2QSZA

Human nicotinamide riboside kinase 1 in complex with nicotinamide mononucleotide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
188
Chain Sequence
VPRGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nicotinamide riboside kinase 1
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 188
sequence length 193
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qszA00
2QM7A 4X8OA 2NOAA 2GETA 3A1TA 2B7BA 3T06B 3TIFA 4B71A 1WBDA 3FMIA 1UKYA 1U2RA 2WJYA 1R8SA 2OAQ1 4EFMA 3MUFA 1E9RA 4AKHA 1ZU5A 2J46A 2UVQA 3LA6A 4C0AC 3MFYA 4C4PA 3AVVA 2YYZA 4NPHA 5JHGB 1A5TA 4GDFA 5KNDA 3KKPA 2D7DA 2FNAA 4M9QA 4ZIRA 2NO9A 4IDHA 4AKIA 2FH5B 4GP6A 2ZRFA 421PA 4TYPA 2ZI7A 3WHKA 1M34E 2QG6A 4TYQA 2NZ8A 4ZCIA 2EWVA 2WAYA 1FOEB 4A36A 2J9RA 1A2KC 2JAQA 4DDVA 5CYPA 1G5TA 1ZUIA 2QENA 1Z6TA 1Z0DA 4ZV4A 3U7FB 2AK2A 4DSUA 2PZFA 3I5YA 3THWB 3PJRA 1AQYA 1ZU4A 1II8B 4ZI2A 4TZ0A 1Q1EA 1RFLA 5JECA 5CB8A 4O3MA 4LWZA 4KBGA 2GDJA 1HE1C 1ZAKA 3ONWA 2OBLA 4M1WA 5BN3A 1C1YA 1OH6A 221PA 5EE5B 3GJ7A 2VP2A 1FTSA 1HA3A 3KXIA 2AFIE 1K6MA 5JSZB 3BE4A 5AR1A 1XBTA 5CJPA 4M1MA 2VHCA 4L4UA 3W5JA 4QG7A 5E7IA 4DZZA 4TT3D 4BFSA 2JJ1A 2A5GA 3C5HA 1G5RA 1W44A 2RGCA 3GEEA 3QSYA 3TMKA 4OQXA 2VYFA 2CLDX 4QGFA 1T9HA 3WRXC 1ZYUA 4W5WA 1OLOA 3W9YA 1NN1A 2CLCX 2RH5A 3NH9A 2AX4A 2REOA 4JMPA 2C99A 4M9XA 4CGZA 3KQHA 4ZDIA 5FTMA 1FNNA 4LV5B 1DPFA 1EG7A 3QIAA 4P4TA 5F9HA 3EZ6A 2GEUA 2OBMA 1Z83A 1KY3A 4MA4A 1TUIA 2ZJAA 3LVQE 3VMFA 4BE7B 3LW8A 2QEQA 4I81A 3QBVA 2ZETA 3ICQB 4IKEA 4RSGA 1RJ9B 4POAA 2ERYA 1T0JB 3G82C 1G21E 4E22A 4JLPA 2VP0A 5DGXA 2O8EB 2UZ3A 4MUAA 2FE4A 4Q47A 1D2EA 1W0KA 8OHMA 4IOKA 2W6IA 1XJ0A 1FPMA 2CHQA 4URZR 3CPEA 1XTSA 3BK7A 1W4BA 4BQSA 2IS4A 4S35A 1NI3A 3MJRA 4PZZA 3DEFA 3QOFA 4KFSA 5FUXA 5KUTA 4URXR 1JR3D 5DNYB 3UG7A 1C9KA 1E6CA 1T3SA 4KODA 2WKPA 4A92A 2HJGA 2ZRIA 3IHLA 4AKEA 1GG2A 5EP2A 1A4RA 3QKSB 1IN5A 2OM2A 4LGMA 4Q4JB 3U6BA 1YRAA 5E4FA 5CDFA 1TEVA 2VTKA 4TL6A 1G3UA 5JBQA 2NO7A 1Z28A 4F92B 1N3BA 1CEEA 3U7HB 2ZSFA 1ESMA 2GJ8A 4Q9HA 4YMTA 3R9WA 1E1RD 1QHIA 2RHMA 1IN8A 2FPKA 2G0NA 3ZZUA 2ZJ8A 1XCGB 1IOZA 2PH1A 4LJ6A 1GWNA 3IILA 4TT3A 2QBYA 5HR5A 2JLWA 4R9UC 3EPLA 4F4CA 2XXAA 1KKLA 3KL4A 1Z0JA 1GM5A 1VG0B 3LNCA 3KX2A 3QPVA 4ZO4A 2RGNA 2FFQA 4C0KA 1F5NA 1KZ7B 4GFDA 4MQBA 4FMCF 1G20E 4Q5IA 2GNOA 3VR2A 3UKDA 1P61B 5EXSA 3OEED 4C3ZA 3FKSA 5GADl 2IUTA 4XD7D 3WNDA 1R2QA 2JJ8A 2BHRA 2JLUA 1AA9A 2XEXA 3OAAD 2IXEA 1XMIA 1W1WA 2CJWB 1WB9A 3CNNA 1H8ED 3ADBA 5EE9A 2BM1A 4ZKEA 2W58A 3GJ8A 3B78A 4CDGA 3PEWA 2AWOA 4BUJA 1DTSA 4JT4A 2PZEA 4QM7A 3EZ7A 3CF6R 5FOUA 2P6UA 2CL6X 3VX3A 4OI0A 4AG5A 2Z6VA 1PUIA 2FN4A 4Q4LA 4Z8XA 3HYTA 4KFRA 3T61A 4BFTA 2FEMA 2IS2A 1K5GA 4QBGB 2ZU0C 3G0HA 1HYQA 3HPRA 3B85A 4FWIB 4ARZB 2ZXUA 2V6IA 3SEAA 1XF9A 1U98A 4EPTA 3AH8A 4BLQA 3A4NA 3KZ1E 1KI6B 3GJ3A 4QM6A 4EDHA 2BMDA 2ODNA 4G5SA 4PX9A 5G40A 1JR3A 3C4JA 5DHFA 2BWJA 4HB0A 2WJJA 2C77A 2GXAA 1Z6AA 1KK3A 4W5HA 4DRZA 2ZIAA 3MGCA 3Q5EA 4YLGA 5IF9A 2QNRA 2P5SA 5JS7A 2HXSA 3KTAA 1JBKA 2Q3FA 1G41A 4ZIRB 4IEEA 1ZNWA 4B3XA 1T4GA 4C0QC 2RMKA 2CK3D 3KJIA 1J8YF 2ZRAA 3DKVA 2OLJA 1XTKA 2VRWA 1E1RA 3AF2A 4KLZA 1US8A 4Q4AB 2NPFA 3SS8A 2I1VB 2GJAA 3AVQA 2YWHA 5EE0A 1N25A 1FNMA 2A9KA 1U8ZA 2DWOA 2FA9A 4C0BA 3AP2A 4IDPA 1SVLA 2FSHA 4YMWA 4FCTA 4B73A 1M6NA 3P4YA 1OFUX 3A1SA 2J59A 5EP1A 4GOKA 1LNZA 1OIWA 2EYUA 4QBHA 1PV4A 1KO1A 2ZRBA 5F3WB 4HB4A 1EESA 4DIDA 3Q5DA 2Q0HA 4OHYA 3IEUA 4PC3A 2IW3A 3K9GA 1FL9A 2OBNA 3D31A 4O2RA 2PCJA 4Q1FA 4V0NA 2PCLA 3VR4A 1X8LA 1AGRA 1P2UA 3GLHB 3IO3A 121PA 5KNCA 3LRPA 4CW7A 4JKYA 3FGNA 1U90A 2YC4C 3I8XA 4LBWA 3N2EA 2XZOA 1E2FA 3FMOB 3IPXA 1FFHA 4CF7A 4QL3A 1X1RA 2J0QA 1VECA 1G17A 3B1VA 3BB1A 4LDJA 2IXGA 3CKLA 4HAYA 4D4LA 3PUVA 4JIMA 4Q7MB 4LK2A 3AF3A 3KQKA 5KSPA 2ZS7A 2IL1A 1XD8A 5LBIA 1FMJA 1P72A 1Z06A 2ZPTX 1NVUQ 1ZNYA 4M1KA 4PSVA 4M1TA 2ERXA 2CK3A 3CBQA 2ZAMA 1Q3HA 1KSGA 3U2QA 2RAPA 3MAAC 4K46A 4NL4H 1VKJA 4Q9LA 1UAAA 1XJQA 3PUZA 4EPRA 2WPDD 4P31A 3THXA 4TZ6A 1BKDR 1R6BX 2ZI9A 1GFIA 1X86B 4LYAA 3LFUA 3SYKA 1G8YA 5L3VA 2VA8A 1HH4A 3VHLB 1T8UA 5AJVB 4JZKA 3WMFA 2Z43A 4YONB 4JLVA 1U94A 4BLOA 1XTQA 4N0DA 2IEYA 1XEFA 2YOFA 4QOSA 3I32A 2BMEA 4Q02A 2HDNB 4NE2A 5FOWA 3DKPA 1SXJC 1NY5A 4XWKA 3VX4A 4C0JA 1XEWY 3NBYC 1DAKA 3GMTA 4A0RA 1ZVQA 5C4MA 1QG4A 1RRPA 1VG1A 2OCAA 4GT1A 5D3MB 4U7DA 3THYA 3CZQA 4MKHA 4TQUS 4PHHA 3RC3A 1PUJA 1XCMA 2ZI6A 3ZGXA 2JLXA 1W7AA 3UMFA 4L9SA 2ZS9A 4JS0A 2REBA 1SXJB 4F91B 2VSOA 1G9XA 1Z3IX 2BVNA 3RS2A 2P5TB 1QHHA 3N70A 4JT2A 4BFVA 1N6KA 3VKHA 2IHBA 5FBQB 1MT0A 3CZPA 4TSFD 2VBCA 2GCPA 1ODFA 2QPTA 3KJHA 2GCOA 2AFHE 3T1TA 1KK1A 4XOIA 4NYIQ 4PC6A 1KO8A 4LY6A 4S2EA 1OB5A 4GOJA 1E2JA 1YZLA 3CH4B 3I3SR 2WHXA 1F48A 3OZXA 1OB2A 3ZD6A 2WKQA 1CJVC 2AHOA 2AD5A 1YR9A 4OYHA 1E2DA 3U4QA 3IO5A 4B3DA 4PO1A 5JLJA 2VQSA 2GBLC 5B64A 2H8KA 4LCBA 2Z4RA 5CIWA 2C03A 4QHYA 4UXIA 1J90A 1HY3A 1KI4A 5TARA 3KFXA 5GJVC 1KI9A 4QFMA 4ZDWA 4KITB 2WM9B 1YR6A 2OE2A 4PPGA 2GVZC 2R6CA 2DFLA 4EFNA 3N2IA 4LJAA 1XCPA 2ZR9A 4LYHA 4UQOA 1QHSA 2WSSD 3KQUA 2QA5A 4OHWA 1CS4C 1M74A 2DBYA 2ZJ5A 