2IF0A

Crystal structure of mouse rab27b bound to gdp in monoclinic space group
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
184
structure length
174
Chain Sequence
b'YDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDAFKVHLQLWDTAGLERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-27B
publication title Structure of the small GTPase Rab27b shows an unexpected swapped dimer
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 46
structure length 174
sequence length 184
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2if0A00
1AKYA 2CLCX 4G5OA 4NCJA 4TQAA 4DEYA 1US8B 3V9PA 3S1AB 4D4MA 3PEYA 1KI2A 2QA5A 3KL4A 4XWOA 4QC2A 2ZS8A 3Q5EA 4BZXA 2AWNA 4IVRA 2VSXA 3U3RA 3QXCA 3AVTA 4TSFA 1L4UA 4Z8XA 1WMSA 4Q1BA 5J4LA 2IL1A 2Q9BA 5HE9A 2XZOA 2BMEA 5JWRA 3P4YA 1DTSA 4M9XA 4O2RA 2NIPA 2RGBA 4HLQB 5BN4A 4AURA 1XJ0A 3DOEA 2Q3MA 1ESNA 2W6IA 4FW9A 4MYHA 2QP4A 4QFMA 4M4SA 3W34A 1ZC3A 2ZJZA 2HYIC 3BH7A 3K0AA 2P67A 4URVR 4XTRA 3MRSA 4ZKEA 2YWEA 2XGJA 1T8UA 1R4AA 2ZYVX 1R0XA 1RKBA 1ZIOA 2YVUA 2FN4A 3Q5DA 2C99A 2QPAA 1FOEB 1G3IA 1N6RA 1XJCA 1W36C 3GEHA 4JVMA 4MDEA 5H70A 1UEIA 2R6AA 3KJGA 4JBXA 2CE7A 4Q4JB 2NG1A 3ZZ0A 2WOOA 5EXTA 4M53A 4NYIQ 2RAPA 3Q3JB 3ZQ6A 4KHZA 1AS3A 4EPVA 3U4QB 1ANKA 1OE0A 2BCJQ 2FSFA 4G5GA 4UNPA 2ZS9A 1JEEA 4BUJA 2F1IA 2PLFA 1W4AA 2RGAA 4IEEA 3EAQA 4LPKA 2ZJYA 2GETA 2HV8A 4M2LA 1UEJA 1ZM9A 4A8JA 1FFHA 2ZM5A 2CDNA 1TU4A 3LVQE 4PQRA 3ZIAA 2EYQA 2GXSA 2J0UB 4ZDIA 3BORA 3W8RA 3B1WA 4OHXA 2GEDA 4M1SA 1HT1E 1NVVR 2GZDA 4OQXA 3I8XA 4IXNA 5KYKA 4YMTA 3ASYA 2Q21A 3BH0A 2J59A 3FFAA 2FNAA 1WCV1 4ILEA 2OESA 4NTZA 3O8CA 3IILA 3HU2A 1ZC4A 3X1DA 1Z83A 1X6VA 3X1WA 1SQ5A 4MKGA 4LJAA 2FG5A 3ADCA 3SNHA 2NQ2C 1II8B 1H8ED 1OXVA 2GWHA 3VU9A 3THXB 3ZYCA 1RJ9B 4NMMA 3RRZA 1B0UA 2VHTA 3MMPA 1JR3D 1NMZA 1UKVY 4XOIA 4V0NA 2A30A 2C9YA 1W48A 2EFGA 3FHOA 2P3SA 1EK0A 1KI6B 1VKJA 4JLDA 1YR7A 4RCYA 3SJBA 3GLGE 1FNMA 1EG7A 221PA 4GI7A 2WWXA 1R10A 3TQFA 2FJUA 2VHQA 4TTRA 2XAUA 1Q20A 1XTIA 1NLYA 4K8OA 2CL7X 1NLZA 1KIMA 3KJHA 2HF9A 1E2QA 3CF0A 4TMXA 3SJAA 4FCWA 1OFIA 4BLQA 1Q1QA 3FWYA 1VG8A 2ZQ5A 2NZ8A 2R6CA 2XB2A 5TVKA 4A6PA 1YR9A 4NYMR 4ZIRA 3A1SA 1DAFA 1N0VC 5FOVA 1KI8A 1UM8A 3CKLA 2FPKA 3C16C 4KYUA 3I3SR 1CKEA 1XU4A 1TPZA 3TSOA 4DB2A 2YWHA 2ORVA 4DIDA 2BOVA 2VSFA 4QXAA 4UJ3A 1CR2A 4JKIA 2DBYA 4HB0A 2O8DB 5FOUA 1JR6A 2X2EA 3LFUA 3RSOA 2QROA 2QTVB 3Q7QA 3BOSA 2JLXA 5CB8A 2ZYTX 2P0EA 4AYTA 5FPHA 1OPXA 1RYHA 1QHXA 3SJZA 4B6EA 1JNYA 1A1VA 4LV5B 5L3QA 1G5PA 3RC3A 3K9NA 2W83A 3U60B 5JLJA 4RY2A 1R5NA 4TMTA 2QE7D 3QSYA 4HAYA 3TMKA 4EJSC 1G7CA 3N2IA 1N25A 3IQXA 4V0OA 3K9LA 1MR3F 1L4YA 4OQNA 4BFZA 1RZ3A 3TBKA 3IBYA 3QENA 1WRBA 2YOHA 3DL0A 4NYJQ 4Q7LA 4IDNA 3PUXA 4PQYA 3EWAA 4OQLA 2ODWA 4NYIR 3GLFE 1IN8A 5DI3A 4EFLA 1TQ4A 3VKGA 4DC9A 2Q0HA 1NJFA 2GXAA 1O3YA 3ETLA 2QTHA 3F8TA 1YVDA 1W2HA 2IS4A 3QBVA 1KK3A 3JZMA 4JS0A 4YDSA 3DMNA 2WWFA 4FMCF 5AUPB 5J47A 1KKMA 4MUAA 2J7KA 4D81A 2AX4A 4Q1EA 2AKAB 2JDID 4Q4AA 3AF1A 3TR5A 3UMFA 5L3SB 2VP6A 4HAZA 1E2DA 2GZAA 1T91A 2FZLA 2RGNC 2ZJBA 1H8EA 2VH5R 1UKZA 1TEXA 2EFDB 2XOKD 2ZRIA 4FWTA 2VP2A 5FOSA 1JR3A 2QGNA 4URWR 5JHHB 2KE5A 3MWKA 1RRGA 1SXJC 3SYNA 1IHUA 3QIAA 2QL6A 4TQUS 2R62A 5DI9A 1OH5A 3KUCA 1R5OA 2IA5A 2UZ3A 3VR2A 4KI0A 4EUNA 2O8EB 1E2NA 3QXHA 3AM1A 1P9NA 5HZKA 4HLDA 2WSSD 2OHFA 3GLHE 3TVTA 3AVOA 721PA 1O87A 3GJ3A 5DYGA 1KJWA 2NPIA 2FOLA 3MUFA 1KI3A 1E2IA 4F4IA 3ZGXA 2GXQA 2P6UA 3LX8A 4NCNA 4XSGA 1U0LA 1MRSA 1XD2B 1HYQA 2JLRA 4TYNA 1GRQA 4NP6A 2P5SA 1E9CA 4NZYA 1Y63A 1RYFA 3BGWA 4Q03A 1DARA 1KO1A 821PA 2PBRA 4J0QA 4HZIA 2O8FB 2ATXA 2WMNB 5AUOB 3MD0A 2X77A 1KJZA 3TUZC 4JLKA 2GJSA 2V6IA 4C7OA 3NBYC 5EQTA 4D6PA 4TYPA 1WE2A 3BERA 5LB4A 5CDFA 4IJMA 2FFQA 2V6JA 3SHFA 1Z6XA 5K8IA 1GWNA 3GMTA 3MCAA 2OEPA 4GOJA 1KAGA 2AL7A 2LWIA 2GJKA 3EC1A 2QE7A 1E4VA 2H57A 1RPZA 4AG6A 1II9A 3CRW1 1S4QA 5FOTA 1CJMA 2X2FA 3I62A 4RZ3A 1FP7A 4PO1A 3AVUA 5LDDC 3IIKA 3IIJA 4CF7A 4TTPA 3I73A 2C03A 4M1MA 2ZRFA 5FTKA 3ICQB 5DO9A 2EWVA 3AVQA 1SULA 2VL7A 4PHHA 2A5GA 2YWGA 1SKYE 4GPTA 2DHRA 1KK2A 3HU1A 2WAYA 5JSZA 1G7SA 2IS1A 1G21E 3HR8A 4BFUA 3KZ1E 2YC4C 5J40A 2W2TA 4TMVA 3EX7C 3EA5A 4KSCA 2JDIA 5DSZA 3HU3A 4RD0A 5DIFA 4D0LB 4JBYA 4DDWA 1ZD8A 2BJVA 3B9PA 5G3ZA 2CL0X 4M1YA 2MSDB 3OFND 2XOKA 4PTLA 4W7SA 1S1CA 1N5IA 4PSAA 2OFXA 1CJTC 1XXHB 4OI2A 2IBMA 5J4HA 2J41A 2P6NA 2ODBA 2Z4RA 1RFLA 3VAAA 2HJVA 3WP0A 5SZKB 3VHXA 3EC2A 1GDDA 4MYCA 2WSSA 1XRJA 3QXSA 3QF4A 3U44A 3PUVA 4JYCA 2D06A 1C9KA 3ZVRA 3M6AA 4RD4A 4CW7A 4W5HA 4D26A 2QTFA 1NG9A 1EFUA 2DB3A 4V03A 2WSMA 3N5CA 1ETUA 1IXZA 2AK3A 1CEEA 1QHHB 4F91B 1KJYA 3BIFA 1IJEA 2PJZA 1FL9A 3T1TA 4HAVA 5DGXA 4HAWA 1SHZA 1QHGA 3A4NA 2QN6A 2H92A 4LJ6A 4RD2A 1GNRA 3GFOA 1N3BA 3BWDD 1DAKA 3CX7A 1CJVC 2IXGA 1A7JA 2ZAOA 1E2MA 1NVXQ 1XJQA 4OL0A 3UK6A 1SXJB 4D0GA 1BIFA 4DCNA 1AZTA 2D4HA 3A1VA 3GQBA 3F5FA 4HUQB 3B1YA 4BGDA 5DE3A 3NIBA 1I4LD 4PPNA 5CJPA 3TRFA 4NDZA 5GVRA 3V4RA 4QGFA 4AIIA 3HP1A 4JZKA 1DVRA 1NMXA 2Z6VA 5EE1A 4HDCA 4GZMA 1VMAA 3LA6A 3IPYA 4CRWB 4LHVA 2I1VB 2ZROA 4P3YA 4QGGA 2I4IA 2ZVPX 3LDAA 3K8YA 4I81A 