2IF0A

Crystal structure of mouse rab27b bound to gdp in monoclinic space group
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
184
structure length
174
Chain Sequence
YDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDAFKVHLQLWDTAGLERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the small GTPase Rab27b shows an unexpected swapped dimer
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Ras-related protein Rab-27B
total genus 46
structure length 174
sequence length 184
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2if0A00
1JR3D 2WAYA 4FCTA 4JMPA 3GLGE 4KODA 2V7QA 2C5LA 1DPFA 1IONA 2GBLC 2J45A 1EG7A 1RYHA 2BMFA 2GJSA 3P20A 5B2ZA 3VKWA 3W5IA 5B58C 1W4CA 4M1WA 2ZE7A 4Q9IA 4F4IA 4URWR 2HXSA 4HAWA 5L8VA 1G8PA 2H57A 1P4SA 1XCGB 2ODWA 4G01B 3R8CA 2WOOA 2ZJ8A 4BQSA 4B47A 3U6KA 1N6LA 3WNCA 1ZM3A 1NJGA 2GRJA 3FOZA 4Q4HB 4OJKA 1VIAA 3PXGA 3A4LA 2IYUA 4OI1A 2DHRA 3EC1A 1W4RA 4DLSA 2TMKA 1D6JA 2H5EA 3AUYA 3CRRA 4PSAA 4BFUA 5J4LA 1QG4A 3AKCA 2O8EA 1KJWA 4QBGB 2RMKA 3KQUA 2RGDA 4Q1DA 1F3OA 3LWNA 5JJKA 1FMLA 2E87A 4G3XA 5SZKB 5FH9A 4ZCLA 1C1YA 1EFUA 2A5GA 1P9WA 4B33A 2QPTA 2J59A 1BKDR 4IOJA 4M9SA 1KJZA 2F7SA 3BXZA 3RC3A 2V55B 1FX0B 4G5SA 5SZHB 4Q18A 4KFSA 1EFTA 4FD2A 3AB3A 1C9KA 2YKGA 1J90A 5DI9A 2P5SA 1W0KA 3U7HB 3AV0B 2C9OA 4PC1A 1E9RA 4MITA 3OFNA 1KYIA 2VHTA 5AJXA 3VX3A 1NG9A 2FDCA 3PUXA 1XWIA 2HV8A 2W2VA 5EP2A 5HCIA 5TMPA 1KAGA 2ONJA 3VR2A 4NCNA 1KDOA 5FBWB 3IHWA 4FWTA 1N5KA 3CR8A 3LVQE 1IM2A 3ZS9A 4CEJB 3I62A 5BYJA 4TTQA 4Q1CA 3U3JA 2QMEA 3VMFA 2ZRLA 1U81A 4V0KA 4PPGA 1P2TA 1Z6TA 1E2EA 1IN7A 5EP1A 1HTWA 2JLQA 3B2EA 1OXSC 2WJGA 4OL0A 3X1WA 4FIDA 3ZD7A 2CE7A 4Q7LA 4V02A 4TMVA 3FYHA 5KU1A 3W6OA 3CF2A 4ACBA 2QT0A 2GEVA 2JJ8A 2PEYA 4HDCA 1EX7A 2QBYA 2OUKA 1I4LD 3FHCB 1XJQA 3IQWA 5FOVA 1US8B 2KSQA 4ESVA 3GLIA 1M34E 2WJYA 1P3JA 4K81B 5DI3A 2PLFA 2AXNA 1CJTC 2GZDA 2ZQ5A 5CLQA 2VA8A 2EWWA 3OEED 3QKTA 2A3RA 3MUFA 4C4PA 3IUYA 4WIAA 5ANRB 1G3MA 4HB2A 3TAHA 2A30A 4KSCA 2QEQA 1Z0IA 2ZM5A 1WBBA 1XEFA 4UJ3A 4N0DA 1TPZA 1HT2E 4RSGA 2BBOA 1FTSA 2IYTA 4M1OA 2QI9C 2IS1A 3QEJA 2RAPA 4W7SA 3Q7QA 2AD1A 3W8NA 1RIFA 2UKDA 4B2LA 4OHXA 4P3YA 4PAOA 4C0SA 5JSZB 4A9AA 5H8WA 3QG5A 1RVDA 1DAIA 3X2SA 4B32A 3N2EA 2IYQA 1NVVR 1XX6A 2D74A 2RGXA 2QY9A 4B73A 1R6BX 1VG9B 4TYNA 2QTHA 1SXJA 1PLKA 5HZHA 4W9MC 1TNDA 1L4YA 5L3QA 2QAGB 2W83A 1NN1A 1OH5A 1D8TA 2KBEA 3QVVA 2H8KA 4I1OA 1P2SA 1QHSA 2AR7A 4YDHB 1NVUQ 2QMHA 4KV9A 1A4RA 2R6FA 2PZFA 3SJBA 2ZRNA 3LX5A 3BORA 1YR6A 2JLVA 1NVVQ 2V6IA 1A7JA 1SVWA 4DT1B 2GEDA 2IUTA 1UF9A 1X1SA 2PJZA 2P6RA 3EC2A 4HZIA 3VKGA 1N0UA 3OF5A 3PVSA 5TV2A 3KFVA 4RD1A 1Q3TA 2WKPA 4Q02A 2CE2X 4C0BA 3PEUA 2ZROA 5LD2C 2Q3FA 2WJHA 1OXVA 2CL7X 3WMEA 4C0KA 3GJXC 4C3ZA 3PIRA 1XMSA 2ZYUX 4OHVA 1G8HA 2GXAA 4IJMA 1QF9A 4ZI3A 2IF2A 4DLZA 2XZPA 1M7GA 2WJIA 4Q48A 5CDFA 4Q03A 3LW8A 4JSTA 1CR2A 1TEVA 3U44A 1W4AA 1ZINA 4QJ5A 2FEOA 2C96A 3EPKA 3LBHA 4QHTA 4BGDA 3CNNA 2R6AA 3BE4A 4P4SA 4TL9A 2AD5A 2BM1A 2AWNA 4MUAA 1V43A 2B6HA 1SXJC 1CS4C 5F3WB 4URZR 1NIPA 5FL7A 3KB1A 1XZQA 1WA5A 5LPNA 2IS4A 1G7RA 4GFDA 4E09A 1NSFA 4LC1A 5AJWA 2WMOB 2G9NA 1GWNA 1N6KA 4NYIQ 5JLJA 4I81A 3VNVA 2ZRDA 5E7IA 3WXMA 2OCYC 4M8NE 4KITB 1P73A 4EPVA 3DVLA 1DTSA 3SFZA 3FE2A 3DOEA 3UG7A 2JASA 3GLGA 2H18A 5CM8B 2REBA 3BGWA 3W3AA 4WZAE 3U5ZB 1R0WA 1ZVQA 4EFNA 2JDIA 2ZI9A 3HP1A 1FP7A 1YHNA 1JB1A 1ZD8A 2Z6VA 1NN5A 5DHFA 1DAKA 1NMXA 2GK6A 4Q4AB 1UKYA 2R9VA 4GPTA 3KKNA 2B92A 2DFKB 4V0ME 3RSOA 1S3GA 4LHYA 1ZU4A 4XWOA 2F9MA 1G8FA 2BMEA 3WHLA 1J2JA 4WA7A 4LJ8A 2ERXA 4AD8A 4KBGA 3GFTA 2CHQA 4XWAA 3SYLA 1F2TA 1GUAA 5EZ6B 4PQFA 1ZNXA 2VO1A 4A8JA 2XNDA 3UMFA 3AP2A 3NBFA 4C0QC 4H1UA 4GDFA 2NMVA 4IFBA 2N42A 1GITA 4FW9A 3LXXA 4JIMA 1NY5A 3P26A 1E1RA 3IEUA 3FDIA 3K9GA 4IHQA 3IILA 2I1VB 4PZLA 2XTNA 1GKUB 1RE0A 3NH9A 5EQTA 4QKQA 1E9BA 1QG2A 5LBIA 4Q9JA 4MRSA 4NYJQ 2WWGA 2ZJAA 1Z08A 3AUXA 4URVR 1IN4A 1N5IA 4ZV4A 1XMVA 1S9HA 1NIJA 1YR8A 2BIFA 4KLZA 5C18A 2F3TA 3T15A 2ZRIA 5FPSA 1DG1G 3DM5A 5E7JA 4HUQB 1EESA 1NN0A 2ZJZA 4KO8A 3QY0A 3KTAA 4ZDWA 4NP6A 2BJVA 2OM2A 2BMJA 2ZANA 2V6JA 4D6PA 3VX4A 3L8ZA 4DDVA 2RGEA 2XNSA 2A78A 3ADKA 2CDNA 3ZVLA 3PUZA 2OFXA 3KQKA 2W0SA 1LVGA 4CT4B 4B34A 2HJGA 3VR3A 2UZIR 3Q9LA 1II9A 1XTSA 4C9BA 1R5OA 4TQ9A 1R4AA 1SQ5A 4WW0A 5L3SA 2OBNA 4RKFA 3V4RA 1XMIA 2WICA 4MGZR 3KB2A 1QHYA 3SBDA 2IL1A 1OV4A 2VIIA 1CF4A 1E2DA 1JXMA 4P4UA 2C78A 3T35A 3DEFA 3I72A 4ZPXA 2W6JD 1EXMA 4TT3D 1GRRA 1B23P 1XU4A 4B76A 4K8OA 3L43A 3CX8A 3WYAA 4O3MA 3RS3A 1UKEA 4EQ6B 5TARA 1Q1ZA 5AUQA 1Z47A 1MR3F 2G1KA 4MH0R 1VHTA 4LBZA 1JAIA 4XOIA 3KX2A 1DS6A 2WKRA 4DCNA 2PEZA 1RFLA 3K0FA 4MRPA 3NHBA 2GEUA 1TMKA 1X6VA 2YVUA 4N1AA 4BE7B 2WBLC 2VTKA 2IXGA 3THXB 3RLFA 3TBKA 4M1SA 5FOXA 5CB6A 1M1YE 1II0A 4B3XA 5FTKA 1KI2A 4O0MA 1T5LA 3EWAA 2GJKA 5AUOB 5JCZA 4F91B 5CLLA 1HY3A 2WPDD 1DE0A 5JJIA 1A5TA 4ERNA 1XBTA 2NZ8A 4LUCA 2YZ2A 2J0SA 1FPMA 2NGRA 1ETUA 2A7QA 4US1R 3VR1A 1ELOA 1VHLA 3QXSA 2ZSFA 1KIMA 1E2GA 3S1AA 2PLRA 4KU4A 2GF9A 1Q1EA 2C95A 1S3SA 2OLKA 2WVJA 4EIWA 5JEEA 1IBRA 2W2XA 1X1RA 4NKRA 3RYTC 1UDWA 4OHZA 3ZGXA 3MCAA 