4ECEA

Crystal structure of purine nucleoside phosphorylase (w16y, w94y, w178y, h257w) mutant from human complexed with guanine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
282
Chain Sequence
GYTYEDYKNTAEYLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANWEEVLAAGKQAAQKLEQFVSILMASIPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Catalytic Site Conformations in Human PNP by (19)F-NMR and Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4eceA00
4JWTA 2H8GA 4OJTA 1V3QE 1PR5A 1U1GA 3GGSA 4WKBA 4D9HA 3ONVA 4JP5A 1OUMA 5B7NA 1B8NA 1RXYA 2A0WA 3KU4A 5FAKA 1TD1A 4TXJA 4R31A 3ODGA 5K1ZA 4OGKA 1T8RA 1PBNA 2AI2A 1PF7E 4LNAA 1V48A 4OF4A 3NM4A 1U1DA 3GB9A 5F73A 4YJKA 1T8WA 3OPVA 4TXHA 4BN0A 4L5AA 2HRDA 2A0YA 1XE3A 1JE1A 4G8JA 3DPSA 4LNHA 4WKCA 1K9SA 1RXUA 2QPLA 4TXMA 4ECEA 4DA0A 3C74A 1G2OA 1Q1GA 3UAYA 1LV8A 4L5YA 1TGYA 2OXFA 3UAZA 1PKEA 1JDTA 3F8WA 1N3IA 3MB8A 1CB0A 1ODJA 1YR3A 3IEXA 4UC0A 1JDSA 3SCZA 3K8QA 4R2XA 3P0FA 4D98A 1Z5OA 2QTTA 3OF3A 4TTIA 4FFSA 1JE0A 5EFOA 4KN5A 1I80A 4H1TA 3NBQA 1PW7A 3E9RA 5CXQA 4QEZA 3DDOA 4MCIA 4DA7A 1K3FA 5F7ZA 4TS9A 1TCUA 3UAWA 1NC3A 2XRFA 5DK6A 5F78A 3EEIA 1VHJA 1RCTE 3BJEA 1JYSA 1A9PA 1T0UA 3D1VA 3FOWA 4IP0A 1Z39A 1PR1A 2ON6A 5KB3A 3BGSA 5F7XA 3DJFA 1NW4A 4DARA 4NS1A 4D8VA 1Z5NA 3FB1A 5EUBA 1OTYA 1YRYE 1YQQA 3EMVA 1SD1A 5CXSA 1PK7A 3DP9A 1LX7A 3O4VA 2QTGA 4PNPA 1OV6A 4EB8A 4YNBA 4WKPA 5F77A 3LA8A 2IQ5A 1SD2A 4YO8A 3PNPA 2B94A 4L0MA 4DAOA 1ECPA 3OZEA 4MARA 1V4NA 5CYFA 3INYA 4YMLA 1Y1TA 2OC4A 2I8AA 1FXUA 3TL6A 4F2WA 1U1CA 2RJ3A 1A9RA 2GUWA 4TYMA 2P4SA 4U2KA 3OOHA 1RT9A 3EUEA 1Z35A 2BSXA 3UAXA 1RFGE 5B7PA 4F3CA 2OECA 4G89A 4TTAA 4TTJA 1Z33A 4QFBA 4F1WA 3UT6A 1RXCA 4LZWA 1Z5PA 2ISCA 4OGLA 3FNQA 1JDZA 1Y1QA 3OZDA 4L5CA 1VHWA 1PR0A 3QPBA 2AI3A 1Z37A 2HSWA 4DA6A 1V41E 4DANA 5B7QA 3KVYA 5CYGA 1V45E 1RYZA 5CCEA 1A69A 4LDNA 2Q7OE 5I3CA 1RXSA 1Y6QA 3E9ZA 3KVVA 2QSUA 1C3XA 1T8SA 3FWPA 2PGAA 3UAVA 4EARA 1YQUA 5B7GA 5JPCA 1PR6A 4WKOA 1PR4A 3LGSA 1U1FA 2OC9A 1B8OA 1OU4A 3ENZA 1ODKA 4M7WA 3NM6B 4QATA 4MCHA 1ULAA 4NSNA 3BSFA 1JPVA 3K8OE 4DA8A 1T8YA 1ODIA 3MMSA 1Z36A 4TXLA 1OVGA 3BL6A 1VFNA 4LKRA 2HWUA 3EUFA 4F2PA 4L6IA 2QDKA 1PWYE 4DABA 5ETJA 1PK9A 4TXNA 4G41A 4PR3A 4D8YA 1LVUA 3DF9A 1M73E 1SJ9A 4GKAA 1A9QA 1K27A 4BMZA 2HN9A 4F3KA 1Z34A 4E1VA 1OTXA 1NC1A 4QARA 4QAQA 4BMYA 3T94A 5IU6A 1JDUA 4GMHA 4P54A 3PNSA 3KHSA 5C80A 1A9OA 1ULBA 3PHCA 1QE5A 1A9TA 1Y6RA 4D8XA 3OOEA 4WKNA 3IOMA 1ODLA 1U1EA 1ZOSA 2AC7A 2I4TA 3NM5A 3KVRA 4R2WA 3O6VA 3FAZA 4DAEA 4QASA 1TGVA 1PR2A 4GLFA 5CCDA 1VMKA 5F7OA 3E0QA 1TCVA 4GLJA 1Y1RA 1A9SA 3U40A 4OEHA 4BMXA 5EPUA 3KUKA 4K6OA 3P0EA 1CG6A 4RJ2A 1Y1SA 3OCCA 1ZL2A 5F7JA 3LBAA 4NY1A 1YBFA 4M1EA 4JOSA 1V2HE 4I2VA 1WTAA 2A8YA 1RR6A 3FUCA 4OY3A 1SQ6A 3OZBA 2AI1A 3OZCA 4TS3A 1Z38A 5IFKA 1JP7A 2A0XA 4X24A 1JDVA 4M3NA 3PHBE 5F76A 1RSZA
chains in the Genus database with same CATH superfamily
4CKZA 3WNVA 3QA9A 4X65B 1ZNXA 4I50B 3IODA 2UXBB 1MR3F 1NUPA 1VDZA 1MAUA 2I55A 3M3PA 1M7GA 3LW7A 3P20A 1NTOA 2WJIA 3I6QA 3A6PC 1EIZA 1IY1A 1WIWA 2AW5A 4OXKA 4D9NA 2C29D 3WGQA 2ZT5A 4MVJG 1M67A 4X1IA 2ISSD 5TF4A 1MOPA 1RYMA 3D6VA 3WOHA 3HHEA 4KMRA 1Q0RA 4F4DA 2JKZA 1F51E 4W8GA 5B1HA 4NF2A 4AG6A 4YP0A 1J2TA 1BQEA 1M0SA 4Y2UA 1J70A 4PC6A 1I1QB 3T1OA 5DNYB 2RAFA 3EAGA 1BWPA 1XGKA 4D97A 2C9YA 4COKA 1V48A 4LNUA 4BO5A 3L8DA 2Y6VA 4P8RA 3I3OA 4EYSA 5F23A 2OV3A 3HN2A 5KC9A 3TKLA 3IHKA 1QVZA 4YRQA 4OMCA 3WQQA 3QBJA 1UWLA 3FWYA 1HMYA 3UUEA 4CL2A 3WWOA 4KC0A 3Q9UA 3T52A 5KU1A 4JXKA 1NF2A 3E58A 3REQB 4D46A 2IPAB 1XMIA 1DPGA 5JFGA 2XX3A 3H13A 4KXUA 5AK0A 3PJDA 4Y0AA 1JBKA 1Z2NX 3ABSB 3VO2A 2Z08A 3TD2A 5CEEA 1XWFA 3A1DA 2P62A 3IRVA 3VNRA 1VPWA 4XOUA 4QTUB 3TOCA 4XWAA 5B6PA 3NHKA 1SB8A 3OECA 3DV9A 4FMPA 2RFLA 4IDFA 3CY6A 3V1YA 3DOHA 1VIDA 3LPCA 4CR6A 4G1EB 2JLBA 2VAWA 4L28A 5GPBA 5TQJA 3DPSA 3IAS6 1COWA 4QT4A 4Q12A 4CMHA 4C06A 3RK4A 3C6ZA 3NT5A 1F2TB 2Z4RA 4G4JA 2BM8A 2PH3A 4HDQB 4DUPA 2D74A 4MK4A 4RTQA 3ZK7A 3O8QA 2YYAA 1MU0A 1HEYA 3AVXA 3AETA 1OBOA 1P39A 4M1ZA 3RWBA 4YY3B 3CISA 4PPQA 6REQA 1JAZA 2EKBA 5AUOB 3LU1A 2RJNA 4YMUA 3P9CA 3G8YA 1Z4MA 1Z0FA 3PDUA 5HR5A 2NU8A 3A4YA 1H2XA 3MB8A 2I1LA 2VSQA 1NVWQ 4I5FA 1ECBA 1RTTA 2C92A 3R9XA 5JH7A 5I7UA 4ZAFA 2BH9A 3RHTA 1KI3A 5G4KA 2P3OA 5K0GA 5FTMA 1OBFO 3ANSA 3I04M 2YW2A 1M0WA 2YN0A 3UEOA 2J59A 3LFTA 2BMJA 1NXTA 1OZGA 3LQYA 4CLEA 4HLQB 4HD8A 4BJ6A 1DRKA 2BKEA 4JL5A 2OCLA 5GVSA 4AG5A 1CS4C 5J63A 3PTAA 3GXBA 5TMDA 5TJHA 4CM3A 1S1CA 3BFXA 3TPZA 3JQQA 3TLGB 2NUTB 3BULA 2Q0SA 3B70A 4FINA 4WLOA 3X1ZA 1ZK4A 4HXFB 4TKVB 4TKUA 1TM1E 1THGA 2WF7A 5JROA 3M9WA 2RH4A 1BCSB 4R16A 3TMKA 1KS9A 4MUGA 4IZHA 4DADA 2AFHB 1WG8A 2FEPA 5C3UA 1XWIA 4QZVA 1ZKDA 3EC1A 1DZ3A 4MV7A 4JI8B 4NPAA 2WNHA 3RW9A 2V5AA 2E4UA 4NPCA 3QGMA 1MP0A 1M6WA 1ZWLA 1BMFA 1J90A 1KP9A 1Z5WA 5KJCA 2OWEA 3A1FA 4ISCA 1DMSA 3NHJA 2OAP1 1HE8B 4OQEA 4B83A 4ZCRA 3VSDA 1I7PA 3T3EA 1Z0DA 2XF2A 4UJ3A 5C1OA 3JQAA 2PH5A 2W7TA 1DWPA 1XKQA 2AJBA 2IZ0A 3D59A 3FPCA 2VCYA 3WAKA 4DLRA 3KJXA 2WSBA 4C05A 3AM1A 1I5OA 4BNNA 4DBVO 1XROA 