2Q3HA

The crystal structure of rhoua in the gdp-bound state.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
171
Chain Sequence
GVKCVLVGDGAVGKTSLVVSYTTPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLLAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras homolog gene family, member U
publication title The crystal structure of RhouA in the GDP-bound state.
rcsb
source organism Homo sapiens
molecule tags Structural genomics
total genus 60
structure length 171
sequence length 179
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2q3hA00
4FW9A 3KXIA 3A1VA 1S1MA 2VQSA 1G1MA 1K5GA 2WIAA 3BOSA 3MWKA 2PBRA 3X1ZA 4EPVA 2VA8A 3H4MA 2PJRA 4P33A 4CEHA 1NN0A 3GLHE 5CLLA 5IK2D 1WE2A 3V00A 2IA5A 2IX3A 1HH4A 1NIJA 1J90A 2F3RA 2OO7A 1VIAA 3GEHA 4I1VA 2B8TA 4DKXA 2OCBA 1F2TB 1SVIA 2GXAA 2BOVA 2WMOB 4JKIA 4AKHA 4N3NA 2VHJA 1GZSA 5FL7A 4B47A 3C41J 2WTUA 2WWGA 1GNPA 1W4AA 3KKNA 1E3MA 2KE5A 1W0JD 2ZRJA 1ODFA 2CL7X 3UWOA 2ZRKA 1CJVC 2ZE8A 2QN6A 3EZ7A 4BLQA 2KI5A 5CK5A 5BQ5A 4RCZA 2GJKA 4CYMA 1ZC4A 5KO2A 2XB2A 1NVXQ 3LFUA 2I3BA 4PPGA 1F60A 4EJSC 1S1CA 3U44A 3AGPA 3AGQA 4KBFA 1OSNA 4YQFA 1WXQA 2IS2A 2LKCA 1DAIA 5EZ5A 4FCWA 4M8NE 1FFHA 4NCHA 3SC3A 3U7FB 5CJPA 4NYJR 4EFNA 5AJVB 4PANA 1GRRA 4LV6A 4BQSA 3AVXA 1JPJA 1JR6A 2GK6A 3JZAA 3OEEA 1AQYA 1Q0UA 1KI7A 5DI3B 2ONJA 5L3VA 1M6NA 3VX4A 4QJ3A 1G8YA 3SOPA 2V8OA 5JLJA 4OHWA 1TQDA 5FOXA 2VH5R 2NPIA 1QHIA 2GJAA 2XOKA 4TT3A 4W9MC 2IHYA 1KI8A 4F38A 1UF9A 3D31A 4PAOA 1QHYA 1G6HA 2EVWX 2IYLD 3W3ZB 2WJJA 4JLDA 3ZVLA 1FZQA 2C5LA 3PEVA 1E9FA 2Z4SA 3MWYW 1EFUA 4P4SA 1XZPA 1IJEA 3SNHA 1SVMA 4ZDJA 4G5SA 3I8SA 2J0VA 2BKEA 1N5JA 3A1TA 4MKGA 3TLXA 3PR1A 1GP2A 1Z63A 1FNMA 4FMBB 4GOXA 3VNUA 1E6CA 2DYKA 1XF9A 2ZJZA 2G0NA 2ZUBA 1J7KA 3IO3A 4LYFA 4ZCLA 1P60A 1D6JA 3RS3A 2VF8A 3EZ9A 3KJGA 4AIIA 4NCNA 1PLJA 3DVLA 3ZS8A 3R8FA 5KHOC 4Q01A 1ZIPA 3NHAA 4POAA 3VFDA 1T0HB 3O8BA 2GNOA 2P2LA 1NBME 5FUYA 1L2TA 2GHIA 4OHVA 1XFAA 4MA4A 3AVQA 2ZREA 4R2IA 3C14C 1NMYA 4JL5A 3LW7A 1I2MA 2OILA 2EU8A 2PZFA 4XTRA 4KYUA 3AF0A 5CDFE 2ZU0C 4ESVA 3WYAA 3K0CA 1YZNA 5H70A 1JALA 1OB2A 1IAQA 2JLQA 1NN5A 3R20A 2QTVB 3Q9LA 3T5GA 4B6FA 1XTIA 1CEEA 3IHWA 3TNFA 2FU5C 2X77A 4KI0A 2IXGA 1Q1EA 4G5GA 2WWYA 4B33A 2ZSEA 2WV9A 4YXWA 2XNDA 1OE0A 4GMDA 4LJ5A 3QKSB 4LBZA 4U00A 2WKQA 3SDZA 1OHHD 3THOA 2DFLA 5HR5A 2WPDA 3TSZA 4QM7A 3QXCA 421PA 1OJLA 1FL9A 2J0UB 3PEUA 2OCYC 4I1UA 3QBVA 1II8A 5EP2A 1N5KA 1TUIA 4F91B 2G6BA 1N0UA 4XD7A 1XD9A 1XXHA 2J3EA 1ELOA 4DRZA 2HDNB 3SR0A 4L16A 1TX4B 3P4YA 1VG1A 1EFHA 2Q3MA 4HLQB 5LD2C 4OI1A 5E7JA 4JLBA 2LCFA 3GJ7A 3QEOA 2DB3A 1SZPA 4Z8XA 5C2JB 821PA 4TYWA 1U8ZA 1G8HA 1SVLA 4C9BA 1DAEA 1YU9A 3LBHA 4HZUA 4QJ4A 4WBSA 1AS2A 4I1OA 4Q1FA 4KSBA 1BYUA 1N6HA 4ZIRB 1U2RA 2WWHA 2ZJ5A 3A1SA 4NTZA 2V6IA 4A6XA 1W44A 4JLNA 4Z54A 4M1SA 3QENA 2CJWB 2CCKA 3WNCA 4ZI2A 2JLYA 4A2PA 1GTVA 4B32A 2FSFA 4MDFA 2NZ8A 3TVTA 3NBZC 2R6FA 3GPLA 3AVUA 3AP1A 1OFTA 4W7SA 5B30A 1CXZA 2HV8A 2IYRA 2C9YA 1G7RA 3GJXC 2QAGB 5L3RA 1UKEA 2WAXA 4PXAA 5HZKA 1NN3A 3RC3A 1KI3A 2X2EA 2GBLA 4W5WA 4F4JA 4RKEA 1W4BA 4HATA 5L8VA 3ETLA 4K46A 4URYR 3BAFA 2IYWA 2QGZA 1OH8A 3WXMA 1M74A 4N0EA 2D7DA 1CBUA 3IPXA 4R98A 1ZP6A 4RD2A 5D3MA 1LNZA 2FFHA 3SJCA 2LKDA 2CCJA 3KXKA 2X8AA 1S9DA 2ORWA 4CT4B 3IIMA 2GCOA 2DPXA 1FUUA 1VKJA 2O0HA 1G3MA 1JR3D 2K5UA 4RFSB 1S3SA 1FX0A 1P2SA 1P4SA 4II7A 3KL4A 4BEJA 1G20E 4JLVA 2OM2A 1D5CA 1OYYA 1AS0A 3EARA 3UKDA 4G0NA 3SQXA 4B34A 3PUXA 1MO6A 2PH1A 3CRVA 1GKYA 4K81B 4LJ9A 2DBYA 3M4YA 1KJWA 1KKLA 2C04A 3CWQA 1SVOA 2RCNA 3KQNA 4XVQA 3B1YA 4DB4A 1P9NA 4M9SA 4IW3B 1LTQA 1E1RA 2RGNA 4IKEA 1W47A 3AKYA 4GZMA 1SXJC 1VCIA 4D81A 2B7CA 4YMTA 1E98A 1O3YA 1KO1A 2ODBA 4D4JA 2O8FA 3QJYA 1ZM2A 2NO0A 2VP9A 3VR1A 1E9BA 4A0HA 3I61A 5FL7D 3LWNA 2IUTA 5H8WA 1G18A 5AR1A 1B0UA 1J8YF 2OT3B 1R0ZA 2JLSA 4KAXA 4GSYA 4GI7A 4H9GA 1TL7C 4BFXA 1OH7A 1ZBDA 3CIOA 4CF7A 1X3SA 4BLRA 3U4QB 2BM1A 1MABB 5UKDA 1PVOA 2PCJA 1Z0IA 1CR4A 1MO4A 2GF9A 2C78A 3GLFB 1P9WA 3THWB 2IF2A 5JZVA 2J0SA 4B76A 1IXSB 3KJIA 1D8TA 4HLCA 3K0AB 4LHZA 3DKVA 4QGGA 1RIFA 3IDQA 3OIUA 4PSVA 5ELXA 1XJCA 2IWHA 3AP2A 5CM8B 4DVGA 1GWNA 3CPHA 1CJKC 2PLFA 1US8A 2AD5A 1R0XA 5FOSA 3OEED 3EPKA 2YWGA 2B21A 3KKPA 5L3QA 1NL3A 3DDCA 4HYYA 2WOJA 3CONA 3VMFA 1XMJA 2ZYWX 3RS5A 3QPVA 5KNBA 1I2DA 3QE0A 2XOKD 3WP1B 5CYOA 3B82A 3QXJA 1E0AA 4US1R 2ZJ2A 1H8HA 2Q9BA 3ZVRA 4UXJA 2J87A 5FBLB 5FBQB 5A5GA 1Z6TA 4HDQB 3ZDQA 4TQAA 1IQPA 2GKSA 2RGBA 3A4LA 5KU1A 2ZAOA 4DCNA 3FHCB 4EJSB 4QKQA 4G5OA 1NVVQ 3MAAC 2ECKA 2D4HA 4NPHA 1P5ZB 3K9NA 3TAHA 2WJGA 4BFTA 1DO2A 2ZRLA 3MSXA 2I1VB 2IL1A 3S1AA 2NTYC 4ZDKA 3KQUA 3HU1A 2CXXA 4DSUA 2AKAB 5AJZA 3HR8A 4PC6A 4F93B 1W49A 1UBGA 5BN4A 3CRW1 3ND8A 4JBYA 4HB2A 4DUGD 2JJ2A 1RYFA 2A30A 4B48A 1ESNA 2QE7A 3T15A 3AVTA 5B2ZA 3REGA 1Z28A 2CL0X 1W36D 4A2WA 2NO7A 1M8PA 4DLZA 1LY1A 4PHFA 2ZRCA 5AUQA 1D9ZA 1OYWA 4GOJA 3L2OB 2GVZC 4G5QA 4PHHA 5DLQC 1Z83A 1K5DA 3BH0A 4DSTA 1E9RA 3DM9B 2CK3D 3ZS9A 5HE8A 2GA8A 3U5ZB 4D26A 1HV8A 4DIDA 3V4RA 3CM0A 2FSIA 2XNDD 4YXWD 1WMSA 4FMDF 1FOEB 2O0JA 4JLMA 2ZJBA 2FSGA 3L0SA 2WPDD 4MYHA 4U7DA 