3CM0A 3O8BA 3SHFA 3TH5A 1E0JA 4BFYA 4US1R 2AK3A 2G88A 3ZZTA 4HAUA 4Z51A 2P65A 2A3RA 3PFIA 3QXSA 1Z22A 2QAGC 1J99A 2FFHA 3B13B 3C41J 1XPUA 1UBGA 1HEIA 2WPDA 1MRSA 2A5FA 2EQBA 4URUR 4DLYA 4ILEA 3NKVA 1S96A 1S9DA 2HEIA 4XVRA 3Q72A 4GP7A 2QMOA 2MMGA 5E95A 2WMNB 4GZLA 5FOVA 3VHXA 1OPXA 2BKEA 3MCAA 4YMVA 1CTQA 2XNDD 4JLBA 2HCJB 4URWR 2QAGB 2GKSA 5H70A 4WXPA 5JEEA 2RKOA 2GXQA 2FX3A 3NWJA 5KSYA 1K5DA 4AI6A 1JEDA 1SVOA 4U00A 4QGHA 5TB5A 3W6OA 1ZM4A 2J1LA 4CYMA 2ZI3A 1OYYA 1XB2A 1VDZA 5IHPA 4DDUA 3AM1A 4EUNA 2F3TA 1VCOA 2IYXA 1P60A 2LKDA 3TAUA 3NG1A 4KYIB 2ZE7A 1J2JA 1II8A 2N1BA 3F0TA 4NCJA 5FUWA 5E3HA 2YWEA 3BC1A 5JFGA 2REXB 3SI7A 2EWWA 1GL7A 1G19A 2HLDD 2IF2A 5JJLA 1TTTA 2XOKD 3QG1A 5EZ5A 1EFTA 5CDFE 1Z0IA 4OI2A 4JVNA 4KBFA 1KZGB 1G4UR 1NIJA 5JSZA 1L4UA 4B76A 1BIFA 1D5CA 2FU5C 3CLVA 5KDLA 2FSFA 5KYKA 2ECKA 2QE7D 2ZTSA 3HWSA 3A37A 4EFLA 1KSJA 4D4JA 1OIXA 2GF0A 1KNXA 4EPYA 1JPNA 1YZUA 5GVSA 3NEYA 3VTKA 2RGBA 1SZPA 4RKEA 2W2VA 2JDID 3BRWD 3M4YA 2C04A 1E2KA 2N46A 4O2LA 2IYTA 2WSSA 1JAIA 3FOZA 2G6BA 4IEIA 2V7QD 3I4LA 1OXUA 2BOVA 1SKYB 4N0EA 4GMXA 4YMSA 1UM8A 1W47A 2YV5A 2JLRA 1HT2E 2JLSA 3K09A 1VCNA 1LV7A 2VEDA 1RJ9A 1MRNA 1ANKA 4HB3A 3R7WB 4ESVA 3ZVLA 1E9SA 5DN6D 2WWXA 2WIBA 4OKSA 4TL8A 2O8EA 1MR3F 2ZAOA 2XNDA 4A0GA 4KYUA 3WRYC 4TQAA 4YQFA 4DLTA 3A4LA 2J0VA 2Z83A 4JLKA 2JJ2A 1R0ZA 1LY1A 4M1SA 3SYNA 5HPYB 1Z07A 4RD6A 5EXXA 2J7PD 3CRW1 3KUDA 1XPRA 4FD2A 3CNLA 1DBSA 3CF0A 1I4LD 1U81A 1G291 2J7KA 4TLEA 4LHWA 5SZHB 4WVFA 1JR3E 1J8MF 1NIPA 1N6NA 2ZYWX 1X3SA 3QKSA 4Q21A 2GA8A 1NSTA 2HLDA 5AK0A 3TSZA 4D81A 4D0LB 3AF1A 4XJXA 3D7MA 1IM2A 4MKIA 3NDBB 2LKCA 1E2GA 3RRMA 5BYJA 4NU0A 4RFSB 5DI3B 1ZCBA 2QY9A 5J4LA 1KNQA 1ELOA 4AC9A 1KI3A 3NBFA 1E2HA 3WYGA 4PAMA 3TAHA 6Q21A 4BGDA 5KDDA 3KJEA 5L8VA 2XB2A 2PJZA 2P0EA 1I4TD 1OFHA 2QE7A 1XTRA 3A8TA 1CJKC 1XZQA 4DLZA 2W0MA 1S3GA 1KTVA 1GITA 3K0EA 1RPZA 2Q3MA 1NJGA 2JDIA 1R10A 1MOZA 3UMRA 1QVRA 3K0FB 1FUUA 2VLIA 3TQFA 4P0TA 3QG5A 1Q1BA 3H86A 2P2LA 1LTQA 2V7QA 2ODEA 4DLRA 5FI1B 4TLAA 3QXCA 2DY1A 2QU8A 5DIFA 2VSXA 1I2DA 3MG9A 1D2MA 4PR0A 4C2UA 3C8UA 2A78A 3WXMA 2FF7A 2BBTA 4MRNA 3EPKA 2CJWA 3LV8A 1T8TA 3RNLA 2QI9C 4NP6A 3MLEA 1JR6A 2ZSDA 1VIAA 5DN6A 1K8RA 4JL5A 4M1YA 3UXMA 2PX0A 1KIMA 1TUEA 4XWOA 1RC8A 3AUXA 2CHVA 5BW8A 5KU1A 3MMPA 2O8DB 2BM0A 2C9CA 4J0QA 4MYHA 2XTMA 3TGPA 4B2LA 5FOSA 1JEEA 2ANCA 2V1UA 3CX8A 3L82B 3M1IA 2XJ4A 1TNDA 4P4SA 1XFAA 2ZE6A 5C4GB 1EWQA 2CL0X 1YR8A 3RC8A 3AVXA 3ZH9B 1KI6A 3VKWA 2WIAA 1ESNA 4V0ME 3FPAA 3HYRA 3D3QA 3EAQA 1ETUA 4ERNA 4BFUA 2SHKA 3K0CC 3REFA 1U8AA 2G83A 5AJWA 2MSDB 5JS8A 1HURA 3B7GA 4QJ5A 2X1VA 4P4UA 1KI1A 1V5WA 3FDIA 3CPJB 1RRFA 3HR8A 4HDOB 4UNSA 1TQ4A 4P33A 4FMCB 2GJ9A 2X19A 2F9MA 4IOLA 4JVLA 4D4KA 2IK8A 2V8OA 2NO6A 3ZIAD 2BV3A 2I4IA 1KDRA 3AVOA 4JKIA 4Q4AA 3UWOA 1W0JA 5KPJA 3GJ6A 3AVTA 2QMEA 2YOGA 3BIFA 2ZE8A 2EYQA 1KK2A 1NKSA 4QJ4A 2F55A 2MMCA 2GVDC 3PV0A 3T1QA 3MWKA 2GK6A 3TR5A 3W8RA 3QI2A 2I3BA 4TL9A 5FOTA 1CJTC 2P6NA 2IS1A 2ZREA 4RZ2A 1DVRA 4HAXA 1G7TA 4BASA 4GI7A 5HE8A 3FWYA 3P26A 5FL7D 1OXXK 1VHTA 2IBMA 3AKYA 4II7A 1G7RA 2OESA 2IA5A 4B48A 4BFZA 4GBMA 3TRFA 3BORA 4Q01A 5SZKB 4JLDA 1LB1B 4HAWA 1M7GA 2BJWA 2FFAA 1G7CA 1ZW6A 4BRWA 2H1LA 1DAEA 4BZXA 4MRSA 3C16C 1SXJD 4LRWA 3BWDD 3OESA 4MRVA 5CM8B 3EZFA 4A8JC 2F6RA 2GJKA 1R5OA 3A4MA 1AJEA 1TX4B 1NRJB 4IOJA 1BYUA 3GLHA 4B34A 1UEIA 4LC0A 1DELA 4ZDJA 4Q7JB 1JNYA 4OJKA 4RZ3A 1XDBA 2FOLA 2HYIC 2FZLA 4KU4A 1U0LA 4A8JB 1MV5A 3RRNA 4C7OB 4MH0R 3IKJA 4H1UA 3JZAA 2FG5A 2B8TA 1OIVA 2CCKA 4HLQB 2WWWA 4Q19A 2Z4SA 3ECCA 3SBDA 5DE3A 3WP0A 5IRCD 3PUXA 4NYJQ 4TTRA 4OQMA 2IUSA 3AV0B 4V0KA 4AY2A 4ESHA 1XMJA 4V02A 3KKOA 2W0SA 4DKXA 4DLVA 1FTNA 3FMFA 4YXWD 1UDXA 1QDEA 1AM4D 4OHXA 1PLKA 1G3MA 2QPAA 1Z6XA 4JL6A 3ZZ0A 1E79D 4XTCS 1FW6A 1H8HD 1NN0A 3VNUA 1KYIA 3GJ4A 4DSOA 4XIGS 3B82A 4Z54A 1E9BA 1E1QD 4OHVA 4CEJB 2GILA 2FPLA 4L9WA 2R65A 4G3XA 2GTPA 3T15A 3A1WA 2OG2A 2VSFA 3LVRE 3DOFA 1PZNA 4DLUA 4JBWA 1E0AA 4DC9A 1CU1A 3H2YA 3QENA 2X2FA 4HLUC 4UJ3A 5CYOA 3BJIC 1KMQA 521PA 1ZC4A 3W6PA 4G5RA 4NYJR 821PA 2ODWA 1YE8A 1E96A 3EPHA 2GESA 1PVOA 1SHKA 2OEPA 2D2FA 3DM9B 2FJUA 3RWMB 1Q0UA 3QXJA 5FL7A 4F4IA 2JGNA 1DARA 1GSIA 2R8RA 2IXFA 4IFBA 3TSOA 5D3MA 5FPKA 1F2UB 1ZD8A 3RVBA 3RYTC 5L3QB 2WWIA 2VF8A 4OK5A 4QNMA 3VQTA 3A36A 1KKMA 2BEKA 2D3WA 3B5JA 4CT4B 5LD2C 1DOAA 3NC0C 1SXJA 2W83A 5FR2A 4I1OA 4IXMA 4LOAA 3THOA 3WY9A 1A82A 4G1UC 4TYYA 3OE7D 2R6GA 1CLUA 4FIDA 5IK2D 3CO5A 3W90A 5JWRA 5A5GA 3RSLA 4CRWB 4V0LA 5P21A 3LBIA 1BS1A 1Z0KA 1F2TB 3OIWA 3SR0A 5LD2B 2J5XA 4NCIA 1KI8A 2GCNA 3BXZA 1YRBA 1CULC 1WRBA 2CXXA 2IC5A 3MSXA 4TL7A 4BZQA 1CRPA 3M6AA 3U3KA 5LB4A 3PEUA 4AD8A 3I5XA 4NMMA 1R0XA 4GPTA 2CEAA 4IDNA 3UWKA 1EGAA 3KJGA 3R9XA 1OFTA 2J41A 4D82A 2G9NA 3RRZA 1LS6A 5KNBA 3DMDA 2FGKA 4YDHB 2OFXA 4A9AA 1KSFX 1IY1A 4TMVA 3T1VA 4LI0A 4YXWA 2EFGA 1F6BA 2OXRA 3GJ0A 4KHZA 2GBLA 4Z8YA 1E79A 1T5IA 4G5QA 4WIAA 5HKKD 4I99A 1E1QA 4Q00A 1UBCA 1W4AA 2XSZD 4PO8A 1IN6A 4N3NA 4QGAA 4LX0A 1S1CA 4HAVA 3AKDA 3DHWC 1COWD 4MYUA 1IBRA 4A1FA 4P4SB 2OCPA 2ZSEA 4WZAE 4C0HA 