2Q3HA

The crystal structure of rhoua in the gdp-bound state.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
171
Chain Sequence
b'GVKCVLVGDGAVGKTSLVVSYTTPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLLAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQYSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras homolog gene family, member U
publication title The crystal structure of RhouA in the GDP-bound state.
rcsb
source organism Homo sapiens
molecule tags Structural genomics
total genus 60
structure length 171
sequence length 179
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2q3hA00
1NKSA 1S2MA 2CHGA 2V54A 1II9A 5TARA 1E32A 3FDIA 2EVWX 3L8ZA 4B75A 1SVLA 1XTKA 4JSTA 1OH6A 2AK3A 2EFDB 4NU0A 4QFMA 5EUMA 5K8IA 1KJWA 1R0XA 1KIMA 3MCAA 3RVBA 2EFEB 5FR1A 3ZDQA 5JHHB 1Q3HA 1E2JA 4HDOB 4ASUD 2ZRJA 3PUZA 2WPDA 1JR3E 3REFA 1DVRA 4LJ9A 4B2PA 4M9XA 1HH4A 4D0GA 1H8HD 3V4FA 4ESVA 4B3CA 1UBCA 4XSGA 1MV5A 3CUEF 4EPYA 4Z51A 3WNDA 5J4VA 1JQJC 2HF8A 3SFVA 3Q9LA 5FUYA 3GLFA 1IOZA 1HQCA 1ZNZA 2OLJA 2QROA 3LXXA 5F2EA 2IXGA 2Q9AA 1ZIPA 4IVPA 3QY0A 2HXYA 1E0SA 1U94A 4C7OB 1DELA 2R6FA 3EG5A 2ZI9A 4CDGA 1PUJA 1XTJA 2XNDA 2O8FB 3AF4A 5H68A 1SVOA 1KY2A 1XZPA 3QF4B 5FBLB 1IN7A 3ZH9B 2GAOA 1AIPA 4KFSA 2ATVA 3T5DA 4EFLA 1E0KA 3A1SA 2FEOA 3QNUA 2QT1A 3BERA 1SVIA 3AP1A 2QAJA 5F3WB 3KKMA 1NVWQ 1N5KA 4UJ5A 1II0A 3EIQA 2YWGA 2WKPA 2QEQA 1MR3F 1XWIA 1DAKA 4DUGA 4MKFA 4KODA 1YRAA 3DZDA 5LD2B 4UNNA 3BFVA 4F91B 2RKOA 4EDHA 5TV2A 1CJTC 2R44A 4E09A 1JR3D 1R5NA 3WBJA 1S3GA 5LB4A 2CCKA 4KU4A 5FTJA 3U3KA 1YJ5A 3OAAA 2GTPA 2EFGA 4A36A 1E1QA 2OFWA 4GL2A 4Z1MA 5JWHA 1J90A 1FQJA 1IY2A 1DAGA 2QRZA 2Z5FA 2JLZA 1SKYB 4RFVA 2CVFA 4KYUA 1KGDA 2D4HA 4L5BA 1Z0DA 4R98A 3VKGA 3VKHA 5JZVA 4CF7A 4KSBA 4KITB 4V0KA 5HR5A 4A8JB 2WMOB 5JWRA 4TTPA 1I2DA 2IF0A 1LF5A 5JCPA 5CB8A 3NTUA 2VF7A 1RYFA 1YZTA 1W5SA 3LW7A 2A2ZA 2HUPA 1CULC 1IQPA 3WMFA 3HDTA 3BGWA 5BYJA 3C15C 3QKRB 2VIIA 1NN3A 4JVNA 2XSZD 1Q0UA 4TT3A 1E2DA 3AVPA 1P9RA 4TQUS 1N6KA 2HDNB 2RGGA 5EE9A 3QBVA 1BYIA 3GJ6A 2WHXA 4KYIB 4ZDKA 4NCKA 4AC9A 4IXMA 3QEOA 4V0LA 1T0HB 3PUVA 3LDAA 3EPHA 4NONA 3PEVA 3WP1B 1GP2A 3QKUA 4LDJA 1HV8A 1UF9A 2XITA 1F3OA 3KFVA 1MABA 2IYXA 4XSHA 4C2TA 3FKQA 2IYRA 4FCTA 5KPJA 3B7GA 4WZAE 1ZAKA 4HAXA 4A6XA 1G7CA 3U7GA 1EFRD 1Z6AA 4GNKA 3U7EB 1Z0JA 4LOAA 1Q21A 3DHWC 3IEVA 4M1WA 2OFOA 2ZRDA 4UJ3A 1OXXK 3JZMA 1T3LA 2J7PD 1Z2AA 3CRW1 3KJHA 4JKIA 4LC1A 4RD3A 4URUR 4U5XA 1T5IA 5CJ2A 1DTSA 1W1WA 4X8MA 4C0HA 1NIPA 4HZUA 1Z07A 5EP2A 2BOVA 1ODFA 5SZHB 1NJGA 5G53C 3TJZA 1YR6A 4FN5A 1VIYA 4LYJA 5CM8B 4B3GA 2XOKD 2AKAB 1E2FA 4EQ6A 1NG9A 1E6CA 4M1YA 4B74A 4XVQA 5KNBA 5L3QB 3TGPA 3Q72A 2YV5A 5FUWA 3CPJB 4Q7LA 1GKIA 4B3FX 2PJRA 1U8ZA 2C2HA 2ZVQX 3L0SA 1KSGA 3OEEA 1XF9A 1VKJA 3BH6A 2ZRIA 4V0OA 2PT5A 5AWFC 3VNVA 5DSZA 1G9XA 2N46A 1XXHA 2AKYA 2QMHA 3VR1A 5SZKB 4Q48A 3OIVA 1EESA 4J0QA 1U9IC 3P20A 4DLSA 4QC2A 2BIFA 1U8YA 2KBEA 5CK5A 5L3RA 1X8KA 1PLKA 4DSOA 2G3YA 1N6LA 2EYQA 3QPUA 3VHLB 1SVWA 3FTQA 3X1DA 1ELOA 5FPYA 1GWNA 1Z0KA 3CF0A 5D3MA 1OJLA 1IJEA 5HZHA 3GJ3A 1T6NA 2VP5A 1NJFA 1XEXA 3LVQE 3NH6A 1KY3A 4HAZA 3OEHA 4E03A 4D81A 1TUIA 2D2FA 1DPFA 1FUKA 5DHAA 1P4SA 1S9DA 4DEXA 1G19A 1OFHA 1QHGA 1LS1A 1GKYA 3KJEA 3NKVA 1JPNA 2GNOA 4JVMA 5KNDA 2D3WA 4AG6A 3SOPA 2AFIE 3DDCA 3RS2A 3MJHA 3QBTA 1UM8A 2GBLA 4UXJA 2H1LA 2JATA 1XMVA 4Q02A 2QE7D 2JLUA 3PEUA 4G01B 4WXPA 4HDCA 2IYYA 3K0EA 4ZKEA 1LFDB 3K70B 2ORWA 3GJXC 2ZJ8A 1SXJE 3WXMA 5BN3A 4C0QC 2D7DA 4FMBB 3TUZC 1E9BA 2Z43A 1FMJA 3I62A 2WJYA 4JYBA 1CIPA 3TVTA 2O0HA 4JL6A 5H70A 1BKDR 4LBVA 3ZD6A 1US8B 2C04A 2GK6A 2VP4A 3DEFA 2QL6A 3U7FB 2JJ8A 1NY6A 4D4KA 1G6OA 3ZZTA 1N2CE 1ETUA 1HE1C 4C7OA 2EWVA 3BRWD 1IXSB 4HAUA 3OHMA 4BFWA 1BOFA 1SULA 1Z8FA 5EXXA 3KZ1E 2BMFA 1W0KD 5H8WA 1JJ7A 2XNSA 1ZM7A 1A1VA 4PZYA 2Q9BA 3QF4A 2AXNA 2HXSA 3IUYA 2ZRMA 1N0UA 4LPKA 3H2YA 1GNPA 2PMKA 2ZYUX 1XD9A 4KJZA 3NIBA 2WKQA 1Q22A 4PHTA 5TY0A 5HE9A 1Z22A 4P32A 2HEIA 3NEYA 1P2UA 1Z6TA 2G83A 4RD1A 1T0JB 4B2IA 2ZXUA 3DMNA 1G18A 1VG0B 1TU3A 2V7QD 2FE4A 2FF7A 4V02A 2QENA 4ZI2A 5FTKA 1CJKC 1W7AA 3C5HA 2P5SA 2OBMA 4OK3A 1AM4D 1JJVA 2P6RA 1ZMXA 4PO8A 4PC3A 4JLAA 3EX7C 1XBTA 3A58B 5KO2A 2FX3A 3K0AB 4ZCLA 1ZUHA 1XCMA 1HY3A 3T12A 1SXJD 4R2IA 1II8B 3QXCA 4ZDWA 2Z83A 4EFNA 4EKDA 1CBUA 4TMZA 4ASUA 2V8OA 3NBXX 2PEYA 3ZZ0A 1TMKA 1G7SA 2YINC 2DHRA 2IK8A 5EZ5A 2D2EA 1H8HA 3R7WB 3QXJA 4A82A 4TZ6A 2CL6X 4MH0R 3BWDD 3CNLA 1KTVA 4ZO4A 3C14C 3KTAA 1JECA 2PZFA 2ZS9A 1KO5A 2YWHA 4A8JA 3I1FA 4QBFA 4OI1A 3DZ8A 1KSFX 2XZLA 1AJEA 1TL7C 4Q9LA 1XEFA 1W0JD 2X8AA 4KI0A 1YR7A 2CXXA 4I1SA 1W46A 1FNMA 1MO4A 2F3TA 4RKFA 5FPKA 2CHVA 3QKRA 1UKZA 3WYFA 3EPLA 2QM8A 4C0BA 3FFAA 3W6PA 2A5DA 2ODEA 4IW3B 1GITA 3SE0A 2YWEA 5P21A 1MH1A 4D4MA 4E07A 1Q57A 4LBZA 4XOIA 1M74A 2F7SA 3IKJA 1JQLB 3VU9B 3P4XA 2NO9A 3IILA 4HAYA 1E2MA 2IHBA 1E2PA 4LGMA 4LCBA 2ANCA 3A6PC 4ZDIA 3AVVA 2MSCB 1GOTA 4MRNA 3GLIE 2IUTA 4E5UA 1N3BA 3SHWA 1SHKA 3B9PA 3I32A 4R7ZA 2W0SA 3AV0B 1BIFA 4ZDJA 2GJSA 3DO6A 2R62A 3K0FB 4DCNA 2JASA 3NXSA 1XCGB 2DR3A 1G5PA 1NNEA 1UEJA 1W48A 5DHFA 4CEIB 3DOEA 