3QF4A 3ADBA 3EPHA 2ZJ8A 5KNCA 5K8IA 4HAVA 3PEYA 4FCVA 4GP6A 3U7HB 1KZ7B 2BWJA 3L0PA 2JLZA 3AQ4A 4TYQA 2GF0A 2V7QA 1XTKA 3T61A 1IOZA 5LB4A 5GVSA 4LBWA 3AUYA 1JBKA 2ZANA 1U9IC 2A5JA 3GD7A 3K9LA 2GXUA 2H18A 2OXCA 3QEJA 4IEEA 3UIEA 1E32A 3LBNA 3IKJA 2EWVA 2OZEA 4QGHA 5KDDA 1II9A 1E96A 2AX4A 2WKRA 3DL0A 4OJQA 2VO1A 3WHKA 3U61B 3LQRA 2NO1A 1JXOA 1X6VA 5BYKA 4E5UA 5FOUA 5C1BA 4ILEA 2V4ZA 1Q3HA 3FPAA 3OAAD 4MYCA 2QPTA 2EYUA 5KDLA 3V9PA 3Q7QA 2HXSA 4ASUD 1NVUQ 2IUSA 3B8HA 1QDEA 3JVUA 1JR3E 1NVWQ 2P5SA 5SZKB 2QMUA 3SE0A 4AC9A 1KSHA 1TMKA 2GZDA 5IRCD 2VHTA 1KMHA 1XEXA 2F43A 2HYDA 3FWYA 3NBYC 4TLCA 4C0KA 5DIFA 5FBWB 3IIKA 1E9EA 3TUJC 4FD2A 4RZUA 1OF1A 1R5OA 1GAJA 3ZQJA 2O8BB 1Q1ZA 3B1WA 2R6AA 4AI6A 2NQ2C 3TAUA 1EX7A 1GIAA 1AA9A 2A9KA 4E07A 2ZSBA 3MWJA 2WM9B 2JLUA 3TR5A 2J59A 4PC2A 3OHMA 2OXRA 2FMXA 5LB2A 1NG9A 2PZEA 1W0JA 4XH9B 3VKGA 4QC2A 2W6JD 2BBTA 4P3YA 3NWJA 1F48A 5L3SA 2FFAA 5LD2B 4ESHA 3IIJA 3EIQA 3BH6A 4XSHA 2CBZA 2Z5FA 4EUNA 3O8DA 1N6LA 4WXPA 1C1YA 4TMVA 2VL7A 4ON9A 5FTJA 2KJQA 3BFVA 1QHSA 4EIWA 1Q44A 4NMMA 4RCYA 2RB4A 5DISB 2BBSA 1ZJ6A 2BMJA 2OBLA 3Q72A 1E2DA 3U7EB 4A82A 3U3RA 5J47A 1NI3A 4W5JA 1XD2A 2NO6A 1UKVY 2BMEA 1E1RD 1CU1A 4CT5A 1HQCA 4C0QC 1Q1QA 1RRGA 4C4PA 2H57A 1CTQA 1IY1A 1N0WA 1VDZA 1CJMA 3RAPR 5E7IA 4UXHA 4RKFA 3ZD6A 3RLFA 3LAWA 3MG9A 3EWSA 4I1SA 3I8XA 2QU8A 3FGNA 3RVBA 1XCPA 4I81A 2FGJA 2GDJA 5GJCA 2CVFA 1MH1A 1PLLA 4QGFA 2ZRHA 3T34A 1MRSA 4NYMQ 4LCBA 2WJYA 3CUEF 2ZM5A 4D4KA 5AWFC 5F3WB 4MYUA 1RC8A 3ZVNA 1QZXA 1VIYA 4Q00A 3CW2A 2WZQA 1G6OA 5EXSA 5AJWA 3QG1A 4LHVA 3BERA 4NE2A 2YV5A 3HWSA 4C2TA 1N6PA 4V0KA 1DADA 5DE3A 2YC2C 3C5HA 3KB2A 2QM7A 2KB0A 4WZAE 2ZRBA 4Q4HA 3HR7A 1QHNA 3R7WB 2A78A 4IOLA 1B23P 3LRPA 4M21A 2DY1A 1ZD1A 1LS1A 2I1QA 4AKGA 1SKYB 1UADA 2IEYA 3PXGA 3EC1A 4R71A 1WBDA 2O8EA 3MGCA 3BB4A 1ONBA 1J99A 1VYVA 2NMVA 3CZPA 2IXFA 2FDCA 1TF2A 4X8MA 1KYIA 4IDNA 4Q4AB 1L4YA 1G41A 3QI2A 2FSHA 5KPDA 2F1IA 1H8HD 1RKBA 4XSGA 8OHMA 4HLUA 5EZ6B 1IN8A 1KI6B 3CX6A 3ZYCA 4BRWA 4NBSA 3FE2A 4AG6A 3JVVA 1LB1B 4KFUA 1G5PA 4P0TA 3OZXA 3OFNA 3AVYA 4JLOA 2ERYA 2RHMA 3NC1C 2WSSD 4UNRA 1Z6AA 4Q9IA 1OIWA 1E0KA 1ZCAA 4O0MA 4OBEA 4HDCA 2JDID 4HUTA 2FX3A 4A9AA 2FZLA 1TQ6A 1G16A 4KSCA 3AVWA 4IFBA 3LA6A 2D2FA 3KZ1E 4G01B 2VBCA 1E2LA 1XXHB 1A1VA 2A2ZA 5H1YA 1C9KA 1G19A 2JIZA 2ZSDA 4IXNA 3CRMA 3EXAA 3VR5A 1E2HA 4DLSA 2UZIR 4WVFA 3QUSA 2FG5A 4A15A 4K8OA 1ZCBA 1XCMA 3JZMA 4HZUB 1E4YA 1VCMA 4Q1EA 1N25A 4B3GA 1N6IA 3KDSE 3QXSA 4HAZA 2WVJA 4UNQA 1M7GA 3MUFA 1UJ2A 4UXIA 2AWOA 1NMZA 1OH5A 1XTJA 2VP0A 2GK7A 1AM4D 4RVCA 4IOJA 4JZKA 1CJTC 3RS0A 3SBEA 3A36A 1Y3AA 2ZROA 4DT1A 3G82C 5C4GB 3DPUA 2Q3HA 4LSGA 1PLKA 1GDDA 4PZYA 3W8NA 1DAGA 3DMNA 4XTCS 1F2UA 2GAOA 4RZXA 2V7QD 1XJ0A 1UM8A 1T3LA 2Z4RA 1HA3A 5JS7A 4J0QA 4AWXA 5JSZA 1YRBA 3FMIA 3TSOA 4O25A 4EFMA 4PQRA 1TEXA 2Q9AA 4M1WA 2ZRMA 4EQ6A 3FTQA 4XOIA 2C9CA 4DLTA 1WF3A 1JR3A 2ZSFA 4P4TA 3T5DA 3GLHB 1S9HA 2XX3A 1G4AE 2BEKA 2NO9A 2ZR0A 3RSOA 3K0SA 1N6OA 4QHSA 2OG2A 3P32A 1XEFA 2HJVA 5JI3E 1E2MA 2J41A 2P6UA 2ZEJA 2ZIAA 1VG0B 1RVDA 2F1HA 3CF0A 3MFYA 1CJUC 3OE7D 2ZRPA 4MRNA 2XXAB 1Z29A 4JYCA 3W3AA 1XPRA 2O8FB 4LC1A 4DLUA 1R10A 2WOOA 3LO5A 4KLZA 3KUDA 4LPKA 4MRSA 5BN3A 1NJFA 4KLNA 1YR9A 3ASYA 4YONB 3FMPB 3X1YA 4IXMA 3KKQA 221PA 3GJ8A 4NYIQ 1KGDA 4CGZA 4B6EA 3ADCA 1E2PA 2BJWA 4QGAA 1IONA 1X8JA 1QVRA 4EPRA 3EZ6A 3U2QA 1IN4A 1P73A 3L8YA 3GJ4A 1OW3B 1DVRA 1ZIOA 3W8RA 2HUPA 121PA 1W5TA 2X2FA 3ZZ0A 2O8DA 3EWAA 3IGFA 3PQCA 3QG5A 2QRZA 6Q21A 3AH8A 1ANKA 4Q9KA 4US2R 2KBFA 3BBPA 4S2EA 1U98A 2QMHA 2XGJA 1CLUA 1M2OB 2HXYA 2H1LA 4HB3A 3Q3JB 3VQTA 1TQ4A 5DI9A 2Y8EA 1TTTA 4IFEA 4TLAA 1AKEA 1JPNA 2VHCA 5B57C 5G40A 5FUWA 4TYYA 1E9CA 3GMTA 2ZTSA 2IK8A 4BECA 1UKZA 1G3IA 3A37A 4JVSB 3TKLA 1KI1A 3K8YA 4OI4A 1OXTA 4U5XA 4Z1MD 4X8OA 2QA5A 3H1TA 3RRNA 4DCTA 3HU2A 4JJKA 3AKDA 1YQTA 3AF1A 4TLEA 521PA 3B13B 1A4RA 5J5CA 5FOWA 1AZTA 1OLOA 1XB2A 2NGRA 5TV2A 1W4RA 4C0JA 4DCSA 2ZPTX 2YOGA 2F55A 4HB4A 5ANRB 4QG7A 5FBVB 5FFMA 1U0LA 4OI0A 1KKMA 4DBLC 4WOPA 3I5XA 5CIQA 2VP6A 5CK4A 3W34A 3B2EA 2KWIA 1IY2A 4H1UA 1T8TA 4A8JA 1RJ9A 3S1AB 2P65A 2ZUDA 5EE1A 1AS3A 3X1WA 1E4VA 1WQ1R 1XDBA 2D7CA 3FMOB 1MO5A 3CF6R 5AK0A 2MSEB 2YVUA 2B6HA 4BFZA 5TVKA 2MSDB 2ZE5A 2OCPA 1PUIA 1Z22A 2GETA 4LC0A 3SI7A 3THYB 4C7OB 4AKIA 2O5VA 3EASA 4Q1AA 1OIXA 3LXRA 1D2NA 3I72A 5TDHA 4V03A 4OQLA 1W5SA 1W2HA 3BRWD 4DUGA 3N70A 4ACAA 2G0TA 1Q12A 5F9FA 1TNDA 2A3RA 4LOAA 2A5DA 1PV4A 4GPTA 4IVQA 4CZ2A 2OE2A 1ZM4A 5CLQA 2OV2A 2E1RA 1E79A 3I3SR 1CIPA 1PJRA 1UKYA 3TW4A 4F4CA 5G3YA 1AN0A 3OFND 3X1DA 4A36A 2CK3A 1ZUHA 3VU9B 4E03A 3PUZA 2G1KA 5TB5A 1UFQA 4JVMA 3K70D 1XX6A 1OFIA 2ODEA 4PX9A 1YZQA 2P6NA 3GLGE 2CLSA 1T5IA 5CITA 3AEZA 3WNBA 3QF4B 4RD4A 2GJSA 3PUVA 4DCUA 4BFYA 1W48A 4MGZR 3I92A 1ZUIA 3GEEA 3NKVA 3WHLA 3K0FA 2PLRA 1I4TD 5AUNB 1BIFA 3TSWA 3KTAA 4Q02A 1LFDB 2JIZD 1XBTA 1F5NA 3ZGXA 1FQJA 3IEUA 2F9LA 3R9WA 1OIVA 3EIEA 3IO5A 5KSPA 3B78A 2PT7A 2FOLA 1SULA 1T91A 1U90A 1D2MA 1FP7A 2C03A 2IYXA 4HUQA 4Q9JA 4D6PA 3UATA 3K09A 3LDAA 4DDTA 4AK9A 1KDOA 3D7MA 2VP4A 1MT0A 2XJ9A 4M1KA 1SHKA 3UWKA 1G5RA 