4ECEA

Crystal structure of purine nucleoside phosphorylase (w16y, w94y, w178y, h257w) mutant from human complexed with guanine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
282
Chain Sequence
GYTYEDYKNTAEYLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANWEEVLAAGKQAAQKLEQFVSILMASIPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Catalytic Site Conformations in Human PNP by (19)F-NMR and Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4eceA00
2HWUA 3KUKA 3NM6B 3UT6A 3UAVA 1PR4A 2AC7A 3D1VA 1VHWA 4GKAA 1K9SA 3ONVA 1PK9A 4TTIA 1Y1RA 3OPVA 1RXUA 1V4NA 1NC3A 3FUCA 1PF7E 1G2OA 3OF3A 3MB8A 4F2WA 4G89A 4D8YA 3DF9A 4M3NA 1PW7A 4JWTA 4JOSA 3IOMA 1Z37A 3PNSA 2QDKA 1I80A 5IFKA 1U1DA 1SD1A 2AI3A 2QTTA 1Z36A 4DA0A 4WKOA 5B7PA 2AI2A 1CG6A 1B8OA 1OV6A 1RCTE 4TXMA 2IQ5A 1TGVA 1U1CA 3PHCA 4DARA 3FOWA 4BN0A 3UAZA 4YJKA 4DA8A 5B7NA 3INYA 1C3XA 1TCVA 4D98A 4M1EA 1RXSA 1V3QE 1JDVA 1Y6RA 2AI1A 4GMHA 3LBAA 1Z38A 4LNAA 4IP0A 2A0XA 1ODIA 1YRYE 3EUEA 3DJFA 4WKNA 1B8NA 3DDOA 4LKRA 5F7XA 1YR3A 3SCZA 1RT9A 1A9TA 3BJEA 3FB1A 1JDZA 4QAQA 1OTYA 5F78A 5C80A 1PK7A 2H8GA 1ULAA 4MCHA 3EEIA 3ODGA 3U40A 1WTAA 4P54A 5K1ZA 4UC0A 1QE5A 1OTXA 3KHSA 4LNHA 1RXCA 4JP5A 4DAEA 2Q7OE 2A8YA 4NS1A 3P0EA 4QEZA 3EUFA 4L5YA 1RR6A 1FXUA 3PNPA 2ISCA 3UAXA 1SD2A 1V45E 3NM5A 4MARA 3O4VA 5EPUA 3OCCA 1LVUA 1A9RA 1ZL2A 4L6IA 1TD1A 3IEXA 4QATA 2HN9A 5JPCA 1Z5PA 3DPSA 5CXSA 4TS3A 5ETJA 4YMLA 4F3CA 1T0UA 2HRDA 1T8SA 1ODKA 4EB8A 4TXHA 4NY1A 3F8WA 4BMXA 4OJTA 3PHBE 1PWYE 3GGSA 4F3KA 1JE1A 2B94A 5IU6A 4TTAA 3K8QA 5CYFA 3OZEA 1NC1A 4G8JA 1Z5NA 2HSWA 4DANA 3KVRA 3TL6A 4WKBA 2I4TA 4TXJA 1Q1GA 3LA8A 4E1VA 2A0WA 4I2VA 1LX7A 3NBQA 4F1WA 2QPLA 4PR3A 4L5AA 2OC9A 2ON6A 3E0QA 5I3CA 1K3FA 3BGSA 3LGSA 2RJ3A 3ENZA 4LDNA 4EARA 1A9SA 3T94A 4L5CA 3UAWA 3OZCA 1RYZA 1V41E 4OGKA 4BMZA 4H1TA 1V2HE 3BL6A 3KVYA 4TS9A 1Y1SA 1Z5OA 3FAZA 4DAOA 4FFSA 1N3IA 2P4SA 4D9HA 1A9OA 1JYSA 4DABA 3KU4A 4ECEA 3OZDA 1U1GA 4GLJA 5F7ZA 5F73A 1VFNA 2OXFA 5F77A 4K6OA 1ZOSA 1YQQA 1M73E 1PKEA 4F2PA 5EFOA 3P0FA 2GUWA 4MCIA 3C74A 1T8WA 3MMSA 1Z34A 3NM4A 5KB3A 3UAYA 1PR1A 1A9PA 1Y6QA 4QARA 1ECPA 1YBFA 4WKCA 3EMVA 4L0MA 4OY3A 2I8AA 1OVGA 4QFBA 5CXQA 1Z35A 4YNBA 4OF4A 4DA6A 3E9RA 1Y1QA 1RXYA 2OECA 1RSZA 5F7OA 1K27A 4DA7A 1JDTA 5DK6A 1PBNA 1Y1TA 1RFGE 4TYMA 1PR6A 4G41A 5F76A 3OOHA 4TXLA 5F7JA 4QASA 2QSUA 4OEHA 4D8VA 1VHJA 3FWPA 1VMKA 3OOEA 1OU4A 2OC4A 3OZBA 4TXNA 5FAKA 1T8RA 4WKPA 1PR2A 1ODJA 3K8OE 2QTGA 1A9QA 1YQUA 1U1EA 1JP7A 1ULBA 3DP9A 3FNQA 2XRFA 3BSFA 1T8YA 4LZWA 5CYGA 1NW4A 4R31A 4R2WA 1ODLA 1JDSA 1Z33A 4YO8A 4D8XA 1U1FA 1TCUA 3KVVA 1TGYA 4GLFA 4KN5A 1XE3A 4RJ2A 3E9ZA 1PR5A 1OUMA 1A69A 5CCEA 2A0YA 1V48A 1CB0A 1Z39A 5B7QA 1JE0A 3QPBA 4BMYA 3GB9A 1JPVA 5B7GA 4TTJA 1SQ6A 1JDUA 4OGLA 5CCDA 5EUBA 2PGAA 1LV8A 4M7WA 4U2KA 4PNPA 1SJ9A 4R2XA 3O6VA 1PR0A 4NSNA 2BSXA 4X24A
chains in the Genus database with same CATH superfamily
1ZUNA 3OKFA 2DG2A 3DUFB 3DZHA 3ELYA 2CFCA 5IH3A 1H8EA 3ZVMA 3G6KA 3ZZTA 1K8YB 3PX7A 2JANA 3L05A 1JECA 1K7EB 1UPTA 3U7RA 1I5OA 1RCFA 2JI6A 4A3SA 3M6FA 1P5FA 4ZT4A 2VTDA 2L2QA 1OXXK 3DT9A 3ONVA 1YKFA 3D64A 5ALRA 3OFSA 2FSIA 1JBQA 1QAQA 1VE5A 2GRJA 4M9ZA 8OHMA 5E2IA 2JS7A 2GN6A 2R8EA 1I7SB 1RXUA 5DTMA 4IQ0A 5SYNA 2DAPA 4JSTA 4DZZA 4Y6QA 1C14A 3UC5A 2CE2X 1SBQA 1VZ3A 3ELBA 3SJCA 2WYUA 4FBMA 1L7AA 3UOWA 1OXTA 4JIGA 5L40A 2GCEA 3WNQA 3N5KA 3BILA 4CCAA 3LRTA 5ERYA 2GEDA 2TRSB 5DULA 1HQKA 1T9ZA 5FTLA 4OUKX 2MYTA 3CB2A 1DLJA 3H1FA 4UREA 1JVNA 1WY7A 1O6ZA 2J4FA 1E1DA 4YAEA 3QXGA 5F52A 5H5JA 1F6BA 4AZWA 1KP3A 1T24A 4WBNF 1DAPA 1VZ2A 2Z1NA 2CLHB 2P1ZA 3IT2A 2FWBA 3AUAA 4ALMA 4J0QA 3T99A 4CDRA 1E3WA 1B2LA 1SQSA 2NO9A 4H6VA 1JNYA 2IPXA 3W4KA 4BB9A 4YDQA 2CDNA 1PBTA 1ADGA 1OTHA 1E8DA 1IN4A 5DRTA 2JAHA 4GPZA 1E2MA 1XTQA 2NM0A 4IICA 4LYEA 3PUVA 4TUYA 5CM9C 2Q0XA 5LSAA 1NX9A 5J2UF 2Z43A 2O2IA 1EFVA 3LQ2A 4XLTA 2JI4A 2J6IA 3ZD6A 1E60A 3JSXA 2PUBA 1WDLA 2ZS8A 2A1UA 4D44A 2Q27A 3N53A 4NJOA 1MLDA 3AF2A 3NGMA 1ESEA 2ODPA 3SHWA 4F4FA 1Z6TA 4MLDA 5CXUA 1KMHB 2O1XA 3HXTA 4FYVA 4DDTA 5DGCA 3CH6A 3MWYW 4BFSA 3S1SA 1YMUA 3IAHA 1ZP6A 2BR3A 1DMSA 3M3HA 4CEJA 1KDOA 2I22A 3EF3A 1L4HA 2Y66A 4HEJA 3BYZA 5GONB 5T7BA 4PO3X 2VJMB 1IXZA 1WMSA 2YNMC 3NNSA 4GMFA 1ELOA 2QVBA 1DQZA 1N0WA 3CXUA 3DBLB 2P9ZA 3QEJA 2I03A 4LOHA 1EE9A 4MW7A 3EWIA 3QBJA 3IC5A 2NO6A 2QVYX 3CRQA 4GOMD 4ZI3A 4XVRA 5EXTA 3E1SA 5BQOA 4HUTA 1BCSA 4DVGA 4FQ7A 4EO9A 1BX0A 4FXPA 3L43A 4ZARA 5LQJA 4QDXA 4DV0B 4MGIR 3L2OB 2ZWOA 2PJUA 3B3GA 4NBKA 4RTSA 2WJ6A 3PNBA 5EAIA 2C8JA 2N1MA 2A0XA 2PKQO 4WDQA 3LZDA 4M7OA 3VYWA 1DC4A 1XMSA 4LZLA 4BDSA 3IKTA 3BFPA 1KH3A 1ZHHA 4JMPA 3LQYA 2DH6A 5FUMA 1EHCA 4XOUA 1YULA 3BSWA 1K4YA 4ARSA 2O0MA 4NF2A 1D2MA 4PANA 2VWPA 3KKEA 4R2IA 4WZZA 2ZYUX 4UM9D 1RQXA 1CQPA 5LOVB 4B6OA 2YRWA 4UHBA 5EWLB 1SXJE 2VPXA 4QG3A 3HWRA 5IKMA 2CLKB 2HV9A 5K0GA 3FB1A 1ULTA 4JOQA 4RZHA 2IZ6A 1B41A 3KB1A 5F78A 3UG6A 4EKYA 3K0AB 3L6EA 4K9OA 5KQPA 4Z3OA 1T8PA 1Y0BA 1GAWA 2QG6A 4QPJC 1M7GA 3KJFA 3QEKA 4EMUA 3BXEA 1QGOA 1RFLA 3GCDA 4HL6A 5FPHA 4DF3A 3QA3E 4XJTA 1EUDB 