2Q3HA

The crystal structure of rhoua in the gdp-bound state.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
171
Chain Sequence
GVKCVLVGDGAVGKTSLVVSYTTPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLLAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of RhouA in the GDP-bound state.
rcsb
source organism Homo sapiens
molecule tags Structural genomics
molecule keywords Ras homolog gene family, member U
total genus 60
structure length 171
sequence length 179
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2q3hA00
5AUOB 4L5BA 3LBHA 2V54A 1R0ZA 2IWRA 3IDQA 3EIEA 2QY9A 3U7HB 2MMCA 1GOTA 1ZINA 1GRQA 2DB3A 3ADDA 2CLSA 4OK5A 3A58B 2ZEJA 4HLUC 4EQ6A 1N6IA 2BHRA 1QBKC 2HV8A 1KSFX 2BDTA 4G5GA 1S9HA 4OI4A 4AURA 1VKJA 4KV9A 1G7SA 2FPKA 1II8A 2WPDD 4JKIA 3UATA 5FFMA 3A37A 3DOEA 3MG9A 4W9MC 3SHFA 3L8ZA 4OKSA 4PX9A 1H8EA 1KHTA 3MMPA 2WKPA 1XZPA 1NG1A 3B2EA 3BXZA 2H5EA 1G8PA 1KI8A 4Z8XA 5FPSA 4A8JB 1US8A 1YHNA 3KZ1E 2XJ4A 2ZYTX 5A5GA 4I1OA 2YV5A 3CRMA 5FPTA 1N6LA 1Q44A 2PEZA 3FHOA 4RFSA 1G16A 1JXMA 4LHWA 3U6BA 2ZJ8A 4BPBA 2BBOA 5D3QA 3D7MA 4DEXA 4DLXA 3CIOA 3TJZA 1V43A 2ZPTX 4M1MA 4URYR 1YQTA 1ZVQA 1DVRA 1JECA 1ZNXA 3M0EA 2DFNA 4RFVA 2IYTA 5TV2A 4L15A 2QTVB 3IHWA 4M1YA 1TQ4A 1M1YE 2H1LA 1LFDB 4F91B 1YR6A 2EU8A 5FTLA 3R7WA 4M1SA 1FTNA 1KZ7B 5B2ZA 1R5BA 2QTHA 4TTPA 4GOXA 4MRPA 4HB4A 2WKRA 1P9RA 4EIWA 1Z0IA 4PSAA 3B85A 4LJ7A 4E03A 3N70A 1E0SA 1NVUQ 3U3RA 2CEAA 4B47A 2EFGA 3BB4A 4C0SA 1W7AA 4Q1AA 2Y8EA 1U81A 3BFKA 5CLLA 1NY6A 1IY2A 1D8TA 1G7CA 3H84A 3OIWA 5FTMA 4EPRA 1WRBA 1KO8A 2W2XA 1ZAKA 1QHHB 5AR1A 3FHCB 4G5QA 5DSZA 4GP7A 3ZH9B 4DHEA 1WB9A 4NCKA 5HE9A 4TZ6A 3AF3A 3EIQA 5FBWB 1XXHB 4HAUA 1PUJA 2ZI9A 3TSOA 2WSSA 3FMFA 2FDCA 1G6HA 4KLNA 1HQYE 3BH0A 3TVDA 4Z54A 1YZKA 2NGRA 1NY5A 4JL8A 3TW8B 4JIMA 4AKEA 4EPWA 2BM1A 1KKMA 1G5TA 1FNMA 3RLFA 2AHOA 3VX4A 1MRSA 2AR7A 3NH9A 2H57A 3AVUA 4PQYA 2ONKA 1NVVQ 1P5ZB 4IEIA 4PQRA 4WZ6A 3K0FB 2V3CC 3M1IA 4M9SA 2JDID 4C4PA 1AS2A 3CWQA 4TSFD 3RS5A 5DE3A 1MO4A 3OEHA 5FOWA 4EFMA 4LRWA 5FUXA 1NBMD 5FOUA 1LS6A 2H8KA 3ADCA 3W90A 4ARZB 1RC8A 4YQFA 1BH2A 4TMXA 2XEXA 3QEJA 1XNJA 3RRZA 2CLDX 1DS6A 1G291 1MV5A 2PCLA 3ONWA 1D9ZA 3HR7A 1AZTA 3LH5A 5L3QB 2C9YA 4YMTA 3U6KA 4DCTA 3A1VA 3QF4A 4IDNA 4IKEA 4LJAA 2B7BA 4JYBA 3TAUA 4BZQA 3OF5A 1IONA 3FKSA 2E1RA 2WICA 4WZAE 1TX4B 5AWFC 4Y0AA 3ZDQA 1E6CA 1N6KA 5E95A 1WE2A 4PHTA 3RS3A 1CXZA 1F2UA 1OIXA 3KTAB 1YZUA 2OCYC 3CX8A 3LO5A 4F38A 3DZ8A 2W6JA 1F3OA 4JVLA 4PHHA 3G5UA 3VU9A 3KQNA 3BBPA 4YDHB 4URZR 3Q9LA 2DFLA 2W0MA 1CR4A 4MYCA 4KHZA 1ZM3A 4FCTA 2YOHA 4H1VA 2VP6A 2VTKA 5FOSA 2OFWA 3VU9B 3ICEA 1VMAA 4TMZA 5DISB 2VH5R 2O0HA 1UKYA 3KXLA 1FMLA 3IBGA 4IVQA 3K70C 2ZR9A 1JR6A 1OPXA 2J7KA 2D4HA 3A36A 1L4YA 1LW7A 2D06A 2ZI3A 3QKTA 4QGAA 3BORA 1FUUA 3TGPA 1BO6A 1YJ5A 2QEQA 1OH6A 1XDBA 1G41A 1D9XA 2FFBA 2BEKA 1EK0A 1FW6A 1N0WA 5JHHB 3T5DA 1T3SA 5CM8B 2CMKA 4BZPA 4D25A 2JJ2A 4KJZA 4QNRA 3TUZC 3ZLJA 3G0HA 1F6BA 2V9PA 1K5GA 721PA 2OLKA 3FGNA 3AVXA 4KO8A 2AD5A 1TU4A 3KX2A 1YZLA 1DAEA 3BWDD 1DTSA 3N2EA 2ZRCA 2N1BA 4EDHA 1YVDA 4V02A 3T34A 2OT3B 3V9PA 3EPJA 4ABYA 2FSIA 3DPUA 3MGCA 1R4AA 3SYNA 3ZD7A 5D3MB 1UKZA 4C7OB 1YR9A 1UEJA 4LJ4A 4AI6A 4DUGA 1W2HA 3A1UA 1XCMA 1G21E 3ZGXA 3VKGA 2Q6TA 3KFXA 4KODA 5KSPA 5FL3A 4B48A 3CB4A 2BMFA 5A0FA 3B78A 1EX7A 3BD9A 2QMUA 2J87A 1OKKA 2XX3A 1OB5A 2W58A 5ANRB 1T3LA 1NL3A 1QG4A 5GJBA 2JATA 3T35A 1OV4A 1JR3D 1G8FA 2J0UA 1NP6A 1SGWA 3CONA 3K0EA 3WBKA 2FFAA 2GF0A 1AGPA 2CCJA 1OFTA 2Z83A 2NO0A 2L0XA 3H0KA 3EZFA 1LF0A 1OJLA 4HDOB 3DHWC 1G19A 4QFMA 3PG5A 4ZI3A 4NONA 5FR1A 2GESA 1GKUB 1ZM7A 4HSEA 1XCGB 2D2EA 4M8NE 1T6NA 4A92A 1PLLA 2OM2A 4QKQA 1E94E 3D6TB 1FX0B 4FMCB 2DWOA 2ZSDA 5H8WA 3KKPA 5CDFA 5E7MA 3L0IB 1JNYA 4GMDA 2O0KA 1JEEA 2VHJA 4PPNA 4XJXA 1Q3HA 3PFIA 4Q1EA 2CK3A 2IC5A 4DEYA 1NVVR 3BGWA 1HH4A 2VRWA 4AWXA 1XMIA 1RE0A 1HQCA 2OAQ1 4LJYA 3PEVA 5L3SB 2IF0A 3LW8A 5EXTA 4DKXA 4Q7KA 3PITA 5DYGA 1H65A 1SHKA 4XVQA 1J2JA 3Q5DA 4TMKA 1IAQA 5K8IA 2BOVA 1XMVA 4I1SA 1PVOA 3VNVA 1HURA 3D3QA 4Q4JB 4OI1A 1TNDA 4KFSA 2QPAA 1Q57A 3KB1A 4RCZA 4OI0A 3NDPA 1TQDA 3VHLB 2ODWA 3A1SA 4ARZA 3RS2A 1E0JA 1VDZA 1OFHA 1QZXA 2VA8A 1IY0A 3R9WA 4KVAA 1HT1E 1KZGB 2HF9A 2ATXA 4TYNA 1XEWY 5L3VA 1SULA 2BBTA 1E4YA 2J7PA 3LVRE 2A5YB 1RFLA 3GD7A 2H17A 5GVSA 1VIAA 2JGNA 2R65A 4JLKA 4PR0A 1P4SA 2YC2C 4W7SA 4BUJA 2CLCX 4NYJQ 1QHHA 2V7QA 5JS8A 3IKJA 3Q85A 4BFTA 3VR5A 3F8TA 4ZDKA 2XZLA 1DARA 3DOFA 4DLTA 1RRCA 1JR3E 2IF2A 4TQUS 1CBUA 4TLBA 1C1YA 3IEVA 1ZD9A 2CHQA 4QOSA 4P4SB 5EP3A 4Z1MD 4CT4B 3AUYA 3EC1A 4QGGA 2QAGA 521PA 2GCNA 3AP2A 5DIFA 1DAKA 3PUVA 4IXMA 3C16C 4LHZA 2B8TA 4XVUA 1T5LA 4LHVA 3SQWA 2IXEA 4DLVA 5FUYA 1KIMA 3QVVA 4MITA 1W5SA 4RD3A 4BLQA 4NCNA 4FWTA 4LV5B 3U5ZB 3GLGA 2GEVA 1P3JA 1KMHA 1O3YA 2X1VA 1OXSC 2G9NA 4R7ZA 2JLWA 4L4UA 3SEAA 5IDVA 5BN3A 4FCVA 3ZQ6A 1TEXA 5JSZB 2ZROA 2IYRA 4DSOA 5FPKA 1TPZA 1KGDA 1UKVY 4KI0A 3GJ0A 5C18A 4OI2A 1Z47A 2QM7A 5KTYA 1G18A 2OESA 4Q4AB 1Z3IX 1EX6A 5KDLA 3RHFA 1VG0B 3IQXA 5DGXA 3AKCA 2ZJOA 2MMGA 3WMFA 4BLOA 1NN1A 4JLDA 3QEOA 4DLRA 1EWQA 5JCZA 3GFTA 1ZUIA 