3OAAA 3FOZA 3F0TA 3ZLJA 3THXA 2AL7A 1R2QA 2CE7A 4ASUA 1TU3A 4A4DA 1KMQA 1KMHB 1XEXB 2OFXA 1BMFD 2OAP1 4FMDB 4BASA 5KDOA 4YLGA 2QBYA 2VSOA 1GRNA 1T8UA 1KI9A 2IS6A 4BZPA 2W0MA 3RWMB 1KI2A 3D8BA 5FTNA 1NSFA 5DGXA 4FN5A 3ADDA 4NONA 3B9QA 3B7GA 3EIHA 1JEDA 2RMKA 4QNMA 1TU4A 2MMCA 4PPFA 4ZO4A 2XTMA 4PC3A 4JLKA 1G9XA 4MDEA 1N5IA 1E2EA 1GNRA 2ZSAA 1GUAA 1G8PA 4OI2A 2VRWA 3PEWA 4D2IA 4OK5A 1VYTA 1ZNZA 5JRJA 5L3SB 4JSTA 3BB3A 4PZZA 1GM5A 3HYTA 2W6JA 1EFRA 1S96A 3SFVA 3AVPA 1P2VA 2BBWA 1WA5A 4XWOA 1LV7A 2V9PA 3ICQB 1G7SA 3SJZA 2VF7A 3TQFA 1XPOA 3WMGA 3BJIC 2B7BA 1KAOA 2VP2A 2YOHA 3QOFA 2WJIA 2VTKA 5GJWC 2AHOA 1XD2B 3RC8A 2P5TB 1BKDR 2CHQA 1XPUA 4CEJB 1RFLA 5JHHB 3B6EA 3IEVA 1QBKC 3NEYA 2P0EA 1NSTA 1XWIA 4HAWA 3EAQA 3ICEA 1P6XA 3PENA 2A5FA 1S4QA 5FPYA 1RRPA 1LW7A 2CLDX 3K0CC 3BE4A 3W6NA 1C4OA 1G291 4QHYA 5HTKA 2C98A 4BFSA 3WYFA 4RD0A 1Z6XA 2ASEA 5K8LA 3L0IB 2YWHA 3GP8A 3F8TA 1Z06A 2HCBA 1Z47A 3SQWA 1R5BA 1Z0AA 5C4MA 2ZI4A 3CO5A 5IHPA 1GVNB 1KTVA 4TN1A 4IOMA 4URZR 2C95A 5DO9A 3DKPA 4V0LA 1R8QA 3ZQ6A 4L9WA 2IYQA 5A4JA 2R6CA 1H65A 2PEZA 4Q4HB 3UMSA 2CEAA 4MKFA 3J81k 4V0ME 3TK1A 4FI3C 4KITB 5G41A 1F2TA 4JSYA 4D25A 2D62A 2FWRA 3SN6A 1KK1A 2IS1A 2ORIA 2GCNA 2QROA 2WAYA 3RANA 4BLPA 1ZM3A 3FFAA 5FH9A 2WMNB 2ZRNA 1RRFA 3MD0A 5JJLA 1QHXA 3VR2A 1R7RA 2O8EB 4X8LA 2VSXA 3GLIE 2DR3A 3TQCA 1Z0DA 4LBYA 4EFLA 1G7TA 2FF7A 4ZPXA 1UPTA 2I4IA 3P20A 4DDVA 3WMFA 4B3CA 2HYIC 2QORA 1A82A 3H2YA 1E2FA 2WBLC 2AXPA 2CHVA 2L0XA 1KO5A 1YZGA 1IY0A 1QHGA 4LYJA 3BFKA 4MUAA 2OSBA 5CB8A 3TH5A 3A58B 2R62A 1A7JA 1P2TA 4PQYA 4B43A 4RD6A 1VCNA 2ZETA 4B3XA 1E2JA 4NP6A 3BIFA 4M1OA 2J46A 3GQBA 5LDDC 3QKRA 1E2GA 2IEZA 3FMFA 5EUMA 4M2LA 1G17A 3OEHA 4Q03A 2OHFA 2OUKA 4GZLA 1UEIA 2VSFA 2WSSA 3B1VA 3DZ8A 4G5RA 4Q5IA 1MRNA 4KV9A 4TTRA 4TZ6A 3QVVA 4UKDA 2W2TA 3RNLA 4QRHA 4ARZB 2GBLC 4ITRC 2UVQA 1PUJA 1KO7A 1RE0A 2JDIA 3A4MA 1CP2A 1N6KA 2XB4A 1KSGA 2NPFA 1D2EA 1DO0A 4R9UC 1G4UR 2R6GA 1ZD9A 1EXMA 1M34E 4TQUS 3RDPA 4TTQA 4CEIA 4DLWA 2GZHA 5FTKA 3BK7A 2C9OA 2Q6TA 3VR6A 4DLRA 2OBMA 1XMVA 4KFTA 3AM1A 1L8QA 2PZGA 3C5CA 4BFWA 2YHSA 1G3QA 3FKSA 1DARA 1E79D 1VCOA 5J4VA 1UEJA 2QPAA 1FMJA 3BD9A 3GLGA 4R2HA 3LQQA 1NIPA 4Q4JB 2W2XA 1KK2A 4L15A 2RGNC 1KO4A 4DT1B 1NLFA 3W5JA 1J70A 1E69A 3C15C 2J0QA 2C2HA 4NYJQ 1SXJD 3QQ5A 4AURA 4BFUA 4XJXA 4JL8A 1HT2E 2XEXA 4RZ2A 4XWAA 1KY2A 3A4NA 2REXB 1TF7A 1VHLA 3EZFA 1OXSC 1XTRA 2H16A 3M6AA 4L4UA 3UK6A 3E70C 3GEIA 3RRMA 3T1QA 4IDHA 1FTSA 2CDNA 2ORVA 5FOVA 3TIFA 1QF9A 2RGEA 4Q1BA 4MGIR 4WW0A 3MJRA 3CH4B 4JVNA 3TR0A 4TMWA 3I62A 3L43A 4PC1A 4LBVA 1Z0JA 2QTHA 3B5JA 2BHRA 4MITA 1Z6YA 3NTUA 3QKSA 4TL8A 3A1WA 1OPXA 1U0HC 1K6MA 3LVQE 2N1BA 2ZI7A 1BH2A 3QKUA 3EZ2A 3BWDD 2V1XA 4JLJA 1SQ5A 1G8GA 1KSFX 2WJVA 3KFVA 4CEHB 3SFZA 3IUYA 1EFTA 5DHFA 3FDIA 2FPKA 4ZV4A 2WWIA 1T5LA 3BFXA 1XTQA 5GJVC 3OE7A 5HKKA 1OB5A 3W5IA 4C0SA 5KTYA 5LBIA 4BZQA 3OIVA 4KVAA 1IN6A 5FPSA 4PR0A 4FXPA 2YKGA 5FI0B 2JLWA 2G83A 4M9ZA 4LJAA 1OXVA 2ZVPX 3ZIAA 4IDPA 2J7PA 1W2GA 4TQ9A 4ZIRA 2HF9A 3U44B 1E94E 4Q9HA 2SHKA 3ADKA 1EFRD 2O8DB 2CJWA 4OK6A 2XNSA 2ZQ5A 4TYPA 5EJEA 1I4DD 1Z2AA 1E2KA 1HQYE 1RPZA 2OLJA 3NDBB 1T3SA 3M1IA 4D80A 1EESA 4RY2A 4Q18A 4LHXA 2EFEB 5TARA 4BRUA 2QAGA 4HLDA 1NKSA 1XNJA 4JKYA 4C3ZA 2F3TA 3OESA 5HCIA 2AK2A 4PFSA 5SZIA 4QFMA 1Q3TA 2GESA 4TL6A 2YZ2A 1NRJB 4RSGA 4OL0A 5FR2A 1D9XA 3NEJA 5B58C 1H8ED 4M53A 3EW9A 2TMKA 1TADA 1KI4A 1P2UA 3CPJB 3AB3A 5FBRB 5DYIA 3TJZA 4G3XA 5F98A 2QMEA 2WWXA 4FMCF 1W1WA 4Z1MA 4AY2A 5G53C 1NF3A 4RFSA 4KFRA 4UJ3A 4OHYA 4KXFB 5E95A 2J7KA 1U81A 2W00A 1KNQA 5EP3A 2D3WA 1NY6A 1LS6A 3NC0C 5C18A 4P4SB 3Q5EA 1U8AA 3ZJYA 4LJ6A 4QXAA 3IQXA 2BCJQ 4BWYA 1EWRA 1P9RA 2FPLA 4URVR 4B3BA 2Q0HA 1W4CA 4JT4A 1Q21A 4EPXA 5C46F 1EWQA 5B64A 1GRQA 2AWNA 4V0MA 1ZNXA 1ETUA 2BM0A 1E2NA 4KYIB 4BFVA 5EXTA 3K9GA 1XZQA 3TUIC 2RH5A 4DCVA 3DOFA 4AYXA 4JBXA 1XMSA 2OCAA 1UBEA 4UJ5A 4XVRA 4TLBA 4LY6A 5KNDA 3P27A 2Q21A 1DAHA 4US0R 2W2VA 3GLIA 5BXQC 3AVOA 1E2IA 5D3QA 3U6BA 2CHGA 4Q1DA 1COWA 2YINC 3GJ3A 1QG2A 4IJMA 2ANCA 3U4QA 4KHZA 4GL2A 2R2AA 2RGAA 1MABA 2WJHA 1ZC3A 3L8ZA 3IPYA 4LJYA 1E0SA 1W36B 2RGXA 4Q7KA 1XRJA 1GNQA 1Z8FA 4PO8A 721PA 4QJ5A 5JWRA 4LZZA 4Y0AA 3THWA 4M9QA 2GAAA 3LH5A 1XTSA 3CF2A 3K0AA 3QIAA 4LJ4A 5FUXA 1MO3A 2ZI6A 1CULC 2ONKA 2ZYVX 4YMVA 2ZR9A 3U3JA 4DSNA 4D4MA 3OEHD 1KO8A 2XJ4A 3DHWC 3IQWA 2JLXA 1Q20A 2FN4A 3I1FA 5GVRA 2KSQA 1NMXA 1I4LD 4JT2A 5EE3A 5BYJA 3G0HA 1A2BA 3BB1A 4HEJA 1HURA 4FINA 1EFCA 1BYIA 1UDWA 3RYTC 3SYNA 1II8B 4QM6A 4I99A 4HZIA 4CDGA 1M7HA 3EX7C 1DAFA 1SXJE 1G21E 1YZUA 5IF9A 2C96A 2AN9A 2QP4A 1NJGA 2J45A 1OH6A 2O8CA 3KKOA 4L5BA 5JI2E 2CNWA 1ZU5A 3CR8A 3RS2A 2E9SA 1QHHA 4HUQB 4EJSA 3U60B 2G3YA 1SVSA 3ND9A 4ERNA 2YWEA 3E2IA 3FKSD 1OXUA 5DN6D 4AG5A 3MRSA 1DE0A 5FPKA 1W0KA 2P67A 2Q3FA 1ZMXA 1ZD8A 5JECA 5KOYA 3THXB 4M0LA 1YZTA 1GITA 1T0JB 3CKLA 4KVGA 1RYHA 3QNUA 2F1RA 4C0BA 1N5LA 1YVDA 2QBYB 1WDTA 2XSZD 3K9HA 1EGAA 1NKTA 2ODWA 1BMFA 3CRQA 1CR0A 2CCGA 1WP9A 5BW8A 2NG1A 4KBGA 1V43A 4PHGA 5F2EA 3VX3A 3LLMA 1DOAA 1FTNA 2JCSA 1GKIA 3FKQA 1NY5A 2NZJA 4KO8A 4Q7LA 3DM5A 4X8HA 1IBRA 4TLDA 