2IF0A

Crystal structure of mouse rab27b bound to gdp in monoclinic space group
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
184
structure length
174
Chain Sequence
YDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDAFKVHLQLWDTAGLERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-27B
publication title Structure of the small GTPase Rab27b shows an unexpected swapped dimer
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 46
structure length 174
sequence length 184
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2if0A00
4D6PA 3LNCA 2IWHA 4DLXA 2ORVA 3IUYA 1T5IA 2VH5R 4ZIRA 4Q4JA 3AUXA 4MDEA 4Q4AA 3BK7A 1U9IA 1NSTA 2ZR7A 3P4YA 4TMWA 1N5IA 2NO6A 4PPNA 4LY6A 1Z0IA 2P67A 4P4SA 5DLQC 4AG6A 1D8TA 1U8AA 5SZJA 2F6RA 2E1RA 1H8HA 3KQKA 4U5XA 2FGKA 2J87A 2MSCB 4HSEA 4HATA 5DISB 2WWYA 5SZHB 4LV6A 3IPYA 4MKHA 2J5XA 2WKRA 3E5HA 4BFUA 3MFYA 1GNRA 2Z6VA 4ON9A 1GDDA 1RYHA 5CB8A 1KSHA 3I73A 1YRBA 3WHKA 3IQWA 3R20A 4OQMA 4O2RA 3LBNA 1CR1A 2W2TA 3B2EA 3ZQ6A 3TJZA 3ZH9B 1FUKA 1QHYA 1P60A 4QM6A 2ZXUA 3BD9A 1S3SA 1XP8A 1YZNA 4QRHA 4DLWA 5BN5A 2FFBA 2D74A 4IDHA 1Z0AA 5LDDC 2OILA 3IIMA 2VBCA 3GEEA 4C9BA 2BIFA 2LWIA 4TMXA 2VEDA 4OJKA 2OG2A 2ZJ5A 3HYTA 4AYWA 5KOYA 1N6OA 1U9IC 2QMOA 5B64A 4PO8A 5JBQA 3UXMA 2ATVA 4LHVA 1Z22A 2ZS7A 3L0IB 2XTZA 2V8OA 4QNRA 3BS4A 1SKQA 5EE3A 2YHSA 4Q1FA 1CJTC 2IUSA 4NCKA 3CNOA 4QM7A 3PEVA 4LJAA 2CE2X 1YZTA 1EFRA 2ZVPX 4OI1A 4Q00A 3C5HA 4PXAA 4N0DA 3NG1A 1G16A 5EXPA 3MAAC 3DKPA 3ICQB 1EXMA 2J41A 3AM1A 2ZIAA 1Z5ZA 4TQAA 1E2PA 4M1TA 2NG1A 2R62A 3AP1A 1WA5A 2HV8A 1Q57A 4PPQA 5A5GA 1PLKA 1ZC4A 3K70B 1NBMA 3EAQA 4ESVA 2OE2A 2O8DB 2H1LA 4BZXA 1P4SA 2NZJA 4GRAA 1Z2AA 1IQPA 4S2EA 4F4IA 5DI9A 3PUZA 5FUVA 3KTAB 3QKTA 2ZSFA 2Q3HA 2C2HA 4UNNA 4P33A 1KK3A 4A1FA 1TUEA 5JSZB 4K46A 1YZGA 4JLNA 5KYKA 2WSSD 1GFIA 1II0A 1OHHA 1Q21A 1TF5A 3QPUA 1GL7A 3RS5A 3T1TA 2FFHA 5FBQB 4QBGB 2QENA 5L3QB 1IBRA 1LY1A 4ZDIA 2ATXA 1XDBA 3UMSA 2AK3A 3KKQA 1G3QA 3ZIAD 1MV5A 1D9ZA 1JQLB 4MGZR 1KI4A 4GBMA 3MGCA 4IFBA 1HT1E 1XJCA 2OFXA 4FMDF 2ZRKA 3CZQA 4RD1A 4TMKA 5LB2A 1GRQA 3HPQA 3CBQA 4L9SA 2O8DA 4B74A 1P61B 1CIPA 3WY9A 4I1VA 2FGJA 2DPXA 2OXRA 1MT0A 3A36A 2C03A 1XNJA 2BCJQ 2ZE8A 1U8ZA 4URWR 1ZNXA 3KTAA 1DEKA 3EA5A 1AS2A 1ZNYA 2CE7A 3KB2A 3K0CA 2VF8A 3EIHA 3F5FA 5JSZA 4B3XA 5KPDA 1Q22A 5EE0A 1KDTA 2REBA 1X1SA 1JXOA 2ZU0C 1J2JA 4RFVA 4I1UA 5GJWC 1N5JA 5L3QA 1SZPA 3A1WA 1JR3A 4NU0A 1GVNB 1UJ2A 4GP6A 3IGFA 2IYXA 5CM9C 1YR7A 3UG7A 4NPHA 4ZCLA 2FU5C 4HZIA 1WMSA 2ZRPA 4DDUA 3BJIC 2R44A 1W48A 3PENA 3QVUA 3MLEA 3K70C 5AJZA 4TQUS 4P4UA 1W4AA 2X2FA 2UZIR 3W5IA 3LWNA 3MCAA 5GVSA 2AN9A 4KFRA 3IIJA 3QXHA 2HT1A 5L3RA 1G3MA 4EIWA 4ACAA 5AUNB 2VP0A 1TU4A 1T91A 2V6IA 4PHTA 2Q21A 1T3LA 4O3MA 1AQYA 1OYYA 2LCFA 1G5TA 3K0CC 4YDHB 3EW9A 3LLMA 4BFTA 1KMHB 2HCJB 2C04A 3TR0A 2HJVA 4Q19A 1KI3A 4BASA 5IHPA 3RAPR 4PZLA 2GNOA 4FD2A 3B85A 3SJCA 2BJVA 4TL6A 4ZCMA 3KUCA 4ZCIA 5FOWA 3BFKA 4DCSA 2WWWA 3G0HA 4Y0VA 5IF9A 1P5ZB 3I1FA 4HDOB 2YJTD 3SHFA 2O0KA 4DCVA 2CCKA 1W7AA 1UEIA 4A0GA 3WRYC 1S2MA 1ZM2A 1HY3A 4B32A 2REXB 1XWIA 1P9WA 1PUIA 2YWEA 2PBRA 3FDIA 4LV5B 3X1WA 1FFHA 5JJKA 1OIWA 4YC7A 2ZUCA 5SZIA 2K5UA 4PX9A 3N5CA 4WBSA 2R9VA 1M7HA 2FNAA 2ODWA 4R9UC 3TRFA 1R0ZA 1Z29A 4JLMA 2NPFA 1A2BA 1KMHA 4IRUB 2J46A 4QJ5A 2FN4A 3C16C 1N6IA 2GXAA 2JLVA 3H1TA 1W46A 2YNMA 3IEUA 1UDXA 4M2LA 4CEJB 1ZC3A 4RFSB 4C0HA 5TV2A 1DO0A 1FTSA 1CULC 1M7GA 3IBYA 1DTSA 3KJEA 4LPSA 4OI0A 2BKUA 4DLUA 5G41A 2EYUA 1CJKC 2R6GA 3OHMA 3U7FB 1F5NA 2WWGA 5KNCA 5AJWA 1AK2A 2J0UB 4JVNA 3ZVNA 2OSBA 1WCV1 2GEDA 4RVCA 4LJ4A 3E2IA 5CLLA 1II9A 4O25A 2I1QA 1UADA 2VHTA 1KI6B 1N5LA 3TAUA 4KBFA 4ZKDA 2JLQA 5K8TA 2QMUA 3SJAA 1G18A 4QBHA 1IY2A 2YWHA 4PQFA 1OXUA 1LW7A 1G8FA 1U0HC 2WM9B 2FPMA 2B7CA 2GWHA 4TMTA 2JASA 2Y8EA 5EP1A 3VU9B 4R2IA 2ZRJA 1Z47A 4RFSA 2WMOB 2B7BA 4J0QA 4NHOA 3P32A 3RVBA 5KNDA 3N2EA 2O8EB 1OXXK 3QXCA 3LQQA 1U94A 1DAHA 2DFNA 3OIUA 5DO9A 1W4BA 3I32A 1Z6GA 2VHJA 2J0UA 4GOJA 2PLFA 2R65A 3TSWA 5JHGB 1W1WA 4TLAA 2WSSA 1S9DA 4MH0R 4F4CA 3VR2A 2WIAA 1QHXA 3I8XA 4PR0A 3DOEA 5EXXA 5AUQA 3GLIB 1KI6A 1ONBA 2P6RA 4FXPA 4H1UA 3ZIAA 2KWIA 2ZI6A 2ZETA 4GDFA 3NH9A 1KZ7B 5GJVC 1DAFA 4QJ4A 1A4RA 2EFHB 1XMJA 4A82A 4B3CA 4E5UA 3R9XA 4TLDA 5FTKA 3VU9A 5BYKA 3AVWA 2D7CA 5J4HA 2QPAA 2HT6A 2IX3A 4G0NA 4D0LB 4II7A 4Q5IA 1XF9A 3L0OA 1ZIPA 4OBEA 4HAYA 3KJIA 4K81B 3B6EA 1AS3A 3D3QA 4AG5A 2O8EA 2G83A 1X3SA 1GNQA 1KY3A 2XB4A 4GFDA 2JJ1A 2P65A 2WKQA 4PZZA 2G77B 4PPFA 4Q4LA 4B71A 4DLTA 3A6PC 1XMSA 2ZYTX 2IW3A 3CIOA 1JBKA 1J8MF 2G1KA 4EQ6B 4QC2A 1F2TB 1ZMXA 1Q1ZA 3IO5A 3NEJA 3AP3A 3W5JA 3GPLA 2ZAMA 4DVGA 2F1IA 2DFKB 1YZUA 5A0FA 2P5SA 4M9ZA 2AKYA 4PAOA 2ZSBA 4LUCA 2ZI4A 3SI7A 2G3YA 1KK1A 5IT5A 5CK4A 4ASUD 2XTNA 3RSOA 1F2UB 1JQJC 3PQCA 1E0SA 4MRPA 1YE8A 3EASA 4PQYA 2NO9A 1VG0B 1IN6A 3E70C 4Q47A 2H5EA 5G3YA 3UG6A 1ANKA 4OHXA 2A2ZA 3AVOA 3ONWA 1IY1A 1KO1A 1VECA 1DAIA 2DHRA 4A2WA 1C1YA 1CJMA 5EUQB 1P6XA 3L82B 3ZGXA 1N6RA 1NIPA 1ZYUA 3KKPA 2JCSA 2C5LA 4DSUA 4FCTA 2QAGB 3VFDA 5FBVB 1GIAA 1BKDR 2I3BA 5LPNA 1GKUB 3ZLJA 1CR4A 1F2TA 1BH2A 4HB4A 