4Y9TA 3AT1A 3HO1A 2REQB 1SIOA 3ND6A 5J40A 1XRQA 4A5OA 1FSPA 2I8LA 3LY5A 2C07A 3L8CA 3EXFA 2I99A 2M6SA 2WA2A 5DISB 5GJCA 3VSEA 4TKVA 2IDZA 4XD7D 5DXFA 2K2WA 1QIIA 2VI5A 4DAEA 4L9WA 1O08A 3V8PA 2QUJA 3W3AA 1VYUA 3WWZA 1J8QA 1VXRA 2G09A 2RG1A 2VFAA 2Y77A 2BFNA 2HOQA 4L85A 5HF9A 4ZREA 2D7CA 1ZITA 2CZQA 2R8RA 4NP6A 4EJ0A 4EUSA 3C45A 3COWA 1EGVB 4HC4A 1FDOA 5TF0A 3L41A 3LNCA 2ZVPX 2DQSA 3DKVA 3PNPA 3TZ6A 3UKJA 2AA3A 5EESA 1RC0A 1SD2A 3HUUA 1MB9A 2MSWA 1V3TA 1C30A 2Z4TA 2QL5A 2QM0A 4K9KA 2QRZA 4LOJA 3UWOA 2C20A 621PA 4GPEA 4QQFA 4XGQA 3QEBZ 4CLOA 4QM6A 2MMGA 4A2QA 1GRQA 2I2XB 3KB6A 2PAAA 3AF5A 3Q8XB 3WWYA 1J07A 1YZTA 2PV7A 5BW6B 1E9EA 5DBGA 2H4HA 3A31A 3KDPA 2C1XA 3AILA 3H1TA 5HJ7A 5JAPA 4G5OA 3A1FA 4HUQA 1CNEA 4LCJA 5SZHB 3I09A 5DEIA 1IN5A 5EJIA 1DL5A 1OMOA 1N2OA 2OCXA 3U17A 1UBGA 4YS6A 3SFTA 4CJXA 2DTXA 1GPBA 2GNPA 3IAFA 4RMHA 4JZKA 3ZDFA 3DAYA 5TRTA 2I1WA 1GZ4A 1FFDA 4PFKA 4BO5A 4DIUA 4QM7A 2BYTA 4D2IA 2GARA 3EGDA 4BQFA 2ZZNA 1YBHA 1XNJA 4M83A 1SA0B 1NR1A 3EG9A 4JB3A 4HDMA 2NUAB 3ZWNA 5ADUS 2GZSA 1IQPA 3D8HA 3IERA 4CF7A 1KDRA 1TA0A 3AF3A 3TW8B 5KWJA 2XDYA 4PFJA 4YQEA 1DV2A 4MVYA 2H2HA 3LO5A 3QJGA 3MJVA 3C6MA 1S02A 2BFCA 3B60A 1VCOA 3O8NA 6Q21A 1QB8A 3RVNA 4E7PA 1QRTA 4X8MA 2G1KA 2C2BA 4A7PA 5A2GA 2FA9A 2R96A 3I4CA 3ITKA 4F4IA 4OCZA 1YJCA 2H2GA 4B0OA 4YXWD 1EESA 1PJCA 5A3SA 3W2IA 3TL6A 3CEHA 1GFIA 2YHAA 1JHVA 3MLBA 3O90A 3B2EA 3SY8A 4DNXA 5IVPA 3GLFA 1EWVA 1N2GA 4YECA 1DBQA 3F5QA 3JWHA 5FD8A 5EZYA 5ALEA 3TLBA 2RH8A 2P79A 3BWBA 3LP8A 3S55A 2XCIA 3SIXA 4WBNB 2D8AA 2CT8A 4LC1A 1R50A 2WU8A 2C5AA 1IHYA 1NF8A 2AFVA 3QELA 4FZ3A 1XO1A 3GGDA 2R86A 3S2GA 1KI2A 2WZDA 3WI7A 2C88A 3KR2A 3FVQA 4OB8A 3HO6A 4EZEA 2IUFA 3QQ5A 5J2UB 3AKZA 1A7AA 2HXGA 1YJ5A 3NMUF 1BXGA 3HRIA 3T94A 5ECWA 1SHTX 4XQ0A 3SKYA 1KZHA 3EPKA 1TIKA 4GOXA 1QDUA 2B6NA 2QRGA 4OJNA 4TSKA 1BTOA 2Q8NA 5FCDA 2DCUA 2FYTA 2P2CA 1F2VA 2QP9X 1MG0A 1ZNZA 2C00A 3P2YA 5IKPA 1J9EA 1T6BY 4U5QA 1JYFA 5HKKA 1FC0A 1J00A 3TNJA 1MW9X 1BO6A 3G1UA 1MP0A 1XD8A 3DDNA 4TS9A 3GPIA 3WMRA 3ZNNA 5KJ6A 2FKNA 4YRDA 3PFBA 2AJLI 3CW8X 3EVEA 2F1OA 3I73A 5GZ1A 3PJRA 4EDHA 1JHXA 1OREA 1AK2A 3ENQA 5AKHA 3WLQA 1EWTA 1XZDA 2EGGA 3P97A 3UQYS 1F17A 5HRUA 4BMSA 3PQ8A 1GZDA 1ESCA 4YIKA 5GWXA 1WSDA 2UZ4A 4DTIA 2A0UA 4E5KA 2PQMA 4F4HA 1TVKB 2PR7A 1L8XA 1MB0A 4CF4A 2XCRB 3TDNA 4P81A 3IP5A 4JA0A 3ZKWB 1WEHA 3CRRA 1PG2A 4ER7A 2KS6A 4X3OA 1LBQA 4X20B 4LJ9A 5DI9A 4BCCA 4G5GA 4NCBA 1FJXA 5JS7A 1Y80A 2IZ0A 4F2PA 1PU2A 1Y5MA 3PNQA 3RTCA 2V45A 2SKDA 3C8UA 5AWFC 3AUUA 4XWTA 3NOVA 5E0OA 4Z0PA 4F3YA 1NXSA 1ZY2A 4L78A 1KJJA 2Q8QA 1V8PA 2HH9A 1GNQA 2JJQA 3MGAA 3HDYA 5D5PA 4KC0A 4AO8A 4B43A 2E85A 1ZUIA 1OLUA 4YJHB 5LZ9A 1RP1A 3AQIA 2PUFA 4L76A 4POAA 2IHKA 4NJEA 4JXJA 2LCIA 2WUFA 1SQ5A 3OZGA 4L1KA 3AW8A 4GC5A 1WW2A 4ZCQA 1EG2A 2VCYA 3EZLA 2GPBA 1C9DB 4TV8F 2X7HA 3UJDA 4WKCA 3GVIA 3UATA 5CXXA 1FDSA 1L7PA 3I2JA 4PCAA 4F4CA 4AB1A 1OVGA 1FVHA 2DKFA 2EW2A 2XBUA 3KDSE 4N0EA 2AXPA 3AJEA 2QZSA 1SOWA 1UKBA 3K9NA 4NZNA 4GZMA 3KYCA 3U3OA 2IGTA 1O57A 2ZUUA 1ECGA 4BFCA 1QP4A 4WVLA 4HO1X 3CPSA 1ZMTA 1Z9BA 1KEEA 1G8AA 3QKTA 3CRVA 4IZIA 4KPGA 4KR0A 1EIZA 4J0FA 1KSGA 2VWHA 1PWZA 3BFJA 3G2MA 1JXMA 2I6GA 4BNGA 3RD5A 1E2NA 4DXDA 4ZVRA 3ZU3A 5AKXA 4YMVA 1L5VA 1PGPA 1HURA 3FPBA 4GMKA 4H4DA 3SYNA 4CMJA 1S1MA 3BWCA 2IPAB 2JCVA 2FK8A 2AHRA 3BXXA 3IPAA 4KQIA 3KEGA 4Q6BA 3ZCUA 1GNVA 5C7YA 1G20E 3BMCA 2GN1A 2IPNA 2A9QA 1ZIDA 2WWVD 2RFLA 4G36A 4P0PB 1PFGA 4YMTA 5JSUA 3GP5A 4QPCA 2BI7A 5TQJA 5D84A 1BHSA 3HZOA 2JRCA 2PKQP 4RZ2A 2DFVA 3I9NA 2PLNA 1KYTA 4YRGA 3OPYI 4DMCA 4JSYA 5B3JC 4M8KA 5FWYB 2WTMA 3S2ZA 2HTEA 1SHZA 4P53A 3WBBA 3SYTA 4P35A 4WOKA 1Q14A 1YUMA 2GBLA 1V39A 3PHIA 2NYAA 2X4LA 2XW6A 3LQRA 3DD5A 1U6IA 3AJDA 4JY7A 2OV4A 4S1WA 4XUEA 1ZD3A 2FPXA 3GXBA 1RBZA 1RKQA 2E18A 4X66B 3U44B 2VRBA 4GGPA 3X3HA 3NDBB 2CVHA 3IAM6 3ZEIA 3SEAA 2AJTA 1IZ9A 3FY4A 1VLVA 1E3SA 3O1JC 4X6XA 4XR4A 5DGHA 3LUPA 5C32A 1A9QA 4L0DA 4BPRA 1RQPA 5BNIA 1JU4A 1FDTA 4YPOA 4QNMA 1EVIA 2DFLA 2FPLA 2JDID 1QBKC 4R9VA 1SBZA 4YEDA 3DDCA 4ZVNA 5HZMA 3ZVNA 2IUEA 2VDWB 1Q7EA 4MRMB 2ZRPA 4MS1B 4H4CA 3WNCA 1OBCA 2X14A 2QVCA 1ZJJA 2O8VA 1TKBA 3K0EA 3LDAA 3VPGA 2Y71A 1Q83A 2ZTSA 2J6HA 1ZSNA 1N6RA 4MV4A 1N6KA 3EVTA 1WVIA 1IHUA 4MPTA 1KJYA 2NU7B 4LZWA 1Z13A 1L7RA 5EWJA 4AF6A 1J5EB 4GPBA 3NBMA 3HSKA 2Q5FA 5JPDA 4AMGA 1V7PC 3F6PA 4D9GA 2XE6A 2VSYA 3LH5A 5DI3A 1I01A 5IAJA 2IV7A 1V1RA 2P3SA 5T57A 5CDYA 4LZZA 4B81A 2I91A 1XTKA 1EFRA 3FPGA 2Z08A 4WASA 2I29A 1GZ5A 4YO7A 1GCAA 3TWOA 4OM8A 4A16A 1XSEA 2AOXA 3TH5A 3VU1A 4G0UA 1XNGA 5JCJA 1SCAA 2VZ9A 4FB5A 3WLAA 4BMPB 1E7MA 2IZZA 3B48A 1XZAA 3O8OB 3QVWA 2JH3A 2X5JO 3CT6A 4YAGA 1YA8A 3L7DA 4MV5A 3LOUA 1NYLA 3LT5A 2PK3A 1DG3A 1E1KA 1LDMA 2ZIFA 3AWIA 4IHQA 3V1YA 4DC9A 1Z39A 3PX2A 4BVGA 1F1JA 4P08A 2I87A 4Q37A 4F2DA 1Q0SA 1YB2A 1ISJA 1P2BA 2W98A 2QPAA 4K9QA 3SU8A 1BMQA 3U26A 3WGQA 3KKOA 4D0SA 8GPBA 4KAXA 4FFPA 2OHGA 2GB4A 2PHZA 1EAMA 3FZNA 3ECCA 1EP3B 3BKWA 2QI9F 4LYFA 1XZIA 4YY3B 1SQ6A 3D8TA 1YI1A 4I8IA 3TLGB 1J5PA 2UZ1A 1H1TA 4EY5A 1NJFA 1U80A 4M0DA 3FSJX 3EG5A 