3SJZA 3VQTA 1T3HA 2ZAMA 3Q72A 5DHAA 1II9A 3E1SA 1JEDA 1M74A 4AYWA 4DLSA 3E70C 2C95A 1GAJA 2FNAA 3OIUA 1GFIA 3KKNA 1F60A 1VYVA 1SXJB 3KKQA 3THOA 5H70A 3Q5EA 4HB2A 3RWMB 1E2FA 3Q7PA 1RYFA 2IBMA 2Z6VA 4HDCA 3UMRA 2JLZA 1NMZA 1DO0A 1XTIA 4DT1A 2XXAA 2GDJA 2BKEA 3QF4B 3TKLA 5AJZA 2YOFA 2ZUDA 1NNEA 2QAJA 4QHYA 5C46F 2WTUA 3VNUA 5EE1A 2I4IA 3M6AA 2ODNA 3R8CA 2IYXA 5KDOA 1YE8A 4A6PA 2AX4A 4MDEA 4JZKA 4AKHA 2FZ4A 4ZDJA 5J4HA 3CPHA 4HATA 1W49A 2W83A 2WOOA 1R7RA 1TAGA 3K0AA 2FX3A 4LUCA 4WXPA 4Q7MB 3QPUA 4TL6A 3IPYA 2O52A 1XTJA 4V0OA 1OIWA 2LKCA 3TBKA 3K70B 1M6NA 5DI3B 1KO5A 4AG5A 2FEOA 5EXSA 2HT1A 2A5GA 2AK2A 1NJFA 2JJ1D 3ZS8A 1R6BX 421PA 2EFCB 3X1WA 4A8JC 3LY5A 2FMXA 3I62A 2REOA 2Z43A 2BMEA 2KE5A 5H1YA 4QRHA 3EA5A 4PZYA 2ZI6A 4US1R 3TNFA 3VR1A 3SS8A 3ZD6A 1E99A 4LDJA 3L0SA 3LAWA 5CYPA 5FBLB 2GAAA 5JWOA 2B6HA 1IM2A 4IOKA 2GNOA 1UAAA 4HAZA 2QRZA 1MKYA 4HLCA 4A0HA 1XCPA 4FIDA 4KYUA 5EJEA 3THWA 1CJVC 1ZC4A 2CJWB 4GI7A 1W0KD 1X8JA 2FFQA 2ZRPA 1NF3A 2ZJ2A 2JLQA 2AXNA 2GRJA 2XSZD 2ZRMA 2VHCA 4LJ6A 4M2LA 1QVRA 2EQBA 3C14C 1OXVA 4Q66C 2ECKA 2IEYA 5TVKA 3C15C 2GTPA 3PVSA 1FNNA 3KXIA 1YR8A 2JJ2D 1MR3F 2OFXA 1RW4A 5JECA 1Y3AA 3L2OB 2C99A 3ADKA 4XVRA 1ZCAA 1G7RA 1G7TA 3CRQA 2ZYVX 5CIWA 4CF7A 4M9ZA 4QBFA 1E2NA 3JVUA 1ZIOA 2W2VA 3GEEA 2H92A 5LBIA 1ZIPA 5CB8A 4JVSB 1ZYUA 4MKIA 1GIAA 1QVAA 3KJGA 1NIJA 2DFTA 3FVQA 2VSOA 1E2LA 4D2IA 2QP9X 2ZI7A 4RCYA 4LYFA 4D4JA 2XJ9A 4HLQB 3U3OA 4LBWA 2CE7A 4DIEA 3RS0A 4DCUA 1VYTA 4Q7JB 4OYHA 2NO1A 3CF6R 3SDZA 3CPJB 1U2RA 4B3CA 1HY3A 1H8ED 5FBRB 3SJBA 1IY1A 1E9AA 4S2EA 3SBEA 4L16A 1ZW6A 3A1WA 4TWZA 5IF9A 3QSYA 2ZRGA 5DO9A 3GFPA 4R2HA 1NN3A 1BYUA 1GUAA 2AKAB 3F0TA 4X8HA 1UDXA 2N46A 1Z07A 4OK6A 2JIZD 1R2QA 1UFQA 4OQXA 1AA9A 2AK3A 4FI3C 1GL9B 4LBZA 3DM5A 3I32A 1M7BA 4Q47A 4B2PA 2X2FA 4OK3A 5JMTA 1U9IC 2ZYWX 2ZM5A 1Z29A 4TTRA 2Z4RA 5AJYA 1EWRA 2VP2A 4Q18A 3U4QB 2EWWA 4M1KA 3W8NA 1CR2A 5BN5A 3WMEA 5F2EA 5FBQB 3SJAA 1OXXK 2Q0HA 2VIIA 2ZRIA 5EP1A 4KBFA 3EWAA 3NG1A 2J5XA 1KO1A 2ORVA 4MKGA 2VP0A 4IVPA 3R9XA 4G5OA 3HU3A 4JSTA 4FINA 1EFRA 4TL9A 1NBME 1P9NA 1GVNB 2BVNA 3H4MA 5KDDA 4WVFA 2OCBA 4B3BA 3KQKA 1IN7A 2YZ2A 1UF9A 4QM6A 2C03A 1KDPA 4Q9LA 3NIBA 3PUWA 2O8DB 4JLOA 3K0CA 1G3IA 1N5LA 2CDNA 3H2YA 4JKYA 4RZUA 3SYLA 2QTFA 4Z8YA 4RKFA 4IHQA 2JJ8A 3QBVA 4MRVA 1RJ9A 1Z83A 1P75A 1S4QA 2BKUA 1SVIA 3BFVA 3QBTA 5FI1B 5HKKA 4HAVA 1TL7C 2QL6A 4TZ0A 4EPYA 2PZGA 1E9EA 3QKRB 1E96A 5KSZA 4PHGA 3U7EB 2GCPA 1GRNA 4C3ZA 3QKUA 3E5HA 2KI5A 3DL0A 3PEUA 3NVAA 2JASA 3I72A 1JALA 3PUZA 2GVZC 2AXPA 2JEOA 4LJ8A 2HEIA 4URXR 1KK2A 2PJRA 1EGAA 3NXSA 1U9IA 3NC1C 2A3RA 3U61B 2FOLA 3VR2A 2HLDD 4DSNA 1ZNYA 1TF5A 1CKEA 2F3TA 3I8SA 2WWYA 4A8JA 2FSHA 1W1WA 3MRSA 1X3SA 2BBWA 3TUJC 1FL9A 2R8RA 3K53A 1G3MA 3HYRA 4NPHA 2WHXA 4G3XA 3W34A 3RRMA 3NEYA 4PTLA 1T4GA 2BJVA 5ELXA 3F5FA 2JJ1A 2ZJBA 2ORWA 1S1CA 3A4LA 4I81A 5EXPA 1KDOA 1EFRD 4IOMA 1FFHA 3H86A 4HUQA 2ZU0C 3RVBA 3CBQA 3GLIA 2QPOA 1GNQA 1X1SA 4YDSA 4NCJA 1KAGA 5IK2A 2ZS8A 1DPFA 1W4BA 4OQFA 2OILA 2QMEA 4NYIQ 4TYPA 5KNBA 4C30A 2O8CB 1KI7A 1DAIA 3OHMA 3CZQA 1W48A 3Q3JB 4JJKA 1KMHB 4IEEA 4ZDIA 5K8UA 1UPTA 4PSKA 5JLJA 2WWGA 5GVRA 4JYCA 2GJ8A 1EFTA 3BIFA 2VBCA 1M8PA 2RCNA 4TLEA 5FI0B 2O8EB 2ODEA 1NLZA 2NZJA 1GRRA 1YRBA 4AIIA 4DLWA 3MCAA 1VPLA 4GPTA 3R9IA 1UM8A 4Q1CA 3FE2A 2NQ2C 3BK7A 4Q1DA 4C0BA 3QI2A 1AJEA 2EFDB 6Q21A 4LWZA 1QG2A 4LC0A 1J90A 5E7IA 2LWIA 2ZSAA 4TLCA 1IXRC 4DSTA 2I1VB 2R44A 1KI3A 4MRRA 3U7FB 1A4RA 1DAHA 1GKYA 3UG7A 3IILA 3ZVMA 2HYIC 1AS0A 2WAYA 5FOXA 5F9FA 3W9YA 3IHLA 1Q22A 3GEHA 4FMCF 1E69A 2UZ3A 3OE7D 1MO5A 2RGNC 3GCGA 3X1ZA 4F4CA 4Q9IA 5B30A 1KMQA 2ZRJA 3LQQA 3CM0A 3GJXC 5J4YA 2J0UB 1OIVA 2J59A 2Q3HA 3RDPA 4DCNA 4C9BA 3U2QA 3ETLA 5KNCA 4B3GA 3OFNA 5EE9A 2AWNA 4PO9A 5HPYB 1KTVA 1G8YA 1NMYA 1DG3A 2OZEA 4IDPA 3LX5A 2FGKA 2WVJA 2VEDA 4OL0A 4TTQA 4C0HA 2IUTA 3O8DA 1W5TA 4ITRC 1COWA 2Z4SA 4MKFA 3EPHA 4G1UC 1S9DA 1E1RA 1S0UA 2WWXA 4BGDA 2VF7A 3EG5A 2ZRKA 1E79D 1XEXB 3PIRA 2JIZA 1N6PA 2QE7A 2Q9CA 4LGMA 4S35A 3BRWD 3B1YA 1XB2A 2EVWX 3B8HA 4UJ5A 5FBVB 2XGJA 5FOVA 4CT5A 2XTNA 1T8UA 3OESA 3WNBA 2OCAA 5JEDA 4V0ME 4DIDA 5DN6D 1IJEA 2VSFA 4WZBE 3GEIA 1KI6A 1Z5ZA 5FTKA 1IBRA 1SVMA 3NHBA 4XTCS 5TARA 3FTQA 1G6OA 1ZM9A 2RB4A 4OHVA 3CW2A 5SZHB 4AYTA 5KO2A 2QGNA 1UBEA 3LRPA 1DEKA 5FL7D 3VR6A 1Z6AA 2Q3FA 1DE0A 5HR5A 3HU1A 4JBYA 1G17A 1GKIA 1ZNWA 1M7HA 3FYHA 4TQAA 3AH8A 4MRSA 4DUGD 3CNOA 1XMJA 1WBDA 1DADA 1E0KA 3B82A 3WMGA 2IEZA 1WP9A 4EKDA 1QHYA 5M04A 5SZIA 2CJWA 4KU4A 4PQFA 2IW3A 2WJJA 3SQXA 5TXGA 5G40A 1DG1G 4GL2A 2GZAA 3RAPR 3L43A 3BFXA 5TB5A 3KJIA 1VCOA 2F7SA 3AGPA 1II0A 3FFAA 1F2TA 1VECA 2XSZA 3T1VA 3MWLA 3AP1A 1WA5A 2RKOA 4NE2A 1ODFA 2QZ4A 4BFZA 1OYWA 3OIYA 1N6HA 4N1AA 3FMIA 3RNLA 1D2EA 1HTWA 2PL3A 3NC0C 1D6JA 2DY1A 2OE2A 1RPZA 4XWAA 1IXZA 4QM7A 5K8LA 3WHKA 1W36C 3GQBA 1IN6A 1AZSC 3CX7A 2NO6A 1XBTA 4NKRA 4KVGA 2VPPA 2AWOA 2J0VA 3GLGE 4Q01A 2R6GA 4DXAA 1XPOA 4D26A 4FMDB 4Q00A 1VTKA 2CCGA 4B74A 2G1KA 4WA7A 3EASA 4KSCA 2ZSBA 2IWHA 2XNSA 2CHVA 2REBA 4B3DA 3LV8A 1MT0A 5IK2D 4MGIR 3GLHB 2WV9A 1P72A 2HT6A 4P31A 2A5JA 2X2EA 1P2TA 4M53A 