1HNNA

Crystal structure of human pnmt complexed with sk&f 29661 and adohcy(sah)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
261
structure length
261
Chain Sequence
AVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PHENYLETHANOLAMINE N-METHYLTRANSFERASE
publication title Getting the adrenaline going: crystal structure of the adrenaline-synthesizing enzyme PNMT.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2000-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1hnnA00
3KPUA 1UWVA 4RTRA 4GOND 3GRZA 3EVCA 2DULA 5LQKA 4RTPA 3UJ7A 5EMJA 3CJQA 2BM8A 1JQ3A 2PV0A 9MHTA 3HCFA 1KHHA 4PGHA 3TM4A 4ER0A 3NDIA 3OU2A 3KPJA 3C0KA 2GB4A 2PJDA 3T7SA 5K0EA 2IH4A 4CTJA 4V0RA 5EIFA 5E2BA 1RI1A 2ZTHA 2GS9A 2WA2A 4MQ4A 4QQNA 4DCGA 2AS0A 5KVAA 1WY7A 2AOXA 2FCAA 4C07A 3MTEA 1R8YA 3FPJA 4OA8A 3OE4A 2AN3A 3JWJA 4KDRA 3BKWA 5EEGA 1KYWA 1R00A 3TQSA 3PTAA 2AN5A 4RX1A 5DRYA 4AZTA 5LQCA 1JSXA 3E7PA 1QAMA 4KIGA 3TM5A 1VL5A 2CWWA 3KHKA 1RI4A 3KR1A 2JHCA 5LQNA 4ZTBA 3G88A 3LX6A 4EKIA 3FZGA 1Q0SA 5LQRA 2C7QA 5HIKA 5HILA 3DMGA 4KDCA 3AJDA 4QPPA 3G89A 3GWZA 4KVZA 1KYZA 1Q0TA 4FP9A 5HEKA 3ANXA 3DTNA 2K4MA 1PRYA 4PYMA 3HVKA 3KQQA 3KQPA 5IKMA 5K0JA 5T6BA 2PX4A 3BXOA 1JR4A 5FCDA 1NBHA 3FUVA 3GO4A 1AQIA 1VIDA 4IV8A 3RODA 3AWIA 2UYCA 3UBTA 2GLUA 3BWMA 1WXXA 2QE6A 3BWYA 5K01A 2JG3A 1ZHFA 4OQDA 5DM2A 4HTFA 4PYOA 2OYRA 1G38A 5G02A 2HV9A 5CVUA 2YUIA 5ICEA 1VQ1A 5EOVA 5K0GA 5HIJA 2IH5A 4O29A 2Y1WA 4DKJA 2QRVA 3B89A 2B3TA 1TPYA 4AUKA 5FADA 3FYCA 3CVOA 1YZ3A 5FA8A 3A25A 3BUSA 5EKXA 3MCTA 4A6EA 3DXYA 2O05A 1X19A 4P58A 2XBMA 3KQSA 1PJZA 1RJDA 1VP9A 5C1IA 2ZIEA 2GPYA 1ZKDA 3FUTA 4WVLA 1DL5A 3B3GA 4FSDA 4FT4A 3P9IA 4GOLD 4PYJA 4X61A 3HCDA 2E5WA 3ELWA 2R3SA 4R6WA 3OU6A 3TR6A 4V0QA 3KQYA 4HH4A 1QAQA 3A7DA 3VC1A 2HTEA 4E33A 3NJRA 2A14A 3PFGA 4ATNA 4E32A 3KQOA 3OE5A 3FYDA 5DX8A 5C9ZA 4E31A 3V8VA 3KR2A 1TW3A 3LDFA 2HWKA 2AR0A 5GOZA 1F3LA 5DTMA 3KQVA 3LDGA 3B5IA 5EPEA 1HMYA 5FQOA 4WXHA 2PBFA 3OPNA 3SX0A 2KW5A 5D1NA 2OXTA 5FHQA 4PNEA 1FJXA 2B25A 4X1OA 5DRTA 2HR1A 1RJEA 4U7PB 5BW5A 2BZGA 3CJTA 3TKYA 3KPVA 4EMSA 2LD4A 5DM4A 3DMFA 2OKCA 4RV9A 3KKZA 3GXOA 5EGSA 1SVUA 4DCMA 3P9KA 2IDKA 2ZWAA 3G5LA 2P3QA 5P8WA 3I53A 3X0DA 3F4KA 4RWZA 1L3CA 3FUWA 1Y8CA 2BR3A 2HMYB 3A7EA 1VPTA 2ERCA 3SM3A 4X41A 4RVGA 1YZHA 2AVNA 1ZQ9A 2AOUB 1X1DA 2PGXA 5K09A 3ERCA 2FPOA 3PFHA 3JWIA 3SGLA 3SMQA 5HZMA 4JXJA 2HNKA 2IGTA 3G5TA 4AZSA 4RVFA 5GINE 3CBGA 1V39A 1G8SA 3KPWA 2R6ZA 3AXTA 1L1EA 3MAGA 3CGGA 5CVJA 3G8AA 5M5BA 5DSXA 5K05A 1M0EA 3VC2A 4PONA 4MTLA 5GWXA 1KPHA 1F38A 2XYRA 5K0FA 1SG9A 4C03A 2Z6AA 3P71T 4OQEA 3H2BA 3MGGA 1G6Q1 2WA1A 3E05A 5H02A 5E8JA 4P7FA 3G7UA 1X1CA 2PKWA 4HGYA 5DXAA 5EIWA 1XCLA 3E23A 1RJGA 4DZRA 5EG5A 4B17A 5T67A 4EQZA 3I5UA 3TOSA 3A4TA 3KPYA 4OBXA 3P2EA 2B78A 5DM1A 2XVMA 4C04A 1XCJA 3M33A 4M7RA 4OA5A 1VLMA 1NBIA 1ZGAA 3UWPA 2B2CA 3JWGA 4MHTA 3IYLW 3OFJA 3FPEA 4K6MA 5F2KA 4OBWA 4BLVA 4L7VA 3NW9A 3PVCA 2AOWA 4PYKA 4R8RA 1RI3A 3AXSA 4BP1A 2JJQA 4E70A 2QY6A 4MIKA 3OZRA 4P7KA 3M70A 4UOEA 1MHTA 1XTPA 2Q41A 5E1MA 4CKBA 4GF5A 3TPZA 3ER8A 1D2GA 1EIZA 3HVHA 4RTSA 4PINA 3GRUA 1JTEA 1N7JA 4HTFB 4XUEA 4QDKA 3I58A 2JHPA 10MHA 3LSTA 4Y2HA 3EVZA 3UZUA 2ZW9A 1M6EX 5T64A 1FBNA 2NXNA 2OO3A 4MWZA 5HFJA 3RW9A 1XDSA 3D2LA 3T0IA 3UJ6A 1BHJA 3SVZA 3RIEA 2V7EA 3QOWA 2ZLBA 4PGGA 1NE2A 4FZVA 2EFJA 4E2ZA 4E30A 2IP2A 2NXEA 2YXDA 3GU3A 5LSAA 3CC8A 1KPIA 3PB3A 3EGVA 4C4AA 1XXLA 2PT6A 5CUQA 4DQ0A 4F84A 3TFWA 1QANA 5ICCA 3NWEA 4R8SA 5EQJB 3FUXA 4RTQA 1VBFA 2ZIFA 3P9CA 4F86A 1ORHA 2O0LA 3IHTA 1FP2A 3HNRA 3MCZA 3E8SA 4HGZA 2P7IA 2VDVE 2YX1A 4PYIA 2C7RA 4DM3A 5GP1A 1QYRA 3GIWA 3LGAA 1SUIA 3SSNA 3GCZA 3M6WA 1I4WA 1NW3A 4HG2A 2G72A 4M38A 2UZ4A 2OBFA 4GOMD 1KXZA 2ZFUA 3K6RA 4E2WA 1SUSA 1WS6A 3R0QA 4QVGA 3LCUA 4LWOA 2EJTA 5DXJA 2PLWA 5FWDA 3NTVA 5CCBA 4EKGA 1KR5A 1ZG3A 2FRXA 3ELYA 5EEHA 4FR0A 4QPNA 5F2NA 4PYQA 2AZTA 3ID6C 2OPBA 4CWAA 4QTUB 2H1RA 3UJCA 3PLAE 2V74B 1BC5A 1G60A 4RTMA 2GH1A 3GDHA 1G8AA 2PXXA 2G1PA 1O9HA 2VZ9A 4E2YA 4YUYA 1NT2A 3HEMA 1N2XA 3GRVA 2YTZA 3G2QA 3M6VA 4FGZA 4RVDA 1KPGA 4HC4A 3R9XB 1AF7A 4A6DA 5JUWA 2CKDA 4DMGA 1UFKA 1JG4A 3Q87B 1YUBA 3BGIA 4XCXA 3EGIA 4HSGA 3IEIA 5CVDA 3KU1A 5EMMA 4BLWA 2ESRA 1NV8A 4YMGA 3DH0A 5CVVA 3DP7A 3LBFA 3B3JA 4ER3A 2ZZMA 8MHTA 3EVBA 3PX2A 1IM8A 2OY0A 3G8BA 3TKAA 2PX8A 1ORIA 1DCTA 3CJRA 3SR4A 3EEOA 2IH2A 3SSMA 5FWAA 3A27A 3OZTA 4F85A 1BOOA 5DPMA 1JG1A 1T43A 2NXCA 4YUVA 4PIMA 1QAOA 1RI2A 3R3HA 3R6TA 4PWYA 5LR6A 2ZVJA 4CKCA 3LL7A 4IWNA 3THRA 1I1NA 5K03A 3FTFA 3MERA 5EMLA 3ORHA 5FHRA 5CVEA 3P97A 5FTWA 5JR3A 2I6GA 1XDZA 3DXXA 2P3OA 4M36A 2XYVA 4BY9E 2VP3A 3BGDA 4E2XA 2CL5A 3HP7A 1NW7A 4XUDA 1EJ6A 3LKDA 2ZSUA 1SQGA 4C06A 2ZWVA 5DLYA 4U7TB 1NW6A 3GNLA 3DLCA 3QV2A 4RVHA 4CXMA 2ADMA 2UYQA 3KQWA 3UA3A 3BT7A 2NP6A 2ZBRA 2ONZA 3LBYA 2BR5A 3ER9A 2VDWA 1JSZA 1L9KA 1D2HA 1P1CA 2P7HA 1L3BA 3VSEA 5FULA 3EVEA 4X63A 1ZGJA 2F8LA 4KW7A 5K0CA 4Z2YA 5HIIA 5DTQA 3NVMB 1RI5A 5E1DA 3O4FA 3BKXA 3S68A 4LECA 1P1BA 2NNWB 4YV2A 5K8VA 1G55A 1M6YA 3T7RA 5E9JA 3AY0A 1NKVA 3OU7A 3DLIA 5BXYA 