5F9FA 4P4SB 3NVAA 2YHSA 4AWXA 5CLQA 4HB2A 3CNOA 4LRWA 3A4LA 3AV0B 1EFHA 3EZ6A 2WHXA 4KSBA 2OAQ1 5EE5B 4AI6A 4F4JA 2ZTSA 4C7OB 2D62A 1X1SA 3LV8A 4MYUA 2JJ2A 4R2IA 3KB2A 2VEDA 1Q1ZA 1J2JA 1TUEA 2KBEA 1KDTA 3NXSA 1VECA 4MKHA 2IWRA 1OT3A 2R44A 2J1LA 3MJHA 2PLRA 3QKRA 2IS6A 4MRVA 4B3XA 4E09A 1KNQA 1QVAA 2RCNA 3TLXA 3TGPA 3IHWA 3K0AB 3TE6A 2RB4A 1E32A 3BH6A 3NTUA 2G6BA 3LNCA 2C78A 1A2KC 1XDBA 5LPNA 3OFNA 4LUCA 2GK6A 1VCMA 4LYFA 3QNUA 4AK9A 3MWLA 2ERXA 4DLTA 4DUGD 1HA3A 1JECA 3DM5A 5GJVC 1BMFA 3SHWA 5C46F 1HEIA 4C30A 1ZNYA 2ZS7A 4PO9A 4US0R 5HE8A 1LW7A 2QQ0A 4TLBA 4JYBA 3TAUA 1FUKA 2QG6A 2RH5A 2A78A 2ONKA 4GP6A 5E7MA 1GKYA 1M8PA 4PC2A 3BB4A 1WB9A 4CEJA 4URYR 1CLUA 1NKTA 2ZVQX 4RFVA 3GLIE 3H84A 4O3MA 4F38A 4JKYA 3GEIA 3Q7PA 4A8JB 3AVXA 2C2HA 3EZ9A 2IXFA 2FPLA 2ZR0A 4I4LA 3R9IA 2DYKA 2WKRA 1LF5A 4HDQB 2FFBA 2DR3A 2YOGA 2ZSDA 3DPUA 2REXB 4Q18A 1AQYA 2ZRNA 3T34A 4JL6A 2ODEA 3PEWA 1UBCA 2QI9C 3A58B 1FW6A 3ZS8A 1G16A 4GL2A 3LD9A 2O8FA 2WWHA 3Q9LA 4ON9A 3H2YA 4BLRA 4MDFA 2HLDD 1UPTA 1XD8A 1R0ZA 2QRZA 4IXMA 5HKKD 1G41A 5GJBA 2QORA 3LBHA 4QJ3A 1OHHD 2ZJAA 1ZU5A 2QENA 3DOFA 1A4RA 3BB3A 4Q01A 5M04A 4JSYA 3CF6R 4TL7A 2AFIE 3L82B 2IEZA 3VU9B 1UKYA 1IN7A 4BPBA 2G3YA 3DKVA 5DYIA 3O8BA 1NNEA 3K0CA 5GJWC 2NO1A 2C77A 1JQJC 2RHMA 1N6KA 3EWSA 3K0EA 3WHLA 4ASUD 2OV2A 1NF3A 3CPEA 5AJWA 2C8VA 2VQSA 5LBIA 4RKFA 4DXAA 2ZU6A 3W9YA 2V1UA 2K5UA 1LNZA 5TXGA 3P1JA 1Z07A 5FTMA 1FUUA 3LRPA 4B74A 4Q7KA 1M2OB 5B2ZA 2FV8A 4GMXA 2XNSA 3OF5A 4WXPA 2HCJB 2WBLC 2MSEB 3ND9A 2VTKA 5ANRB 1T3SA 2A7QA 1Q1EA 5FUYA 4S2EA 2WICA 2QSZA 3CX6A 4PQFA 4ZIRB 1ZYUA 4BLSA 3D3QA 5DN6D 2BVNA 4MGYR 1S0UA 1E9EA 4QOSA 4EPRA 2GKSA 2WAXA 3FVQA 2ZRGA 4Q4HA 1X3SA 1Q3HA 1QHSA 2ZIAA 2N1BA 1KZGB 1E0AA 3LLUA 5TB5A 4HB4A 4L16A 3VQTA 1DE0A 3QPUA 1G4AE 1ZNWA 4XWKA 4DUGA 4L9WA 4N1AA 4FMDB 2GCPA 2W0MA 4HEJA 4XSHA 1P2SA 1GAJA 1JXMA 2IHYA 3QG1A 4PPFA 2B8TA 3ADKA 4DSTA 2R6GA 1PVOA 4OK3A 5L3QB 3AUYA 4PSVA 1YZQA 4LHZA 3ZVLA 1PV4A 3I72A 3FDIA 1P6XA 1WQ1R 2V55B 1LB1B 2FSIA 4Q66C 1ELOA 2JLVA 2GVZC 2ZR9A 1W49A 4URUR 1DBSA 4M22A 3UMSA 1R7RA 1F5NA 4MKFA 2A3RA 4TL9A 3TH5A 5FPTA 3T1OA 4DDVA 1Z3IX 2GRJA 5JWOA 2ZEJA 4HUTA 5DI3B 3X2SA 2JLUA 4D4JA 3LY5A 3ZZTA 5FPSA 4KLZA 4GP7A 4OBEA 3QKSA 4PSKA 2IYXA 2OCAA 2BC9A 2J5XA 1T3HA 3TUJC 3GP8A 2HLDA 2AWOA 5JS7A 2PCLA 1XTSA 2ODNA 5HKKA 1W4CA 4R9UC 5JRJA 3PFIA 1K5DA 4TWZA 3ZLJA 5AJZA 2IYZA 2O8BA 4HUQA 4Q4AB 1OHHA 1YKSA 1Q12A 4WIAA 2PZEA 5KUTA 1YJ5A 4FWIB 1ZUIA 2JIZA 2WWGA 1IN4A 5BW8A 1SVSA 2X1VA 1HT2E 2O0KA 4KLNA 2D74A 4DDUA 1NKSA 2J7PD 4G3XA 1SHKA 4LJ5A 5KTYA 3BK7A 5EP3A 4PC6A 2EVWX 4B6FA 5J4YA 1LF0A 1V5WA 4ASUA 1RRFA 1SVIA 1KMQA 3DHWC 4KBGA 3KQNA 2BCGY 1OSNA 2RGDA 4OYHA 4V0ME 5EE9A 2CCJA 4UNQA 4RD6A 5LB2A 1CR0A 2XITA 3THWA 2G1KA 1W0KD 4IVQA 2XZPA 2PZFA 4FMBB 3OZXA 3ZD7A 1A82A 3RRNA 5EE3A 4G1UC 2ZE5A 1NRJB 1EFCA 1D5CA 3L43A 2IUSA 3FE2A 5AUQA 4GT1A 2N42A 1U98A 4Y0AA 1CJUC 2MSCB 1T0JB 3I5YA 4IW3B 4JLOA 4ZI3A 2IF0A 4QGAA 4IVPA 1XZPA 1M7BA 2BKEA 2GJ9A 2HT1A 4CEIA 3IHLA 4F7WA 1XMIA 4UXJA 4PHFA 1KY3A 2FX3A 5DN6A 2W0SA 5JCPA 2BMDA 1P4SA 2ZI6A 4TN1A 1IONA 3BFXA 2JJ8A 4C3ZA 3RRMA 3Q85A 3AF0A 1NBMD 4IEIA 3OIUA 5C1BA 1E9FA 1P75A 3AKEA 5DH9A 1KSHA 1Q57A 4LBYA 4ZPXA 1Z6AA 4JLBA 5JI2E 2XSZD 3DZ8A 3BE4A 3QVUA 2WOJA 3FMFA 3T5GA 5KSYA 2OG2A 4KFSA 4TMWA 1E2EA 1Z08A 3CR8A 3EXAA 1M34E 1TUIA 3IEUA 1N2CE 4MA4A 4UKDA 3RABA 4AYWA 3CF2A 3SQXA 4MH0R 1OKKD 1DO0A 3CZPA 1YR6A 4JL8A 4XVQA 3K70D 3NDPA 2LKDA 1OH6A 5CM8B 3G5UA 3QEOA 4C0SA 4AKHA 3RHFA 2OUKA 2HF8A 3U7GA 3FYHA 3LX5A 4CT4B 1P5ZB 4QNMA 3R20A 1CR1A 2REBA 2OXRA 2BKUA 2DWQA 2IEYA 1Q1BA 1YZKA 4JVLA 4WZ6A 4ZV4A 3AKCA 5HZHA 1JBKA 5KSOA 4BLTA 1FQKA 2H8KA 2EYUA 4B3BA 1Q22A 4YLGA 1TNDA 2XTNA 5JSZB 3WYFA 1W5SA 3MG9A 4OJQA 3WYGA 2QMEA 3OE7D 2CCKA 4IFBA 4QHTA 5AJXA 5DLQC 5KNCA 4RKEA 3X1ZA 4OHYA 5JMTA 4NONA 1OH8A 5AUNB 4RZXA 1XNJA 2XNDD 1ZD9A 3AUXA 4A82A 2GHIA 2G77B 1P9RA 1L7VC 2J7PA 5JJIA 2N46A 5F2EA 2DFKB 5EP1A 4IOLA 4B47A 1Z0IA 4E22A 4Q1DA 4BEBA 1G8FA 3TUIC 3HYRA 3A8TA 5UKDA 5J5CA 4RD3A 3WP1B 2IX3A 3QF4B 1ODFA 3U44B 3FMIA 2R65A 1W0KA 5EP2A 2GF0A 1XF9A 1E98A 1U0HC 4YMVA 3L2OB 1G3MA 5DHFA 1P72A 2L0XA 1T5LA 3B60A 3K0CC 4MUBA 4F92B 2QM8A 1UKEA 3AEZA 1UBFA 3H86A 4G0NA 1T4GA 4PXAA 1WBBA 4HLUA 4KYIB 2GAOA 1D6JA 2F3RA 3KQUA 3K9HA 2GESA 2OXCA 2QT1A 5B57C 3QXJA 1PZNA 4B2IA 4YMUA 1KO4A 2ZRCA 2Q3FA 2V3CC 2W2VA 2AXNA 1YR8A 4Q7JB 1Z0DA 2I1QA 2FFHA 1NBMA 1CTQA 4Q1FA 4NCKA 2GCNA 3NHBA 2FEMA 3IBGA 2JLQA 2ZRKA 3QPWA 4JSTA 3AP1A 3PCRB 2XSZA 4Z54A 3D6TB 1ZM2A 2A2ZA 1EX7A 3A6PC 1FP6A 2BBOA 1PLJA 2WIBA 2XJ4A 3OAAD 1VDZA 4YC7A 3NG1A 4DLVA 1S2MA 1U9IA 4LK2A 2WV9A 2RMKA 3DVLA 3EG5A 4LWZA 5AK0A 3ZJYA 3R8CA 1UADA 3C5HA 1CRQA 1AGRA 2HXSA 2LCFA 2ZSFA 4M21A 3VKWA 1NVWQ 1OKKA 2YINC 3JVVA 2ZYWX 1OYYA 1TL7C 2Q3HA 4P4TA 3QJYA 1QVRA 621PA 1N6OA 4TLAA 4GBMA 3R8FA 1N5KA 4MGZR 2VP9A 1JPNA 3B7GA 4A1FA 2RGXA 3LW7A 3VR4A 5C18A 3WYAA 4M9ZA 1E2PA 4FCVA 2H7VA 2DWOA 2FPMA 3PEVA 3N70A 2KB0A 4XD7D 3CIOA 1LVGA 2GDJA 3I5XA 1AK2A 3HPQA 2P2LA 4OQMA 5FL7D 3GLGB 5A0FA 3EW9A 3KKPA 4FN5A 3KKNA 1YZGA 3QKRB 4I1SA 3OE7A 