1EFHA 3FMOB 4W9MC 2VLIA 2ZU6A 2N42A 2NG1A 2OV2A 1FTSA 4URVR 5EZ6B 4R9UC 1ZBDA 1AKEA 1ZNXA 1YVDA 3H86A 3FYHA 3K1JA 4ACAA 2H7VA 5K8UA 4IFBA 4M8NE 3S1AA 1Q1QA 4US1R 1UKEA 2PMDA 4B43A 4FMCF 1DADA 1IN8A 3M6AA 1E69A 2VL7A 1G64A 4BFZA 2KE5A 4JKYA 2C96A 2ZSFA 4O2RA 2VF8A 3W6OA 4QM6A 2A5FA 3D3QA 4I1UA 3HU3A 3VR4A 3RSLA 1XP8A 3W6NA 1G8FA 1ZM9A 4GBMA 4BEBA 4POAA 1UEIA 1JXOA 3PUWA 4IEEA 2FSGA 1DOAA 3R8FA 1DAEA 2BWJA 2QMEA 4Q4LA 2C9CA 2MSDB 4M9SA 3AM1A 4TYWA 3HYRA 4BEJA 2FFQA 1X8JA 4Q4JB 5JI2E 1W36D 5JEDA 4YONB 5EQTA 2R6AA 4XIGS 2Z4SA 5C18A 4TLBA 1L2TA 2Q3FA 2VH5R 4BLQA 4BE7B 4TMVA 3K0CC 5HE8A 4LBWA 4BLSA 1S1CA 1Q3TA 3ADCA 5CJPA 8OHMA 4LJ8A 3GLGE 5K8TA 1Q20A 3THOA 4GMXA 1PV4A 2B7CA 4D0LB 3T15A 1E94E 3CW2A 1EFRA 3NVAA 3L8YA 4X8LA 2QQ0A 4DSNA 1XTQA 4BRWA 4DLYA 4PZLA 1J2JA 2J7PA 4BFXA 4P4TA 3CNNA 3KX2A 3DL0A 2IYQA 2OEPA 2D06A 4OK5A 4BZPA 3NBZC 4B3BA 4S35A 4UKDA 1N6NA 1RRGA 1R0ZA 1ANKA 4FI3C 4GPTA 1ZP6A 2ZIAA 2ZJBA 3SEAA 4A0GA 2IXFA 5DH9A 2B8TA 2I3BA 5F98A 1CRQA 3EXAA 3LLMA 1WBBA 5CK4A 3KB1A 2ZAMA 4AKGA 2X2EA 4O2LA 1OXTA 1US8A 2PZGA 4A2PA 4BFYA 4XWAA 2WJHA 4NCHA 2OBNA 3VTKA 3GCGA 1S4QA 2VEDA 4OJKA 3ZYCA 5IRCD 2ZJOA 1RFLA 3Q8XB 1UFQA 3O8BA 5FBWB 4PXAA 4E22A 2QPTA 2J1LA 2XAUA 3MUFA 2WWHA 4Q00A 3UWKA 2ZUBA 4EIWA 2JLWA 2GEDA 1VHTA 3PV0A 3K0SA 4DC9A 2WVJA 1CJUC 1E9CA 1AGRA 1KKLA 3I5XA 3TRFA 1VIAA 1BYUA 1D5CA 3LV8A 2CLDX 4JBXA 4QXAA 2GVZC 3VX4A 2FZLA 4LX0A 4MRSA 3MGCA 3JVUA 4MUBA 4TMTA 1I4TD 4B34A 2ONJA 3QPVA 4XTCS 1RC8A 1DG3A 1LB1B 4CW7A 1NG1A 1W4BA 1G5RA 3KKPA 4W5JA 3K0AA 2DB3A 4HAWA 4PR0A 5JECA 1U0JA 3QI2A 2F1HA 2NOAA 3A4MA 2G1KA 1Q1BA 3FHCB 3QEJA 2C8VA 1KI3A 1OW3B 3CKLA 3H1TA 1E2QA 2YHSA 1G8PA 2QE7A 3CRMA 2CMKA 2J59A 2Z4RA 1G7TA 1XTIA 3R7WA 4WW0A 3LLUA 3U4QB 4U00A 2PCLA 3CR7A 2REOA 4LJ5A 3EWAA 4Q1DA 1E9RA 2ZSBA 4DCSA 3PXGA 2X77A 3O8RA 4HUQA 3GFOA 1EG7A 2A3RA 4MYTA 1IBRA 3IO5A 1GVNB 5AUQA 3EA5A 1XPOA 1OIXA 5KHOC 2OBLA 3FMFA 3RHFA 4OQNA 1P61B 2AWOA 1FNNA 2ZROA 3R8CA 3UPUA 4DIDA 3BS4A 3EWSA 1NBMD 1VTKA 5G41A 2ZE6A 3IPYA 1W0KA 2F1IA 2A5YB 2ECKA 4EJSA 3TK1A 5KDDA 2VQSA 4CGZA 2VSXA 1XDBA 3SR0A 2VTKA 2WWGA 3H0KA 4OI2A 5FPHA 4P33A 4A2WA 1DAHA 4RFSB 2X1VA 1X1SA 2BM0A 4WOPA 3VU9A 2YWFA 3GMTA 5C46F 2QMUA 1FOEB 2OSBA 4LV8B 4AD8A 2BMEA 2TMKA 3GJ7A 1XX6A 1C1YA 2V7QA 5GADl 3OE7D 1V43A 3TNFA 4FCVA 4QGAA 2ODWA 1NVUQ 3CRRA 4H1UA 5KUTA 1TAGA 4NBSA 4RY2A 3K0FA 1U0HC 4GOXA 5LDDC 1RW4A 3MFYA 2UVQA 4HDQB 2OESA 2Q3HA 4W5HA 1OB2A 4CEIA 1P60A 4LJ7A 5JJLA 2ZTSA 1E2LA 2X2FA 2GESA 1JBKA 1E1RD 2BEJA 1SXJA 4C0KA 2GRJA 3SDZA 4A92A 2CL7X 1E3MA 2GDJA 2Q21A 3GJ0A 3FMPB 4RSGA 4K46A 2V1XA 4GZLA 1JEEA 1UPTA 2CE7A 5B58C 2W6IA 1FUUA 5HKKD 1NN5A 1KO4A 4QBHA 3PITA 3EAQA 1KI8A 1KI7A 2IW3A 2EYUA 3DMDA 5J4HA 5D3MB 3UG6A 4BQSA 4RVCA 2ZSAA 1ZNYA 5C4MA 5CDFE 5IK2D 1JI0A 1XEXB 3TE6A 2YOFA 3UIEA 2DWPA 2ZS7A 3TW4A 1W0JA 3CBQA 1TEXA 2Q3MA 3MD0A 4EJSC 4LRWA 3EC1A 4Z8YA 4IDQA 1W2GA 3FVQA 5FOWA 1WA5A 2P6UA 1UJ2A 1EWQA 2DFKB 1FPMA 4Q4JA 3ETLA 4HB3A 2CDNA 4NTZA 4NPHA 1E9AA 2OILA 3T1TA 2P2LA 3U6BA 1G4AE 2JJ2D 3ND9A 5J4KA 3KJIA 4Q9HA 4BZXA 1K5DA 2B21A 1KI6B 4P31A 4HB0A 5B57C 1E2KA 1XB2A 4AK9A 3M0EA 4EPXA 4IOMA 3PEYA 1CJVC 1P3JA 3KKNA 5A5GA 4M1TA 2DFTA 2NZJA 1KZ7B 1UBGA 3GJ5A 3M1IA 3A1VA 3TIFA 4C3ZA 3MLEA 4IDNA 2QI9C 2GA8A 1SXJC 3RC3A 4O3MA 3CB4A 4ZIRA 2ZVPX 1QRAA 3W5JA 4D82A 2IYLD 1N5LA 3VMFA 3GP8A 2IYTA 2BHRA 3ASZA 1CR2A 3PENA 4QGFA 3KQNA 3DOFA 1K6MA 1R0WA 2OAQ1 3LBIA 2FWRA 1KK3A 3TR0A 4K81B 3ZVMA 4BLTA 1ZC4A 3B8HA 3B5JA 3ZGXA 3KXKA 4LI0A 4Q9KA 3A1TA 4GOKA 4B33A 5JS8A 2HJVA 3PG5A 1KHTA 3LA6A 4L15A 2ZS8A 3KL4A 4NYJQ 4XTRA 2DPXA 4FWIB 1XFAA 4ON9A 3R9IA 1RRCA 4CYMA 3OESA 4IDHA 5FTLA 1FP7A 3IHWA 1E9FA 4MKIA 1QDEA 4DLTA 4IHQA 4IXNA 2DFNA 1Q44A 4JVSB 5D3QA 1U0LA 4YXWD 5JHGB 1WE2A 1H8ED 3CPEA 2J3EA 5BWMA 1J8YF 4HEJA 4PFSA 4Z8XA 1T5LA 5E7MA 2LWIA 2ZJAA 1NLFA 3HU2A 1N25A 4MA4A 1HA3A 3KKQA 4P0TA 1IN6A 2OM2A 5DIFA 3I61A 4II7A 1A4RA 3AVUA 5AJWA 4W5WA 1KDRA 1TPZA 2F43B 5FOVA 1YE8A 1QHIA 1Y63A 5GVRA 4DLZA 2EWWA 4HZIA 2IYVA 1ZNWA 2OFXA 1AZSC 1LW7A 3KTAB 4TQAA 5IDVA 1UBFA 2GXQA 4NDZA 4D80A 4TWZA 1KJYA 1WBDA 4PX9A 3KB2A 2HCBA 1AA9A 2WIBA 4QNMA 3RS0A 3FOZA 2ORIA 4M1OA 4JBYA 1OXVA 1U9IA 1ZCAA 4NYMQ 3U4QA 1HE8B 1SGWA 1XJ0A 1AKYA 3JVVA 3FB4A 3F8TA 721PA 2JJ1D 3KJGA 4EPVA 4L9SA 4P4SB 1KSHA 2ZRHA 5FL7D 5HCIA 4B2LA 1N5IA 2IUSA 3TSOA 1D8TA 1FZQA 1CR1A 3ZQJA 2CCJA 5FOSA 4AKIA 2IEZA 3UMFA 1YQTA 4Q4HB 3SHFA 1A82A 3A37A 3AF2A 4WVFA 1G1MA 4L4UA 5B2ZA 1ZJ6A 2Z6VA 4TYQA 4AKEA 2AHOA 1EX7A 2IUUA 1LTQA 5LBIA 3LBHA 3B1ZA 4Q66C 2LKDA 1W36C 1QHNA 3WYGA 3Q85A 4RFSA 2J0SA 1E9SA 4HUTA 3X1ZA 3MAAC 2WICA 1P75A 4D2IA 1JAHA 2JAQA 3WY9A 5DGXA 2NQ2C 1OB5A 4CEHB 4TTQA 4LSGA 2BJVA 4PZZA 1G16A 3EIEA 5HPYB 1DAIA 2W83A 3VFDA 2W2VA 4A6PA 3BB4A 1G3UA 3ZVRA 4Q5IA 4RZUA 4OQMA 3LH5A 4RZXA 2H57A 3SBDA 5TMPA 4PC7A 3S1AB 2OAP1 4BWYA 2CJWB 3ADDA 1TQ2A 1E0AA 4GFDA 2IS4A 2ERYA 1NMYA 1OHHD 2WM9B 4JLBA 4KFTA 4CZ2A 2BEKA 3AF1A 2ODNA 1IXZA 1AK2A 1FTNA 2A30A 5EXPA 1QHSA 2O0JA 1G41A 2OCBA 1E2IA 2YZ2A 4A1FA 1Z6YA 4BLPA 1XCPA 5JSZB 3A1UA 4G5OA 1C4OA 3A1WA 1Z29A 2G0TA 2P3SA 3B2EA 1LV7A 3EIHA 