2IF0A

Crystal structure of mouse rab27b bound to gdp in monoclinic space group
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
184
structure length
174
Chain Sequence
YDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDAFKVHLQLWDTAGLERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-related protein Rab-27B
publication title Structure of the small GTPase Rab27b shows an unexpected swapped dimer
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 174
sequence length 184
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2if0A00
4BLOA 3KFVA 3A36A 1F48A 4DEYA 4C4PA 4K8OA 5LD2C 2OCPA 3ZVMA 3I72A 3IIMA 4CRWB 1U94A 2WOOA 2Z5FA 1BH2A 3A4LA 4NCJA 2PT5A 4AK9A 3O8CA 5HZKA 1GNRA 1ZM9A 2PMKA 4KVAA 5JWHA 3BH0A 4M1YA 1E1RA 2G1KA 1EG7A 2C95A 3ZGXA 2IYYA 5FPYA 5IHPA 4WOPA 2YOHA 1WCV1 1OHHD 4DT1B 2O52A 1VYVA 2WKRA 2FF7A 3KJIA 4FMDB 1FMLA 1OXXK 1BMFA 1RRPA 1W0KD 5UKDA 1S2MA 5G40A 1SXJA 4Q7KA 1P9WA 2J46A 4C9BA 3VAAA 1MR3F 3K0CC 1ZW6A 2GILA 2V6JA 1TAGA 1AK2A 1DADA 2CXXA 1AS0A 1W7AA 2V1UA 4PANA 3GLHE 3EAQA 4KHZA 1R7RA 4JL5A 1G7CA 2OUKA 3B8HA 5LBIA 1CR1A 3M4YA 3KXKA 1E2NA 1OKKA 1E0AA 1QBKC 1YR8A 5DHAA 1N6OA 3ASYA 1T5LA 2FMXA 5JJIA 2Q3MA 2A5DA 3AUXA 2QP9X 1RIFA 2ZITA 2NGRA 2W58A 3QXSA 1EFRA 1QZXA 3IGFA 3LV8A 2NIPA 4ZDJA 2D62A 4B76A 1C9KA 4R7ZA 4JS0A 4HUQB 2BBSA 1Q20A 1KSGA 1VCNA 5KTYA 4FWTA 1QHHA 2PL3A 5DN6D 2DFNA 2OZEA 3Q72A 4G0NA 4CZ2A 3ZYCA 4PPGA 1GOTA 4S2EA 1G291 4IXNA 1O87A 3CPJB 1SVMA 1N25A 1E9AA 1RPZA 3W6OA 3O8DA 1FX0B 1XXHE 3OIYA 1KNQA 4KO8A 3SOPA 2WWYA 4BRUA 3EC2A 4POAA 3BH6A 4GNKA 4FWIB 3U2QA 1TU4A 2VP4A 3EA5A 3B1YA 1KTVA 1ANKA 1P6XA 1XEFA 1FTNA 4PO1A 4F4JA 2RMKA 1XCGB 4YMSA 2VQSA 2BEJA 1P9RA 2O8EA 3T5DA 4Q4JB 5EP1A 4EQ6A 1OXVA 1OPXA 1W5SA 2W6JD 2YV5A 1E32A 4B2IA 2QQ0A 2YNMA 5HCNA 2OO7A 2ZRBA 4XSHA 1KK0A 3GJ6A 2OILA 5L3QB 4Z8YA 5KNBA 4IW3B 4A82A 1ZYUA 4DIEA 2FE4A 1ZUHA 5FUYA 4PO8A 2OSBA 2FX3A 2B6HA 2WWGA 4XOIA 4ZDIA 3LDAA 4QGAA 5CLLA 3PXGA 2JIZD 4ZKDA 3WP1B 2RGNA 3CRW1 3Q7PA 3LW8A 1MO3A 3EWAA 4TZ6A 4PSKA 1EFHA 2YC4C 3E2IA 5JRZA 4RFSA 3W90A 2QP3A 4KLNA 3ZZTA 3X1DA 1JNYA 1OFHA 2ZRKA 3U44B 2BC9A 2MMGA 3OEHA 1F2TB 2FV8A 2WKQA 2ZR0A 3GLHA 3KKOA 4TYQA 1TPZA 5BYKA 5IK2A 4MRVA 1FFHA 3EZ2A 1Z6GA 4TL9A 3WHKA 4UNNA 2I1QA 2GDJA 4GFDA 5JSZA 2QAJA 1TF7A 2IWRA 2QENA 2IBMA 3CF6R 4CEJB 4CEHB 3FKSD 1P4SA 3U4QB 2WICA 1H8EA 3AF3A 3IIJA 5EP2A 4QRHA 1E2KA 3BH7A 4OQXA 1W49A 2FPKA 4XJXA 3U61B 2VP6A 1UBCA 5KSZA 3A4NA 5BN3A 5TVKA 4OI0A 5A4JA 2X77A 4C3ZA 4DLZA 3QG5A 4D0GA 2CJWA 3CIOA 3K0CA 4A8JC 4BFVA 4TYYA 3VFDA 3AKEA 2OHFA 1XTSA 4AD8A 3DL0A 3QJYA 4FW9A 4AG5A 3KTAB 2WMNB 4MYTA 1IOZA 5FBQB 3BGWA 3EXAA 3GEHA 3JVUA 1WQ1R 4LV6A 5DNYB 1HYQA 3SEAA 3KJEA 4JSYA 5CYPA 1XXHA 3Q85A 1Z6AA 4JYBA 4RD1A 5DSZA 1BKDR 4B35A 1ZD1A 4DCNA 2QMHA 3QKSB 5J40A 3NH9A 4JLOA 2EFHB 3L43A 1G3MA 2GCNA 1W36C 2J5XA 4E22A 5IF9A 1I4TD 1DOAA 1ELOA 2J45A 4GL2A 2I3BA 2NTYC 2QPAA 2ZE8A 5JLJA 1KYIA 1OFUX 2V1XA 4JVMA 3FHTA 1GRQA 4URXR 2Q9BA 4TLBA 3U6KA 1OJLA 2J0UA 1SVSA 4II7A 4PQFA 2OBNA 5EE0A 2L0XA 3WY9A 4EIWA 1MO6A 1CR0A 1II8A 2WJYA 4ARZB 3H86A 4D0NA 3QF7A 4MKHA 2RHDA 2Q9AA 2QMOA 1LS1A 3TR0A 2C98A 4I1SA 4HI0E 5CJ2A 2QTVB 1FUUA 5EE1A 2AX4A 1U9IC 2V7QD 2DFTA 3DM5A 3THWB 3GFPA 1I2DA 1HT1E 1M1YE 3CX7A 4DLXA 4KYIB 4DSTA 2W2XA 2JLZA 4W5WA 2W6ID 1N5JA 1SXJD 1G21E 4NYIR 4UNPA 2WSMA 5LDDC 4HAXA 1YVDA 2B21A 1TX4B 1OH8A 2YVUA 4OK3A 4YMVA 1JXMA 1DG3A 3KQNA 3G5UA 1SVLA 4QBGB 1JR3D 5ELXA 1BYIA 1E3MA 2HJGA 1ZU4A 2RH5A 1GL7A 2WWXA 1HE8B 3CONA 4TMXA 4AY2A 4GZLA 3U60B 1G8GA 4BFUA 2GJSA 1KO7A 2AD1A 4MYHA 2PZEA 2P6UA 1E6CA 3LD9A 1SKQA 1OKKD 3U7GA 1N6IA 5L3VA 4QNMA 2YINC 1Z5ZA 4NYJR 3AF2A 1J70A 1E2QA 1XRJA 1G6HA 2H8KA 3REGA 4OKSA 2GVDC 1G1MA 3OESA 5FUWA 3CH4B 1HQCA 2F1HA 3GLGB 4IFEA 4X8MA 1U0JA 2GJ8A 3EIHA 2J1LA 1KMHA 1S3GA 2DWPA 4RCYA 1KSFX 1OE0A 4ZPXA 1OH6A 3R8FA 1E0SA 3R9WA 1R0ZA 1Q44A 4ACAA 2CHGA 3IDQA 2JDIA 4Q66C 1E2IA 2GXQA 4U7DA 1NIPA 1Z07A 1IAQA 3SU8A 2FNAA 2QRZA 2Z43A 3B9QA 1E9RA 3D7MA 4YMTA 5CM8B 1WP9A 4Q4HA 4A0RA 4BE7B 5HZHA 2QI9C 4NH0A 1Z6YA 4QHYA 3T1TA 3TGPA 3SS8A 1GDDA 1KZGB 1N0WA 4DLTA 5JRJA 5IRCD 4TYNA 2W00A 1AQUA 1KAOA 3CZQA 3THOA 1NVUQ 1Z6XA 4BQSA 3REFA 2GHIA 1Q3TA 5D3MA 4B6FA 4DCSA 5G53C 4WBSA 1KSJA 3HU1A 4US0R 1NMXA 2PCJA 1Z28A 4M21A 1E2HA 3SYNA 2IYTA 4A8JA 2CVHA 3E1SA 4JBYA 4RD4A 5TDHA 4A92A 4LWZA 1V5WA 3MD0A 1P73A 2WJGA 5KUTA 2C8VA 3GJ5A 2RKOA 3RWMB 3C16C 4BLTA 2GXSA 1M7GA 1GAJA 2F3RA 3IILA 2ZJ8A 3LAWA 4NZYA 5BW8A 8OHMA 1I4LD 2B7CA 2DYKA 1E1QA 1S9DA 5FR1A 4Q9HA 1TUEA 3CUEF 1CU1A 2JLVA 2ATXA 3D3QA 1T6NA 2OT3B 1MOZA 4F91B 3I3SR 3NKVA 3ZQJA 2J7PD 4ZO4A 1ZC4A 1VG1A 1FUKA 1HT2E 5LPNA 4QHTA 3RSLA 1ZM3A 2WSSA 5HPYB 3RDPA 2DCUA 1NG1A 1U90A 2RGEA 2QG6A 4PSVA 4TN1A 1V43A 2QBYA 4K81B 4RFVA 4QJ5A 4EUNA 4NDZA 3QENA 4JKYA 4ZKEA 4BRWA 3BWDD 2N1BA 2C5LA 3PUWA 1LF5A 4ZIRB 4PHTA 3NBFA 1KGDA 5L3RA 1VPLA 1U9IA 3OE7A 2AWNA 5J4VA 3A37A 2N42A 2XOKA 1Q3HA 4A2QA 2J0SA 1F60A 5GJVC 4OQFA 3TQCA 4YXWA 3FMIA 5EJEA 2A3RA 3FMPB 3PCRB 3MWJA 1AJEA 3GFTA 4IOLA 1NMYA 4JT2A 4QBIA 2WPDA 2GXUA 3AGPA 1RKBA 4ZI3A 2VHUA 3KQKA 