4YQFA 4EIWA 3TK1A 3CLVA 4QM6A 1X86B 3CWZA 5C4MA 1PUJA 5EUQB 3FHTA 3VR1A 5LD2B 1FNNA 2FMXA 2GCOA 2XNDA 4QHSA 2G9NA 1ZVQA 2CJWA 5KHOC 2PT7A 2Q6TA 3SBEA 4ZDJA 3KTAA 1ZUHA 4I1UA 3VKHA 4A2QA 5G53C 2J3EA 1Q44A 2CVFA 2WM9B 4OI0A 3WNCA 1S8FA 3QQ5A 4KO8A 3A4MA 1PLLA 4L4UA 2MMCA 1L8QA 4HDOB 3LQRA 3A37A 5JI3E 3KUDA 1R0WA 1U2RA 1E4YA 4H1UA 1ZM7A 2WJJA 1VG1A 4TLEA 2V7QD 1KI4A 3THOA 1LY1A 4GOXA 4MYTA 2GZHA 5FBQB 3UANA 5IRCD 4OI1A 4CEHA 2A5YB 3UG7A 4CEJB 4A36A 2HT6A 2H5EA 3QKTA 3W6NA 1BO6A 5L8VA 1WA5A 4JLPA 2C9OA 4B43A 4LBVA 1MRNA 1G5RA 2OSBA 2ZE8A 4BLPA 4L15A 5JCZA 1DS6A 4DLWA 3EZ7A 4LX0A 1XEWY 4G5RA 1D2MA 1N6PA 3TSZA 2ZRLA 1CXZA 3B1ZA 2H17A 4FD2A 1NIJA 2BEKA 3KKQA 4GDFA 1FTNA 3GFPA 2H1LA 4JMPA 4A92A 1NJGA 2FA9A 1AIPA 3LO5A 2W6JD 1T5IA 2YC2C 2VA8A 4II7A 3ZQJA 5JEEA 3LBNA 2REOA 4HYYA 2PL3A 3IPXA 1TF2A 2D3WA 3SZRA 5AWFC 3ZDQA 1E2HA 1NL3A 5KU1A 1C4OA 3C15C 4KVGA 1EXMA 3OAAA 3LWNA 4PC7A 4OHVA 4AD8A 1OF1A 3K0FA 3O47A 1XXHE 2NTYC 1A2BA 2HJGA 4FMCB 4EFMA 3Q8XB 4IRUB 3AH8A 5A4JA 5KPJA 1QBKC 3FPAA 1EWRA 3BD9A 3TR0A 4BE7B 2CHGA 1RW4A 5CK4A 3SYLA 1U99A 5E3HA 5FH9A 1ZM4A 3FMOB 1P9WA 2V4ZA 1T6NA 2QAGA 2BV3A 2P5TB 3RS3A 4BFTA 5KDLA 2WIAA 2PJRA 1AZSC 1BS1A 4C0KA 1E2LA 1YZNA 3P4XA 4LHWA 4DRZA 1KAOA 1H65A 2CL6X 2JGNA 4N0DA 4HB3A 4Q9JA 4CYMA 4XD7A 2QQEA 4PAQA 4GNKA 2GBLA 3SS8A 1W0JD 4ACBA 1IXSB 1GTVA 2H18A 3W3AA 4TYQA 5FL7A 4DLXA 1MO4A 3PENA 1HQYE 1KI9A 2JLWA 4PR0A 3MAAC 3R7WA 4NYJR 1E2KA 4V0MA 3EPJA 2O8CA 4I99A 4CDGA 4KFUA 5JEDA 4QBHA 2AHOA 4KXFB 3BBPA 4A8JC 1SXJE 1PUIA 4C0HA 1IBRA 4Q4HB 1NIPA 1Z06A 1XD9A 2DFLA 2J0SA 2A9KA 3IDQA 1G18A 4C9BA 1G1MA 5C4GB 4OK5A 3CRVA 4EFNA 1IOZA 2ZRBA 2CEAA 2HEIA 3VX4A 2ZAMA 3CO5A 2IF2A 3GJ6A 1NN0A 3PG5A 2GEUA 1W36D 3QVVA 2V7QA 5SZJA 2ORWA 4JVNA 4P33A 1I2DA 2G83A 4C0JA 2F1RA 4PZZA 4B2LA 2O5VA 3NBZC 5TY0A 3B1XA 3BB1A 4PHTA 1Z2CA 1G8HA 2ZREA 3NBXX 1J8MF 1ZCBA 3EIEA 1T0HB 2ZJOA 4PAOA 3LVRE 3PVSA 1LTQA 2B8WA 5F98A 3BRWD 2F9MA 2CHVA 3OIVA 2QMHA 3ONWA 1E3MA 3A36A 4B76A 2KSQA 1TMKA 5TARA 2NO6A 4W5JA 3B82A 3QKSB 4TZ0A 1F2UA 4QRHA 5FUWA 3I1FA 4D4KA 3UPUA 1XPOA 1HURA 1W5TA 2W6JA 3PR1A 5FI1B 3H0KA 1ZMXA 1R5BA 1V43A 2BBTA 3NKVA 1WF3A 1KHTA 1E69A 1WXQA 2GEVA 2HYDA 4TLCA 4EQ6A 2O8BB 4IOJA 1NG1A 4U7DA 3SC3A 1G3RA 1FQJA 3SJCA 5J4VA 2VHJA 1R8SA 3F3YA 1GKIA 1PLKA 1RIFA 4M1TA 2AD1A 4S35A 2OILA 2IYLD 2EFEB 2F7SA 2UVQA 3NEJA 4IHQA 4WVFA 2KWIA 3B78A 4DDTA 1KGDA 2J87A 2DY1A 2ZYUX 3CM0A 4DLSA 1E9RA 3M0EA 2V54A 2JLZA 3TIFA 4XH9B 3UMRA 4N3NA 2Y8EA 4N0EA 3RANA 1GG2A 3E70C 1Q3TA 1QG2A 3THWB 2PEZA 3AP3A 3WNDA 2YZ2A 4LHYA 3WY9A 4BZPA 4DIEA 4EPXA 2ZUBA 3D7MA 5E95A 1YRBA 2VPPA 1ZU4A 1ZCAA 3RDPA 1W0JA 3KDSE 2ZANA 1QHNA 4FCTA 1E0SA 3MWJA 4PO8A 3GLGA 1Z47A 4CEIB 3JZAA 4W5WA 1BYUA 1DPFA 3VX3A 3QG5A 1FMLA 2VP5A 5FOWA 3CRQA 1ZINA 3KFVA 2B7CA 3ZS9A 1TQDA 2NZJA 5E4FA 4FIDA 2GNOA 1LS6A 2H16A 4DCTA 1I2MA 1W46A 2VYFA 4OKSA 2XZLA 1Z0KA 4GMDA 4Q4LA 5DHAA 4Q00A 4QKQA 3H1TA 1T8TA 1XFAA 3I4LA 2C5LA 1G4UR 2BEJA 1W1WA 3CUEF 4W9MC 2J46A 4HATA 3KJIA 3KQKA 3GFTA 4EPYA 2ZI9A 3QPVA 5B30A 1Z22A 5IF9A 4XWAA 1GKUB 4JVSB 3E5HA 4RJLA 3FOZA 4QNRA 3T12A 4NBSA 2OBLA 3KJEA 1FZQA 1GIAA 4MGKR 4F93B 4LDJA 8OHMA 4Y0VA 1G8PA 1OFTA 2F1HA 4I1OA 3EIHA 3PV0A 2FSHA 1XEXA 2BM0A 4RFSA 2F55A 1X8KA 4LY6A 5IK2D 4BECA 4DT1A 3B1VA 1GZSA 4ZO4A 3Q72A 3LXXA 5FTNA 2ZPTX 1JPJA 1VCIA 2JEOA 1XWIA 2OM2A 1J90A 1D9ZA 3PITA 1XBTA 1EESA 1KDRA 1T9HA 1P62B 1WDTA 4DLUA 4KBFA 3TAHA 3CZQA 1KK1A 1TF7A 4TMZA 1VHTA 2QSYA 4DEXA 1TF5A 1OXSC 2Q9CA 2DPXA 3C41J 3T06B 2QT0A 1N6LA 1CULC 2W58A 1J99A 2HCBA 2QPTA 1G3QA 5DISB 3TKLA 2ZRHA 1G64A 2DWPA 4JLNA 1P73A 4DKXA 3GLFA 4JJZA 4FI3C 4MQBA 2IYQA 4AC9A 1TQ2A 2ZI4A 3U7HB 3I92A 4EAQA 2OFWA 1ESMA 3U7FB 3EASA 4L5BA 1OW3B 1N5JA 3OHMA 2RKOA 4YMWA 5AR1A 1NLFA 4DLZA 2AK2A 4MRNA 2IHBA 1JAHA 3LAWA 1JJVA 4BRWA 2A5DA 5IT5A 3QXXA 3PUYA 3J81k 2QM7A 4M1KA 1JEDA 1Y3AA 5JHGB 4F4CA 3IKJA 1Z63A 4US2R 3LW8A 2EWWA 521PA 4CVNA 5FPKA 1F3OA 4ESVA 3GJ5A 1IXRC 4YDHB 4PC3A 4RVCA 3PUWA 3CX8A 2VIIA 3CPHA 4B2PA 1K6MA 2J0QA 4IDHA 4KAXA 4HZUA 5KDOA 1BOFA 1YZTA 4ZCIA 1EFRD 1XTJA 1DAGA 4GZLA 3B9QA 2QAGC 2QNRA 3B13B 2ASEA 1NSFA 3U2QA 4V02A 1OV4A 1CRPA 4LYHA 4QM7A 3GLHA 4NCHA 4PFSA 4XTCS 3MSXA 4Q9LA 1VYTA 5KSZA 1ZIPA 1DAEA 3SFVA 1G6OA 2ZRDA 3RS7A 4B48A 4URXR 1KSFX 4AY2A 3U5ZB 5IHPA 1RVDA 2PX3A 5CM9C 3IO5A 2IUTA 2ZU0C 2C96A 3RC8A 1U8YA 2OAP1 3SFZA 4KFTA 4RD1A 1BKDR 1YU9A 1XB2A 3O8RA 6Q21A 1JR3E 3PIRA 2BHRA 4NE2A 2FEOA 4O25A 5JZVA 3RS4A 3ECCA 5SZHB 5GADl 2W6ID 1E9DA 1X8LA 5KDDA 4CT5A 2YWFA 4NL4H 3THYA 3K70B 2QPOA 2PEYA 3K53A 2F43A 3WBKA 3AGPA 1FX0A 5AJVB 4ZCMA 1MO3A 1M74A 2IYWA 4EJSA 4E07A 2WJIA 2YYZA 1TU3A 5IK2A 1W44A 5KO2A 1IY2A 4ZI2A 1HE8B 2UZIR 5K8UA 3KXIA 2FZ4A 1XP8A 3P20A 1OFHA 2BDTA 2XJ9A 2ZR7A 4WBSA 3CBQA 1VTKA 4PX9A 1P7CA 5F9HA 4NH0A 2C9CA 3M1IA 4U00A 4BEJA 2QP3A 4XVRA 2J45A 1RC8A 4MRPA 3RVBA 4IOMA 2GCOB 4JBWA 4E03A 4DVGA 2ZXUA 2QEQA 1AS0A 5KPDA 3GJ4A 2CJWB 3NC0C 2UKDA 1U90A 1HUQA 4BFWA 5CDFE 3UKDA 5DNYB 4H9GA 3KTAB 2RGNA 4QBGB 2WKQA 3TW8B 2O0HA 1DG3A 3REFA 3ZD6A 3CNLA 1VHLA 2KI5A 3C5CA 4NKRA 4Q47A 3RS5A 1NN3A 