2DFKB 4CRWB 2OBNA 3B1XA 1JJVA 1U94A 4D0NA 3ECCA 5D3MB 5H68A 5EP4A 2IS4A 1FMLA 1GSIA 2R65A 4AKEA 2WHXA 4I4LA 4Y0VA 4EDHA 1SVWA 2GCOB 3N2EA 3IBYA 4TYNA 4LDJA 3CNOA 4QL3A 2G77B 1IXZA 3LW8A 1FX0B 1KDPA 3RWOA 4ZI3A 3O47A 2GEUA 2H92A 1CF4A 2W0SA 1P62B 1JI0A 1KY3A 3NHBA 5JJIA 2VIIA 4TMZA 3U6KA 1UBFA 1JAHA 2ERXA 3CR7A 1VG8A 4B3FX 1YJ5A 1OFHA 1FPMA 4FCTA 4PTLA 2EFCB 4CIDA 1G64A 1Z5ZA 3NIBA 4DEYA 5F9HA 3ASZA 1XP8A 1O87A 2VP5A 1RZ3A 3TRFA 5HKKD 4JLAA 1KOFA 3QXHA 1AJEA 4BEBA 1HE8B 2BJVA 3LBIA 3KJHA 1WRBA 2GJ8A 3PIRA 2WWWA 4M4SA 2QY9A 3W9YA 4EPWA 1KSJA 4EPYA 1NLZA 4LRWA 4HLUC 1NVVR 2FH5B 4V0OA 2RGCA 1FNNA 2B8WA 1YKSA 1U0JA 3ZIAD 3HJNA 4PO1A 2J7PD 2BCGY 3MLEA 3WRYC 4TMTA 4OYHA 3K70C 1Z2CA 1KZGB 4DHEA 5CB6A 1IM2A 4M1TA 1X1SA 3IBGA 2XAUA 1HE1C 3LY5A 4WZBE 2ZRAA 3T06B 3TW8B 1P7CA 3LX5A 3VAAA 4B74A 3SJBA 3SEAA 3N2IA 3N5CA 5EP1A 3ZZUA 5CJ2A 1GL9B 4JIMA 3SZRA 5TY0A 3QF7A 5HE9A 2O8BA 2DWOA 2ZI3A 4DLXA 4QBHA 4DDWA 2CVHA 1OKKD 3QXXA 4N1AA 5M04A 1Z6GA 4U02A 5SZJA 4LWZA 3T1VA 1US8B 4DXAA 1Z0KA 3CX7A 3R8CA 1DS6A 1X8LA 4URWR 3SBDA 5L3QB 4QNRA 4BLTA 4B73A 4XVUA 4DLYA 4NCKA 3K53A 1VHTA 2BDTA 3AV0B 3FHOA 4P31A 3WMEA 5AUPB 2RKOA 3AF2A 4PPNA 2PX3A 4IDOA 3SHFA 2W83A 2YJTD 3RRZA 4MKHA 2PMDA 4OHXA 1SKQA 2GCPA 2QP9X 1ZM7A 1DAKA 3QKRB 3U3OA 4DIEA 2FZ4A 3MCAA 2CE2X 2F1JA 3D6TB 1UBCA 1DEKA 2D2EA 1JAIA 4UNSA 5DH9A 3VKWA 2G88A 5JEEA 1XJQA 4LPSA 1Q1BA 2BBOA 1VTKA 3NBXX 1E9AA 2P3SA 4NDZA 1S0UA 2DFTA 1W46A 3GJ0A 3I32A 4KODA 1R0YA 2IHBA 1IN5A 5DYGA 1COWD 1NP6A 4CEIB 4OQNA 1Z0FA 1J8MF 3GFPA 3BH7A 5SZHB 5EE0A 1P61B 2A7QA 3ONWA 4F92B 2IW3A 3UPUA 5BWMA 4E09A 2FEMA 3KXLA 1ZU4A 3QSYA 4A1FA 4TWZA 1LVGA 1WCV1 1F6BA 1FW6A 4IVPA 1BO6A 2QGNA 3GFOA 5KSYA 2ZUCA 2FFBA 5DSZA 2ZS7A 2HCJB 1CRQA 3TGPA 3GLGB 2IWRA 2AXNA 5KPJA 3I73A 3R7WA 1OV4A 1CKEA 2OFWA 3Q85A 1HT1E 2IYUA 3AUXA 3PUWA 4QBGB 2HLDA 4TTPA 4URXR 3RS4A 2JATA 3WRXC 4PAQA 3LX8A 3UG6A 1SXJA 2VPPA 3H0KA 3RSLA 4Q4AA 3LV8A 1OFUX 2YOFA 3QPWA 3DMDA 1AK2A 2AFHE 4N0DA 2BMDA 2IYVA 1KI6A 4IOKA 4M9XA 2QENA 3REFA 2IUUA 2CNWD 3Q7PA 4NKRA 1K8RA 2GEDA 4A0GA 1XCGB 3KB1A 1ZUNB 4C2UA 1W0KD 2WICA 5JBQA 4UNPA 4YMUA 4UNNA 2ZRFA 4MGYR 5TXGA 2O52A 1FP6A 1ZW6A 1YR6A 1IHUA 4OKSA 4ZKDA 1Z3IX 2DFNA 1P3JA 3WNDA 3FFBA 4ABYA 2JJ8A 2EW1A 2IYSA 1X86B 2F43B 2JASA 4PZLA 3NH6A 2H7VA 1P72A 1T4GA 2ZAMA 3B1ZA 3UXMA 2X1VA 3P26A 4BUJA 4Q21A 3OIYA 3A1UA 4NYMR 3VR4A 1LF0A 2GWHA 1TAGA 2GILA 2MSCB 4DEXA 4GNKA 1G8FA 1QRAA 3UANA 4BLSA 1DG1G 1E9SA 1VPLA 4RJLA 3QKTA 5JJKA 3BORA 4Q7JB 3KFXA 4QHTA 1SGWA 3TVDA 5E3HA 4A6PA 1W7AA 1L4UA 2IBMA 4A92A 4DZZA 3ZVMA 2ZXUA 3A8TA 4YDSA 3Q8XB 4TZ0A 5JMTA 3W90A 3KJEA 2W58A 1AKYA 2R9VA 1Z08A 1E1QA 5CM9C 4A8JC 1VG9B 2X19A 2RGGA 3QVUA 5J40A 2GTPA 2ZJYA 4LK2A 4PC7A 3NDPA 1JQLB 2ZE7A 4O2RA 4DC9A 2V1UA 4JVLA 4TMXA 2AK3A 5JWOA 5G3ZA 2PMKA 1KNXA 4NL4H 3SS8A 4LX0A 5BN5A 1T6NA 2FA9A 2IYTA 5J4HA 2GRJA 3L0OA 1ZNWA 2N42A 4MUBA 2E87A 3A6PC 2ZYTX 3IILA 1H8EA 1KDRA 2ZRIA 1JB1A 1U8YA 1XEWX 1W36C 3FB4A 4D82A 3NXSA 4V02A 4BZXA 3CH5A 3CB4A 4PO9A 4M22A 1N2CE 4PHTA 4Q1CA 2IYZA 4HAYA 2WWFA 5EXPA 3VNVA 1R4AA 5FOTA 2PJZA 3T35A 2BKUA 3GLHA 3CNLA 3VKHA 2ATXA 4RD1A 2QZ4A 2A5GA 2NOAA 4TSFA 2ODNA 1HEIA 3UG7A 2IXEA 3W6OA 1HY3A 2GXSA 1EK0A 2QRNA 1KJYA 4GDFA 2XXAA 1YZKA 2VHUA 1ZYUA 1AIPA 3FHTA 4ZDWA 1KJZA 2JAQA 1QVAA 1NLYA 3GLIB 2EYQA 5K8TA 2ZYUX 3KKMA 1Q22A 2ZI9A 5K8UA 5JEDA 2D74A 1E99A 4O2LA 4B35A 2PX0A 1FUKA 1OT3A 3BS4A 1U9IA 2BMFA 2OEPA 4GT1A 3C16C 1FQKA 3K0EA 1XD8A 4FMCB 2QEQA 5JHGB 5KYKA 1HYQA 3K09C 1X8KA 4ZDIA 3G5UA 5FR1A 2W6IA 2G1JA 3HPQA 1X1RA 1TF5A 2JJ1A 2REBA 3MWLA 3PVSA 3VR3A 2VYFA 3NBFA 3PCRB 1XEWY 4LJ7A 2ZI5A 2JGNA 4A0RA 1S2MA 4QBFA 3GLFE 3H84A 4L8GA 1DPFA 3VHLB 3FVQA 2C99A 4S35A 2FGKA 5FI1B 3K70B 3P4XA 4CVNA 3CLVA 4DSOA 1IXRC 1QG4A 5AJYA 4P32A 5P21A 3PITA 2JEOA 2QQ0A 4A2QA 3AKEA 5DI3A 2DCUA 4F7WA 4LV5B 4TT3D 3F5FA 4FIDA 4BGDA 4OJKA 2ZRDA 5JRZA 2QSYA 2EFDB 4B44A 2NIPA 1RRCA 5KUTA 3EG5A 3SHWA 2F6RA 4LI0A 2OESA 5HCNA 2O8CB 1EX6A 1R5NA 3SYKA 2H17A 4LV8B 3C8UA 4TMKA 4GFDA 1HUQA 3CBQA 1QHHB 3R9XA 3CX8A 2FJUA 2FPMA 2EWWA 5AJXA 2G9NA 4BPBA 3SJAA 4TL9A 1DAMA 3K1JA 2Z0MA 1T3HA 4LGMA 3MMPA 2ZS9A 4L9SA 4GBMA 5DN6A 4DDUA 1NBMA 2PL3A 2QAJA 2XTZA 4PSKA 1WBBA 2GVDC 4BLOA 1G5TA 4OQMA 3O8RA 4EPTA 3KQHA 1XU4A 2ZE6A 5FUVA 3NVAA 1ZRHA 4OK3A 1L7VC 4C7OA 1KK3A 3THYA 2XSZA 2MMGA 4NYIR 2HLDD 2R8RA 1VECA 2IC5A 5CDFA 2UKDA 4HAUA 4MQBA 1AGPA 1AQUA 1GL6A 2H8KA 4Q66C 4H1VA 2EFGA 4MRPA 3HPRA 2P6RA 4D0LB 621PA 3AVVA 4C30A 3WBJA 2Z6VA 4W5HA 1II0A 1F2UB 4IRUB 2DHRA 2GJ9A 4Z8YA 4NU0A 1YRAA 1JXMA 3BC1A 3DEFA 4BE7B 4O3MA 2D06A 2IT1A 1TEVA 5JSZB 1TUEA 2HEIA 4MGKR 2DWPA 5EUQB 1F3OA 4M1YA 2O0KA 1YHNA 2V54A 3VU9A 4AD8A 3GCGA 4YMWA 4LHYA 3SU8A 4EQ6B 4YDHB 4IHQA 5LPNA 2QPOA 3T1OA 1ESMA 2Q9CA 3EPJA 2C77A 2RAPA 1NN1A 2Z43A 4FWIB 1R0WA 2J0UA 2QI9C 4RFVA 4XD7D 5GADl 3QPUA 2F7SA 2BVNA 3RHFA 2LWIA 5KSZA 4Q47A 1IN7A 4Q4LA 3ZD7A 5FPTA 1ZNYA 1GFIA 2BEJA 4R7ZA 2YC4C 3B60A 3KQKA 1HTWA 2PEYA 3PFIA 1S8FA 4GP7A 2XITA 2GEVA 5JCZA 3OF5A 4NCIA 3RABA 5J4KA 2CL6X 4CW7A 1R6BX 3LD9A 1MOZA 4LYHA 5EE9A 1JEEA 2OAQ1 4OQXA 2F9MA 4ZCIA 