4ECEA

Crystal structure of purine nucleoside phosphorylase (w16y, w94y, w178y, h257w) mutant from human complexed with guanine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
282
Chain Sequence
GYTYEDYKNTAEYLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANWEEVLAAGKQAAQKLEQFVSILMASIPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
publication title Catalytic Site Conformations in Human PNP by (19)F-NMR and Crystallography.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4eceA00
1OVGA 4UC0A 1N3IA 5F77A 4LNAA 1B8OA 1OV6A 1PF7E 1A9QA 2OECA 1Y1QA 3ONVA 1ECPA 4GLJA 3FAZA 3FNQA 3DDOA 5F73A 1Y1TA 4PR3A 1LV8A 3NM6B 3NBQA 3KUKA 4TXHA 3FWPA 3D1VA 5F78A 2PGAA 1JPVA 1WTAA 5F7ZA 5I3CA 1T8SA 3OZDA 2AI2A 4TTAA 4L5CA 5B7PA 1CG6A 1V45E 5CXQA 1B8NA 4DA8A 3F8WA 1TGVA 1A69A 1ODKA 1RR6A 5DK6A 3UAVA 1M73E 1Q1GA 1RCTE 3QPBA 3K8QA 1Z33A 3DP9A 4OJTA 2HWUA 1T8RA 2Q7OE 2QTTA 5F7OA 3TL6A 4D98A 1TCVA 1RXCA 4L5YA 1ODLA 4LZWA 2BSXA 1JDTA 4WKPA 1ODIA 1A9PA 4E1VA 3FOWA 4QEZA 1ZL2A 1V3QE 4JP5A 4OEHA 4LNHA 1V48A 4MCIA 1XE3A 3SCZA 1YQUA 4LKRA 5K1ZA 2A0XA 2QDKA 3OZCA 3UT6A 1RXSA 4BMYA 1ODJA 1Z34A 1A9RA 4WKNA 4DA6A 3KVYA 1JE0A 1LVUA 3EMVA 4DABA 3OPVA 3PHBE 3BL6A 5CXSA 1CB0A 2XRFA 3DF9A 3FUCA 5B7QA 1JDSA 4BMXA 2QSUA 3NM4A 1ZOSA 3IOMA 4OGLA 1Y6RA 4OY3A 1PK7A 4DA7A 4YO8A 3EUFA 3ENZA 3EUEA 4IP0A 1Z5OA 4NSNA 2OXFA 1RXUA 4G41A 1Z36A 4F2WA 2AI3A 1A9TA 1T8WA 4TS3A 5EPUA 4DAOA 4NS1A 3LGSA 1PR5A 4F2PA 5JPCA 4QAQA 4TXNA 4YNBA 3UAXA 3BSFA 3EEIA 5CYFA 2GUWA 3MB8A 4BMZA 4I2VA 1U1GA 5FAKA 3PNSA 1TGYA 3NM5A 3KHSA 1C3XA 3ODGA 2ISCA 1VHWA 4QATA 1SD2A 1VMKA 1SJ9A 2RJ3A 4U2KA 3OZBA 1RFGE 4LDNA 5IU6A 4PNPA 2I4TA 4JWTA 1JE1A 2AI1A 4GKAA 3GB9A 1PWYE 2H8GA 4M7WA 3OZEA 2P4SA 4M3NA 4TTJA 2IQ5A 3U40A 3T94A 5F76A 3OCCA 3KVRA 1PR2A 1PBNA 3DPSA 4DANA 1YQQA 1NC3A 4M1EA 4WKCA 1QE5A 4JOSA 1VFNA 4OGKA 3FB1A 3BGSA 4F1WA 1I80A 3E9RA 4EB8A 1Z5PA 1SD1A 5ETJA 4L0MA 4G8JA 4TS9A 4TTIA 4WKBA 4GLFA 1JYSA 4MCHA 1JDUA 4YJKA 1ULAA 4F3CA 5B7NA 1U1CA 5EUBA 3P0EA 4D8XA 5CCDA 3UAYA 3IEXA 1Y6QA 1PR6A 3LBAA 1TD1A 4QFBA 1OTXA 2QPLA 3MMSA 4K6OA 1SQ6A 2A8YA 2A0WA 2ON6A 1T8YA 1K3FA 4ECEA 1LX7A 1V4NA 1T0UA 1VHJA 5C80A 1OUMA 5F7XA 1NC1A 3INYA 4OF4A 3O6VA 1U1EA 3O4VA 1V2HE 1YRYE 4NY1A 1YR3A 4R2XA 4MARA 1PK9A 3DJFA 3KVVA 1Y1RA 4R31A 4KN5A 1PW7A 1RXYA 3BJEA 1RSZA 1OU4A 1JDVA 3OOEA 4DARA 4H1TA 5CYGA 2AC7A 2B94A 1FXUA 3P0FA 1Z37A 4P54A 3KU4A 4D9HA 1RYZA 3K8OE 3LA8A 4X24A 4R2WA 5EFOA 4DA0A 1U1DA 2I8AA 5CCEA 4D8YA 4L5AA 1A9OA 1YBFA 4QARA 4DAEA 1U1FA 1PR0A 3E9ZA 4FFSA 1PKEA 4TXLA 1NW4A 4QASA 2OC9A 4RJ2A 4WKOA 4BN0A 3OF3A 3PNPA 1RT9A 4EARA 4D8VA 3OOHA 1Z5NA 1PR1A 3C74A 4F3KA 1V41E 1K27A 4G89A 1Y1SA 2QTGA 1K9SA 2OC4A 1JDZA 1A9SA 1Z39A 1PR4A 5B7GA 3E0QA 1G2OA 3PHCA 2HRDA 4TXMA 1OTYA 5KB3A 3GGSA 3UAWA 1JP7A 1ULBA 4YMLA 1Z35A 1TCUA 2HN9A 5IFKA 3UAZA 2HSWA 4TYMA 4GMHA 4L6IA 5F7JA 2A0YA 1Z38A 4TXJA
chains in the Genus database with same CATH superfamily
1FYVA 1OZAA 1USVA 1Q2XA 1F51E 4I36A 4NFSA 5D3ZA 4CMEA 2E89A 1RHMA 2DBQA 5KYWB 3N2GB 1A5ZA 3OA0A 2XXAA 2RH9B 2DKFA 5DNYB 2BBTA 3RS9A 3U3JA 1U4SA 3RJMA 2W8BA 5C1DA 1OV6A 3TOXA 4KAXA 4D9NA 3PR2B 3ICPA 4H27A 4G67A 3EJ6A 3VGJA 5JDIA 1NVMB 2I7CA 2RHOA 4FEGA 1BMTA 3OEHA 2WD8A 2XYGA 3NEPX 5BNWA 4HWRA 1XA4A 2CBZA 2NT4A 1P1JA 3K5WA 1C2YA 3QUAA 4OVKA 5HZHA 4L07A 5EZYA 3RHSA 5DF1A 2AJBA 4F8EA 4H7IA 1YV9A 4JJFA 3H05A 3PPVA 3U62A 5BW4A 1G20A 2VQ6A 4LRWA 1TJNA 3ZQ6A 4PO8A 3PL5A 1KIMA 5KSYA 2FUG1 4GW3A 4D3YA 1VL6A 5F4BA 1WBDA 1ZK0A 3PGVA 3DKKA 1E1RA 1GGJA 4G85A 4ARCA 3F6CA 1QLWA 4WZAA 4BV2A 2Q5EA 5AK6A 4LBWA 4EDHA 3WGMA 4LXXA 3KSAC 6LDHA 3A9RA 4HWTA 2D06A 4JUIA 5C8VA 2W4QA 3IP8A 4MGZR 4Y1EA 1C4KA 2YV2A 4QOHA 4YWJA 2VCYA 3FOZA 3WGHA 3I01M 1W36D 1EVQA 4DJFC 3BXPA 4PANA 1V45E 2FLVA 3GFRA 2AYZA 2VZ0A 1ORVA 3NHYA 1E7RA 1H2HA 4DIEA 1ZD9A 3A6ZA 4XOUA 4OQFA 4YJGA 5ALGA 2REXB 2BMAA 3A04A 2PUEA 1JGTA 4WJKB 2VQ3A 1PUJA 3R8XA 3SJZA 1XPOA 4YK7A 1HEUA 1DXHA 2PBLA 4CL3A 3GLIE 4PYRA 1QB7A 3U26A 3RUAA 1LDBA 1PL8A 3ABZA 3IJRA 2XDAA 4DN6A 4W5TA 2OORA 3LM8A 3HN2A 4N01A 5AJWA 2MCFA 2FTKE 2KI5A 4N6OA 4PF1A 5BW6B 2AG8A 3TQIA 4FR2A 1E9RA 2J59A 3HBFA 2R00A 1O5IA 4DIFA 3U81A 4RF4A 4O29A 1X1RA 3OLVA 4CKWA 2GCOA 3LQ2A 2XSZA 4JVLA 4LZWA 5CM2Z 4JXKA 1XAJA 4KUGA 4LRSB 4YT2A 4RK4A 2OAEA 1H2RS 3A7EA 5KVCA 2H4JA 4MVJF 3CPSA 3VKWA 2LIVA 4W8HA 4D43A 3H5VA 2O48X 3L8CA 3HI6A 3F3YA 4WGGA 4B74A 1RVDA 2EWWA 4XVQA 2GN9A 5ELXA 2B61A 2QZSA 3BCUA 2HHHB 1JXQA 5IN4A 4K9KA 5EQJB 3T3DA 4JP5A 4LY9A 3GFBA 4QJBA 4Q7KA 3G1UA 1DRVA 1ZAYA 1E1RD 4DEXA 3RC8A 3T3IA 4QXAA 3N8IA 3ELWA 3ICWA 1V6CA 1ZEMA 3MRVA 4UVEA 5E3HA 2EF1A 4HNAB 3ZTTA 2DUMA 4PX9A 3KQMA 2F8SA 1GGNA 3ROEA 2CBXA 5KTPA 3D6TB 3VDQA 1IEXA 1VRCA 3HG7A 1GPMA 4M0PA 5AM3A 1L7QA 4UAJA 2V1XA 4EUHA 1A9RA 4W6QA 3KTAB 2XZOA 3AEUB 3KVYA 2NUPA 4PZCA 2ZVJA 4UULA 4UU1A 1WABA 3MD9A 1L8AA 1CZLA 3QLUC 3DOHA 4RY9A 1IQ0A 1R3DA 1VXRA 2HOQA 4H1VA 4MUJA 4DRXA 3UV7A 1NA5A 4HVCA 4C89A 4IKOA 4MWGA 3ZDQA 2NUBA 2C98A 5HXAA 4X8LA 5G0TA 4CIXA 2H2FA 1WTCA 4PIPA 5IJ0B 3K7EA 2DR3A 3MLBA 1CB7A 1TC1A 