2YOFA 3TJZA 3W6PA 3E2IA 4L9SA 1NN5A 2GILA 1S96A 4CEHB 2GVDC 3RWMB 1GITA 3GJXC 3U3MA 2IXEA 5JJKA 4C0LA 1B23P 3I8SA 2JLYA 1GL7A 1EFRA 3RS0A 5CB6A 2ZE7A 2OE2A 1NI3A 2OBMA 1QG4A 3UWOA 4ERNA 5BQ5A 2WWWA 2ZI3A 1F48A 2R6DA 3LLMA 5H68A 4OK6A 3QI2A 2IT1A 1I4DD 4G5QA 2C95A 2FSGA 4NYMQ 1TX4B 1P2TA 4DSNA 1GRRA 1DAHA 4NHOA 2ONJA 3SEAA 4WW0A 3CWQA 3AVYA 3EZ2A 1MABA 2FH5B 1QHIA 5FR1A 4BQSA 1N6IA 5CIWA 3PQCA 1CS4C 3EZFA 4ZDWA 1YRAA 2G88A 1NMYA 3K0FB 1W2GA 2QBYA 5FUVA 1W47A 3VHLB 5LD2C 1BYIA 3T35A 2F9LA 2OT3B 1ZJ6A 4E5UA 3D8BA 5FUXA 2C98A 4HAUA 2W00A 3NC1C 1GFIA 3L0PA 2QAGB 4KJZA 3BJIC 4A4DA 1QF9A 1D9XA 1QHYA 3OEED 1SKQA 4KODA 1M6NA 4A15A 2HXYA 1JB1A 2QU8A 2RGCA 2BMFA 1F6BA 1KMHA 5GVSA 3HJNA 4LV6A 2P6RA 3V00A 2VP4A 2PZGA 2MMGA 1U81A 5FTLA 4LYJA 3WMEA 2FGKA 2FGJA 2CK3D 4LPSA 4WZAE 2RHDA 4JLJA 1R8QA 2CNWD 1JXOA 4PAMA 1VCNA 2AFHE 4QBFA 2B21A 3R7WB 1VPLA 1RRPA 2CMKA 4UNNA 4JJKA 4CZ2A 1X8JA 2O8CB 4DWJA 2NO0A 3UATA 4L8GA 3VR5A 3ZVNA 1JJ7A 1KDOA 2AXPA 2PX0A 2CBZA 5BYJA 4JLAA 4A0GA 4JLVA 2Z5FA 1CR4A 1JI0A 1LFDB 4I1VA 1G9XA 4IFEA 4UQOA 2IYTA 3FMPB 1VYUA 1TQ6A 2WJGA 4MRRA 4Q1AA 1I4TD 2DFNA 1W4RA 4OHWA 4D82A 2FU5C 1OB5A 4A0RA 2PCJA 4K46A 1E9BA 1KO8A 3B2EA 1SVMA 2EFHB 4LC1A 5G3YA 3KKOA 1DAIA 4GFDA 4DHEA 2D2EA 4R71A 1Z5ZA 3G82C 4Q1CA 4MKIA 3WBJA 4LBWA 2B7BA 2AR7A 3WRXC 1GILA 3W3ZB 4B71A 3R9XA 5CK5A 2WKPA 4B33A 3QF7A 4A6XA 4A0FA 5HCNA 4KV9A 1OFUX 1R6BX 4U5XA 2ZSEA 1G3UA 2FE4A 2ZRJA 1OIVA 3SOPA 1S3GA 3AVWA 3KKMA 3W5JA 4BLOA 5CYPA 2YV5A 1P2VA 2DFTA 4EPTA 1MO5A 1F2TA 4RZUA 1R2QA 3EA0A 5EXXA 1VG0B 2GF9A 5TDHA 1G19A 1F2UB 3QKUA 4IDOA 1IN6A 2Z0MA 1HTWA 1IQPA 2OLJA 5G41A 4OJKA 4TL8A 3WNBA 5A5GA 2ZSBA 3GLIA 5FOXA 3M4YA 1HV8A 4BWYA 4EQ6B 5EUMA 1OB2A 1KK0A 1HH4A 3VNUA 3N2EA 3QBTA 1U8ZA 5D3MA 2R9VA 4LOAA 3BXZA 3KXKA 2NOAA 3ZH9B 1YHNA 3CR7A 1SGWA 4LV8B 1ZUNB 1E1QD 3UIEA 3L0OA 1J7KA 5JBQA 4Q9HA 2VLIA 3VTKA 3NH6A 1G7TA 5EZ6B 4DSUA 3ZVMA 3LXRA 3MJRA 4C0QC 2WJYA 4LJ7A 2W2XA 3MFYA 2HUPA 2P65A 1E79D 1Z6GA 3OEEA 5HTKA 4DBLC 1JAIA 1II0A 1VG9B 4O2LA 2ZI5A 4Q9KA 2CLSA 3BFVA 2QZ4A 3CPJB 1OIXA 1KI1A 1Z0JA 3TSWA 3AVVA 3TQCA 4JT4A 4EPWA 3RWOA 1RRCA 3FTQA 1DELA 2X8AA 3IUYA 4PANA 5BXQC 5KOYA 3FFBA 2CK3A 4A0HA 4ZDKA 5TMPA 2IYSA 1Z29A 1G7RA 2BWJA 4G5SA 4B3DA 2CNWA 4QJ4A 1HQCA 5JFGA 1COWD 1KY2A 2VRWA 3B6EA 1JALA 3HPRA 4X8OA 2E9SA 1YQTA 4US1R 4RZ2A 4QL3A 4B34A 3GD7A 4ARZA 2VF8A 2FF7A 4TQ9A 4KITB 1G291 4NCIA 4Q21A 5GJCA 2WWYA 1RE0A 3JVUA 4Q7MB 3EPHA 3DEFA 5JECA 2XTMA 3V4FA 1N0UA 1IY1A 5EJEA 3REGA 3AF3A 2G0NA 1ZP6A 3NH9A 2OCYC 2OO7A 2FWRA 3T61A 1W36B 4BFVA 1G8GA 2R2AA 3GCGA 3AF2A 3X1YA 4LJYA 4C2UA 1A5TA 5L3VA 2DCUA 4PZYA 2CVHA 2QY9A 2EU8A 1XCPA 3B5JA 3U6BA 1XEXB 4RFSB 5BWMA 4WOPA 4KU4A 4DZZA 4PHGA 4DT1B 1SVWA 5B58C 1ZBDA 3VR6A 1UDWA 2IK8A 3SE0A 2B92A 1E9AA 4O0MA 3L8ZA 2XXAA 1EGAA 5IDVA 2XEXA 3QUSA 5FR2A 2V8OA 3UWKA 1US8A 2J9RA 3S1AA 3EPKA 3HYTA 4D25A 1KO7A 4POAA 1F60A 3OEHD 4M9QA 2WJVA 2YJTD 4TL6A 3VMFA 4C2TA 3GLFB 3T1VA 4LBZA 2ZJ5A 1OIWA 3SQWA 4XIGS 1E1QA 4AKEA 1E2JA 4LI0A 2VHCA 3VNVA 3RRYA 1E2GA 1OH7A 1G20E 2ZI7A 1D2EA 4HLCA 4LYAA 4BASA 5H8WA 4Z51A 3PXGA 1ZD1A 4DLRA 3BFKA 5EE0A 1SVLA 1E79A 1AJEA 1YE8A 5FL3A 2PMDA 3EPLA 1WP9A 4FXPA 3PJRA 5G40A 2WWIA 3CRMA 3SBDA 4JL5A 2JAQA 4AYXA 2BMJA 2BBSA 2WPDD 4P31A 4BFYA 4DSOA 4AKIA 1XMVA 3C4JA 2D7CA 1K5GA 1E99A 1UFQA 3F0TA 4HZUB 3UXMA 2NMVA 1YZUA 1OXXK 1P61B 3KFXA 1AN0A 3NDBB 4Q4JA 2GJAA 1CU1A 1COWA 1MH1A 1NVUQ 3VR3A 5FBLB 4UNSA 2BM1A 2NGRA 3U4QA 3O8DA 4IOKA 4TYYA 2WZQA 4AKGA 2BBWA 2D2FA 3GLHB 3D31A 1KTVA 3IIMA 4BFSA 5E7IA 2PMKA 3P26A 5EXPA 3W5IA 4DCVA 1KNXA 2V9PA 3GJ7A 3U3JA 1Z6YA 2WTUA 4UXHA 1M7HA 5FI0B 4B35A 1XPRA 1X1RA 2ZETA 5HR5A 3IO3A 2FDCA 1G5TA 1SVOA 4PC1A 2JATA 1TEVA 3CRRA 3KB1A 4KCGA 5JS8A 2JJ2D 3C7KA 1ZNXA 4TT3D 3DZDA 3U61B 1UBGA 1S9DA 2J0UA 2VBCA 4URZR 3TVDA 3R9WA 1XZQA 4Q19A 2ZITA 1ONBA 1T3LA 4TYWA 1BH2A 1TTTA 2ZUCA 3P32A 5FTJA 3RAPR 2QUZA 3NWJA 3SR0A 4YMSA 4QG7A 4V0KA 1KYIA 4MITA 2V1XA 3RYTC 3THYB 3C14C 3CW2A 2F43B 3MGCA 1FX0B 1G8YA 2AN9A 2BJWA 2IYUA 3H4MA 4P4UA 4TTQA 4D2IA 3NHAA 4HAXA 4EJSB 1II8A 1AKEA 3THXA 1E0JA 2IYVA 1RJ9A 4M8NE 1L2TA 1CF4A 1BMFD 2ORIA 4LGMA 1XMSA 1XTKA 3ICEA 1Z8FA 2A5FA 4LJ9A 5BN3A 1KI6A 4HSEA 4B73A 1E94E 2IC5A 3AF4A 2OZEA 3K9GA 4V0LA 4ITRC 3BS4A 5FBVB 5KNBA 1AS2A 2FFAA 2XX3A 3SYKA 1FTSA 2CHQA 1KDPA 2R6FA 4M0LA 2Z4SA 1GOTA 3X1XA 4ZKDA 2WMOB 4WZBE 3TW4A 3KQLA 2CE2X 3U3KA 4IKEA 3SDZA 1VIYA 3OEHA 4KFRA 3SU8A 4HLUC 3OESA 1P60A 4ACAA 1GL9B 1U8AA 4B32A 4P0TA 2NPFA 1AA9A 1LV7A 2XB4A 1XMJA 2GJ8A 3CH5A 3IQWA 2IWHA 3U7EB 4LCBA 1GRNA 3AKDA 3PEUA 4WXRA 3ADBA 1ZNZA 3L0SA 1SKYB 3GEEA 2ZRAA 1GSIA 3EARA 3GJ0A 1E6CA 5E7JA 2IW3A 1DEKA 1MOZA 1N0WA 5JJLA 5EP4A 5CITA 3AQ4A 2Z43A 4X8MA 4Z1MD 2G1JA 3T1QA 5FPYA 4D4LA 1JQLB 2GA8A 4R2HA 2AD5A 3K09A 1Q21A 1IY0A 2O8DA 3L8YA 4M1WA 3WHKA 2ANCA 4X8HA 5FBWB 2WPDA 1XTQA 1KKLA 1IM2A 1U9IC 2ZUDA 5JWHA 1MO6A 4GRAA 1XTRA 4NPHA 4Q9IA 5BYKA 4NU0A 3K70C 2ERYA 1DAMA 4OI4A 1AM4D 1HE1C 5JRZA 2IYRA 5CJ2A 1VYVA 3E1SA 2D7DA 1XCGB 2OLKA 3A1WA 3DMDA 1NP6A 2GK7A 4D0NA 1H8HD 1NN1A 3I32A 2ZSAA 1UDXA 1J70A 3AKYA 3LQQA 