5E3HA 3WHLA 3K9NA 4M9SA 3T06B 3KUDA 1HE1C 2IHBA 1U81A 1SULA 4RCZA 3R9WA 3IPXA 3O47A 3QOFA 4M21A 5G40A 4DKXA 4O0MA 5FR1A 2WICA 2QA5A 1OB2A 4JLPA 1SXJD 4DCTA 1S1MA 4QBFA 1JXMA 3GJ8A 1YR9A 4IKEA 1EFUA 1Z0JA 1Z2CA 2JIZD 2VSFA 3TQFA 3KXKA 3GJ0A 4N0EA 2QSZA 2XAUA 5HPYB 2F43B 2V7QD 3A1VA 3V4RA 2PJZA 4BRUA 3AF1A 2WTUA 1WBBA 2VP2A 2Z4RA 5DHAA 5CB6A 2EW1A 1LVGA 3CRQA 1G1MA 2IXEA 3BH6A 2GAAA 1L8QA 3EARA 2QAGA 4A8JB 1UF9A 4JLDA 4NH0A 4EPWA 1OXSC 2ZANA 3SR0A 4Q1AA 3TUIC 3VKHA 3B5JA 5DH9A 4XTRA 3K0EA 1MO3A 4YONB 2ZS8A 4GPTA 1E9BA 4B35A 4FMDB 4FCWA 4KLZA 1T5LA 2BMDA 1E2HA 1HEIA 4UKDA 1GKYA 4CZ2A 2FSFA 4MKGA 4BFSA 1GP2A 2VRWA 2QTHA 1T8UA 2QZ4A 1EGAA 2WZQA 4FMBB 1FPMA 4WXPA 2V54A 4IXMA 1G21E 2F43A 3H86A 2GXQA 3E1SA 3CF6R 4OHZA 3BWDD 1SVMA 4V0OA 3N2IA 1R5OA 1W44A 2EFEB 1OF1A 2X77A 1D9XA 3B7GA 3LDAA 4LHXA 4LYJA 3PEYA 2RCNA 1XEFA 4XWOA 4US0R 3TNFA 1KJYA 1X1RA 4UNSA 3PEWA 1ZUNB 4C7OA 1MOZA 2A5GA 4I1SA 2QRNA 4US1R 4C3ZA 2N1BA 4A8JA 1MRSA 3DL0A 3PEUA 1YU9A 1N6NA 3CF2A 2H7VA 2C95A 1KNQA 2QM8A 3WBJA 2EU8A 5JZVA 4Q1BA 2QAGC 4YMTA 1E2JA 2JAQA 3CRMA 1BYUA 3R9IA 3QENA 3CH5A 2KE5A 3DM5A 3F0TA 1J8YF 1KK2A 2ZSAA 3U44B 1X8KA 2YZ2A 4TZ0A 2BEKA 1A5TA 2ZYWX 1MABA 4NYJQ 4Q9JA 3ADBA 3BFXA 3OE7D 4DEYA 1KSJA 4TYPA 4XOIA 2NO7A 2RHMA 2ZJBA 4YMWA 5BQ5A 2IT1A 2FH5B 4LHZA 3T34A 1KO8A 3VMFA 3FE2A 3IBGA 4L9WA 2CCJA 4YLGA 2C9OA 1E69A 2Z5FA 2NO0A 1AQUA 4A8JC 4TQ9A 1N0UA 4XVUA 5CDFA 4MYTA 3V9PA 2OCPA 3U44A 2IC5A 2R6DA 1QF9A 3EZFA 1AIPA 1NLZA 2OFOA 1E1QD 4PC6A 3EC2A 5HCNA 3UK6A 1NL3A 4JKYA 4D4LA 2YOFA 5BW8A 1Z08A 4BWYA 4LBWA 5EE1A 3C5CA 4EPYA 1H8ED 3AF2A 3BGWA 2F3TA 1RRFA 4HAUA 4EJSB 3I72A 2ZS9A 3NDBB 3AKCA 4AIIA 1Q1QA 3B9QA 3UATA 2XXAA 1EK0A 1Z07A 2ZYVX 3B1XA 1JPNA 1KDOA 1QHHA 1CF4A 5K8IA 3ASZA 4DLZA 2G6BA 2QP3A 4JVMA 2PCJA 5DN6A 3HYRA 4ASUA 4DDTA 4LYFA 4Z8XA 2OEPA 1SXJB 4HAWA 4JL6A 4OL0A 3RWMB 1VYUA 2CHGA 3QF7A 4JJZA 1RZ3A 3FOZA 1TPZA 1CR0A 1VDZA 4GMDA 4E09A 1XXHB 4DSTA 3P26A 3KQHA 2GZAA 4Q4HA 2MSDB 3FHOA 3O8CA 1Q44A 2RB4A 3DKVA 1W36B 4DB2A 2C78A 1N3BA 4DZZA 3QIAA 4GP7A 2FFQA 5BN4A 1G8HA 1W0JA 1NSFA 2WOJA 2RGCA 3CH4B 4BZPA 2ZYUX 1JI0A 1E2IA 4EJSA 2JLSA 3GLGE 1I4DD 3AVQA 4AD8A 3SYLA 2IYTA 2R8RA 1ZD8A 1RE0A 4XD7A 1OV4A 2C8VA 4BQSA 1JEEA 4KCGA 2BMJA 3VAAA 4B75A 3O8DA 1SVLA 1XCGB 2PT7A 1DAEA 3C14C 1SXJA 3K0AB 3CRVA 4ARZB 3T1QA 1CLUA 1OFTA 1KYIA 3Q72A 1NN3A 2JIZA 4YXWA 1XXHA 1KO4A 1L4YA 3LW7A 2GILA 2V7QA 3ASYA 5F3WB 2ZQ5A 1MRNA 2AD1A 4JT4A 1IJEA 3M1IA 2VP5A 1P62B 1GM5A 2J0VA 4Q4AB 2UZ3A 3K9GA 3MWKA 2C99A 3QKSA 2DWPA 3ZS8A 3LQRA 3CUEF 2A3RA 2OT3B 4FCVA 2RGNA 1BMFD 3FTQA 1XMVA 4AKGA 2ZJOA 3H0KA 3F8TA 4EJSC 2RGEA 2IS6A 1W49A 4KFSA 5JS8A 1ZU5A 1HV8A 2WOOA 3K0AA 4LHYA 4CEHB 1R0XA 4JLAA 4JVLA 3D7MA 1AN0A 2GK6A 2P3SA 4W5HA 4QGHA 4C0BA 4JBYA 1D2MA 4M4SA 3TVTA 3HR7A 2BBTA 1SXJC 1TQ4A 2RHDA 1RRCA 3KQNA 3HP1A 4Z1MD 1UM8A 4XTCS 4FIDA 3U3RA 3SZRA 1DAMA 5KNBA 2ANBA 4A0FA 1HQYE 4HEJA 1N5KA 2ASEA 2BKEA 1PUJA 3QSYA 1KO5A 2MSEB 3GCGA 2ZI3A 1W36C 3SYNA 2R6AA 2DFTA 1YVDA 4MDFA 1CJVC 3TKLA 2ZI7A 3SC3A 5JJIA 1W2GA 2FMXA 4PAMA 2RGNC 2KJQA 3PFIA 4C0QC 1E9AA 2X8AA 3LVQE 1ZUIA 2PL3A 2BVNA 3MRSA 3NIBA 2B8TA 4CEHA 2XB2A 4TYNA 2ZR0A 5D3MA 1JALA 3MUFA 5KDLA 4NCHA 2XOKA 3IHWA 4NYJR 4POAA 5CYPA 4A6PA 4QFMA 2CLSA 3FKSD 1JAIA 3GJ5A 2P2LA 1U0LA 4C4PA 1T6NA 1ZM7A 2ZRNA 4HZUB 2O8FA 3VX4A 1SQ5A 3EIEA 2XSZD 5E95A 4FW9A 5J47A 5AJVB 2W6JA 4UXIA 1MO4A 4D0NA 2Q0HA 5B30A 2A5DA 3QG1A 2ZM5A 2VTKA 4URZR 4AKIA 1DADA 1I4LD 4BPBA 1UPTA 2OZEA 2GEUA 4RZXA 4B2IA 1IHUA 4Q1EA 1ZNZA 4GMXA 3QPVA 4ZPXA 4O2LA 3GJ6A 2RGGA 2JATA 2JJ8A 5JLJA 3NC1C 3TSZA 4CT5A 3GFPA 1DELA 2GJ9A 1D6JA 4EPXA 3Q85A 3PVSA 2ZRIA 3X1YA 5AUPB 3RYTC 4QNMA 1GG2A 1NKSA 1NLYA 2GBLA 3GLHB 2AX4A 3OESA 1E1QA 1GITA 1XZPA 2LKCA 4NYMQ 4XIGS 5JEDA 4HZUA 3UMRA 3TLXA 3UIEA 4V0ME 4DLSA 4NDZA 5H68A 5LBIA 1CTQA 1LFDB 1SKYE 5DSZA 1XEWY 2BMEA 4JLBA 1R2QA 2GJ8A 4G1UC 3SQXA 1FX0A 1XD2A 2IF0A 1E94E 2OCYC 4X8LA 3AVUA 1COWA 4RCYA 2N46A 3WNBA 4MKIA 4C0KA 5DGXA 5TDHA 3MJHA 1A2KC 1QVRA 2IYYA 4P0TA 2DFLA 4KLNA 3B82A 1L4UA 1CKEA 3KKOA 4E07A 5EJEA 1IXZA 1S3GA 1XZQA 2F1JA 1ODFA 3MWYW 2GETA 4HB2A 3PITA 2VPPA 1JB1A 1XTRA 1TMKA 4Q21A 4X8MA 4F93B 2PJRA 3QEOA 4Q1CA 4TYYA 3GLHA 3NBXX 3EPHA 3TVDA 3LW8A 4C30A 4DCUA 2J9RA 4TL8A 4RD4A 4C0AC 1TAGA 2OUKA 3IILA 2OBMA 5FI1B 4OQLA 3AB3A 2CMKA 1EX6A 2GBLC 2C9YA 2YC2C 1DVRA 4PC1A 2FDCA 2DCUA 2F1RA 2OHFA 1RW4A 5JWHA 4ZDWA 1N6LA 2KSQA 1QHIA 1M2OB 2H18A 4Y0AA 2CEAA 3R8FA 3WNDA 1AKYA 3Q8XB 3LX5A 4LJYA 3W6PA 3U7HB 4ZKEA 3SHWA 4B73A 3LVRE 2B21A 5SZKB 5C1BA 3RRNA 4KSBA 1UBFA 3P27A 3U3JA 4G5RA 2ZJAA 4R98A 1VPLA 2CL6X 4IEEA 4QL3A 4Q66C 2QPOA 2IK8A 2GA8A 1YZKA 4DT1B 2J3EA 2GKSA 4CGZA 3ZVRA 2BWJA 4KHZA 4V0KA 1FL9A 3BERA 1IOZA 2HEIA 4LBZA 1BMFA 5DHFA 4AI6A 5JWRA 2GESA 2P6NA 1RFLA 2H57A 3SN6A 5F2EA 1AGRA 5TY0A 3FGNA 4B6FA 2ZUDA 4PC2A 3IQXA 3W34A 4DRZA 1VCNA 3LX8A 4LX0A 5CLQA 1G20E 4A6XA 2WJIA 1R0YA 1K6MA 5EZ6B 1SGWA 4IW3B 3C41J 2KBFA 2N42A 1IN7A 2BJWA 2G0TA 4Q9IA 1W0KD 2E9SA 2VYFA 3UMFA 5FL7D 4C0JA 4H9GA 2GVZC 4ABYA 1E9RA 2QEQA 3GMTA 2JJ2D 3DZ8A 1JPJA 3RRYA 4LJ7A 4BZQA 4DT1A 