2Q3HA

The crystal structure of rhoua in the gdp-bound state.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
171
Chain Sequence
GVKCVLVGDGAVGKTSLVVSYTTPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLLAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics
molecule keywords Ras homolog gene family, member U
publication title The crystal structure of RhouA in the GDP-bound state.
rcsb
source organism Homo sapiens
total genus 60
structure length 171
sequence length 179
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2q3hA00
1UAAA 1E2LA 1Z47A 5DYGA 5EE1A 3VFDA 2OLJA 3B1ZA 1Z2AA 1BYIA 4JLOA 2ONJA 3G0HA 3CRRA 3O8CA 1G8FA 3LBIA 1E2MA 4Q1DA 1MABA 2YWEA 5DSZA 4KV9A 3UWKA 4P31A 1XPRA 5G3YA 2XX3A 2NGRA 3LY5A 3GLHE 3C14C 3PG5A 1MO3A 3R8CA 1H8HD 1H65A 2C77A 2ZJZA 3CRVA 3CPHA 3EIHA 2HLDA 3FHOA 3B1XA 4LHWA 4Z8XA 3S1AA 3ZZTA 5TVKA 4I4LA 5AJVB 2WOOA 3LO5A 1QHSA 2QUZA 3LLUA 1AS3A 2IYXA 1ZCBA 4QRHA 3U3RA 1KK0A 4EQ6A 2D7CA 1G64A 3K0CC 3QEOA 2P5TB 4NDZA 2RH5A 4NU0A 1TNDA 1CIPA 5JJKA 2ZQ5A 4O3MA 1HQYE 3BBPA 3N70A 3MWKA 4KI0A 2JLZA 2RHMA 1QZXA 1CJVC 1Z3IX 4HZUB 3K09C 1NKSA 2G88A 3W5JA 4GFDA 1JNYA 3LD9A 1PZNA 2EU8A 2QTVB 1MABB 4Q1EA 2C2HA 1K5GA 2P65A 2X2EA 2F3RA 3LQQA 4ZCIA 3H4MA 4BPBA 1UPTA 2GAAA 3LX8A 1WE2A 3LAWA 2QENA 2B8TA 3ZZUA 4HDQB 2ERXA 2IBMA 2WKRA 2D62A 2H18A 1R0WA 4DVGA 2C03A 2H1LA 2VF8A 3H0KA 3MG9A 5KO2A 1T8TA 1BMFD 5JFGA 5KDLA 5EP4A 1KOFA 1J8YF 3AKEA 2BKUA 1DELA 3PQCA 4B3CA 3VU9A 4NCNA 2RHDA 4AKEA 4EQ6B 3PXGA 5JEDA 1XEWY 5EZ6B 5JECA 3FKSD 1I4LD 1G7CA 2I1QA 4URXR 4DSTA 3K70C 1YKSA 1XF9A 2J45A 5FPYA 521PA 3U7FB 3U60B 5E3HA 2IF2A 1FFHA 1XPOA 3JVVA 3CWZA 1Z08A 2JASA 2EYQA 3MD0A 2A5GA 1FQKA 2HV8A 3K70B 1N6PA 1YRBA 4N1AA 4B33A 3ZYCA 4BFTA 4C2UA 1N6HA 4M21A 1J8MF 3T1OA 2GXSA 3QF7A 1NBMA 2PX3A 3AP1A 1P9NA 4AY2A 3RVBA 4DIDA 5K8LA 3AF3A 1OXUA 1FL9A 3QE0A 4KCGA 4OYHA 1W5TA 2CHQA 1ZM2A 4JYBA 4V0OA 3I8XA 2O52A 3C7KA 4PO1A 3VU9B 3B5JA 1F5NA 4TT3D 3UXMA 3BH0A 2QL6A 4LV8B 3CNOA 4D2IA 1E2FA 2IHYA 2IYZA 4ILEA 1YR6A 3RHFA 1VTKA 1VYTA 4AIIA 1EFRA 1G3UA 2F6RA 3I72A 3TR5A 1UBGA 3AH8A 3K0AA 3ZLJA 4HZIA 1II9A 1XCGB 2ZUBA 4F7WA 1N0WA 4B3DA 4P33A 1KNXA 3X2SA 4XWAA 2VEDA 1OIVA 4B2IA 3RDPA 2RB4A 4QJ3A 3PUVA 4NCJA 3ADDA 1CKEA 3R8FA 3B1WA 1ZIPA 1N3BA 1ZNXA 4JLJA 4US2R 1ZYUA 2ZE5A 2WVJA 4R71A 2IXEA 2JIZA 1R5BA 3P26A 2ZI7A 4LV6A 2ZSFA 4DWJA 2GNOA 5BXQC 1Q1QA 1RYHA 3WY9A 2QRNA 3P32A 2BIFA 3EA0A 1R4AA 1TU4A 2P0EA 2FF7A 4ZCMA 3VKHA 4UKDA 1FNNA 3WRXC 1AIPA 3IQXA 4ASUA 2C9OA 4ON9A 4B2LA 3Q8XB 2BMFA 1YZKA 2CDNA 1AQUA 5L3SB 3QKRA 2ZS7A 4WZ6A 1HT2E 1OT3A 1GOTA 4P32A 2JAQA 3I73A 4GMXA 1RJ9A 2DR3A 2IXFA 3IEUA 3NVAA 3SFVA 2QAGC 2ODBA 4ABYA 1XTRA 3KQUA 4KVGA 1E32A 3SJBA 4HDCA 2GRJA 1LV7A 1P5ZB 4Q7JB 2HJVA 2QN6A 3F8TA 4LHZA 2V54A 2ZUCA 1L4YA 1Z07A 4Q19A 5DIFA 4A15A 1P2SA 1UDWA 2IYQA 1ZVQA 4RZ3A 1OXTA 1SVLA 3ETLA 5AUNB 1Q12A 3AKDA 2G0TA 4HLQB 2JLXA 1OH6A 2DB3A 2OCPA 2ZSEA 3LW7A 5LPNA 4RY2A 5DLQC 3WBJA 4A8JC 3GJXC 1A7JA 2A9KA 2J7KA 4M1SA 2KSQA 4BUJA 4KO8A 4BASA 5B58C 3QKRB 4F4CA 2H17A 4Q1CA 3U61B 3AKYA 3Q9LA 4DLXA 2WMOB 4WXRA 1WBDA 1DEKA 4FMCB 2FPKA 1UF9A 4A8JB 3CZQA 4HLDA 1Y63A 2WJHA 1E2DA 2QEQA 3KXLA 1EX6A 3B2EA 3CH4B 3U44A 3EASA 4TQAA 1D8TA 4DUGD 2C95A 4C0QC 4DT1A 1OKKD 2BBOA 2QP9X 4NYJR 2R6AA 2QBYA 3U7EB 3QBVA 4MRRA 2JJ1D 2HJGA 1CJUC 2WSSD 1MT0A 3WYFA 4JKIA 2C78A 1M2OB 3Q5EA 4P4TA 2PJRA 5FTJA 5LDDC 3GFPA 2HF9A 1YQTA 1TUIA 2QRZA 3B9PA 5KOYA 4OI0A 1E3MA 5KPJA 2GA8A 1GAJA 3CWQA 4TMZA 4ZDWA 5JJLA 1AZTA 3AV0B 4V0ME 1I2MA 4Z1MA 3FVQA 1R6BX 1CF4A 1XZPA 1T4GA 1NVUQ 3I5XA 1C9KA 2YVUA 3WMEA 1GKYA 4PZLA 3GMTA 3K9NA 3BGWA 3EZ6A 4XVRA 1G9XA 2YKGA 2P3SA 3AF2A 4H1VA 4LI0A 4AWXA 5B2ZA 4DT1B 1Z6GA 5FBWB 3EXAA 2SHKA 2GJ8A 2F1HA 2W2XA 1TQ4A 2QBYB 3GCGA 4JL6A 1CP2A 1YZQA 3FHTA 2WWWA 1W0JD 3CF0A 3GFOA 5JRJA 5TARA 4X8HA 5FI0B 3I62A 3ECCA 4JKYA 4GOKA 4YMTA 3U4QA 1E96A 3ADCA 2OE2A 3P20A 4LRWA 3R9WA 2N1BA 3U3OA 3W9YA 1SXJD 4M8NE 3MCAA 1VPLA 5FUYA 1XU4A 4CZ2A 5A5GA 3F5FA 2X8AA 1Z0KA 4L16A 4MYTA 1DAHA 1AM4D 4P4UA 3TK1A 1E6CA 1E9CA 1KI3A 3GLFB 5JI3E 4C9BA 5LD2B 4LBZA 1B23P 3BRWD 2QA5A 2D4HA 3M1IA 4OK5A 1Z28A 4GRAA 3ZIAA 4B34A 1E1QD 3C41J 2XNDD 3U3KA 1N6RA 2JJ2A 2ZRHA 4EFLA 1FQJA 1KK2A 3T5GA 4IOLA 4JMPA 3E5HA 4X8OA 4F92B 4IFBA 5KSYA 2VRWA 4IDHA 4EPTA 4P0TA 3EWAA 4TTRA 5CK5A 3TQCA 1JR3D 2VHCA 4PQFA 5F9FA 1RKBA 2QU8A 3U4QB 5FL7A 1M7BA 2UKDA 3A8TA 1ZBDA 1NVXQ 2GXUA 4PTLA 4QOSA 5FH9A 3ONWA 1UBEA 2JLRA 3R7WA 4V0NA 3PEVA 3T35A 1ZNYA 1S1CA 3W6OA 3JVUA 5E7IA 1W48A 3FHCB 4NYMQ 4AYXA 3IIJA 2MSDB 2WAYA 4XD7A 4Y0AA 1BKDR 4E22A 3BB4A 4F4IA 4B75A 2HCBA 4RD6A 4Q47A 1M7GA 2CBZA 2EYUA 4BZXA 3A4NA 3KKPA 3U7GA 1HT1E 3PUYA 4O2LA 3CPJB 4KYIB 5EUMA 4IXMA 4M22A 3W8RA 4G5OA 2RGEA 2ZJYA 1EG7A 4URYR 4DCTA 1OHHD 1XEXA 2UZ3A 4KVAA 4NZYA 2QSZA 4XIGS 1NKTA 4N0EA 4TMXA 3HU1A 3A4MA 1NMZA 4URWR 2ZRFA 5FUWA 1Q3TA 2Q3MA 2OBLA 1DG1G 4DLVA 1G17A 1OFUX 2HXYA 1F2TA 1N6OA 3R7WB 1UJ2A 2CE7A 1GRRA 2ATVA 4HB3A 1F6BA 1NN5A 4D0NA 3QY0A 5AK0A 4M1TA 4JLBA 4A0RA 2PMDA 3AF1A 1N5LA 2WPDA 4OQXA 2BKEA 2FPMA 4HYYA 3PUZA 1KMHB 1XEWX 3A1UA 2N42A 4DZZA 