2QSZA

Human nicotinamide riboside kinase 1 in complex with nicotinamide mononucleotide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
188
Chain Sequence
VPRGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinamide riboside kinase 1
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 55
structure length 188
sequence length 193
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qszA00
1E3MA 1SXJB 4LV8B 4MKFA 2JIZD 3VU9A 2XTZA 1P7CA 4LK2A 3CF6R 1E79A 2GJSA 1KO5A 3QPVA 4BZQA 2Q9AA 2YZ2A 3EC1A 4NZYA 4BFYA 2OV2A 3M0EA 2ZJZA 3EA5A 5DO9A 4Q4AB 1W36C 5K8UA 3B8HA 2ZAMA 2QAJA 4DCTA 5GVRA 2AHOA 4LV6A 2PZFA 2KWIA 1EX6A 4PHFA 3P4YA 5EZ5A 1QHNA 1R0ZA 5E7MA 3BWDD 2PCLA 1PUIA 3H86A 4NYJQ 1W46A 2VF8A 4HDOB 3HR8A 3CF0A 3ZH9B 1OPXA 2LWIA 4DLSA 1GL6A 3K1JA 1JQLB 5LB2A 4UNPA 3SQWA 2EFCB 4LJ6A 3LXXA 2FEMA 3BFKA 4NYIQ 3H0KA 4RFVA 5GJCA 3K0EA 4LBVA 3RWMB 1TEVA 3I3SR 1QHHB 3TJZA 2ZE5A 5FL3A 4HB0A 2FOLA 4XSHA 3CZPA 1KIMA 2GBLC 4DSTA 4HSEA 2QBYB 1G64A 5L3VA 3U7GA 1OH8A 3MWKA 4LC1A 3TQFA 2B6HA 4BEJA 5FPYA 1JNYA 1VCMA 1YR8A 3K9NA 3UXMA 3K70D 3NBFA 1HV8A 1XF9A 4D0LB 4KO8A 2ZQ5A 3GLIB 4EJSA 5JHGB 4GPTA 4QNRA 4LOAA 5HE8A 1GOTA 3B1XA 1JXOA 4AKIA 4L16A 2Z5FA 5K8LA 1SZPA 1G7TA 2MMGA 1COWA 2C77A 1TNDA 3JZMA 3E2IA 4FMBB 2FX3A 1Z06A 3ZIAA 3LY5A 3UMSA 1KSHA 1JR3D 1Z6TA 4WVFA 1TL7C 4XH9B 1YZNA 1DAIA 1KSFX 2BJWA 2NPFA 2ZRFA 1BO6A 4A92A 3SBEA 1T3LA 1E2DA 1DELA 1IXSB 3NWJA 4FWTA 4C0LA 1T3HA 3FPAA 1XXHE 4R2IA 2PLRA 4X8LA 2C99A 1NVVR 3K70B 4PSVA 3VAAA 2PEYA 1GG2A 1TF7A 2ODNA 4LX0A 1IN6A 5TDHA 2VPPA 4HEJA 5LB4A 1E2LA 3TQCA 1HUQA 1RKBA 4LJAA 3QEOA 5B30A 2NG1A 1M1YE 3FFBA 4JJKA 3KXLA 4GOJA 4EFNA 4GMDA 3UMFA 1JAIA 1I4DD 1RVDA 4GNKA 5JECA 2VIIA 1GILA 2QMHA 1UM8A 1XX6A 1ZM3A 3ADDA 1OH7A 1E32A 4JLOA 5J4VA 3PVSA 4PO1A 5JEDA 4ZDJA 4DLXA 2A5JA 3TAHA 2LCFA 3K0CA 2BHRA 3VHXA 4Q9HA 1OXSC 1Q1BA 2OSBA 2WTUA 1ZU4A 2IYYA 1E2KA 3Q85A 1TTTA 1D8TA 3EARA 5AUPB 3TBKA 3NH6A 3RDPA 1AZTA 2XZOA 4UKDA 3OE7D 1H8ED 5GJWC 1G17A 1AS2A 3TUZC 2P67A 1ZIOA 2JJ1A 2IW3A 4MUBA 2JCSA 3I8XA 2F3RA 3MUFA 1W36D 4JSTA 1GKIA 2ZJ5A 3LAWA 1AGRA 2D7CA 3GJXC 3LW7A 5FI1B 2YYZA 2J9RA 4WBSA 4CW7A 1Q3TA 4M1SA 4NCIA 4RVCA 1XJ0A 1TUEA 3PV0A 4F4JA 3EPLA 2QBYA 4U02A 5DNYB 1F6BA 1Z5ZA 2CJWA 2ZPTX 4L5BA 4Q1EA 3VX3A 5B64A 5TY0A 2GK7A 3VKHA 2ZJOA 4YC7A 1NP6A 1B23P 4EQ6B 3L82B 1NF3A 1MO3A 4M1MA 2X2FA 1E1QD 1SULA 4DLZA 4PSAA 2C2HA 1NN0A 4EPRA 4M8NE 5UKDA 5IK2D 2D74A 1FPMA 3ADBA 3W3AA 4NU0A 2WSSA 1E2JA 5EP4A 1E9FA 2FPMA 4TMKA 1AKEA 4LBYA 2Z43A 4GSYA 2W2TA 4D0GA 1J99A 1IY2A 1B0UA 5BXQC 1W36B 3VFDA 1ZUHA 4Q7MB 2O5VA 1Z3IX 2RGEA 4HUQB 4MYCA 1UADA 2ZE7A 4EPXA 3AV0B 3I4LA 4QBIA 1DVRA 1G5TA 3PENA 3PEUA 2VSXA 4QM6A 1W4BA 2YV5A 1YRBA 1ZNZA 2ZITA 3EX7C 1UDXA 2ZI9A 1S0UA 5G41A 1X1SA 4LYHA 2D7DA 4ACAA 5CJ2A 2IL1A 4XSGA 3UG7A 1E0SA 2DYKA 2CCKA 3X1WA 3GJ0A 4LY6A 1I4TD 1VYTA 4DB4A 3LRPA 3UANA 2J41A 4OK3A 4RD1A 1XPRA 3SQXA 3CWZA 4ERNA 3VR6A 2NTYC 1T8UA 3A4LA 3IEUA 1E9AA 1SKYB 2IXGA 3RAPR 2QT0A 2P6NA 4NPHA 3ONWA 4U7DA 1M2OB 1JR3A 2DFTA 2QA5A 2O8FB 2GAOA 3HDTA 4JL6A 2ANBA 2ZRAA 2ZI7A 1RRCA 2D06A 4Q9JA 2HLDD 4XJXA 1Z0KA 4WXRA 4QKQA 3NC1C 2KB0A 1F2UB 2XEXA 4Z1MD 1KY3A 3EWSA 3FDIA 1CJTC 3QG5A 5EP1A 1G6HA 4B48A 3VR1A 4NTZA 3CLVA 1R0XA 1G19A 1Q1QA 1VHLA 4BASA 4DDUA 1T6NA 1W5TA 2J46A 2XAUA 3Q3JB 4M22A 1R8QA 2WKQA 3ZDQA 3A58B 4DBLC 2ZRMA 3BRWD 2YKGA 4FCVA 4JLDA 2J0UB 1XTSA 1NRJB 4IJMA 4BGDA 4PC2A 1JALA 2P0EA 3ZGXA 1Z6GA 3IO5A 2IYUA 2BC9A 1RE0A 5JJLA 3GEHA 1XCGB 3U3RA 1PZNA 3W5IA 6Q21A 4ABYA 4Q21A 5DIFA 3ZZTA 2JJ2D 3C41J 4F4IA 3FMPB 4C0QC 3BH6A 5AR1A 2ZSBA 3H2YA 4BZXA 4H1VA 5DI3A 1AS3A 5HCNA 1U0LA 2PT5A 1H8EA 4JVNA 4Z51A 3V4FA 2QY9A 2ZE6A 5G3YA 1Z83A 2JLSA 3NBXX 5L3SA 1OJLA 4A9AA 3GLGE 4UQOA 1SXJE 2FFBA 2R65A 4G5QA 5LBIA 2DWPA 2PX0A 3ECCA 1N0UA 4LZZA 4M9XA 1YHNA 3EAQA 3W9YA 2AFIE 3X2SA 1Z63A 1E0AA 1MO5A 2F3TA 4JT4A 4QGAA 2RAPA 2W0SA 4LHWA 5JLJA 3CNNA 4QXAA 4RZ3A 3TSWA 2YINC 1GWNA 2WOJA 2Q3MA 2GJ9A 2HJGA 2QORA 4M0LA 1ELOA 1P4SA 2WJIA 1XDBA 2KJQA 1Q12A 4B73A 1YZUA 2PZGA 1CEEA 5GVSA 1IJEA 1E1QA 2GVZC 2ZRJA 1XMJA 2J7KA 2QSYA 2W83A 3AP3A 3QKTA 5IK2A 1EG7A 1IN5A 2QMOA 1ZC3A 4FCWA 3LBNA 2IF0A 1ZRHA 2E87A 5TXGA 3BB4A 3MD0A 1G20E 2L0XA 4OHYA 1QG4A 3ZQJA 4IXMA 1E9CA 1E2NA 4D6PA 1EWRA 4I81A 1RYFA 4B71A 1RW4A 3GLHE 2VA8A 5EP2A 3UIEA 2V1UA 1W49A 5J5CA 1KOFA 5L3QB 1GFIA 1FP6A 2DFLA 4TMXA 2HT1A 2AD5A 3CO5A 4ZKDA 1JJVA 4LV5B 3V9PA 4G0NA 2GK6A 4CEIA 1N6IA 4DT1B 2DR3A 1Z6YA 5CIQA 3GLIE 3EC2A 2QP4A 3R20A 1TF5A 4TMWA 2GETA 3RANA 2J87A 3I32A 1GSIA 3R9IA 5BYKA 4Q48A 4DSOA 3SZRA 1FUUA 2WJHA 2FSFA 4D82A 1G3UA 1VCIA 2X19A 4V0ME 4US2R 2NZ8A 3LH5A 2QEQA 1R0WA 2J0UA 4FMCB 4XTCS 5C4GB 3QBTA 5FBQB 2XB2A 3CRW1 5FOWA 3RRYA 1XZQA 4B75A 2XJ4A 2GCPA 2GF9A 2OM2A 1NVVQ 2WJYA 1IBRA 3AVXA 5JRJA 1IY0A 1AKYA 4XWOA 1EFTA 1OF1A 2IYZA 5HTKA 1ZW6A 1O3YA 1NN5A 3SYNA 3RHFA 2NMVA 421PA 4GDFA 4NCKA 3W34A 2GKSA 5G3ZA 4D25A 3T61A 1RC8A 5TMPA 3GLFA 3DPUA 1KAGA 2Q21A 3O8DA 5AUQA 2BKEA 1OH5A 1WCV1 4RZXA 5AJZA 2FSHA 4GZMA 3PCRB 1HY3A 3RSOA 3NDPA 2H18A 2FSIA 4BLPA 2FJUA 2QPOA 3O8CA 