1L7VC 5JI3E 2V54A 1NG9A 1TF5A 4UXJA 5AJXA 3WBJA 5JEDA 5DHAA 1SKQA 3K8YA 4JSTA 3QXHA 2O8BB 2L0XA 4Q7KA 3S1AB 1IHUA 2XJ9A 1U9IC 3CUEF 2QAGA 1Q12A 1ZNXA 1XMSA 1TMKA 4CIDA 3CWZA 3EA5A 5TV2A 1PLJA 4DLXA 4PTLA 4HI0E 1S3SA 4RY2A 3RS0A 3PITA 2QGZA 5J5CA 3OEHD 4DEXA 2FPMA 4Q66C 3OE7A 4MDFA 5FTLA 2XGJA 1RZ3A 4K8OA 3JVVA 3QF4B 4Q7LA 1CF4A 4UNQA 2BBWA 3U3MA 3KXKA 2H5EA 1NVWQ 4IRUB 1ZNZA 3KKQA 2J3EA 3LLUA 4AURA 5FPTA 2BBSA 2FEOA 4EPVA 3VR1A 3K0SA 3QEJA 4GSYA 5CLQA 5LPNA 1KI2A 3NTUA 3MD0A 1XNJA 2AN9A 5AJYA 1OYWA 4E07A 3DO6A 3K70C 1FP7A 2QPOA 5H1YA 1L8QA 2VH5R 2VP9A 3OEEA 3GP8A 2WOOA 4B3FX 1HV8A 5J40A 4XD7A 4ZKDA 3BGWA 3X1XA 1CR1A 2HF8A 2NGRA 5FR1A 3OAAA 3I61A 2H16A 2EFHB 2QROA 2WSMA 2BKUA 3KB1A 3ZVRA 1H8EA 5EXTA 5UKDA 1PJRA 2ODBA 1GOTA 3R9IA 4JVMA 3C5CA 3GPLA 2IHYA 2IEZA 4JLNA 1NVXQ 5DI9A 5G3ZA 1NBMD 1X8KA 3NC1C 1GNPA 5GJBA 2ZANA 4X8HA 1J70A 5FTKA 1E99A 1P62B 2A5YB 5HKKA 4K81B 2XSZA 5JZVA 4DSTA 5J4YA 3GLGB 2ZRLA 4I1UA 2V9PA 3BH0A 4LHZA 3QEOA 4B47A 1COWA 3B2EA 4ZCMA 5F9FA 3P32A 4AK9A 4Y0VA 5DYGA 4RFVA 1KAOA 4LJ7A 4NTZA 3R7WA 4A2PA 1P4SA 3EXAA 1HTWA 4NH0A 3CR8A 3Q3JB 4HATA 4V0MA 4C30A 4EJSC 4EPXA 3NIBA 4PC2A 2OV2A 4JBYA 2RGGA 1QHXA 1NL3A 2J0SA 4Q48A 3L0PA 4LJ8A 1B0UA 1XXHB 3P4XA 1GKIA 3TW4A 4WW0A 1X8JA 4B6FA 1ZUHA 3LQQA 1E9CA 1RRCA 1M7BA 4Q1CA 5SZIA 5TVKA 4EJSB 1N6IA 2XZLA 3ADDA 2ORIA 2EW1A 1JI0A 2C96A 5TDHA 1XD2B 4A2WA 3K53A 3TLXA 1NKTA 3RHFA 4CVNA 2ZVPX 5JRZA 1ZM7A 2IYLD 2I1QA 2EVWX 2OXCA 5FBRB 5K8IA 3AQ4A 4M4SA 2EFEB 3BBPA 3WMEA 2ZVQX 4QJ3A 1KDPA 4Q1BA 3GEIA 2IYSA 1AKEA 1DAIA 1GRQA 2XTZA 2ZUDA 4RFSA 5DI3A 1JAHA 1AGPA 1NY6A 3BFXA 2FDCA 5FPHA 2VP4A 5B2ZA 2AXNA 1Y63A 1DS6A 3LY5A 1N2CE 3CX6A 3DZDA 4FWTA 3LQRA 3I1FA 1YKSA 3LBNA 1XP8A 3ND9A 1E4VA 2ZROA 1ZMXA 2ZRNA 4DIEA 3M0EA 1HUQA 2Q21A 4BEBA 4MGZR 1JXMA 4WBSA 2BDTA 5KTYA 2TMKA 2GRJA 3QUSA 4LV6A 3SQWA 3FKQA 1QHNA 3K0FA 1GL6A 4JYBA 5FL3A 4QKQA 4DJTA 2NO1A 1WF3A 2HT1A 1NBMA 3K9HA 1JB1A 2QRNA 4A82A 2AWNA 3IDQA 1YVDA 3R8CA 1FX0B 4B2PA 4MKGA 4PO9A 1GRRA 2AKYA 3E1SA 3I73A 3UMSA 4JLAA 5FPSA 3SJBA 4HSEA 4PAQA 2ZRKA 1S1MA 1ZIPA 2RGNC 4KJZA 3CIOA 4US0R 2Q9BA 2O8DA 1E94E 3GLHE 3UANA 5FBWB 4CEJA 4TYWA 4BFWA 3QBTA 3ZD7A 2EFCB 4UKDA 4EPWA 2VL7A 3DOEA 4FCVA 4ON9A 4CT5A 1EFCA 1NP6A 2ZEJA 4Q9IA 4NCNA 2DPXA 4B44A 4GNKA 5L3SB 1CXZA 2A7QA 3H1TA 3A6PC 3EWSA 4L15A 2JA1A 1E2PA 1DG3A 2X8AA 3VR3A 3QPUA 1MABB 2ZRJA 4QNRA 3VAAA 3T12A 1P7CA 3GEHA 4PZYA 4BEJA 2O8CB 1NVVR 3TUJC 2HT6A 4D2IA 1QHYA 1XWIA 3QY0A 1P73A 5FTJA 3V4RA 2XNSA 1XXHE 2V4ZA 1TAGA 3C14C 3TSWA 1ZM9A 3KKMA 2E9SA 1YZQA 3Q7QA 2YJTD 3V4FA 3K0CA 1HE8B 1QZXA 3DM5A 3LXRA 3OF5A 5HZHA 1TL7C 1Z63A 4IVQA 1IN4A 3IQWA 5JJKA 1OHHD 5AUPB 1M7HA 1Z29A 4TLDA 5EE1A 1WBBA 3LWNA 3AB3A 3MWYW 4TMWA 2HF9A 4TSFA 2GZDA 5M04A 2GZAA 3R20A 2FMXA 1CBUA 3QKRB 1JQLB 2CMKA 1HQYE 1OH8A 3LAWA 5G41A 3EZ9A 1SQ5A 1Z6GA 2CVFA 1WDTA 3ZS9A 3R8FA 1T5LA 1W5SA 2WMOB 2D74A 1IXSB 5FUYA 4CZ2A 2WBLC 4OJQA 1XMVA 3FTQA 4WAUA 4R98A 1SXJE 3UK6A 1N6LA 3SHWA 3SQXA 1RYFA 4KFTA 4BLTA 4D6PA 4LBZA 1TQ2A 4EAQA 2EU8A 4G01B 3GFTA 2IUUA 4PQYA 2H92A 1Z8FA 1R5NA 3ZVNA 1OH5A 5JWHA 4Q1EA 2A5DA 4A8JA 4C7OA 2DFKB 1IJEA 4WA7A 3SC3A 1Z0FA 1P75A 3GLIB 2KSQA 3L0OA 2ZRPA 1E32A 4IW3B 1TADA 1DAFA 1WP9A 3RABA 2A2ZA 4IXNA 2NMVA 4V0OA 4TTPA 5JMTA 4A6XA 4F7WA 3RDPA 4LYJA 2IYWA 4JJKA 2Q9AA 1E9EA 2J87A 2W2XA 4KLNA 4OI4A 4NCHA 1ZD1A 1U0JA 4ASUD 4HZUB 5G3YA 2GZHA 1W46A 1YHNA 1W49A 1E3MA 2ZI5A 1KI7A 3VU9B 4H9GA 1B23P 4DB4A 1DAHA 1Q1ZA 2IX3A 3BH6A 1O3YA 3AUYA 2RGDA 4JL8A 2WWYA 1MKYA 1NN5A 2W00A 3HDTA 1JJ7A 4HUQB 4YC7A 4C2TA 1TF2A 4B3GA 1VIYA 2D06A 2P67A 3FB4A 4I1SA 4A0HA 2QORA 4BECA 3B8HA 5AWFC 3X2SA 5G53C 1T3LA 4OK3A 3PR1A 1OHHA 2KJQA 2QUZA 4CEHB 2ZJBA 2DWPA 4GZMA 3SNHA 4M22A 5BN4A 4LPKA 1NJFA 4MGYR 2ONJA 4KSBA 3FYHA 2B7CA 3Q7PA 3AGPA 1MH1A 1CRQA 5A0FA 3SYLA 1GTVA 3W8NA 1KGDA 4XSHA 1F2UA 1RRGA 2H18A 4DLSA 5L3QA 2JEOA 2XOKA 3EC1A 1WE2A 3B1ZA 2D2EA 4TMXA 1GZSA 1NMZA 4DCSA 4FMDF 1II9A 3SJCA 3RWOA 3HU1A 1YZTA 4YMUA 2W2TA 3K9NA 1EFHA 1CR0A 4LUCA 4R71A 2YINC 1GNRA 2QRZA 1KHTA 1F2TA 3EIQA 1EX7A 1I4DD 1G3QA 1FMLA 1E9DA 4RD2A 2GJSA 5ELXA 3Q9LA 1G8PA 2FV8A 1NNEA 3HP1A 5KSOA 2F43B 3GD7A 2YC2C 3OHMA 5E7JA 2ZI4A 4EIWA 3BH7A 1GKUB 4DVGA 2OILA 4DLWA 2P6RA 1E2QA 3DMNA 1AZSC 1FP6A 1P5ZB 2K5UA 4PC1A 2ASEA 5AUNB 3IBYA 2KI5A 1RW4A 4HDCA 4AWXA 3U5ZB 2AKAB 1EWRA 1G6HA 2IYVA 2C9YA 4IJMA 2PT7A 4L5BA 4KSCA 4F4JA 4TYNA 1CIPA 4Q9KA 4OQFA 4ASUA 2NIPA 1GNQA 1NLFA 3K70D 4PZLA 5BXQC 3W3AA 4B33A 1DE0A 4FXPA 2ZJYA 4RD0A 3ASYA 4DT1B 4B6EA 4BFXA 1RYHA 2WJVA 2D4HA 1ZM2A 5FH9A 2D62A 1SKYE 1BO6A 4OI1A 2EFDB 4IHQA 4AIIA 4BZPA 1N0UA 1OV4A 1T0HB 4KVGA 2V6JA 1QHGA 2GWHA 3A1VA 3A1UA 1SVSA 5H68A 4C0SA 3U7EB 3BB4A 1CP2A 2ATXA 2J7PA 2JCSA 3IBGA 4PHFA 3KUCA 3TJZA 2O8BA 1Z5ZA 5B30A 3S1AA 3T1OA 5CITA 3MRSA 3O8DA 2JJ1D 3VFDA 3P27A 1IXZA 3K1JA 3AP1A 2IS6A 4LC1A 5HCNA 4OQLA 2OUKA 3U44B 3LH5A 4AYWA 2R2AA 4D4MA 3TVDA 3ADKA 5DSZA 1BYIA 2ONKA 4M21A 3L2OB 3FFAA 4E09A 4P3YA 5LB2A 1PLLA 4EQ6B 1SULA 1SVIA 1U9IA 4DBLC 4DDWA 4IDQA 1CKEA 1U8YA 4B3BA 4C9BA 2CE7A 1R0YA 3QF4A 2PMKA 3QQ5A 