1EFCA 2BJWA 5EE9A 5TB5A 5GVRA 3KKQA 2VHCA 1TNDA 4Q00A 4JLDA 1XJCA 5AUQA 1U99A 1U8ZA 5FTKA 2WJJA 1RRCA 2RGAA 2DWQA 4D80A 2ZJYA 4BZXA 4H1UA 4TL8A 1XPOA 1L8QA 5JHGB 3LFUA 2O8FB 4PPFA 2VEDA 4NCNA 5EZ6B 3ZVLA 2FFHA 4D4KA 4UXHA 4OQNA 4WA7A 1GNQA 2R6FA 2D06A 4CDGA 1UKYA 4XVRA 1RRGA 2IF0A 4JLAA 1H8HA 1OIWA 1NL3A 3RLFA 2QNRA 3L0OA 3Q5DA 4QG7A 1JR6A 3I92A 1RYFA 2F1RA 4EJSB 3RYTC 4ESHA 1GRNA 3J81k 1LTQA 2BIFA 4P4SA 4PZYA 1ZJ6A 2JJ1D 3K9HA 1WF3A 4OQMA 4BECA 3UANA 5K8UA 1GTVA 1A1VA 3LVRE 4MRPA 1RYHA 1VTKA 4EPRA 1TQ4A 2IYQA 4HZUB 4AG6A 3PUVA 4Q1CA 4OI1A 5CK5A 4Q7MB 1ZUIA 3TVDA 1LV7A 3A1VA 1ODFA 5C4MA 1M6NA 3B85A 1W5TA 3LRPA 2Q6TA 4AYWA 1ZNZA 4B75A 4V0ME 1OXUA 2RGCA 2ZRGA 1XZPA 2J87A 4OL0A 3CX6A 2JJ2A 4PC2A 2F43B 4C0KA 2ZUDA 2GEDA 5GJWC 3TLXA 1AQYA 2D2FA 4JLBA 4M1MA 5KO2A 3HYRA 2GXAA 3B7GA 4J0QA 3U5ZB 1ONBA 4L5BA 4UNSA 3CBQA 2HDNB 3A8TA 1N6HA 5C18A 1K5GA 3RVBA 5GVSA 3I32A 2F1JA 4HB0A 1SULA 4CIDA 5FOUA 2BM0A 4OJKA 3LBIA 1TF5A 2IHYA 5H1YA 1IONA 2VRWA 5B2ZA 4DCVA 2HF9A 2H92A 1IN7A 1X8LA 1D2NA 5CITA 3MGCA 2VF7A 4TWZA 5AUNB 2P2LA 4AYTA 4TQ9A 4I1VA 3GLFA 4IJMA 4RSGA 3NEYA 1XMSA 1Y3AA 3WMFA 4BFTA 1P75A 4Q9LA 2JASA 1T4GA 4EKDA 5HKKD 4P3YA 1NBMD 2IYRA 4WIAA 1D5CA 1NKTA 4BFSA 4DLUA 1MV5A 4TSFD 1KKLA 2WAXA 3AF1A 5DIFA 2QE7A 1GL9B 2QT0A 2VO1A 4MRSA 2QUZA 1PUJA 1SQ5A 2A5GA 2ZQ5A 1ETUA 2Z0MA 1PLLA 2ZSFA 4ASUA 4GOJA 5B58C 6Q21A 1R5OA 2RAPA 2QU8A 1NF3A 1OFTA 3UG7A 4HDCA 2ZVQX 2XZOA 3VNUA 5F2EA 1TU3A 2ZR9A 3FFBA 4NTZA 4QHSA 1EWQA 3EPLA 1FTSA 3C5CA 1PLJA 2P0EA 4XSGA 1GZSA 4AKIA 1YZLA 2EU8A 2MMCA 3MJRA 2JEOA 4LCBA 2XSZD 1XU4A 4KITB 1JEEA 1AGRA 1R4AA 3BORA 4B48A 1FP6A 1W46A 2CE2X 1W36D 4FMCF 5EZ5A 5FBLB 2OAQ1 2IXGA 5L3QA 2WJVA 3A58B 4M22A 2KSQA 2W83A 4LI0A 4DLYA 3AUYA 2ZYTX 3I61A 4EPWA 4O2LA 2ODNA 3PQCA 3K8YA 4FCWA 3UWOA 2WWHA 5GJCA 4G3XA 3LNCA 1DVRA 3W5IA 3KDSE 2O8DA 3NIBA 4XTRA 4QM7A 4TT3A 1B0UA 2WAYA 3ADKA 1N3BA 2GAOA 2GJKA 2H7VA 1R6BX 1XMVA 2NZJA 3GJ4A 4JLNA 4LC1A 1ESMA 1E2EA 5JEDA 2REBA 3SJAA 3SC3A 3G0HA 1ZM7A 1G8FA 2QROA 1ZCBA 2OESA 2ZI3A 2CVFA 2DPXA 1IQPA 3WYAA 1KJWA 3OE7D 1XJQA 1KDPA 2R6AA 2VP0A 2Z4RA 1TF2A 4MGZR 4P4TA 1HH4A 3N70A 1ZD8A 3WP0A 1KO4A 4AIIA 2QL6A 2XOKD 4IVRA 4KFTA 3WYGA 4QM6A 4ABYA 2XB4A 3P1JA 4KAXA 3C15C 1XWIA 1E2JA 4RD2A 1X3SA 1SHZA 2PMDA 1YZQA 3H4MA 5JMTA 5KSOA 4CEHA 2IS6A 3BAFA 1GKUB 1W2HA 1R0YA 4JMPA 2VIIA 2G3YA 3VMFA 4TYWA 1SGWA 4BFZA 1G18A 5E4FA 2OCBA 3IQWA 2K5UA 2BVNA 1LY1A 2ZSAA 2O8BB 4JLMA 4PAQA 1VCMA 2C77A 3RNLA 4F4IA 2BBOA 1YRAA 4Q1BA 1G3RA 3PEUA 3DKPA 4TLEA 3WRYC 4KBFA 4HLDA 2GF0A 2ATVA 2HYDA 2R6DA 4L15A 3VKWA 1W2GA 4JJZA 4JVLA 1YRBA 1J99A 1W0JD 3R20A 2HUPA 4IDHA 1S1MA 4YMWA 1TQDA 4LBYA 3WMEA 2H16A 3C4JA 2V3CC 3SQXA 4P32A 3LQQA 5C46F 4TTQA 4IXMA 1J7KA 1G5RA 3DMNA 2RGNC 3MMPA 3SJBA 2QMUA 5FH9A 3CRRA 1FZQA 5FBRB 5JEEA 2WM9B 3IPYA 1EXMA 4PSAA 3QKTA 4PC6A 3W8NA 1QHXA 2BMEA 5AJYA 3IIKA 1DS6A 3ZDQA 3KB2A 3P26A 1UBGA 3EPKA 1OIVA 3LLUA 4LHZA 4C0AC 2ZS9A 4PQRA 2FN4A 1EX7A 1SVOA 4CGZA 2FSIA 3NXSA 1RJ9B 4JLKA 2W2TA 4AC9A 4BLRA 4LK2A 2ZS8A 1E4YA 1G7RA 1XMJA 1UKEA 3AGQA 3GMTA 4L9SA 1NY5A 3THXB 1VYTA 1GWNA 2ORVA 1NP6A 3AVPA 2D7CA 1SZPA 2G83A 4M9XA 1X8KA 3B1VA 3T1QA 3C8UA 4Z1MD 3WBKA 3BFVA 4IOMA 3EZ6A 1OLOA 3X1YA 2JJ2D 2KWIA 4H1VA 4B3CA 1R0WA 4XVUA 4B74A 5H8WA 4OI4A 3TSOA 1MRSA 4O2RA 2ZVPX 3SZRA 2E1RA 3P20A 3VHXA 1TEXA 5SZIA 1KNXA 4G5QA 3PEYA 3AH8A 3THYB 3E70C 1DO2A 4Q7LA 4B3GA 1IXRC 4IKEA 5AUOB 2UZ3A 1QDEA 3DDCA 4UQOA 3AVVA 5DI9A 1R8SA 3EG5A 2ZYWX 5E7JA 1IBRA 4X8OA 1CJTC 3AVXA 1ZUNB 5C1BA 1YQTA 721PA 2CEAA 2OG2A 1Z6TA 4GMDA 1WBDA 4LYJA 4EPVA 1S96A 2KI5A 2AKAB 3CNLA 1NVVR 2EFGA 2EFDB 3OAAA 4HAUA 2AR7A 4IVPA 3OHMA 1L4UA 3AVYA 4DSOA 3T5GA 2JLYA 2QE7D 1NVWQ 2ZJZA 2ZS7A 4IRUB 5JCPA 2OE2A 4MGKR 4MGIR 4EDHA 5FL3A 3FWYA 4LZZA 1U0LA 2IW3A 3NTUA 4WAUA 2R2AA 3WBJA 5C2JB 3UXMA 1NN5A 1XF9A 2QM7A 1SHKA 1QHGA 4W7SA 3WMGA 2AK2A 4NP6A 2XITA 4R98A 1CEEA 5CLQA 1UPTA 2C99A 3CF2A 1G3UA 3RRMA 4BZQA 521PA 3H84A 1KI7A 3OFNA 1EWRA 2ZROA 1OXTA 1JBKA 4Z8XA 4DHEA 1SKYB 3E5HA 4Q4AA 2QAGB 1T9HA 3RS3A 3C7KA 2PZGA 3VU9A 4HSEA 3X1WA 4QGHA 4HAYA 3AVWA 2ZRMA 3BJIC 4H9GA 3NHAA 3UK6A 1I2MA 2AHOA 4UJ3A 1Z83A 3KQUA 2AFHE 5TARA 3P4YA 4NHOA 2IK8A 2CCJA 4G1UC 1E2LA 2HEIA 3RC8A 1F2UB 2HCBA 2PJRA 4LJAA 2B8WA 4KV9A 2V54A 5AWFC 4LBZA 1GG2A 4TTPA 2OLKA 5DYIA 5TY0A 1NN0A 1WMSA 4BUJA 2A30A 1GRRA 3ETLA 2JLRA 4RJLA 5F9HA 2MSDB 4A2PA 1A5TA 4K46A 2KBFA 4TTRA 4X8LA 2WKPA 3QBTA 1U0HC 2NQ2C 2QSYA 1RC8A 3HP1A 3CNOA 1Y63A 3O8BA 5BWMA 1CJMA 3B82A 2ZRAA 5JJKA 3EA0A 3TUZC 4CEIA 3VNVA 2C2HA 2XGJA 3T1VA 1PZNA 3V4RA 3CZPA 1CXZA 3LBNA 4KI0A 2OM2A 5FOWA 3FKQA 2F9MA 3U3OA 3PVSA 1EFTA 4QC2A 4V0OA 3BOSA 1IN6A 1GP2A 3I4LA 4RCZA 4URYR 5BN5A 1YR6A 5KHOC 3KKMA 1U81A 4QBHA 3H2YA 3NG1A 2LKCA 1IHUA 3PITA 4PHHA 3VR3A 1U2RA 1WRBA 3TAHA 1KJYA 2CK3D 4B43A 4KFSA 1Q57A 5FTMA 4ZIRA 4QXAA 4MUBA 4LPKA 5KSPA 4B32A 1W47A 4DSNA 4LBWA 2OV2A 3AKCA 1UF9A 5CDFE 1NLFA 3QXHA 3W3AA 4GOKA 3B9PA 3EZFA 4Q1EA 2N46A 2CBZA 4WZ6A 3KUDA 3MWYW 4DVGA 2BV3A 1F6BA 3CRMA 1DBSA 3DVLA 1YKSA 4Q7JB 2F7SA 4KJZA 1OYWA 4AKGA 3U3MA 4ZDWA 2ZAOA 3AF0A 3X2SA 