3EX7C 3K8YA 2BMFA 3VHLB 2V1XA 2HCBA 1EESA 1XTKA 3FPAA 4EFMA 4LWZA 2CXXA 1NKTA 1XEXB 2IYWA 2PMDA 4HYYA 1OXVA 1WQ1R 1ZM3A 3IIKA 4XH9B 3GLFE 3QUSA 3UANA 1I2DA 4BECA 3TW4A 3MD0A 5JI2E 3VKGA 2ZJYA 4DB4A 1E2FA 2Z4SA 3CNNA 4LYAA 4W7SA 1OXTA 4MRVA 5KTYA 3AF3A 821PA 2VP9A 3THOA 4ZI3A 4LZZA 2ZRCA 4F4JA 2QBYB 2PZFA 2J59A 5GVRA 2F7SA 2ZRBA 4Z54A 1E0KA 2C9CA 3KKNA 1Q1BA 3PIRA 4Q9LA 4CF7A 3I5YA 2FPKA 3IDQA 1Z28A 2DB3A 2B8WA 1CRPA 4MYUA 2J7PD 1YR8A 5ANRB 5B58C 1R6BX 1TF2A 1II8B 2FSIA 2QG6A 3FKSA 3M6AA 3QXJA 4WZBE 4E03A 2XZLA 1E32A 1QRAA 2IS1A 1T3HA 1VYVA 5E7MA 2ZRFA 2XSZA 1GNPA 2QGZA 1L2TA 3IKJA 4M1KA 2DY1A 1XEXA 5ELXA 4U02A 1E4VA 1GOTA 4XSGA 4DSOA 2BEJA 3G5UA 2ZRHA 3OEHD 5EQTA 4B76A 3SE0A 3SYKA 1G8YA 3AQ4A 1ZP6A 4D4KA 1OKKD 4DUGD 1JNYA 5F9FA 4ITRC 2J45A 2GJSA 3CONA 3L43A 4KXFB 2EFGA 4ILEA 1KI2A 2WWXA 2QBYA 3ZZTA 4ESHA 4LI0A 3AVVA 3A37A 4A9AA 5KSZA 1LF5A 4OK6A 2BM1A 1VCOA 4Q1DA 5DE3A 2X2EA 1NLFA 4GT1A 1II8A 4NYMR 3A4NA 1HURA 4AY2A 2KI5A 1ESNA 1HA3A 3KJGA 2ODNA 3OIYA 3GLIE 2P6UA 4KYIB 1ZM9A 4D80A 1UEJA 4OHWA 3O8RA 1K5GA 4Q48A 3K9LA 4R7ZA 1WB9A 2ZSEA 2IHYA 2FEOA 3HU1A 5J4LA 2H8KA 3C15C 1XBTA 2OXCA 3KFXA 1IY0A 3U4QB 3CM0A 4OK3A 2GXUA 4HAVA 2ZE5A 4GZLA 1P9RA 2IXFA 2D3WA 2OLKA 1E2QA 2YOGA 2QTVB 3F3YA 4RZ2A 4HLUA 2IXGA 2ZREA 3AVTA 1I2MA 3EIQA 4WW0A 3RWOA 4DIDA 1B23P 2DWOA 3ND8A 2F3RA 4LGMA 2VL7A 3DOFA 5HKKD 4BUJA 1DAGA 2CNWD 3CPEA 1E0JA 4UNRA 4DBLC 1TQ2A 1E9EA 1HQCA 2CVHA 5HTKA 2F1HA 4IOJA 5FOVA 3W90A 3EWSA 4QHTA 5CJ2A 3CRW1 1IONA 3Q7QA 1XMIA 2QUZA 1K8RA 2VA8A 2IYQA 4LPKA 1XCMA 3PCRB 4CIDA 3U4QA 2G0NA 3GEIA 3HPRA 5KSPA 4AK9A 1NVWQ 1C4OA 4XJXA 3JVUA 1YKSA 1TUIA 3SS8A 4A92A 4R71A 4RD0A 1T4GA 1KK0A 5E4FA 1Z3IX 3K0FA 1KIMA 2YVUA 5H1YA 1VTKA 1XPRA 1DAKA 3NBYC 2VSXA 5JCPA 4CT4B 1PLJA 1ZINA 3NBZC 3THYB 1E3MA 4HLUC 2GK7A 2WJVA 2AFIE 2Q9CA 1DOAA 2FG5A 3I4LA 4LDJA 3SJBA 5AR1A 3TMKA 5A4JA 2P0EA 4B3BA 1OE0A 3HWSA 4M0LA 1G8PA 1OT3A 4NCJA 3ZJYA 3WMGA 4DLYA 1SHKA 3TGPA 4TWZA 2NGRA 5K8LA 1NJGA 1IJFA 4MYHA 4WA7A 4DC9A 5J4YA 1PJRA 2C98A 4B3GA 5HCIA 2W2VA 3PV0A 3ETLA 1RPZA 1UAAA 4B43A 3LXXA 2CL0X 1AZTA 5DI3B 2OV2A 4LK2A 5FBWB 3BB4A 1JAHA 1G7CA 2A5FA 2CLCX 2ZSDA 1IN4A 3SFVA 4URXR 1LTQA 4EDHA 4ZI2A 3VX3A 4FWTA 1W0KA 5FL7A 4U00A 1MR3F 3A8TA 4IXNA 3P1JA 1G7TA 4HDQB 2QP9X 3BAFA 4LJ8A 2A7QA 4M1MA 3THYA 2F55A 3OIVA 5F9HA 4V0NA 1AGPA 5J40A 2FWRA 3EWAA 2HYDA 2QN6A 2OFWA 4MUBA 2O0HA 1AJEA 5CM8B 3C4JA 2BBWA 3A4MA 4HDCA 4B34A 4EAQA 1U90A 5JEEA 1NRJB 1F3OA 1NG1A 5C46F 1GTVA 1DG3A 1W4CA 2ECKA 4TLBA 3U5ZB 2QGNA 3LFUA 1XPUA 2P5TB 3QXSA 4G3XA 1G5PA 4WVFA 1UBEA 3QKUA 3DZDA 1OH7A 4ZDJA 2ZVQX 1OH8A 3B13B 5DI3A 3ZD7A 4DCNA 1XTIA 4XVQA 1QZXA 2EQBA 1T0JB 2ERXA 2HYIC 1XX6A 2J7PA 2RMKA 3OIWA 4XWAA 2XJ4A 3NEYA 4C7OB 3EZ7A 5FUYA 2CL7X 1MH1A 1KTVA 3T15A 3V00A 2YWFA 2NQ2C 2QI9C 4TMZA 5EXTA 1E98A 1FTNA 1N6PA 3Q9LA 4GOKA 1CP2A 3DVLA 2Z43A 1IN5A 2V3CC 2CJWB 1IAQA 2RAPA 3VHXA 1ZAKA 2JGNA 4M53A 3RABA 2JDID 4BLOA 5J4VA 4QHSA 1OKKA 3WMFA 3WYGA 1TQDA 3X1ZA 2CK3D 2O5VA 3PR1A 3K1JA 1G7SA 3AVXA 1PZNA 5KO2A 4OHVA 1N6HA 3DDCA 3QE0A 3TQCA 1MABB 1QG2A 2DYKA 1DO2A 4V0LA 4Q7LA 3UKDA 5FUXA 2RGBA 1F60A 1U8YA 1X6VA 4NYIQ 2IUUA 2GZDA 4QOSA 5CJPA 4DEXA 4TTRA 4FI3C 3FFBA 3CX6A 3U3MA 1WDTA 5EUMA 1KKLA 2WSMA 3PUVA 4HLQB 1GUAA 2PZGA 5EXSA 1SVIA 2ZITA 4NBSA 1G8GA 3VQTA 1OFUX 1ZCAA 3R8CA 4A0HA 4ZO4A 1E2DA 2IS4A 1DG1G 4KVGA 2CJWA 1X86B 4LJ9A 5EE5B 3REGA 2V6JA 4MGKR 4A15A 3CX7A 4LV8B 1ZW6A 1XRJA 4GZMA 3U7GA 2GJAA 1C9KA 2A5YB 3LBIA 2ZRDA 1WBDA 2ZROA 3K09A 3THXB 3HJNA 2J7KA 2YKGA 4TLCA 2WJHA 2OO7A 1OLOA 3B1ZA 2RH5A 3U61B 2IS2A 2TMKA 3RLFA 3OEED 4NE2A 2GRJA 4OJQA 5HKKA 5KUTA 2XZOA 3T5GA 2I4IA 2OAP1 1ELOA 4M1OA 4QGAA 4TT3D 2QSYA 2GZHA 4KITB 4U7DA 3ADDA 2ZAOA 5C2JB 3QVVA 2XXAB 2V4ZA 1QHHB 1WRBA 2XJ9A 3AGPA 1NN1A 2C77A 4BFYA 5TXGA 3A1TA 2XGJA 3CPJB 3L8YA 3FMOB 4X8OA 3SQWA 1M8PA 4FN5A 4BEJA 1FZQA 3THXA 4FWIB 4Q4HB 3AEZA 1I4TD 4I99A 2AKAB 1FMLA 4JLKA 2BCGY 4KU4A 3A1UA 3EZ9A 4NL4H 4CVNA 2XZPA 3K09C 4IDQA 1KY2A 4JMPA 4MKFA 5H8WA 1N0VC 2LKDA 3VR5A 1OJLA 3NDPA 5HZHA 4PSKA 2RGDA 3KJHA 3IEVA 2PLRA 2AFHE 3BOSA 1R10A 2WWIA 1ESMA 5BYJA 2QMHA 5HZKA 2W0MA 1Z6XA 1XCPA 1GKIA 4QXAA 2JA1A 4Z8YA 1D5CA 1QDEA 1EFCA 4LJ6A 4GNKA 3AF0A 3I62A 2FZLA 3ZQJA 3B1WA 2IYZA 1GWNA 3FYHA 2OCBA 4QGGA 5FR2A 4UJ3A 1NIJA 3FMIA 1DE0A 3ZZ0A 1T0HB 1EFHA 3CO5A 3RC8A 2WAYA 4NZYA 3BBPA 3FB4A 1SVOA 1W5SA 3SFZA 1FQKA 3W8NA 1DS6A 3TE6A 1UBGA 2YYZA 3H2YA 2W2XA 5FPTA 3QKSB 1IXSB 1E96A 4KYUA 3PG5A 3U7EB 1OIXA 2QQ0A 4URUR 5JRZA 2ERYA 4AYTA 4D4JA 1NP6A 2CHQA 4RD2A 4UXHA 5FOSA 4JBWA 4TYWA 3JZAA 3CWQA 1G41A 2ZE6A 1G3RA 4NKRA 1RKBA 3QF4A 1RJ9B 1OHHD 3U6BA 1OFIA 3FKQA 5GJCA 4YMVA 2ZUBA 5FUWA 5BN3A 2C96A 4Q7KA 4WAUA 4MGIR 5FH9A 1LF0A 3T5DA 4L8GA 1BO6A 4P4TA 4JZKA 1FOEB 3CNLA 5AUOB 1UKVY 3D6TB 5E7IA 5K8UA 3CB4A 2RKOA 3CZPA 2ZJZA 3VNUA 2PEZA 2W6ID 5J4KA 5FTJA 4KO8A 4Q9HA 3RNLA 4TL7A 4TSFD 2AD5A 2OBLA 2JLUA 3DMNA 1Z0DA 1RJ9A 5HR5A 2QRZA 4WZAE 3WYFA 3AKEA 4DIEA 3LLUA 2WIBA 2ZRGA 1RVDA 1SVSA 2ZJ8A 4MYCA 5D3MB 1T9HA 1XTJA 4BFVA 2ONJA 4DSNA 1KJWA 1JR3D 3U3KA 5FPYA 3ZZUA 5IK2D 3CW2A 2PEYA 3GLGB 