2E1RA 1E4YA 1LVGA 3WMGA 2XB4A 3QVUA 4ZCLA 5K8UA 4MYCA 1GDDA 3AF0A 4LJYA 3BS4A 2XX3A 3LX8A 4JBXA 2UKDA 2GK7A 2PZGA 1IXRC 2B6HA 2XAUA 3EG5A 4NHOA 3PCRB 3U6KA 1W0KD 4JSYA 3PQCA 1L4YA 2W6ID 1LF0A 1X6VA 3ZJYA 3FHTA 2VHQA 4HLCA 3I72A 1N5KA 2JLZA 3PIRA 1UF9A 4BLPA 2ZYTX 1L2TA 1OFIA 4RCZA 1GKYA 3WYFA 1KAGA 1S0UA 4CEIB 2ZM5A 1WA5A 2AXPA 4UNPA 1AS2A 3PXGA 3X1YA 2R44A 3F5FA 2QT1A 5DYIA 4DCTA 1T91A 1OXTA 1UADA 2F3RA 3CB4A 3EIHA 4HAZA 1NBME 4NBSA 3PENA 2XZPA 2ORWA 1A7JA 1CJMA 1Y3AA 4KCGA 1E2LA 3IIKA 3SJAA 2BMFA 3GLGA 2JLQA 1N0WA 2YKGA 3W3ZB 2CBZA 2MSCB 1XZPA 1YU9A 3MJHA 1OXSC 1YZGA 4LHYA 4PPQA 4BLSA 3WNCA 3AKEA 2C98A 2CHGA 4LBVA 3GJ5A 3U3RA 4EKDA 2ZU6A 4X8MA 1G16A 1W36D 2ZJ2A 3WYAA 2C2HA 3GFPA 1LS1A 2QP4A 4BLRA 4HUTA 3UPUA 2R6FA 2CNWD 3OFND 4OHZA 5GVRA 2QM8A 3K09C 3IEVA 1XXHA 1KOFA 1U99A 1WXQA 3TE6A 3HU2A 3ETLA 1QF9A 1WCV1 2Y8EA 4EJSA 2QSYA 2QP9X 3FE2A 5FTNA 2BEJA 3SFVA 621PA 1CJUC 3ZIAA 3FKSD 3BAFA 4ABYA 1XD2A 4GL2A 4PC7A 1OH7A 1N6HA 1P2TA 2AL7A 1W5TA 1P6XA 2HV8A 2VHUA 4FW9A 1P9RA 1U0HC 4OL0A 4UNRA 2GXUA 3LW7A 5KPDA 4PAOA 1P9NA 5HTKA 1Z08A 3QKTA 4YDSA 4XH9B 4HZIA 1TU3A 3SDZA 3RSOA 5BQ5A 2F1HA 4LSGA 2OFOA 3H84A 1VYTA 4W9MC 2KWIA 1FZQA 3IUYA 3TR0A 2WVJA 1D6JA 4RCYA 1S4QA 1ZIOA 2FFBA 3EC2A 3F3YA 5L3RA 4BPBA 2VHTA 1DAMA 2RGEA 2KBFA 3SU8A 4MYTA 2RGXA 1OJLA 2GF9A 3KDSE 3RS7A 4LHXA 1UKEA 1S2MA 1JQJC 2ZS8A 4XTRA 3CONA 2ORVA 4DCUA 2AD1A 2Q9CA 3B6EA 2QQ0A 5GJCA 3NEJA 4B35A 3KQNA 5CK5A 1HT1E 2WWGA 1VG8A 2NZJA 5FOXA 1YQTA 1IY2A 2WWFA 2V1XA 3HR7A 1Z2AA 1FX0A 1KMHB 2B21A 3FHOA 1YZNA 3AGQA 1KSHA 2JLVA 2YZ2A 3NHAA 1EXMA 3VR5A 4E03A 5KDOA 2G77B 4MKFA 2FSGA 2PLRA 4JJZA 1JPJA 2OFWA 5J47A 4IOMA 5B57C 4MITA 4DHEA 2OT3B 2WOJA 4C0LA 1R5BA 4Y0AA 5CB6A 2A5JA 4FCWA 4Q9JA 2BIFA 3KXLA 5EE3A 3SBEA 1KDOA 3CRQA 2F1RA 3SZRA 2JIZD 3TUIC 1NMYA 2CNWA 4I1VA 4NZYA 3OFNA 2YHSA 4R2IA 3CW2A 4ACBA 1CR2A 1NF3A 3TVTA 2BMJA 5JCZA 4ITRC 4O0MA 2VIIA 3GLFA 2ZJZA 3BFVA 2OLKA 5AJZA 3VKGA 5L3SA 3NH6A 2JLYA 1GL9B 1KK0A 1OF1A 1H8HA 2O52A 1VCMA 1RIFA 1TF7A 4B32A 2O8FB 3V00A 3U60B 1OT3A 4M9ZA 1MABA 3X1ZA 1MO3A 1UFQA 1KO7A 2WICA 4QBIA 5JRJA 4XSGA 3CRVA 2O8CA 5TXGA 1EK0A 3IGFA 4LJ4A 3QJYA 1UBEA 1Q20A 3GCGA 1GRNA 1Z6YA 2BCGY 3K9LA 4G5GA 4KXFB 4UNNA 1XU4A 4A6PA 3O47A 1R8QA 4RKFA 4D25A 3HJNA 4WZ6A 1UBFA 1UKVY 2ZRDA 3B9QA 3K0AB 4HB2A 3TBKA 4Q03A 1EX6A 5EP3A 2XITA 3UATA 1XEXB 5LDDC 4MDEA 2X2EA 5JI2E 4W5JA 4NONA 4Q4HB 1Q22A 2YNMA 4L8GA 4IVPA 1E2IA 5HE9A 4B43A 1ZUNB 5F98A 5KOYA 4R2HA 1LFDB 2DFTA 5IK2A 1XJCA 1IAQA 1M1YE 3QNUA 1N6OA 1QRAA 1GIAA 1X1SA 2ZJOA 4LJ9A 1OKKD 5KSZA 3QKRA 2X77A 2R6DA 2VO1A 4XVUA 1NN3A 5GJWC 3DDCA 4PPFA 4US2R 2QL6A 1G8HA 3D8BA 3I8SA 1N6RA 1E2MA 1G7SA 2O0JA 4TN1A 4B3CA 4E5UA 3VNVA 2FZ4A 2ZUBA 2WJIA 5EQTA 3U61B 2WJGA 3C15C 1G6OA 3O8RA 2PMDA 3MWLA 4RJLA 2CLSA 2DCUA 3LO5A 2OCBA 3BERA 2VPPA 3Q85A 1GAJA 3UG6A 3QKUA 4RD1A 3NVAA 4L16A 4TMZA 2ZRCA 4B75A 1JXOA 5HZKA 3CRRA 1G3RA 2JIZA 4XVQA 1E9AA 2ANBA 3U3JA 2H7VA 5C1BA 1Q1QA 3ADCA 1KY2A 1T6NA 1KO4A 3K70B 3KFVA 3DVLA 1UKZA 1UDWA 4B2IA 1M8PA 3GLIA 1W4CA 4M0LA 5IDVA 3P1JA 5KHOC 4LZZA 3H0KA 1J7KA 1LW7A 2JASA 2R6AA 2IWRA 3PG5A 1CR4A 2CL7X 3GFOA 4U02A 5J4HA 3RANA 2MSEB 5TY0A 3EARA 3ZYCA 2RB4A 2DFNA 2YVUA 3Q8XB 4HYYA 4PHTA 4BRUA 1KDTA 4A0FA 3DZ8A 1XTIA 2YWGA 4PQFA 3GQBA 4NKRA 3TUZC 1ZJ6A 2ZITA 5EUMA 1YJ5A 4HZUA 4FI3C 1SVMA 5ANRB 3TNFA 4PPNA 2PX3A 4OK6A 2J0UA 1AZTA 2WJHA 2BJVA 3SOPA 2NPIA 3VU9A 2QMUA 3EPJA 3AVYA 4LPSA 3CX7A 3EW9A 2NG1A 3IIMA 3NDPA 3ICEA 3PUWA 3ZS8A 4GRAA 5FBVB 2C9OA 3AEZA 4HUQA 1D9ZA 4OBEA 1TU4A 2QMHA 4MUBA 3ZQ6A 2IT1A 3SN6A 1ZRHA 1F3OA 3B1YA 3C7KA 3P20A 4FN5A 3GJXC 2OZEA 4TLBA 3TK1A 4CEHA 2ZQ5A 1MO4A 1YR7A 2H57A 1I2MA 3OEHA 1E69A 4LHVA 3TKLA 1VG9B 2OHFA 1VTKA 3SFZA 2OCYC 2V3CC 3J81k 3FVQA 1OKKA 3HU3A 4ACAA 1A1VA 1VHLA 2CE2X 4G0NA 3CRMA 3RS4A 3W5IA 2C5LA 2QTFA 3RRYA 4AYXA 3X1WA 1XRJA 1OW3B 5JCPA 3E70C 5AUOB 5AUQA 2F9LA 4IDOA 1N5JA 5FI0B 5IT5A 1RE0A 4M1OA 1G18A 1V43A 2UZIR 2DHRA 1D8TA 1M2OB 2DR3A 4PANA 2G1KA 4A2QA 2DWQA 4KI0A 4ZDKA 2FWRA 4D80A 1ZCAA 4WZBE 3U3OA 4PQRA 1IONA 1ZP6A 4P32A 4Q1DA 1VMAA 2HUPA 4RD3A 5K8LA 2QGNA 3L8YA 2F43A 4JYCA 2IWHA 5CLLA 4IVRA 1FUKA 2VP5A 4TMKA 1D9XA 1TPZA 2QSZA 1XD9A 5FBLB 2W6JD 2QT0A 4OQNA 2F1IA 5HCIA 3QE0A 2P3SA 1DO2A 1W36C 4W7SA 4QC2A 3EWAA 1ONBA 2Z0MA 1E2EA 3AP3A 3KKNA 3BD9A 1NVVQ 1A2BA 4AG6A 5EUQB 1DAGA 4F93B 4ZPXA 1EFRD 2ZE5A 4DCNA 4DT1A 4NDZA 2GEDA 3D6TB 2E87A 5J4KA 3BOSA 4URVR 1P9WA 2KE5A 4TWZA 1W36B 1Q44A 2QBYB 1HQCA 4U5XA 5EZ6B 4KO8A 4MRRA 3W34A 721PA 2R9VA 2J45A 1AQUA 1LF5A 3OIYA 4Q1AA 3GLGE 2F7SA 2XXAB 5E7MA 3GLFB 2HCBA 1N0VC 2Q6TA 4FMDB 1D2NA 5A4JA 3T5DA 2DYKA 1XX6A 2WTUA 1WQ1R 3RS3A 2A30A 1ZD9A 2LCFA 3L43A 4N1AA 2C95A 3QXXA 5SZJA 5C18A 1UEJA 3N5CA 3RLFA 3U44A 1AS0A 1VPLA 4JLOA 1DEKA 3AF4A 1WMSA 4LV8B 4RZUA 4G5OA 5TMPA 4QXAA 2WKRA 1N6PA 2PEYA 1R7RA 1VYUA 4PHGA 1UJ2A 4EQ6A 4NYIR 5FUVA 3PEVA 4JLJA 3QPWA 1NSFA 1MO5A 2R62A 2LWIA 4PSAA 5D3QA 2WAXA 4M2LA 4TQ9A 2ZRGA 4Q18A 1OSNA 2ZYUX 3DL0A 3EX7C 2QTHA 1SVWA 3BB3A 1RKBA 2ATVA 1VCIA 4DUGD 4I4LA 4O25A 4A4DA 1Q21A 1E98A 4RZXA 3WNBA 