1JQEA 3DMHA 1EQAA 3DULA 5E1BA 5E8RA 3FTEA 2OB2A 3FPGA 4KIFA 2OZVA 4GBED 2ONYA 2PVCA 4BP3A 5DSTA 4ER6A 3MQ2A 2ZBQA 5GM1A 3HA3A 1BKYA 1N7IA 4P7JA 3UA4A 3NDJA 3NVKI 5ICGA 1FPQA 3O7WA 4YMHA 5HIMA 4AX8A 3TLJA 4FS8A 4PYLA 5E9QA 1EJ0A 3G2PA 4ER7A 3U81A 5CCXA 2GA9A 4LWPA 2NXJA 2P41A 3UJDA 3P9NA 4G56A 1X1AA 1SQFA 2FK8A 3LPMA 4QDJA 4CKEA 4KWCA 2PY6A 3LKZA 5GIOE 1O54A 2IBSA 3HCCA 4RSRA 4DF3A 2VS1A 5K0NA 2ZCJA 3R24A 4IV0A 3M6UA 2Z6QA 1VE3A 4BLUA 2Z6UA 2PXCA 3EVGA 5LQAA 3LCCA 2QRVB 3IV6A 4P7GA 4YUXA 3P8ZA 5GM2A 3A26A 5DX0A 3EVDA 1X1BA 3MHTA 2QYOA 2AOUA 4QQKA 2IPXA 4M37A 2PT9A 4YUZA 4Y30A 1R6AA 2PSSA 1WG8A 1JTFA 5DM0A 5HOQA 2C7PA 3C6KA 4EVIA 3G2OA 2ZZKA 3HCBA 3HVJA 4CTKA 1YF3A 3REOA 2AOTA 2I7CA 2JHAA 5DT2A 2P3LA 2YVLA 2GAFA 4RYLA 1JG2A 3EVAA 2XYQA 2P8JA 1R74A 2G70A 3QOXA 3NWBA 3UJ9A 4ER5A 4RTNA 1AV6A 5IH3A 4GUAA 3GRYA 4R6XA 2NP7A 4C05A 2FHPA 5EHIA 5EZQA 1R8XA 4C08A 3MB5A 2ZZNA 2IFTA 2G71A 2H11A 5DX1A 3B3FA 3DOUA 3C3YA 1R18A 3V97A 1P39A 5EKUA 2N47A 2NYUA 2I62A 3KQTA 3WSTA 3THSA 2P35A 3TRKA 2ZBPA 2YXEA 3OFKA 2IBTA 2VDUE 2EX4A 3FRHA 4GEKA 4XUCA 5ERGB 3SXJA 2BR4A 2YXLA 4YV1A 1VP3A 2JH8A 2FYTA 2ZULA 3CKKA 3BWBA 2YR0A 4GC9A 4YV0A 3FRIA 2O06A 3FPFA 5C0OE 4YUWA 5KYGA 2AOVA 3GGDA 5FQNA 2AVDA 1HNNA 3PT9A 1TW2A 3UJ8A 2DPMA 3LHDA 4PYNA 1IXKA 3EPPA 2BH2A 3M4XA 3NMUF 2OB1A 3UJAA 3P2IA 3UJBA 4QVKA 5EZSA 1L3IA 3KR0A 5B1SA 2O07A 1I9GA 4RTLA 2B9EA 3DUWA 4GQBA 3HVIA 1INLA 3FTDA 4GC5A 3HCEA 4RTJA 1RJFA 4ISCA 2ZIGA 5KQSA 3LECA 1U2ZA 3M6XA 5CM2Z 3FUUA 1JQDA 4IKPA 1Z3CA 1EG2A 5DWQA 1EAMA 3OCJA 3I64A 3LCVB 2ORED 3FPHA 5EC8A 1AQJA 2UYHA 2PX2A 3HTXA 3C6MA 2FK7A 1WXWA 5F2OA 4DA4A 4FSXA 5D1HA 2IDJA 2EG5A 3KR9A 5E2AA 4HRAA 3EGEA 3K0BA 4QTTB 4AZWA 1SKMA 1WZNA 5FUBA 3I9FA 4RTOA 1DUSA 5KS2A 3HM2A 5EHGA 1UIRA 5EVJA 3HCAA 3EVFA 4X60A 2YQZA 3EEYA 3ELUA 1B42A 3P2KA 5BP7A 5DTRA 2O57A 1KIAA 1XVAA 5EMKA 3T7TA 4KRGA 1NV9A 4R05A 2WK1A 3FTCA 3ME5A 3CCFA 3TMAA 3BZBA 1P91A 2PXAA 5LQJA 3KQMA 2PX5A 3DXZA 4GOOD 4LG1A 3OZSA 4PCLA 2H00A 7MHTA 1XJ5A 2JH9A 3G2MA 2P40A 5K0LA 1IY9A 4AZVA 1FP1D 5KQRA 2XVAA 2Y1XA 5LQUA 3EMBA 3HA5A 3JWHA 2BM9A 3PX3A 3BWCA 3L8DA 3ELDA 5E9WA 1XDUA 2QM3A 3DR5A 1H1DA 2AN4A 2UYOA 4EK9A 5BW4A 2C7OA 1D2CA 5E1OA 5ICFA 1YFLA 3Q7EA 3UFBA 5U4XA 4H0NA 1NW8A 3B7PA 4RTKA 1QZZA 3GRRA 2AOTB 1YFJA 3MTIA 1OR8A 2PWYA 4NECA 5MHTA 3VYWA 1MJFA 1YB2A 2G8NA 4PIPA 5FA5A 3BGVA 3GJYA 4PCAA 5CD1A 4POOA 4FT2A 3SSOA 1NW5A 1O9GA 2CMHA 2EJUA 3LDUA 4OX9Y 2CMGA 2PWPA 3C3PA 3HA7A 3PS9A 3O31A 5GIPE 2I9KA 1KP9A 2P1DA 5K0BA 1JG3A 5CIYA 3EMDA 2IIPA
chains in the Genus database with same CATH superfamily
3ZN2A 1XFDA 2FJ0A 2PZ8A 3OTOB 1KMCA 4UHDA 1E6CA 4ZI7A 3KB6A 5AOAA 1DQSA 3RVPA 1FJGB 3L6RA 4AY3A 2PWZA 3TW4A 1RPZA 2OZEA 5AVZA 1IRIA 1VHTA 2ZJBA 3RF6A 4MQFA 3NB0A 1K8YB 3F46A 3C39A 1H0SA 1A8SA 5IW8A 4DIFA 3RAJA 4ND3A 3EK2A 2N75A 1ZCJA 4CCYA 1YI1A 3S1AA 3UAVA 1BJTA 3BMCB 3N1UA 4R7GA 1A76A 1TYDE 1Y3IA 1JKFA 3O84A 4ZRMA 2VPPA 3PPVA 4TWBA 1SCDA 3AIIA 3KZXA 1XWIA 2QP3A 3T5CA 3E3OA 3HBJA 4C07A 5C8YA 2I7VA 1CCWA 3KJNA 3UB3A 5ER6A 1U0NA 3SPXA 1C9YA 1OVMA 4D82A 1P6UA 2UUPA 3NRCA 2B7CA 4FC6A 4K9MA 4RPKA 4U63A 1URPA 2WSSA 1VL5A 5IBPA 1NVEA 4MRSA 2PGNA 1GL3A 1R0XA 4ND4A 1KOLA 1VG1A 2ZI6A 6GPBA 3G0DA 4OHFA 1Z56C 2FV8A 3E3MA 3ETNA 4H1UA 4JB3A 5DLPA 1KYZA 1LJUA 1YVRA 2G80A 3KE9A 5IBQA 3WA6A 4E94A 4JA2A 3DTNA 1TM4E 1W87A 1XL1A 4MXDA 2JLXA 3OKAA 3HKEA 1J0DA 1H5UA 1UWLA 4JT4A 4U9UA 3VNSA 4TTIA 3D1JA 2Q6OA 1T4CB 4U0JA 4EEKA 3F7NA 3IX7A 1JR4A 4IY1A 3DOCA 1WY5A 4RVSA 5IT0A 3MWJA 3BERA 3NBKA 4BHTA 3O0DA 3Q72A 4O2BA 4TKVA 3TG8A 4KXQA 4CZ2A 2WUWE 4LDPA 1M6VB 3HPRA 2DC1A 4I5IA 5J58A 4MGZR 2P77A 3QU9A 4IO0A 4BVHA 4OHPA 2WIBA 3WBKA 2J45A 1VA5A 2PYDA 2QRGA 3DV0B 1E8DA 3I04A 4MP6A 2ETXA 4ZVVA 2JF0A 2CHFA 5B36A 3KKKA 3KLBA 4EJ0A 1XRPA 4O5OA 4G86A 4J3NA 4A8JB 1E9BA 1HK7A 1X70A 1L8AA 4L27A 5L3ZA 2VEDA 3LT5A 1KI1A 1BCRA 3HR4A 3R0JA 4GBJA 1CB0A 2ZJZA 3NGLA 3P9IA 3TLEA 3SY8A 3A1VA 3OA2A 3LY7A 3ELWA 3HUFA 3N8DA 5K7SA 1N8TA 5ENVA 5ICMA 1U5AA 3DZDA 4NPHA 1L4UA 2SCUA 4EG3A 3KQOA 2CSUA 5PGMA 1JQBA 3O8OB 2JFBA 2GETA 3VU9A 1F4LA 3WDKA 4E31A 4US2R 3V9AA 4RKFA 2BFEB 3W5CA 1DEXA 5JAOA 1IN4A 4TYPA 4IWXA 1P1KA 2WD7A 2YRWA 4B33A 1Z36A 4MYRA 1JHDA 5T4BA 4O4JA 4EABA 2F1KA 2F9LA 4C30A 3OVMA 3L6OO 5HF9A 5B5SA 1SKBA 4PLZA 4WOBA 2OILA 2W2KA 4MWCA 5FHQA 3RVQA 1EYZA 2I8AA 2CJPA 2GBGA 2OO5C 2ZAMA 4M0CA 4U7PB 1M5TA 2QVLA 3OE7A 5FKJA 1Z18A 2BOVA 3DMFA 3ND6A 3KKZA 3P9KA 1WLSA 1PHPA 2CK3A 4NH4A 3WMRA 2HCBA 5A6VA 2B4KA 1MQ8B 3WL5A 1ZMXA 2I2WA 2XDWA 1OX6A 1BYIA 1QE0A 1Y8CA 2OGSA 4PZUA 3W5SA 3V7NA 3WLRA 4AB1A 2OCGA 4BJ1A 1O96B 3L4JA 1ZQ9A 5JS6A 1BE1A 2HSEA 4MR8A 1G19A 2W6MA 2OQRA 3DZFA 3ZUPA 4XJSA 5IK2D 4LEIA 1IMJA 1QHIA 3WNBA 2ZJ8A 1FU8A 4QICA 5F3WB 4OVKA 5A06A 3CBGA 3TI9A 1XDGA 4BKOA 2QPTA 1Z4OA 2AFVA 2R6ZA 2D5BA 2R79A 4WE3A 5J1TB 1WB5A 5TC4A 3FX2A 2HQOA 2JKZA 1X80B 1DC6A 4C03A 1OJLA 4DHWA 4Z3DA 3V8BA 4DV6B 2PANA 4QDZA 1POWA 3EIFA 4L02A 4ZQFA 1WXGA 1UT8A 1H2FA 3MXOA 1WQ3A 4BEWA 4YMUA 1EUYA 1WW2A 2FDCA 3UUEA 2XI4A 3PQDA 3QX9A 3RUIA 4WKPA 4EW1A 2QN3A 1L8XA 