3KQHA 1XPRA 4R9UC 1BYUA 4YLGA 3DZDA 3ZS9A 1RFLA 4QKQA 2TMKA 4C0LA 4WZAE 2BMDA 3CR8A 1XEXB 3CO5A 3NC0C 1CJUC 5FBWB 3AP1A 4FMDF 1G3QA 3PR1A 3CWQA 3UMSA 2HXSA 3RAPR 4MGYR 221PA 3B6EA 2NPIA 4D4JA 2ZRNA 1FMJA 1RZ3A 1XCMA 4LJ9A 5BYJA 2ZSBA 1P61B 2CCGA 2DFKB 1P2VA 2IUSA 4KCGA 5G3ZA 3NH6A 1R2QA 3RABA 1TUIA 1US8B 3SR0A 2OFOA 4PAMA 1G16A 5P21A 1ZNYA 4DUGA 4EJSA 1E0JA 2VL7A 4WXPA 4PC3A 2OBMA 1E0KA 5DE3A 1E1RD 4PAOA 2IWHA 4HZIA 1N6NA 2GTPA 4DB2A 4L8GA 4BPBA 1NLZA 2EWVA 1P2UA 4C0BA 4DB4A 1DAHA 3N2EA 3S1AB 1XPUA 1BMFD 4HLUC 1GUAA 2VP2A 3QEJA 3CNNA 3L2OB 3UG6A 4F7WA 1YHNA 4M9ZA 1BS1A 1VDZA 1KK1A 3VR6A 1FQJA 4P33A 1OH5A 1G4UR 2GKSA 1DAGA 3KX2A 3OF5A 4Q1FA 5AJVB 5K8LA 4ZDKA 3ZD6A 1TQ6A 3KJGA 3L0IB 2WVJA 4M1KA 1TEVA 4OYHA 4XH9B 4IOJA 3IEUA 4AURA 4R2HA 3DO6A 2VP9A 1IY0A 2RB4A 3ASZA 1SXJB 5AJXA 1GKYA 2YWHA 3T06B 4BWYA 4RZ3A 1XTKA 4A2WA 2BCGY 4JIMA 4URUR 1DTSA 2QORA 3NBZC 5FPKA 3UMRA 1E79A 3KFXA 5FOVA 1NNEA 2NMVA 3CPHA 1T3LA 2IC5A 1GILA 3MUFA 5CDFA 1EFRD 3TK1A 3IHWA 2NPFA 3NWJA 3KUCA 4JT4A 5DHFA 2O8CB 3SFVA 2GWHA 2CHVA 4A6PA 4DJTA 1YZGA 2ORIA 2W2VA 1XP8A 2GCOA 4L9WA 4QNRA 5CB8A 3K0SA 2LWIA 3H1TA 5AK0A 4NYMR 4LPSA 3BFXA 5M04A 2RGDA 3SE0A 2FDCA 2IHBA 1XJ0A 2BKUA 1UDXA 2AWOA 3GEIA 3SI7A 4PFSA 3IBGA 1Q21A 3U7HB 2A5YB 1U8AA 1Z0IA 4LRWA 3BBPA 2H1LA 1XD2B 5HE9A 1KDOA 2QA5A 3LW7A 4RZUA 1NKSA 2C03A 3LLMA 1QHHB 4M8NE 2R9VA 2XX3A 1ZMXA 1Z8FA 1XBTA 4MKGA 2CDNA 2ZYUX 3O8RA 4D26A 3VR5A 4GRAA 2ONKA 4QJ4A 3RS5A 1G9XA 4DC9A 4M1TA 1XEWY 4F92B 4DWJA 5FOXA 2IF2A 2PLRA 4Q47A 1XTJA 5AJWA 5DH9A 3SJCA 2PX3A 2ZSEA 1E69A 3AVQA 4EPYA 2ODWA 1C4OA 1ESNA 3A1TA 4PHGA 4A0GA 1T3HA 4LJ8A 4Q18A 1Z0FA 3W3ZB 1C1YA 1KO1A 4B3XA 3K0AA 2O8EB 1NVXQ 2JLQA 2ZXUA 3QXXA 1Z06A 2IYSA 3KZ1E 5DYGA 2ZREA 2HYIC 2ZJAA 3PIRA 2B8TA 4PQYA 1Z63A 2NO1A 3UATA 2FZ4A 3H0KA 4FMBB 1D9XA 1JAHA 3QSYA 4YDSA 2FFAA 3QY0A 4NBSA 5BXQC 1G20E 2IUUA 2A7QA 3OEHD 3LX8A 3GJ7A 5IT5A 5KDDA 2VSOA 3VR1A 2EYUA 3SQWA 3NDBB 1EESA 2RHMA 1IN8A 1J8YF 4V02A 3DEFA 5IK2D 1LNZA 4NYIQ 1W48A 2FZLA 3IQXA 3K1JA 4ACBA 3WHLA 1Z0DA 3L0PA 4HUTA 3FYHA 421PA 1VG9B 3IPXA 2FFBA 4Z51A 2XTZA 1CBUA 3PV0A 2ANBA 2ZU0C 4TLCA 4Q02A 2YWEA 2E87A 1H8ED 3IBYA 3NEJA 2XEXA 3ND9A 2VHQA 4I1UA 1AZTA 5FTLA 1QG2A 2ZE5A 3GLHB 5JCZA 5JBQA 1KI4A 2ECKA 3T15A 5LD2B 1HY3A 3ZS8A 1R10A 1DARA 2XNDA 3BFKA 1AZSC 4NYJQ 4LJYA 4HLUA 4EPXA 5KOYA 3K70C 5JSZB 1NRJB 1A82A 2GF9A 3HU2A 3FOZA 1IJFA 1U8YA 3B78A 2D2EA 4HAZA 4N0DA 1AKYA 5GJBA 2FEMA 1WB9A 2O8BA 3HWSA 1L4YA 3K53A 1MO4A 4FMCB 3K09A 1Z47A 2QGZA 1PLKA 1NJFA 2QT1A 1YZKA 2ZUCA 1M34E 2FFQA 5FUVA 4TQAA 3DOFA 1ZIPA 1UBEA 1P60A 3AVTA 1N6PA 4ZCMA 2CJWB 3CB4A 1E9SA 5KPDA 2GK7A 3AKYA 3ONWA 3C41J 4GP6A 4PO9A 4Q19A 5EUQB 4O0MA 2JLXA 4LYFA 4M1OA 1UJ2A 4TLAA 4DLWA 4NL4H 4LYHA 2H18A 4QGGA 3BB1A 4X8HA 1XXHB 3T34A 3K0FB 4C30A 1FNNA 2R6GA 1KZ7B 2W0SA 2P3SA 1VG0B 4IDOA 4DDWA 1KI6A 5AUPB 3VTKA 2AXPA 2VHJA 3PENA 4D4LA 2VP5A 3EIQA 1ZC3A 3TSWA 5HR5A 1SKYE 1W4RA 3L8ZA 1E4VA 1DG1G 1E94E 3VQTA 4DUGD 3MAAC 4C7OB 2PT7A 1NJGA 2CCKA 3FHCB 3O47A 3GPLA 2XTMA 2H57A 3ZVNA 1Z2AA 1UFQA 1UDWA 2IYWA 2PEZA 1R5NA 2GA8A 2DBYA 2GEUA 2GNOA 1FOEB 1II8B 2IXFA 2GJ9A 2YWGA 3L82B 4I99A 4LJ5A 3R9IA 3ADDA 3TMKA 3K9LA 4A15A 3IEVA 3QEOA 4LHVA 4DLRA 3GLIB 3FTQA 3A1WA 1G17A 2OCYC 3HPQA 3TBKA 4FXPA 4B3DA 5J5CA 4DEXA 1G19A 4JLVA 4RY2A 4OQLA 2QPTA 3LVQE 4DT1A 3SN6A 2ZRJA 1G8PA 1NIJA 1DAMA 5BN4A 1JALA 4FIDA 2DFLA 2EFCB 3RWOA 1D2EA 3TSZA 2ZYVX 4GOXA 1HUQA 2Z83A 4OI2A 1ZU5A 3QE0A 3THYA 5ANRB 3QBVA 4OHXA 3SNHA 2F55A 1E79D 1G8HA 1W4CA 1I4DD 3FMFA 1BOFA 2FSFA 1S3SA 4E5UA 1W0KA 4AKEA 4YQFA 2CE7A 4N3NA 5CJPA 2WIAA 4W5JA 2WJIA 2AFIE 1JJVA 1GIAA 3MWLA 1DO0A 5EXSA 3TQFA 2JDID 3ZZ0A 2XJ9A 4TMWA 3MFYA 1A4RA 5G3YA 5JECA 3OIWA 4D6PA 5JS7A 2BHRA 3ZVRA 1Q0UA 1EGAA 3F5FA 4BFYA 2FG5A 3B60A 2CMKA 3X1XA 4HUQA 1EX6A 3BC1A 1QHNA 3IUYA 3LA6A 3DZ8A 3GJ0A 1CRQA 2JAQA 2RGXA 3WYFA 4LBVA 3CW2A 4B3BA 4RD0A 2ERXA 1TQ2A 4R2IA 3AM1A 1G5TA 1DELA 3UMFA 5B64A 2NO7A 1R5BA 5FPSA 2Q3FA 4CVNA 2UZIR 1WA5A 1QHSA 2OXCA 1FX0A 4KODA 1OT3A 5J4YA 1GKIA 3KL4A 4GP7A 2ZU6A 1G4AE 1KAGA 2B7BA 1Z0JA 2G6BA 2GBLC 2UVQA 2W0MA 2WWWA 4I4LA 1XZQA 2C04A 4XIGS 3WXMA 1PUIA 5DN6A 2IYZA 2Q0HA 5TV2A 5FBVB 3U6BA 5C4GB 4B2PA 4DXAA 4RZXA 1E2MA 5D3MB 1KJZA 3K70D 4Q4JA 4M0LA 4ESVA 1KSHA 2P5TB 1E9FA 1E1QD 4D4MA 5JI2E 4MITA 3SBDA 1LFDB 2X1VA 1M7HA 2GJAA 3SYKA 1FQKA 1S4QA 4A8JB 1JPJA 4PZZA 2ZSDA 4V0MA 1TTTA 1XCPA 1JQLB 3QXCA 5H68A 2XJ4A 3N5CA 1W44A 1HEIA 2WSSD 1F5NA 2F3TA 2G9NA 3QXJA 1OV4A 2E9SA 3EZ9A 3K70B 5E95A 2YC2C 4FD2A 1BIFA 3EX7C 1KI9A 4MA4A 1W36B 3RANA 4US1R 1N5LA 1Q1BA 2FU5C 3U44A 2IS4A 2LKDA 4Y0VA 2FSHA 2ZRCA 1JPNA 1F2TA 3AP3A 1GNPA 1BO6A 4TYPA 5SZJA 3IO3A 1D2MA 5CB6A 1IY2A 1XD9A 2BCJQ 2NOAA 4B34A 2OFWA 4KVGA 1KDRA 1NG9A 2IS1A 1VMAA 2JIZA 4OK5A 4XWAA 1F3OA 3AKDA 1VHLA 3NBXX 2WMOB 4DCUA 1H65A 4YXWD 3W6PA 2QBYB 2EQBA 1FW6A 1D8TA 1W4AA 4CEJA 3JZAA 2ZPTX 1N0UA 3EW9A 3TNFA 3U4QA 1N2CE 3NBYC 4GSYA 3B13B 2IYLD 4JL8A 2J0QA 2WPDD 1SXJE 5FI1B 2EFEB 5EE5B 3FPAA 3SYLA 2AL7A 2BMJA 1WDTA 1T0HB 3QKRB 1IN4A 2VLIA 4URWR 1JR3E 5KNCA 3MLEA 3CH5A 3GLGE 2V4ZA 1CKEA 