3I92A 2WICA 3F8TA 3NBYC 3OF5A 4P33A 1VG8A 2FSGA 1ZJ6A 2ZRIA 1XTIA 3PIRA 2JASA 1G16A 2ZJAA 4EPTA 1QHGA 2EWVA 4UJ5A 3K9HA 1SQ5A 1G9XA 2MSCB 3FYHA 2BKUA 3ND8A 2HXSA 4JSYA 1VPLA 4RD2A 5SZJA 4C30A 4BLOA 4LJ4A 1M7HA 1TMKA 1XJQA 1NVWQ 3CWQA 1XTKA 1T0HB 2QROA 3MGCA 3U6KA 3KKQA 3KKMA 4I1SA 5IHPA 1F2TA 3KJGA 1KI4A 4F92B 5FI0B 5AJXA 3TGPA 2CCGA 3THXB 1N5KA 4A2QA 2G88A 4TTPA 4UXIA 3THOA 4G5SA 3L0IB 3AF2A 4HATA 1QHIA 1KMQA 4FW9A 2ZU6A 4LC0A 2WWWA 4DEXA 2AX4A 4MKGA 2XZLA 1ZVQA 3ICQB 1JEDA 3CRMA 4PC1A 1R10A 1BMFA 1CJUC 1XXHB 3GJ8A 4OQMA 3RRMA 4O25A 1TUIA 4OQNA 4MYHA 1YZLA 2QZ4A 2JJ8A 2ZRCA 4V0NA 1CJVC 1S1CA 3SE0A 2BBWA 4ZV4A 3W6OA 2E9SA 4POAA 3IBYA 2IWHA 3OEEA 3OIUA 3RWOA 1XJCA 2QTVB 5KNCA 1H8HD 2YWEA 2YNMA 4OI4A 3EPJA 2ZVQX 4Q7LA 1E96A 1N0VC 5M04A 1FQJA 1NBME 2JDID 4HLCA 1ZINA 4Q47A 4DIDA 1JECA 3A1VA 4X8MA 3QF4A 1N6OA 3ZVNA 2IYTA 4F7WA 2EWWA 4TLBA 2EFDB 5H1YA 4RD6A 1Z47A 2QL6A 1TADA 3AKCA 2O8EB 4JLVA 3LA6A 1IXZA 4L8GA 1NMXA 4Q4HA 2ZUCA 2Q0HA 1JR6A 1TEXA 5BN4A 1NLZA 1OXVA 4V03A 4OKSA 1CR1A 5F2EA 2OESA 1ZM4A 4TYYA 1J7KA 4C3ZA 1T8TA 1Q44A 4KYIB 2UZ3A 1P9WA 4MITA 4N0EA 4TT3D 2R8RA 1UBEA 5D3MA 3L0PA 1AZSC 2GVDC 2BBTA 4PAMA 1CRPA 4QJ5A 2YHSA 4IOLA 1N5IA 2J59A 3X1DA 2G9NA 4BRUA 1RIFA 1TPZA 2VRWA 1VIYA 3B1WA 1HEIA 1II9A 1T4GA 4NYMR 4YLGA 4RJLA 4HI0E 3BFXA 5B2ZA 4G5OA 1DPFA 3OIWA 2EYUA 1SKYE 2VHJA 4ZO4A 3CKLA 3DHWC 5EXSA 3QQ5A 3A36A 3GEIA 4P4UA 1SVLA 4JLBA 5DISB 2ZRBA 4A8JA 5JWOA 2VP5A 3KKOA 3IGFA 4G1UC 1KI9A 3EIEA 1C1YA 5AJVB 1SVSA 4HLQB 4A4DA 2A5GA 2OXRA 2WWIA 5FL7D 5FH9A 3VR5A 1WRBA 4NL4H 3H1TA 3SYLA 1GDDA 4QJ3A 1UBCA 3THXA 2QGNA 1HYQA 1IM2A 1KKMA 1UPTA 2QE7A 8OHMA 3R7WB 1NIJA 3N70A 4F93B 3MFYA 2QTHA 3VX4A 3WMEA 4DB2A 3B82A 2FFHA 1U99A 2G0NA 3WYFA 3THYA 1VIAA 3OEHA 3CPHA 4XTRA 3U44B 1LV7A 1P3JA 2EYQA 1NSTA 4TLCA 1XXHA 1A82A 3WYGA 5CB8A 5L3RA 2QPTA 1NN1A 3HU1A 2QQ0A 4TL7A 3NEJA 2OUKA 2ZYTX 1U2RA 1HH4A 3QJYA 1R8SA 4OBEA 5BQ5A 2IYXA 3U60B 2ZRPA 5K8IA 1SHZA 5EE1A 4WZBE 4P32A 3N5CA 2ASEA 4B33A 4BFUA 1IN7A 1X6VA 4DXAA 1ZM7A 2EVWX 3P1JA 1S3SA 2CE7A 5A0FA 4AYWA 4JL5A 4O0MA 1VG1A 1NG9A 1VG9B 1IQPA 1II8B 4DKXA 3GPLA 3L8YA 2MSEB 1MO4A 4HZUB 2K5UA 1TQDA 3TSZA 5KPJA 4B2PA 2RB4A 1FTSA 4US0R 4LJ5A 4GL2A 1CJMA 2IXEA 4IDPA 4KI0A 1OYWA 3UATA 1W5SA 2QTFA 3IPYA 3DDCA 2YOHA 3QXJA 4XWAA 1ZM9A 2HDNB 2FN4A 1FUKA 4FIDA 3R9WA 1HURA 1XD2B 2OO7A 3UK6A 2AFHE 2QPAA 1H8HA 4B3DA 2B92A 3T35A 5CJPA 3OFND 1DAGA 4Q19A 2BEJA 2CVFA 2XJ9A 4DDTA 1XCMA 2FGKA 4JL8A 3DMDA 2AKYA 2WVJA 3QI2A 1KNXA 1E2IA 1GNPA 4JBYA 2WHXA 2IBMA 4M21A 1NLFA 4DUGD 2GEVA 3EZ6A 5DLQC 4KVAA 3CR8A 3K0FB 3W5JA 4C0JA 2O8CB 2F43B 2H5EA 4JVLA 4M9ZA 3P27A 2YOFA 4GZLA 4TT3A 4ON9A 5IF9A 2WV9A 4Q9KA 1GVNB 1RJ9A 4PFSA 1KMHA 4A82A 3NIBA 3R7WA 3K09A 4OK5A 2VYFA 1L4YA 2REXB 2WWXA 2X8AA 4B3GA 2CL7X 4Q7JB 2CNWA 1G8HA 2FPLA 2WKPA 3D31A 2IHBA 4NP6A 5KSYA 3E70C 4V0KA 1MR3F 4M1OA 4R98A 2JLWA 3CW2A 4KODA 3NC0C 4M9QA 2O8BA 2NO9A 5IRCD 3N2IA 2GCOA 4LYAA 5IT5A 4B6EA 2ZI6A 1MO6A 1Z22A 5FL7A 2EW1A 2PT7A 3QIAA 2O0HA 1ZNYA 4QBFA 3D3QA 3RNLA 3ASYA 3MWJA 1XTJA 2GWHA 4NKRA 4JYCA 4LBZA 4MRPA 3GLHB 4JMPA 1II8A 2WAXA 4AIIA 1QHYA 2NPIA 2J45A 1G18A 1PLKA 4AG6A 3HYRA 4HZUA 4QJ4A 1YJ5A 2QENA 2ZI3A 3NKVA 3P32A 1D2MA 1KI6B 5FUWA 3S1AB 4CT5A 2GEUA 3BORA 4ZI2A 3CB4A 3MCAA 2XXAA 4TTQA 3AF0A 3B85A 3ZS8A 4MYTA 1X1RA 1TQ4A 4NBSA 2GZHA 1Z8FA 1XU4A 5EP3A 4HLUC 3TR5A 3I5YA 3UPUA 4II7A 1JJ7A 2ZXUA 2XSZD 3AKDA 1EFRD 2VH5R 2QM7A 1XTQA 2ZYWX 3LFUA 3FMIA 1IOZA 4ZIRB 4TZ0A 2ONKA 4EFMA 1GRNA 1IN8A 1UEJA 1ZU5A 3C4JA 5B58C 5KPDA 5EE0A 4AURA 2C98A 2C8VA 2YWHA 5H68A 3UKDA 3E1SA 5HZKA 1M7GA 3VQTA 1RZ3A 3HPRA 3GJ5A 2OXCA 2QAGA 4G5RA 4LPKA 2GA8A 4AYTA 4KYUA 2A78A 2QP9X 1MKYA 2CHVA 2YWGA 2HT6A 3U5ZB 4W5HA 4H1UA 4BLRA 2BMDA 5J4LA 3K0FA 1WP9A 2HV8A 1EK0A 1N2CE 1SVIA 3WNCA 3WHLA 1QZXA 3RSLA 2JLUA 2DPXA 3NHBA 3GLGA 4B32A 1SXJA 4PHTA 1T5LA 4PPNA 4RKEA 5FBRB 3GEEA 3WYAA 1A2KC 3O47A 1S9DA 2CHQA 1U98A 2IYVA 3UMRA 3JVVA 3FKSD 1Q1EA 4R2HA 1K8RA 1LS1A 4TWZA 4M1YA 4DCUA 3OFNA 1X8LA 1KK0A 2FZ4A 3BJIC 3QPWA 4Q4AA 4LJ7A 2WPDD 3I1FA 2PLFA 2RGXA 3OESA 2BBSA 3CR7A 2VEDA 4BFTA 4C9BA 1ANKA 3KB1A 3GMTA 2QNRA 3RYTC 1M6NA 1MRSA 4KFRA 3HYTA 4DUGA 1P9RA 1A4RA 1NBMD 2IYQA 4NYMQ 2ZRDA 1E2GA 4NCNA 2ZUDA 2NO0A 4OI0A 1XMIA 5P21A 3GD7A 4KFUA 3FHTA 5J4KA 2AK3A 1XBTA 2JIZA 2CL6X 1QHHA 3T12A 2C96A 4C0HA 4GP7A 2C03A 3GLHA 3QSYA 3KUCA 3L43A 1IJFA 2C9YA 5FBLB 1NY6A 3F3YA 1P2VA 2F1IA 3AF4A 1R0YA 4LJ9A 2QQEA 3B2EA 2YWFA 3JVUA 4FD2A 2B8WA 2HJVA 2PH1A 4G3XA 2ONJA 2OE2A 2W2VA 1ZD8A 4C0SA 2XGJA 2R9VA 3BXZA 3FMFA 4E5UA 4XD7D 2FG5A 5JCPA 3TVTA 2BMFA 3SNHA 3GLIA 1KO7A 1EESA 4B3CA 1M7BA 1GRRA 5FPTA 1WQ1R 1ZUNB 5SZIA 4Q00A 4MRNA 4V0MA 4CT4B 1LFDB 3U3JA 4ZIRA 1BIFA 4Q4LA 4K81B 3RC3A 4IFEA 2JLYA 1FMJA 1U8ZA 3G82C 2REBA 3B1YA 521PA 2GZDA 4QFMA 4PC6A 3QG1A 1SVOA 4MGYR 4QGHA 3IHLA 3U4QB 4WOPA 2ZYUX 2KI5A 3JZAA 4RCYA 3QENA 3SBDA 621PA 2Q3FA 2HCJB 1VCOA 3AGQA 4WAUA 2OCBA 1DAKA 1WB9A 3I5XA 3Q5DA 2AK2A 4ZPXA 4HAWA 4M2LA 5HPYB 2ZSEA 5SZHB 4AI6A 2OILA 4HB4A 3TNFA 3GCGA 2JEOA 221PA 2AWNA 2XSZA 1EFRA 2MSDB 3KXIA 1U0JA 