5AK0A 2ATVA 1KO4A 2YWFA 4JLNA 4D0LB 4B3FX 2JA1A 5DYIA 3GJ6A 3IIJA 2EFEB 3UANA 2GAOA 3VTKA 1GTVA 3FDIA 1XPRA 3OZXA 2XNDD 4KFUA 4OJQA 1RKBA 1E2KA 1JQJC 1XTQA 2Q3MA 1WXQA 4OHWA 4Q4HB 4HDQB 3QNUA 1G20E 4JLPA 5DNYB 2ZANA 2C98A 5P21A 4KYIB 1L8QA 3CH4B 3DKPA 5EE5B 1FP6A 4Q4AA 3RYTC 4UKDA 4Q03A 1CLUA 3QG5A 1CR0A 221PA 3C7KA 3J81k 2KBEA 3WRXC 4BLSA 3KQUA 3FOZA 3PJRA 1MABA 5GJVC 2YOGA 5IT5A 4XD7D 4URUR 5UKDA 5AUPB 5JBQA 5JHGB 4B75A 4B2LA 1E3MA 1KI6B 3QQ5A 1TADA 4LJ9A 4JBWA 5CJ2A 1S96A 4O2RA 3W6NA 1TUIA 1T8TA 4L9WA 2V7QD 3C8UA 1RRFA 2ZE5A 3A6PC 1UKEA 3W5IA 1HV8A 4DT1B 1JBKA 1M34E 1CIPA 3PCRB 4B34A 5JWHA 1ZM2A 2C9CA 3UMFA 4EAQA 3K70D 1N6RA 2ZJ5A 4XSGA 5DI9A 1QHNA 4Z1MA 4BLRA 4P33A 4IJMA 3GLFB 3KQHA 1GL7A 1CU1A 2ZQ5A 3GJ3A 2HUPA 3K9LA 4U00A 1XMSA 3REGA 4ASUD 5FUVA 1KK0A 3QXHA 2RGCA 1ZD1A 1T9HA 4NHOA 4M0LA 4I1UA 2UVQA 3B9QA 4PZLA 2IYUA 3WYFA 3WXMA 2N42A 3ZJYA 1R0XA 3UPUA 1J70A 2RGAA 5EZ5A 1AKEA 5F3WB 2WJVA 2RGEA 4E22A 3I8XA 1QF9A 3K9NA 2IT1A 5TMPA 2BWJA 2G3YA 3I5YA 5FTNA 1EFHA 1OXTA 1II8B 1U8AA 3RSLA 5IRCD 1SXJD 1R8QA 4C0AC 2GKSA 3HU2A 2LKDA 1XXHA 2WIBA 5CDFE 2WSMA 2X19A 3K8YA 1UADA 2ANCA 2QG6A 2DHRA 1HEIA 3PEWA 1S2MA 4QJ5A 3L82B 4YXWD 4M9XA 5D3MA 1PV4A 4B33A 1KI9A 3GMTA 3KFVA 4EJSC 4CEHA 1A2BA 4Q4JA 1N6NA 5HTKA 2QQ0A 1VIYA 4Q48A 3W5JA 4B2IA 5C1BA 4US2R 2YHSA 2IS4A 4IFBA 2CNWD 3SC3A 3LXXA 4WXRA 3DKVA 3ZIAA 4DCSA 2WZQA 5J47A 4D81A 4QHSA 2CXXA 1WF3A 2EFHB 2FJUA 4LY6A 1JJ7A 2ERYA 3KDSE 4UNRA 2ZE6A 2ASEA 1Y63A 4IOJA 4UXHA 1VG9B 3SI7A 3RS4A 3AF0A 3ZS9A 2GILA 1XD8A 4TN1A 2J0QA 4GBMA 3R7WB 3X2SA 4OHYA 3MUFA 4NBSA 1Z2CA 2KBFA 5AUQA 1SHZA 2WWWA 2PBRA 4GFDA 4KITB 4DZZA 2NTYC 1XEFA 4P32A 1KO7A 1ZRHA 1WMSA 5FOTA 3IPXA 3LXRA 4A0RA 1FX0A 3A1TA 4A2WA 4XOIA 1RZ3A 1OHHD 3TR0A 2HF8A 2Z0MA 1Q12A 2ZE7A 4B35A 4IDQA 4BEJA 4V0LA 1LF5A 3QXXA 2F43A 1KJYA 3EC2A 1XD2A 3EIHA 3WBJA 3AM1A 1P73A 1SKYB 2OXRA 2WMOB 2JDIA 4AD8A 4EJSB 3CR7A 2QAGC 1Z63A 1G8GA 2PX3A 1SKYE 1E1QD 4A9AA 3V00A 3EARA 1XJQA 4LYJA 2AL7A 4DLYA 4K8OA 5HCNA 4GOKA 3I3SR 3T12A 1F2UB 3IIKA 3KTAA 3LLMA 2WWIA 4QXAA 5CK4A 2FZLA 4CGZA 1ESNA 4XWOA 5B57C 2QGZA 5L3SA 1XU4A 5CJPA 1DOAA 4PXAA 2XTZA 2D7CA 5G53C 3MJHA 2DWQA 2CL6X 3QXJA 3O8RA 1G64A 4NYIR 3P1JA 1U0HC 3T1QA 1J8YF 1U99A 2O8FB 1L2TA 3SZRA 1U8ZA 4CEJA 3T61A 2ZRFA 2VYFA 3CWZA 2CL7X 3P4XA 4F92B 2CL0X 4HAWA 1TQ6A 1JB1A 1L7VC 2NIPA 4GZMA 4PC7A 4QNMA 1C4OA 1Q3TA 4P3YA 4CEIB 1OHHA 2VSXA 3THWB 1CJKC 2C2HA 5LB2A 5BW8A 1N5JA 3TVTA 2P6NA 3TQCA 5SZKB 3T5GA 1KDTA 3IEUA 4Q9KA 5AJXA 4PPQA 1W46A 4CYMA 3CX6A 3GLIE 3BB1A 4GRAA 3SNHA 1VG8A 2P67A 1W36D 2UKDA 2HYDA 2DYKA 1G4AE 1NLYA 2NPIA 4C2TA 4RD0A 5HCIA 3EWSA 1TMKA 2VO1A 1U90A 2WWHA 2DPXA 4HAXA 4PSVA 2TMKA 4BLPA 4A6XA 4JL6A 4POAA 1IN4A 4Q02A 4CEIA 4CIDA 3RANA 1E9RA 2OV2A 2WJGA 1RJ9B 4Q7LA 3TK1A 4J0QA 4QHTA 5G3ZA 3ZQJA 2VHQA 3HPQA 4JMPA 3TR5A 2ZVPX 1G3RA 2IUSA 2QENA 2QRNA 1T0JB 3SN6A 1KYIA 3R8FA 4ZKDA 4M21A 2ZETA 3VKWA 4G5SA 3CO5A 2C78A 4DLUA 2H7VA 1SVLA 3O8CA 5GJCA 1N3BA 2W6JD 3PENA 3QVUA 4NYMR 1DAGA 2W0SA 1SZPA 2V8OA 4I1VA 4BRWA 4TYYA 1GZSA 1OH5A 4PO1A 1MRNA 1BIFA 1ESMA 3EA0A 3N2IA 3Q8XB 4IFEA 1PJRA 1OKKD 1X86B 2I3BA 1H8HA 2WBLC 1PLKA 1AS3A 1XD9A 3RS7A 3U4QA 3CRRA 2YJTD 3EZ9A 4TMTA 3X1DA 3PV0A 5GJWC 3WP1B 3TIFA 5F98A 4AG6A 4RFSB 2WWFA 2ZXUA 4HUQB 2IA5A 1SQ5A 3RRYA 4TT3A 4QL3A 1GWNA 1P60A 4DB2A 4ERNA 1NVWQ 1RVDA 1FTSA 1HT2E 1LVGA 1IOZA 5DHFA 1WCV1 2A9KA 1FZQA 1DO2A 3MFYA 3QJYA 4YONB 1E2EA 2QQEA 1KJWA 4B76A 3BC1A 1W36B 4FCWA 1EESA 2HLDA 4LYHA 2ORIA 2F1HA 1U94A 3RC3A 5LPNA 5CB6A 4DB4A 1XPUA 4RZ3A 2ZIAA 3QENA 4B71A 4CDGA 1K8RA 2BC9A 1UJ2A 1X6VA 3LX8A 4MUAA 1J7KA 1LTQA 1E9CA 5TY0A 3TH5A 4UNQA 3MAAC 1CEEA 3RC8A 4BWYA 3BJIC 2A78A 2YWHA 3VAAA 1NN0A 3B1VA 1R8SA 1C9KA 3CNLA 3LD9A 2F55A 1Z0KA 3GJ5A 2CK3D 4IVRA 4A0GA 3QY0A 5FR2A 2PEYA 2E87A 3LA6A 3SHWA 1GNRA 4CRWB 1QHGA 2QN6A 2RHMA 2BJWA 3P32A 3THYA 3U3JA 3P20A 4R98A 3F3YA 4BFWA 2GA8A 5DI3A 1Q0UA 4BE7B 2PLRA 3TE6A 3L0OA 1U8YA 5HKKD 5L3QA 2XB2A 3ICQB 4A36A 3WY9A 2GCOB 1NJGA 1KK3A 2GJKA 2CE2X 4GNKA 1T91A 2P65A 5J5CA 3X1XA 1ETUA 3OAAD 1A82A 2ZVQX 4EPVA 2OO7A 4BECA 4C7OA 4IDOA 3WYAA 3AVYA 3UKDA 4JLJA 4UXJA 2YKGA 1EXMA 4OHZA 3QKSA 4E5UA 1NSTA 4PHFA 1NG9A 2O8FA 4A4DA 1CULC 1SVOA 3SR0A 1EG7A 4E07A 2R6FA 3LBNA 1W47A 2D74A 1MOZA 2J7PD 1NKTA 2J9RA 2BBSA 1SVWA 1ZU5A 4WAUA 3WRYC 4F4JA 4B6EA 2MSCB 2G0NA 1V5WA 3K9HA 4MGKR 1E2MA 1EFUA 1SVKA 1ZCBA 3MWKA 4D6PA 1Z08A 3B1WA 3REFA 1U0JA 3SFVA 4N0EA 1AQYA 4XH9B 5CM9C 4BLTA 1ZNZA 3AF1A 4H9GA 5KOYA 5DH9A 4JSYA 4TYQA 1UBCA 5KSOA 2V1UA 2HDNB 2YINC 3BB3A 1AIPA 4B43A 4CVNA 2O8BB 1US8B 2QPTA 2DR3A 4MYHA 3B7GA 2IYLD 3E2IA 2GBLC 2ZUBA 4B44A 1E32A 2FV8A 1Q1EA 2GJ9A 2FWRA 2H18A 2GZHA 1SKQA 4PC3A 2A30A 3CRW1 3HPRA 5LB4A 1NKSA 1E9FA 2QE7D 3KL4A 4M9QA 2DCUA 4XTRA 3IUYA 3B9PA 2IS6A 2G1JA 2IYVA 1FQJA 3OFND 3FHTA 2X8AA 3CNNA 4C0LA 1CJMA 1R0WA 4MA4A 1RIFA 2O8CA 2C8VA 4O25A 2IS1A 2CNWA 1TQ2A 3B60A 2P5TB 4P4UA 1KNXA 1GP2A 4LPKA 4KCGA 1HA3A 4EFNA 5LDDC 4FMDF 3GLIB 4IDHA 3CF2A 3VR4A 1VG1A 4DDVA 1U98A 2WAXA 5EUMA 4X8LA 1W0JD 5KU1A 1E79A 1SXJC 5CLQA 2W6ID 2NZ8A 1Q1ZA 2YYZA 5BXQC 