EEHA 4V0QA 1L3CA 10MHA 3EEYA 5GINE 8MHTA 1P1CA 5FWDA 3SM3A 5FULA 1FP2A 2ZIEA 3VYWA 5GIPE 4WXHA 4O29A 5E2BA 3LPMA 1SQGA 5DXAA 7MHTA 4QPNA 3A4TA 1NW8A 4ER6A 1R8XA 4LWOA 1QAQA 3MGGA 5CVDA 4RX1A 2VP3A 3G8BA 2OB1A 3PX2A 2QRVA 3HP7A 5T64A 2PXCA 2PGXA 1HMYA 2HTEA 2P1DA 1IM8A 3LGAA 4ER0A 3THRA 3BWYA 3FUTA 2ZFUA 3R24A 2ZSUA 4AZSA 2XBMA 1G60A 1BKYA 3RODA 5K09A 3CGGA 2AOTB 1RI4A 2BR3A 2ZIGA 3DLCA 3BKXA 4HTFA 5EG5A 1NE2A 3KU1A 5E1BA 4H0NA 4IV8A 4QQNA 4RTJA 1KPIA 1VBFA 3IV6A 1I4WA 3KQQA 5GOZA 1JTEA 2AZTA 1KYWA 3SSOA 2YVLA 3UJCA 1PRYA 5E1OA 4RTQA 3GJYA 3MAGA 1KXZA 2FCAA 2P3OA 5EZSA 4DCGA 1WXWA 1V39A 2JJQA 2FRXA 4P58A 3SGLA 2PBFA 4BP3A 1Q0TA 3MHTA 5E2AA 2OO3A 3M6XA 3MCZA 4M37A 3KQOA 5EMJA 1R00A 5K03A 3DUWA 1SUSA 2JHCA 4OQEA 4KWCA 2PJDA 3L8DA 2AOUB 5K0GA 1JQ3A 2IFTA 3ME5A 4RVHA 2BR4A 3SXJA 3DXZA 1RJFA 4OA8A 3LDGA 1ZHFA 1KR5A 4GOLD 3ANXA 5HIJA 1L3IA 1QYRA 4PWYA 2CMHA 3LBYA 2AOVA 3KQTA 3DP7A 3LHDA 3QV2A 5CVUA 3UFBA 3LCVB 5DRYA 3LSTA 2B9EA 3AWIA 3OU7A 4PYNA 5DTRA 3SSNA 1M0EA 1P1BA 5C1IA 3T7RA 2AOTA 4E2XA 5GM1A 4YUYA 3C3YA 3SMQA 2BH2A 2B2CA 4QVKA 2CL5A 2ZTHA 5EQJB 1EJ6A 5MHTA 5EMMA 3KQYA 4C08A 3AY0A 4YV1A 2XYRA 4IWNA 4FP9A 1X1CA 1H1DA 1NT2A 1UIRA 4ER5A 3G88A 5EC8A 3R9XB 4YUVA 3G2MA 2I62A 2FPOA 4MIKA 3EVBA 4DF3A 3PB3A 3D2LA 2AOUA 5EKXA 3KPWA 4PYLA 5IH3A 3A7DA 2XYVA 4YV2A 4PYQA 3NW9A 3BWBA 4YUWA 3EVGA 2YTZA 3EPPA 3PT9A 3FPEA 3O31A 2CMGA 3GO4A 5CIYA 4RTMA 4BLUA 4FSDA 1R74A 2YXLA 1EJ0A 2EJTA 4E33A 2Z6QA 3FRHA 2UYQA 4GOMD 4YMGA 4EK9A 3CBGA 2PT9A 2PT6A 3NDJA 2DPMA 3LX6A 5BXYA 1AQJA 2ZBQA 3K6RA 3SR4A 2EG5A 2EFJA 5BW5A 2C7OA 5U4XA 3ERCA 3KR2A 3IHTA 4LECA 3FUWA 2WA2A 3LL7A 5FTWA 3GRYA 3GNLA 3M6VA 5HILA 1YB2A 3BKWA 2ZZKA 4C05A 2I9KA 2R6ZA 5DX0A 3LKZA 3UJ9A 3B89A 1OR8A 4LWPA 3JWHA 1WG8A 3KQPA 5K0LA 3FRIA 3SX0A 2OZVA 3FTDA 1D2HA 3G2QA 1ZQ9A 5HOQA 3AJDA 5CM2Z 5HEKA 2GAFA 4GBED 4DMGA 1YFLA 1VPTA 4PYMA 3DOUA 5K8VA 1P91A 3FPFA 2EJUA 3G5TA 2GLUA 3BZBA 2UZ4A 4C07A 5DXJA 4RTOA 1VP3A 1WZNA 4IV0A 4EKGA 3HCBA 4PIMA 3B3JA 1IXKA 4QVGA 4CKBA 4PONA 3V8VA 2O07A 1KPGA 1Q0SA 3MTEA 1F38A 3GRZA 5P8WA 1R8YA 1BOOA 3OZRA 2JHPA 1TPYA 3F4KA 3MERA 4YV0A 4X1OA 1EIZA 2QM3A 3LBFA 2ESRA 2GPYA 1SUIA 1NV8A 3B3FA 3UJ7A 2IBSA 2G71A 2ONYA 1JQEA 4X61A 1XCLA 5GM2A 5EPEA 1UWVA 4PYIA 1N7IA 5EHGA 3M6WA 2H00A 5FA8A 3THSA 3CJTA 1EG2A 4CKEA 4RTKA 1JG2A 3EGEA 2C7PA 5DLYA 5ERGB 2EX4A 3OPNA 2PLWA 5KS2A 1T43A 3DTNA 3KQMA 1NW5A 3FTEA 4KRGA 4FSXA 4DZRA 4XUCA 2ERCA 3EVEA 3OFJA 5BP7A 4RTPA 4MHTA 1RI2A 3C6MA 2G8NA 3TLJA 4YUXA 2P3QA 2P7IA 5C0OE 3KQWA 5F2KA 4QTUB 3MTIA 4WVLA 5FA5A 3V97A 3GGDA 1TW3A 1ORIA 2BZGA 5LQRA 3PVCA 1TW2A 1X19A 5K0FA 3I9FA 4P7GA 2B25A 3CKKA 2C7RA 3B7PA 5ICCA 5M5BA 4HGZA 2UYCA 2OYRA 3PX3A 4ISCA 3I58A 3MCTA 4IKPA 4RVDA 2PXXA 3TR6A 1P39A 5LQJA 4A6EA 4CKCA 4FT4A 1RI3A 3R6TA 2IH4A 3NVMB 3UZUA 1NW3A 2B78A 1ZGAA 5K0BA 4GC5A 4OQDA 4DKJA 1X1AA 3DULA 3HEMA 5F2NA 1JSZA 4BLWA 4RVGA 4BY9E 2O57A 5FCDA 3C0KA 3RW9A 1XDZA 5E8JA 5EVJA 2G1PA 3HM2A 2XVMA 3KQVA 3TKAA 5LQKA 3GWZA 2NXCA 2JH8A 2VDWA 5E1MA 3GCZA 3BWMA 3T0IA 3VSEA 1NV9A 3NTVA 3NWEA 3GRRA 2CWWA 3JWJA 4Y2HA 5EMKA 5HZMA 1JSXA 2F8LA 4PGGA 1ZG3A 3OCJA 4DQ0A 3P9IA 3LDFA 3TRKA 4AX8A 5K0JA 4HC4A 4HG2A 2OKCA 2ZZMA 1XCJA 2V74B 3B3GA 5F2OA 3TQSA 4AUKA 4FZVA 4EMSA 5HIMA 2IH2A 4F84A 3SVZA 3OFKA 1RI1A 3GXOA 3KR9A 1XDSA 3FPHA 4PIPA 3KPYA 3DH0A 1SG9A 2G70A 4HSGA 1VE3A 3H2BA 3NMUF 1MJFA 3P71T 2NP7A 2JH9A 5K0CA 4RYLA 1G55A 1BC5A 2IP2A 2VDUE 2HV9A 2P7HA 3BGIA 3JWGA 3KHKA 2YUIA 3OU2A 4GUAA 3UA3A 5LQCA 4YUZA 4KIGA 4KIFA 1RI5A 3VC1A 3K0BA 4E32A 3ELDA 1B42A 2FK7A 5KQRA 1KP9A 2BM8A 5CUQA 4LG1A 4AZWA 4CTKA 2Y1XA 5E1DA 3PTAA 3C6KA 5B1SA 3UBTA 2OPBA 3ELYA 5GWXA 2OB2A 4GC9A 3ER9A 5LQAA 3UJ6A 1F3LA 1RJDA 3DMFA 4R05A 4E31A 4E70A 1O9GA 3AXSA 3TPZA 4Z2YA 2PSSA 3KKZA 5BW4A 5CD1A 3U81A 1G38A 1Y8CA 3GDHA 5CCXA 1ORHA 1QAOA 3QOXA 2AN5A 3FZGA 3FUXA 5HIKA 3P2KA 2I7CA 3FUVA 3ID6C 2BR5A 5DX8A 4GEKA 4ER7A 4EQZA 2ADMA 2AN3A 5FWAA 3Q7EA 1DL5A 2QY6A 2ORED 3A27A 3EGIA 5T67A 5ICEA 1X1BA 1KHHA 5FQOA 2ZBPA 2PX8A 2UYOA 2WK1A 4PGHA 5CVEA 2JG3A 3LKDA 1YZHA 3G2PA 1D2GA 5ICFA 3G7UA 3G2OA 3P97A 3P2IA 4R8RA 3CJQA 3OZTA 3E7PA 3PFGA 2AVDA 1VIDA 2PWYA 4HH4A 5D1NA 3DMHA 4HGYA 4XUEA 5HFJA 1DUSA 3CC8A 3NWBA 4XUDA 3FTFA 2XYQA 3A25A 4V0RA 2ZWVA 4PCLA 4OBWA 3FUUA 3CJRA 2NXJA 5FHRA 2H1RA 3KR0A 2YR0A 3SSMA 4X41A 2ZLBA 3DLIA 4G56A 1D2CA 3HVIA 5JR3A 3M4XA 3UJBA 3G5LA 2ZWAA 1L3BA 3FTCA 5K05A 3C3PA 4C03A 1JG3A 3R0QA 2K4MA 3HA5A 4P7FA 4KVZA 3OE4A 1NW6A 1KIAA 5FHQA 1I1NA 2IDJA 5EMLA 4ER3A 2PV0A 1ZGJA 4GOND 4RSRA 2JHAA 5D1HA 3G89A 2I6GA 4DA4A 4F85A 1QAMA 2P3LA 3DMGA 4FGZA 3JWIA 5EKUA 1R6AA 3FYDA 3PS9A 4QTTB 3BGVA 1WS6A
chains in the Genus database with same CATH superfamily