2GXUA 1EFTA 2Q9AA 3DO6A 1XCMA 4QGHA 2I3BA 4QBIA 4TT3A 2IUUA 1MABB 5KSPA 2VHUA 4D80A 1DO2A 3BC1A 1Z2AA 4B3FX 2F3TA 3WMFA 3EIQA 4OQFA 5EZ5A 2GAAA 2QBYB 3KX2A 5K8LA 1E0KA 4YXWD 1Z0FA 4DCSA 2ATVA 2KBFA 5FBRB 4UJ5A 2TMKA 5L3SA 3MLEA 1QRAA 2IYYA 2IS2A 4XJXA 1N5LA 5P21A 4CGZA 1DADA 1KO5A 1WBDA 2YNMA 1CBUA 1G6HA 1N6NA 4DLYA 1XPUA 5FFMA 1TAGA 3OIYA 3A1TA 3W8NA 4G01B 1SZPA 2GTPA 2NO9A 1VIAA 3G0HA 1GM5A 1KMHB 3AGQA 3WXMA 4DCUA 2VP0A 4LJ8A 2CXXA 1S3SA 2QRNA 5AJYA 1KOFA 3DM9B 3WRYC 5KNDA 4LC0A 5F3WB 2O8EA 3HR7A 2OCBA 1CP2A 4Z8YA 1U0JA 3FKSD 3NBFA 2NO7A 1AQUA 4OHZA 4CIDA 1D8TA 1E1RD 4ZCLA 1FMJA 2ANBA 3IGFA 1OLOA 1P2UA 3RNLA 1NBME 4A2PA 3ADDA 1EWQA 4DB4A 121PA 2X19A 1E9SA 1QZXA 5CIQA 2JLSA 1GL6A 3RLFA 1XD2A 4M9SA 4IDPA 1U94A 4Q5IA 4BFXA 3ND8A 4PPGA 4FMDF 5SZIA 3AB3A 4U02A 2XTZA 1AGPA 3CH4B 5J4KA 3T15A 3C8UA 4TZ6A 2RGEA 3CONA 5HCIA 3OIWA 2B6HA 1ZM3A 4Z1MA 1D2NA 4EDHA 4LJ4A 3U3OA 2JJ1D 2JASA 4QHYA 2E1RA 1SXJD 3U6KA 2O52A 2VSOA 1CIPA 1OXTA 3QEJA 1XEFA 2ZRPA 4K81B 1UJ2A 1FPMA 2CLDX 3KXLA 1IN5A 4R7ZA 4UXIA 1P3JA 2JIZD 1HY3A 1C1YA 1Q0UA 3QOFA 4YONB 3NEYA 2VF7A 2ZRMA 1ZAKA 4A9AA 3GJ8A 5D3QA 3T5DA 4MGIR 1F2TB 3A1UA 1W7AA 1N6HA 4AG5A 1IAQA 3ASZA 3LBIA 2QMUA 1UBEA 4H1VA 4C4PA 1H8HA 3FB4A 2OBNA 3HDTA 1MKYA 4Q48A 1J8YF 1M7GA 2A5JA 3L0IB 2E87A 1GP2A 5K8TA 3GLIB 4B44A 3DKPA 2ZJ8A 4KVAA 3WMGA 2GBLC 3MWYW 1PJRA 1NY6A 4TSFD 5D3MB 1QDEA 3FKQA 3ZZUA 3RS2A 1KZ7B 1UF9A 2QGZA 4M1OA 1YZLA 3PUZA 2JCSA 4X8LA 4RCZA 2OFOA 2G0TA 2ECKA 5ELXA 4YXWA 4C0AC 4TMKA 4LZZA 5HPYB 3FHCB 1R0YA 1ZW6A 3SN6A 1DOAA 4EKDA 1Z28A 3QY0A 4GSYA 1K8RA 2OCPA 4PPQA 2EFCB 2JA1A 3I61A 1LS1A 3VFDA 2QAJA 1KI7A 4JIMA 2WJHA 5BN5A 2O0JA 1KSJA 3CNNA 3CB4A 2QP9X 2HDNB 4XVUA 1TADA 4UNRA 1XXHA 4QJ5A 3GPLA 1NY5A 2PH1A 3LH5A 1Z6TA 2WVJA 1W4BA 4P32A 1S1MA 4JLMA 3FKSA 3P27A 4JT2A 1EX6A 2QMOA 1GUAA 4R98A 1E1RA 3TNFA 2RGGA 3IEVA 1VCOA 3AVPA 4PZLA 1GNQA 5C2JB 3B8HA 4B3GA 4DJTA 2CCGA 1NVVQ 4IDQA 5EXSA 5H1YA 2F1JA 1E96A 1QHHA 3W90A 4ARZB 3SI7A 2LKCA 3UG6A 1M1YE 2C04A 4HI0E 4LHXA 5CLLA 1NSTA 3FGNA 1SVKA 3ZIAD 2VO1A 4ESHA 2BIFA 1ZRHA 4ABYA 4TLDA 4A2WA 3K0SA 4GOKA 4MRSA 4B3CA 2Z83A 3KQHA 2SHKA 4Q02A 5L3RA 3B85A 4BZQA 5B64A 2JJ1A 4WAUA 1Z0AA 1SXJA 2AKYA 2ZE6A 4BRUA 1OXUA 3AP2A 1KSGA 1S9HA 1G17A 4FINA 2KJQA 4B75A 1XX6A 4WA7A 2J0VA 5CYOA 1OYWA 3BAFA 3RSLA 1GNPA 421PA 2EW1A 1CJKC 1DG1G 1XEWX 2EQBA 1UAAA 1E2FA 1GVNB 1OJLA 2YKGA 1MT0A 3QE0A 4C0BA 3K1JA 5TV2A 3K09C 1IJFA 3DDCA 4RSGA 3W6OA 4LSGA 2XXAB 3HWSA 2PT5A 4P4SA 2ZJ2A 1MV5A 2F6RA 2R8RA
chains in the Genus database with same CATH superfamily
1AKYA 4TQAA 1DX9A 3MMNA 1WNTA 1CEXA 1TRKA 3H2ZA 1XTPA 3QLEA 3V9PA 1KI2A 4C7OA 1P17A 2Y77A 1ZQ9A 2ZS8A 2AWNA 3BL6A 4IVRA 4QC2A 3QXCA 3HN7A 1FB5A 4TSFA 3HJHA 4Z8XA 2ZM6B 5AM0A 1AQNA 1ENYA 1GPLA 1QO7A 1E2BA 4UMEA 4YRBA 2P90A 4AULA 4G8CA 2QRLA 4UBIA 5A3QA 2BMEA 4GGOA 2RONA 1Y1QA 1N2EA 1HRKA 1M76A 4J0GA 1WU8A 3KV3O 4KBYA 3I6BA 5JWRA 2RGBA 3GLVA 1XJ0A 3MRVA 3OTIA 4MQLA 5JDCC 4FW9A 4QFMA 4LTNA 2DBRA 3V55A 2J3HA 3GA0A 2ZJZA 1UDRA 3L7AA 4WZBA 4INJA 2CGEA 2XQJA 2HWUA 1N7IA 4ZKEA 2PNFA 3DAGA 1HEYA 2XGJA 2C5AA 3MTDA 2FPIA 3IFSA 2Z8ZA 1R0XA 4FBGA 1ZIOA 1DQZA 4C6RA 4LMBA 3VH1A 5AW5A 2QPAA 5TS2A 1WXGA 4DMKA 4LZPA 1N6RA 1JFLA 3KNZA 4WJKB 2HSDA 3TX2A 1XNRB 2WTEA 4WDRA 1QYWA 3VKVA 4J9VA 1IAVA 3HFGA 1WDWB 3LDUA 5H70A 1UEIA 3KJGA 3V1LA 4JBXA 4QU0A 3GRRA 4M54A 2RAPA 4FB4A 4KHZA 4CM3A 5KYWA 3WK7A 1LWNA 1WM1A 1OE0A 1L5OA 2BCJQ 3DFFA 4DNOA 4EHAA 5JNVA 1CF2O 2HSWA 3KEQA 4Z9XA 4IQ8A 1BU8A 5AKKA 1KC1A 4KNWA 3O2SB 2LCQA 2GETA 2UZ1A 2ALJA 3K92A 1GJRA 2PS1A 3CZCA 2HRCA 3HV2A 3T99A 3ZNQA 1FFHA 2J08A 2CDNA 1UMCB 1JYFA 1TU4A 4OXIA 4G97A 4DMRA 1F0PA 3LVQE 1JHUA 5IASA 1ULAA 1FS6A 3MWGA 2J0UB 2R1VB 3NETA 3B1WA 4OHXA 3HSYA 2EOAA 4AF7A 1NVVR 3LBAA 5CTAA 4EELA 1BCRA 3ASYA 2EJVA 2Q21A 4AY3A 4DJFC 4JYZA 2FNAA 4ILEA 2PU7A 4NTZA 2OBXA 4J7XA 2FZVA 1BAPA 4FS3A 2WNHA 4CM7A 4UFOA 4NMWA 2NTJA 3X1DA 1Z83A 2RI1A 3CZ5A 3WGOA 1DSSG 2ZK7A 1GU7A 1QK4A 2FG5A 4LJAA 1VPVA 1U7PA 3OKAA 2PXAA 3WYCA 1B2RA 1E8MA 1P9LA 1O95D 5K03A 4Q9NA 4P2GA 4IDBA 4ARSA 3ZYCA 1RJ9B 3UNXA 4NMMA 5JC1A 1B0UA 1HDOA 2IYPA 3O5AA 3MMPA 4LMAA 5CVJA 4JLUA 4ER3A 1NMZA 3IMCA 3FXAA 1XYGA 3MLAA 4KN5A 1M34B 1A76A 3WB1A 1UC9A 4GYKA 4DA7A 3RAFC 4K6CA 1BD4A 1KI6B 1TCCA 2M32A 3M1YA 4JLDA 3RVDA 4EG7A 5LOVA 1D09A 221PA 5CD9A 5HBGA 1VI2A 1X7WB 2WWXA 4GI7A 1TFUA 2FJUA 2OFPA 4N5DA 3VR2D 1T8SA 2BEVA 1A04A 3UA3A 3M7IA 4IIBA 4AX4A 5EJ5A 1GUFA 4K8OA 5H3LA 1KIMA 3OOJA 2HF9A 1E2QA 1RWNA 2A6PA 1PQ4A 4TMXA 5J23A 4NAHA 1M2OA 1U5BA 1PS8A 3G02A 3QPDA 4H1TA 1UBMS 4U7JA 4JXKA 1E5TA 2VDJA 3HV0A 2XB2A 2ZTVA 4KHPB 3UO8B 1JIVA 5BQ3A 2OBYA 1S2IA 1TK9A 1KY4A 4RHTA 1YU6A 2N47A 4RV5A 4ZIRA 1DAFA 5FOVA 1KI8A 3IMEA 3W1WA 2PGJA 1YJXA 1CKEA 4CMCA 4DB2A 1CFZA 2YWHA 2ORVA 1TUBB 4KQMA 2BOVA 4M7OA 4QXAA 4TXJA 4LE0A 5KNDH 1ABEA 3FTEA 3E84A 3NV7A 4JKIA 3WA6A 4B81A 3V4PB 1J9ZA 4Y7CA 2X2EA 2WZDA 3RSOA 2PPLA 2OECA 1DJOA 1LTKA 4X71A 1SVUA 4GRDA 1KZ1A 2Y1CA 3FVRA 2BHSA 2QVGA 3VSBA 1UPCA 4B6EA 1JNYA 1L0BA 2I62A 3HKEB 1RMYA 4KUHA 4MAAA 3EVNA 1G5PA 3BDIA 3K9NA 3KKZA 4KSYA 