5KPJA 1TADA 1G7SA 3NVAA 3FKSA 2IT1A 2GETA 4HB2A 3KTAA 4A1FA 3M0EA 5FI0B 2DR3A 2GRJA 1COWA 2Q9CA 3N2IA 3ZQ6A 1DAFA 2J9RA 1VHTA 4XD7A 4DLSA 5KYKA 3SHFA 2ZI4A 4ITRC 4M53A 3QKSA 4I81A 1VG8A 4R71A 2CLSA 1H8HD 3RS7A 1ZIOA 4US2R 1ZD9A 1G3IA 3KKNA 4BLPA 1FPMA 3A6PC 4LJ6A 4GDFA 2D4HA 2QMEA 2A78A 5HCIA 5F3WB 1OB2A 3WNDA 3Q8XB 3K9NA 4EFNA 2ZUBA 4NE2A 4ARZA 2BM1A 2H17A 1RE0A 4JYCA 1KY2A 1AA9A 1US8A 2P6RA 1KI1A 5GADl 4IEIA 2ZJ5A 3AB3A 4JLJA 3R7WB 3OIVA 2HV8A 1JAIA 2QEQA 3GD7A 3A1UA 3AEZA 4P4SB 3THWA 3VHLB 1P62B 2JLSA 5LB2A 1A7JA 1HQYE 4PC1A 3TUJC 4KBGA 2XB2A 4DKXA 3LY5A 2V8OA 4WZBE 3I62A 5AJZA 2XAUA 1E2GA 1HE1C 2GBLA 5LB4A 4HYYA 4PPQA 4IDPA 3S1AA 2R65A 2G1JA 3U7EB 5F9FA 4A36A 4KSCA 4D25A 4PPNA 1XTRA 2A5JA 2CL6X 2F6RA 3L8YA 2V7QA 1CJVC 4JSTA 4LHYA 2X2FA 2XXAB 3ZH9B 2CLDX 1RRFA 5EXTA 5JFGA 1DE0A 1P2TA 3TR5A 4O3MA 1E9EA 2W6IA 4RVCA 2B92A 2PLFA 4RKFA 1N6LA 1G64A 4G5OA 1OIXA 1R8QA 3EWSA 3IKJA 4LYAA 4UXIA 2D7DA 2WOJA 1CLUA 1JR3A 3RSOA 5FPTA 4URZR 4A9AA 5L3SB 1QRAA 2LCFA 3F3YA 1XD8A 2C9YA 2IXEA 4BASA 5DI3B 4BGDA 3GLGA 2O8CA 1EFUA 2JA1A 5K8IA 4LSGA 3TIFA 3FFAA 4HLCA 1FL9A 4ILEA 1GSIA 4IHQA 4ASUD 1QVRA 2Y8EA 3DMDA 4M9QA 3GLFB 4EJSC 1QF9A 1ZRHA 1XEWX 2ZJ2A 3MCAA 5EE3A 5E3HA 1KKMA 4DDVA 2XNSA 4JBWA 4BLQA 5B30A 4EFLA 2IYVA 4IDNA 5DISB 3EIEA 3GCGA 3JZMA 1XD2A 2QTFA 2RCNA 5CIWA 2J59A 2SHKA 1AS3A 2MSEB 4GPTA 4MKIA 4LJ4A 2VSXA 4DCTA 1NN1A 1XTQA 1GITA 4D0LB 4HAVA 2ZE7A 5FUXA 1UEIA 1YE8A 1ZM4A 4C2TA 4M1WA 3Q9LA 3TW4A 3CRQA 3B1WA 4HATA 4Q9IA 3V9PA 3LX5A 4B71A 1UM8A 4M2LA 2IL1A 4LX0A 1IJEA 1A2KC 1KMQA 2FGKA 1TL7C 4Z54A 4QOSA 2Z4SA 2YJTD 5TXGA 4F38A 4TT3D 4D81A 3HU3A 3ZLJA 4TMTA 4ON9A 1M2OB 3I5XA 5A0FA 3BD9A 1KO5A 1CRPA 2V6IA 3CKLA 4IOKA 3QF4B 1PV4A 4UNRA 4RZ2A 4MH0R 2ZRFA 3GP8A 1DPFA 4HAWA 1K8RA 4TMKA 3TRFA 3BIFA 2UKDA 1KHTA 4MRNA 1N0VC 3QOFA 3GLIE 5KDOA 2BBWA 4OBEA 3LH5A 1MH1A 1YR7A 3MWKA 2NZ8A 2O8DB 4YONB 4V0LA 1P9NA 2DWOA 1VKJA 4TZ0A 1VIAA 3DKVA 3UPUA 3ICEA 1WXQA 2BBTA 1AKEA 3BE4A 2XTNA 4LHWA 2PEYA 4B6EA 5J4LA 4GMXA 5FOTA 3DPUA 2O0JA 4MRRA 1J2JA 2I4IA 2J7PA 2QM8A 2YKGA 2IX3A 2ODEA 3OIUA 3U3JA 5J4KA 2NO0A 1FNMA 1NLYA 1QG4A 3D6TB 5L8VA 3X1ZA 1UADA 4P4UA 3D31A 1OB5A 1HA3A 3OEEA 3OZXA 4GT1A 4JVSB 2BDTA 1M7BA 2D74A 1ZVQA 1LS6A 2WJHA 1JQJC 1M8PA 2ZI5A 1D6JA 2AK3A 3LXXA 1X8JA 2P6NA 1NVVQ 1R0XA 4PTLA 4BFWA 3B1ZA 2ORWA 1M74A 4GZMA 1J8MF 4C2UA 3TW8B 1COWD 2G77B 3BRWD 4XD7D 4B2LA 1MABB 3D8BA 3HPRA 1LF0A 3PFIA 5JWRA 3DOEA 3TAUA 1G41A 1Z08A 2X19A 3KKPA 4F4CA 2C9CA 2O8FA 3C14C 2CL7X 4S35A 3VX4A 3EASA 3T12A 1LVGA 5CYOA 1QHYA 4NCIA 3AF4A 2P65A 4UJ5A 3BXZA 4E03A 4MDEA 1JECA 2GVZC 1KIMA 1NBME 3K0FA 1AGPA 4ZI2A 1Z2CA 3ICQB 2VPPA 5SZHB 2CHQA 4Q21A 2ONJA 2P5SA 3MSXA 4A0HA 3PUZA 4MDFA 3EPHA 3VKHA 1KI2A 1Q1QA 2BKEA 4C7OA 1CF4A 4NCHA 3W5JA 5JWOA 1IY1A 4KU4A 4DDUA 2EWWA 2XZLA 5DGXA 4Y0AA 1T91A 2R62A 3CM0A 4TMVA 2OBLA 4TL7A 3CWZA 3TVTA 1OF1A 1S9HA 2PJZA 2Q21A 2VHTA 4HB3A 2ZRPA 4TLDA 2C96A 2G88A 4QJ3A 2ZI9A 4HZUA 2C9OA 2KE5A 4PC7A 4DSUA 2YHSA 1VYUA 1ZM2A 1UKZA 2VSFA 5KNDA 3GLIA 5H70A 2FOLA 4RKEA 3QIAA 2BJVA 1JXOA 2JLUA 1OFIA 1LB1B 5D3QA 2DHRA 2ERYA 2JJ1A 2IEZA 3CF0A 5K8TA 3GJ8A 1CIPA 5E7MA 2F43A 4GI7A 4HDOB 3K09C 4V0NA 1N6KA 1YZUA 3RC3A 1VCIA 4QFMA 1OYYA 3AP2A 4FI3C 3W34A 1XNJA 3FVQA 4AYXA 2OLJA 2VF8A 4OK6A 1KO8A 1MRNA 3OAAD 2ZANA 5FL7A 3AV0B 5F98A 1Q22A 1UKVY 4UKDA 2EYQA 2FPLA 3FE2A 1Z0AA 4A4DA 1T0JB 1T8TA 2X8AA 4RD6A 2YOFA 5KDLA 3VKGA 2GZHA 4CYMA 2PCLA 2ZIAA 3V00A 3KJHA 1S0UA 3QQ5A 2PX0A 1KY3A 3VX3A 3AVOA 1J90A 3OFND 2QPOA 4DZZA 1T3SA 1P5ZB 3KB1A 3QKUA 2RGGA 4ZCLA 4B47A 2DY1A 3BB4A 5B57C 2BEKA 3EPJA 2F1IA 4HLQB 4N1AA 2YZ2A 3SFZA 3F0TA 4UXJA 3CLVA 2ZI6A 2IEYA 5HKKA 1L7VC 1NBMA 2AN9A 2OFXA 3K9GA 1XFAA 3QG1A 4JL6A 3NC1C 2P67A 4TSFA 2NO6A 4IEEA 3T61A 4XWKA 1W1WA 1AS2A 2WWFA 1E9DA 2FSGA 4KYUA 1KDTA 3ZIAA 3U7FB 1VIYA 4MKFA 1NMZA 4Q4AB 3I5YA 3VU9B 1KOFA 4Q03A 3JVVA 4E07A 1CS4C 1FP7A 4C0JA 3ADCA 2QQEA 4JJKA 1RVDA 2HCJB 4M9SA 3UKDA 4JVNA 4EQ6B 3B1XA 1G8YA 3CR7A 4C0QC 2IUTA 4DDTA 5FTNA 1Q12A 1HTWA 3PG5A 4WW0A 1NN3A 1L2TA 4HDQB 2MSCB 2XSZA 3GFOA 2QP4A 2KB0A 1CJKC 4KFUA 1ZNWA 1E9BA 4OHYA 1IXZA 1KI8A 1SVIA 2ZRDA 2J41A 4HB4A 3RRYA 3FB4A 1CTQA 4PZLA 1N6RA 4RFSB 1MKYA 2ZEJA 2VTKA 1E2FA 3UWKA 1NSTA 2A2ZA 3I73A 3SHWA 3EC1A 3R8CA 3PEWA 5FR2A 1IXSB 1HV8A 1XMIA 1YR9A 4EFMA 2PZFA 3WRXC 3A4MA 2GEVA 4CEIB 1AM4D 3LXRA 4LY6A 3RRZA 3I8XA 2CNWA 4JLPA 3CPEA 4OHZA 3FDIA 2PBRA 3T1OA 3OEED 4A6XA 2Z6VA 5FTJA 3KXLA 4G01B 4P0TA 5JI3E 2VYFA 2R8RA 1X1SA 4TL6A 1CULC 3RHFA 3PEVA 3BB3A 3R9XA 1HURA 3GJXC 2QAGC 2H5EA 1OXSC 3BK7A 4IDQA 4LC0A 1MT0A 1JEDA 1E9CA 2WV9A 1N5IA 1OW3B 2CLCX 4AWXA 4E09A 4URVR 3UIEA 1IN5A 4BEJA 1K6MA 2HLDA 1GM5A 4EAQA 3QI2A 2PH1A 2FWRA 3RS4A 3QKRA 4QL3A 3ZZUA 4BLSA 3IHLA 1DAEA 1S1CA 4YDHB 3RS0A 4TMZA 4ERNA 4G5RA 4NYMQ 1AN0A 2J0VA 2OCAA 2GZDA 4PR0A 3EARA 4GBMA 4TQUS 1ZCAA 2O0KA 2OAP1 3HYTA 1X6VA 4LV5B 5CM9C 3TUIC 1YZNA 1K5DA 2O0HA 5FPHA 2FEOA 5E7IA 3ECCA 2AKYA 4A0FA 1XB2A 3WNCA 4BZPA 3GLFE 2ZAMA 5JS8A 5EUMA 4EPTA 1XTIA 3P27A 3LWNA 2YWFA 1E2PA 2IA5A 4KLZA 2QGNA 3U3KA 4D82A 4NCKA 4YMUA 1X86B 1UEJA 2VH5R 