2VF7A 1FQKA 4D26A 2ZSAA 4M9SA 2CCGA 3AVUA 5CK4A 1IN7A 4HDQB 2HYDA 2W6JA 2QTVB 3L0IB 2D7CA 1R4AA 1S8FA 2AR7A 5EP4A 2JJ2D 1NG1A 1AKYA 2IYRA 2O0KA 1ZINA 3VR6A 3FFBA 1TQDA 2IYUA 1Z0AA 4AKGA 2QQEA 3WP1B 1G5PA 3KTAB 3I62A 4CEIA 5BN5A 3MWJA 1E9FA 2IYQA 2OSBA 1SHZA 2H17A 3QVVA 1C4OA 3THWA 5FPYA 1IJFA 1EFRA 2CDNA 1US8B 5CJ2A 1DO0A 1OXVA 4NCKA 1XTJA 1ZM3A 1G4AE 3IHWA 1AIPA 1QVAA 2PT5A 1VYVA 4JLMA 5DLQC 1YZKA 5H8WA 1OE0A 1MO6A 2VHJA 2HXYA 4PFSA 4RVCA 2WV9A 1BH2A 3O8CA 2YOHA 4URYR 3U7GA 1UPTA 1XEWX 4GOXA 4F38A 1Q57A 1P3JA 2NQ2C 5EXPA 3E2IA 3LD9A 3ZDQA 2PJRA 3HPQA 3L8ZA 5KO2A 2ZR0A 4UJ5A 3E5HA 2QP3A 3EZ2A 3TW8B 1Z2CA 5DISB 1XPOA 3ZLJA 2G0TA 3DPUA 5FFMA 3LXXA 3IIJA 1F60A 2PLFA 4QHTA 3JZMA 3LDAA 2WZQA 4KAXA 2J0UB 1FQJA 1II0A 1NLYA 1TEXA 3EA0A 1G1MA 1N5LA 2ZUCA 1BMFD 2PBRA 3T5GA 1P2VA 4LJ5A 4LYFA 3GLFE 1JECA 4XWAA 3IQXA 3WHLA 1NLZA 5CM9C 3V9PA 1E2NA 4Z1MD 2F1JA 3TQCA 1W2HA 1Z47A 4R7ZA 2V55B 2QN6A 4DUGA 3WBKA 1QG2A 4MGIR 4DCVA 3NXSA 1JJVA 4LBYA 1Q3TA 1EFUA 2QAJA 3EASA 2RGAA 3CF2A 1JALA 3BFKA 2JATA 3JVUA 4X8LA 5JWOA 5K8TA 1E0KA 1P2SA 4KFUA 4B74A 1TQ6A 2O0HA 2KBEA 3RS5A 1G8GA 1KJYA 1KO5A 4WXRA 2C8VA 4QBFA 1T3HA 2KB0A 4HLUA 1W2GA 4M53A 1QBKC 4M8NE 4MRPA 2Q3HA 3OIVA 2BC9A 3ND8A 2NO0A 3B60A 2GHIA 1GVNB 2OO7A 4H1VA 2G1JA 1R0WA 1H65A 2RCNA 4FINA 3H4MA 4QRHA 1E0SA 3NBXX 3PVSA 4PXAA 4DDTA 3NHBA 4HEJA 3I92A 3THXB 2YWFA 3AKCA 3CWQA 3CR7A 3ZVMA 1AS3A 3FHCB 4HLDA 4DWJA 2ZR7A 1KMHA 5J4VA 4Q4JA 3PUYA 4WOPA 2Z5FA 3CNOA 1GUAA 1BOFA 4NYMQ 2N42A 2C78A 3QF7A 3B1XA 3AVPA 1ZBDA 1W4RA 1SGWA 3A58B 5C46F 1W0JD 4KVAA 1KJZA 2IYYA 3KB2A 2IYZA 2QZ4A 5BYKA 3THYB 3IPYA 1IY0A 2XTNA 4KV9A 3ASZA 3SJZA 3EIEA 2ZYVX 1AN0A 5F2EA 3REGA 5BWMA 4TTQA 3LBHA 5DO9A 2BBOA 1QHHB 1GP2A 3RAPR 4ZI3A 4A15A 2HJVA 4D0GA 1G64A 2FSIA 4QGGA 1BMFA 2GXSA 2WWHA 1IQPA 2CVHA 3GLIE 2B92A 2ZRMA 4TLCA 3LLMA 3X1DA 2GCOB 4DSNA 2O8FA 5JJIA 3PEYA 3B9PA 1KJWA 4Z1MA 1DADA 2GEVA 2NTYC 4NYMR 3KQLA 1NMXA 4GMDA 4IFEA 4V03A 1AK2A 2RHDA 2GAAA 3ZQJA 2ZSBA 3CH5A 1G3IA 3SE0A 1S9HA 2BCJQ 3U4QB 2G3YA 2FGJA 1G8FA 5CIQA 1ZC3A 2PEZA 2GAOA 2IF0A 5DH9A 2PL3A 4DB2A 4TMTA 3B1WA 3W6NA 1SVKA 2OAP1 2VP6A 3CPHA 4PSKA 3FMPB 3K0AA 2CCJA 3NBZC 3L0SA 4FMBB 5JHHB 1RVDA 1XEXA 3LX5A 1W48A 4MGKR 3UIEA 3OIUA 1GILA 1DG1G 4RD4A 4Q4HA 5EJEA 2DB3A 4DXAA 2ZRHA 3F8TA 2B8WA 4JVSB 3T34A 3T35A 4ARZA 4AYTA 4D0NA 4DEYA 5B58C 5C2JB 4BWYA 4QHSA 3AVWA 1N5IA 3G5UA 4UXHA 2O5VA 1O87A
chains in the Genus database with same CATH superfamily
2QM7A 2NOAA 2GETA 3TIFA 2B7BA 1Y4DE 4ER7A 4YRZA 3OFJA 1RU3A 1UKYA 4JJAA 1NSYA 2WJYA 2OAQ1 4WZBA 1BCSB 3D8RA 4L4SA 4OXQA 5A4FS 4CLRA 3VSBA 2COKA 3QPBA 1QWSA 4N3BA 5FEUA 4AKHA 1GCOA 2GYVA 1EM6A 3TTSA 3KZXA 3R7FA 4C0AC 4E70A 2SNIE 1CDZA 3AVVA 2OQIA 5JHGB 1LD3A 4NPHA 1H85A 2O23A 4GDFA 5KNDA 1ZK1A 2O3SA 3FIJA 3GP3A 2FNAA 1L5GB 4OHOA 4ZIRA 4UU0A 1M5RA 4GP6A 2I78A 4AKIA 1QFMA 3G2QA 3PDHA 4MI1A 3VKVA 421PA 3ZHUA 5GP1A 2VYQA 2NZ8A 3ONNA 2O7QA 1TFRA 4N3GA 2WAYA 4DCOA 2F8SA 4R1TA 3L4EA 4B5KA 4A36A 3VYVA 3PQDA 2JAQA 3OECA 4DDVA 5A5FA 3W3ZB 2C5BA 1P0MA 1Z0DA 3QVLA 3FVWA 1NFFA 2RHWA 4UMFA 3RH0A 3I37X 3RIYA 3HJCA 1UFOA 2NUPB 4R1QA 2F3PA 4JHXA 1X94A 4EKNB 1NUTA 2RSLA 2DH6A 3THWB 4BAZA 1RMQA 2PS3A 1VKZA 4NIMA 5ALUA 3RTBA 1WEHA 3MWEA 1RYNA 5IDYA 2AN5A 2ZIFA 4LWZA 1UZUA 3N9IA 3W04A 3G0BA 5C32A 1OX4B 1Y4UA 4HN4B 2J6BA 5EVCA 3ONWA 5BQ3A 2RONA 3GB9A 3K05A 3RIMA 3O21A 221PA 4OMFG 5EE5B 3KQTA 5A4DA 1FTSA 1URPA 3GXOA 1K4MA 2P91A 2VTVA 2W2MA 2BDUA 3KCNA 3KXIA 4QU0A 3DLHA 5ECGC 4TZTA 2E2WA 2OHJA 4BNIA 1TD1A 1RKUA 4R7TA 3CLSC 2WJ4A 3GLVA 2VHCA 4C5CA 5JD5A 1SCJA 3MTIA 5H4GA 1XV5A 5C8ZA 4BFSA 4ZVNA 1MQAA 2JJ1A 1YUNA 2A5GA 4I5GA 1G5RA 4K6KA 4A8TA 4Y1RB 1GSOA 3QSYA 3L1KA 5CEJA 1AF4A 2EBHX 4HRXA 1WW3A 5EJ9A 1PFUA 1OLOA 4PZDA 4HMQA 2XA1A 5JAOA 1TUBA 2REOA 6CHYA 2C99A 2WJ6A 4ZI7F 3ZLTA 3VR2D 3HJFA 4ZDIA 4ZYLA 4WCVA 4QUJA 1OBFO 3DKRA 2I7CA 3QIAA 4WDQA 1BEZA 3EZ6A 3H6KA 1TLLA 1OZGA 4CMCA 3VMFA 1ECJA 3IR5A 4MUMA 1AE1A 4RSGA 5CFQA 3R3UA 3ICQB 4POAA 4YY3B 2ZWIA 1T0JB 3WDKA 4QARA 3KKLA 3G82C 1HRKA 4JLPA 2VOEA 4F9FA 3Q8WA 2B3DA 5DGXA 4UBKA 3BVPA 3BL6A 3NNNA 2EF1A 2RHTA 3RSCA 1XZDA 4MWDA 3NEAA 1FMTA 1M2OA 8OHMA 2ZJ6A 2W6IA 1KQ3A 2GAJA 5EXDA 2G9RA 1CY1A 3JWHA 4Y2RA 4I8DA 1KVSA 1A4UA 3PEEA 3SMVA 5CEEA 4GL4A 4URZR 3CPEA 3GPIA 1PL6A 4CF3A 4PNEA 1E1CB 4FNOA 1CETA 4HYQA 5EJ4A 2RG7A 2FUG1 1J8FA 3KXDA 2VG8A 3VH4A 5INTA 1YS9A 2C4WA 4PZZA 3BGDA 5IJWA 3QOFA 4KFSA 3BD6A 5KTKA 5CT8A 1K27A 1K7FB 2AA3A 2NYVA 1NPYA 1JR3D 1WSAA 5AT1A 3RJTA 4O63O 5DNYB 2WIJA 1T3SA 2DWCA 1WSBA 4RFLA 3WK5A 4R8RA 2R4QA 4MVJG 3KVOA 3WL7A 3Q7TA 1TW3A 2PLAA 2RJNA 3BK1A 3QVMA 1V35A 1YRAA 4CG0A 1TEVA 2X5NA 2D2IA 2VDWA 2NO7A 4MVCA 1Z28A 3E1KA 4MS4B 5JBQA 4GI5A 1XYGA 3U7HB 1PQWA 1ESMA 2ZOSA 4BFCA 1KDVA 4C1NA 4H0FA 4O29A 3R9WA 1SOMA 1ZIYA 1QHIA 2RHMA 2FPKA 2G0NA 1HQKA 2NYAA 1AGXA 2VC2B 2ZJ8A 3ONFA 1YL7A 5IM4F 1IOZA 5IBQA 4B6OA 4F3YA 2CXPA 4CODB 4HSGA 3AU9A 1VZ3A 4FJ2A 2CYBA 1XKXA 2HM7A 3LLCA 3KELA 3ROXA 5DNWA 3TRDA 1RLMA 3DHVA 4Q4DA 1UC4B 3VV3A 1H9CA 1YMVA 1MNQA 4TGLA 2EW2A 4DM7A 5DHQA 4ALNA 