2E6UX 4H6PA 2B1RA 1VYTA 2OTCA 4WIAA 1G3UA 2YXNA 3HN2A 2FSVA 4MW6A 3WJ1A 1QGUA 4RO0A 1B0ZA 5AVWA 3FVVA 1T2CA 4O4LF 1NJGA 3SC2A 2IS6A 3KUXA 2BGLA 1YZFA 2FSSA 1TCAA 1FFEA 1DADA 4W5HA 5K8JB 1D2NA 1OI3A 4J2TA 4OSEA 3WLJA 2WW8A 4X00A 5BW8A 3F1LA 3HB5X 1X74A 5KUTA 3RYCA 4XB6B 4NSNA 4G0VA 3JTEA 1TVMA 3TQOA 3S8EA 3L18A 1RYNA 4MV3A 2O8DB 2QX6A 3AERB 3RBZA 5L4NA 3HRKA 4M99A 1DJOA 1RWBA 3IHTA 5CIWA 4F8JA 4QGSA 3RAEC 1EK5A 3EEOA 3EEFA 3JQ9C 1R15A 1SUWA 2VJQA 2GDZA 2WEKA 3MJTA 4OMCA 5EGSA 3R8FA 1Q0PA 3EOBI 3VNAA 2BGKA 2WSSD 1M10A 1J0DA 4FPXA 4KU4A 2XZTA 5DNEA 5BSTA 4F85A 2HMAA 3Q7EA 5LXTF 2F8TA 4NH0A 5K8LA 3FWZA 3VR6H 3GMSA 2B21A 3N2EA 4G23A 4UXHA 1ZUWA 5B36A 1QJCA 4L5BA 2IHVA 4RJIA 1L5FA 1AQLA 2RB5A 1CUVA 2C0CA 2AN5A 3O95A 1Z68A 3OVMA 4LHWA 3ZWXA 3R41A 3FA2A 1TF2A 1PF7E 2I67A 2A5JA 4ZI7F 2CE7A 1Y5LA 2NZWA 3DYVA 3E5HA 1J8MF 1ORDA 1HXHA 1WZCA 2CVZA 2FPIA 2VF2A 3C4QA 2Z6AA 1JWBB 1FSGA 2VDMB 3HB7A 3ORHA 3UMYA 1QHEA 3CNHA 1U3DA 5DPMA 3O2NA 4IH9A 5FI3A 4AIRA 1DEAA 4GICA 4NYIR 3VZQA 4KXXA 3TQFA 3N28A 4G3XA 4RAOA 4AZVA 4TRMA 4TSFD 5FBQB 1WPRA 1N0VC 2WUDA 1T1JA 1YJQA 3GFRA 5FOTA 4NZPA 4RM3A 2G8LA 3D6MA 4TV8B 1IAQA 1HMYA 4ZOEA 3U13A 4B34A 1I1QB 1A88A 1CS0B 2CF5A 4KSCA 2QRJA 2H1VA 4HX5A 3SJZA 3THWB 1H42A 1QE0A 3I04A 1M6EX 1YVPA 2QW8A 3H8SA 4G67A 5EIEA 4RDHA 4MLCA 4FEAA 3S27A 2WU4A 3T7CA 5C1PA 4QSHA 5I8WA 3RH0A 1HO3A 5KTNA 4RTRA 3E53A 2PZLA 1KC3A 2GPYA 3GLGA 1LVHA 1RAAA 3KXLA 3DZFA 1C7JA 4NU6A 3TTWA 3MSCA 1OKKA 4FE3A 4BGIA 3B53X 4LWQA 9LDBA 4MRNA 3I2GA 2JBAA 3WGJA 1O96B 5A6SA 3GQBB 4JS0A 3NAMA 3CCFA 5D3QA 5DN6A 3PHCA 2HCRA 1N5RA 3PC8C 4I4CA 3K70B 1NNI1 1N92A 1C9YA 3VV2A 4R8MA 3F5MA 4ZYVA 4X7BA 4S24A 2FEAA 3IVAA 1NXXA 4FEEA 1NN5A 4GAEA 4U6QA 2ES4A 3QUSA 3I39X 2QSZA 2QMYA 2PYDA 3EA5A 3Q7PA 5EJ6A 3ULKA 1XF9A 1JG6A 1O2DA 4FHGA 4MO2A 4ZHSA 1SVNA 4KRYA 5AUOB 4AY2A 3TR0A 1UMCB 1A5SB 5A9SA 2GPTA 4LHZA 3KZOA 2P4QA 4MR8A 3RU2A 2A5DA 3ADCA 3LPDA 3ZY2A 4OUDA 2FV8A 4FD2A 4RPLA 1W5FA 4YUAA 4EW2A 1K3TA 3S5UA 2YMQA 4GSYA 2CCGA 1NNSA 4NU8X 4DCPA 1XD2B 3OBBA 5HBRA 4DY4A 1EHIA 2NXCA 4M1KA 2FDXA 3LT0A 4P3KA 3KPVA 1K0FA 1ML3A 2QN8A 4Q18A 3WC4A 4BWFB 1XKQA 1D6NA 1RM4A 2MYUA 2XTZA 1AZTA 3QV2A 1Y8AA 3DAGA 4U7TB 1E1MA 1NUSA 1P72A 5EHQA 4C2TA 1KRXA 4BQSA 1XDWA 3QE3A 2GXAA 3M6WA 2VT3A 3V1TC 4CM9A 3E61A 1A9TA 1MB3A 4DCTA 3CR3C 3LHSA 3AH8A 4G1UC 4AJLA 3RS9A 4K6CA 4YBRA 1X80A 4PC1A 4W63A 2ZETA 1FX0A 4R8VA 1G19A 3GGPA 3OF5A 3S7TA 1N8SA 3D43A 1PK7A 4LDJA 3V4OA 5IWAB 2KB0A 1O94D 2UAGA 5LJIA 4WY5A 1H94A 2ANBA 1SWWA 1XQXA 3M9XA 3CC8A 1H93A 3VFDA 4D43A 2Z4RA 3S7ZA 1TEVA 3UTDA 2DWPA 4TWBA 2QE7D 2ZG6A 1QKKA 5ADWA 2LCQA 3H5IA 4MB6A 4WESB 3ZV6A 1JFLA 1GTG1 2H4JA 4PLGA 4QUGA 2WFMA 4CNQA 4ZT5A 4FWTA 3VDXA 1ID8A 3DEFA 1RXCA 4PLVA 1LS1A 1A76A 4R1OA 4AX4A 4PZDA 4U4AA 5IWCA 3K9BA 5HBGA 3CGGA 3M0EA 4BVBA 1ISRA 3P0EA 4RF3A 1NSYA 5FPKA 4O59O 1SQFA 4P32A 1U0TA 1E58A 1G5PA 3IIEA 3LK6A 5DP1A 4V02A 2P11A 1RI1A 2SBTA 1DVRA 2WMOB 3QKRA 5BSMA 3D7LA 4X65B 2GBGA 2YCLA 3RE1A 4PONA 4DSNA 4A0SA 3I5MA 1CCWA 1E3TA 1VCIA 2BMEA 1CZNA 2VKTA 2HI0A 3AYXB 1MVNA 3L8GA 4M21A 2JGAA 3ZU5A 4DLVA 5IJ9A 2A3NA 3KK0A 1U2DA 1GG2A 2A4MA 4ZQBA 3WRYA 4LXGA 3OCCA 1O58A 3FCUB 3ETLA 2ONJA 4D9FA 2HQSA 3A2NA 3M6LA 4XM2A 3E22A 1RKXA 2X0IA 2X9NA 3OSZA 3PA8A 4GO1A 1BX3A 5FA8A 3IEXA 5GAJA 1ZM4A 4BMVA 2H9AA 4ETIA 3WGZA 3DYBA 3MFYA 3Q87B 4G26A 3HWX1 5DM0A 1K7SN 2YQ4A 5I47A 2P4HX 4FQ5A 1NTRA 5I6DA 3PQ4A 4JT2A 1DC6A 1FS5A 1IBCA 3D0RA 4IFEA 4O4LB 4D1YA 5HS6A 1KYYA 2FFJA 2BFBB 1CDDA 1JQ5A 1QSGA 1YQWA 1YIDA 3DE4X 3O82A 5K2MA 4EDFA 5B57C 5JJKA 1NJ1A 3HA2A 4E6EA 3LX6A 4MR9B 4JUDX 3PEVA 3PD1A 1B14A 1U4NA 2G67A 2ZJYA 3K30A 2PT6A 1E1RA 3SLRA 1GZVA 2KHZA 1Y9ZA 2GXSA 1QVZA 1X38A 1H1LA 1FNNA 5K9ZA 1E98A 1J25A 3EC2A 1MH9A 5ARCA 1GD1O 2LP4Y 5DCLA 3K09A 5KTKA 1ZCFA 2JFZA 1UWKA 2KLHA 5C5CA 2QLJA 3PGXA 1CJCA 1R10A 1V5FA 2OP1A 3Q5DA 2FSHA 1XAGA 1XJWA 3PJGA 4BNUA 4Y0NA 3ACBA 5EPUA 3ZEAA 1Y63A 1XZBA 5E3JA 5THXA 5HRAA 3SG0A 3UWDA 5LXTB 3MHTA 3G0OA 2VPTA 3A1VA 3ID6C 4GI3A 2CUKA 3N2ZB 3REFA 4FILA 3GJ5A 4BV2A 4O2BF 4TLMB 3G89A 3OQNA 1OAKA 2JJ2A 5HQJA 2DU8A 4PX9A 4BNFA 2V0CA 5JCZA 3NW9A 1DT3A 4M0LA 1SVOA 4C0XA 3CE9A 2NU8A 3TD2A 1M34B 1YRQA 4ZI7B 1RVDA 1VG8A 1KMCA 4U8HA 3L0SA 5ILOA 2P90A 3TRJA 2GPSA 2EX0A 2ZSJA 1AG9A 3V1MA 1Q3KA 1VCHA 3SM3A 2EIHA 4HNGA 4BP3A 1KZ7B 2NNLD 2DFDA 6REQA 4EB3A 2D5BA 4YV7A 2KX7A 1NASA 1RE1A 3IA2A 1E6KA 1E7QA 3PXEA 3FCAA 1NXOA 2R6ZA 1IZ7A 2A0WA 4I1SA 2TMKA 1E5VA 4J1SA 3H9UA 3U7IA 2BKEA 2HU7A 3GFQA 3FRHA 1O3YA 4MVJP 5EXSA 2OC9A 3OTOB 1AMOA 3IFSA 2GHTA 3PF9A 2JGNA 3GF4A 2ON6A 3AVQA 1ESDA 4X94A 1YCHA 3Q0EA 5BQ3A 1E3JA 3VMFA 4HSGA 4UNPA 5F98A 2XMBA 2ZATA 3MTGA 3OEWA 5SYAA 1Z56C 3WGNA 4E08A 5IEJA 1WS6A 2B8EA 1EX9A 1ZCZA 3LVQE 3E03A 4QOIA 5A03A 5TQ2B 2P8SA 1TYEB 1UPBA 5ULLA 4NE2A 4CFSA 1I6LA 4YRPA 1TK2A 4J2OA 4CMIB 5JJIA 3KUDA 2RG7A 2B7BA 3OZCA 5NLLA 4XYGA 6LDHA 2VTBB 1F2TB 4OFZA 2E5LB 2I34A 5EIAA 1V41E 2W8BB 2I6SA 5B4TA 1EG7A 1L5QA 3I01A 1Z0UA 4NZ9A 1WXGA 5IX8A 1I3CA 3NIDB 4Q3DA 1MPXA 2Z4SA 4BO1A 2YJ3A 3M4JA 2PU5A 3IB3A 4M54A 3THRA 4ENUA 