1XTIA 1OH7A 1EK0A 1VDZA 2KWIA 2F1JA 4YDSA 3KQLA 4Q7KA 2A5YB 2EW1A 4BZPA 4DJTA 4OK6A 1JNYA 1G20E 2RB4A 3AP1A 3GJ7A 3KXLA 4JLBA 4Q1BA 1D5CA 2O8DA 5HZKA 5JRZA 2AWOA 3CKLA 3F5FA 1Z2AA 2IK8A 2PX0A 1KAOA 1E1QA 3THYB 4HLUC 5K8LA 2J87A 3W5JA 1M2OB 1TF5A 2JA1A 5DHAA 3EWSA 5C4MA 3LBNA 1AS0A 4A6PA 3QSYA 2GVZC 4A0GA 3HDTA 2FSIA 3HU2A 4G5QA 4ZO4A 3LQQA 1T3LA 3RS0A 1MO5A 2QMOA 1OYYA 4PO1A 4Q21A 4WXPA 1CXZA 1QHIA 5FPKA 1SVLA 1CULC 2GF0A 2XOKA 4OQFA 5FFMA 2O8BB 2IYZA 1N6NA 3I1FA 4FMDB 5FOUA 1AS3A 2IXEA 2J1LA 2VHJA 3EA5A 3QENA 4GBMA 4I1UA 2E1RA 2VP9A 3NTUA 3AQ4A 4Q4JA 2OEPA 1SHKA 1LY1A 4LRWA 1CIPA 3AH8A 1NKSA 1P9NA 1WDTA 4TLDA 3TKLA 5AJZA 1SVSA 1VG0B 1ANKA 2GXQA 3SHWA 4YMVA 4CEJA 4BLPA 4MGKR 1A2BA 2R8RA 3PUWA 5FI1B 4WBSA 2DB3A 3H1TA 2ZRKA 2P6UA 1KHTA 2OXRA 5L3VA 1I4TD 1RRPA 2HF8A 4Q9LA 4EAQA 1SULA 2A5JA 4JYBA 4KI0A 5HE8A 1CRQA 4BUJA 5FTMA 5LD2B 2ORIA 2RGBA 4TYPA 3ADCA 3CPEA 2OXCA 1E2NA 4MYHA 4V0MA 1Z63A 3NH6A 4NL4H 1E1RD 1T9HA 1XNJA 2QT1A 1XXHA 3BC1A 1AN0A 2FSGA 3X1XA 5KHOC 2IXFA 2Z0MA 3PENA 3VKHA 4QNMA 1QDEA 2ANCA 1XPUA 2GA8A 3DOFA 1FQJA 3HR7A 1WF3A 2QUZA 2ZS9A 3DO6A 3QXJA 4QBIA 4EFLA 1EFRA 3CO5A 1YR9A 2ZJYA 1AGPA 1IQPA 1DADA 1SVOA 2HXYA 4DLTA 1KNQA 1OHHA 4KBFA 3OE7A 4GT1A 4URUR 1K5DA 4DB4A 4Q4LA 3CIOA 1J70A 2IF0A 2GK7A 1XP8A 4HAYA 4YQFA 1ZUNB 3DZDA 1NSTA 1KI7A 1W47A 1T6NA 4NPHA 2WWFA 4QM6A 4JBYA 4PSVA 1TEXA 3GEEA 3OE7D 3GQBA 5GADl 1QBKC 4A0RA 1N3BA 2ZJ5A 3SJAA 4B3BA 2QAGA 3A1WA 1ZJ6A 2Q9AA 4B2PA 2CLCX 1UBEA 2AHOA 2ZI3A 3UG6A 1EWQA 3I73A 1JR3E 3PUYA 4NMMA 1CJUC 5JI2E 5FOSA 1AA9A 1GZSA 4UNQA 3Q3JB 5EJEA 5CIWA 5IK2D 5JEDA 2O8EB 2ZSDA 1FFHA 1BIFA 1UEJA 3PV0A 1F60A 2YOFA 2RKOA 3GLHA 4UXHA 3FKSA 1ZC4A 2N1BA 3F3YA 4OHWA 4ZKEA 4AC9A 4HI0E 2QROA 4QNRA 3L8YA 4Q19A 3K0CC 3QVUA 3RRMA 3FHTA 3B78A 3CRQA 4D81A 2JLXA 3AVQA 5J4HA 3B13B 4C7OB 3TMKA 3EPJA 1CRPA 3IIKA 2IYRA 5J4YA 1S96A 4BLSA 1WB9A 4R98A 4C2TA 5G3YA 3GJ0A 3E5HA 4KSBA 2XZLA 1TF2A 2WSMA 4LJAA 4DLXA 3R7WA 1XFAA 4PHGA 2JAQA 3AVOA 4JVSB 2XX3A 4PC2A 2VBCA 4QHYA 4DEYA 3R8FA 1JEEA 3CX7A 3R9IA 4WZBE 4ZCMA 5GVSA 2ZRJA 1P75A 1Z5ZA 3NWJA 3QJYA 3B9PA 1JALA 3LLUA 2J7PA 3K70C 3RS5A 3OIUA 2ORVA 4XSHA 3LA6A 2NO0A 1Z6GA 3S1AB 2AKYA 5KSZA 3OEHA 2X2FA 4XIGS 1E9EA 2ERYA 4D4LA 2FF7A 2J7KA 3RHFA 2GTPA 1WCV1 3BJIC 1Z3IX 3KDSE 4Q1EA 3AVTA 3PEYA 3MJHA 1ZMXA 4LPSA 4M1TA 4NDZA 1G5PA 2ZSAA 3C8UA 4H1VA 1D9ZA 2A9KA 3SZRA 5JJLA 3T06B 4C0AC 2GAOA 4K46A 2JJ1A 3KTAB 1UDXA 3GLFA 2JGNA 3NXSA 3MJRA 2O52A 2UVQA 3M0EA 3QUSA 4IW3B 2R6DA 4RKEA 1S1MA 1GKIA 2GILA 4PXAA 4US2R 1S1CA 1NLFA 1M7BA 3C16C 4MKIA 1LS1A 4P0TA 1K8RA 2J0UB 2QGNA 3K9LA 1OF1A 5FI0B 1XD9A 2R62A 4LX0A 1CTQA 3FFAA 2G88A 1E2KA 3BH0A 2QGZA 1J99A 2YC2C 2ZJ2A 2CK3A 5CIQA 4GMDA 1N5LA 1P2VA 2ZRFA 4LPKA 1NLYA 2P3SA 1VPLA 3U60B 3K09A 2R65A 4LYJA 5EUMA 3U7EB 4Q7MB 1XF9A 5AK0A 1W0JA 5FL3A 3NHAA 3SS8A 1ZCAA 4XVQA 5EE1A 4BASA 5CJ2A 1X8JA 1YVDA 4JLVA 3MFYA 2J0VA 4KVAA 3NC1C 1E2HA 2B7CA 2QTFA 3CX6A 1CLUA 5EXPA 1P2UA 4KYUA 4L9SA 3C15C 4TMKA 3TRFA 1P60A 1X8KA 3UXMA 1N6PA 2QBYB 1Z29A 1E0KA 4N3NA 3H0KA 1KZGB 1G291 2E9SA 3LV8A 4B6EA 4M0LA 1SHZA 4ITRC 1UKVY 4BEBA 2BHRA 2JDID 4P33A 2BMDA 4GP7A 2XZOA 1RJ9A 2FFQA 2G6BA 2VLIA 1U99A 4OQXA 3EIEA 2B21A 4Z54A 4U02A 5FTJA 821PA 1J8YF 3QBTA 4TMWA 2AK2A 3T61A 1XXHB 1Q3HA 3QKSB 1G6HA 1N5JA 2HF9A 2CMKA 3C5CA 5JS7A 2RGCA 2FPMA 1IY1A 1G8GA 1BS1A 1T4GA 3HPQA 2PMDA 3UATA 1XTKA 5EXSA 3TJZA 5KYKA 1GP2A 1KDPA 4A8JC 2YINC 3U44B 1H8HD 4U5XA 1BMFD 1T8UA 2EQBA 3IHLA 4RFVA 3K0SA 4PHTA 1W0JD 4FMCB 4WVFA 1WBDA 3QKUA 2YOHA 2G77B 2XAUA 2ZS7A 5K8UA 1XEXB 1S4QA 4ASUA 1E9AA 1BMFA 3HU3A 1JEDA 2ONKA 1ZD1A 4IEEA 3CUEF 1VG1A 5DNYB 5TDHA 3CNLA 2ZYTX 4EPRA 4A8JB 3R7WB 5FL7D 1G3QA 4FMDF 2ECKA 4URXR 4MRRA 4RVCA 1ZIPA 2AX4A 2WWHA 521PA 4HSEA 5M04A 4QOSA 2CNWD 4NYMR 4OJQA 1COWA 5KUTA 4AYTA 1DG3A 4Q1AA 4II7A 2EFDB 1J7KA 3JVUA 2J9RA 4IXNA 1T0JB 2A5DA 2RCNA 2P5TB 2CL0X 2ZEJA 4A2QA 3AM1A 5G41A 1NNEA 4CEHB 4C0JA 1M8PA 3K0FB 4B3CA 4D80A 1AZTA 3QF4B 2DWPA 1O3YA 1N0VC 1VCNA 3GLIB 4DHEA 2ZVQX 4OI2A 4QXAA 3MAAC 4DVGA 2FV8A 4LZZA 1KI8A 4X8MA 2IA5A 4B3DA 5KDLA 2VSOA 4UQOA 1YRAA 4QJ4A 3JVVA 1G5TA 3D3QA 3GJ6A 2O5VA 3WYGA 1H8HA 2GCNA 1YZKA 4PR0A 4LBYA 3EPHA 3K53A 1OB2A 3C14C 3CNOA 4XTRA 4UNNA 4JBXA 4BFZA 5F98A 2JIZD 2FWRA 2YWGA 1PZNA 3AF0A 4BZXA 4BPBA 3X1DA 1KI3A 4M22A 3M1IA 3LD9A 3L82B 2J46A 4MYUA 4EPWA 4CEIB 4LHWA 1T3SA 4OQNA 1UFQA 4YXWA 3A1VA 3SQXA 4AKIA 3TVDA 2JIZA 4PFSA 1AS2A 1Z8FA 3DHWC 2PBRA 4RFSA 4DLYA 4PQRA 3HU1A 4Q00A 4V03A 1JQJC 2ZR7A 2BEJA 1NI3A 1VYVA 1E4YA 1US8A 1ZCBA 2CCJA 2I4IA 2NPFA 4JS0A 4PTLA 4IDOA 1FZQA 1KO8A 4Q9KA 1IY2A 3FB4A 3I8XA 5DYGA 1G64A 3ICQB 1HE8B 1I4DD 4DLRA 4KJZA 1OSNA 2QE7A 1TADA 4CZ2A 1KNXA 1ZUHA 1Q1BA 3NVAA 4IRUB 2V3CC 2JCSA 5UKDA 1FQKA 2BVNA 2RH5A 2QMUA 3NDBB 3MLEA 4IOKA 1OLOA 3WP1B 2XTZA 1KK0A 4M4SA 1KMHA 1U9IA 1PJRA 2IHYA 5GJCA 2ZSEA 4HYYA 1HE1C 3VNUA 4HLCA 2BM0A 1Q44A 3TGPA 3ZIAA 1VCIA 2NO7A 3NIBA 3IQXA 3ETLA 2O8CB 1HEIA 4MDFA 3C41J 2R44A 1W36D 1OH6A 2Q6TA 2J7PD 2X77A 1R0YA 1COWD 2KB0A 1U98A 2BEKA 2BBTA 3FMOB 4O25A 3TQCA 1CBUA 4YMWA 1G1MA 1VCOA 1UEIA 4Q4JB 1D2EA 