1JEDA 1DBSA 3W6PA 4RFSA 1T9HA 2ANCA 2ORIA 2GDJA 3FB4A 2NG1A 4RD0A 2RGBA 4CIDA 3LXRA 5EXSA 3RLFA 4BLQA 2FSFA 2PCLA 5CITA 2IT1A 3T1QA 2GKSA 4UNQA 2V6IA 2ZYVX 3PR1A 1SXJE 4IDOA 4DCUA 4R98A 2J46A 3C5CA 1MOZA 1KJZA 2OG2A 5L3QA 3BAFA 1F2TB 1FP6A 2VHUA 1FNMA 2J5XA 1WMSA 2EWVA 3HWSA 4RZ2A 1KSJA 4CT5A 2VBCA 2MMCA 4GZMA 4NYJQ 3TUIC 2P2LA 2ZYUX 1G8PA 2IXGA 3A37A 1OJLA 4E07A 1KJWA 1SULA 4KODA 3EAQA 5KNBA 1FOEB 2XZLA 5KSPA 3KX2A 1LS1A 1SVMA 3TSZA 1N6IA 2IEYA 5J40A 4RFSB 4XWOA 4GOXA 3EC2A 4YMSA 1LB1B 1RPZA 5KSZA 3VR4A 4JL8A 5A4JA 5SZHB 3KQHA 2CVHA 4QBHA 1U81A 1IN7A 2TMKA 4LJ4A 1BO6A 1JR3E 1HEIA 3N5CA 1NVWQ 4TWZA 4JVLA 1S2MA 5F9HA 4HUTA 2IYLD 3KTAA 1NI3A 2VSXA 1KI6B 2XAUA 2ZSBA 2GJ9A 4K46A 4ARZA 5K8IA 5GJBA 1ESNA 4DDTA 4W9MC 5L3QB 1ZAKA 1KK1A 4HAZA 4LYAA 5FOVA 3RS4A 1GNRA 1Z5ZA 3GD7A 1FUKA 4II7A 2ZI3A 2CK3A 4FD2A 2JLUA 4RZUA 2ZJ5A 1QHGA 4WXPA 2IYRA 4S2EA 1JEEA 3RANA 3ASZA 1VG8A 3FE2A 2EFDB 2IW3A 2QY9A 1CR0A 4GP6A 4LBVA 2A7QA 2FE4A 2OEPA 3RRZA 1E2NA 4C2TA 4KJZA 4MGKR 3NWJA 3O8DA 1M1YE 3FMFA 1QVRA 5TV2A 4PX9A 1CEEA 2ZRBA 1G7RA 3A1TA 5JS8A 3NIBA 1T3HA 3SHFA 2E87A 3LQRA 5HKKA 2HUPA 2ZI6A 3AB3A 4XOIA 4A36A 2YV5A 4AYWA 2L0XA 2CLCX 3DO6A 1SHKA 1D2EA 4LV5B 3B78A 4KXFB 1G3RA 3KTAB 5BW8A 3VX3A 5FR2A 1US8A 3X1XA 4ARZB 3EW9A 2GBLC 1P60A 3D8BA 5EE3A 2CL0X 3DOEA 2Q3HA 2CL6X 2W2VA 1SVKA 3WHLA 4Q1AA 1OXSC 4G0NA 1X1SA 1KK3A 3DL0A 1NRJB 2VHTA 2F9MA 1AZSC 1LF5A 3WBKA 4QGHA 4B76A 1Z6YA 4ERNA 2FWRA 3TBKA 4TZ0A 5DE3A 5J5CA 4H1UA 4XTRA 1OFTA 2F1IA 3I92A 3J81k 1OB5A 3OAAA 3M0EA 1NLZA 1HURA 4UNSA 4JLNA 2YNMA 3H84A 5JHHB 5HTKA 3PITA 1EESA 2QAJA 2J7PA 4DHEA 3MWJA 4AKHA 3C15C 4Z8YA 4LPSA 3SBEA 1VIAA 3OEEA 2B7BA 2O8CA 2NO0A 4LZZA 5JMTA 5UKDA 2ZJBA 3RRMA 4EPXA 2C96A 1US8B 3HDTA 5AJXA 1R0ZA 1QG4A 1E9FA 5KDOA 1TU3A 4KBGA 1G7SA 2JA1A 2R8RA 1DVRA 1JPJA 3ZJYA 4EKDA 1W2GA 1KAGA 2FFAA 3RYTC 4PQYA 4RFVA 1KY2A 3GLHB 5C18A 2BVNA 1L4UA 3DKVA 4WVFA 3RSOA 3TSWA 4DIEA 4DCNA 4EPRA 2ZE7A 4ACBA 4OHVA 3VR5A 3FTQA 4K8OA 2FEOA 5CIWA 5ANRB 4V0LA 3H1TA 2F1JA 3VR3A 4TYYA 3AKCA 4JT2A 2JDID 4D26A 3KB1A 4JSTA 2WHXA 4NONA 4PZZA 2CCGA 4Q9KA 1EFCA 2OCAA 3FOZA 4NHOA 3ZD7A 1S4QA 1QVAA 2O8CB 2NQ2C 4PAMA 3BOSA 4KFRA 2OBNA 4M4SA 4Q7KA 5SZKB 4HLUA 1W0KD 4HAVA 4M1KA 2NO6A 1UEJA 2IYVA 2XTMA 1XEFA 721PA 4GZLA 1ZCAA 4GT1A 4IDQA 2W0SA 1D6JA 1DPFA 2GF9A 2GHIA 2OM2A 1E2QA 1E2GA 3EG5A 4Q4HA 3GEIA 4TYNA 5BWMA 4V02A 6Q21A 2OFOA 5F98A 4ZI2A 3IPYA 2GJKA 1Z0DA 1VCMA 1XXHE 1NVVR 1F2UA 3EZ7A 5JI2E 3CBQA 1G7TA 5KSOA 2Y8EA 4KFSA 1GVNB 4G1UC 3CX8A 1VG9B 2ATXA 3VKWA 4NCIA 4PSKA 3FKQA 1OB2A 3BFVA 1ZRHA 4QG7A 3G82C 3R9XA 1LY1A 2OFWA 3SI7A 3LDAA 3TUZC 3GLIA 4FWTA 2J87A 3KZ1E 2EFCB 2R62A 1YZLA 1GL9B 1TEXA 3R20A 4LY6A 1X8KA 1WP9A 5EP3A 3BORA 2ZYTX 1AKEA 3CM0A 1J99A 2VSFA 3VTKA 3WRYC 4DRZA 4KHZA 4Q4HB 1OV4A 1DOAA 5FOUA 3N2EA 1OIWA 2H7VA 3CPEA 1NN1A 2VP9A 3L0OA 1H8HA 1U0JA 5BYJA 1UBFA 2Q3FA 4HZUA 5BYKA 3K0CA 3L43A 1CS4C 1F2UB 4ZIRA 1IN4A 1XMIA 4HAXA 1Z06A 2FSIA 3TUJC 4NP6A 2GAOA 3REFA 4JLVA 2HT1A 4TLEA 2JLYA 1COWD 3K09A 2FFHA 4UJ5A 2PX0A 1DAFA 2A30A 4CT4B 2ZREA 2W6ID 4RD4A 3GLIB 1G19A 1IY2A 4TLCA 3MJRA 3W5IA 2XTNA 4MDEA 8OHMA 1ODFA 2F43A 2IUSA 2A5FA 1R2QA 3SE0A 4QBGB 1A4RA 3AVVA 2IYYA 4NTZA 1QHYA 1X86B 3EA5A 3SYLA 4LJ9A 1FP7A 3QJYA 3SYNA 221PA 1E98A 2XZPA 1ZC3A 1KSHA 3QKTA 1IN8A 3T06B 1YZUA 2I1VB 2YYZA 3P4XA 4IOJA 4G5SA 1EK0A 2ZRNA 2VQSA 4YONB 4B32A 1XJ0A 4ZIRB 2IUTA 3MFYA 5KU1A 1G5PA 1BMFA 2Z4RA 4M1YA 1KI1A 4V03A 4JSYA 4PSAA 1Q3HA 3ADBA 3ZVNA 1IY0A 3PV0A 1FMJA 1YZGA 2REBA 2ZITA 1XCPA 1XWIA 3Q7QA 4NKRA 3FKSA 1ZC4A 4DSUA 5AR1A 3MGCA 2VA8A 1RFLA 4OK6A 1QBKC 2PZFA 2V7QD 4TSFD 3NC1C 2W6JD 1QRAA 2ZE6A 3B1YA 2PEYA 5BN3A 4N0DA 2F43B 5FOWA 5EXTA 4JS0A 1OXXK 1T91A 2MSCB 4YDSA 3WNDA 2FSGA 3EZ2A 4B48A 1Q20A 3TJZA 4TTQA 3BH7A 5GJWC 1II8A 4AKIA 4RVCA 2EW1A 4UXJA 4ZPXA 1J70A 3E2IA 4NPHA 4JBWA 2F7SA 4L9SA 4TMVA 1T3LA 2NO7A 4IHQA 5AJZA 4BFVA 3A58B 4JT4A 5KDDA 2R6CA 4BZPA 2BEKA 1YR8A 2VF7A 3IBGA 3RRNA 2JATA 1P61B 3EPKA 3MWLA 2QP3A 1FUUA 3K8YA 4TT3A 5L3VA 4LJ6A 1E4VA 4DSOA 4FMDF 5SZIA 4WZBE 3AGQA 3UG6A 3LW8A 3Q5DA 2OXRA 5KNDA 1DO2A 1KI9A 2FJUA 2FV8A 2ODNA 2P6UA 5C1BA 3LXXA 2O8DA 1AA9A 3SBDA 4TN1A 2Q6TA 5FBVB 4D4KA 5JEEA 4F38A 5KYKA 4M53A 1MR3F 1XJQA 4V0MA 3JZAA 3K0SA 2ASEA 1T3SA 1E79A 3UMRA 2BMJA 4R7ZA 2J0SA 4OQMA 4B44A 4YXWD 1Q21A 4GL2A 2JEOA 1I4DD 1II8B 1IQPA 3KL4A 4LBYA 4YMWA 2AN9A 3BC1A 3QEJA 3X1DA 2YHSA 5JBQA 2P6RA 3RWMB 5IDVA 3AM1A 2J0VA 1N6KA 1LS6A 4NL4H 3TRFA 3ZS9A 2XNSA 2CCKA 2CNWD 4BLRA 5L3SA 2P67A 1Q0UA 4PHTA 2OFXA 4EJSA 3VHLB 3V9PA 5JS7A 2V6JA 3OHMA 1I4TD 2F55A 4TLAA 5E7JA 3A1SA 2J9RA 3KKNA 1L2TA 4TQUS 4WW0A 3T15A 1TMKA 4MYCA 4A6PA 3TE6A 2O8DB 5J4HA 4NYMR 1OPXA 1PUJA 5TB5A 3DMDA 1XTKA 4BE7B 1F3OA 2WIBA 3AUYA 2QAGA 3UPUA 5BN5A 1NVVQ 1G8YA 1RVDA 4YDHB 3BD9A 3OIYA 3TIFA 5DH9A 3FYHA 4EJSC 1G8GA 1W4CA 1D5CA 1G6HA 1XX6A 3QKSA 2NOAA 1E1RD 1ZD8A 4PZYA 1G5TA 1OH7A 4KYUA 1GFIA 4JVSB 3B82A 4GP7A 5TXGA 5CDFE 2IS1A 1ZU4A 5EZ5A 1EX7A 2RGCA 1JPNA 4OQLA 3E1SA 1W36D 4EJSB 2D2FA 2NO1A 3BFKA 4A8JA 1MKYA 3EIEA 3IUYA 5FOTA 2G1JA 2GEDA 3QVUA 4TMTA 2FG5A 3TR0A 