1VECA 2R2AA 2H92A 3U7HB 4KHZA 4A2PA 1DO0A 1T5IA 4G01B 2VSOA 1D6JA 3LX8A 3X1ZA 3H84A 4V02A 1WBDA 4CEJB 5EZ6B 1AS0A 1KI1A 3F0TA 4IEEA 5KNDA 2P6UA 4UXHA 3SR0A 4HAYA 821PA 4LHVA 1OB5A 4XVRA 2KBFA 5K8TA 2F1RA 4R7ZA 4YMVA 1XPUA 1YE8A 3NH9A 1DOAA 2GXAA 2GXQA 2BJVA 5JHHB 3ETLA 2EU8A 3W8NA 4CVNA 3AVVA 1KJZA 4FMCF 2VHUA 1KO1A 3C5HA 3LWNA 3CF2A 3KJEA 1GTVA 4ASUD 1NJFA 2JLZA 5JRZA 2QMUA 2OFOA 4PO9A 1YZGA 1KZGB 1E9SA 1UFQA 4LHYA 1HE1C 1UJ2A 3RS5A 3ZS9A 4EPVA 2G6BA 4RY2A 4ILEA 4MA4A 2IYRA 5CYOA 1T0JB 1W0KD 4LRWA 1WDTA 2F55A 1K6MA 1Z0AA 5FOVA 4DLUA 3GFOA 2DFKB 3WHKA 3X1XA 4W9MC 1R2QA 5FBWB 4EQ6A 5CDFE 1W7AA 2IS6A 1IXRC 4JLKA 4TQUS 1KAOA 3UG6A 1Z0DA 3EZ7A 2ZYVX 1ZYUA 4C0AC 3QY0A 1JQJC 1Z08A 3T1TA 4B3XA 2W6JD 5F9HA 1NBMA 4OHXA 3PUZA 1CJKC 2G83A 1QG2A 2W00A 3OE7A 5CLLA 5DH9A 3Q7QA 4ZCMA 5FOXA 2ZVPX 4C0BA 1FW6A 3TAUA 2XITA 2PBRA 3NXSA 5H8WA 4P3YA 2GXUA 2ZRHA 2AL7A 2C9CA 3BE4A 4YMWA 2VSFA 1QF9A 3NG1A 3EA0A 3TW4A 1NKSA 1FTNA 4HUQA 2D3WA 2WMOB 1QRAA 2VP2A 2ZI4A 2ZRLA 3U4QA 1KDTA 1P62B 1Y63A 3TIFA 1NSFA 3HPQA 2IYLD 1US8B 1G3MA 1BH2A 3LVQE 1BYUA 1JPNA 3ZD6A 2H17A 5EXPA 2V6IA 3EZFA 2GCNA 3FB4A 4XD7A 1ESNA 1UAAA 3LBIA 1M74A 4BWYA 1Q21A 3V00A 2VF7A 4JLNA 4PC3A 1CF4A 4JIMA 5A5GA 2GBLA 1KDPA 3MSXA 1E94E 2JLXA 1KDOA 3OZXA 2Z0MA 3AP2A 2WSMA 1ZCAA 2N46A 2G1JA 2O8FA 2JATA 4Q03A 2RGCA 1R5OA 4CEJA 3B5JA 1G4UR 3C16C 5JZVA 3WP1B 3BH7A 2V54A 2ZRKA 4ACBA 2VHTA 1F2UA 3I72A 5CM8B 3O8RA 1G3QA 2VHQA 2LKDA 2ATXA 5F3WB 1W2GA 2Q6TA 3CPJB 4FCTA 2CCJA 1I2MA 2PL3A 2W0MA 3P4XA 1DADA 2D4HA 3T1VA 1AQUA 4N0DA 1GNRA 1G21E 1E4VA 5CK4A 2P5SA 1HTWA 4OQXA 2OHFA 1E9BA 1OSNA 3L0SA 4GFDA 2B7BA 1G5PA 4TSFD 2WWFA 2YC2C 2G1KA 2CBZA 1XP8A 2QMEA 1Z07A 1UKEA 1ZD1A 1VYVA 3QOFA 3HR7A 1W0JD 4IXNA 4I1VA 4MKHA 1NG1A 2QGZA 4Z8XA 2OFWA 4PXAA 3D8BA 2ATVA 3T5GA 1A1VA 4A0HA 1NY5A 2P2LA 1HE8B 2GJAA 3PEWA 1FQKA 2HLDA 2X1VA 1Z2AA 2BWJA 1U81A 3P26A 4NE2A 5CYPA 3IILA 4Z1MA 3G0HA 3ZYCA 4DLVA 1GP2A 1E9EA 3OHMA 4TQ9A 1G7SA 4GOKA 1H65A 1Z0FA 4UXJA 3SEAA 3AVYA 1VYUA 5B57C 2A2ZA 1G6OA 4B44A 5KOYA 4URUR 2J0QA 2OT3B 2PMKA 4Q4JB 2A5FA 4KBGA 1Z0JA 2RCNA 4Z8YA 3LW8A 4C4PA 1U8AA 2GTPA 2VLIA 1E0KA 3VMFA 3QEJA 4ZKEA 3SC3A 4I1UA 4PPQA 2ORWA 4BPBA 4B34A 2NO7A 2OCYC 3GJ6A 4BZPA 3KFXA 1VHTA 1EWQA 5FPKA 3SFZA 1XPOA 1R5BA 2V4ZA 1F60A 121PA 1DEKA 2PMDA 5BW8A 4K8OA 1W1WA 4AKHA 2JJ2A 3THWB 3NVAA 2OBNA 3DVLA 4JYBA 1XD8A 4IRUB 3BOSA 2W6JA 1R6BX 4B2IA 1OIWA 3SN6A 1KKLA 2ZJ8A 3DM9B 4LHZA 3ZVLA 5CLQA 3B13B 4C7OB 3I73A 4WZAE 5KSPA 2RMKA 1G7CA 1P72A 2WBLC 2OBLA 4URYR 4A6PA 1Z0IA 1E0JA 4QHSA 3WNDA 2CHGA 4FI3C 5FTLA 3C7KA 1EFCA 1N6HA 5L3QA 5JFGA 4OHVA 1WMSA 1SKQA 3QNUA 1RRPA 4BLTA 1GZSA 2V8OA 3WBKA 5L8VA 2W2XA 1Z6XA 4DDVA 4IKEA 4ESHA 4M1TA 4TL6A 5G53C 4LWZA 2DWQA 4DT1A 4JBXA 1NVXQ 4UNNA 4EJSC 4W7SA 3T34A 4EDHA 4AKGA 5C1BA 4LHXA 1EXMA 2ORIA 3D7MA 1YU9A 3KQUA 3Q8XB 2AWOA 1E9RA 1L8QA 1YRAA 3F5FA 4KLNA 5FTKA 4YXWD 3TUIC 2WIAA 4CF7A 4HYYA 4EIWA 1FMLA 3GP8A 4CDGA 3QKRB 5FBVB 4URVR 1WF3A 2CVHA 2VBCA 5FOUA 2ZE8A 4HAZA 2R62A 3R8CA 3BBPA 3U61B 1D2EA 4IOKA 3ZVMA 3AKEA 3HU3A 2R6GA 4H9GA 4W5JA 3SJBA 1XEXB 1N5JA 2F1JA 4TQAA 2IUSA 4PO8A 4RZUA 2V3CC 2BVNA 4FWIB 2QSZA 4M1KA 2G77B 3KQKA 5DN6D 4HAUA 3PXGA 3QVVA 3B60A 5IDVA 3A4MA 1OFHA 4PPFA 2IK8A 1G8GA 3KJIA 4BE7B 3SJCA 5AWFC 4D4MA 1KDRA 4TSFA 5LDDC 3TKLA 1NMYA 2YJTD 3GFPA 5EE3A 2ZAOA 1OHHD 4GMXA 2AXPA 2ZS8A 2W6ID 2FNAA 4IVRA 3TUJC 2DWOA 1U8YA 4ARZB 1NL3A 3ZJYA 2BV3A 3ZD7A 3AVQA 1O87A 3BD9A 2O8DB 1ZUIA 3REFA 1P60A 4IFBA 4IDOA 2P6RA 4Y0VA 1BYIA 1RPZA 1KHTA 3SJAA 3CRRA 1CR4A 1E79D 1EFHA 1JXMA 5HR5A 3KXKA 4Q18A 2QRNA 3C5CA 4LYFA 4URXR 2RHMA 2R44A 3U7FB 4C7OA 3OAAD 3BAFA 5C18A 1Q22A 2QP3A 1K5GA 1X86B 4KAXA 2VP9A 4UJ3A 3E5HA 3NHAA 2YOGA 4E07A 4BQSA 4XOIA 1LTQA 2FA9A 1F3OA 3LD9A 1YKSA 4RD0A 3VTKA 3A1WA 5CITA 3U3KA 1VCNA 1XEFA 1I2DA 1GAJA 1EGAA 1ZIPA 3R8FA 1NI3A 4RKFA 2RGNC 1MH1A 2WJVA 3DL0A 3RLFA 1ZNXA 3TR0A 2AR7A 4RFSB 4O3MA 4KFSA 3O8BA 3BGWA 3SJZA 3VU9B 4F91B 1PJRA 4DJTA 3B7GA 5HZHA 2ZRGA 3PJRA 3HP1A 3T1QA 3FMOB 3A4NA 1ONBA 2VTKA 4BFSA 4XVQA 1NJGA 4FMDB 3V4RA 3GQBA 2BCGY 2IS1A 4A6XA 2RH5A 1N25A 4B43A 3TE6A 1OXTA 3B9PA 1XFAA 5D3QA 4PZYA 1CKEA 4NHOA 1I4LD 1P2UA 2H16A 5AK0A 4DCNA 2O8EA 3LLMA 3R9XA 1AQYA 1P61B 5FUXA 2NO1A 3KQHA 2EFHB 2GF0A 3PFIA 4PSKA 2FF7A 3RRZA 4IDHA 4CEHB 1UF9A 1N3BA 1YZQA 2QRZA 4NDZA 2OEPA 5EXTA 5KNBA 3K9GA 1QBKC 5JWHA 2GNOA 1E98A 1IHUA 1JI0A 2A5YB 3ZZ0A 1GKUB 1COWD 3AEZA 2N42A 4D4LA 5DHAA 2G0TA 2X77A 3A37A 4Q1FA 2Z4SA 3U3MA 3LQQA 2I4IA 1FFHA 3QUSA 2CXXA 1GNQA 1IN4A 1RYHA 2WMNB 1E1RD 2JDIA 2CL0X 3QKSB 1ESMA 5AUOB 4N3NA 2CK3D 3KFVA 4NONA 4BFZA 3TH5A 2CLSA 4LUCA 5J4YA 4TN1A 3VR3A 3CPEA 3J81k 3AVTA 1E2HA 1P75A 2R6FA 2O8DA 1ZD9A 1E2QA 5FTNA 1KGDA 2HXYA 1LNZA 1ZCBA 3PUYA 4YDSA 4EJSB 3CNLA 2P65A 3FHOA 3BIFA 1Z6AA 2NGRA 2WAYA 1S1MA 5DN6A 1N6LA 2FFQA 1R7RA 1X8JA 2HF8A 2QM8A 5JCZA 1S9HA 1KYIA 1N6PA 3IO3A 3DKPA 3IBGA 4IVPA 2ZR9A 5EJEA 2GDJA 1YR6A 3X1YA 2IXFA 721PA 4DZZA 3QXHA 2DBYA 4GT1A 1U9IC 3TMKA 3DO6A 1BS1A 3KJHA 3U44A 1TQ6A 5H70A 4CGZA 4PQYA 1N6KA 1LS6A 5C46F 2OLJA 4WZ6A 2FPKA 4RFSA 3FE2A 