1OWNA 4ZHSA 4QXOA 5IVDA 1BWSA 2AE2A 1GFSA 5TQJA 2IWRA 4G81A 4C22A 1H85A 4CUKA 3DLTA 4RVOA 4EGQA 4RKEA 1GPKA 2A33A 1NBIA 3TR0A 1HZZA 2BDEA 1Z37A 2Z4RA 5H7XA 4GAEA 3OMXA 1QIIA 4K6MA 2ZM6B 1Y3DE 3WB2A 2ODBA 1ZVVA 5LOVB 3PD0A 2QY6A 3ZU4A 2DFNA 3RS9A 2ZAIA 4QJIA 1AUVA 1ARZA 5JNTA 5A5VA 1FB5A 2X40A 3CNEA 1JXAA 4PINA 5A4AA 1VSBA 2Q3DA 2HU7A 3L8EA 3ESZA 4GNRA 4Y2HA 3RRXA 1H05A 3BK2A 1MTZA 1DG1G 3S1SA 1AZLA 1M6EX 4HZUB 2XKJE 1NF9A 4MS3A 5GMOA 4XPIA 3STXA 3BK1A 5CG2A 2AKEA 3K0AB 1H42A 3A58B 1GQFA 1KEUA 4JBNA 5JHHB 5ALZA 3ZG6A 1K08A 3OFND 4WA7A 5KKCA 3M6AA 4EBBA 3SU8A 4BV8A 5CLQA 3I61A 4WADA 3BCSA 1CJMA 2DHQA 1YC2A 4X1IA 2FRDA 2C82A 1FLVA 1KZGB 4CVNA 2FQQA 4JL6A 1CRQA 1UDCA 1G6KA 2ZSJA 3BX1A 5T4EA 2OLKA 1PGJA 3GT7A 3ORYA 4LYDA 1RXYA 4OH1A 4YAKA 1A0OA 2RKBA 3NUZA 4H4EA 3OTQA 3TQHA 4COOA 1ISMA 1PU2A 1ZN7A 2GVDC 3OEWA 1ZD2P 1UJNA 3RT1A 3SHTA 5HFNA 1TM2A 2QP4A 2GPNA 3LZ6A 3ZYCA 1EVYA 4JJFA 2I7TA 3PXXA 3JZIA 3KYIB 1REQB 2QTLA 1N1EA 4YXFA 4BYMA 1C3LA 2C95A 3UATA 1BWRA 3IIEA 3O91A 3OEHA 4Y6OA 5G4LA 3ZU3A 2IE0A 4C88A 4L75A 1ZINA 2CHUA 2VYQA 3VJLA 2ARKA 2HCRA 3X43A 1ND6A 1Y4SA 3SWWA 4MUXA 1MO4A 1WHTA 4GX1A 3K6SB 1OOEA 4PQGA 4O4LA 3DE0X 1TZBA 3CB2A 3EZ2A 4L4XA 2G1PA 1KZ1A 4YUYA 3GMSA 4D8XA 1V8FA 3NALA 4DARA 1WUIS 2ZTLA 3PGMA 4OXKA 1WZ2A 2C1XA 4KXWA 2RIPA 5FUVA 5HKKA 1U9JA 5AVOA 4HDRA 5LMZA 2E5LB 3STUA 4HAOA 2OLEA 5F9MA 3W3AH 5JFOA 3TSZA 2NLOA 2XODA 2RH9B 3KYCB 3P0FA 4TN1A 2BP7A 3DH0A 3S2EA 1ZIPA 3HA2A 2W11A 4HFJA 3GVHA 3ZCSA 4EO4A 2OFPA 2OY0A 4EW6A 1E3WB 2QMHA 3CLUD 1Y5MA 2PL3A 4P36A 1SBCA 5DYWA 4Z86A 2UAGA 3PF8A 4NABA 3T1VA 3LUDA 1U4SA 4UJ5A 2WHPA 1FVHA 4ZJZA 3A27A 2OCBA 3E84A 4R8MA 3ZXYA 2Q5CA 1T43A 4MW4A 1EH5A 3E9DA 5DCYA 3KEQA 4NBKA 3MTGA 5SICE 4D4IA 4JZYA 4CKCA 1TQ6A 3BSYA 3T3HA 4KK4A 1F2UA 3TNFA 3PHIA 3OQ6A 1E62A 4JVSB 2AE1A 1T36B 4OK5A 3SZGA 2WG1A 4HQKA 3W3ZB 4ID9A 5IXJA 1ZNZA 2ODNA 3AHJA 4NBUA 2DETA 3ISTA 3WBJA 3I04M 4YRCA 3LPNA 3NR2A 2AG6A 3TZKA 4RVNA 3X1DA 5ERXA 4ND7A 2NP6A 2CNNA 5CT5A 4FYKA 2ZM5A 2TMKA 3TNLA 3DC7A 4R83A 4CCYB 1ONNA 1SKUA 4ZO6A 4CKBB 3S1AB 3VSEA 3UUWA 4G5SA 3EVEA 2FF5A 1M8KA 2HXGA 4R1NA 3DBOB 1BDIA 3T8YA 1UXOA 2CYBA 2OV4A 3O38A 1RJWA 3L6CA 1PZHA 2D5AA 2A78A 4GPBA 2NTVA 4IJ6A 4RDIA 1CY2A 2DUJA 2DM6A 3I1FA 1M6YA 3DMDA 1I2MA 3OZEA 5C8YB 5DNCA 2FMTA 5ARDA 4AJ9A 1J8QA 1FUYB 1HETA 2ZQZA 4GEGA 4IIUA 3C5EA 1QNFA 4TRRA 4MX8A 2QW8A 2QG6A 1UFOA 3LHSA 4QU9A 2BJWA 3RQSA 1RS0A 3NTRA 1TPZA 3PXAA 4ER6A 3E0XA 2KS6A 1BIFA 1P29A 5GOTA 3FMGA 1NVVQ 4IMRA 2NVBA 4U7WA 3OJLA 4PNPA 2JBAA 3FVWA 5J1SB 2VZLA 1Q3HA 4IV5A 4PVCA 4YY3B 4YRFA 3HN6A 3S5JA 3HZOA 3HKEB 4G1VA 1MT3A 2NXJA 1VL0A 5JNRA 5FB3A 1ZLYA 1QH1A 4I55F 1AKMA 2C20A 5F5LA 1EVQA 2D6FA 4G0XA 1P9OA 2PS9A 3H3FA 4EFKA 2XRZA 1DCFA 4XQ0A 3IOMA 4LY0A 2I87A 5GIOE 1V71A 1YQGA 4JBLA 1E3JA 5ITZA 3ZVMA 2I2DA 2YJZA 3DYVA 1RT9A 1R4NB 3T9AA 1PQ4A 3SI7A 3O73A 1WCIA 5HQ3B 2ZUVA 2KPOA 3GV0A 5PNTA 5BOVA 2IODA 3T95A 4MI3A 3PE4A 4PTLA 3JQBC 1YRQA 4BZWA 4U8GA 5LDHA 2K7FA 1X94A 3H2SA 1P73A 3UC9A 5IN4A 4YUZA 3HCNA 3IDFA 2EZ8A 4Y30A 5H3LA 1R6AA 2E4WA 5JMOA 4HH0A 1BCRB 3ETGA 4XEHA 1ZD8A 2GZSA 1V11A 1O94C 2C0PA 2PMWB 2PWBA 3C6YA 3LYAA 1K68A 1G8GA 1A7AA 3Q0IA 3PIRA 4E2FA 2WWVD 4P22A 3OJWA 3QKUA 3EWSA 4S35A 5DT2A 1MO5A 3O4IA 3U1VA 2C59A 1RNLA 1CJKC 1ZXLA 3GVIA 4DV1B 1DO8A 1R74A 4UU7A 2I65A 3GPLA 4N49A 3VU9B 4R16A 1PFVA 4MV1A 1PN3A 1DP4A 4TQGA 5ERYA 1R8XA 4QBGB 3TINA 1Y1TA 5DX1A 1EXNA 4O4JB 1N2CA 4EYKA 4MGYR 5EJ9A 1E2KA 3LC1O 4ZVOA 1E1MA 2TRSB 3KQTA 1YVPA 3PUHA 4IDHA 4EG7A 2NPOA 2NMVA 2NV2B 4M22A 2Q27A 2CXXA 1FCJA 4CMAA 1XKLA 1KERA 1WSBA 2WWHA 1WD7A 2W8BA 3LLSA 1NOIA 1KYQA 2FYTA 2RBGA 2J5RA 2PAFA 1PFQA 1D7AA 3PFNA 2ZBFA 1ODCA 2VF2A 3PNYA 4JI0B 2XOKD 1ZD4A 2WZCA 5TPZD 2FZKA 4D5GA 5BN3A 3CRRA 4MR8B 1V5FA 4XB2A 3DWGA 2JLQA 3K31A 2NG1A 2YL2A 4BO8A 4DR7B 1M8JA 3D6NB 4OP2A 2X23A 1OWPA 3KR0A 3HP4A 4JI2B 2A5DA 1FYVA 1P4JA 2VJOA 1TJ4A 2QY9A 4Q4HA 4DT1B 1U2ZA 2PS1A 3DKIA 5EE0A 2H5JA 4B80A 4EI2A 5JSZA 1WB4A 4V0SA 5CW1A 4C0LA 1V9LA 3KKMA 1XJ0A 1NRWA 3L1VA 3U13A 1HEUA 3TK1A 5F23A 3L4KA 1M8FA 3FSRA 4KFTA 3AF2A 4Z9BA 1ZD1A 3V8QA 3FOEC 4AJ1A 1CVIA 1TKCA 1UQRA 2YN0A 3L7IA 1DIHA 4HRAA 3IA2A 4RD6A 1QNLA 4V0NA 1WZNA 3G0OA 4CLOA 4H7EA 1L6RA 1N6IA 5KS2A 2VRNA 1LNQA 4R0MA 3CUVA 4FPXA 3DXFA 4KV9A 4ZMRA 1JHYA 3ZJVA 1CUGA 2WWIA 1X39A 2IUEA 2VYCA 1NONA 2JCXA 2Y27A 3BE4A 3E27A 3I92A 1DBSA 1G5PA 3VXKA 7MDHA 1V8OA 5LPNA 4Z5XA 5C46F 3KZVA 3EZ7A 5BP7A 4DR1B 2OOKA 1IXZA 2JBWA 3DCIA 4D42A 4HN9A 4KREA 3NHBA 2EIXA 2ZBEA 5CH8A 1R7RA 2Q6LA 3NJ4A 1WW8A 2V3VA 1E2QA 4FFPA 5HS6A 3DDNA 4BX3A 2PH5A 1EX1A 3HFGA 5FPKA 5LQJA 5JCPA 2ID4A 2BEWA 3ZE9A 2P67A 3VYSB 1U3FA 1WBJB 2QD4A 2XCIA 3QJ5A 1XJ5A 5ALEA 4XPIB 4HGRA 3FOFC 3BMNB 1WEHA 1ZGBA 3CX7A 4AZVA 1M8PA 1KFJB 2IHUA 2VF4X 4OHVA 3WQHA 4QJ3A 4TTRA 4DY4A 4IW3B 3C7DB 5AIAA 3GDOA 1HM5A 3WB0A 5E9WA 2PZEA 1JAYA 4WFIA 3OX1A 4IJKA 1TA4A 2QD5A 3E03A 1XVUA 4H08A 4JUFA 2VAVA 5K6RA 2EARA 3QU4A 4JJ4A 1V7ZA 1T13A 2D1TA 5AYVA 1XF9A 2D13A 3GLUA 3J7TA 4OP1A 3U4HA 3BEDA 1DC7A 1QKIA 2GN4A 3RK4A 3IP8A 4YAFA 1JU9A 1Z6YA 4FT2A 4GDMA 