3LNCA 3WYBA 2FFQA 4WI1A 3MJDA 3OY2A 4R68A 1F5NA 2WUWE 3IQGX 1W88A 4MQBA 2GNOA 4IJVA 1P61B 5K0FA 4MVJP 1WTAA 3OEED 1BXZA 4C3ZA 5IDQA 1DRKA 1XLWA 2IUTA 2JARA 4WSOA 1N4AA 3WNDA 2ZIWB 3RHTA 1U2DC 4D0RA 5CURA 2XKKA 1IBMB 3KOWA 3OAAD 2IXEA 4RWZA 3I12A 2CJWB 2UZ0A 3GRRA 2P1ZA 3AWIA 2B2CA 3CNNA 1P91A 1SBNE 2QX9A 1FXWA 4MP6A 4UZFA 3TQQA 2DBRA 2CJFA 3DVAB 3GD5A 3OU2A 1J1IA 3A04A 4R54A 4CDGA 4KQEA 1HETA 1WHTA 2V7BA 2ZYAA 3MCWA 5JH7F 3ZQUA 3VR4D 3A6ZA 4JI4B 2IVFA 4Z1MD 3R7SA 2PZEA 1U8XX 4P84A 4UM9D 1LTHR 1VP3A 2CL6X 4OI0A 1IM8A 3FVRA 1P4AA 2Y0DA 2Z6VA 4AG5A 5IAAA 4Z9XA 3NVDA 2VKTA 4KFRA 1QGDA 1R6VA 2FEMA 3IAM6 3WLOA 2FW6A 4YRPA 3OX4A 4BNKA 1YJAA 5GAJA 2PWYA 3B85A 5MN4A 1ZXXA 2V6IA 3SEAA 3MHTA 3EQ6A 1XF9A 1E3QA 4EPTA 1JE1A 3F67A 3S2ZA 1B43A 3A4NA 2ODNA 2H4YA 4G5SA 2REQB 3QOXA 1JEJA 1Y7LA 4EMBA 1A95A 2FQWA 2PGOA 1AUQA 3SM9A 1NQOA 2GXAA 4U6SA 1Z6AA 1BVHA 2OB1A 4E5YA 4ARVA 1OC2A 1MX1A 4PYOA 4W5HA 4XCXA 2ZIAA 3VO2A 1RWWA 1Y82A 4NFSA 4PXYA 4EBBA 4EO7A 1I6LA 3R0QA 2AXEA 2E4ZA 3CS3A 3HN6A 4BB5A 1NJ1A 4CI0B 2PZ8A 1T4GA 3ICWA 2Q6IA 4RK5A 1DT3A 1WPRA 2XTJA 1K3UB 2X0DA 4EI9A 4DLAA 1B1CA 1M6YA 1MNAA 3D6FA 3DKVA 3H5NA 3KYJB 4PCUA 4MA0A 1WNFA 3RC2A 5HIKA 1XTKA 2VRWA 3GT3A 3KCQA 1US8A 1SHJA 3D8UA 1B0PA 1JT2A 2IP1A 2JKVA 5TPZA 2FZEA 5L9AA 4QELA 1X87A 3V6LA 1QTRA 3AVQA 4XLLA 4P1ZA 4H0CA 5BSHA 2W90A 4KQWA 2PZKA 1QYDA 1RIIA 5LYJF 2DWOA 3IOYA 4YJ3A 1T9CA 4YYZA 4ZI5A 4C0BA 4EA8A 2HZBA 3AP2A 3QTBA 3WADA 5EIXA 1DKLA 3MC1A 4FCTA 4JB8A 5D85A 4WESA 5FXMA 1IJKA 1OFUX 3A1SA 3JCZA 4HWKA 4NLLA 4OFXA 4K40A 4GOKA 2W6OA 4LAFA 1Y42X 3QP9A 4IEFB 1BEEA 3TW8A 2ZRBA 2A1TR 4RS4A 3JQ6A 4E7OA 2ZKIA 3P9NA 1F4PA 4RMGA 1EESA 5IC6A 4EGJA 4LDPA 2Q2OA 2C7BA 2BR3A 2OMKA 2AT1A 1G42A 4TS9A 4ECEA 4Z4FA 1ZISA 3U0BA 4HNGA 4PX5A 2OBNA 4O2RA 3WK6A 4Q1FA 1GL3A 1EM8B 2PCLA 2WHYA 4V0NA 5A4MS 2J9FB 3GLHB 121PA 4B4DA 3LRPA 3AEUA 1AVTA 3MRXA 3BGOS 2R8BA 4DLKA 5FUBA 3NTOA 3ROGA 1MZVA 1D2GA 3RTDA 2YC4C 4HFJA 5EIEA 2XZOA 1TM1E 4N5HX 4U2FA 4YAIA 4LRTB 1R12A 1JDZA 2WW8A 1DKQA 5FKJA 5IZ4A 4MW0A 1HSZA 1WABA 3GOQA 4TV9A 3WWOA 2J0QA 3DCYA 1L7NA 2X0FA 4LDJA 2FW7A 3ZNNA 4AMGA 3U39A 4HAYA 1PL8A 3CZAA 3NBKA 1DXQA 3CINA 4TQGA 4LK2A 1JBQA 1BXGA 1XRNA 3V8NA 1SHTX 2ECOA 2G28A 2R1UA 3NETA 5KSPA 2ZS7A 5I4KA 4DV0B 1LW6E 1XD8A 4ZALA 3CBGA 4G0QA 4RESA 5KYYB 1CUVA 4UARA 2AZTA 1NVUQ 1LK5A 3KUUA 3FSGA 1OBVA 4LE2A 5CVDA 2V65A 3DL2A 1MB3A 4PSVA 5BURA 4MW1A 5A9SA 4J16A 1DPGA 3RASA 2ERXA 2CK3A 3DC2A 4OHFA 4QYSA 5B4TA 5IAOA 1IEVA 3OOEA 4NL4H 4ND5A 3TJRA 2OXFA 1H4QA 1PTJC 2QL9A 1R6BX 3KYCA 4LYAA 3SDSA 1G8YA 2YXLA 5FRDA 4EY5A 1MC5A 4JGGA 3N3BC 1BWPA 3GJRA 3BBLA 4O6VA 4Q16A 2XXJA 4S24A 4F3NA 4V1CA 2Q1WA 2IEYA 1F8GA 1XEFA 1XU9A 5CHEA 1Y34E 2OFPA 4K9LA 1YVPA 5KTNA 3N0WA 5CA1B 4IUDS 4LXTA 2VCHA 2IU6A 3OHSX 1NY5A 1AO3A 3SICE 4MEBA 1XEWY 3JARA 3VAZA 1YS6A 3INGA 1VG1A 1VE5A 4Y67A 3DAHA 4EP1A 1ZJWA 5T8KC 4WJLA 4L73A 4AECA 1FLVA 5FP0A 2ZS9A 4F2PA 3VGPA 1U0NA 4QYIB 2REBA 4F91B 4XGKA 1R4MA 4F60A 5JT1A 2VSOA 5D00A 4MCJA 2BVNA 1XTTA 4DCGA 1L7OA 2C1XA 5FBQB 5FLXA 1MZPA 1OYVA 1NOJA 3FWKA 3SE7A 1D0VA 3LP8A 3DT6A 2QPTA 3N2GB 2R84A 4HJXA 4BCDA 3OP1A 3K8ZA 4EZBA 1OB5A 3W06A 4IV5A 4GOJA 3KOYA 4EB3A 1GGKA 4QFDA 2W71A 5AVTA 3H3XA 5G4KA 3ZD6A 5K45A 2WKQA 5KYUA 1YGYA 3JV7A 4OYHA 1YR9A 3HR4A 1E2DA 3O82A 2G71A 4RHFA 4RANA 2DBZA 2XRFA 1P19A 5B1YA 4NXMB 4ZYZA 1YO6A 5C51B 3K0HA 4WFIA 1ST2A 1IEXA 3A6KA 1JKMA 4B3DA 1CUIA 4PO1A 5JLJA 4DFDA 1LK0A 2Z4RA 1VPDA 2IGBA 1KAHA 3GF4A 1J90A 4LJLA 3FZEA 4F2HA 2ARKA 1FSZA 5BYBA 5HUHA 4GBED 4KPYA 1N1EA 1BXRB 1FE8A 1YR6A 1O89A 4G1MB 4C6HA 3GNQA 3FPEA 5DGHA 3N2IA 4DIFA 4LJAA 1Z15A 1N2SA 2Q49A 2A94A 1YS7A 3OZIA 4DG9A 4UQOA 3CLSD 1F8FA 4ZFNA 4BKUA 1GAEO 1OI2A 2B4YA 4C7JA 1PR2A 2X3UA 2YXDA 2J48A 2BCEA 3CM0A 2FPSA 3SHFA 4JEUA 2V96A 2G88A 1C3XA 2A3RA 3ND6A 4OHRA 2I2AA 3EIXA 3QUQA 2FFHA 2LD4A 1XZLA 1SUBA 4G0MA 1HEIA 1WS6A 5CA0F 2NSDA 2IODA 2XYRA 1MRSA 1YI8A 2A5FA 3O38A 3PYXA 4Y2PA 1N34B 4DLYA 3D2BA 2JI6A 4ILEA 2O3UA 1ZIDA 3IVCA 4CKWA 2HEIA 1G98A 3T6KA 5LZ7A 5SY4A 5FOVA 1GZ6A 2VR1A 4NPCA 3W1EA 2BFAA 4JI8B 2GM5A 2W2NA 2ST1A 3I2HA 4URWR 4WXPA 2RKOA 4XJTA 4FFMA 4YP7A 4ZXPA 4DCPA 2FX3A 2OG1A 3QTTA 4MQUA 5TT0A 4EG4A 1K5DA 3NUGA 2P7IA 5FO0A 5FA6A 1MV8A 1QYVA 3D7LA 4AI6A 3H75A 3R3ZA 3W6OA 1M3SA 2E7ZA 1OYYA 1XB2A 1Y3DE 4OEHA 4DDUA 3M6UA 4EUNA 2F3TA 1VCOA 3ACDA 3FG9A 1NF9A 3PXDA 3NG1A 4B3TB 1PR0A 2XA2A 4KYIB 2QSJA 3P8ZA 3QHQA 1QRTA 3GEDA 1II8A 2JD1A 4JXZA 4HEA6 3K8OE 1RJDA 1U2SA 3UQYS 1F7VA 3ZN2A 1RYEA 3BC1A 2ZDQA 1CRWG 2OLEA 4J94A 3SI7A 2EWWA 1FQOA 2HN9A 1G19A 2HLDD 2ZAGA 1VSBA 3M70A 4H31A 1EJ6A 2XOKD 5EZ5A 3CG4A 4IJWA 3L0DA 4M0KA 3ZGLA 5AMXA 1GQSA 5LIPA 5CDFE 1EX9A 4AXBA 3PFNA 4NMLA 3MBIA 2E4AA 2RIRA 1NIJA 3CSSA 5JSZA 1LXCA 1BIFA 3V2IA 4IICA 4D9IA 5BSFA 3F49S 1GQRA 5K20A 4EY8A 2ZTMA 1QAMA 1I9GA 4IWNA 1W2WB 5JTUA 1ZD5A 4U2DA 3B3AA 4XX1A 4EFLA 1CUBA 1KSJA 3BFJA 2L17A 1OIXA 2M6SA 3RC7A 1YZUA 1WU7A 3DCNA 4W6QA 4RKEA 1SZPA 5G2OA 3SXUB 3BRWD 3M4YA 2XOEA 2C04A 1QG6A 2PA3A 4HRAA 4OREX 4PLVA 2IYTA 4C7BA 4PZEA 2WSSA 4BQPA 2YUTA 1UM9A 