3PUXA 2REXB 2GZAA 2AD5A 4Q01A 4Q48A 1PJRA 3GQBA 1LW7A 1W0JA 4Q5IA 4B3FX 3V4FA 5KU1A 4W5HA 2FGJA 2WBLC 5A5GA 4FCTA 1P7CA 1D9ZA 2J0UB 3W8RA 2ZM5A 4DRZA 2BWJA 1RJ9A 2A5FA 2FPMA 4JZKA 2ZTSA 5CIQA 1G6OA 1XDBA 3W9YA 1N5KA 2O5VA 2WTUA 5G41A 1VECA 1DEKA 3AQ4A 5BQ5A 1WBBA 1Z3IX 3FMOB 3THXA 1YZTA 3R7WA 2V9PA 4KXFB 1B23P 1UBFA 2FA9A 3SDZA 1YU9A 1VCOA 1EK0A 4LV8B 3RS2A 2JLWA 3L0SA 1IM2A 4PXAA 5EXPA 4W9MC 4M1SA 3QVUA 4N0EA 3WNBA 4OHWA 1T5IA 3KXIA 4NPHA 4D2IA 1KI3A 2NO9A 5KSYA 1XX6A 2FJUA 4V0KA 1Q1EA 621PA 5J47A 2ZETA 4Z1MA 2XXAA 1QVAA 1II9A 2OEPA 2KJQA 2GCPA 5JHHB 3CRVA 2ZR7A 1OHHA 1QHIA 2HT1A 2FH5B 3HR8A 4MYCA 5DLQC 1CR2A 3FGNA 3I1FA 1SVKA 4WVFA 5FL7D 4HEJA 1G5PA 2JGNA 2ZE6A 4OHVA 3MJHA 2D3WA 2EW1A 5IDVA 2ZJOA 4I1OA 4M4SA 3QPWA 1G7TA 3G82C 2X2EA 3CX8A 4DIDA 5L3SA 1Z22A 4Q1AA 3NHBA 5SZKB 3QVVA 5DI3A 2XZPA 1OH7A 1KMHB 4PHFA 5FOSA 2AXNA 2JCSA 3A1SA 4U5XA 5EP3A 3MRSA 2ZRLA 4CT5A 5EXXA 2ZI7A 2GCOB 4Q4LA 4JKIA 3KQLA 1YJ5A 2ZRHA 2HXYA 4Q9KA 1Z29A 1GL6A 2GK6A 4MYUA 4FCVA 4Q4HB 4U02A 3HJNA 4Q1DA 2V55B 3TKLA 3EZ7A 2VBCA 4MQBA 3TJZA 3BERA 2QAGA 3VR2A 4P31A 2WHXA 5CK4A 1ZINA 3ZIAD 3NDPA 3C5HA 1T8UA 2GESA 2ODBA 4MUAA 4F93B 5TMPA 3MG9A 2HF8A 3RRNA 2ZRIA 1E98A 2ANCA 1CP2A 3M1IA 1F2UA 5HTKA 1ZBDA 2WZQA 3B5JA 3Q3JB 1JB1A 2R6CA 2RGBA 3ND8A 4C0SA 1KK2A 4FINA 4XTCS 1X1RA 2REOA 1AIPA 3QNUA 1MO5A 1NI3A 2KBEA 4CW7A 5JZVA 4ZCIA 1KK3A 4CF7A 1SXJC 2Q3HA 4RD3A 4LGMA 4U00A 3K0AB 2OXRA 2JATA 2W6JA 2BOVA 2HJVA 4WXRA 2ASEA 121PA 3DM9B 3GJ3A 3M6AA 2HT6A 1UAAA 3ZJYA 4NONA 4DBLC 4DLVA 2QRNA 4V03A 3QPUA 3LBHA 3QF4A 2IYXA 3LQRA 5AR1A 1DAIA 3P4XA 3ZD7A 2YYZA 2J3EA 3IO5A 1Q1ZA 4LJ7A 1E96A 2C78A 2IYUA 4O25A 2ZJBA 4L16A 2CNWD 2I1VB 3U3RA 1P72A 1ZAKA 4AI6A 1CR4A 2XNDD 3PUYA 3ADBA 3TE6A 2A9KA 4FN5A 4QGFA 3AVUA 4KFRA 4Q9JA 3QPVA 1P3JA 5J4HA 3Q7QA 2BMFA 1TMKA 821PA 4YC7A 4JBXA 1E2DA 4OJQA 4QBFA 3PJRA 2HLDD 3K0EA 3HR7A 1DAKA 2VA8A 4IVQA 4C0HA 4LDJA 5HE8A 5FFMA 3LO5A 3TH5A 3DHWC 4G5SA 3P32A 4NMMA 4ZV4A 4BFXA 4LUCA 2J7KA 2CK3A 3GEEA 4B73A 1U98A 2F9LA 3HDTA 1NY6A 3I8SA 4LOAA 1II0A 2DB3A 2QZ4A 3BS4A 1ZNXA 3SBEA 2QY9A 2CL0X 1MABA 2QSZA 4NU0A 1WE2A 2YOGA 1W4BA 3VR4A 4IFBA 1RW4A 2QTHA 4BEBA 1XEXA 2NG1A 5EQTA 3T35A 5JJLA 4PX9A 4L4UA 4B44A 2G0TA 4UNQA 2IS2A 4CT4B 2QN6A 1OSNA 1GFIA 2WIBA 4XWOA 4LHXA 1P2SA 1GVNB 2EVWX 3QUSA 4KSBA 5EP4A 1PVOA 1JJ7A 1O3YA 4NKRA 1NSFA 4G5GA 2R44A 1ZP6A 5DO9A 1KI6B 1JI0A 4AKHA 3W6NA 2G0NA 1SVWA 1E99A 1Z0KA 3Q5EA 1S8FA 4XVQA 3F8TA 3SJZA 1A2BA 3B2EA 4B33A 2JJ8A 2WWIA 2GAAA 3FHOA
chains in the Genus database with same CATH superfamily
2I6TA 3KFVA 3CEPB 5LD2C 3JW8A 3EHEA 2CJFA 1AKUA 3I72A 3OPYI 3F2IA 5KOHA 1WPQA 2HY7A 1FSFA 5IYZF 2Q3CA 1KARA 3THRA 4CRWB 1I1NA 1HOXA 3WB2A 5I7AA 3WYEA 4DZRA 2XQVA 3IEIA 3JQ7A 1BH2A 2YZMA 3W06A 1MVOA 4GMHA 2FW9A 2GPJA 1SKAA 3D7LA 1O6BA 3MN1A 1GNRA 3NOXA 5JWHA 3UHOA 2ICAA 4QATA 3U9SA 2PX5A 4GM0A 3R0ZA 1A7KA 1ZR4A 3AUKA 3DL4A 4LMAA 4MO9A 3ZGXA 4OPMA 3OOEA 4GP9A 4Y30A 3IQZA 3G7NA 1MA0A 4WOPA 1EFDN 5AYVA 2VK2A 3RIEA 3WK7A 2BGTA 2HPVA 1QYDA 1PWXA 1GA6A 1VYVA 1TAUA 1BMFA 3LKZA 1JEQB 2CL5A 1KEUA 4EW3A 1B16A 1JBEA 4HRAA 5HF5A 1TZBA 4AY5A 1WVGA 4BDSA 1MR3F 3OHSX 4D9KA 4ZU1X 4ZAWA 2VRCD 1K1EA 5CD1A 4BKMA 2AG0A 4UZFA 5F5LA 2ZKIA 3AHDA 3GLHE 3R5KA 3DP7A 4PANA 4PCUA 3WV4A 3U4CA 4EX7A 1TIPA 2MSKA 2WYIA 1XVAA 3D81A 4ZCTA 5HX7A 1AH2A 2W6OA 3LSYA 3R44A 3USZA 1MNAA 1CR1A 1WO8A 2I7CA 1ZWKA 2PKEA 1AXEA 3KXKA 1E2NA 4LSZA 1V7QA 3WWOA 4HFMA 2C2YA 3ASYA 3ZNQA 3R6DA 3FYDA 1ICIA 1V4BA 4F3RA 3E3OA 4J76A 2V0GA 1L7XA 1CZHA 3LHFA 3DZHA 4QU5A 3LSTA 3AUXA 1OZAA 3GT4A 5EWJA 1I5EA 2DCMA 2NGRA 2NZUG 3NALA 4G8CA 2A0YA 3HCDA 1E3JA 4KXXA 4BJ1A 1SC3A 3TPCA 4ZDJA 4RWEA 1H05A 2OB2A 4NLLA 4WERA 5IZCA 1PS0A 2BBSA 2ADOA 2AS0A 2H2AA 2QDKA 1PWHA 4ML3A 1QHHA 5AM0A 5ESWA 3ZW9A 4BVBA 1Y1PA 4MPDA 2M2IA 3WGLA 3BHIA 3Q72A 5KTPA 3OM1A 4G0NA 4PE5B 5AK5A 5CXSA 4A1OA 4OD0A 4U7HA 1GOTA 1RI5A 4MCHA 3M9WA 4ZQEA 1N25A 2I2AA 2W6CX 5JZMA 5I3ZA 3W6OA 3O8DA 4S24A 4KO8A 2AOVA 3EC2A 1KJ9A 2Q3DA 3JWJA 3N2ZB 3FRIA 2HMWA 4YQYA 1TU4A 1NXTA 1QFSA 3AMVA 2OFPA 1U2GC 3WLIA 2YYSA 4CFYA 3CNBA 3T41A 5I9BA 2D5CA 1XCGB 5I9MA 4TV9A 4N0QA 5CLGA 2DLCX 3T5DA 3WTCA 1BDIA 3AJAA 3BRQA 4KGDA 4EJ2A 1KEWA 1OPXA 1W5SA 4ME6A 4ALKA 3A4VA 3ABQB 4ND2A 4QXRA 4NZPA 5C37A 1A9XA 1JKMA 3ACBA 1I1OA 3LUHA 2CYCA 4IW3B 2I6QA 4BWGA 1K6XA 1T2NA 2VDWB 1TW3A 2E4ZA 3K31A 4MB6A 4J9UE 4DIEA 1CZKA 3EVFA 3HKDB 3HVUA 2AC4A 4D74A 1CV2A 4KQEA 3T1HB 5JSYA 1THGA 2FX3A 3PWZA 2WWGA 4W8GA 4NJEB 3MRVA 3TKAA 4WH0A 2RGNA 2H7YA 3KD3A 4K40A 4MVJG 1WVIA 4TZ6A 4FC6A 4PSKA 2ETXA 3E2IA 1MUUA 4RFSA 3W90A 2QP3A 3SICE 3F96A 1SXGA 3ZDAA 3KJQA 4J1SA 1THMA 2WG0A 3A2MA 4J91A 2NVUA 2XLCA 4NS4A 2PBFA 2NXEA 3IBSA 3GPDG 4QVKA 2FV8A 4DDHA 2G6TA 2OP1A 1XQVA 3OLYA 3KKOA 1C9MA 1TPZA 1H3NA 2ZYAA 2ZB2A 5E1DA 2X1LA 3OZAA 5GZ6A 6PFKA 1FFHA 1T6YA 5JE8A 2A88A 5C81A 1Y1LA 2O3SA 4EH1A 4UNNA 4Y6RA 1SBTA 1NXWA 2IXDA 5DBEX 2Z2ZA 1CY2A 1KMNA 1OC2A 1TF7A 2IWRA 2QENA 2YWCA 1HLPA 3NHKA 4CEHB 1MF7A 1TAQA 3D2AA 1L5GB 1OTYA 4WFKA 5BSKA 1JIJA 1S8AA 2WICA 4RMHA 4MIEA 4RK6A 5T4BA 3QRWA 1V9SA 5EP2A 