1L5KA 3NHSA 2VSYA 1NAHA 5CGZA 1KP9A 4M0DA 4YJHB 4LXGA 3SKXA 4B2IA 4X20B 1P0FA 3PDIB 2BONA 5CCXA 2PRSA 1ESEA 4MV0A 3RIYA 3GYBA 2A4KA 2GCEA 3C97A 5BSVA 3ZE7A 2GF0A 3HCFA 3WWDA 3ETHA 2HSGA 4MR7B 4OHOA 4BZZA 2MSWA 3E2MA 3BDIA 4EGCB 3T3IA 5K20A 4O4LB 4NEHB 4WKBA 2H9AA 4M8SA 5JSHA 2CZGA 4JXXA 1I5EA 1UODA 2AQKA 5E3HA 5EIFA 1RD4A 3E8MA 4G0MA 1QK4A 2XHZA 3A6GA 1EP2B 3VC3A 1L1RA 1TOAA 2BFBB 5EJFA 1TQ4A 3BIOA 3DDSA 4MV5A 2WU3A 4BDTA 3TNJA 2G9QA 2G77B 1CQWA 2BP7B 5HCIA 2Q99A 3G9XA 3HUTA 2AN5A 4GP7A 5MGBA 1TYCA 3KHKA 2V4ZA 3NM4A 1UKAA 2WU4A 3DZKA 1E20A 3NHFA 1DLIA 2V6FA 4NG4A 4D80A 3KZKA 4JVMA 3VR3D 5ALTA 3LXUX 5I45A 3A4IA 1FFBA 1RMQA 1YZNA 2YV1A 2EDCA 2YWEA 4KVZA 5FO1A 3DTVA 1QV7A 5LD2C 4AI6A 3D54D 4Q9AA 2I67A 3LC2O 1WTAA 2HB6A 4DYVA 2DBQA 3DZGA 3VR6D 4FJ2A 5EQDA 4CKCB 5AW0A 5T6BA 5K0JA 2CNLA 2ZRQA 3TAHA 1IHPA 3E1GA 4AG5A 3G3EA 1ZD9A 1PV1A 2MR5A 1ACMA 4LSZA 2W2OA 3ZWVA 1A5AB 4PX9A 4XLTA 4C2AA 4Q4LA 4LY3A 2GEFA 1SN7A 2JD1A 4X8LA 5FNVB 3RIMA 2FSPA 2QEQA 4NPCA 3A9UA 3N39C 1XJWA 3ND9A 2XEXA 4GU5A 1JLLA 3UJNA 1DMRA 3U6BA 1H9AA 3NORA 3R6LA 1NDUA 1HO3A 4A1FA 1EDEA 2QRZA 4LRSB 2K2QB 3HN2A 1TZMA 4BN4A 2OBNA 3CVOA 3RANA 3HBAA 3Q7QA 4NCBA 2FZ5A 1Z5NA 2NSJA 3FPSA 1EWYA 3TRDA 5CIWA 2JGMA 4Q3DA 5EUMA 1N2HA 2J6CA 4JS0A 5LOVF 4QWMA 3RG8A 2ZIEA 4V24A 1RKXA 1ZKDA 4JZKA 3B3GA 1K5PA 4UZEA 1NN5A 3R5KA 1SXGA 2DUMA 4PXYA 4WVLA 4NBWA 3AFGA 1MC8A 4YREA 4R6WA 3VKFA 4A03A 2BFPA 2I3DA 1G7CA 4HH4A 1QFSA 4OSPA 5CT4A 5FXMA 3SCZA 4B83A 3U37A 3QSGA 4YVFA 3NYWA 1OFUX 2J4DA 3AR8A 2UUAB 3A2MA 4FLFA 4G2NA 2V59A 5T57A 2VQFB 2YY5A 2O8CB 3T3GA 1YACA 4Z7OB 2GBCA 3LDGA 4MVXA 4M53A 1NWHA 1NNI1 2YVKA 3IESA 4BQIA 1P5RA 4OXRA 3P4YA 3QP9A 3K5HA 1MP0A 1P45A 4Q19A 2K87A 3VR4A 1OILA 2P75A 3O4JA 5GJCA 3LK7A 2HF8A 2G5CA 3LNTA 2Q4EA 3JTEA 1IEQA 1NRXA 3D6TB 2FZ4A 3KPVA 1V6SA 3OPQA 5EGSA 5ITZB 4C2UA 4U2FA 4H3VA 1GZ5A 4OB8A 3G7SA 4QQRA 5IKOA 1GA4A 1NJ6A 2RGNC 4K2AA 5AUQA 3TTYA 1GT91 2RHTA 1NBAA 3RS0A 2IYEA 1GSOA 2IHKA 3KDSE 4ABYA 1ODTC 2ZTVA 4I9UA 4DLWA 1VSVA 2GI4A 5JXGA 2VBIA 4XB1A 5EL0A 1L5ZA 2BFDB 3DUFB 4HLNA 4JXJA 5EIAA 5CFMA 4MKHA 2JVJA 5AW7A 3TLXA 3H8SA 4FYXA 5C31A 4PNHA 3GJSA 3UH0A 3D2AA 2OBYA 4FE3A 1V11B 5KNBH 1AKQA 1UBHS 1KWGA 4NU0A 2DZDA 3MJ4A 1L8OA 5CXSA 3RUFA 2BZSA 3KS9A 4QUBA 4U7FA 4JVOA 4LJKA 1K7EB 3I45A 3T1QA 4E15A 2WA1A 3DBRB 5JHGB 2FMIA 3C6XA 1DZ3A 1HG1A 3SICE 1V43A 1X1RA 5ESWA 3WL6A 1I1OA 1GV0A 1Y3FE 2B69A 1P2SA 1GTRA 1E98A 2RGGA 3K70D 3I83A 1Q20A 2Q0XA 1GRRA 2EBHX 5D8DA 1HOTA 2A8YA 4Y3UA 3GLGB 3KYJB 1Q11A 4K0KB 4ZQIA 2GK3A 1N2CB 2GKSA 2A5GA 1ZNYA 4UREA 3CKLA 3JWGA 4MHTA 2YYAA 1DZIA 2XGGA 3IYLW 3MRVA 4ZO7A 3IRVA 4LHEA 4BAZA 4DKXA 4L7VA 4B7XA 4JITA 3OWHA 1CUWA 4URVR 2FP4A 2JJQA 2I4MA 4P7KA 2JNWA 2W8BB 1NQWA 2E4VA 2QTAA 2QRHA 3K4HA 4MW6A 5E1MA 3U1TA 4S1OA 4ZVQA 3MLBA 3A6ZA 2B61A 1O95D 4X91A 2PR2A 5DBEX 4LQCA 2FE1A 1GILA 1EP1B 3Q3HA 4E46A 3RSSA 4N03A 4GGMX 2NAPA 3IUQA 3TBFA 4C7OA 3MFYA 3F97A 4PC6A 4Q4HB 2YFHA 1IXRC 2EFHB 3CPJB 4DMFA 4CIWA 3SJCA 2VHTA 1NJFA 1ONOA 1UMBA 1OJ7A 1DIBA 5AKEA 2PRIA 4E5VA 3GEDA 1KPIA 4IUBS 3ORFA 2VRBA 2ZPUA 2LDXA 3ONDA 4HQOA 3DE2X 5EFZA 3AHFA 1DPGA 2QPLA 3G59A 2V5UA 1WTCA 1PV2A 3TZQA 4K40A 2EFGA 3E8SA 1XZ8A 4NYMR 4FMPA 2B4YA 3ZJ4A 1E3QA 5C8YF 3C8ZA 3ABOB 1IBSA 4WQMA 4X8HA 2YUTA 2QMYA 4HH1A 2G1KA 2JEYA 2ZT6A 2KM1A 3CX3A 1A3CA 4FGLA 4MVJE 5BWMA 2G72A 3UGTA 3CYFA 1KP3A 3VHRA 2J7KA 4C7XA 3AB7A 3V8EA 3AJRA 4UD2A 5THKA 1PYDA 2AYXA 4ZFNA 5FWDA 5IASA 2A9PA 2XOEA 2I6UA 2GT1A 1GAWA 1ZG3A 2C9ZA 2YS6A 3OI7A 4FR0A 2XNDA 4PX5A 3QELA 4OU4A 1NTRA 4CMJA 1RKUA 4UW9A 2AF4C 2VXCA 1XYGA 1OLXA 3SXPA 4CLXA 4JC8A 2X14A 4KH0A 1Y6GA 4FB5A 4XIYA 5CM8B 1VDMA 3ZI7A 2F43A 5L8VA 1MEOA 3A4YA 3LUBA 1XEFA 2QLMA 2YCBA 1CIVA 2YZ2A 5FBZA 3H42B 3PENA 3TGLA 5K8CA 1YUBA 3WP1B 3BDAA 4DPLA 3IKMB 2IPMA 3OCUA 3QUBA 5CP8A 2MYTA 4BGEA 4BLWA 3PFWO 2WAAA 3TSAA 3HABA 3IDOA 3B48A 3UMCA 1ILEA 5KYNA 4DA9A 3BOSA 3IE2A 1EUCA 4K8RB 5TF4A 4GR9A 2P9FA 1Q6YA 2J3QA 3W04A 3OM0A 1XZEA 2V7GA 2V7QA 3ZCUA 3EN0A 2M1XA 4CV1A 5TNXA 1E60A 2A5LA 1JDTA 1TI7A 1Y9ZA 2KHZA 2X58A 5HZKA 1PT6A 3MJCA 2HF7A 1E0DA 5I47A 1JIKA 4IWNA 2W37A 2D0PB 3P9ZA 2VOJA 2JK0A 3OD5A 1BNCA 1C8VB 2ENUA 5KU7A 1CR2A 4BPBA 1YK1A 4CTNA 1SUEA 1ZO8A 4JP3A 4YAJA 3X1JA 4YK7A 2BUAA 2XRYA 2XE6A 5DLYA 4N3GA 1NW9B 3Q4GA 1UKZA 4L16A 5F5XA 3GNLA 4MVJI 3BT7A 2PU5A 4AP5A 4O4JF 3NAQA 2AEEA 3BGWA 2Y0PA 3UMMA 5I3ZA 2H4FA 2PUCA 1L9KA 2XZPA 3CNHA 3LF1A 3SKVA 1U7UA 2BFCA 5AQ1A 1W4LA 2IYPA 1THZA 3JSAA 1KH2A 3RREA 1NULA 1F6WA 3KVRA 3WMFA 5LP1A 1P1BA 4U3JB 3MAAC 1PTJA 4EHDA 3FCEA 4B6GA 3CRQA 1NG1A 3OPMA 4PHFA 1PK7A 1H4SA 3W8RA 1FP7A 2CJXA 3RO7A 1BXZA 1LSSA 4DJTA 1YVDA 1R9MA 1LBSA 1ODFA 2O3UA 2ONYA 3N2LA 4LOJA 2OZLA 3PUZA 4LF6B 2BTEA 1G5IA 1ZWKA 3EAQA 4FFBA 1X3SA 4LYJA 4HB0A 3WY9A 3HLTA 4KMRA 2ON6A 5HIMA 1XU9A 3AI7A 5KNDD 1TM7E 1TF2A 2Q6IA 3HPQA 4NJMA 5IAJA 2ZB2A 3WNZA 5AM2A 3HR7A 3BIXA 2FMXA 1OKKA 1OU4A 4FW8A 4EHHA 1HDCA 1B0AA 5J43A 1D6MA 1YMQA 2OPHA 1ZR2A 3U60B 1RAHA 4FHGA 1NUSA 2WQ7A 3R3YA 4G4GA 1U02A 5GPBA 5IKPA 4UDOA 3M89A 4EUKA 1UDAA 4YLYA 3MWDA 4YACA 3VPBA 