2WSSD 4GL2A 1ZYUA 5BN5A 4GI7A 1Z06A 3THOA 3SQWA 3ICEA 3REGA 5TY0A 1OIXA 1PUIA 1IY0A 4PX9A 4NCKA 3SE0A 1YZGA 3MWLA 3U61B 3RRYA 2ZR0A 2C77A 1K5GA 1QHGA 3ZZ0A 3IGFA 1HQCA 4IVPA 2DFTA 3MGCA 2Q3MA 4HB0A 4RD2A 1HUQA 1Q20A 1N6OA 3QBVA 1IXSB 4PHHA 5KDDA 4Q4AA 2FX3A 3WBKA 1ZUIA 1AK2A 5FR2A 4EJSC 3QF4A 2ZPTX 4TWZA 4KLNA 4Q47A 4TLBA 2F55A 1WE2A 3VR4A 4V0LA 3IEVA 4C0LA 1U9IC 3CPJB 2EFEB 2NO1A 1XDBA 3TW4A 3B85A 1P61B 4Y0AA 3E70C 2YNMA 2DFNA 3VU9B 1YRBA 4YC7A 3I61A 4A6XA 1J8MF 4XVUA 3T1VA 2XXAB 3AF3A 5CJPA 4NYIR 1PLLA 2CK3D 3MRSA 1N6RA 3HWSA 3KXIA 3WY9A 3GFOA 2KBFA 4PC6A 2CJWA 4GOKA 1G3RA 3ZIAD 4F38A 1XCMA 4BEJA 2ZE5A 1AQUA 3H4MA 3HR8A 5AWFC 1W36B 4EQ6A 2JEOA 1GL9B 3LH5A 2HLDA 2A2ZA 3B1YA 1NVWQ 2HYDA 4LSGA 1JXOA 3IO5A 3LDAA 1KI9A 1KO4A 4HEJA 2XSZD 5IHPA 3BBPA 3FGNA 1YZQA 2QE7D 3CWZA 3O8DA 4OYHA 3SN6A 3WRYC 4XD7D 2FZ4A 3EAQA 4JJKA 4TL6A 3H86A 3O8BA 1JECA 4OQLA 3K0EA 1OIWA 1EGAA 4DCVA 1Y3AA 2F9LA 5DSZA 4IDHA 1QZXA 4HUQA 2NTYC 3DKVA 2YWFA 1ZC3A 3U3RA 3GJ8A 2ODEA 2C8VA 3KQHA 1ZM4A 5F2EA 3U3OA 1GIAA 2YOGA 3WNBA 1E2JA 1G7SA 2C98A 1VTKA 2EFHB 4KVGA 4WOPA 3SJZA 4MRNA 2IT1A 4KCGA 2ZVPX 2ZRBA 1OXUA 2VF7A 2QP9X 4A36A 2AKAB 1T91A 2ZSBA 1GRNA 4LBVA 5IK2A 1FP6A 4LJ4A 1G9XA 2RGNC 1GDDA 3AF4A 3U3MA 2WJVA 3VU9A 5FBVB 3UK6A 1XJ0A 4GZMA 5FPTA 5IF9A 4LHXA 3ND8A 2D06A 4LHVA 2F1HA 4DSTA 2JLZA 5AR1A 3A4MA 1II8A 3D6TB 3ASYA 3BB4A 5DLQC 3B5JA 3BB3A 4I1SA 3L2OB 2GBLA 5IDVA 5G3ZA 5E4FA 4PC7A 5BN3A 4HLQB 4CYMA 3OEEA 4IDQA 2H16A 2CBZA 2DBYA 4JLMA 1OFTA 3OFND 1S2MA 4ZKDA 2BDTA 3WYFA 4JLKA 2EVWX 1RRFA 2O8CA 5FBQB 1YE8A 3AVXA 1IN8A 5H68A 1W7AA 2P6NA 4QHSA 2FJUA 1YZTA 4JLAA 3PJRA 2CLDX 2ZRCA 2VF8A 5J4VA 2R2AA 1SGWA 4TN1A 3UWKA 2BCGY 4A0HA 5EE3A 4MYTA 1F2UB 3TUJC 4D4JA 2PH1A 3W8RA 1OIVA 1MABA 4Q5IA 3B1WA 1VECA 3IO3A 3QXHA 4MYCA 2MSEB 3LY5A 1MOZA 3DM9B 2QPOA 2UZ3A 3QF7A 4LJ5A 3THYA 2ZE8A 4D0GA 3B82A 4ASUD 1G6OA 1NF3A 2QNRA 1DAGA 2CXXA 4XJXA 4RY2A 4TSFA 5EE9A 3QEOA 4YONB 2IC5A 1E69A 4IVRA 2RGGA 4Q4HA 1GKYA 3KKOA 1MO6A 2WTUA 5B30A 3A1UA 1SKQA 1U0LA 4LJYA 1NMYA 3QXCA 1P5ZB 3TSWA 2CVFA 2D4HA 3KQNA 4M1YA 4DDWA 2B8WA 1Q57A 4TL7A 4W5WA 1II8B 3CF6R 3VAAA 4OI0A 4ESHA 2FFHA 3RANA 2FU5C 5HPYB 2VP6A 3I5YA 2AFHE 4Z1MD 4TTPA 4AG6A 3MMPA 3P32A 1D2NA 4G5OA 4LJ7A 1IOZA 2ZETA 3OAAD 4AY2A 1W1WA 4TQAA 4NYJR 3LQRA 1ODFA 4JZKA 1KKLA 3UMRA 3K09C 3PFIA 3B60A 1KSHA 6Q21A 1JBKA 3ASZA 3KJGA 2GXSA 3GJ4A 2OBLA 1Z0JA 2W0MA 1G4UR 1UM8A 4I1VA 3UPUA 2JLRA 3AGPA 2CCGA 4F4CA 3EZ7A 5FR1A 1KO7A 1HQYE 2GESA 4W5JA 2WM9B 2RHMA 5AUPB 4YLGA 3QKRA 5C1BA 3I92A 1Z6AA 1WRBA 1E2QA 3QKRB 2IX3A 3BAFA 4FMBB 4EKDA 3DDCA 3NC0C 5CM9C 5E7MA 4HLUA 1S8FA 4M1KA 4OKSA 4M53A 3KJHA 3WNDA 1NLZA 2ZRHA 3DL0A 2ZUBA 2FN4A 5DH9A 1DAFA 1KMQA 1R7RA 5CITA 1H65A 1U8YA 4TZ6A 4B3FX 3SDZA 5JSZA 4A1FA 1NMZA 1R10A 2RHDA 5FBLB 5GVRA 1X8LA 4D26A 1M6NA 1GSIA 1GFIA 3TLXA 1CR4A 2HLDD 1FMJA 3TSOA 3DMDA 1KJYA 4ON9A 2OCPA 1JPJA 5KSOA 1P6XA 3BH7A 1VCMA 2PCJA 5LB4A 1CP2A 3TNFA 1AKYA 4CT5A 5AUNB 3AVYA 4RZ3A 5FTLA 3PR1A 1YKSA 3IIMA 1E2FA 1MABB 4RD4A 3KXKA 3PQCA 3W34A 2QM8A 1WQ1R 2O0HA 3JZMA 5C46F 4BLTA 3P4XA 3C4JA 1YR7A 3B9QA 4XH9B 2XNDD 2C9CA 4UNPA 2QAJA 4KAXA 4ZI2A 3KKPA 2ZI7A 4FXPA 1U90A 4CIDA 5EE5B 3F0TA 5A0FA 1FL9A 1IHUA 3MWKA 2W6IA 1E2LA 4JVLA 5D3MA 5DI3B 1LTQA 1T3HA 2FMXA 3IPYA 3K0CA 4NZYA 4Y0VA 3L0PA 1DOAA 4G0NA 3U3KA 5P21A 2GVDC 1XPRA 1YQTA 4CGZA 1E9CA 4XSGA 3SR0A 1YJ5A 3FPAA 1LV7A 3NBYC 1RRGA 5DIFA 3L0SA 2KE5A 4JJZA 3G0HA 4GOJA 4EPYA 4ZDKA 3T1OA 4NTZA 3ADBA 1NJFA 3SEAA 3KUDA 5J5CA 5TXGA 4JL6A 1A2KC 4UNRA 4PC3A 3TIFA 1UAAA 1ZIOA 1IAQA 2NIPA 3EXAA 2FA9A 4TLAA 4DKXA 1E99A 3LNCA 5KDOA 1E94E 3RWOA 1W5TA 4A15A 2AK3A 2BKEA 2GDJA 4QBFA 4D2IA 2VQSA 5HKKD 3KKQA 2D2EA 1HT1E 4C7OA 4LC0A 2ZIAA 2RGAA 4A0FA 2VHQA 4LV6A 1ZM2A 3B1ZA 4E07A 4DBLC 3UKDA 4TL8A 2WMNB 5DO9A 1F2TB 1Z0FA 5KO2A 1HH4A 1TL7C 4AI6A 2C9YA 3MD0A 1G4AE 2JATA 1SVMA 4Q1FA 3RS2A 1SVKA 3A1TA 4PSKA 1W0KD 4RD0A 4JVNA 2IHBA 4PAMA 3CM0A 3JZAA 3N5CA 2WWIA 3GJ5A 1XEXA 1G19A 3N2IA 3PG5A 4YMUA 2ZI4A 2OV2A 5SZIA 4DWJA 3U7FB 4QL3A 4HZUA 3GD7A 1SXJB 3GPLA 1KI1A 5TB5A 1W2GA 2IEZA 4YXWD 2PCLA 2H1LA 4GZLA 4NBSA 1EFHA 4RZUA 4HLDA 2D3WA 2G1JA 2GWHA 3U2QA 3R20A 4A2PA 1CR0A 1S0UA 2IEYA 4D4MA 4LI0A 2IS2A 3WP0A 1TUIA 3UMSA 5DGXA 5J4KA 1RRCA 3X1YA 5B57C 5KPDA 3E2IA 3C5HA 2ZREA 2XB2A 4P31A 3AF2A 3NDPA 1GM5A 4EFMA 1F5NA 2REOA 4CEHA 1GOTA 5FPYA 3TE6A 3K0AB 3BK7A 2ZYWX 1N2CE 4NE2A 2I3BA 4TLEA 5G40A 4GMXA 1XEWY 3EX7C 2ZU6A 4B2IA 2F43A 1XMJA 3ZH9B 1UPTA 4B3GA 4NH0A 2ORWA 5H1YA 4LDJA 1P62B 1NBMA 1M7HA 1Z0KA 2YWEA 3AKEA 3ZVMA 2W00A 4IFEA 5KPJA 4DIEA 4GOXA 2FNAA 1U2RA 2WZQA 2DWOA 1XPOA 2BC9A 3RRNA 2PT5A 4M1MA 1KTVA 2WV9A 4CF7A 3ZZUA 5E95A 2CCKA 3Q5EA 3O8CA 3CF0A 5A4JA 3DZ8A 5EP4A 1Z6YA 5HTKA 3FKSD 3UWOA 1G21E 2W58A 2ZJOA 2J41A 4V0NA 5JWRA 3RSLA 4M9ZA 3SJCA 3CH4B 1RYFA 3A36A 4PHFA 2Q21A 2IWHA 3BS4A 4HAZA 1KZ7B 3TQFA 4TTRA 1YZUA 2L0XA 3NG1A 3QKSA 4ACAA 2REXB 4HAXA 1RZ3A 1A1VA 1QVAA 3ZZTA 2QQ0A 3EZ6A 3A37A 1SVIA 1XRJA 1KOFA 2C99A 3D31A 4RZXA 1XJCA 3VTKA 2BV3A 2CJWB 4FWIB 3BWDD 2OESA 4AKEA 4B71A 1Q12A 5JMTA 5JRJA 4WZ6A 2Z83A 4GP6A 2HT6A 