3NM4A 1DAEA 1HA3A 1QWSA 3H5IA 4QYMA 1K5DA 2YMMA 2GM4A 1QTQA 5ALRA 4ZICA 2O8DA 2BGRA 3DEHA 4NVRA 4J1TC 2OZVA 3QEJA 4N49A 4ZCSA 1M2OB 1HX7A 4HSGA 3SJBA 1IHYA 2AMFA 4MYRA 1OAOA 2O9JA 1ML3A 1P4SA 3EVFA 4WZBA 5ECYA 2V8BA 4FFDA 3MM4A 4GF5A 3NIGB 3RYTC 4M1TA 1TKCA 4G8CA 3W9SA 2CXUA 9GPBA 2Y1OA 3GPCA 4FYMA 3OEWA 5FQOA 5KYYA 4LDJA 1IZ9A 5BN3B 2ATIA 4S2EA 4WNIA 3BZUA 2J0UB 4RZIA 5HJ5A 4I1PA 2QL7A 4X20A 4BNUA 1X14A 3IMGA 3PQ3A 4ZA2A 3DVAB 3K3PA 5ICCA 4KDFA 5LSAA 3VNAA 2Z9DA 1PR5A 5F3DA 4XYGA 3JPYA 1WF3A 4ND8B 3PQEA 3F6SA 3U0BA 8OHMA 2D2IA 3GLFE 2I4NA 4Y9RA 4JOCA 4CLRA 4LE2A 4NBUA 1PU2A 2A92A 4FKMA 4M88A 4R5MA 1WB4A 3ZZ1A 4DLLA 2H5EA 4YAKA 3GD7A 1UZUA 1XEAA 1DV2A 1ZUNB 1FEZA 4IILA 2A1TR 3IDZA 3WLIA 3GWZA 4LOAA 1WHSB 1RVV1 4PSVA 4TM7A 1HE3A 4OLAA 1QH0A 5LP1A 4LQCA 2AOTA 3ASZA 5F5XA 5FTKA 3UWOA 4UOEA 4RZQA 2BHRA 5K01A 3KRTA 3UPTA 3B2EA 4OKSA 2VAPA 2LV8A 2VRBA 5KAMA 1Y1PA 3PEVA 4QYXA 5HBRA 2VF4X 4FSHA 2QRUA 4JASB 3FA2A 3X1MA 5K3BA 1CJMA 4ZCPA 3W3AH 5AKIA 1WMFA 3VHXB 1SVNA 2B8EA 3ETNA 3F78A 3REOA 1XMQB 3KAKA 3TGPA 1K0FA 2EFEB 4HL6A 1X2BA 4AG5A 5JCPA 1UBLS 5K8LA 4H9GA 2CEKA 2PAAA 3WLFA 2ZT6A 3VPSA 4YRNA 1LB1B 1K4KA 1SD2A 4XFJA 1NXVA 4HDNB 4XYMA 1WUJS 1ZG3A 2P9TA 3F6BX 1YZUA 1KF0A 1BEUB 1RCUA 1U2EA 3JD3A 3R4VA 4KQFA 4RKYA 2OO7A 3RFCA 1HXHA 3CKKA 1FZTA 2VJQA 3ESAA 4MVJM 4ZCLA 2IIQA 2ZS8A 2GD2A 3KDPA 4ND5A 3TTVA 3ROGA 4P1ZA 4BN5A 4HVLA 3HKCA 1Z4PX 1JJ7A 3I64A 3QLVC 1DXYA 4MO9A 1N33B 2J9FA 3A9CA 2FMFA 1L5SA 5ALHA 3TNDA 3DONA 2WSSD 3LP8A 1XJCA 3PTZA 4KXYA 2AG0A 2FSVC 3FGZA 4ND2A 3I5YA 1P17A 3NKVA 3I4FA 3H18A 3L0PA 1QGOA 3EZXA 5WRFA 3ICQB 1CEEA 1PWYE 4YYEA 2BM1A 1KZ6A 1P5ZB 8AT1A 1AZTA 1M6VB 4QELA 2C2GA 1V8BA 3BD9A 5I8WA 5TQ0B 1XGKA 7ADHA 2VHUA 3JQEA 3ABIA 4GH5A 3CPJB 3H1FA 1FDIA 5AW5A 2WYWA 2QN1A 3ETDA 3QOXA 2VUUA 1ZQ1A 3TRFA 2BDUA 4C4TA 4JQSA 5I9SA 2FUCA 3TPFA 3UGQA 4WLNA 3G2LA 3P9IA 1KJ8A 1UAGA 1MLDA 3BXHA 4BWFB 4EY3A 5E6RA 1RQ2A 1VM6A 2X41A 2AFVA 3OI7A 1VPEA 4BJ5A 4C7XA 5I6DA 2NZJA 3TLMA 4BP8A 3N3BC 1RLTA 1J2YA 2PKXA 2QX7A 2YIVX 1UIRA 3PENA 4P31A 3U13A 1EDZA 1M0SA 1PEDA 4MMYB 4QWMA 1K7EB 1ABBA 2WHYA 1O77A 3LRPA 5DMXA 1CQZA 2XQKA 4BLSA 1E3SA 5KSZA 1CDDA 2PMBA 2B78A 3DF7A 4KKVA 2BP7B 1G8MA 4MW2A 1LQ2A 1T1RA 2B1IA 2F17A 4EGQA 4DWWA 3K70B 1VB5A 3ZLTA 3A2MA 1WD5A 4U39A 4DQKA 1FMTA 2PZKA 3PYLA 4TRMA 1UC9A 4IVQA 4JI3B 4DV1B 1MO2A 1S1MA 4EG3A 2FDCA 3EFOB 2VCEA 5F9FA 3Q4GA 4DLBA 1V9LA 2R1UA 1FJXA 2JRLA 1N5OX 2GOYA 5TDHA 3S55A 3B6ZA 3A06A 2VJYA 1KDVA 3SXJA 5A7FA 4HADA 1WSAA 2AX4A 4YALA 3STUA 1XZAA 2G3YA 2CVFA 4QFMA 1KA9H 1Q19A 1YCFA 1N3LA 3GPIA 3IDQA 1L5VA 3LUGA 4MZXA 5A4KA 1P60A 1XD9A 4UHBA 1ORHA 2HIGA 3TE7A 3E7XA 5B64A 2EZ9A 4HNQA 3FUXA 3WGTA 5JYEA 1W5FA 3FTDA 2WUDA 2BR5A 3TUIC 1CFJA 5GZ3A 4DG8A 2YXDA 5BYKA 4MJLA 2G5PA 3T5DA 1EB9A 4MA5A 1XTRA 5T57A 1X8LA 2PNFA 4JLKA 2ADFA 3MJTA 3B20A 3AG6A 3QPAA 3R0XA 4J0KA 4O4JF 3QFSA 3PBKA 3UHJA 2J3IA 5FEUA 3IV6A 1AIPA 1RPTA 1NT4A 2ORWA 2ZXUA 4LMRA 1ES9A 4UHKA 1C4OA 4C88A 1N5MA 5GONA 3AFHA 2OV1A 5ED4A 1FVOA 3HR8A 5EVJA 3JZIA 3EIQA 2NLOA 1M9NA 3P9CA 4NNPA 4TSRA 4DWJA 2DSNA 3A4MA 1OYWA 1U94A 4HNGA 5I8ZA 3SXPA 1QO9A 1AX9A 2IGTA 2O3TA 2WYVA 4R7GA 1ZGZA 3ETLA 4HEHA 3VNVA 3H16A 1B0UA 5L53A 5BV0A 3KQYA 1F4LA 1O97D 4P5DA 2A57A 4UU7A 5LPNA 1FXWF 4LG1A 9LDBA 2YN2A 3W9UA 1FTWA 1YMVA 4OX9Y 2QD3A 3DDHA 1V4NA 3PR1A 4O3FA 4BBPA 3G5UA 4IIJA 2OD7A 3FYSA 1YR2A 4HDCA 4TLDA 3WQHA 2WKSA 4AT1A 3BF8A 3UMGA 2C9OA 2V03A 5BRNA 4YRCA 5ALWA 1H65A 2HTFA 3CUTA 1JR4A 2UXDB 1TKBA 1Z5GA 5EN4A 2VRNA 3P0JA 5ARDA 3T0FA 2MSCB 2J07A 4PG8A 3L7BA 1ZRMA 1YRYE 3RBVA 4AF7A 1M2EA 1WD7A 4DCSA 3DMYA 3A4NA 3T52A 4DR4B 2WP8J 3EGVA 2PPVA 2H1VA 1MC1A 4XDHA 3R7LA 2PSJA 3ZVMA 4NQRA 1E77A 2R8ZA 1FMLA 3V00A 1DWPA 3H9BA 4LOIA 4U7WA 3ZHSA 2Q4BA 1NBAA 3UJDA 2IOFK 1EUYA 4LF9B 3O3CA 5F64A 4CDNA 3GXOA 1K8XB 2YINC 1A1VA 4BUCA 2CDRA 1SKYB 3PQ2A 1DKPA 3I76A 2CMDA 1I51A 2DQ4A 2PJZA 5DNVA 4NPHA 3ZWQA 3DDUA 4FMDB 2Z08A 3KU4A 3T9AA 3CVYA 2KLHA 2QG9A 10MHA 3NBUA 4U9HS 2IP2A 2EOAA 2O2GA 4NULA 2YFYA 1R64A 2RGAA 5IWAB 2E87A 1JWAB 1GR0A 1FSGA 2GILA 2YHIB 2ZAYA 4CFZA 5J4YA 1CUGA 2DBZA 1GV1A 3I30X 2NPOA 1L1QA 4MV4A 3KQHA 1G8KA 4BP1A 3T0GA 1NP3A 2I99A 4JLBA 3V4ZA 5C5IA 2QENA 5CEJA 1VJCA 2F4VB 3KJXA 3R09A 3EXG2 2UZ3A 4HNUA 3LOUA 3PEFA 3SF8B 1E92A 5M7EA 4JLUA 4GBMA 2PSDA 1XMPA 4MLDA 3WWEA 5EIXA 4Q3OA 4ASUA 4PG4A 2FZWA 4QASA 2CB0A 2REOA 3SHQA 4V39A 3OQIA 4ZJZA 1MEJA 2VVTA 1S2LA 3KOXA 1BIFA 1AG9A 1B74A 3WQQA 1N3YA 3FSGA 4QGAA 4CQJA 4C6RA 1RRCA 4J7AA 4AUEA 3SBEA 3HA5A 3NMUF 4OBWA 1QIMA 3ND5A 2XI4A 1Y9AA 4E03A 2FWNA 3JQRA 3FN4A 5KNDA 1KZYC 4AMZA 5D5QA 3N5KA 2VJNA 3LVRE 1UQRA 2EQAA 5JXHA 2FW6A 3KKMA 4P4LA 4LGMA 2HRBA 1RQLA 1WSBA 2ERXA 2QTCA 1RLJA 5JMWA 2D1YA 5LOVB 1C7QA 4FZJA 4HWOA 4HXFB 2G9NA 2RB4A 1BXZA 1WZ2A 3COYA 1F5NA 4F8JA 4U2FA 1JFVA 2C2KA 4DQDA 2GO1A 3CVVA 2VK4A 3KYJB 4DKJA 2B6HA 1JTFA 1Z0DA 3AEQB 4YP9A 4YDRA 4BB5A 1FA9A 2GH1A 4EP1A 4QAJA 3DE6X 1P91A 1TVKA 1AKRA 2GERA 2P65A 3TOSA 2AXNA 1R27A 5E7JA 3ERCA 1TYAE 3LT0A 3ILSA 1C7EA 7ABPA 3N2LA 1Z28A 5CFLA 1TEHA 1CBUA 3CZ5A 3QWFA 4Z5XA 1RBMA 