2CZGA 4MO2A 1GUZA 1P2BA 1SCAA 3B1JA 1DQSA 2PXHA 3SKXA 5JNSA 1JXMA 3FOEC 1FCJA 1KFEB 2NZXA 1GQQA 3RVDA 2GS9A 5IC5A 1CUWA 2PAFA 2DR2A 4C04A 1Y9AA 3K3PA 4PHGA 1K3UB 1SCIA 3SEQA 4CTJA 4ASUD 1NXSA 2HF9A 3ZKAA 1PGQA 3R8XA 4RD3A 2ZSDA 5L3VA 1ES9A 3BT7A 1R8QA 1ZXBA 3AHCA 1OKKA 1V1MB 2EWMA 4QGSA 2XOKA 4JT9A 2F1KA 2VDPB 4KFTA 5C5EA 5IXSA 1EK6A 4EHIA 2RGYA 4JU8A 3NLLA 2VRNA 1E1QD 3ZGNA 2WHPB 3MILA 3A10A 4MPRA 3S2FA 2VH2A 1QV9A 3HBFA 4E7PA 5I5EA 1MA3A 4GE3A 2CCJA 1E0KA 1RXSA 2GZMA 2A5FA 1I3KA 1KEWA 3NIBA 3QVXA 4M0KA 4TM8A 4I5IA 4ID9A 1CR2A 1F2VA 3QE2A 4TL6A 2R6CA 1IY0A 4RTMA 2A14A 2PX4A 2VH5R 5DNWA 3T7KA 1V96A 3W2GA 3IBGA 1CETA 1KJZA 2ENWA 3A4VA 4QQ8A 1BVYF 2R7NA 5LP6A 3EX7C 3RF7A 3ECAA 4HQRA 1KAOA 4MH0R 5C5DA 1BVRA 2CJFA 1E77A 1P6UA 2IT1A 3ONNA 4MPPA 4OJNA 1RT9A 1T6YA 2JZCA 1V6CA 1CVRA 1DBIA 5G0VA 1KMHB 4CEHB 4RS4A 2RGBA 2GRJA 2P65A 3F1LA 4Z0HO 2Q3EA 3B2QA 4H31A 4PCAA 5B57C 3DE7X 1VLQA 1W87A 2WJGA 3JAKB 1DG1G 2YDXA 4DA9A 1ZL2A 4B7XA 1FJHA 1D2AA 3RSHA 4BWVA 1IE3A 3E9QA 1VP9A 2D2IA 4LZAA 5DYYA 3OEHA 4MS1A 1JHAA 1W2WB 1OASA 1T1JA 4PTLA 1YZFA 2J9GA 3M1YA 4Q7LA 2ET6A 1TQ2A 1M8PA 1G4HA 2VR1A 4HNTA 4GSKA 5LD2C 5EMHA 2IZOA 5HG0A 4R98A 3DFKA 3F4BA 5CVJA 1ZK1A 2HSZA 2HX1A 2P2GA 2R96A 4YCMA 5JO0A 3AJ8A 3N2IA 3AFGA 4UHFA 1ISGA 4ILKA 5AK5A 4HDOB 4BC1A 2JEOA 3R23A 3ZIAD 3FBGA 4FHEA 4Q9KA 4MDEA 4OV6B 1E6LA 1LF5A 2EBHX 2IKSA 5IP5A 3FCOA 1GLNA 2QYHA 1QH1A 2HU2A 1ZJ5A 2V7QA 3DFMA 5B3KA 2QKYA 1Z4LA 1CNEA 3GFPA 4L27A 3OPVA 3JD2A 3WWPA 4DCMA 3LLCA 4FYPA 3HWRA 3QF7A 4L7QA 4C4SA 1KZ4A 2WYVA 4LK2A 1WDTA 1VCHA 3KUUA 4MS3A 4TTRA 3UWKA 1SC4A 5KWIA 4AXBA 3J80A 2H2DA 2BP7B 2WUFA 1M75A 4TSFD 4QPZA 1JDVA 3JWPA 4MV6A 4MUMA 1QU2A 1WUYA 4DDVA 4AYTA 2I03A 4C6TA 1SQFA 2UKDA 1O54A 3ZS9A 3BIWA 3EGXB 4LBYA 5CLGA 1GR1A 2PZMA 3OY7A 4QJIA 4WXPA 5DRTA 2WVJA 4NBVA 3ZEAA 4BFUA 2ZVPX 1VYUA 2ZZNA 1T5HX 3K1TA 4B3XA 1WB9A 5IT4A 4DDHA 4DRXB 3NHKA 5DHPA 3DL2A 3DNFA 3QBEA 2C7QA 2XADA 4CDRA 3USZA 1NY5A 2I3BA 1HUQA 2GRUA 1JI3A 2H7YA 3G9XA 3M4NA 1P2FA 1P5HA 2Y2VA 2CXUA 4NYJR 4UM5A 3T94A 3VR6D 4OBXA 3VR5A 4FNGA 1GSHA 4M36A 1ZEJA 4WV3A 4ZEWA 2GPBA 1SNYA 2DPHA 3N76A 1ODSA 3AVWA 1NMEA 1BXGB 3GX1A 2BGMA 3WFIA 2ONZA 4FFDA 3RJ9A 5LP6F 2B3TA 1IOVA 5AUOB 5LSAA 4MV1A 4JJEA 3MB5A 2NOAA 1ZR4A 2FI1A 1P29A 3ZVNA 1ZD4A 3ETLA 3A6GA 3BAFA 3KSBC 1A2OA 1QYVA 2ZRPA 1R0KA 3H9UA 1PUXA 2BFOA 5K4GA 4FNMA 16PKA 4M22A 2ZGVA 5ALNA 5BT9A 2A0YA 2C2ZA 1H5UA 4O2LA 4X6LA 3ROGA 5CCBA 3ITDA 4HRAA 2D0OB 4WJZA 2YBDA 3N9IA 1YL6A 3E9RA 3E5MA 5K99A 5TDHA 5K3OA 3BWEA 5C5CA 1CF2O 3PGMA 1S0UA 1U2DA 1I2MA 1M1NA 4WBXC 3PGXA 2LDXA 5EYPB 4CM6A 4U7JA 2GKGA 1N3YA 4B87A 3ITNA 1I33A 5FWDA 4EG0A 2VQFB 4QGGA 3AP1A 2JFPA 4XR4A 4B2IA 3NALA 3Q1LA 3TDMA 3UAVA 1N9GA 1W1WA 1DADA 4E12A 3QE0A 1BZYA 3EF3A 4A0HA 1ATZA 2PL3A 3L0YA 1NTRA 3DHEA 5LXTB 4C29A 3OJFA 2RIPA 2V7TA 1FNNA 1QGOA 2OQ2A 1PDVA 3IAUA 4HNAA 1MQSA 5CH5A 3ORSA 4KNWA 2NAFA 4DR2B 4I66A 4KMRA 4UTVA 5CURA 4TTAA 1ZZGA 4OGFA 4LMPA 1CHDA 2OEPA 1ZCBA 2PGXA 4ND4A 4R9NA 2E6UX 4FJ0A 3UV6A 3G9QA 4QU5A 1LW6E 2RHLA 1TAGA 2ERYA 2UVPB 4JBHA 3RODA 1SBZA 2CXSA 3U6BA 2JFVA 3ZUPA 3ENVA 3KU1A 1E6CA 1T3SA 3L7MA 1UJ4A 3BG5A 1EIWA 3EZ9A 5KZMB 1IRIA 5KU7A 1E4EA 1N8TA 2TRSB 2ZQ5A 2QL7A 4CGZA 1SFRA 4Q3AA 2OXCA 3H99A 4RL4A 3BTUA 3IT1A 1X8LA 2Z2IA 5IKXA 3UTDA 1K0UA 3HKDB 4K03A 3MCZA 3GUHA 5ESDA 3OLZA 1DEXA 1KSJA 1Z6PA 1SXIA 3R5TA 2BHRA 3IQGX 2PL9A 1Y7IA 2Q2OA 5CU7A 3V48A 4RVHA 2C92A 2OAGA 1YBFA 1GL3A 3WDSA 3ZLJA 1F48A 4IOMA 1XZNA 1ND6A 2YW9A 3VTZA 2SCUB 1G7CA 2B7CA 3DM9B 2WIBA 3LHDA 4KZPA 1CULC 4MYRA 4W8OA 3WGYA 5KNDD 3IBTA 3L6UA 1EFCA 3IVCA 1U7UA 4UVEA 1XMVA 3KG2A 4QATA 1MN6A 3AVVA 4AB1A 4GGOA 2BH2A 4DCJA 5TQ2B 2ZTHA 3NIWA 3N2KB 5CB4B 4XIJA 3B9PA 3GY0A 2M32A 1HYEA 5ITVA 3JQBA 1GGKA 5CNMA 1U3UA 1Z8DA 4TMVA 3T3PB 3EA4A 4WK2B 1XMJA 3KZ1E 4GP7A 4EA9A 1YE5A 4PC6A 3WQRA 3ZQKA 1ZM2A 4R84A 5EKXA 4ACAA 2QRMA 3KPWA 3O47A 2WJAA 2XHEA 4LZPA 3ZE2B 2EKZA 3RAFC 3HVUA 1T9CA 1YT5A 4B2LA 2O2IA 2Z1MA 2QTAA 3K8QA 2R4TA 3WGJA 1MO5A 3ROQA 1XHFA 3HE3A 3JARA 3N2ZB 4HDRA 4EUSA 2ZYUX 3S2YA 3EPKA 4MA5A 4IHQA 3UXHA 4XGIA 2CNWA 3CVVA 3NDJA 3E18A 2PT6A 1DX6A 2GK3A 3F74A 4IVRA 4UHJA 2ZBQA 3Q85A 4OXXA 3RFVA 4CFSA 1VHTA 1T91A 1V5IA 1JIUA 1H1TA 2AXQA 2RHGB 4E0BA 4EJSB 3R77A 2QAJA 1GUDA 1MOPA 3QSYA 3EIHA 1QB8A 3L01A 3AJEA 4P5DA 4ZO6A 3PLRA 4PVCA 1YB2A 2BTOA 1Z5GA 5ESWA 3TLBA 1PN3A 4IICA 3HB7A 1QG2A 3C14C 3F3SA 1I80A 3Q5DA 4CT0A 4D3SA 3GFVA 1BKDR 1EFKA 4URFA 2NU8B 1HDZA 1AKVA 1T5IA 4J0DA 4MJ7A 4TRNA 5TS2A 1MB0A 3G2QA 4Q1EA 1IXYA 1FS4A 5LB2A 1HFEL 1WD5A 3DZHA 1U28A 3RFTA 1QH8A 3T3DA 3JQ9C 2AZDA 3DVSX 2WB2A 1L8QA 1P91A 3H1GA 1U0SY 3IQXA 5MN6A 1JQAA 1OI7A 4BTEA 2PRYA 3I6YA 5EJ8A 2D59A 3TUZC 2IGBA 