3FMIA 1E2IA 1X86B 1Q21A 3SFVA 3SYNA 5EXXA 4F4JA 3RVBA 4F92B 2PZEA 2VEDA 1DAEA 4Q66C 2QQEA 4TMXA 2WPDA 3BFXA 1IXRC 4QBHA 4YMTA 2J5XA 1OYWA 3W6NA 3CW2A 1VG8A 1SXJE 4RD6A 2EU8A 5KOYA 3LW7A 1UBFA 3CR7A 1G16A 4NCHA 2YV5A 1L4UA 4Z51A 5B64A 3TH5A 3DPUA 4HAVA 1OPXA 2F1RA 1EX6A 1F2UA 3H84A 4KFRA 5K8IA 2Z5FA 2I1QA 4BFWA 4CDGA 1VYTA 1OH8A 1KSJA 2DFLA 1XCPA 2XOKD 4MKHA 3FHOA 4ZDIA 5FUVA 4FMCF 4CEIA 1OFUX 2P67A 3QG1A 2Q9BA 1ZW6A 3CWQA 2GKSA 1E9DA 2NQ2C 3O47A 5AJVB 1A82A 3VQTA 3ZDQA 1LF0A 4ILEA 5E3HA 4AIIA 2IYVA 4ARZB 1OXTA 1NY6A 1N25A 2KI5A 3QQ5A 4GRAA 2DWQA 1X3SA 1YU9A 1BOFA 1QVRA 1E1QD 1KI4A 4BFYA 3EZ2A 3KL4A 4JKIA 4QM7A 3LRPA 1KO5A 1QHHB 2IW3A 4S35A 4DCUA 2VH5R 3CZQA 2HDNB 1OFHA 5KSPA 4EPXA 3SI7A 721PA 3B1XA 4Q9HA 4DDTA 2D7CA 2OILA 3LO5A 4UXIA 4C0HA 5EXTA 4JYCA 3LAWA 2VHUA 2X1VA 3W3ZB 3RWMB 4E03A 2FPKA 3R9XA 4MKGA 3IIJA 2D62A 3AKDA 3SNHA 2Q3HA 3I5XA 1JR3A 1KKMA 4PO9A 1U94A 4D0NA 1JQLB 4DLWA 2X19A 5FOTA 3T1TA 1T5IA 4FN5A 4A92A 4ARZA 3L0OA 4AYWA 5HR5A 1C4OA 3THXA 3B1VA 1G7TA 1GILA 3D8BA 2LCFA 4IOMA 5IRCD 1KDRA 2O8DB 3GFPA 4JLJA 5HCNA 3RAPR 1TQDA 4Q01A 4JBWA 3R9WA 1KDTA 1L8QA 5SZJA 2V1UA 2IUUA 1E32A 3O8RA 4LGMA 4DIDA 1CR1A 2Z43A 3TW8B 3IPXA 4DCSA 3OESA 4QGHA 2VPPA 1G3UA 3QOFA 5CB8A 4JLOA 1H8ED 4L9WA 4GNKA 5JHHB 2W6ID 4Z8XA 3RS4A 4LJ6A 1AZSC 5JHGB 3HYTA 3W90A 3CZPA 1ZM7A 2G3YA 4DLUA 3KKMA 3T5DA 5GJBA 4MKFA 1VMAA 2LWIA 2WSSA 4R7ZA 1JJVA 4BLOA 3BFKA 2FOLA 2QG6A 1GRQA 3LXRA 4I4LA 1GL6A 4MGYR 3L0IB 3BD9A 3EZFA 1PLJA 4EDHA 3U7GA 1UKZA 1EFRD 4U7DA 5J47A 2XSZA 4URYR 4ZDJA 1R5BA 4BFTA 4M9QA 4MDEA 4LY6A 1QRAA 3A8TA 4TQUS 1KI6B 1NBME 4WAUA 1E9SA 1E4VA 3AKYA 1E2PA 4DUGD 2DYKA 3IBGA 2IWRA 1CJMA 2FH5B 2ZI6A 1IN6A 3SBEA 3AVWA 4DT1A 5BWMA 2ZI5A 4B75A 1R5NA 1XB2A 3CBQA 1BH2A 4DUGA 3HYRA 2O8BA 3OAAA 2GCOB 3A1SA 3CH5A 2DY1A 1FUUA 3TAUA 1Z22A 3ZLJA 4OHYA 1E6CA 4AK9A 4EJSA 1U0HC 1AKEA 1Z0DA 2V7QD 4DRZA 4ZCIA 1U8ZA 4TLCA 1TQ6A 1QHHA 4PZYA 4PPQA 2GAAA 3F8TA 1LB1B 3B8HA 2FGKA 1AIPA 4H9GA 2JLSA 1XTJA 4NONA 4RD3A 2QA5A 5FBRB 4DLVA 4F7WA 2FZLA 4MQBA 4XD7A 3SHFA 1VKJA 5FUWA 2FSHA 1GTVA 3LLMA 2J3EA 2QP4A 2LKCA 2ZXUA 2XEXA 2CLSA 3QPUA 1GL7A 5LB2A 2F3RA 2ZAMA 1GAJA 4HZUB 3K70D 3FFBA 1RKBA 4OBEA 3EIQA 5CYOA 5GJWC 3AVPA 1Q1QA 2DPXA 2A5FA 2FG5A 4UNSA 5TVKA 3T1QA 2QL6A 1U8AA 3OHMA 4RCZA 2ZRPA 4D0LB 3QPWA 3EARA 4X8HA 4TYYA 2P2LA 5DYIA 2XGJA 5JWOA 3I4LA 1JI0A 2BWJA 4WXRA 4QG7A 2HJVA 3CRW1 3Q7PA 4L15A 3OEHD 1OKKA 1OT3A 1F6BA 2QSZA 1KK1A 2H7VA 4TMZA 5CYPA 4AKHA 4DB2A 1WXQA 1IJFA 1LF5A 1RW4A 1FX0A 2ODBA 2QU8A 4BWYA 1DARA 1TQ4A 1DAHA 2C2HA 3BIFA 3MWYW 3FVQA 2ZAOA 2MSDB 2WOJA 5ELXA 2V1XA 4EJSB 2ZUDA 2ZS8A 4XTCS 2ATVA 4PPNA 1E79A 4Z8YA 1OB5A 4TYWA 1BYIA 1FOEB 3H2YA 1Z07A 4CRWB 1SZPA 2Q9CA 1OHHD 2VRWA 2ZYVX 3GLIE 2OLJA 4JVMA 2VL7A 4QJ3A 5KNBA 3U4QB 421PA 1MT0A 3WMFA 1ZD9A 1TAGA 1W2HA 4BZQA 2QORA 2XB4A 2ZU0C 3G5UA 2B8TA 2AXPA 4C30A 1AM4D 1TX4B 3RNLA 1W36C 1GG2A 2R6CA 4OK5A 3EA0A 3VHLB 4LV5B 1OXXK 3T12A 3CPHA 4A2WA 1E0SA 4QFMA 2QPAA 3ZVRA 2RGNA 2OBMA 5BQ5A 1KK3A 2VP5A 4CW7A 4F93B 5K8TA 4UXJA 5D3MB 1O87A 2HCJB 2W6JA 3D7MA 1NVXQ 1ONBA 3AP3A 5CK5A 4QGAA 3U4QA 2AL7A 4IXMA 4AKGA 4AWXA 1G5RA 1T0HB 2FFAA 1KI6A 3U6BA 2IYLD 4TZ0A 1W5SA 4MGIR 1HYQA 3Q72A 4HATA 2CHVA 4JKYA 2ATXA 3K9NA 4IVQA 4BFXA 4S2EA 1IJEA 2O0JA 4D82A 1B0UA 4L8GA 2V54A 4PZZA 1TUEA 4OI4A 1LS6A 4AG5A 3V9PA 3TUIC 2ZRGA 1N6IA 2GCOA 2B7BA 3DMNA 2QRNA 3A4NA 1XXHE 1NKTA 1T8TA 3K0AA 1YZLA 4FCVA 1GNRA 121PA 1R0XA 3FTQA 5DN6A 2D7DA 2MMGA 2CNWA 4JL5A 4W5HA 5KNCA 2VSFA 3TUZC 1KSFX 1R8SA 1FW6A 1WP9A 1RJ9B 4X8LA 1XD2B 3QIAA 1ESNA 4E5UA 3ZS8A 5CK4A 1TTTA 1MRNA 1M74A 1KSGA 2SHKA 5JBQA 1E3MA 1DO2A 1ESMA 4KYIB 1LFDB 5JI3E 2JJ2A 1PV4A 4Q7JB 4DEXA 4G5RA 1DO0A 4FI3C 4P32A 4NHOA 3RC8A 2FGJA 4TMTA 5F9HA 1VYUA 5FUYA 4JT2A 3NKVA 1FNNA 2P0EA 2YYZA 2ZTSA 2OCAA 1R2QA 2XJ9A 1HV8A 2JJ1D 1DELA 2NO9A 5HE9A 3SU8A 3KFXA 2QP3A 3PEVA 2OSBA 4DSOA 1Q22A 4XWKA 4A82A 3VHXA 1H8EA 4POAA 4IEIA 4ZIRA 1E0AA 4Z1MA 4LYHA 2OG2A 4B6FA 4BFVA 3KUCA 3Q5DA 4LYAA 4M21A 3GLHE 4BLQA 3GLFB 2NOAA 4PO8A 1E98A 5HKKA 3FMFA 4PQYA 2OHFA 1P72A 1ZM9A 2VHCA 1QHXA 2HCBA 5JECA 2FFBA 1Q0UA 2O0KA 3RRZA 3FMPB 4DCTA 2JLWA 3WHKA 3PEWA 2BBWA 4TT3A 2VYFA 5FTNA 4AYXA 2AFIE 3ONWA 3QNUA 2QZ4A 2J0UA 3GCGA 1ZP6A 1E9FA 1MV5A 3GJ3A 4JLNA 3T34A 3QI2A 2CL6X 1IXZA 5BYKA 2CHGA 1WMSA 2WKQA 1MRSA 2OFWA 1W4BA 5G53C 1W49A 1E96A 3MG9A 2BOVA 3ZVNA 2WJJA 3B6EA 1RPZA 2ZR9A 3AF1A 3BRWD 1Z2CA 3TR5A 1N6HA 5DISB 1JJ7A 1G3IA 1UJ2A 1G17A 3BOSA 3UIEA 3SOPA 1W46A 1BYUA 2CVHA 4R71A 2DR3A 1G8YA 1OJLA 1W44A 1Z83A 4PANA 1U0JA 3IKJA 1KK2A 1R8QA 1ZAKA 5C4GB 3K9HA 2NG1A 1L7VC 1AQYA 3VFDA 4MUBA 5EE0A 3AEZA 3MWJA 2JLYA 4R2IA 1FTNA 2F1IA 5L3SB 3HPRA 4U00A 1ZNWA 5FOWA 1ZBDA 4L16A 3GEHA 4IOLA 4B44A 3ZD6A 2WWXA 3Q8XB 2BCJQ 2WIAA 4RFSB 1NG1A 3BFVA 1JR6A 3BERA 1K6MA 2JLUA 2XJ4A 4D25A 3TK1A 2K5UA 1V5WA 5L3RA 4FINA 4KHZA 3BB1A 3KJIA 1E79D 2IUSA 5KNDA 3LVRE 4EUNA 1NP6A 1XD8A 3V00A 2PL3A 4PPFA 1CU1A 3ZQJA 4P4SB 3ZJYA 1GNQA 2G0TA 2WIBA 3PUVA 3CB4A 1LNZA 2ASEA 3VR6A 4QRHA 3OIVA 5KTYA 2WWYA 3AVVA 4JT4A 4IKEA 5C2JB 1DEKA 2HUPA 2MMCA 3P4YA 2Q0HA 2VSXA 