3F3YA 3NH6A 4FMCF 4US1R 4XSGA 3UIEA 1HE1C 3VKGA 5AJWA 1AJEA 4D80A 1EWRA 2WJYA 1NY6A 4KU4A 3HPRA 4TLBA 3AVOA 4X8LA 3VQTA 4Q4AA 2B7CA 2QAGB 3T1VA 2XSZD 5EP1A 2CXXA 2VH5R 1EXMA 4LJYA 5DISB 3AP2A 4BEJA 1XD2A 2JCSA 3BE4A 4M9XA 1RYFA 4EIWA 3QKSB 1RIFA 5K8UA 1D2MA 2QGZA 1T5IA 2VYFA 4DLZA 2ZR0A 4RCZA 1UKEA 3BERA 5GJCA 4DUGA 1OH5A 1J7KA 1OKKA 4LJ7A 2DFKB 4DLYA 1P9RA 3PVSA 2PZGA 4YLGA 3ZS8A 1XMVA 3IIMA 2WSSA 4C0KA 2OILA 2W83A 1Q1ZA 2ZI4A 3QOFA 3W3AA 3SJAA 4M9SA 4I1VA 2GZDA 2IHBA 3SS8A 4EAQA 2XOKD 3THXA 4BFZA 4C0AC 1CU1A 1HTWA 3PIRA 4FINA 4CDGA 3OE7D 1HYQA 2CMKA 3SR0A 4Q4AB 1U9IA 1MO6A 1ZINA 2BMEA 2OUKA 4KLNA 1T5LA 3KJGA 3O8BA 4LDJA 1DAGA 3WP0A 4FXPA 4BLOA 2IWHA 1FTSA 1XD2B 2JGNA 2Z83A 4E03A 5J4KA 2WV9A 2XZOA 4KFTA 4MRVA 3TNFA 1RE0A 4TYQA 5IK2D 2WAXA 1RC8A 1WQ1R 1SQ5A 3TGPA 5DNYB 5FTMA 1F48A 4MRPA 3SNHA 2HCJB 1N2CE 4C0SA 5ELXA 3H2YA 4PAOA 1ZU5A 5KNCA 4B2PA 3GLFA 4IOKA 4DCSA 5EQTA 1VMAA 1W0JA 2B92A 1NP6A 2JJ8A 1RRGA 1K6MA 1S3GA 1UDXA 4MKFA 2H8KA 1U9IC 4TLDA 1KI4A 3M4YA 5DN6D 1U8AA 1R5OA 5JWRA 3THXB 1NBME 2EQBA 3THWA 2GZAA 1NMYA 3HU2A 2GXAA 3QUSA 4RKEA 1ANKA 1DAIA 1U90A 4ZCLA 5JCPA 2YWHA 2IK8A 4HI0E 1H8ED 1IOZA 2FFBA 1IAQA 1GILA 1Y3AA 3T34A 2FDCA 1G291 5JHGB 5GVRA 1QHXA 1GNQA 3OFND 4AC9A 2FA9A 3CONA 1Q1BA 1ZNWA 1XTQA 4I1SA 2ZEJA 4TMKA 4W5HA 2OV2A 1CXZA 1B0UA 2XXAA 121PA 1E1QA 1R7RA 2XNDA 1UBCA 5H1YA 4URZR 5FBLB 2QT1A 2AR7A 2RCNA 3K9HA 3PFIA 4HEJA 5G40A 4DLUA 4PAQA 1D2NA 1YVDA 4AD8A 1VYVA 4YQFA 3D6TB 3LFUA 5GVSA 1M34E 2FU5C 1MRSA 1SXJC 3UATA 1LNZA 2YZ2A 1X6VA 1GKIA 2WWYA 3UMSA 2Z4SA 4FCWA 1M74A 1JR3A 2IA5A 2O0KA 1DARA 1G4AE 2A5DA 2WIAA 3THWB 1GWNA 1SXJB 3HPQA 4XWKA 1VYUA 2BBSA 1ZJ6A 1U99A 1DTSA 3CUEF 3M6AA 3K53A 1UADA 3K1JA 1CJMA 4R2HA 1FZQA 2AK2A 1A1VA 3H86A 3BH6A 2QPAA 1ONBA 3MAAC 4QM7A 2WM9B 2KBEA 4PC1A 2D2EA 2A3RA 1NL3A 4TL7A 2XXAB 1VHLA 2DYKA 4XJXA 3B60A 3EPHA 1E4YA 3RNLA 3U6KA 4GBMA 1MRNA 3GLGE 2H16A 1JR6A 2KI5A 2GK6A 4MA4A 5KTYA 1TEVA 1MH1A 2DWPA 3KFVA 4IJMA 4B6EA 2NMVA 4MQBA 2KWIA 1VCIA 1NLYA 1ETUA 1OHHA 3RS7A 1R10A 2JLVA 2AXPA 1KMHA 1GDDA 4MITA 5CB6A 1AKYA 2V3CC 2ZRIA 1YR9A 1JJ7A 4U7DA 4BEBA 5HPYB 1Z6AA 1NSTA 3OEHD 3LBNA 4B3BA 2A5YB 5D3MB 2VP5A 1CRQA 4IW3B 2ANBA 3TSOA 1IY1A 2AD1A 2PZEA 4DCVA 2PL3A 5FTLA 4Q1FA 1RW4A 1OSNA 1T6NA 2Z6VA 2WJGA 1T0HB 2GZHA 4MH0R 5FOXA 3QXJA 1SVSA 1IN5A 3FMOB 1SKYB 1XRJA 2IYWA 1OW3B 1U94A 2WMNB 3ZH9B 3Q85A 1GIAA 3LNCA 1IHUA 1PV4A 3SC3A 4BECA 5FOSA 2GESA 2OO7A 1UKYA 4LOAA 2BC9A 2FNAA 2ZRCA 3OIVA 3THYB 3HYRA 4O2RA 4IEIA 4Q4LA 2PBRA 3U3MA 3QKUA 1S3SA 2EFGA 2C98A 2QE7D 1WBBA 2J59A 2V4ZA 2VTKA 3IGFA 4LHYA 1KKMA 3WHKA 2QQ0A 3IO3A 2C5LA 5AUQA 2WWGA 3LH5A 1OFIA 4XSHA 3SFZA 5CM9C 5GADl 2ZTSA 1AS0A 1KDOA 2R44A 2YOFA 4PC6A 4MKIA 821PA 2BOVA 3DOFA 2HDNB 4Q66C 5CJPA 1KI6A 5C4MA 3OIUA 2RMKA 1MO4A 4S35A 5CB8A 4CEJA 2Q21A 2DHRA 3WYAA 4BWYA 3OIWA 1A2BA 3G5UA 3CKLA 1GKUB 3LWNA 4OKSA 2GWHA 3NEYA 4I1OA 3RS0A 1N6LA 1NLFA 2YC4C 2ZJOA 5FUVA 2ZRDA 1A2KC 1E9SA 3I4LA 4NE2A 1KJYA 5EE9A 4DBLC 2ZROA 1S0UA 2YOHA 4LHVA 2UVQA 1PLLA 2ZJ2A 3LRPA 4EDHA 2AX4A 5HCIA 4DDWA 4US0R 5FTNA 2AWNA 2QTHA 1XB2A 2VO1A 3QG5A 1DS6A 1QG2A 1LF0A 1E9DA 1QF9A 2ECKA 1FPMA 1XZQA 3KUCA 5B57C 3C4JA 3DM5A 4QNMA 3CB4A 2V55B 1G3QA 2ZETA 3L8ZA 4MGZR 4Q03A 4QJ5A 4TL8A 4NYIR 2AFIE 4D4LA 2VP6A 4PXAA 4TL6A 5EE5B 5G53C 2AKAB 3W8NA 3PEWA 1TF5A 4GPTA 2X77A 1BIFA 2VP2A 3QSYA 3U6BA 4CEJB 1XBTA 3BWDD 3CRQA 5B30A 4U02A 2ZR9A 2ZANA 1X8LA 3W6NA 4DLSA 1JAHA 2GXQA 3I5YA 1N6NA 1GM5A 2VHJA 1CR4A 3VHXA 2PCJA 2GBLA 2WZQA 2EFEB 2QMOA 5EP2A 4BQSA 1QDEA 4Q21A 1HUQA 3SYKA 3V00A 1XTIA 4H9GA 4J0QA 2FOLA 4GNKA 1KI7A 4POAA 4JZKA 2DFTA 2Z0MA 3IDQA 4CEHB 2PLFA 4PFSA 4CGZA 3TW4A 5HCNA 1Q44A 5J4LA 5CYOA 3VNVA 1G21E 1V5WA 1QHIA 5J4VA 4TMWA 4B71A 3SU8A 1TF2A 3EPJA 2YJTD 1YHNA 4Q9HA 3IHWA 1XXHB 3AVYA 1HV8A 4JLKA 2BM0A 1XJCA 5FPKA 2VP4A 3GJ7A 1BOFA 2FEMA 4A6XA 2J0QA 2CK3D 3U2QA 2IEZA 2J41A 1P6XA 4M1WA 3CR7A 1GITA 2PJZA 3GLHA 4OL0A 1DG3A 1OE0A 1N25A 3E70C 1PLKA 3NG1A 3RS5A 3TVDA 1N5KA 2CHVA 5JRZA 3IBYA 1SVIA 4BFXA 5DI3A 4LYHA 4F91B 1Z83A 1JQJC 4Q5IA 2XJ4A 4OHXA 2BCJQ 3B1VA 3LVQE 5G3ZA 1OH8A 4IVPA 5FBQB 4Q1BA 4ZV4A 1BH2A 1A82A 1HH4A 2B8WA 1P2UA 5CJ2A 3HU3A 3DDCA 1SKQA 4GSYA 1MO5A 1M6NA 2GEVA 2J0UA 3QXHA 4A0GA 4CYMA 2WWFA 2GEUA 2OAQ1 4A4DA 1PVOA 1ZMXA 1WB9A 1P2TA 2JDIA 4P3YA 2F9LA 5FR1A 1W4AA 2VPPA 3CO5A 3DZDA 4PPQA 1N5IA 4G5QA 4JLPA 4B47A 4ZDIA 2NZJA 2V9PA 4WBSA 2C9YA 1T8UA 3P4YA 1TPZA 3QF4B 4ESHA 1ZP6A 5DI3B 1W0KA 4ZKEA 2ZR7A 2AHOA 3LV8A 3P27A 1LW7A 2Q0HA 4C0LA 4MGYR 1CULC 3C8UA 5FPHA 1Z0FA 3ND9A 3O47A 1ELOA 3AF4A 4MKHA 3K9LA 4DLWA 3OEED 4PHGA 3KDSE 2ODEA 3NC0C 2D06A 3QPVA 4DLTA 2I4IA 4OHZA 2J0UB 2V1XA 2ZU0C 1KO5A 2AFHE 4A92A 2NIPA 2FZLA 2WJVA 2ZU6A 2C9CA 4LHXA 4LYFA 3VAAA 1E2PA 2DFLA 5FTKA 1U98A 1IXRC 1R5NA 1R8QA 3FGNA 4MRSA 1YZTA 1EGAA 4A2PA 4IFEA 3SJZA 4WOPA 1Q1EA 2C04A 3KKOA 1Z6XA 4NBSA 1P2VA 1W2HA 1YRAA 1JXMA 4JLMA 2FMXA 1JALA 4IEEA 1G16A 1CLUA 1NMXA 3NDPA 2ORVA 3UG7A 3KJEA 1S8FA 1QHHA 4Q9IA 1NN3A 1HE8B 3T5DA 2IX3A 3DVLA 1N0UA 2BCGY 3GJ0A 3I1FA 2PLRA 3PUXA 1JJVA 2ZI9A 4KSBA 4UXIA 2WJIA 3U7HB 4HB4A 2IUUA 