4JMPA 1AGRA 2V3CC 1Q57A 4JS0A 2FV8A 1A5TA 4P4UA 1SVKA 2QG6A 3X2SA 3L82B 3ZZTA 3EPLA 2GZAA 3EA0A 1E1QD 5FTLA 3PJRA 2ZS8A 3KUCA 4NHOA 4E22A 3GJ6A 2AKYA 3MJHA 5IK2A 1DELA 5FTMA 5J4YA 2HJGA 2QUZA 5TMPA 1JECA 3DOEA 3NG1A 2QNRA 2B92A 4NH0A 4HB0A 3ZH9B 4PPQA 3DZDA 1OKKA 3TBKA 1R8SA 4B2PA 3PUYA 2IF0A 4URUR 2ZU6A 3AP3A 3AF3A 3IHLA 4JJZA 4MRRA 5IDVA 2WKPA 2REOA 3E1SA 3HP1A 1NG1A 4IVRA 4LJ8A 4YC7A 1GKUB 1PZNA 3PG5A 4HAXA 4ZKEA 4Q9LA 3EA5A 1UDXA 2ZITA 5E7MA 2J9RA 2VLIA 2XTNA 1MR3F 2YWFA 2FNAA 2V6JA 3PV0A 3VHXA 4WAUA 1IJFA 5JS8A 3O8CA 1T9HA 4F4IA 1KHTA 4JYBA 3M0EA 3WY9A 5FL3A 2JLVA 1ZINA 4LUCA 4DB2A 2ZJOA 4G1UC 4TSFD 2YNMA 5EXXA 4B2LA 1NNEA 2H5EA 2JA1A 1S3GA 4C0LA 4MYTA 1M1YE 4CEJA 1N0VC 2RHDA 2V55B 4A8JB 1RJ9B 4B71A 2UZ3A 4MKIA 2QMOA 4D0GA 1AZSC 1KK0A 1GL7A 5JFGA 2ANBA 5GJBA 1JNYA 2CMKA 3D3QA 2QSZA 4WIAA 4IDQA 1TPZA 5DHAA 5FPHA 1BOFA 3I5YA 3VTKA 2BIFA 4KJZA 4XWKA 1MKYA 3CRRA 1JJ7A 4QOSA 1GILA 2EQBA 2YYZA 3UMRA 5E4FA 3RRYA 1YR8A 1MV5A 4IEIA 4C0HA 2AR7A 2XZPA 4XIGS 5JCPA 5IT5A 5DNYB 1ZVQA 5CIWA 3U7GA 2W6ID 1V5WA 2DWQA 4QBIA 3R9IA 3FYHA 3GLFA 2JJ1D 3B9PA 4HDOB 2R44A 1VYUA 4AYTA 4B3DA 1TQ2A 5AUOB 1EG7A 4GRAA 3WYGA 5HPYB 3QY0A 3P1JA 2AFIE 4Q48A 4Q19A 4PSAA 4V0NA 5KSOA 2OFOA 1E9DA 1SXJB 3HU3A 4JBWA 3X1XA 2PT5A 3QBTA 3T1TA 3Q5DA 1P75A 2HT6A 1Y63A 3LLUA 1SKYE 1CS4C 2R6DA 4PQFA 3K0FB 3C7KA 3U3KA 1YE8A 3KTAB 1G3RA 2VHQA 3HDTA 2Z83A 4ZCMA 1E2QA 4JL6A 4EKDA 2HF8A 1XMIA 2IYYA 3TUZC 1LF5A 4KFSA 2XZLA 4DWJA 2KBEA 1N3BA 2ZRGA 1YR7A 1WB9A 5JWHA 2JLRA 4NCJA 1VMAA 4DJTA 3C4JA 1G7CA 1DG3A 2QAGC 1Z07A 3CPEA 4MRVA 1NBMD 4EAQA 1ZM9A 1OHHA 4YMSA 4ARZA 2QT0A 1KAGA 3LXXA 2HT1A 3BGWA 2FEOA 4KU4A 4KCGA 4B2IA 2A5YB 4JLPA 4LHWA 2EFHB 3WP0A 1G3UA 4UQOA 1A2KC 4Q7MB 1CR1A 1J2JA 2JJ2D 1CRPA 2BV3A 3KX2A 1OXXK 2QE7D 4M1MA 2PCLA 3F3YA 1XXHE 4MH0R 4ACBA 3AF4A 4GOKA 3CNNA 4Z51A 4WA7A 5EE5B 1M7BA 2RGDA 4PAMA 1RW4A 2J5XA 3OIWA 2OLKA 1CR2A 2WSMA 3T12A 4C0AC 2VEDA 2QTFA 2ZVQX 2BC9A 5J4LA 1KDTA 1N6RA 1UAAA 5HZHA 1SHZA 4LYAA 2J1LA 3CWZA 3LNCA 4Q4JA 3TE6A 4DLVA 3LVRE 3AKCA 3RS7A 2C8VA 5CYPA 3KQLA 2N46A 2QT1A 2ZJAA 1ZAKA 2ATVA 3GJ5A 4HI0E 4B75A 3W6PA 2QP3A 2FFQA 4NZYA 3UMFA 4A0FA 2CLCX 3H86A 2FE4A 3SYLA 3I4LA 4OHZA 2QQEA 3HYRA 3BXZA 1U99A 4WXRA 3U3MA 2AD1A 1JQJC 3NH9A 3EC2A 4OQFA 2QL6A 1N6NA 1GOTA 2ZR7A 3GFTA 4WZ6A 3V4FA 4D4LA 2XZOA 3WBKA 3TMKA 5A0FA 4AYWA 3B85A 3E5HA 4RD3A 1GG2A 4RZ3A 2WIBA 4HSEA 2QM8A 4GMXA 5EQTA 3CZQA 4TL7A 1BS1A 4FWTA 3DO6A 2GXQA 1KIMA 1E0JA 1DBSA 1DTSA 1YZLA
chains in the Genus database with same CATH superfamily
3D8UA 3CW8X 3KXIA 3A1VA 2X0DA 3LZCA 3KKZA 2XCIA 4RIGA 5KAMA 1K5GA 1A98A 3DZIA 3DBRB 4EPVA 3VU8A 3VDMA 5ALVA 4HXFB 2PUWA 3FCXA 4I8XA 3RYHA 1B6SA 2Q0XA 3FUTA 4PLWA 2BFFB 1L5VA 2IA5A 2AJLI 2PGXA 2RGWA 1HE3A 3PQ2A 3BJRA 2F3RA 4HNGA 1VIAA 1TA0A 3GHYA 3MM4A 4I1VA 3WFZA 4XGNA 1J42A 2OCBA 3JY6A 2BOVA 4Y2VA 3NHSA 1TCAA 4JKIA 1H9BA 1R5JA 1SJ9A 4YRFA 5FL7A 4B47A 4AKHA 1X1EA 2WWGA 1BEEA 3PUKA 4WLFA 1T6YA 2ODAA 4IH4A 4ND4A 3UWOA 3HQ4O 3FTEA 4GYJA 4D5GA 3P9XA 3ZWBA 2BRUC 2KI5A 4JQYA 5CK5A 5F76A 4AJLA 3F78A 5TQJA 4CYMA 4E21A 4E88A 4ZVRA 1Q3KA 1RTKA 2H51A 1T26A 3U44A 2C82A 1EVJA 2FJPA 3KQVA 2P9QA 1UJ6A 1V7ZA 3RC7A 1EX9A 2P77A 1ODTC 4CV1A 1YE3A 4YECA 1SC6A 2KLBA 2DBZA 1UPFA 3WYDA 1W29A 2ZXEA 3UXEA 4PLTA 4NCHA 3K6SB 1I5RA 4H7PA 4YQEA 4WCFC 3U7FB 1M1YA 3Q7IA 4NYJR 4EFNA 2VJOA 2YXNA 3DDWA 2GOYA 3KRTA 3VDNB 1EU1A 2HNKA 2Q2OA 2YS6A 2O2XA 4D3ZA 4DLKA 1U3GA 2GHTA 3GQBB 1GRRA 4DL9A 5JUWA 1EUDB 4LXXA 6GPBA 2X1MA 1G2QA 3GFRA 4KGDA 3BSWA 1IM8A 1XCLA 1DCTA 1AQYA 3MRTA 4R54A 1Z7YA 4NDNE 1GZ4A 1KI7A 1NQTA 2WDZA 5DI3B 3VX4A 4QJ3A 2XTAA 1G8YA 1TVKB 5EJAA 3FUUA 1PYGA 1E58A 2ZYAA 3NHRA 2GJAA 1D7OA 1SQSA 5ECDA 2XOKA 3MT0A 4XX0B 3TLKA 5BORA 4BIIA 2R0QC 2RIPA 4R8KA 3D31A 3RBVA 1G6HA 2I1WA 2IYLD 2CXTA 2WJJA 5FBZA 3KTDA 1UC9A 3BZWA 1FZQA 2C5LA 1E9FA 3MWYW 1EFUA 2GN8A 1XZPA 2V3WA 1XZAA 1SVMA 3WGMA 1Y8RA 3S68A 3I8SA 4XGKA 3RC9A 5ADVA 3ER9A 3AJAA 4I3FA 4MKGA 4DV7B 2GNAA 4RNDB 2C0QA 4LYEA 1BD3A 3OT1A 5HBGA 1WKCA 3OLYA 1VGRA 4G5YA 4GOXA 3VNUA 3HEBA 5HILA 1AQJA 1J7KA 5AOCA 5C1OA 4ZCLA 4MCHA 3TLYA 1QK3A 3EZ9A 2VDRB 3KJGA 1B6GA 1S5PA 1WVGA 2X4LA 3V1UA 3BQ9A 1PLJA 3PX7A 2A0UA 2FUEA 1WW2A 1ZIPA 4POAA 1BU5A 1W85A 2I4TA 2IUYA 4XB1A 3WOVA 5B1EA 3ZNNA 4MUYA 4ENQA 4NABA 1NBME 1LBQA 1UDCA 1XU9A 1KP9A 2P2ZA 4KXNA 4XZ3A 1XFAA 3RJ9A 2Q4RA 1GSOA 4H6PA 4R2IA 4RCVA 1NMYA 2XGOA 4YMHA 2AFHB 2OILA 2EU8A 3ROQA 1JLLB 2IHTA 1ZH4A 1XZGA 4UNIA 4XTRA 2QD4A 5EJ2A 4DQKA 1ULUA 4DWOA 1U8EA 1MZVA 2J3JA 2QYSA 1C7IA 2QGFA 2H9IA 4LYDA 1YZNA 1BXZA 1ZXXA 4YCBA 1WXWA 2JB9A 5H70A 3M3DA 4N76A 1BVHA 2JLQA 3LT5A 3R20A 4PN3A 5IUKC 5BWNA 4LNUB 1XTIA 1CEEA 3WV4A 5FWXB 4IS3A 2O1EA 1U1CA 2Y67A 3RAJA 1CNFA 3DOIA 1NRWA 3KOUA 3L77A 4DLPA 1Q1EA 1URPA 3IKTA 1ZEJA 3B7PA 1FVFA 1SU7A 3PP8A 1PNOA 1UBUS 2HA6A 4FLFA 3V4LA 5BSWA 3UJBA 2WV9A 1PGNA 3QKSB 4U00A 1NBAA 1E4OA 2HHLA 2WKQA 1OHHD 1IJBA 1RZUA 2DFLA 4OUKX 5TT0A 5HR5A 3TSZA 5KBYA 421PA 2VA9A 1FL9A 3A9TA 4UU1A 1HFKA 1CR6A 1P4AA 1N5KA 1TUIA 1TDJA 2GMWA 4HJXA 3JSAA 1CP3A 3WLSA 3SZUA 5EJFA 4BNGA 4F91B 3KSRA 1UXKA 