1UKYA 1P5ZB 2IA5A 1GRQA 5HE9A 2GAAA 3AF3A 2C9OA 5KU1A 5EUMA 2OFXA 4Q9IA 3RRNA 4HUTA 2QUZA 4K46A 2H57A 2IYWA 4XWKA 4EPYA 4Q1BA 4B74A 5JJKA 2UZIR 3KQNA 5FUVA 2C5LA 4PQFA 2A9KA 5ELXA 3OAAA 3AGPA 2H7VA 4N1AA 3CRQA 5GJBA 3DKVA 2KSQA 3AH8A 3W6NA 2WIBA 3GJ7A 5E3HA 1DO2A 1CXZA 4US1R 4UNSA 1WA5A 3I62A 4PR0A 2AKAB 1GL7A 2I1QA 2AN9A 4YMSA 4Q66C 4CEHA 4QG7A 3RS7A 1LVGA 5FFMA 5BYJA 1E4YA 2WSSD 4DC9A 2VP4A 4OHWA 4AYXA 2B8TA 3K0AB 4ZDKA 3CH4B 1OE0A 4P31A 2OBMA 1KJYA 4HDCA 4B76A 2C78A 1ZAKA 3IIMA 3KTAB 3DOFA 1TU4A 1XD2A 4DRZA 4P4TA 2P3SA 5JWRA 4E03A 2IC5A 3MAAC 5FTJA 1IAQA 1CTQA 3EW9A 2QG6A 3HU2A 3T06B 3A1UA 4MDEA 4D80A 2WOOA 3QKSA 2IEYA 2CJWB 3BFVA 1KNQA 1VG0B 3IHWA 1XMVA 3M6AA 2D2EA 3B9QA 3AP1A 3L0OA 1Z2CA 4OI1A 4WXPA 5CDFA 2IWRA 1VTKA 1W4RA 4JBWA 1NNEA 1FNMA 4X8OA 4OJQA 4F38A 4PPGA 3AKYA 1T9HA 2O8CA 3WMFA 4U5XA 1Q20A 3TVDA 2F43A 3CX6A 4B35A 3PEVA 4DSUA 3HJNA 2NO6A 3C14C 5C4MA 3K0SA 3ZQ6A 2ZJ2A 2F6RA 4J0QA 4LDJA 2HCBA 3TSOA 3NDBB 1ZC4A 5GADl 1CBUA 3C15C 2OCPA 5JSZB 2RGGA 2AD1A 1RFLA 2BMJA 4S2EA 3LDAA 2XX3A 3SU8A 2V6JA 4GBMA 2KBEA 4TLDA 5G40A 3P20A 3RC8A 1UEIA 5JEEA 1G3IA 3SFVA 2FV8A 3A6PC 4KLZA 4QBHA 1FOEB 1E1RA 2Z4RA 2CK3A 1AK2A 1OXUA 4TYQA 4L9WA 3ZZUA 5JS7A 4MRVA 4WA7A 1BKDR 1G7RA 3CRVA 3LXRA 1EX7A 4EUNA 3KKNA 3MJRA 3QXCA 4IDNA 4Q5IA 4BUJA 1KI3A 2FE4A 2RHDA 3IIJA 1YVDA 4YMTA 3EXAA 2VHCA 3L2OB 4M4SA 4HLDA 2YVUA 2FZLA 2JAQA 4A0RA 4C0KA 1G291 1OT3A 3K9LA 2WJGA 4O2LA 3ZVRA 5E4FA 4V0LA 3B1VA 2PJZA 1LW7A 1JPJA 3K53A 2FFAA 4PC7A 2H8KA 4D2IA 3TW8B 1VDZA 2BEKA 4W5WA 4HAVA 4A15A 4BEBA 3UWKA 2ZSFA 4QOSA 1G8FA 2RGAA 2JGNA 1KI6A 3IEVA 3S1AA 1CRQA 4BFWA 2ODWA 3IIKA 1KI7A 3K0AA 4L4UA 2VL7A 1YQTA 4JVSB 2XNDD 5BN5A 2ZREA 1J70A 1M8PA 1C4OA 1HQCA 3KTAA 3IKJA 2DCUA 3CUEF 1MV5A 2NOAA 2NQ2C 2QU8A 1L2TA 3A1TA 2AXNA 1LF0A 2V55B 4DWJA 3W3ZB 2A3RA 1OB2A 2O52A 4KJZA 1AGPA 2EFGA 4DCSA 5LD2C 2GZAA 3VR2A 4PZZA 1DAMA 4UNRA 2GILA 3AVOA 5DYIA 1Z28A 5EQTA 2FWRA 2RGNA 3MRSA 3WRYC 3KQLA 3SI7A 4KU4A 1E2MA 3K8YA 3QF7A 4EPWA 1OV4A 1IONA 4NCJA 3A8TA 1ZMXA 3W6PA 3HWSA 1G3RA 5SZKB 5JS8A 4O2RA 5DI3B 3EG5A 4MQBA 1S3GA 4TYNA 1QVRA 3ZLJA 1UKZA 4A36A 5J4HA 4L15A 5L3SB 2D62A 4ZCLA 1U0HC 2ANCA 2R6CA 1OIXA 1AM4D 1G8PA 1CULC 1Z29A 2VO1A 5EXXA 4ZI3A 1CLUA 2CMKA 5JSZA 3MG9A 2FGJA 1AN0A 2A30A 3SDZA 3Q72A 2XTNA 1E6CA 5KTYA 3CX7A 2J0VA 2XZPA 1CR0A 2JLQA 4AWXA 4IHQA 4A1FA 4QHYA 2XOKD 2OLKA 5FR2A 1D9ZA 4RD4A 2E1RA 4YMUA 1W2HA 2WWGA 1XWIA 2C04A 4B3FX 3LX5A 3A1SA 3BB3A 5KSZA 1TX4B 4Q9LA 5J47A 3QPUA 1JAHA 2FEOA 4URZR 1AIPA 2N1BA 4OHZA 4D4JA 4MRSA 4QBGB 3TLXA 3FVQA 4MRRA 1XEWX 1OXXK 4CIDA 4RZ2A 4PTLA 5F9FA 4QNMA 3PEYA 4KCGA 2J5XA 3N2EA 2GESA 4A0FA 4BFVA 2YC4C 2FDCA 5AJYA 3FOZA 4TMVA 1QVAA 3Q9LA 2HF9A 1DE0A 3FKSA 1N0WA 1HT2E 1F48A 2OAQ1 5FOSA 5FUYA 2BDTA 1V5WA 4GRAA 4P4SB 5FPHA 5TV2A 2ZS9A 4EAQA 5J40A 3WNBA 1Q1ZA 2WPDA 1T91A 1LY1A 4CEIB 4MGZR 4Q1DA 5ANRB 4WIAA 1FNNA 5TVKA 3VNUA 2ZS7A 1DAHA 3LQRA 4A8JC 1FL9A 4A2WA 1CR2A 2IX3A 4LCBA 1A2BA 3BB1A 4AKEA 4U00A 5JI3E 1L7VC 4KXFB 1G41A 1MABB 2VQSA 4C2TA 4TLEA 1FX0B 3BK7A 1Q57A 1RRGA 4HAXA 4LPSA 4LGMA 1U9IA 1GL9B 3CNOA 4Y0AA 3SHFA 4X8HA 3FGNA 2V7QD 4DLRA 2W58A 2ODEA 3BERA 2OAP1 4M9SA 1A5TA 1QHSA 2WKRA 3SHWA 2H1LA 2GJKA 4YONB 5DGXA 3T1OA 4OL0A 1ZM2A 4IDQA 3GLFB 4TLAA 3ADCA 2ZIAA 1KO4A 4E09A 2UKDA 1XMSA 2I3BA 2ERYA 3M4YA 3CM0A 1VMAA 2BM1A 2XNDA 4OJKA 5FPSA 3FKQA 4P0TA 5DSZA 1T3SA 3RVBA 4JKYA 1EFUA 2GJ8A 3IDQA 5DYGA 4D0NA 2QI9C 2WM9B 1CU1A 4WW0A 5CB6A 1DARA 3T5DA 1J8MF 3LBHA 2ZUBA 3LV8A 1BMFD 5DHFA 4B3BA 5KDDA 1GUAA 2EQBA 3KKPA 3PUVA 1FZQA 4B6FA 1Q3HA 1VKJA 4XVUA 2O0JA 4DEYA 1OH6A 3RABA 1YR9A 2I1VB 2Q3HA 4EKDA 1GM5A 1MT0A 3EASA 1BOFA 1X8KA 1NLYA 3OEED 4HLUA 3ND9A 1W48A 3PUXA 4LJYA 1OKKD 4RD3A 4MDFA 4KBFA 2DHRA 1F2TB 3WP0A 4GP6A 4BLSA 4RSGA 1DAEA 2CEAA 2J3EA 2ZROA 3EZ2A 4D4KA 2PJRA 3GJ4A 4JLAA 5LD2B 1KY2A 2NZJA 1K5DA 3WBJA 3VKGA 1P9NA 1S2MA 1DAFA 4YQFA 2PCJA 1ZP6A 1SGWA 3VKWA 1XEWY 2XNSA 1PLLA 4ESVA 2Z83A 4P4SA 3QBVA 3AUXA 3EWAA 4L9SA 2XOKA 2WWHA 4JJZA 2J0SA 1KK2A 1XRJA 3IQWA 3BS4A 4GI7A 2BMEA 4KVGA 2ORVA 4CRWB 3I8SA 1N5LA 5HKKD 1NIPA 1W47A 3KUDA 1RRFA 4PHHA 4QM7A 4OQFA 1S8FA 2B21A 2ECKA 2ZM5A 5HCIA 1CIPA 1N6NA 1R4AA 2HYIC 1C9KA 4PHGA 1F5NA 1XB2A 4DCVA 4Z54A 1MABA 2ZRNA 3G5UA 1FX0A 1JB1A 4IOJA 2Y8EA 1D2NA 2C95A 3QF4B 4PAQA 3WRXC 3NTUA 4OK6A 4OI2A 5E7JA 3DEFA 4CYMA 3AB3A 4S35A 1PV4A 5DI9A 4IOMA 4QL3A 1E2EA 2F1HA 2VP6A 3FFAA 3K09C 4Q4HB 4GOXA 4ASUA 1E69A 3WY9A 1UBFA 4TL9A 4JLPA 4I99A 1KSJA 2HYDA 2ZSDA 2PZEA 1ODFA 5DE3A 1N6RA 2REOA 1US8A 1W44A 2OZEA 4XIGS 4TYPA 1DG1G 2GHIA 1TU3A 1W0KA 3BH0A 3AM1A 3PG5A 1SVKA 2Z6VA 2JA1A 4AG5A 5D3MB 3M1IA 1D5CA 4KV9A 5AJWA 1ETUA 2WJJA 4KSBA 4Q01A 3ICEA 2QE7D 2ZANA 2IT1A 1OLOA 4NYJR 2J7PD 4HB3A 3LO5A 4NH0A 4R9UC 4LYJA 3KDSE 4Q1AA 2OG2A 1OIVA 2IS4A 2NIPA 3OEHD 2BOVA 1GIAA 2F9LA 4PAOA 3LVRE 3WMGA 2SHKA 2IHYA 3OIVA 2UVQA 3B78A 4NYIR 1KJWA 1AA9A 1X3SA 3DMNA 3MJHA 1V43A 4C2UA 2IEZA 1DBSA 1JR3E 3DOEA 4QRHA 3CIOA 2B7CA 2V7QA 3FWYA 4A8JB 1TAGA 4FN5A 4IEIA 1MOZA 4HZIA 4QHTA 4RCZA 1LF5A 1Q0UA 4TTRA 4R71A 1OYYA 3EPKA 1KO8A 1II0A 