3EPJA 1N2CE 3BORA 3AP2A 2VHQA 4NYIR 4WXRA 2O8FB 4URYR 1FNNA 2NOAA 3BH0A 3Q3JB 2ZJ2A 4LC1A 5JS7A 5TVKA 1R5BA 3U3OA 3RRMA 4D26A 4P3YA 3M0EA 1MKYA 2AWNA 3RS4A 1AS0A 1NBME 4JT2A 2RGAA 1U2RA 3NTUA 5JMTA 3FFAA 1N25A 3LAWA 4M1WA 2GVDC 3B78A 3VR3A 2OLJA 2AWOA 5DIFA 4WOPA 2QE7D 2W83A 4GI7A 1OIVA 1KSGA 1M6NA 4PSVA 1FP7A 1NY6A 1S96A 3GFOA 1GRRA 2WKPA 3GLHE 1DBSA 2GCOA 3W8RA 4PO1A 2FSGA 3OE7A 2QPTA 4X8HA 1WXQA 3CR7A 3N70A 1EX7A 3GLGA 1GILA 3RSLA 3ZVLA 3W3ZB 4EKDA 3HDTA 1LS6A 3OEEA 4RD3A 2D2FA 3EPLA 1GSIA 2ZU6A 2ZRMA 4MGYR 1Z0FA 1OW3B 1UDWA 2H17A 1J7KA 4XWKA 4TT3A 1FX0B 1XD2B 3KB1A 3NH6A 4V02A 5IDVA 1QG4A 1YRAA 2BV3A 4XSHA 3LBHA 4LHWA 5FBRB 2PMKA 4IVQA 4D2IA 4JVSB 2OAQ1 3LV8A 5L3SB 1BIFA 1BS1A 1YJ5A 2VHUA 4JSTA 1CEEA 1O3YA 4ERNA 1F6BA 1BYIA 2VLIA 5EP2A 4L5BA 1G7RA 1E79D 4BLRA 3TAHA 1KMQA 4AKEA 2W00A 4DXAA 2X1VA 1R4AA 1TEXA 4R2HA 4DHEA 1VIYA 3RS0A 4BRWA 3AH8A 1Z63A 2GDJA 4D4MA 1GL9B 2L0XA 1EG7A 4G5OA 3WRXC 1H8EA 4Z51A 4QG7A 4MRNA 4DLVA 1E2KA 1XU4A 1VHLA 1JR3E 3GP8A 2WWHA 1FMJA 1AM4D 3BB1A 2XNSA 5HE9A 1HUQA 4PHGA 5G53C 3RDPA 2ODBA 1U98A 5KPJA 4AURA 3EZ2A 1RRGA 2H92A 2G9NA 6Q21A 1X8LA 4B47A 2YOHA 4JL5A 3RS7A 4B33A 3BIFA 2YV5A 4RJLA 3I8SA 2GCNA 1EWRA 5L3SA 3O8BA 2BBSA 2WVJA 3RHFA 1NN5A 2QT1A 3C7KA 3EPKA 2Q6TA 4JJKA 4H1VA 1E6CA 3TIFA 1VIAA 4RZUA 5JECA 3CR8A 3ZS9A 1KO7A 5TB5A 1W5TA 3OF5A 2DR3A 1NN0A 1KOFA 1XTQA 4LCBA 3X1XA 4BLTA 4PC3A 5FPKA 1RRPA 3SNHA 3S1AB 4EUNA 3ZYCA 3ZVMA 2QQEA 1E99A 3QEJA 1E2MA 3ADCA 1Z8FA 2D62A 2QY9A 5CK5A 3GJ3A 4N3NA 8OHMA 1LS1A 3QQ5A 4PAQA 1VYTA 2QTFA 4A2PA 4DDVA 3AF4A 4PZYA 4TTQA 1G64A 1SVWA 4B2LA 5FFMA 2PH1A 2WPDD 3Q5DA 4BLPA 1ZBDA 2IF2A 3V4FA 1N6KA 4PO9A 4S35A 1U99A 3THWB 2CLDX 1QHNA 2XTMA 4JLOA 2EYQA 2OESA 1ZD1A 2GCPA 3NHBA 1A7JA 2RGXA 1G6OA 4JLJA 3TH5A 1SKYB 2JEOA 4FINA 5FTMA 5UKDA 1KSFX 3G82C 2D7DA 4BGDA 2GHIA 2YC4C 3LH5A 4MRSA 4HI0E 4JS0A 1TL7C 3DM9B 4V03A 4KJZA 3S1AA 2HF8A 4BLQA 1P72A 3TK1A 2QAJA 4P32A 3WNCA 1V43A 2ZR9A 4D0GA 4E22A 2W6IA 5JJLA 2Q3MA 5JRJA 4A0RA 4D82A 3TUZC 4KAXA 4IVPA 4TSFA 3RRZA 1UKEA 3KXLA 2OBNA 1ETUA 2JJ1D 4F91B 4PFSA 1D2EA 3MWLA 5HE8A 3EA0A 4URVR 3SOPA 3GD7A 1IN8A 5C4MA 3THWA 4CDGA 3ICEA 4V0MA 4ACBA 5D3QA 2FF7A 3Q7PA 5AK0A 2I1VB 3SEAA 5IK2A 3WP1B 3LRPA 3SBEA 2CDNA 4Z1MA 5H70A 2FJUA 4IOKA 1J90A 3NC0C 1KI1A 2A5JA 1G4UR 4PSAA 4KFUA 2D06A 2IL1A 1NY5A 3ND9A 3QY0A 3KXIA 2IWRA 2XX3A 1P75A 3GQBA 2J1LA 5DYIA 4OQFA 1GZSA 2AK2A 1TTTA 4C0LA 2HXSA 3L0PA 2GTPA 1HYQA 3MSXA 1FNMA 4KV9A 3PUYA 2ZI5A 3BH7A 4LSGA 5AJXA 1VG8A 3EXAA 3PUWA 1AA9A 4KFTA 4DDWA 1NG9A 1ZIOA 2QE7A 1GL6A 2QT0A 4OHYA 3WP0A 2JLRA 2NO1A 4Q18A 4Q9KA 4YDSA 2VF7A 2R2AA 4WIAA 3HU2A 4D81A 1TNDA 2KB0A 1Q3HA 4PC7A 2A30A 2FE4A 5KHOC 2Q9AA 4JYCA 2B92A 4K8OA 1IM2A 5CIWA 2BHRA 4W5WA 2Q9BA 3EC1A 1FW6A 2EWWA 2IA5A 1B0UA 1VMAA 3I92A 2JLZA 2XNDD 3L0SA 4F92B 3WMEA 2QU8A 3C8UA 1A1VA 2GJKA 4IOLA 1RIFA 1FUUA 5B2ZA 1SHZA 3NXSA 3RC3A 3U2QA 3MJRA 1NF3A 2ZEJA 5C4GB 2WV9A 2IYUA 4D25A 2FA9A 4YMSA 3J81k 3BXZA 3I3SR 2IYSA 2SHKA 1E79A 3ZD6A 1TADA 3OFND 3SDZA 2ZPTX 1N0WA 3NBFA 1M74A 2UVQA 3CLVA 3OZXA 3W9YA 4EPVA 1OH5A 3K9HA 3GLFB 3TR5A 1TEVA 3I61A 4I1OA 5L3VA 2EFDB 4EFNA 1TX4B 2WJYA 4M8NE 4UQOA 4KODA 5JHHB 2BBOA 5FTLA 3BC1A 5FL3A 3GJ4A 3BRWD 3QKRB 2PCLA 4TL9A 3T35A 1NVUQ 3MMPA 3VKWA 1NVXQ 3X2SA 4B3DA 1YHNA 1Z83A 1H65A 3P4XA 4I81A 4N1AA 1IXRC 3RANA 4RZ3A 3DPUA 1CBUA 4PPGA 2WHXA 1KZGB 5KSYA 5DNYB 2EFCB 1E1RD 1S4QA 3U60B 3HU3A 4G5QA 4TYQA 3K0FB 1ZRHA 1G6HA 1E2EA 1VG1A 3D31A 4LYHA 4M9QA 4MA4A 2R6CA 2VSOA 1X8JA 2AXPA 2QORA 3CRRA 3AKDA 5FPHA 1J99A 4GSYA 4Q03A 4EPTA 4M1YA 2UKDA 1P3JA 5FBLB 3GLFA 1ZUHA 4HB3A 4IOMA 4IVRA 2ONKA 4TMVA 1J70A 3CX8A 3T12A 2QMEA 3PJRA 3Q5EA 2ZTSA 2PX0A 3DEFA 3VR6A 5M04A 3QKRA 3GJXC 2X19A 2IEYA 2ZI9A 2JLYA 4CEJA 2ORWA 1E2NA 1T8TA 2YINC 4B2PA 3KFVA 4A4DA 3WBKA 4DWJA 1EWQA 4HAXA 5CITA 3AVYA 5EP4A 1FP6A 5CYOA 4A36A 1XB2A 3NWJA 1WP9A 1US8B 1KI8A 1QHGA 3DO6A 4B6EA 1E4YA 2WPDA 2XITA 4NCNA 2A78A 1R0WA 2HUPA 4CW7A 3GFTA 1Y63A 1Z6TA 5LD2B 2CCGA 4G5SA 2Z83A 4LBYA 1S8FA 4LJ5A 1XTSA 4HLCA 2O8CB 2QL6A 3QPWA 4F38A 1RYFA 1KI7A 2EWVA 3KQLA 3FHTA 1JR6A 1DPFA 3KDSE 3EZ6A 3QBVA 4Q7MB 4TTPA 3QBTA 2E87A 2QROA 3GEHA 3GJ7A 1S9HA 1JJ7A 2QP4A 4RKEA 4Q02A 1AKEA 3FWYA 1CR2A 1E9CA 5EP3A 3UPUA 3TBKA 3KKMA 4GOXA 3VTKA 1KAGA 4OK5A 4FMCF 1KHTA 1CS4C 4A2QA 2FPLA 1AZSC 4IDOA 4OI4A 4OYHA 2ZE7A 1KKMA 1M1YE 4QGFA 3KX2A 2Z0MA 5TARA 4JYBA 5AWFC 1M34E 5TMPA 1US8A 2IEZA 4BLSA 1OYWA 1V5WA 1Z6AA 2DBYA 4OKSA 2D4HA 3R7WB 1ZNWA 4EFLA 1UBCA 2NPIA 2FZ4A 3BE4A 1LV7A 1OB5A 2ANCA 2O8CA 521PA 1OH6A 1TF7A 4QKQA 3GLIA 2ZRAA 1XEWX 2VP6A 4IDPA 3P20A 2H16A 2WJJA 5F98A 1Q12A 2JJ2A 2BOVA 1WE2A 1OFHA 3RS3A 5G3ZA 5DN6D 4BFXA 1KDRA 4AC9A 2GF0A 1A82A 3UWKA 2VIIA 2IBMA 5GADl 3SU8A 4NMMA 5P21A 4MITA 1QHSA 1KGDA 1G4AE 1QBKC 3JVVA 4HLDA 3QI2A 3TW8B 2OCAA 4UXJA 4L4UA 4UNPA 5JI3E 2G1JA 2WWFA 3W3AA 2A9KA 1GRNA 1D2NA 1QVAA 2FSHA 2DWQA 2HLDD 1W0JD 2O0JA 3LO5A 5FOTA 3R7WA 3I5XA 2EVWX 1G3UA 3A1SA 3QXXA 4EQ6A 2MMCA 3AVPA 3A4LA 1CXZA 3H84A 5DYGA 3LA6A 2HJGA 5L8VA 1UKZA 2CBZA 2D2EA 1R7RA 4XD7D 1LB1B 5AJYA 2WBLC 5LD2C 3CWZA 1NVVQ 