2OBYA 2Y77A 2PJRA 2W6IA 3S2SA 2JFUA 2C1EA 2CYCA 2NT3A 3IQFA 5HA5A 1D6NA 1MC4A 1E7MA 1ZI6A 3OTQA 1KI3A 4NZMA 3DZ8A 2CY0A 4JMLA 4Y9TA 2H8KA 3KK0A 1OWMA 1M2VB 3ZV7A 3L4JA 2EFHB 3TTSA 1Z7GA 2R751 3ODPA 5J47A 2GF9A 1T5TA 4ASUD 3I6ZA 2HKIA 4BEVA 5A02A 5JHGB 2AFIE 2AJCA 3PQ8A 2I3ZA 4FQ8A 4YCJA 1FL9A 5F77A 2F1RA 3BIOA 4C5AA 4TQ9A 3UCFA 1E9DA 2H06A 4I1VA 1X74A 3FSGD 3SX2A 4BLOA 3KJQA 3VKUA 1PF7E 3PL1A 4PO9A 3ZWDA 2O50A 3SSAA 3FCXA 1TZKA 3PU6A 4QGSA 5KNDD 3FW1A 5AYVA 3EQ7A 1AMUA 2R47A 1UMBA 3BC1A 1Y1QA 2OK8A 5JQGA 4GQAA 2Q9BA 1A97A 4OG2A 2YY6A 1KPHA 4DMMA 3HGMA 1GA4A 1P77A 3DD1A 2ZBUA 3EVTA 4LPKA 2Y9PB 4IQ8A 4KOAA 3A1DA 1ZLYA 1V8FA 2QX8A 1LI7A 3OPYI 1R12A 4RKRA 3VKGA 2VZ8A 5D87A 2XNJA 4C5BA 1LY1A 1WNFA 4DNXA 3WKAA 4ZCIA 3GRAA 1KZ4A 4P6VF 3TW8A 4EOGA 1H1LB 1Z2PX 1NKVA 3HGQA 4BQOA 3FWPA 1U0FA 3THWB 1Y0BA 4LDAA 2PGAA 4GL2A 1VLQA 4RDIA 3TQFA 4B4UA 2RKWA 4D0LB 2OA0A 4EK9A 1FP7A 1ZVVA 1DC4A 2L18A 4HLDA 1S8OA 1TMOA 4BRZA 2EW1A 3MOSA 2G72A 4YCNA 4QYSA 2VXOA 2JCVA 5IDVA 2W8BB 3D2BA 3FE2A 2MSDB 1WDMA 3OZDA 4MWDA 3E9QA 4RFVA 2V3CC 2WUVA 2ZRLA 1VHDA 5J63A 1T10A 4CIVA 1HT3A 4B4KA 4A2WA 5CLFA 4NYMQ 1T1GA 4NENA 3SFZA 4BFYA 3O5AA 4F84A 5EZYB 1CYDA 4QNRA 1A69A 2GSWA 3CF4G 4W5RA 3AEZA 4I5GA 4NOLA 3F1LA 1VLLA 3WP0A 3ZGOA 3USCS 1K6IA 2ZZKA 2O4UX 5JS2A 4ZVPA 1O94A 3OSUA 2JLYA 2UUCB 1MABB 2XD9A 1MVNA 4G5RA 2WFLB 5IJWA 4QOJA 2QTZA 1NRWA 1PWEA 1WVMA 1RLMA 4EI9A 2HLNA 1ONNA 2VJMB 4ETIA 1OASA 4RYDA 4WZAB 4TRJA 1XYGA 4V03A 1K9VF 3U7QA 3NG1A 4UOQA 2ZBEA 4BWGA 4KVFA 2HHJA 1WB5A 2WSYB 4AG3A 2ZKIA 3LPNA 3Q5DA 3AP1A 4G5HA 4KXFB 3ELDA 2GZDA 4IQ0A 1VPLA 4YRFA 4DM7A 1NG9A 3GLVA 1XK7A 1OX4A 2UDPA 4PAMA 2IA5A 5IULC 2BF7A 1ZY2A 1XROA 3CRVA 2JAOA 1MC8A 1QG4A 3IPCA 4NH0A 5AM4A 3M3DA 3IMFA 2FPLA 3ZY3A 3X2FA 1P3JA 2WDPA 2Q46A 1N2CE 3SQNA 3U3KA 1TAUA 3B5JA 5AO9A 1TADA 3EXFA 3JQGA 2RDMA 4UCXA 3RLIA 1NHGA 1YOBA 5CB0A 2OFFA 2HSGA 3BDAA 3DWIA 4XCQA 3H11A 4RFLA 1P1CA 1HFJA 2QMHA 2CLHB 4YP7A 5J59A 4CM4B 5BVHA 3IUMA 4E70A 1GG9A 5EVCA 2OAQ1 5LM3A 1QTIA 1YZFA 2WAXA 4LSGA 4RLHA 4GPZA 2X23A 4LRTB 1PD0A 1W1IA 4WI1A 3E22A 3GVCA 3V9PA 2PH5A 3CLRC 1PTKA 2PGDA 1MV8A 2RHJA 1NYRA 1JV2B 1PRYA 1VGRA 2HRCA 3DUWA 3EIEA 4JP1A 4L02A 4Q4AA 5E9JA 3RIXA 3KQPA 3FTEA 2WP0A 1XL1A 4LE1A 4C4RA 3M5DA 4CKWB 3KTDA 2BFEA 2GCOB 5E1DA 4AJNA 3G8BA 1KAMA 5BR8B 1U2DA 1U80A 3EGWA 1VDMA 5AJXA 1DQYA 3HSYA 4K8RB 1ND5A 1WDLA 1YBAA 4DMGA 3ZWPA 4WWHA 4KQEA 2PL9A 4AJLA 4UATA 5KNCD 3G79A 4RGVA 5F1OA 3ZCVA 2QBYA 1RMTA 1Z2AA 4Z9AA 5EWMA 4R69A 4EYEA 4RJLA 5LJIA 1K6EA 3INGA 1HPLA 2C1ZA 1YB4A 4FWIB 4Q37A 5LA6B 2Q7DA 3U80A 5A03A 1LPOA 3CFYA 4XQEA 1A9XA 2YKGA 2BFMA 2D54A 2YRFA 4XSHA 1ZNYA 1GR1A 4KN9S 2IDZA 1B0ZA 4CDRA 4CODB 4X65B 3PE6A 4TTPA 4A9AA 2IW3A 2J3QA 2POQX 1SR8A 5DTJA 4BO2A 1BDBA 5C8ZA 4G41A 3KOOA 4I0WB 1HRDA 2IF2A 3HVHA 1FYFA 2AI3A 1M5UA 3HHPA 4TVBA 1UDBA 5ALVA 1Z8DA 1RQ7A 4HWSA 4HAOA 4LY0A 4CCYA 2ZROA 5AW2A 1X0VA 3FJ1A 4MRAA 4GKJB 1V37A 2WZBA 1TQ8A 3VXKA 2A1IA 4MI1A 4URXR 3KSZO 3A10A 4NBKA 4K26A 1T36B 5G4KA 3S70A 3R24A 1AN0A 3LGSA 4HHEA 2PSEA 2JGDA 4XCXA 3V9AA 1IPHA 3U3XA 3NDPA 2I9PA 2D3TA 1N0UA 2AXQA 1R0XA 5AD1A 4TKZA 1XRQA 2BKAA 5CYFA 4F1KA 1NJ1A 1ISRA 3KKEA 1EZ4A 2BCGY 1P62B 5F5LA 1QYVA 2ZRAA 2X3FA 3EVBA 3LPMA 1L4LA 1P3Y1 3T7TA 3QW2A 5C51B 4KE6A 1GARA 2IYRA 3AF5A 1E8DA 4NBTA 1W0JD 1RCFA 1GPAA 3DCYA 3JD2A 2Z8XA 3KV1A 4J1TA 4UAUA 5FWYA 4B5KA 4CV1A 1GPLA 3U5TA 2O54A 2Z58A 1MXHA 3Q5GA 3AF2A 4X6YA 2EAUA 4F8YA 1OBFO 2VDVE 5EE9A 4QTXA 4E33A 5BUZA 5LLTA 2CT8A 2OHGA 3ND9A 3OFSA 5E95A 4B6PA 1U0LA 5J1SB 3WRVA 3DXZA 1A8PA 4DCCA 1TQDA 1NI4B 1OV4A 3FTFA 2N75A 2EJUA 3KE8A 4UHDA 1TLFA 1D2MA 1W46A 1OHHA 3AHCA 3D6UA 3FMPB 4O4LA 1G5HA 4R8LA 1XYVA 1ZM3A 3VR6D 3VR0A 4ZPJA 4YR7A 5LWHA 3DEKA 1IBMB 3BMQB 3UFXA 1OYOA 1WUIS 4TLLB 4ZQFA 1BCRA 4WK6A 2CNDA 4BNLA 4J03A 3HYSA 4CL8A 3ONEA 4CLRB 4YEDA 3GNLA 5L9AA 1WXXA 3EPHA 4W8GA 1LSOA 2OHHA 1IJFA 4IQFA 1H2YA 2A94A 3L2OB 5C8XA 4RIEA 2I7VA 4YJFB 4DT1A 3EHDA 3H2BA 2OCPA 1J8FA 4O0LA 2WUGA 2AOTB 2IRWA 3B9RA 1QHHA 3I73A 1KTVA 3GB9A 3KHUA 2CMFA 1L7BA 2LRHA 2XKKA 2Y2VA 4Y2GA 1R6XA 4EAAA 1GPWB 2IPLA 4MULA 1JHPA 1E69A 1G5RA 4QECA 1RP1A 1KDZA 3T12A 1LCIA 3P7MA 1SULA 4EX6A 2L19A 5A5EA 1RHUA 4M3NA 1GD1O 2P11A 1ZCBA 2BMWA 2R8XA 4LXIA 5D6OA 3TRHA 3NI2A 2AWNA 1R8XA 4GX2A 1Q0PA 1QHNA 1ZSVA 3JQ8A 2GHIA 1NQUA 3DHEA 3KVRA 3UB2A 3PNYA 4II2A 5I7OA 4Q1EA 5ALFA 4ZD6A 4MRMA 2ONZA 3WLPA 1ZNZA 1KBOA 2OQRA 3DOIA 3EZFA 3O8NA 1GNRA 2JCSA 5K51A 3VYTB 1SUBA 4Q4JA 4PSKA 2QL5A 4D4GA 3I04M 2C7GA 4M8NE 4MUKA 2J9FB 2ODPA 4HYYA 2FZ4A 3INNA 4ROTA 3OKCA 4YLGA 1IM5A 1C9JA 1QE5A 2FN9A 4FN5A 5T64A 2PMEA 3FPSA 2J6CA 3FWNA 3AY0A 1C1XA 4CT5A 6Q21A 3L0ZA 3E9RA 3LUPA 1BW9A 4L76A 3C97A 2C2OA 4PE5B 4U7GA 1R9GA 5CH3A 3T0IA 4EB8A 1BA2A 1XDWA 3FCOA 1RHQA 2XLBA 2D4HA 3Q7IA 2UXCB 2WJYA 2R4TA 4UDXX 3H1AA 1E4EB 3MBOA 5KHAA 4GBJA 3WYCA 1VC2A 4RTLA 3QTLA 3V32A 1C9MA 4ALIA 4UOZA 4QQKA 2I2BA 4JYCA 2F62A 4YUVA 3ZCTA 3V8RA 2QVCA 1SUDA 4ITUA 4KN8A 3IIJA 4XH9B 4XSGA 3RVJA 3AF6A 2QRNA 2H07A 4ETWA 4WLUA 2QI9C 4KCGA 1AF7A 1QG6A 2J7PD 2NTVA 3E15A 4HDKA 4K7JA 2OILA 