1WXQA 2CLCX 1KSGA 4DSNA 3W90A 4FMDF 4OYHA 5CIWA 1S96A 4JS0A 1L4UA 2FH5B 1JBKA 1GKYA 3GJ3A 1P2SA 3AQ4A 5KSOA 4QC2A 1HQYE 1E99A 1SHKA 2BIFA 3IQXA 1G1MA 1W4CA 1OFIA 2KE5A 3NEYA 3THYB 1R5NA 1E9DA 4KSCA 3FHCB 2ZR0A 4A0GA 2ZJBA 4B2LA 1YR7A 1CS4C 4JLMA 3VR4A 2PX3A 3ADKA 2O0KA 2QAGC 3RS4A 4BFXA 3FTQA 3MLEA 3DM5A 3OIYA 1UBGA 1NKTA 3CONA 5FTMA 3UWOA 1OKKA 3ASZA 4YDHB 5A4JA 1ZNWA 2P5TB 3DZDA 1D9XA 1KI8A 3MWLA 5KO2A 1A7JA 1SXJC 2XB4A 3SYKA 4HDQB 1Y3AA 3IUYA 1NVUQ 3BC1A 4IW3B 3W8RA 4Q4JA 3GFTA 1OFTA 4D26A 2IUTA 1ZBDA 4HB2A 5EE9A 1HA3A 3TK1A 4V0OA 1W0JA 3RS2A 4TMZA 4LSGA 2FMXA 3CBQA 4I4LA 1LB1B 1W4AA 2FU5C 2CLDX 2HEIA 5EUQB 4ZDIA 3SOPA 4DVGA 1KTVA 1SVWA 4PQRA 1TQ2A 2Q9CA 4AD8A 3K0CC 1WBBA 5E7IA 3AVUA 1E2PA 2EFEB 5HKKA 2OCAA 3PQCA 4F4CA 4PZLA 2JLRA 3THWA 2G3YA 2V9PA 1WE2A 4MYUA 4JT2A 4I1OA 4URWR 2CNWD 5JMTA 4M1WA 4TYWA 4TZ6A 1KK1A 5F98A 3EIQA 5BWMA 1G4AE 2GEDA 3RS0A 3RS3A 4JVMA 1SVMA 1PLJA 1XTRA 2ODBA 3EPHA 2ERXA 3VNVA 1M34E 1P6XA 5C2JB 3AUYA 1FP7A 3TRFA 4EFLA 2A5DA 4ZCIA 5JI2E 5KHOC 2BCJQ 3C8UA 3CH5A 4D81A 3AVPA 2F7SA 3KZ1E 5CK5A 4KITB 4MH0R 1U90A 1XNJA 3PR1A 4JZKA 2X2EA 4Q1CA 5KDLA 5JBQA 3REGA 4ZDWA 3AF1A 3MWYW 4OQLA 4QGFA 1RJ9B 2ZJYA 4JKIA 1XD9A 3KX2A 2GXSA 1KMHB 1NMZA 4QGGA 4BRWA 2ZR7A 2J7PA 4DLYA 1PUJA 4JLJA 2JLVA 3AVWA 1KZ7B 2IUUA 4LJ8A 1CP2A 3B6EA 3Q5EA 1G5RA 2F9MA 5AUNB 4MGIR 3CX8A 2TMKA 3QKRA 1AJEA 2LKCA 1KI2A 4MKIA 2XTMA 1J2JA 2BM0A 3T15A 5LPNA 4M53A 2O8BB 2CDNA 4TL8A 1YZTA 2GCOB 1HT1E 2ZTSA 3NBZC 5EE5B 4UNQA 2HUPA 1JEEA 1XEXA 3EIHA 3WXMA 4PX9A 5CM9C 2DB3A 2Q9BA 4LBWA 2DY1A 5KYKA 4Q7KA 3U2QA 3K70C 5TARA 1OFUX 4DIEA 4NCHA 3GLFE 1DS6A 1P73A 2PEZA 5JJIA 3ZIAD 3U3OA 4Q02A 4FXPA 1QHXA 1UKVY 3PITA 4DLWA 2D2FA 3Q7PA 4DHEA 1OW3B 2GRJA 2IYSA 2IF2A 4MUAA 2IS2A 1IY1A 2MMCA 2RKOA 4YXWA 3U6BA 3MMPA 2ZSAA 2V1XA 4DLTA 5BN3A 4KFTA 4BLQA 1UDWA 3SS8A 2WWYA 2VP0A 3PUWA 1PVOA 4ARZA 1YZKA 5KDOA 2ZETA 5FR1A 2XXAB 3L8ZA 3U7EB 4FINA 4B47A 2QN6A 3QXSA 4LI0A 3IPXA 1SXJD 1TF2A 2CE2X 1DTSA 1MRNA 3H4MA 4TMTA 5KUTA 4CZ2A 3D6TB 3EZ9A 4NMMA 2ZI5A 3KL4A 4G5GA 2BBOA 4DDWA 4ITRC 2RGDA 3QXXA 4AY2A 4E22A 3KB2A 4BECA 2A7QA 3DZ8A 3QE0A 1J90A 3QVUA 1DG3A 4IVQA 2ZU0C 3VHLB 1P2TA 2WZQA 1XZPA 1J8YF 2R6DA 5E95A 1G8YA 3B1ZA 3LNCA 1NN3A 1KK3A 2R6AA 4PANA 1E2FA 1GITA 2QAGB 3CZQA 2ZEJA 5GJVC 1OHHA 2RGBA 2QT1A 1S4QA 3QKUA 1QDEA 1U94A 2W6IA 3I61A 4MGKR 4AK9A 5TB5A 2J1LA 3LLUA 4AC9A 2DFNA 1XCPA 3GLGB 2JJ1D 5FOTA
chains in the Genus database with same CATH superfamily
4CWAA 1CUBA 5G0WA 3C4QA 4MKFA 1E1MA 3F4LA 5BRAA 4DCGA 4LK2A 3OC0A 2X9GA 3LLVA 3UW3A 1E8DA 3VJLA 1FBNA 1KO5A 1O2DA 2Q9AA 2IZ5A 3EC1A 3O3CA 3DOUA 1EKXA 2X0IA 5AOVA 4CHTA 4J0HA 2ZJZA 1J4AA 3DZFA 3QEKA 1SJ9A 4N5NA 3CV3A 4K87A 1WP4A 2FHPA 3L1IA 4ZOAA 5DO9A 3PFGA 4JC5A 1CLEA 1LDBA 4FFBB 4CM4B 4G07A 2I76A 2QSUA 5ECGC 5IW8A 2PVPA 5DVZA 2OORA 2AHOA 1T8PA 3CUWA 4HJRA 4BS9A 4EHIA 4WXMA 4DIMA 3K71B 2I67A 2PZFA 4FT2A 4PHFA 2XMSA 4HNSA 2W2MA 3IP3A 3RJTA 3HZRA 1T5OA 1RQNA 2P90A 1QHNA 1R0ZA 3MTIA 4RIGA 5E7MA 5BUZA 1PUIA 1X7GA 2VWPA 3IUSA 1E61A 2VF8A 3ITDA 4HDOB 1JXAA 4G4SP 4NBWA 1GL6A 3DLTA 5LB2A 3CUYA 4UNPA 2LCIA 3R6GA 1RLOA 4X9XA 4RFVA 1Q7GA 4H6XA 4ZZIA 1DTWB 3I2JA 3K0EA 5ADWA 4MPRA 1QHHB 1K4YA 4MKXA 3TJZA 5LKAA 2C83A 3JSXA 4UTRA 4HB0A 2FOLA 2JHPA 2QRMA 1D7OA 1QFJA 3B5EA 4WNAA 5B1SA 1P0QA 3RLIA 3RTDA 3PR3A 4J3NA 3CSDA 2AUTA 3MS2A 1S3FA 3MWKA 4LC1A 4HEHA 1CDDA 4BEJA 1O9GA 4MUXA 5PGMA 1JNYA 2XUJA 9ABPA 3IERA 3TX2A 1TRHA 1WCIB 3DLBA 3L4EA 4BCBA 3K5PA 3VNAA 3K70D 1QXSA 4KMOA 1ZR2A 2YUTA 3H4VA 1P39A 1GL3A 1P3DA 4UBKA 4C06A 2XQGA 4PX5A 1FFGA 1Q0QA 4KQIA 1ZIXA 2JB9A 1MX5A 2O1EA 4ZZ3A 3UHAA 2O2IA 4X6YA 4US2R 1QFZA 3PNOA 4IQ4A 3ZHTA 5IBPA 1RI1A 3FSJX 2Q4OA 1NSYA 1COWA 2M1XA 3WTCA 2VDKB 4QVIA 2FX3A 5HSGA 1SOUA 3ZIAA 3LY5A 5SYMA 2BFBA 3ZR4B 4MS1A 5A5DA 4WVFA 1TL7C 1OBHA 4HDNA 5IARA 5HFAA 1QOZA 1U0OC 3LT2A 1YZNA 4WCFA 3NBAA 3E7XA 4QEDA 1ORDA 1LZKA 2G4VA 2ZRFA 2NPFA 5HUHA 2D1RA 3OIGA 1YRQA 1JA9A 3NWJA 2XCSB 1NW7A 1PEDA 2IGBA 1T3HA 2VSQA 1XXHE 3FPAA 4EWLA 2PLRA 3KD3A 2ZIVB 2GJ4A 4MW6A 3HFGA 1NVVR 1M67A 4LTDA 1NRWA 2EAUA 2JH3A 3EGDA 4FOTA 4PSVA 5FI3A 3VYVA 4WOBA 2PEYA 4COOA 2JGEA 4K2HA 2JCYA 4DIBA 4OGFA 5LB4A 1WKCA 1ZN2A 1CY8A 5K6AA 1NRIA 4QDKA 1RKBA 3TXYA 4O08A 1O4WA 4H4CA 1GUBA 2NG1A 3RWBA 1O97C 4GZ3A 3BSWA 3SZUA 4CNQA 4J2OA 3KXLA 4TZKA 4GOJA 2SCUA 1W2WB 3HCNA 3N0RA 5F73A 3ZIDA 1Z4JA 5NLLA 2DH6A 5KTMA 2CNLA 1PFYA 3BSFA 4EATA 1OH7A 1Z45A 3N75A 5CFOA 2HB6A 2ZJ6A 4EUKA 5A9RA 2O2DA 5JEDA 3BVPA 3PX7A 1B93A 1J09A 2C2YA 3G8CA 3K0CA 4BBPA 4OREX 4UHBA 3RQSA 2WTUA 1ZU4A 3L8HA 4DTCA 2NUBA 3M9LA 4GI1A 3M4XA 3EARA 4YA6A 1AZTA 3MLAA 1S2OA 3DZIA 3WLEA 5JARA 3OE7D 3NU1A 2GZ1A 5GJWC 1AS2A 2W70A 4B1FA 5KQPA 3TUZC 2XF8A 1XDWA 1XELA 3AY0A 1D1QA 1MB3A 4MUBA 2M6KA 1ESZA 1UKAA 2NYVA 2YDXA 3BFPA 3DMRA 1NQXA 4N3BA 4JI2B 1AGRA 1U7UA 3T7DA 3LW7A 2CDAA 1PWEA 2YYZA 2QIOA 5DBFA 2YQZA 1Q3TA 4CW7A 3HY4A 2Z5VA 1CY6A 4IUBS 3T54A 2DPMA 1M3SA 1IHXA 1OXKB 3GT4A 3NETA 3PRKE 4PRZA 3RF6A 5DNYB 1WXXA 4K8RB 4S0ZA 3H4IA 3IA2A 1Z7EA 4GS5A 1M1UA 1T24A 1ZA2A 3AZPA 3HYLA 