2QM7A 3Q85A 2N46A 1PVOA 1NL3A 4GSYA 2GXUA 4RJLA 3THWA 4M9XA 2OAP1 2GNOA 2IS6A 2IYXA 1JAHA 1F48A 1EWRA 2F43B 1PUJA 4BLRA 1GNPA 1E0JA 1D9XA 2WWWA 1KY2A 1MO3A 1Z6XA 3B7GA 4AURA 3WMGA 3GLFE 4R2HA 1NRJB 3C7KA 3EPLA 2H92A 4RCYA 4XVRA 4M2LA 5KSYA 4LYFA 2OE2A 3WRXC 2QRZA 3K1JA 4DZZA 3QXXA 2QAGC 5A5GA 4R9UC 2QN6A 2PT7A 3ZQ6A 1MH1A 1L2TA 2NO6A 4HB3A 3THWB 2MSCB 4I99A 2QTVB 2GHIA 3RS7A 4HDOB 3J81k 3BH6A 3TVTA 2Z4SA 1FUKA 1AGRA 1OKKD 3NEJA 4QC2A 2LKDA 4CVNA 2HYIC 1UBGA 2XITA 3RABA 1OW3B 2ZRAA 4BRUA 1XD2A 4L4UA 3EASA 3QE0A 4L5BA 5L3QB 4D4KA 2GCPA 3ND9A 2OFOA 3KZ1E 2O8FB 5LDDC 4NU0A 2ZJBA 2GJAA 4TYQA 1SXJD 1E2MA 1ZRHA 621PA 5AJYA 2ANBA 3T5GA 4KFTA 1NN3A 4HUTA 1ZNZA 1KGDA 3LX8A 1LW7A 1TF7A 4G5GA 3W6PA 2EFCB 1SKYE 3SC3A 4DC9A 2JJ2D 1KMHB 1MKYA 2VP2A 3M4YA 4PAQA 3MSXA 1S9DA 3EIHA 1FNMA 2IYSA 4JSYA 1XTQA 1CKEA 1MO4A 2IYYA 5H70A 1CJKC 221PA 2PJRA 1N0WA 1W48A 3V4FA 4ZIRB 2YHSA 1G18A 3M6AA 4O2RA 4QGFA 2EWVA 1VIYA 1IN5A 1P7CA 1TU3A 2PMKA 2ZRMA 3GLGB 4HAUA 2PZGA 3GEIA 2OO7A 3K70B 1G7CA 2XXAA 4QGGA 3IDQA 2C04A 4NCIA 2BBSA 2F6RA 2PX3A 2QSYA 4IDNA 4NYMQ 2O8FA 5IT5A 1Z28A 1KO1A 2FEMA 5DE3A 4DDUA 1YZNA 1GVNB 3N70A 4J0QA 1EFCA 2OAQ1 2GJ8A 1XTRA 1SKYB 5CDFE 4JLPA 4A4DA 3ADDA 2X2EA 3NBZC 3X1ZA 5JS8A 5GJVC 4IDPA 2V9PA 1DAMA 5JFGA 4B48A 4BRWA 4N0EA 4B43A 3EW9A 3EG5A 3UANA 2IBMA 1TU4A 2R6GA 4FCWA 5EZ5A 1ZU5A 2HT1A 2AN9A 2OCBA 4NCJA 1NBMD 2FSFA 3CLVA 2GZAA 3NBXX 2Z4RA 8OHMA 2ZUCA 2IYWA 4US0R 2GETA 2NZJA 5FPHA 3WBJA 3ZYCA 2WAXA 3CRMA 4TSFD 3PITA 3W9YA 3LBIA 4BFSA 2XTMA 3SYKA 3P1JA 5J40A 2QENA 2ODNA 2ZITA 3I8SA 4LCBA 4MA4A 4X8OA 3REFA 2YC4C 2GJ9A 4V0OA 1BO6A 1KY3A 5DN6D 2EYUA 3K8YA 4LV8B 2BJWA 5EUQB 3A6PC 5FUXA 3VR5A 2WHXA 4P4TA 5BXQC 4RZ2A 1DBSA 4JL8A 4ABYA 3A58B 1I2DA 2EYQA 4KXFB 1JPNA 4BECA 4JLDA 4KFUA 4HDQB 1XZPA 3CONA 3EZ9A 4YMSA 5JWHA 1Y63A 2G83A 3LFUA 1P9RA 2V4ZA 4OK3A 3ECCA 4B35A 4DXAA 4E22A 2BKUA 3G82C 2C03A 2VP0A 4OQMA 1QHNA 5BN4A 3FWYA 3KJEA 1OE0A 2H17A 4HB4A 3OZXA 1I2MA 5BW8A 2J0QA 3DKPA 4LWZA 5JCPA 2VP4A 1Z0AA 2D2FA 4LJ9A 1AJEA 2P65A 5D3QA 2OZEA 4O2LA 4DSUA 3GLHB 2GZHA 2Y8EA 1HURA 2EFGA 2X8AA 3IBYA 1HA3A 3E1SA 3TR0A 3RDPA 1CEEA 2DCUA 2NPIA 1CJVC 2OT3B 2W2TA 2YJTD 4G1UC 2V8OA 4LOAA 3NEYA 5F9FA 2G0NA 2FE4A 3I3SR 3TSZA 3PCRB 1UBCA 1RC8A 4C2UA 1UADA 2CEAA 3GMTA 5EP3A 5JZVA 1DVRA 1TQ2A 2FPLA 3QPVA 4B74A 1R0ZA 3AGQA 3AVUA 3HJNA 4LK2A 1D2MA 3I32A 3OIYA 3P27A 3FKQA 4MRVA 2YWHA 4LHZA 3CRVA 1XEWX 4LBWA 1OFIA 2HEIA 4UJ5A 4EPTA 1G41A 2ZE6A 4DSNA 3OIWA 2KJQA 3GP8A 1ZNYA 4UKDA
chains in the Genus database with same CATH superfamily
4NNPA 3C43A 4HEA6 1PR3A 3AUTA 3DV0A 4ZEXA 3GLGE 3AY3A 2EQAA 4KODA 1DPFA 1M67A 2PFSA 4MS3A 2PTGA 5IKOA 2IXDA 1KYZA 1EXDA 4JA2A 5B2ZA 4CCWA 2QU7A 3WGIA 3VOAA 3M9WA 1HLGA 3B2QA 1DC7A 3WWDA 4P2BA 2NVOA 4KH1A 3U1VA 2NAPA 1DC3A 4URWR 1TC1A 2ZBDA 2V7VA 3PUJA 1IC6A 2XPCA 3JQGA 4KWCA 4BJ3A 1QNLA 1KH3A 1WOYA 3DLTA 4LY9A 3R8CA 2WOOA 4D9IA 2PUVA 2RHJA 5EHNA 3N2YA 2PYIA 1NJGA 3FNQA 4I19A 3UJHA 1Z17A 2HO5A 3PZBA 3GA0A 4YI5A 2L19A 4Q4HB 1EZ1A 2FVYA 4MYDA 3RG8A 1Q7TA 3QFFA 5C32A 1EA5A 3A4LA 3HMQA 4JY7A 4DYDA 2IYUA 4YCMA 4DMGA 2DHRA 4M8SA 3WZ2A 2YMQA 3ELUA 4KITB 2TMKA 4OGKA 2ILVA 2H5EA 2H4JA 1E3WB 1ECJA 3AUYA 2BGJA 3CRRA 3NC4A 4C43A 1RACA 1O6CA 1UXGA 4FYYA 4HWGA 5GAJA 1JVNA 1KJWA 1YA4A 3UT5B 3KQUA 4Q1DA 1VPTA 2QL5A 3FW1A 5A05A 2AMVA 5JQGB 1FUEA 2WIGA 4N82A 3TKAA 5C4IA 3RYCB 2A5GA 2LE0A 2R1UA 2W5UA 2QPTA 4J0JA 2DPLA 1GU1A 3R0XA 1M1UA 4M9SA 1VB5A 4X60A 4E94A 4NMXB 3M83A 1KJZA 1IH8A 2TMYA 1K63A 1FBTA 1R15A 1IWOA 2V55B 4G5SA 5SZHB 4CF4A 5CLJA 4YRBA 1EFTA 1C9KA 2QJRA 2QOEA 3ITNA 2YKGA 4EGCB 1SU4A 2QW1A 1EFAA 1W0KA 3WFJA 1IMJA 3GYGA 4F2HA 2JI7A 5I7RA 3RFTA 3UAVA 3RJZA 4FM9A 1EJ6A 2GPAA 4P0QB 2MYPA 1NG9A 2FDCA 3HBFA 3ZDCA 1DJMA 2HV8A 4P2GA 5DEOA 1Z25A 2WABA 2WUGA 3OKAA 3SQOA 3WB9A 4MUNA 2JHGA 3M2PA 2JIPA 4QPZA 3VR2A 4NCNA 4MRAA 3FVRA 3IHWA 4N48A 3CR8A 1QUEA 3DDHA 3NOXA 4OH7A 3U3JA 3LS2A 1G42A 1X7YA 4YJ2A 2ZRLA 1U81A 1QO9A 2PSEA 4X45A 1P2TA 2QSUA 4I4IA 1E2EA 1FU7A 4Y6OA 3SLKA 1KZ9A 3QOWA 1EJ0A 3G3EA 4FIDA 4MEJA 1NPYA 5KU1A 1NGSA 1MX3A 1TUBB 2QT0A 2GEVA 3KQWA 4HDCA 1EX7A 1BN6A 2A35A 4TS9A 1MNAA 1XJQA 3KSDO 3IQWA 3GPDG 5FOVA 4L3WA 3G5TA 3DUWA 3KYDB 4LQCA 3FNFA 4EY6A 2NSYA 3BIOA 5BWNA 1P3JA 4ESVA 2AXNA 1CJTC 5CLQA 2ZQ5A 3E8SA 3FRJA 3K1TA 3R5SA 3V4PB 4RH0A 1EVEA 3OEED 4RZQA 1NX9A 3P4UA 1QG6A 2A3RA 1RMTA 4C4PA 1Q77A 4XGKA 2W2MA 3PRYA 4WGFA 1SOMA 2BH9A 4WIAA 3TAHA 4QXOA 4LMBA 2A30A 4WA8A 2QEQA 1Z0IA 2ZM5A 4IG9A 3INYA 3VKHA 1QGAA 2W37A 1QG0A 4M1OA 5AP9A 1PIWA 3HCNA 4X9XA 3IPRA 1NW5A 2QI9C 3LHDA 2FMIA 3CHYA 5F2OA 5F73A 1E5QA 3J7AC 4GP9A 2I6QA 3O7WA 2PQ2A 3MF4A 3S27A 3UAWA 4E5KA 1ILEA 2CV2A 1X7ZB 1EK2A 3W8NA 2LDXA 2DUUA 6ADHA 1RSZA 2QTVA 3GAMA 4C0SA 2GRAA 3HO8A 1K88A 4A6EA 4K88A 1JFFA 2OHXA 5LP6C 2IYQA 3ZEIA 1XX6A 1R0BA 2A9JA 2D74A 3COYA 4OP2A 3O84A 2ZBQA 5AKIA 3LBFA 4OIFA 1P6UA 2P6OA 3G1TA 1SXJA 3OICA 4W9MC 2Z6QA 1EGVB 1BQ4A 2JIQA 3LUJA 4IVNA 4K9KA 4BO1A 4ERXA 1D8TA 3K3PA 3MT7A 5GINE 2PGXA 2WW8A 3X44A 2H8KA 2QMHA 3ZTTA 5L51A 4IGIA 4BQIA 3PGLA 1DKNA 4INOA 3ZG6A 2WI8A 2R6FA 