2J9FA 5AKYA 5JO0A 3VOSA 4IQ0A 5DM1A 1UC8A 4RQBA 1P9OA 2OR3A 2VNHA 1UOQA 3VSEA 4N47A 3WGHA 2VRBA 1MX5A 3PQDA 1DEXA 1X8KA 2GA8A 1MVLA 1PLJA 1L6IA 3EQZA 1J39A 2OA0A 3NKFA 4HWTA 4MTCA 5HZMA 5H81A 4OH1A 2RH9B 2WJ3A 3GRAA 3IAUA 5IDQA 4LHZA 2J3LA 3L9WA 5G53C 3COJA 3CNOA 4LPKA 1ZW1A 4ZEXA 5F7XA 2PWZA 5B1DA 2Q29A 3EJ6A 5K0BA 4BNFA 4KSYA 1YQGA 1N2CA 2RG7A 3BH7A 4C4AA 3DDWA 4DSUA 3B5JA 3FUXA 1A4UA 1EQUA 2HNBA 3LPAA 1UP7A 2FG6C 4MP3A 3Q8XB 5HKLA 1E1CA 1QG4A 1UR5A 2JJQA 2PX6A 4J3NA 2P3QA 1SD1A 1NAHA 1TMGE 4PF1A 1HNXB 5CXSA 1AHHA 1BVYF 2DQKA 4PAGA 5CG1A 2Q07A 1TRKA 2EVWX 3PSHA 4H7FA 4C5AA 4DNQA 4PXYA 2QTGA 3E6AA 3FYUB 1LW7A 4YREA 5I7VA 3HCFA 4MV3A 2WIBA 1W8DA 3G2LA 5DTJA 3B52X 2PNJA 3JV7A 5KTRA 4QUGA 8ATCA 4MDHA 5EIBC 2WUVA 4KX5A 5JSZB 3C1OA 1UDWA 5B12A 4JYZA 3QUCA 3BHNA 4WKPA 2W2KA 2R2AA 4UOQA 4ZVQA 1MJGM 3BMXA 3I2KA 3OSZA 3SHVA 5LMNB 1F9AA 3CH7A 1ZM7A 3X1DA 4WXHA 5KPDA 1KR5A 3BCRA 4KJZA 3U16A 3K0HA 3T7CA 1KP3A 3W7BA 1C7FA 1NVUQ 5AH0A 4Q9JA 5IUJC 1KMQA 4PLZA 1W4AA 1R37A 2XUJA 1UPUA 2WWIA 4L0MA 1NWHA 2J6IA 2H85A 4N7RA 1MHPA 3PFFA 4NZZA 5CT6A 3ZU4A 3CTMA 3QOFA 4ITRC 2FPPB 3I9OA 2CYCA 1SA0B 2CXTA 1L5WA 5BSFA 2H52A 2RARA 3KRTA 5A71A 4PC3A 2FPGA 2G83A 4OKIA 4YLEA 2XB4A 3TEMA 2FV8A 4BECA 4BGDA 4UAUA 3CG4A 5DI3B 3K9CA 1CZOA 2VPPA 1ZM3A 4GRAA 4D44A 3HUTA 4Q4AA 4A8JA 4B8ZA 3QXJA 3LZDA 2J9ZB 2VJOA 2QQFA 4Q1BA 3AESA 4F2GA 4YMVA 1MA3A 1N0WA 1S1MA 4WBNB 3FDJA 1U2QA 4Y2XA 4AJKA 3RKUA 5ERGB 2HA4A 2JHFA 2O2JA 1WDMA 1Z4OA 5K7SA 2Q6TA 4CEHA 1M66A 2EWWA 2A94A 1EKXA 2W2PA 3GG2A 3NAQA 2P2NA 3X2SA 3ZN2A 4ZYXA 4LI0A 5K6RA 4U2FA 1OWPA 2BTOA 1JECA 3N0XA 3UMJA 1HOXA 3LSYA 3BCHA 1RQGA 4CIBA 4N4AA 2ODAA 2C5HA 5HMMA 2AUTA 2XYVA 4LRTB 4TMKA 5IPFA 3WISA 1XNHA 1KU6A 3K6JA 3GBPA 4X91A 5KTMA 1Y0BA 4P53A 4TWIA 4RCVA 1Z29A 2TSYB 4LFCB 4S2EA 2AN1A 3L9XA 4ZDWA 3ZU2A 1Z5PA 3I4CA 4DM7A 1S89A 2C3MA 4CQMD 5IAAA 4Z51A 2B1GA 1EGHA 2GN8A 4C6TA 1GGNA 3EFEA 3U17A 2NNLD 3BMOB 1N1MA 1GG2A 3OJOA 3K0CC 4W5RA 3R0JA 3ESXA 4QDZA 1AGNA 4H60A 5EVJA 3UXEA 4D57A 4BFCA 1FP7A 5H02A 3BC1A 3N6VA 3CA8A 3IP5A 1FDTA 1XCJA 2ZBPA 4PO1A 4DA6A 5FA5A 4Q19A 1AN0A 4LDZA 2AOWA 1N33B 1T3GA 1ULZA 2V0CA 2QIOA 3N0VA 4RNCA 4FLMA 1HE1C 4L2IB 5G0TA 4DQKA 3FSRA 3SJBA 3NOXA 1XRQA 2QY6A 2XE7A 3C3CA 3L1KA 1VE3A 1YZLA 3EEYA 3H9CA 2D06A 3TAXA 2ZRNA 3B13B 3HCOA 4IINA 2E4ZA 2ZIZA 4LY0A 2R6GA 5L9AA 3ABQB 3CF4G 4BWGA 1SKBA 2IHNA 4U9HS 1DAFA 1U4NA 4H4DA 4EGFA 1ORDA 4MWSA 1I6KA 2FCAA 3OQBA 3UAVA 4QO7A 3TLEA 2I2XB 4EARA 3KJQA 5F5LA 1YMQA 1PUIA 2QG6A 3HDJA 2ZTUA 5E6SB 1AHNA 2WDPA 2NV6A 4GX1A 3GYGA 5IASA 4X45A 3EDYA 1H4QA 2V6JA 4IIJF 4DIMA 1NI5A 3IIEA 1YZGA 2DWPA 4KGDA 2HADA 1R4NA 1Z2CA 4S12A 4LRWA 4YAGA 4R9RA 3ORHA 4UM5A 4R9SA 2A7QA 3OAAD 5ARCA 4AAYA 2VXBA 3TXYA 5LQCA 1YB1A 1WU8A 5BSWA 3QX8A 2WU8A 4PZDA 5CDYA 5NLLA 2GM9A 3BF8A 2ZYRA 1PJCA 2WLTA 1IPHA 4JP3A 3D6NB 3ODPA 2NG1A 4JDPA 4G4GA 1VL5A 1GU0A 2JS7A 3K8OE 2KBEA 2EOAA 3PDCA 1XD9A 2QRGA 4TS1A 3DZKA 5TPWA 1EZZA 1SOMA 3ZXXA 4Z54A 3DDNA 3OLCX 1YZUA 4RFSA 4E7PA 5LFAA 3MK31 4Q4CA 3AYXB 5KUTA 3U13A 3WB0A 1K0UA 3OPQA 3OVMA 4XX0A 4JWKA 1XHEA 1VCIA 3JWHA 4IOLA 1T4DA 1IBRA 1U8UA 3FLEA 4OAOA 4DQUA 5ITWA 1ZHOA 2F00A 4F4JA 2E1PA 2X2OA 1GA4A 1I4WA 3N74A 1Z88A 3CW2A 3IUEA 4E22A 1NBMD 2Q6OA 3B2NA 3GL9A 5L7YA 4L16A 3I6YA 5TGZA 4UOEA 1CY6A 2W6ZA 3F7MA 4GMXA 4JFRA 4BMPB 3RBXA 1U2GC 2COKA 3MHTA 2VIIA 1XRRA 3H83A 5JPIA 1YJAA 3Q3GE 3SZMA 2VPZA 4YRPA 1B23P 1Q91A 1EX9A 1DTSA 3WRYA 4XGQA 2REBA 3HNPA 4V0KA 3AW9A 2VI5A 5EP3A 4B43A 1JG7A 4BN4A 4EUHA 2B7LA 2K4MA 2G9QA 2Z04A 3A3OA 1UFOA 1SBQA 2B21A 3NWEA 2R6HA 3QQPA 1K27A 5CP8A 2QU8A 2VF7A 3QEOA 4TTPA 3WA6A 1N5RA 2YN4A 3PGKA 4QXPA 4GBGA 1E61A 2HZBA 1R5OA 3HKBB 1TQ2A 3ACBA 1Q7TA 1RHUA 3A7EA 4FS8A 2PZLA 2XKBA 4JLDA 5CVDA 5AK4A 3TTYA 3S0JA 5LP6C 4GC5A 2ZB2A 2J5XA 2OILA 4KWTA 5JXGA 2PRSA 4O6VA 1QIEA 4R1UA 2EW2A 4BU1A 4G1VA 2Q2QA 1BS2A 3PI6A 1LBSA 1F6DA 2Y1FA 3VU8A 4ZHSA 4US2R 3PHHA 2Q50A 3L2OB 1PDOA 2RB5A 3EWSA 2C5GA 3HI4A 3HVIA 1RZRA 2IH4A 1KI6A 3RSFA 1AA6A 2CJYA 3OJCA 5DB4A 4ZQBA 5CB4A 2J0UA 3FWKA 2BF7A 3H7IA 2W4MA 2C57A 1U3VA 3M49A 4PO9A 4UTXA 3DYIA 3OPNA 3CUSA 4E3ZA 1G41A 1PEAA 2OEPA 4BMVA 1E9EA 1E9FA 4BBJA 1IIBA 1U8FO 2GGSA 4KIWA 4UOZA 3HWX1 5FKJA 5CDFA 3FZNA 4MGHA 1F8YA 1G291 4EL5A 2OXIA 2WU0A 5DRYA 3MWEA 4POAA 3UFXB 2UYHA 3IEMA 3F6CA 4I8DA 2BSQA 1Q3TA 3HJUA 2WQZA 1B16A 3GAAA 3P8ZA 3NALA 2YYSA 3BWCA 3M6IA 1NYTA 1QYVA 3LS2A 4TLCA 2XCUA 4UTNA 2JKVA 2NUBA 3H2GA 1SQSA 4FYJA 1N32B 3CX3A 4EJ0A 1MCZA 1EDEA 4WLUA 5BW8A 2F1JA 2P6NA 2WJJA 3SKXA 2I2BA 2KLHA 3USCS 1TX4B 3E27A 5LOVA 1ETHA 3DC7A 3DLIA 4HOYA 1ZCJA 4EO4A 2QRLA 3RC9A 1ADBA 2G07A 2MINA 3DD1A 3N1UA 3WRXA 3MB5A 4LBYA 2HRBA 5IJ0A 4EBBA 1TCVA 3PFWO 1RRMA 5K09A 2BHNA 2HY7A 4D9EA 2ZITA 2PGJA 5IULC 2SKDA 2BFFA 3DMGA 3B6IA 4DCGA 3W3ZB 5CA0A 3TFWA 2CVHA 1W4BA 3EX7C 3QG1A 1LJ8A 1FDUA 3P0EA 4Q9HA 1JLKA 4YALA 3RS8A 1JDBB 1NOIA 3LUBA 3HBJA 1I0ZA 1EAMA 1WOYA 1Y6ZA 5HIKA 4TSKA 2RBGA 1OXSC 1Q1QA 2ZIVB 1CJVC 1ZL2A 2C1ZA 1Q7GA 1NBAA 3M1AA 4YJGB 3GLIB 1YDWA 1U2RA 2IELA 1H6BA 1HV8A 2AVDA 2D6FA 4PZEA 4DIKA 4F3TA 4ZOLF 