1U0JA 4AYXA 4KI0A 1F2UA 2Q3FA 3EG5A 3FMFA 1XJQA 3VNVA 1NMXA 4YXWD 3PXGA 3OEHA 4IHQA 2XNDA 5JWOA 1TQ6A 1R5NA 3NKVA 4M1SA 1T3SA 3LD9A 4B3FX 3MWJA 4QHYA 2B6HA 4PTLA 4DUGA 4HB0A 5CDFE 4OQXA 1W36D 1NMZA 4AKHA 2HDNB 2OM2A 1R8SA 4BFWA 4JL8A 5E7JA 4MRRA 1Z0KA 1XD8A 3K0SA 1KI9A 3KQUA 4PHHA 221PA 1NI3A 3OFNA 2V9PA 3UWOA 1VCIA 1W2HA 3BFVA 1G19A 1P2SA 3OAAD 1PV4A 1Q20A 3IO3A 4C2UA 2ORIA 1Q3TA 5KSOA 1SVKA 3HR8A 4DLRA 4P31A 1S0UA 2IUTA 4EPRA 3B1VA 2O52A 1VG9B 4L15A 1UFQA 5J5CA 4OI2A 4C0SA 5B57C 1YZQA 4LRWA 1HT2E 3AUYA 4CYMA 4C2TA 4JLVA 3KZ1E 1ZD9A 1P2TA 2QM7A 5FPSA 2FFAA 1KDPA 4IFEA 721PA 3DMDA 3ZDQA 1E1RA 3DHWC 4DJTA 1RC8A 4W9MC 1P2UA 3TUJC 3A58B 5KU1A 4HUQB 3ADKA 1H8HD 1E9FA 3FVQA 3CF0A 3CKLA 3W6OA 4IEIA 2VHCA 1Z06A 4LOAA 1OSNA 2CNWA 4LC0A 5JCZA 1JEDA 1O87A 2IYRA 1E2GA 2VQSA 4KVAA 3B9PA 3U6KA 4JIMA 2QNRA 4IJMA 5GJBA 1P9NA 4LBVA 4NP6A 2IYVA 4MQBA 4CRWB 2ZRLA 4QJ3A 1E2LA 2XOKD 2WAXA 2R6FA 4RSGA 4YMUA 3IHLA 1SXJE 2WJGA 3VR1A 5KDOA 1XJ0A 2PT5A 1Q0UA 2W58A 1FQJA 4WZ6A 1XXHE 1KAOA 4G01B 3QNUA 2F9MA 4G5GA 3AV0B 2W6JD 3CPHA 3B1YA 4I4LA 1G5RA 2J0SA 2NMVA 1E9SA 1EFTA 1P2VA 4QBIA 5EE9A 4HUQA 5LB4A 1ZCBA 1G291 1OPXA 2KBEA 3ECCA 421PA 3T61A 1UKYA 4RKFA 4CEIB 2XEXA 4KSCA 3LXRA 4US2R 4TZ6A 3B8HA 1CU1A 3REFA 3FMPB 1HH4A 2AXNA 4ZDKA 3D8BA 2PX3A 1F48A 4NONA 1L7VC 3W6NA 1HE8B 4XVRA 3NVAA 1G3IA 2GAOA 2BC9A 1M7BA 1EFRD 3AKYA 1DARA 3QF4B 5CIQA 2O8BB 1ZJ6A 2V1UA 3X1DA 3QG5A 2ODEA 2NIPA 2J0QA 3QJYA 2V55B 2VO1A 4KBGA 4HUTA 5BWMA 5BXQC 1NMYA 4CEIA 1COWD 1PLLA 1G9XA 1NBMD 2NZ8A 4GL2A 1W47A 1XPOA 2GXSA 5EZ5A 1VCMA 3RS2A 4JSYA 4F7WA 3M4YA 4UJ5A 2AR7A 2YWGA 4TN1A 1TU3A 1R8QA 4BEBA 1E9DA 4L16A 1CRQA 1VHTA 3B60A 4OQNA 1JECA 1E0AA 3K53A 5JFGA 1MO5A 3LY5A 3BB3A 4M22A 1YZLA 1Y3AA 2F9LA 3AGQA 4B48A 4UNQA 4M9XA 1S1CA 4BFZA 1NJFA 2O8BA 1GAJA 4IDNA 2GF9A 4MUAA 2HLDA 2AL7A 1YR6A 2HXYA 1PVOA 2HF9A 4HAZA 1ZM4A 3L8ZA 2BM0A 5C18A 3KL4A 3JZMA 5FOUA 1Z6YA 3K70D 2BDTA 1P73A 4JBXA 4Q7JB 2VP4A 3NHAA 1VKJA 4W5JA 2G88A 2REOA 2FV8A 3WYAA 1KNXA 2FOLA 3H4MA 1NVVR 1W4RA 2W0SA 2NTYC 4B44A 1NNEA 4AWXA 2FEMA 4JKIA 2CHVA 4Q01A 3SBDA 3VR4A 1MO6A 4ZV4A 2PZEA 1YQTA 2AHOA 2JDIA 2JLXA 5FI0B 2WMNB 1LNZA 2CK3A 4Q4JB 4NCIA 4ZIRB 2GEVA 4TLEA 5KDDA 1G17A 4NTZA 3TSOA 4P4SB 2GCOB 1Q1EA 3T1OA 1HTWA 4PHFA 3SJZA 621PA 3MG9A 1P7CA 1CJUC 3OAAA 1ZU4A 2MMGA 1JJVA 1BOFA 4RY2A 2JLWA 1KJZA 1ZVQA 2FX3A 3L2OB 4PQRA 3WXMA 1WF3A 4FMCB 3FHCB 1XFAA 4ARZA 121PA 4RD6A 4YQFA 5IRCD 5FTNA 1K5DA 2CVFA 4BE7B 4PANA 5FOXA 2IYLD 3PUXA 3T1VA 1XD9A
chains in the Genus database with same CATH superfamily
3CJTA 2OM6A 3PBKA 3K31A 3DOHA 3SSOA 3AJAA 2ORVA 3IUYA 4D0RA 4MDEA 3WGUA 2IOYA 4Q4JA 2JAWA 4B82A 1DTWA 1F8UA 2PUHA 4TMWA 4F11A 1N5IA 2RC6A 2EP8A 4CV2A 2NO6A 3IQIX 1B6GA 2ZIUB 4MQEB 1WAMA 2Q1SA 2I6GA 3FFXA 3N3BC 4I9NA 1WCWA 1GTG1 4QJBA 2RBKA 1U8AA 2G8LA 4FFMA 1WCIA 4U3JA 1U9YA 3MBOA 1N34B 2DEUA 2FGKA 2BTEA 2KM1A 3TZCA 3NRCA 2WWYA 4ZYZA 5ARBA 1RLOA 1PTJA 2FR8A 3EGXB 4HWPA 3WNZA 3UJHA 2J5XA 4RLHA 4BZWA 3E5HA 4CM6A 3QWAA 4W1RA 1GDDA 3BN3A 1EP1B 2GPNA 4KQ1A 4BJ1A 4KX3A 1S2LA 1XRLA 2B9VA 1YRBA 2PLWA 4TRMA 2QLFA 5T3YA 3WHKA 5HCUA 4YCBA 3G0GA 3KYCB 4KIGA 2CFCA 2C5FA 1CQJA 3CLSD 3QJGA 3R4CA 2BEWB 5FJJA 1P60A 3L0BA 2VJMB 4L2IA 3F9RA 4E1AA 3BD9A 2ZXUA 4DLWA 3RRJA 2C4UA 2IHKA 1ZWLA 4GKAA 4MVXA 4IDHA 1Z0AA 2GUWA 2OILA 4TZTA 3DL2A 3T3PB 4F4DA 5AKLA 4X6XA 1LLDA 2NNLD 2CXTA 2W6NA 3OM1A 2PUWA 3HBJA 3UW1A 3NUQA 2DAPA 1Z26A 3Q2KA 3EN0A 3CLUC 2JHCA 4PO8A 5JBQA 1W5BA 1DUSA 3G5AA 2IZ1A 1Z22A 2ZS7A 4ARUA 4Z4FA 3ANNA 1O77A 4W63A 4TM8A 4R31A 3N8IA 2V8OA 3EJWA 2LW7A 1R9MA 4URHA 1E64A 1GCAA 2PIDA 3VPCA 2NTEA 2H5JA 1QK4A 1L7BA 2NT3A 3A7EA 4H7DA 4WZAA 5EHNA 4KMOA 1RQGA 3REQA 1CJTC 3STYA 3CNOA 4QM7A 4YYEA 1EIWA 4LJAA 5KNCD 1GTZA 4II3A 5C80A 5LJIA 5AVTA 4RXUA 1XLTA 4Q00A 3UT0A 5BNZA 3O4IA 2HGSA 3QVKA 3C6XA 5EQJB 2UZ1B 4DVJA 4ZZ1A 1GNVA 2VWGA 5CXUA 1VJTA 1RM5A 3HXMA 4MQMA 1RSZA 4H6XA 4X85A 3G5MA 4C76A 2X5XA 3GARA 1DFHA 4FZ3A 4TMYA 1T9KA 3GZTB 3W9UA 4E2XA 3JQDA 4M1TA 4TSKA 3W5UA 3JQEA 1IK4A 4Z9FA 4RTNA 4B6SA 1KJJA 2EGHA 2HV8A 3A6ZA 4LE0A 1PLKA 4GQIA 1YSCA 4WN9A 5CXQA 1ABFA 1C8LA 2E55A 3HFSA 2Q2VA 1NZJA 3K30A 2QW1A 1N9ZA 2NUPB 1FC0A 4HQNA 4HGOA 3DO8A 3BSWA 3N2KA 3QW2A 3R6WA 2VDWA 3DVRX 4K3UA 4S2EA 1XKTA 1IQPA 3BQMB 3FUTA 4CMBA 5K0FA 4HWSA 5DI9A 5K3CA 3DBIA 4MHTA 1TA4A 3PUZA 1G98A 1PJCA 5FUVA 3THRA 3KTAB 1UBJS 1XTPA 3QKTA 2V7EA 4WK2B 4UNNA 2ZUTA 3CXUA 1IDOA 4EA7A 2QF7A 2YMPA 1P2GA 1KK3A 3FR7A 3KAPA 5EINA 4DHWA 3IURA 3D2LA 5LQMA 1K8YB 1NV9A 4K46A 3TIXB 4DZTA 4O4IA 3T3EA 1Q21A 4CWAA 3RS5A 1GL7A 4D99A 2AI3A 1TYEB 3H2IA 2FPSA 1L1QA 3UCEA 2QENA 4A2CA 5L3QB 2ZYDA 3ESQA 4P53A 3UUWA 4ZDIA 1XDBA 2I3GA 2IYOA 2Z8ZA 4G5HA 1MV5A 1D9ZA 1JQLB 4MGZR 4P4NA 3LYHA 4QNNA 1Z45A 1KI4A 4XB1A 4YUVA 3ZXUB 4JU8A 2PYIA 3G88A 4LSWA 1GPNA 3PT9A 1HT1E 1OWLA 3SLRA 4CG0A 4FMDF 4RD1A 2HSZA 4GGOA 2ZT7A 1GRQA 3VISA 1YKGA 1A7UA 3VVCA 4YROA 3GQBB 1AF4A 1DAPA 1ZMBA 4J29A 4LWPA 2DPXA 4X84A 2Y1LA 4GO1A 3QUQA 4LCEA 5FWYB 3VBCA 5C7IO 2PZKA 1ZNXA 2C9BA 1YB5A 5M5BA 2PBLA 3D8TA 1N5RA 1AS2A 4XI9A 3OU7A 5DW3A 3K0CA 