4L9SA 2BKLA 4RMJA 1U3VA 2WW8A 5E6RB 1Q14A 2H1FA 8LDHA 4RKWA 3D0OA 3FKSA 2CF6A 1I7NA 3HMKA 1HLDA 5J1TB 5A0TA 1F2VA 3FHCB 2Y0CA 1YVPA 2V4MA 3LBIA 1XZLA 4XAQA 2HSJA 3VGPA 1YMQA 1NSYA 3D4PA 5LQMA 1XZNA 1P5RA 3QX9A 1R16A 2B4AA 3JVDA 3QPCA 3ZWKA 1JH9A 4L8FA 5CA0A 3Q3IA 1DT5A 3PC7A 3Q8KA 3VM6A 1PVVA 1CJVC 2HNBA 4NIMA 4G0XA 4IRUB 1TD1A 4TZKA 1YR8A 2BFBA 3QSYA 1IG3A 2BMVA 1M0WA 1VRWA 4CF6A 3LQ1A 1IVYA 1R9MA 4DDMA 3GBPA 4ZYYA 5B30A 1P0FA 1PGPA 4IRXA 3L07A 1FRZA 1T9GR 1TCAA 1WE2A 4RSRA 5C5CA 5K0BA 1FP6A 2VXBA 1YS4A 4B6RA 1ZD1A 2WWVD 2LPMA 1DOZA 5EMKA 3VPXA 1K3FA 2UXBB 3MRSA 5IUKC 2CDNA 2HSDA 2XCQA 2Q3EA 1YTLA 2Y0BA 5BSRA 4JC5A 1AGRA 4MVJE 1GQ2A 2Q7XA 3A3NA 3PFFA 1TAQA 2F55A 2OG1A 2ZIAA 1PJRA 1FBTA 1T26A 4GUAA 4JB8A 2FFRA 1IK4A 1LJLA 5LP6A 1TA9A 2Y99A 5FOTA 4D9MA 1X7GA 4AJHA 4UMFA 1E20A 3E48A 1SOWA 4F04A 5AW6A 3JARA 3B60A 3HB9A 2X5XA 3MCZA 2HIHA 4EWLA 4IIDA 4A15A 1NUHA 1NJ6A 3PDWA 5GVRA 5GONB 3LOQA 1XKTA 2ZUCA 2PUHA 3LYLA 3HZRA 4HDRB 4R31A 2QLMA 4IX1A 3OJCA 5DNAA 1RXYA 1V26A 4OJQA 1RHJA 2YC2C 4FLFA 2WM2A 2MYUA 3PKIA 5E6UB 5B1EA 3SHFA 1PJBA 4QUEA 3FKSD 3A3PA 2J87A 3GJQA 4OP1A 2B4TO 5AW9A 4JU8A 3E3AA 3WMGA 4O3MA 2IT1A 3P0FA 1IOZA 2H7CA 2PKWA 4KNVA 1GDHA 5G3YA 7REQA 3DMNA 1OWOA 4YJ3B 5HYVA 2NAPA 1CIPA 2IPNA 2RGBA 2AE1A 3KT0A 4OKNA 3RRXA 3EG9A 4RHYA 2ORYA 1TUEA 1Z18A 1S9DA 1E3EA 2A88A 2AVDA 2OHJA 3QV1A 4RCZA 5H59A 3NT2A 3L6OO 3D2LA 4FHFA 4BO4A 2NUAB 3R0ZA 3LC0A 3RABA 3LHSA 2Y4NA 4I8DA 2I8AA 1Z8HA 4UQLA 1IBRA 2YZ7A 3MJVA 2Y05A 1XPUA 1A9OA 3N9IA 1M7GA 1NW6A 1RP7A 3FBTA 1LA2A 2J6IA 2FHSA 5JPIA 5KDDA 5U9CA 1DDGA 1GTZA 3NPAA 3CV3A 4A91A 1PLKA 3AY7A 4QARA 4C03A 5EXDA 1EDBA 1NVUQ 3LUKA 5IVPA 1PIWA 5THQA 1C8LA 1E3JA 1QJ4A 4PGGA 5GWXA 5KYNA 1LLQA 2PMCA 2J3HA 3X1YA 3PHGA 3TGLA 1J9ZA 1SUFA 2OBXA 2VJKA 5CJJA 2PFGA 1QRSA 3OF3A 4X84A 3DKVA 3UOWA 1ZZEA 4GECA 1NL3A 2ZYRA 3UENA 5A4FS 4LA4A 4KUEA 3OAAA 3CCFA 3SBDA 1WPRA 3KQWA 1XF9A 5EP2A 3GD5A 4PLVA 1XT6A 4QT4A 1DQZA 3GJ3A 1MKYA 1MP0A 3AK4A 5G0WA 4I5EA 3U3MA 1JW9B 1MPTA 4DCNA 4Y2UA 1H05A 2SKCA 1IJKA 1P4HA 3EJWA 4G89A 3J81A 4OHCA 3JQAB 3GV0A 2W2LA 3ENKA 5EMNA 5IFLA 3QY9A 3O1IC 3CH5A 1X1SA 2RHLA 2WV7A 4OSPA 4DR1B 4B87A 2PUFA 3HLTA 3W5VA 2WFZA 2Q4DA 3ZE1B 2HRDA 4KV9A 4RK7A 3PG5A 2ZIXB 1CIVA 3B1JA 4KACA 1PJTA 2H6EA 4XGNA 3M9LA 5AKLA 4JR2A 1R0KA 2EIXA 4YCAA 2E1PA 2J08A 5I8PA 5A5VA 2ZUVA 3OQIB 4GBGA 1ZPDA 3GAMA 2IYNA 2HN9A 3HXTA 5FR1A 3BTUA 2R8RA 3MAJA 4TQUS 4I9NA 5JALA 3TQRA 3LO8A 4J0IA 3PKJA 5TIIA 2NO9A 4GICA 5A3RA 2C77A 1I4OA 1WY5A 1R88A 1OFVA 3HU2A 2DSTA 2CJWA 1IU9A 4CEIA 1NWCA 2G1UA 4S12A 1Y98A 3ZCXA 4W63A 5JCXA 1E2HA 1C7IA 3L04A 1W75A 4LGVA 1PUIA 3LY5A 1R0BA 3OLXA 5EJFA 4YB8A 3CO5A 1SD5A 3H8JA 3B1ZA 4YV1A 1GWNA 1J33A 1V5FA 3BFXA 3P9ZA 1TFRA 3AJ9A 5KYTA 1O57A 5IMSA 1S2OA 1IOWA 2WVGA 1XDDA 3GIWA 4NP6A 3C7KA 3S27A 2C5SA 2FEPA 2RKOA 2ZI6A 4IIFA 5JC1A 3R5KA 1QH8B 3T5MA 4EKNB 3L7AA 1V3UA 4H1WA 2BIFA 1W0CA 2NZWA 3OEYA 3EIUA 3OAAD 3DR5A 3RVRA 2GD0A 3IV9A 3MTQA 5SY9A 3R23A 3WLEA 2OV2A 1HDZA 4FYVA 1P0MA 1V3VA 4CM3A 1QQTA 2J45A 1CRQA 3OC6A 4HAVA 1PO7A 2F9MA 3LQQA 4FZ5A 4ZDWA 1DU4A 1VLVA 2VA9A 3MJDA 4MW1A 4R2KA 3T7AA 2G63A 3H3FA 3WGQA 1RABA 4CRWB 2X6QA 3CUEF 3TQTA 4F4CA 1I0IA 2ZI7A 3O90A 1Z2OX 5G0SA 3CGWA 5GMOA 1KO1A 2A9PA 4BO8A 2ZJAA 3V8MA 5IBCA 1CD5A 1GNPA 1DCKA 1MHPA 3QOWA 4JBWA 4TYQA 2CJYA 5EG5A 1H1DA 1JMKC 1NFQA 2RBEA 3Q3JB 1N0HA 2XNCA 4BU0A 3ROQA 3L46A 3DQZA 4KQ6A 4PPFA 3NIFB 1NU8A 4N3AA 5DHRA 2HDNB 2V3VA 2I54A 2H4HA 3DAPA 4HFRA 3D3NA 3IEUA 1JQKA 4BWYA 2OXCA 5I4IA 3P2MA 2W98A 3ZQUA 5IDQA 3KYCA 3STYA 5COBA 1KI1A 1DX4A 2EATA 5KI6A 5JS8A 2HK6A 3E3OA 1XVVA 1Z6PA 1UMDB 2NXCA 2PSFA 4IXMA 3V3TA 5B7PA 1AB6A 1DUIA 2GZ3A 3DBHB 3JZAA 4LXTA 4TVSA 1JFFB 1B8NA 5BWNA 5L45A 4Z86A 4KLZA 1PEAA 5HTKA 2E1RA 2GN1A 4MW5A 5HZKA 1R18A 1D4AA 2P90A 4HD8A 5JQGB 2IS6A 1UKCA 4BTVA 2I6QA 4DRXB 2BKVA 1XP8A 2VNAA 2XGOA 4LBZA 3MELA 4F2HA 2H7VA 4G23A 5JADA 5JNVA 4HEJA 5K0EA 2PZEA 1QP7A 3IAM6 2VHJA 3WO0A 1XTKA 2X9GA 3EVCA 3ZCQA 5IJ9A 4KGZA 2AK2A 5HIKA 3Q7EA 3UK1A 1QAQA 1Q1GA 1RCTE 3CRW1 1Y5LA 5JS7A 1XTTA 1AKYA 1GXSA 4M0DA 4UNPA 1R00A 4WDRA 5DSXA 3RB8A 3NH9A 3C6XA 1PX0A 2XOXA 3E1KA 5CT6A 5AKYA 5LL6P 3HR4A 1P2BA 5F7OA 4BCCA 2DFTA 3D3KA 3UYLA 5U4QA 3EGXB 2NZ2A 3TVYA 2NU6B 2R1ZA 3DHVA 4FMCB 1JLHA 4R6XA 4A6EA 4AZ0A 1LF5A 4RHEA 4DLRA 5B2FA 4L6AA 4WY2A 4RK1A 1RACA 1Y7HA 4ID9A 5JJBA 2PL1A 4HC4A 1L1EA 2PUBA 4KYVA 2B3DA 1UP6A 3A8TA 4DNPA 4MYHA 3ZU6A 1T8TA 2G09A 3ZWWA 4OQDA 3AHHA 4DZTA 1KE2A 5KNBD 3IEKA 5BSHA 1N2SA 3DZFA 1V3QE 1SH7A 2ZSJA 4LNHA 1N8SA 5K8CA 3GDHA 4KRXA 4XB1A 5FNVB 2GCIA 4LZZA 5FTLA 4YQFA 3FFXA 1Q95A 4MVJI 3W4KA 3BAZA 5BNFA 2LCFA 5AJYA 4D5GA 1YQUA 3A0RB 1NIPA 2XA2A 1ISHA 1RRGA 4QDZA 3TUJC 4CUJA 3AUXA 3SZOA 2XB6A 4N5NA 1RZ3A 3GQVA 1Z34A 4ZIRB 5FLXA 3HUDA 3U7QB 4XVHA 3LZDA 2XTAA 3D3WA 1T1IA 1FSSA 1YOVB 3QVGB 1G21E 3UT5A 1H93A 4PX5A 2P9HA 1U3TA 3ANSA 2QE6A 1Y9EA 2VQDA 3H1TA 1GSAA 1OFGA 2XUHA 4FTWA 4NBNA 4WIAA 3V55A 1W0KA 4OQNA 2V5UA 4R1UA 2WD9A 3EIXA 4IWXA 1HMYA 1E4YA 3B8HA 4JQCA 4LJ8A 3ENQA 4HB3A 5T4BA 3UN1A 1KAOA 4F1JA 6REQA 2X14A 2XRFA 3WB9A 