3BA6A 4BO5A 5BP7A 4MICA 3GT0A 5EZYB 2I62A 2C94A 3BH7A 3LZCA 1IY9A 4Z0NA 1W49A 3C1UA 2FPKA 3FSEA 1G59A 1PZFA 1FVXA 5IH7A 2UYQA 1Y1RA 1UBCA 3U61B 2VZEA 2FUNB 1WABA 1J0BA 3FSGA 4JGBA 4U9UA 3LUJA 3WLJA 3PTZA 3W05A 2O9JA 3I3OA 3QU7A 2X77A 4BQEA 2Z1DA 4FILA 4WCDA 1L5SA 1UWVA 1EUCB 3CW8X 3WAGA 2I65A 3LTNC 3CIOA 4J7XA 4YAGA 4ZHQB 3CLSD 3TX6A 3AKEA 3DOJA 1XTSA 3QJYA 4FW9A 3V1LA 3Q10A 3D8HA 3KTAB 4MYTA 1Q0ZA 5E6SB 3TG8A 3IQHX 5L6MB 3ITNA 5DNYB 3EXAA 1MAHA 1PBTA 1WQ1R 4PYKA 1HYQA 4BO3A 3EWIA 2NZXA 4XLTA 5AJUA 3WL6A 1XZCA 3Q85A 5DLPA 1Z6AA 1BKDR 2PUJA 4PSUA 1DHRA 1I7PA 2QMHA 3QKSB 3VKFA 3FWHA 4JLOA 4LOKA 2YVLA 4NK4A 3ZWXA 2C4TA 2D1TA 3HVJA 4GGOA 1AGNA 5IF9A 4BO0A 4MQFA 4TWJA 3VUEA 1LNQA 5BRAA 4GL2A 4M7PA 2ZE8A 2QPAA 1PEKE 2MT9A 4WJKB 2GD0A 2V1XA 1QV7A 4A27A 5EIWA 1PI3A 3FHTA 2Q9BA 3V48A 2J0UA 1F4PA 4EMTA 4II7A 1OI7A 1V8PA 3B1FA 5EXEA 4ARZB 2HA2A 3O2NA 2GZ3A 1DHTA 2H54A 3UVEA 2RHDA 1CVIA 4CCSA 2QMOA 4PYNA 3RADC 4GNRA 3IV9A 2O2IA 2ZYSA 4RHCA 4RHUA 4BB6A 3ANYB 4C03A 3WL3A 4P2GA 3PDUA 5EE1A 1U8TA 1U9IC 2JIBA 2DFTA 3O4RA 3R9KA 5LQRA 1Y9AA 4X20B 5J3JA 1TECE 5DBFA 3HZHA 3U48A 5HS4A 1A5SB 3WLAA 4IEFB 3N28A 4C05A 2OPBA 4DSTA 3T7TA 4PIVA 2W6ID 4ZZ2A 1O9HA 3T9BA 1N5JA 1PJCA 3GA0A 4U2EA 1SXJD 1SC6A 1G21E 3EIWA 4WLFA 1JEAA 3LWZA 4JUAA 2BTQB 2WSMA 4TS4A 4CM8A 4HAXA 4HC4A 4D3DA 1OH8A 1SKMA 5BSGA 3IPLA 4OK3A 4R6WA 4IY1A 4JLSA 4PYLA 4C08A 5EHIA 4YMVA 1DG3A 3SVTA 3D8RA 3RBXA 2BUBA 1RHJA 3LLSA 5ELXA 4BCBA 2HJGA 2IE0A 3CONA 2WWXA 1HE8B 4Z7QB 1SHTX 2UVPA 1UQUA 2D13A 4TMXA 1HYBA 4X9XA 1G8GA 4EELA 1T8SA 5BQXA 2AMYA 1OGYA 3FDFA 4JSRA 1C8BA 2P6UA 3J7AC 4FTWA 4YP5A 2I4LA 1AV7A 1SKQA 3LD9A 1ZXBA 4RABA 5L3VA 2H11A 1G55A 2XLBA 2QIOA 1ZG3A 3AIOA 3FVVA 4H3KB 2Q9UA 3KV1A 3UC5A 3ZEAA 2FPPB 1G6HA 3JAKA 1Z7BA 1LTHR 5LP6B 3L8CA 2GVDC 3ZCTA 3MHTA 1G1MA 5L6LB 4QOFA 3HJFA 2F1HA 3LXMA 2CZGA 2GJ8A 3EIHA 3GZJA 5BMVF 1EJ6A 2R84A 3A7DA 4Q9AA 3ONEA 1ABBA 3C2QA 1XRRA 3FMGA 4EF5A 1OZ0A 2JVJA 4MS3B 5CBPB 1E0SA 1E7QA 3R9WA 3VO2A 1R0ZA 1T2EA 4KZKA 1Q44A 5JANA 2CHGA 4Q66C 1A7AA 1T2VA 2KX7A 4H60A 4H77A 1TYBE 4NG5A 3SHVA 1Z38A 4NU5A 1KE1A 3M33A 5CM8B 1AUOA 4BE7B 4F8EA 5L9AA 1BW9B 1W76A 5JAZA 4MROA 2QI9C 4OREX 4YR7A 2IP1A 2A9FA 4EHIA 2DJIA 5F73A 3RYCB 1DTWA 2OM6A 3O0DA 1FFDA 1X80B 3PGKA 4L4XA 4PIPA 2ILVA 5FLEX 3THOA 3WGHA 3ZX5A 1WWKA 1JDBB 4RAQA 3VH2A 2R5WA 4LJKA 4XVCA 5DTJA 3RC1A 3RLIA 5I4KA 4WBSA 3HU1A 3ZW7A 4M21A 1E2HA 1NGSA 4G67A 5BYBA 3EGDA 4HWTA 3JZDA 4NOKA 1NXXA 4B9EA 2WTNA 1EXDA 4RD4A 2P2DA 4DWOA 3COJA 3IMFA 4A92A 3ZWPA 4OUDB 1ICEA 1V5WA 2HMSA 4ND8B 5CLFA 3DUFA 1QWOA 1Y6JA 2E7ZA 5KUTA 3EAFA 4W5NA 5HIIA 4ZZ3A 4ZQGA 3UK1A 4BUCA 4BLTA 3ROZA 2OBBA 1KH2A 4KPUA 3WZLA 1DQPA 1I4LD 2AG8A 2ACWA 3TGWA 4P8RA 1EP3B 3L7IA 4NBVA 3I05A 2HK7A 2CY0A 3EVZA 4DLLA 4U5QA 2MWMA 1QO0D 4D9BA 2OT3B 1Z2OX 4XZ3A 3N8DA 3NKVA 4M76B 1AX9A 4TRMA 3L6RA 6NULA 4ZI7F 4OQQA 1R88A 2NX2A 4G1VA 1BQ3A 4ZO4A 1MX3A 3SMQA 5LPNA 1JHRA 1DV1A 3DC2A 2V65A 1JAXA 1KVUA 1ZM3A 1Z6PA 1N9ZA 2WSSA 3O8QA 1SXPA 4BYMA 1NG1A 1ZQ9A 2R97A 3ZWOA 3KB6A 3OU7A 4OX9Y 2XH8A 4K81B 3ORSA 2J5KA 3HFSA 5TR9A 2P3LA 1MPTA 4BNDA 1P19A 4NDZA 4EHHA 4KR0A 4BRWA 4RK4A 2WM2A 3WYNA 2YN2A 3PUIA 4C4OA 4QUJA 2LTAA 1LF5A 4QTTB 4H15A 3NBFA 1KGDA 1K0FA 1VPLA 2EC5A 2FP3A 3NRJA 5FAXA 5FBKA 5L3RA 1FXUA 1SKBA 3OTHA 3WLMA 2N42A 4RY9A 4BO8A 2R8YA 2A5LA 3CRZA 3HEBA 1W30A 5IC5A 1Q3HA 2IIQA 4IMRA 4PBRA 4ZVKA 4A2QA 4ENQA 1BSVA 5GZ1A 1WEHA 2A59A 3TG2A 2A3RA 4KUGA 1GU1A 3VC7A 4J0CA 1GV0A 4YY3B 2IIBA 4IQ0A 1AJEA 2ZKLA 3QZUA 4JT2A 4QBIA 5BVHB 1NU6A 1JIQA 3IOMA 5T67A 5IJAA 2VHUA 3W2IA 1EFCA 5TB5A 1Z5VA 2FMHA 4YRFA 1L1EA 1C9NA 3G9UA 4V0QA 4YFYA 2O7QA 3HA7A 2BKAA 1TNDA 4O8CA 3ONNA 3EVDA 2MJLA 4OLHA 5E2IA 4JI2B 4CQLA 3T7AA 1RRCA 3CYFA 1TZ2A 2X9NA 1ZIXA 3Q0TA 4CTJA 1Z73A 2FMIA 2V58A 4HKTA 4UDOA 4LXIA 1A77A 4TL8A 1J9EA 2JH8A 4G4JA 1AE1A 4PQGA 1KYWA 2QG4A 3FYCA 4KPFC 1L5NA 2FFHA 3PP8A 3TGLA 3KJZA 3V2GA 1E3EA 1RZUA 1V45E 3C7TA 3CKMA 4GZ5A 4BNMA 4C4XA 1UKYA 4UU7A 4XVRA 1D2AA 1RRGA 4JLAA 4YJHB 1H8HA 1H2FA 1ZOLA 5AI0A 3VYTB 4CCYA 1FSPA 3RLFA 3AHHA 2NUAB 5BV1A 4EJSB 3M8KA 4RHYA 3RUFA 5D84A 1RP7A 4X20A 3X3HA 4KMOA 4WN9B 1DXQA 2JJ1D 3NFYA 3K9HA 1WF3A 1Z82A 2BI8A 2W2OA 4V3BA 4LXUA 1VGRA 3IEXA 3CKYA 1JHPA 2NZVG 4FDTA 3HBFA 4I50A 5A9RA 1Y6GA 2IH4A 4BMVA 1VTKA 4EPRA 3F4KA 1KOJA 3IAUA 4HZUB 5ESXA 2PUHA 1K7FB 4ZFNA 3F1KA 4H7HA 3A1VA 4F85A 2WSBA 2N47A 4KUHA 5JLAA 2FY8A 4C76A 3UZUA 3TRIA 4ER5A 5B53A 2H2IA 4V0ME 3GZTB 1FU8A 5DYNA 3WGVA 1JE1A 3QYJA 3H7IA 4ZV9A 4RQAA 4AUKA 3WJ7A 4M0CA 1DRJA 4OGFA 5GJWC 1GNSA 4D79A 3U49A 5F3DA 2D2FA 4M1MA 3UCEA 3ZGLA 4AB1A 3GMSA 4OHUA 1YFKA 1U0RA 2QQFA 4H7PA 4WY5A 1MFZA 1ONBA 5LYJA 4UNSA 5HKBA 3JXEA 5C18A 1N6HA 1KAHA 1K5GA 1RWWA 2YJ5A 3B38A 1VMIA 3EXEA 3FR7A 2LIVA 4M8LA 4WE3A 1P7VA 5CM2Z 5EIHA 4L4YA 2VTBB 1RMTA 3ED5A 1WU7A 1AXRA 1F0NA 4L6IA 3QU2A 1TF5A 2IHYA 5H1YA 2GERA 4RL6A 2P2NA 3VTZA 1F17A 1RQGA 1IONA 1EIZA 2BKVA 3EVTA 4DCVA 4EZIA 2XHEA 1YF3A 1KFEB 1VLZA 2R751 3AILA 1X8LA 4Q4CA 3KYJB 2I80A 2EGUA 5IC4A 2G1PA 4RPCA 1IB0A 5AUNB 2JG3A 5DLYA 3UT5B 3GLFA 1ZONA 4IJMA 1CUJA 2VS1A 