1UBKS 2VF8A 2OBBA 1DJOA 3F5FA 1MA0A 4WD3A 5JSZA 2PL5A 4XVHA 4Z9AA 4ALIA 1KDTA 5K6AC 1MQSA 5HIMA 1Q95A 2RKWA 5K6TA 4RFVA 1W88A 2I7CA 1A27A 1PVDA 2WWTA 1JMVA 1QYRA 1RHUA 1GQRA 2QY6A 3A1WA 2GYUA 3DZCA 5ICFA 4DBLE 5I7VA 4ZI7B 1JR3A 2OV4A 2XGGA 4M1EA 1ZD4A 1GVNB 3A06A 4R41A 3SF8B 4LX8A 4R6XA 1UJ2A 1DJPA 3VZRA 4D3DA 5JSYA 4GP6A 3IGFA 4FILA 4OY3A 1DUVG 4NJEA 2C2ZA 2G4LA 2AYXA 4I6GA 1Z36A 4XJSA 4ZOEA 1LK0A 4X7PA 5AVOA 4ZCLA 3UG7A 5C1OA 2FU5C 2BTOA 1HL7A 2F90A 1BS9A 2ZRPA 4IP0A 4JITA 4UOQA 3G0BA 3HVJA 4DDUA 3A11A 2R44A 3HYCA 1IOWA 1IZ0A 5ALDA 3PENA 3D6UA 5F7JA 3ZV5A 3KC2A 3QVUA 3K70C 1E8DA 1U4SA 4TQUS 4P4UA 2E5WA 1W4AA 2X2FA 3AJ8A 2UZIR 2HDOA 3H9QA 3RH0A 1PNOA 3UY4A 2AN9A 3T38A 1D09A 2AS0A 3QXHA 4Q3NA 3AESB 4CKXA 5GQSA 4F3NA 3JV7A 1T8YA 1B16A 1U5AA 4E5MA 3KB6A 2IYFA 4I50F 1BXZA 3ROPA 5LXTA 1ZGJA 3EBPA 4PHTA 4O3MA 3UUEA 1SBQA 4E2WA 4XIJA 1N2EA 1R6UA 1G5TA 1TMYA 3FBTA 1ST2A 3NQ41 4OAPA 1BD3A 1H2XA 4QELA 4BFTA 4EJ0A 5C5CA 1KTIA 3CZ9A 3IUSA 3JYHA 3AIMA 1CUAA 2V8BA 5JG7A 4HQ6A 4Q19A 3RAPR 4ALKA 3HNPA 1SQ0A 3AUKA 3NCTA 1X7HA 4E13A 1KBZA 3IHTA 1X7GA 1XQYA 3CJRA 1QUEA 1X1QA 1P6QA 3DMTC 4KQMA 5CHYA 2EW8A 1H9AA 2JAHA 3ZHRA 1G1AA 4IICA 4ZCMA 4DV1B 4DCSA 3FD8A 4GGMX 1FCJA 4Y0VA 4R1UA 1P5ZB 2ID9A 3SHFA 3GUYA 2P68A 4P5EA 5IF9A 3SVLA 1BEEA 4JBHA 4XM0A 3KCNA 3NNDA 2CCKA 4DCVA 3TINA 2HIMA 3UYLA 3BL6A 3WRYC 1JSZA 1DRWA 1H85A 4GGPA 1C3EA 1Q0HA 1Y42X 1XWIA 2VG8A 2ZDGA 1P9WA 3GMIA 3FDIA 2GZRA 4KWTA 3DLHA 1UM9A 2FPIA 2BW0A 5LFAA 4I1YA 4CG2A 2K5UA 1BA3A 2V6GA 3N5CA 3DC7A 2P40A 1M7HA 2J4CA 4F6RA 2M2IA 3E22B 3WA7A 1RBQA 1UWLA 5JJBA 1UIMA 2P9BA 1KMHA 1K06A 1C80A 3IMKA 5C8YA 1XCBA 3MM4A 2GXAA 2F8SA 2ORYA 2GK3A 1YRWA 2O7QA 1H3NA 1L9XA 2YNMA 1UDXA 3BTUA 1F0YA 3MWFA 4M2LA 4R01A 4R6WA 5E4TA 4KRFA 1D03A 1OQAA 2DTDA 4NAVA 3A7DA 1KP9A 5J1TB 1JKXA 8MHTA 5TT0A 3ZHUA 1BQ3A 5TV2A 2VQDA 3KUXA 3FFWA 2O8NA 5AKHA 3ZJUA 1DO0A 2BL4A 2QD4A 1DTSA 2J5BA 1EWVA 1H93A 3ILVA 4U63A 3ZDCA 4LZAA 3WIOA 4CI9A 1DFIA 4HDMB 1FFXB 2GEDA 3KR9A 4RVCA 4LJ4A 4N12A 5IXJA 4WKBA 2I1QA 4C7XA 1V39A 3VV3A 1KI6B 3CLSC 4CE6A 4L3WA 1U2SA 4GEGA 2JLQA 2TMGA 3DE0X 4FNAA 1UEXC 2HNKA 2OP1A 4BMOB 5D5HA 4O1MA 2O2GA 2B69A 2HRQA 4FUQA 1U0HC 1W76A 5EP1A 4X64B 2GWHA 3DDNA 2Y8EA 4I9GA 3VU9B 3NIDB 1CDDA 1U3TA 3WTBA 3HSYA 2FAXA 3LUKA 4MUXA 3TEJA 4LY0A 4E4YA 5HUHA 3HDHA 1FTYA 1IU9A 1TIBA 2ZCVA 4NHOA 4L78A 1SPXA 2ZVJA 2VUTA 3H5AA 4RGBA 1SM4A 4C6RA 1HFWA 5JY6A 3N2EA 2NZVG 1RPAA 3IT2A 3TCKA 3LQQA 1U94A 1DAHA 2D4AA 3OIUA 1U3GA 1UOQA 5DO9A 2CD7A 2R86A 2PKXA 1H6DA 1R18A 2VNAA 1Z6GA 2J9XB 4ILKA 5FADA 5F1OA 1Z18A 3O3CA 4UREA 2PLFA 2W70A 2I6FA 4EG3A 4IDFA 2C7QA 4TLAA 4CIXA 3MWEA 3C3BA 1HDOA 2GTHA 2Y93A 3AHCA 2QNBA 2PRZA 4MPJA 3ZDDA 3VR2A 1KU0A 1QHXA 4RSHA 5HJ2A 1ZMTA 3K6KA 4ABTA 1P7VA 1U8TA 4FXPA 2WQ6A 4OFWA 5I5EA 4KWCA 1S8OA 3AY7A 4AUKA 5SY9A 3UT6A 2ZI6A 3BULA 1TM1E 3OKAA 5JISA 2IFTA 2EFJA 4JP5A 4BHTA 3UT5A 2HN9A 5IDYA 1RQRA 1DAFA 1M5UA 5SYMA 4BU0A 4A82A 1OCEA 4E5UA 4J7UA 1OPRA 3R9XA 1M73E 4TLDA 1U1DA 3CUYA 5FKJA 1Y1LA 3EDRA 2O1WA 2QPAA 1FVOA 1P45A 2XD4A 3C1AA 3FNRA 2EKZA 5E4YA 4QYMA 4X44A 2HPAA 1AO0A 1TT7A 1GYQA 4JI3B 1ZIPA 2WHPB 4HAYA 4BP8A 5K0ZA 3E7WA 1U8FO 1Z6QA 1O96A 5U1PA 4UVHA 3ZQ4A 1E66A 1YDWA 5JY1A 5KZMB 1TYDE 2G77B 3DT6A 3LLSA 3A6PC 4DNFA 1FRZA 2Y0DA 3IUBA 3BXEA 4IHAA 2XUAA 3QPDA 1J8MF 3RRBA 5J43A 3IBSA 4RTLA 3GA7A 1Q1ZA 3W5JA 2H2FA 3EMVA 1A7AA 4NHEA 1NPTO 3GVHA 3IV6A 1ULZA 3G2HA 1LSUA 5AK3A 3IDOA 4WOCA 5IULC 4BQPA 4AJ4A 2AFRA 3SI7A 2JK1A 4MQLA 3RFUA 5CK4A 3ESRA 1EGMB 4FVTA 2PX2A 1ZUD1 4KRXA 1YE8A 2NO9A 1VG0B 1KVRA 2VPIA 3E70C 4MTCA 4ZVLA 3ZDRA 4AWAA 5FPPA 1OXBB 1GNSA 4DQXA 2A2ZA 3AVOA 5FJIA 4EI7A 1IY1A 2Q07A 3JQFC 3SEZA 1Z7YA 3C3DA 4IIVA 4Y2JA 2AEFA 3W2GA 1XQVA 1DX9A 2PFSA 4A2WA 2RG1A 2BMWA 3ZGXA 3FVRA 3E3OA 4MNTA 2IBTA 1U7WA 1CEYA 2C5LA 4EBFA 5B3AA 3NHWA 3FWKA 4EARA 1P2DA 5FBVB 1GIAA 1UMBB 1JFTA 3ZLJA 3IEIA 1CR4A 2DR2A 1P0FA 1BH2A 1WQ3A 2CJPA 3FGOA 5B1IA 3K9NA 5IC5A 1EUDB 4JQOA 5DCWA 1JFFB 2FSVA 1E3EA 1HE1C 2O3JA 1C5KA 1SULA 1JEYB 2WUVA 2YJ6A 2ERCA 3IPXA 2C1XA 2GR9A 2PRJA 3FUWA 1YRLA 2ODAA 1SXJD 2RK6A 5DHPA 1JXMA 7AT1A 1J39A 1EFUA 5I4BA 1JF8A 4LDAA 5A71A 3QWFA 3LKDA 4N0EA 2XAUA 1XT6A 5FBKA 3PQ6A 4E32A 1GNTA 1OBCA 2V7QD 3A1VA 3HP7A 3IDFA 3L79A 4TKUB 2F1OA 3GLFE 4BRUA 5EWJA 1WBBA 3A0UA 5DHRA 1NXPA 2EZTA 4R9NA 1AF7A 2E4VA 4BP9A 1CVRA 5JUWA 5LN1A 4OHCA 5EJ6A 2ZULA 3ABSB 3AQIA 2H4FA 3F47A 3EMBA 4REQA 1TAQA 4H7KA 3SR0A 1XVIA 2GD1O 2GDZA 3ELWA 3VKHA 3B5JA 4O1IA 5DH9A 1MO3A 2ZS8A 1XU7A 3B3FA 4ZCSA 2G04A 4B35A 2C20A 2X9VA 3N76A 2FX2A 1C8VB 4IUDS 2BMDA 1E2HA 1HEIA 3GIDA 5AI8A 3IC5A 1LQTA 4CG3A 3ROKA 4HP8A 4BFSA 1GP2A 4UHBA 2VVTA 3EVZA 2VRWA 3O3MB 2QTHA 4PGFA 1I2ZA 2V4MA 3LL7A 3ZLBA 3AT1A 4Y2SA 5KKNB 2QZ4A 3O8NA 3AEKA 4IIBA 1FPMA 1JE1A 2AB0A 1T2FA 4QYWA 1G21E 1XMXA 4MPDA 5FRDA 1BDHA 2GXQA 3HHEA 4EOGA 4ENSA 2X3YA 5HBRA 2PG3A 5C81A 1R5OA 4ZU1X 3TB4A 1U8CB 5DKFA 4JUIA 2X77A 2WU0A 3CUTA 4XGRA 3U09A 4O4JB 5BPFA 1MOSA 1KJYA 1X1RA 3C87A 4TWJA 2BI8A 1EJBA 1R64A 2A5GA 2Q5QA 4I1SA 1H2YA 2AJ8A 4UC0A 1JQ3A 2WDZA 4KUHA 5IBPA 2OLEA 5E38A 4OGLA 