4DJTA 1F48A 3CWZA 4DLUA 2C9YA 5C4GB 2O8CA 1A2KC 1Z0IA 4N3NA 1NSTA 4MYCA 1E4VA 2C95A 2A9KA 2BM1A 1L4UA 3HR8A 4Q1CA 1T4GA 4AY2A 1EWRA 5CITA 4M1SA 1NBMA 4C0AC 2F3RA 2GZAA 1RPZA 3T06B 3EZFA 3HR7A 2OE2A 1MOZA 3K8YA 2GEUA 4LHVA 2YYZA 4BASA 3K9HA 4ILEA 2FA9A 2FPKA 4ZPXA 2QP3A 1KI6A 1IXRC 2QZ4A 3HPRA 3K9LA 3RRNA 3GJ4A 4M0LA 4HLCA 2FPMA 5JLJA 3GEHA 1R0YA 3WHLA 1L8QA 3LXRA 4UNQA 4A9AA 2BBOA 4JJKA 3G5UA 1D2NA 2ZRBA 3OE7A 2FSIA 4R2HA 2ZI4A 4TL8A 1J99A 2XJ4A 1TF5A 1GL7A 1GAJA 2JLSA 5L8VA 4F4CA 1OV4A 2OLKA 1TX4B 4KHZA 1LS6A 1S9HA 5GJBA 4HLUC 4NHOA 3CRQA 4DB2A 5KSPA 4U02A 4EAQA 4KCGA 5JFGA 1E1RA 3BH0A 1JR6A 2EFHB 2JLQA 2QP9X 3IBGA 4JLKA 1XMJA 4M1MA 2WJJA 2YNMA 3SJCA 4KFRA 3TVDA 2EU8A 3TMKA 3IHLA 3I73A 3C5CA 1P9WA 4JT4A 1TNDA 2WWIA 5HKKA 2CVHA 5TDHA 4C0SA 3GLHE 2R2AA 1KNQA 2C78A 3TUIC 4WZ6A 5IK2A 3GFPA 2V55B 1E2NA 2O8EB 4KBFA 3IEUA 3W90A 4HATA 4MGZR 2XZPA 1TEVA 3CRVA 4OK6A 5CYPA 4A2QA 4DZZA 3KQUA 3RAPR 3MJRA 5KSOA 1NVVQ 2PCJA 5EE3A 2VHCA 1SQ5A 2UZIR 1VYTA 1KDTA 1GKUB 4D26A 1S0UA 3HWSA 1KZGB 1G8GA 2JJ2A 1AN0A 2YOHA 4MRVA 1CR0A 1GRNA 3VX3A 4DWJA 4PPNA 2WZQA 2JLYA 3OZXA 5J40A 2I4IA 2BCGY 3E70C 3AVQA 3NWJA 2FH5B 4M2LA 3QG5A 2R6DA 3CIOA 3CX6A 5KOYA 2F43A 1W4RA 2ZI5A 3D6TB 5EE5B 4Z54A 5M04A 4ZCIA 5HZKA 1KDOA 1XZQA 2PLFA 2WMNB 4B44A 4BLOA 3ZJYA 1CRPA 4LJAA 3UANA 1KO1A 3QE0A 5DNYB 4HUQB 4MKGA 2G88A 1VG9B 4K8OA 3GLFE 1C9KA 1ZD9A 4B32A 1W49A 4Q4AB 2HT1A 2ONKA 3BOSA 2FSFA 4NMMA 4A0FA 3WYAA 2L0XA 1XPUA 3R20A 4IEIA 4YDSA 3QJYA 4LC0A 2D74A 4P4SA 4EJSB 3AQ4A 4HB2A 2NIPA 5FBQB 1JXMA 1X86B 2ZR9A 4V03A 4EPRA 1KO7A 3AVWA 1GSIA 3N2EA 3AKEA 4MDFA 3M4YA 3U44B 4Q4HA 2XGJA 1KYIA 3RSOA 1G3IA 4QHTA 5CB6A 3CM0A 1GTVA 3K0CA 3V9PA 1IY0A 3VKWA 2KI5A 3T5GA 1PLLA 1RRPA 2O0KA 3AP2A 3L82B 4KLNA 3LBNA 2WJVA 3ONWA 2MMCA 4B3DA 1RVDA 5FOUA 2REXB 4QHSA 5IT5A 1UKVY 4OL0A 3BAFA 1IAQA 4LPSA 3I3SR 2XB2A 3E2IA 1KK0A 1LVGA 1JR3A 1OPXA 5J4YA 4CEHA 2VSFA 4OQXA 4FMCB 4XVRA 5GJCA 3ZD7A 3ADBA 2FOLA 1KJZA 4RD6A 4YXWA 2RH5A 1H8EA 1E96A 3AKYA 2QY9A 3SI7A 1QG2A 4PHFA 1SXJB 2GCPA 3BC1A 2J87A 1ZUIA 2IYWA 4IFEA 5AR1A 3MWJA 2HYDA 1NP6A 3LRPA 4O25A 4LJ4A 4QOSA 2Q0HA 4RJLA 1GG2A 2OO7A 4CVNA 4LZZA 4G1UC 3WNCA 4Q21A 2CJWA 2REBA 4KFUA 4MDEA 1QVAA 2H8KA 3QPWA 3KQLA 4QKQA 4CT4B 1N6HA 1G4UR 3T1QA 1KI1A 2CK3D 3B1VA 5B64A 1DAMA 3BK7A 2Y8EA 1IM2A 1P73A 2B8WA 1GRRA 2HJGA 4G5RA 3QIAA 1G291 1ZU4A 2ZJYA 4W7SA 3SFZA 3KQKA 4BGDA 4BFSA 2XNDD 5JSZA 5DO9A 3X1YA 2FV8A 1VYUA 2X19A 4GI7A 5FL3A 2OUKA 3LW8A 2MSEB 2XSZA 3U61B 3D7MA 2JJ1A 1Z63A 3GEIA 1IJFA 2FPLA 2W6JD 5FL7A 1BMFD 3TLXA 4UXHA 2LCFA 1P5ZB 4LYFA 2GJAA 2V6JA 3NHBA 2QT0A 3QKSB 5CLLA 4TSFD 1RYHA 1Z2CA 2A5JA 5KYKA 2PJZA 1MRNA 2UKDA 1M2OB 2LKCA 4Q47A 2ZR0A 1YZLA 4URZR 1RRFA 4YMWA 2ZRGA 2C77A 1XPRA 1XJCA 1ZW6A 221PA 4ZI3A 1QHHB 2ZI3A 4PSVA 3FHTA 4CRWB 4CIDA 3ZS9A 3KKOA 2XZOA 1P7CA 2GF0A 1PZNA 4PHHA 4KVGA 1K8RA 1NY5A 4NCJA 2WAYA 1DO0A 2NGRA 1GRQA 3LQRA 4IRUB 1RZ3A 3CX7A 3RRYA 4ZIRB 3THXA 1UBEA 3DM9B 2CEAA 3O8DA 2WJGA 1U8AA 3SN6A 4WAUA 2ZSEA 2PBRA 4KVAA 1F60A 2XOKA 3QQ5A 4MRPA 3WRXC 3ASYA 2PX0A 5SZIA 1XTRA 4ABYA 3TAUA 2IYUA 3K09A 2QORA 2JA1A 3ICEA 5GJVC 4OJQA 4B6EA 3T1OA 3LNCA 4LHWA 1Z47A 1FP6A 1ESNA 3U3MA 5JCZA 2VPPA 3MMPA 1LY1A 2G1JA 3RWOA 1GNRA 1ZVQA 2JIZD 5FPTA 2Q9CA 1OHHA 2RGCA 2QBYA 1UKYA 2FN4A 2ZREA 1XXHE 5DLQC 4F92B 2BBWA 2GJ8A 4EPWA 2BDTA 1T8UA 3OF5A 4PQFA 4FMDF 2ORVA 1HQYE 3EC2A 2BV3A 3GFTA 1DARA 2XXAB 2QGNA 1G21E 2CNWD 2G6BA 4Q03A 4XWOA 3WBKA 1TUEA 3NG1A 1W36B 1JAIA 4OI4A 3T1VA 2N1BA 2O8EA 2H16A 2DBYA 2Q6TA 2FFBA 3SYKA 3GLIB 4PHGA 1QG4A 4PPQA 4G3XA 2ZJ2A 1GM5A 1WDTA 2FDCA 1KI9A 3AGQA 3AGPA 5FI0B 4PC6A 1XMIA 1OLOA 2CLCX 3IGFA 4NYJR 1QHYA 2F9LA 3CH4B 3LQQA 2WWFA 3EZ6A 3RS4A 5AUPB 4ACBA 5C2JB 5CM9C 3VR3A 1VDZA 3TQFA 3EPJA 2IXEA 4UNSA 4F7WA 5FH9A 4GOJA 1VECA 3QUSA 1W5TA 5AK0A 3W5IA 1RE0A 2ZYTX 3BORA 1CKEA 3WP0A 1R4AA 2IT1A 1XD8A 3QKTA 4B48A 3R9WA 3K09C 1DEKA 3TH5A 4R71A 2ZSDA 3GJ8A 3DKVA 2JGNA 5EP1A 2P0EA 5CYOA 4NKRA 1F2UB 1VPLA 3CZQA 3KUDA 2WTUA 3ZIAD 2FGKA 4N0EA 1OIVA 521PA 2PL3A 3IQWA 4OBEA 2RGBA 1VCOA 3X1WA 1DS6A 1KAOA 5EXSA 1FL9A 4TTRA 4BUJA 2C03A 1KI2A 3CO5A 3EZ7A 2GXUA 3SJBA 3RWMB 2ZUCA 3WMGA 1T91A 2NTYC 4QRHA 4Q4AA 1IN5A 1KOFA 1RIFA 2JEOA 3F5FA 3PJRA 2AFHE 2FZ4A 4L16A 4OHXA 3K9NA 3HJNA 3Q7QA 3HP1A 4XVUA 5FBRB 2AN9A 3SJZA 1U98A 4NYIQ 3BBPA 4B76A 3REGA 4PSAA 2BCJQ 3U44A 1GFIA 4JSYA 4I4LA 3OEHD 4NYMR 1NMZA 3P32A 1OH5A 2J41A 4HLQB 4JS0A 3RRMA 3TBKA 1E9DA 3NBYC 3UATA 2H18A 2FEMA 2OG2A 3MWKA 3EPKA 4OI0A 1S3SA 5FFMA 4BZQA 4QBGB 2QNRA 2KBFA 1F2TB 2VP9A 1FQKA 3L2OB 1ZCBA 1O3YA 3GQBA 2QAGC 1OIWA 2IWHA 3VQTA 4MKHA 2ZM5A 1L7VC 4MUAA 4D6PA 2WOOA 4OQLA 3I4LA 2DYKA 2O8DB 3BFXA 4KXFB 2NZ8A 1NLYA 1Q1ZA 5JJKA 4FWTA 1KK1A 4QGHA 5CIQA 3I8XA 2RHMA 4P3YA 4TQ9A 1BO6A 3AVYA 4D4LA 4LJYA 1S8FA 2FU5C 1XEWY 2XJ9A 4BRUA 3F0TA 4AWXA 2PEZA 1OFIA 4TLAA 3BB1A 4Q7JB 1CF4A 2OCAA 2GK7A 4URXR 3L0OA 1D2MA 1FW6A 1R10A 3W8RA 1ZC3A 4V0NA 1QZXA 1SKYE 2V6IA 4PC2A 2E9SA 4Q18A 5J5CA 1Z6XA 2O8CB 4TL9A 3SQWA 3KFXA 2O8BB 1CP2A 3CLVA 4TN1A 2F9MA 4C0LA 2O52A 2B92A 4C4PA 3RLFA 3ZLJA 4GDFA 4NE2A 4TMXA 2IS6A 2ZEJA 1X3SA 