3ZQ6A 4BRWA 2O8EA 2RAPA 4Q9JA 4YMUA 3OESA 4QBIA 2QMHA 2QNRA 4KFUA 3TVTA 2RGGA 2ZUDA 4AG6A 1E0JA 1O3YA 2QZ4A 4I1UA 2G1KA 2GK7A 3GPLA 2GCPA 1G8HA 2ZVQX 4I81A 1XMJA 4GI7A 4UNNA 4TYWA 2ORWA 3HR7A 1Z0JA 2CE2X 1W4RA 2JLSA 2BMDA 4R2IA 1JXOA 3DM9B 4NYIQ 2W6IA 1CTQA 5FI1B 4LGMA 5A0FA 4M2LA 4AKGA 5FBRB 3GJ5A 4RD2A 2P6NA 3FFAA 3ICEA 2WSMA 2X19A 1QHHB 1JI0A 4A82A 1T0JB 3UANA 4OI4A 1ZW6A 2OAP1 3SZRA 4TZ6A 2BM1A 1S9HA 1SVOA 4HB2A 1G6OA 2QM7A 4D81A 4D82A 2QT0A 1JB1A 1UKVY 1G3IA 3GEEA 3MLEA 2CL7X 4JVNA 4QXAA 5IF9A 2O8EB 3NBYC 4DJTA 1OXVA 1CJTC 2ZPTX 4G01B 5CDFA 1AGRA 2WWIA 3GEHA 4I99A 1S9DA 5FPSA 3AVWA 3DZ8A 1Z6TA 2OZEA 4G5RA 2X1VA 4HDOB 4NMMA 3BK7A 4OI1A 4WAUA 2ZRJA 2WKQA 4LJ5A 3TQFA 2V7QA 2VIIA 4TSFA 2W6JA 2V8OA 3U5ZB 1II0A 1E94E 1PLJA 4LJ8A 2HEIA 3ASYA 3CLVA 5AWFC 4DEYA 4D25A 2IS4A 2YWFA 3OF5A 1UFQA 5D3QA 1DAEA 1R0XA 5FUXA 1VCNA 3UMFA 1XP8A 3NHBA 4FI3C 4OQFA 1W4BA 1KO4A 2HLDD 4B73A 2JLWA 2RGDA 4BRUA 3B6EA 4PANA 4CEIA 1PJRA 1VHTA 1D9XA 4WA7A 3L82B 1CJKC 3AVXA 3RC3A 1W44A 5JCZA 4Q01A 2EFHB 3CF2A 1JQLB 1E2KA 2NPIA 2ZAOA 1P9WA 2KJQA 4ZO4A 1TQ2A 3F0TA 3KB2A 4FW9A 3KKQA 2XTZA 1UM8A 3IKJA 4DB2A 1CRPA 4DDVA 1ZUHA 3CX6A 1NNEA 3S1AB 1Z8FA 3Q3JB 2GETA 1IJEA 1RRPA 3VMFA 1RRFA 2ZYWX 3K70D 3SOPA 4G3XA 2CVFA 2GILA 4XTCS 4URVR 3D3QA 4QGFA 3ICQB 1XTSA 4YXWA 3RABA 1HQCA 3EWSA 1OFHA 4XVQA 4TQ9A 3B85A 3KXIA 4PHHA 2OHFA 2IC5A 3KJHA 3D31A 1IONA 4F93B 4CEIB 2CNWA 4GDFA 4JLDA 5TY0A 1FX0A 2GJSA 4PC2A 4B35A 4FN5A 4GMDA 4BZQA 4UQOA 4LUCA 4XH9B 1SGWA 2G0NA 2VSOA 2B21A 3IO5A 2GF0A 3D7MA 4Q02A 3TMKA 2REXB 2R9VA 1KTVA 4Q4JA 4JJKA 3HJNA 1U0HC 2AWOA 1M8PA 3SHWA 4YC7A 3CIOA 2NZ8A 2H92A 1D9ZA 4MRNA 4PO9A 1Q22A 1F60A 4EPVA 3CH5A 2X2FA 4QL3A 4BLPA 4D6PA 2RGXA 1XD9A 2ODWA 1U2RA 1NBMD 3AP3A 1E2IA 2H57A 3CRW1 1ZM7A 2W0MA 2QMUA 3EARA 4FIDA 1E1RA 4HATA 1U8ZA 5LB2A 3GLIE 2WICA 4M0LA 4W7SA 4IVRA 4QBFA 4FMDB 2PH1A 3THOA 1P73A 1E79D 1P7CA 2OBMA 3KJIA 3B13B 3U3JA 1FX0B 2Q9BA 4LK2A 4LCBA 4ZDJA 2CJWA 5LBIA 1EFRD 1G4UR 3EPLA 3VNUA 1CR1A 2HYIC 2PEZA 4JBYA 1I2DA 4PPNA 1A5TA 3TLXA 5M04A 3KQLA 4CVNA 1VKJA 2ZRKA 3SEAA 1XTJA 4Q4JB 2WJJA 5EXPA 2FX3A 3A4LA 5G41A 2DWQA 2XGJA 3IQWA 5HE9A 1TF7A 4QM6A 2ZRGA 1U8YA 5F2EA 2BBWA 3KXKA 3FWYA 2XSZA 4O0MA 5EUQB 1E0AA 5HE8A 1W36C 4Q00A 4B43A 5CK4A 1J90A 4QNRA 3MSXA 1Q57A 4RD1A 4CRWB 3K0AB 4LX0A 3X1ZA 2CLDX 3B9QA 5LB4A 3RS3A 1GRQA 1GNPA 3R9IA 5DO9A 3ZVMA 3LBHA 4FCTA 4M1OA 3GLGA 2JIZD 3KKMA 1W36B 2WKPA 4L4UA 3W34A 5H70A 2RKOA 3SJCA 4C3ZA 4KITB 2GCNA 3WYGA 1GP2A 2CJWB 1GSIA 4C0HA 4B74A 2QQEA 3B7GA 2O8BA 1DADA 1NIPA 2ZRMA 2DY1A 1AN0A 1FMLA 3EZ9A 3MJHA 2XOKA 4IDNA 2GCOA 4LSGA 5SZJA 4ASUD 2O8FA 3AVQA 2PT5A 2OESA 4OJQA 2ZRLA 3O8RA 2R65A 4Q9LA 1E0SA 2PMKA 3HP1A 3OE7A 2JJ1A 1UKZA 4IVQA 2A5JA 3NTUA 1PUIA 2GTPA 2BHRA 4OBEA 2WBLC 1GG2A 4WZAE 3W3ZB 2F1RA 2Q9AA 2ZJAA 1NIJA 4D4JA 2ZVPX 2QORA 4TL9A 5H68A 1E9EA 4FMBB 4ZKDA 5IK2A 5H8WA 2ONKA 4ACAA 1E2JA 3CZPA 3GLGB 1KGDA 4DEXA 2AL7A 3FMIA 5DYIA 3SQXA 4A0HA 1RZ3A 2QI9C 4A2QA 1TTTA 4DB4A 2LCFA 3AQ4A 1RJ9B 2ZSAA 2O8BB 3L0SA 2ZS8A 4BLSA 3GFTA 3QNUA 5DN6A 3IEVA 2AK3A 2GCOB 2HF8A 2W2TA 3DPUA 4JBXA 3I32A 3LA6A 2O8FB 4U00A 2ERYA 5DHAA 3PEUA 1ZM3A 1JECA 3JZMA 2NO9A 2AXNA 2VP0A 1XDBA 4C0JA 1H8EA 2ZM5A 2Z5FA 2FZ4A 2QROA 1OIXA 1VIYA 4GOJA 1KHTA 3OFNA 1Z2CA 5JWOA 3ZQJA 4HAYA 4Q18A 5CLLA 4E5UA 1R0YA 2ZAMA 1ZNZA 2BBTA 3KFXA 1LTQA 4NCKA 2IL1A 4M9ZA 2XJ9A 1SXJA 4EUNA 4OHYA 4B6FA 4MYUA 3OZXA 3REGA 4B3GA 4HAUA 1MV5A 3HR8A 4PR0A 4QHTA 1NN0A 1G3MA 4PO8A 3MMPA 4A9AA 4CF7A 1E9RA 2KE5A 2CLSA 3LVRE 2BV3A 2YC2C 4JL5A 1CBUA 1TQ6A 4LC1A 5J47A 2UZIR 3U44B 1E69A 3RAPR 5F3WB 2LWIA 3AVUA 3MUFA 3BIFA 4ZDKA 4B3FX 4Z1MD 3SQWA 1V43A 3EC1A 4IXNA 4U5XA 5DI9A 3ZZ0A 5C2JB 5HZKA 3UKDA 4LWZA 2G6BA 4UNRA 5JJIA 3X1YA 4O25A 5KUTA 1KDTA 4C7OA 3TAUA 3QENA 4WIAA 3QI2A 2FSHA 4KSCA 4KLZA 1KKLA 3C16C 5LD2C 3NKVA 1P62B 1X8JA 5BN4A 5JSZA 1YZNA 2EWWA 1EFHA 3AGPA 3QXXA 5D3MA 1Z0AA 2Z43A 3WNBA 1KO1A 2CHGA 3RSLA 2OLKA 1E9AA 3IILA 4DXAA 4Z54A 5DHFA 2G3YA 1ZIOA 5IHPA 4IRUB 3RC8A 2A78A 1E9BA 1VDZA 3WMFA 1YE8A 3KQNA 3AUXA 2BWJA 2HT6A 2R6GA 3PEYA 1IBRA 3OEHA 4D4MA 2I3BA 2D7DA 3CF6R 4A0FA 2QSYA 1YJ5A 5IRCD 5K8TA 1KO7A 3QPWA 4QC2A 1WA5A 1DO0A 3BB1A 3FPAA 3I3SR 3THYA 5AUPB 1IXZA 1K8RA 3ZIAD 1ZD9A 2O0HA 4DSNA 4C7OB 1P72A 1X3SA 3NH9A 3NHAA 2JJ2D 1GL6A 3PENA 2QP4A 3ZDQA 1ZD1A 4LBWA 3GP8A 2WWXA 2RGAA 5JSZB 4KBFA 1BYUA 3BJIC 2QM8A 4TYPA 2E1RA 4HB0A 1KSFX 1NF3A 2HYDA 1OF1A 3LX5A 1TADA 4OQNA 1N5JA 1Z29A 4EFMA 4KAXA 2ZE8A 5FL7D 3C5HA 5CLQA 3L0PA 1UEIA 5E7MA 4RJLA 4LYJA 2QE7A 3DEFA 1E2EA 4C0BA 1VG0B 3SDZA 5HR5A 2DCUA 2WWHA 4NH0A 2REOA 2IYUA 1ESMA 2IYTA 1W47A 4PQRA 1KZ7B 1XCMA 4OHWA 4XD7D 1XNJA 3V4FA 4FCVA 2OSBA 4AYTA 2O5VA 5BQ5A 2A2ZA 2DBYA 3A6PC 1WXQA 4ITRC 5KPDA 5TDHA 1KSGA 2O0JA 3W90A 3FMPB 4PHFA 3Q72A 1O87A 5B64A 4RCYA 3BB3A 4DKXA 2RGNA 4XVUA 2NTYC 5FL3A 2GVDC 3A1VA 5L3RA 1G1MA 4FWIB 1OLOA 2R2AA 4Y0VA 3AF0A 2C99A 4HAWA 4B3XA 4W5WA 4L15A 3VR2A 2FN4A 2P5SA 1KDRA 3GLFE 2FGKA 2MSEB 2WPDD 1OYWA 4AK9A 1XEXB 1W5SA 4C30A 4QGAA 4D0GA 1NSFA 4BFYA 2QMEA 1DAKA 5GJVC 1ZM4A 2RGNC 3VX4A 1WF3A 3SN6A 4CEHA 1ZUNB 2IF0A 