4BNDA 2QW8A 1PFGA 3I4CA 4CKCB 3NRJA 3U60B 3BZBA 5JTTA 2PRSA 5JLJA 3RUPA 4RY2A 3L41A 3L8HA 5B1SA 5JQGB 3QSYA 2VUUA 4HAYA 1U7UA 3FX2A 1QR6A 1K08A 1HFEL 3H9UA 2PUHA 5HK8A 5JZBA 1AY0A 4OQNA 2F9FA 3I01M 1AK1A 3UK1A 1Z0SA 3EBOA 1Y1SA 5IDXA 3QENA 4ZI5A 3PK0A 4JJGA 2AZXA 4NYJQ 4O59O 5EUCA 4IDNA 3U39A 3DCYA 1BFUA 4KWTA 1GA6A 5HEKA 3GLFE 1IN8A 5DI3A 3VZPA 4EFLA 4W5QA 3VKGA 3ZE7A 3V4OA 3EXIB 3HCFA 1EJ6A 4FEEA 5CU7A 1R4MA 2BUBA 3I83A 3O8OA 1ND5A 1O3YA 2V03A 4GDMA 3SIXA 4DTIA 1DRJA 2ZYAA 1WD7A 2Q9UA 2F59A 2LGJA 4PAGA 3TZQA 4JC5A 1YVDA 2C9DA 3QBVA 4QOIA 3JZMA 4JS0A 5AUPB 3AJRA 1IE3A 1KKMA 4DILA 3EEFA 4XX0A 1RXEA 2WU0A 5LC1A 1Z56C 3DAOA 3JS5A 1ZW1A 5D84A 2JGFA 4Q4AA 3V97A 2PQMA 3AF1A 1E4EB 3EZLA 5DSTA 4IUYA 2WU1A 3HLTA 3UH0A 4AZ3B 4CR7A 5JU6A 1YOVA 1AUVA 2CLKB 4E5SA 3NTOA 3NLLA 2CDRA 2VYCA 1WDLA 1UKZA 2EFDB 2XOKD 3E7XA 5LU9A 3AI7A 2AOUA 2Z2JA 3DFIA 4RPKA 4EO9A 3N74A 2QD3A 2PQ0A 1PWYE 2IQIA 2KE5A 3IS3A 4U0JA 2H2FA 1W9HA 1Y8RA 1EGHA 4B5KA 1KF0A 2CV2A 1YBVA 2ZBFA 1FFCA 3WLHA 5DM4A 4IX1A 4WN9A 2JH3A 3KPYA 3SYNA 3UM9A 3ENKA 3OX2A 4TQUS 5TPZD 5TY0A 1V5GA 3SVTA 1Q7GA 3FNFA 3HY4A 3Q3IA 5DF1A 2O8EB 1HE5A 2AJDA 1E2NA 3LK7A 4MEJA 2XOXA 1SN7A 1GUZA 1VE1A 1JHZA 1V7QA 1ZA2A 2OHFA 3GLHE 4GPIB 3QUCA 4GYJA 1ORDA 2FOLA 2I4LA 2QRJA 3CRNA 1X7HA 4F4IA 1E18A 1CZNA 2ZIWB 3O4RA 3ZGXA 1Q83A 2GXQA 4L02A 1SJ9A 3JQAD 2YIVX 1QCCA 1AD2A 3VKFA 1E8NA 2O14A 1P19A 3KE8A 1HYQA 2WD7A 2RHOA 3L5KA 5AXCA 4DUZB 3LYAA 3ZBQA 1SQFA 3HMQA 4JFAA 1EUDB 2NU8A 4F72A 1P6UA 8ABPA 3K1TA 1Y63A 3L3BA 1RYFA 1ZUWA 2H63A 3OH8A 4HNAA 2NU7A 1VMKA 2D2IA 2NW6A 2OR3A 2Y68A 5AH0A 3WQSB 2BFOA 4J0QA 2DVMA 4JJ4A 4Q24A 4QUHA 1P0QA 3GROA 2CXPA 3FWHA 3MD0A 1KJZA 3IKLA 1MEOA 3MGGA 3ANTA 3LCJA 5J1TB 4G23A 4AIRA 3DDOA 4YRZA 4YLYA 5T57A 5EQTA 3A25A 4D6PA 4P7FA 5FNZA 2KM1A 2I7TA 1SA0A 1FK8A 2VATA 3NYWA 2J9XB 4TZTA 1PEKE 4E4YA 4I36A 5TT1A 4HGZA 3SHFA 4AJEA 4MW6A 2EP5A 4OKNA 4CMEC 4Q34A 3COYA 1Y81A 1EYZA 1ULZA 4HBZA 2DHEA 1KAGA 4F21A 5LA6A 1HZJA 2GJKA 3EC1A 2QE7A 3ZWPA 4AG6A 5HMMA 4D5EA 1FLDA 1XFDA 4HQOA 5IUKC 5TJHA 2D1QA 4IUCS 2Q27A 5DX1A 3OY7A 4RDXA 3CRW1 2VR1A 3UJBA 2HK7A 4ID3A 5AM1A 4GLLA 3D4BA 4OREX 5ULLA 1FP7A 2Y1LA 4Q6WA 5BR7A 4CF7A 5ESDA 5E9JA 2VJMA 1QIMA 2OHOA 1F2DA 1E1YA 1TVEA 4FMPA 4LYGA 2JAUA 5LDGA 3IP8A 5CA0F 2PWZA 5FTKA 3WB2A 1ZOSA 4D98A 2JI4A 4CMIB 2EWVA 1F9AA 1K8ZB 2ENWA 1ODCA 2YMPA 4ENRA 3DQQA 1GPJA 4QTYA 3KEMA 4GLBA 4J0FA 1G21E 4BFUA 2QIPA 4I5DA 4MKRA 13PKA 2W2TA 4TMVA 4TPKA 4YRFA 2E6KA 1MX9A 5DSZA 2WNSA 3LUKA 5DIFA 5B1EA 1EA7A 2RK6A 4MCAA 3D5EA 3AEUB 3JAWB 4J6EA 4RZSA 2CL0X 4E13A 2I87A 6YASA 1K06A 1JH9A 2D2VA 3G2OA 4PSAA 1JFRA 5IPFA 2OFXA 2O1EA 2J3LA 1IIBA 4CT0A 1T4CB 3RTGA 1I7QB 4DSAA 1ZLXA 2ZRQA 4OI2A 5CUQA 1I0IA 2GASA 1G20B 3G2HA 2J41A 4KH0A 2P6NA 4PCVA 3UC5A 1GLNA 1HDRA 2ODBA 2A5LA 2OV4A 2HJVA 2Q0XA 1MP0A 3FN4A 3V9AA 3O0DA 3WP0A 2O19A 4OGGA 4DQDA 2IJGX 3PDWA 1L7BA 4XIIA 1PO7A 3EGDB 2WSSA 4CUJA 1QH1A 3QXSA 4RWEA 2P9FA 3IEIA 4JYCA 4MWCA 3CSSA 4R51A 2XBUA 5IT0A 3RSGA 3EY4A 3ZVRA 1W8IA 4IMIB 4W5HA 3K71B 1A9PA 4D4IA 4LTDA 2DB3A 3FFXA 2PZLA 4BMNA 4YPFA 1EGQA 2YFQA 1NVTA 1DBQA 2AK3A 3N5CA 1QHHB 2FHSA 4FTWA 4KLRA 4L4XA 4X1YA 5HFNA 5A02A 5BSVA 4F91B 1EFVB 2J9ZB 3Q2KA 3CCBA 4IL5A 1J09A 3E3OA 4LOLA 4E14A 4Y67A 4NBLA 2VNAA 5ARCA 4FQ5A 1CJBA 2C84A 3RASA 1FLNA 1M8KA 3NHUA 1SHZA 4OQYA 5EKSA 1U3WA 4JJAA 1VLVA 1MO2A 2B2XA 2C88A 2QYOA 4K9RA 1GNRA 1U1EA 3GFOA 3QW4B 4URFA 3H87A 2IXGA 3ASUA 2A59A 3T7SA 3QPBA 1E2MA 2QLTA 3DWFA 2A0UA 5LL6P 4UHDA 1UANA 1BIFA 3EDOA 4GC5A 2XTJA 4NZNA 4JP2A 4DCNA 4YROA 3F5FA 2X7XA 1EB8A 5DX0A 2JARA 4KACA 1V6AA 1I4LD 3OPYA 3OCZA 1KARA 2WSIA 3E8MA 4J29A 5TF0A 4QGFA 4RS4A 3T3GA 3SZMA 1NMXA 1OMOA 5B12A 3A4VA 4HDCA 2R6HA 1KJQA 2ENUA 1VMAA 3QMWA 3GWGA 3DMRA 3IPYA 4KQ6A 4MV7A 4RC9A 2AMLA 1HETA 5CT9A 4CRWB 3FI9A 4WZZA 5C37A 1ILWA 1YS7A 4UZEA 3LUFA 2I4IA 1DDOA 1UMKA 3K8YA 4I81A 4AFNA 3TCNA 3NVAA 3ST7A 2A9PA 4HB2A 4WJZA 4WT7A 4PLFA 3AV0B 1EFHA 2PVPA 4KSBA 1B6RA 3I12A 5TQ2A 5CEEA 1FYWA 2NYRA 2VXBA 5LZ7A 4QUEA 1PV1A 1K75A 4F4JA 2IP2A 3NHZA 2Q4TA 2HRZA 3NT4A 4DV4B 5DIZA 2IKSA 3VZBA 5KVCA 4L9RA 2DFVA 2PAFA 4MYUA 5DMXA 5A4KA 1J2JA 2R1TA 1T6XA 1PNTA 1M0SA 1OBFO 3PF8A 1KDTA 4ZVQA 5ITWA 3HA2A 2BM9A 5BN4B 3L0ZA 3VU1A 2B35A 3K96A 4KWCA 2P2CA 4MUJA 5H7XA 1KNQA 1WJGA 1EQAA 3CPSA 1QVAA 3QE2A 4NEHB 4NXNB 4U1RA 1AKRA 3OHSX 1Z62A 5LU8A 1HPLA 4GI3A 3DCIA 4EH1A 3CVUA 3F97A 3U7QB 1QPGA 1NXTA 1VCMA 2IDZA 3QNUA 4ER5A 3MPOA 4O6VA 1TIKA 2ERXA 3Q4GA 4UW9A 4DLTA 4DUGD 1PZMA 4XM0A 5K3FA 2NNLD 1JECA 2XHEA 5GJVC 1BMFA 1Q5PA 4GZ3A 1LWOA 4XR4A 1P1RA 3JD3A 3H1EA 3PXBA 2Z2IA 3JASB 3UJ6A 2Y71A 4MV6A 3IT1A 2VRBA 1TDJA 3RAJA 1ZL0A 2ZP1A 1JIXA 1O94D 3E27A 1Y3IA 2QQ0A 1Q16A 4UZFA 1EP1B 2YQ5A 1KZHA 3REOA 1IUPA 4IKPA 4AB1A 1V1JA 3BWVA 2QG6A 1JMKC 2RH5A 5KB3A 3T7JA 3SHTA 3FPLA 4B3SB 4FVTA 1Y89A 2A1UB 3A3NA 3CHYA 2A9RA 1VRCA 5HF8A 5THKA 3ROXA 1NKTA 1PGJA 2KQUA 2XYRA 3A28A 4I5GA 5ALWA 3ZVKA 3OWOA 3TIVA 1QF7A 3OT5A 5AI8A 4CWAA 2BH9A 4BX2A 4DJ5X 4MWBA 3RT1A 4C4OA 4Z49A 2BFBB 5HUHA 1BJRE 2WKRA 2ZUTA 2JRCA 1W59A 4J4HA 5EZYB 3T1NA 1AQYA 2ZRNA 