2NO7A 4TYNA 3OIWA 1X1RA 2BKUA 4LUCA 1FFHA 2YC2C 5EE1A 1YHNA 3QKSA 3W3ZB 2OXCA 2VO1A 3MG9A 1T9HA 3Q7PA 1W47A 2HV8A 4C2UA 1VG1A 4LWZA 2R6GA 3A4LA 4ARZB 1M1YE 3CONA 4YDHB 5JI3E 2ZITA 1T8TA 2ZR7A 2BMDA 4I81A 2R8RA 1IONA 4B73A 3U3RA 3NDBB 1B23P 4Q1AA 1EFCA 3SYLA 4M53A 5KU1A 1P6XA 4GMDA 1QHHA 1R7RA 3BD9A 3PVSA 1VHLA 2ZJZA 4IDPA 4Q19A 4LHZA 1AS0A 3CNOA 3U2QA 4ZCMA 5LB2A 3LFUA 3OFND 4PAOA 3PFIA 4NCIA 1G3MA 5ELXA 1SVMA 1W2HA 4IOJA 3CH5A 4DCUA 1GDDA 1V5WA 2F1RA 3SZRA 4C9BA 3U3OA 1WB9A 1HEIA 2ZYWX 4A4DA 4WBSA 3QVUA 2OZEA 2IX3A 4LHYA 4OHWA 4JLDA 4IOLA 1M8PA 5CLQA 3HYTA 1HT2E 2WWYA 4IVQA 1TF7A 4GRAA 1NF3A 2VRWA 4N1AA 1IN4A 2R65A 3CF2A 4Q1FA 3HU1A 2B6HA 4JLMA 2G9NA 3PUXA 1YZKA 1PJRA 4D4JA 2CK3A 2JDID 4LK2A 3G0HA 2NMVA 4DDVA 1P2SA 2R9VA 2VP2A 2QUZA 3B60A 2FJUA 2WIAA 3NDPA 5E95A 3LY5A 4U7DA 2RAPA 2GVDC 4A15A 3RRZA 1G6HA 2XXAA 1Z0AA 2IS1A 2V3CC 1KI4A 1MO5A 2G77B 1NVXQ 3VR2A 3OIYA 1VMAA 3UMRA 5AJZA 4BFTA 2RGAA 2W6JA 4KLZA 4M1KA 1BMFA 2ATXA 4I1OA 3GLIA 2QSZA 4AYWA 3SS8A 4TSFA 3L43A 4DDUA 2RCNA 3CF6R 4F93B 1NMXA 4WIAA 3C16C 1SHZA 2BC9A 1S96A 1NLZA 3TKLA 1A7JA 3NHAA 1ESMA 3W8NA 2BBSA 1UDXA 5TXGA 1COWD 2Z0MA 4Y0VA 4YMSA 4JLNA 1T3SA 5J47A 5E7IA 1JALA 1R2QA 3KQHA 3C4JA 3Q3JB 1M7GA 1NVVR 4IDOA 3CWQA 3LX8A 2ZRCA 5FTMA 1E0JA 5IHPA 1I4LD 2DFLA 4B47A 2UZ3A 4OYHA 4PC1A 3E5HA 5B30A 1F2UA 1IY1A 2V9PA 1KDPA 5EE0A 1JEDA 3T61A 2H92A 3A8TA 3ZQ6A 3I72A 4QL3A 5G3ZA 3DVLA 2NPIA 1DG1G 3G82C 4B35A 2YVUA 3LX5A 3CX8A 4DSUA 4LY6A 2ZAOA 3O47A 4FW9A 1TF2A 1Q12A 2JIZA 3AVOA 2RGEA 1CTQA 2D62A 3EASA 3FFBA 3RANA 1HTWA 3THYB 1R8QA 3QVVA 4DHEA 1D6JA 1TQ4A 4JBWA 4V0ME 3RS5A 4US2R 3I5YA 1OFTA 3Q5DA 2ZI6A 4OHZA 2ERXA 5C1BA 5H1YA 2QGZA 2GZDA 2C98A 1GILA 4HI0E 3THWA 1J7KA 3SQXA 4G5GA 2KWIA 1Z5ZA 1YR9A 5DYGA 2DWQA 1WQ1R 3IIKA 5SZJA 1M34E 2QG6A 4G5QA 2CNWA 5FTNA 2VHJA 3BE4A 1GIAA 1WXQA 2GILA 2IEYA 3GLGA 1SKQA 1U99A 1TADA 2HT6A 3BB3A 1LNZA 1ONBA 1ZD1A 1TQDA 1F2TA 3BIFA 1OT3A 2WSSD 4RZ2A 5A0FA 3PIRA 1CR4A 3U5ZB 1MO3A 4GP7A 4EPTA 2YOGA 5AUNB 5EP3A 2O8DA 4PAQA 2EQBA 2XEXA 4RD4A 3WHKA 4JVLA 5KSZA 4PQRA 4JIMA 5FR2A 2IYSA 2WKRA 2HYIC 3AKDA 4AG5A 3T34A 4PPGA 4HLUA 4ZV4A 3LWNA 3K70D 2QMOA 3I92A 3NH9A 3P26A 1FMLA 1J70A 2W2TA 2KJQA 3F3YA 2AR7A 1VCMA 3ECCA 4MGYR 1JNYA 3KXIA 2AX4A 3RNLA 1NKTA 4TZ0A 1G3RA 5ANRB 4N0DA 3FPAA 3QSYA 3A4NA 3DPUA 1R6BX 3K53A 3QXSA 1F5NA 3ZIAA 4DLVA 3PR1A 4XJXA 4EFMA 1E4YA 3TSZA 2PX3A 1AQYA 1DO2A 4DIEA 2O8BA 4S2EA 1VCIA 5AJVB 3KDSE 4I99A 2QN6A 2RGNA 4M22A 4RZ3A 3BXZA 2ZJ5A 5AJYA 1VG8A 1NIJA 3VR5A 1CLUA 2ZE5A 3EZ9A 1J8MF 2RGDA 3ZVLA 1KAGA 4IVRA 3FKSD 3N2IA 5E3HA 2XTZA 4NZYA 3WNBA 1XD2B 3VNUA 4IOKA 1CEEA 3KUCA 4X8HA 1CJMA 2PLRA 4UXIA 4B71A 5BW8A 3L0IB 5FUVA 4M21A 2QTVB 4ARZA 2ODBA 1P2VA 4JJZA 2PH1A 2J0UA 5DE3A 1HT1E 4A0HA 4PSKA 3JZAA 4RKEA 2NO0A 3THXB 1RKBA 3BJIC 4C30A 3TW8B 4AYTA 3X2SA 1U2RA 2NPFA 5GJWC 1N6PA 1WMSA 2VP6A 2WOJA 1MRSA 4YMVA 4YQFA 4LV6A 3U60B 4DLRA 1KMHB 2C5LA 5FI1B 2OCPA 2OT3B 2RMKA 5HTKA 1AGPA 3WMEA 3IBYA 5FPSA 3U7HB 2IBMA 3CPHA 2CLSA 2V4ZA 1G3QA 4DLXA 2RGXA 2QBYB 5L3SB 2RB4A 5J4LA 2CCGA 4OHYA 1N6OA 1NL3A 2D7CA 3ICQB 3IIMA 2WSMA 1EK0A 4CT5A 1B0UA 3OIUA 4F4IA 1YZNA 3NEJA 4XD7D 1Z3IX 4D25A 3EW9A 2OXRA 1EGAA 1E79D 3DM5A 2QM7A 4FD2A 2J0VA 3QF7A 2H5EA 2RGNC 2GF9A 3TAHA 1YZGA 1BH2A 2VSOA 1E2GA 2QPOA 3CZPA 3PEWA 1ZINA 3MSXA 3GD7A 2O8FA 4TLEA 2HCJB 3VAAA 4YLGA 1MO6A 1Q1EA 4GP6A 2VHUA 4HAVA 3QXXA 4QJ5A 3ZZUA 1G7RA 2OCYC 1N0WA 3B6EA 3SC3A 4ZKDA 1ZD8A 1X6VA 2QAGB 1P62B 3Q5EA 4DKXA 4Y0AA 3GPLA 2ZPTX 2YKGA 2DWOA 3FHOA 1G5TA 3ND8A 4TLDA 5KTYA 1WCV1 1Z83A 2P67A 2E1RA 4JT2A 1SVKA 1R5OA 5UKDA 3X1XA 3QOFA 3FGNA 4QM7A 1T3HA 2FNAA 3RDPA 2IWRA 1EXMA 2IA5A 3HPQA 2GBLC 4Q7KA 1F6BA 1D2EA 3AF0A 1EFTA 3DKPA 4F38A 1WRBA 2CHQA 3B82A 3OFNA 5JMTA 5JS7A 4QG7A 2F55A 1W4CA 3MRSA 4QBIA 4BECA 5EUQB 2GHIA 1AS3A 3CR8A 4PPFA 4M9ZA 4CEJB 5JJIA 5EXTA 5G3YA 4G0NA 1A5TA 3AKCA 1OYYA 1ZM4A 2A78A 2W6ID 5FOTA 1NN1A 3TSWA 2AK2A 4DDWA 5DN6D 2GXSA 1OKKD 4KBGA 5CDFA 3O8CA 1UDWA 3MWYW 4KV9A 2QQEA 1DE0A 2PZEA 2FG5A 4US0R 4XWKA 2ZYVX 3THYA 3U3JA 3QENA 3PUYA 2QTFA 2VHTA 1PLJA 2C9OA 2QA5A 2JDIA 5TB5A 4TL7A 4H9GA 3B9QA 2HLDD 4BPBA 1R5BA 2NO1A 3B1YA 2XX3A 4DCTA 4AKHA 3TQCA 4LBYA 1EFUA 2QRNA 4BFVA 2R6CA 1U81A 4JYCA 4NCNA 2ZQ5A 3SBEA 2EW1A 2QTHA 4TLCA 2J0QA 1GL9B 2IF2A 4HB4A 2MMGA 2ZRNA 2BMJA 2AWNA 1E99A 4DT1B 4WA7A 2IC5A 2WAXA 2WPDD 3BFKA 3AH8A 4NYIR 1KSJA 4C0JA 4H1VA 5LD2C 2WWXA 1GL6A 5GVSA 2IHYA 3N5CA 2ZRAA 1XTSA 4P4UA 2HF9A 2QP4A 3T35A 4DSTA 5DI3B 1FX0B 1ZM2A 4JLVA 5BN4A 1XU4A 1ZU5A 1SVSA 1XJQA 3I8SA 4NP6A 4PANA 4PTLA 5DISB 5EP4A 5JBQA 1YU9A 1QBKC 1PUIA 1QHXA 4GT1A 3QG1A 2J45A 3R9XA 4DB4A 3GEEA 5FBVB 1COWA 1P72A 3FWYA 2RHDA 5BN5A 2O5VA 1OH7A 3VHXA 1TQ6A 2CE2X 1E9EA 2ASEA 5L3QA 1YZUA 3AUYA 3RABA 3A36A 5LPNA 2ANBA 2XTMA 1OFUX 3B1XA 4RCYA 4FIDA 4QHYA 2BKEA 1OE0A 5JWOA 3GLHB 3NC0C 4A8JC 5L3VA 1JPJA 1TU4A 1M7BA 3D31A 2CL0X 3RC8A 4UQOA 4AIIA 2VYFA 2FMXA 4OHVA 3V4RA 2G0NA 121PA 3UMSA 1HURA 4IJMA 1VCNA 1M6NA 4XH9B 2B7BA 1WF3A 4QJ4A 4AURA 2FFHA 3B85A 1RJ9B 4L8GA 2DY1A 3K9GA 4DUGD 3EA0A 2GCOB 5F9FA 1QF9A 4Q9IA 4TMWA 3FE2A 4AI6A 3W34A 