3QXCA 4BFUA 2AD5A 3GJ4A 1W49A 3T61A 4QJ4A 2JLQA 2D74A 1S1MA 2GVZC 3CX7A 1VCOA 1KAOA 2IWRA 4IDPA 2IS6A 2VLIA 1Z0IA 1NY5A 1IN6A 1C1YA 1KMQA 2XITA 5IT5A 2ZIAA 1TUEA 2BEJA 3TAHA 4MYHA 4G5GA 2ZS9A 4K81B 2XB2A 1K5DA 5JZVA 1XXHA 4QGGA 1G5RA 5P21A 1AS2A 2LKDA 3T12A 3QVVA 2OXCA 2YWGA 2ZSDA 1WDTA 3PCRB 3UK6A 4MUBA 2DFNA 1XFAA 1CR2A 1SZPA 5L8VA 3MWYW 1P4SA 3ZD6A 4X8MA 3GJ6A 4HLCA 2R6DA 2XB4A 3FDIA 3BFXA 4PPFA 4ZI3A 1U0LA 5FFMA 2V1UA 3DMNA 4QHYA 1KIMA 3CRMA 3RRYA 4A2WA 1XMSA 2DPXA 3A1WA 1L8QA 3ZGXA 1KY3A 2QG6A 3L2OB 3N2IA 5CYPA 2PT7A 5JWHA 2R6FA 1TAGA 3TH5A 1FW6A 1YR7A 3MRSA 621PA 5AJYA 4HSEA 3T1TA 3FFBA 3CW2A 2H5EA 4PC3A 4AG5A 3UWOA 1E0KA 3WP1B 1SKYE 3K0FA 2NPFA 5FPTA 1G20E 4IKEA 4RD3A 1JAIA 1HA3A 1HY3A 4C4PA 3B8HA 5C4GB 3NXSA 4LC0A 2LKCA 3TKLA 1L7VC 2D3WA 2KBFA 2W58A 4LJAA 3AVPA 4L9WA 3I61A 1SVWA 4AI6A 4JLAA 4UNPA 5C46F 3PJRA 3VR1A 5KHOC 5EE0A 2CCJA 1TL7C 3QF4A 2VL7A 2G83A 3EIQA 4Q48A 421PA 3GJ8A 3WNCA 1DAMA 3ZVLA 3IHLA 1IM2A 2MMGA 1TX4B 3RWOA 2ZXUA 5HKKD 1WCV1 1KNQA 2IS2A 4CW7A 1BS1A 3K9GA 1ZUIA 2XEXA 4RSGA 5EJEA 3QG1A 2Q9CA 3NBXX 1NJGA 1WRBA 2BJWA 1W46A 1AQYA 4YMVA 2AKYA 3GQBA 3K0FB 3Q7PA 4P4SA 4UJ3A 1EFUA 4AURA 3GJ3A 2QPTA 1P75A 2C8VA 2DWOA 3NBFA 3BXZA 4L8GA 4M1MA 4BFWA 4EFNA 4V0KA 1GL7A 4ESVA 2ZRPA 1E2HA 1IXSB 2J1LA 2G9NA 2E9SA 1NG9A 4NCHA 3CNLA 4BLTA 5E4FA 3AVTA 3A36A 2ZJ8A 3X1WA 1KI8A 4N3NA 4MUAA 1Z63A 4LPKA 1C4OA 1KI2A 1GUAA 1QHNA 1KYIA 2VHQA 3OAAD 2QTFA 3PUWA 2N46A 1LFDB 3EZFA 5CM8B 3HYTA 1GRNA 1ZM9A 2J7PD 2G77B 1KZGB 1M7HA 1AK2A 1EFTA 2OCBA 1GTVA 3I8SA 3IPXA 4F4JA 4UXHA 1N0VC 4QKQA 2OCYC 1EWQA 2J3EA 3NEJA 1DE0A 3QIAA 4JJZA 2WOJA 4L5BA 3K0EA 4P4SB 4QHSA 1P3JA 2K5UA 4DC9A 3WXMA 4OJKA 3ZVRA 4OI2A 2BJVA 2CEAA 4DLRA 3DHWC 3P1JA 1SHZA 1KO8A 4BFSA 3KUDA 2FPLA 2B6HA 3BS4A 4IOMA 2QPOA 5AUOB 1KDPA 1FTNA 2QGNA 4JVMA 1RRCA 1NJFA 1GZSA 4A1FA 4BGDA 1E99A 2IYSA 4PC7A 1OYYA 5CIQA 3ADKA 2KB0A 2ZRAA 5JLJA 2YINC 1S96A 3NBZC 1X1RA 1VECA 3CR8A 2WTUA 4HUQA 2BDTA 3V4RA 5HZHA 3L0IB 1IJFA 1W1WA 1G18A 4JIMA 1XD8A 5DGXA 3QQ5A 2YOGA 5J4YA 4M9QA 5E95A 2FGJA 4URUR 1JBKA 4W5JA 1VG1A 4MDFA 4RKFA 4E09A 2HXSA 4MGIR 4TTPA 3WMGA 2EVWX 4HLUC 4JYCA 1AGPA 1COWA 4Z51A 2FFQA 4DDUA 3AEZA 3VR6A 3CNNA 2OT3B 4EPYA 3ND8A 4OK3A 2GJAA 3KQKA 4Q7MB 3IIKA 3L8YA 4Q7LA 1LVGA 4R9UC 3RS2A 1W7AA 3QXSA 1TQDA 1J2JA 4D0LB 4PPGA 4EPWA 2W00A 4PSVA 5TMPA 1NG1A 1R8SA 2FH5B 3QPUA 4QFMA 3TW8B 3NDBB 1YU9A 1Z22A 3EX7C 2ZI5A 1G41A 3QBTA 3DKPA 4HUQB 1XPUA 4MKGA 2F3TA 3LLMA 4RZXA 5EXXA
chains in the Genus database with same CATH superfamily
3VFDA 1LX7A 1X38A 4WKPA 3ANSA 1ZOPA 4XPIA 4I0WB 5EE1A 5EWJA 2XIQA 3RREA 3T8YA 2ONJA 2DPYA 1BYIA 2X15A 4TN5A 1G8FA 3CWCA 4G8DA 4ENTA 4Q1DA 4C4XA 3J80A 5L95A 3HTXA 4KV9A 4AO6A 1YR3A 2R7LA 3RU7A 1TKRA 3R3JA 4WSOA 1V25A 2XX3A 2NGRA 3B1FA 3LY5A 1OUMA 3GLHE 2VDUE 4B1FA 3PBKA 5JD6A 4MRMA 3O38A 2II6A 4YB8A 4KQKA 4LF7B 3GJRA 3CRVA 3FHOA 4P3NA 2FLWA 1R0RE 2EKPA 2WK1A 5CD1A 4FYKA 3EAFA 1A9XB 2JFQA 5L4NA 1XN1A 3SSOA 4O8CA 2WOOA 1RP1A 3CNHA 4O4JB 4R8VA 2W2KA 1PL7A 4M89A 1PHRA 1ZCBA 3U3RA 1GT6A 1ND5A 3FPJA 3K0CC 1Y4SA 2C2GA 4MUYA 1CUDA 2RH5A 4XE5A 4NU0A 1TNDA 5I8PA 5AIBA 1IWBB 1W19A 3HJCA 3NZEA 3KSZO 3HGMA 4AZSA 4O3MA 2V0GA 4AZWA 4O2BB 2YY7A 3NRBA 3MWKA 4KI0A 4Q24A 2OV1A 4CQMB 2JLZA 1T5HX 5H5JA 4F6CA 4F2GA 1Z0SA 2E48A 3QV1A 1M73E 1T3GA 4EI2A 2WY2D 3NASA 5IC4A 2XCUA 1UC8A 3ELYA 1E6UA 2JGMA 1O2DA 4MB0A 4MPJA 1P1CA 5LWQA 2QTVB 2HRRA 2RGUA 4Q1EA 3ZHQA 1QF7A 4PRYA 3RVSA 3S1LA 1RQNA 1GTL1 1BD3A 4D0RA 3LVFO 4BPBA 1OGYA 5IAAA 4MI6A 1SXQA 4WZAA 5KVVA 1EUZA 1NYTA 1WE2A 1J1UA 3LAWA 4HDQB 2P1RA 2IBMA 2UZ1B 2H18A 1J0CA 5JFOA 4X61A 3V34A 1O8BA 3P0EA 3MG9A 4HKTA 4TRJA 5AM0A 1T8TA 5EJIA 2ZUEA 5EP4A 1DELA 5C7LO 5AI0A 3T4UA 1HKHA 5AI9A 5BQPA 1WV1A 2RHDA 3IC5A 4BWVA 3ZGVA 4EQ6B 3LGXA 4PU0A 1BHO1 3PXGA 1KIAA 1J49A 5JECA 3OE5A 3ESQA 1U8UA 1GQ2A 1B0AA 3D8HA 3FDZA 1I0LA 4TV9F 1QYDA 4DSTA 1YKSA 5IEJA 5FPYA 1OX4B 4FVTA 3B20A 5E3HA 1O94A 1JPVA 1XPOA 1SY7A 1YD7A 2G80A 2I3AA 5B3AA 5JZ9A 3A9UA 5F7XA 2PAAA 3ZWCA 2JASA 2OHOA 2ZYHA 3G2LA 3QIVA 1NDQA 2A5GA 2HV8A 2Z08A 3IDFA 4F3CA 5AQ1A 4LVCA 2GKGA 4FJ1A 5A4DA 1V8ZA 5FNVA 4I1RA 1N6HA 4M21A 4MI3A 1XYVA 3T1OA 4MI9A 1NBMA 2PX3A 2YV1A 3D3WB 3AP1A 4I14A 3TOCA 1CEQA 2A59A 4KPFC 1KDVA 1OXUA 4DIDA 1DIRA 2HU5A 2I4MA 4ERXA 1KVUA 3PK0A 2M98A 4Z9AA 4LRYA 1VL0A 4OYHA 2J31A 5T64A 4CLDA 3DQZA 1NJ5A 3AU9A 3D8NA 5IYZF 4DCMA 4CLRA 1WB4A 3LPMA 1CEYA 1GVHA 3QV2A 3VU9B 1XVAA 2FDRA 1F5NA 2JI4A 3D1VA 2QL6A 4LV8B 3ZJ4A 4D2IA 4MVJP 1E2FA 2VJMA 5K0SA 5DU2A 3O3CA 1MEEA 5IEBA 4YV7A 4I2NA 1M67A 1G3UA 2FYTA 3H8JA 3PEEA 4RVOA 3TR5A 5KNDD 5AVVA 2XWQA 4AUNA 4IHJB 1II9A 5FA8A 3I9MA 1PNQA 4Z0PA 5HQJA 3AFIA 1RWNA 4PTYA 4X1YB 5HXAA 3G0DA 3VM6A 1N0WA 2A35A 3WB1A 3HS3A 1JBQA 1P4RA 3PQ5A 3JQFA 1RFGE 2NUAB 1OIVA 4N18A 5A02A 2H1IA 4B2IA 5C7IO 2V0CA 2XEDA 3RDPA 2PRJA 3GDWA 3MILA 3GDGA 3PHJA 4O4LF 3TL3A 4DUZB 1P3DA 3D7KA 3UK7A 3V1MA 1EGVB 1ZIPA 4ALNA 1PJQA 3SE7A 1ZNXA 3GBVA 3GCXA 3IAS1 4MEBA 2XYHA 3CTPA 3FB1A 3N2GA 1GUZA 2GBGA 4AFNA 5GONA 1XU7A 2ZI7A 3RRFA 3FOEC 3GB9A 3BQNB 4YO7A 2XVMA 1RYHA 4BDTA 2ZSKA 