1XD9A 2W6ZA 1W8DA 5D84A 2J3EA 5FHQA 4JI3B 4X1IA 3TW0A 2M98A 5DYWA 4S1OA 1ABBA 3BGSA 2VYND 2Q3MA 4NAUA 5LD2C 4Q9NA 5E7JA 3UT5A 3QEOA 4RZSA 1LTHR 2OHGA 4MP3A 3DE0X 4JT9A 4WPGA 3KEMA 1U8ZA 3V8RA 5C2JB 1SVLA 3IP3A 6YASA 2ZB4A 3GAZA 4TYWA 1T6XA 4M86A 4QPJC 1DAEA 1BZYA 1R0LA 3FJYA 1QG0A 4NCBA 4NS4A 2F3PA 5F35A 3DTVB 2QLTA 4M37A 1AS2A 4WBSA 1IUNA 4PQEA 3N76A 4Q1FA 4X1YA 1BYUA 5LKRA 1FNCA 4ZIRB 1LLDA 2ZJ5A 3BZBA 2Y2UA 3EGXA 4PCAA 2HJWA 5K4AA 1EB9A 1ZI6A 4M1SA 1M2JA 2XH8A 4X41A 3VVBA 2ZSJA 4BNWA 1GTVA 3E9NA 2AR0A 4MDFA 1VJ1A 1CZOA 4FOLA 3E2PA 1BSVA 4INJA 2R6FA 3M7IA 5A6VA 3GPLA 3KZVA 4W7SA 1SD5A 4KE6A 1RWQA 2HV8A 2NUAB 2C9YA 3UHOA 3GJXC 2GQ0A 1AOXA 3C6YA 3JALB 4H35A 3RC3A 3FNGA 4GG1A 1W1UA 4BJ3A 4J43A 4GMHA 5BXYA 5C4IA 2RI6A 4KE9A 1XK6A 3PGXA 1J6UA 3ETLA 3QFFA 4K46A 4URYR 1C1HA 3WXMA 2WUGA 3IUMA 2PS1A 5JNUA 3KXKA 2CCJA 3L0YA 2VAWA 3K0BA 2XUZA 2GCOA 4EARA 3QU5A 2Q7OE 1T1RA 2HPZA 3DCJA 5ICEA 1V4VA 5TJHA 1P2SA 4DIKA 4KN5A 1BCRB 1OA0A 1X9IA 2WYHA 2ZYDA 4INZA 2OM2A 2DVMA 4KN9S 4NBKA 3DV9A 4AP9A 1AS0A 4J7AA 2E7ZA 2XDQA 2XNJA 3GDGA 3EARA 4I8IA 2AG6A 2JI7A 4ZHQA 4AQYB 1T5HX 2CLEB 3IXMA 1CUGA 1UZUA 3CRVA 4RC9A 3V6LA 1OX6A 4MMZB 1S89A 3M4YA 1KKLA 1GXSB 5HRUA 2PR7A 1Z7GA 4KRGA 4TKLA 5JCJA 2JLBA 4Z4FA 5H3HA 1O8BA 6REQA 1ZWKA 4I4TF 2JCVA 1SUSA 2GJ4A 3AKYA 3H5OA 4IKEA 3IX7A 4N6GA 3BRQA 1SXJC 4CTKA 4D81A 2NXEA 3KWMA 1SXIA 1E98A 1O3YA 4MQUA 1HI9A 2HU2A 3AZPA 2ZB7A 3VR1A 4EI2A 1E9BA 4YS6A 2XIQA 2YQ4A 3C7AA 3MBOA 3IKLA 2PQ6A 3FM9A 1N78A 4FGUA 1P80A 1TL7C 3ZE0B 1ZBDA 1XKLA 1X3SA 3RF7A 2D59A 4IG9A 4YAOA 2V8BA 4BRZA 2Q4OA 3KM0A 2QG4A 3CG0A 1Y82A 1ADFA 4JP1A 2ZUVA 1QDUA 2BP7A 2PCJA 3G6KA 4J0HA 1DZ3A 4FT4A 4JEIA 4KGZA 4MQFA 4B3RB 2GF9A 4EW2A 2AZXA 1YS4A 2G4VA 2C78A 1GARA 2DECA 1HZZA 3G79A 2QLNA 4YHBA 1U3WA 3OCJA 4B76A 2EATA 4B1FA 1IXSB 1HTTA 3LECA 1D8TA 3LHIA 5DTIA 2XQJA 5ERYA 4ME6A 4QGGA 3RBZA 2Z08A 1CT9A 2WHQA 3COVA 4LZOA 4PSVA 4TOIA 4EMUA 5ELXA 1DWPA 5JMPA 1JU3A 4FX5A 5E6RB 1E7MA 2X8WA 3FVVA 4U3JA 4DVGA 4PCUA 3GP3A 1XRMA 2XD9A 2FHSA 1H2EA 4BAZA 1HFEL 4KAAA 4BX2A 2YWGA 1X8XA 5K8VA 3C87A 3KKPA 1MPTA 2DTXA 1H6DA 3DDCA 2BR4A 2WOJA 3CONA 3VMFA 1M66A 3WK7A 2A59A 3P2KA 1A5SB 3S2ZA 3QPVA 1S2LA 2A0FA 2QM3A 2WU8A 3ZU4A 1I2DA 1PNQA 2H4WA 2W93A 3AHEA 3QE0A 4LSZA 4Q39A 5I7EA 3WP1B 1IE3A 1WU7A 4RDIA 3OA2A 1C0LA 1T29A 3CUKA 4XDZA 5CYOA 4C07A 1E0AA 4G8CA 2OCLA 2RG7A 1P1BA 2BFDA 4ZT4A 3W9UA 2FEKA 5T64A 1ZCZA 3Q8KA 3GLVA 1E6MA 3TTXA 4BNYA 4KUGA 1Z6TA 3ZDQA 2XUFA 1SU4A 3A4LA 1T0PA 3FDZA 4AS2A 4BO3A 2WTXA 3UOAB 2V65A 5K0TA 2PVSA 3L1IA 5FQNA 4BZZA 4YT8A 2NU6A 2QRPA 4JBIA 3A3PA 3CXUA 2HIHA 4HEA1 1MFPA 1DO2A 4DR2B 3MSXA 3PU6A 3QWFA 1GCIA 2CLHB 2I1VB 2IL1A 4G2NA 4ZDKA 4G56A 3PNVA 2VOEA 5HFAA 4DSUA 1A1VA 1NFRA 1ZJYA 1B3RA 2AYXA 3BEOA 5EWLB 1I10A 4FQ5A 1SC1A 5DFAA 4O4LF 3BA1A 4CLEA 2YVQA 3CRW1 5BN4A 4RLHA 4DUGD 3JD4A 1YJ8A 1GUYA 2JZOA 4DNFA 1NW8A 4GR5A 4RJKA 3P52A 2ZWPA 1R50A 3REGA 4DY6A 5ILOA 1IHOA 4WVLA 1WHSA 1W36D 3P5SA 2YHAA 2QVXX 1LY1A 5AUQA 4F6RA 5TQ0A 5BUQA 1OYWA 2EBHX 1ICEA 4JR1A 2WFZA 3L2OB 1N33B 1U5CA 4MPRA 4PNZA 5DLQC 4H7FA 1YHZA 4K6KA 4ZALA 5GZ1A 2JIPA 3RO7A 3GRZA 5TQVA 3SZLA 3ZHQA 5HE8A 5ALWA 1GGHA 3PF8A 3ZE8A 1QQ6A 4IJUA 2EJWA 3C6BA 3CM0A 4ND1A 1V16A 4YRDA 2IIQA 4WFIA 4IF6A 1ZQ1A 2FSIA 2XNDD 4ENSA 4A6EA 1ZGGA 3KYDA 1FOEB 1R1DA 4NZZA 1R9NA 4JLMA 4QPCA 4ZRMA 3BWXA 4WLVA 5IJXA 3ILYA 5EKXA 3GLRA 3UK7A 3AB7A 4JYAB 4MYHA 4U7DA 1DMRA 3QF4A 3ADBA 2DX7A 2ZJ8A 3NT2A 4IIEA 2A14A 2BWJA 1T4BA 1RRMA 2CDCA 4TTAA 1E5TA 4IX1A 4DBLE 3QEBZ 3HG7A 4N3GA 4XDYA 3T61A 4C29A 1P3DA 5LB4A 4UHDA 3AUYA 4EFKA 2ZANA 1U9IC 3LVFO 5K7SA 2K2WA 1E32A 3SSNA 5HM6A 4H18A 1H05A 3U4GA 4XW2A 4DMMA 5IXJA 2EARA 2AQIA 4PO3X 2AX4A 1Q92A 2DLDA 3DL0A 1GTG1 3OUZA 4DV6B 3U61B 1A69A 4C4TA 2I4OA 1AK9A 1CRWG 1PJLA 4KNVA 5AHXA 1C0IA 1EFDN 1Q0QA 4ZT3A 1PT5A 2HPHA 1QC5B 4FVTA 4GXNA 4MIOA 2DQ4A 3DE4X 1Q3HA 4GBGA 2B0JA 3LVBA 3ROPA 4COKA 4DARA 3HM2A 4WESB 1Q6YA 3TLAA 1NM5C 5BRNA 1QV6A 1YQQA 1QDEA 2ID7A 4OCZA 1JR3E 1NVWQ 4MUJA 2P5SA 3SE0A 2QMUA 3O4RA 3MGGA 1KSHA 5JV5A 2VHTA 2PMFA 1XDUA 1KMHA 2HYDA 5EIBD 4FGKA 4C0KA 3ZDRA 3U5TA 2YDXA 1HNZB 3PL1A 2R97A 2Z6AA 5FBWB 5IVKA 3I6ZA 1Y7HA 4ZHSA 4A1OA 4TX1A 3U60B 2V7UA 4LOIA 2EBUA 1Y3BE 3ZQJA 1J1ZA 2OFFA 3SHTA 1GIAA 1AA9A 2A9KA 2EKDA 3IQHX 4DM7A 3MWJA 4E07A 2WM9B 4RZQA 2J59A 3OHMA 1CY2A 1HC7A 5BV0A 3D4PA 1NG9A 4PGAA 1W0JA 5J1TB 4TUYA 4QC2A 3T5MA 4YQYA 1MVOA 1VE5A 3NWJA 1AB5A 2FFAA 3QLTA 4ESHA 2FLVA 3QU7A 1ACLA 3SR4A 3BH6A 3O4GA 2CBZA 3HU5A 4BNUA 5AJTA 3C98A 3KJQA 4ON9A 4RY0A 4LG1A 5DBGA 5FTJA 4GF5A 1Q44A 4RCYA 2RB4A 2ZP1A 1ZSYA 3R0ZA 3LOQA 2FDXA 3PE4A 2OBLA 3CZ4A 3ZI4A 1UP6A 3Q72A 3L46A 3N87A 3SJUA 1Y3CE 3U7EB 3WHPA 4A82A 8MHTA 2WD7B 1NI3A 3RODA 1XELA 4IZ6A 1XD2A 1IOVA 3JQFC 4Y1RA 2NO6A 3GRPA 3U3XA 5BSKA 1RZRA 5DHPA 3BIXA 2B25A 3EISA 3KELA 2IUFA 1GYRA 1HQCA 1Q1QA 3DUFA 2FVYA 1I2ZA 2WTBA 1T4CA 4RHCA 5B6PA 1EVYA 2DRIA 3RAPR 4PZCA 3N3AC 3LAWA 4JUFA 3EWSA 3ED5A 3FSEA 5CCEA 1OGYA 1RYBA 3FGNA 3RVBA 4GGOA 1M0TA 2PU5A 4I81A 3ZGLA 2FG7C 1WQ4A 4QGFA 3GBVA 2ZRHA 2YVLA 4QTZA 1VA4A 3NAGA 2DKFA 2ZM5A 3ZJTA 