1A4IA 1JLLB 4GYJA 4KNVA 1DCKA 1EINA 4Y6QA 5K0NA 2VP6A 3WNDA 4IMJB 1U0SY 4EG8A 1ULHA 3JR3A 5IZ4A 3B2QA 3L04A 2C4NA 3ONWA 2RK6A 4C6SA 2VN8A 3H1AA 6ADHA 5D5PA 4YRZA 5CEEA 1M6WA 4PHCA 1VYTA 4RFLA 5SZKB 2TMYA 3N8HA 4L8LA 3VPGA 2TS1A 4LRWA 2P9HA 2Z56A 1K2VN 1Z33A 2A35A 1LS6A 1WPGA 1F7VA 4PZCA 1EFVB 2C7PA 1FX0A 1C0PA 1NPYA 4HMOA 4REQB 2HSJA 3REOA 4JBGA 4MW2A 1ZJJA 1Z8FA 2V8BA 4MUIA 4B73A 1KZ7B 2P3LA 1AZTA 4BFSA 2DQZA 3DAPA 4DWVA 4I0WB 3OJXA 2Z8YA 4P3YA 4AW9A 1UJCA 3L4EA 4RUKA 2W4MA 1E6UA 2HYDA 5JBQA 1NIJA 2R87A 2ZJYA 3MLEA 4R6XA 3ML1A 4FHDA 2EFCB 2A9KA 3CLTD 3K0CA 4IHJA 4TT8A 1B4DA 1TU0A 5AW9A 1XKXA 4CT4B 4ZTUB 4PNZA 3RFTA 1P39A 2FUG1 1JSCA 4HY3A 2AJBA 1HRKA 1Z7WA 2YWBA 4A0GA 1N34B 4TLBA 4YROA 1T8YA 1G6HA 3NFRA 2YXEA 4IP0A 4WCDA 4BN5A 1NSFA 3IAHA 2VPWA 4C4XA 4KEAA 1P5HA 2IBTA 2H4HA 4KQFA 2H0QA 4M1MA 2J46A 2ZB7A 5AKGA 1YQ9A 4YASA 1DEOA 1DTWA 2SKCA 1PJCA 3GCXA 1PWZA 4AJHA 1QDEA 1V7PC 1GNLA 2CUTA 4D4GA 4YUWA 1GP2A 4X97A 3IXMA 3GGDA 4M1ZA 5BQFA 4DIKA 4EA7A 3DBLA 1D2AA 5I8WA 1I9CA 2VKQA 5JMPA 4J0IA 3WO1A 4DB2A 1OI2A 2CLKB 5JAQA 3ZWBA 3E9RA 3GT4A 3VDQA 3MW8A 3A1DA 3IP9A 3HCEA 3T3EA 1TQHA 3GNTA 2V96A 4O4LF 1YS1X 2PUJA 2GRAA 4NARA 5LBIA 2D7JA 3ADKA 1ZEJA 3OCJA 3L8HA 5IMSA 2IYAA 4MHOA 4PYRA 2XDAA 4BTEA 3HTXA 3K4PA 4LQLA 4QXQA 1ZI6A 1EDBA 2Z2XA 4DVJA 1KY3A 2OOSA 3EGDB 5E2AA 4EX6A 3JQCA 2G40A 2H06A 1VGQA 3WQRA 1FW8A 4PLFA 2AYYA 5KNLA 1JEYA 1TA0A 5SY6A 2RHCA 1TM1E 2EHDA 3BRWA 3EEYA 4LYAA 5JLAA 4RFSA 5DLQC 5IJWA 1M2EA 1JHQA 5HJ7A 4V1CB 4QNNA 5HNKA 4M7OA 3ENKA 3LFUA 3QH4A 2VXYA 5AW3A 4MVJH 4DY6A 2CT8A 1L5LA 2FW9A 3ME5A 2WY2D 3CX4A 2CLFB 2M98A 5FBHA 3QOFA 1KI6A 2DWPA 2JFHA 4FE7A 1ECPA 3C1OA 2ZRJA 4PCLA 4CMEA 2HGSA 2R8RA 4MWBA 4O2AB 3ROMA 3UAOA 3WYDA 4YI5A 3PKIA 4D9HA 1DELA 2EW2A 2ZRAA 1K92A 2J6HA 1S4MA 3R8XA 3TTSA 5KQRA 5FNVF 3T54A 1VA4A 2NV0A 5ALPA 1EP9A 3D8BA 3PX3A 2XYHA 3GPDG 5CX1B 3C8MA 5J2UA 4R51A 4QGSA 5D5QA 3DR5A 1KI3A 1UMBB 5EZ5A 1BOFA 3KJHA 3ITNA 1UP4A 1PGQA 4MAAA 3T9BA 3V1TC 1LDMA 2BZ0A 2O7RA 2F9MA 4RZ3A 3EUFA 1NW8A 4H0NA 3VU3A 4DGQA 2ZSBA 3GRRA 3I73A 3ROFA 1JXMA 3R3WA 1CQIA 2Q45A 2W2TA 4GICA 4YCSA 1Z83A 1BMFA 3QZUA 4I3GA 4O8CA 3GJYA 2RGDA 2WF6A 2JW5A 1ORRA 4S04A 1I7QB 1NYTA 1BTOA 4QBIA 2J41A 1S3FA 2VUUA 3F7OA 3HA7A 3R6DA 5HRCA 4Q9HA 2AUTA 2NPFA 4B84A 5LXTA 3ZY5A 1T3HA 1UWVA 2BCGY 4TV8A 1RQ2A 2OD7A 3IJEB 2XCQA 2JB9A 5ALIA 3CF6R 4D9MA 4ZI3A 1TM5E 5LQKA 1GKKA 3QELB 1T2UA 1GCAA 4N0EA 1M74A 3CJQA 3I8SA 2IZ0A 5F73A 1UPXA 4TYNA 4BWYA 1EQ2A 1JA1A 1W94A 2XLBA 3E9ZA 4IS2A 1ZH4A 4E11A 1TRKA 3MNFA 1YO6A 2G5GX 1HT2E 1QTNA 4ZAWA 3D6FA 3NEAA 4URZR 4X64B 4GSKA 1H0KA 2G9ZA 4TYYA 3Q8KA 2F43B 2YYSA 4TKUA 1Q57A 2GS9A 2QMZA 2H2AA 2PVPA 1XLTA 3EGWA 2AB0A 3TW8A 5AJTA 1UJBA 2JLBA 3IPCA 4D9JA 3IAFA 3GFTA 2CLMB 4RYDA 1LNSA 3QHAA 1D6JA 4WOCA 1JSXA 1IXYA 4FLMA 1EESA 1XMPA 3OIWA 5ED4A 3GFSA 3JW8A 3O83A 1YHZA 2DPGA 4URUR 3R20A 1C3OA 4JLOA 2OHXA 2R25B 3R77A 1JYFA 3VVLA 5JMWA 3PFBA 1H1LB 1K3TA 2X0DA 2YN2A 1RYDA 2DJ5A 4IZOA 1R6VA 3QTBA 5KYKA 4DLKA 1HV8A 1OIXA 1ZA2A 5FUYA 1PFKA 4RHFA 1DS6A 1ECBA 3HVKA 1GZVA 1PQYA 5IKMA 1UZLA 6ABPA 1P77A 4LKRA 3BXOA 3H11A 4WKCA 2Q4RA 5FCDA 2R5FA 2XHEA 4CETA 2C5BA 1OIVA 4PS1A 3IUSA 2OCYC 1P61B 2UXCB 1ZHFA 1Z16A 4JFRA 5DM2A 2I2CA 4CM4A 1Z4PX 1E9VA 2NO5A 2X5XA 1ZW1A 3NASA 1HYQA 2R11A 2ZROA 1IOVA 2B0CA 3S6JA 1Z2OX 4IF4A 3GJ5A 1FMLA 4HVCA 3IXLA 3B89A 2H52A 4JEUA 1QQ6A 2OHGA 1XYVA 2I4LA 5CG1A 5EKXA 4GMHA 1TVEA 4CQMA 2VNIA 3PWZA 4R41A 3DXYA 1PKEA 3GP3A 3IPYA 3FAZA 4LTMA 4OMFG 3T7AA 3DM5A 1SCQA 3PHLA 4A8TA 1YTLA 1CNEA 4LF5B 3PZBA 1DL5A 3EG9B 4DA8A 5HXAA 2EGHA 2EZUA 2X86A 2YIMA 4X61A 2ZUEA 5CLFA 4V0QA 1N7GA 2PH1A 5JSQA 1DARA 2OZLB 3ABSB 3ZK9A 3TMKA 4ED9A 2A14A 1EWTA 3PFGA 1Z34A 3RS4A 3IFSA 3CLSC 3S1LA 1LNZA 4WCVA 1PK8A 5LC1A 4F6LA 3O1LA 1KKMA 4F4DA 2Q7OE 4BNLA 1LRJA 3EMVA 3KR2A 4OHXA 1NXSA 4NJMB 1X77A 1ZR4A 3LQ4A 4TXLA 3QI7A 4PG4A 1X0VA 2HBRA 3A37A 721PA 3ISJA 2ZATA 4XQCA 3MWEB 1P9RA 3SZRA 1GJRA 2E21A 3UMBA 4HNTA 1SIBE 4W9NA 3UQZA 2FWIA 3F49S 5CDHA 1RIIA 4X1OA 3H1TA 2JC3A 3OZGA 3UOGA 4EZEA 3SM9A 2E4UA 1ECGA 1O6CA 5JI2E 1TEXA 1JL3A 3K0CC 4Z1MA 1KE1A 5F5NA 3ZGNA 3MWDB 2Q2VA 2IDKA 3AI3A 3BFVA 1DWUA 2R44A 3F4KA 1Y63A 3JVUA 3LX4A 4HDCA 1I1QB 2OV2A 4NU5A 2BKEA 3IQWA 3ZJYA 4QEKA 2HMYB 4KVAA 2O2IA 2P30A 2WKWA 5I9BA 3FUCA 5L95A 4RVGA 4M1WA 2KMLA 5BV2P 4W5RA 2G08A 2PS3A 4BMVA 3LUJA 5I51A 1QONA 3RSZA 3KPWA 2XUKA 3SJBA 3EOBI 4EB0A 1C0IA 4HFRA 3PTLA 3CGGA 4MPDA 4QC2A 5IEJA 4OFWA 4HDOB 3LUFA 3DG9A 4BFUA 1NFQA 3I72A 1M1YE 3RC2A 1JAXA 1DKRA 4OHZA 3E6AA 3P71T 3PR1A 3PQ2A 4RXUA 5ALOA 4DMLA 4RGVA 4E12A 1AHPA 4FN4A 4RSMA 4EO9A 1YR2A 2FMKA 4J0FA 5FTJA 3FOZA 1TEZA 1IBKB 3MOGA 4DS3A 4ZYTA 2W71A 2B4RO 2CC2A 2C97A 1QGYA 3L0CA 2FPMA 3X2FA 2GZAA 2H31A 5T67A 5JY1A 1PZGA 3NBQA 3TOSA 4Z4GA 2XVMA 1FFCA 2PKQP 1R0BA 3F8WA 5B3AA 5CA0A 4GPZA 4E51A 5JALA 4GI7A 1AHNA 1NLFA 3JAKA 3UWPA 2AFIE 3V33A 1T9GR 4F97A 1Y42X 5BUZA 3SYRA 3P45A 1CZUA 3AZPA 4V39A 1G5RA 4R8RA 3FSJX 3VKWA 4ESHA 5GAJA 3TRKA 3GPBA 1AO3A 1XTPA 4ZAVA 1DTWB 5BXQC 4ZYUA 1IONA 3VNVA 5KX5B 2GZ2A 4XB6B 4XUEA 1VCOA 3RYFA 