4ZALA 1X86B 1QTQA 5KMGA 4JU9A 1ORHA 2C4TA 4YJHA 5J47A 4JOSA 1H6CA 1WCIB 4MYSA 1LPBB 4MXDA 1ZOIA 3GAFA 4PTZA 2FX3A 4XPIB 5DIZA 3VZSA 2IXEA 4AMBA 3GO4A 4I4NA 3HRKA 4MW6A 2WHYA 1TKBA 2AI1A 2CT8A 1QPGA 2A88A 4WNYA 4F4UA 1DUVG 4JQOA 1I24A 1W34A 3PKJA 4EGAA 2NP7A 4WZZA 3OEED 3C5EA 4CR7A 4NFSA 3V8RA 4MGIR 3C98A 3NBUA 3SFVA 2FEKA 1VHDA 2C1EA 1D4ZA 2QN9A 5F2OA 3VZDA 3E9YA 1OPXA 3Q2KA 1CE8A 1NRWA 5GZ6A 1Q1AA 3SKYA 1M1YE 4MQBA 1BEEA 1EX7A 1Q7RA 4HNAB 2YMLA 4KP7A 2FOIA 2FVXA 1Y6GA 2E6UX 4UTVA 1UC5B 1Q83A 2HU5A 1IY9A 3AR4A 2O5EA 5FO1A 1GY8A 1H23A 3R74A 4EHKA 4KFUA 5BXQC 1MV8A 3Q6NA 2XGJA 3BUSA 1E2FA 5EWMA 1J56A 2D5IA 1A77A 2UYGA 3GD5A 3I8OA 3NUZA 4LTDA 5CHYA 5B7NA 2KE5A 3FNBA 3ZH2A 4MA0A 1U28C 4JLSA 1RE1A 3U7EB 4R3NA 3JWIA 3HADA 4GYJA 4D3XA 5IXJA 2VFAA 4QNNA 3H9GA 2NUPA 1YQ9A 2TYSB 3Q3JB 4LNAA 1WDTA 4XH9B 1PGPA 3TO5A 1LI7A 2I4OA 4CNBA 1DUSA 1OGIA 2PX5A 1V37A 1XCLA 3NAGA 1RM3A 1IN6A 5JEDA 4PONA 5I7FA 4X9XA 2O9JA 3BJZA 3MXOA 5FFFA 4N12A 3U3JA 4BO9A 1GHTA 1ACJA 1QOPB 2YMQA 2NTJA 3C3AA 2C3UA 1AUOA 2DH5A 3TBHA 2IQIA 2GEFA 1O0CA 2JJ2D 4YAWA 4Z4HA 3A6KA 1JU4A 1KHHA 3CUEF 3U0VA 5AVVA 1UDXA 5IZCC 2XOKD 3AW8A 3EC7A 4M4SA 1V16B 2A78A 2D62A 2WWTA 3BIFA 3TI9A 4A0GA 1NVEA 4CKBB 3M9LA 2ILTA 2QRMA 3A4IA 4U3JA 2R97A 1R2QA 2Y67A 3A6JA 1VCMA 2Q1UA 1EDBA 3EIHA 4ZXFA 2PUFA 1D4AA 2G1KA 2IY7A 1V96A 2B82A 1PYGA 2P3SA 3IEPA 3PC6A 4JUAA 3BWYA 4P38A 1V0JA 5AHKA 2R1UA 2O4UX 3ZTYA 4WKCA 2CWDA 1ISPA 2DULA 1SU8A 4U5XA 1SOUA 4NJMB 1X7XB 4YV2A 2G72A 1WHTA 1XQ9A 2YUIA 4ZMBA 1WX1A 3QUAA 4P5PA 2W43A 4TUYF 5M5BA 3RHFA 2AN9A 3WL8A 2JB9A 3GF4A 3FOAA 4C1BA 3WLQA 2ZSKA 1O6BA 1DMRA 4RF4A 3A1NA 4YMWA 4OQQA 4DQ0A 3LC7O 1S3SA 4JLVA 3DSRA 1NKVA 4U8GA 1NE7A 1B0AA 2HSJA 3LWNA 4F71A 1ZHHA 2UUOA 2AFIB 3DVAA 3F8WA 5K8JB 3DMTC 1S3IA 4BBAA 2BR5A 3I8SA 2EF0A 2XA1A 5BSUA 1V8FA 1MO4A 2BKLA 3W34A 4D8TA 5LDDC 3DTYA 2EEPA 3D5QA 4OJMX 4Y7DA 1KEWA 1WHSB 2NXJA 4QX6A 4ZQCB 3E5HA 3VPBA 1T5BA 4B75A 4MIYA 2QLFA 3Q9NA 2HU2A 1FXSA 1F0NA 3EGXA 4UPVA 3E2MA 2FB9A 3KZOA 4FZ3A 2XWPA 4IXMA 2Y1KA 1BGVA 1H2FA 5CBPA 1SUIA 4HR7A 4KQ6A 4YXFA 4E5SA 1H8HD 1VLHA 1OAOA 3IR5A 4GWGA 1FIUA 4DB2A 5I8ZA 3SJ7A 4LJAA 3ZD6A 2PNFA 3GI1A 2ZYUX 4N5LA 2XKJE 4MPTA 5P8WA 3WRWA 3V6MA 4RANA 3WR5A 3A36A 3OM1A 3ZV5A 3FKSA 4ER7A 1LLUA 1AUPA 4C6SA 1E3QA 1E69A 1X80B 1M76A 4GBMA 3CUUA 4IMJB 4MI1A 3RBZA 1NR7A 1QG0A 5F9MA 4J1NA 4BQEA 1CXZA 2CXOA 3WL5A 1F1BA 4E30A 3UXYA 3GPCA 2XWSA 3H2HA 3JTEA 3UG6A 3WB1A 2CUKA 4NYJQ 2ECPA 1JLRA 1QFMA 4Y9UA 4WBSA 5EHIA 1QFXA 1LVGA 4RY9A 4UEJA 3NANA 1T5SA 2P9QA 1HQKA 5CU7A 1VSTA 3VXKA 4M9SA 1RYEA 1U8TA 2DECA 2VWPA 3A6LA 3KXKA 1H5QA 1JI3A 3ZQKA 2D54A 1O89A 4FEEA 5LLTA 2HKIA 3O75A 3RIYA 2N46A 3GZTB 1XNGA 1I8TA 4WZAE 1V26A 3S8MA 1UT5A 3TZQA 4N5MA 1YAHA 3MJCA 3PF8A 4KWEA 1APBA 1A9PA 3KJEA 2V7PA 1KBQA 2CNNA 3GA5A 4HNQA 4MW0A 1VSBA 3WKEA 1QDEA 4QHTA 5IAOA 2WJYA 5JXHA 3BWEA 4KQHA 1UXHA 1CUFA 3KB8A 2H1IA 3WLJA 4KMOA 1OH6A 4PG4A 2HK7A 1YE3A 2WT4A 4NLLA 4RA6B 4RF2A 2Q1TA 5CLIA 3K2QA 3ML1A 3RD5A 1Y80A 1O96B 4DKJA 5DYIA 1GARA 4Q3EA 4DARA 1R3DA 3GUCA 2VPTA 1YRYE 5EKXA 2X5KO 2V7BA 2H54A 3MT8A 5CA1B 5F4ZA 5A1TA 5B3JC 1RJWA 4M0LA 5CJPA 1O0SA 5ELLA 3D0QA 3EA4A 3UH0A 4C7MA 4HB2A 3V4ZA 3FTQA 1PJRA 3FNEA 3CYFA 1KH3A 2VJNA 2IHZA 4Z0HO 1LXCA 4CQJA 3KTFA 1XPJA 5HS6A 4C87A 4DSZA 2OHFA 4QOFA 4HDSB 4EKEA 4GICA 5K0LA 1ZGAA 4ZZ0A 2QMQA 1YR6A 3AR9A 4NYJR 4R3UC 1V43A 1DZIA 3B85A 4Z3DA 5IK2A 5MDHA 1J7KA 3NOVA 4D9MA 2O8BB 1OA0A 4ZOQI 3NBAA 1I1HA 4I3GA 3C7KA 1L7MA 3N58A 4PZLA 1GT91 2HRQA 1V3UA 3ESAA 4UBMA 3TDKA 2V8BA 3VX4A 1NZJA 1U3DA 2QT9A 4YRDA 5DHQA 5A3QA 2VRCA 2FFBA 1SIOA 1EWRA 3L0YA 1TTHA 3S2FA 4DLYA 4JH0A 1ODFA 3D3QA 1M1NB 3OESA 3QW4B 1HMPA 2JVKA 3ZK8A 4ARCA 1VKRA 1X39A 5DASA 4XARA 5AJUA 1EUYA 2Z43A 1MHTA 4CEJA 1WPQA 2Z6AA 2VNJA 2FE4A 3HCNA 1BMDA 1JR4A 4TZTA 1TCBA 1IN1A 2V3CC 1NJ6A 5BSRA 4CKEB 1CUIA 3G2PA 1BTOA 4HS4A 2IEYA 2YXLA 1UP6A 3BXEA 5CLLA 3V55A 2EQBA 4KYVA 1T35A 1OLOA 3HACA 2BGKA 3HU3A 2C8VA 3OUZA 1QRUA 1OOEA 1S0UA 1FFDA 2WKQA 4UREA 4KWIA 3UAXA 3SR3A 2DBRA 3ZE1B 4P84A 4B7CA 1G38A 3FBWA 3O8RA 4DYVA 1WOMA 1SU4A 1SG9A 1V3VA 1YVRA 1NVDA 3IVRA 1L4MA 1VI6A 4WY5A 5LIRA 4DR6B 2ZRAA 4KZPA 1FTSA 3AEUB 4DCNA 3KEQA 4AKTA 4DBLC 2A9OA 2HHLA 3PNBA 1BRMA 1JG2A 3IJ5A 3Q5DA 2I6UA 421PA 1KZ1A 1PV1A 1FFXA 1VLVA 2GBIA 3A06A 3D4IA 2BFMA 3KPJA 4JJZA 4P4LA 4Y0VA 3VGPA 5HCNA 2GLTA 3P4UA 4H7IA 4KU4A 1FQKA 1J33A 2BVNA 1CK4A 1AC5A 1NXVA 3U4QB 1V1MB 1JSLA 2O52A 2B3DA 1I7QB 4G5QA 3ROZA 3R6GA 1NP6A 3HFGA 3ZJ5A 5HKBA 4HCJA 1R6AA 4NE9A 2JLVA 1T8PA 3PENA 4LVCA 1P1RA 2D2FA 1B7GO 5BNTA 2NQ2C 5U1PA 4MMXB 2V54A 4O4LB 1FYWA 1U0RA 3OIGA 1IFXA 4J29A 4MUEA 3GP8A 3OU2A 3FYCA 2JA1A 4INPA 1ZONA 1V8OA 4EW2A 3QLTA 2HSEA 5GM2A 4PTLA 3I6ZA 3FGOA 1QCDA 1TKCA 4QYSA 2FQXA 4KFCA 1JT2A 4KDFA 4S0ZA 3X1XA 4DYDA 4RAQA 2O3SA 2EF1A 4D9KA 1D2MA 1H2ZA 3GCWA 5KOJA 4AJ1A 4BCCA 5I7RA 3AFHA 2R8BA 3K9QO 3BGDA 3UMMA 1COWD 3AF0A 2FSVC 3LLSA 2IDKA 4AZ0A 1VSQA 2RGCA 3A37A 3S7TA 4URYR 3QTBA 2EHDA 3EIQA 2REOA 2DLDA 4ARSA 1ZD5A 3CVJA 4U7HA 2R8RA 2NZVG 1MJHA 2NTVA 4FEGA 1VKZA 2G88A 3NWOA 1TQDA 