4CVNA 4YMUA 4WZAB 1DGQA 5KDDA 4N5HX 4IDDA 1X7YB 3LBYA 3L7NA 5KPDA 2YQ5A 3N2NA 4NFYA 2DH5A 3OMLA 2AD1A 2XRYA 1M1ZA 1ZM2A 1N2HA 2OZPA 3QBEA 1TJYA 4URFA 3KBOA 2IZ7A 3AJRA 2SKCA 4CODB 4DE5A 2VRCD 2PH5A 4H1HA 4REQA 1GFZA 2BBSA 2Q8PA 4KQ1A 1U1GA 4IJ6A 4LSGA 4NVRA 1N2BA 1IY9A 3GARA 5FNZA 3NH9A 4TN1A 2XKAA 2W0MA 1SBNE 3FLMA 4NNOA 4B2LA 1Z4OA 1NQXA 2PBLA 1RYFA 4YMIA 3HR7A 1ZX1A 2JZNA 1VL0A 5JXHA 1LXCA 3CVWA 2HU8A 3DT6A 4AZ3B 3AL2A 1ATZA 2FGKA 3R5XA 3OIGA 5JSQA 4H27A 3QEMA 2PX3A 3LS2A 5JQWA 2WJJA 4KLCA 3GXOA 5M7EA 2ACEA 2ZUCA 2FZKA 1HDEA 2XLBA 4HS4A 2AR0A 1A9PA 1PT6A 2EFGA 1SB8A 5HF6A 2ZRNA 3FVWA 4JR2A 4FYJA 1C0LA 3TRIA 4C2BA 4DM4A 3HZHA 4WNYA 2ZJ1A 1KO1A 1ZVJA 3THYB 4YN3A 2GN2A 2RAFA 3I2HA 2CYBA 3KR1A 2C77A 3QUCA 5CXQA 4NEGA 1R8SA 4G0YA 4Q12A 2YJ5A 1GADO 4HN4B 5G1PA 4D8UA 3ZW8A 2ZB3A 1WF3A 2W6JA 3S99A 4Y30A 1OFUA 1AVTA 3MK31 5IANA 2IPLA 3BN3A 3K5HA 4RJKA 3C7DB 4EHBA 3IQGX 2Z6VA 3HA5A 1Y1QA 4MR7B 4OTZA 3A3OA 4Y1EA 2OBFA 3GPBA 3OO0A 3SKVA 2VXCA 3UXEA 3CGWA 4IUBS 1RADA 1EVJA 3GFTA 1RKUA 1P2VA 2XH8A 5CMLA 2DUUA 3A6HA 4RPKA 4KOEC 4CL2A 1M6VA 2VXBA 4MW1A 3EAGA 3U60B 5FBHA 3M2TA 4B7XA 1LS6A 3RSSA 3FDJA 4DQKA 3GLHA 5H0IA 4RD3A 3VDRA 2P75A 1E2UA 5LBIA 1U0SY 1K8RA 2H1SA 1XVIA 2R00C 3ESAA 5CR9A 5KX5A 3OQ6A 3KD3A 3E9DA 1UXOA 4UNRA 4MOWA 4N5DA 4Z4GA 2VZEA 3QMPA 4TWRA 1GG8A 3IBSA 2GZMA 4CV3A 1UDCA 4PYNA 2D5IA 3HZZA 3BBLA 3VYTB 3STUA 2L82A 1X42A 1OX4A 5DOVA 3H9CA 4Q82A 3DCNA 3RAPR 1L1RA 4XWOA 2ZZMA 1E7WA 1V16B 4KZPA 2WWYA 4D4MA 3V1NA 4Y2TA 2NSYA 4OQQA 5FL7A 1M0TA 1M2NA 4PAQA 4YJ3A 4DSZA 3IIKA 2KLBA 3JPWA 1ODSA 1BJRE 3ED1A 2ARKA 2WZBA 3D5TA 2XYHA 2G63A 3PDUA 2FFQA 5BNTA 1OBOA 3AI2A 1XZNA 1HLPA 3T9BA 4DDUA 5J58A 1DFIA 5K0BA 3GC6A 3KT3A 3LUDA 3CRMA 3WWCA 2Q0SA 3ODPA 3W5CA 2CFOA 1PZFA 1S01A 1SOUA 3VPCA 3IJRA 3G85A 2D5LA 3H97A 4K26A 4O5AA 3KJXA 3P9KA 1E2JA 2V7QD 3JAKA 5DNYB 2A5YB 4QFDA 3FNHA 5HF8A 1GKUB 2JC3A 2QZJA 1VA5A 1ZWKA 2QM7A 4TMVA 1O94C 4H2DA 4RK5A 1D6SA 2Q6LA 4O2BB 5ICGA 1T1RA 2Q4RA 5DGTA 4D96A 1EDDA 4Y7DA 3X2SA 1TEZA 2QRUA 1R0BA 3H2GA 1RI4A 5JATA 1XU4A 4QTYA 2WMYA 1PWHA 1U90A 2FAXA 1NXWA 4UHFA 4D4GA 3FPLA 3OFKA 2RBKA 5BVHB 4MW0A 4C3VA 4MGKR 1NHWA 1ZBQA 5I4BA 4D80A 3DPUA 2ZYAA 4DLZA 2OQRA 3N6XA 4IRXA 3PIRA 3H9JA 4BQOA 2VS1A 4JEMA 4MYCA 1JX6A 1BIFA 3PHJA 4C3UA 4BE7B 1DAMA 5B7QA 1QYDA 4MP6A 1E3EA 3W7VA 1DKOA 1F4LA 4HH1A 1O95D 2Q28A 2VZ8A 1I4EB 3BXOA 4TWAA 5BRAA 4FJ1A 2JNWA 3NVMB 4PZUA 4RYLA 2Z2YA 1OIVA 2VC2B 3I2KA 2ZR9A 2Q4OA 1X86B 4P4SA 3AF4A 4MIOA 3X2FA 5FBVB 2HT1A 3QXSA 1N25A 4XWKA 2Q21A 1LBEA 1WXDA 4Q9NA 3QLJA 3WLIA 2NG1A 4DCGA 1QU3A 2JKYA 1S8FA 4A73A 5G3YA 1FS6A 5F2OA 1J9ZA 4CM3A 5KYXA 2HGZA 2OD2A 3V3TA 2OCYC 3UYKA 1PX2A 3L4BA 5K6RA 4QQ8A 2JD1A 5JH7F 5L95A 1V37A 4EYSA 1KDPA 3PJEA 4GR5A 1CR0A 2GPJA 3EH1A 5C8XA 3F3KA 2P69A 3MD0A 1NWHA 3A6EA 1TTQB 5BW4A 5K8IA 5IT0A 5K4HA 1TD9A 2RKOA 2II6A 4LHYA 3JQAB 3K6RA 3BXPA 3DBRA 5HJ2A 1YWGO 3G49A 4U7FA 1U99A 3QU2A 5GZ6A 4IIXA 1KNQA 5EXXA 1QPZA 4COKA 2NO4A 3FNRA 2JGKA 4B5LA 2NVWA 3W6UA 3ZHXA 4F5EA 3JQRA 2PJRA 1KO8A 2AJDA 3HU2A 1T26A 3AM3A 1LPAB 1JR6A 4G81A 5E9JA 3H1GA 1F9EA 3QU4A 2IYUA 4YWJA 4ZYTA 5BOSB 5J2TA 5COBA 5MN5A 5JARA 1NBEA 2TYSB 1NRWA 1ACJA 4ILKA 1M33A 1TTPB 4QUIA 2Z30A 4GZ3A 3B3QA 1CR6A 1TZ2A 4DVJA 1IM8A 3CNLA 3TGLA 1WQ4A 3LMKA 4ZAYA 3T9FA 5HGXA 3J7TA 4A8JA 4Y2HA 1H9AA 2VDRB 1OFHA 3RYIB 5LZ7A 4FFWA 4R2MA 4B48A 2XVZA 4EJSA 3V8RA 3G2NA 4Q9KA 1HL7A 1DNPA 1S7CA 2CLLB 3N86A 5E2BA 4MDHA 4AP6A 4DBZA 3NPMA 4RNCA 3TSOA 1X1AA 2ZXEA 3HEAA 4NU0A 1RLUA 3T3HA 1CVRA 3VUEA 3WRXC 5HUQA 4DB2A 2B7LA 4HN9A 1PR9A 3TI9A 3E2IA 5KWIA 3LKBA 2OHJA 3PD0A 4EHDA 5LA6F 3QPUA 3AESA 3IT1A 4ZKEA 2QU8A 3IRVA 4BLTA 1QH1B 4N8SA 3TRKA 4A23A 3NXSA 2IEBA 4KXFB 2AJ8A 1G7RA 3A1UA 3Q0TA 4FZRA 4R83A 2YHIA 1AS0A 2BV3A 3AGPA 3LOPA 3NDJA 5DT9A 4LQDA 3IOMA 4QO8A 2CFIA 1AKEA 2F43B 1IHDA 2ZRKA 3MT0A 4DCOA 4UNSA 2LD4A 1I32A 2OXCA 3UBTA 5DBHX 4Q6WA 3DR5A 5HTOA 2EG5A 2IW1A 1PN3A 2FH5B 4KQEA 2F90A 2Y9PB 3SVTA 4OMDA 4G5RA 1YI0A 4F04A 3TLYA 3EEBA 3ZDAA 5FB3A 2EKQA 2H4XA 3IOCA 1VYHA 5CA0B 4B40A 1MIOB 1RYEA 2MMCA 1SC4A 2AG0A 1K68A 2WI8A 5IKXA 5IBQA 3V34A 1AD2A 3MLAA 2R5FA 2V3VA 2QN7A 1GXSB 4KYTA 5K3SA 3RFFA 1QMPA 3VYRB 4BYGA 1T5DX 1U1CA 1O9HA 2AE1A 5JSKA 4UUPA 4BWGA 2H8KA 4ZCSA 5KBYA 1T4DA 5AM1A 1ZH6A 1WKBA 2QSYA 2V5UA 4RDXA 4JA2A 3WYEA 4UHKA 4WZ6A 2O5EA 3KTDA 1JRLA 2ZPAA 1GA4A 4AJJA 5L3ZA 3R24A 1GYPA 4YRMA 3LDGA 1XN1A 1K75A 1VL1A 1WCV1 2G5PA 3EODA 3FGNA 2EZ9A 3IULA 3QBTA 1I7QB 3LUJA 3H42B 5DHSA 1FUIA 1SGWA 2AE2A 2BWJA 3FMPB 2G9VA 3GAZA 2PUWA 2VHJA 4H6WA 4C06A 1EAYA 2Y0CA 1HNNA 1GT91 2A88A 3OTHA 2RIRA 3RSCA 3MWFA 1YZQA 3OE1A 3BKXA 3IXMA 3OQIB 4L3VA 5JISA 4CR6A 2YWEA 5F35A 2GZ1A 4XVCA 3GGCA 5BURA 4HZUB 1P0MA 4UZFA 3JTMA 5ALZA 4BV8A 3SWWA 3IP6A 4EI8A 1VJ5A 2HJHA 4O3FA 3UPUA 3AIOA 2WR8A 4KQ9A 1E0KA 2CFRA 2AB0A 1XDGA 4NV3A 1GP2A 4PVDA 5G4KA 3EARA 4LZPA 4Q1BA 4JNKA 2XCUA 4ZVSA 2QJWA 1MVOA 3W8RA 4M7RA 3HKBB 1QC5B 5DGIA 2FFRA 3KFXA 4KQMA 1IVSA 2OCIA 4ZDIA 4D0RA 2ZB8A 4K9MA 2OZVA 3KQOA 4BAGA 3AHFA 5DK4A 1KQGA 3OZ7A 3QTLA 5FQNA 4KYUA 3W3ZB 2PBRA 2VQSA 