2AYZA 4AMUA 3VOBA 3ZH9B 5CDUA 1LI5A 2FR1A 4L74A 2ODAA 4G8JA 4XI9A 2IV7A 2BZ0A 1IXKA 3PGA1 3DZ8A 4GVPA 1EWRA 1IEWA 5DNVA 4BQQA 3EOBI 2VATA 5H5JA 2NZWA 1C81A 2E4VA 4UAUA 5A9TA 2ZJ6A 3FPKA 1OVMA 4Q3NA 4NNPA 3KC2A 2Z5VA 2BBWA 5FI1B 4DE5A 2BF4A 3M1IA 3G13A 3UJ7A 4KPFC 2Q4OA 4TROA 1CG6A 4NS1A 4W5JA 3FFBA 4IIDA 1R12A 3QMWA 3MJRA 2ZDHA 4P92A 1UZNA 1JLMA 1EG2A 2Q46A 5L3QB 1EHIA 5KJ6A 2IW1A 2BFBA 3DOCA 5DISB 1WPXA 2JVIA 3BBLA 1RWPA 1IY2A 4Z9YA 2W4QA 1P1RA 1U7XA 4YUXA 2X4DA 1TAHA 2NTNA 3C3MA 1P2TA 5CNKA 5F2KA 4DL9A 5AVWA 1ZJZA 4EUFA 2O7SA 1QGUA 2XNSA 1JKJB 2I2XB 2GFIA 4JBYA 4KE9A 4C76A 3IGFA 2ATIA 2B25A 4I9UA 3T3OA 3I4FA 4PFSA 2AKYA 3FI9A 1OFHA 4AJ4A 5HZKA 1QE0A 4R5HA 4N6GA 1GPNA 3RUHA 1V7ZA 1KFBB 3NTRA 3W90A 5IWAB 4DR3B 1C4KA 1SUFA 1W2HA 3HZOA 4ZN6A 3W06A 1X7ZB 1R37A 3CRVA 5BRJA 5IVHA 1WMSA 4IG4A 3HEBA 4OJTA 3ZLUA 1QGYA 1KRXA 4AF7A 1WXIA 1XCMA 4R3WA 3ZXSA 4Z3KA 2GM5A 1ZGHA 3HY3A 1E60A 3ZJ4A 2HWUA 3BRWA 5KOYA 2FN8A 3F7NA 3VKVA 4KLAA 3WNQA 2CVZA 2ZS8A 5LQKA 2AQIA 1TU0A 4RKRA 4B6SA 2C61A 3GXBA 2GX6A 1F8FA 2OHXA 3FYUC 3NWPA 1QFYA 3FCUB 4MWOA 3BGOS 1UDXA 3DE5X 3OCCA 3O9MA 4Y6QA 5DLQC 3ZHQA 2VZEA 3HWSA 1GKYA 1NN1A 1Y7HA 4HXFB 3LNCA 3VR4H 5IHPA 1R27A 4D5GA 2C99A 1U8ZA 4D9KA 1PNOA 4MQ6A 3K92A 1C9EA 2VNJA 3R0JA 4C4OA 1JUDA 2BE7A 2VDMB 2XUPA 3SZRA 4ZODA 4IXMA 2DQSA 1XQXA 5G41A 3BXEA 1ZO8A 2Y1OA 4PHFA 4IO0A 1QR6A 3OOWA 4EECA 2JH9A 3SJBA 1HH4A 3ZTYA 1WBJB 3M1LA 5HJEA 4MB2A 1PFWA 4FX5A 3OU2A 4PYIA 1R0YA 1UDWA 4JQCA 2F1IA 4UHEA 2XZOA 5ITWA 1O6CA 2BUAA 4YUZA 3KQNA 5AI8A 3DDSA 3STYA 3L9XA 1GSIA 2EGHA 1OBCA 2II6A 3VC1A 1OU0A 5DI3B 5DN6D 2JAUA 2FW0A 4BPBA 4D9BA 1GU1A 3MQFA 1DRUA 1P45A 4L75A 3OC0A 4BEBA 5EIXA 4FW9A 4NKRA 3RGWS 4ZVVA 1SC1A 2JIBA 2VPYA 3CUEF 1T4CA 3DQQA 3L7AA 4GMGA 2C77A 3HI6A 1W0KA 1JEJA 1LK7A 4YBRA 3M1AA 3FFAA 4UTZA 2QNBA 5I51A 2KSQA 1L8LA 1ZICA 4Z2YA 1YRYE 1EH5A 3U9LA 5JCXA 1Y8CA 4UZEA 4EG3A 1RACA 1CXZA 3NNDA 4GECA 1K6JA 2F9MA 3UM9A 4DY6A 4JODA 4HWOA 1DJMA 3LM8A 3JV7A 4EHLA 2IDMA 3ZWBA 1KAHA 1E5LA 2I4MA 1FDVA 1X1BA 3DV0A 2ZRLA 2FPPA 4JZYA 1UBLS 4IIJA 2DHCA 4WLNA 5MN5A 3BTVA 2PR7A 2INGX 1BA3A 4K6OA 2R6AA 1JHPA 3HJGA 1UK6A 1CFJA 1G8PA 3ONWA 5A6SA 1G18A 5C7YA 5K20A 5LR6A 4HYTA 5DGIA 2FH5B 3W77A 1YE3A 4PLHA 4YJFA 4AC9A 1LRJA 3C3EA 3T8YA 4XB1A 1ZCZA 4OBWA 4CW7A 2H4HA 1B73A 4OXKA 4HNHA 4RCZA 4XEUA 1Z2AA 4LDJA 3EZXA 4OXYA 1O94C 2HA0A 2TS1A 3HBAA 5E4FA 5GV8A 5A3JA 3FIUA 4PGFA 1MJGA 3CRRA 4UU0A 4MDHA 2Z58A 1T4DA 1Y89A 2C57A 3O5AA 3C5HA 1ODIA 3C3PA 4I3FA 1HR0B 3UAZA 2HBYA 4ZMBA 2QG4A 2YZ7A 1JQ5A 3B78A 2ORWA 4INOA 1HQYE 4GLLA 4F5WA 4Z4FA 2WLSA 3GOHA 5FHQA 4AVYA 4YI3A 1GCGA 5H3CA 4ASUA 4IRXA 1LDGA 5IUKC 5LYYA 4EPTA 2HT6A 4PLGA 2BRUC 2I6GA 1VPWA 1VE9A 3OAAA 1YJQA 2X3UA 2PS1A 4QOIA 4A8JB 3F2IA 1RMQA 1R6AA 3OLYA 4L5YA 1ESZA 3V7FA 5JNLA 4QAQA 1E1QA 3C24A 4MKFA 1VE5A 2ZTVA 5FEMA 4F46A 1AN0A 3GEMA 3NDIA 4ARBA 3J7AC 3UOGA 3GEEA 3VMMA 3JQRA 3UJPA 3B9QA 4CIXA 2Q50A 1THMA 5D84A 5EWMA 2O06A 3OO0A 4U5XA 3WL4A 1NKVA 4CHGA 1NC1A 5M29A 1ZSYA 3DKRA 2I4LA 4Q7QA 5C7LO 3I4CA 3OE7D 1JG4A 1GQFA 1KJQA 1N0VC 2AUTA 3B1WA 3WMXA 1J24A 1EWVA 3EIQA 3DVQX 3I2FA 4N7RA 1Z0IA 2HF2A 2HT1A 1Z5VA 3TTVA 2J0UA 3CZMA 4TTPA 4G85A 1OT3A 2JGLA 2RH5A 4K6HA 1T8WA 5E7MA 3WLKX 3OP4A 4MS1B 4C1BA 1WABA 1WXGA 1GXSA 2E37A 4ZC1A 2PUCA 3PWSA 4GMKA 1L4HA 3QQ5A 1Q14A 3TKYA 4ANFA 4R0NA 5ALZA 2RKBA 3I2YX 4JL8A 4D45A 4OO3A 4BUCA 2Z4SA 5C32A 1V3UA 1VGQA 4NCKA 1I2ZA 3DE2X 3E61A 3ONEA 3OVMA 2CJWA 1RXVA 1BMTA 5DM4A 1DBRA 1MQ8B 3L4KA 2VXBA 4N41A 1M1ZA 3AR6A 2H3EA 3KXPA 4K86A 3KSMA 1A2KC 4Q9NA 3V2IA 4BXOA 5ILQA 1BG6A 3P19A 1EUYA 3C7TA 3CS3A 5EJFA 2JLVA 1YQDA 1OY1A 1QH1B 2CKDA 2QT1A 2VKTA 1CDZA 2X6TA 2YX1A 1I4OA 4GOOD 4IIJF 5HK8A 3ZIAA 4EFLA 1PTJA 1ZD9A 2W6QA 1ADGA 2DECA 3B1VA 1W46A 4MICA 1YA8A 4AT1A 4ZT7A 3HUUA 3BH0A 3L6BA 3TTYA 3H9GA 3P9SA 1EZ4A 2QORA 5FBZA 4MS3B 3CSDA 2NUPA 5DEOA 3BWXA 2JLUA 5IM5A 4B79A 5AW8A 3W2EA 3OFSA 4KV7A 2ZJOA 3IV7A 4B3HA 4CXMA 1ENYA 3D2CA 3IAEA 2WIAA 3NXKA 4FJ1A 4WN3A 4C6TB 4I5FA 4RJ2A 3DBRA 4HO1X 3QLTA 4RNCA 3T5MA 1G9TA 4TSFA 1KS9A 3SS9X 5T41A 4Y2XA 2VHCA 1DJNA 1XKLA 3W1VA 2X86A 1OOEA 3LBIA 4P81A 3AINA 5GGYA 2C4NA 3L79A 1T26A 1TZCA 1V8BA 5LWQA 1KI7A 2XGGA 5THQA 4PO8A 1MC5A 4RVNA 1T9DA 1U9CA 3WLJA 4WCFC 3ZJUA 1Z0SA 2CMFA 1DIHA 5BRNA 4UM9D 4WBSA 2H7CA 1J4AA 2HRBA 5AW2A 5JDIC 1PJAA 4K9PA 1KO5A 3LG2A 1C0KA 2KX7A 4ALMA 1EGHA 4L4RA 1JPNA 3HJBA 5FUYA 4EVIA 4C88A 1R6BX 3RHSA 5HJ7A 1FJGB 1F20A 5DPMA 1PYDA 3HXMA 3ZI7A 4M3NA 3M6AA 3ZJ5A 1U9ZA 3WDLA 3FNGA 3GJXC 1XKQA 3HDJA 3G1WA 1E2LA 3MUOA 3O2JA 1ZR2A 1JIJA 4Q66C 3R76A 4XM2A 3EAQA 1L5GB 4EMBA 2AG8A 1H0HA 2NQTA 3KPJA 4U7HA 2ZATA 5IN5A 4ZCTA 5BUQA 2K2QB 4BL5A 5HGJA 1XEWX 2IS6A 1PLJA 3MGCA 