5EIOA 2A5DA 1N7HA 3H9EO 3OQPA 4UCFA 3LG2A 4EQ6A 2PKXA 3HHPA 3PD0A 4K6FA 5BVHB 2NNWB 2Y4OA 4Q03A 2E21A 3FD8A 2GN4A 2WG2A 2PIAA 1ML3A 2R60A 3ET4A 4YRCA 2OPBA 2B1RA 5D5PA 4ZAVA 1W4CA 3GD7A 4MCHA 1E0JA 4IDEA 4D3DA 1MENA 2ORVA 3LC1O 3GT4A 4ZCIA 1CYEA 1A71A 4QDXA 2ZIGA 2P6OA 1VMIA 4DT1A 4YFYA 1T8YA 4R1NA 1QG6A 1JKIA 3K96A 3N05A 4PHCA 4RD2A 4CQNA 1JVSA 4DYHA 2XDYA 3ZE8A 3E0XA 4UTOA 1F2DA 2QDXA 2AMVA 3ZCSA 4XTCS 3M4YA 4PGMA 4BRSA 4C43A 3H5NA 5L3QA 1WXHA 2AX3A 1G64A 3ZGOA 3VHRA 1SRRA 3NNDA 4PQGA 5IBRA 4UUBA 1IMJA 1FPQA 3C24A 1RYFA 4K81B 5E2AA 4I3FA 3RSHA 3NRJA 4YRFA 3RANA 1VKOA 1E9VA 2UYOA 3QUSA 3D8SA 2XCLA 3JD4A 1Q0QA 3SM9A 3R09A 4REOA 4FP9A 5FT9A 3AX6A 3PDJA 5BWBA 1BMFD 4K0RA 4Q5IA 1EESA 4EA7A 2VHUA 5TLSA 3JQCA 4R2HA 1B15A 5LKRA 2ZS9A 1BQ4A 3OQIA 9ABPA 5LZ2A 1RZUA 5IVHA 2GJ4A 3OFKA 3RB8A 4F60A 2WFLB 3JQAD 1Y1KE 4IHAA 2X5OA 4KLRA 1UJCA 4H4EA 4C4PA 1ZK3A 3VAAA 1EG7A 3O8QB 3KNZA 3GFOA 4C0XA 1R5JA 3NT4A 1OTXA 2HAEA 5J1SB 5A3SA 3HXOA 2WHPB 2X42A 1A5BB 1COZA 4QARA 6REQB 3OICA 1F0KA 1Y3HA 2GBCA 2Y1EA 2JFPA 1CCWA 3RGGA 3IMKA 3RVKA 1B6TA 5CH3A 2NU8B 4DUGA 5C7LO 4ZQIA 4F86A 4QL3A 2IODA 1E20A 1JFLA 3WQRA 4KSCA 1H2HA 2PZBA 2V4MA 5CAEA 4W5WA 5LJIA 2O7SA 4HTFA 2BUAA 4X20B 3K70D 3WLHA 3RS3A 4ERXA 4MW2A 2R1TA 4KDCA 5KYTA 2M9MA 3TNFA 3MINA 3QU2A 1Q3HA 3VSAA 2G4CA 3H5OA 2TMGA 3W05A 1TIBA 4HLUC 1YACA 4XWWA 4XVUA 2UVDA 1K63A 2Q5IA 2QT0A 1V5WA 4HPXB 5KNCD 1Y6RA 4MCJA 4FB5A 2DC1A 2Q7XA 4B8YA 3GJYA 1H4VB 4I55B 4Q4DA 5DTQA 3OEHA 2NMVA 5KWVA 3OI7A 3L05A 2BFOA 4ENPA 3AF5A 4KTTE 1XSEA 4TKUB 3C43A 4ACAA 1SBTA 2JVJA 2G80A 4OIFA 1QFSA 1IY0A 1M34E 2Q3CA 1KEVA 1WJGA 2NTYC 2HNKA 2J31A 3H99A 1TUBA 5EAIA 1RYBA 2JEOA 4P5EA 1Z07A 1KO1A 1H0HA 3BMQB 1GPMA 3CJQA 1OX5A 1XI2A 4PPGA 4RU1A 1EDZA 4ZRNA 3BE6A 4KQ9A 1UJMA 1SXJB 2JGDB 4URFA 4OYHA 3HBLA 2FWBA 3HR8A 3UUFA 3K0BA 4H1WA 1ISHA 4NQZA 3MJVA 4KYTA 1Y37A 1HDYA 1JZSA 1SQGA 1R4ZA 2ZROA 2DPHA 5JE8A 4BTEA 1PYDA 1RWNA 2GT1A 2WE7A 2ZUVA 3L01A 4YP5A 5GJVC 3F73A 3MWDA 3JQAB 4B48A 3WJAA 1WY7A 4QSHA 2J9XB 1WUIS 5LQSA 3VYTB 4ALMA 1MAHA 4TTSA 3H9BA 3PDIA 1ESEA 4JITA 2B4RO 2WJHA 3LHFA 4HQNA 2QX4A 1QAMA 2J9FB 1MLDA 1LRKA 1XK7A 1H94A 3EG5A 4HWKA 3GARA 4P7KA 3NHRA 4QXMA 2EX0A 5FWAA 2G4VA 3KJFA 1XDZA 1YZTA 4U02A 5ES3A 4DKXA 1X7ZB 1M2HA 3MW8A 5KVSA 1N3LA 1Y9EA 4JB2A 1K3TA 2LP4Y 3O26A 4V0OA 5H5JA 5TT1A 3GFQA 1GLVA 3EZFA 2P77A 3OQ1A 2IYOA 4NWIA 2F3QA 1ZXLA 2OD9A 5ALYA 4HZIA 1D6JA 2G7ZA 3AM4A 2KBFA 2QD3A 1AO3A 2VTEA 3RVBA 1WDWB 3URKA 4M1EA 2R7AA 3JATB 3BD7A 4L22A 3Q87B 3TSCA 1LRJA 2GRUA 2D5CA 3P9RA 1BOOA 3OBBA 2K87A 3MMXA 3G5UA 3SYKA 1N92A 1DB3A 1E1CB 3T4PA 2H4FA 3H05A 1QRAA 1DSSG 3F8SA 4BO0A 2VT2A 5AQEA 2PBLA 4M0UA 2PWPA 1TADA 2J46A 2VBGA 3E84A 1Q20A 1G7TA 3L6DA 3LUFA 1TQHA 4NMMA 5L3RA 1E0AA 1BE8A 3E2PA 2BGNA 3D3EA 2I3GA 1Z5UA 3CLUD 4F7WA 3SNKA 4OHXA 3PK0A 2M6LA 4AIRA 4B7ZA 3DLPX 1KHTA 2C4VA 3MPUA 2OO5C 4RA9A 1XBTA 5AXDA 1PTKA 3ECSA 1KAHA 1NNLA 2PRKA 4I4TF 1V35A 4MMZB 1SC1A 2ATXA 1NOJA 3TQCA 4AROA 2SNIE 3T7DA 4BY9E 5EINA 3MTGA 5J1TB 1Z2DA 3H0EA 1KRWA 1PJSA 1MBZA 1V7PC 3LMKA 2CE2X 4KK4A 2HWYA 3M1YA 4BQRA 5CYOA 5DPMA 4S1WA 5CFNA 4JP5A 4G5HA 3PEWA 3FJ1A 3NV7A 3ZLTA 1B8NA 2QX8A 1G17A 4JVNA 4R9UC 3AHDA 3T7JA 4YRKA 1W93A 4CIWA 1F17A 4ENSA 1O6CA 4PAOA 1R10A 3EBPA 4OB6A 3Q3EA 4AJPA 1XAJA 4FMDB 1KK1A 1TQ8A 3RFCA 1A50B 4MUAA 4IOMA 4OK5A 4M83A 5F33A 1NG9A 4AO7A 1XTZA 2HA0A 2BGUA 5BN3B 2XSZA 5FR2A 3S2GA 3WMXA 1NUQA 2QTMA 2Z2JA 2JFQA 3G49A 4Z9XA 3Q0TA 3HCBA 3O4RA 5LSAA 3CKLA 5C8YF 3KBOA 3C3JA 4S1NA 1RQPA 1AJEA 1JS1X 3AESB 3BL5A 4CCWA 1YZVA 5BNIA 3A9CA 2XUZA 2ZJBA 1ID1A 2WUWE 3AEQA 3GV0A 4C6HA 3TKAA 3VKWA 1NIPA 3CNBA 4HNGA 4HNRA 3U2QA 4DWJA 1UBUS 2QT1A 3HDVA 5LMUB 4BRWA 4WASA 2C58A 4MEJA 1Y8RB 4HY3A 1XVLA 1Z2PX 2IP2A 3HCAA 1VL8A 3QPWA 4RLSA 3WDSA 3GJQA 4GZ6A 4AYWA 4WWHA 1J21A 3D6TB 3GEHA 5ALOA 3GA7A 4JJGA 2PXHA 2L18A 5LPNA 2ZBQA 4MLCA 4UBNA 3DPUA 2FEAA 3FYUC 3N8KA 1X7GA 3QIVA 1RXUA 2V8OA 3BWDD 4HL6A 1KO5A 4OGFA 2NPIA 3D7RA 2C2WA 2M1XA 5AYVA 5P21A 4RXTA 1AQNA 4Z0TA 1UDCA 2CB0A 4IOJA 5BQPA 4IWYA 4BE4A 1XHFA 5KYXA 4C6TB 1DO2A 5ELXA 4BS9A 2UAGA 2AG5A 3OIWA 2PL3A 3LRTA 1J49A 4HAIA 1F3LA 5EQFA 5HTKA 2NV2B 2ZREA 5JCOC 3TG2A 4NCAA 2R65A 3KDSE 2CL7X 2OSVA 3FBTA 2YNMA 4I6GA 3COYA 4ZI3A 5C32A 1DKQA 1ULHA 2AZ4A 3HO8A 3ZVMA 1EK0A 1YR3A 3DPIA 3T3GA 4I2NA 4B7UA 3HO1A 1UBRS 3DOOA 3PQCA 1YJXA 4QQ8A 4RJLA 2D5LA 3AJAA 5IAKA 3RO7A 3OZTA 1YTUA 3L8HA 3R6LA 1I94B 3SLGA 1GJRA 3PPXA 4PLYA 1T29A 4DTIA 2ZETA 1N5OX 4CV0A 4O2RA 4V1CB 1NNUA 5D3KA 2QRUA 3NNNA 2C4HA 4AYTA 5L6MB 4ND1A 3AI2A 4CT0A 4DJDC 2NSLA 5JLJA 2V7XA 1DJQA 2G9VA 4S0XA 4EW6A 2OBNA 3VSBA 3PXDA 4W1QA 1GZDA 3WVNA 2WF8A 2ZKIA 3MWFA 4TL8A 1KA9H 3ONEA 3WZMA 1Y7IA 3ZWXA 3PYXA 3DNMA 1AUVA 5FFNA 4EMTA 2BM1A 3K2BA 4FFVA 1T1GA 2AJ8A 2IE0A 4R51A 4DLZA 4IH4A 1R4NB 3OJEA 3GOQA 3HKDB 3K1AA 3QBTA 4H1TA 3E18A 3PIDA 5BVGB 3QMVA 1V71A 4JN6B 4JLAA 2QTHA 4TRMA 5CR9A 1ZOLA 5EHXA 1V4VA 4OB7A 1E18A 1XTBA 1QOZA 2EX1A 3R5TA 4MCIA 2RK6A 1E9AA 4JC8A 3T1QA 3LHSA 5JD4A 3QA3E 5JADA 5K51A 5AKZA 3ZX5A 3HCEA 1U98A 4U7FA 4Z7OB 1PEKE 5AW1A 4PVCA 