1QKKA 5AHWA 2YRXA 4G1VA 2G6BA 1ULUA 4IVNA 1GPUA 2Q4BA 1SKYB 4N0EA 1XTZA 4MQLA 4O5AA 3T9DA 1UM8A 2WDPA 4C14A 3SEQA 1ZOPA 1U7TA 2JLRA 3TEFA 3SJ7A 1UK8A 3WRXA 3RROA 1NW3A 1PZFA 1O58A 3ABRB 3BXXA 3K2BA 4IINA 4MARA 1FCJA 3WGZA 1RJ9A 1ANKA 4JFRA 3EWIA 5BOVA 1KJNA 2B1JA 2GFHA 1ZEMA 3OPVA 3ADOA 1ACLA 4C88A 3ZVLA 4ESVA 1E9SA 1K89A 1RJGA 2WSYB 2WTEA 2H5LA 1PHPA 3FKJA 4KXQA 5G0UA 3D8TA 4OKSA 5KB3A 4EYQA 2O8EA 5AKXA 1ND5A 1YL6A 1ULSA 3DFKA 4QD3A 1J5PA 3VVLA 3WRYC 3DMHA 1Z34A 4HWTA 3A4LA 4RDIA 4E1BA 2Z83A 4JLKA 1LY1A 3AU8A 4M1SA 1L7MA 1U2GA 1QQBA 3ITEA 4OIFA 1VE6A 3GK3A 3RUEA 3QYPA 2H4ZA 2VT6A 2Y1GA 3IX7A 4ID3A 1ENPA 5HF8A 4ZT4A 4YREA 1TIBA 3NV9A 4FD2A 4L7QA 2HO5A 1DBSA 3S29A 3RV3A 4AN0A 1DX6A 4NOLA 4TLEA 4PN3A 4LHWA 5SZHB 2B25A 5HKLA 3NHLA 3A1EA 3Q1KA 3TX2A 2BEWA 3FVTA 2PGAA 3DR3A 2ZYWX 5C9ZA 4L6IA 3QKSA 4M0MA 1LRJA 4Q21A 4I7EA 1IG3A 1U1IA 4D81A 4PQEA 3IDZA 3THRA 3AF1A 4XJXA 1ND6A 3D7MA 4OXKA 4ZOEA 3PF8A 4UPEA 4H7JA 3MUOA 2D5LA 2YL2A 2EFJA 3M5CA 1E5XA 4L4RA 5EWJB 1HDXA 1Z8DA 4O2BA 1LKZA 3FI0A 3LRTA 5DX8A 3SKXA 4KE9A 5DHRA 2QY9A 3BXOA 2C4HA 2G80A 2PR2A 1KI3A 4KZKA 1NF2A 1ZONA 2PRJA 4FILA 4OATA 4FNAA 2Y0BA 3GEPA 3JPYA 3PZRA 4QFCA 2AV6A 4QUAA 1ZJYA 2P0EA 3I30X 1OZAA 2QE7A 3CE6A 1S2GA 3NAGA 4C76A 1KJ9A 3EH2A 4N39A 2PRIA 4DLZA 1LQUA 4MPTA 4CNQA 1ZHFA 2C2ZA 2CFIA 3HL4A 1WUHS 3WAGA 1RPZA 4G8CA 2UUCB 1WXWA 5AVRA 1K6JA 2CFTA 3CNBA 2VOJA 4NZZA 4C4OA 2FUNB 4EG3A 1R10A 1GV1A 1MOZA 4P5DA 1UXJA 3K0FB 4IQGA 1DQRA 2MHCA 4NG4A 3HLTA 4XWWA 1TC2A 4KVZA 3WJ7A 4NF2A 4Z2AA 2V7QA 1L7XA 2BHTA 2FJ0A 4FKBA 4ENRA 5FI1B 3HTXA 2BDEA 2AN3A 2HU5A 2XMBA 3QXCA 2MOKA 2OQRA 2QU8A 5TSDA 4B31A 1I2DA 1GLGA 2Q4DA 4PR0A 2IW1A 3C8UA 5TE9A 2AQHA 3PNVA 1A4XA 3DF9A 3NOQA 3PNQA 4ETNA 5IZCA 5AHOA 1CUHA 1U5BA 2I2FA 1L1FA 1T8TA 2NQ8A 4K2AA 4MV5A 4M9CA 1L7AA 4NP6A 5G0SA 1ABFA 2I99A 2HY7A 3MLEA 1Q0SA 2ZSDA 1LSUA 3N59A 1JR6A 3UXMA 4TLMB 1K8RA 1R3UA 3BMOB 2D54A 4NXNB 2YJ6A 1KIAA 3G9UA 4XWOA 4E21A 4GQIA 2HDOA 5F7ZA 5KU1A 1WCIB 5GONB 1TM7E 3MMPA 1TLTA 4QU8A 2QJTA 4YRDA 1PJ8A 4MYHA 3E9ZA 2G40A 3T4XA 4YV2A 2G4LA 4YEDA 5ABPA 4B17A 3QHAA 5FOSA 3JY6A 4ER3A 4PFKA 1XXLA 3O75A 1X70A 4MWCA 1QQAA 3UWMA 4LRSB 3M1IA 1VJ5A 2XJ4A 4P4SA 1O95A 2ZIXA 4GZ5A 2YX1A 2CL0X 4BVFA 3AVXA 3IDSA 5KU7A 3ZH9B 4JITA 2UU9B 2XUFA 1RRKA 3K4QA 4J7AA 5JO0A 2H4JA 1ESNA 2QX7A 4MAMA 1CVRA 3D6JA 3LHSA 4ERNA 4BFUA 2QYSA 3K9CA 3N2LA 2B1QA 3JD4A 2B4KA 4WXMA 2JLCA 1YOVB 2YY5A 1HURA 1U02A 1C30A 1LQTA 2WILA 3HB5X 5DPMA 3B7GA 3AIMA 1LU9A 3QJ5A 3AEXA 1YA6A 1JRLA 3MJCA 4MV6A 2VKQA 2VYVD 3HKDB 3UJHA 3UUWA 1A5ZA 4UNSA 4P33A 1E63A 2M6KA 2F9MA 2C4TA 1NATA 2I76A 4BOYA 4ZVTA 1EDZA 3NOVA 4MLDA 3KNZA 5KPJA 4JKIA 4Q4AA 2I3DA 4L0QA 2W42A 4ZOCA 1Z0SA 4YJ2A 2W2OA 4W5OA 2B69A 3A0UA 2XQFA 4BU0A 2JGEA 4X1KA 1D5WA 2Y0EA 3EA4A 4P3XA 1KK2A 2I8LA 3RYCA 2MMCA 2NSLA 1J07A 3J80A 4MAFA 2GK6A 4IF4A 3C5EA 3QI2A 1V9CA 3PFBA 4TL9A 5FOTA 2P6NA 3R76A 3SF0A 1W5BA 1SC4A 1YTLA 2BP7B 4G09A 4WNAA 5AI9A 5EZQA 5CLFA 5HE8A 5LQCA 2X1HA 2PUGA 3ZXXA 1T8YA 3JWJA 4JGBA 4DWOA 1VHTA 2PJDA 1SB9A 2W2LA 1IK6A 3AKYA 1I5EA 2OESA 1OBOA 1K68A 3BHNA 1HE5A 3GXBA 3L6EA 3Q12A 4GBMA 1RYDA 5HBRA 5SZKB 3RVRA 5LZ5A 4YCCA 4DN6A 4KIUA 3K15A 1DJMA 4MRSA 4J1TA 3OESA 1MB0A 5F1OA 1TGVA 3RVLA 4LSWA 1X1QA 4FOLA 1EKXA 3HL0A 3IH5A 4YPOA 6AT1A 4YMGA 3TQTA 2E49A 3I1IA 4IOJA 1BYUA 3W5HA 1TXGA 2UUBB 2HZ7A 4B34A 3FCXA 4RKQA 2GSWA 4IJ5A 3KO8A 1EVLA 4BE9A 4Q7JB 4OJKA 2C54A 1JDSA 3DTVD 4N65A 2CMFA 2YN4A 3CLKA 2W37A 4IH9A 1T43A 5I7SA 2IRWA 2B20A 4I4NA 2FEWB 4MH0R 2ESRA 2H9IA 1X2BA 2FG5A 3JAWB 1QP8A 2CCKA 3G0CA 5F1PA 4UQLA 5K2MA 2Z8YA 4FLEA 5EL0A 5ERXA 1DKMA 2Z4SA 4F5DA 1V5EA 4LVUA 2PFGA 3V7WA 3MS4A 1AQJA 2BAGA 4KO1S 4NYJQ 1MOPA 4RELA 3AV0B 3B1JA 4PLCA 4AMVA 3O3NB 4ESHA 2OQ2A 2M6LA 4C21A 2OZLB 4AB1A 3EFOB 2QF7A 4R2LA 3WSVA 4C04A 4DLVA 3WWCA 3GYGA 3FMFA 5H5JA 5TVGA 1FDRA 4UZSA 1R6DA 4YXWD 2B5OA 1ZRSA 1AM4D 2BPOA 3V8MA 1PLKA 2VJKA 4JL6A 1Z6XA 3FDXA 4PZAA 5EKTA 1NLMA 4ZD6A 3ZZ0A 4KRYA 1FW6A 3JQ9C 1LK7A 2HX1A 3GJ4A 2A7XA 3SPXA 3B82A 5A1JA 3P0EA 1FP4A 4YI5A 1UOOA 1K92A 3VOBA 1M0WA 2O2EA 1RTKA 1A9XB 2QE6A 2OG2A 2VSFA 3A1WA 3DOFA 2EG5A 4F4DA 1L5QA 3HVUA 1CU1A 3H2YA 3QENA 4IQ8A 2RGWA 4HLUC 1CNMA 5EFZA 1FDSA 5KX5B 4ZOBA 2CJYA 1PJ4A 4RVDA 3CRZA 2OCGA 3A4YA 3GLRA 3MAGA 3N2YA 1OT5A 1M1YB 4PLYA 5HM6A 2Q6VA 4P3NA 821PA 3OF3A 3EPHA 3RWMB 2D2FA 2FJUA 3Q6IA 4JUFA 1FLDA 4K87A 1MQ8B 5JBIA 1HMYA 5FL7A 1QQ7A 2XMSA 2VDVE 5DLYA 4G23A 5CT4A 4RXUA 3FA2A 3TSOA 4BO5A 1H4VB 1KZ4A 2W8ZA 3OMXA 5L3QB 4MUJA 3TINA 4OK5A 3VQTA 1A04A 2I7DA 3VV2A 3URKA 2YNMD 2Z2JA 2BEKA 1E62A 4GQAA 4NDAA 3CEMA 3ZGOA 3QRWA 5FR2A 1PS0A 5DTMA 4I1OA 4KR9A 5CFPA 4H6VA 4G1UC 2VYND 1MIOB 4XEUA 5E4YA 1CLUA 4HEHA 2B94A 3F7OA 1TMOA 1GZ3A 1Y8RB 4UAUA 3QLEA 3OFVA 1FYWA 3LBIA 4RY8A 4R9RA 2X14A 1ZOIA 1YONA 1Y6GA 1GGMA 3T5PA 1YJBA 1EK5A 3O6VA 1U6IA 3ANMA 2JG3A 4H27A 1DV1A 5DLDA 4B0PA 5TQ0B 3I39X 5D5QA 4DR2B 1U0TA 2ZUVA 1QZTA 1AG9A 3KFLA 5CPFA 2XVYA 3T95A 4Q9DA 4DVJA 3II6X 2NNWB 2NAPA 3M6AA 4RACA 4Z9YA 4DDMA 1K3FA 4IZOA 5TNXA 5TQ2A 3I5XA 1V0JA 4BQQA 3L84A 2Z04A 4OX9B 