1L7AA 1HNWB 4RF2A 2AX4A 3L4BA 1ZCFA 5DYIA 5CXUA 1Y5NA 5JO0A 2ODWA 3EVZA 3SQXA 3DBLB 4A73A 2LKCA 1JBEA 2R4UA 4G5YA 1TZKA 1C7RA 2MT9A 2OO3A 3DKPA 3T0IA 4BJ6A 4F21A 4CLRB 4UDXX 3T7IA 1W5AA 4F91B 4BMDA 3AU8A 5CB4A 3ZE2B 1IN7A 1WDTA 3IAUA 2D5LA 4W8GA 3WGKA 3E81A 4RIEA 2P6MA 4AG3A 3DQQA 4HOYA 1BEEA 3I5YA 2NXEA 5B12A 2DY1A 1H65A 5CVTA 2V6BA 3N6RA 3SFTA 4BLTA 4C6TB 5EHZA 3LL4A 5ICCA 3MTJA 1F0NA 3IC5A 4R8SA 5KIAA 4HEQA 1PJ8A 5E0OA 1ZK0A 1OX4A 3F6SA 1RLTA 1PZEA 4E09A 4P3NA 3QE2A 1V3QE 3S2SA 1HDOA 2CD7A 3NX4A 4DM3A 4KXYA 4BL5A 4DUPA 3LUAA 1BRTA 4RMNA 3SXUB 1GDTA 1N2OA 3LLMA 1JEYB 2N0SA 1B15A 2XDQA 5KVSA 4N6NA 1GTSA 2J67A 1KO4A 3HXOA 1U9ZA 4H2DA 1J2JA 2PX0A 4HS4A 4FUQA 3QX3A 4B6FA 4ESOA 1U4NA 3DZCA 3IEUA 3DNPA 4NFLA 4UXHA 3E9EA 2R1VA 3FLBA 3E1SA 4EO7A 1DT5A 4WH0A 3X3HA 2HXSA 2XEDA 4RH1A 1KJWA 5JQGA 1KI6B 4CKYA 3B53X 2AJCA 1EX7A 2HWWA 4EGFA 1Z0KA 1MDBA 2HMSA 3G2QA 3SYTA 3U7IA 3KWFA 3NIBA 1KPGA 2JLSA 3F67A 3L1UA 3NOOA 2IV3A 2AA3A 2C7BA 3LT4A 3SHOA 5JUWA 1FTWA 1CJUC 2EVWX 2VUIB 4NYJQ 4HSGA 1N7HA 2A3RA 2ZYRA 2J0EA 4Y2QA 4HWPA 4KQ6A 4JBYA 5J2UB 4KFRA 2CL7X 4S1VA 3L07A 5DV9A 3A0RB 5AESA 3NANA 4HQRA 1ORIA 1KJZA 1SBIA 1BGWA 2H2WA 3JVEA 5DT9A 3GCGA 4JWTA 1TYBE 1QG4A 2QZJA 4TS1A 3H0EA 3QEMB 5MFPA 3TOXA 1CQIB 4L51A 4BVFA 1Z0AA 1AKRA 2BE7A 2FSVA 2A0FA 3D0OA 2HMWA 3DGEC 3E9NA 5FLEX 4BNUA 2O14A 3ONEA 2R6JA 1N0IA 4F96A 2JARA 4Y9DA 2GQ0A 1CF9A 5EE1A 3ORHA 4JI8B 5L40A 1Y1SA 1TADA 3FNBA 4YT2A 3KBOA 4DJJA 3OOHA 4KAXA 3AYXB 1XEXA 4OAOA 4FHFA 1LCIA 1AQLA 2NTYC 2DWCA 1JB9A 2WF9A 4WN3A 3X1MA 2YICA 2YZNA 2DF8A 4EIWA 3RF7A 4GH5A 4EFMA 3O92A 1J8DA 3GVPA 3VZRA 4XWWA 1TJPB 3B78A 3CV3A 1IEWA 1EHIA 2ISSD 3MSXA 4RD4A 5KJEA 3AFMA 1EVZA 1YR3A 2F1HA 2LBPA 1M76A 2BFOA 4ZVTA 2OVFA 2VH5R 2VDWA 3CRMA 3NDPA 2FPPB 4WXYB 3VQTA 4B3SB 1U81A 4P4SB 4V2IA 5NULA 1G8JA 3HRIA 4KE7A 3GMDA 2F8LA 4K87A 2JGKA 4KW7A 4QA9A 4TKUB 5GV8A 1C7JA 4KOEC 3WGTA 5E4TA 1ZH2A 3WV4A 3GNQA 4GS5A 4N5MA 3LVRE 3L7AA 1EFAA 5BVHB 1AO0A 1RZUA 4G0WA 2F6RA 3HWSA 1BZYA 2IXGA 2PSDA 1XCOA 4PLYA 2DTDA 4RK5A 2WSSD 3OU7A 3OM9A 3PXBA 4IJWA 2J9FB 3B5EA 2H07A 4OYYA 3AHCA 4BNYA 1RYMA 3DE4X 4KQXA 3C8UA 4I14A 3P27A 2XUZA 2BFFA 3O8DA 2PLRA 2QLFA 3AFOA 1Z2PX 1N7IA 3DE7X 1B8UA 1YNSA 2IUTA 4Q9JA 3MMXA 1E0SA 3E1KA 1E4OA 5KYTA 4MDFA 2I4RA 5IG2A 3TLJA 2LZ0A 4KBFA 2RC6A 2WABA 3HDVA 2YYZA 3CLKA 3OPYB 4HXYA 4RADA 5HTOA 2QRUA 2GESA 2H1SA 3AYZB 4IGIA 4LZWA 2HHJA 4MAFA 2X4DA 1EK5A 3K0FB 1CG6A 3H11B 3IQZA 4PFJA 2X8JA 3QXGA 1G3UA 2HJ9A 4DRYA 3LPMA 3MVEA 5MN4A 5JDCA 2H16A 2WMDA 1HT1E 3GH3A 4XYBA 1P19A 2BFAA 2FSHA 1DV1A 3LKZA 1J33A 1DRWA 2ONJA 3W5DA 5CT8A 2C9CA 1LJ8A 4RSRA 3W9SA 2PUBA 2F4VB 3RC3A 5B58T 4G0OA 1YRHA 2CKMA 5JD6A 1WMSA 1X92A 5D86A 5GM2A 4C87A 1QQ7A 2BKXA 2W9XA 2QYOA 3L0OA 6NULA 3OZFA 3G17A 3STWA 4BKUA 1FE8A 3WGVA 4DXAA 3FJ1A 3EW9A 2YWJA 1PVOA 4JGIA 1A2KC 3VO8A 1G3IA 3MWYW 4NFHA 5ALJA 5IARA 4JJKA 4PZZA 2AG8A 3VOTA 4IOMA 2H9YA 2OCDA 1U2DA 2WTBA 5ECDA 4CTKA 3KJEA 3CNNA 2VNSA 1SQ5A 4WECA 5CB0A 3W34A 2J30A 3ANNA 3GRPA 4K9SA 1MV5A 5FH9A 3F3KA 2NZ8A 4HNGA 1VTKA 1FPMA 1YQUA 1FNDA 3KZ1E 1PJAA 2G70A 4O2AF 2BPOA 4BBAA 5L3QA 4MEBA 1J7JA 2QGNA 3GRYA 3N0TA 4J0HA 4JI6B 4D8TA 4JASB 4G0YA 4C08A 4WJLA 2FWPA 2FGKA 3R5TA 3UXMA 2QI9C 4C7VA 3ED5A 4UARA 1YK0A 3PJGA 1BEUB 4CNQA 3OUTA 3VNUA 1Z75A 3OE7D 4GGOA 2C00A 3CZ9A 1JPVA 1JU4A 4KAFA 1RZ3A 2P35A 2Y0EA 2AW5A 3HYRA 1U9IA 1Y5RA 4G84A 4L6AA 4E7PA 1KGDA 3VR0A 3L92A 5BPFA 5K8IA 2VWQA 1RBMA 1BJKA 4I81A 4TVSA 3W7BA 2L0XA 3FRHA 3Q3CA 1BMTA 3ZWNA 4YV1A 1VP3A 6Q21A 4K9LA 1A8PA 2XA1A 3ETCA 3NUGA 1R6DA 1FFXA 1P80A 3DHVA 1YOVB 1T1JA 1P75A 4MS4A 1O94D 3EOAI 3VPHA 2PUEA 5JCOA 4I2NA 2HF2A 4IHAA 1BQ4A 2VK2A 4HWRA 1G1MA 1MUUA 4LMAA 4UOQA 3QSYA 3ITDA 1Y7PA 3LHDA 1MIHA 4OXNA 2CVQA 1EDDA 1NAIA 2P3SA 1Y7LA 2ZYUX 2VF8A 2C4MA 3AV3A 4PGMA 4GR5A 3KZCA 4MCIA 3EXEA 2ZBUA 5AKHA 5BW5A 3AUYA 4PICA 3U4DA 4RTJA 4ENVA 1XRJA 1RJFA 3BC1A 1HQKA 2MJLA 3FWKA 4IG4A 5DP2A 2D59A 3FOAA 3K4QA 4BB6A 2QORA 4A36A 1J0AA 2HX1A 2DY0A 2R6CA 1GA6A 2EZ4A 4RY8A 3U7HB 1GAEO 4MCAA 1WP4A 3HI6A 3I12A 3LFHA 4EQ6A 4IVRA 3Q7IA 3B2EA 3EPKA 1J0BA 1JLKA 5DMXA 3VNAA 2L17A 5ARBA 1I7SB 3DA8A 3DHWC 4MK4A 5EHGA 3JAKB 3PEFA 1TFUA 5B53A 2MSCB 3HDQA 4IEEA 3K5PA 3ELUA 1Z8NA 3NHYA 1SU7A 2ZUDA 3TZ6A 1ZI8A 3I6MA 1ISGA 3QLUC 1X6VA 1Z0IA 4ZK2A 2O2JA 2P9TA 2VDMB 3K92A 1Z17A 4OXIA 1P1IA 1RR6A 3TUJC 3VC7A 3CZMA 1LW7A 3FMFA 5AK0A 3CLHA 1P5JA 1XTZA 3HEBA 1MX3A 2DPLA 3TMAA 1EEHA 1QJ4A 3HZZA 4FHZA 2QPOA 1QS0A 4NP6A 3RYFB 3ZHXA 1GGJA 2CJYA 3KQMA 2JFWA 2RHWA 5A6SA 1XA3A 2C88A 4ECEA 3SMVA 5AVYA 4IDCA 2GD1O 2AK3A 5KNCD 4PHGA 5C7LO 1SBHA 5K0LA 2J3EA 3A3OA 5FL7D 3ROPA 1KFEB 2VHVA 3WTCA 5BSGA 2XVAA 1DB3A 1N77A 3PKZA 5CDYA 1DKNA 2ZIUB 5TT1A 2WMOB 3SLGA 2QM3A 5EESA 4ZVKA 3WNCA 4EYQA 3MD0A 2UYOA 1CULC 2VBCA 3ZY4A 4E07A 3M5WA 4QELA 3LH5A 3I3OA 4NAHA 4JLDA 1H66A 1JMVA 1RXIA 4DLTA 1HL3A 5EPOA 4ZKDA 1G8KA 4UXIA 2AOTB 1SXQA 1ENZA 1KFCB 1SVLA 1JKJA 4ZWNA 1D6NA 3ECSA 4AJEA 1A7UA 2E4YA 2YOHA 1Q1AA 1TIKA 1DAEA 3ONFA 1KO1A 2CMHA 3PRYA 2YWDA 3WLPA 3EIOA 4MJLA 5BR8B 2XDQB 1F48A 1BJRE 1I3CA 2RG7A 1G8PA 