1S3SA 1IN5A 4ZIRB 1HUQA 1P61B 1D2NA 4NCIA 2XAUA 4P0TA 4LBVA 4Q4HA 1Z0JA 4I4LA 4BFYA 1TF2A 4OQMA 2QNRA 4RZXA 3NHAA 3ASZA 1Z28A 3ECCA 2F43B 3OEED 2F1IA 2ZR0A 1HE8B 1COWD 3O8BA 4QGHA 1UBFA 2JCSA 2OXCA 3MLEA 5E7JA 1GDDA 3SU8A 3U60B 4UJ3A 4A82A 4RD2A 5FL7A 3FMPB 4A2QA 1E4VA 4EQ6B 1S8FA 2GXSA 1VCIA 1XTKA 4TQ9A 1AN0A 1KJZA 2VLIA 1LV7A 4URVR 4C0QC 5EQTA 4YC7A 3T15A 2FGJA 1FPMA 3MWYW 3ZVNA 3T1TA 2IYSA 1OXUA 2VQSA 3ADBA 3QPWA 4DJTA 2IYYA 4Y0VA 4FN5A 1G9XA 4ZDWA 2PZEA 2QMOA 4ESHA 2OBLA 3AUXA 1XX6A 2C04A 4FW9A 1F5NA 2FA9A 1F2TB 4LZZA 2YC4C 4JLVA 3SBDA 3OIVA 5JEEA 4NCHA 1N0VC 5EUQB 3KKOA 3U7GA 1Z0AA 4Q19A 2Q9AA 3AVPA 3AQ4A 4JVMA 2ZREA 4OJKA 3IIMA 3LWNA 4O3MA 1E2QA 1OSNA 1P2UA 3U3MA 1TTTA 3AKYA 2BM0A 5G41A 1LY1A 2IL1A 2KSQA 2VHUA 4RD1A 1JAIA 4U7DA 2QT1A 1OW3B 3AGQA 5AJVB 3VR3A 3AF4A 1QHXA 3GP8A 3ND9A 1AK2A 1A1VA 1KOFA 2NMVA 1BMFA 1OE0A 3VMFA 3D8BA 2FEMA 2XNDA 1HYQA 1UDWA 2PT5A 2V55B 2HJGA 1G3QA 4DDTA 3ZZTA 1ZMXA 4HZUB 4A0FA 1W0KA 4PO8A 2O0JA 1WBBA 4Q4LA 3CLVA 4OBEA 4HB3A 4HZUA 1JXOA 2D3WA 4XWKA 2GK7A 4MYUA 4DSUA 3NBZC 4ZV4A 2JLYA 2FU5C 2WPDA 4WBSA 3UK6A 1N0UA 3ZVRA 4Q9HA 1ONBA 1KDRA 4E09A 1GG2A 4GT1A 2IK8A 2PH1A 2RAPA 2DBYA 4XD7A 4BFSA 4GDFA 1JPNA 5IHPA 1OYYA 2XB4A 4QJ3A 1AQUA 4R71A 5EZ6B 1G5PA 5JSZA 1P62B 3WNCA 4Q21A 5KPJA 5C4GB 3GLHA 2QI9C 1CJUC 1ZD8A 2ZYUX 2HJVA 4LBYA 1OFIA 1B23P 1E9BA 1FQKA 2DFKB 1PLJA 3K09C 4I99A 2P6RA 3T1OA 2GBLA 3WP0A 3MWJA 1A7JA 2W00A 2ZUCA 4Q1FA 1Z8FA 2G83A 4MQBA 3K0FA 4LPSA 4V0MA 1TUEA 3IBYA 3A4MA 4G5RA 2R62A 2FPMA 4EUNA 3T06B 4Q1BA 2R6CA 5FUWA 3FB4A 4NMMA 4KBGA 3ASYA 2QORA 5EP2A 4HAYA 4M22A 2GXAA 1PZNA 2WM9B 3TRFA 2W2TA 5EE3A 3WNDA 4BRUA 3C4JA 4LI0A 3CUEF 5JJLA 3BERA 2GF9A 1YZQA 5JJIA 5JRJA 3I73A 1NRJB 3MJRA 2C77A 3W3AA 4D4LA 4BZXA 4LHYA 3LW7A 1X8LA 4NZYA 1SXJA 2FFHA 4JVNA 2QA5A 4C0KA 4A1FA 4R2IA 1G3UA 4B73A 1W0JA 1VHTA 2OEPA 5E4FA 1MH1A 4NU0A 2PMKA 2B7CA 4F7WA 3TSZA 3B1ZA 2ZRHA 3HR8A 4ZIRA 2K5UA 1AGRA 1KI4A 2ODBA 3P4YA 4AKIA 4JLBA 2G77B 1M2OB 3JVVA 5JS7A 5JFGA 3JZMA 1Q1QA 2NPFA 2OLJA 3GLFA 1OB2A 2GWHA 1LS1A 4PAOA 1ZC3A 1A5TA 2JAQA 4G0NA 3OEEA 3NDBB 1AKYA 1I4DD 1GILA 3HYTA 3NEJA 2F9LA 1XWIA 2ZSEA 2WOJA 3LFUA 1GNPA 3THYB 2BCGY 2P0EA 1JQLB 3QPVA 1WDTA 2GEUA 1J8MF 3KB2A 4LX0A 4MKHA 4W5JA 4YXWA 4BFXA 3GPLA 2OSBA 3W8RA 1P7CA 2BCJQ 2ZAOA 3CPEA 4G01B 4LV6A 1N2CE 3NBFA 3P26A 3UIEA 4FD2A 3B1XA 4Q9JA 3QG1A 4RZ2A 4TLDA 2CVFA 1J99A 2HCBA 4Q5IA 5BWMA 4ZI2A 4ZPXA 2B92A 2ZSFA 1N5IA 2LCFA 3EX7C 3I92A 3QXSA 5KUTA 2FSGA 2O8BA 4KLZA 2G88A 3I5XA 3TW4A 4YMUA 3CH5A 1NN5A 5DLQC 2ZJYA 5HE8A 2OBMA 3UWOA 2VP5A 3EPLA 1KY3A 1KSHA 1TU3A 1GM5A 1KK1A 5LD2C 4D82A 2AD1A 2NO9A 4DLZA 1BYIA 2JLXA 4NTZA 4TSFA 2IHBA 2QP4A 5A4JA 2J3EA 4PPGA 4D4KA 3JZAA 1SXJE 1YZTA 2GHIA 3DMNA 3O47A 4HLUA 4RD6A 2WSSD 2YNMA 4IW3B 3BS4A 3Q7QA 3WHLA 2JLRA 2P6UA 4O2LA 2XZPA 5H68A 2GETA 4DC9A 5BN4A 3QKRA 4JT2A 3PUXA 3G82C 4P4TA 1CTQA 3QOFA 3THXB 4D0NA 621PA 3UXMA 2X77A 2GEDA 1F48A 3TMKA 2D7DA 5B64A 2EYUA 2QP3A 5J4KA 2F3RA 1D5CA 3PUYA 4LJ5A 1IXSB 2I1QA 3H1TA 4A15A 4YLGA 1X1RA 2FPLA 3AP3A 5JI2E 3PEYA 1GSIA 3K0SA 4JT4A 2XITA 2IXFA 4OQLA 4F93B 2BV3A 1K6MA 1Z2AA 1E1QA 2P3SA 3FMOB 1XRJA 3BAFA 3EW9A 4MUBA 2ONJA 1NSFA 1FMJA 5C2JB 1CRQA 3PR1A 3B5JA 2RGDA 2QAGB 1OF1A 3LBIA 2ZU6A 1G5RA 1G8HA 4P4SA 4FMBB 1CF4A 2BIFA 2D62A 3FPAA 3U3KA 4D80A 4YMVA 2B8WA 1E9SA 4QC2A 4QGFA 3K09A 3FKSD 1VCMA 4ZKEA 2MSDB 5JZVA 5CK5A 1R10A 3AF2A 2Z5FA 1Z6TA 4RD4A 5KPDA 3I4LA 2W6IA 2ZJZA 1D2MA 121PA 5TDHA 1MO6A 2XZOA 3HJNA 3L8YA 3C5CA 1JJVA 2RGBA 3GLHE 2XXAB 4L8GA 2IX3A 3IGFA 4NYJR 4HEJA 2R6AA 4PANA 4F4IA 4HZIA 2ZRLA 4US0R 5KSYA 3VHXA 4AY2A 1Q20A 4EJSA 2PT7A 2FN4A 2C9OA 4N0DA 4RKEA 1WQ1R 1I4LD 1XD2B 2VF8A 1HE1C 5BYJA 2WKQA 2R2AA 3NBYC 2NG1A 2BMJA 2WJHA 2ZRBA 1RRPA 2ZJAA 5CIQA 4D4MA 2OG2A 5HZKA 1O87A 4JLMA 3LNCA 3S1AB 3IO3A 2WIAA 4NP6A 2IHYA 4V0NA 3AVTA 1OLOA 1NVXQ 1AM4D 2H16A 3CRVA 5FPYA 4LC1A 2XOKD 5C4MA 1W2GA 1XJCA 2CHGA 2J45A 3KQLA 3K0CC 5G3YA 1M7GA 3LLUA 2GVDC 3NKVA 2QBYA 1FOEB 1QHSA 5BQ5A 4UNPA 2OBNA 2V6JA 3ZVLA 2CCKA 2D2FA 2SHKA 4DWJA 2RHDA 3U44A 2QROA 4ZCMA 4UXIA 1CJTC 4ACAA 1H8HD 3QKSB 2O8DA 3C41J 5HZHA 2QBYB 4LCBA 3OE7A 4WIAA 3U44B 2ANBA 2UZIR 5JRZA 4K46A 4M1TA 4NH0A 4ESVA 2IXGA 2VP4A 1KNQA 1P2SA 1P6XA 1XTRA 2V1XA 1T5IA 4MRNA 3EZ6A 1N6OA 2WJYA 4QJ4A 2KWIA 3R20A 4OHXA 4DRZA 1E2JA 5K8TA 4MGZR 3V4RA 1PUIA 4K81B 1KI2A 2R9VA 1E0AA 1YZNA 1X8KA 3DMDA 2OHFA 4ZO4A 5JJKA 3SFZA 1W44A 3IO5A 2AN9A 1QRAA 4EFLA 1Z06A 4TL8A 4Z51A 1N25A 2YVUA 2GJAA 1E2HA 4X8OA 4JL5A 4BFVA 1ZJ6A 1NIPA 4W5WA 2Q21A 5F9HA 1XTSA 3DDCA 3SOPA 4U5XA 3AKEA 2B21A 2ERXA 4PZZA 3SYKA 2QUZA 2ZRDA 4EPXA 5AUNB 3EAQA 3TUIC 1OH8A 1ZUNB 4M1OA 4AKGA 2V4ZA 3RABA 1R0YA 2EYQA 4MH0R 1OFUX 1ELOA 1CRPA 3KKMA 4LV8B 3BOSA 2KB0A 4JJZA 1VYUA 4LHXA 2REXB 2F1RA 2ZE8A 4LSGA 3NH6A 4QG7A 4KSBA 5KYKA 2VP9A 2QSYA 5KNDA 1ZBDA 1E9DA 3I61A 3BH6A 2RGXA 1ZP6A 4PFSA 1Z6YA 1A2KC 3EZ7A 3UWKA 4TT3D 4CEJB 2MSEB 1L4UA 5JCPA 3AKDA 3CF0A 4CEHB 5JWRA 2O8EA 4L9SA 5KHOC 3NBXX 821PA 2A2ZA 2F9MA 2J0SA 2OFOA 2IYQA 1JI0A 3THXA 2ZITA 3GJ7A 2QM8A 4BQSA 2JLUA 1KKLA 2YWGA 1Q1BA 5CYOA 3PXGA 2EW1A 3VFDA 