3MB5A 1T3TA 5G4LA 5TY0A 3T7AA 3VJKA 4R3NA 5KNDH 3IUQA 5F33A 2NU9A 2JFBA 4FR5A 1NP6A 3UA3A 3O2JA 3QI7A 4TLLB 4B3IA 4EQ6B 1MHPA 1BVUA 1E6WA 1RM3A 3H9CA 2XMZA 2JRCA 4TV8A 4IDFA 4PSAA 4CIXA 4F1KA 3PFWO 4R31A 5UKDA 4RLHA 5C8ZA 3Q40A 4RQAA 5LQNA 3W3AA 3OZRA 4PHCA 5EYPA 2XWSA 1WXGA 4UATA 1HDZA 5EP4A 2Y92A 2H1VA 1V5GA 1K6XA 1YS9A 2FKNA 1QS0B 2ZT5A 4HJXA 1ZK4A 2FPMA 2FR8A 3LJKA 3N74A 5KAMA 4CKWA 2Z43A 3AEUB 4RV5A 3QVKA 5BXQC 5LQUA 1ZUHA 3E3MA 4YIKA 1Z3IX 3X1MA 3VVLA 4HUQB 1XZ8A 3SEQA 4MYCA 2Z9CA 3EQ7A 3AV0B 3OPYB 4I9UA 5GV8A 4ZTBA 1TRKA 3IOYA 1W29A 3QU5A 5EEHA 4LMAA 1YRBA 1ZNZA 4UZEA 3EIFA 1WABA 2ZITA 3E2PA 4C6SA 2ZI9A 1ZHHA 2R1UA 1X1SA 4LYHA 5CW1A 3T4UA 3UOAB 3WE7A 3FYDA 4XSGA 3HI4A 2GN9A 4N40A 1GYRA 2X2PA 2DYKA 5H0IA 1F8FA 1Q14A 2H4JA 1X1TA 1VYTA 3GFVA 1SURA 3KWMA 3LRPA 3UWMA 1I0LA 4L75A 4OK3A 4RD1A 4XD2A 3BKXA 1C8LA 3SHVA 3KSBC 2PD3A 1YQ9A 3FZGA 1WR8A 5LIRA 2REQA 4Z0PA 1SKYB 3IELA 3O82A 3OURA 3OZAA 2HXGA 1QHEA 4MUEA 5EKDA 2BKAA 1JLKA 2CZCA 2P6NA 3B6ZA 4NPHA 4N48A 1XK7A 2X6RA 2QA5A 4U7HA 4B4KA 4C03A 2O8FB 2ANBA 2FN7A 1KE1A 4MCJA 4BLUA 3CCCA 2UVPA 3ES9A 1RMYA 4MMYB 2DMRA 4IJ6A 3TRKA 2LRHA 3II6X 3OKFA 4ZAGA 4RH3A 3IB6A 1CJTC 3QG5A 1DTEA 3DDNA 5DP2A 3WNZA 3ZDDA 5KVQA 2HPHA 4XB2A 1G19A 3WKAA 1O94C 3O9MA 5IABA 3CVUA 1VHLA 3AFIA 1LJUA 1EUZA 1D6NA 4EGFA 2ZJ1A 1PTJA 2XUIA 1U7PA 2YWRA 3I01M 2J46A 3Q3JB 4M22A 4YK7A 5EZYB 2ZT7A 1XRPA 1R8QA 1XQWA 1A5AB 2R8EA 4QICA 1U0FA 1K6IA 3A58B 5TMDA 1KYYA 4ZHSA 2ODAA 1SUBA 1BKYA 2OZVA 2FWJA 4FFMA 2YFKA 3NGMA 3AERB 4IJMA 3C5VA 1ONSA 1JALA 2WU3A 4MDYA 1YL7A 1Z6GA 2H59A 4KPEC 2OV3A 2YRFA 3W5HA 5HQ3B 4CMJA 1RE0A 5JJLA 3GEHA 1L5WA 2GSDA 1PZNA 4YDQA 4BGIA 5DIFA 4YIHA 2APJA 2XDWA 5AOAA 3WWPA 5LR6A 4PNPA 4C0QC 1BRTA 2WHPA 4QEZA 4RZHA 2I6FA 2WD7A 3UMBA 4PCVA 1H2RS 1BDBA 4D6XA 3R77A 5DX1A 2FJPA 3RH0A 3V7WA 3WQSB 1XSEA 1U0LA 3IE1A 1O7JA 2I7XA 3IBTA 2JGFA 3OT5A 1FTGA 2DRIA 4GM0A 3N8DA 4YP1A 1P4HA 3EE6A 5M2QA 3HQ4O 3NBXX 4JJFA 5FAXA 2Z6QA 4PYKA 1OJLA 1P17A 3W5VA 4CLOB 4H0FA 3L0DA 1QKKA 4PYJA 5E2BA 3M4JA 5LBIA 2DWPA 1DC7A 1HE5A 2PX0A 1N0UA 2WTEA 3UUGA 2EL9A 1X7DA 3H3JA 3BTUA 3TNJA 1QVVA 1DKRA 4BNMA 2F3TA 3FLBA 1QYDA 2ETXA 3GIDA 4KXWA 3IVXA 5AI8A 4CLXA 1ISHA 3EXHA 1JA1A 2BHNA 3CNNA 3WK4A 1YVEI 3ZWCA 3VPXA 2Q3MA 2GJ9A 2HJGA 1FDTA 1JHDA 2KJQA 3V2HA 3H75A 3KE9A 4MW5A 2PZ8A 1JDPA 3L7CA 3F6CA 3ZY6A 4BX2A 4DGQA 2H2IA 3W5CA 2PZGA 1AKNA 2HZ7A 3AI1A 2GVZC 3AHCA 5AJTA 4XRRA 2W83A 2HTEA 2Q6OA 2Q5LA 4WK6A 5CUQA 3VPSA 5E1MA 4Y6GB 3RCBA 4B6OA 1ZC3A 1C4KA 2GYWA 2ZWIA 3ENKA 1LPMA 2QL7A 3NIDB 4ZT5A 1JFFA 4O02B 5TXGA 3MD0A 1G20E 3DVAB 2B30A 2L0XA 4ZV9A 4W9RA 3VU0A 1QG4A 4CV1A 5IU6A 4OHYA 5HIJA 4UPEA 1E2NA 4XX1A 1YA6A 4HGYA 2JF0A 2VA8A 3T4XA 3PEEA 1R37A 3RYFA 2PUEA 4NULA 1UCFA 3FCYA 3FR8A 2YV2A 2IPOA 2AD5A 3CO5A 5EFOA 4IDBA 2DHDA 3OA2A 3PNVA 4M1EA 4ZKDA 1JJVA 4CEIA 1R27A 2AG8A 3X2EA 4C7BA 4FHFA 2IYEA 5E3IA 3B89A 2W7TA 2WZBA 2DR3A 1OZGA 2QTBA 5D86A 4NIMA 4MWEA 4W8GA 3GLIE 1TF5A 4TMWA 3RVLA 4BO5A 1ZMRA 2GETA 3G2PA 2J87A 4BKRA 3A4IA 1ZPDA 1T36A 2P78A 4QODA 2NAPA 1ZK3A 4Y7DA 3VBCA 3WGGA 4CNBA 1UEXC 1OYVA 1GZ5A 3NYQA 4GYKA 4UD2A 1BTOA 4L6IA 4GVPA 4V0ME 1CUVA 5K4GA 5A7FA 1ZOPA 1TCAA 4XTCS 2XBUA 5C4GB 3RIHA 3UK1A 5BSFA 4MWDA 3WGQA 5HIAA 3CRW1 1UMDB 5FOWA 1JQKA 3G8DA 4OKIA 4B75A 4XRGA 4YDRA 2GCPA 2PWPA 5B1DA 1NVVQ 3NALA 4EHJA 4JP2A 1CJSA 3ZTWA 1HOXA 1Z39A 1Y1RA 4IICA 3IBCA 4CV2A 5A1JA 1KZ4A 1A2QA 3EIWA 4UEWA 1OF1A 4PAWA 4ZI7F 3CBGA 4IJVA 2NMVA 4HFMA 3CF4A 3W34A 2WF6A 5G3ZA 2ZYDA 1RC8A 3VPHA 4BLWA 2VRCA 3M9WA 4DYHA 1NW8A 1UFKA 3F5MA 5HUJA 1VL0A 3EH1A 4R83A 3OPNA 2BKEA 5CVUA 2F64A 1N1GA 4GZMA 1HY3A 3NDPA 5TPWA 1L5FA 1NFFA 2FJUA 3F8TA 3LP5A 3OF5A 4RL4A 4P33A 3BFJA 1T6YA 3KYCA 5KCMA 3QU9A 1VRWA 1Z9BA 3OM0A 3ER8A 4EPTA 2HIGA 3E9CA 1HQDA 1L7PA 1YFJA 2XT9A 1G9XA 5JDCC 3GROA 4BNDA 1N5RA 3HH8A 1ZH2A 1Y5MA 4HNGA 4JSYA 4DE5A 3FVWA 4BLOA 5D51S 3AYZB 1TMKA 1IUKA 2W4MA 5CTAA 2NSHA 3GV0A 1XTKA 2BMAA 3ONDA 2MYUA 1UZUA 4NJMA 4HAIA 2PR2A 2EBUA 1EVKA 4I1SA 1F2TA 3FWHA 5CVEA 3VSAA 1A8SA 4KYTA 5FI0B 2FZWA 1V6SA 1A9YA 1N5KA 2CCGA 2J3DA 3ETGA 4NPCA 4XQCA 4CMKA 4XQ9A 3PTZA 3MNFA 3JALB 1G6KA 2AC4A 1TYDE 3G5AA 1L1FA 5IYZA 2YZKA 3AF2A 2ZJ4A 1SCAA 1HDEA 1KMQA 4LC0A 4N39A 4IIUA 4ND3A 3T5BA 3U81A 2AX4A 1WKBA 1MPTA 1UZNA 1XVVA 3CRMA 3IAAA 2A33A 3RRMA 1BMFA 1VPTA 3JRWA 5CVDA 5EJ7A 1J06A 3ZU3A 4OUKX 4ZT3A 4V0NA 4BJ5A 1R9MA 3RBXA 4FFPA 3WLAA 5MGBA 3GPCA 2C4NA 3HB0A 3KCQA 4XCQA 5BQOA 3WSWA 2V6FA 2TYSB 4EG4A 2IVZA 3RWOA 2BR4A 3PI7A 1P45A 5KNCA 1PJAA 5D5HA 1DUIA 2Q7OE 4PF1A 2M9MA 3NOOA 4BGEA 2ZVQX 4OQDA 5CDTA 5M04A 1FQJA 1QBGA 3PTAA 3WIOA 2JDID 4FS3A 4L3VA 4Q47A 2GYYA 1UJ6A 3A1VA 3GDOA 4JEHA 5LJLA 1AUXA 2A9FA 4KNYA 2X0DA 3ESDA 2EWWA 5AESA 2IV2X 2XKKA 4DBZA 1Z47A 1J6UA 1TADA 5DNEA 1D3AA 2WA1A 5DLDA 5T4EA 1NMXA 3PF8A 5IXSA 2DGDA 5E6SA 3M6MD 4TRRA 4LQDA 1QX3A 1SPXA 2R6HA 2VJAA 3FYUA 3I30X 1Q16A 2X40A 2ZSUA 4G36A 1AKTA 4OKSA 4A03A 3A1CA 5F2EA 3LNTA 2VYND 2FRXA 5E4TA 2RIRA 3ECSA 4L8LA 4EEXA 1ZM4A 5HHTA 5JYDA 4TYYA 5D6OA 3WLHA 4P84A 4BNXA 4MLPA 1E5DA 4KLRA 5KBYA 4MITA 3D0KA 3N3AC 