4WCFC 3M4XA 5NULA 1CQJB 1VKRA 2YWBA 2QI9C 3CLUC 4MVJI 3T4XA 1FW6A 5IJ0A 4EJSC 2J5KA 2ZULA 1L6IA 2DT8A 3DL7A 3Q9LA 4ON9A 1SUIA 4TWBA 5G4KB 5AM4A 4FHFA 1VSQA 4E5KA 4MDFA 2QXYA 4X84A 5HKKD 4OUDA 2NUAB 2SKCA 4F56A 1L9KA 1DRUA 1D0VA 2QORA 3BWYA 1AN9A 4QJ3A 4YWJA 3KEOA 4UHJA 2NTVA 4NBRA 5E1MA 2POCA 2K7ZA 4L4SA 2DG2A 4ILKA 3PNSA 2OORC 4OQDA 1YRHA 3S68A 4Q01A 3T3PB 5C1DA 5M04A 2AFIE 1N2OA 1IWOA 2IEZA 3IULA 3L82B 3VU9B 5DNCA 1O08A 2Q4DA 1IN7A 3EXFA 2I66A 3SMQA 2A67A 1RXVA 5DYIA 2PGAA 1NNEA 1TB4A 5ED4A 2NO1A 2JHGA 4UHHA 1J7JA 3LMKA 5K3CA 5BWOA 4YRIA 3VSEA 3WLNA 1NNUA 1QIIA 3K0EA 1XG5A 1H9CA 4H7FA 3I5UA 4KQEA 1NF3A 3CPEA 3ZWOA 5GV7A 2ZUEA 2WB2A 1XDZA 1PK7A 4B4WA 4GVPA 1QOPB 5CVEA 3RD5A 1YH3A 4O63O 1QFMA 3CXUA 3N5KA 1ADFA 1LNZA 1UWLA 3REQB 2ECPA 4BVBA 2CNBA 2M6LA 2I34A 3UQZA 3V8EA 4NBNA 1GZDA 3K73O 5B1IA 5CBKA 3Q7TA 1U3CA 5K0LA 1U6JA 2HCJB 4DIBA 2AI3A 2FE1A 2FZKA 3ANYB 3ND9A 1VGRA 1YCFA 5ANRB 1ZX1A 2EAUA 2GEBA 1Q1EA 5EKDA 2VYVA 3UCEA 1VLMA 1XZJA 4CUKA 4YRDA 5AHWA 4QEZA 3W0LB 5B6JA 4X92A 4R8LA 4OIFA 4F06A 3EPPA 1PJSA 3D3QA 5ERGB 4YR9A 5IKEA 1KORA 3H05A 3N28A 4Q3BA 2AVDA 3SXJA 4FGLA 3PQEA 4EZIA 4LY3A 1V5FA 4CQLB 4ZMSA 2N1BA 1UH5A 1KZGB 2Y05A 4J76A 5C7IO 1Q0PA 1F1JA 4MIYA 5F77A 3WKBA 4TTAA 4XWKA 4AG3A 4L9WA 4GW3A 4I5EA 4N1AA 3KRTA 1C3XA 3ZHQA 2GCPA 2P1ZA 2W0MA 2VHXA 4XSHA 1JXMA 1FJ2A 4ZRNA 3FNHA 3QG1A 1YCGA 2B8TA 2YHBA 1PVOA 5AXBA 1RJEA 3G0BA 2A1TS 2YYSA 4X95A 5L3QB 1XRQA 4MV1A 4PSVA 1IVNA 2BFCA 2XPCA 2QD1A 2C57A 421PA 3FDIA 3JATA 3KAPA 3L7NA 2FSIA 3L8GA 4HFRA 4MQUA 5E1BA 4GVLA 1ELOA 3H5RA 3CCCA 3GFRA 4I1IA 2JLVA 2GVZC 2ZR9A 2EW2A 2HZ7A 4X00A 3WIBA 3BVPA 4UAVA 1W5AA 2ZTLA 3DDSA 1U4OA 3L7OA 4YBZA 4CQMA 1X7YA 4B17A 4GGMX 5FPTA 1O96A 1VB3A 1YMQA 4X41A 1P6QA 4GP9A 2WJWA 1C9YA 4BMXA 4FGJA 1PTKA 4U4AA 5G1PA 4PGAA 2ZBGA 2NN3C 5F4ZA 5KBYA 5JSFA 2IIBA 3AO0B 4GP7A 4OBEA 4UUPA 2BC9A 4F2DA 3NT2A 3IEPA 4DV2B 4CIVA 2XGMA 3ZCRA 5BRJA 5JS7A 1KTIA 1XZLA 2PMCA 3A1EA 2VZ8A 5SICE 2DUWA 3SYRA 3PFIA 2XQVA 4TWZA 5AJZA 3F90A 2LNDA 4BX9A 1YKSA 4BVAA 4BBPA 1IY8A 1KP9A 1NVGA 3ABSB 1N33B 3OSZA 4FWIB 4UCWA 1GNLA 1OLUA 2X58A 4ALJA 2VCEA 2WG2A 1FQOA 1SVSA 4D9NA 1Z5UA 2X1VA 3OPYI 4Z2YA 4M8LA 3DZGA 4R4JA 4HWPA 4DDUA 4HNTA 5KTYA 4HNRA 3BK7A 2AEEA 2II6A 2UVDA 4PC6A 3QIVA 2Q1SA 3VC2A 4F5EA 1LF0A 1NT4A 1V5WA 3TZHA 4ASUA 4TOIA 2I2WA 4KBGA 4EG5A 2BCGY 1OSNA 1V9CA 1VHQA 2DBZA 1IZZA 3EMBA 3GFGA 3QU2A 4N0QA 4RD6A 4Q16A 1O89A 2J8ZA 3THWA 4R2LA 4G1EB 3VUFA 1U7HA 2G1KA 3JALB 3O31A 3B38A 2OHXA 3OZXA 1WEKA 3IQFA 1EEXB 1YA4A 3AT1A 4ND8B 4ZXFA 1AHHA 5LXTB 2HMWA 3L43A 4Z4CA 4UDNA 3LSTA 3RKSA 4K03A 4GT1A 4FYYA 4Y0AA 2WLSA 2NVBA 3ISVA 3VAZA 1DXHA 3OJLA 4AUMA 3LGAA 2AXQA 2AZ4A 1M7BA 4PZEA 4CEIA 1J42A 4F7WA 1CZRA 3JSXA 2FX3A 3A0UA 2W0SA 4PHFA 3HQ4O 5AKLA 3RK4A 1NWHA 5ADVA 1GPH1 1EDZA 1FY2A 2AC4A 1WV0A 2ZI6A 3QMMA 5G0TA 4ZYYA 2VTBB 5EPEA 4CV0A 3RRMA 3OTQA 2GERA 2I2AA 1NBMD 5T3YA 4N40A 5C81A 3GVIA 4O2BF 3Q3HA 4EB0A 3AKEA 2CVQA 1G2PA 2XVMA 1Q57A 2V59A 1RHUA 2XSZD 5HCUA 1E1NA 4LWQA 5J63A 1SG9A 3BE4A 1XL1A 1U1DA 2WOJA 4QYIA 4CMJA 4DHWA 5BSEA 5IAOA 2XYVA 4R1UA 2OG2A 4RW0A 4EBFA 5K0BA 1DJNA 1Z08A 1CK4A 3ZD8A 4BNMA 3EXAA 1CD5A 1TUIA 5BQPA 3BA1A 1V7CA 1SKBA 1N2CE 1ZEMA 2Z3WA 3VH3A 1GAXA 4X1KB 4XM2A 3ZBPA 1ONPA 2JHFA 1E8DA 1KEZA 4GECA 4W8GA 4MH0R 2YNMC 1O0SA 4CM9D 4ETWA 1OKKD 2W4IA 4HNUA 5AW2A 3I39X 2SCUA 3K70D 3NDPA 1IU9A 3E35A 4CLEA 3H3FA 4AKHA 3L7CA 1SNYA 2OUKA 1GUBA 1QKJA 2JGDA 2C4WA 2X4DA 4CT4B 1V11B 1UBHS 3KD2A 3RHTA 3R20A 5EGNA 3WGYA 2RC6A 1K6JA 4B7AA 4P0QB 2REBA 1FP1D 4R1OA 2IEYA 3TQTA 2BY4A 3DMYA 4KYVA 4EKGA 3AKCA 4PYNA 1FW8A 5ENDA 1DDIA 1NNSA 1HSOA 1JBKA 2QTTA 3HE3A 5T4BA 1K9VF 2AG5A 2H7YA 5CDHA 1W85A 2H8KA 1YZYA 3E8SA 4WH0A 5E2IA 2AKEA 3OTHA 2WIGA 2FPGB 4YLGA 3S27A 2H4JA 5HKLA 5HZGA 1TTHA 1F14A 1UZAA 2AUNA 2WD8A 3OTWA 3EXEA 5DCUA 4QYSA 1W5SA 3A9TA 3WYGA 3QGMA 1CS0A 3OE7D 2M1ZA 2PL5A 4KE7A 2UXBB 2CCKA 4IFBA 4QHTA 4F5ZA 4FQ7A 3Q8WA 5KNCA 2IP4A 1MQ9A 4RKEA 3X1ZA 4EUKA 2FDXA 5JMTA 1QJCA 2G67A 3LT5A 2WTAA 1ZESA 4L74A 5BQOA 4WJLA 5AUNB 1OH8A 2XMGA 3WB9A 3TIGA 2GPAA 3AUXA 2GCIA 2HA0A 2PT9A 3WJ7A 1MD9A 2R84A 3WGUA 1JG7A 1P9RA 1BHSA 1QH8A 5JJIA 2J7PA 4OFZA 5F2EA 3FUCA 2C42A 2XXJA 1GCUA 2D00A 2BHNA 2IHJA 4IOLA 4V38A 2G5TA 2XV1A 1Z0IA 3M3HA 4XFDA 4B47A 2O5EA 1X77A 3HYRA 3R4CA 3GEDA 1UZUA 3AFOA 5A6VA 3RKUA 1UIRA 4GI5A 2Q4OA 5E3IA 1HR0B 2HIHA 3L8MA 1ZRMA 3WP1B 2IX3A 2A33A 2R5NA 4L3WA 4HCJA 1P18A 3RBVA 1ZGCA 3LLCA 3W79A 1W0KA 5EP2A 2B78A 3WIVA 1E98A 1BHO1 4YMVA 1PR0A 3JARB 3LPDA 2HK8A 1MOPA 1C30B 2QM8A 5BOSA 2O3RA 3RROA 1UKEA 2Z5GA 3I2IA 3IE2A 1UBFA 1MGPA 2WG1A 2PRIA 1JEQB 1M8FA 4DJJA 1V7PC 3DT8A 3FCEA 2BR3A 3H4VA 3MJDA 1UBKS 3HUUA 4ZVVA 1JU9A 4WZAB 1I9GA 1OUMA 5TRTA 4RVGA 1OA0A 4GOOD 1X92A 4PLCA 1PZNA 4ND2A 3W4KA 1D07A 2I78A 2Q3FA 2ZRCA 5ES3A 3SP1A 2YJ6A 3L6OO 4DV0B 1JDSA 3LUJA 3DCNA 3GUYA 4LXIA 2FFHA 1CDOA 3OI7A 3ZJ5A 3DO8A 4Q1FA 3UOWA 1WKCA 2ODTX 4NCKA 5C7OO 3C3CA 3NHBA 1C0IA 3IX7A 4MW1A 4JSTA 1NATA 3GQBB 4MR8A 4AUKA 3PUIA 2IELA 2OGTA 3HGQA 3G17A 4G4SO 4DV7B 2BBOA 3MOIA 2C7VA 2XJ4A 5CGZA 3OAAD 2BYTA 3NG1A 