1E8NA 1JDPA 1PG0A 3DUFA 3HCNA 4JC8A 1P7WA 4UHDA 1KVQA 3V8VA 4HHEA 4JU8A 5JHGB 4U0JA 4W9RA 2GILA 2LNDA 4L4ZA 1MHPA 1Y8QA 3F4BA 3RC2A 4PN7A 2WUEA 2PRIA 4HEQA 1GYQA 4TT8A 2AX3A 4KBFA 4Y0AA 4F93B 5AJZA 1KJWA 1N2EA 1FK8A 2GK4A 2Q5OA 3V9AA 3Q3VA 4IJWA 3FPCA 1UBHS 3ODGA 1WCIB 3D1LA 3BIWA 5C5EA 4X1YB 3WZ2A 5FV4A 2PGLA 3PI7A 4KLRA 4DY6A 2O7NA 5LWHA 2R79A 1X7XA 2CXUA 4JBIA 4MSUA 4QDUA 2YRFA 4MYHA 2CLFB 4B4UA 4P2BA 4LZAA 4ZO8A 5FADA 3ROFA 4C4RA 3WIUA 5BN4A 4R8KA 2PX0A 2X2EA 5FYDA 3K0KA 3LHFA 3PLRA 4N48A 1E92A 1BDIA 3ZTTA 2UZ0A 3EUFA 2XUDA 1UZNA 1CJBA 2MYPA 4OXIA 4XPZA 1USIA 3FPFA 1U2GC 1O1YA 2F64A 2ONKA 3M2PA 4UAUA 4Q4JB 5CLQA 3VPXA 4DMFA 4KMOA 1YDMA 1VIYA 2HFKA 2OV2A 2YXDA 1VKJA 3BIJA 2ISQA 4MIKA 2G40A 2A0KA 1CUIA 1NJ5A 1GV0A 1QOPB 1F4PA 1EI9A 3NHLA 3RTBA 3UAOA 5AIBA 1Q91A 2PYZA 5CGQB 1MD9A 2CJWB 2J3DA 2ZBEA 3OLVA 2NTVA 4C01A 2DWUA 3R40A 2RK6A 1PW5A 1RHMA 2G04A 3E8MA 4JHXA 4TT3D 1R0YA 3SC4A 5T8KC 3P9PA 4YRAA 2N3ZA 2HLHA 1HETA 3CA8A 4IO0A 1FQJA 1ADFA 3AKCA 5JH7B 4UVIA 1NY5A 5DW0A 2POQX 2G80A 2OGTA 3EZGA 3MWKA 4I14A 4IGIA 3FBTA 1R9JA 5ETJA 4NDNE 4GD3Q 2IZ5A 4RACA 2P0EA 1CEXA 4JL6A 3ZOZA 2P1DA 3GT7A 3QWFA 4FFDA 2HA4A 1H5UA 1YZUA 5DTJA 2H0QA 1T9GR 1KMHA 2AIRA 1MABB 1XDUA 2GS9A 4BX0A 1VCNA 4WERA 5EQJB 4H3KB 1KA9H 2QN2A 1GM5A 3ED5A 1TO6A 2QX8A 4WLFA 2YASA 5KHLB 1QCYA 1UBRS 4X8HA 3HR4A 4UULA 4MS4A 4ZN6A 1SCDA 4ZTZB 4O33A 5JY1A 4FLFA 3EBLA 1JE1A 3WFJA 4FE4A 3DBLA 3DXYA 4YXWA 1XTJA 2VA9A 1LPBB 3K8QA 2OBNA 2W00A 3LECA 2VHCA 1PKXA 3R5KA 3OZEA 4JLAA 3RJZA 2W43A 5A06A 4RORA 1KDTA 2OQIA 4DSAA 1YQ9A 5DTEA 4FOPA 3KWLA 4Q7EA 5TT1A 4X3CA 4XI9A 2P35A 5JMOA 2G9ZA 1I51A 4BFTA 1Z5NA 2XB6A 2JARA 5K5EA 2F9LA 3BX1A 3LX4A 2I2FA 2QP4A 4I50A 3IVXA 1S2DA 3UAGA 3FUXA 4TXJA 2A5GA 4XB2A 5IBRA 3U6BA 1Q1GA 4KQ2A 4O1HA 2O5RA 3R23A 1SXJB 3G0IA 4R7TA 4LDPA 5LA6B 1YH3A 1CWUA 1K5PA 3U62A 2ZR8A 4Q7KA 2JD2A 3EIFA 4TYYA 3DLCA 5LOVA 1U31A 4HB0A 5EWLA 3O8BA 2D54A 2NUBA 3IR7A 4WOJA 1JALA 2D1FA 1M7HA 1DDIA 1O95C 2EKPA 2QIOA 4TRJA 5AOCA 3OZUA 2KYRA 3RF7A 2RHHA 3H0EA 1NLYA 2JGDA 3TZEA 2FWPA 1YZVA 3UMMA 3K0AA 2G6TA 4YA6A 5C8VA 1FS4A 4P8RA 4KPEC 4RF4A 1W2WB 2OLKA 4O29A 2FE4A 4G0QA 2C7BA 4EI7A 1Y6FA 3A9CA 2YV5A 3ZK7A 2WAAA 4LHXA 2BY4A 1XTPA 5HIMA 5CJPA 2IW3A 2XX3A 3NWOA 1EUDA 4V38A 5IVIA 1LRKA 4UUOA 2I7CA 3SIRA 4NMWA 1FJGB 2REQA 3FZYA 3R3UA 3LHKA 1FMTA 1FU7A 1YL7A 4EGAA 3B1FA 4G65A 2EARA 2LXNA 3OM8A 4WLNA 5FTJA 3IQEA 4OJMX 2CY0A 1GAXA 4TLDA 1FCJA 4FNAA 2ISSD 4V2IA 3DQPA 3KD2A 3FGOA 1U9IA 1UK9A 2PMEA 4KB5A 3SQXA 4ASUD 4DV7B 1HORA 1JYEA 2WZQA 5G40A 5HX7A 1E3MA 3PE3A 2ZPTX 2CVFA 1J8VA 2W48A 3NUGA 3DXXA 1ZM9A 5ARDA 4DMLA 1Q95A 3WHKA 4RSGA 4TYNA 1G21E 3TNLA 1T9HA 1PLJA 3F90A 3R3JA 4PWYA 1WWKA 5DSZA 4HMQA 2K2QB 3AIKA 2JIPA 4N65A 3B3JA 3P2IA 4E5SA 3U31A 5F7ZA 2NXWA 3PZRA 4YBZA 5CFPA 4HFJA 5JT1A 4BPBA 2E2WA 4FDMA 4PC2A 2J41A 4RKWA 3DZDA 5A0FA 1VJDA 2Z8XA 4WACA 4TM7A 4JXXA 4XASA 3SF8B 2IOFK 2FN4A 1TNDA 3PL5A 3RIHA 3KT6A 1L4NA 3ANMA 3HGQA 1DCTA 1EM8B 1XZLA 2BF7A 5ELMA 5HFAA 1T8WA 1FFYA 2RCYA 3TCKA 1WZNA 2EFJA 4CTKA 1XTVA 3OD5A 2H3HA 4N3AA 4EBFA 4JXZA 4QOFA 4UAVA 5MN4A 1YZHA 1FYEA 2O57A 2PGNA 1HYQA 3JSAA 2J59A 2WD7B 3VR6A 1HUQA 1QH8A 2JCGA 2UYYA 4IDQA 2ZCJA 3DW3X 1YMVA 3KYDB 2OO5C 4RVFA 4QYIB 3RUHA 4QQKA 2C0PA 1BZYA 1G5TA 1K89A 2J09A 2G36A 1QXSA 3EMVA 3HU3A 4KE7A 3RM3A 3L7CA 2Y4NA 1KJQA 4I8XA 3V48A 2Z04A 1IJEA 1H69A 1SA0A 1SKQA 2IOFA 2NUAA 3QVLA 2OVFA 5AVKA 4D6XA 4R68A 3NBYC 5L51A 5H3CA 3QY9A 3TMYA 5M04A 1PNRA 5C5DA 1NT2A 2GKGA 5H82A 3SOZA 3C3EA 5CBPB 1V4BA 3I28A 3LUAA 2QMQA 2PZAA 3A1CA 1ZZGA 3JALB 5TEVA 3KQPA 4MKGA 2FN3A 2O9JA 4P3OA 1O6FA 1K27A 2FDRA 3UWSA 4YYEA 9GPBA 3RAJA 3OMWA 3CYFA 4Z9YA 1R64A 4QU9A 3NHSA 1G8GA 1T9BA 5AM5A 4AK9A 1ITZA 4YK7A 1ORVA 3HDGA 3JYQA 5ALIA 4CNBA 4R1LA 1IRXA 2Y2VA 1AQIA 1Z8HA 4D3ZA 1P18A 2PQ0A 4B85A 3H2BA 5AVUA 1R6VA 3OUZA 4ZT2A 1CQIB 3B70A 4G5SA 3EJWA 1T36A 1BCRB 2LVBA 4FMPA 1L1QA 3ENVA 4M1TA 2VR1A 5ICEA 5FI1B 4AULA 4BFWA 1ZL0A 4ZT7A 5CDTA 3HV0A 1E20A 2C03A 1IWBB 1XRMA 3P71T 2BKXA 3G1TA 3G02A 1T29A 3WGOA 2QD5A 1CUGA 3KZCA 4JD5A 3PG5A 2GEVA 4TTTS 4XWAA 4Y9SA 3RW9A 2DEUA 5IAOA 1FIUA 4PYMA 2MYNA 4HZIA 5JWOA 1M6WA 5KC8A 2FN8A 1SD5A 2MOKA 3JXEA 1O6GA 1GG9A 4EATA 1EHYA 3QXJA 1WDWB 2QDXA 1VDZA 3BCHA 3N7TA 3WB2A 4ED9A 2DBYA 1PEKE 1MEEA 4ND6A 2FOIA 2IIPA 1QF6A 2G70A 3IV6A 5J2UA 3SZMA 2BKUA 1QRAA 4OO3A 4K5QA 4BO6A 4R16A 4YYZA 1U02A 3PKIA 2GD0A 4EJFA 1NVUQ 5H4GA 3K71B 2RAVA 4CKBA 2VL7A 2NVUA 1GQQA 1QIGA 2E55A 2HHLA 2OL4A 2XUGA 1QE3A 1QTIA 3AHCA 3SFVA 3V4FA 1GTSA 1ULBA 3HCEA 4NH4A 4R1SA 2ROQA 1JF8A 3VKWA 1ACMA 4EA9A 1LW7A 2B9VA 2EDCA 4KLNA 4MJLA 3V42A 3ZI4A 2PANA 5CLFA 1JA0A 4YJFA 4BU1A 5A5FA 1Z6PA 1N2XA 4HYEA 2YWBA 2ATEA 3MLEA 4L8GA 2HHJA 4Q9IA 1JGTA 2FZCA 3OG9A 1JH8A 1T8YA 3AUKA 1KO4A 3EC7A 4ZC8A 5EGNA 3USES 1HZZC 3LLMA 4BX3A 5J59A 2OA0A 5IASA 1AB6A 3MCTA 2DPMA 2AK2A 3I5UA 3IELA 4OQZA 5EINA 3SP1A 1WPGA 1L5LA 3LC7O 1ECCA 4DQDA 4DUGD 2YWRA 1HYHA 1Z2EA 2C61A 2X5NA 3KO8A 4KYVA 4MP8A 4BRUA 1G6HA 4X20A 1WV1A 4LJ5A 2D5CA 1ONPA 1R18A 4RJ2A 3RVQA 2L42A 5LP6F 1OYYA 4BEVA 1TMGE 