2CLKB 1NBWB 4Q02A 5JWRA 1XCOA 2HL6A 3B3FA 4LWPA 4LXQA 4YRJA 4Q16A 2FFJA 3SC4A 4A8PA 4ARUA 5K5EA 3PXGA 2XYGA 3CPHA 4XX0B 3DWGA 3N2GA 1HZJA 5HILA 3AV3A 2IU4A 3JWPA 3GDHA 3IP1A 4W5NA 3TMYA 3CM0A 1U02A 3L1IA 4IIJA 3UJCA 4CYMA 1OH5A 4IP0A 4OX9B 1N57A 3AOGA 3ZIUA 3W5BA 3JPYA 3GC6A 3JQBC 2GCEA 3LBHA 5KX5F 1V7QA 2G0AA 2PGNA 5AOVA 1K8ZB 5FPPA 4XM2A 4CLRA 1KMCA 1IEVA 5HOQA 4YCSA 4M0FA 1M1YA 1O6ZA 1QU2A 1XO1A 3RAPR 2XB9A 1PLLA 1IM5A 1NIJA 4MMYB 1KY5A 2BFDB 1G20B 4U4AA 3DE0X 2FPXA 5CK5A 3WLFA 4ZHQF 3GRVA 4A26A 1OXXK 2O3JA 1MV5A 3UMCA 4EL0A 2JAUA 3U1TA 2B5OA 2XLBA 4JEIA 3TLKA 1F8UA 4ESOA 4RGVA 4KW7A 1IHUA 3KD2A 4AYXA 5ICMA 3EOAI 1UZUA 2C03A 5BYBA 1NR1A 3H7AA 3T06B 1S2GA 1QTIA 1E7YA 5F77A 2J0VA 4YK7A 3T7KA 1G1AA 1YGYA 3RRJA 4ALNA 4URXR 4EHFA 3IEVA 2R6DA 3AL3A 5A9SB 2AE1A 4HS9A 1E3MA 3TTTA 2ZS8A 3D4BA 3AP3A 3PNPA 4HGQA 3TLAA 1RXVA 3DLBA 3O94A 2W42A 2PAFA 2XODA 2FF5A 2VJLA 4Y98A 1ISIA 4AJEA 2J0UB 4HXEB 4B81A 1OR8A 2WFMA 1YA8A 1ZRNA 5AVRA 2JGFA 3OP1A 3ORSA 4HV4A 5AW2A 1QB7A 1GTZA 2XVAA 4K9KA 1HYQA 3SR4A 3ZHUA 1BVHA 3JQRA 3RHSA 1U1CA 4QBKA 5DLPA 1E1MA 4LWZA 4OI4A 3BGVA 3ZC3A 4J9UE 5L8VA 2YHBA 4OFWA 1JILA 2ENUA 2IA5A 1O97D 2O2SA 1B0PA 4QTYA 4AS1A 3JARA 3TRJA 1JEAA 2D7JA 3PXUA 4IJQA 4O4IB 1B73A 3R8CA 1ZEJA 3QUTA 2UZ4A 2RHRA 5GIOE 2A4MA 4PCAA 3NX4A 1RW4A 4LF4B 2W6QA 4M9ZA 2CE7A 1L4HA 1BFDA 1B8VA 4GSLA 1RFGE 4PR0A 1JFSA 5JS1A 3DMHA 1ZJ6A 4PYKA 1JZQA 3DZFA 5LBTA 3R3UA 2OECA 1H4SA 3I2HA 3WLAA 1RRPA 3WC4A 2OMKA 2F3PA 4UXHA 5BUZA 4KO1S 2ANCA 1NUHA 3VNSA 3KYBA 1OKKA 1VBNA 3C45A 4LRSB 4ZVRA 1MFPA 2E4YA 3L8CA 2DVMA 2ORIA 5KNCH 3B7PA 1JKXA 3AR3A 4UUPA 4LDRA 2EAUA 4EOGA 5A1JA 2PANA 3ESRA 4LZWA 2Z0MA 3WHLA 4Y6LA 2ILVA 1F2UB 1YIDA 3C3YA 5CA0B 5BR1A 4BNZA 1ZI8A 4HWGA 3VDQA 2FDCA 2P2YA 3NBMA 3QKSB 2VHQA 1IPEA 4QXQA 3QPBA 5K6AA 2A2ZA 2HJWA 3ZY2A 2JZNA 3AK4A 4G8BA 4TYWA 1Q1BA 1O1YA 2GPBA 3PXBA 3G1WA 2W6ID 2IHTA 5BMVF 3RG8A 1ZPDA 1X1BA 2C98A 2D4AA 2Y0EA 5DTEA 3PP8A 1GL3A 2OCXA 5HGJA 5JARA 4UJ5A 2QMUA 1VA4A 4AT1A 2VAVA 1SOAA 4GQIA 1YBAA 1GDDA 3GFGA 5AVOA 3GFBA 5BOVA 1RXSA 3ETGA 2C31A 1JMVA 3T5CA 1D0IA 1KFEB 4FHFA 3VU9B 1M7BA 5AVUA 1T8SA 4GMDA 2YHIB 3VJKA 3OFNA 2BFBB 2PZMA 2WTEA 2FEWB 2P4UA 3RU9A 2BBWA 3KXLA 4CIAA 5IN5A 3IUBA 1UKCA 3JZAA 3LKVA 3NH9A 4FKMA 2E4AA 4H59A 4NAUA 4V24A 3W79A 5EJ4A 5B7GA 4HJXA 4RNDB 1PR6A 1EJ0A 3R2JA 3WGMA 4WKOA 1HH4A 4X93A 1M5UA 2FMFA 4A0FA 3NHYA 3KUCA 2O7QA 3ZHSA 3EXHA 3FMVA 3ZWBA 2OBLA 2ROQA 3M5CA 4ZOLA 1T4BA 1M5TA 1BQ3A 4KRGA 3U09A 3JQGB 4ZP1A 4ZAZA 3UZUA 2WIDA 1E7MA 4GZ3A 1HXHA 4IGKA 5EWMB 1T2VA 4YB8A 3KPYA 1I7DA 4I6EA 1GG5A 2INGX 4D1YA 4QATA 4RL4A 4AY4A 1TVKA 2GRAA 5AM0A 1SKYE 2NXNA 5LWQA 3QVKA 3UJ9A 1JPVA 2FVYA 1DDGA 2PZKA 3A6ZA 5FBWB 4LF5B 1AMNA 3CRW1 1MXHA 2HIGA 1TM5E 1AHPA 3PTZA 2CYBA 4RVSA 4WJKB 3NJRA 4XLLA 2O2ZA 4NRDA 4NU0A 1BHJA 3COVA 4RPKA 1RRVA 2FJUA 3ADCA 4X84A 5HQ3A 4QUJA 4A16A 2FWNA 1ZVKA 4W1PA 5JCJA 2BGIA 1U0JA 2JRLA 3MQFA 4C0AC 1RJGA 3FKSD 3IAS1 3LI2A 2QYTA 4IAOA 3QOWA 3LL7A 5AXAA 1WCYA 3SS9X 5C81A 1H3EA 4PX2A 3CX7A 4L6IA 5D3ZA 3UKJA 4F2PA 2OB1A 4TL9A 1I3KA 1Z7YA 1Y4SA 1ZINA 4RE6A 4D43A 2GM4A 2WUDA 4U3JB 3F96A 4IIFA 1Q7CA 4DLPA 1PNRA 1N8TA 3AI3A 4RVUA 4CV2A 3GLTA 4YT5A 2OCKA 3H5IA 3QV1A 3ED5A 1PQUA 1SJ9A 1MIHA 2QGFA 1QPZA 4MYDA 5IARA 1DOZA 3CVOA 3E8SA 1OV4A 3KAJA 4L08A 4IVQA 1SUPA 1Y3CE 2OFWA 3HU2A 5DHFA 2XMSA 3SNHA 3NFRA 4DMUB 1BE1A 1HTWA 2UZ3A 3MWLA 2ZK7A 4FNAA 4PBTA 3M6XA 4TKZA 2PX3A 2VBIA 3OQVA 1J9ZA 2WAXA 4RFVA 4DMFA 4GO1A 4IOKA 5LVAA 3U44A 5AW3A 4BN5A 2A0KA 2JBAB 3DVAB 4EDFA 621PA 2CCGA 1N7GA 3EVFA 1X1CA 1P80A 4JT2A 2IZ5A 5E4FA 1VMDA 3DAGA 4QDUA 4K7JA 4M7PA 4RE5A 5KINB 3LDGA 3W4KA 1S7GA 5D85A 2EKLA 2YJ5A 4LX8A 1F6WA 2PS9A 2UZIR 1Z45A 2BI7A 4P54A 1NT2A 1ZD1A 3HDYA 4LJ9A 3A1VA 5CW2A 1KU0A 2F4VB 5H83A 3VO8A 4L3OA 2I6XA 3OQNA 5EY5B 2VF4X 1N2OA 3FF4A 4R83A 4TUYA 2EC5A 4MIOA 3OLXA 2PO5A 2X8BA 4PX5A 2OHXA 4HDNA 4DXDA 4X92A 2VDMB 5AOAA 1IEWA 1K08A 4GRIA 2BEUA 2IYUA 3PHJA 1KQNA 3V4LA 2MSDB 3A2MA 4I08A 5C5EA 1A8SA 4MPPA 1RYYA 3OF2A 3GUUA 4HVTA 3U9LA 1OILA 1A7AA 1IK4A 1J0CA 1N5DA 2VDUE 1OX4A 3QPAA 3DVQX 4FQ7A 4YRMA 3OMLA 4CPDA 4Q9KA 5IK2D 2E5WA 3T7AA 2WQ6A 5GADl 2B20A 3BWXA 4MYTA 5AKHA 3ND9A 3FOZA 3CUYA 2XDWA 4IG4A 1W46A 1KEKA 3V4VB 3OEYA 3SG0A 3ABOB 4FGJA 2XZDA 1GGJA 1I1OA 1Q0SA 1QO0A 2WM9B 4LQ4A 3OO0A 2WY2D 4FBMA 4UFPA 4TS4A 3HO6A 4FWBA 3U9TA 4I1PA 4KNWA 4L6CA 1UUFA 4IDCA 3EXEB 2VRCD 1HC7A 3ZHQA 4FZRA 3H11B 4DLLA 1JX6A 4B6QA 3KEFA 2A5YB 3GJ0A 1PT9A 3BE5A 2IXFA 3RNOA 4DTCA 1OBVA 2ZRCA 5ALRA 3KUKA 2HJGA 3RF7A 4DG9A 1GAXA 1R64A 3E9DA 4YLGA 1C2TA 2H1SA 2G04A 4IEFB 4D3SA 3E03A 1Y5MA 4G63A 1VG8A 4WBXC 1ZDMA 4DMMA 4RADA 1JH8A 1L5HA 4EY4A 3K9GA 4P0TA 1CNEA 3KP1A 3IA2A 4JBYA 5D3MA 2YWBA 2W71A 4MRNA 3SJZA 3FYTA 3G7NA 4IFIA 1Y7HA 3BXFA 3KKOA 1XMJA 2H5JA 1EHYA 3DW1X 1WBBA 1G6Q1 3AWDA 4J07A 3DBIA 1MO5A 4HEQA 4P22A 2FXIA 3PUXA 5EMMA 5K8LA 2V7QD 3T99A 1KFBB 3TAHA 3LPMA 1E1KA 3OZBA 5HNKA 4MQ5A 4K9MA 5EZQA 4UHBA 3KQYA 3DTTA 1Z38A 4IRXA 4D5EA 2O3QA 1T3LA 3M6UA 1GKKA 2D5AA 2KLBA 4P35A 3SSMA 1N5MA 4R54A 3P2EA 2HMYB 4YPOA 2P9ZA 4KPUA 