1ZUHA 2PMDA 4M1WA 1OT3A 2F1JA 1E1RD 4DCVA 4AC9A 4LOAA 3QXCA 5EXXA 3PQCA 1GL6A 3ZYCA 3L0PA 3OAAA 3S1AA 4DBLC 2A7QA 1XFAA 3RSOA 2ZI4A 2A5FA 4XSHA 3DEFA 4B32A 4GOJA 3AVWA 2OUKA 4UNSA 2YWEA 1KSJA 3QIAA 1Z0FA 4V0KA 3ZZ0A 1I2MA 1E2PA 2J46A 3FWYA 2GK6A 4NDZA 1I4TD 1CR1A 3BH7A 5DN6A 1Z6GA 5L8VA 2OCPA 2PCJA 3QUSA 2ZRNA 3B6EA 4YMWA 1LB1B 3UMSA 4O0MA 4H1UA 3DM9B 3X1YA 4UQOA 2RGGA 2O5VA 4QBIA 3VX3A 3CR8A 4YMSA 2IS2A 4PAMA 2PLFA 2ZTSA 1KI1A 1ANKA 3KJHA 3OEHD 2C5LA 5BYKA 4AK9A 1W4CA 1CP2A 2GJSA 4C0JA 3HP1A 3SE0A 3BE4A 5J4LA 4V03A 4JLAA 3EZ2A 4PAQA 2JLSA 1R5NA 1QDEA 2WMNB 2F6RA 1Z6XA 4M4SA 2FF7A 1BOFA 1K5DA 1XEXA 3RRNA 3P27A 3DZDA 1R5OA 2CVHA 4PC2A 5JI3E 5GADl 4IRUB 1KY2A 4UNNA 2V6IA 2IUUA 3EXAA 3TAHA 1MABB 4ASUA 3ZZUA 5E3HA 4CZ2A 1I2DA 4FWIB 4ON9A 5FTJA 4OQNA 1ZM4A 4GP6A 4WW0A 4D0GA 4BEBA 1XZQA 4DVGA 1W4AA 4CW7A 1ZU4A 3W3ZB 3KJEA 3B13B 2IYWA 2C96A 4KAXA 5LD2B 4B6FA 1SVSA 1VCNA 2PZFA 2GZDA 3D31A 3KUDA 1DELA 2DWPA 2OAP1 2QT0A 3C5HA 3UG6A 2FE4A 3ND8A 4HI0E 3AVQA 2HXSA 1LNZA 2AFIE 2G6BA 2XTMA 3AV0B 2P2LA 8OHMA 4QBGB 5J40A 1NMXA 4IXNA 4U02A 2NO7A 2HXYA 1DBSA 1G4UR 1E2GA 2G0TA 2GXQA 2J41A 4DDUA 2FH5B 3LDAA 4N3NA 1TF7A 2VHTA 1P9WA 1E2DA 3SJCA 4LK2A 4LYAA 2P5SA 4RSGA 3FKQA 1YKSA 1P2VA 3LVQE 1YRAA 3WYGA 1QHIA 2RGNA 1G1MA 1IQPA 1XXHE 4GZLA 2ZRAA 1E2IA 3I1FA 5AJWA 1S3GA 3ZIAD 4KXFB 1OH7A 2FSFA 3GJ4A 1NI3A 2KJQA 3AEZA 1IJFA 1JAHA 4HLDA 4II7A 4PPFA 2QSZA 3N5CA 4XIGS 3NWJA 4IOLA 3DO6A 4RY2A 1MO3A 4HB0A 2EWVA 2CBZA 3QE0A 5L3RA 3V4FA 3GLGB 4TMVA 5EP4A 1Z22A 2A5DA 4URWR 1Z0DA 4KFTA 5SZJA 4NL4H 3AVOA 2VL7A 1B0UA 1IHUA 2PX0A 1FP7A 1XEWX 3GJ8A 3HDTA 4ZCLA 3W6OA 5FH9A 4PC6A 4AYXA 4MYTA 4GMXA 2FG5A 3TLXA 4W5HA 4BASA 3VKHA 3MD0A 3DVLA 4QBHA 1EFCA 3M4YA 1T0HB 2ZS9A 3NTUA 1XP8A 1JR3A 4WOPA 4JBXA 4RJLA 1IN8A 1YZGA 2BEJA 5FPHA 1FUKA 1KSGA 3LQRA 4MDFA 2E9SA 4TYWA 5B58C 3GLFE 2WJIA 1RYHA 4B3XA 3GFOA 4C2UA 3EPKA 2QMHA 4TL7A 1CS4C 1NBMA 3MSXA 1E98A 3A4NA 2IYZA 3K9GA 4HUTA 1XF9A 2AFHE 3FFBA 4A2PA 2ZI5A 2NOAA 4MGYR 4PC1A 2JLVA 1UBGA 4EPTA 3TQFA 4NYMQ 1YR7A 3QF7A 4JS0A 4KFRA 2HCJB 3IQWA 2AKYA 2PJZA 3CZPA 4ILEA 3CKLA 4TMWA 1VHLA 1DAMA 2Q9BA 4X8MA 1BMFD 2ZS7A 1KAOA 4DDWA 1Q21A 2GXUA 2J1LA 2RMKA 3HWSA 4TLAA 4RVCA 1N5KA 1XJ0A 1YU9A 3AB3A 3KUCA 4ZCIA 1GITA 5J4VA 2XOKA 2QU8A 2GCOA 2R6DA 2RH5A 1S1MA 1BKDR 2BMDA 1JPJA 3AVVA 3A8TA 1BS1A 1W4RA 2ZR7A 3K1JA 4GSYA 1UEIA 3W6PA 4BFUA 3K0AB 5CITA 4HYYA 4FXPA 5EE0A 3RWOA 1U0LA 3KXKA 3TSWA 1NLFA 1TEVA 4ACBA 4R9UC 1DAFA 1RRGA
chains in the Genus database with same CATH superfamily
4PZEA 1J97A 4EFKA 3IAM1 5AUOB 4CM9D 2IWRA 3IDQA 4WK2B 3FWKA 3VM6A 2QY9A 3U7HB 2MMCA 3NWPA 1EKXA 1GOTA 2BKVA 1ZINA 2OYSA 3SHTA 3O26A 4OK5A 2Z3WA 2ZEJA 4HLUC 1BVYF 1GZ7A 2ADMA 4MZXA 2BDTA 1PGQA 2XE8A 5FQOA 3BHIA 4C7KA 3QLUA 4AURA 4CT0A 1I3MA 1G7SA 2OWDA 4KV9A 2FMTA 4JKIA 1U2TA 4PFJA 2D2VA 3A37A 4PSCA 1U5AA 3O4JA 3DOEA 3MG9A 3GNTA 4P92A 4CMJA 3SHFA 3L8ZA 4OKSA 4PX9A 2F17A 2NUPB 5KKNB 2JIPA 4RFLA 6ABPA 2WKPA 1RJGA 1KU6A 3IVRA 3BXZA 3OIDA 1H1LB 3G2MA 4Z8XA 5FPSA 2ZBVA 2ZSIA 4ZMBA 3AJ9A 5JNUA 5EIBD 4YHBA 4EB6A 3R7LA 4UFOA 3I5UA 1VYHA 1N6LA 5F1YA 2VNJA 2RAUA 2BSAA 3FHOA 4RFSA 1XRNA 1G16A 1JXMA 3THRA 4DBVO 3D5EA 4U39A 2FZEA 5B3AA 5C37A 2H2IA 4H08A 1QFZA 3I9NA 2GERA 3CIOA 3OT4A 4OQ4A 4RLSA 1V43A 5EIWA 3TJZA 3L1IA 2BDUA 4YP9A 3DFUA 3WL5A 1YQTA 2HO5A 1DVRA 2JHCA 1ZNXA 2FPRA 1DO8A 2C9BA 2DFNA 4ZC8A 2OKCA 3W05A 4EZEA 4MB2A 3ZEAA 5JNWA 2XMDA 1E7RA 4WCFA 2IYTA 2DU8A 4L15A 4M1YA 4MVJG 4KR6A 1U2DC 1TQ4A 4BTVA 1G0OA 1TCAA 4NZ9A 4AZSA 2C2MA 1LFDB 3T3OA 1ENYA 3FCOA 1QH8A 4P93A 4I4TB 3I6ZA 2G36A 1FTNA 2GYYA 2Z6QA 1EJ6A 4C0XA 5CVTA 1PJ2A 5B2ZA 5MGBA 4BATA 1XK6A 4MRPA 4BNLA 1B0PA 4HB4A 2X0NA 1CS0B 1MMFB 3ABIA 3EMBA 3WFJA 1C2YA 1ULAA 3WQSB 3K31A 4PLWA 3U3RA 1TD9A 5BR1A 1D2AA 4B47A 2PFGA 2EFGA 3GZNA 3UBTA 4HTAA 4NCXA 1G0NA 3NCTA 3L07A 2IPXA 4DIOA 2Y8EA 2NU6A 2X3UA 3KLBA 1YDWA 3IEIA 4EB3A 4ITUA 1VGVA 5CLLA 1XRQA 4C3VA 1NY6A 1WETA 1WEKA 1SUAA 3H84A 3M1AA 4EGCB 2XMZA 4JA2A 4RM2A 3UKOA 2PFSA 1T6ZA 1IULA 1QRDA 1FYVA 3PC4A 2B0JA 1RAFA 4WY8A 5JS6A 4EGQA 1DRWA 1KHHA 2ARKA 2GAFA 3G85A 3K15A 5AKIA 1WB4A 2TMDA 2C2YA 4EMBA 3WZMA 3ZN2A 4X54A 3RC2A 2ZI9A 2NX2A 2WD7B 1USKA 2C42A 1TC2A 3T0IA 2AI3A 3FBGA 1DBIA 1XZKA 1LPNA 2HWWA 3V1YA 4Z54A 5CD1A 4DN6A 2AXEA 3IQEA 4MR7A 4MA5A 3LFHA 3PFNA 3RLFA 1RZRA 4IQ8A 5BQ3A 2QM3A 2B4AA 2AR7A 4D96A 2H57A 1QUFA 3AVUA 4PQYA 5THQA 5KJEA 3MEQA 2POCA 4PQRA 2KX7A 3GXOA 4U9UA 2XPCA 3M1IA 2JDID 3U0BA 4WKBA 3FOWA 1MX3A 1LJLA 3OZVA 2JAHA 3EGXB 4JEMA 5DE3A 3UT6A 4D44A 4GR5A 2LGJA 3SWWA 4R9SA 2F8TA 1ZN8A 2C9MA 3TTYA 4EEZA 2H8KA 4YAKA 2W11A 3S55A 3WHPA 3IJ5A 2HLHA 5JPDA 1WXEA 1RC8A 2CF5A 1BH2A 1TIBA 3OO0A 4TMXA 3QYFA 1CNMA 2ABWA 3RRZA 2CLDX 1KOGA 3K9QO 4KNYA 2PCLA 3ELWA 3ONWA 2XGGA 2Q9UA 3HR7A 3A27A 5AM1A 5JSQA 1ISIA 1TM2A 4CR6A 3P4UA 1W19A 2N0SA 3KZOA 3OJOA 2NXJA 4WZAB 1FXSA 1NXXA 2IYFA 3G49A 5E0KB 4DCTA 3QF4A 4IKEA 3ZGYA 4ZOLF 4BNKA 4K26A 1EMDA 1Z7YA 4UVDA 5BVGA 3EVAA 1TX4B 3QHPA 5AWFC 2CLHB 3WK6A 1E6CA 4EEXA 1N6KA 5ICGA 5ERYA 1XQWA 1VRVA 2XGMA 4JB0A 4BDSA 1SU4A 3DDUA 5CLGA 2GVNA 1JTFA 