3TAUA 1ISSA 3JTEA 1Q17A 2DTDA 3JQGB 2RCYA 1XG5A 2OHXA 2QSUA 2UYQA 4IDHA 1EVZA 1X1AA 4QUKA 2PU7A 1R8JA 1IDOA 4XPZA 1YNSA 2WOJA 3OBIA 3A4TA 3F5DA 2A9JA 1N92A 1B6RA 3KAJA 2XE7A 3B36A 2CWDA 4DA7A 2W90A 3ZZMA 1ZICA 2ZFUA 4BNKA 1J8YF 4MKFA 1QYIA 5DRYA 4FGUA 2H2GA 1J70A 3IUBA 3EUWA 3O73A 4V0ME 4RS4A 2FW8A 2WIKA 2Y1FA 1ORDA 1TECE 1XI2A 3AUYA 5DM70 1WW3A 5CH5A 1TQ4A 2PS9A 2PWBA 1ZIXA 4TS3A 4ZMBA 3O4GA 5CBKA 1AURA 2F3UA 2W2KB 3O92A 4W9NC 1XMIA 3E9NA 4GXNA 4IXDA 5BP7A 4JI4B 2JJ1A 3UC9A 1V2GA 5BUQA 2FRDA 2JLUA 3PXAA 1V5EA 5KVAA 1NYQA 3OZAA 2YJTD 2XGJA 2CUZA 3IHTA 3AVUA 1AKWA 2GTHA 4ZOLA 3GNQA 4G4SO 1WZEA 1Z7BA 5F52A 3NONA 4MUIA 2GK6A 2Z2IA 5IK2D 3U49A 2QBYB 4WNAA 5EWMB 1MB4A 3RFUA 3P4YA 3MYRA 1ZJ4A 4ALMA 1KRWA 5F2OA 1CUCA 3REGA 1CUSA 2JGJA 3RVNA 4HRAA 4DSUA 2C82A 3V34A 4XLTA 5LZ4A 1NLZA 2C57A 2FWIA 3U4IA 1L9KA 5IRCD 2GT1A 2X5KO 1B00A 1NJ8A 2XMGA 2Y4OA 3AG5A 3NM5A 3P5BA 4M6WB 4P7GA 2G4LA 5KHLB 1R8SA 1U28C 1G9XA 4W1SA 5COQA 3EWSA 3CUWA 1L5OA 1O6ZA 3LOPA 2IHTA 2JAQA 1W0KD 2RGDA 4N6NA 5LXTA 2G0NA 4TL9A 1REQA 1A95A 1SVSA 3AEKA 3ZDAA 4MP3A 4G0PA 1G7SA 4QATA 3W34A 2CBGA 4WCFA 2D8AA 4FE3A 5HGJA 6YASA 3EZLA 4U2KA 3U09A 1QXSA 2JGDB 4IIJF 2EJWA 2X0NA 1RYDA 4LJLA 3PQ6A 1G6KA 4YIHA 1P7ZA 3O84A 4OKIA 4BOYA 4AURA 3LUAA 5HBGA 4D9EA 4F91B 1R6UA 4A16A 3C3AA 3T99A 2OQVA 4RC9A 4LF6B 4G0YA 1COZA 3FHJA 1DOAA 5BQFA 1ADFA 1RTKA 2Q6TA 1IY9A 2FP4B 1OI7A 3GLQA 5KYXB 3S8EA 1ZM9A 3GLTA 1Q0UA 2R1TB 3CT4A 2BCJQ 3QEMB 3AEYA 1XEFA 4JVSB 4M8LA 4UEJA 5FWYB 1A8QA 3VU9B 5A2GA 4WK4B 1G38A 5FBHA 4IVRA 3LK7A 3W5HA 1QR2A 2G17A 2JFBA 3HCNA 4B47A 4HQRA 2V7EA 3HXMA 3UGTA 1RAAA 1JEDA 4MW4A 2ZYGA 2O2IA 5G1NA 4BKRA 1PFQA 1E2KA 1N2GA 1H0RA 3H4MA 3NYIA 4LYFA 3E53A 5BUCA 2OB2A 3OPNA 2JIQA 1ZKMA 2BGIA 4Q7JB 2V65A 1VJRA 4LX0A 5JZMA 2D2XA 3V8PA 1JR3E 2VJBA 1I4DD 2GPTA 2G06A 3T94A 4AP5A 4COKA 2IXTA 2HAEA 3ELYA 2P0EA 1E6CA 3IQXA 1QTNA 4NHEA 1XZCA 1OR8A 1KP2A 1OLUA 2C1XA 2JFHA 2QROA 2YNMA 4IR7A 4F96A 1MW8X 4OX9B 4RM3A 5F4ZA 4HPWA 4P98A 4Q48A 4QO8A 1TZMA 2GLXA 2NTNA 3DPSA 4LF8B 2DG2A 1NVBA 4TGLA 1HDYA 3NALA 4Z4FA 1ZN7A 4UMEA 3V7WA 3B78A 5JD6A 2A1UA 4PHHA 5C8DA 3M4YA 2IEZA 3CWCA 2ZYAA 3BGSA 2E4YA 3RM3A 3AFIA 1E7WA 4E0BA 3PJDA 2HQ1A 3PRHA 1Z2DA 3V3KA 3EULA 4EENA 5KTOA 4WL0A 4YP5A 3GPLA 3JAMA 4K2AA 4J16A 4UUBA 4DG9A 3AJAA 3JYPA 3IR7A 4B85A 2FGJA 3TZHA 1DEHA 3HKEB 3MAAC 4O2AB 1GRRA 5EGNA 1K2VN 3FNGA 4B31A 4R1NA 5FOQA 2P3OA 5AJVB 2H5LA 3G02A 2EFJA 5DLYA 2QJWA 2CKDA 4G8BA 1ESCA 1SVUA 2QN8A 1CQJB 2ZIEA 5SYNA 2FZCA 1JJBA 2DUUA 2VFAA 3ACCA 1U8AA 3R3VA 2F9FA 3LCRA 5KQMA 1F2UA 4A6DA 3IAS1 4OSOA 5KOIA 1BD3A 2H1WA 5B3AA 1SVOA 1EVLA 4NEHB 5AOCA 3HRIA 4D6XA 1M6HA 1EMDA 1AMOA 2WOOA 3FPHA 4GP9A 4B3XA 3OX1A 2O3SA 3MINA 1U9IC 2O5RA 4RD2A 1KQOA 2IKQA 5ALQA 5ARCA 2O3QA 1MGOA 421PA 3CRMA 4Z6KA 3P1JA 3A3OA 2WINI 2C5EA 1C1XB 2RC6A 2JA2A 3OQJA 3IEXA 2PKCA 4QJ5A 1WUKS 1BW9B 1T2UA 4L28A 1MU0A 3TAXA 1CUAA 3OHSX 4M4SA 4TWAA 2DHQA 3QENA 3FWHA 1V96A 2O6HA 2Q1WA 2C0QA 4QYIA 5EE0A 5GM2A 2JHGA 2W2XA 1Y42X 5DCWA 2ZUWA 5ILQA 4BXOA 2BBWA 2ODQA 2JI9A 4H4DA 3QBDA 3K0EA 5L8VA 3FMOB 1CLUA 1KYQA 1L7PA 1PQ4A 2FEAA 3CY6A 4CMBA 1RXWA 2GKSA 2DHCA 3RAPR 4BLRA 2IHJA 2V6BA 1JPNA 4DUPA 4LI0A 4DR2B 1XBTA 4XRRA 5AVVA 5JAZA 3PB3A 1LX7A 5ER6A 1FP4A 4RTJA 5ENZA 2YYAA 1MGPA 2A5YB 2BDEA 5KTKA 1K66A 1GEGA 3DB1A 4YCBA 3IVCA 2CVOA 1BJKA 1XDUA 2ILVA 4GPBA 3W7VA 4RELA 2PH1A 3WAJA 1L4NA 2VUSA 3FZYA 4XA8A 3EPKA 2I7TA 4CKYA 5FAXA 1JX6A 4ARZA 5CA0B 1XTPA 2M6RA 3PCTA 1ONOA 3H04A 1J0DA 1LDEA 1T9KA 4MW0A 3VYWA 2PLNA 4B3DA 4YJ2B 1T1JA 3PUWA 1OH8A 4BNDB 1NUPA 1QONA 1SCBA 1GU0A 1YHZA 3NEJA 4EY4A 3PDHA 4WX2B 3S8YA 3WNDA 3DVRX 3G0HA 4WQMA 3SC2A 3NBZC 2BFBB 2JZCA 5GM1A 2A4MA 1JT2A 4GVXA 1U2ZA 3KC2A 4OFZA 4PXAA 1E5LA 2ODBA 3C6KA 1WU7A 1P2TA 4C4YA 2H4ZA 2QIOA 3PUZA 2LBPA 1XWFA 4X71A 2ZCJA 3R74A 2NVBA 1MG0A 1RPJA 2O1XA 1AZWA 2JS7A 3TLXA 3PDIA 1IH8A 4NV1A 1JIUA 2O2XA 3TKLA 4M99A 5G1OA 4PRYA 4LMPA 5F3WB 4L8YA 5HK9A 1BEEA 3G5MA 3GLHA 1P7VA 4RE6A 2OCIA 4IFEA 1MF7A 1RYZA 1H1TA 2OD2A 3ZW7A 1GSIA 1H9BA 3LYUA 2QY9A 2HDOA 2VT2A 3IPLA 3ZYCA 1LJUA 4EHKA 1LWNA 1XMJA 4FHCA 1I4WA 3UCXA 1XTZA 2XNKA 1MO3A 4JLNA 4HVTA 5HF6A 3JARB 3WJ1A 1U1IA 5LQUA 1BG6A 4DILA 4WCVA 3WV5A 4EY5A 1YKSA 2KYRA 4GGPA 4M55A 4A2PA 4FMCF 3U4AA 1UBSB 3IVRA 3RUFA 5H4GA 2HEIA 3CZQA 3LO5A 2XOEA 3ZKAA 3EX7C 1A4RA 1OFTA 4C04A 4R8KA 1UBEA 4LVOA 4HMOA 3ZE0B 1H23A 3P9YA 2ERYA 1CZKA 4FUQA 1X94A 2Q0SA 2DULA 1L3BA 3LLCA 4LJ7A 4O63O 4BFUA 2GARA 3L8FA 3U1VA 2Z3VA 3P8ZA 4D92A 1E0JA 1PZFA 1A5BB 3PNPA 3OM9A 3CLVA 4OXNA 2PYDA 2VP6A 3P2YA 2PNJA 1RRVA 1DC5A 2NW6A 4TLBA 5C35A 5C4MA 4TVOA 2R8BA 3L7DA 1RBYA 3BZBA 1OZHA 1VCOA 2F59A 2JLSA 2ZS7A 5LWQA 1Z4MA 4IQ4A 3GFVA 4NOJA 3P26A 1PZGA 2FOXA 1RRPA 4ZDKA 5LQNA 3LAWA 5FLEX 1ZUIA 3DVSX 3AUAA 4PFKA 1YJAA 4MV0A 5DLQC 3PT9A 2R1VB 5EJMA 3A1EA 3D8SA 4C7BA 5JY6A 1Y8QA 5GGYA 1E79A 2CXXA 2J9ZB 2H4XA 1PG5A 2TMYA 3ETGA 3ZJUA 4LXUA 4PV7A 1Z39A 2HB6A 2COUA 3QBVA 3FRIA 4EGAA 4BE4A 2CHVA 4IO0A 3ZNOA 3G23A 4HMQA 5A05A 3Q7TA 1S6YA 1XXHA 4A1OA 4JXZA 1MO5A 5T8KA 3CC8A 5JCJA 2RK3A 3KJHA 1FX0A 4MS1B 1QIFA 