4ZVLA 3BJIC 4KVGA 1MMFB 1DE0A 1GPJA 1TMKA 5THXA 4JODA 3HDTA 2FFAA 3ZUGA 3I28A 1UJ2A 3RROA 5TQVA 5TJ9A 3OCUA 3JPWA 1KDYA 2E87A 1PP4A 3HYCA 3FDFA 3RTEA 2HSZA 3GBVA 1X3SA 3OURA 3L0DA 1ZSYA 5J5CA 1PR5A 3I9NA 1JHQA 1O3YA 1RFLA 3DEFA 4ND2A 5CLGA 2QQGA 2ZYVX 2WB4A 3VH4A 3CWQA 4B2YA 4TKLA 4FZVA 2AEJA 3DULA 3IE1A 3ESBA 3DCIA 3FKJA 2AJCA 4YUZA 3EQ9A 2XV1A 4FFOA 2Q49A 3A4TA 3HKCA 4R2JA 2YHAA 3OX4A 4I1OA 4LK2A 4X8OA 4JXJA 2CXHA 3TGLA 2B8NA 2WFAA 2W8BB 3BQNB 3NETA 4CF7A 3ANTA 3NTVA 5D7NA 5FF9A 1YV9A 3LLUA 1U4OA 2HV8A 2YH2A 4IILA 4MHSA 4QYTA 5CT4A 1SUBA 3R7BA 4CKCA 2K7FA 2JGIA 3FMGA 4J16C 4Q9IA 1KE2A 1A9YA 4LBZA 3NOQA 4HWPA 1OX6A 4EMUA 1KEEA 1JWBB 1O94C 3IQXA 4OTZA 5DTMA 5EWLB 3C3WA 1ZCBA 2XQIA 4HUJA 4KAXA 1PZEA 1VDMA 4I1UA 5KAMA 3WL6A 5TSDA 4PG7A 3FFWA 1QO9A 1S2DA 4XGIA 1EUQA 3MIZA 3GPBA 2NOAA 2ZU6A 5FV7A 4DJTA 1FNMA 2E37A 1FFXB 1KORA 1NT4A 3TIFA 3KWLA 2X1LA 1ACLA 2I66A 3GJ7A 4JR2A 1P5HA 2AMFA 4UKDA 3AL0C 5CPFA 1RWMA 2R44A 4MPRA 4Q9AA 4BUCA 3IA7A 1LC3A 4TSRA 4YDRA 4YMHA 5K20A 1I13A 3HMKA 4QOJA 4DA4A 1UXGA 3UAZA 1KVRA 2YMMA 1I6WA 3KB6A 4DA9A 5AVJA 3ZWDA 4QRIA 1Z5GA 5WRFA 1H6DA 2AV6A 1XZ8A 2OV8A 1TZBA 1RQ2A 5CB8A 1CDOA 2QKYA 5HCIA 3SIRA 3H1EA 3AY3A 3JQ9A 4N0QA 5I9BA 1F4LA 1ZMOA 1M34A 5BW5A 1KJQA 1IY8A 2D0PB 3A70A 3WSVA 1LH0A 4ESHA 4HQRA 4KFTA 3G89A 3WZLA 1ZMTA 2GUGA 4JC0A 2BKAA 2EFJA 3V32A 3ORRA 4RUKA 4L8WB 3UJHA 5KOJB 5T6BA 3IL2A 2JFUA 4X6XA 3UUWA 2W22A 2YY5A 3HZZA 1XZJA 3WP0A 1RAEA 1MDFA 2OK7A 3OF3A 2P2LA 3T1HB 3AERA 4AZ0B 3W7AA 1QHHA 9GPBA 3ZW7A 4R5MA 1FYDA 4CR8A 2JD0A 4MKZA 4B3FX 3EVCA 3FWNA 1OLSA 4EG7A 1VSVA 2AXEA 4WINA 1QQ6A 1G4UR 2GJSA 1WBJB 3ICPA 3KEMA 3OCXA 4FMCF 5FOXA 1TTTA 1EHIA 5FHQA 3ZQ6A 2FP3A 2C83A 4DUGD 3E3MA 1DI0A 3B82A 1DC4A 5BV7A 1JFTA 2AKEA 1YDMA 2J9RA 3D5TA 4AFNA 5CXQA 3KL2A 2XNHA 1GSIA 4MINA 3UATA 1XAIA 1YDHA 3CV3A 3D3KA 5E9QA 3Q12A 3EZ9A 1K3FA 4KI0A 5EIHA 4E5YA 4DJAA 1A04A 1HFWA 5FOTA 5EZYB 1DC8A 2OFOA 3EEBA 5TPZA 1MB4A 4KLNA 1XZLA 2H1FA 2IWHA 2V3WA 2YFKA 2Q1XA 3A31A 4OA5A 5JLAA 4F6LA 2WIKA 2FRDA 3NORA 2BJVA 1A95A 1XXHA 4QJ4A 1MGOA 1EIWA 3INGA 3A4NA 3G0OA 2ACEA 1OXBB 2Y8EA 3BA1A 4RD0A 4KV7A 2Z4TA 3AI7A 2HQSA 1Z4IA 3GK3A 3RUAA 4ABTA 1EX6A 2NZXA 3OEHD 3PRHA 4ZYYA 2O0MA 3TOVA 2ACKA 4YP6A 2BI4A 1I4DD 5IF9A 2PZAA 1T36A 5DOVA 2H7XA 1NNEA 4D4LA 5KREA 3CEHA 2CUTA 1M8GA 2QXYA 3DZHA 4DNPA 5A05A 5KB3A 1OPRA 4EG1A 4MH0R 2VQEB 2PVSA 1AQ6A 4EGQA 1R5NA 4RV4A 4NECA 3T1NA 4M99A 2JD2A 2YIMA 4DJFC 2LW7A 1DX6A 5HK9A 3UK7A 1U99A 2Q5HA 1FFAA 5JECA 1FNNA 4GWKA 4J1QA 4IL5A 2F9LA 2DSTA 1CHNA 5TT0A 1WMBA 3OM0A 4YT4A 7MDHA 3EMVA 4OLJA 1N2IA 1QVVA 1T0IA 3MTBA 4JR1A 2HJ9A 3FWZA 4EHHA 3LX8A 3SICE 3C6QA 2GK6A 4RL6A 1YK0A 5CX1B 3BQ9A 1PTJA 2Q3HA 4I9NA 1QVWA 3QP9A 3KAPA 1SAYA 2E3JA 2GD6A 5K4AA 4E2FA 1UZLA 2GCOB 4YEDA 1XTTA 4B4OA 4Q1AA 2H08A 4B84A 2C94A 4R8VA 1HWYA 1TAQA 5ESXA 2VZLA 1G7SA 4FLEA 1C3VA 4AKGA 2XA2A 3P5BA 4FOSA 4CMEC 2ZS7A 4RTMA 1B4DA 1OFUX 2PZ8A 3FDIA 4KH1A 4KLAA 4O2BF 2X19A 4ZI2A 4BFUA 4DR5B 4NMWA 2WHEA 3UA4A 1KJIA 1WBDA 4DV0B 1EMDA 1YFKA 4EY7A 1VBMA 1NQXA 4DIBA 4AKIA 2GVDC 1XZHA 2JLWA 2C5FA 3EWNA 3P2MA 2ODNA 3T3PB 1O54A 3WIOA 5BY2A 3VOBA 4KKVA 1U7TA 3INYA 1H65A 3MINB 5DBIA 3F98A 3RT7A 3TPFA 5JBNA 5B3KA 4D6PA 3W1EA 1VIVA 3FOFC 2O2CA 2P69A 1IZZA 3G88A 5THQA 1FTGA 1UC4B 3FN4A 4C89A 2CLMB 2X8JA 4Y1FA 5CFLA 2I71A 2ZM5A 2H2AA 1Z4JA 1DT5A 4Y1EA 5TVGA 1EBUA 2ZIEA 5DHUA 4LF6B 1SC3A 4C0SA 4Y2PA 4AQYB 1VXRA 2AOUA 3BIOA 1VYHA 4JJ8A 3VFDA 2QW0X 1WZCA 4DMKA 1A27A 3D6HA 3HVKA 1R88A 2YBEA 3JW8A 4HADA 3GUYA 2LNDA 3KFVA 1Z5VA 3MJDA 3UJ6A 1V5GA 2IY8A 4KXNA 2IOFK 3OPXA 1R6UA 1QK3A 2UVPA 3WJ2A 3BGOS 1WA5A 3G2JA 1Y3AA 2DFPA 3C5WP 4J0HA 3PT9A 1J8MF 4FYWA 1GPNA 2NSYA 4MA4A 5LXTB 3RADC 3WBJA 1X1EA 3IUJA 1QKIA 4BO7A 5B5SA 4H0NA 3VTFA 2CF6A 2GCGA 1KJWA 2VVTA 3WNQA 1P6QA 4BQFA 1UFVA 2Q3BA 2WM2A 3A3PA 1NYQA 5HZGA 1IOZA 3NBKA 4E11A 3R8FA 2B35A 3V00A 1ZIXA 2RHCA 2PUTA 3HPRA 4QG7A 1DC7A 1AKNA 3ADOA 4MYUA 3IEKA 3O95A 5A3JA 1LTHR 5LZ5A 4B0OA 4CGZA 2WZCA 1K0FA 2PXCA 2AI3A 3JWEA 1W88A 2NPOA 2BR3A 2W48A 3ZTWA 5I7WA 2XUAA 1LPSA 3KWFA 3R24A 5ENZA 4DLXA 4GXNA 5TF0A 5DYYA 5J5VA 2PKRA 3VPAA 1JEQA 1LZLA 5H9VA 3V4OA 3W2TA 5FTLA 2BT4A 2H7CA 3BSWA 1P75A 4A6EA 3EFHA 1YT5A 1A69A 5HIJA 3HI6A 4PZAA 1FSZA 1IUKA 4OVKA 4RABA 4XM1A 1ABBA 4DLUA 8MHTA 5BV2P 4DMHA 1U9CA 1HLGA 1RNLA 3B9PA 5JNVA 3R3WA 2D2XA 2ZJ2A 1ZMXA 1LC0A 1OGYA 3O2SB 1XU4A 1JIUA 1K89A 2PD4A 3NIFB 2AQKA 5EN4A 3VPHA 2PGAA 1QIMA 1VE9A 2GZSA 4I7EA 4TVOA 4ZMRA 2H4YA 5DNWA 2ZKLA 2HQBA 3RT1A 5A3RA 1SKMA 1DG1G 2YQZA 3F4BA 5GONB 1SIUA 2ZVDA 1SBHA 4YRSA 1K6JA 4TM7A 3AR6A 3QLVA 4ZU6X 3TD6A 1NF3A 4K5QA 3Q1LA 4QTTB 5FDFA 2WM8A 3I6MA 3O9MA 5EPOA 5DWDA 2CXSA 1JIJA 2AKAB 2P9HA 1S8OA 2QX9A 2YNMD 2HF9A 1PJAA 5EJGA 3W6ZA 1P1KA 3MMNA 1QKJA 3AVOA 3I37X 3LHDA 2EZTA 2JFFA 4BLRA 1ADGA 4KK3A 4CVNA 1UBTS 4Q3AA 5A02A 1NVVR 2GDJA 3ADDA 4PICA 1C3OA 5FWXA 5GOZA 1PFGA 5LZ9A 1QWSA 2NO4A 4F3RA 4ZVKA 4WN9B 1OT3A 5AVTA 2B8TA 2QN6A 2YV4A 3C3MA 4URHA 4DDKA 4DQXA 3VHXA 2BOVA 1Z36A 1UKYA 4GECA 4Y0NA 2Z3WA 1T10A 1CP3A 2IL1A 3CPSA 3DE4X 3MJHA 2JCSA 3BAFA 