2AF4C 3TNJA 3OM1A 3ND7A 5EMHA 1EGAA 1I6KA 1KMMA 1QK5A 2BGMA 4U7HA 1XQXA 3CWCA 3P9KA 2IGTA 3HXQA 3R9XA 3NYRA 4OP1A 3HN7A 2G9NA 4IGAA 3TM5A 3DMDA 2FGKA 4IFIA 4TVBA 4A9AA 1NYTA 5FWXA 1IY1A 1FIUA 2C57A 1F6BA 3MOGA 3R9KA 4JBHA 4KHZA 2GBLA 3KTFA 5EJ7A 5JNVA 1T5IA 2C8JA 4G5QA 1ZHOA 5HKKD 4GECA 1IN6A 3G2IA 4N3NA 4M76B 4XQEA 3OOJA 3BDVA 1GTZA 4WXEA 1NF8A 1IBRA 4P4SB 3RREA 3ISJA 1N5OX 3PRYA 3Q3IA 2ZIXB 4W8GA 4ZOLB 2ZSEA 3EMBA 3V8RA 3EMDA 1J42A 3X43A 4JI7B 4OAOA 2PMWB 4B3IA 1NG9A 1UXKA 2QXYA 1USVA 3V80A 1NQWA 1W93A 2W9XA 4JSTA 2R11A 3M33A 4HWSA 4Q7KA 4AZTA 3FSRA 2PO7A 4X7MA 2E4WA 1QDLB 3FPLA 1J00A 4MS1B 3S28A 2FUKA 4FFDA 4OD0A 1DBQA 4KIWA 5DK4A 1BHQ1 2D8MA 2H7XA 2RGYA 1GYRA 4NVRA 4GGOA 5ED0A 3WLEA 4DLXA 5DMXA 2V97A 5G0WA 1SM4A 4JYZA 1C7JA 3GOHA 4HI0E 4YCAA 2GBIA 3F7NA 2NSJA 4UHCA 1TYCA 1KFBB 1S3SA 4FZ3A 5T3UA 4DV2B 1O0SA 3F4LA 4YMHA 5J5CA 2CLIB 4MDFA 4HNTA 2B34A 3KTDA 3LL7A 3NOOA 4NBWA 5DT9A 3BILA 3IAUA 2YIVX 1CDDA 2IDZA 2I03A 1H1LA 1V4BA 3ENKA 1JHQA 3HKCB 3JVVA 1B8OA 2G09A 1PQ4A 3A6JA 1S2IA 4G67A 3STUA 5JR3A 1Z7WA 2RD2A 2O5RA 4GPD1 3NJ4A 4XA8A 3D3NA 3GFFA 3L4BA 4IRUB 5H59A 3RYCB 1PDVA 2BEUA 3IDAA 4EPVA 2BBSA 4JJ8A 2Q2QA 3A31A 4K03A 3VVBA 4GSYA 5LPNA 3PC4A 3RFUA 3PR2B 4N6GA 5FADA 2AN9A 2R5WA 2QD5A 1HYBA 2YV4A 5AJYA 1W6RA 3CLUC 2FK7A 3LA8A 4Z4GA 4E07A 1VBNA 2C88A 3UB4A 2QRJA 3GA7A 5BWCA 5H1YA 5G1PA 2QTZA 4DQKA 1CF9A 4MUIA 2Z2KA 3OEEA 4D46A 2CXTA 2KS6A 3FFTA 3VMMA 1RMYA 1HV8A 2OPHA 3UN1A 5JFTA 4ZKDA 3BGWA 3LBAA 2R751 5FR1A 1XA3A 3OAAA 2H16A 4QODA 1JQDA 2BKUA 4QOIA 3GRCA 3ZVRA 1CCWA 4JUBA 5B3AA 5UKDA 4B7ZA 1JAYA 3OKAA 3MUEA 3EMVA 2IHYA 2ID7A 1K3TA 3EMKA 4JLNA 1SBQA 1XDWA 1C1XA 1NBMD 1KVTA 1X8KA 1XQYA 3G8YA 3NC1C 2ID4A 3FYTA 4G97A 4RORA 4I3HA 4EHDA 2UVPA 1HI9A 1J70A 2BYTA 5EWMB 5T4HA 2X8JA 4GC5A 1F5SA 4DSTA 3LT1A 4LOIA 3BH0A 4LHZA 5EEGA 2VDJA 1R88A 2OA0A 2YVKA 4C22A 3IV7A 3R7WA 1L4FA 2ZYIA 3NR2A 2ZVDA 4N54A 4NOJA 1D04A 3CR8A 1RABA 4C30A 4NI5A 4B82A 1R6AA 2I87A 1NU8A 1E59A 2D2XA 4X60A 3DLCA 4JBYA 1G2PA 4CETA 2FLWA 1HDIA 4D3DA 2FPIA 1EJ2A 1JIUA 3ZCSA 2J0SA 3LKBA 1JJFA 1OWLA 3UC5A 2H7YA 3AW9A 3W4KA 4G37A 3EXIB 1GKIA 3QE4A 3TW4A 3AZQA 1U4SA 2BTQA 2BMVA 1LDYA 3LQQA 1E9CA 4JI6B 1XQVA 1RRCA 6REQA 5SZIA 3W5AA 4DMCA 5EJ6A 3IKMB 4RQTA 4CKZA 1B6SA 4TV8B 3NAMA 4EOGA 3I83A 3TFQA 1BWRA 3T3GA 1BDMA 1JHXA 4YNBA 3EYAA 3FUTA 4FBGA 4UU1A 3DAOA 3FGOA 1ZR2A 4EMTA 2ZVPX 3H0CA 3O9ZA 1ZM7A 4ND8B 5HSGA 1M66A 3SR4A 2QR3A 3UMYA 2I1QA 1D1PA 2HIAA 3B6MA 5IJ0A 2PMFA 3P2MA 4PS1A 4DQDA 4M4SA 1TO2E 1H6AA 3WMEA 3HXMA 2FYTA 2PXXA 1KDPA 1HEYA 2BEVA 3CY6A 3GEIA 2IYSA 5CVEA 5DI3A 3KOUA 1JAHA 1AGPA 2GWRA 3CFYA 3I1JA 3KV3O 5FPHA 4YRNA 3BJEA 1H4TA 1SC1A 4PYNA 3J7AC 1JG3A 2PQ0A 3LY5A 1N2CE 1UODA 2H0QA 1YKSA 4MW4A 2WQ7A 1ESZA 1K97A 1PNVA 5DGIA 3ZD9A 4WFKA 3O3CA 1M1NB 4QLOA 2XZTA 2NN3C 1QK3A 4DIEA 2R7NA 4E5DA 1FRVA 5AYVA 2X13A 3AB8A 2O2ZA 3TLZA 1TFUA 3WLNA 1JIXA 4B8YA 5ILOA 1IBKB 4HN9A 1CYDA 2J67A 5FL3A 2DC1A 3FDFA 2O3RA 1E6KA 1KEUA 2RE8A 4YHBA 2H65A 1WY7A 2JCYA 3DBOB 2V59A 2QRNA 2A0XA 2V58A 3E9QA 4AX4A 2BFWA 2OHOA 3IDQA 3GPCA 4IQ4A 4QPZA 4IM7A 4MUYA 3R8CA 2BH9A 2AKYA 4MQFB 1GPYA 2XBMA 4ZAYA 4DA9A 2O5EA 4K6CA 3CV3A 4PAQA 1PV1A 1LX7A 5G1OA 1I7NA 1S1MA 2JZCA 1ZIPA 3MXTA 5J63A 5FBKA 3W2IA 3N7AA 3AIOA 1PGNA 4US0R 4NCAA 3QWAA 1CNFA 1JYEA 3MJFA 4AUEA 3JD0A 4R2MA 2X8BA 2O8DA 1E94E 3UANA 5FBWB 5KQSA 3WZMA 4KMRA 2M1XA 5KVCA 4ZMSA 4XUEA 1HFEL 4F4CA 1TCVA 4EPWA 4F0JA 1TJ4A 1EBUA 1W9HA 4WOBA 3HUTA 3KLOA 1K88A 4Q9IA 2HMUA 3IL2A 3E5MA 3P2KA 4QWWA 1DC7A 3M6VA 1CXZA 1FUIA 2J3LA 2VH2A 2A7QA 2RHBA 3H1TA 1V1MA 4I08A 4RY0A 3EWSA 2HFJA 5A5VA 4L15A 2XNJA 2FPOA 3QPUA 1AX9A 4HDSA 4MV9A 5EINA 3VAAA 4ALJA 4ZK6A 2ZM6B 2OORC 2ZULA 3DLTA 3W0LB 3I52A 3KR1A 5AM2A 3NHMA 4YJ2F 1P7CA 2VQ3A 4PZYA 2O8CB 1NVVR 3CU5A 1VGVA 2HT6A 4H1TA 4LNAA 1BEUB 1CFJA 2XDWA 3W9BA 2EIXA 1ULHA 3FYUC 1FF9A 2XNSA 3KB6A 5IXJA 3TSWA 3JR3A 3HDYA 4YAFA 1G5IA 1ZM9A 3KKMA 2E9SA 4HH3C 1XZGA 5CHYA 3NAQA 3ZKWA 5JZMA 1W29A 5CXUA 2JFWA 1YZQA 3Q7QA 4XDZA 2YJTD 4L7VA 5JAMA 1T4CB 1PT5A 1QZXA 4HQOA 5KOIA 1R0LA 4P86A 3FOFC 3IP9A 2IIVA 3OF5A 1NXQA 1U4OA 3QSGA 4BNZA 4EWLA 2P77A 2IH4A 1I1OA 1XYYA 2DE0X 1Z63A 1MB2A 3A06A 4IGEA 4IVQA 3FYUB 2BGUA 4MR9A 3IAAA 3T7IA 4YGYA 4YALA 1UJBA 3HBJA 3H2HA 4HUJA 4ND1A 3VYSB 5DM2A 4XQ0A 3B5EA 3RJMA 1BROA 4LF4B 1RQPA 1UP4A 3FCYA 4IIJA 4O08A 4KH1A 5EE1A 4EYEA 1IN1A 5I5EA 5M04A 3WZLA 1F3LA 3H6HA 2GZAA 3OICA 3QXGA 1JQLB 1Y6QA 1HQYE 5LA6B 4LMPA 2WWRA 4RVOA 2Q1XA 1L4KA 3LAWA 3HJAA 5G41A 4ZEWA 4KLRA 2C2YA 4C4TA 4DLLA 2DJIA 1T5DX 4M60A 1XMOB 4LCJA 1W5SA 4I46A 3GLQA 2V5AA 4MTLA 3OLXA 1PCXA 3AC0A 5L3ZA 3TTUA 5JV5A 3WTCA 2BFEB 4EARA 5HWSA 1Z6ZA 3D02A 2VJAA 5DX0A 4CTMA 2A14A 3HCPA 2VNAA 5IU6A 1EVIA 5CFZA 3HB7A 4E2YA 3OZVA 5DMHA 3SHWA 3SQXA 2HTFA 1YVUA 1W59A 1ZWKA 2W70A 4EMSA 4F3TA 1JMVA 4GI2A 1JZSA 2VZ0A 1QB8A 3NO4A 3E8XA 4A0SA 4EG7A 3GUCA 1OLXB 1R5NA 1JL3A 4MP3A 3ZVNA 4D9FA 4TYMA 2OENG 1NP3A 2A5DA 2QM0A 4YA6A 1J25A 4A8JA 2DFKB 1IJEA 3G6KA 1CQJA 3SC3A 1I13A 4CKBB 5L4LA 3D4LA 1Z0FA 3OZSA 3DDZX 4ZYYA 1ABBA 3HO1A 4NHEA 1UMDA