1QNLA 1YJ5A 4EDFA 3I42A 3AUKA 3LWNA 4UXIA 5AESA 2RGGA 1PCXA 3BKXA 3CQ9A 4WXMA 1LPMA 1J9EA 2CB9A 1ISIA 1RFLA 4J6EA 4JSTA 1VPWA 1DRWA 3BB3A 1LZLA 2Y1LA 4LAFA 1KI7A 4FC6A 2FK8A 3FUUA 5FPSA 3O7MA 5EPEA 2H9AA 4JHLA 1M8FA 3UANA 1P1IA 1SWWA 1AMNA 3WQRA 4TT8A 4RPGA 5IJXA 3D9QX 1I5OA 4KRGA 5LDGA 5JEEA 1C4WA 4IUBS 2CNLA 1B42A 1D1SA 2HPZA 3G2KA 3NIBA 1V7QA 1P19A 1CXZA 1ZD8A 2PSSA 4P82A 2K2QB 4MIYA 4N3CA 5L51A 3G7SA 4R7ZA 4ZVSA 1Y7PA 3I2KA 4A0SA 4FOSA 5CB6A 2FW9A 1GTRA 3RSOA 2XPCA 5CDFA 4UC0A 3NUZA 4M1SA 2GCGA 1ZW6A 3NIWA 1GQOA 1KKMA 3E9DA 4MYTA 5AH0A 1HY3A 3SP1A 1W96A 4Q3AA 3TI7A 5KBYA 3HCWA 1NJSA 4RULA 4DSZA 1EE9A 3O1LA 2BKXA 3P97A 4FZ3A 3NAMA 2ZSEA 1ODSA 3IKJA 1XR3A 2UZIR 1M7HA 1O03A 4B5LA 3QVKA 5JMPA 2ZQYA 3HBJA 2CZQA 3HZOA 4URWR 4DV6B 1NI5A 1H5QA 2A1TS 2PRIA 3FAZA 3OQHA 3CURA 4DM4A 2HWXA 4G4IA 1PNTA 5DTRA 4A27A 1SVMA 1W85A 1HSOA 2ZR9A 3IHLA 4QDKA 5B1HA 1ARZA 3U7EB 3MZ0A 7AT1A 3LDGA 3NAZA 2ATXA 4NAHA 4QJIA 4FS3A 2FE1A 4YAWA 5FNZA 4EYQA 3B7WA 5LQDA 1JFSA 2V7VA 1ULUA 2IUEA 2NVUB 5KVSA 3TGWA 2JEYA 2KB0A 4PYJA 2W6OA 5UKDA 3WIBA 1T91A 4ENSA 2DHEA 1UT5A 1VE7A 2O3RA 3GLGE 2V58A 4MYDA 3I6MA 1VDZA 1J8MF 1LBQA 4K81B 3IDSA 3EYAA 4N3GA 2Z57A 3LLSA 4LYEA 3GRKA 2C7BA 4L08A 4RO0A 5ESRA 6ADHA 2ZR8A 4I7EA 3JQ9A 2WV9A 2ZYVX 4Z4HA 1SQFA 2FSFA 1T29A 3URKA 4Q4HA 4DIKA 2G4CA 4AS2A 1P45A 5D84A 2EIHA 3RH0A 1KH2A 1IULA 1E5TA 3OY7A 3IE1A 2BW0A 1BOOA 4M22A 3QUSA 5DBFA 5C4GB 4LJ9A 3K9GA 5BYBA 3TOCA 3ZX4A 4WUTA 4EI8A 1DDIA 1JMVA 1GZHB 2PH3A 1ZHHA 1NRIA 4RVCA 1NVDA 4IHJA 4P3XA 3RTDA 1P0QA 5IYZB 2EGGA 2HF7A 1WOYA 5GOTA 4M37A 3WYBA 4D80A 1PT6A 3QPBA 3QVJA 4DPLA 4A36A 3BB1A 1YJCA 2BFWA 1EGVB 2HJRA 2W6CX 2Z5GA 3A7DA 2FSUA 3GNTA 4BFZA 4DCOA 4LTMA 4DLTA 2RJOA 2CMGA 5TMPA 2APJA 3NX4A 2VUHB 2X15A 3TR5A 4EQ6B 3PEWA 4L5YA 1Z73A 2QX6A 4O4LF 1JIIA 1NR7A 4RPJA 4C07A 2QNIA 3GG9A 4LY3A 2C88A 5A6VA 2HO5A 2R6FA 3NJ8A 3PRYA 2M6LA 4LC9A 2V6GA 2FHPA 4BC0A 4EJSB 3JATB 1U8YA 1UDCA 1UINA 3I8SA 4N4AA 3TM5A 2EKDA 1QDLB 1T5LA 2L69A 3RC1A 3WHLA 2VJLA 3GFSA 4BDTA 1YFLA 4JBXA 2UZ4A 3I2YX 2OCLA 1FYEA 3MFYA 3OF2A 1FFWA 4TTQA 4XTRA 1XQYA 1ZJ6A 5IH7A 3BHMA 4P9NA 4H3SA 4TX1A 4M1YA 2RGXA 3TJZA 4MEBA 1BKYA 1ORRA 1DE0A 3L7MA 4PZUA 4YRAA 1FTSA 1XA0A 1M75A 3P9PA 4OTZA 3OFNA 5TC4A 4FYHA 4J0JA 2I87A 4R2JA 5DHTA 2BCEA 2A0XA 3WL5A 3R20A 3UBMA 4DLNA 4EA7A 1GXSB 1L5KA 2AG1A 2H3EA 2G6BA 4V0OA 4D3SA 1J9GA 1KAGA 4RA9B 4HRYA 5SICE 2MYTA 4YT4A 1F6DA 3D6FA 1T2AA 3L8GA 1UR5A 1CJSA 1VKJA 1GFIA 3WLLA 3LNCA 4YQZA 4ZTZB 1VE9A 2IKSA 4RYLA 2WWRA 4HN2A 1NP6A 3KHTA 1CTQA 4RADA 3ID6C 4V2IA 1WXDA 2QTAA 5EIEA 4DQUA 5I9LA 3S2YA 1FU7A 1YK0A 2DLNA 3FUCA 3KALA 4GMGA 4UBOA 1EFCA 1JKIA 1RAFA 3MMZA 4XPIA 3QE4A 5D7NA 3L4SO 4DNQA 4E13A 4FIDA 1NZFA 4OOEA 2I2FA 3AYZB 3GA5A 4MAMA 4A03A 2R6AA 1D09A 4DSAA 4QLOA 5AXDA 4PNEA 4E5NA 1R4MB 2AOUB 4GKVA 4XYLA 5LKAA 1G20E 1PHPA 3NNNA 4TYYA 2YUIA 4JITA 1YAHA 2CVZA 3QI7A 2QU7A 5DCYA 4OHZA 1K5HA 2VPXA 3FDFA 3KIPA 2VT3A 3DTVA 1L4HA 1WF6A 3PF9A 2WMYA 2I4LA 3BDVA 2HMWA 1XD2A 3O93A 5I45A 3WMWA 1KOJA 3D3WB 3UT5B 2J5QA 4DLXA 1IONA 1ZGJA 1CUHA 1UBTS 1XTJA 4JLMA 5BSUA 3RRMA 4V0RA 1QV7A 5TVKA 1T6NA 1MB9A 2UU9B 3ZIDA 1SKQA 1L4BA 3WIUA 4MJXA 2HT1A 4OA5A 3SXUB 1U0BB 3WZMA 2OPHA 1CJBA 1ID1A 1BH2A 2SCUB 1LVHA 3GEPA 4RWZA 3NTOA 1BROA 1CX9B 1XHLA 5EESA 5FPTA 5IKOA 3SG0A 3TZKA 4DY4A 3OQNA 3IIEA 1GCOA 2J3DA 4TQAA 2FPKA 2VPYA 3LUBA 3F5SA 3GXBA 4TV9F 5E0KB 5EIOA 2HLDD 4LWZA 4YXFA 1DBPA 5JZBA 2JLZA 3HBAA 4R8MA 3OIDA 2H48A 2WHXA 3HP1A 3UIEA 4GLBA 4DDWA 2ZJ0A 3WBFA 5AHRA 1H2WA 4GL4A 5H68A 2IC5A 3GFQA 1NN0A 5D3MB 5ADUS 1LPPA 4FEAA 4RZUA 4AY5A 4QM6A 2E49A 4MKRA 5KOYA 2HF2A 1XNRB 4XFDA 2GEJA 3V8NA 4RNCA 3L7IA 3FVTA 1VHQA 4W9NA 4MKHA 2HJWA 4MA4A 3AVWA 4Z4IA 1CRLA 1DTEA 2P67A 3F9CA 3UJ7A 4RCVA 1IYZA 3H83A 3VH2A 4INAA 1JEYB 2JH8A 1I4LD 4NNOA 3S1AB 4BMVA 3EEQA 5A5FA 2ZIUB 5CB8A 2A6PA 3QF7A 1HQYE 2PEZA 1QBGA 1UANA 2OMKA 4ZOLB 4AJPA 5CFRA 1KYZA 3ZHUA 4UVDA 5D2CA 1D2GA 2WUEA 5LVAA 2I9KA 4URYR 1JKXA 4EMSA 5LP6F 3ZZNA 5L3SB 4JD5A 1WX1A 1GZDA 1XTVA 1KZ9A 1M1YE 4JI1B 3Q8XB 4IZ6A 2C8VA 3DTVD 4R6WA 1IM2A 1CQPA 3DZCA 4AZ3A 2Q4OA 3DZHA 5KWIA 1OLXA 3IHKA 1ZVMA 3JZDA 2P6MA 1E7YA 1XQXA 1GP2A 1GTL1 2AN1A 4W7SA 4XQ0A 4RIIA 5EUCA 4DIBA 4YIKA 3HDQA 1C0KA 1O87A 1U8ZA 3OMLA 1KEEB 3R77A 3ES9A 5AUQA 3ZV3A 3K4QA 4WNCA 1FP2A 3SIXA 1VP3A 4C76A 4DDUA 2GGSA 2AG5A 3A14A 1XU9A 4ENUA 1OXKB 1U8EA 2JBHA 5LXTB 2PLWA 1Y9JA 2BTEA 1MDFA 1WQ4A 3Q7RA 1SG9A 3AJ8A 1FTGA 3ZUPA 1KH1A 2Q49A 4HGOA 4C30A 4D99A 3E2PA 3RYIA 1HYQA 4WCFB 3ITDA 4LEIA 5H3HA 3I6QA 2NYUA 5TQ2A 2XCSB 3LPCA 4CEIB 1YGPA 1PR2A 1P9RA 4MVWA 2ZJFA 2IU4A 1G59A 3ANXA 3G9UA 2H00A 3OQ1A 4CR7A 3I12A 3M4JA 1Y89A 1GZSA 2P5UA 2C2HA 5C1BA 1ZIDA 3NORA 4JOSA 2EKBA 1VFNA 4KSCA 4BJHB 4RIHA 3W5UA 3AUTA 2D7CA 2YWGA 3DMRA 3FM9A 5IAGA 1EP1B 1NBEA 1YBVA 4R83A 1QLJA 2JGMA 4H16A 2NSHA 4MIOA 1GILA 3R3WA 5I4BA 1EK2A 4ZOAA 4CLXA 3TZCA 3UJHA 4DRYA 1JG4A 2OCDA 2FUG6 2I6GA 2VBCA 3NOXA 4WZBE 5EIBC 5J2UB 5FTMA 1YZTA 5FBLB 1RADA 4CM1A 3ED1A 3QFHA 2IZ5A 3VPHA 4WKBA 4UM9B 5JH7B 1JYSA 1Z0FA 1JKJB 2VTVA 3RASA 1TA4A 3K1AB 1FDWA 