5JQGF 5FLYA 2LD4A 1SUPA 3MWFA 2GBCA 2V0GA 3GDFA 4N47A 5GTDA 4AY5A 2O7QA 1VIYA 4IIXA 3FYUA 1UODA 4YACA 1AT1A 5EXSA 5AJWA 4BNDB 5L40A 3O9ZA 5T4HA 2B9VA 3NJRA 4JB0A 4CNBA 2L82A 5DVZA 2R96A 1D8AA 2AFIB 2DP4E 2FTKE 3ZLVA 3CG4A 3UGTA 1MGPA 1L5SA 3O26A 3WGOA 2ZRBA 1SK9A 2Q5QA 1EXWA 3BXXA 3HR7A 4XRRA 5AXAA 3F3KA 4IOLA 1H85A 3MOSA 4MVWA 3R44A 1LS1A 4YPFA 3HDVA 5MFPA 5ALKA 4D46A 1BD4A 4EMTA 2IEYA 4DLNA 3QWBA 1TT5B 1WBDA 3FDFA 3IVRA 5KQMA 2HGZA 2A7XA 1XRNA 1G59A 2B94A 2FDCA 3AUFA 1HNNA 2RHCA 4CCYA 1DNPA 2X5KO 4IDNA 5AOAA 3SE7A 3TINA 1Z8HA 3QP9A 2WINI 3N58A 2F1IA 4L7VA 3LLVA 4HLUA 1DFGA 1P1FA 3K1AB 3CE6A 1EVIA 4I55B 4F5YA 1W87A 3FE2A 3JVVA 4D3XA 1F1BA 1G5PA 1BE0A 3OZXA 4GMFA 1Z38A 3AEKA 4IAOA 2PZBA 1SZJG 2GDZA 3OUUA 3P45A 2O5CA 5A1TA 2IUEA 3CSDA 1J07A 3IULA 1U0SY 1D6SA 3QA3E 1V37A 2F8MA 1E0KA 4N49A 3IEPA 1J0XO 5K0CA 1Q0PA 4I5IA 5BUSA 2Z2KA 4ZO8A 2FX3A 1XZKA 2C5FA 4HUTA 4CKCB 3EAGA 4KSCA 4AECA 5BNZA 2FZEA 1PR3A 2J32A 5KYVA 3V42A 4QDXA 1E2LA 1XXHB 3KBBA 4RQTA 3CFYA 2A2ZA 2XB8A 3CBGA 5H1YA 1C9KA 4I19A 2JIZA 4IXNA 4BJ6A 1Y9AA 3D9QX 3EXAA 1X1BA 3FTDA 2XA2A 3PRJA 4O29A 3RK1A 3D81A 3IDAA 1E2HA 2BM8A 3K7EA 3ZI0A 2UZIR 5LL6P 1I3OA 4WVFA 1XKQA 1XOIA 2XCLA 3N8DA 3FPSA 1JN0A 3EAFA 2VDWB 2GTIA 3JZMA 2PRZA 1RAEA 2QJRA 4HSGA 5FF9A 3W04A 3P2MA 4DV1B 2QX8A 4A8HA 4ZO6A 1QUFA 5KX5F 5ICGA 1UP7A 2AZDA 2YNMC 4UDOA 4UNQA 1FXSA 1M7GA 2FWAA 5FWAA 2VTBA 4UXIA 2AWOA 2P27A 2R00C 1OH5A 1AB6A 2VP0A 3KUUA 4O4HF 3DLBA 5JO0A 4IOJA 1B93A 2FEXA 1CY4A 4WJZA 1FXWF 4HHEA 3RS0A 3TZQA 3IOBA 3HO1A 3G2OA 4JNCA 3LCMA 4Y7DA 1CK4A 3VO9A 2I62A 1F2DA 1NRXA 3TOZA 1XZEA 4G89A 1IXKA 1OBCA 2ZTVA 1ZY2A 2O2HA 3DMNA 1ONSA 4KH1A 1TM7E 1USUA 5KJ6A 2AVDA 4B4WA 1FP1D 1NYLA 4U2GA 5B7GA 3LXUX 3VZDA 3F8WA 1K3UB 3U16A 1MA3A 1D6NA 1T3LA 4YAIA 1YUNA 3R4CA 4YT4A 3WKAA 5JS7A 3TPZA 3KJXA 6CHYA 1M0EA 5AKLA 1QF6A 3HCDA 1B7GO 1C14A 3C45A 1R9GA 3JQ9C 4O25A 1IIRA 4M1WA 1SEPA 2QR2A 4UMDA 1FYEA 1JLSA 2QVYX 5LMNB 2OGUA 4C89A 3FTQA 3NALA 2C9CA 2EIXA 4CM9D 4OMCA 4GR9A 5BQPA 4DIOA 5KX5A 1LH0A 3SIPA 5BMOA 4WN9B 4NU5A 4KQ2A 3T5DA 3WA7A 4YI5A 2BEKA 5HIJA 4MRMA 5G1NA 1IMOA 2X3UA 3HKDA 1EHYA 3O4FA 2QTGA 3QYAA 4JGIA 4PAWA 1HYGA 4O4HA 1O2DA 1F8XA 1N6OA 3E1KA 5I5GA 3RFXA 3O4HA 1NI4A 3SQMA 2PRIA 5EG5A 4ACAA 3QE2A 1I0IA 2DOKA 5JI3E 4Z49A 2P6UA 5JFTA 2F1HA 3MFYA 3CF0A 4WJKB 4BCCA 2ZRPA 2FKAA 3FX2A 5AW0A 2O8FB 1ZJWA 4BFLA 1I6MA 2FMKA 2R4UA 4F0JA 3C3KA 3L8CA 2WOOA 1GPBA 1FUIA 3LO5A 3KUDA 4LPKA 3WRXA 4F3CA 4B7ZA 3CZAA 1FDUA 4KLNA 3T3NA 3ZV7A 4IXMA 1O4VA 3GJ8A 4HVLA 3KOYA 1EA5A 1E8MA 4B6EA 2WMYA 3GGSA 4OY3A 2BJWA 5DNVA 1H1LA 1WSBA 2XADA 3ENWA 1FFDA 3FYSA 4RZIA 1EVZA 1QVRA 4YCSA 3EZ6A 3U2QA 3PFBA 3HA2A 5EN4A 1JEQB 2W48A 2V5UA 4EW1A 3JRXA 3W8RA 5FLXA 1RP1A 2QRVA 1W5TA 2X2FA 5KC8A 1HDCA 3JD0A 2BFCB 2Q1WA 5FEMA 2C54A 3EWAA 3PQCA 5K0NA 4DC0A 3L40A 1DAPA 3I34X 3PDJA 5J2UF 4Y8VA 3Q3CA 2XW6A 3C5EA 1ANKA 4Q9KA 1E6LA 4G8JA 5FQOA 5TX7A 3NVKI 4RY8A 2C2BA 3H87A 5B1YA 1L4BA 3UYKA 2P4HX 4OYLA 4RLQA 3PQ5A 1KVQA 3JD2A 4FT2A 2WW8A 3ILXA 2YDYA 3G2PA 5H83A 2HXYA 2XYGA 1Y7IA 3CNQS 5KU7A 5BVHA 1B1AA 3EWNA 2Y8EA 4GI2A 1TCBA 4TLAA 1JPNA 1WCIB 1K89A 2E89A 1NU6A 5E3IA 5G40A 4DY4A 4PRLA 2JNWA 2GN2A 4BNTA 4UMFA 3VDRA 2IK8A 3A37A 5CD1A 1X7XB 3I45A 4ARSA 1YU6A 3D59A 3O8LA 1MQ9A 1OXTA 4U7JA 3WKBA 1NVKA 1SD1A 4QYXA 3HU2A 4KB5A 4F8EA 4YYEA 5IKMA 1A4RA 1AZTA 1LJLA 2NGRA 4UMVA 2FZCA 4BKRA 2ZPTX 3UCEA 3I5AA 2GAJA 3T4XA 2YOGA 2ZVJA 4IDAA 4E2FA 3OCZA 4HB4A 3JD3A 5ANRB 5H7XA 2SCUA 3GROA 4BE4A 4I66A 2PS9A 3Q2OA 1ZAYA 3CSUA 4YUAA 1SU8A 3I5XA 3PHCA 4FBMA 2CLMB 2H2WA 5CIQA 5LXTF 3B2EA 2KWIA 1K3TA 1IY2A 4WZAA 4ZYZA 1ZCFA 3ODGA 2D0DA 3RRBA 3ZCTA 4QEDA 5L3ZA 5J2UA 1T8TA 3G68A 1RJDA 1RJ9A 3S1AB 5KNDD 1AS3A 3D6AA 3GRVA 4DMLA 3CF6R 5AK0A 3AFNA 3K1ZA 1R66A 2B6HA 5KVQA 1PEAA 1UZNA 3P97A 2BCEA 5EZSA 3T3PB 1XQ1A 4N40A 2ZE5A 3CUTA 2B2NA 3VJLA 4MW4A 3SI7A 4C7OB 2CNKA 2P9YA 3EGVA 3RT7A 2O5VA 3PWZA 3D3JA 1QV7A 3EASA 3L6OO 5CH3A 4AO6A 1DJPA 1D2NA 4DNPA 2XCTB 3H2GA 3W2EA 5BO5A 3KQOA 4OQLA 1OAKA 4RF5A 2JARA 4F7DA 1JGTA 4XAQA 3U62A 1XZ8A 5A6SB 5C35A 4LDZA 1TM4E 2XI4A 2G0TA 3M49A 4LDNA 1TNDA 2C5SA 3GFQA 1HSOA 4LOLA 4LOAA 1PV4A 2BSAA 2GHRA 2Q8NA 4OO3A 4Y2HA 5CLQA 3TBHA 3AIOA 4DBVO 1T25A 1TKCA 2BL4A 1XA4A 1N32B 5JNSA 4F4CA 5G3YA 3K35A 1AN0A 3X1DA 4QREA 3PQ7A 4A36A 3ACCA 4J0JA 3IAEA 4E03A 4E5DA 4ND6A 1JZSA 3DEHA 3KJFA 3U19A 1UFQA 1XX6A 1ORDA 5C8YB 2ODEA 3EZXA 1V1RB 3SR3A 2C2XA 3G8CA 4KQGA 5K0ZA 3SEZA 1TC1A 2A4KA 3PF9A 5CITA 5DNDA 3AEZA 3HKEB 2GJSA 4Y1GA 5HKLA 4DCUA 4BVEA 4DG8A 5LYJB 3TGWA 3TL6A 3OQHA 1OXMA 1ZUIA 3GEEA 3ITDA 4XJVA 5CEEA 5L4LA 4UHFA 1UBOS 1JFFA 3K0FA 1I4TD 4XIJA 3PD0A 4J1TA 5T5QA 5C7OO 3TSWA 2GPJA 5DW0A 1MAVA 4QECA 1MEEA 5FD8A 1KYZA 5DCYA 2X86A 3ESXA 2C3UA 1C4XA 1IVYA 1OIVA 3D1LA 3B78A 2FN3A 4YJFB 4BVLA 1R12A 5DZSA 1T9CA 2C03A 3HBFA 4D6PA 4UFPA 4HNTA 3LDAA 1VHQA 2Z5LA 3LKBA 3ZYZA 2HF2A 3EMVA 3TDKA 3UAWA 1SHKA 1W6RA 4WFQA 1U9ZA 4DG5A 1Y8QA 4Y6QA 1WMBA 2G9ZA 3NVDA 4LXIA 3FOZA 3H5RA 3ZLJA 4KXWA 5EIFA 4H0CA 4IM7A 1BHQ1 1TU3A 3EQ2A 3G02A 5ENZA 1JYEA 2XE4A 1XEXB 5TEWA 1Z56C 1ZGJA 4R2MA 1BXGB 