3NDRA 4FLEA 4Y9TA 2BEUA 4LIPD 4DFDA 4W82A 4EG4A 1EM6A 5IANA 2ZI4A 2Y77A 1RWOA 3LW7A 4LUCA 3JY6A 2DJIA 1JDBC 4Y2XA 3LPLA 5M04A 4AC9A 4RXMA 1VPEA 2C5LA 3B70A 4UMFA 4DILA 2PRKA 3HS3A 3QFCA 4B2YA 1T6NA 1M2FA 1HLFA 3KOYA 5FYQA 5JQGB 4L57A 2VAWA 2DPHA 2VTBB 3NDIA 3NFYA 4Z0HO 2OQVA 1FVOA 1K86A 5H59A 3NOQA 1ULZA 2C4VA 3VPAA 1L5QA 1S96A 2FH5B 4B6QA 4Z49A 1XKTA 1UPFA 1KZHA 3S29A 4F56A 2Z2KA 3W5JA 3D7RA 4ETIA 5I7RA 4FZJA 5BPHA 1ZK4A 1HKHA 1I5RA 2MWMA 2AFHE 3IIJA 1KBZA 1Z15A 4EYOA 2G04A 1SU4A 4PANA 2WAYA 2JFGA 3JWJA 4KDRA 1WKCA 2CVFA 3WK7A 2GEVA 2UVDA 1R0WA 3G2IA 5DRYA 1QFYA 3E7PA 4DE5A 3QPUA 5LVAA 1AMUA 1RI4A 4JCOA 3BEOA 4ZCLA 1F14A 1XVLA 2A57A 3ACCA 1GTL1 2GF9A 1BKSB 4YJ3B 1PFYA 5DGCA 4EKIA 5BWBA 3PGA1 1PJ2A 2G83A 3BXGA 5A2GA 1A95A 4L8YA 1T9BA 3IT1A 4W5NA 1WCWA 4C0KA 16PKA 1L4GA 2ACEA 2QTFA 3D4BA 2XPCA 4LQ4A 3RS7A 3ZZNA 5CFLA 3QKSA 4Q05A 1FFYA 2H9IA 5IXYA 2V9CA 1SVSA 5CPBA 1C9JA 3CFYA 1XZFA 1U0JA 2ZR7A 3GO4A 2XLCA 3O94A 1XEXB 4OTZA 2UYCA 3AESA 4Q1DA 1WXXA 2QE6A 3A1UA 2JG3A 1IOWA 3DEIA 2Y76A 1ZVMA 1AT1A 1I4OA 2FPXA 2NAFA 3PPYA 2W6ZA 3VZDA 1M10A 2L82A 2ZRDA 3IRUA 2P68A 3F6PA 3ZK8A 2O59A 2JFVA 4GLBA 2P8SA 1GYPA 1P6QA 4TLCA 2E4ZA 2Y1WA 1M7GA 4UMVA 1SCUA 5KSZA 3KQLA 3Q8LA 5CMLA 1QGAA 4DR6B 3UXEA 3GJQA 2X0EA 2XGJA 1BCSB 3RARA 2NN3C 1XTQA 1Z5GA 1NI3A 1YDFA 4A6EA 3FTPA 3KT8A 1PR2A 2Q0SA 1C1XA 1OYYA 1W4AA 4WUVA 4F9EA 1E1YA 3A36A 2CYCA 4QQ8A 3V1NA 4JYPA 1EGMB 1UZAA 2OBBA 1SB8A 4CPDA 2H4WA 2IEBA 2Z1NA 1R8JA 4M21A 1LPSA 1QCZA 3B3QA 3S2FA 3TR6A 2XBUA 5KX5F 1IZ7A 2QRLA 1BQ3A 1PW5A 4TMVA 3RU3A 3CUUA 3MS4A 1A9ZA 1UWCA 3PQ8A 5THXA 4B1FA 1G8HA 2P2LA 3PCRB 5DX8A 2YHBA 2G4CA 2GPSA 1NWCA 5AVJA 1MG0A 3RVNA 3RHFA 4K6KA 1K7XB 2X6RA 4F4HA 4OL0A 1TW3A 2HAEA 2JPDA 1U2DC 3DFUA 4HAVA 3COWA 4EENA 1W2WB 3B5IA 1ZMBA 3O4VA 3PNLA 5EPEA 2ZP1A 4J7XA 4K3UA 2BYTA 1GCUA 2BGKA 2EGUA 3TDMA 1V5WA 2KW5A 2X8JB 2WDPA 4TVOA 3RUHA 1FMJA 3CS3A 4FGKA 4OM8A 1V26A 4PN7A 1F12A 1Q0RA 4QLBA 3WIVA 3A05A 2HHHB 2F90A 3H9UA 1QVVA 5DM4A 1P2VA 4UU1A 4DCMA 3F90A 2RHDA 3COSA 2O7QA 1NN0A 4DDKA 3WWOA 3ASVA 3OX4A 3LY5A 1PQWA 1ZISA 2QIOA 4R2WA 5AJUA 2ZUSA 5G0TA 3VRHA 4RSHA 4ESEA 1L7VC 1NL3A 4DGSA 4WNIA 2DHRA 3WK5A 4YMWA 1GU1A 2SECE 4QHSA 4AWXA 1LDYA 1QO0D 1JIJA 1WZCA 1SOWA 4KC0A 3EUEA 4FYMA 4DDHA 1MX5A 1U3DA 2GYVA 1U28C 1P1JA 4MLCA 3NNDA 3QXSA 1PJRA 4ZVUA 1UR5A 3HDTA 3WGQA 3WP0A 4EHIA 5JCOC 1VE5A 2WUEA 5AJWA 5TARA 3GOQA 1UWKA 4HDMA 1P0MA 4RJ2A 2CL0X 2WC1A 1MLDA 1SR8A 3H2BA 1WXHA 2IW3A 1QH9A 2JL1A 1JIUA 1UFRA 1G5HA 4BEBA 3DD1A 3JS5A 1KRHA 1K5GA 4NRDA 3G7UA 2CY0A 3UKDA 2RHJA 1JYSA 2XTNA 4COKA 1FBTA 2GHTA 4JUIA 5L3QB 4OI0A 3TUIC 3JQPA 4MWOA 2J3IA 1SCBA 3A4NA 5EHQA 3C3AA 2PZBA 5J2UF 4J07A 5A4JA 1SVWA 2YJ6A 3K3PA 3DF9A 3V2IA 2VHXA 4NBTA 1E2GA 4PC2A 3WB9A 4A8PA 4EHAA 5H70A 1NPTO 4ZHQA 3HADA 2FDRA 2E49A 1GHTA 3V4FA 2AF3C 3IULA 3M70A 3CQ9A 1BFUA 2F1IA 3PV0A 2PVSA 1T2DA 2Q9UA 3I9OA 5ECGC 3S2YA 5IKEA 3ER8A 4IQ4A 5JJKA 1LW6E 2C0CA 2ST1A 2TMGA 4MS4B 3RLIA 2QJRA 3RVJA 4BLQA 3HCOA 3VYVA 5BV1A 2QMOA 3I58A 3AP1A 3IBYA 1DV2A 3ZW8A 2PV7A 3UZUA 1XYYA 4G5FA 5DXFA 4KKVA 2LKDA 5DNAA 1Q0HA 1GA1A 2QZSA 1U5CA 3FVQA 4TS3A 5C4GB 1G2QA 4I19A 2OXEA 4K0RA 4DBLE 8MHTA 2VPQA 5DK4A 1EK1A 4AMGA 1TGYA 1DDOA 1GRNA 1YB7A 1VLHA 1XU4A 2QVCA 2VL7A 3HB0A 1OBHA 3QXXA 4QM7A 3U4QA 3EGVA 4XYGA 2H4ZA 4XEUA 4XQEA 1DXQA 1BW9B 2IUFA 1G64A 5L9AA 5F2EA 4TYWA 3MCZA 1IQUA 4O2LA 3HXQA 2VDVE 1QF7A 1XX6A 5GP1A 1RFGE 3G5MA 3LT0A 2PWAA 3TDNA 3OETA 3HI4A 2JLVA 1AHHA 3C3BA 5JJIA 2E4AA 3FMPB 4D3SA 3RV4A 1Q1NA 5I4BA 3WTBA 5CCBA 2GAOA 3WIUA 4YIKA 2FR1A 2ATCA 4BFTA 1BU8A 1DI0A 2AI3A 2RJNA 4PYQA 4C4PA 1ADYA 2PQMA 1PGOA 2V4MA 4KXFB 5IHPA 1VIAA 2QLTA 1GT6A 2RSLA 3LQFA 1K4MA 3IR5A 3HSSA 1QS0B 3RIHA 4E2YA 1CZHA 1NT2A 1HFKA 3KC2A 2BISA 1XD2A 1LC0A 4NV1A 4HC4A 3PC7A 3OZUA 5E7MA 2Q2NA 3KFXA 1EDZA 2P90A 2W6CX 2REOA 1U1GA 4H60A 1VCNA 1HLDA 3NBZC 4HEHA 2YIVX 1W34A 1BA2A 2ODAA 3B36A 3PE3A 1K6XA 3JXEA 5IMBA 3H2JA 4D1YA 4OQNA 3EVBA 1DEHA 3A6LA 4G0ZA 4GOJA 1F5SA 4QOJA 4ARUA 2OFWA 5BOSB 4D45A 4L07A 1OV6A 1JWBB 3BMQA 4WBNA 3GJ3A 3IUMA 1RRPA 1GPLA 4B09A 3L1JA 3RADC 1K5HA 3OZVA 1GVNB 1YDHA 4RQUA 4OJTA 4F85A 4YB8A 2ES4A 2I22A 2CMDA 5FPQA 4RY0A 3RVSA 2YW2A 2VNAA 5GZ3A 4Y2YA 4NZZA 1XMIA 5K03A 2ADOA 2RGUA 3UF0A 3ZWQA 3IEMA 1FNMA 1Q7GA 4RY9A 1N5MA 1MVLA 1X7HA 5FTWA 2Q6TA 2J07A 5EJ2A 2HLDA 3OT1A 4MUNA 4GXQA 3TD2A 1NW7A 3DEFA 2JFQA 4KG7A 4L0MA 3VM6A 4JV5B 3G23A 2IXBA 2G88A 4RVHA 1D0IA 3SS7X 2D2FA 1V7QA 4MRMA 2VXBA 1PS9A 2OQIA 3QPAA 2ZBRA 4G9BA 2WFZA 4KE9A 3LBYA 4FBGA 3T5BA 1YDMA 5BV7A 2ZJ6A 5JAZA 1I5OA 1TYAE 3QG5A 3P0HA 2E89A 1G4AE 3IQFA 4N5NA 4QYTA 2FR8C 3D3WB 3IQHX 5DFAA 3DNFA 1Q0QA 3PGJA 3VKUA 3PA8A 4D9EA 4KFCA 3TZEA 4ARZB 2NNWB 3I8XA 3ADPA 2XAAA 1C50A 3EODA 3A28A 4RJLA 3AF6A 4D43A 2GARA 2AXQA 3DT8A 4X44A 3OIVA 4LTDA 4ZO4A 3LRXA 1B16A 1JQEA 3E3AA 5E1BA 1KKUA 2YC4C 2EP8A 3JWEA 3L0BA 3WK6A 5DNUA 3FTEA 1UKBA 5L3SA 1IAQA 3T38A 4EMTA 5CGQB 1IZ0A 1T2AA 2OG1A 3RRBA 3WDLA 1BKYA 1RLUA 3WYFA 2JDIA 1NNLA 2I2BA 2ORVA 3HC7A 1E58A 4XXHA 5JW6A 2OHHA 4X1KA 3E7XA 4ACAA 3RH0A 3W7AA 4FHEA 5D3KA 