2C3UA 3LDHA 3OP1A 2ZRNA 2JLVA 4CMCA 1HTBA 1EFKA 2ZYRA 2GM5A 1RYEA 2VNSA 4G85A 2ABWA 4GE3A 4RYLA 4DT1B 2GEDA 3NIGB 1U8CB 5J23A 4IUYA 1Z4QA 3IKTA 3I4CA 1Z5VA 3LUFA 1J23A 1ZVVA 3VKGA 4FFOA 2ZTHA 3PVSA 5TV2A 3EVDA 2ZSIA 3KFVA 3OD1A 4RD1A 1UXKA 3OQJA 2ZROA 3PEUA 1AXRA 5E4TA 5LD2C 1OXVA 3WMEA 1SKMA 1GZ5A 4DRYA 4LVOA 3GJXC 1VJDA 3DMGA 4XWWA 2TECE 3GA7A 3PIRA 4OHVA 3QA3E 3AETA 5BMVB 2IIPA 1QF9A 5KVCA 2HK6A 1SY7A 2YW2A 3Q7TA 1M7GA 5AVTA 3DXYA 4M1EA 5CDFA 4Q03A 3LW8A 4YT4A 4OAOA 4BYMA 1CR2A 1N7IA 4G63A 3KWMA 1QFZA 1W4AA 1ZINA 4BB6A 4OBBA 4W5TA 4YV7A 2G1PA 4HN9A 3MRXA 5BVGA 4MMXB 5FT9A 3SF0A 3CNNA 1D03A 3BE4A 2C92A 2AD5A 4CV0A 5HDQA 2E4XA 5KTOA 2ZGVA 2VOJA 1ZMBA 4MUAA 4AM8A 4DV2B 1CS4C 2R7KA 2YV2A 5I5GA 3DOHA 3MD9A 1XZQA 4HEQA 1PT5A 2OO5A 1G7RA 4YP9A 4BWFB 2H4YA 4RF5A 2Z8ZA 4PF1A 3ORHA 2Z3VA 2G9NA 2AFIA 4AVYA 1LFAA 3T9BA 2K7FA 5KWVA 3AEUA 2NV0A 4MUHA 3JWEA 3OQ6A 4YMLA 4KB5A 2ZRDA 5BV7A 5E7IA 3WXMA 2VJMA 5AW8A 3KVOA 1P73A 1WSDA 3I6BA 1CUAA 4PQGA 3FE2A 1DRKA 1MP0A 2ZLBA 1UJNA 1BCSA 1UJBA 3WR5A 2RAUA 3OMWA 3G2PA 4TUYB 4NABA 4D79A 3BDIA 5DNWA 3W1VA 2JDIA 3ED5A 1MAHA 4I3HA 1GTSA 1GUBA 1U7WA 2H29A 4WK6A 1JEQB 4JFAA 4M36A 4MV4A 1FZTA 1Z5WA 2V59A 2PQMA 2EX0A 1B6SA 2W7TA 3CYFA 4GD3Q 1P18A 4MUGA 5DHFA 4Q4AB 1UKYA 4PSCA 4C5CA 2R9VA 4EZEA 2FWJA 4Q9NA 1BH6A 3KKNA 1R6AA 4G1EB 4RGBA 4LOHA 4RLFA 4XWOA 2D54A 2QB5A 1G8FA 1CDOA 3AZOA 1B1CA 4ALLA 3R7BA 3E3AA 3B1KA 4Z49A 1DIHA 5I4KA 3UV7A 3ZY2A 2ERXA 1QS0B 1S2NA 3GFTA 1ZI9A 2CHQA 3JW8A 1YB4A 4XWAA 2JBWA 2QXYA 1SUBA 4MZXA 1Z5NA 2IITA 2XNDA 1GAXA 2X22A 1XU9A 1MDBA 5D8DA 4EW3A 1IK4A 2JK0A 3OT1B 2WVHA 4ISBA 2QL9A 1UQTA 3SEFA 3UMFA 4H1UA 1PN3A 1EWVA 2MIIA 2HIAA 4XLZA 3WL5A 1A9XB 2N42A 3OT1A 3M4ZA 1F1JA 3CB2A 4XGIA 4DUZB 2F64A 5E8RA 1E1RA 3IEUA 1Y48E 2EW8A 4IHQA 1DMSA 3IILA 3T5MA 4OKIA 3F7MA 3PC8C 3NONA 2R8OA 4PZLA 4CM8A 1D4ZA 4NZNA 5EQTA 3ETCA 4BLUA 5CFZA 3FPKA 1KQOA 4NYJQ 4J3FA 2ZJAA 3KAQA 1MC8A 3JV7A 1F6DA 1Z08A 2FOXA 1IN4A 1BRTA 1T2UA 4ZV4A 4JI7B 1S9HA 2EBHX 4FP9A 3RM3A 2ZYSA 1I24A 4AO6A 4J2OA 3F7NA 3IULA 5FPSA 2R1VA 5JQWA 1C0IA 3IUBA 4IO0A 5F7JA 3W2FA 3D3NA 1EESA 1Q17A 5F9MA 4KREA 5ESRA 4MINA 4ILKA 1HE2A 4TZTA 2BJVA 3I53A 1RWPA 2ZANA 3AHIA 1QPGA 1C0LA 1BE8A 4D6PA 1TM4E 1TRKA 3F9IA 4TT8A 4TUYA 4BKQA 2RGEA 2R7NA 2VXBA 2XNSA 3NIWA 2SNIE 4KOAA 3PUZA 1JDZA 2CBGA 4WKBA 1SQ0A 2PZJA 4YRRA 5EC8A 2Z5GA 5LMCA 2DVMA 2NADA 3SDBA 3A28A 1IZ9A 3H8WA 2BEVA 4BKPA 4WACA 4PTYA 1N2HA 1L5FA 3Q7RA 3G5AA 2OBNA 4L6CA 1KY5A 4R8MA 5A7GA 3AL2A 2CLOB 3PT5A 2BT4A 2V7XA 3NHKA 1ZH8A 3R6LA 4WLVA 3GBSA 1M54A 4MHSA 1JXMA 3H9CA 1E1DA 5H3CA 3ODGA 5BW6B 4M88A 1T8PA 4XIJA 3T35A 1O5OA 4YUWA 5IJ0A 3TG8A 3I72A 2ZQZA 2GFQA 2JEYA 4TT3D 3WAKA 1OQAA 4YP0A 3TQHA 2Z2KA 1XZMA 4OFWA 4B76A 2FSVC 3CX8A 4O3MA 2BRUA 3RS3A 3VNQA 3SICE 4EQ6B 4YYZA 3ZUPA 1XLTC 2B37A 4D3YA 3V9AA 3VUEA 3A11A 2G1KA 4IDGA 5LDHA 1HLPA 3T7SA 4IQ4A 3FI9A 1I1QB 4ZRDA 1JAIA 4XOIA 2C5GA 2WKRA 2PWPA 3ZE0B 2FHPA 2YY7A 2HJWA 1RFLA 2IXBA 4MRPA 1J1UA 3DMTA 3NHBA 3EOBI 1UC5B 4HHEA 5BRNA 4AECA 3ZQUA 3CEAA 3FETA 2WBLC 3PX3A 4BE7B 3HDGA 1ZUNA 2VTKA 4HBGA 3THXB 1VI2A 1NJ6A 3OBIA 4TS4A 4PN7A 4QDXA 4F96A 4M1SA 3C74A 3HBLA 5E2AA 5TPWA 3HI6A 3C0KA 1M1YE 2W2PA 1VA5A 4B3XA 3K15A 3FOAA 4UFOA 3RKSA 1BHO1 4Q24A 4L4XA 3EWAA 1Q91A 4O2BA 2WTBA 3PFNA 5FWAA 5AUOB 2DX7A 1DE0A 3C7AA 3HB1A 5JJIA 1HC7A 1YBMA 5DNAA 2YL2A 4UPEA 2YZ2A 2CBXA 3G0CA 4WFIA 1FPMA 2YIVX 5YASA 4F5EA 4DLLA 1W59A 4US1R 3VR1A 1A8SA 1CS0A 1ZGGA 3QXSA 5H16A 2EC5A 2ZULA 3X3HA 3L18A 5HHTA 1ZISA 4JX8A 4KXQA 2PLRA 4O6VA 2GF9A 1CG6A 1Q1EA 3EEIA 3GZTB 3AQIA 1S3SA 2HK9A 3EOZA 3PKJA 3RWBA 1PQYA 4EIWA 2DKOA 4NKRA 1UDWA 1HM5A 3T9FA 5A7FA 2G1UA 2YJZA 4RFLA 1FNBA 2R87A 4UTXA 5I48A 3OC0A 3MCAA 1Q19A 2LW7A 2YQ4A 3HSKA 1P1CA 3EZNA 4WXHA 1VDZA 4BJ6A 5GIOE 2KWIA 2V8BA 4FFMA 4YDSA 2NU8B 1J25A 2EW1A 5CW1A 4ZHQB 4Q1BA 2RB4A 1O0BA 5TF4A 3FCEA 4B5KA 3DMFA 3GZJA 1P7WA 3OTHA 1GAWA 4CF5A 4U4AA 4AJ2A 1V8PA 4R9RA 1KAOA 2G07A 3KJXA 1UQUA 3RUFA 4P92A 1M2OB 4KYVA 2CNDA 4RUKA 3EYAA 5DHAA 5C4MA 5TQ2A 4A0GA 3HU2A 4ZO4A 4WPGA 3S4YA 1RXVA 1T3LA 2YJ4A 3RS0A 3WDLA 4MARA 1OYYA 2G9ZA 1GPDG 3W2GA 1JPUA 2BI4A 4PZDA 5FPKA 3JQGB 1CULC 1ADYA 1S8NA 2HC9A 3ZHXA 5IUNC 1OAOA 2XOKA 1YUMA 3GRPA 3E35A 2IYZA 2IHZA 2VP3A 3OG9A 1N6NA 3WLMA 4FMDB 5B12A 2RI6A 3EXHC 4ZC1A 3ZCRA 3CNHA 1RAGA 5EGSA 2VP9A 1DV1A 3NRBA 4YY3B 1B8UA 1KZ4A 3HHPA 1JTEA 3RBAA 2OEPA 1SHKA 3NTXA 1K86A 3DBHB 3AH8A 1F8XA 5HBRA 2X3YA 3B1JA 3P71T 9MHTA 5LBUA 2PY6A 1B2LA 3VGPA 4MAFA 4BN0A 5GP1A 4XQEA 1VHQA 3SHWA 1PF7E 2GXQA 1UJ5A 2C4TA 3ZWXA 1JNXX 1O8BA 2H5LA 4MGKR 1A2BA 3PQ5A 2AG5A 2M6SA 2JJMA 5FI1B 5AKZA 1UC9A 3T99A 3ZK9A 2DB3A 3PXEA 2ZRKA 3HO1A 4X6YA 2B0CA 3IAHA 1VLMA 5D5PA 2AC7A 3GVPA 1SULA 4JYBA 3HDYA 4IQGA 3FSJX 5HE8A 2GPBA 1NP7A 3E84A 1R0CA 5FTMA 4BUJA 1URPA 3TL6A 2ORIA 1ISFA 2RGBA 5HKLA 3CPEA 5JNVA 3TECE 3F6CA 2OXCA 2H63A 1UP4A 2XDYA 3HDHA 3RQIA 3L6DA 2QZPA 4NCAA 4BNWA 4JUAA 2WF6A 2HK7A 3HYLA 4DVJA 1XNJA 1Z34A 2GFIA 1XXHA 3H9JA 4KPUB 3RO7A 3VZQA 2BM8A 3MMXA 2NUPB 2O3UA 1RCTE 5KHOC 4UXIA 2AC2A 1OZAA 2IXFA 1WO8A 2Z0MA 3C6XA 3PENA 1JDVA 