2FPSA 1FFGA 1MRSA 5CB8A 2BD0A 1YBHA 2V7EA 4B4WA 1C2YA 1RRGA 3LZCA 3KDPA 2UAGA 3DTYA 2IY8A 1UMBA 2HK9A 1M1NB 3W9BA 1EQUA 1EU1A 1EWYA 1RBYA 3PHIA 4X60A 1ZQ1A 3THXA 3L7KA 2YJ6A 4GM1A 4HAOA 2D4AA 4QM6A 1MORA 1ADBA 5CXXA 2H85A 2ILVA 2VYQA 1DAGA 1JNXX 1NBHA 3GGGA 1U0NA 5M3BA 1N9GB 3ST7A 4BNVA 1BHQ1 3UWSA 4GDFA 1UL1X 4IGFA 2FXIA 4Z9FA 1C7IA 2IIBA 3TNJA 4HNAB 1NBAA 1VMAA 4FFBA 1W5SA 3ZOKA 3OIDA 2FN4A 2YIMA 1YZ3A 4O1MA 3QUQA 4M8KA 4R2XA 4LNHA 1N2HA 5I9BA 1P0PA 3A6PC 5A2QA 3DOHA 1BD3A 3H2GA 3Q87B 3EARA 4K05A 5J4HA 1ONOA 2HWWA 1DHRA 3N0VA 2C3UA 2AF3C 2B92A 3UJ3X 1WU8A 3DFIA 5DDIP 4TL7A 3G2NA 4IYJA 3AKYA 4PQYA 4RXUA 1WPRA 2TMYA 1RKVA 2B94A 3MCUA 4AJ2A 4U00A 4LJ5A 1E4EB 3IYLW 1HDIA 3LYUA 3LOUA 4IQ8A 4JI3B 3ZWCA 4I4TA 5FOVA 2BVNA 3DDOA 1RYDA 2EZUA 1DQZA 4B32A 4CM9D 1KP2A 1MU0A 1OBVA 3CY6A 2WKSA 4QC2A 3ZWQA 1WPGA 3GYGA 4O29A 5U9CA 1KAMA 1UEJA 4R1PA 1RCTE 4KO8A 4MUYA 4AJNA 4FFRA 1YZGA 1FW6A 1QG4A 3MGGA 1GGHA 3O4JA 2OB1A 2P2YA 3OTIA 4EG8A 3D4NA 1KK0A 1ZXLA 1KWKA 2FFRA 2G28A 2HIAA 1IBMB 5DEIA 3DAFA 2IYOA 3LGAA 3R7NA 2OFXA 4ARSA 3PPXA 3BWYA 1BRMA 2IYWA 1YI0A 3FUTA 5DLPA 1JG7A 3PI7A 3A6JA 3NUQA 2YMLA 3KXIA 5KQMA 3HBLA 1OZGA 4HEHA 3L7NA 1JU3A 3RYFB 4UPDA 4M7WA 2EQBA 4LCEA 3CX6A 2JI6A 1YC2A 3B36A 4O3FA 4TSKA 3ROTA 3SP1A 5FX2A 5KNDA 1DBVO 1OV6A 4BX8A 2DGDA 2N75A 5K3FA 4DT1A 5AM2A 3Q6IA 5JHHB 3F90A 4YRZA 1U0HC 3IR6A 4HP8A 3I0MA 1ZOSA 4HUJA 4XJTA 4ZYTA 2H31A 4J2HA 1GZ6A 3ZJYA 1X7XA 1X1SA 2A4MA 2B4KA 1P4HA 4O2AA 5E2AA 3OOHA 2WT9A 2P9FA 3E6AA 1M2JA 5EI5A 3U1VA 4KE8A 3IKTA 3HWWA 4IJ6A 4EDHA 4ZVLA 4IKOA 1U31A 4OQEA 3L8DA 3LIIA 2B21A 4WL0A 1QB7A 2VJOA 3E81A 1Q3KA 1YQUA 4KWEA 3AZOA 1PF7E 3O21A 1RJFA 4UNNA 1ZHFA 2J33A 4C0WA 4ZV9A 3K71B 1UKAA 2P6MA 4JOCA 4KNYA 1G4UR 1AHNA 2A78A 1DJQA 2H54A 4O08A 2WQ7A 3M3DA 1RKBA 2G17A 3C6QA 2I4NA 2PA3A 4QX6A 5AJUA 3JARB 1G17A 4L4XA 4HDRB 3TL6A 1T6ZA 3J81A 5JWRA 3BL8A 3IUMA 3RVMA 3G2HA 2XE7A 1WUKS 1O96A 2HPHA 3KVNA 4TOIA 2CXRA 2CF6A 2HY7A 3M49A 3MRVA 2QZZA 3L3BA 3MWEB 3OEYA 5AI9A 4B3IA 5MHTA 2JEYA 5THKA 5KINB 1ZC4A 1QX3A 4OI0A 3EZ2A 1H3FA 2BMFA 1GA1A 3K0AA 4YVFA 5DHAA 3B53X 2XYRA 2VF8A 5E0OA 4C0HA 3MZ0A 4JYZA 1E0AA 4MVJM 3ON5A 1F8UA 3U3MA 3QU7A 4AQYB 1BE8A 4LHWA 1YR7A 1LW7A 1T9HA 3IILA 4Q93A 1ZHOA 3DT9A 1N0IA 4R3UC 1QQBA 2FQXA 1NZJA 3DMYA 2H4JA 2QN8A 3PD0A 4K1LA 3A7DA 1KA9H 1NHGA 3IT3A 4ICIA 1IAQA 2D8AA 5B7NA 1QH8B 1EUDA 4OMDA 3BEOA 3OOEA 3UMFA 1Z2EA 3OZGA 3G3EA 4FGKA 3VO8A 1AHHA 3RT9A 1DKOA 5DZSA 1GRCA 3L6DA 4I4TF 2TYSB 4BFVA 1T1EA 5JBIA 5LP1A 2YQ5A 2ZJAA 1I5RA 4GYYA 3DCJA 2EEZA 1UBTS 2H4WA 2Y05A 3BA6A 3HDYA 3T06B 1AQJA 2GEVA 5IVDA 4OKIA 2Z1DA 2XNHA 4ECAA 4WA7A 3G0BA 4FOLA 3FNFA 3CEHA 4F2DA 1KYIA 4LRXA 1NJGA 1PFQA 1PX0A 2VDQB 5G0TA 2CDCA 4X20A 3V8PA 4EO4A 1XC7A 1DG9A 3KOMA 4ENRA 2VAXA 1K92A 2ZZKA 4HH1A 4NYIQ 3OF3A 4TRRA 3TLKA 2YZNA 2BFBB 1OXMA 1KSFX 4EA8A 2QTFA 3UMGA 2Z5LA 4P32A 1PKXA 2E6KA 3V4LA 4TZTA 4ZMRA 4PG6A 4R2LA 4OJQA 3G5TA 4E07A 3AM1A 1CKEA 3T12A 4PM4A 3PQEA 3KTOA 1QGUB 3IULA 4ROTA 3RS7A 3UKOA 3I9LA 2GXAA 3ACBA 1Y9ZA 2O0KA 5LLSA 3UF0A 4AD8A 5I9TA 1TEHA 1QGDA 3EW9A 4S3MA 5B7PA 1IZ7A 1AKTA 1PWXA 2G5CA 2MSWA 4H6PA 3AKZA 5IJ9B 4PR0A 5BUCA 2OCPA 1H4VB 3H1AA 3FLBA 1P61B 3ANTA 3O8LA 1R0XA 3QFHA 1DG3A 3LQKA 4M60A 4MA0A 2V58A 3AHFA 2QJWA 3JAWA 3U56A 4PQRA 5EUQB 1V8OA 2IWRA 3QFFA 3VISA 4DG8A 4JXXA 2V6IA 3BOSA 1UBSB 3JQAD 3KDAA 4L9AA 4RTKA 2XB6A 3CJTA 2PH5A 2WRZA 1JG2A 2C9CA 4J0JA 2WD8A 3SYLA 1CY7A 2AYXA 1RXYA 3PYLA 2POCA 4LYFA 4TV8A 1TE2A 4JQYA 4JBNA 3OIUA 1PSZA 5H59A 4GMDA 5BP7A 1Z7YA 1BEUB 5GTDA 4TL9A 1OUMA 2FRDC 2H17A 2DLNA 4RPKA 5CR9A 5AW6A 3DT6A 4KRFA 4DLNA 5KNBH 4MKIA 1P0IA 4JUBA 5FYQA 2PZ8A 1FA9A 2FSPA 3PVCA 5FA6A 5FD8A 5DTIA 2W11A 5H9WA 4JI1B 3A2LA 2H06A 2C7RA 3MGBA 5ICCA 2NVWA 1KOFA 2KI5A 5M5BA 4Z3OA 4G97A 2AF4C 2YWRA 3RS4A 1OIWA 2ACEA 5F76A 3VHRA 1DKMA 4WIAA 1ORTA 5COBA 3RF6A 3RLIA 2BKVA 3TR6A 2OE2A 4E5DA 1GR0A 2FEMA 3KO8A 2H2AA 4LYJA 4KUGA 1G8KA 3P2YA 3P2JA 4YEDA 1H05A 5D5HA 4ZVPA 4BEJA 4EYSA 4DKJA 1SHJA 2ZKIA 3HC7A 2XTAA 4IINA 4AY5A 1C7JA 1TM7E 3C0KA 1NNEA 1RXEA 3BIFA 3THYA 4UMDA 4YQFA 2XVMA 2QM0A 4J07A 3WTCA 3RHTA 4A23A 3BWMA 3R7DA 2HGSA 4CLRA 3GRRA 5EMKA 3CZQA 1T4CB 2G6BA 3BQ9A 4OUDA 1EA7A 1A7UA 3CWCA 4GX2A 3OCJA 4B81A 4MCAA 5JS1A 1GG2A 1YRWA 5DN6A 2G1KA 4HG2A 4Z0PA 3DQPA 3B3GA 2H2HA 3CX8A 1OFVA 3E5RA 4KAAA 4KQMA 4H6XA 4KYUA 4DEYA 4ARUA 4YPFA 4BVFA 4KXQA 2AKAB 3EC7A 4HUTA 2XQJA 1ZJWA 1WSAA 1R9JA 2WAAA 3BIXA 4GGPA 1JHXA 1GG8A 3DV0B 4B76A 2A5DA 1JB1A 2FPPB 4IIJB 4DTIA 3DTTA 4L8VA 1EMDA 1S9HA 5ALYA 1A7KA 3MCWA 2ES4A 1QZUA 2FR0A 1F3OA 2GLTA 4KIGA 3ZTTA 1A9XA 3WA7A 5A6SB 5GADl 3SQDA 1KWGA 2JK0A 5LDDC 5CG1A 4G3XA 4AZWA 3PRJA 3VDNB 3Q40A 3OZIA 4YJFB 3L41A 3A05A 4ARIA 