1HXHA 3R5JA 2B4RO 1YOVA 1K4MA 4F46A 4O2BA 2O8NA 1GRNA 1X14A 4YCJA 3O0DA 3LQYA 5DK6A 3LGAA 4UATA 3HYLA 4KMRA 4D43A 2PD6A 3OFVA 2W0MA 2HTEA 4KOAA 2W70A 4LQCA 3A05A 2VDNB 3IVCA 3O1HB 5DT2A 5DGXA 4FN5A 2DG2A 3ADDA 3B7GA 2WWVD 3AWDA 4DMFA 1J23A 4BMNA 1DPGA 2H2IA 2RMKA 3AI7A 4MNTA 4RO0A 3TL3A 3NW9A 3QVKA 1J33A 3SEQA 2XTJA 4JLKA 1G9XA 1IQ0A 5SYNA 1N5IA 2ZSAA 1GNRA 3F7OA 3LXMA 3R3UA 4PEVA 5JD6A 4OI2A 1UK9A 3PEWA 2GM3A 2ZW9A 4QJIA 4OK5A 1VYTA 2OECA 1C9EA 5L7YA 2RBKA 4ZVNA 1N2CB 2AEEA 1FNDA 3BB3A 3OQPA 4PZZA 5FFFA 4LGYA 1S3FA 2I6TA 3T7KA 3HYTA 3GK3A 2W6JA 2PZJA 4QFDA 2BYTA 5DTQA 1P2VA 2XYPA 3KQMA 1OILA 3ICQB 5DM70 3BTSA 4MUNA 3TQFA 1U7TA 1XPOA 2W5UA 2Z98A 4N0PA 2AGVA 3AFHA 3GMSA 5IM5A 1KAOA 2YOHA 3IR6A 3QOFA 1L1EA 2PGLA 1O94D 2WJIA 1O95A 3MXOA 4Y2XA 1NV8A 1E1CA 2A1IA 5JY1A 4GO1A 3LHFA 3TLCA 3G17A 1RFLA 2G63A 4WEOA 4RORA 3B6EA 5JZMA 1QBKC 3NEYA 3ZEAA 3GAFA 1Y5MA 3EDCA 5AVJA 3VPDA 3EAQA 4DMRA 3ICEA 1UZLA 3HRKA 3TNYA 4YAWA 1ABEA 1S4QA 4GI1A 4N0MA 3O90A 1RRPA 1LW7A 1Z5VA 2CLDX 3BE4A 3EGWA 1HLGA 4ZZ2A 3AX6A 1G291 3BG5A 5HTKA 4D41A 2H65A 2DF8A 3JYPA 3TOSA 4BFSA 1QOQB 2A9FA 4DTIA 1WOMA 1T2UA 5U1PA 5BY2A 1VLMA 2YH2A 5AVWA 4QOIA 3CIFA 2A86A 4GLBA 2YWHA 5JXGA 1ESZA 3BL6A 5LZ7A 4YRSA 1Z06A 1Q14A 3WWZA 1ZI9A 3KAQA 3STWA 5EFZA 1Z0AA 1UFOA 1POXA 5LSAA 1TUBB 3ZEIA 3U4MA 3DBRA 2JHGA 5IHPA 3TW8A 4MR8B 4XARA 2D8MA 3DKPA 2VT2A 2IYQA 1M8FA 5HJ2A 2BFFA 1O8CA 5DSXA 5BQ3A 4EB8A 2W2KB 5E9AA 1SG0A 4MKFA 4CKBB 3TK1A 2ON6A 1BFKA 1FDIA 2B1QA 4FI3C 4QWMA 4F5WA 4KITB 4D3YA 4O63O 3CMMA 4R4JA 4RSMA 2ORIA 2WAYA 1C3VA 4IGKA 5I9SA 2V3VA 1F6DA 1LEHA 1D2GA 3FFAA 4BLPA 2WMNB 2YHBA 2G7ZA 2ZRNA 3MD0A 3QEKA 5GAJA 2I6QA 2VSXA 3EUFA 1PK9A 3N6RA 4EFLA 4ZPXA 3RV4A 5KYWB 4I1YA 4YALA 1WZCA 3R7NA 4B3TB 2HYIC 2QORA 5EY5B 1N2BA 3H2YA 3MUNA 4O0LA 3H2JA 2AXPA 3Q6NA 4JJAA 3WAJA 1KO5A 1X2BA 4ABTA 4CG1A 3BIJA 3M6IA 2BGNA 2ETXA 4MVXA 4A10A 3K6SA 3PWTA 3TH5A 3A58B 4L5YA 4TGLA 1A7JA 1P2TA 3IVXA 4YIKA 4GH5A 5DX8A 1MQ8B 1Y6FA 3T7TA 1VCNA 5FPQA 1NZFA 3OJWA 2G70A 3BIFA 4G9GA 1DQRA 2J46A 4FR2A 3GQBA 4AZ0B 3QKRA 3EXFA 1Z4OA 1EUDA 5EUMA 1CX9B 3M2PA 3P9CA 5JCXA 4DV2B 3DQQA 5CLIA 3TSCA 1GY8A 1XR3A 2VHVA 3QYJA 4TTRA 1MB0A 2H48A 2H11A 3NUZA 3SC2A 3KUKA 1ZMTA 4TZ6A 1U02A 2PJUA 4TKVA 5TJ9A 1TKRA 4PZDA 1KO7A 4NZMA 1XZFA 1TVKA 2JDIA 3L1KA 3GN2A 4LE1A 1VL0A 3HLKA 5E2IA 2VJAA 1KSGA 4BNNA 3G2LA 1DV1A 1D3AA 4R9UC 3VZRA 3C0KA 5KOJB 4KG7A 1G4UR 2R6GA 2QUKA 3STUA 3X44A 1EXMA 2IIPA 1T9AA 4U7HA 1SBHA 1TLLA 2C2YA 2GZHA 1VI5A 2Q6TA 4B6QA 1UT6A 1E6WA 2EZ9A 4QAJA 3W9BA 4BO8A 4DA0A 1WDMA 2OBMA 2YW2A 3A26A 2QLJA 1J9GA 1M0WA 4KFTA 2J5QA 4DLAA 4CL3A 3HI6A 4E2WA 1FU8A 1NNLA 2Y9PB 4BFWA 3FWNA 1G3QA 4GX5A 3T7SA 3FKSA 4MV5A 4EY5A 3LCRA 1E79D 2BZ0A 2I3GA 3ZWKA 5J4VA 3AWIA 4ZZ0A 2MT9A 1UEJA 4L08A 4ZXPA 3EJWA 4NULA 2QPAA 2HRQA 3BD6A 4S2UA 1FMJA 1N3YA 1K6XA 4WXYB 4RUKA 5AHWA 4R2HA 2BEWB 3GLGA 4I1PA 4JB8A 1NIPA 4Y18A 1SXHA 5J63A 4L6CA 4DFDA 3ZGOA 1D4OA 4EA7A 2JL1A 1E69A 2DSTA 3USZA 1UOOA 2XYQA 3ER8A 4AAYA 4DZTA 3GOHA 1MDBA 4NYJQ 1WUJS 4ENRA 2AFHA 4JL8A 4GXRA 3KKKA 4K3UA 2WIJA 3FI9A 1JLLA 4A27A 3BF7A 5A9RA 1KY2A 1YSCA 4JBHA 1VHLA 2GK3A 3EZFA 2FP3A 1XTRA 3PHIA 2W8ZA 5LBTA 4F97A 5FX2A 3GEIA 2J3QA 3GH1A 3LCUA 3T1QA 4IDHA 2CDNA 3VZSA 1K7SN 1XSEA 2R48A 3SPXA 1EUCB 2FQWA 5HXAA 3MJRA 1OVMA 3PPXA 5DHQA 3TR0A 3I62A 3T54A 1WD7A 2QMYA 2BHRA 3FSGD 4MITA 5D5PA 2BFAA 3QKSA 1MOSA 4D9CA 2WUVA 1U0HC 4P98A 1TEHA 2ACEA 1Z5PA 4MEAA 4XR9A 4LX8A 1OWPA 4FJ2A 1GQ2A 3QGMA 1GADO 2H4FA 5AM5A 3EZ2A 4JLJA 2V1XA 4M87A 1G8GA 1Q84A 5DNUA 5EA2A 2HCTA 2R68A 3F7NA 4E5SA 4FKZA 3O91A 3UJ8A 4CEHB 5DHFA 1BHSA 1Z2NX 3FDIA 3H04A 3H3XA 3V55A 1WU8A 2WWIA 3FRIA 3B9RA 5HKKA 3OE7A 3KB8A 2WHPB 4GZ5A 3RADC 4QU8A 1W581 1J8DA 1EH5A 1B0ZA 1NDQA 5LBIA 4BZQA 1YB6A 4KVAA 1XO1A 2Q0QA 2A9VA 2VATA 4ID9A 4ALLA 2OB2A 3TLGB 4Y2YA 5SY6A 1GEEA 4RTJA 1IN1A 5A7FA 3DTVA 2C2WA 1R0CA 2ZVPX 3QUAA 3ZIAA 4L27A 4ZIRA 5LIRA 1I1HA 5EIWA 1K66A 1Z37A 1ZK1A 2C4UA 1GPWB 5J23A 1EFRD 3I9OA 3I83A 1SMKA 2HA3A 2XNSA 4HG2A 4MVJM 3FZYA 4OK6A 2C58A 1I7LA 1Z2AA 2ZJ3A 4L85A 5COBA 1E2KA 2Z3VA 3LPAA 4C7MA 4G1BA 2NUAA 3GRKA 2BAGA 2PO5A 4FFVA 5INTA 4D8UA 3CCBA 3GGJA 3DE6X 4BRUA 4HLDA 1NKSA 3JALA 1K08A 4JKYA 4QODA 4A5SA 2F3TA 3DBLA 2AK2A 4FC7A 4PFSA 2YRXA 2GESA 3HJTA 2FN8A 3OLCX 1A76A 1NSYA 3W5AA 4RSGA 1NF9A 5AKGA 2YFQA 3PT9A 1Z12A 4EPWA 3O8NA 1OD6A 3MWGA 5KINB 2I33A 4J7UA 2ETVA 1RPJA 4H27A 4HH3C 4DKJA 2IH5A 4WDRA 1JHRA 4K0RA 2W7TA 1LSUA 3D54D 4ITVA 1N34B 3L06A 1P2UA 4R69A 3AB3A 4MJLA 5FBRB 3E2MA 3NFRA 2QMEA 4FMCF 4IIJB 2EW2A 2VK8A 1N2ZA 3QLUA 4NICA 4BBZA 4CCSA 4B6RA 3ZLTA 1BCRA 2V4MA 3EY4A 4KQEA 1VPWA 2W00A 1FMFA 1RBYA 1RYZA 2ZYSA 3O2SB 4N0QA 3IQXA 2WY2D 4KW7A 1QTIA 4ZVKA 1UL1X 4DC1A 3ZJVA 1P9RA 1NW9B 2B8JA 3OY2A 4LECA 3KSBC 1Y8ZA 3FVWA 5B64A 1GRQA 2IDKA 4V0MA 3DXZA 2QJWA 1ETUA 4PLPA 1E2NA 2YY6A 1RAGA 3GVPA 3FZEA 3K9GA 3TUIC 3GJQA 4BFVA 4D8YA 3DOFA 4OXRA 2FPSA 4JBXA 3DAFA 3ICPA 2GPBA 2NSHA 5GV8A 3GU3A 3T0GA 2P1RA 1C9YA 3GA0A 2QW0X 1QH0A 1QB8A 3IALA 3P27A 1DAHA 4UBNA 3WI7A 5KTOA 1RNLA 4LYGA 1LQTA 1QNFA 4PLVA 1PBTA 2VHXA 2CNDA 3NPMA