3UK6A 5JAZA 1IDOA 3TK1A 4JI6B 1A69A 2DULA 1W4RA 4G0PA 4IV8A 1BS2A 2CWDA 3PF8A 4HATA 4U2GA 5EG5A 2C9ZA 5AK4A 4EW1A 5ITSA 3DXZA 3HY3A 3KVOA 4YJHA 1W8IA 4M0EA 2WPDD 3UH1A 5IDQA 1P33A 1W4ZA 4ZCPA 4A0QA 4AP5A 4ZMRA 2OHVA 2A6PA 2WU0A 2R65A 2GCNA 4XX1A 3K0CA 2WWRA 1ZHOA 3FWYA 2Y6VA 4INPA 3ZDYB 2F1JA 2PO5A 4HGNA 1T5LA 1MMFB 3E27A 3QKSA 4GT1A 4HDRB 3SQLA 2BGTA 1LNQA 2I1LA 2GPAA 4GLOA 1R00A 4AKSA 5JNUA 3U7FB 3UV6A 2FUG1 4C0QC 3S1AB 4BFVA 3ZQJA 3MRVA 2RC6A 1GSIA 2ZRIA 1DKUA 4OSPA 4UFNA 5TLSA 1ZJZA 1G3RA 1Z4MA 4E94A 2R44A 4LNUB 4RL6A 3R5HA 2DSTA 2QE7A 4YFYA 5EEGA 5HOEA 1N34B 4EAQA 2EFCB 4F21A 3KOUA 4Y2QA 1U8AA 1XZPA 4HNTA 1BDMA 1XGKA 4LOAA 3TOXA 4A5SA 1Z07A 4FYXA 1TO1E 3RK0A 4AO6A 3P32A 5A9RA 3DLHA 3ET4A 4MVJF 3NHWA 3GA0A 5H7XA 4LSWA 2GAJA 3NEJA 5A62A 3UT6A 4ZD6A 2P9TA 2WM2A 3P94A 3VX3A 1TQDA 2E7ZA 1P7PA 1C7QA 1DS6A 4TLEA 1Q7CA 3ZE9A 2V97A 1MJFA 4Y98A 2REBA 4BBZA 1R6TA 4EECA 5CT9A 1UIRA 4OXXA 4NCKA 3UQZA 2CL5A 2DC1A 3NRCA 4RKQA 3O4JA 4F12A 3ZDBA 1YZGA 2AGVA 1VA4A 1VMAA 2OMKA 5FWYA 4YAWA 1PHPA 4MTLA 1TW2A 2ZVQX 3D4LA 4WKGA 4OA5A 1PT9A 4N7JA 1MJ5A 3PFNA 4EL0A 1MRNA 2C3PA 1G2OA 2WJPA 3IKVA 2ASEA 4I9HA 2EERA 2FW1A 3K31A 8AT1A 2P2NA 1ZRNA 1P4JA 3QQPA 4CLRB 5AVZA 2W2TA 2YOGA 4CKXA 2HF9A 4D8YA 2XB9A 3N0TA 3F67A 4ZVMA 2FZVA 3SS9X 3NTOA 3QHPA 5CFZA 2KSQA 4L3OA 2UXBB 1HC7A 4DMUB 2AUNA 2O8CA 2EG9A 1UDXA 5AT1A 4RFVA 5ALNA 4G24A 1KIAA 2J5KA 3AR4A 5CDFE 3HH8A 3BH0A 2QAGB 3F7OA 2GRUA 4BNLA 4J2HA 2OYSA 2PBZA 4YREA 4XEHA 2Q2OA 4KGZA 2Q2VA 5KQLA 1QG2A 5JTUA 5M34A 4CZ2A 1OILA 3HY4A 3ZCPA 4DPKA 1Y3HA 3KWJA 4EKEA 1HLDA 2QV0A 2BGGA 5GGXA 2FI1A 3ABIA 1LDEA 3IDFA 1PFVA 4HQNA 3IYLW 3GPCA 4TVKA 1G6KA 3SX2A 4CIAA 1LPOA 2NU7A 4KI7A 4MW5A 1QNFA 2GSWA 5ENVA 2FZ4A 4UUAA 5KYNA 3ZY6A 4LJRA 1MRZA 2B1IA 4LEIA 3ZU2A 4DSTA 3DOEA 3CJRA 4D0GA 5LMCA 2IUTA 3R0ZA 5LU9A 1RCTE 1USVA 2J3KA 4KQCA 1JLLB 1JV2B 2I2WA 4EHHA 2JJYA 4P84A 1C0PA 3BGDA 1WAMA 2G7ZA 2WF9A 2ZQYA 2QRQA 1NDQA 3ESXA 1NF3A 3O8OA 3FCOA 3QI2A 3W5BA 1MEJA 2H1WA 2PJZA 4QRIA 1MTZA 3CEMA 4HVLA 2FY8A 4LE1A 2C2XA 3M89A 1GUDA 4ID3A 4G0XA 3OCVA 3T1YB 3AHIA 3CKKA 2V6GA 1HDZA 3TLAA 1RXSA 4QPNA 4TYPA 4M0UA 1KRWA 3B1KA 2QRVA 4BVLA 4QXMA 4E33A 1Y7LA 4FBLA 1R7RA 5CJ2A 5IC6A 4B3MB 3FCXA 3CF2A 1YQDA 3G5TA 3H0CA 3MB5A 1ES9A 1RI2A 3U4QA 1J97A 2IWRA 5I7AA 1XFDA 3HJHA 5GP1A 5T3YA 3TLGA 1BFKA 4YRSA 2WHYA 3PQFA 4DGQA 4XUCA 3HDQA 1JFRA 3T3GA 1FFGA 1EUCB 3WBJA 5ALHA 5EY5B 3SMQA 3U3RA 1X7ZA 2H7CA 4G5HA 3BA6A 3Q6IA 4MHOA 5DHFA 1CJSA 1UMDB 3VI3B 2FF5A 4IEIA 1RJWA 5ECYA 4HMPA 3GJZA 1KH1A 4X1IB 4L72A 5K8VA 5F9MA 1UBCA 2R8PA 4RMIA 4C0SA 4YQYA 4UPEA 2IHNA 4EBBA 1KVUA 1JDZA 4ZOBA 2NU9B 5HWSA 3V8NA 2O8DA 3AERA 5A1TA 1XFAA 1T8UA 1NOIA 2JZOA 3GMDA 1HOXA 1M0EA 1CYEA 1IN8A 2WJYA 3WL5A 2RGEA 2ZSIA 5L3SB 1M0WA 3WSTA 1FFXB 1P1IA 3EGWA 4J6EA 1YBVA 4LW8A 2OPHA 3QHAA 4PTZA 2HUPA 3ZIDA 1UMBB 1NR5A 4LMAA 5FUWA 3IILA 3SI7A 4RUKA 5F2EA 4AF8A 4AT1A 3KOOA 4YP1A 5T4HA 1KI8A 1RWQA 2NZXA 3J7AC 1NVVR 2FXIA 2WLSA 3EEIA 3EIWA 3HLKA 1W93A 2GN0A 4UTNA 1VE7A 3TS1A 3DTVB 2OUIA 1N7GA 1LTQA 4GXRA 4B2PA 3P4YA 1CLUA 3F46A 1CZLA 5LP6B 1ID1A 1ZJ5A 4NICA 5CLGA 1NY6A 2HMYB 1GL6A 1QQ7A 2V96A 4TL9A 3X1MA 4NS1A 4DWJA 4Z0HO 3NHPA 4KG7A 3L92A 4BOYA 4JI8B 1EUZA 2FRXA 3N8DA 5EWMB 2QN3A 4YT5A 2QJFA 4U63A 3GYGA 3RIEA 5AVTA 5JWRA 4IDPA 2VTEA 1T1IA 4L4XA 2PNJA 5F12A 3V1UA 4ZJPA 4JV5B 4AICA 4B3SB 2FK7A 1JILA 1UFVA 3CF4G 3D3WB 1OSNA 2QLNA 4HXGA 4NENB 4OLJA 1QTQA 3CLKA 4XLLA 4ALLA 1V8OA 4A6EA 3O91A 1NXQA 1JFTA 3JR3A 3SDZA 3OOJA 1ECBA 2HQBA 1K8QA 1PJ2A 3I5AA 1CS0A 2WT4A 3RYFB 3WGTA 1Z0FA 1UKEA 1J5XA 2ZEJA 3THWA 3R0QA 1PD0A 1YAJA 4FGJA 5F21A 2O2SA 4OGWA 3K2BA 1E66A 3T7TA 1MZPA 5HDQA 1OXVA 4P58A 3L8HA 4KI0A 4XYLA 1ZK4A 2ZRQA 3SEQA 5JIBA 5K0SA 1P0CA 5ESDA 1VE1A 3SEZA 2G5GX 3U2QA 5ALGA 1O03A 1KH2A 2HT6A 3BGIA 3LHDA 5DZSA 3GN2A 4GPAA 3S2EA 4Q0MA 4EM6A 3BC1A 3BL8A 2F3UA 4GM0A 3M4NA 4QG7A 1O9GA 5CFRA 2Q07A 2H7YA 1FB5A 1GRVA 3GQBA 4NYMR 4ESHA 3LQ4A 2CL7X 1CETA 1XWWA 1ODKA 3KZ1E 1NNLA 1CUSA 1D5CA 1GGVA 2VSOA 3A1DA 3ZW7A 5CB4A 5KTRA 1QRDA 2C7PA 4YPVA 3IR6A 4F72A 4BQEA 1UT5A 4FDVA 1NVDA 1F60A 4K9LA 2D4HA 4MH0R 3ZDQA 4LZJA 4BRSA 3TQRA 5MN6A 1V25A 5A4FS 1SPBS 1RHQA 4HFNA 4PZYA 4GX0A 3NWBA 3WK7A 1NN1A 2E4AA 3NT2A 4L8LA 1NJ2A 5EMLA 1QM5A 3PSHA 2VEDA 1MFPA 1FP6A 1UMCA 1WO8A 3OZRA 3QIVA 2J7PD 1VBNA 3HS3A 3QW4B 4JK3A 2PUDA 1OPRA 1S2MA 3O21A 3O4FA 4E21A 1C1DB 3DBHA 2B6HA 5EPOA 4G8JA 3CF0A 1MCZA 1RW4A 2X19A 1BAPA 3KVRA 2BFPA 3C8ZA 2GM4A 2B1QA 3KQTA 3V6MA 1UP7A 1FMFA 2EGHA 3FVTA 1IN7A 1E4YA 3EUAA 4IF6A 1T2DA 3I1FA 2QR3A 3W79A 5LBUA 3DFFA 4DPLA 3NKLA 2VG8A 2EKBA 3EJ6A 1YTUA 3UT0A 2FWRA 5JECA 4L74A 4D0NA 3DULA 1JHRA 1ZRMA 4FINA 5LQDA 2I4RA 3ON5A 3DCJA 1TU0A 2ZUBA 4L5AA 3AHJA 5IJWA 4Q16A 4EF6A 1AZSC 2I54A 4IG4A 1Z47A 1EZZA 4ZEWA 5I3CA 2JF0A 1OA0A 4D7AA 2WIBA 2YVQA 3LBIA 3QP9A 1KBOA 1TJPB 3TG2A 2QRMA 2JHFA 4H6XA 4JR1A 5FWDA 1KAQA 1XEFA 3UJHA 1NG1A 1A9SA 1JEEA 2F67A 3R74A 3VJMA 1L8LA 2XAUA 2WKWA 4HGZA 1NQ5A 2P5TB 4OPMA 4WESA 5KOJB 1PDVA 2XUOA 3R4CA 4IIUA 1DIOB 2FXVA 1RRPA 1I2DA 2I7TA 5FPPA 3TGPA 3CBQA 3FKSD 1QVAA 