5DGCA 5IWAB 1Q7EA 1R4AA 2R1VB 2Y1GA 3YASA 4I8IA 4ZCMA 2CW5A 2JANA 2WF6A 4OATA 4AWAA 3WKAA 3AG5A 4K6GA 4LE1A 4MZDA 2BMFA 2X4IA 2CDNA 2N3ZA 2P6MA 4OOFA 4WNAB 1SCJA 2O54A 1HT2E 1OT3A 2OKCA 4BP1A 1M34B 4C4TA 2JEYA 1I01A 2XMCA 4ENUA 5M29A 2AG1A 1JJFA 1WVIA 4GMXA 3ZOZA 3D0QA 2ZSJA 4GQIA 5LQRA 2IXFA 3E27A 2ACVA 2BGUA 2ODBA 2BLNA 1WQ4A 1XTRA 4ABYA 2QNIA 4KVGA 1E32A 4ADSG 3SJBA 3KQUA 5DTQA 2YFYA 3Q9SA 3NHUA 1LV7A 4J0KA 2XRYA 3IA7A 1P5ZB 2HJVA 1S2LA 1XZIA 1Q14A 2ZUCA 3DTNA 2VXBA 3HFSA 5GWXA 4B45A 4I8DA 1Z07A 2VFAA 4DXDA 4KPEC 1EYZA 3E61A 3U1TA 1FP4A 1P2SA 1ZBQA 2QMZA 4RZ3A 4YWHA 2NVUB 3CNBA 1SVLA 2ETVA 5E4JA 1Q12A 2JLXA 2G0TA 1A69A 4OYLA 1E9VA 1B6GA 2R7MA 1DC3A 2XTJA 4AJEA 2NYVA 2PWPA 4RY2A 4D0SA 1J0DA 1YFZA 2E7ZA 4CL8A 5I4IA 3GJXC 5DYNA 2A9KA 2V59A 1GGMA 2AEEA 2FUNB 1WCIA 2KSQA 5TGDA 4MUKA 3TRKA 4ARBA 3WBFA 4J16A 3TZQA 3M81A 3SR4A 3ZWXA 3AKYA 1G38A 2JHFA 4B6GA 3GGCA 5IUKC 3QU5A 2OD7A 4WXRA 1EUCB 1WBDA 1MBZA 1H6DA 4FEAA 2A8YA 4A8JB 3OZWA 4Q16A 3PC8A 4M7OA 5BSEA 3T95A 1WUKS 1HRKA 1ML4A 3MB5A 4MUIA 4TUYA 2WJHA 1E2DA 1XZKA 3SBXA 4Z86A 2CYBA 4QQ8A 5J2TB 1D8TA 4RV5A 1XAJA 3UMVA 4MVWA 1N9GA 4DT1A 4DUGD 1AQIA 2TECE 5EAIA 3PPXA 2QP9X 2GPTA 2R6AA 1KPHA 3PXAA 5EFZA 3U7EB 2Y9PB 3P9KA 3QBVA 4MRRA 4TZKA 4FONA 1CJUC 3GBSA 1WF6A 3WYFA 4WHMA 1NR1A 3KEOA 4JKIA 4EUFA 2PRKA 3W3AD 2VHVA 2VJAA 2VLBA 2C78A 1L7NA 3GLRA 3Q5EA 4E2XA 3O9VA 3OT5A 3KS9A 4P4TA 3TQHA 2PJRA 2XD9A 4OXYA 1TUIA 4UDXX 1G63A 3E3LA 3NQ41 5KPJA 3BFPA 2GA8A 1ATIA 5G4KB 3KM0A 5D1HA 2A9VA 4B80A 3U4MA 4V0ME 1I2MA 1JRLA 1P44A 3FVQA 3OHSX 4A0SA 4HNVA 2IS2A 1XZPA 3SMVA 5IG2A 2I55A 1NVUQ 1BGVA 3G7NA 3X43A 4P82A 3GFVA 4CM1A 1T2UA 4MQFB 3HUDA 4PZLA 1E61A 4CTOA 3BGWA 1O58A 4HEA6 4OPMA 4C3VA 4NF2A 2CGEA 2P3SA 3EG9B 3AF2A 3DDSA 3ED1A 1VJ5A 4LNUA 4H1VA 3DTVB 5CDTA 1Y7PA 2YXEA 3TMAA 2HV9A 4CL3A 1Z6GA 5FBWB 10MHA 2GFHA 2CZCA 1ZK2A 2W2XA 3PUKA 4L85A 3GCGA 2YYSA 5EWLB 3NETA 3CF0A 3GFOA 2BHLA 2K4MA 4OVKA 5TARA 1T36B 5K0TA 4CM4A 4AN4A 1QYXA 3GGGA 4XUEA 2PFGA 3ZI0A 2QD3A 3RH0A 4X45A 1MQ8B 3E4CA 1YS1X 2CNOA 3P20A 2QTTA 3VGJA 3WNVA 1KVSA 1CYDA 2WFZA 5FUYA 2J09A 2HO5A 3ELBA 1XU4A 3G5AA 1NUPA 4QDZA 5AJTA 4EB3A 5A2GA 1Z0KA 2CHEA 4CKBB 4L4XA 1DAHA 4PF1A 4F60A 4EAAA 2ZRQA 5DN9A 4O4IF 4B81A 3OJLA 3DD1A 1GXSA 5JI3E 5JFTA 1L5OA 5H80A 4FD3A 3L1KA 3ORHA 3PC6A 4DGSA 2QA5A 2OGWA 3M1IA 2WQ6A 1LBHA 2F48A 3FY4A 3SC6A 5BMVB 2FSPA 3HLTA 4GRAA 3K31A 5JAUA 2W9XA 4OUDA 3ZE7A 5BN1A 4TRNA 1SELA 2BP7A 5E7QA 1CUYA 1VLLA 2JW5A 4Q3EA 4F04A 4G4SP 2LCIA 5KYVA 3T5GA 1JHDA 1GO2A 1HPLA 3LY8A 4BNGA 4F92B 1RKVA 2VCYA 2RHLA 4IFBA 1NXVA 3MZ0A 3A1CA 1AT1A 1GQQA 4HDSB 4IDHA 4KOEC 1FZTA 3AR5A 4EO4A 2UUPA 4IGKA 4QASA 4IZ6A 1CCWA 3EVFA 5AKXA 1RKBA 1YJAA 2QU8A 4XUGB 1JDZA 3L6DA 4EY3A 3KV1A 4MTLA 3CVUA 1PL0A 3RTAA 3U4QB 1FYDA 3A8TA 3D8SA 3LPLA 3DG9A 1KYTA 3FNHA 3ZKAA 4INAA 1NNI1 1W6RA 4IXTA 4IV5A 5JSFA 3VA7A 1CUXA 1DB3A 3JR7A 4RL4A 3R7WA 3EXFB 2YFQA 3F90A 1S1CA 1KQOA 5IH3A 3JVUA 4B09A 3E03A 3FHCB 2C3UA 2NU8B 2WIKA 4Y0AA 4B3IA 1Z9BA 2HQOA 2QLNA 4B75A 1JVNA 1VSQA 4HNQA 1BHQ1 2HCBA 1RAEA 1T5TA 4RDCA 5G0TA 4B4UA 1M7GA 1ISJA 4HPJB 3QEMB 2VRBA 3ZEAA 3U7GA 4GI5A 1HT1E 4CMBA 3UGJA 3GD5A 1NI4A 4EENA 4KYIB 5EUMA 3FRIA 4M22A 4Y2QA 4WT7A 2EDAA 5C9ZA 1XC7A 4QDKA 4A8PA 4IV0A 1ADJA 1XEXA 1L8AA 2J85A 2H1CA 4KVAA 1EVQA 1PIWA 1TZ2A 3HHPA 5ALGA 4Z7OB 4MRPA 2P41A 1KEWA 4MV3A 1YT5A 4URWR 1X0VA 2H1HA 5FUWA 4OA8A 1HOXA 1Q3TA 4DLVA 3EDMA 3AJEA 3DOJA 2JBAB 4O59O 2L42A 1UJ2A 2ATVA 2EKQA 1B1AA 1QIDA 4P4NA 4GPEA 5AK0A 4M1TA 1TMYA 4AZTA 4V1CI 3COWA 1EGQA 4L9AA 5AKHA 4A0RA 5JDIC 1N5LA 4EABA 4UBIA 1PS0A 2BKEA 1SEVA 3WKBA 5LXTB 1QOQB 1XEWX 4MV4A 2N42A 4HWOA 3Q6NA 4L74A 1DBSA 3F3MA 3W6PA 3F2IA 5JMTA 4TPKA 4O1IA 1SKBA 4OQPA 1FSPA 4AAYA 4RVUA 1GLGA 4RD0A 3W78A 4YNBA 1PQPA 2RGBA 3CY6A 4OH1A 5REQB 2QD2A 5BR8B 3RC2A 1ZY2A 3C24A 4D97A 5LKRA 3OQJA 3JPWA 3S55A 4KPUB 2XCLA 5FA5A 3BMXA 3DH0A 3FN4A 4UMVA 5JD5A 5L45A 1J5EB 1QDUA 1FFXB 1PD1A 3W4IA 2EL9A 5KNCH 2GKSA 4WERA 4EY8A 4HNTA 1LVHA 2I22A 3NNNA 3CPSA 2V6IA 1WMFA 2ZYVX 5FYDA 1T8YA 1Y1SA 2J46A 3C5CA 1KJZA 4CF4A 4DPMA 4EHIA 5HM6A 1UK6A 2X41A 5LYJB 3BAFA 1F2TB 1FP6A 3BCRA 4F72A 1FNMA 3EQ9A 1QRTA 1SO8A 1SOAA 4X3CA 4N82A 3LUDA 2VBCA 4BMNA 2ZBFA 1B26A 1ILEA 4ZMSA 4G56A 3TUIC 2W48A 1G8PA 3RRJA 1KJWA 5SYNA 2BUAA 1V0JA 5KNBA 2WU0A 2XZLA 4QU5A 3OBBA 3KX2A 4LQDA 1N6IA 3ZV4A 4DLNA 3EC2A 4YMSA 5D6OA 1LB1B 3KR0A 3HSKA 5L53A 1YIDA 3ILVA 3VR4A 5K3FB 1NR5A 2BTOA 4BC1A 5EEHA 5HYVA 1N2OA 3IDAA 2Z1NA 3NR2A 4NBTA 5AW5A 3AW9A 3M6LA 2B4QA 3O8OB 4LJ4A 1DAOA 4CGYA 3O0DA 3HJAA 1XAHA 1FVHA 3H3JA 1NVWQ 3ORRA 4QIHA 1S2MA 4NVRA 1NUSA 2WHRA 5I3ZA 3USES 4V38A 1BZYA 3H87A 5AFSA 5CR9A 5K8IA 3LT4A 1ESNA 4R0NA 3JV7A 5ENZA 3QLVA 1ZAKA 2JFOA 1KK1A 2Z1DA 1ADCA 3RS4A 3TLYA 2Z6UA 3GD7A 1FUKA 1ACJA 2CK3A 1MC1A 2JLUA 4RZUA 4PE5B 1R0KA 4BQOA 2H0QA 4OLFA 1V7QA 4KX5A 1NTRA 2QX4A 3ASZA 4TVKA 2P35A 4CG3A 1WMDA 2EFDB 1E66A 2QY9A 1JJIA 1ULTA 3RGGA 4G9EA 3DW3X 4GP6A 4GEGA 3D4LA 1ITZA 1EJBA 1O57A 3TDMA 3FCYA 4AJ2A 4KQXA 4RGBA 1QVRA 1UDAA 2QTZA 4HN4B 5G1NA 1W25A 1JMVA 2PLNA 3WYDA 2CHFA 3AR2A 3KQSA 3E9ZA 