4I4TA 2EP8A 2FZ5A 3MTQA 3KZCA 3S55A 3EF1A 4ZAGA 5ITZA 2FUEA 1YQEA 4RIEA 1CEEA 3EF0A 1SEPA 2VNAA 4EW1A 4R1TA 2DCMA 3G8BA 2FGKA 1N4AA 4F72A 1QK4A 2NT3A 1A2OA 4TQAA 2GEVA 3R20A 3UGJA 1GNRA 1ZVQA 1OFGA 2RI1A 4L74A 3D4PA 4PQRA 5G0SA 1CUEA 2NSDA 3FRJA 2GN6A 1JXQA 3AUJB 5E7IA 4C2AA 2J9YB 1N5JA 2YL2A 5IANA 1W9HA 1XZEA 5AT1A 1L8AA 2ST1A 4Q7QA 1RLTA 3P9KA 1LVUA 1X77A 1II0A 3DF9A 1U11A 3PSAA 1M73E 5EGSA 4DNFA 1Z2OX 3EQ7A 2R7KA 4DVGA 4GOOD 2G6BA 4LW8A 3RDPA 3AZPA 1XL1A 3CU5A 2RJOA 5AW8A 3IDFA 1OWNA 1T2EA 5EQJB 3IXQA 1Q7EA 2LTAA 1RAHA 4G2TA 3N8IA 1DRVA 1XYVA 3HB7A 4KQ1A 1XIVA 5EA2A 1HQDA 2J87A 1L7VC 4L73A 3WSTA 1A2KC 5C8YA 1QGOA 4Y67A 1ZVMA 2F3UA 1Z2AA 3C7AA 1BW9A 4RV9A 5HM8A 5G2OA 1U9JA 3T1VA 2ZRLA 4BZWA 5INTA 1GZ6A 3JAKA 2C7BA 1OFUA 1OFIA 3IELA 2OORA 3R5XA 3DKVA 1QH8A 4MITA 4NOJA 5JNUA 4EVIA 2JLUA 2VWHA 3VTKA 2VAPA 1OU0A 4BLQA 4BX9A 2C82A 4KXMA 3PL5A 4B31A 5LQJA 4FB4A 4BGUA 3WS7A 3CEAA 4BNTA 1J0DA 1EVZA 4O02B 4RTOA 3DT6A 3OY2A 4RLHA 4Y2JA 3K5PA 2QRJA 3DV0B 1A76A 2ZI4A 2GYWA 3O47A 3B5EA 2XY4A 4G8CA 4D26A 3EHDA 1B43A 4ER3A 4RKQA 4RYLA 1O94D 5HKAA 2P9BA 4ASUD 1QRSA 2PKCA 5IN4A 3REFA 4ID9A 2W9XA 2X22A 4HQLA 2YXPX 1OAKA 2FDXA 2EL7A 3IO5A 1DU4A 4URZR 4NZMA 1DQNA 2QAGA 3OPYI 4FFWA 5JD5A 3Q0EA 2DAPA 1PQPA 1ODLA 2YZ2A 3E3NA 2NZYA 2PBZA 4RPCA 3WWEA 1FJHA 1BVRA 5BT8A 2RKBA 1KZYC 4JYMA 1OLUA 4QU8A 5E6RA 2P4HX 3O5AA 4QSMA 5I9IA 1R6TA 1Z26A 4HMPA 4K3UA 3PQ6A 1RP7A 2WOOA 3NM5A 2AS0A 4H17A 3SBEA 1AKYA 4GXQA 2XOEA 2ZE7A 4R2WA 5E4JA 3RC7A 1IJKA 1K1EA 2PYDA 3FAZA 4ZQHA 2N1MA 5IKEA 5AI5A 3U7QA 2CVOA 1WSDA 2IUYA 1ZNZA 3RG2A 3NHFA 1C9NA 2EQAA 2AE2A 3IMCA 3OCJA 4YXWA 1L5QA 3B9BA 3ZCUA 1YBHA 2AFRA 2QTNA 4FYMA 1J8DA 1Z22A 2KYRA 4YC7A 5DCYA 3DHVA 4ACBA 2QRHA 1PG0A 2YHUA 3AVPA 4LZAA 4CF6A 1CEQA 2ZRPA 2FDRA 1EG2A 1E4VA 1X0XA 4ICIA 2IEGA 1GZUA 1Y1SA 3CH5A 1TCAA 2GK3A 3UK1A 5U4QA 5HKKD 1NPYA 3T35A 2BUCA 2WYVA 2XUDA 4FK8A 2OV2A 2RHOA 2BHSA 1CY1A 3OX3A 3ASYA 2E4XA 4FDVA 4NYMQ 4PFJA 4HP8A 3P97A 4M98A 3ZI4A 2RC6A 4LOAA 1YBFA 2QPOA 3W5IA 1QYWA 5EIEA 5F2NA 1M1YB 3JX9A 2WTAA 1EVYA 1QDLB 4FD2A 1GNTA 1OC2A 4XRGA 4GM4A 3QV2A 5KNDA 1EUZA 1H8EA 2ZFUA 3K1JA 4X97A 5JYDA 5LL6P 821PA 1OKKD 4FYHA 4KOAA 4WK4B 4LK3A 4YAUA 5FWNA 4WGGA 2IS2A 1W0KD 1XF1A 4FC7A 5K0EA 1E2DA 1CQXA 1E60A 1FMTA 1NI4A 1KRHA 2G5CA 3KOUA 1ZH2A 3GZNA 2XADA 1PFWA 4LV8B 3RF6A 4OYYA 3TKYA 4YROA 3V3TA 2PMDA 3ROFA 1S2LA 1NVTA 1W73A 1TZKA 5B3LA 2XH8A 1WV1A 2Z1DA 1YFZA 4JLJA 5EIFA 3VC2A 1IU9A 1WPRA 2IXGA 1CUCA 4OJTA 2Q3MA 2GB4A 3RC2A 4BOYA 5C1PA 1YCHA 1C5KA 2BY4A 1U8CB 2J07A 4OHWA 5KX5A 1XTQA 4LV5B 1DRJA 1T6XA 2R00C 2WTNA 4KQGA 3KZKA 5IEJA 5KCMA 4PE5B 4YYZA 3HE3A 5BURA 1RXYA 2A92A 3NXSA 1VL6A 2JFZA 1CTQA 3UJAA 1C81A 2YJTD 3KR0A 4MWEA 4ZHQA 5KEIA 5L4SA 4QG3A 4XD2A 3BDVA 5FYDA 3TI7A 4L9SA 1JHRA 1EA7A 3OT1B 4CQLB 4X64B 1IXSB 1WUHS 2YIDA 3OFND 4NYMR 1KQOA 3C5HA 5REQA 1JLLB 2IPLA 1IUNA 2Y9PB 2BEVB 2I5PO 4PNHA 4O8ZA 2Q2VA 4PGFA 1XVIA 3AF2A 3JARB 3PUJA 4A3SA 1W5EA 2TRSB 1YJ5A 2LGJA 1VI5A 3KOWA 3H3FA 4MR7B 1KVSA 2XE4A 4RY0A 3ORQA 1ZH0A 4MROA 4BX8A 4D74A 1XPRA 3THOA 3WGYA 2Z2IA 1N2BA 3MUFA 1MABB 3RBVA 1QIFA 1DDIA 2Q4BA 1T13A 4J1TA 2E0IA 5DXAA 3ABIA 4EX7A 5HYVA 1D0SA 1O6FA 5LQKA 5DHPA 1N9GB 3Q7EA 1XRMA 2JGKA 3UPTA 5IX8A 4LZPA 4FYVA 1YVEI 2YVAA 4TWRA 2W90A 1F0PA 2OT3B 3F6RA 4HQKA 1G3QA 4HAXA 2ZRKA 3QXXA 4ZO7A 2J3EA 1A8PA 1RKUA 4LFAB 4XWOA 5JG7A 1E0DA 1EGMB 3I64A 3KQQA 1RAGA 2VHYA 3DA8A 3FW1A 2SHKA 3GFTA 2C2GA 5FNVF 4DA0A 2DHQA 2JJ8A 1Q1GA 3TS1A 4EP1A 4YCDA 2O7NA 1XZAA 3R41A 2O2YA 3ADKA 1RVV1 3Q41A 1PD1A 3MVEA 4OCZA 1KDZA 4F93B 1RDFA 2GAIA 3GFFA 4MQFA 2PKQO 4LJRA 4G4IA 5C7IO 3DMYA 3FPLA 3PQ7A 1IBMB 1N3IA 4YRBA 1XUOA 2WNSA 1JB9A 2EFCB 2F1KA 3JQFC 1ZUIA 4XAQA 5M04A 4V0NA 3G85A 4TMTA 1L3IA 1YKSA 1P2TA 3HS3A 4LGCA 3S6JA 3NEJA 1MQSA 2IW3A 3ZHXA 1M83A 1LUAA 2FZVA 2GX6A 3K9LA 3N75A 5HQTA 4OL0A 2VHXA 4PSUA 3K8QA 2NZJA 3V1NA 4EENA 4EO9A 4EW3A 3WL7A 1JXMA 3AJRA 5EP4A 4ZAXA 5JATA 4YUAA 2HJSA 3FCAA 4OOEA 1B0ZA 1OZFA 1ESCA 4YGXB 4YHBA 5J2UB 2XEDA 2FW9A 1BWQA 3FDZA 4MP6A 4QDOA 1P74A 3G9TA 1MVOA 4D0NA 4D98A 2OTCA 5CXXA 3UTDA 1IB0A 2DUUA 3D0KA 2OHIA 2XMPA 4LOHA 1JH9A 2R8OA 5BWOA 1KI1A 4FOPA 1JHDA 4KPFC 3KQTA 4YP9A 3VYVA 4GKBA 2H2WA 4D80A 2PL5A 1YQTA 3TINA 1EXVA 1S3GA 1YNOA 3W3AH 4WZAB 5BN5B 4UPDA 5BMVA 3RKRA 1TJNA 1VZ3A 2GFHA 3KZXA 4F6RA 4PYJA 2PZFA 1XJQA 2R2GA 3BQMB 4LJKA 5DH9A 5BQXA 2IP4A 5I9NA 3IIKA 4QVIA 4E33A 5L3VA 3PHLA 4QOSA 1PT6A 3ZJUA 1YR8A 1IM8A 2EEZA 2Q2WA 3GZJA 1KNQA 1YGPA 3GT7A 1EQ2A 3JD0A 1G21E 2NVUB 3FUVA 1TCUA 1P45A 4G5SA 5JDIC 3KYDA 3QELA 4XCQA 2JA2A 3F47A 3TNDA 3JY6A 2Z8XA 5F78A 2O5CA 1GQSA 3BSSA 3OCWA 1FE8A 1UMDA 5I7EA 3ZNOA 1B42A 3QF4B 4DY4A 1N1GA 1QIKA 1JG4A 2KQUA 4HWRA 5HQ3B 3L4JA 2JH9A 1M5RA 4KHPB 3WWZA 2Q1WA 4CKWB 3IQZA 4IQ8A 1L7PA 2AYYA 2D1TA 2ASVA 1U3UA 3IIIA 3IO3A 4IRUB 5C7OO 1QE3A 3EISA 2PH1A 2DWUA 1F2VA 2DMRA 3OTQA 5EEGA 4F1KA 2LBPA 4XI9A 1JSZA 4B34A 2WWGA 5HFAA 2Q6IA 4XWYA 1WLYA 4MGYR 3U49A 3UHJA 3PR2B 4GLBA 4M1OA 1FFYA 1SC4A 3GJ8A 1YS6A 4JUCA 3K1YA 3DZBA 4HB4A 1YE5A 4HGRA 4UEWA 1QO0D 3RHZA 5BPHA 1XLWA 3EXFA 