3OA2A 1TAQA 5CH5A 4ZAGA 4JJ6A 1NW8A 3OPYB 2QW1A 1YZYA 3L3BA 3VR2D 1IN6A 1QFJA 1QHFA 3C7TA 4A6DA 2XZLA 4R4JA 3MUFA 2C4VA 1LBSA 4XX0A 3OQHA 1YZLA 5E9WA 3UCEA 4AXXA 1EVQA 1PZGA 2FWJA 1D9XA 2N46A 1DTSA 2ODEA 3HBAA 3LPNA 4K0RA 2GHRA 4H17A 4FSXA 1IXYA 2Q0HA 4LYYA 2EHJA 1QUEA 4D6YA 1ZRSA 4KDEA 1W49A 3NAGA 1X7WB 2B61A 4DABA 4QFMA 4MKXA 4CN9A 5LQMA 1CEEA 1AXRA 4EYGA 2V7EA 4V0SA 3VR3A 4CV1A 1CUZA 2BM0A 3WYGA 4PX2A 4JJEA 1ZK0A 1P2FA 5AKLA 1E3LA 1MU0A 2ETXA 2YC2C 5CM2Z 3TTXA 3VTFA 1T4MA 3VZBA 1YR1A 5H02A 5LU8A 1LWNA 2V5VA 2P6UA 2HRQA 3ORFA 4PIPA 5DM1A 3OHSX 1UEJA 3VR4D 4UE2A 4KIGA 2XDQB 4WOPA 3WLEA 4JT4A 3EVDA 4N54A 1JHQA 4RW0A 4GKKB 1MB4A 2BFBA 4EB0A 1E79D 3CVOA 4P93A 4LXQA 1M67A 4MR9A 3LT2A 5DHPA 5EVCA 4JEUA 4ZAVA 1YC5A 3TRHA 1D0VA 2V3WA 3PEUA 2C4WA 2XGOA 3FN4A 4NNJA 3PZBA 2J0UB 5KAPA 4GC9A 1JPNA 1BE1A 1JLKA 4RHFA 1IWOA 1CFZA 1Z2OX 2C2KA 3I0ZA 3PNKA 3OLZA 3QPCA 4OY3A 4BXOB 1PTJC 3NJ8A 2HCFA 2QOEA 1OAOC 1BGWA 2ZTVA 4MQEB 1CTQA 2YTZA 2H7VA 5KNBA 4MUGA 4QLAA 3L6RA 4R40A 4V39A 2B2NA 2HBYA 5LXTA 3I3SR 3MTIA 5FDFA 4PR0A 3QOFA 1NV9A 4BFZA 1SKYB 2OORA 3R7AA 3DCYA 4BRWA 5AVQA 2PUEA 2X86A 4B75A 1I30A 3SZGA 2JFXA 4JBGA 5T6BA 2PCLA 2GK3A 4FFBB 2VUTA 1VJRA 4KQFA 2ZE8A 3LM8A 5D7NA 4HNHA 5CK4A 3CH4B 3GJTA 2CHVA 3TVTA 1M34A 3HY6A 4ZI7A 1H8HD 1EUQA 2W2OA 3OQJA 4DLBA 3I9LA 2VHWA 1ISPA 3T4PA 4L7VA 3GO4A 1SCIA 1E0DA 1ORRA 2BEVB 4C6SA 5JLJA 4EFDA 3L7IA 1UPFA 3RVRA 3AKYA 4C4AA 3MAGA 4RKRA 4E0BA 4BY9E 1V9SA 4GPIB 4DXHA 2F8SA 2Y1KA 5KMGB 4Q05A 4CL3A 5MGNA 4AQ7A 1E63A 1POWA 2OKGA 1W1UA 1BHJA 3NVAA 4DMKA 3ADPA 4PC7A 4X90A 1ZR2A 3QH4A 2J32A 3A9WA 2HK7A 3BB1A 4CM8A 1TM3E 1P60A 3AEUB 1GFWA 4J4BA 4PLHA 4B3HA 4RELA 1KQNA 4M55A 1Q0HA 3DLBA 3KJZA 4GBGA 2C94A 4HNRA 3B7PA 4JQYA 4YAOA 4GE0A 3ZKAA 1NW6A 4H59A 2BCJQ 1ZINA 4C3OB 3OOEA 3ZQUA 3ZQ4A 3NS7A 3WGUA 5E6RB 3VC1A 1ZFNA 4II3A 3WMFA 2CF6A 1YA4A 3H6GA 3WMEA 1FPMA 5I7UA 4GWLA 5D6OA 1W5SA 3CZ9A 3ZQ6A 2WWIA 2Z09A 3BF8A 4KPUB 5TQ2A 1IZ0A 3RSQA 1RC8A 3JYOA 1ZK1A 1YOBA 2ZXFA 4IWYA 2WQZA 4RJJA 4LJ6A 3OD1A 1F2TA 5IHXA 4NLLA 4MZDA 4BJ6A 4ZK2A 3LBHA 1ICEA 1V4VA 3BWEA 4RKEA 4R1TA 1WTCA 2FVYA 1CNFA 2JJMA 4GSKA 4LGVA 4P9NA 5KNCD 5AD1A 3O4IA 2NPIA 1JR4A 1V8BA 2J9ZB 3BSYA 4MYRA 2VSQA 3GDWA 4WZAA 1TT7A 1X7YA 1A2OA 2J07A 4MYDA 4JVLA 4Z51A 1KEVA 3TXXA 3UB3A 5DB4A 1SBIA 4JT9A 1RU3A 3T5CA 4CIVA 4GZ6A 4F0JA 3Q72A 2P9FA 2QUKA 4LBVA 1S0UA 4AFNA 5BYKA 2PWBA 5BV1A 5HP4A 3NDPA 4CKEA 3RC8A 1S2NA 3GG9A 5KSWB 3DTVD 3KKZA 1RVV1 1QHSA 1TCUA 4OXNA 4MUMA 3ONEA 2PZGA 4P3XA 1LQUA 1SG9A 1N6OA 4O4IA 1U0FA 5KNCH 4RU1A 2GD6A 1KJNA 2CNBA 1KE2A 1G5HA 2ZRCA 1GIAA 3GCXA 2FLWA 3H75A 4LWPA 2HWWA 2J8ZA 5C46F 4AZ3A 2P9CA 2H16A 4XB1A 2IV3A 1OUMA 1WXWA 2YNMA 1KP9A 3DDUA 1R8JA 1II0A 3IAM1 4E09A 4ZJYA 4QWMA 3D3JA 1R9GA 2QAJA 2I3ZA 2CFTA 5TNXA 1HF3A 3WIVA 1HEUA 2SICE 4MMXB 3LPMA 1R3UA 4Z8YA 2WIDA 2YV4A 1YC2A 3NI2A 3BEDA 3R9XB 2DPXA 3U19A 3A9RA 2X22A 4QE3A 2ZVJA 3MC1A 1B0AA 3PV0A 1GCOA 1C3OA 1LJ8A 1PWEA 2GM3A 4ZHQA 2WE8A 4RWEA 2QGNA 3P8ZA 1GQSA 2NO5A 3UK2A 1P5ZB 5EUBA 3T4UA 5HQ3A 1PJ8A 4I7EA 1A0OA 4UOZA 1M2JA 2AJBA 2PZFA 3OHPA 2R7KA 5ALJA 3ITNA 1GCIA 1LI7A 2CUZA 3C87A 4GI7A 4Y8VA 3RNLA 4ZQEA 2VPQA 1SUCA 4Z53A 4QGAA 3R3WA 3JQDA 1MV8A 2Q3LA 2RONA 3O2SB 1SKUA 3A32A 2VKQA 4MR7A 2AFIB 3V2GA 5IMSA 1N78A 3FDXA 2H6EA 4JLMA 4FD3A 2HDWA 4RD0A 5KVVA 5IRCD 1GDHA 1TMOA 4PZAA 4BMOB 1W4LA 3NV7A 3ENWA 2H4YA 2BZ0A 3DG9A 1DCKA 3SX0A 4CM5A 5HMLA 2Y76A 1PGOA 4DWVA 1Z4JA 3N3BC 4LY0A 4NJMB 1NE7A 4TMTA 4AYTA 4N5NA 5LQAA 1MH1A 4H0NA 3OE7A 5JBNA 1PVDA 4P3YA 1KORA 4UARA 4DJJA 1OYWA 2BR5A 4IXDA 2PNFA 4LBZA 4MVJH 3RJ5A 3GNQA 3VJKA 1RAIA 1ISMA 2JGFA 4IVQA 4OLBA 4B4OA 4IIYA 5B1DA 4CQNA 1NF2A 3UTCA 3R4VA 1BWPA 5CJJA 1CU1A 3VC3A 3G2PA 1GPMA 1SK8A 5IM5A 3ASZA 3HKEB 5KTPA 4EMSA 4Q34A 3PJDA 4WE3A 2ZROA 3M6XA 3SK0A 3MWEA 2UXCB 4F5DA 3EOZA 4MI6A 1GU7A 2XMSA 1GVNB 2JZCA 1G8FA 2QGZA 3DJYA 4B6EA 2W22A 3VVCA 4EG7A 1J1UA 4FE7A 4DJ5X 2IHUA 1XCOA 3DMPA 3FYUA 3HVUA 3QUTA 1V11A 2X0DA 2XA2A 3R76A 4CUJA 5J47A 3ADKA 3UUFA 2A78A 1K92A 2EWWA 4RXUA 4F6CA 2QMOA 4TRNA 1W36D 2ZI9A 4BLRA 1UH5A 3F2IA 1WU8A 1U7XA 3CBGA 2GSDA 5B37A 5JYDA 1U1DA 3COPA 4ALKA 3NJ4A 1G4UR 1XXHA 2KPOA 3P26A 4C9BA 4POOA 4LA4A 2EBFX 3CX3A 4PPFA 5FBRB 5H83A 3QITA 3IRUA 3MT8A 2EWMA 4ICIA 2FPUA 3U1VA 4CM1A 5B7PA 1DO8A 5JSFA 3F0TA 2HJSA 3PYMA 3O9ZA 1GUBA 4P4UA 2ZI7A 1JIJA 4W6ZA 1T9KA 2C5BA 1QHNA 4DW8A 5CEJA 3ZHVA 4EFNA 2FWMX 2XMCA 1E5TA 2JBHA 4KO3S 2YWHA 1C1HA 1I1OA 5DP2A 1ZK3A 4F86A 1R8YA 1QYWA 2CW5A 2DHRA 3CZQA 5BVHA 5FOWA 5EXPA 2HA6A 3GRAA 5KNCA 3BK2A 4U6SA 3MTDA 4UCXA 2G9NA 3URMA 3KOMA 1EXWA 4ZZ3A 2Q41A 2OB1A 3P9XA 1YR2A 3ROEA 3W5UA 4WK0B 2YOFA 2ZIEA 4UVDA 3SPXA 3INYA 3L7JA 3BHMA 3NIFB 1QIEA 1TCVA 3PUIA 3EISA 4U02A 3WOHA 1I4LD 3DTNA 4J91A 3FM9A 3WICA 3AF6A 1DC5A 1KO7A 4HAVA 3L8ZA 3SDSA 1FNCA 2MT9A 1K8XB 3BTSA 2PH7A 3P4XA 2WT9A 3ZS9A 1EDEA 2OXTA 3ZBUA 3CJTA 1LJLA 3OUTA 4NV1A 4GXTA 2DHCA 2DMRA 5CURA 3QBDA 4FIZA 1GDTA 4X61A 2G1JA 2G9RA 4H16A 4YVFA 4PNHA 1P61B 3WWPA 1NQVA 4F92B 4GKBA 3EA0A 3LVBA 4NDAA 4WA8A 2WWGA 5JZVA 1D6JA 1GQOA 1A97A 1AZLA 2C99A 