1T3HA 4UM7A 3GU3A 2ZI6A 1DC7A 3AB3A 2C3PA 3W6UA 5YASA 2PD4A 4GYKA 4DANA 3VSAA 3DO6A 2R3SA 5A9SB 3U7QB 5BW8A 1G3RA 2HRZA 2NZUG 1US8A 4ARZB 2JLCA 2OQIA 4EJ6A 2WAOA 2FQWA 1ORIA 5BNTA 2XKJE 3E3AA 3OQIA 2FK8A 2JAXA 5EE3A 3U3XA 2AE2A 2CL0X 4D4IA 1E1KA 4GKKB 2W2VA 4FDMA 4IG9A 4L27A 3WHLA 2SKCA 2YJZA 3AJAA 5DEOA 1ATZA 4Q1AA 3MTJA 5FADA 1X1SA 3IUQA 1YVRA 1OOEA 3DL0A 3ZN2A 1PVVA 4DZTA 5C7YA 2D5BA 2YYAA 3F5QA 2NSHA 5IXSA 2D1SA 2WD9A 3GEBA 4JLUA 1UQUA 3ESAA 3V4SA 3DE4X 3V8BA 1Z6YA 4D8XA 5DE3A 2QLFA 1EHIA 2QTNA 5IJAA 1HC7A 1ST3A 1MN6A 1SVNA 1TD1A 2J3JA 2QN1A 5DB4A 5F78A 3TLGB 2BEWA 2P78A 2PANA 2WF8A 3RS9A 3TX2A 3VVLA 2ODAA 5GP1A 3EYAA 4JLNA 4ZCSA 5FORA 3KR2A 5HTKA 3PITA 4PYRA 3VAYA 2C7RA 5THXA 1QCYA 1F6WA 1V4NA 2EZ4A 2J7PA 4PYLA 1QGDA 5DT2A 3WGTA 2V6BA 1SURA 3EW7A 3WFIA 3I6BA 2PLWA 4WKBA 2PVCA 1K92A 2ONCA 3FGPA 2B7BA 3PQ4A 4TLMB 3P2OA 4Y1FA 3BREA 3JAWB 4CF3A 1JG7A 3RC9A 2O5EA 1U1GA 5I7VA 1X7ZB 3E3NA 1ND6A 3UJ7A 4EHAA 2O07A 4JMLA 3RIEA 3U4CA 4BZWA 3DTTA 2R8RA 4CQNA 1XRNA 1JPJA 2YXLA 1H4VB 2FFAA 4IEFB 4BV3A 7ABPA 2O1SA 3K9CA 1TZBA 3BULA 4KQHA 5C18A 3DKVA 3RSOA 5EXEA 3NHFA 2CVPA 4DIEA 5KYYA 3HV2A 1O95A 1R3UA 2NV6A 5DTIA 3C3EA 4FGZA 3S68A 3UJNA 3VR5A 2J6HA 1QOPB 2PRIA 2ACWA 3UT5B 3AL0C 1RHQA 1RLOA 3QSGA 3VR3A 1W5EA 4NIMA 4TYYA 2EF0A 2WAAA 5LSAA 2BEVA 4U2KA 2WJWA 2O7SA 1QTRA 4J1SA 2DB3A 4BE9A 4PZZA 4Q9KA 2YJ5A 1GA1A 1P31A 1WP4A 4Y9DA 1WCXA 2OCIA 3IKVA 3ZD7A 2O8CB 4QT0A 4PAMA 4EJMA 5I51A 1CB7A 4X6YA 4KFRA 4RPKA 5GM2A 3BN3A 1I1NA 2QM3A 2XVZA 3M33A 2NO6A 4LMAA 1KH2A 1YCGA 1UEJA 1YDEA 1MB4A 2HIHA 1FP1D 1XEFA 2HWYA 3QVGA 3DE5X 3H2KA 4GZLA 1ZCAA 4O63O 4XFJA 5E8JA 4I6GA 1J56A 5IKXA 1YS6A 4JFRA 2GHIA 5KYGA 5TX7A 3EG5A 1K0FA 1LVUA 1FLNA 1U2QA 4TYNA 2OFOA 5I7AA 3B36A 2AT1A 3IPYA 2GN1A 1X1AA 2H1SA 2R8XA 3BICA 1DI0A 1QQ6A 5C3UA 1NVVR 2X0IA 3EZ7A 2FP4A 5AW9A 3V97A 1OU4A 3F97A 3QM1A 1XA4A 1P8AA 3NXKA 3SEFA 1ENZA 1GVNB 1VJTA 3MJFA 1GA4A 3LT0A 3MRTA 4LJSA 4R2KA 5JOQA 5DMXA 2NADA 4OU4A 3COZA 1PX2A 4YYZA 1FNDA 3O31A 3WB9A 1VB5A 1T4CA 3T7EA 3R9XA 5DNDA 1WXFA 3LDAA 1EX1A 1X1QA 3GLIA 1C8LA 2J87A 2B9VA 3V8VA 1Q15A 1DDIA 2I7TA 4HWSA 4XJVA 3KL2A 4Q05A 1Y5LA 3ZWDA 4LMPA 1WP9A 3AFHA 1JG3A 4M83A 1AKEA 1R4ZA 2DHCA 1B76A 4GH5A 5D1NA 3KJXA 1XYGA 3RUPA 1JFVA 1OV4A 4I2VA 1DOAA 1I14A 1JFFA 1V48A 3E9DA 3F7MA 3N2EA 4UEJA 5I7RA 4F4UA 1X74A 1NN1A 2D1FA 3L0OA 4J6FA 5FP0A 1H8HA 2MYTA 5BYJA 5BQXA 1CY7A 2CB9A 3R3YA 4V0QA 1IN4A 4HAXA 2FSIA 2O5RA 3TUJC 3JQCA 4RSHA 1ZI8A 4KKVA 5KWVA 4IIJF 3TZEA 2ZB8A 1GQRA 3IDSA 3GFBA 1OLXB 2Q3CA 5JXIA 4HQ0A 2X9VA 1BCRB 1WAMA 1T9GS 2MU1A 3FNFA 3K09A 3PCTA 1LPPA 3LKBA 2PX0A 1XEAA 3PDCA 1IE3A 4TLLB 2ZREA 1WMEA 1J8QA 3JWGA 1C1DB 4R7GA 3IBTA 2W6ID 4JJIA 4Q0MA 1IY2A 3H4VA 3BMNA 1A3CA 2XODA 4JOQA 3VJMA 3KQHA 5EIEA 4MDEA 3C85A 3PWSA 4CIXA 3JCZA 4KGZA 1JDTA 4LTDA 4PCLA 4R54A 4E30A 2XCRB 3W6ZA 5FUQA 2YV4A 4MQ4A 2VJPA 1R2QA 1CX9B 2I9PA 2P40A 1A4RA 2OV8A 3I34X 5IJ9B 1Q92A 1WHSB 1QHYA 1IDOA 1DBVO 1KJQA 1X86B 3A9TA 3EA5A 1FP7A 2ZSUA 3QJYA 5GMOA 1ZC3A 4V2IA 3PDJA 3JX9A 3QKTA 2QK4A 3QE4A 4UCFA 1R16A 3FWNA 2FDXA 3MCWA 1WDWB 3MUOA 4TGLA 1JBEA 3PHHA 1NV9A 2VYVD 1SKMA 4G24A 5KU1A 1G5PA 5DNVA 3STYA 2R8YA 3DUFA 4Z2YA 5EJAA 4HGZA 4J0IA 4V03A 4OKNA 4S12A 2CVOA 2NLOA 4YY3B 4ONEA 3R9KA 4TRMA 1E8DA 3EDOA 2WQZA 4KIFA 2RFLA 2PKWA 4XRRA 3E8XA 3I9V1 1XCPA 1XWIA 3Q7QA 1A27A 1Y7HA 3FKSA 2VYND 3KTFA 1EP1B 1MOPA 1Z4MA 4D5GA 5B6IA 1YU6A 4Z4IA 1A7KA 1KARA 4OK6A 2PZFA 2V7QD 3KJFA 3NC1C 1X1TA 3FM9A 1QRAA 3QUBA 2PEYA 1MTOA 2QMYA 2X5JO 3JQPA 2O3SA 1IMJA 1OXXK 1U1FA 2GN2A 1W34A 3VYWA 2FSGA 4B48A 1Q20A 4ER3A 4U2BA 3BH7A 1T6BY 5GJWC 1Y34E 4B84A 3IEPA 1H1LB 1UIMA 4PCVA 1U1DA 4UXJA 4E1BA 4WLNA 2NO7A 3O8QA 4UULA 1DIHA 4LZWA 2ZBUA 3WL6A 2DQSA 3R7LA 4C08A 1UZLA 3QUTA 5EJ7A 5KDDA 2R6CA 2Y0PA 1WZ2A 2VF7A 3RRNA 2GQ0A 2QE6A 4JODA 3T3HA 4DRXB 3OLWA 1GL3A 3PA6A 2QP3A 1FUUA 3K8YA 5FQNA 4RPIA 4TT3A 1BRMA 2ZUSA 4LJ6A 5KOIA 4DSOA 1T4DA 2DTEA 3A2LA 3GWZA 3LUHA 1Q0HA 2ADOA 2PS9A 1Z6QA 2UUOA 4WZBE 3ZHBA 4C29A 9ABPA 3IT1A 2BZ0A 2CDAA 5CM2Z 3KLMX 4FMPA 4NV3A 3AF6A 5IAJA 2FSSA 2J4DA 3WSWA 2L18A 4JC4A 2FV8A 1T9DA 3GUCA 2EJVA 1ECJA 2NVWA 1GLVA 1EA5A 3TD9A 4AQYB 3E3MA 5EZYF 4TN1A 2Q6TA 4FBGA 4D4KA 1OX5A 1XJQA 3SKYA 1XHFA 2QZJA 3JZAA 4EB6B 1PF7E 1T3SA 3T4EA 3ERCA 4R7ZA 3WC4A 3WL4A 4OQMA 5FIUA 1TFUA 1I4DD 4LBYA 2DWUA 3OM8A 1SG9A 2IHZA 4YMWA 1USVA 3BC1A 3X1DA 4PYKA 1FB5A 5BT9A 2P6RA 2HBYA 3WQBA 4KGVA 3FNQA 2GAFA 3KSRA 4AS2A 5HIKA 1AOXA 5AKLA 2OHIA 2ZB2A 3DE0X 4UMEA 3KD3A 3IUMA 4FGUA 3VHLB 4CLEA 1BEEA 2GZMA 3V9PA 4NESA 1ZUWA 4WXEA 1R15A 1SHJA 2AN3A 2AMFA 5E7JA 3Q0TA 4R1QA 1LRKA 5LZ8A 1PJSA 4A6PA 1I7DA 1ZN7A 9LDBA 1DXYA 5D5PA 3DEHA 2O8DB 3P9YA 4H1TA 4NYMR 5H82A 3QKWA 3WDSA 2JHGA 1Z4QA 2ZCUA 3WLHA 3COYA 3RBXA 1F3OA 2O4CA 5K01A 4BNKA 2VK2A 2F67A 2QAGA 3AUYA 3NIFB 3WLAA 3BK1A 1NVVQ 5BN5A 1G8YA 2OGUA 3BD7A 4YDHB 1AMOA 5CCEA 4KYVA 5DH9A 2Y1KA 1YS4A 5CFRA 4S2UA 1JUDA 4AMUA 4XRGA 1YB1A 1G6HA 1P8JA 1XX6A 1LXCA 5SYMA 2J30A 2X2PA 3E1GA 4MAAA 1GFIA 2B4TO 3DFUA 4UBJA 5CDFE 2AE1A 1XZMA 2OKGA 3I52A 5CXQA 1JHUA 1W36D 2ZLBA 7MDHA 1XTZA 4IM7A 1Y80A 