1XD2A 3FMIA 1O87A 2WJIA 3RS7A 4DVGA 3OAAD 4KAXA 4Q7MB 3PQCA 3E1SA 2ZUDA 1E1QD 1KK2A 2XTNA 3NBFA 4Z1MD 5BYKA 1HUQA 2ZANA 2ZRFA 4L9WA 2GKSA 3UXMA 1AS2A 3P1JA 1P9NA 4PQYA 1OYWA 2K5UA 4D0NA 3C41J 2SHKA 2WSSA 2H17A 5BQ5A 2ZRKA 1I2MA 1Z28A 1ZYUA 2BBTA 4NL4H 4M4SA 4URWR 1KMHA 1N6RA 2NO6A 2I1QA 2CBZA 4MGKR 3TUJC 4LYHA 4KSCA 4FMDB 5K8LA 2QU8A 1YRBA 4MYHA 3GLFB 1H65A 3N70A 2KSQA 4DCVA 1E2HA 1E2EA 1YR8A 2QPAA 5L3SA 2J9RA 4Q01A 3C8UA 3ZVNA 1ZUNB 1IHUA 2F1JA 4YMUA 1N5JA 3H4MA 3VR6A 2XB4A 4JL5A 4WXRA 1W4AA 4TT3D 5HCNA 3W3AA 5TVKA 1Z08A 3ADKA 4LV5B 1G8YA 2GCNA 1AQUA 1JB1A 1N0VC 2V1UA 4FINA 3AVXA 1G17A 3UWOA 2I1VB 2GZHA 4TL6A 4V0MA 1W44A 3SJAA 1OH8A 3KXLA 3QXHA 1D9XA 1MT0A 4M9QA 2GJ9A 2JCSA 3P27A 2JLVA 4OKSA 3IO3A 2GJKA 5EJEA 2GXAA 5DI9A 3B1WA 3J81k 4MRRA 1NSFA 1Z06A 3EZ2A 4LYAA 5KDOA 1QVRA 1Z0FA 4DLWA 4O0MA 3FKSA 5A4JA 4UNPA 621PA 4Q1EA 3B78A 2QAGA 2GEVA 1NBME 2W00A 2FSHA 2VA8A 3EARA 5BXQC 1XEWX 2BVNA 4FCWA 1NI3A 4IKEA 1R8SA 2J46A 3UG7A 2ZRLA 1LF0A 3LAWA 5E4FA 2YJTD 1G8HA 2W58A 3AB3A 1ZM3A 2OHFA 3ZS8A 5JEEA 1GZSA 4RD0A 1I4DD 3AVTA 1KNXA 4JZKA 4TMKA 3OEED 4DEYA 1HYQA 4JLOA 4ESHA 4HSEA 5KDLA 4HLDA 5IF9A 1OSNA 4JMPA 4JL8A 1II8A 4TYPA 3AF3A 4URYR 3K70C 3SNHA 6Q21A 4GZMA 1DBSA 4CEJA 1NN0A 3L0PA 1OF1A 2DCUA 5KSYA 4BLRA 2FGJA 4ERNA 2IS2A 2P6NA 1XRJA 3IQXA 1CS4C 1EX6A 4I1VA 4RD2A 4NH0A 3AEZA 2ZE8A 2ZE7A 1N6IA 3H84A 1KO8A 2E87A 2WWWA 4G5SA 1U90A 2AL7A 821PA 3W9YA 3THWB 1A2BA 2EFCB 2W0MA 4XD7A 5E7JA 4A0RA 5F9HA 1YZQA 5JRJA 4B6FA 2GETA 3V00A 1GUAA 1E79A 2WBLC 2AD5A 4MYUA 4B3XA 1YKSA 3GLGB 2A5GA 4ITRC 4RCZA 3UK6A 2JLXA 4PAMA 2GWHA 3UKDA 4F4JA 4WZBE 1MABB 4DRZA 4MGIR 1GNQA 1X8LA 4X8OA 1KKMA 4GSYA 5DYIA 1ZIOA 1K5GA 5G40A 4FXPA 5KNCA 2ZETA 5AUOB 1Y3AA 4JLJA 3MWLA 5KPDA 1L4YA 3LD9A 3IDQA 3SYNA 1CXZA 4PO9A 4MITA 4QGGA 3SU8A 2VP0A 4Q9JA 4DT1A 3AUXA 2ZRPA 2BJWA 5AJXA 1MKYA 4TYYA 4HZUB 1VYVA 1SZPA 4LHXA 4EUNA 2JLRA 5JRZA 4YMTA 1OXSC 2A7QA 3TR5A 4QNRA 3LVRE 1FX0A 2AD1A 2ZI7A 5DI3A 4EQ6B 4OQFA 1Z6GA 2VBCA 1DAFA 3BH7A 3RS3A 2FFAA 1S1MA 1KMQA 2P5TB 1TTTA 2IYZA 1UAAA 3LO5A 1UADA 5FUXA 3P4YA 3RYTC 3C7KA 2WV9A 4PO1A 1XXHB 2IL1A 2PT7A 3D8BA 4YC7A 1G20E 1P2TA 1XNJA 4QJ3A 3IIJA 1XMSA 2P65A 4AYXA 5DN6A 4HYYA 3GLHA 4KO8A 3WRYC 1NRJB 2W2XA 3IPXA 2GAAA 1OKKA 421PA 2AXPA 4DXAA 1BS1A 1M7HA 2ZU0C 4LJ6A 4UNRA 2J5XA 2VHQA 2KB0A 5FOXA 4DDTA 5CIWA 3B13B 3PCRB 4MQBA 1RJ9A 1D9ZA 2F6RA 1WP9A 2J0UB 3NC1C 2C99A 2QSYA 1PVOA 3AP3A 3U6KA 1ZRHA 1E98A 1OXUA 2GCOA 1AZTA 4BFUA 4DBLC 2J7KA 2YC4C 4Q1BA 4JLPA 1CU1A 2HLDA
chains in the Genus database with same CATH superfamily
4MDHA 1S2MA 3OQOA 1XP5A 4UHKA 5TARA 4CL3A 2EVWX 5JMPA 3HFJA 3C8MA 5AK4A 4B75A 5JCOC 2DLCX 3PGMA 3BWBA 5HOQA 5KBYA 5K1ZA 2ZWMA 5IT9A 4D74A 2C0CA 5BXYA 2Q5IA 2G9VA 2EFEB 5FR1A 3RYFB 5AW8A 1Q3HA 4UOQA 2OENG 2RH9B 2Q3JA 4MQEA 2NXNA 4RPGA 3F78A 1RJDA 3REFA 3GMDA 4HT3B 1DVRA 1UL1X 1Z8NA 3ER9A 2JHCA 4NNJA 4M9XA 1XKXA 2AN3A 3FNHA 2FMUA 1J9ZA 1C7JA 5KJ6A 5ITSA 3UJ9A 5JYEA 3W0LB 1NI5A 1UBCA 1RMTA 2V6GA 1SD1A 2WEKA 2B78A 2Z58A 3E0QA 4EPYA 2UYHA 5BVGB 1ZSVA 1PS9A 1GO2A 1W4LA 2JNWA 3HXLA 4TT8A 1IOZA 3GH1A 1OZFA 2EARA 1ZK2A 3MWFA 4O4LA 5G4KB 2Y6UA 2NACA 1FU7A 3C5EA 5F2EA 3OT1B 3TNJA 1T29A 3H5OA 1XE3A 5D3ZA 1WXEA 2Q6OA 3EB9A 3DT6A 4ZQEA 5ABPA 2AFHB 3IYLW 1U94A 4H60A 4PGGA 3OCZA 1DELA 3PHHA 4WNYA 1Y6GA 3EG5A 4DMHA 5BOSB 2ZI9A 1JQ5A 3Q41A 4JP3A 4FZ3A 3RYIB 5BY2A 4ZD6A 1XRPA 1XTJA 5JZ9A 2JI7A 2OORC 5AJTA 3OOHA 4P9NA 4FMPA 1KFJB 4YJ2F 2ZDGA 4TM7A 1ISMA 3CLTC 1K97A 3ZH9B 3G2QA 1RLMA 3AUKA 3G79A 2PUDA 1PSZA 4KFSA 2C2BA 5B3AA 4TXLA 1JFSA 3CZ4A 1LNQA 5DXAA 1LLCA 4LZAA 3QNUA 3KFLA 4C3UA 1SQGA 1SVIA 2GO7A 3P52A 1N5KA 1F9AA 2ONYA 4UTZA 1L4MA 4OJTA 1V48A 2WKPA 3EEYA 4ZAGA 2QEQA 1MR3F 1GAWA 4ZICA 1DAKA 4DUGA 4WCDA 4KODA 3CWCA 2F64A 1EXNA 2KW5A 3BFVA 3OX2A 3I42A 4F91B 2RIPA 3U1BA 8MHTA 2G09A 2R44A 1R5NA 1EA7A 5DDIP 1S3GA 3U3KA 4BNNA 1YJ5A 4LY9A 1HBJA 4DS3A 4JR2A 4GL2A 1TA0A 2HO5A 2F8SA 5B1DA 3WJ7A 9LDBA 5DCYA 5K45A 4LZWA 3A6ZA 2JFOA 1GCOA 4ZRMA 4DMLA 1FQJA 3MJSA 1EE1A 4DNXA 1IY2A 1I24A 2QRZA 2O7QA 1Y4SA 3C3CA 4CMAA 1E9VA 1XHFA 1XROA 1KGDA 1U3TA 4Y7CA 4CIAA 4PZPA 4RV4A 4R98A 3E5MA 3VKGA 1JG6A 3EULA 3H5NA 1P7VA 1OLUB 3UVEA 4KITB 4B8WA 2C42A 5LBTA 4D99A 2B69A 3AIOA 5HR5A 4XEUA 4FFBB 2I3DA 1I2DA 1LF5A 1FFBA 3T7IA 3NTUA 5K4GA 2P2NA 1YZTA 2OKGA 3TINA 1PT6A 2A2ZA 1F12A 1XGKA 2HUPA 3P2YA 3UH0A 3HDTA 3ETNA 2BN4A 1OAKA 5CRIA 5CCBA 5BYJA 4RNDB 3C15C 4OGKA 1L5RA 1I3LA 3AVPA 3S1SA 1HPLA 3E9CA 3QBVA 5B7QA 5DASA 2VVTA 4CKBB 3N1UA 3LOUA 4PBRA 4E21A 4BNWA 5IDWA 4F7DA 5B55A 1M1YB 3LDAA 2I9PA 2VF4X 3SEFA 3V4VB 4B6GA 4B6PA 3WP1B 1GP2A 3AJDA 5ALNA 1HV8A 3OZWA 2PANA 4ISCA 3QBJA 1F3OA 4RIFA 3O1LA 1MABA 2WUGA 1KEWA 4XSHA 4MHTA 1TVCA 1SIWA 2FHPA 3FYSA 2G06A 4GKJB 5KPJA 5CU7A 3B7GA 4GE3A 4BMOB 3UH1A 1ZAKA 3O9MA 1WZUA 1G7CA 1IWPB 1KF0A 4P53A 1Z6AA 3U7EB 4YUXA 3C3PA 4WASA 4II2A 3RKRA 3S68A 3WK8A 3ZBQA 1S8AA 4C7JA 2O5CA 3D3WB 3PPWA 3H75A 2EP7A 2J7PD 1EVYA 1GA4A 3LKZA 2HI0A 4KKVA 4URUR 2IZ5A 4U5XA 1JHMA 1T5IA 1DTSA 5ICSA 1W1WA 3HKDB 1N2HA 3NS7A 1ZGZA 1YGYA 1M3SA 2R97A 1NIPA 3IAM1 3KQTA 4H08A 4HZUA 