5KWVA 1IG0A 4QGSA 2OHHA 1BKSB 4BMZA 3K0KA 5JCOA 4PAMA 3UUFA 4QJ5A 2YHSA 4M0MA 3LP8A 2J59A 5BORA 1TW2A 3LUFA 3W1VA 5CDHA 1D2RA 4BRUA 5IZCA 2QD1A 3B1WA 2H48A 3AB8A 3ANYB 3IEPA 3LDHA 1SK9A 4NYMR 5ED4A 1V16A 5K3AA 3BFXA 5F2OA 1MC5A 4A16A 5BSMA 1PV1A 3KJQA 4JI8B 1SCIA 4RA9A 1NUUA 4PLYA 5C8YF 2IP2A 5FOQA 3TNDA 1ZIDA 5JDIC 4ZO4A 3PWTA 2TECE 4ARAA 2PH5A 3H11B 4LXGA 5EXSA 2IV7A 2QZ9A 4GOLD 4NBRA 3GEIA 4ZVLA 4IS3A 4A8PA 1C0PA 4JP1A 3ONNA 1CC1S 4G1UC 4DLKA 3ZWMA 1K6JA 1KI9A 2YHIA 5H80A 4BAZA 3EIEA 5F1PA 4NOJA 4YS6A 3L6RA 4XGKA 4A4DA 3EGEA 5FH9A 1CY7A 1A9SA 4ZALA 1SXIA 3OPQA 2D7JA 2Q4EA 3H1TA 4XFJA 1SXQA 2G70A 1IUOA 2IZ1A 3HCOA 1ADGA 1JT9A 2FSVC 1UBCA 5FYDA 2QGNA 3JX9A 2VDWB 3QFCA 2QE7A 2G36A 4L08A 1NIJA 1USIA 4TWRA 2CSUA 5DMHA 1QIJA 2VSYA 3BGOS 5IX8A 4YP6A 4B3HA 1KARA 3OC6A 1U99A 4WX2B 1Y7IA 3WYFA 3OEHA 4BBZA 3UMMA 2CXTA 3ICPA 1VPDA 3R0IA 2EYQA 3U44B 1XNHA 2RKWA 1YULA 3C48A 1M2VB 1H3NA 2H3HA 3G0CA 5F7ZA 3RD5A 4EGQA 2VDRB 4OU5A 1P1FA 2JD1A 3ND7A 1JH8A 5CBKA 3KKKA 3TFWA 3FTEA 1HH4A 2A84A 1R8SA 1M72A 1CUEA 3U60B 1DEXA 4CIYA 1PS9A 1T10A 2VEOA 3S55A 5BSGA 1EWVA 1X3LA 1A5SB 2FX2A 2BP7B 5EIFA 4C1NA 1V41E 4JX9A 4P32A 4L4RA 7ADHA 3DFMA 4QPJC 4OFXA 1FNDA 1IN7A 4YT5A 2EKLA 3ENQA 3BTOA 5IAJA 2WNSA 4CR7A 3HDYA 1KGSA 1L6RA 1IM5A 3WLJA 4EZIA 1XTTA 2XD4A 1LPBB 4JUAA 4Y8VA 5JPCA 4EA9A 3NRBA 2Z8YA 1PBTA 4MHSA 4DKXA 3QFRA 4EX6A 1SBQA 4AMBA 1XLUA 2X7HA 1MO4A 1V5EA 2GLTA 3MT8A 3TSZA 5KPJA 1IPFA 1RD4A 2ONYA 4OHPA 4TV8F 4B2PA 2IRWA 2Q1YA 3N7TA 2IEIA 3IAS6 4GL4A 3KIPA 1A7KA 3KKZA 4LJ5A 3L3BA 3O4JA 4GL2A 3WC4A 2COUA 3STXA 3U7RA 4PWYA 3A1FA 1YQWA 1W5SA 5IKOA 4QFCA 2IIBA 1FTQA 3QXJA 5JJCA 2WIKA 5EWMA 2EW2A 2FN4A 2FWBA 3R9WA 1HURA 1XD2B 3FGZA 2OO7A 3OBIA 3UK6A 4HNVA 1JG1A 2QPAA 4O2AB 5E9JA 5FP0A 3MRTA 1KQNA 4RJJA 2WYVA 3JARA 4WOJA 4X44A 3C74A 3ZV6A 1L4NA 3F6SA 4HDMB 4K88A 4OTZA 1ZCFA 5KQSA 3SDSA 2QLTA 2CVFA 2C7BA 1R6VA 3HSSA 4WD3A 5I9NA 3KVRA 3O7WA 2NP6A 4B7ZA 2GUWA 3K15A 3H99A 1YH3A 2OGTA 2WVJA 3CVYA 3QI2A 4UVHA 2WHXA 4FSDA 2IBMA 2WG0A 3LG2A 4M21A 1BJTA 5C53B 2GEVA 4EG6A 2O8CB 3CR8A 2DR0A 1F2VA 1UOEA 1E20A 2F43B 1T8WA 4M87A 3K05A 4PRKA 5LUAA 1VYHA 1IQ0A 5CB4B 3WQQA 4BN0A 4FIZA 5B7NA 5FFFA 2Q6IA 1RZRD 1R6AA 4MV1A 2WV9A 4O29A 3T8YA 4TTTS 3O21A 5ILQA 3A26A 3R7WA 1T15A 1UWCA 3G17A 4Z0TA 4RVSA 3K09A 5ADHA 1DG9A 5ALYA 1J2RA 2I65A 4AULA 1TTHA 3DOHA 2CL7X 1P9LA 1OU0A 3LXMA 7REQB 4B3GA 2FPLA 2WKPA 3D31A 4W1RA 3BTVA 4E5KA 1MR3F 4TPKA 3KAQA 1IK4A 1J5PA 1ESDA 3Q2KA 4G1BA 3FOEC 3DO8A 3ZV3A 3F5QA 3ZNOA 4PS1A 2HF2A 1U9YA 3RSCA 2UVDA 5IRCD 4F85A 3ZHSA 4GKJB 4QJIA 1CIJA 1P8AA 1R0LA 5DX8A 3FHLA 2OLEA 1YE3A 5EGNA 4ZMBA 1WSBA 3DLPX 1WMBA 3KELA 3NDRA 1J0XO 4QPNA 5FL7A 3H8WA 4H6WA 4C0XA 4BNYA 1T9GS 4QBFA 1ZNYA 2DFDA 3D3QA 3MWJA 5AW7A 1JDVA 2IZOA 3IQGX 1XTJA 2GWHA 4X63A 5H16A 5IN4A 1QIIA 4MRPA 4MV9A 1VFNA 2EX4A 2MSLA 2VAMA 1WZCA 1EE2A 1CSEE 2VXOA 1YS6A 3PXXA 3Q3IA 4O1HA 4AIIA 1QHYA 2PH3A 1G18A 1PLKA 2A1TS 2FPXA 5TMEA 4C87A 4HZUA 4UEKA 1C81A 1OLUA 2V7UA 4KGVA 4EYQA 4DHWA 1YS4A 1X87A 2V7VA 1D2MA 5AXBA 3TKYA 3NTVA 3S1AB 4RLQA 3UTCA 4ZI2A 2QYSA 5GWXA 4BQFA 2ZWAA 4DUYB 2XXAA 2XW6A 3FIJA 3KQTA 2WFZA 2PKQP 3HDQA 4OFWA 3ZS8A 2FMHA 3DMTA 4HGPA 4TLMB 1TQ4A 4NBSA 5F3WB 4ZAVA 3IKVA 2ZCJA 4RIHA 1C9NA 3K3PA 4HLUC 4G0WA 2X8WA 4ENWA 3GT3A 2RD2A 3TR5A 3I5YA 4B8YA 1C7QA 1ULBA 3VGJA 3CLUD 3RG8A 4FU0A 3OZVA 2ZXUA 2RG1A 3WMGA 3IAS1 1P5RA 1XTQA 2I3GA 5A9SA 2HBYA 3DDUA 2P27A 4EFMA 1GRNA 1UEJA 4IPTA 4LTMA 2PSFA 1DIRA 4CKZA 1K66A 1P81A 2P9GA 1CD5A 5EMHA 4AURA 4F71A 2YWHA 3CLHA 2ZM6B 3NFYA 1JLMA 3DCYA 3VQTA 3EZNA 3ETJA 2VC2B 2QAGA 4LPKA 4X7BA 4S05A 1CNEA 1X7YA 4M0CA 2QP9X 1RNLA 5D01A 2HT6A 3GVHA 2G9VA 4MVJE 3N2ZB 2BMDA 2QYOA 3IMGA 3FVTA 4GSLA 5A05A 3QW2A 1P9OA 2X4LA 3AEYA 1SVIA 1FSSA 3QY9A 2Z2XA 4FQ5A 3WNCA 1QZXA 5KOHA 2JLUA 2DPXA 4LCJA 3GLGA 3TQTA 4BO7A 1FYWA 4LZWA 4IDGA 1U5AA 1F8XA 4MW0A 1QZZA 4REMA 3SC6A 1FP4A 2P7IA 1A2KC 1UODA 2XB8A 2C5BA 3IT3A 3LZDA 3HDVA 4UBLA 2Y1EA 3P2OA 5L7YA 2ZIWB 1QAMA 2ZBPA 2C59A 4M1YA 4LFAB 2J9ZB 2OKCA 3NEAA 4RGQA 1E7YA 3OFNA 1QAOA 1QG0A 3NIFB 4QAQA 1X8LA 3V2GA 1ZXLA 1KK0A 2FZ4A 3BJIC 4LRXA 2WPDD 3UJ8A 3ZKWB 1YJXA 4CG0A 2PLFA 3EF3A 4FFBA 2HJHA 4R68A 4O6VA 4Y9DA 5IAKA 3D5TA 1FDIA 5JANA 3IDZA 3W9BA 4BFTA 3GMDA 1SK8A 3G79A 3KB1A 1WQ4A 5F51A 3JQFA 1JDSA 4WL0A 1T34A 1DJPA 1LPSA 1P9RA 1JGTA 4ZOBA 1BVYF 1NBMD 3NUGA 1BFDA 3LUKA 4PSUA 4NYMQ 4XGIA 4NCNA 3ZHZA 1RBMA 1XMIA 3FGPA 3I1IA 3GD7A 4GI2A 4JU9A 4YCSA 4QYWA 2FWMX 1CEXA 3D3WB 3DTVA 4JB8A 4RHXA 2P9TA 4L74A 1QHHA 3V4SA 1RPTA 1E66A 2PBLA 2VJPA 2C03A 3GLHA 4NNJA 3R8XA 4C0HA 4MR7A 4UOZA 3QSYA 2AJDA 1IJFA 3TYXA 3NANA 2Q28A 4B3MB 1P2VA 2F1IA 4KAJA 4QUIA 3WGTA 3E15A 1R0YA 2J09A 2YS6A 4MWOA 5CEJA 2YWFA 5DLPA 1R4NB 3HGTA 2E55A 4RTQA 4P86A 4CMGA 3VH2A 4G3XA 1AX9A 1DO8A 2OE2A 3CGGA 3QFHA 4QJBA 2ONJA 4C0SA 3BXZA 5CXQA 4JCOA 4E5UA 2I1WA 1BW9A 4MV3A 3GPBA 1JHVA 2W8BA 3ZXYA 2NTNA 3OE1A 2A9VA 2NUTB 3GFGA 3L07A 3NHPA 3UPDA 2PJUA 3VR6H 4B3CA 4DAOA 3VA7A 3WLIA 5ICGA 3KZCA 4BV2A 1ZUNB 5SZIA 1JZSA 4C89A 1U8CB 3IP6A 4CT4B 4P5DA 1VI6A 2XF2A 4ZIRA 