3CSSA 2G76A 1U94A 3CSDA 4LNHA 4PYLA 5JWRA 1K3UB 4I9HA 4INPA 4QUAA 1E3MA 4F3TA 2WSIA 4KXUA 1JJAA 3BD6A 3OKPA 4ZV7A 2ZB4A 4AXBA 4XWKA 2QI9F 1RJ9A 2XKKA 5JD4A 3R7NA 1JTVA 2JD0A 2WHXA 3F9IA 3PVSA 5CW2A 2PYIA 2CCKA 2WAOA 3AESB 2OHVA 1DRJA 1G0OA 4A0FA 4F3NA 3T15A 1JFVA 1SRQA 5FD8A 4G1FA 4ZKEA 4WN9A 3ND7A 2LE0A 2W83A 3QFHA 1WXFA 2JGJA 3ZNQA 1W93A 2V3WA 4LJ8A 1SCUB 5C37A 4KYUA 1DAMA 3L8GA 3R7AA 1BFDA 1V5GA 2Z8XA 1HG0A 1S7CA 2W6IA 2AOUA 3HCWA 4JCCA 4D4KA 4XD7A 4M37A 2Q9CA 1G8FA 4I6JA 1C1XB 3BSWA 3GL9A 1ZJ5A 4IX1A 1AX9A 1U0EA 1KO5A 5DM0A 2IPOA 1HFWA 2CJWA 2HJHA 5CVCA 2G9NA 4HNVA 3G2OA 3EULA 3HM9A 5ABPA 3WS7A 4KSCA 1MB3A 3DL7A 4EKDA 4YRJA 1Y48E 2XT6A 1ULSA 1KK3A 4RD3A 3W9UA 3CEHA 1UFVA 4BN0A 4HAYA 1C1HA 1UM9A 2PSFA 2X4GA 2W6JA 1HI9A 2E7ZA 4WDQA 3P2JA 3GGCA 3PDCA 1JHXA 3JVDA 4G23A 3PVZA 1ZMRA 1K7SN 3K9HA 4QUDA 2HCFA 4PLPA 1WXEA 1T5HX 3THSA 3RSGA 4JYAB 4ZT2A 3UKJA 1QHNA 1ESNA 1EA7A 2ONCA 2XVYA 3E58A 2V5AA 2Y4OA 3IUPA 3PNOA 5F4ZA 2YHAA 5B1YA 3EXIB 1OFUA 1EHCA 2Y1FA 4X85A 3TLCA 3ASZA 2QUBA 4JNKA 2YC2C 3ZQUA 3EZ6A 3VYTB 3R7BA 3FPFA 4LJ7A 1SHZA 2AOVA 2HO5A 1SQ0A 3H2ZA 1GPDG 1WLYA 4O08A 3RYHA 3M4XA 1X9IA 2A6PA 2D5IA 2J7PD 4JP2A 2AIRA 5KYUB 2X5NA 2Z43A 4F7WA 1P1HA 5EZSA 4F8JA 2R86A 2ZE7A 2QUHA 3FTDA 4DZZA 1QIKA 3BN3A 4OGGA 1CR0A 4GKKB 4RPGA 1HYGA 1KO8A 1S02A 1Y9AA 3C5CA 1JQDA 3V5NA 3VH4A 4D6XA 4EDFA 4UM9B 4RBNA 4J6EA 4KSYA 1JPUA 4W9RA 2YJ5A 3ET5A 2PBZA 1I0IA 4B5LA 2QVXX 4Q48A 4RLQA 3CF4G 1JFSA 4GM1A 4QM6A 1R0YA 5KWJA 1WXWA 3GQBA 2VJNA 2GK4A 5BYBA 5AXDA 3WL8A 1H69A 2ACVA 2HA4A 2ZE5A 3EGEA 2HT1A 4W8OA 5D3MA 5HMMA 1BKDR 5LYJA 3A6FA 3ISVA 1E2DA 4JT2A 4N12A 2HDHA 4QDUA 4H4CA 4DR3B 3QPVA 1YIAA 2EKZA 1OD6A 4DLZA 4YJ3F 3QWIA 1Q0UA 3SOPA 1HQCA 4RQBA 2ZIVB 5JAMA 2J6IA 3AC0A 3RYCA 1YJXA 1DE0A 1ANKA 1LSOA 3FTCA 1SJ9A 1A7KA 2AMFA 4Y98A 3LV8A 5AHKA 1BO6A 2XCUA 3ICCA 1P91A 3LZDA 3QLVA 4UE3S 3Q2KA 3WLHA 2WTMA 4BP9A 2JVIA 4OA8A 2DWOA 4RGQA 3FGNA 3QMVA 4OKNA 4B2PA 2PKQO 5HUQA 4KAJA 3GGJA 1RXCA 2GLXA 1LDNA 3P26A 1W36B 2HIAA 2QQGA 2HSDA 1JEJA 3QXJA 4Z8XA 1HFEL 5C34B 4GRDA 2Z3VA 3DAGA 1P1FA 5C3MA 3BD9A 4ZRDA 4EK9A 3R40A 5IFKA 3U4QB 1RAIA 4HNSA 5BYJA 3AOEA 5CNIA 1B93A 1XRLA 2OECA 1G1AA 2VPIA 5EIHA 3DAOA 3VSBA 1DJQA 1E1KA 5KAMA 5FBLB 2RMKA 3H5IA 1T6XA 2W58A 3BB3A 4ZEXA 3L6EA 3TWOA 4IFBA 4HPWA 2R62A 3STYA 1D4OA 4B3DA 2Q8NA 2O8BA 1XZGA 3A1FA 3PS9A 1W0JA 5AVVA 1OTHA 1EMDA 3RRZA 4DLYA 3T9CA 5EWMB 3RK0A 4PZDA 5J3JA 5JV5A 4XGQA 4DWJA 4CQLA 5JTUA 1KYYA 3ZOZA 3T7KA 4R2MA 4KXMA 4UC0A 2WP8J 2QD1A 3Q2IA 2XUOA 3C5HA 4ARAA 5BWNA 3LT1A 2GJKA 2QE7A 1OWMA 1AF4A 1Q92A 4XI9A 5ALWA 3OIGA 5DWDA 3SIWA 4ZQCB 3MD9A 1W0KA 2O9JA 5IXSA 3DQPA 4B45A 2Z4TA 2XGMA 2WA2A 3OQIA 1S2LA 1KF0A 3E70C 1Y8QB 5A5FA 4FN5A 1SC1A 4ZCPA 1DWQA 3S2GA 1JH9A 1D04A 4K05A 4A0RA 1JEQA 3SVLA 5DHTA 4PW0A 3G2JA 1CV2A 5LQNA 4LZOA 1RPTA 4Y1GA 1E2IA 2V7QD 4Y9UA 5EWJA 1NF2A 3BMQB 3ND8A 3RNLA 4WBNB 1B1AA 2XWBF 3R4CA 3FKSD 4DDVA 5I9LA 1E5TA 5LQRA 3M5PA 3J81k 1GPNA 1K6EA 3SOZA 1KDVA 4G5GA 4WOJA 2V98A 5DBIA 2VHWA 4BFWA 2HQ1A 1RBZA 2VHYA 2A1TR 5A9SA 5AK6A 2H17A 2GASA 4BO1A 4BCCA 4DV3B 2VZ0A 1CFJA 3KD3A 4DANA 2JIQA 1T0JB 3HJAA 4HDKA 2PGIA 4ND1A 4NJEA 2A5JA 3C3MA 1H5QA 3OT1B 1XD9A 3BWYA 4Z9AA 4A2QA 3QUCA 1I7NA 1UMDA 4W99A 3ZWXA 2D54A 5K2OA 1FIUA 7AT1A 3N5KA 1USGA 1XXHA 3HWRA 3IE0A 1H3FA 1OHHA 1Q0ZA 3TJRA 2PMDA 2QMQA 2QTWB 4OGWA 3QLEA 1XT6A 4HK4A 5FIUA 3IBSA 4N0QA 3K9GA 5K0ZA 1HDRA 2QL7A 3PWKA 4K9RA 2IHJA 4QT4A 1LX6A 2AMJA 3BUSA 1CRWG 4ALKA 1OMOA 3M6LA 2LUOA 3CXUA 2H7VA 4W1RA 4OLHA 1CZKA 5FTKA 1HT0A 3H04A 3GJTA 5IFLA 4P83A 3W78A 4JUBA 5EA2A 3I9JA 4GOLD 4KACA 4XDHA 3L06A 5J59A 1J1ZA 2NVUB 5IM4A 1PLJA 2VPYA 3PUKA 4GZMA 2YASA 3JYOA 3H7AA 4GBMA 5L3SB 2ZRFA 4PG6A 1NVAA 4JFAA 5JYEA 2QNBA 3QXHA 3K05A 4PTZA 1APBA 1BX3A 2UZ0A 4LVOA 4YWHA 3VNQA 3WLIA 1F3LA 4IUDS 1CDZA 1IUOA 1CUYA 1OKKD 1OYOA 2B5WA 3BF8A 3HDJA 1YMVA 4X3PA 1Y3AA 4ERXA 1JIXA 1HMYA 3QEJA 4JIGA 3M82A 1YB6A 3W5VA 4F3RA 1RJ9B 4B9AA 4PNEA 2WJYA 1DTSA 1IB0A 4AURA 5CDFA 1ZBQA 1RZRD 4C4YA 4O2RA 4RCVA 2ZVQX 2XYGA 1KR2A 1W5TA 4RV9A 2ORIA 4CF4A 5JNUA 4WN9B 1MOQA 1NE7A 2P3QA 1WZIA 1OFHA 3BA6A 1M0SA 2J9XB 3GPCA 3I53A 3IMKA 1W1IA 1AC5A 2WVAA 3B1ZA 4H18A 2O7NA 3KAKA 2B21A 3BH6A 3R9XA 3RYIB 1VPTA 4ZEOA 3DFFA 5IC6A 3GYGA 3PXUA 1DBQA 2AOUB 2Q1WA 4Y1EA 5C81A 1UBRS 2WWYA 2G17A 5H9VA 3JYLA 3QUQA 2Q4OA 3CLSD 4Q3AA 2JGRA 1DIAA 3GZNA 1GPYA 3WSWA 3ZXXA 1EK0A 3R0IA 4CF3A 3U4GA 1GPH1 2LNDA 3GBVA 4B6OA 2CJWB 3WSVA 3EDMA 4YXWA 4BKQA 3UWOA 5K0FA 1LLFA 2DFKB 2UVPB 2FUNB 1ZIDA 2I66A 4W5HA 4C2BA 2PSEA 4CG2A 2JZOA 2TYSB 2XKAA 3WKCA 4YP1A 2JI6A 2RH8A 2ZRGA 1DJNA 3JQ8A 4UAGA 2Z5FA 4LOIA 5H02A 4P7FA 1E94E 3ZCRA 4V38A 1X42A 3VTKA 1NR1A 2PKWA 1FRVA 2GK7A 5B7NA 1GZ7A 1UM9B 3D3NA 5EGNA 2VIIA 1ZSNA 4HJRA 1E9EA 1DJLA 1I7PA 3A4TA 3FIUA 3P2EA 2DBYA 4KWTA 3D2BA 2ZIXA 4FCWA 4NC9A 3EIQA 1C9KA 4M76B 4U5XA 1NPDA 3M6MD 2WJJA 1VLMA 4BFVA 4CMIA 3B2NA 1SXPA 2AK2A 4B3MB 1IVNA 1PDWA 3D8UA 3KL2A 3E48A 1DKLA 4I4NA 2EKPA 1KAEA 4R9NA 1RLMA 5IP5A 5E95A 2Q8QA 4K46A 4EY5A 5B6JA 1IIBA 4F5DA 5JRDS 5CTAA 1M67A 1SKQA 3QVTA 4ND8A 1ZVJA 2YVUA