4QWWA 4X60A 1DKQA 3UT0A 3FSRA 2JASA 1T4GA 1HDIA 4G1CA 4B6GA 4BFSA 4EKDA 2XE6A 1D5CA 4K6CA 4JGGA 3O2JA 2FPIA 1MN6A 1I14A 4TSFD 4QT0A 3MT7A 4R31A 1XNQB 1G8AA 2C3UA 3DMGA 3EZYA 4AMUA 7MDHA 1V5EA 4KSYA 4UUPA 3DMRA 4DL9A 1QYXA 2GX6A 3OPQA 2YYYA 2RIRA 2FCRA 2MINA 4GOJA 1R0CA 2HGSA 4S1VA 3TIIA 5B58C 1NF3A 6Q21A 5K7SA 3H2HA 1YZYA 3X43A 2RARA 4K28A 3K4HA 5IN4A 3VNUA 1SCUB 2WF7A 4G25A 4OIMA 4PX2A 2OSVA 4IWXA 3V4ZA 3P97A 3LE8A 3HV0A 1XQ1A 5FL3A 2JI6A 3DD1A 1EWQA 1AHHA 3LFHA 3RGWS 4U1RA 4WSOA 2EBUA 2R7NA 2BFFB 2ZBVA 1JT2A 2P0EA 3KUUA 4AMBA 1ULHA 5C5EA 1Q11A 5I6DA 4EGJA 3JZIA 1UEXC 3MLBA 4EKEA 1Y7TA 1C29B 4QODA 1VBMA 4FHZA 1E61A 2PGAA 1J2EA 3AETA 1HEUA 2NXJA 1FP6A 2D0OB 1MB0A 1M67A 2E82A 3D6MA 3O4JA 5CNIA 4E33A 2WNIA 2FPGA 3PZBA 2OAQ1 1M2FA 5L3QA 2WJAA 1NDHA 2HNBA 3A58B 4LI0A 3AUYA 4NOJA 1JPVA 1F0KA 2QUIA 3JQGA 4OLBA 3RVOA 3UWOA 4G3XA 1P3Y1 5JQGA 1DVRA 1T8PA 3TQOA 1RJDA 4QM7A 3GVXA 4XTRA 1QB8A 3HSSA 1R3DA 2QD4A 4WOCA 1WM1A 3TEJA 2CUZA 3A0UA 2GJKA 1FNCA 2NZJA 4JLNA 4LC1A 1E2EA 1DEHA 4JHLA 2PUFA 1UFKA 2CD9A 1RPNA 2OV8A 2REBA 3SC3A 4AMZA 1G8FA 3BIWA 1X38A 2QVCA 4KR3A 2BFEB 1ZBQA 2IUEA 4K9PA 2Z2IA 4D44A 4E5NA 1LDNA 2BM8A 1KDPA 4GX0A 3TL2A 1MX5A 1TF2A 4K05A 1KP9A 3K6JA 1HH4A 3N70A 3ZDEA 4N3GA 2QL6A 2IP2A 2XOKD 2G82A 1V8DA 1ADCA 2FZVA 2OKGA 1JDZA 1O9BA 2R4UA 2XB4A 1NI4B 2ZTHA 3AR4A 4FS3A 4IMIB 4TSKA 4CR6A 1AMUA 2EJUA 3U7RA 1XWIA 3DZIA 4CHTA 3DNPA 3R9XB 2PMDA 1JLMA 3H4MA 4N7RA 1DKRA 3DO5A 3A27A 1GKUB 2EQAA 4TYWA 3VMFA 3VSEA 2XD4A 4KYVA 2WU0A 3TW8A 2P1ZA 5JY1A 2CT8A 4B4OA 3VU8A 1YC2A 4L50A 1T0PA 2BVNA 3RVSA 2OMEA 1AUVA 4PAQA 5DCYA 1SG0A 1VCMA 2O3UA 2TMDA 4AZTA 1HNNA 1KBQA 1C2YA 1EGVB 1SC4A 4RF2A 3H5LA 3RNLA 1OAOC 1R6VA 1R18A 1YRAA 2ISCA 2JL1A 1G3RA 3NJ4A 1X7YA 4Q1BA 4Q9DA 3S27A 1AZLA 3I12A 2NN3C 2ZYRA 3P9PA 4PHCA 2GF0A 2ATVA 2HYDA 2GM4A 3EUWA 4JJZA 1QH1B 5K3EA 3PVZA 1OBCA 5DNVA 1J99A 2FW7A 4WEOA 2EG5A 3AR8A 1AQNA 3SQXA 4FJ2A 1L4KA 2QAIA 4J0DA 5FT9A 2NU8B 5JH7B 4TXHA 3QVSA 1A9TA 2IKQA 2MHCA 4TTQA 5C46F 1G5RA 2Z95A 2WT4A 2P9EA 3SJBA 1X7GA 2HK9A 5I8WA 4N01A 1ORWA 1O89A 3EH1A 4YCJA 2A33A 1RPAA 1REQB 1T29A 5EJ6A 2WM9B 4Q3LA 5ITWA 1PIWA 1ZMRA 1KWKA 5HJ5A 1L8AA 4QNNA 2BMEA 1VSTA 3DDHA 4QDTA 1Q77A 5AJYA 3IIKA 3WV5A 3L77A 3D0KA 4TTVA 1E3IA 2DKFA 3EDMA 4CM9A 3IJRA 1ST3A 1UBGA 5FPPA 4LHZA 3HWRA 3QYAA 1O95C 4LTDA 4F2DA 4ZD6A 3K6SB 3U7IA 1Y6QA 1SVOA 1U1IA 2FSIA 3ADOA 4HQLA 4MAMA 4QPDA 4IGFA 2EKLA 2QB5A 3H3FA 4AY6A 4AC9A 4MR9A 1DC4A 3E9EA 1R9JA 2VJKA 4P7GA 2ZS8A 5HUJA 1T36B 1E4YA 3GMTA 4EGSA 3PNOA 1VYTA 4UDNA 2G83A 2HIAA 1X8KA 4L85A 1VXOA 3C45A 4AF7A 1PT5A 2D8MA 1DJNA 2POQX 2VC2B 2XODA 3IP6A 3LT1A 1MO2A 1WR8A 4PAWA 1GPNA 1R0WA 2Q50A 5ICFA 2DETA 1BRTA 1XNHA 3IPRA 3WDSA 4AL4A 3TSOA 4MHSA 1BXKA 4NBTA 3SZRA 1ISJA 3N8HA 3K72B 4ZWNA 1RQ2A 1E5TA 3EULA 2NSJA 3QMVA 3ZXIA 3PEYA 4JT9A 1NM5C 3AH8A 1NF9A 3ZWVA 3THYB 2DM6A 2VG8A 3A28A 4B6OA 1JSZA 2GYYA 5EJAA 4X93A 5JYDA 1UJNA 1X9GA 2UZ3A 2X5KO 3Q2KA 4EY7A 5JEEA 1BU5A 3AY7A 1FF9A 1VDMA 2VOJA 2ZYWX 5E7JA 2Y0CA 4CL8A 1IBRA 2FDXA 1SBCA 3FNBA 4X8OA 5ALZA 3AVXA 4BKPA 3JD0A 4JR0A 4E5VA 4HWKA 2NTJA 2X0JA 4TUYB 3G2IA 1ODTC 3LFTA 1YVUA 3S8MA 4A26A 5HF9A 2JI4A 1GARA 4LYJA 3E9ZA 5AKEA 2H5LA 2CJPA 3GGGA 1FTGA 3HA2A 4HG2A 5HQ3B 1F8FA 4LTMA 1I6MA 2EFDB 1OFVA 2PKQO 1L4UA 4NEQA 2P8SA 1L3BA 2HSDA 1NVWQ 3I09A 4YRKA 2GK4A 4MKRA 1R00A 3S28A 5A03A 4RHXA 1CX9B 3LCJA 3ON5A 1EFVA 2BMWA 3FWYA 4JXKA 4LZZA 3NTUA 4I6EA 2R2AA 3WBJA 3ESCA 2FLKA 3BRCA 3BF8A 4CL0A 4YLYA 4LIPD 2QM7A 1QHGA 1UPFA 3ZHUA 4NP6A 4ZP1A 1CEEA 5CLQA 5LKRA 3L8GA 1UPTA 1EQAA 4BZQA 4RENA 2JGAA 3F5DA 4RTNA 2GS9A 3QY9A 2OBFA 3DV9A 1EWRA 3OFNA 3OLCX 4Z8XA 1W1UA 4P82A 4HDMB 1SKYB 3RK4A 3K9BA 4DHEA 1KMMA 1T9HA 3RS3A 2PZGA 2TECE 3V4SA 1QV9A 1M6YA 4QGHA 1PFKA 2ZRMA 3DPIA 3HKCA 1I2CA 1VE5A 5TARA 3P4YA 1ZR2A 4BC1A 3O82A 3WKCA 2PANA 1XRLA 1MLDA 4FE7A 4NX2A 1O0BA 3RC8A 2Y0EA 3V1YA 1PZEA 4GX1A 4C7XA 3WK6A 3M49A 2AYYA 1PTJC 1QCDA 2B8WA 2ROQA 4Q3CA 5K3CA 3DD5A 2WTAA 3MT8A 4LTNA 5HILA 5TY0A 3HB7A 4CUZA 2HL6A 3R6TA 1NN0A 3QVOA 4PYIA 1B8OA 3OZFA 3TD9A 4BUJA 3QVLA 2VJOA 1GRRA 3WRVA 3CZMA 3K5IA 4QBKA 3RJ5A 4BKUA 2B25A 3ILHA 5F9HA 4FUTA 2MSDB 4M37A 1FS6A 2ST1A 3LL7A 3ESQA 5AVTA 4A2PA 4K46A 2KBFA 3MYYA 4X8LA 5AOVA 3C3EA 4NVRA 2H65A 4YTEA 2J5RA 3AIMA 2ATIA 2QSYA 4PX5A 3IUQA 3GG2A 3HP1A 5G4KA 1L7PA 1FS4A 1SCDA 1Q6ZA 2P2ZA 3RBZA 5JJKA 4MRAA 5B4VA 1Z4LA 1I3OA 3EA0A 3UUWA 3NR2A 2XGJA 3WGQA 4ROSA 3T1VA 2Z5LA 1D7AA 2BN4A 2QRLA 2WU8A 1JZSA 1HLGA 2F9MA 3U3OA 2C82A 3PVSA 1EFTA 4QC2A 2FKNA 2CVOA 2WFMA 3C98A 5ALEA 4ZANA 3KELA 4MO2A 4P7BA 3RS8A 3GPBA 3VZCA 2AFIB 1U81A 1A72A 3ZBPA 3LK6A 5EYPA 3VR4H 4MUKA 4BKQA 3KQOA 1AB5A 1IVNA 2X8JB 5KYXB 1BS9A 1Z7GA 4KFSA 1GGEA 1Q57A 4W82A 5FTMA 1VHDA 3AB8A 4I2NA 5AM2A 2QSJA 1LD3A 4X95A 1W47A 2AR9A 2CLOB 4DG9A 2B94A 3DAPA 4LBWA 1QGUB 1CFZA 2BFCA 4Z7JA 1NVMB 3QH4A 4RW0A 1IAVA 1B0ZA 5EIEA 1XTVA 3QXHA 3W3AA 3WWYA 1XJWA 3B9PA 1U9JA 1GNVA 3C6BA 3IH5A 4I3FA 4TTSA 5EHNA 2VHVA 3GLQA 3M4ZA 3OP4A 4MYDA 4X45A 3ZCUA 4DVGA 3DVLA 5M7EA 3RFTA 3DVRX 2WHEA 3A3PA 3CLUC 4R1UA 4Q16A 1JLSA 4TVOA 1IM8A 1ZVJA 