3SOZA 4IJ5A 3ESZA 3ND5A 5CLIA 3LO5A 1A9SA 4MW0A 4MHSA 4Z86A 3WB2A 1JLSA 1SUCA 3DZ8A 2W6JA 3DTTA 4TWIA 1NQAO 3GV0A 4PHHA 4CI9A 3VU9A 3ZE8A 2NYUA 4W4TA 5BSUA 4KX5A 4XM0A 1Z25A 5DBGA 1VJ0A 2PPLA 4UZEA 2YOHA 1GGHA 2VTKA 2H2WA 1A7UA 1GSAA 3K1TA 2OFWA 3FMVA 4MQ6A 1VMAA 2QRUA 3VU9B 1NQUA 5LJIA 1JR6A 1AY0A 4N5IX 3C3EA 4RETA 1WZNA 2XQFA 1N3LA 1PR5A 3NAZA 3L4EA 3OZUA 2VDWA 1G59A 2NUPA 1OPXA 2J7KA 4LXXA 5E4JA 1L4YA 3U49A 4F1WA 2W2MA 3QKTA 1B76A 3A1DA 4FQ5A 4WGGA 4KDEA 3ZBUA 3ZW8A 4ISBA 1GJRA 4RIHA 3UW3A 1OH6A 2SCUA 2G82A 3E3NA 3HXLA 4G26A 5JU6A 2WIFA 5K0GA 3D8RA 4BBJA 2G25A 2FFBA 2Q5CA 2R97A 2BEKA 1EK0A 3F6CA 3ZCRA 5EKSA 2VZ0A 1TYZA 1EXVA 2J8ZA 1QK5A 2OGSA 5KOHB 4D25A 1EFPA 4QNRA 3QFCA 4LZAA 1VLZA 3IT2A 3G0HA 4JI3B 4P4LA 3KD3A 3DMYA 3FGNA 3PL5A 4KO8A 3GH1A 3AVXA 3V7YA 5LQAA 3T7DA 2AD5A 3OLZA 4F3RA 1X1DA 1EA7A 1DAEA 4AMYA 3BWDD 1NAHA 1DTSA 5EIFA 5CX1B 3IB3A 3MOSA 4EDHA 5B7QA 2ZCUA 3HYLA 3EPJA 5K51A 4ABYA 4O2AA 3BCUA 1FLVA 2QUJA 1GTL1 4PIVA 1UKZA 3ZCQA 1UEJA 1JMVA 3D8TA 3ABRB 3ESXA 1V16A 4IDBA 4WDQA 4AS3A 3G1WA 1O9HA 3VC1A 3ZGXA 3ZBTA 3VKGA 3KFXA 2B2NA 5KSPA 2B5WA 5FL3A 4P3XA 3CB4A 4WLVA 1GNLA 3QLEA 1JQ3A 2IXDA 2ZIWB 3B78A 3F96A 3D9QX 2LDXA 1EBUA 4Z1OA 3NVKI 3DV9A 2VTEA 4N3GA 5FLKA 1QTNA 1WO8A 2W58A 1KMIY 4QUDA 2YDYA 1QG4A 4DMLA 4OLAA 4FKZA 1OV4A 1PDOA 4R3UC 1HLPA 4J8PA 1NP6A 4AF6A 3IHTA 2HPAA 2F4VB 1DXYA 4G8CA 4N54A 1OFTA 2Z83A 4F3KA 2EGUA 1T4BA 3INNA 3UC5A 4H7PA 2QZSA 3ZD9A 3EZFA 2QUIA 5AI6A 4BX2A 3A26A 4ND4A 1H9BA 1SUPA 1T8PA 1C8BA 1USUA 4KAAA 1XCGB 1Q19A 3L7KA 2W5UA 2G17A 3KQTA 1QC5A 4QKQA 1JJAA 3ZY3A 2DULA 3DZCA 2BFMA 2DWOA 1Q1AA 4CI0B 5DXFA 1TUBB 3DCIA 4M37A 1XTPA 3VR4D 4ER3A 2JIDA 1NM5C 3A7DA 3RADC 3AOGA 1RJEA 2GEJA 2BLLA 2O0KA 3JD3A 1M10A 1O89A 3ESYA 4HQ0A 4XWTA 5AKGA 5AKJA 5U1PA 2VHJA 3VYVA 1YS9A 4UZSA 5I8PA 4XJXA 1Q3HA 1KAEA 1CJSA 1D09A 1NUPA 3BF7A 1RI1A 4KYVA 1BVUA 2IC5A 1RCFA 4R6WA 1DMSA 1HH4A 3BGWA 3E0QA 3TNLA 1FW8A 3M4ZA 4AWXA 3KQVA 2VK2A 2OAQ1 3GGCA 4OM7A 2OWEA 2R1UA 4LJYA 4X61A 3FSGD 3OZSA 1Z4OA 1FRQA 5D3KA 2X9VA 4ZQCB 4CM8B 1ENOA 3PA8A 1H65A 2PUAA 4ZOAA 5EOVA 3JQ9A 3BSWA 4YAOA 4BNDB 3D5QA 1U7OA 3OKPA 5EKTA 5B7PA 4L0QA 3FA2A 1LLQA 1HURA 3HXTA 4YRPA 1Y7PA 4GKAA 2RCYA 4MQLA 1TNDA 3TLCA 4KFSA 3UB2A 5CCEA 4D0SA 5EHZA 2BHNA 2ZIEA 4F06A 1OUMA 2OHVA 2B37A 1RWNA 3ZH2A 4MJ3A 2ODWA 3ZE7A 1LWNA 1FFCA 4CKEB 1UZUA 5KINB 3ZWMA 1SU6A 3UPTA 3DVAB 3WX0A 1KZYC 2V96A 5JVDF 1FFWA 3FD8A 1T8SA 3LWBA 4XIFA 2HF9A 5HRCA 2VT2A 2P91A 1D4FA 1ZPDA 4ZZ1A 1QZUA 4RULA 3PJRA 3A4IA 4RQUA 2O5CA 4Q3KA 4BTEA 1IRXA 2OGWA 3H8WA 3T3PB 1EB8A 1IDOA 1OJ7A 3GD7A 1NJ2A 3O0DA 1L5NA 3PUHA 2BEWB 5FNZA 3JVIA 4XRGA 5A7FA 1XUOA 2CXRA 2X0RA 1VIAA 2JGNA 5AXCA 3HY4A 3SD7A 4ZYTA 2HA6A 1BEUB 4K6FA 1P4SA 2OKGA 5EWJB 1R15A 3ZPXA 2X5OA 3N7UA 3OX4A 2CLCX 5JCJA 2W48A 4OB7A 3ZGLA 3QVMA 2R66A 3UHOA 3V8VA 3N8HA 4WFQA 3GPCA 5BYBA 3SZUA 4BFTA 4CMIA 4IIHA 4DLTA 1MG0A 2XIQA 3E6AA 1K7SN 4TQUS 3DE4X 3A11A 2O14A 1JHXA 3LYLA 4ZYUA 2CDAA 4Z0HO 2CVQA 4AQYB 2DTDA 4B4KA 2CHQA 2GLTA 3HFSA 4YMIA 5KAMA 1E2UA 2GCNA 1VE7A 2ICAA 1E89A 2YIJA 3AP2A 3GQBB 3WI7A 1WX1A 1M8KA 2DM6A 3UAOA 1Q84A 1OFGA 4HLNA 5A0TA 1XKLA 2B8TA 2XVXA 2PR7A 5FULA 3T5MA 4W5NA 3TDNA 4F84A 3J7AC 3LU1A 1MD9A 3QVVA 2DH5A 4BLQA 4NCNA 4EVIA 1ISJA 3HWRA 3ZXUB 1N78A 2QTCA 2J30A 2YN0A 4R7ZA 2XDAA 3D0OA 1GPWB 4MMYB 1YIDA 1OFVA 1HQDA 4G89A 4IG4A 3DAOA 5PGMA 5JSZB 5K0FA 4F6LA 1FC0A 4OOEA 4C1BA 4X66B 1QR2A 2OL4A 2Y05A 1EEHA 3GJ0A 1T5OA 4X1IA 1VFNA 2Y0DA 3JCZA 3EEIA 4OI2A 4RHTA 4MQFA 3FWHA 3AW8A 4ALJA 1FP4A 1YL7A 3NETA 2XUZA 1FVFA 1CF2O 2HA7A 3IKMB 2Z1MA 5JZOA 3RHFA 5CCDA 5DGXA 3AKCA 3PX2A 2MMGA 2H4FA 1NN1A 1ZS9A 1VL6A 3F6RA 3O03A 1CY4A 1Y9JA 3B70A 1EWQA 4KV7A 2PUGA 3SJZA 3UK0A 3PQ3A 3P9XA 3PTAA 4E1AA 1JEDA 1JR2A 3NVMB 5T64A 2HIGA 2ZSHA 2RK4A 2HMWA 3AC0A 1GR0A 1VYVA 3THOA 2IH2A 2AGVA 5KVCA 3PR3A 1TM4E 4O4HA 1IOWA 1E2FA 4WI1A 2AQ8A 1RYFA 2IBMA 4HNHA 4WFKA 2JLZA 1T5DX 1UK6A 1YUBA 1D0SA 4FFNA 2C7BA 2GPTA 5DYYA 1NJSA 5EZQA 2BKEA 3MS4A 1GLNA 4KUEA 4R9VA 3R5KA 2UYCA 3OH8A 2ZUDA 1EJ2A 5C46F 1EFLA 3R9KA 3RHTA 4YA6A 3I2FA 3O38A 3TECE 5DX1A 3WKDA 3AHGA 1P4RA 5TQ0A 4LWPA 4AG3A 1D4AA 3CE9A 2O2CA 2H1WA 2ZJ4A 4EWLA 1CNFA 3FROA 4DQVA 3OQMA 1B3RA 3PIDA 3T52A 4D1YA 5IU6A 1DJNA 2W83A 1W6RA 4XQ0A 5CP8A 1DJQA 1TAGA 4H2DA 3WRYA 4ZVNA 4Q7MB 1BQ4A 3DB2A 2O2SA 4OTZA 3TBKA 3PWKA 3C48A 1SEPA 4LQ4A 5ICFA 4IGIA 1JQDA 1KMNA 1TGVA 1ZY2A 5DI3B 2HJRA 2FEOA 3FNHA 3RC1A 1G9TA 4F5YA 1MOPA 2XF2A 2WU8A 3DOJA 4OP2A 3RUIA 1SA0A 3VNRA 4CKWA 3H1PA 4WK0B 2JJ1D 4L8YA 3IESA 1EFPB 4W9NA 3ZS8A 3COJA 4R3NA 2AEFA 1M3SA 2LE0A 3D2LA 3LP8A 3TCKA 1VI2A 3ZNNA 3I3OA 4DXDA 2FMXA 2REOA 5HUHA 2BMEA 2KE5A 1QK3A 4IINA 2QTLA 2W71A 1FDWA 3EA5A 2AW5A 3N58A 4US1R 3SS8A 3TVYA 4D4IA 1GKLA 3BJEA 3PD7A 2R96A 1JH9A 4PZAA 5FBLB 4GECA 3TNDA 4XPIA 2WF7A 4ZQIA 2GNOA 4Y2PA 2QRZA 2BEUA 2VWHA 2CGEA 4AFNA 2Y66A 1JWLA 3N0XA 5TMDA 5EJEA 3WKBA 3VH4A 4WXYB 2FDRA 2HQOA 4GI7A 1Q6ZA 2IZ0A 4ARCA 7YASA 1X77A 1SH7A 2XUDA 4G0YA 2F48A 3IUEA 1UPCA 4R2XA 3S2FA 2GRJA 1YB6A 5IKMA 2DBQA 3ZGNA 5TVKA 2ECKA 3USZA 3VSEA 4ZCPA 4KPUB 5KQSA 3GU3A 4J9VA 