1OI4A 2ZU6A 5CFZA 1M0TA 3LKBA 4OEHA 3SI7A 1SY7A 1O57A 1JA0A 3GPCA 2BBTA 4YLEA 3INYA 1CD5A 1KY4A 2L2QA 4E1VA 2JLYA 2FOLA 1NLYA 1LZKA 4FHZA 1FS6A 2PWAA 4JDUA 1GY8A 4V0LA 3QOXA 3PXDA 2MR6A 3KYCB 2EZ8A 1E3EA 1CLUA 3PLNA 3D4IA 3QM1A 4ER7A 1N6HA 4P82A 4Q4JA 4TV8F 1SK9A 3P9RA 4MV5A 4UHHA 2ZBPA 3EXG2 4AMGA 4F6RA 1EVZA 4PRLA 5JTTA 2OK7A 3VU1A 2NO6A 2F1RA 3ICWA 4IS3A 5F5LA 2Y92A 5AUPB 2HXYA 1VXRA 3G2OA 5KJEA 2XMDA 1I2DA 1SHTX 1J2TA 3CF2A 3E7PA 4IDDA 2H0RA 4HDCA 1P75A 1MW9X 5L7YA 4DPKA 3HDGA 5J1TB 3FTFA 4FOTA 3A25A 2QGFA 1Y1SA 3EUAA 4DUPA 5KOHA 3CJRA 4XDZA 5KYWB 3I23A 1XFDA 2D4HA 3JRWA 2GJ9A 3ENQA 2HO4A 3O2SB 3ZD7A 1YGPA 3G7NA 5KAPA 3OPYB 4YMUA 1PR3A 4UHCA 3UWMA 3KZNA 2H29A 2JFOA 5JDCC 2WSYB 2D00A 4EO9A 2PEZA 4UCXA 5DHUA 5JASA 1T2EA 3PTLA 2J0UB 1WL8A 3EUWA 1IK6A 1KIAA 3ZVMA 1I1NA 2G1AA 2R97A 4S1NA 3DO8A 5BWOA 1TI7A 2Z98A 2WSSD 2HEGA 1GXSB 5EP3A 4BO8A 4HRXA 1UT8A 2GPWA 1ZBQA 2GPJA 4MQLA 4YDRA 2BGTA 4E5MA 5HUQA 4DREA 1U2RA 2DUUA 3OZCA 1ARZA 2J6BA 4H7JA 5HF5A 3K0SA 1B00A 3K4QA 4EBFA 1U1EA 2XNDA 3UUGA 2WUEA 4QULA 3VPBA 2CJWB 2YWHA 4S0ZA 3RTDA 4ZIRA 5C9ZA 4M54A 4ZEXA 2VDVE 4S1PA 5AM1A 1E1YA 1D5CA 2AR7A 5DULA 2IV2X 2PUEA 7YASA 3TM4A 3F4LA 4DWVA 2EP8A 1ENOA 4UAGA 2JCVA 4UE2A 4UBKA 2XGSA 3LCCA 5IAGA 4BXOB 1RQRA 1U9IA 4KQEA 5KBYA 1AS2A 1NSTA 2MOKA 2WHEA 1GSAA 4UHBA 3AB7A 3PXCX 1RAHA 1Z56C 4G65A 2CDNA 2QJFA 4JH0A 2CEAA 2SNIE 5BW6B 4Y1GA 1RYNA 2X8JA 3CZPA 5E7JA 1E3TA 3A11A 1J0CA 1AK9A 1DAIA 3I04A 5DO9A 1AV6A 1M6YA 5DSXA 2WILA 1JVNA 4JA2A 3ZHRA 1Q17A 3W34A 4YCLA 2RE8A 1P0CA 3P1JA 2RIRA 3CLVA 4A2QA 5CXUA 4BFCA 2J5RA 2C97A 4C4AA 3DBRB 4EJ2A 4EGCB 2V6FA 3VOTA 5TF4A 3OCUA 3AY7A 2VQDA 3PKIA 4NZNA 1RC0A 3RHFA 3VPCA 3FVWA 1Z8FA 3JTEA 5HTKA 1E98A 3KT3A 1JG1A 3SIXA 3H86A 1B6TA 1J2UA 3MB8A 5IJWA 2AUMA 5TGZA 1FSGA 2GI4A 4NEGA 2J6IA 4LDQA 3ZKWA 4PNEA 1NJSA 5EERA 1V11A 1KQOA 5H02A 2FFQA 4EHJA 4LBWA 5LNK1 2O8VA 1RKUA 3PWZA 4JR1A 1FSPA 4U7TB 4P3KA 3CNNA 2RI0A 5DTQA 4ZT6A 3L0OA 4FDVA 1FU8A 4YP9A 4JN6B 1U98A 3H97A 4XEHA 5I9LA 5B4VA 4LY6A 3VX4A 3HCAA 3P9NA 2C4MA 5BT8A 5K3AA 4L0DA 5KYKA 3E84A 4NH0A 1N5OX 2HWKA 3CBQA 2GPNA 2RHRA 3IXMA 4XYMA 4CI0B 3NJ4A 4X24A 1KR2A 3ELWA 4HN9A 4KXLA 3JYPA 3LDUA 4B17A 3H6GA 3UENA 3ILYA 2GLXA 3VQTA 5K01A 1N7HA 2IDKA 3MQ4A 4OGKA 3QG5A 5FUWA 4YQYA 5BNWA 1T3HA 2P41A 2GZ3A 5EGSA 3FHOA 3TK1A 1JR2A 5KI6A 4YT5A 3RIMA 1JT9A 3UAOA 3ELUA 1NI3A 2PMCA 1UMBB 2OVBA 3CIOA 4RH1A 2FZ4A 3SJCA 3GT7A 4MHSA 2JJMA 3THXB 3KETA 4MVJG 1X0XA 2ZB3A 4UASA 1GARA 4D0NA 4MIEA 4AN4A 4EKIA 4F4JA 1U3GA 5AW3A 3EWIA 1CE8A 4X45A 2JCBA 4JD5A 4Q4AA 4E5YA 2ZRMA 2BAGA 1YCDA 2PY6A 4ZWNA 1ESEA 3AFHA 3ECCA 4PYRA 1ISSA 3BCSA 3HVJA 2JAXA 1E1NA 1IMJA 2ZE6A 3OESA 4LYAA 1KEVA 3B52X 2ZJYA 3BD7A 4MTLA 2AE2A 3HUEA 3N2GA 3V4PB 3UATA 3KNZA 3AF3A 3OMWA 5JZ9A 4ARCA 1PEAA 3R6DA 1RWVA 2QN9A 4KQ6A 4MVXA 3LHIA 2ARKA 3OCYA 2BRUA 2HRQA 1B2LA 3NYIA 5DM1A 3PC2A 5EKDA 4FGUA 2O7NA 2REXB 5FNVA 3EIXA 1GPAA 2OXEA 2GNPA 2F8TA 1IHUA 5HJ5A 1FNSA 3TAUA 4D0RA 1VJTA 1J0EA 1GD1O 2OBYA 5J5CA 3X2SA 1RHUA 3UA4A 2HZ7A 1NFFA 2GB4A 2JKYA 1I4LD 1IN7A 5ALPA 3SR0A 4LF6B 2I6FA 2ZJ8A 3LX5A 3M6IA 2XI4A 2CK3A 1E2MA 2VTBA 3S29A 4J4BA 9ABPA 2OPHA 5ICMA 4TTQA 5DP1A 1UT6A 5H0IA 1NI4A 1CEQA 1SJ9A 3NEAA 5I7HA 2OSVA 2WPDA 4EKDA 2JIMA 3F3KA 3I2GA 5HS4A 3GVHA 2ZRDA 3L4BA 2ZXUA 4UUQA 3HU5A 3PXBA 2ZJ0A 1Q7CA 3IALA 4OHPA 4S1TA 4AURA 5LD2B 3COJA 2HW8A 3BQNB 5K3FB 1G8GA 3CUSA 3N3AC 4DT1B 1NM5C 2FMHA 3WI7A 3H19A 3L6RA 3LC0A 4POAA 1T9GS 1WCWA 4Y7DA 5ECWA 1R0ZA 4ALKA 1T1SA 2XWQA 4LGYA 4DMRA 3U40A 4TTIA 1L8OA 2GNAA 5KSZA 3L8GA 4DA8A 1UJNA 1X7XB 4FKZA 2QW8A 2D3WA 2ZR9A 2YC2C 3BFKA 5FNZA 4JI5B 1SQGA 2PZKA 4XH9B 3A4TA 3SDZA 1W4RA 4DV0B 2BMAA 5LMUB 5PNTA 2IU6A 4RX1A 1WW3A 4CJXA 5JAOA 1R1DA 4HLQB 3E1GA 1KZHA 1D0SA 2HTEA 2XRFA 4D8TA 2XB8A 4KC0A 3D6VA 1AVTA 2J48A 3LF1A 5HBGA 5LCXA 2VJMA 4M1OA 3O38A 4E7OA 4E14A 2XBMA 2RAPA 2CNLA 1DHTA 1WZUA 2OV6A 3ONVA 4B5LA 4AS3A 3R0VA 5B3LA 4JIMA 4ZDKA 3NFRA 2FZ5A 1O96B 1COWA 2C2BA 4OQYA 1ZFNA 2HCRA 3ICPA 4N18A 5CT6A 1RC1A 4YAIA 3VZCA 4E5UA 4H7DA 2NADA 3VTKA 2FCAA 2O3UA 2VUHB 2F55A 4LOIA 1OC4A 2JJQA 3P2OA 3WLQA 2AEMA 3A6EA 2A2ZA 4JP1A 2IHBA 4N0MA 4ENUA 4NPHA 4LF7B 4TV9B 5EMJA 5KPJA 1CJUC 1E4OA 4L4YA 5JJKA 3W3AD 4Q05A 4XD2A 4M1KA 1C80A 4NMWA 4A10A 3RRZA 3CZ5A 2JI4A 1CUBA 3DXZA 4FVTA 1D7OA 2IHZA 4R41A 1EUDB 3LTEA 1N2CE 1WE2A 4GOLD 2IV3A 2BTQA 3V4FA 2C78A 3HFSA 1S2IA 4LJKA 2ASEA 2QI9C 5FNVF 1Q2XA 3ESBA 4G5GA 3WK4A 2BHNA 3MJEA 4PBRA 4C0BA 5D3ZA 4Y1RA 3EXHC 3T9BA 4S1VA 4E2XA 4YRSA 5KWEA 5FV7A 3MM4A 4R2MA 2O3SA 3OKFA 2HQRA 1TM1E 4QVKA 1RAIA 3RFXA 3SZGA 3TZQA 2ZUBA 2IXAA 2O2GA 4ZOBA 5HHTA 2GEBA 4RWZA 1E8DA 2VDRB 5BNIA 1RQPA 3NBQA 4X20B 4YK7A 4Q3OA 2H1CA 4KI7A 1IN6A 1V5FA 