3FLEA 5I7HA 5F3WB 1G2QA 1V26A 3E3NA 1Y4SA 2O06A 2YFYA 1W30A 4J49A 4OOFA 4Y1FA 1E2IA 1UXGA 2YW9A 3C8MA 4Z3DA 4Z4QA 4RQAA 1IM2A 4AJNA 1AKNA 1CY0A 1LW6E 4UCWA 1P77A 2UUPA 1YOVA 3JQAA 4S05A 2ZXUA 3FOFC 1ZGCA 4MS3B 4NPAA 4KFSA 4P5EA 2ZSKA 2QAGC 3I0MA 3FMIA 3JYNA 3CE6A 4ZOCA 1E5QA 5DN9A 3UWMA 2H8GA 3MAAC 1R37A 3NFRA 3G1WA 3DHYA 3IMKA 1MAVA 3CKMA 4HQKA 4EGQA 3E9NA 1JR3D 3TIFA 4EI2A 4GP9A 5BOSA 4YP5A 3WMXA 1N5JA 3FHJA 4Z1MA 4LRYA 5LWQA 3O9MA 4FHCA 5BQ5A 1TU4A 5CW1A 4CRWB 1N5MA 1IQRA 2CMGA 2DT8A 4ZAWA 3PQ3A 1D7AA 3OH8A 4WK2B 3UNXA 1XTZA 4PBSA 4Y2GA 1UT8A 4BFLA 3AB7A 3PR3A 3RYIA 4R0MA 3EQ7A 3WGIA 4IJUA 5LDGA 2QT1A 4D9CA 1ZD9A 4JLWA 2OSVA 4QEZA 4XVUA 4BWVA 3QF4A 2XY4A 3H0KA 4KXWA 2E6KA 4R05A 5AKEA 4LJAA 5HK9A 1RKBA 2BBWA 2RHMA 1CVLA 2H92A 1DZ3A 1MX5A 3N2GB 2NZUG 2G0TA 3T5TA 1RP7A 4ODIA 1QH1A 4Q7QA 3L4KA 2MSCB 2VDUE 2IEGA 3TZLA 1U7OA 3NM5A 2A9PA 3R7FA 1OGIA 3PCTA 1X8KA 1ZIOA 2FPKA 2WG2A 1LU9A 2OK8A 3D59A 1A9RA 1DWQA 3HVIA 3KZNA 4B31A 4CV0A 5F2NA 4M1WA 2W2PA 5DIZA 4Z4FA 4X92A 4QATA 3SHFA 4GM1A 4LF4B 1P17A 2CHEA 3MJ4A 1NQWA 2OGUA 1A5AB 1CLEA 1E1CB 2YUIA 2ERYA 3GEDA 4FHDA 4JLOA 4WNIA 3UXHA 4B4DA 1U5CA 2P9HA 1KJ9A 1NJ8A 4QLOA 4I9FA 4BAZA 5KNBH 1UFOA 4IV0A 3EZ9A 2HF7A 3AY3A 3QLVA 4QFCA 2TSYB 3MWLA 4OHBA 1IH8A 3HKDA 5FTMA 4EG0A 1YHYA 2J4CA 2AF4C 3AEXA 4RFLA 1IOWA 4YACA 1QF7A 1W2HA 1MO6A 2ID9A 2OAP1 1N2CE 2DPYA 2OAEA 1WOYA 3TCNA 5LM3A 1TQ6A 1VMDA 1UBTS 2ECOA 2O1SA 2YFKA 3C5CA 2NGRA 4G0MA 3AXTA 221PA 4MWZA 5AOBA 1JWLA 4F11A 1JPUA 1NZJA 2G4LA 2GK7A 2HJWA 4TXHA 1NVAA 3KAPA 1QRSA 1NQTA 3PDJA 1PLKA 2JATA 5U4QA 1VP3A 3RT7A 5HQTA 3AY6A 3FJOA 3KZKA 2XQGA 5JDIC 1H2YA 3DC2A 3C6BA 3SZLA 1ATIA 1Z0SA 1XKLA 2YYAA 5UKDA 4BP8A 4DIKA 2I6TA 2J0QA 3WIOA 4BP1A 3ZDZB 1UPUA 4TTAA 2UYGA 2WZCA 3GA5A 1ZC3A 4GX5A 1HL3A 1TQ4A 2C4KA 2RHTA 1ODCA 1DAHA 3LL7A 4YRLA 5CDSA 2FWNA 3OPQA 1THTA 3MJSA 3TIVA 1ZI6A 1A4XA 2IP2A 3NTUA 4HZUA 3UF0A 3J81A 3EQ2A 3N1UA 3HLYA 1G2IA 4DLKA 4FS8A 4QYSA 6ABPA 3KQKA 1N36B 1DQSA 1KHTA 1WMBA 2V7UA 4WINA 3ROGA 1A04A 2I6QA 2J33A 2R7NA 3L7YA 1UAYA 4YLEA 4B79A 4LRUA 2H0RA 3JQFC 2CNWA 4NMLA 3AFMA 4F3NA 3HKBA 4JFAA 1L4FA 3Q4GA 4LGYA 5DMHA 2X8JA 3IAUA 3NB0A 1G16A 3W9UA 2Q9AA 3EVBA 5JCPA 4ZYZA 3A3NA 1KVTA 5HSGA 1E32A 1V96A 1SCQA 3JZAA 3NT5A 3PLNA 2ZJ7A 2VH1A 1E3WB 2ZJ3A 3GD5A 2BIFA 1MDFA 1NYTA 2FQYA 2WT8A 1FFCA 2ZRHA 3I9V6 5KEIA 3EPHA 2X42A 3KUUA 2HU2A 3LCRA 2WNSA 3ESZA 3TBHA 4BGDA 2O2GA 1PZXA 3H9GA 4OYHA 4OM7A 3NGXA 3GLTA 4UEQA 3GRCA 3QPDA 3FH0A 5LLSA 2FUEA 2BF4A 4JQZA 3DE3X 4X1YA 3VH3A 4O4JA 4BX9A 2IT1A 2PT5A 5GV8A 2EP7A 4N0MA 2QTWB 3GY0A 4D6PA 1A8IA 4JYMA 1NXTA 4HB4A 1YRAA 1E9RA 1DJPA 5AJWA 3O73A 4KWTA 3O3MB 1EZ4A 1WVGA 1Y1SA 4FMCF 4PYJA 1PFYA 3T1QA 2IXBA 1Z5WA 1TQHA 1H2BA 4JH0A 3C97A 1EWYA 4G1FA 4ZO4A 4WXPA 3BJMA 4ARVA 1H2WA 3IURA 1W0KD 2PZKA 4KMRA 4W5NA 3U1BA 4PW0A 1I6KA 1N3LA 2GPNA 2J67A 3K2EA 1OZAA 4D4IA 1FLDA 3TFWA 3KYBA 1GT6A 3D8BA 2ZAMA 2DX7A 2FP4A 2R8OA 4ZI2A 4CG2A 4KN6A 3T7RA 1CQXA 4YCCA 1BCSB 1UXKA 1KYIA 2CJWA 3ICPA 4DV4B 1ZWLA 1G8SA 4S2EA 1UMKA 4YRFA 3AM1A 1PKEA 1M2GA 2GASA 1NVFA 1CR1A 5EFOA 2MJLA 5CT4A 4RVUA 1XWFA 4MCIA 2BRUA 3C74A 4K3VA 1MOSA 3AR8A 4K28A 2IOHA 5EMNA 3VNUA 3PB3A 1Y8RA 5KB3A 1PQPA 1QO0D 1G3IA 1NATA 2ERCA 3LPLA 4CMBA 1E8MA 3N8NA 4G9EA 4BNYA 5BPFA 2VJPA 4BQQA 3PX3A 3BVPA 1FTSA 3HNRA 3L6DA 5BSFA 4DV5B 1P31A 5P8WA 4GLLA 4YX9A 3KU1A 3EVZA 5CDGA 5AI6A 5J1SB 1Y89A 2FDCA 2HDNB 1H4QA 3A2MA 3MGKA 1Q22A 3MBIA 3QG1A 4PLFA 2H59A 1GTJ1 5AXBA 4XYBA 5B1SA 4B3DA 4EHIA 2AFHE 2OHXA 4BO8A 5EHIA 4OHPA 3IB6A 4ACAA 4K0KB 4H1WA 5AW0A 3T1OA 1IL0A 1W36C 5IK2D 1UBOS 1OH6A 4KZKA 4DA6A 3C3XA 2GJKA 1KBQA 1NLZA 1U11A 4MI3A 2V7BA 5AKIA 2PEZA 3LYLA 1BS1A 2QQGA 2W7TA 2Q7DA 4R9SA 4NYMQ 1EE2A 1ZKMA 2C2ZA 2WTNA 3HB1A 3NEYA 4JXKA 4IIHA 4V03A 1HQYE 1WV0A 3T3EA 2CHUA 4LJKA 4ZOQI 2O54A 3N3AC 1GEGA 4LPSA 4OBBA 1QVVA 4N6OA 4TWJA 5KINB 2V9ZA 1JKMA 4B6RA 4AC9A 4FUTA 1Y1TA 1XZGA 3K53A 1T5SA 1AF4A 2N9UA 4NR0A 1Q2XA 4Q02A 3RAGA 2O52A 2YXLA 5FRDA 1UKAA 1C1XA 1SXJA 4QIHA 4EL5A 3U56A 2ZSUA 1T2FA 2ATIA 3RSLA 3BBPA 4GBJA 4Q39A 1A1SA 3OOHA 3PPVA 2IEAA 1CUHA 1JU3A 1OY1A 2NV0A 2ZU0C 4LVCA 4YRNA 5BNZA 3AM5A 1FYVA 3OJXA 4E2YA 5LDDC 1KKUA 1V6CA 1W0JA 2WNIA 4BVHA 4RTNA 4Z4IA 2XWQA 1CF9A 1Z7GA 3WBFA 2Y1WA 3VRHA 4CLOB 3NUZA 2QD2A 1ECJA 1I6WA 3FWPA 3LCMA 3BAFA 5DOZA 4OG2A 2Q3HA 4QPZA 1R16A 4BKPA 3HVRA 4JI0B 2VYNA 1S2GA 5G41A 1TM1E 2ZQ5A 3EZYA 4FP9A 2P8JA 3S6JA 3TOSA 4HDSB 2HIGA 1PG5A 2VF4X 4KSBA 5E1BA 2OESA 4P36A 2SHKA 5D8DA 5BORA 4TQ9A 3RK1A 1KVSA 2FWAA 4TTRA 5BYBA 4ZCMA 3CF6R 3HACA 1G3QA 1T6YA 3CNOA 3OJEA 2QTGA 1YGYA 3FOAA 3QU5A 4HUQB 3ETCA 5JNTA 3LUHA 5K7SA 4HXFB 2UKDA 3VSAA 4BVEA 1X8JA 4AJOA 3JYHA 1QPBA 3PUKA 1FNSA 4I4LA 5D87A 2WAXA 1BMFD 3PCXA 2OAGA 5GV7A 3FHTA 4LS3A 3UIEA 8ADHA 2EFYA 2HL6A 4YCMA 2DVMA 5BPHA 2VK2A 1ZAYA 1BQ3A 2DJIA 1VI6A 3UFBA 2DUWA 3WIDA 2O2EA 3ZHUA 2I4IA 2WB2A 1PJRA 4G8CA 1U65A 2XNDA 3EG9B 2H52A 5CNKA 3BIXA 4PN3A 1DXYA 3ERCA 3BMOA 3AUSA 3I5YA 4ZDWA 1XJCA 2JAXA 4OIFA 2BJHA 5BWLA 5LR6A 1TGYA 2XCQA 1NF9A 4UQOA 4ZZ2A 1VCMA 3WYDA 5JZSA 2F48A 3DO5A 3UHAA 1OLXA