4V0SA 1K3FA 3UJAA 1QDEA 3TFQA 4BNXA 4MB6A 4Y6QA 5B37A 2QN7A 1KC3A 2GA8A 3ZW7A 4OLAA 1XZKA 2I1WA 2PVPA 1JHDA 1GPMA 5JNRA 3DO6A 4QQRA 2GM4A 3CO5A 2HX1A 3AY6A 4G84A 1IQPA 2ZSKA 5JTTA 1NP3A 3F6YA 4NATA 2O2DA 1BWPA 3Q2KA 2HNAA 1YQWA 3CIOA 4GI2A 4QTZA 3HJUA 1L8LA 1WSBA 4YQFA 4PGFA 4QJIA 2XECA 4RK4A 4CIBA 1C1XB 2NSDA 3F2IA 4EKYA 4L74A 1KI7A 1W47A 3TLZA 3RARA 1T6NA 2H52A 2VTDA 1QKKA 2WWFA 3MT9A 4QODA 4JBYA 4PSVA 3GEEA 4PG5A 2QJWA 3G17A 1TAHA 5B6JA 3WKEA 3IBTA 4DA8A 1NPTO 4CV2A 2G8LA 1DKRA 1L5KA 2XZTA 3SHTA 3R3WA 5I7UA 2ZCJA 2CLCX 1B8OA 2AHOA 4F4FA 3I9NA 2D0DA 3I73A 3KSRA 3RVLA 5DIZA 1EWQA 4UQLA 3JY6A 5HUJA 1JEJA 4UNQA 5CEJA 1DI0A 5EL0A 5JO0A 1P4GA 2DHQA 2O8EB 2VQDA 3I9OA 4EZIA 1V37A 3W5DA 3M1YA 1T13A 3IUPA 4LAFA 3PV0A 5KQPA 4UTPA 3FKSA 5LU9A 4OHWA 3FVVA 4AC9A 4BBZA 4QNRA 1U9JA 4BATA 3K1AB 3SHQA 5HOQA 4Z7QB 3IX7A 2PUDA 1I01A 3K0CC 1SUEA 3D4OA 3B78A 1C80A 5MDHA 1TTHA 5A2QA 5JIBA 1WW3A 3FWPA 4EK9A 4RK0A 2XEDA 3ONVA 3PNYA 3DZJA 2QLLA 1NMEA 4KGXA 5SYMA 4X1OA 5HZMA 5IMSA 3IIEA 2QRKA 1PCXA 1S96A 1PZEA 2IZ5A 4C03A 4TSRA 4FBLA 4R98A 4WZAB 2FPIB 4C2TA 1ZK2A 4S2UA 3GFQA 1YS7A 3MN1A 2XZLA 1U3CA 3C8MA 2VAPA 3MAGA 1R9NA 5D86A 1NOIA 3INGA 2VHWA 4MW4A 2Q4EA 2FMHA 3CLUD 2JI9A 3LWBA 3AVOA 1F4LA 3EF0A 4JVSB 4X44A 3UTCA 1P17A 4KAFA 3R3SA 1ABEA 2VBCA 3DAOA 4X6UA 5JY1A 2NZXA 4WZBE 5CH3A 1I9CA 4LN1A 1IDN1 1Z5ZA 2QK4A 1I3NA 1QC5A 2VN8A 2GK3A 4MWBA 5BT8A 4LWOA 3RK0A 1H3FA 5KWSA 2FF7A 3GJQA 5KOIA 2WSBA 3RHFA 3KDSE 3AVTA 5EKSA 3MJHA 3N3AC 1FVOA 4EJ0A 2QTGA 1G5PA 3SAJA 3ZV6A 4AU1A 1BMDA 2PX4A 3HUFA 4FE4A 4W5QA 1D9ZA 3SZRA 2MJLA 2QRPA 3ZCSA 3WL8A 1K2VN 2O20A 4S1TA 1CEYA 3VPHA 5LM3A 4MQ5A 4MVJE 1SIOA 5G0UA 3KTAB 1UDXA 5LYJA 3TRKA 4QYIA 3GLFA 4CMJA 2JGNA 2C4KA 1W9HA 3NXSA 4UDYX 1F8FA 3MJRA 1GGKA 1FDIA 1K0FA 2O52A 1XTBA 3M0EA 4IW3B 4OATA 4ND1A 1N2OA 2R60A 1XNQB 2GILA 2X1MA 1QJ4A 2VDLB 1S1CA 4IIHA 4OOFA 1PEDA 3DTTA 2DWCA 2HA4A 3P8ZA 4WKGA 5LP6F 4YJ2B 1LS1A 5JJ5A 4GPIB 4E6EA 2I9KA 3H4IA 2DKFA 3FTPA 4RO0A 3ZZNA 1FVHA 3K9LA 3F9RA 5TE9A 1GPH1 4CM3A 2R62A 3GAFA 2JGDB 3OQNA 1PWZA 2DLNA 2G88A 3BH0A 4LXYA 5FBHA 1X7ZA 2QGZA 2VJPA 1MAVA 2ZJ2A 2CK3A 4RKRA 4WNYA 4GMDA 1KPGA 1N5LA 3TIGA 3G13A 4UEOA 1M6VA 1N7HA 1C5KA 4GEGA 5K0JA 3U60B 3IT3A 5FL3A 3DMHA 1ORDA 3E5RA 2YZNA 4G4JA 3E58A 4JQOA 1HLDA 4ALIA 4Y7DA 2H1OA 1JEYB 3K6KA 3ICVA 3QU9A 1WSAA 3ABOB 3FUTA 4L27A 5CJ2A 5A9SB 1YVDA 3U81A 4R05A 1PSZA 2GGSA 2IP1A 5CLFA 1FFXA 2AMYA 3B48A 3NC1C 4UBKA 5LZ7A 4EATA 2V0GA 4AKTA 3KUXA 1RQRA 1S6YA 4RL4A 4KYUA 1PP4A 3C15C 4TMKA 1I32A 5EYPA 3TRFA 1OT5A 3UXMA 4WXMA 1FA9A 4Q9AA 1SJ9A 1N6PA 2M1ZA 2CF6A 4P35A 4ONEA 3HVIA 4JEIA 1T2CA 3IEKA 3OZTA 4XIIA 1VL6A 1MZVA 1N2CA 5EQFA 5FBKA 4FFPA 3LV8A 4M0LA 1GTMA 2PHZA 1BJRE 1QH1B 4MS1A 3G1WA 2XUPA 3LTEA 2BHRA 1SXHA 2IPAB 3WJAA 2WC1A 3OX4A 3QY9A 4O4JB 4O4IB 4W7HA 3VC3A 3VR2D 3D8RA 4QQKA 5JDIA 3AONB 4GRDA 4RSMA 3QYJA 5IKPA 3N87A 1J8YF 3BMQB 3QBTA 1ZKMA 2AK2A 4KX5A 4TMWA 1N32B 4BV8A 5LQAA 4LRTB 3L1KA 2DEUA 3QKSB 1YB5A 1T36A 1N5JA 3PGMA 1BE1A 4G9BA 4H7IA 3JR7A 1QGYA 4HR7A 2C9DA 2UYGA 2PMDA 2DBRA 3ODPA 3DMRA 3IVRA 3SC2A 1KAMA 1KWGA 5T41A 1KYTA 4A3SA 3LCMA 2EGGA 5HVNA 2YINC 5CBPA 3U44B 1H8HD 3AESB 4K9DA 1T8UA 3C5EA 1W52X 4TLLB 3ZH2A 3IHLA 4WNAA 2REQB 3HKBB 1FYWA 3JQ6A 4MCHA 4MPPA 1M1ZA 4RY9A 3IDFA 3QKUA 2D8MA 1Q0LA 3WKDA 4GZ3A 1CWUA 4D57A 4H6PA 3H5LA 4JP5A 5ED4A 2H51A 1E9AA 1YKFA 2KW5A 3QBEA 4UE3S 5E2IA 2JARA 3HU3A 3SWWA 2PANA 1DTEA 3TRIA 5JS1A 1WJGA 4ZU3A 5TDHA 3GHHA 4EPRA 2UAGA 5HF6A 4E5YA 2SCUA 4NAHA 1PVDA 3EQ6A 3IJ5A 1LSUA 4FFDA 3O8QB 5L95A 2VS1A 3GJSA 4MRRA 4RVCA 5AM3A 4R4JA 3NMUF 2AX4A 3FF1A 3WJ2A 4F1JA 3NP9A 3P7MA 1MN6A 4NYMR 5B5SA 4I6EA 1L1EA 1C9EA 3O94A 5KUTA 1H2ZA 4Q1AA 5TLSA 1RPAA 3E27A 2WUDA 3JVUA 3NTRA 3DQQA 4L4YA 3V4VB 4EI2A 2BFFA 1IY8A 2A5DA 2IEIA 4WDRA 3P0FA 5F76A 4BEVA 4TKZA 3L1VA 5G41A 1B0PA 4UAJA 1NNEA 2BKAA 5DYWA 1EUYA 1JH9A 2V5UA 4D80A 5LWHA 1G20B 3NQ41 4D3XA 1KEKA 2DWPA 1O3YA 4BMYA 1PJAA 1N0VC 1VCNA 1XF1A 3GLIB 3P19A 2C4WA 1LC0A 4D9EA 1Z2EA 4OI2A 4JHLA 5KC9A 3Q98A 4EMUA 4RHTA 4LZZA 1KI8A 5BV0A 4DLBA 2P41A 2VSOA 5AKLA 1T29A 4UARA 2OFFA 3CSDA 1YRAA 4QJ4A 3RU9A 5BQ3A 4EW6A 3GJ6A 1G0NA 2NU6A 2O5VA 3TTXA 4TXHA 2ACVA 4PR0A 5EHXA 5I9MA 3BWBA 2COKA 3A04A 3GAZA 1OB2A 1O97D 3CNOA 4GX2A 2ZBUA 1UM9B 3FROA 4HPJB 4N7JA 4BFZA 1N9GB 2ZVJA 4PV7A 1YO6A 4XDZA 6REQA 3ZWBA 4NXMB 4DCPA 4GSKA 1DKQA 2AFVA 2AZDA 2EJVA 2H07A 2J46A 5TNXA 4JBLA 1YRHA 2QD1A 4RTOA 2DQSA 1YBVA 3QLEA 4OQNA 4IHJA 4R8LA 1UFQA 3E8XA 3R7AA 2IY7A 3BWYA 1A69A 2YJGA 1R3UA 3AIOA 5ICEA 1J24A 1AS2A 4UVDA 3DHWC 3HC7A 1UK8A 2BONA 3RUAA 3PGKA 2JFQA 1Y4ZA 2ZJ1A 5EIAA 3FD8A 3MUEA 2ZR7A 5EWLA 3TPZA 1NI3A 1VYVA 1E4YA 2WU0A 3RSZA 3NGLA 3UYLA 2MSNA 3WOHA 2IOQA 1FZQA 4J1SA 2XUOA 3N8HA 4H1HA 1WETA 3HKEB 3U56A 3I8XA 3OQHA 1G64A 2Q50A 1JSXA 4NCBA 1I4DD 1IOLA 4N49A 2X1LA 1FQKA 2BVNA 2RH5A 3FOBA 4N5HX 3DEJA 3VI3B 4G0PA 3NDBB 3FPCA 4KNWA 2P4UA 1HL7A 1A96A 3E7WA 1BRMA 4R2JA 4TTTS 1C7FA 4IGAA 3WP1B 4M4SA 4IEFB 1PJRA 2X0IA 4A16A 1DQPA 1HE1C 1P4AA 2GZRA 1ZITA 3RK4A 3FDZA 1Q44A 2AG0A 2VPTA 2J3DA 3HDVA 4XWYA 1SBCA 1T8SA 4KACA 