2BHSA 4DMKA 4YUYA 3VSCA 2DFDA 2W93A 4QBKA 2ZWPA 1WJGA 3T7KA 2B7BA 3GJ8A 1DTWA 2X7HA 4NZPA 3JYNA 5HUHA 5H16A 3DDNA 2I4OA 3ECSA 1U0GA 3AJDA 3JQQA 3QPWA 4IIXA 4LCJA 4WFKA 4DR6B 1E5XA 3LTNC 1EFPB 1H85A 1DBQA 5EUBA 2PUCA 3GOQA 1M2NA 2YYSA 3WA7A 1B1AA 2CLCX 3Q3EA 3EOZA 2RGYA 1U0EA 2DWQA 3TKYA 3ULKA 5TT1A 4KJZA 2A1UB 4ZTUB 1E3DA 2BN4A 2H5IA 2ZI9A 4XWOA 1Y6GA 4BVKA 3GVXA 3C87A 4QOSA 2WIJA 1NYTA 1Y48E 3MUFA 5DT9A 4L8LA 2WU1A 4BX9A 2QDXA 3E3NA 1QRDA 4EJSC 1TVEA 4HLNA 4LECA 3LLUA 4Z4GA 1U0OC 3EFEA 2AS0A 2NSLA 4M53A 3V7YA 4CKBB 1QE0A 4D81A 1P39A 4CEJB 3AP3A 2OPBA 1C7FA 3AB8A 3GROA 5J4LA 5JBQA 1QVWA 3DXXA 1RAGA 2Q1YA 4PYNA 2R6GA 3KE9A 1GN8A 3PF8A 1IRIA 4DJJA 4ZV9A 3VOTA 1SQ6A 2VJCA 2VZLA 3HJUA 4MHTA 1N2ZA 4Q1VA 5CRIA 2EV9A 5L7WA 4A6PA 2E7ZA 2FWMX 1SIUA 4MR8B 2MR6A 4TN5A 2EWMA 1LNQA 2OVBA 3KZNA 2PHZA 2ZWOA 1B4DA 1D6MA 4DV7B 4D57A 4GXQA 4IKEA 3ZCSA 1LEHA 2NZUG 3MCUA 4QOGA 3RSSA 4BNVA 3HNOA 4ZO8A 1G6OA 4O2BF 2H18A 1P9OA 1WW2A 5CCBA 4RVFA 1XQ6A 2WAOA 3D59A 1ZDMA 1Z06A 2ISSD 3PLNA 1ICEA 4CV2A 1Y7IA 2FVYA 3KLPX 4OIFA 2NPFA 3U1TA 5IASA 1GPJA 1Y34E 2G0AA 3BQNB 1RQGA 2BFPA 1XK6A 2E4XA 2B4QA 2V6FA 3HJAA 4FJ0A 1SQ0A 3PA6A 1NURA 1FVXA 2NO0A 2CHUA 1PW7A 4JVMA 4IH4A 4X1KA 1TIKA 4Z8YA 2R2GA 2BUAA 4Q7EA 1MOZA 1LDGA 2D0PB 3HH8A 4PU0A 1JH8A 1S4MA 2A4KA 4MRNA 4L15A 3WRYC 3DMHA 2NV2B 3AXSA 4L9RA 5HMLA 5T4HA 3E5RA 1J97A 4GM4A 2YQZA 4UNNA 3JQDA 1T4GA 1HUQA 2VXYA 3NRJA 3PXBA 1IIBA 1FP4B 3ER6A 2H1SA 1VL2A 4XYBA 3AM1A 4UKDA 1ZX1A 1G60A 3C1UA 4MYSA 3PHLA 2QEQA 5TMEA 5IYZF 4E3WA 2AT1A 4WESA 2EZUA 1USWA 1LSSA 2CE2X 3WLMA 3B48A 2HCFA 4EMUA 3TCNA 3VU8A 4ZZ1A 1IG0A 2HPAA 4R2WA 5EHQA 5EHGA 2R7MA 4ARZB 4CGZA 2XX3A 1RJGA 3E35A 2BFOA 4HJXA 2NVWA 4NYIQ 3KWLA 2AQIA 4YFYA 2PL5A 4KPGA 5HGXA 1UJ2A 5JMOA 1RC1A 4ALJA 3SC2B 2V96A 3FMGA 4RH0A 1DAFA 1CE8A 3D7SA 4LZPA 3RBZA 1BVRA 4U7TB 2OFOA 1GV0A 4B6GA 1K7SN 3NGMA 1YDFA 2VT7A 2WBLC 5JAUA 1WUTA 1J07A 4JL6A 1GAJA 3H2GA 3QMMA 2W2PA 2JGEA 5CIQA 1Z83A 5TLSA 3ZGZA 3PWTA 3VO9A 3L4KA 1UK7A 3WWYA 2QVGA 1PZHA 1IE3A 1YJBA 1MT3A 1ENPA 1CVIA 1PR1A 2XUAA 1L7NA 1N0IA 2H0QA 3C74A 2VDMB 5JC8A 1PNQA 3GLHB 4CIWA 1EFHA 5K0LA 4TN1A 4DXHA 2VSXA 3D4NA 3H13A 3PLAE 1NBWB 4V0QA 4YT5A 1L1FA 3D6NB 3SKVA 1T5OA 2IODA 3PNLA 2KX7A 1FUIA 3MG9A 3RSLA 1GCIA 4XUCA 2WPDA 3D7RA 4MUHA 1JAYA 2OC4A 3OZXA 1C8VB 1NOIA 4EO4A 5JJKA 1T34A 3H6HA 4Z9XA 2BSAA 3JAWB 4BV8A 3R9IA 2QGNA 1QAMA 3IJEB 5BURA 4TMTA 4ZAVA 5P21A 3W2GA 5EKDA 1WKVA 2PS1A 1K5GA 4TXMA 3SVTA 4V1CI 2O2DA 3A6JA 2Q3CA 3UAWA 1KWKA 2BM0A 3CNEA 2R6ZA 2CV0A 1Z12A 4ANFA 2I76A 1RQPA 4HXYA 1XHFA 4TKLA 3P19A 3OD1A 3IOCA 4RV4A 5AMXA 2EVWX 4F85A 2LCIA 1UJMA 3FPKA 1LVGA 3CLTC 3MXOA 5L95A 4CTKA 4NPAA 3SPXA 1JL3A 4O0MA 3U7JA 3Q0TA 3C6BA 2ANCA 4KX5A 2FE4A 3F5MA 3IP6A 2FKNA 3OPYA 5LNK6 4CG1A 3SX0A 2IOHA 2WUWE 2ZIGA 3HFGA 4UBLA 3GFPA 5D3QA 3KFLA 5IF3A 1ZBQA 1DKQA 4M9CA 4JI5B 3UTCA 3V7NA 2QRKA 1WWKA 4OH7A 3GUZA 3JS5A 4CQLB 1DMRA 4J6FA 3TSYA 1ZLXA 5ALEA 1SCIA 2AR7A 2JLVA 1DKRA 3DEZA 5LQSA 5TQVA 5HKAA 3G17A 3G8CA 1VPTA 3U7IA 5KNLA 1J8QA 1FU8A 3X1XA 1N4DA 3SIWA 1QC5A 1Y80A 2HMSA 3X2SA 1XXHB 5E1MA 2Y1EA 4ML3A 1B16A 1SHTX 1E3IA 2LWIA 1FX0B 1P7CA 2G07A 4EB0A 3SVLA 4WW0A 4UE6A 1VCNA 5FUWA 4M0CA 5AKJA 2VDJA 1HDIA 2WR8A 4IOKA 3AF0A 5FQNA 4XEUA 3CXUA 1PZMA 3OFVA 2PJUA 2PFSA 5CG2A 2FFHA 1SCDA 4I8XA 5CITA 4LRYA 4IKPA 5C31A 1LBSA 3ZDYB 1L7VC 4PLYA 4QD3A 3GUUA 2WPDD 4U8HA 2OCGA 1C30A 2VNJA 3BGWA 4F97A 5BN1A 2VHQA 1NVWQ 2VCHA 2C2WA 5EY5B 5E1OA 3X3HA 2WT4A 4KAFA 2FN4A 2SKEA 2Q1XA 4GMDA 4OHMA 3OE5A 1ZL0A 2GFIA 3X1DA 5I7SA 2WLSA 1XLVA 4E7PA 3HI4A 1XWIA 4F11A 1IHUA 3VSDA 5LU9A 4G6ZA 4AZWA 4D9JA 2XYRA 3B52X 2VP2A 4O33A 1QRAA 1CEYA 3A2NA 4ILEA 3SX4A 1WTAA 3MF4A 4U3JB 5C46F 3DBIA 3P0RA 3NDRA 2BMEA 3VH1A 1I5RA 4B3JA 3LMKA 4Q6BA 1A9YA 1NOJA 5BT9A 5BOSA 5JS1A 4L5CA 4ZOLF 2A78A 4Q34A 4EUSA 5JU6A 3F9RA 4YMTA 1DT3A 1I2DA 2XUJA 2YH2A 4NMLA 5JJ5A 3ETCA 1BDMA 3NNDA 2CUKA 3X44A 5DM4A 1W6RA 3BK7A 3WZ2A 4IDPA 5FBWB 5BR1A 3T3MB 3D4OA 3HN6A 4MYCA 3ZU3A 4BV9A 3IUJA 1SU6A 1ODKA 5DK6A 1PGNA 3CKYA 2FA9A 1OW3B 3OLZA 1WQ3A 1SBNE 2GSDA 1W85B 3ROMA 2R68A 4I99A 5KTRA 1ZITA 3QTBA 2CXTA 2WABA 3AI3A 4C4OA 1Y8RB 5G4LA 3SYLA 3I1YA 2JGNA 3THXB 3K8QA 3C3CA 1Z6GA 3MT8A 3Q3VA 3OWOA 4AWBA 2MINA 4FYYA 5DYWA 3V97A 3QVSA 2J9RA 4G1UC 4H0CA 4PFJA 1WXIA 2X2FA 2QLLA 4EEXA 5CDHA 3QPUA 1JG1A 3FBGA 1AS2A 4FQ5A 2GBLA 2VF8A 4QQFA 2YZMA 4B3RB 4ZEWA 1GN9A 3DV0A 1AKQA 3RVKA 1QV6A 2OV4A 4WKPA 5A3JA 4MWSA 4S2UA 4JS0A 5ESWA 4PLFA 4RVDA 2Z3ZA 5K8TA 3QYJA 1CZUA 3KYDA 4OL9A 1H2AS 3JQ6A 2JRCA 3MTEA 3QA9A 2HU8A 2HLHA 2AJ8A 1GFZA 1K75A 4Y9SA 5TGZA 2X6RA 1PJSA 1RZUA 2E9SA 4YH1A 3I9JA 1JJAA 3IXMA 4W5JA 2NWQA 1T8PA 5YASA 3RWOA 4UEQA 1URPA 4IHJB 5U1PA 1YL7A 2KQUA 2Q6LA 2ZJ8A 3PQ5A 5CDTA 1DJOA 1L4EA 3BL5A 3OFKA 3OZCA 5AM5A 1XKXA 4TZ0A 2VHVA 1Z62A 2Y76A 2LP4Y 3KM0A 1Y33E 4ZT6A 4NBLA 1UFQA 2BEWB 2P79A 2YOHA 3OEEA 4EHDA 4A8JB 1JQLB 221PA 4AYTA 2A9RA 3H19A 3BDIA 5HQ3A 2GEVA 3PQ7A 3VR5H 3X0DA 4RQUA 2UYGA 3QYAA 3QKSA 3HYLA 4YHHB 3A4VA 4LRQA 1GGMA 2QJRA 2IS2A 3B2QA 1VBKA 1GUFA 3EDOA 2C9CA 4ZU6X 4NCJA 1CJUC 2P9GA 4CV0A 