4YWJA 1NW4A 2D5IA 3NXSA 4FP9A 4XQ9A 3SMVA 1ML4A 3K2QA 5CA1A 2KE5A 4GRIA 4KFSA 3WOHA 5IMSA 2XIQA 1U8CB 5IT9A 4PEVA 3N2LA 1O6GA 4UTPA 5CDGA 1NVWQ 4PYQA 3WLHA 4RY8A 4YUWA 4XKJA 2EW2A 5JS8A 4DMLA 3W5DA 2D5CA 2NUBA 3IIIA 5BWCA 3O94A 3DS8A 2PIDA 3ZCVA 3ES9A 4C4XA 3T5BA 4F2HA 1NKSA 2B98A 3GVXA 4BO2A 3Q8LA 221PA 3IP6A 2QDXA 4LNUA 5UKDA 1ZNXA 5JSQA 2QYSA 4RULA 2QNRA 1M2WA 3QEKA 5BORA 2JVJA 3FMOB 2YJ5A 1WU7A 2WW8A 4MYUA 2MTBA 5TR9A 3UXMA 2G8LA 3LL7A 3ERCA 2FPUA 2AG6A 2OENG 3JAWB 4HAXA 2CVOA 2CFCA 3UOWA 3HU1A 4H4DA 3FNRA 1EX9A 1XZMA 3CKYA 5DX0A 1OIXA 3T1OA 3QQPA 1DFIA 2ZSIA 4OGGA 1LRKA 2FMIA 3FI0A 4RLSA 4UNSA 2VNIA 2XMCA 3U4DA 3DD5A 1V0JA 2AMYA 3KEGA 5AJZA 5JSKA 3ZVRA 2R8BA 4MP6A 3HXPA 3LYAA 1VPTA 3FPCA 2OHFA 3JQAA 3L8YA 3ZZUA 5HM8A 1E3DA 1VDZA 4WRRA 1ZJ6A 3LGXA 4BJHB 3V8RA 1CZHA 2R00C 3FXAA 1YB4A 3H9CA 5DXJA 4IDFA 1RYEA 2V6BA 2B1QA 2ZI5A 4LMBA 1AXEA 3QKUA 3RTBA 3UWDA 4F92B 4K46A 3LY8A 4K1XA 4TXNA 2CMKA 4RVSA 4KXXA 4AMVA 3OECA 3JRNA 1N5DA 3QWAA 5C8XA 4D4LA 2RMKA 3HHEA 3MERA 4YV0A 3LBFA 5TSDA 1EUQA 1USVA 1BX1A 1XPUA 1P31A 3QXSA 4OYRA 4BRSA 5IFKA 4KPYA 1XDBA 1YNOA 1NVUQ 3PDIA 5AVSA 1H66A 1QF9A 3P2MA 3WK5A 1F4VA 3T3IA 4AMZA 1OXVA 2L18A 2OBMA 3BYZA 1RYHA 1ZNYA 3G0DA 1Q16A 4G8BA 2OD7A 1LCIA 1HURA 3DTNA 5FOTA 1XXHA 4U6SA 4KRGA 3THYB 4MYHA 4RY0A 1EGQA 4UXHA 3OJXA 5CYPA 3VSAA 1RM0A 1RI2A 1XCBA 3BGSA 1B6GA 2RH4A 3HL4A 4GG1A 2Y0PA 1XTKA 4LZOA 4D3DA 2YJGA 3IMKA 4OUDB 1I2AA 2DCMA 5FA5A 1K8YB 2KBFA 1FFXA 2NVOA 2Q1UA 1ORIA 3V97A 5GJBA 1TW2A 1W6UA 3PG5A 2HA3A 3DGFC 5AM5A 4IMJB 1QIHA 1UKCA 3U3OA 5J2UA 4GKBA 3K9CA 5EXXA 4I5EA 3ICVA 1G5TA 1TGYA 5CA1F 4PF1A 1E4VA 3GT4A 1QBKC 5JNRA 2AB0A 3LPLA 4OL9A 4QEZA 3WYAA 4HAYA 3O4RA 1SHKA 1IVNA 1IBRA 1NW3A 1DOZA 3UHJA 2CJPA 1QP8A 1PU2A 1XEFA 2XVXA 2WU3A 4HNQA 2ZYAA 1W5FA 2WBLC 4L4SA 4RVGA 2PQ0A 1A9XB 4B3SB 3M9WA 3FCYA 1YR1A 1ZOLA 1MABA 4GR4A 4TKUA 3NHWA 1ZA1A 2JH8A 5E1MA 3KLNA 3RUDA 2PRZA 3BTOA 3RJTA 5I7RA 5KNCA 1Q44A 4F5ZA 3BSYA 2BM0A 4NE7A 5HZMA 2FSVC 3RNLA 3RFUA 1DXHA 2Z4RA 5ERXA 3TQSA 2ZYGA 2EZ4A 4CLHA 1YFKA 3V4VB 1IXSB 3UAWA 3GB9A 4KN8A 4P31A 4E1BA 1C9YA 1E2JA 3AGPA 3NAQA 2ONCA 1APBA 4Q4JB 2IIQA 3NT4A 1XTJA 3DAPA 1GNPA 2HQSA 4NCJA 4X1IA 4C6HA 5K0CA 5FTJA 4F21A 4F6RB 1CJKC 3IAFA 3L6CA 1W25A 1BC5A 3KBBA 3KOWA 3ZWMA 2DVMA 4E15A 4F4FA 5KTPA 4XWTA 3LRTA 3M8KA 4OQLA 2XNCA 1NOIA 4RH3A 3MK31 2G4CA 2ZAOA 2N46A 4LE1A 4C0AC 3SX2A 3PXXA 1A7JA 2P62A 3PHGA 5EIBC 2PYDA 4HX9A 1RTKA 4N5NA 2AZXA 3FY4A 4BFLA 1OU4A 5CUQA 4E51A 4U2EA 2OMEA 2FW7A 3C6KA 4RLQA 1PL6A 2WJJA 4L8FA 3TI7A 1NYLA 3UJ6A 1FQJA 2B6NA 3Q0TA 4KTTE 2WZQA 1ID8A 4R2IA 1AE1A 3E4DA 3G1TA 3JASA 4K6KA 3FCAA 4YRFA 2DFDA 5CCXA 1C5KA 2R8RA 3BXZA 2QLNA 3NHAA 4GM0A 2XMQA 1NVXQ 1V7PC 4BKMA 3GT0A 4PN3A 4IFEA 4N6OA 4I19A 4QUAA 4ZOEA 4RZHA 3ZDEA 5K8IA 4GI3A 1PE0A 1WZCA 2FUG1 2IHTA 2QD5A 5FQOA 3PFIA 3IUNA 4QTXA 1YVDA 4XVQA 2D0DA 1N1DA 4QECA 4EUKA 3QVVA 1OI2A 3BORA 4CV1A 4FEEA 1T10A 4Q4CA 5HF8A 5IABA 8ABPA 4W99A 3ZY2A 2C88A 2WSSA 3WS7A 5BR1A 5KKCA 2O5EA 1WDWB 4MUKA 4ZRDA 4ZIRB 4MW0A 1E66A 2MSKA 3FVRA 5J2UF 3DBLA 3EY9A 3OURA 5BYKA 1O03A 2O8BB 3GNQA 2CLMB 3TGPA 3WL6A 1FYXA 2CC2A 3CURA 3N2EA 2NXJA 2JLAA 2AEJA 1ZRNA 1UFQA 1JFRA 2PKQO 4I1UA 1UF9A 2C1EA 1J00A 2P9HA 4R31A 3SS7X 3ZHOA 5HKBA 3UICA 1KI4A 1WY5A 2PV7A 1OWOA 5F64A 4GKJB 4P6VF 5IX8A 1PVOA 5GZ6A 3UEOA 1FFBA 1G42A 2VLIA 2XR1A 2K4MA 3KVRA 4IVPA 3RU3A 4C03A 2BGWA 4MUIA 1JEYA 3TIFA 2A6PA 2IDJA 2X8JB 3H0CA 1XDDA 3G23A 3ZU5A 2QW1A 3IIJA 1PYOA 3KX2A 2FRDA 3C8HA 3PNVA 1MO2A 3FYUB 5BSUA 4DA4A 2WM3A 4U8GA 1C1XA 1MX3A 2FG7C 2Z8XA 4ZO7A 4LDPA 3USES 2BGGA 1WS6A 1CBUA 2C20A 1K3FA 1SVUA 5FL7A 4ZC8A 4FSHA 4IMRA 4H0FA 4P93A 3PLAE 2FWMX 4QDJA 1AY0A 1GNRA 2O3JA 2P5TB 3QXJA 1B8UA 1JA9A 4AWXA 2VVTA 4PQFA 4O4HB 3ZKWB 4CT4B 4F60A 5BNZA 1IY9A 4TSRA 3F1KA 1XB2A 2BOVA 1V11B 3JYQA 2YCLA 2QDKA 2PD4A 2QUIA 1FUIA 1KYZA 4JB3A 5EP2A 1IBKB 7MDHA 1K7CA 2I6UA 3D31A 1UUFA 4Z86A 3GFRA 4QDXA 4NBUA 3RROA 3HJNA 3RSFA 3GFFA 1F60A 1YRHA 3ODPA 3VU8A 1DUVG 1LBEA 1NP6A 2WWGA 2J3LA 3ASZA 1GQOA 1Z83A 3GCXA 3HRIA 2C5EA 1V37A 1VMKA 3GRVA 3GROA 1DELA 4RKEA 2HK7A 5JAQA 5C2JB 1CY0A 1GJRA 1M2FA 3GDWA 2H9YA 5LUBA 3C45A 1W5TA 2Q5IA 3I9OA 4KXYA 1LJ8A 4CQMD 2PJRA 1VC2A 3ESDA 1JLHA 1FDIA 3NP9A 1W0CA 4AJIA 4BJ1A 4BX0A 1L1RA 2VCYA 3VBEA 1F8XA 3GWGA 1VIMA 1XRQA 3ZN2A 1ZNQO 3N5CA 4V0KA 2LIPA 2IJGX 3JQ6A 3V1LA 1Q95A 3STTA 1Q92A 1HQCA 2WF6A 2DFNA 2R9VA 4CL2A 1G7RA 2LIVA 1EKXA 5B53A 2NPFA 4CETA 1P18A 1S8FA 1X2BA 4JJIA 3MS4A 2XVZA 4QTZA 4Y2GA 3NWOA 2OXFA 4OA5A 1ZUHA 4A16A 4L08A 2C5SA 1T1GA 4R68A 3PR2B 1ORRA 3EVFA 4HFNA 2HA7A 5E4TA 2VT6A 5FADA 3VOSA 1VQ1A 4EI8A 4DPMA 4XIGS 2B8EA 2OUIA 1KVUA 1S6YA 1CE8B 1XV5A 2AD5A 3MT0A 3HDQA 4GF5A 4Q4AB 2OXRA 