4UEWA 3DL0A 4C22A 3EF0A 3O73A 5JPDA 5GONF 5JSFA 13PKA 2GS9A 1R8JA 1U5BA 3GRRA 3GA5A 4Z9XA 3DKIA 5JZVA 2QAGC 2VF4X 3UFBA 2NXEA 2OWEA 2XODA 3S0JA 1ECCA 1NMQA 1Y8RA 2YICA 3ZIDA 4YT5A 4LWOA 3AL3A 2XWPA 3V4OA 2AI2A 2R84A 1KK2A 3U44B 3R3SA 4AVYA 1WZIA 3PWSA 3VJMA 2CV2A 1DEHA 3RTBA 5GV7A 4LFCB 3LUHA 3BFXA 3IUJA 4O2BF 3RW9A 4LFBB 3ZNNA 1JYFA 1BWSA 5CMLA 2H63A 1BQ4A 1S01A 1T2EA 3C4VA 4TYPA 2BE7A 3UJDA 4EA6A 4D9CA 4KN5A 2NO7A 1AX9A 2VWHA 3FSRA 3IEPA 3SKYA 5MHTA 5CLHA 5IJAA 4P84A 4NJMA 3LDGA 3T34A 1VP3A 4AM8A 1ECBA 1WWKA 3FYDA 3OLQA 4ZHSA 4ZJPA 2PAAA 1VE1A 2PUJA 2QVXX 2NO0A 4IG9A 1XZCA 1AQUA 4ZYXA 1Q0QA 3DLAA 3QHPA 4HWGA 1N0UA 2PMCA 5E3IA 3SLGA 4IKPA 1P6UA 4IWNA 4C4ZA 4OGFA 1NRXA 3Q2OA 4GXTA 1EWKA 1LDMA 3UGKA 2OCPA 3ITNA 4HQOA 4YJDA 3TRHA 5LQRA 2IC5A 1UFKA 2RDMA 5FXMA 5REQB 5LNK6 2PA3A 2WIJA 3H5LA 3M3HA 1W52X 2GCEA 3S5UA 2OFOA 4RLSA 4PC6A 4Q3KA 2EF0A 3EC2A 3UK6A 4N9WA 3A3PA 4OUDA 4CDMA 1BEUB 4D4LA 5H9VA 4I50A 3UJ7A 5BW8A 4MV9A 1GRCA 1H4SA 1KXJA 3AEXA 5FLEX 2BFBA 4ENRA 3NAMA 2DU8A 3JASB 3AF2A 5FTWA 2Y6UA 5JSKA 5BN4B 4CHGA 4QXOA 1UK8A 4DADA 1O6FA 4H7FA 4WH0A 4QFBA 2EFYA 3L7OA 3NDBB 3R5HA 1DHTA 4GVLA 4MI1A 3U37A 5DU2A 4ODIA 1AXRA 1JMKC 4IGIA 4DR1B 1G5IA 3UATA 1EK0A 2XUZA 4HMOA 2VTBB 2ZYVX 2Z2XA 3B1XA 1JPNA 4FZJA 4ZCRA 4QU0A 4P58A 3H3FA 1BCSA 2HK7A 2G6BA 3OJFA 4HADA 1C9MA 4KXNA 3HYRA 3A9RA 2IDJA 3RBVA 2W6OA 2OEPA 4Z8XA 3UJ8A 4JL6A 4OL0A 5FO1A 3D4BA 3VC3A 4Y6OA 5L3ZA 2CHGA 2YXPX 4LDRA 1SKUA 4JJZA 4UZEA 3FOZA 1CR0A 2V9ZA 3EF3A 4AJIA 1JP7A 2R00C 5JW6A 4INAA 2XB8A 3L46A 3GDFA 4Q4HA 3VYTB 3DB1A 3WKCA 4R1SA 4TTTS 1CZHA 1JJFA 1ZD3A 2W22A 4EWLA 3V97A 2EBFX 1Q44A 2J9FA 2V03A 2XXJA 3DZBA 3EHEA 4AMBA 1W36B 1N3BA 4DZZA 4R83A 1A7KA 4DIOA 2Y0CA 1OFUA 3RYFA 1KZ9A 1YS6A 2FCRA 3HCPA 4YB8A 3NTXA 3ZU6A 1I4DD 3AVQA 3FMVA 4QYIB 5JO0A 3P0EA 3SYLA 2IYTA 2R8RA 3BJMA 3SX4A 1ZD8A 2Q1WA 3OQIA 4RZHA 5GOZA 3NDIA 1C3JA 2EG9A 1OV4A 1QNLA 1F8FA 1PK8A 4RVDA 2ZTUA 4PX2A 1T0BA 2BMJA 3L7KA 4LG1A 3QMMA 4R7GA 4AG3A 1YB1A 2NTJA 4QO8A 3A6GA 3C14C 1PS9A 3L4EA 1YKFA 3DLCA 2BFWA 1V4VA 2TS1A 4ARZB 2E18A 4U7PB 1CLUA 4LTNA 1EVQA 2M1ZA 3T1QA 4BMNA 5FEUA 1A1SA 2JIZA 4BV2A 1ZK3A 2PIAA 1WZNA 5G2OA 3LW7A 5F3WB 4ZTBA 1JU9A 2AD1A 4JT4A 1X92A 1IJEA 4HN2A 3ABQB 5ALOA 4XPIA 5AVSA 2NU9A 2FE1A 5CA0B 6LDHA 3LT2A 3TXXA 3TLKA 2WFZA 5ALVA 4YN3A 1L6RA 4B7XA 3MWKA 2C99A 1A8SA 1Y89A 4RMHA 3LCJA 1PAUA 4JEIA 1ISRA 2AHRA 1H9BA 1KIAA 2HFKA 3C3YA 3PC3A 5F3DA 1NC1A 1WCIB 2WYOA 4UCXA 1O97D 1VLJA 1XCLA 3A6JA 3FUUA 3LQ4A 4RDIA 1I7QB 4BNVA 3NNSA 5DBFA 3SC2A 3C39A 3OLXA 1W49A 2HR1A 2A86A 3EUEA 2WOOA 3ETHA 4RACA 5I8ZA 1DLJA 1QBGA 3SZ3A 4CTJA 4CBVA 1I3CA 2EJBA 2Y9MB 4R51A 5E2AA 1TMGE 3L4SO 3JQ7A 5K3SA 4AX8A 4JLAA 4CL8A 1C7FA 3WL6A 5FP0A 1CQJB 4C0BA 5CU7A 4M4SA 3HR7A 1N1GA 1SXJC 2Q8QA 2ONZA 2RHDA 2WE8A 3NTQA 3ROQA 2NZWA 2ZK7A 3KQNA 4M9RA 1UM8A 3P9SA 1HNNA 4BAUA 3RSCA 3U3RA 1JU4A 2QK4A 1DAMA 4A0FA 1KYVA 2QX7A 4DWOA 1HQYE 4GOOD 2JFUA 3BDIA 1N1EA 2HHLA 1GU0A 3GCGA 1J25A 2ZI3A 2ZYHA 4OOEA 3WB2A 4YECA 3SYNA 1I6MA 2HH9A 2R6AA 4R7TA 2DFTA 3HADA 1T25A 1YVDA 2IQ5A 3L0ZA 1Z2EA 2A5LA 4YCJA 4RLFA 1GG9A 3DV0A 4BUCA 2QTBA 5JJIA 2R7KA 1W2GA 1U7TA 2DTEA 2QVBA 4PAMA 2RGNC 1K98A 2XA9A 3B7PA 1ZONA 5LQKA 3UB4A 1O6BA 2QR5A 4Z0TA 4BIMA 1QFYA 2BVNA 3EODA 2G07A 2B8TA 1O6CA 2Y05A 3D2BA 3NIBA 3PP8A 5EIWA 4CNQA 2HF2A 4RLQA 4D97A 4TYNA 3CSSA 1KETA 1JALA 3UTDA 1F7UA 5KNCH 4NCHA 2YQ4A 4A6PA 2YXLA 4QFMA 1CWUA 3GJ5A 1JQ5A 4RZSA 2VP3A 3IODA 5CT8A 2JH8A 4HZUB 4PYQA 5AW8A 4HRYA 1QGDA 3U56A 5J47A 3ONVA 3ZW9A 5EGSA 4MVJE 1QOPB 1JKMA 3HM2A 1JKIA 1H0HA 1QAMA 2BN4A 3QG1A 3UXYA 1NASA 1QVWA 1X1EA 2UZ0A 3T41A 1CEEA 1X38A 1K3FA 2A9JA 2Q5HA 3QX8A 2GEUA 4LRQA 1IZYA 1IHUA 3BZBA 4Q1EA 4RZXA 3ZWVA 1ZNZA 1KY5A 1BWQA 2UVPA 3T7IA 4EY4A 3WQSB 1WHTA 2JFNA 4EB3A 1RAEA 2JJ8A 5EXDA 4CT5A 4KI7A 5E6SA 1SURA 5DOZA 4EGSA 1Y4UA 1Z4JA 4NMWA 3I52A 1V8BA 2ZRIA 1XCJA 1P1HA 2EKQA 1QH8A 3PTZA 5AUPB 5JH7A 2O23A 2RE8A 3MGKA 1MAUA 2H1HA 4QNMA 3VAZA 3EPRA 1GG2A 1NKSA 2GBLA 1J97A 3GLHB 3IR6A 2AX4A 4L74A 3P19A 4PXYA 4XB2A 4WCVA 4F60A 1GITA 1JVBA 4TS1A 4NYMQ 2NVUB 3U1BA 2YV2A 5FF9A 2IY8A 3A10A 4XIGS 3WLLA 1JA1A 5LYYA 3UMRA 3TLXA 1FYDA 2B4YA 4KQIA 4N76A 1NX6A 4H17A 4EAAA 1S7GA 2VNJA 3MC1A 3OO0A 3U49A 4G86A 4JLBA 1C1DA 1IK6A 1TIPA 5LMZA 2IHNA 1BWPA 2G40A 2BUAA 4PSCA 2B94A 1FX0A 1XD2A 3U7JA 4RIFA 3S68A 5F33A 4ZT2A 2HJSA 2JVKA 3WNBA 2FMTA 2ILVA 2FUEA 3EAFA 3GC6A 3OPYI 2O5RA 4MKIA 4C0KA 5TDHA 2CXOA 4MWOA 4C3UA 2I2FA 1A2KC 4BB5A 4P0TA 4IEFB 2DFLA 4U2GA 2I6XA 2YS6A 2GAFA 3KKOA 4UHEA 4F21A 2V5VA 1LX7A 2F1JA 3MWYW 3VZSA 7ADHA 5CFZA 4BVGA 3PITA 5M34A 2NM0A 5A4DA 1TMKA 1T9DA 3HHPA 4TSRA 1WB5A 1WEKA 4XIIA 4TYYA 3NBXX 3TVDA 2XDWA 5T5QA 3GAAA 1G5HA 5CPBA 1YC5A 5JAUA 1MC8A 3KU1A 3SS9X 4YJFA 3MJVA 3P5SA 3IILA 4BMZA 3LGXA 5DLYA 5FI1B 4LDZA 4CKBA 2B0CA 3LPMA 3TLGA 4CM9D 2A9QA 5CB8A 1ISHA 1NW7A 1ZVJA 1BFKA 2F1RA 2P75A 5AXBA 4QOEA 2P1DA 1RW4A 5JWHA 4EY5A 5CB4B 4QPPA 2KSQA 1JIJA 1QHIA 1E7RA 5KAPA 4DDMA 2CEAA 1E7YA 4QX6A 2OZPA 1U2DC 4KX5A 4QQKA 3U4DA 3EIWA 3H1GA 4C14A 3R3ZA 5KQGA 2UUPA 4FCCA 1K3UB 3W6PA 3DOCA 4ZKEA 