1EFVA 2I5PO 3QF4A 1Z56C 2OXTA 1P72A 4MX8A 1GNSA 1T8UA 3GLUA 4XFKA 4B6SA 4HV4A 1LDYA 5A9SB 5BSWA 1JDSA 1HI9A 3AR3A 3UXEA 2H4YA 2UUOA 3KZOA 3G89A 4GSLA 2X0FA 1G3IA 4OY3A 4DE5A 4HDOB 1R8YA 1B6TA 2R3SA 1X2EA 1EG7A 2JIMA 4PYMA 4IP0A 5PNTA 3OT5A 3B7GA 5ALIA 5DTQA 3KEQA 5KX5A 1YF3A 1DG1G 3K6KA 2VJPA 4ENTA 1QRRA 4EBFA 1O6BA 5HKKA 3EXHB 4QTUB 4DAOA 2EZ8A 5E4FA 3P52A 3OIWA 5DSZA 1T9GS 4QC2A 5AVUA 3H9EO 2I62A 2JIZD 3AOEC 3DLTA 4UM7A 4BQNA 5E9AA 4F4UA 4Z7QB 4B6JA 3F7TA 3BQMB 5FO0A 3T35A 4YMGA 5C7IO 4KWHA 3SIRA 4TT3D 4QAQA 2X1LA 4HXEB 2IH2A 1QIIA 1ACMA 3EEIA 3QI2A 4MUXA 3EC2A 5HILA 3K9FC 3C3DA 2QQEA 4EG4A 5L7TA 5G1PA 2XMZA 3U44B 2QGFA 4IMPA 4F4FA 2C4HA 3RHTA 2DKNA 4E08A 4BNIA 1R6VA 1Y4AE 4L95C 3D02A 4R0VA 4B4OA 2AW3A 4RL4A 2QD1A 2E6KA 3JVIA 2R25B 3DVLA 1QV9A 2NZYA 1DG3A 4MV5A 4XOIA 1KY2A 3O21A 2IPOA 3CH6A 4US2R 1BMFA 4UPEA 1GGVA 1VSVA 1PNOA 2A9OA 2O0HA 4J9VA 4RETA 4EHJA 1TB4A 3R9WA 4BUJA 2DTEA 1PS8A 4LJRA 1SCAA 1BVHA 2CYAA 2CLMB 1Y3CE 2ZAIA 1W5BA 2CC2A 1X7HA 4TKVB 4ERNA 1HK7A 3EIWA 1TUGA 1ZINA 2R65A 2VOEA 2P4HX 1V3TA 1GZ5A 1RAHA 3CEJA 5AKHA 1YACA 4BZQA 1Q0TA 1M34B 4YMUA 2VXCA 5JISA 4JYBA 3F8TA 5BNIA 2KMLA 3N3AC 2ZQ5A 4JGIA 2PD6A 3N87A 4D25A 4ND6A 2FW0A 4GGMX 3CMCO 5C0OE 3C14C 5K3FA 5IAAA 1S3GA 1ZD5A 4UBKA 4MQEB 2I2CA 4BGIA 1AGNA 1OAKA 5SYMA 4AYXA 3WLSA 4Y30A 1BQEA 2JLWA 2EF0A 1G0OA 1ZO8A 5HKKD 2NZXA 5DW0A 1JBEA 5HRUA 2EP8A 1N2OA 5JS6A 1PJ3A 3N8GA 4GZLA 3EF3A 2NZ8A 1A0OA 2QZ9A 4DTCA 1X3LA 4BNHA 3PUHA 3NKFA 5JVDA 3N7TA 3JPWA 3RV3A 1XMXA 2L42A 1FFXA 1OT5A 3WYAA 1MHTA 3ET4A 2PRZA 1UOPA 2OCXA 1L5RA 3D4LA 3ZK8A 4YLEA 4EM6A 1ADYA 4DBZA 2QRPA 4MSUA 3BICA 4ENRA 4OQEA 4HI0E 4WH0A 1O5OA 2W71A 3BWDD 8ADHA 2H4WA 2OY0A 4PHCA 2FG7C 3RYCB 4RV5A 5CFZA 3PWZA 3B3GA 1R4NB 3DZJA 3RIMA 3L3BA 4XVUA 1T0HB 4M0LA 4JA0A 4Q1AA 5KTYA 3TLJA 1WCWA 2IU6A 3CNLA 3DM5A 4TRNA 1HZZA 2B7LA 2PD3A 2XQFA 3FD8A 3N6XA 1NDQA 7YASA 3VR3A 1DBVO 2XV1A 4OGKA 3AV0B 4D3FA 1SVKA 4K46A 4J91A 4ROSA 5E0OA 3PGLA 4A2QA 4G8DA 3GDWA 5FD8A 4G0QA 4GPAA 4CCAA 4HWKA 1C8BA 3RBXA 4E2YA 4JL8A 2YXNA 5CURA 3W0LB 5EPOA 4GM1A 3SZGA 4PS0A 3QKWA 2ZETA 1MNQA 2O2SA 4JP2A 5COAA 2D00A 5B4TA 2HY7A 2ICAA 3BUSA 2YICA 1JFRA 1D2HA 1Q83A 1EQ2A 2H59A 3H4VA 4XCVA 4BAGA 4Z7JA 4BPBA 3MT9A 2PT6A 3A9SA 4YJKA 3ZHYA 2ZUFA 3I9OA 2GVDC 2ZT7A 4IBOA 1CY4A 2F43A 3LY7A 5I48A 4J90A 1W47A 3UJ9A 1P2VA 3HEAA 4ZREA 5FB3A 3OHMA 5AM2A 2Z98A 1AB5A 2DR2A 4AUMA 2JLBA 4R8RA 1W581 4GT1A 1P5JA 4MV9A 5E6SA 1U2GC 3ZVKA 4L4SA 3FOAA 2O8EA 5KJ6A 1TUIA 3IMCA 4C21A 3GLIB 4FGWA 4JJAA 5TX7A 1CWUA 1WLYA 2W4IA 3EDRA 5DP2A 5M29A 1Q92A 1A72A 1JHMA 2YXEA 3DFKA 4MDYA 2I6XA 1PDOA 3H86A 3N0RA 2QUAA 4KE9A 3N0TA 4ZZ2A 3LHIA 2O2JA 1S2DA 3H1PA 1QIDA 2G9RA 2XKAA 3L79A 1ISMA 2YWHA 3LBNA 4GG1A 3R7FA 5KMGB 3ZY2A 4C0BA 4K6OA 3UK7A 1YE8A 2HWWA 3ZU4A 2AN3A 4CETA 2OT3B 1BXGA 4IDBA 4TL8A 1I33A 1M1NA 4KR9A 4AYWA 2GRUA 3DDSA 4U9IS 2K6GA 4CMAA 2AR0A 1U5CA 4L3OA 4PNHA 1RRKA 4IGEA 4K0RA 3JWIA 1LJ8A 4BGEA 1GCAA 4BV3A 4BO6A 2XUPA 2D0DA 2DF8A 1DFGA 1NUAA 5E4YA 4CG2A 4YV7A 1O6CA 2ZREA 1JNXX 3WRXC 3L0IB 1GG8A 2XE8A 5JXWA 1RC0A 3BZWA 3IOYA 4RXTA 3P94A 3DMTA 4A8JC 3ZY6A 5GGXA 3JSAA 4FMBB 4HXGA 3F5QA 3R76A 1PW5A 3BWEA 4RK0A 5EKSA 3B70A 1XN4A 3N58A 5KJFA 3OQOA 1OGYA 1PK9A 3C2QA 3AWIA 3WISA 3EDCA 4TUYB 4C5CA 5HF5A 1SMKA 2J3EA 4ZTBA 4HY3A 1L3CA 2C8LA 2ZYSA 3HRHA 1KP3A 3SBOA 1YI1A 4CI9A 4C0JA 4JP8A 1HDGO 2V7QD 1W4CA 1NHWA 4MQ4A 3GIDA 5DYGA 1EA7A 4QUBA 3RVBA 4L9AA 1J5PA 1F0PA 4TV8B 3L0YA 5DI9A 5K3CA 3TR0A 1TO1E 5DWVA 1NXPA 1NN1A 4NNJA 2CF5A 1U90A 2H1OA 2FSHA 4H1TA 3U3DA 2OLEA 1W4LA 4DLYA 4W7HA 5T7BA 2WF5A 4XIYA 1TZ2A 3G0OA 1VTKA 4R1QA 3DHNA 1Z37A 3BMOB 3RC3A 2NADA 3N0WA 1W9HA 3I0MA 2G0TA 4P54A 4N8SA 4NAVA 2F1HA 3OLCX 1MIOB 2P91A 1X92A 3KJNA 3DS8A 3H0CA 3EXHC 2RMKA 1KIFA 2JIRA 2XVAA 1K68A 3AVPA 3QV2A 4Y6QA 2HGZA 4I1IA 2QLBA 5EIBD 5EZSA 3SYTA 1ZSNA 4B4WA 3WYEA 3L4BC 5A7HA 4JEUA 5CA1A 3U60B 3SK0A 2Q2NA 3CF2A 3B1YA 3NLLA 3AJRA 4LKOA 4MW7A 5E3IA 3W5IA 2Z2KA 4RPCA 3EOBI 3VV3A 4DSOA 3SZLA 1XJQA 2QLJA 5JOQA 4NE7A 4O08A 2EFCB 4P36A 4XUGB 4B7ZA 3IGFA 1QHIA 3LXXA 1L4UA 1U1FA 4XIJA 2HT6A 3OU6A 4F5ZA 4U5QA 4BE9A 5IHPA 3H97A 5EJ4A 2YVKA 2HO4A 2YC4C 3H2JA 3K6JA 4ETMA 2YR0A 4A92A 5SZKB 2PQ2A 1X1EA 2EHDA 1JSZA 2FMHA 3QIAA 4JC8A 5FUBA 5T3YA 3DE0X 1EUQA 4FEEA 4HX5A 2O8BB 3I92A 1PT9A 1Z3IX 1ZM7A 2HPVA 3QSGA 5FORA 3TRJA 1MQAA 3DYVA 3GLFB 3HCEA 2QORA 2AUMA 3PI7A 4GSYA 4RQAA 2JIDA 1HNWB 2VUTA 4EYOA 1YIOA 4GZMA 4QPJC 4WESB 5FUXA 2X0DA 1P8JA 4YC7A 1V41E 4DSTA 3FDXA 1JLLB 4L4RA 2OO5C 4BGDA 4HAYA 2OWDA 2WHEA 2IK8A 4WCDA 3MIIA 1PP4A 1DO8A 2QD5A 1OJLA 2QR2A 5ALUA 2IY9A 1G6Q1 1YZLA 3IBCA 3R2JA 4PIVA 4WXPA 1AOXA 3VA7A 2CXSA 2Q9CA 3LJKA 2JBAA 1HWYA 1N5LA 3HE3A 3F4LA 2ZRHA 4ZCQA 5HE9A 1KK2A 1N5JA 4A5OA 4ARBA 4BAZA 5IABA 3EYWA 1JP7A 2EEZA 3VU1A 3ZIAD 1GL7A 4UCWA 4W1RA 2XNDA 4RSHA 2OGUA 3ITNA 1W93A 1XOIA 2O05A 2WJ3A 4OK3A 4DR5B 3KP1A 3AUJB 3S8MA 4BP9A 2WY2D 1EIWA 1WPXA 2A7XA 4KTVE 2AW5A 2BVNA 2Z5VA 1DMSA 2OCYC 2D7DA 1VIVA 4JBGA 4N7RA 1I2CA 1WHTA 4TYMA 1C3JA 3ZLBA 4F92B 1N6OA 3TD6A 3CSSA 2VDWB 2B6NA 1H5NA 4RL6A 3IVXA 2Z56A