3DMDA 4KQHA 1S96A 4ZCQA 1UPUA 2J31A 1CFZA 4JLPA 2IOYA 2LR0A 4LA4A 3FAZA 3GDFA 2GESA 2B8TA 2P5YA 1KO1A 1TCCA 3KYDA 1XJQA 4MA4A 3NOXA 3HCEA 3N2GB 2O48X 2VWGA 3UPDA 4KMMA 2WWRA 4IOLA 3Q2OA 4GOKA 1FC0A 1GTMA 4CLXA 3FHJA 5IUNC 1MHTA 3F9CA 4GKAA 3B6ZA 3PC8A 3KUDA 5EIBD 3NATA 1PIWA 2PNJA 4BNYA 5L8VA 2C31A 2OV1A 3B70A 1JAXA 4AP5A 5FNVB 2A5LA 2QWXA 1TB4A 3MN1A 1YL5A 2GDJA 2ZIWB 4FLFA 2NO9A 4U7PB 4DLTA 3GCDA 3SC3A 5JSHA 3QMPA 1HNZB 2OOSA 3WK6A 1GPBA 2I7VA 3BE5A 4QUGA 4DAEA 5BV1A 2YQZA 4WNCA 5AKZA 2XV1A 1NX6A 2Z09A 1N4DA 1DFHA 1EWQA 3WV4A 5LZ8A 1HDCA 3HRHA 4YCJA 4PXAA 3T4XA 4KR9A 1NU6A 2NNWB 2VTBB 3EUEA 5SY4A 4MI6A 1H94A 4POOA 1IQUA 5JDCA 4E5KA 1S3FA 3WIVA 2GH1A 5E7IA 1X1DA 4KQ2A 1BDHA 4PLVA 4EG4A 4EA6A 1LNQA 3K5WA 2O2CA 4XQ0A 4XRRA 4XAQA 1XD2B 4Q18A 1UC9A 5IU6A 1JBQA 1USWA 4RZQA 1D8AA 3PFHA 4RSHA 1LJUA 1ONBA 2XOXA 4XVCA 3L7BA 3GIWA 3PUKA 3S68A 1XEAA 1CUCA 4IRMA 3CA8A 1VKZA 4IMPA 1CP2A 5CLIA 1FFCA 4XE5A 4BLVA 4COOA 1ICEA 1YJ8A 1Z3CA 1MPXA 3DVRX 3LVBA 4ALLA 5C80A 5KYTA 1G8SA 1UKZA 2RCNA 2Q5QA 2C9ZA 1B1AA 2XVAA 4JYMA 1UC4B 3P32A 3FPSA 5C1OA 2IBTA 2QRQA 4QSHA 4DDWA 2HXGA 2EJWA 4KBGA 1P5FA 4CI9A 2I2WA 2VEDA 4GBGA 3HNOA 3JQEA 2NQ2C 2AS0A 4GUDA 2HYDA 1U7TA 1YASA 3PFFA 2VJMB 4KQXA 1ADYA 1XK7A 4G0NA 4O4JB 1QJ4A 4EL0A 5EJ4A 1NQAO 1ZKDA 2Y1WA 1VHLA 3GL9A 5BSTA 1SC9A 5BMOA 1DOAA 3AHJA 4I1RA 4TWIA 4AKGA 1B0AA 3F8WA 1LDBA 1JYFA 4K9RA 3HB1A 4ED9A 5HRAA 2C95A 1OCEA 2O2YA 1W59A 3FGZA 5SZJA 2C00A 3F67A 4KV9A 5KDDA 1D03A 3ZDYB 1BO6A 3WHLA 1NASA 4FWIB 2PRKA 3MLAA 4KE6A 3V4RA 4ABYA 3R4CA 4BBPA 4C43A 2FFJA 7MHTA 1K5GA 5IXJA 4Y2SA 1CUDA 4TXLA 1XZPA 3AUAA 4G84A 4WK0B 5JECA 2BLNA 4OH1A 5LMCA 4F5YA 5JJCA 5EQTA 4WCFB 5A03A 2DQYA 1EDBA 2E87A 2SICE 3W3AA 1BYUA 2CLKB 3X1DA 3JATA 2IY9A 2J32A 3F3YA 2WJ4A 2YQ4A 1EB8A 3IUYA 1I32A 1L8XA 4HB4A 4QBKA 4Y1RB 3R7AA 1E2BA 2ZIGA 3ZDRA 1M6WA 3TR0A 3BE8A 3IJRA 4RA6A 2XH8A 4U5QA 4ZV7A 3G17A 3KQQA 4BE9A 3F46A 5JISA 3HI4A 3QE9Y 1KOGA 1EGVB 4YAEA 3C39A 1XNHA 1Z5UA 1ISIA 4EW1A 3AFNA 1NQTA 3MHTA 3RG2A 2XMZA 4B8WA 1FJ2A 2DWCA 2R0QC 5JS2A 1W9MA 1PFUA 1R00A 1W96A 2AN1A 3L0PA 4U1RA 3UH0A 4IYRA 5CA1B 5K03A 1WP9A 2BFFA 2ZBEA 3LCJA 2AIRA 3K9QO 4XSGA 1CQIB 3U0VA 5ENVA 2IFTA 2VA8A 3RVKA 4X97A 3SXJA 3TH5A 1OTXA 3Q4GA 2DF8A 2Q5CA 3VR4A 4W7SA 3W78A 4JENA 5CIQA 4HLUC 4AFNA 4A36A 1HKHA 1H1LB 4WQMA 4ZKEA 2I80A 4ERXA 2N9UA 4PYNA 1THTA 1YZQA 5I9NA 1I94B 3CEJA 1T3LA 3FLAA 4U39A 5C1IA 3MGAA 3T7RA 4DJDC 3B60A 1Y81A 4GO1A 4B3TB 4OU4A 1GRVA 3SMQA 2WSBA 3LBNA 5LDGA 1K06A 1W4ZA 2B2CA 4N9QA 4TVSA 3X43A 1ZEMA 3HMKA 1K7FB 4YRJA 2MDTA 2NZ8A 1GZ5A 2O2EA 2E85A 1GSOA 1Z13A 3M2TA 2ISQA 4P0TA 4ZZ2A 2VN8A 3PQ3A 5AOCA 3ZBQA 4DLVA 4X8LA 1ZAKA 5C1DA 4J7CA 2WFAA 3NBMA 4OD0A 3PQ6A 3FDZA 1X1CA 4DHWA 2BH9A 3ESRA 3R7FA 1ODLA 5EGNA 4AWBA 2R6JA 1NF9A 1Y6QA 2CE7A 1ULTA 4WI1A 3OZBA 5KX5A 1GG9A 5JTUA 1WRBA 2Y68A 5ED0A 2BLLA 4DLBA 2YNMC 4B35A 1A4RA 2O2JA 5HWSA 3NHUA 3JQAB 4JKYA 4BFYA 2BL4A 1GCUA 1H85A 1T2FA 1WQ1R 3KCQA 1TVKB 5JSYA 1ABBA 3WGHA 2VK4A 1VA5A 4AICA 4HS9A 4OB8A 4K88A 2GN8A 4DZTA 1AO0A 4AY3A 5B55A 2CFOA 1G0OA 3SXUA 1TEXA 4IJVA 5KSWB 5SZHB 3EZYA 2XXJA 4I1IA 4HYEA 3PUHA 1OXKB 1Z6GA 4GDMA 4WFJA 5D6NA 5BW5A 3UMMA 3ZGZA 3V32A 4GZMA 1C3XA 3IP5A 3DO6A 4IDPA 1SB9A 3VDMA 2X5JO 3ED5A 1FDUA 1LXCA 3HKCB 3RCBA 4EI7A 3TB6A 1OFIA 2WSLA 4NBWA 4KWTA 3OCZA 4GPTA 4RAOA 2CVHA 4QFCA 2AG0A 3N07A 3VOAA 1OFUX 1TC1A 1RJ9A 1D2HA 1XXHB 4V39A 3ZW8A 3PU6A 3PDCA 4DMGA 4DIMA 4IXWA 1J0BA 2ZYWX 4QPJC 3ZV6A 1A0OA 1NM5A 4QASA 1FFXB 3WIOA 4M53A 4C07A 3UUFA 1TCVA 4DM4A 1PP4A 3DOJA 3PX7A 4K0KB 3HCBA 1V1RA 4HL6A 4CEJA 2HBRA 4OHYA 3KLMX 5J2UB 4UBJA 1OWMA 5JBNA 1ONPA 3UJNA 1T5SA 1Q12A 3SYNA 3GZJA 4LY3A 3M9XA 4RD4A 1X7HA 4KFRA 5P8WA 1FYWA 4C87A 1RE0A 2QMEA 4TLDA 4FILA 2GSWA 3KEQA 5AK6A 2QY9A 1HY3A 1VKNA 4M1QA 1P4RA 4PPQA 3L43A 2ESRA 4UQLA 4Y0NA 4YMLA 5AVXA 4DJFC 4IXDA 4KRXA 3NNNA 3MYRA 2GGSA 1KQGA 1PG0A 4IDOA 3M6WA 4K9QA 1KF0A 2BE9A 2XY4A 1H0KA 3FCXA 4TQ9A 4WLUA 4AL4A 3GBVA 4G4JA 3ZE0B 1VMIA 3U4QA 4R8VA 2AW5A 1Y5RA 3E82A 5T3YA 1C7ZA 5K6AA 2YJNA 4RBNA 3SC2A 4A73A 4TKUB 4RZXA 1ATIA 2G36A 1JIVA 3AW8A 1QV7A 1GGVA 1UZAA 1UBHS 2E89A 2P3QA 2PFGA 1WMBA 1M1YE 2N0SA 2PUGA 4QTUB 3MTIA 3VR3D 4IIGA 2V0NA 3GW8A 5LQRA 2QX8A 3G1UA 3RKRA 1QLWA 1XYYA 3UW1A 5IM4A 3NB0A 2AG5A 5C8DA 3R0IA 4CG1A 2OYRA 1VJGA 5CIWA 3PIRA 4IKPA 1EAYA 5FV4A 5IAAA 4YRBA 3K35A 2ZAYA 3W79A 3OQPA 3FOWA 5CAEA 4JJFA 2XCIA 4FT4A 5KX5F 1FRQA 1USUA 4RW0A 3NVMB 2Q4EA 4OM8A 4X1IB 1P74A 4F1JA 1VCMA 2PMEA 2RHMA 1XTIA 2YXNA 5KTTA 1R15A 3W7VA 1JJ7A 1PGPA 4N65A 1P7WA 2Z57A 4GX5A 5DHTA 4F38A 2P91A 1SHZA 4IJKA 4MAFA 4RPCA 4BZQA 2XWPA 3RW9A 4MUAA 2G1PA 5TE9A 3NC1C 4RZ2A 1XTUA 3LW7A 1UPAA 1JE1A 4RGVA 3GWZA 3WMFA 3X1KA 1HLGA 