1VCIA 2NO7A 3NIBA 1FFCA 4FFWA 5CURA 3SKXA 4ND7A 3TQTA 4RVOA 4NDAA 3RIGA 2J7PD 4Q4JA 3LY8A 5AO9A 4NNOA 3A6LA 5HNKA 2C7QA 4YMWA 3AJDA 1BCRB 1N34B 3TLAA 3AI1A 3ENWA 4GI7A 4ETNA 4YT8A 3O2SB 3SQWA 1TM1E 4K8RB 1ADJA 1OXMA 1Y8RA 3REGA 5BY2A 3ICEA 1KF0A 3UUWA 1OIXA 3L05A 1QE5A 2WTMA 2Q1TA 3BXPA 3HQ4O 5ESWA 3MWLA 2Q4OA 4XPZA 2C77A 2QJOA 3SX2A 1W8IA 1NXQA 4QUKA 4XQ9A 2PV0A 3DYIA 1UK9A 1C3OB 3JD3A 4ZANA 2DFTA 2QD2A 3H0CA 1RPJA 3MGCA 1HDEA 2VXCA 2XMRA 3HBNA 1XYVA 1CJCA 4FGJA 1HUQA 4RD2A 4LF4B 3A6KA 2Q3LA 2Q7DA 2QUJA 5CFLA 1JFTA 2PPVA 3QBVA 4DTCA 3OCVA 1Z68A 1H3NA 5IDYA 4Z7NB 3DFKA 5F3RA 2FX3A 4TV8A 3TOCA 3WBKA 4DIOA 2FXVA 1ZUIA 1AK2A 4TPKA 5AM4A 3ZYZA 4Q1VA 5A4FS 1G6KA 4RACA 3A9TA 1GYRA 4PIMA 4V0LA 2I8LA 4XYMA 1ZIXA 4UHDA 4XGQA 4C0LA 2HBYA 3FPFA 1XN4A 4QQ8A 3SZMA 3KJNA 2O3TA 3TNYA 3UK7A 2IDMA 2NO1A 2QSJA 1XDBA 3GXOA 3TW4A 3EVGA 3VO1A 3PGVA 1AV6A 4GMGA 2A3NA 2X7HA 2D1TA 1BU8A 2JNWA 1VLLA 3K9BA 4YC7A 4XVUA 1EAMA 1LA2A 1E7RA 3WFIA 2VUUA 2AOUB 3AF3A 4A7PA 3VR5D 1PLLA 4AXBA 1QF6A 3GWGA 1Y3CE 2G7MC 4E5DA 1HSZA 3HWSA 3L7JA 3WY9A 2KBFA 3JQ8B 4PC6A 2XNKA 1XVUA 4BYGA 2XKKA 4BEJA 4INPA 3W4JA 1YQGA 3HR8A 1SCNE 2GO1A 4EQ6A 4KE8A 1WY5A 2HQRA 2JEOA 1TCAA 3WL6A 3LH5A 1DKLA 3GLTA 4TKVA 5G4KB 1YK1A 1C7EA 4RJ2A 3P2IA 2XWBF 1ZG3A 1B6TA 4EEKA 3FUCA 3IO5A 3LDAA 1KI9A 1V1MB 2BFNA 1U8XX 3G0GA 4OQQA 3S2UA 4ARSA 4X1KA 5IHPA 4R9SA 3CZ9A 4OL0A 3TKYA 1V1RB 3FGNA 2G76A 2ZBPA 1N9KA 3LHKA 4XFJA 3RVRA 1ST2A 3R3ZA 1JHPA 4MCAA 4BP3A 3EAQA 3IAUA 1PEAA 1L3IA 3E5NA 4UC0A 1JMYA 3QWHA 3K5HA 1JECA 1U3GA 1R74A 1XP5A 3K0EA 5I7EA 5A0TA 1EGAA 1NOJA 1PG2A 3EB9A 1JP7A 1XVVA 4BZWA 4D3SA 3GP5A 3OX3A 5JJBA 4N6NA 2VBGA 3QVKA 2D2XA 1VPWA 2P9GA 5ALGA 3CNBA 2ACKA 2Q3CA 3LL4A 3ZCUA 4PLFA 3RIEA 2HZ7A 3GDOA 5F2EA 3U3OA 4DC0A 2YOGA 4LYYA 2EFHB 4AY6A 2AYZA 2FRDA 1JT9A 4M89A 1A88A 1UZAA 4K7JA 4WOPA 2C2WA 1XQ9A 5FNZA 3W9UA 4MRNA 2O59A 3AF6A 5B4UA 4KCGA 1C30B 5EFOA 4NC9A 3S40A 3QX3A 3EEFA 1TUBA 2K7ZA 2ZSBA 1YL7A 4LBVA 3UO8B 1FP6A 3KKLA 3A1CA 2RGNC 4LJ4A 1GDDA 2EBUA 3AF4A 2WJVA 3K8OE 5HFNA 1P3DA 3WGJA 3GLQA 4YV2A 3UK6A 2HW8A 1XJ0A 2VPYA 5FPTA 4LHXA 1KE1A 4N3CA 3ETNA 2PDAA 4DSTA 2JLZA 4RETA 1NI4A 5CTJA 5AR1A 3RSFA 1II8A 1SPXA 2QN9A 3ASYA 1XRRA 4FYHA 3I9V1 4ZYVA 5KQGA 4PC7A 3TMYA 3WO0A 4YCSA 1RPNA 4FDVA 5IYZB 5IS2A 2WHPB 3NOQA 5GMOA 3GGCA 4IDQA 2H16A 3E2PA 3Q7SA 4NZ9A 1OFTA 1XVLA 1H1TA 1S2MA 3OFND 5B53A 1KKUA 1NJ1A 4FX5A 4OTZA 2VC2B 4PO3X 4EVRA 1AK9A 2GBFA 5IZCC 2R47A 2O8CA 3QGMA 4IMPA 5KTKA 1WXWA 3AVXA 1IN8A 4QDKA 1SQ6A 1T1RA 3HKDB 2PJDA 3R77A 4MLCA 2P6NA 4RHFA 1NZFA 2B1RA 5DBOA 2CLDX 4TGLA 4H7PA 2VF8A 4RA6A 5ECGC 4DR2B 4K9PA 4ZAXA 3UWKA 4ND8B 1E6KA 4NWIA 3PQ2A 2M6LA 1ZXLA 1F2UB 1SC9A 3WIUA 3W8RA 1FQOA 5I8WA 4IIVA 1R4NA 4Q5IA 4CQMB 4EFKA 4HS9A 3CS3A 4ZT4A 3FSGA 5A3JA 2PKXA 3HCPA 3N2NA 3UT5A 1NTOA 1T5OA 4NBLA 3GUHA 1IBLB 2OBYA 4J7UA 3OH8A 4MO9A 1M8GA 4HBZA 3ZZ1A 3PI7A 4ASUD 4JNKA 1NF3A 2I7TA 1DAGA 1RMYA 3Q40A 2UXCB 2JGMA 4FEAA 4TSFA 4G8BA 4CCYA 2WYHA 2PAFA 1PJ4A 2SBTA 1ITZA 1T5HX 1ZVJA 4IVRA 3EZYA 2RGGA 4LQ4A 4NK5A 4Q4HA 9GPBA 3KKOA 4KXYA 5CB4F 3A1UA 1GQYA 4FHEA 5JAZA 3D6AA 1SKQA 2AG1A 4C76A 5GM1A 1P5ZB 1X7HA 3AXSA 1TKBA 4JDPA 5AI9A 4COKA 2IYNA 3IQDB 2O2YA 4PWZA 4LZOA 1Q57A 4DGSA 4TL7A 4W5WA 3RYHA 1II8B 4XYGA 1Z45A 4H35A 4KQXA 3DFFA 3VAAA 3NW9A 1QZUA 2XRZA 3RANA 4RA9B 1D2RA 2VP6A 5M7EA 4DL9A 4AG6A 3MMPA 3P32A 1CY0A 4G5OA 2ZETA 1T3GA 1XAGA 1W1WA 4Q37A 2AG6A 4NYJR 2PXCA 3BDVA 3JQDA 2QF7A 4DWVA 1ZI8A 1S8OA 5I4CA 5L4LA 2NZVG 5EERA 4BDSA 4WESB 1EIZA 3O4JA 1FDOA 4LKOA 1KKLA 3D3JA 3K09C 3B60A 3V8PA 1EHYA 4ZTBA 6Q21A 1MB3A 5AHOA 2FPSA 1QQ6A 1Z0JA 2OBLA 2H48A 4B8YA 4A91A 1MJGM 1QO0A 2IPMA 3G2LA 3X0DA 1AH2A 3JQ7B 3IT1A 1FYVA 3TZLA 4I1VA 1OAOC 3RSSA 2AX3A 6AT1A 5JS6A 1R50A 4PXYA 2G25A 2CCGA 5CEEA 4F4CA 4DF3A 1LPAB 2B35A 3KQTA 1DBQA 4IBOA 1HQYE 3ZLTA 5ES4B 3FHJA 4DPLA 2P1ZA 2OCLA 4WY2A 1WRBA 3HYCA 1E2QA 5DHSA 5T7BA 4EKDA 3NC0C 5CM9C 1YR3A 1RXIA 1S8FA 1NF9A 2WYUA 4OKSA 3ZU6A 4M53A 4FSXA 3WNDA 1THZA 3FFTA 3CSUA 5EI5A 3VYRB 5AW3A 2QHXA 3FNHA 5EJ2A 1DAFA 1PBTA 2BZ0A 2ORED 5H7XA 2HJRA 1H65A 5EY5B 5FWXB 4Z3KA 1MFPA 1SBZA 3O8NA 4B3FX 3DL7A 4A1FA 3KSMA 3SLGA 2J9FB 5GVRA 5IYZF 4BU0A 3PTLA 4GHWA 4CIXA 4D26A 3KT0A 4IY1A 3TLXA 5JD5A 5KJ1A 4UPDA 1FMJA 1MIOA 2PKYX 3GJRA 3UQYS 1U0OC 1JFFB 1MPXA 5K6RA 2A0WA 3W1EA 2OCPA 1JPJA 1Y8QA 5ALIA 4EARA 5KSOA 1TKCA 1E3QA 3VUFA 2ZB2A 3H9GA 2PCJA 3DO8A 3HY6A 3KD2A 1AKYA 4RPHA 3TNFA 5I5EA 3EYWA 3LVFO 4EYQA 1A5AB 3BSWA 5FTLA 5I4BA 2GJ4A 1YKSA 3IIMA 3PR1A 3OFKA 3PFKA 4RD4A 2OOKA 5JD3A 1RHMA 3W34A 1NNI1 4Z1OA 1QP0A 2O0HA 5C46F 4EEZA 4HRVA 2C5SA 3EVZA 4GOMD 4HPXB 4YJDA 1TAUA 1YR7A 3RRXA 1QORA 1U8FO 3AI3A 4GZ5A 1WS6A 1VJCA 3IPLA 2PUTA 4GU5A 2C9CA 4I9FA 1KDZA 4XR9A 3O93A 2GPJA 4CIDA 4CMEA 1OI2A 1H0KA 1S7GA 5A0FA 1FL9A 4O02B 5CXXA 2W6IA 1WKVA 1X94A 4H7HA 1LTQA 3IPYA 1Z7WA 4NZYA 3L0PA 1EAYA 2GVDC 2H4XA 2HRZA 4A8HA 1DKMA 3I3OA 2BTOA 5BNFA 3QPBA 2O19A 3CVOA 2ISSD 5JNUA 2R1TA 1O96B 1JX6A 2C7GA 2WE7A 5FIUA 4B9EA 1RRGA 2XBUA 4KUHA 4NF2A 3ZJ4A 5BR8B 4OXQA 2JZCA 3G0HA 2OD7A 2YBEA 3JASA 4GWKA 1L7QA 3T7EA 4AY5A<