3KQQA 5B4VA 2OFXA 1RW4A 3GRAA 3ZW7A 4HX2A 4GWLA 4X94A 4NXMB 4EI9A 3L2OB 1P5JA 2PX6A 3DAFA 4GLBA 3E8XA 3LM8A 1X80A 2RHCA 3OOJA 1G7RA 1PKEA 1VHJA 3CRQA 3RTDA 4CF7A 3L1JA 1EZ4A 4GC5A 4PBTA 1SUDA 1TOAA 1E2NA 3QKIA 5JSHA 4E11A 4EHFA 2WFAA 1N2CB 3HN2A 4JVSB 5CB8A 4QUEA 1CIJA 4MWTA 1NHGA 1JDZA 1QVAA 3KJGA 2VSOA 4FGJA 1JIKA 1DQZA 3I2JA 3QVTA 3NEPX 2OHHA 4LYFA 3EDYA 5JQGF 4LY3A 1N2CA 4ZAYA 4EMTA 4GKBA 1U1GA 1SVUA 2PKCA 5ES3A 2PU5A 2CE7A 2A9PA 2I91A 3T3EA 3HU5A 4UMVA 3JYNA 3PFFA 5JH7A 1XLUA 3JYPA 1CUIA 2BGRA 4TVSA 5FBRB 3SJBA 3K0KA 3ROZA 4S2EA 1SKMA 2E4YA 4TWZA 5IF9A 1ZD5A 4L9AA 2O06A 4W5TA 2OG1A 3FAZA 1NN3A 3WAKA 3ABZA 4KNVA 3UHPA 5BSHA 3NKLA 3EZGA 4E5SA 3PHLA 4R1OA 2B7LA 3EA4A 4PLCA 1R2QA 1UFQA 2E4XA 1AA9A 4OQXA 1PR3A 2WE7A 2X8JB 2VTDA 1GL9B 3GWGA 4RHFA 2BFNA 3H11B 3DM5A 1NBEA 1M7BA 1ISPA 2G70A 2NU7B 4PE5B 4Q47A 4B2PA 4C05A 1GZ3A 3E84A 3L18A 1U9IC 4PNPA 3E3AA 5AW0A 1JJBA 3MLBA 2Z4RA 1URPA 1IPHA 5IASA 1QIJA 2HA5A 4Q18A 2FB9A 4BMCA 4UASA 1TQ8A 3TF5A 1R4ZA 1VKRA 4I9GA 4RVGA 3WMEA 3RJZA 4BMXA 2PBLA 1GYRA 1ZMOA 5EP1A 2QJTA 2HTFA 1D6SA 2Y71A 3EWAA 2H51A 1VP3A 4P6VF 1R6AA 3PJGA 1Y4UA 1YQDA 5EY5B 1QOZA 1DU4A 1Z0ZA 2I3AA 3O75A 4Y9UA 3CXUA 4WVFA 5AKLA 4BLWA 3GHYA 3AHEA 3BL6A 2H3EA 1V7PC 3L4KA 2YZ2A 1KDPA 1UOPA 4FDLA 2G71A 1DAOA 2GBGA 5F2OA 5KYYB 2BUCA 3DEKA 4JLOA 4B4VA 1EP1B 1NRXA 1XLTA 3H3FA 4G41A 1VKOA 4S24A 4RKFA 1KRWA 3GRKA 1Y98A 1BWRA 2YXBA 4YV2A 2OQIA 3R3VA 4GGOA 4MRVA 1BGWA 3EH1A 4PYJA 1F06A 1SVIA 4JUDX 2IQ5A 1EUYA 3RUHA 3K1AB 4HWPA 5FI1B 4L8WB 2QL6A 2C97A 2A94A 2PZGA 5DULA 4OYYA 3UGQA 1N1DA 4XUDA 3IX7A 1DLIA 4P2GA 3NONA 2GCPA 4DC1A 2GM4A 2C1ZA 3E5HA 1TUGA 4YRAA 1U6IA 3NVAA 2VJBA 2PKEA 5CNMA 1KMMA 3FXAA 5B3KA 4N39A 4R7TA 3K6SA 4URXR 1P7ZA 1I80A 1XAJA 8AT1A 2HHHB 4ZHQF 4DHWA 1YJBA 4O08A 1BWSA 5EHIA 2FOLA 4HL6A 2HLDD 1VGQA 2IIBA 2QX7A 3ZCXA 3ZZ1A 4QULA 5J5VA 1CKEA 1RRKA 1SXGA 1ZUWA 5KVQA 2QZPA 2H9YA 1VLHA 4TV9B 2P4UA 4RXMA 3I05A 4XYEA 2L2QA 3KTDA 3NHLA 3JD0A 4MVCA 3HK2A 1Z4KA 1EUDA 1WZCA 4OXIA 5JISA 2H2AA 1QP8A 1HO3A 2VHXA 3GZNB 3RRMA 4CLXA 1SBIA 2WHYA 1T1SA 3BJRA 4HD8A 5F4ZA 4FHDA 2JJ1A 2PSHA 1E6MA 1C8VB 1KJQA 3EGDA 1YUNA 5EJGA 1IY8A 1L5WA 3PXCX 3NHSA 1FU4A 1FFHA 2QLMA 3PHBE 1QIGA 3AY0A 5J2UF 1Y3IA 1I3CA 4QOGA 4GLJA 2JFHA 4JFAA 1AURA 2QPOA 2WVGA 3K1YA 2VDUE 5DLDA 3LL7A 4A2CA 4ECEA 1GNQA 1KZ6A 1OXKB 5TX7A 2Z6AA 4MZDA 4AY6A 3C3JA 4GM4A 4TM8A 1FCJA 4CMAA 3WWDA 4IPTA 4TYPA 5KNBA 2GTIA 3ZD8A 4U3JB 1PWYE 4NBUA 1DTWA 3IJPA 1KMHB 1N77A 5K8UA 4OKNA 4EABA 4PSKA 1N1EA 2WWGA 5GVRA 5JLJA 1EFTA 1ONNA 2PZAA 3X1MA 2VBCA 3ZBQA 4RH0A 2WTBA 4K05A 3HV0A 3WLSA 4DJAA 1YNOA 2QKYA 1IJKA 1YRBA 1MQ9A 3AR4A 3LUCA 2LPMA 3NEAA 5FORA 4DLWA 4C43A 4R9RA 2GKOA 1A5AB 5IBCA 3FE2A 4HNAB 3PT5A 3DULA 3Q98A 4JN6B 5FP0A 5B53A 3QI2A 6Q21A 5A9SB 1QG2A 1K86A 2Q29A 4LC0A 4Q4DA 3I6IA 1RABA 3EQ6A 5KWVA 2PZLA 3QWBA 2X0FA 4ZZ3A 2I1VB 1KI3A 1QGYA 1DAHA 2BTQB 3IILA 1KE1A 1RBQA 2V45A 3IS3A 1B43A 1A2OA 1JFLA 1Q22A 2OPBA 3I09A 1YO6A 4ME6A 2DT8A 3TW8A 4F4CA 3GCGA 3TL3A 3X1ZA 3ZDBA 4Q9IA 1LJUA 4IWYA 4K2AA 2DBZA 3CM0A 1P2DA 4IUYA 1OIVA 2Q3HA 1QIDA 1OMOA 1RHKA 1XWWA 4PCUA 2QZZA 2YBEA 5CVDA 2YHUA 3KSMA 1ZGGA 2PDAA 2H59A 3BGIA 3ETLA 3V4SA 5KNCA 4DUZB 1ZXXA 2FY8A 4B3GA 1M8JA 2NO5A 4NNPA 4PO9A 2PL1A 3L8EA 1G8YA 2XWQA 4Z9AA 4MS4B 1DG3A 1ZVMA 2GBCA 1GUDA 2OZEA 3G88A 5GZ1A 2A5LA 4IDPA 1K9VF 3HB1A 1L5LA 4QRDA 1IWBB 3KVOA 4UAGA 3ZHOA 4C0HA 2IUTA 1X38A 4ITRC 3HEMA 2B30A 3FGOA 4PEVA 4IICA 1I24A 2Z4SA 3DPIA 3NOOA 4HQNA 1E1RA 3O2QB 3PQ2A 4RY8A 3EG5A 1Q7CA 1PZFA 3UICA 1ONSA 2AOTA 5ICCA 3W8EA 1N6PA 3KTOA 3PDIA 2QE7A 2BFCB 1EJ0A 4S35A 3R0IA 4E2ZA 2IBTA 4WH0A 1RPAA 3B8HA 4UJ5A 2ZUEA 1K7FB 3JRNA 4CT5A 4E2WA 3PQ5A 3HTXA 1DKNA 4QAQA 3CUVA 2OXFA 2G9ZA 4GM1A 4FU0A 1A88A 2QX9A 3C8DA 3GLVA 3OESA 4E1VA 4MV0A 3HO1A 3H5WA 3KELA 1NRWA 3FNEA 1J8VA 3GEIA 4YN3A 1L1QA 3RIXA 3ENNA 3JQ8B 4RZIA 4AVYA 3IDOA 3LUGA 3HS3A 4JSRA 1MOSA 5CRIA 1G6OA 2G7MC 4GXNA 1KVSA 1W87A 2HQ1A 5AH0A 2QGNA 3TQRA 1DEKA 4ZMSA 5A7GA 2ILTA 4C5BA 1G17A 3GCWA 4M46A 3QVSA 5T8KA 4B81A 1M7HA 4TQAA 1CZOA 1FU8A 1E4OA 4HX9A 4BNMA 1UP6A 3CNOA 1W5FA 5DEOA 1KAQA 1WBDA 3B82A 4MUNA 1I14A 3X2EA 1AB6A 2X9NA 1I7SB 1QCYA 1QHYA 1ODLA 4LF5B 1FRVA 1KQ3A 3F9IA 3LDGA 5EGSA 3QLVC 4L2IA 4MROA 4KU4A 4PQFA 5L45A 1Y48E 1TZKA 3NHZA 3SQXA 5TXGA 1RC0A 3ZE9A 4DIBA 1DI0A 2J09A 3Q15C 4BGVA 1XHEA 1A95A 1UMDA 3L43A 2D1FA 1NNLA 1ZGCA 3EVCA 1IG0A 4WEQA 2ZJ7A 2QLTA 5IX8A 2IW1A 3BWCA 3ID6C 3OOHA 1SIOA 2P4EA 2GHRA 1ZLYA 1F2TA 1VECA 1CRWG 2VHEA 4GZ3A 1NBWB 2PUFA 1I7PA 1CUAA 1U0SY 5JZMA 2QZ4A 2VZEA 3VVLA 2YY5A 4IDFA 3VR2D 1MRZA 4I5FA 3FMIA 3FNQA 1F0NA 4AWBA 1A4UA 4NAVA 2DY1A 2QVBA 3LTEA 4JGGA 3FDJA 2ZSKA 5K8LA 4FLEA 1X7HA 3WHKA 3QE2A 1EE9A 4NCBA 1KYWA 1C0IA 5D7BA 1AZSC 3CX7A 1LLCA 4R01A 2FK7A 3CZMA 2OHJA 2HQSA 2VPPA 4HYQA 2R6GA 3AJDA 3G5TA 5EJ5A 4FMDB 1IUNA 1YJQA 1VTKA 2G1KA 4WA7A 4BN0A 2L42A 5D5HA 4EKNB 4DV1B 1W2WB 2ZSBA 5IAAA 1X7XB 2CHVA 3IEKA 4X9XA 5TGZA 2DR2A 3BE5A 3HJRA 5J5AA 3PHIA 1GL3A 3JARA 3WGTA 3GLHB 1CT9A 1RPJA 4I5GA 4ZAGA 1P72A 4YRJA 4M9UA 2W2LA 5REQB 4GYKA 4PN7A 3BDIA 5CFNA 2XDQA 3P97A 