3GBPA 4EY3A 3PEVA 3IE1A 1FFDA 3A58B 1NUUA 1GZSA 1AGXA 4CIBA 3DFZA 3SKVA 1J1UA 3QV1A 1DOHA 1Z2DA 2P5SA 2X8BA 4IIFA 5FJJA 3TRKA 4B47A 4AX8A 3TSZA 4II7A 4P3OA 4LXHA 3RVNA 3SBOA 3JASB 4PSKA 4Q47A 3T9CA 1JR3E 3SVZA 3KR9A 2GN1A 3FPHA 1G21E 1IJEA 1GITA 3KPYA 4TKZA 2R7LA 3FPBA 1NN0A 4FOPA 3DTVD 1MJFA 4QU0A 3ADBA 1BXRB 4WECA 2HF7A 5E6SA 5I8WA 4QHSA 1YKSA 2IP2A 2O3QA 3QSGA 4A8HA 2J5QA 4LVOA 1XX6A 3CM0A 1DVRA 1YKFA 2RHTA 1O58A 2GD0A 3CN7A 3KT8A 5FI5A 1RI5A 4EG6A 3LY5A 5K51A 5C37A 1GYRA 4QBHA 2EDAA 3OZ7A 1K4YA 3U3XA 4NYJQ 3FTPA 1DLJA 3FNQA 1PQWA 3DBLB 1YQEA 3QJGA 2RGUA 4NIMA 3HGMA 2X40A 5E1DA 4XYBA 5JD3A 3PTAA 1Q83A 2PHZA 1BWPA 3KYBA 3PE6A 3ER9A 1Z15A 2Q27A 5ADVA 4W5TA 1HL7A 1F3LA 3EYAA 1K0FA 1EP2B 1RFLA 2G09A 1ECGA 2IP4A 3IOMA 3QEMA 5I9MA 2PSSA 2VYFA 3AP3A 3PC6A 4KQIA 4D80A 5BW4A 4DLAA 3V55A 5B2ZA 5K45A 1FFSA 4RD1A 3CVXA 3WRYC 3IQDB 2WYIA 3WYEA 4UOQA 1R0SA 1OXSC 1JEYB 1TL7C 4HDAA 4BC0A 2E0IA 4G9GA 4RFVA 4U2DA 4TTSA 3TQFA 4HOYA 1TM5E 4U2BA 2XOEA 2J1LA 3B85A 3FOAA 3JVDA 4BNZA 5FFFA 4FOOA 4JLVA 1C1XB 2WJHA 1KQPA 3P97A 3QLVC 3LUHA 2VRCD 4PW0A 3CJQA 5JZMA 1QOPB 2FZLA 3B9RA 5GVSA 1M2OB 1MBZA 2XE6A 4LVCA 2Z5GA 3VHQA 2NO1A 3GVCA 3Q12A 4GZ3A 1HQDA 5IM4F 1H2FA 4L5JA 4IG9A 3Q5EA 5AVKA 1M33A 4ND3A 3GRAA 4QRHA 4GAEA 1MO3A 4RM3A 2NM0A 5CDFA 3SSMA 1R9NA 2QL9A 2O54A 1ADJA 5JR3A 3OLVA 2CNOA 4LZZA 5E0KB 3TZKA 3CG4A 4V0ME 3OTHA 4M0PA 1WR8A 2QI9F 3R0QA 4LJLA 3HA5A 1XK6A 2JFFA 1IBLB 4A3SA 4RY9A 3VPAA 2Y4NA 3OIVA 1TOAA 1G1AA 3RI3A 4IIYA 3AEXA 4LY9A 4X95A 3SDBA 4C5CA 3QF4A 3L92A 2VF2A 1S2OA 2V3CC 3BC1A 4LOLA 5IZ4A 3HPQA 3AQ4A 4FWBA 4RCVA 3FF4A 4LOAA 5KTRA 2QB5A 3OJLA 2VXCA 2JAPA 3O4GA 4FFNA 2IEIA 4RD2A 1Y8RB 1T2NA 2D8MA 5L6LB 3PEUA 1G5RA 2FSFA 2C82A 4RYDA 5AJWA 5TQ0A 4INAA 3ED1A 3R9IA 3HA7A 2JFZA 4MS4A 1BOFA 3RK0A 2WHRA 1TKAA 2QTLA 4UTNA 1PJ3A 1QYCA 1UDRA 3S2SA 4CQMA 1QP4A 2VT7A 1C1YA 1EPUA 4F97A 3MHPA 4ZHQA 1M8JA 4WADA 3DV2A 3TZLA 1GO2A 1MJHA 1TMOA 4UE3S 1O9HA 3C3XA 4AJPA 1I3MA 3IEPA 3GJ0A 2BYTA 2OO5A 2PAAA 3W5UA 2Q49A 3RBVA 3INRA 1J23A 2DTEA 2VAWA 2R6R1 4H4EA 4KO2S 1Y6JA 1W4BA 1W4LA 2QXYA 3ZBUA 2AOXA 3CW2A 4RELA 4L95C 2ZTUA 3NBKA 2D06A 3GMSA 4XDYA 4B7ZA 2IYXA 2PGAA 3JYHA 4MV3A 3NTXA 2W90A 5E6UA 4BVBA 2HF8A 3IEIA 4KQ9A 3VNQA 1L6IA 4RD6A 4D7AA 3EWSA 4M2LA 1XYGA 1MVLA 1SVWA 1HDGO 3PVZA 4CG0A 4W5NA 2COKA 2QX9A 4QWMA 4KPEC 2DQKA 2IPXA 4IHKA 3K0FB 1JWBB 4BV3A 5JOQA 3KYDB 3EF0A 2COUA 2H7VA 3PGKA 4BZWA 5EXDA 2HA2A 4N8EA 1KRHA 2WV9A 3WGKA 3PNSA 4PWZA 5CEJA 4BFWA 1H2BA 3U9SA 1L6RA 3TLAA 3WLSA 3PHCA 2HR1A 2JLWA 2FSSA 3RUPA 1UK7A 2PSDA 2YHSA 4LX8A 1WQ3A 2X5OA 3N0WA 4A6DA 5KC9A 4GL2A 5GIOE 3B9BA 1HRKA 2B5OA 2DM6A 1TIKA 3MWGA 3WMRA 1MIHA 4M0FA 1CRZA 2A35A 6ABPA 1XZDA 1YVPA 4ZO4A 1VHQA 1GADO 4F86A 4AY6A 3E2IA 1O9BA 2R65A 2QJTA 1YULA 4US2R 5FTNA 3QFSA 2WABA 4F3KA 2OHIA 4IV5A 1QO0D 1XELA 1CP3A 2IL1A 4D4HA 4G0WA 3KZVA 4P0QB 4XWOA 5CYFA 4C3VA 4N5IX 1TPZA 3P45A 4DKXA 4UDYX 1R6TA 4L6AA 3GR6A 3VXKA 3LPDA 4BLOA 3AOGA 4ZGWA 4DV3B 4DIEA 3CONA 4GPD1 1U1DA 5A4FS 4BUZA 4E4YA 3QTLA 1PJ2A 2ZYHA 3B1KA 4FFMA 5CDHA 5FBVB 2GJ8A 4DJJA 5B1HA 1YHYA 1YNSA 1NLFA 1GL7A 5JJIA 3RS0A 5LKAA 4EUEA 2VJKA 4L07A 4R81A 3WZMA 2EL7A 1CB0A 1PEYA 2CFIA 4DXAA 2Q9UA 3MQ2A 4NY1A 5E6RB 1Z5PA 1EBUA 3SZ3A 1AT1A 1EK1A 3FKQA 2J67A 1WAMA 5K3DA 1XNJA 2GEJA 2WVAA 3EMVA 3RSLA 1VM6A 2FLWA 4TVOA 1A2QA 2Z3VA 4UXJA 4W5WA 2Q7XA 3VNRA 4D4KA 3LQQA 1MDBA 4Q6BA 1N1GA 1NDHA 3AHGA 1OA0A 2HZBA 2Q3BA 3LXMA 3ROXA 5JRDS 4ZHQF 4BMNA 2Y76A 2B8WA 2HU8A 3I64A 1PVDA 1O3YA 3W5AA 5TXGA 1TC2A 3GCGA 1AQUA 4MWTA 4DIBA 1GA6A 1OW3B 3HPRA 3AT1A 4KP7A 4J90A 3T4PA 2Q28A 3PWKA 1OBOA 4GZ6A 4WASA 1TEVA 3TX2A 1VL1A 4EF5A 4B3RB 2A0KA 4DAOA 1VKOA 1WHSA 3RASA 2PZBA 1SN7A 2Z6AA 4CEIA 1TFUA 3B2NA 1M34A 2W2MA 3B6MA 4LHSA 2YY7A 4C7XA 1R0BA 2IUTA 2XB4A 1JH9A 5BQFA 2HMTA 4JKIA 2OZLA 3VR5H 4ZQEA 4P2GA 2I7TA 4HPXB 1OLSA 5KQGA 1WF3A 2VOJA 3AVQA 2D6FA 3ULKA 4MWCA 2RB5A 3VDQA 5J4VA 4UJ3A 2H11A 2IOFA 2O2DA 3B2EA 4BGEA 4MQMA 2I87A 3GQBA 2ONKA 2XHZA 3AY6A 1WXQA 4O3MA 4UBNA 3JATB 4HQNA 3HYTA 3E9ZA 2LD4A 2W37A 3CO5A 5HUJA 5DE3A 4JBWA 4OG2A 4ETMA 4FEYA 1TKCA 1MG5A 1NBIA 4RA6B 1Z63A 2PWPA 5F9HA 3GLIA 1L4BA 1N1EA 4RL6A 2W2NA 4V0QA 4J0QA 1VJCA 2FWIA 5DXFA 4DJ5X 4PNZA 3DG9A 4H35A 4YR9A 1P7YA 1W2GA 1ZUNA 3JYLA 3K0KA 5JMWA 2VNSA 1GWNA 3AG6A 4EUHA 2VBIA 5TV2A 1A9SA 5AHRA 3LA6A 2BKUA 3OM9A 2QBYA 2BFFB 3OCVA 3NH9A 1SZCA 1FOEB 3BF8A 3W05A 1JAZA 2G7ZA 2VP3A 2QPLA 4JEIA 3GGSA 4H7IA 5ER9A 3U4AA 1IEVA 5JIBA 2JAHA 2VLBA 3RU9A 2P0YA 1TT5A 4ZPJA 1Y1KE 3TUIC 4GIBA 1P6QA 2FMFA 3G8DA 1S2MA 3ZI0A 2ZFUA 2OA0A 1EBFA 4NZMA 4ACBA 1T5OA 2CE2X 3PZBA 5KVQA 4BFXA 4DMFA 3ZI4A 1BDIA 2K6GA 4LHZA 3CF0A 4FDTA 3WHIA 4KFCA 4RC9A 3WK7A 4BO7A 4LTMA 4RTJA 3F6RA