3BGIA 1C50A 4MX8A 2WV9A 3EG5A 3G2MA 4LWZA 2BFAA 4PG4A 4TTTS 3R8CA 2IYNA 4UBJA 3EFEA 3C5HA 5E2AA 3OIGA 1CRQA 4RK6A 4ALKA 2LCFA 2ZSFA 5SY9A 3BD8A 2P41A 2P9QA 3VKWA 3JQ7B 3O90A 2IFTA 1W0CA 3O1HB 4Z5XA 2FFJA 4CDNA 1YACA 4P4TA 2P9ZA 4Y6GB 1QVRA 3RUIA 1N6OA 3W5AA 3FZYA 5AOCA 1N5KA 1FTYA 1N9GA 1I10A 2VP9A 3B7GA 1LDNA 4UBMA 4XDHA 3OIFA 1JFSA 4JI4B 1OU4A 4YJ2A 5JS1A 3MS2A 2H7CA 1PJ4A 4ZRDA 1B6GA 4EJMA 3PEVA 3D7LA 2QQ5A 1XVTA 3PNVA 4RGYA 1IWPB 1K4KA 1NM5C 1DHTA 3WOHA 2P9YA 3KB8A 3E0XA 5ETJA 4UTOA 5A5EA 4FN5A 1FRNA 2VZEA 1X15A 3IIIA 3R5HA 5TR9A 4QZVA 1SCQA 4HS4A 4EIWA 1UCFA 3TK1A 3CLVA 2QTAA 3B6ZA 5C4MA 4RF3A 3GPIA 4YALA 3BHMA 3T6KA 2I54A 3CMMA 3DYVA 2GKOA 1ZGAA 3MBOA 4M7PA 5EKTA 5ERXA 3WL7A 1WZNA 3PU6A 1C9EA 4MPPA 5D6OA 1ZVQA 1SUEA 4G1MB 3SBEA 3OCYA 1T26A 2CJYA 4I1UA 1ZUHA 5DYTA 2RHCA 4A2QA 2HIAA 2WM9B 2PV7A 4Z0NA 2EZ4A 2YL2A 1S8FA 2QDKA 3QQ5A 4KO8A 4L4UA 5K6TA 5L6MB 3JZIA 1CQIB 4K6GA 5C5IA 1LI5A 3LQRA 4O08A 4FSXA 2X0EA 1CHNA 3KUDA 1GCGA 2FJ0A 4G26A 1ZM7A 2W2PA 1Q0ZA 5FIUA 3BHNA 3KQTA 2V7QD 3USCS 5ECGC 5KSWB 5E9AA 5AKJA 1H2RS 1Y8ZA 2AC2A 1KI4A 1PJ2A 3JRXA 2O8VA 2Z3ZA 3STYA 5FBQB 4MTLA 3UANA 5IRCD 4F4FA 4CEHA 4LMPA 5ALSA 4A36A 2HT6A 4IRMA 3ENVA 3HR4A 3IQZA 1BO6A 2ERCA 2H11A 3FCXA 3GDFA 4Q9DA 4U3JA 4KX3A 5L8VA 2C7PA 4P83A 4LRUA 3ER9A 2MSLA 4L15A 3S55A 1DS6A 1P7PA 1DJQA 1XEWY 4G5RA 1D2MA 1V41E 3RQSA 2ZRLA 1EIZA 1CXZA 3BJEA 3OJ0A 1RHKA 1LVUA 4G65A 1NIJA 4RHUA 4AMVA 3HM9A 2HSGA 3VNQA 3QVSA 3AHHA 2XRYA 3AI1A 3D7KA 4FE7A 1JKMA 4GR4A 3HUFA 3S2FA 1E6KA 2FW1A 2W6JD 4II7A 3MTGA 1QRDA 5JEEA 3LBNA 3IPXA 1RYBA 1BE1A 2QMZA 1KEPA 5LQJA 3CVXA 5HILA 1NXSA 1TO6A 4QBTA 5EMJA 2OFFA 4R7TA 3W8DA 2GNPA 1NL3A 5KU1A 5E6UA 1VJGA 4FONA 4LVNA 5AT1A 2XCUA 1I9CA 3HDVA 4PC7A 5GONF 1T0UA 1DTWB 5DBOA 5DHQA 4AD8A 3PLAE 1OF1A 2NSYA 2PH5A 1H42A 1XXHE 1LBQA 1A2BA 1W5BA 2HJGA 1ZRNA 2HIGA 2NTYC 3AH8A 3C45A 4MB2A 1ZMTA 2YFKA 2J3IA 3P9YA 4G9EA 3DOUA 1T1RA 1W19A 1VE5A 2BELA 3BD9A 4G37A 4GKVA 2P9TA 5AO9A 1U99A 3D8RA 1MRZA 4P98A 3SYLA 5JVDF 4FEYA 1RQGA 2VK8A 2BV3A 2P5TB 3UWPA 4BMSA 1RZUA 4BFTA 1AZSC 7ADHA 3KYDA 3M34A 2FAXA 3F8WA 1JVSA 1E2LA 1YZNA 3MUEA 3MQFA 3BHIA 1EFLA 1KAOA 3BGOS 3QELA 3H13A 5EIAA 1MJ5A 5BUCA 2GBCA 2AGVA 2JGNA 1W8DA 4EOGA 2YCLA 3DULA 3JYPA 1ONNA 4I8IA 3RIHA 3DBLA 4CYMA 4XD7A 4TS9A 1FUEA 4PAQA 3SS8A 3HYSA 3TPCA 1IHDA 3HZZA 4AJJA 2VCHA 1IXSB 1Q1AA 1DUSA 1SY7A 2NQTA 2ZVDA 3JD0A 4K9QA 4LJLA 5BT9A 3RRBA 2JLWA 4NZ9A 1UXIA 2IEIA 4Z86A 4FFBB 2WC1A 4JB2A 1E2KA 1SOAA 3EPJA 2QYHA 9LDBA 5JYBA 2O8CA 2AEJA 4C7VA 2ISQA 2EEZA 2H3HA 1QRTA 2VSNA 2A4KA 2PVSA 3FWNA 4MTCA 1MC1A 2Y9MB 3UWDA 2AUMA 1O8CA 1SXJE 4A8JC 4F60A 4C0HA 1SC6A 1NZJA 5KTMA 3DMGA 2DFLA 4NOKA 4N6OA 2RI6A 4UEWA 2BONA 5C4GB 1AUOA 1BS9A 4I4TF 4EY3A 3EXG2 1C1DA 1YQGA 7REQB 1N9ZA 2ZRBA 3DLHA 2CEAA 1JAYA 2ZAMA 5IW8A 2P4UA 2R8BA 1CZUA 5FWAA 1JTEA 1CB7A 2C8JA 3X44A 3O4HA 2CB9A 5ES4B 3R44A 4D26A 1Y1LA 1ZPDA 3N0VA 4MV8A 1NXVA 6CHYA 1BKYA 5IUJC 4JU8A 3CZAA 3DONA 1VJCA 1IHPA 2F8MA 1ISRA 1JBEA 2QRVA 2X9GA 3EW7A 3M33A 3NBZC 3ON5A 5DWQA 3ZU3A 3BCRA 1PBTA 1R27A 3DTVD 4RE6A 2ZREA 2F4NA 5HF5A 1QDLB 1EWTA 3EIEA 5DU2A 1NNI1 4PAOA 3BMQB 3LVRE 3PVSA 3HVRA 1NUAA 4U6NA 1KDVA 3ZK7A 1U80A 4ED9A 3RK1A 3L8DA 4EEZA 1T8WA 5JPDA 1KOJA 2RBKA 1GQ2A 1LU9A 3A36A 3W05A 3ESZA 2YRFA 3NHKA 1PGPA 5KYTA 5JNSA 3GRFA 4B76A 2PLWA 3Q7EA 1TMKA 1THGA 3JWJA 5TARA 2EP8A 2JIRA 4G1FA 3P7MA 1F2UA 1QE0A 2X5XA 5EN4A 5FUWA 4XRGA 2MYNA 3UPUA 4M0CA 1XPOA 3PR1A 1X1AA 5C8YB 1REQA 2HYDA 1QKKA 4IYJA 4L76A 4OCZA 5DASA 2VDWA 4TLCA 1M1XB 1Y48E 3PFWO 4FYWA 1Y3BE 4HRXA 1T24A 1X19A 2Y67A 1NG1A 3QX7A 1F0KA 4Z9BA 4F5YA 4U7DA 5CA0B 4XJSA 1G3RA 1Z4KA 4G67A 2ZDHA 6REQA 1FQJA 3SJCA 1Y6GA 4X66B 2WB4A 3LKZA 3F3YA 5AVSA 2ATEA 2YH2A 2AD1A 4BV2A 3JYQA 1I24A 3NEAA 3NEJA 3ROGA 1POWA 3MA0A 1PG2A 1NPDA 4JQYA 1ZD2P 5THQA 1Z6QA 4DDTA 3EEOA 1NW5A 1G21B 2ZYUX 1X74A 4AP9A 1OBVA 4H6WA 3DLBA 1QGOA 5JJ5A 3ZHYA 2CHEA 4MRMA 4KPUA 2E4XA 2EKLA 3OBBA 3LP6A 3TIFA 2PS9A 3FRHA 3UMRA 4P3NA 1U0SY 4ETMA 1KRWA 2ID8A 4RTOA 1GG2A 1CY2A 1C9JA 2GN2A 5EWLA 2QPLA 3SCZA 4LHYA 1M33A 2KLBA 4Y2RA 1IWBB 4EPXA 2GM3A 2CT8A 2VPPA 5JAMA 4Y0NA 1ZCAA 2PUFA 3MAGA 3PC3A 1XLWA 4LVOA 3KDSE 4DC0A 1SU7A 1YBHA 1NQ5A 1QHNA 4MWZA 4FCTA 5L4NA 3WWYA 3GLGA 3RYFB 1UAGA 3Q3GE 1S2LA 3JZAA 4BO2A 2GQ0A 2ICAA 1FVOA 5GQSA 2YWJA 5COAA 1DHRA 1DQYA 1IUKA 3D54D 3CRQA 5FOWA 3MWFA 4CXMA 2R60A 1X1BA 1ZIXA 3KFVA 4J4TA 3R6WA 3ZS9A 1TQDA 2AMJA 2JBAA 3PTLA 5E4FA 2CW5A 4E08A 4FIDA 3TD2A 1MQAA 3E1GA 3L7LA 1XV5A 2H16A 1I2MA 1W46A 2H1SA 2YJ4A 4L8WB 2JCXA 2VYFA 1E1CA 3AC0A 2QZJA 3OMWA 5IVHA 2K6GA 1B6TA 4JR2A 5DHAA 1HC7A 4NQRA 4Q00A 3WK9A 4S1TA 3GIWA 4LZWA 2PGOA 3OETA 4F3KA 2CXSA 2VG8A 3V1YA 1MVNA 2QSUA 3PL5A 4O4LA 4GXNA 3A2KA 1N1MA 1DQNA 3EDMA 3OE5A 4G89A 1BOOA 5EHQA 4EKEA 5AM2A 4OJMX 1X7XA 3QOYA 4MS1B 5ICMA 3PLRA 2QN1A 3KOYA 1SO8A 2AF4C 1NUTA 2ZI9A 3HKCB 1I1OA 4CU5A 3ZW8A 4KDRA 5BWNA 1UKAA 1ECGA 4I4NA 4NBSA 2OWEA 1GFZA 1QZ3A 1BQ4A 3WA7A 3HP4A 1ZHHA 2C9ZA 4LDJA 4F93B 1ZKMA 2YBEA 3BRWA 2FSHA 4Y2UA 2BM0A 4ZZ1A 3U5TA 2F55A 5ALHA 5IK2D 1ENOA 2PKEA 1GZSA 5FTNA 1YDGA 5FEUA