4D57A 3LVRE 1CQWA 3V8VA 1KL7A 4HYTA 5SZKB 1TTHA 5A4KA 3PNPA 2W7TA 4KSBA 4Q24A 1UBFA 4AT1A 1SQFA 3S99A 4V38A 5C5IA 4B1FA 4JDPA 1AZLA 3VZQA 2EEPA 4EUEA 2CMFA 1O5OA 3DDOA 2Y0PA 1RQXA 2IK8A 2GA8A 1QRRA 3W1WA 3DAOA 4QT4A 3COZA 3ZYZA 3KBOA 3SR3A 1JIKA 4H18A 5GONA 3QM1A 2H2AA 4CKWA 1YD7A 3OMLA 1IOZA 2HEIA 3LDUA 2IPXA 4LBZA 1EM6A 2YDXA 2GBGA 3C1OA 3OOEA 5DZSA 4AI6A 2B8EA 3OUUA 3UWDA 1NMEA 1JBEA 2GESA 3IKVA 3IKLA 3JD0A 2JGDA 3QTTA 4H08A 1QG0A 4U2BA 4ZARA 1DDOA 2VPTA 3BWCA 3E18A 3JAKA 3V3KA 1ZGHA 5TY0A 3OQOA 1ZICA 3IQXA 3FVVA 2PKWA 1LX6A 2DOKA 3GRZA 2WJIA 4C88A 1EG2A 2QVZX 2Z2ZA 1QE0A 1QZUA 4BBJA 5EZ6B 4O2BA 3D8HA 3K6RA 5EMLA 2NP6A 2N42A 1IN7A 3VSCA 5ALNA 1W0KD 3UMFA 4YRKA 3AR8A 5FUBA 4ABYA 2GVZC 1JZSA 5AXDA 4CKEA 4LI3X 4XDHA 3OLVA 3RRYA 4LJ7A 1L7AA 3EFEA 4CU2A 2G7ZA 3F8SA 2WTBA 2V1XA 3EIOA 3EZNA 3I4CA 1EESA 1FFBA 1QV7A 3FX2A 4LWZA 3F67A 3LPNA 1NKTA 1XEXB 1Q5PA 2NXNA 3HNOA 1WQ1R 4B3DA 4P7KA 3DDHA 3A2NA 2EKPA 4KIWA 1DJMA 3MD0A 3STTA 5DX8A 5IKEA 5JI2E 4DB4A 5IASA 2Z57A 1KEKA 1QX3A 4AKSA 4KPYA 3W1EA 4MVCA 3UO8B 2FWBA 2PTGA 4ZI3A 1S89A 1OVGA 2BP7B 2ZIEA 4EH1A 4UATA 4U7JA 2BKVA 3NRJA 4JN6B 1MB4A 3VZBA 3D6HA 3M2PA 5KKCA 2FEWB 4R2MA 2C9CA 1PZFA 3KKNA 4OB8A 4GI2A 4OXQA 4RNDB 3QA9A 3AXSA 2JPDA 3K9FC 3I5YA 3IDQA 4DR7B 2B1RA 1D2RA 2C4NA 4FFBB 1YE3A 4LGVA 1FZTA 1QRDA 5G4KA 3FKSA 4JH0A 5EZYF 1AUPA 3I37X 3FWPA 4Z0HO 4ME6A 4NOJA 1M8KA 2CY0A 4MDYA 3BSSA 4R68A 1E4VA 1GOTA 1QIHA 2BEJA 4NNJA 2ZRHA 5EQTA 4HX2A 4BO7A 4V1CB 1U7DA 3SE0A 1NXOA 3SYKA 1YCDA 4NCAA 2QLJA 1SCAA 4D4KA 1G8KA 4NBRA 4DUGD 3RTGA 2FSSA 5F9FA 2CXPA 2J45A 3WIBA 4CQMD 3L43A 4FIZA 5LA6F 2GYYA 3E5NA 1KI2A 2WWXA 3GLTA 3BE8A 2IELA 4OREX 3IJEB 4I2NA 3S8MA 4ZMSA 4M1ZA 4FWBA 2CXNA 2ZGVA 3V2UA 5KSZA 1T43A 2Y4NA 3OBBA 3OEWA 4Q6BA 3MILA 2P4SA 4XARA 2BM1A 2CEKA 4BYMA 4PZDA 5EOVA 4TV9F 4B3MB 1Z2NX 4OYYA 4B8YA 5DE3A 3ROMA 5JALA 3OU6A 1II8A 1RI1A 2QZ9A 1HURA 3FDZA 3K2IA 3MWEB 2DFDA 1QP8A 1AUQA 1ESNA 1HA3A 3KJGA 3MA0A 2JCXA 2ODNA 3OIYA 3LIPA 1IVSA 2QM0A 4C1NA 4Y2PA 3BEDA 3D6MA 4HQKA 1K5GA 1ZH4A 1V26A 2XMGA 2YWCA 1N33B 3ABIA 1WB9A 1Z25A 2R11A 1YJCA 5AHXA 4RK7A 1RPJA 2FEOA 3HU1A 1SIWA 3UT5B 2EQ5A 1FDUA 2H8KA 1CERA 2OXCA 3JW8A 3FDFA 3KFXA 3E3NA 3CM0A 5KI6A 2GXUA 3C98A 3R6GA 2ZE5A 2V45A 4NAUA 3LUGA 3E61A 3WKBA 1Z4PX 4JXZA 4NEQA 3VTFA 1ICEA 1BHSA 1E5QA 2J07A 2QTVB 4QOJA 4Y7DA 1Q2XA 1B6SA 2IXGA 4HLUA 3AUJB 3QVJA 4LA4A 4M83A 4MQFB 4MA5A 3QU5A 4Y2QA 3ZE7A 4WW0A 5GVSA 3JQRA 2JBAB 1DKQA 2HPHA 2L82A 3WWCA 1GCGA 1I4EB 4GZ5A 4RHYA 4XUCA 1YJBA 2VPYA 2Z2JA 1R9NA 2VDPB 4L5YA 4AO8A 1DAGA 3WL7A 4Z5XA 3MYYA 5AIBA 1T9GS 3LC7O 1E0JA 3PRHA 1M3SA 4JWKA 4BQOA 3RROA 1T8PA 3DFMA 2PQ0A 4IJUA 3JZDA 1A77A 5FOVA 4D98A 1NUUA 1UPFA 3EWSA 5SICE 3PHLA 4MKXA 4EHFA 4ZJYA 4Q4CA 3CRW1 2XT0A 1IONA 5H4HA 3ZG6A 2QUZA 2GD0A 3GZNA 1MT3A 2IYQA 4GPAA 5EFZA 1XCMA 1HZJA 3PCRB 2OFFA 4CIDA 3U4QA 5KSPA 1GYPA 3HH8A 4NI5A 5JPIA 4AK9A 4QLBA 2PUBA 1BXKA 5CVCA 1LV8A 2RHRA 3JVUA 2OSVA 3M6WA 3DBLB 3P9PA 5FX2A 5KX5F 1QHEA 4W5OA 5E4FA 1KK0A 2YVUA 3ZE0B 1PE0A 4FOTA 2DPLA 1KPHA 3CB2A 3NBYC 1HYBA 4F9GA 3JQAD 3ZOKA 4CT4B 3T5MA 2NACA 5F4BA 5K3FB 4P3NA 3PDHA 3WIDA 3KZCA 3WISA 2GK7A 3TRDA 2WJVA 3AHIA 4AY3A 4N39A 1ES9A 3OVMA 3ASVA 2FG5A 1MTOA 2WQZA 3I4LA 3UH1A 2WWRA 5A4JA 1M1NB 4BE4A 3GH3A 4K7JA 3C45A 1RFGE 4BNXA 4C7VA 3U3XA 1J5PA 2VNIA 5HBGA 4C3OB 3BMOA 2ISCA 3IUMA 2JARA 2NGRA 3RK4A 4P82A 2E6UX 3OSUA 4FW8A 2EGGA 2HCFA 3AERB 3NP9A 5IAKA 3KPWA 1K9VF 1NJGA 1A71A 1K7EB 4WA7A 5K8LA 5D5QA 1V7PC 3QVMA 1PNQA 1JTFA 4Z49A 1UAAA 3IIEA 5JJKA 3HLYA 5FBWB 2I54A 1JAHA 1BCRA 1TIKA 2A5FA 2ZSDA 2CZGA 3ZGZA 3BFJA 5AKZA 3PQEA 2IODA 5KTMA 4GVXA 4F06A 2KLHA 3AUUA 4Y1FA 2AMVA 3P1JA 5C5DA 5JBNA 4AQYB 4RA9A 1ZMRA 4M1MA 2FX5A 3L1JA 4KEAA 4ZZIA 4REQB 2X5OA 1MCZA 1RDFA 2FWRA 2HYDA 3AUAA 1YCHA 3TLEA 3NT5A 5LBUA 1B2RA 1BE6A 2GPBA 4HS4A 4WK0B 1AJEA 5CM8B 2WHEA 2BBWA 3A4MA 3C4JA 3KV1A 5FBHA 4BGUA 1RHRA 2Y1WA 3KIPA 4DQKA 4XCVA 1NG1A 1CY4A 1GTVA 2NU6B 5A5VA 4ZJZA 4MPRA 2WMDA 3O8OA 3MUEA 4KAAA 3LFUA 4TXJA 1JG2A 4I46A 4MCAA 4YRDA 5EWLA 3PQ4A 3DDUA 1J0AA 2ZJ0A 3V9AA 2XCQA 1V25A 3AEKB 1UFVA 3D4NA 4LYEA 4G97A 2NLOA 1OH8A 4JYPA 5DI3A 1MX5A 2ATIA 1GUDA 1XTIA 1QZXA 2FWAA 3C85A 2FW6A 2B4KA 5GGXA 1FLVA 1IE3A 3X2EA 3N0XA 4LECA 1HNZB 2WK1A 3JQGA 3Q2IA 3RQSA 3VOTA 1XX6A 2J7PA 3FOAA 1DC4A 1FP1D 5EKTA 3KOXA 1T4DA 1A50B 4YHHB 2MINA 3ZJ4A 2OOKA 2YX1A 5LWQA 3PF8A 3V00A 1R9GA 2YWFA 2NQ2C 4DQVA 1IRXA 2V7BA 1N6PA 2RHHA 3EIXA 5B53A 4I08A 5A6VA 1IJBA 1CP2A 1EP3B 3GFQA 3ICCA 4NMXB 4WVLA 1G8AA 1QCDA 1F6DA 1Y6JA 2CJWB 1U31A 2ID7A 3VHXA 5JSHA 1ZAKA 1M0TA 2ENWA 3DE3X 3PPIA 1E1KA 1LSSA 4IXTA 1OKKA 2C4MA 3T8YA 2O5VA 1G7SA 3AVXA 2W2MA 1SC4A 5KO2A 4BNTA 4ALLA 3QE0A 4A8HA 1WABA 3TJRA 4Q7LA 2COEA 3DBRA 5FUXA 2PDAA 2Q45A 1F60A 1DWPA 2J0EA 3G89A 2CFRA 4MEAA 2FQQA 2GZDA 3PIIA 2V3WA 3I5AA 3N7AA 1RAAA 3SDBA 1WU7A 1TJ4A 2YQ5A 1EAMA 1GCIA 3CX6A 3UUFA 2HBZA 4LVNA 1PFWA 1GRVA 1ZGBA 2CLOB 3INTA 1DT5A 2WSMA 2O3TA 2WU3A 1AKWA 3HA3A 2IGTA 5DDIP 3VNSA 5BN1A 4W5QA 1MV8A 2ZITA 3BILA 3OC6A 5AXAA 4AZSA 1X7YA 2YVQA 1HI9A 1ZCAA 5DM1A 2TSYB 3RT9A 4A0HA 3UICA