1WPGA 2HFKA 4NABA 5NULA 2QUKA 3EIEA 5FOTA 1L1EA 2KLBA 4E32A 3KE9A 1YC2A 1AO0A 1IN1A 2VZ0A 2FG5A 1VOTA 3R0VA 2CNKA 3STHA 3COJA 3L0DA 3TR0A 1NPTO 3F3YA 4FMCF 3O1JC 4US1R 1DC8A 2RHOA 3KXDA 1HE1C 3L6EA 3WZ2A 5AVQA 5E6RA 2CBXA 3R23A 4AM8A 1RMTA 4D80A 3VKGA 3EBLA 1NY6A 1KOJA 4OHOA 4R01A 1M1XB 3HPRA 3K35A 3PZBA 4X8LA 2OXTA 3D5QA 4Q4AA 5MN5A 4WXMA 5KQLA 2XH8A 2ODTX 2QI9F 1T6YA 3IMCA 3IV9A 5EP1A 3FZNA 3R3WA 1V96A 3HEBA 4UBOA 5NLLA 4GWGA 3WQHA 3U7IA 1XD2A 5EJ6A 2NV0A 2PPVA 4FQ8A 4GGOA 4OYRA 1T0UA 4AMVA 3ENKA 4MJLA 3CXUA 1E3SA 1RIFA 5JD4A 1YC5A 1P7ZA 3ENNA 4RHCA 3BD6A 1HGXA 1T5IA 2CMDA 2ZR0A 1A8HA 4GKVA 3RW9A 5GJCA 3OFVA 1BN7A 1OKKA 2XI4A 3UY4A 2DFKB 1PE0A 1A8UA 1E3LA 1E7YA 1EUYA 3UJAA 2PZGA 1U3VA 4YLGA 4COOA 3L1UA 1XMVA 4KDFA 1GR1A 2YJ3A 3D4OA 4PYOA 2AG5A 3FH0A 5IXJA 4C0KA 5CA1B 2W83A 3JU3A 4B4WA 1KYZA 5EL0A 5KOJA 5IM4A 4I1VA 4CN8A 3GUVA 2GZDA 3THXA 2E5FA 2UU9B 2C7GA 1CU1A 3NWOA 4I4IA 1J7JA 1DX9A 1HT3A 3JVIA 1QTIA 1R6TA 1PK7A 2ZUVA 4CDGA 1UJCA 2P9BA 1WV0A 1Y48E 1KDZA 1GG9A 4GRDA 4UU8A 1MO6A 4JLSA 4V0RA 4A5OA 4GKBA 4JB3A 4KQCA 2BMEA 2OUKA 2E5LB 3Q1KA 3PTZA 3QOXA 1E60A 1T5LA 3KJGA 4BKRA 4BLOA 2P27A 3UUFA 2IWHA 3HVRA 3RUHA 2PIDA 3R5KA 4D8UA 1PG0A 2OWEA 4NV1A 3DCYA 3RFFA 2WWRA 2QTBA 1GPJA 4TYQA 3TNFA 2P90A 4MLCA 3WE7A 1BEUB 1SQ5A 5JJCA 3GDOA 1F48A 1RYYA 1NJ6A 3CN9A 2HCJB 4L4SA 1FS6A 1U4NA 3C2QA 1YH3A 3FCEA 4H7HA 5FB3A 1IK6A 1F8UA 3PJGA 4B8WA 1MNQA 4IOKA 2FHSA 1Z38A 4F85A 1CJSA 4NCBA 1G9SA 1V1MA 4GXQA 1LK7A 1T9AA 1V11B 1NFQA 5FPQA 4TLDA 1VL8A 3M4YA 1H66A 1U8AA 1R5OA 1MXHA 1CE8A 1Q7GA 3TQOA 1ZR4A 2GZAA 2XY4A 3HU2A 1XZEA 1NW8A 5JCPA 4B8ZA 1Z4JA 1NW3A 3TRDA 4JR0A 1E7RA 1JXQA 3KHSA 4KPGA 1H8ED 3EAGA 3MC1A 3N8NA 5HGJA 2WVAA 4MDHA 2XDQA 5LNK1 1IXYA 1A5AB 2VWHA 5I7UA 1MJNA 2HHJA 1GNQA 4XDGA 2WT4A 4QEKA 3BRWA 3CONA 3I0NA 1XTQA 5B4TA 3FNGA 4OMFG 4LTNA 2P9FA 3TTXA 2NXNA 1CXZA 2H4FA 1TEHA 121PA 1CETA 2H1RA 1PT8A 4WNIA 3MNFA 2RCNA 4HEJA 3PFIA 2Z8ZA 1EE2A 2JKVA 4DLUA 4M9UA 4WTOA 3PQDA 4AD8A 1VYVA 3D6TB 2HREA 1M34E 5ESXA 1SXJC 4JP1A 1W73A 1LNZA 1CNMA 1JKJA 2HM7A 2D00A 2ABWA 2VI5A 2YZ2A 3C5EA 3PL5A 3KZNA 2OQVA 3U39A 1CY4A 2B82A 2BISA 4FCWA 2GBFA 2IA5A 3EFOA 1DARA 3IEIA 3EOBI 1UMBB 2VCHA 5KYUB 1FFYA 4YRKA 1XK7A 3OTWA 3S1SA 1T3ZA 3DFZA 3JWEA 5JPIA 4ETMA 5KWJA 2O2CA 2VK4A 4OH7A 2HCTA 4RVSA 1U99A 3WGMA 3M6AA 5DNUA 5ALYA 3HXMA 1TJ3A 4BVFA 3K1JA 3VHRA 4CKYA 4LRTB 1FZQA 3H86A 5LUBA 1BQ4A 3F1KA 4BWFB 2QPAA 3MAAC 3DS8A 3OOJA 1KQFA 3CZ5A 2JF0A 2OB1A 4W7IA 5CCDA 3RHTA 3F4BA 3NUZA 1OTYA 4K6KA 1XGKA 5D85A 1VLVA 5ALJA 4EUSA 5KWSA 2ZIZA 3EPHA 3R6WA 4ZYVA 1IXKA 1JILA 4JDUA 2J9GA 3UBTA 2GK6A 3MBIA 4L4RA 2FQYA 4J2TA 1VBMA 3TZ6A 1LSOA 2DWPA 4HDNA 4MQBA 3GW8A 1H93A 2R00C 2R7NA 2JLVA 2AXPA 1KMHA 3E84A 1JNXX 3AHEA 4G4SO 4HH3C 4ZVLA 4DQKA 1RI5A 3OU7A 3BXPA 1C9EA 2Q2OA 2DECA 3MMSA 3S7TA 1IZ7A 3N7UA 4U7DA 5HPYB 1NSTA 1YJCA 1T5OA 5DHPA 5AVOA 3LBNA 4WX2B 1VPTA 5M7EA 1O1YA 1NUHA 1B2RA 5IT9A 5BURA 1UKAA 1CRQA 1U2GA 3NO4A 2GK4A 2DWCA 3G23A 2PZEA 2YS6A 4RJJA 4RU1A 3H5VA 3IJRA 3WFZA 1W4ZA 1UANA 3OUTA 4A5SA 4CIYA 2PYDA 4YIHA 4FSHA 5F76A 1M8KA 4CKCA 3CYFA 1Y5RA 2O14A 4GYYA 1TIBA 2YJNA 4Q15A 3ZHRA 4R2JA 2HPHA 3W04A 2EBFX 4AY5A 4CXMA 1XRJA 1FMTA 1U94A 4C6TA 3M7IA 1QZZA 1D1SA 4LISA 1ZH0A 5KTPA 2WDZA 4CKWB 5LA6A 3VNBA 4RJ2A 1J8DA 2EZ8A 3F67A 4QUIA 2HU8A 3SC3A 3P0IA 4MWTA 4DPLA 1UT6A 3ESRA 4DMUB 3TRJA 4CCYB 2HB6A 5ILQA 2FNAA 1A98A 1S4MA 1Q7TA 1SA0B 4NBRA 2WU3A 3ZWNA 1L5HB 3U3MA 3COVA 1S3SA 1ODCA 2QE7D 3BWCA 3GBPA 1JT2A 2WHEA 2VTKA 1I94B 3G2PA 4LQLA 3ZI7A 2W4MA 5SY4A 3IO3A 5AUQA 5ADHA 3ITNA 1OFIA 2X9QA 4X20B 3VC1A 3WIDA 1KBZA 4ZT7A 2R85A 3TOSA 3ILHA 3WL8A 2GD2A 3HMQA 4UPEA 4R1OA 4KGDA 4G8CA 1KDOA 1Y3FE 2R44A 1SCDA 2A86A 4NFLA 4YALA 2BOVA 3MJVA 2QVYX 3F5SA 3V33A 4EHBA 2DHQA 1V5EA 4OU5A 1PZFA 3DC2A 4JI5B 4PLYA 1P1BA 5JCOA 5CJPA 1KI6A 4ZZ1A 5C4MA 3OIUA 4FC7A 4CEJA 2JGAA 4HJXA 2XYPA 3JQ8A 1N7IA 4BWYA 4C89A 5JNWA 1RBQA 3G5UA 3P71T 4NE7A 4YJHA 3ZHTA 4DDMA 1DU4A 3LQKA 4CETA 1YI0A 1N3LA 4R05A 3RS0A 4ER7A 3MAJA 2YC4C 3TPZA 4Y30A 4HTFB 3NGMA 3M70A 5IN4A 3H3XA 4DBLC 2BY4A 5HCIA 2YHUA 3S8YA 5F1PA 2QTHA 4BAGA 4QQRA 3DE6X 3F1LA 2YY5A 4QXQA 4YACA 4ZAXA 4GMGA 4I9GA 5K0CA 4JA0A 3DM5A 1X14A 3ZHSA 3T1YB 1L6IA 4Q03A 4YGXB 4P5DA 1U2EA 5AT1A 3BM5A 3HY4A 4D4HA 3C6XA 4C1NA 1D1QA 1I1OA 1W6UA 1FUIA 2X77A 1BIFA 2VP2A 3NYRA 4OYYA 1TLTA 3I64A 4BBZA 5B30A 3WGOA 3K2QA 3NUGA 4JQSA 4LRSB 5JNVA 5JYBA 1MX1A 1FXUA 1U6KA 2ZANA 4PZ9A 4BJ1A 4DJDC 1PTJA 4ZEVA 3F7OA 2HI0A 4DLSA 4L4ZA 3VOSA 3I5YA 1KOLA 4UATA 1N6NA 3DNMA 3VHXA 1H1TA 2EFEB 4N7JA 1HUQA 5F52A 1XV5A 4OSOA 4TX1A 2ESRA 5ERGB 5GGXA 1C0PA 4EMUA 5AW4A 4GNKA 1KI7A 5DV9A 3B51X 3W79A 2YV3A 3PI7A 4PZUA 3IDQA 3RYHA 4HGPA 3GPIA 3DV0A 1J39A 1E6WA 1Q44A 2BEUA 4U7TB 3VV2A 5J4LA 1XCOA 1DEOA 1QHIA 1W35A 2DVMA 4B71A 1SJ9A 3H5WA 1ZZEA 3ZDYB 4P34A 1IHYA 2ZIEA 2ZAGA 3WLQA 2EHDA 4OSEA 1LC0A 4BNIA 2DH5A 5G0VA 3O75A 1KFEB 5A4MS 4JLKA 1VBKA 2Q45A 3OTGA 3R44A 3WAJA 5DBEX 2R2GA 4GICA 4R40A 4WFJA 4AB1A 4MWDA 5CBPA 4FFLA 3GLHA 4CCAA 2H4ZA 1DG3A 2G9QA 2HPZA 3MTDA 3U40A 4F8JA 1RXWA 2A9OA 1NVDA 3HVJA 3RS5A 3NG1A