3X1KA 4DMGA 3KQOA 5J2TA 4JLNA 2AC7A 4WLUA 4E94A 3L6BA 3CJTA 5DYIA 3UANA 3R7BA 4GQBA 1R4NB 2JBAB 4GPAA 5FB3A 4WT7A 1WXQA 1T43A 1YOVA 3G13A 1HYBA 1ZMTA 5K0ZA 3GYGA 3P2EA 2PO5A 3LXUX 2PO7A 3QNUA 1C0PA 5EJ2A 5F1PA 1AHIA 4MOWA 1D03A 2ZANA 4YCDA 5IBRA 3TDKA 4KIGA 5I8WA 3BE6A 1EDOA 4RX1A 3JZDA 1G98A 4EARA 3CH4B 3DKPA 4OJNA 4CLRA 5EE5B 2L18A 4Q4AA 1A76A 3RYTC 1AOXA 3QU7A 4O02B 1PGPA 3OY2A 4MMZB 1CLUA 4MI3A 1JZTA 4C6TB 4CM8A 3LXMA 2WKWA 3S6JA 4E7OA 4L5IA 3IEMA 5HKAA 3C7KA 5EZYB 3FOZA 1GU1A 3FPBA 4PS1A 2YOGA 1ZW1A 4LRQA 5IAJA 5JAQA 1GGNA 1T0UA 4A27A 2OHIA 4B75A 4ENPA 2PGDA 3ZU5A 5K8JB 1E3MA 2P9BA 1G55A 4JBWA 1IVYA 3A25A 5KTKA 2KLHA 3DCYA 2FWIA 1KC3A 4B1FA 1T8TA 1ODJA 4L9WA 4YBZA 4B0PA 2PA3A 1GPAA 4CMCA 4EHJA 2QDKA 4OO3A 3TQHA 3A70A 2A92A 5BP7A 1XALA 3EXEA 3SAJA 2YN2A 2YJ4A 4EYEA 5TMBA 1I4OA 3F49S 2DUJA 1JBKA 3N3BC 2B0CA 5JWHA 4MKZA 2A8YA 2C9CA 4EAQA 1U11A 1P4HA 4KXQA 4F85A 4XSGA 1BCSB 2YZKA 4N40A 1RADA 5DI9A 1QHNA 2CBXA 4IM7A 1PYDA 5G4LA 3IBSA 2O6LA 5ELLA 3H6HA 4Y1RB 3ZHRA 4BQPA 4NE7A 1AO0A 3I37X 2W2QA 4O8ZA 3ENVA 5FUVA 1KK0A 3QXHA 1CWUA 4NULA 1KWKA 1Q16A 2I9KA 1T9HA 4RXUA 5MN5A 2PMWB 3N2KA 4PZLA 5JROA 1CVIA 3UJCA 5FQNA 2N42A 5AVYA 4GG1A 4INJA 3WTCA 1RQ7A 1J70A 2RGAA 4ZJZA 3UPUA 1SOUA 1FJXA 5F3WB 3QBDA 4UTXA 2RGEA 4RTKA 3I8XA 1GUYA 3LK6A 4Z7OB 5TMPA 1QO9A 2BWJA 2G3YA 3ANSA 1U8AA 1OXTA 5EPEA 3EFBA 2AOUB 3FCAA 3LRXA 3P2JA 2JAWA 4ZCTA 4C14A 5CDFE 1L5ZA 2WSMA 4PG7A 4ROTA 1S3FA 1ZBQA 5AI4A 3ZHBA 1FP1D 3FDFA 3PEWA 1S2MA 3N28A 4B79A 3U56A 5DBHX 3A31A 3JQBC 2BT4A 3RAJA 4B33A 3IBTA 3KFVA 1B4DA 1PWZA 4QAJA 4DR7B 4CEHA 1A2BA 1PP4A 1YDFA 1X1BA 2QQ0A 3R5HA 4R7GA 3DQZA 4F3NA 4TS3A 5TRTA 4G84A 2IS4A 2AN5A 3O6VA 2CV0A 3F97A 3ND6A 4IFBA 3JV7A 1GZUA 4J1QA 4UBOA 3CH7A 1U9JA 4YRBA 1E1LA 5AVWA 4BMYA 5C9ZA 5JY1A 1Y6RA 4LY6A 1NR5A 4OH1A 2QXTA 4YV0A 1LBQA 3W4JA 1QX4A 3NYRA 4G9EA 2FWJA 4XM2A 4A16A 1EM8A 5EI5A 4R68A 4GO1A 3DE0X 2W6CX 3E2PA 3RS4A 3AF0A 4DXHA 1K8ZB 2PQMA 2VDJA 2JF0A 1CC1S 4DYDA 1RXSA 1YXMA 2IZ1A 3MOIA 3VR0A 1VLVA 2V59A 3K20A 1XRMA 4KXXA 3MUFA 1Z2CA 3BULA 1A9TA 3DFFA 5I9LA 3A2LA 2PBRA 1WXIA 2CMDA 4GZ6A 4TGLA 2Y9PB 2OA0A 2IZ6A 4WFJA 3RC9A 5FWXB 3RF7A 3F5QA 4P32A 3ZDRA 1RAHA 4ZZIA 1SZJG 2GOYA 1DKUA 1H6CA 4U5QA 5AI5A 3IPXA 5E3IA 5FOTA 4CDMA 3UM9A 4DNQA 5J58A 4DV3B 3AXSA 4XQEA 1TT5B 1E66A 1WMAA 3LVFO 2Z0MA 2VDQB 4PZPA 4Y2HA 2K7ZA 1YAJA 5EFOA 4IDQA 1D04A 4BBZA 5I4IA 3SC2A 4V0LA 1KJYA 2D0IA 4LS3A 3AM1A 3QMVA 1J5PA 2DLNA 1P73A 3DDZX 1UDAA 3UCXA 2WMOB 1QM5A 2QAGC 3T7CA 1QTRA 2HQBA 4HQ6A 4XLZA 2G5PA 5FADA 3CISA 4ZVQA 3RAFC 5HFJA 2C54A 4CN9A 4EM6A 1AMOA 4RV5A 2C2ZA 1RYDA 2RJNA 1EVIA 4GOKA 4JASB 5HCNA 1F2UB 1MX9A 3OJEA 1Y8QB 4QXAA 3LUHA 3PI6A 4CGZA 1ESNA 5B57C 5L3SA 1HXHA 3EXIB 5C31A 2ZQYA 3DBHA 4DBZA 1AC5A 2H00A 3E9QA 2VJDA 3LC0A 3MZ0A 1WCIA 4WOBA 3ZLBA 2HBZA 3NT4A 2DWQA 2CL6X 1TKAA 4BCBA 4CR7A 1SC6A 5BR4A 4YUWA 3IPCA 4M9RA 4NYIR 5DCLA 3M82A 9ATCA 1UMCA 2XE6A 4GR4A 2W2KB 5K4HA 1Q7GA 2VLBA 1UDRA 3SQNA 1L2TA 3STUA 3CLHA 1U8ZA 3SYTA 4BEWA 4A10A 3MINB 1U80A 3EG9B 2ZRFA 3IHKA 2Z98A 3PGXA 3D6JA 3T5CA 2G80A 2ID9A 3AEKA 3MWDB 5HRUA 5BVHB 3WRXA 2EBWA 3RBAA 3I28A 2E48A 3EH2A 2VZ8A 4WNYA 5I9TA 3TG2A 4F4UA 2H8GA 2NIPA 4EGAA 3I9LA 1NVTA 3KNZA 4O2AB 4BO6A 2BGUA 3FNRA 4CEIB 4KN9S 4AJKA 2JHAA 3C1TA 3PP8A 4MR7B 1CY2A 4RYDA 1R12A 4FYKA 2HA3A 4YJ3F 3GW8A 3THWB 1Q0HA 2C7QA 3NBMA 4LOIA 1S4MA 3AEYA 4B7CA 4GAEA 4X1YA 1NDUA 2FW9A 2Q07A 4YCBA 4CKBB 4CYMA 5AJXA 2QN3A 3ZU4A 4DEVA 4Q3DA 4PTYA 1BD3A 2Y2VA 2HYDA 2RHWA 3RJ5A 2P2SA 2LBPA 5C3UA 5ALFA 1N9ZA 1ZGBA 3OPQA 1NLYA 2GLUA 4I2NA 5DNCA 2NPIA 2HL6A 1ZI6A 1ZMRA 5H59A 5HCIA 4NICA 5HVNA 4JEIA 1NVDA 1PT9A 2ZB4A 1U90A 2WSYB 1PIWA 2DPXA 2CF6A 4BLPA 3N86A 4IH9A 4M76B 4KPGA 2FZKA 3ITDA 4PSVA 4RZHA 5B1HA 4EUKA 1V5FA 1T8WA 4N18A 1QQ7A 3BICA 3RANA 3S99A 4D42A 4MAAA 1EH5A 1RJ9B 2C4MA 2Y6VA 4DZTA 3K32A 3IXLA 1OPRA 2ST1A 2FSVC 2ZVPX 4C6RA 2QENA 1Z6QA 2VATA 4G24A 4OH7A 4AJ2A 1HBJA 4ZKDA 4NFSA 2JGRA 3F2VA 3JWEA 2HMAA 5AW6A 1GN9A 3T5TA 3PEFA 3ODPA 4ZT5A 4CMGA 3BHMA 3PENA 3QVUA 1DB3A 2DE0X 4J4TA 1AHPA 1FBNA 3E8SA 4FCCA 2PZKA 2VZ9A 4R1NA 3WK5A 4AKTA 2P35A 2YQZA 1PQPA 3KG2A 4WV3A 1Z5GA 4XDGA 4XR4A 4C6HA 4L72A 1MRNA 1ESMA 3DXXA 1ODIA 1BE0A 1A27A 3OHSX 4GOLD 2FP4B 2FP4A 2OC9A 3B53X 4XASA 4BVHA 2ESRA 1RWQA 1XD9A 3EFEA 4LFBB 1JYEA 1P1KA 4WBNB 1BG6A 2YJTD 5JALA 3PV0A 1M33A 4WZAA 1Z26A 2CMFA 4L0CA 4MVJA 2RHHA 3OD5A 4RFSB 2DTEA 2IA5A 3KSZO 3UHFA 2H9IA 3OCZA 3WOHA 3I2YX 4QL3A 3G2PA 4TT3A 1P60A 1ORVA 2QTRA 4ERNA 1NVWQ 4N41A 3E7DA 1WCV1 5IPFA 1EVEA 1FZQA 1DO2A 1OR8A 4CM1A 1NNUA 3MFYA 4IHKA 2V7UA 4R1TA 1E2EA 3E4CA 1KJWA 1A69A 1K98A 1X7GA 1RWVA 2A9FA 4FCWA 1O95C 1H0KA 5CMLA 1E3EA 1FSPA 4IQGA 2XQGA 2F1HA 1U94A 2PS0A 1XZBA 4DB4A 3JQBA 1XPUA 1OI2A 3A7EA 3PYLA 1YRHA 2BL4A 1VSTA 4EJ0A 1WKBA 2BC9A 1Z5UA 3GGOA 4BO3A 1MF7A 1J7KA 3VNSA 4A03A 4DAOA 3U09A 4B3TB 4LZPA 3WO1A 3FNGA 2H9AA 4V1CB 2ACEA 1UQUA 3QTTA 1QYVA 4FYIA 2IUEA 1E61A 3L77A 2E6KA 2D5CA 2E4UA 3VAAA 3AZOA 4MLCA 2MSLA 3VJKA 1P3Y1 3A3KA 1C9NA 2DOKA 3LD9A 5F64A 4EJMA 3FCCA 2CK3D 4IVRA 2F1KA 4A0GA 1J25A 3QY0A 2QIPA 3QEAZ 5BSFA