4JC4A 5G41A 1PI3A 5SY6A 5JT1A 1SCAA 1YQQA 1W4ZA 1BD4A 3WLLA 1ZEMA 1FNCA 5B1YA 2DFVA 2HDNB 1JV2B 2E82A 3AEYA 1WB5A 3AEKB 4H6XA 2POQX 5AWFC 3U3XA 3G6WA 1P2SA 5BW6B 4EJFA 3ZEIA 1TECE 3PV0A 5JAQA 4MUYA 5L40A 2J45A 1XN1A 3FPJA 5KTNA 2GFIA 3BX1A 3CKKA 3CR3C 1FP2A 3NYQA 4EB8A 1ZWKA 3A25A 4B79A 1KJ8A 1C8BA 3U44B 1P4JA 3K6SA 3HU1A 4X7RA 3SXUA 1ADJA 3KB2A 2QXUA 5A2GA 1DEHA 4YQZA 2VHEA 4CHTA 3L43A 121PA 2WZQA 4UM7A 3SMVA 3MN1A 4BYGA 2UZ0A 4LDPA 5CLHA 2B94A 3ROKA 1P5ZB 2I80A 2H1HA 1OYWA 1DOAA 4EB0A 3VOTA 4CHGA 4YMGA 5L45A 3CX8A 2WG0A 1D2AA 2QSZA 4TV8B 2WVHA 2V7VA 1OFTA 1N2HA 1MEEA 4PZ0A 1UBSB 5DV9A 1TYEB 2GEBA 3PYLA 4RH0A 1Q44A 4ZIRA 4TUYB 1AKUA 5KTSA 1OE0A 4M1QA 4GXTA 2GR9A 2ZRIA 3HRIA 4A6PA 3PIRA 5CUQA 3KQNA 4IFEA 3EOBI 1NSYA 3G7SA 1OGJA 5DYGA 3DT8A 2VYNA 2QP4A 1RWKA 3KJIA 2CK3D 4KITB 1E5LA 3VKHA 4ZO8A 2OB2A 3HP7A 1Z35A 3K20A 2XOXA 3LK6A 5I48A 5F9HA 3HQ4O 1X1RA 1SELA 1FY2A 4LECA 1UXKA 3GJ5A 4BJ3A 1XMOB 4IJUA 1LLFA 1XEWY 2Q6VA 3WIEA 4EHJA 2CNLA 1Z7WA 3ZDAA 1FMLA 4RXUA 1R27A 3ZOKA 4IHJF 2VS1A 4KIFA 4DRXA 1NW5A 3ZDYB 4M1SA 1GTSA 2DT8A 2P8JA 3USZA 1RXCA 3W5AA 3PYMA 1IZ7A 3QE0A 2Q7DA 5CFZA 3G82C 1SHKA 1PJBA 4XDGA 4BMNA 1OYYA 1XEXB 1ZICA 1MIOB 3F5DA 3FNQA 3ITEA 4B6EA 2BPOA 3VX3A 1T91A 2QL5A 3D2CA 1AUQA 2XXJA 3JVDA 4U2EA 1WY5A 1XZNA 4NHOA 1L5ZA 1K88A 1UT8A 1VHWA 1XDGA 1RM0A 1JFFA 4PLWA 2WSYB 2WMDA 2NO9A 3CH4B 3EVBA 3PEEA 4DB4A 1E1YA 4DANA 5D3MB 2X58A 5HZHA 1RJ9A 1D1TA 1VJDA 3I1YA 4ZQFA 1IB6A 2R68A 1GPDG 1YTLA 4LPSA 4MWDA 1P60A 5F1PA 4YBRA 2GA9A 3EG9B 5ALPA 4V03A 1GGMA 2Z09A 2P6PA 4DIDA 1R6BX 1Q14A 2IKSA 3FPFA 2QAGC 4WFKA 3TRIA 4F0JA 1KSHA 2I4NA 3FJYA 3B3QA 3PC3A 5B30A 5IXSA 1NBME 4ZN6A 3H75A 1GSOA 4ENVA 3K9FC 4ZD6A 2R84A 4PGAA 1UQRA 4NHEA 3V2IA 1AK9A 2F1HA 3C6BA 2ISQA 5H3CA 4Z4QA 4B4WA 2J0EA 2WD8A 3QVXA 5B58T 4UDOA 3BIXA 3GEEA 2HPHA 3ORFA 4U7TB 5KTTA 3FI9A 3UT0A 1MNAA 4N40A 4BNDB 1YB6A 4PANA 4E6PA 4NENB 4UVIA 1IZ9A 2GBGA 1DXQA 1XG5A 2P0EA 1NJ1A 2V6FA 3TR5A 5IZ4A 1B8OA 4ITVA 3AKCA 1FX0B 2BFAA 2ZJ6A 3DNFA 3MUEA 1Z2EA 1OU4A 4QGHA 3U4DA 1QHIA 1E6EA 5AKGA 1P29A 3QVTA 1EE9A 5LC1A 5IVKA 1JQKA 3CLTD 4G5OA 2IZ6A 4JVSB 2IP1A 1GSAA 1WP4A 1WULS 2Q21A 3RU3A 1EXNA 1PBTA 3T15A 5T67A 1F1JA 1F8GA 2JGEA 7YASA 5MFPA 4B8WA 1DBPA 1EB8A 2IOFA 3AO0B 1P44A 3CG0A 5DTIA 4ODIA 2A5FA 4EYEA 4DC1A 1VGVA 1ZP6A 5AVYA 2QTVB 1ZITA 1GT6A 1R9NA 2KM1A 2GJ9A 3KLNA 1YB5A 1FLVA 1HSOA 4G86A 3EDRA 2EERA 2AGVA 5K0FA 3L49A 3NW9A 4NZPA 4BUJA 2HPAA 3K4HA 4WNIA 4L8VA 4Q4HB 4BASA 5I4IA 2VDWB 1UJ4A 2WIAA 1GTL1 3GJTA 2H16A 4HATA 1ZW6A 4JCOA 3WK7A 3DQPA 3OX2A 1FW6A 2NX2A 2X0RA 2PFSA 2W2LA 4PV7A 3RSSA 1K5GA 3D4NA 3SEAA 3TRDA 2YXBA 3WYFA 4BAUA 5BQOA 3T5BA 1RAAA 1YRQA 4QA9A 3VPSA 2O8VA 3A0UA 1VGQA 2QRPA 3EDCA 4A2QA 1RRGA 5A6VA 4MS1B 1W4RA 1R8YA 1G5HA 2Q4EA 3E9EA 2IYAA 3DTVB 3D0RA 1QG2A 1EK1A 2QTWB 3HV2A 1M2OA 2GHIA 1RWQA 1HRKA 1BE6A 2WV9A 1KGDA 4XJXA 5TPZD 2PUBA 2AXQA 1NYRA 3O8OA 2ORWA 2P2DA 2WWXA 1D09A 4M9CA 5AICA 4W6ZA 1WUYA 3M6WA 2XHEA 1SVNA 2HSDA 5D87A 1Z34A 4DLAA 2D59A 3JASA 1V6CA 3OZGA 3TTSA 1UBGA 1BX3A 2C7GA 3BFPA 2FZGA 1BO6A 4YUXA 1PO7A 5AVXA 1MH9A 3D1JA 3G0CA 4FVTA 5LB2A 4G4SP 3NOOA 1NJ8A 3HB1A 1OQAA 4EEXA 3GLHA 5TS2A 3EODA 3D02A 1CUBA 4KR0A 3JXEA 4WRRA 2C88A 1YHNA 3D3WA 4INOA 3U48A 5JJCA 5JZVA 3W90A 4BNUA 1M34B 1FEZA 3F6BX 1EFVB 5JEEA 2HA2A 3EH1A 3OFVA 3S70A 1EFPA 3EIWA 1C8VB 2O2IA 4FGUA 4KXYA 5BUQA 4EPWA 4G1MB 1CIJA 1M6EX 2R6CA 4KMSA 4EF6A 1F7UA 4Q6BA 1J8VA 4GP9A 2JLAA 2Q4OA 1AZWA 4JCCA 1VCHA 2PWYA 4JT9A 5EMLA 3DEZA 3O9ZA 4BNJA 1YJCA 2XITA 5ALDA 1DS6A 1VE6A 2JGAA 1GGEA 2C8JA 1UKVY 2FR0A 1X9GA 2VCEA 2HMTA 3H2JA 3QHPA 4QLBA 1QNFA 1B1AA 4OATA 1JQEA 2B6HA 1DG9A 1OLSB 1IUPA 3M81A 3LECA 4F4CA 4HEJA 3GUZA 1JVNA 1QAQA 1XTSA 3GLUA 3I76A 4OUDB 3ZHYA 4UPEA 1WPXA 2P90A 2GASA 3AR2A 1XZKA 3KKNA 1JUDA 2AC7A 3CF2A 4LVOA 3BF7A 5IUNC 3BZBA 4K9RA 4BO4A 4NJOA 2GEUA 1R1DA 2GO7A 4OHVA 4TV9B 3G9XA 2JIPA 4UD2A 4MGKR 4UM9B 1PR2A 4MRAA 5KVQA 1QP7A 5HJ5A 2C2KA 2A5LA 4GW3A 3P9YA 1GV0A 3RYIB 1SK8A 3EFOB 1V9LA 4S04A 4HAYA 1N0VC 3OOJA 1XAHA 1YCFA 1C1XB 1MD9A 5EESA 3TUZC 1CJSA 3M6VA 1J2UA 3EZ6A 4XFKA 1P5JA 1SK9A 1SUCA 2GAJA 4XX1A 5EPEA 1D04A 2VDRB 3QH4A 5SY4A 4F3YA 4ZJZA 2EBWA 4C4TA 3NYRA 3HKEB 2JFHA 1JHMA 1CG6A 4OJQA 3WYBA 2CL0X 2OXCA 3N59A 3VC7A 3ZBTA 3TE7A 4BFXA 3HMQA 2HF8A 2H2DA 2C54A 4QOIA 1WZIA 4DMLA 3CBGA 2X5JO 3EGDA 3FTNA 3H2BA 4NAVA 3STUA 4QFCA 1WCV1 3LBAA 3OMWA 1I3CA 3SLKA 4IFTA 1ZM2A 3WKBA 2FJ0A 1ZNQO 3DEAA 4N8SA 1UQUA 3LJKA 3ND8A 5LD2C 4EH1A 2NLOA 7AT1A 3W2GA 2RGDA 3NHWA 3ZJVA 4CTJA 2W6JA 4DC0A 2FP4A 4IUYA 4OHOA 4BB5A 5IBCA 3DFKA 4DV7B 3TWOA 3ANMA 5T5QA 2WBLC 2WJVA 1G8SA 3QVUA 2JL1A 4QUEA 4ZANA 1N2EA 3ETLA 3SM3A 5JJBA 3FLMA 2GCIA 1DBVO 1CUWA 3G1TA 1KDOA 1UBFA 1XZIA 3IRUA 4LA4A 4JI0B 2PWAA 3PHBE 1IVSA 3OQ6A 1HDEA 4V38A 1QH1B 2BLLA 1QV6A 3TQSA 4LY9A 1T3HA 2ODBA 3P26A 1EXMA 3KC2A 4P82A 4CLOA 3WWYA 1Z6AA 3ABZA 3BRQA 3C3KA 2G3YA 3R1IA 3RLIA 4KMMA 3ELBA 2QN8A 3STXA 1UIRA 1EGQA 4QOGA 1ESMA 5LP6F 3E82A 4GDFA 3R4VA 5F9FA 4WKBA 3IPYA 1NOKA 2H3HA 3SZGA 1X87A 2Y4NA 1OUMA 3LNCA 2ZJ0A 3AWIA 2NU6B 5FOVA 4B3SB