3NOQA 2PUGA 4K81B 3W1EA 5L40A 3BJEA 1CHDA 3I52A 5AO9A 3R4VA 4Q12A 5LYJA 2GTHA 4HPWA 2REBA 4HG2A 4WNYA 4PC6A 3GN2A 1QGUB 4M38A 2NZUG 4MVYA 4WOPA 5KVAA 3LGXA 5LXTB 5H9VA 2Q3LA 2Q3FA 1O0CA 2XQJA 4WAUA 5C34B 3UMCA 1ENZA 3LF1A 1P1IA 2AZDA 3A06A 3P19A 1U7ZA 5KYWA 3RVQA 1A04A 1K97A 1E1DA 1KFBB 5EJGA 1I0ZA 4KVFA 4M2LA 5HPYB 2Q6KA 5JCXA 5LZ2A 5SZHB 4AI6A 2VJOA 1LU9A 4MIYA 4HB4A 3MJSA 5DHTA 1DWUA 5EUCA 5IAEA 5IYZF 4B31A 3TIXB 3ZJVA 2FG6C 2MSDB 4KMSA 2GPWA 2QSJA 2PL1A 1Y1SA 3L1HA 4CG3A 4OQQA 1DOHA 2BGNA 3KVVA 1IDN1 4KIGA 1SA0A 4G01B 5IWAB 2VSOA 1UBUS 3F5SA 5FUQA 3TSYA 2JFGA 3M9XA 1MTOA 1DKUA 2VVTA 4I0WB 1H2FA 2V03A 1L5RA 5EZ6B 4Z6KA 5AVSA 1WBDA 1UBJS 1J0BA 5CP8A 1UXHA 1GPKA 4UXHA 3E8MA 1M5RA 4LHVA 5EIOA 3JD1A 1BN6A 4J16C 1X1AA 2ZDQA 4V39A 1BNCA 2X7JA 1XPUA 2AX3A 5KJ1A 2J3IA 3NH9A 4AECA 4F8EA 2GXQA 2AT1A 5JHHB 3ETLA 8GPBA 4EA6A 2DWUA 3PPYA 4CVNA 2XUAA 1ACJA 2F3QA 1EHIA 3BJRA 3GPIA 3LWNA 3DHYA 4FMCF 4FB5A 5I9IA 1RI4A 4CFZA 3MIZA 2FW7A 4Y30A 3CVXA 3LA8A 1NJFA 4KQMA 2OECA 2JLZA 1USUA 2QMUA 1GSAA 1QRUA 1J8FA 1KZGB 5TJHA 1UFQA 2R4TA 2C84A 4DNQA 2B69A 1UJ2A 3RFTA 1U9ZA 3PGLA 2G6BA 3NASA 1E2BA 1MRZA 4MUGA 4MA4A 1QV9A 3IPLA 3FWZA 5F4BA 4EOGA 3QYAA 4JP8A 2HF7A 4BQOA 1W0KD 2F55A 1NP7A 1WDTA 2XUOA 5IASA 1K6MA 1Z0AA 3ICCA 3PBKA 3EGIA 4DLUA 1E3QA 2DFKB 1CUFA 3GDWA 1HKUA 3RQIA 4EQ6A 1XVLA 1KAOA 4N5DA 4P2BA 4QNNA 3FYCA 3VJRA 1Z0DA 2PKCA 2ZYVX 1G2IA 1N5MA 3UO8B 1T9ZA 4NZZA 5GQSA 1NKVA 3TRDA 3JYOA 3WWZA 2FHSA 3C97A 1KE2A 2JJYA 3HJHA 3OE7A 2Q5IA 3SR4A 4YYEA 4JOCA 1MO2A 3KT8A 1U3VA 1Q6YA 1AKMA 1JTEA 1PK9A 1QS0A 2J6BA 2ZVPX 5FOXA 4DY6A 4ZCMA 5H8WA 3L6EA 3IR7A 4P3YA 3T7SA 2GXUA 4EY8A 2FSSA 3BE4A 1TA0A 5AW0A 1JHUA 1FRQA 1YS1X 2ID9A 3IALA 4F3NA 4GO1A 3EA0A 1NMEA 1Q0LA 4HUQA 4UHFA 1DL5A 2XAAA 3TB4A 1AG9A 4BX3A 3OPYA 2O3RA 3IFSA 1E1KA 1NSFA 1QGYA 3B2NA 4IIHA 4RS4A 5KCZA 2JGDA 2B20A 1QF6A 2C1ZA 1D6SA 1SEPA 2H17A 2YIMA 4PSDA 3EZFA 4LRTB 4M8IA 2HK7A 2NSYA 1ESNA 4ZU1X 1T2CA 4J75A 3F9RA 3L05A 1Q21A 2PYDA 2X9VA 3D6HA 1OLXB 1RAEA 1TZBA 4GGMX 1CF4A 1KQ3A 1KBOA 1HK7A 3UHFA 2PGDA 4ABTA 5D5PA 3AONB 4BQPA 5A5GA 3MSXA 4H3HB 3ANNA 3TZHA 3JR3A 3QHAA 3Q10A 4P4NA 2JLXA 4J0DA 4HTAA 4Q6BA 1Z4KA 2XGSA 1ID1A 2ATIA 3OT4A 4AJPA 3MJVA 4IMIB 4BMPB 2O8FA 5JQWA 4Q03A 4C88A 4OA8A 3UXYA 4YQZA 1IRIA 1GKLA 3WP1B 3PD1A 2ZRKA 4EBBA 2JGJA 2VHTA 4FGJA 5K0BA 3O8RA 4XYGA 4KREA 4RZSA 4HXFB 1PT6A 3AF6A 5E4JA 3CPJB 4LOLA 3DULA 3W9SA 4FCTA 2QYTA 3T1VA 4U7TB 1AQUA 1B74A 2K2QB 4LZPA 1G21E 5CK4A 4WK0B 4RXMA 1HTWA 2WFAA 1E9BA 4LZOA 1OSNA 4GFDA 3ZD8A 1XQ9A 1T2UA 4TSFD 1CRLA 2W8ZA 2WE7A 1XP8A 1V3QE 3UAYA 3LY7A 3O90A 3BCUA 4QULA 1HMYA 3P2MA 2XOEA 2PUVA 2WRZA 3DUFA 3QOFA 4GR4A 4HDRA 4KPGA 3TBHA 2YICA 4I1VA 4TUYB 3DW1X 4MKHA 1GN9A 4R8VA 4WECA 2EIHA 3HHPA 1GPDG 4AJ9A 3WDLA 1YFKA 1Y82A 2Q29A 3UB4A 1CUHA 4N6GA 1B6TA 2ZWMA 3C8HA 3GBSA 1WV1A 1PYDA 5HQ3A 2YWDA 3R5XA 1CFZA 1HE8B 4RORA 1XPJA 5ESRA 4L0DA 3PYMA 3TD2A 3BG5A 1R4ZA 1Z2AA 3NNNA 4KXMA 2JAOA 1IHDA 2UYHA 3PX3A 4J1TA 5CYPA 2FETA 4L1KA 4ZPJA 3RKSA 3ZYCA 1GP2A 3Q0IA 2WTAA 3PC8A 3NB0A 3AFOA 1Z0FA 3DSRA 1RBYA 3AVYA 2A2ZA 4IGFA 4OSPA 1SUAA 4I1PA 3MJEA 4CLOA 1J97A 5DDIP 3W2HA 1NQAO 4JXJA 2A5FA 1XZDA 1Z0JA 2OK8A 3MAGA 2FSPA 3LW8A 4Q4JB 4Z8YA 3WOHA 3G9QA 9GPBA 2P4QA 3B7WA 3LWDA 4IUDS 3JQ7B 1SQGA 3AFHA 3SC3A 3VYRB 4QXMA 1DFGA 2G5PA 2ORWA 3VR4H 3OUUA 1MB4A 1OTXA 1DEOA 2NO7A 2OCYC 2XKBA 3BXHA 1VHTA 1EWQA 1JEYA 3OHPA 4M83A 4AWAA 3LWBA 1XPOA 1XV5A 5EWLB 3LHKA 2OORC 3WA7A 2QW1A 1RLTA 1BEUB 3BGIA 4GXQA 3UVEA 1A3CA 1EIWA 5BW8A 2HWWA 4K8OA 5B12A 4CMCA 3GGPA 1JIUA 5FHRA 3WJAA 1DX6A 6ADHA 3HXMA 1C4XA 2OBNA 1U11A 3PLRA 5ALFA 1CETA 3GB9A 3GGGA 4JYBA 4OB6A 3F67A 1A50B 1YR2A 2A4MA 4KO4S 4B2IA 3H2JA 2HV9A 4EI2A 1KKLA 3VC7A 3ZVLA 2OV1A 5LP1A 1N2XA 3B13B 3I73A 2I0FA 1DQYA 1JHQA 4RY9A 4QXOA 5HZMA 2WQ7A 1C0IA 3RF7A 1G7CA 1SBCA 2ZXEA 2WBLC 1UMCA 1Z2OX 3Q15C 5CFMA 10MHA 3PQ5A 4MEJA 1FSFA 1K4KA 4J3JA 5AFSA 1TKAA 2NXNA 1SOWA 3A0UA 3C7KA 3HCBA 3TIGA 3A1NA 1EFCA 1N6HA 2O3JA 4HXGA 3EVDA 5JFGA 1AKUA 1FUYB 1YCHA 1XR3A 1XQYA 3LUPA 4OHVA 1WMSA 2E4YA 3VI4B 4BLTA 3FPBA 4EUHA 4IRMA 2Y0BA 3AJ8A 4DDVA 2I6QA 2Y68A 3KYDA 4M1TA 4ESHA 1GPUA 4TL6A 3WDKA 4Q93A 3CZ4A 2OKGA 2JL1A 4B09A 5HUQA 3OHSX 4P0PB 2RJNA 3EQ6A 4MUHA 1GG8A 3OU7A 1SEVA 4NMWA 5CFQA 5IAAA 2CLKB 4WK4B 3DHVA 2HSDA 1C14A 4UEQA 5EHGA 1VRVA 2HN9A 4DYVA 3KQUA 4YXWD 2AWOA 1E9RA 4KLNA 4K9OA 4XE5A 4CF7A 3ER6A 2B4YA 3WO1A 2QVCA 3DZGA 3M3PA 2XE7A 3OFKA 3CLRC 3IXLA 4ZVVA 5U9CA 3QKRB 5FBVB 4KXYA 1UMDA 2CVHA 4ES6A 2HMTA 1IB6A 4HAZA 2J9FB 1RM4A 3GFBA 3BIJA 4F45A 2CLOB 3DNMA 3OCZA 4WCFC 1JQ3A 1R8YA 3S40A 2ISSD 1IB0A 4W5JA 3BXXA 4X84A 2JANA 2AIRA 1T3ZA 1XZJA 2F1JA 1EGQA 5A03A 2R1TB 1GGJA 1IBMB 2BVNA 2ZZNA 2HY7A 3I6IA 3KQKA 2R11A 3OP1A 3R5JA 3E8SA 4HAUA 4BNNA 5DN6D 4U8GA 2Q41A 3MEQA 3BL6A 2YV1A 3UJCA 4MVJP 5IDVA 3ZWWA 1IM8A 3F4BA 2CC2A 4KQ6A 1OFHA 2J6HA 3KJIA 4BE7B 3P5BA 2Q46A 2P2YA 3S2EA 2J3JA 4D4MA 4KB5A 1VMDA 1FJHA 4GR5A 3HA5A 2BSAA 1WPQA 4C7KA 4CF6A 2X1MA 3VKFA 1PG5A 1U1GA 4FLFA 1OHHD 4W5RA 4C4RA 1BXRA 3TUJC 1O08A 3FVVA 1RJDA 2QDKA 2BV3A 1H6DA