1Z07A 9LDTA 3OSUA 3IQFA 5EP2A 3QFRA 1ODFA 5CT8A 1NJGA 5SZHB 2OHJA 5JS6A 4LYJA 1ABFA 3IOYA 2UZ4A 2WHRA 4EQ6A 2AKAB 2IX9A 4WCFC 1Y6RA 3GRCA 1NG9A 4M1YA 1E5XA 2FSPA 1ZKMA 2Z8YA 1JHXA 3DLTA 3TGPA 2JIBA 4DTCA 4UMFA 5FUWA 2JFWA 3CPJB 1C7RA 4GI1A 1C8VB 4Q7LA 3PTZA 5CVJA 5B3KA 2PJRA 4JLSA 3L0SA 1VKJA 1LTKA 4EB0A 3AUTA 5AWFC 2WILA 3VNVA 1G9XA 3VU8A 1D2HA 3S2UA 1G98A 3LUGA 3X1JA 1EESA 2B37A 1U9IC 4MV1A 4YRAA 3QLJA 2BIFA 4OH1A 4ZC8A 2KBEA 3QVSA 4HO1X 5CK5A 3OLQA 4GKVA 2X3FA 3QPAA 4DGSA 4E88A 1G21A 5K0FA 5DBOA 3VHLB 4V3BA 1SVWA 3X1DA 1ELOA 1JA0A 5AI9A 1E3WB 1Z0KA 3CF0A 1ORDA 3CGGA 5AKYA 1X1AA 4WNIA 3V1LA 1TPYA 2XF2A 3GJ3A 4ROTA 2VP5A 1XEXA 4QFCA 3OEHA 1XZ8A 3JW8A 1TUIA 5ELMA 3V55A 1JW9B 1LI7A 4DYVA 1GAXA 5IZ4A 2MINA 1AQJA 3IVMA 3IS3A 1IZZA 1E6UA 1S9DA 3LQ4A 1VOTA 1G19A 4NMXB 1HM5A 1OFHA 3BQNB 3UYKA 1GKYA 3SG0A 1ZLXA 3I64A 4J7XA 3NKVA 1BDMA 4ER7A 4OOFA 2D3WA 2VT2A 1G5QA 4AG6A 1WZEA 4DA6A 4P6VF 2PKXA 4RA6B 1Z5VA 3SOPA 2ZTUA 3PDUA 3DDCA 5IVHA 3MJHA 3NIDB 3GLVA 2O3JA 4NV1A 3KLPX 2W6NA 1N8TA 1M0SA 3OQIA 2GDZA 1AOXA 4IIJF 4AJ4A 4DABA 3M1LA 4HEHA 3NFRA 2YS7A 2VXBA 4H6VA 1WKVA 2IYYA 4ZKEA 5A6SB 1GRVA 1XQ9A 1Z12A 2UYCA 3K70B 5NULA 5J5VA 4PHCA 3ROGA 2JBAA 1FNBA 3OLVA 3ANLA 2W2KA 1TC1A 4JY7A 2OZKA 3TRHA 4BNZA 4C0QC 2VAPA 2Z43A 4CN8A 1FMJA 1A69A 2WJYA 3F8SA 2I4MA 2OZLA 3H16A 4PONA 3V80A 5LQCA 2PSJA 3LKDA 1BKDR 1MJGM 4PG8A 5J1SB 4DDHA 3DBRB 3DEFA 4R84A 1AMUA 2QL6A 3G0OA 5MHTA 1FW8A 1G6OA 2I65A 3ZZTA 1ODIA 1HE1C 3G1TA 2G4VA 5J43A 2EWVA 5ECYA 1WSBA 5TMEA 1MQSA 2QTLA 5DMHA 4ALMA 5EXXA 2XYVA 3KZ1E 2I2DA 3ZHSA 2F1KA 1ZVVA 1A1VA 2X5NA 1JJ7A 2XNSA 8AT1A 3ZIUA 1SY7A 1GPYA 2W5UA 2I87A 1KVTA 2RB5A 4BNDA 2AXNA 3WJ1A 3P5BA 2ZRMA 3EFOA 3H2YA 4C7MA 4D0RA 4PN7A 2X4IA 2BFOA 1I6WA 1UMCB 2WUFA 1Z5PA 3UV3A 1NC3A 4E5YA 2RFLA 5TY0A 4PHTA 4BMXA 1KRHA 1XTTA 1Z22A 5FV4A 5KNCH 3N59A 2WP8J 3LDUA 3WLMA 1IPEA 1HYBA 1XLTC 3MOIA 3LUFA 1PR9A 1J1UA 3HDJA 3IUMA 1X9HA 4AMBA 5A1TA 2QENA 4WL0A 5FTKA 5LMUB 1H1DA 1CUYA 3V97A 1PCXA 1UBLS 4DQUA 1AUOA 1TTPB 4NBWA 2P5SA 2PSDA 1ORTA 1T10A 4OK3A 4Z1OA 3CX4A 3G2PA 4ND6A 4JLWA 4PO8A 2P6RA 4PC3A 4C14A 3STHA 4BC0A 4ZZ1A 5KO2A 1W88B 4FNGA 4YJ3B 3WLIA 1VPTA 1QE3A 1XWWA 4K86A 3ZTTA 1ZUHA 1XCMA 1C2YA 3E84A 1SXJD 4BNUA 4R2IA 1II8B 3QXCA 4KWIA 2Z83A 1LUAA 4RCVA 2V9ZA 2IIQA 4TMZA 1PYDA 2WZCA 3NBXX 2PEYA 3V8VA 2WLTA 4BU1A 2IK8A 5HSGA 2H1VA 1PYGA 1H8HA 2YXDA 4TZ6A 2CL6X 1DWQA 3CNLA 2Y4NA 3KTAA 2AE1A 2PRYA 4E94A 5E4YA 1VMKA 2ZS9A 4G0ZA 1Y6ZA 3THSA 2EP8A 1N5DA 2QAIA 4PNPA 1T4DA 1KSFX 5CLIA 2XZLA 2Y1FA 1NXQA 3E9EA 2QX8A 4ZODA 4Q9LA 2QMZA 1W0JD 2X8AA 2P75A 4ZMBA 2QUJA 3Q0EA 3LECA 3HRKA 5MN6A 2CXXA 3HY6A 4R1LA 1W46A 1FNMA 2F3TA 4P5PA 5FPKA 1C9DB 5HRAA 3EXHC 2CHVA 1UKZA 1J2YA 4HWKA 4OHKA 4XGNA 3M6MD 2WT4A 1OX5A 1Q7BA 5ENDA 5JXJA 2ODEA 4BMYA 1KZ9A 1L8XA 4XRGA 2HWYA 4GI3A 1NPTO 4D4MA 3OZAA 1WUTA 4AZTA 1SUPA 3L7OA 1M74A 3D4BA 2VYNA 1UXHA 2BFWA 3WOHA 4EI8A 2NO9A 1NW9B 4LCBA 1E2MA 5LQNA 1U6JA 3QXGA 4KR2A 1RABA 3GMIA 1G6KA 2H63A 1H6CA 3HBLA 4MRNA 1YZHA 2IUTA 1UQTA 4EG1A 5KINB 2BEUB 2ZB8A 5EWMB 1L5LA 3GR6A 1WAMA 1G60A 3RVQA 3I32A 4MV3A 1M2FA 3EVBA 4R0VA 2HR1A 1XVAA 1K8ZB 3KC2A 3HCWA 1XA3A 4FKBA 1E5VA 4J0IA 4K7JA 3DOEA 2BISA 4CODB 2OGWA 2WU4A 2Y2VA 2AYXA 4E1BA 2VS1A 4D9MA 4BMSA 2N42A 2FRVA 1FTSA 2LIPA 2Q6LA 5A5EA 2YJ4A 1BEZA 3QWIA 4GBED 5A3RA 4CQLB 2JFFA 4RK0A 4MARA 5KC8A 2D1TA 3CNBA 4KDRA 2XCQA 4OA5A 1UOEA 3S1AA 1GTZA 1SHTX 3K9CA 3QA9A 2PMDA 3MEQA 3PNBA 4FMCF 4B43A 1YASA 3IEIA 5I9LA 3AQIA 5TR9A 4F0JA 3M6AA 3W4IA 4EWLA 5L6MB 2PPVA 3QK7A 2HZBA 4LVCA 2PRZA 4NY1A 3ZGVA 1BQ4A 3BHNA 3HE3A 2VF8A 5H4HA 3TOCA 4QM6A 2A5FA 2HH9A 3D4OA 1U1EA 1Y1PA 3UMYA 3ZPXA 5HHTA 4QLOA 1ZIXA 2TSYB 1JXOA 3TPZA 1B0AA 4IEEA 1E3TA 4NEHB 2AN1A 5ERYA 4KC0A 4NNOA 1WU8A 2JA2A 1FIUA 5DTMA 4EY7A 4HQLA 4IGKA 2AI1A 3K4QA 5DXFA 4JD5A 3UAXA 1WMDA 2VJOA 4PLPA 2LNDA 4A1OA 4W5NA 1X15A 2CUZA 1QZ3A 2W2OA 2EW2A 1R9MA 3OMWA 3P9RA 1FXWA 4P58A 2OVBA 3EDRA 4YONB 3U9LA 4BQQA 3ZR4B 3UJNA 5JPDA 3BM5A 1IOWA 2VH5R 5F1OA 1VJGA 4C4ZA 1AY0A 5U4QA 4XQEA 2PUVA 3LUHA 2AIRA 3BFPA 1QZZA 1TKCA 3ICPA 3PNVA 4YDQA 2VHWA 3NAMA 2BZ0A 3ITNA 2PZ8A 2VDWA 3VXKA 3KD3A 5K8TA 1Q20A 1GLGA 4GMXA 3BIXA 4DBVO 3SLKA 3MS2A 2B7CA 3EGWA 3AHCA 3UY4A 1G8AA 3H97A 4CIBA 1BHO1 4D8VA 4QJBA 1CUJA 1R5JA 4AIRA 4I3FA 4LSWA 3TZLA 2QQ0A 1DLIA 1QORA 1XTQA 5F7OA 4B6RA 1SZJG 3WQHA 1GPKA 2AI2A 4B40A 4P4TA 3IKTA 2WQ6A 1T4CA 2IYQA 1O7JA 1MC8A 2CB9A 4OK5A 4QXPA 4XFJA 3TLEA 4B3BA 3N8IA 4UKDA 1N6NA 1TXGA 5BURA 1L7AA 3OP4A 5KTNA 1ANKA 2P3LA 4Z3KA 2C8KA 3WQRA 4F3KA 2YXPX 2I3BA 5CXXA 3VYRB 3KLBA 1U8FO 1KWKA 1UP6A 4O2LA 2HWKA 1JGTA 2E5WA 3RR2A 4AWAA 2WJHA 5REQB 3ZD8A 1NP3A 5ALPA 2XDWA 3M89A 1S4QA 1JT9A 4OJKA 1A3CA 3ZYCA 1ULUA 2JGKA 2Q41A 3K6JA 1FS5A 3CSUA 4HVLA 5KEIA 3OTWA 1AC5A 3F73A 3WDMA 3LUDA 3ZHRA 3G9QA 4KGZA 2XAUA 3H9UA 4H7KA 1HKHA 3C2QA 3SXUB 3VZCA 5L51A 1CZNA 2W9XA 1OGYA 3CLRC 1M34A 3UWKA 2H2IA 3AEUB 4TRMA 3L92A 5KX5F 1VHTA 2VWGA 4RLFA 2ZQZA 3PV0A 4I9UA 1HDYA 2JHPA 4NOMA 3K0SA 4FGLA 3R5HA 4RZSA 2WVJA 4FN4A 2Y0BA 1E9CA 4TPKA 4YACA 3SHOA 3BF7A 5CGZA 2EF1A 4FZVA 4Y9UA 4PS1A 2ZGVA 3ZDXB 