3ZNOA 3KWLA 1L4MA 2F7SA 2VT6A 3TVYA 5LP1A 3U3MA 4Y1GA 2ZAOA 2GTIA 3DKIA 1XPRA 4R9UC 4PY2A 3DZDA 1XHLA 3GLSA 3L7AA 2QVGA 3GJZA 4WZAE 2BMDA 2P9JA 1K7CA 4MV0A 3VDXA 4CIXA 3NC0C 1MXFA 1IG0A 3AP1A 1VLJA 4OB8A 2QW0X 4IH1A 3UN1A 1JG3A 1ZLYA 2NPIA 1OXKB 2XQFA 4EI2A 1FMJA 4N18A 1DZ3A 1MOSA 3QHAA 1HETA 3N6RA 3MM4A 4JMLA 4L4RA 1M8FA 5A2GA 1QQ7A 3CE9A 3KALA 4GF5A 1X1EA 2DAPA 2IUSA 5G3ZA 3EIFA 1OGIA 1W6UA 3EEYA 4PAMA 1G16A 1PG5A 1NE2A 4NCAA 1Y4SA 3H87A 3MTAA 4IMPA 3TFOA 1E0JA 1G8SA 3F3SA 4LVCA 1R6AA 3EXIA 5KAPA 3T6KA 4B6SA 1NUHA 1QIIA 1AUPA 4QXQA 4L4ZA 1RTTA 4WXPA 2OBMA 5ADWA 5KYYA 3K71B 3UHAA 4PEVA 4MQLA 1MJFA 2W71A 2OCGA 1V2HE 2GTPA 3L93A 1UK7A 5ICCA 1FRZA 3BXHA 2FEAA 2EWVA 1P2UA 1SELA 5EJ2A 1DAHA 1C14A 1YRQA 2RFLA 3N2EA 1PW7A 4RBNA 4DFDA 5KOHB 1Q95A 1BMFD 2CD7A 5H5JA 1NP7A 2I0FA 2Q4BA 3QEJA 3ZU5A 4ARIA 2ZLBA 4EKNB 2ZJ0A 3A9SA 2CNBA 2ECPA 3IIIA 3LT4A 4EHDA 3W5DA 3DEAA 3JQ7B 3TOVA 2NZWA 3LNTA 1PZGA 1BS1A 2BFWA 3RS9A 2XNKA 3VR6A 4JP2A 4EHFA 4PTZA 5L4NA 2GKSA 1OVGA 5K8LA 4ZDKA 4BMOB 2FR1A 1TQ6A 2HRBA 5ALRA 3VVCA 5HIJA 2WVJA 3G2LA 5C8DA 1TEVA 4XH9B 1H22A 2YY7A 2L69A 2D1YA 3NHJA 2E55A 3R3ZA 4RA9B 4UDXX 4X1IB 3Q7SA 4AURA 7ADHA 3DO6A 2VP9A 3PFFA 1IY0A 2RB4A 3ASZA 5DTQA 5J2UA 1PVOA 1XCOA 1GKYA 3HB0A 1KPHA 3TR6A 3P2OA 4YP7A 3ECAA 1DKUA 1LBQA 2B30A 2DY0A 4LVOA 3Q88A 1DTSA 4IUDS 4URUR 4D8VA 1T8RA 2YXBA 2GPSA 4QYWA 3CPHA 4QLAA 2IPLA 2B98A 1T3LA 1GUBA 2PD4A 2V97A 4XB6B 4YASA 2Y9MB 2OVFA 4N5HX 5CDFA 3LWBA 4IZOA 1B26A 3GMIA 4UE2A 4JT4A 4DRYA 4UFNA 1CDEA 2XV1A 5CH8A 1UMCA 2QW1A 5EHGA 5FO1A 2GWHA 2PGIA 1JA1A 2B4KA 1W19A 1P17A 4A6PA 4CT0A 1CUHA 1UR5A 1X7HA 1YFZA 2BLLA 2HQ1A 3G1TA 5D3ZA 5B36A 4MRMA 5D7NA 3VBCA 3C5VA 2XNHA 4C21A 1ZOOA 5A9SA 3T3NA 4B5KA 4QNRA 3AJEA 2FETA 4FWBA 1RYDA 3A6EA 2V7XA 2JFZA 3KWJA 4KE7A 5AK0A 1ORVA 5LN1A 5IT9A 2PGDA 4LPSA 2FDCA 5EWJB 4RJ2A 5IASA 2D0PB 1WQ3A 3JWGA 5HBRA 1U3GA 1J0CA 1NQAO 2VJMA 2GZSA 8LDHA 4RZUA 3A70A 4ENRA 3OQ1A 1QHHB 3KAQA 4HAIA 4KPGA 4O4JB 1P29A 1J1ZA 5DU2A 2R9VA 5ADHA 5KNBH 3O8RA 1XBTA 2AG6A 2PS0A 2VDVE 3GRRA 3LKVA 4S1TA 1EIWA 2YQZA 4UUQA 2HJWA 2ONKA 4MV1A 4NK5A 3RS5A 3WFIA 1VKNA 3I6MA 3AJ9A 3KSZO 3W7VA 4N9QA 1KL7A 1DIOB 1RACA 2IF2A 4Z86A 2C8JA 1Y80A 5FOXA 3EGVA 4OKNA 5AJHA 1UXKA 3KKEA 5C7LO 1NW8A 1GD1O 1JLLB 3OJLA 1UQRA 3CTPA 5LQNA 2PZKA 1FSSA 2CLHB 2A0KA 1OR8A 3PRJA 3VV3A 1I10A 3W3ZB 1C1YA 2GASA 2YJNA 4B3XA 4O4LF 3JYLA 3LA8A 1KA9H 2Q1XA 3O3CA 4TV9B 1RI1A 1ZVMA 4EVIA 4DMCA 2ZXUA 1HLFA 3EEIA 4PFJA 4JCOA 4DV1B 4X6UA 3MJFA 2B8TA 2HDHA 4JB8A 3GK3A 3ESZA 2OZPA 3FX2A 3H0KA 3E9NA 1A9XB 2ZSJA 3TQTA 1D9XA 2I3DA 4RF5A 3HCFA 3TIXB 3FOEC 2BW0A 2FFAA 3HDGA 4ABTA 2O6HA 3ICOA 2P9FA 2A7QA 4J0GA 2WT8A 3GJ7A 1QFJA 4L3WA 1BWPA 3M5PA 1M5RA 3TRDA 3NDBB 5AKZA 2RHMA 2JCVA 2Q3JA 3FTNA 3IQXA 1TTPB 1DC8A 4ACBA 1JZTA 1UJ6A 1Z0DA 5HBGA 5JO9A 1DWPA 4HUTA 2X0NA 3WNZA 2FFBA 5AKKA 4PQEA 3PV0A 1T15A 2OWEA 3H5TA 3JQAB 2ZU0C 2AVDA 4LG1A 3I1YA 2A3NA 4NH4A 4Q02A 3V7NA 2JIMA 3KOMA 1U3CA 2NVUB 1K3FA 4I1UA 3IQGX 3G1UA 2ZT5A 4G0MA 1Y3BE 3DNFA 3N6VA 2Z56A 3TM4A 4WCFC 1TO1E 3BL8A 4V0SA 4IQGA 1ZH6A 3ZCXA 3EC7A 4IZIA 3ZS8A 4DNQA 1R10A 1DARA 3FSGD 1AKTA 4E2ZA 1AZSC 4NYJQ 5A06A 5AFSA 4LJYA 1RXSA 3MTJA 3B9RA 5KZMB 1BD3A 2H1WA 2DKOA 1CUXA 1AKWA 1F1BA 2GF9A 3HU2A 3C4QA 4YN3A 5KIAA 1O2DA 2IUFA 1YI0A 2RKBA 2QLMA 3KQPA 3SWWA 1QMGA 2XMSA 3H6GA 3HYLA 4PRLA 4EBFA 1KTIA 2E89A 1E5DA 1ZL0A 2B2CA 1BEEA 3FDZB 3P45A 2ZT8A 2BR4A 2EWMA 3HWSA 1L4YA 2FCAA 2LNDA 1DX6A 4FMCB 1V8BA 1M2VA 2QT1A 4GXTA 4YRAA 1N9GA 4HR7A 5FUVA 2FFQA 4TQAA 2NXCA 3DOFA 3ZWKA 4IH4A 1P60A 4UHBA 3AVTA 1N6PA 2P78A 3CB4A 4ZCMA 2O5CA 4BQIA 4IIFA 4V1CI 5JAPA 2CB0A 3ONWA 3ND7A 3QXGA 4GP6A 4O1MA 5TRTA 2LCQA 3H3JA 3ZU3A 4C43A 5LZ4A 2OZLA 3C8MA 1QVWA 3NP7A 4M1OA 4X54A 4J29A 2H18A 1AHPA 4B6PA 2EZ9A 2SNIE 3W9BA 3IUSA 3K0FB 1C3XA 4TPKA 1N2XA 5ES4B 5DWQA 3LUAA 2JAWA 4QXMA 2FW1A 3L4KA 3PX3A 5CVTA 3ETEA 1SKYE 1XLTA 4HFJA 3NDIA 1E94E 1DG1G 4DUGD 4EUEA 5D2CA 4XRRA 3AR3A 4R9SA 3VTFA 1B15A 2XTMA 1N92A 3DHEA 4FHEA 1TTQB 1Z2AA 1T9DA 1UFQA 1CNMA 1XZMA 3I45A 1ZJ4A 5JPDA 2NWQA 3WQSB 3TSYA 1R5NA 2YS7A 3F6CA 3RBVA 2QXUA 4AY3A 1U63A 2GNOA 4I99A 4AP6A 4LJ5A 1GAWA 1XVTA 2XUJA 3L82B 4FYJA 4OFWA 5IXYA 1G20A 3DKRA 1W5BA 4D98A 3IEVA 5IS2A 1QKIA 3PE3A 4LHVA 1Z7YA 1QP0A 4DV4B 2XUPA 4BKOA 2OHVA 3ABOB 4LDNA 4BU0A 3RQSA 3R3HA 1I1HA 4HDSA 4BNKA 2X4DA 4QTZA 4MQEA 4U7WA 1CUUA 4JLVA 4D6XA 4MWOA 3ZK8A 3IBCA 1XZFA 1EUDA 1TRKA 1E60A 2HXGA 3U1TA 1JHOA 3V80A 4P53A 1SO8A 1YCHA 4FCCA 5AK6A 4EY4A 5JTTA 2AN4A 1JALA 1OLXA 2FJ0A 3RSZA 1E58A 2DFLA 2EFCB 4RJKA 4EFKA 1Y0BA 4GGPA 1V8FA 1HUQA 3OBBA 4K6OA 4NV3A 4CM8B 5IABA 3ZWDA 4DNPA 3IODA 2A9OA 3QBVA 2F55A 5I4CA 1YWGO 1OFGA 1W4CA 5LBUA 1WXEA 3MERA 5EWMA 4G0WA 2UVPB 1NYRA 4AS1A 3VZDA 3RB8A 4L8FA 3L02A 5C35A 2FSFA 1MC5A 2FN8A 3G9TA 3T3EA 3IMCA 3PXCX 4N03A 4W5JA 2AFIE 4U2BA 1MC1A 4DIBA 1GIAA 4LRQA 5F77A 4D4GA 3ZZ0A 4TMWA 5SY9A 1OAAA 2VH1A 4C7BA 1RXWA 1K6EA 1FQOA 3JAKB 5IYZB 4D6PA 1S8NA 3EVCA 1EGAA 1RHUA 3F5FA 3PGLA 3UK2A 1PR5A 1YCFA 2YWRA 2IY7A 1LX6A 3N76A 3O83A 3BAZA 4PFKA 1EX6A 4UEQA 5ARDA 3HCAA 1QHNA 2ZXEA 3FOFC