1YV9A 1M6VA 1E3JA 2DKFA 2XT0A 2W93A 3RH0A 3JQ9A 2J30A 1R4MB 3O3NB 3LV8A 3QYAA 3RFXA 5KYYA 1NXWA 1V8PA 3F3MA 2WIDA 3O6VA 3MGCA 4MRSA 1IM8A 3ZYZA 1NM5C 4TMTA 4QSMA 2XE4A 1MAVA 4YRJA 2FPRA 4Y1RB 2M2IA 4GVPA 5T4BA 1RC8A 4WCFB 2H2WA 4CKEB 5GIPE 1NG1A 3K0AA 1EB9A 3VSCA 3UTDA 4HAWA 4PR0A 4C43A 3PXEA 2C4TA 3R40A 4IWXA 3N53A 4G0YA 2G1KA 1PJCA 3KALA 5F7ZA 5HKAA 1A8SA 1U1FA 3BCSA 1KI3A 3NMUF 3FHJA 1E2QA 2D8AA 3NR2A 1G8PA 1NURA 1WZCA 4NFYA 3RF7A 5JZSA 1VFNA 3HV0A 1GT91 3VC1A 2JFNA 2XUPA 1CQJA 1LLDA 3GZNA 2EGUA 3RVMA 5DLEA 3R7WA 2PUTA 5H81A 1Y3DE 5CG2A 3LLUA 5CVDA 2NP7A 3CR7A 4LJ5A 3AO0B 3NIFB 4PQEA 5JPIA 5AXDA 1NI4A 5CA1A 1ORWA 2VUSA 5AHKA 2BI8A 1NYLA 1S2NA 1YAJA 2C3UA 2IUYA 3GFOA 1U3CA 4QPJC 5A5FA 1KOGA 3DL7A 2YWDA 1V7ZA 4WERA 4D43A 1DIAA 1IBRA 2QLFA 3CEHA 3OOEA 4GQBA 5JH7B 3EMDA 3U4AA 4HJRA 3UPTA 5KHOC 2ISQA 1IQRA 2DUWA 5DCWA 4ZYUA 1QM5A 1Z25A 2PD3A 3I01A 1JVBA 1Z0UA 3PA8A 2BSAA 3FY4A 3OPQA 3OOYA 4BWGA 5JQGB 1C1DB 1FNNA 3ETCA 2ZROA 4FDLA 2QQGA 3ANSA 4UASA 3EWSA 4UVGA 4EUEA 4QQFA 1K6XA 1YO6A 4K6GA 3TK1A 3H11A 4D3DA 2WTMA 3KZMA 1DZIA 1MX3A 2HU2A 3AR5A 3PR2B 4GHWA 4WRRA 4BVLA 3TLMA 3SR0A 4RESA 4B4UA 5FWNA 3H0KA 1CUEA 5FPHA 4P33A 3TD2A 1UJ6A 2X1VA 4LXUA 1X1SA 4I55A 4LNUA 4WOPA 5FWAA 2WFMA 2PX2A 3NOOA 2Q5CA 4KFCA 4GWKA 4NPCA 2BFEA 2V7QA 3GCXA 3M9XA 4KRGA 1LDNA 1J8DA 3LO8A 4BQRA 3KQOA 5I7WA 1ZK4A 3O8OA 1V43A 2OAEA 2NUAB 1NVUQ 2QRMA 4QUJA 5HRCA 2XHZA 2PDAA 3TQSA 1NVBA 1TAGA 4NBSA 3LTEA 1W5AA 2M1XA 3S1LA 3CCCA 5L7YA 4ZVQA 3ROKA 4HDQB 2Z98A 1PFQA 2Y71A 1U2ZA 3GYGA 5LL6P 5LUBA 5JJLA 1E2LA 2IDJA 2X2FA 1PL8A 2FUNB 3L49A 3NOVA 4BMZA 4DWOA 4C0KA 1E1RD 1H2YA 2GRJA 2P9FA 3LUPA 4PO3X 4ZCQA 4A92A 2GDJA 2JARA 2Q21A 4IFTA 3KWFA 4J75A 1QBGA 4QPZA 1QRRA 1YQQA 4GAEA 2W6IA 5CT5A 4HDNA 4C76A 5CB4F 4M55A 5HKKD 1NN5A 5JE8A 3KJXA 5BUQA 3HZOA 1KI8A 4GQIA 1TYZA 5KVCA 3P8ZA 2EBUA 3OZDA 4U7GA 3UG6A 2HF2A 1TM5E 4ZTUB 4IBOA 4QLBA 3OMLA 3W1VA 3TE6A 2YOFA 3OT5A 2VPXA 2VJLA 5I5GA 1MCZA 1CQWA 2Q3MA 1HDZA 1DBWA 1NYTA 1N92A 4Q3DA 4AU1A 2HD4A 1WV0A 4IDQA 3N0VA 1X7GA 5FOWA 1GD1O 3OPMA 5K09A 1UJ2A 1PGOA 4Q93A 3L8EA 3CYFA 2CDNA 1JSZA 3I58A 2P7HA 3MAGA 1ECLA 4N82A 4W4TA 5KWEA 1CVRA 3EIUA 5EJMA 3H7IA 1CRWG 4Q9HA 1BCRA 2ZIEA 5GZ6A 5WRFA 4EY4A 2B4YA 3ZOZA 3PT9A 4P31A 2QD1A 4ARUA 5E1MA 1E2KA 1XB2A 3HACA 4AK9A 1AE1A 3M0EA 4IOMA 4UBOA 1X7YA 3C45A 2B4KA 3KKNA 1JRLA 2DFTA 3IT0A 3L8GA 1IBCA 2EJUA 4NE9A 5BN3B 1EUYA 4P86A 4C07A 5SY9A 5BSEA 5H02A 3UK7A 5ALMA 2AN5A 4MB2A 1UDBA 1HNXB 3MM4A 4XM0A 1SXJC 1LK7A 4ZIRA 2G9RA 3OM0A 4R5HA 4TUYA 1JP7A 3RSHA 4BLVA 3HA3A 2EATA 4L4XA 5AOAA 4IXWA 1B8UA 5HIIA 2C2YA 1ML3A 3D0KA 4AZ3A 3WLLA 4P3PA 2DQYA 1I36A 1I13A 1BE8A 2HMUA 3I6QA 3P0IA 4CMCA 1E60A 1QFSA 3GP8A 2IYTA 3V6MA 1Q7GA 2HSDA 2RGUA 3CGWA 3EQ7A 3NTXA 4IWNA 3LPCA 2HA7A 3VPSA 3K6RA 2VYVD 4C89A 1R0WA 3QYFA 2QZ9A 5DM4A 1K8QA 3GOQA 3TOZA 4BLTA 2DFVA 5E6UB 3EXHB 3B5JA 4ZU1X 3D8UA 4Q9KA 3A1TA 4H35A 5JJBA 4NBVA 2ZBFA 3M49A 2W4IA 4YCSA 1KHTA 2QL9A 3LA6A 4LS3A 2ZS8A 5B1YA 4HBZA 5FA8A 3IQGX 1AF7A 2SICE 4M87A 3VSAA 4DM7A 2GNAA 3FWNA 2JL1A 5I7UA 1YB5A 3EDOA 8LDHA 4IHJF 3Q0TA 1XDGA 5AVZA 5DNDA 3HCAA 1ODLA 3SYRA 4DRYA 4W5RA 5AK6A 4KIGA 4IZOA 2EHDA 3D5TA 3R5XA 1NP7A 5FTLA 3GDGA 1XZHA 4N5HX 4F3RA 4EATA 1G6Q1 4NAHA 3S28A 3WGTA 3B3AA 3RG2A 1X74A 4GLJA 1QYRA 3L7AA 1L5HA 5K0GA 1T9BA 3C6XA 4B4KA 3WQBA 4B79A 5JHGB 1P74A 2LGJA 3F1KA 4PFSA 1ML4A 3H05A 3N28A 1A2QA 1BE6A 1TRHA 3TDNA 3AHHA 3QKWA 2PRSA 2LWIA 2ZJAA 2TMDA 1F2DA 1NLFA 1HZZA 2X8LA 2GYYA 4RIEA 1GNLA 3KKQA 2XE7A 4JXZA 4KIUA 1ZG3A 2OM2A 6GPBA 4GLFA 1C0IA 3H9QA 2ZATA 2XYPA 1UXOA 4N8DA 1OX4A 3SEZA 3P9KA 3TX6A 4XQ0A 1YE8A 3T3DA 3SY8A 5GVRA 1S4MA 2P30A 2IYVA 9ATCA 2OHHA 2PS1A 3GLSA 3QPDA 1AZSC 4PLVA 4O4JF 2OP1A 2D1SA 1ZD4A 3DMHA 4NC9A 2WWTA 2WU0A 3Q8KA 1AA9A 2X3YA 2QV0A 2WYHA 1JF8A 3RS0A 3FOZA 2ORIA 1L5FA 2HHHB 4JBYA 2RGWA 4AN0A 2DWUA 4KYTA 2AG6A 2O7NA 3E9RA 3JVVA 2JCXA 1ENPA 1R8XA 3GLUA 721PA 2HSGA 4EGSA 2HY7A 2JJ1D 4Q39A 1FTQA 1YQGA 4L9SA 2UU9B 1MIHA 4UEOA 4FQ7A 4K9QA 1K6JA 3TSOA 4GL4A 2FZVA 1CR1A 1E64A 1H0RA 3WWCA 2IEZA 3STVA 5K0EA 1V3QE 1DI0A 3ELYA 5EG5A 5C5CA 4MKRA 3SHFA 1KIAA 1A82A 3WK9A 3A37A 2ODPA 4DANA 1Q15A 4L4UA 1M2VB 1YOBA 3T8YA 1ZJ6A 3NRCA 5DX0A 1LLFA 1EX7A 1PJ3A 1LPNA 4I8DA 3F8WA 3CHYA 3QU5A 4MCHA 4DREA 1YA6A 2PKQP 2G5GX 5LBIA 3B1ZA 1E5QA 2I6QA 2R1VB 2V7GA 2C7RA 1H2EA 1DWOA 1GAQA 1RYNA 3UJDA 4HUTA 3NXKA 1P75A 2V74B 3MWDB 5EWLB 3KL2A 3RVKA 2P9JA 3L0ZA 1JYSA 5DGHA 4DGQA 4CEHB 2SNIE 1Z8DA 4H0NA 2PSHA 4PZZA 1QC5B 3AJ8A 3PWSA 4XCQA 4IJ5A 4Y1FA 1DJQA 1XSEA 4ZVVA 2KX7A 5FUMA 3VFDA 2ZSHA 2HDWA 3D6HA 2WD8A 1AH2A 3WX0A 3BB4A 5JW6A 1N78A 2VNSA 4U2EA 2IYFA 1HFWA 2QTTA 3LH5A 3PDHA 3DZJA 3ZEAA 4PC7A 1I5OA 5EJIA 4MIOA 4O4HA 3DGEC 3IESA 1XC7A 2PMBA 4IHAA 3SQOA 2O54A 1KJNA 2PFKA 1T2CA 4NHEA 1OHHD 4JLBA 1DWUA 4Z2YA 5JC8A 2ZSKA 4P4LA 2JCVA 4ZYVA 3DZKA 2QE6A 1H6AA 4HWRA 1KBZA 1GUFA 1YFKA 3QEKA 3QYJA 1G41A 1M1XB 2OCBA 2YZ2A 5TPZA 4A1FA 3R6WA 1EZ1A 3O90A 5JDIA 1QJCA 3A1UA 1SCJA 1XXLA 2C92A 2FOXA 1MA3A 1DUSA 3WNZA 1F0KA 1Z29A 2G0TA 3WGKA 3UW1A 3I1JA 1RHMA 2C9YA 2C0QA 2WJAA 4LDPA 4B85A 4GU5A 4N3NA 1U3VA 4PXYA 2AQ8A 5T67A 1E4VA 2O50A 3D2BA 3D8HA 4RQUA 1PFKA 5IBRA 4OHMA 3HR8A 3LUCA 3FUTA 3JR3A 2QUIA 4YRZA 4Q1CA 1Z75A 3O21A 2VDVE 3A3OA 3EPPA 1R8JA 5EFOA 1A27A 2FPIB 2GK3A 3A27A 3PZRA 4I50A 1NWHA 1FFXB 4MB6A 1NBMA 3HKEB 4C0AC 4UHEA 1E4OA 2GZAA 1Q50A 3UUFA 4FVTA 2DMRA 4Q24A 1CZKA 4JP1A 1LBSA 2O2ZA 2PBLA 3Q87B 5D6NA 3LT5A 1HYGA 3K8YA 4JQSA 4Q4DA 1YB7A 3C3KA 1SCIA 4MPTA 1RI4A 4BWFB 5BUSA 1KI6A 4KEAA 2ZG6A 4R2KA 3MC1A 1F38A 5HF5A 2FPMA 4YYZA 2F00A 1JQDA 3RYCA 2G0AA 4NR0A 5HA5A 4NXNB 3LXRA 2Q1WA 3BJZA 3IUEA 2JVKA 2BGMA 2Z8ZA 2ZBRA 3DVAB 4JJKA 4K9OA 2HJWA 4DA9A 8ABPA 4PYJA 2R00C 5K7SA 3PNOA 3IR5A 3AFIA 2FSIA 1EDEA 1N5RA 3DOHA 2XJ4A 4ZO6A 1RYZA 2ZUUA 3LBYA 1U3FA 2JLSA 1J06A 2Y68A 3GT4A 1DC6A 3O9ZA 1SOVA 4RXMA 4UQPA 4WK2B 3M5PA 4JLUA 3W78A 2OV1A 2FG6C 3INNA 5TGZA 3RV4A 4WZZA 5FADA 1RAFA 1KKUA 2HV9A 2MHCA 4FQ5A 4Q3BA 1K2VN 4U02A 3AOGA 3WIDA 5C8XA 5JFGA 2GN4A 2Q8NA 2Z2KA 1GQOA 3BH0A 1QP8A 1PG5A 1P1HA 1XMPA 3L8HA 2JLQA 4M1MA 2FDCA 1XMJA 3SJCA 2YNMA 4ZQCB 3S7TA 4GI5A 3ZGZA 3PPIA 3QTBA 2VCHA 3A2NA 4AMUA 4JT4A 4MZXA 2A1TS 4TVSA 4DZTA 1KAMA 1U4NA 4C0SA 1PNOA 3KEGA 1DQNA 3FNBA 1WQ4A 5CFQA 2GOYA 4PZUA 3UM9A 1TT5A 2R2AA 3JTEA 4KYVA 2FJPA 1XZCA 3KYDB 5EPUA 4FFLA 5IMBA 3GVPA 4WZBA 5CA0F 1GJRA 5ICCA 2IU0A 2O8EB 5MGNA 2IOFA 4OP2A 1EGMB 3STXA 3CRZA 1ND5A 1DXOA 1K7XB 1Q3KA 1UCFA 1WW3A 1YFZA 1TEVA 2RHJA 3AB8A 1O6GA 3BMCA 3CRVA 4FIZA 4OK6A 5CYPA 1JAXA 4DZZA 3E5NA 5DRTA 3UBTA 1SXQA 3MJRA 1G0NA 3QUBA 3GJZA 1UFRA 3G2IA 3NX4A 4H6PA 5CH3A 1SCDA 4CKZA 4R81A 2V3VA 4D26A 1KDTA 1GKUB 1XAJA 2HHCA 2R1UA 1KARA 3JQQA 2XGMA 3P96A 2AJ8A 2DLDA 4I4TF 2VBFA 1CR0A 2BFCA 1SURA 4FDMA 2MYNA 4DWJA 1C5KA 1I6KA 3H3FA 3OZXA 5J40A 4RTSA 2C3YA 3E70C 3TBFA 3O1HB 4XB2A 1IEXA 3QG5A 4U2GA 4ZC1A 5JBNA 4C4OA 5F1PA 4OB7A 5ARCA 2F43A 1GV0A 2WFLB 2ZI5A 5SYAA 3D6TB 5EE5B 5HFNA 3HR4A 3M70A 3HGQA 1IUPA 2D2VA 3FB1A 4M8KA 2IZOA 5EMLA 4J29A 3SX4A 1P1FA 2XNHA 3V4PB 3HB1A 4UD2A 1CRPA 1N1DA 3KOXA 3QE0A 5DNYB 3WL6A 5DNWA 1P0QA 4YO8A 2IH4A 3L9WA 5CHEA 1UC4B 4XR9A 2RI1A 3NTRA 4K8OA 4RGQA 3U7IA 4DJ5X 3ZWQA 4ED9A 3E22B 3KP1A 4M3NA 4XX1A 3I9KA 1U31A 2A9JA 2GTHA 3I52A 3L7CA 1W49A 2HT1A 2ONKA 4L6IA 4Y7DA 1C9NA 4X95A 3WYAA 4A0FA 2JFYA 1VL8A 3TG2A 2I7XA 4IEIA 5CPFA 4WE3A 4F1WA 2OCXA 5FBQB 1JXMA 4EPRA 5LZ8A 3L7BA 1HRKA 4Q05A 3AVWA 1ZGCA 1CG6A 2CSUA 3AKEA 3H9GA 3AI7A 1TRKA 4MQFA 3SQDA 4MDFA 3O8QA 4A8PA 3JWGA 4QHTA 3TL6A 1RRMA 3K0CA 1IWOA 3C74A 5DHRA 3VKWA 4MV4A 4EMUA 1V6CA 1UKBA 3T5GA 4ENSA 2O0KA 3L82B 4WMLA 4KLRA 3JQBC 4OHPA 3AFOA 3TL2A 3IB6A 4B3DA 1ID1A 2AOVA 1JU3A 2AFIB 2VT6A 4EGQA 2REXB 1PNRA 4W9NC 2R7NA 4RS4A 3OLWA 2AC2A 3RTCA 3BAFA 1Y7PA 4Z53A 1U9JA 3AY3A 2XB2A 2PV7A 1LVGA 1JR3A 2IQ5A 3NONA 1JQEA 2X9NA 2JBWA 3PQDA 4XVRA 3ADBA 2QRLA 3CIFA 1PBNA 4R01A 4RD6A 3ZD7A 3LWDA 1E96A 2C7VA 3L0BA 4WACA 5A3VA 3SI7A 3O75A 3VJKA 1PJQA 1WMFA 1U2GC 1SXJB 1IK6A 2J87A 3PEEA 1H93A 4HR7A 1C7QA 1P8AA 1ZMBA 1ZOLA 4IFEA 1L4LA 1I5EA 2W48A 2AJTA 3BCHA 5ALIA 5AR1A 3LRPA 1VPWA 1WB6A 3FUXA 4LJ4A 4O25A 1I8TA 1KP2A 1LI4A 4RJLA 4FHGA 4AJ2A 1P0CA 2GMWA 2FXIA 4C1BA 3WNCA 4Q21A 5H5JA 2CJWA 2REBA 3O1IC 3WGNA 2XNCA 4MDEA 3FPGA 1QVAA 1HDRA 3F3SA 3F71A 1G4UR 4MUMA 5C8YF 3B1VA 5HMLA 3BK7A 2D6FA 2H1FA 2B8WA 2HADA 2Y8EA 3A0RB 3AZOA 4O08A 2EJVA 4G5RA 1Q0PA 2R84A 3OFVA 4BGDA 3I34X 1ZIYA 5IBQA 3DZIA 2O2CA 4LZLA 4E4RA 3NORA 3ZWBA 1N3IA 4WSOA 1FFEA 3TQOA 2FV8A 3FOBA 1JKJB 4ALJA 3JAMA 3LW8A 5K3FA 2BMWA 5GZ1A 4QTTB 2MSEB 3H2JA 5FFFA 2O4CA 2IYPA 3D7MA 3NJ8A 1TFUA 1UBHS 1Z7GA 3H4IA 5FL7A 2H85A 1BMFD 1RFGE 4KQGA 3ZNQA 3N6RA 5IKXA 4MAFA 1P5ZB 3FZQA 2GJAA 3MFQA 3T9EA 1DC4A 4EKNB 5JY6A 4LSZA 4JI7B 4AULA 3TTXA 2UKDA 1O97C 2Y1EA 2C4UA 2ZR0A 1YZLA 4MWCA 3PUHA 2PBZA 3GBPA 4RY8A 1NSYA 4HQKA 1ZDMA 3GVIA 4URZR 2C77A 4YMWA 5AK5A 1HYEA 1W5BA 2R47A 4CLDA 4D9GA 4EG8A 1ZW6A 3ZHXA 1TCVA 1QLWA 1PU2A 1U04A 2IY9A 3GFFA 1U0RA 3ZHUA 3FF4A 4X1YB 2WB2A 1ENOA 10MHA 2HTFA 4F6CA 1NYRA 1QB8A 1K8RA 1NOKA 1VL6A 1NY5A 2OHGA 3L8MA 4NCJA 4YP5A 1Z39A 3IJ5A 3MMSA 3IV9A 4OQYA 1W5FA 3FSRA 3RRYA 5C5EA 1UBEA 3UMBA 2CEAA 3O8DA 2DKNA 4IGIA 4KUEA 5L6LB 5ERGB 3ZWYA 2HWUA 2PBRA 4KVAA 3VO9A 2BHSA 5KYWB 2F3UA 1OD6A 3ASYA 1FSGA 5SZIA 1FXUA 1PGNA 4ABYA 4V0SA 1BE0A 2O2EA 5GJVC 4D4IA 5KVAA 3PXUA 4FSXA 3G5MA 2BD0A 5EHGA 1L1RA 1Z47A 2XQFA 1FP6A 1ESNA 1WB5A 2J9FB 2VPPA 3KZXA 4RORA 5BNWA 2HF7A 3MBOA 3REQB 2V96A 1FRVA 4JEHA 5IJZA 4MPJA 4AUMA 5ELLA 3L7IA 5DPMA 1X1TA 4GSKA 1DB3A 1GZDA 3NGXA 5TQ0B 1N4AA 4QODA 3N07A 4DQXA 3DZBA 1X1EA 3I5AA 1G0OA 2LVBA 1NRXA 2ZPUA 3KM0A 3PDIA 4FP9A 1A5AB 2J6HA 3O0DA 1SU8A 3EC2A 4FZRA 1THTA 1ISSA 3G2OA 3GFTA 2NV0A 4ER5A 5EHQA 1G21E 3JZFA 4K87A 2Y1OA 1BGVA 2P41A 1TUEA 2PGXA 2YQ4A 3LHDA 3VSDA 4ALNA 3UUEA 2R3SA 2HBQA 3DH0A 2BFNA 5KOJA 2Q6TA 2FFBA 3HDGA 5HF8A 3K9QO 2IU4A 4I66A 4R2XA 4PPQA 4G3XA 4ZWNA 1UP7A 4ZQBA 1H3EA 3CSDA 1THGA 4J1TC 3B3QA 3DT8A 2FG7C 1WDTA 3E2MA 1PK7A 3A6LA 1FZTA 2ZTHA 4FFSA 1CNMA 3JALA 1O5IA 5GWXA 1XZEA 2GYWA 1QHYA 1WY5A 5LWQA 1BX1A 1QIEA 2WJWA 3RS4A 1K3FA 4J1NA 5C2JB 3B12A 3SIXA 3I6IA 3BL8A 3IQDB 3O4IA 3TQFA 4CJXA 1VE7A 2Q4RA 5CFMA 3WK4A 5A9SA 2NTJA 1W5TA 3DE5X 4EUFA 1B8NA 3BORA