2QSZA

Human nicotinamide riboside kinase 1 in complex with nicotinamide mononucleotide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
188
Chain Sequence
VPRGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Nicotinamide riboside kinase 1
total genus 55
structure length 188
sequence length 193
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qszA00
3OAAA 2DY1A 1CP2A 1TUEA 2HYIC 1NRJB 3K70D 4JLMA 1G7CA 5AUPB 4FN5A 4MRSA 2G6BA 4WIAA 5DHAA 3BJIC 2ZS9A 3NXSA 4OYHA 3LVRE 2JJ2D 421PA 1OIWA 1E3MA 4BFYA 2CHQA 4BZXA 1SZPA 3R8FA 1YVDA 2Q9BA 2OFWA 3CKLA 1PLLA 4NPHA 5FI1B 1XRJA 1AN0A 5BYKA 5DN6A 1AKEA 4OI2A 2CK3A 3PV0A 4FWTA 3T1VA 1U9IC 2KB0A 3ZQJA 1KMHA 5ELXA 4CEIB 2NPFA 1TQ6A 2TMKA 2X1VA 2ECKA 1F2TA 4JLDA 1GKYA 1KDRA 4HB4A 4A15A 3QF7A 3OE7A 2J5XA 4ABYA 1E2KA 2QU8A 1O87A 1IY2A 3U60B 3F8TA 4CVNA 2A5YB 2YOGA 3C15C 1PLKA 4ZDKA 4GBMA 4JJZA 2IYYA 5L3QB 3M1IA 1XPRA 4MRNA 5FR1A 1E0JA 2G3YA 3BC1A 2QP4A 4YMTA 4C2TA 2ZVPX 1SQ5A 4OI0A 4ZCMA 4JYBA 2GETA 3W9YA 1E96A 2CDNA 2RGEA 2XNDA 4S2EA 4XOIA 3A1VA 3AP3A 3LBIA 4EQ6A 2X2EA 4QC2A 2QN6A 5C4GB 4TYNA 4IVPA 2BC9A 1XJQA 4NZYA 3CPEA 2FE4A 1SXJE 1YZNA 4A4DA 1OJLA 2I3BA 1PUIA 1KNQA 4PZZA 3TJZA 4PFSA 4ZIRB 4PAMA 4PHTA 4TT3D 2VO1A 4HLQB 2VP6A 4C2UA 1NIPA 4R98A 3CO5A 4UQOA 1E4YA 2D7DA 4PHFA 2WHXA 3EARA 3BB3A 1DAGA 2FG5A 3CH4B 4JLBA 3GJ5A 3MSXA 2ORVA 3V9PA 4RKFA 4LC1A 4GSYA 1LVGA 4KFSA 1OH5A 2WPDD 1OE0A 1G64A 3B1ZA 3GLFB 121PA 4LWZA 2AXPA 4Q18A 1X3SA 2C77A 5EXSA 2GXQA 4F92B 3SS8A 3FMOB 1D9ZA 1G18A 1W36B 1YZLA 5EP3A 3I8SA 3BFVA 1J7KA 3TRFA 5JHHB 2RGNA 1S4QA 1EFHA 4U7DA 1HE1C 4URVR 3IIMA 1L4UA 3DHWC 3RLFA 3TUJC 5AUOB 3UPUA 4JL5A 4D4KA 4F4IA 1NVWQ 5FOWA 3ZJYA 5G3YA 1TNDA 2NGRA 3WYAA 2QAGC 2ZAMA 4BECA 1NJGA 1KK3A 4TLAA 1RRGA 1VG8A 2GVZC 4IFEA 4ZI3A 1K8RA 1QDEA 1M7HA 3PR1A 1R0XA 4BE7B 4AKIA 2JJ8A 4B2LA 2XJ4A 4JVNA 4DCSA 1NIJA 4B34A 3RYTC 2VP4A 4TTPA 1II9A 1DARA 4K46A 5UKDA 1CF4A 1ZD8A 2QTVB 4FINA 5JFGA 2AX4A 3GLGB 4KCGA 4JMPA 4JKIA 3VX3A 1NF3A 4M1SA 1E69A 2FNAA 4V02A 2NO0A 3OFNA 3X1XA 4AYXA 4BGDA 2OSBA 2ZREA 4TQ9A 1H8HD 2A5GA 5B30A 2GEDA 2O8CB 4M8NE 4V0MA 2A3RA 3B8HA 4TL8A 3KQKA 3B6EA 2CEAA 2PCLA 4HDQB 2W2XA 4B75A 1LF5A 2IWHA 1CTQA 1NMXA 2A30A 4MGIR 1NI3A 2HCBA 2WJYA 1XU4A 3MUFA 1XEWX 2VH5R 1DG3A 3CF2A 3PG5A 3X1ZA 1EFRA 1UF9A 4IEEA 2GILA 1GM5A 4ESVA 5E7JA 3THOA 1AIPA 3SYKA 4HEJA 1UKVY 2VTKA 3GQBA 3CW2A 2H18A 4B43A 3WYFA 2GRJA 3DL0A 4RD1A 3KL4A 3FYHA 3ND9A 5HCIA 5F9FA 2XSZA 3GLGA 2FF7A 2HDNB 5JEEA 4C0AC 3PUXA 4IDOA 4L15A 2A5DA 2D2EA 3WMGA 2ZS7A 3W6NA 2RCNA 4XWKA 1XWIA 3GLFA 2O8DA 2VYFA 2ZE6A 2JLRA 3O47A 2JGNA 1ZRHA 4Q02A 2B92A 4QBFA 1OH7A 3AVTA 2YJTD 4D0LB 4J0QA 1O3YA 3NWJA 4LBWA 1VG0B 4ZO4A 4GT1A 1F60A 2VSXA 4LI0A 5AJWA 1B23P 4MH0R 3UWOA 3NBZC 1KSGA 4Q7KA 2BKUA 4RD0A 1NL3A 3IEUA 3U6BA 3ETLA 2WMNB 2CXXA 2XITA 2HUPA 5JWHA 1VIAA 4D0NA 1JI0A 1E9RA 1VHLA 2RGXA 2WV9A 3A37A 3BWDD 4Z51A 2XJ9A 2HJGA 4UXHA 1YE8A 1DAHA 1KSFX 2KBEA 1E1RA 4B3DA 3I5YA 3KXKA 1W4RA 4NYMR 1D2NA 3P1JA 2LKDA 4WAUA 5TARA 4ZDJA 3ZD7A 1A5TA 5ANRB 3ZQ6A 2EQBA 4LBZA 2GVDC 3AVQA 4KBGA 1JAIA 5GVRA 3QKSB 5TB5A 2ORWA 4POAA 3SJAA 2D2FA 2ZVQX 4QJ3A 4CEJA 1N5LA 2PH1A 2QG6A 3D31A 5KU1A 2ERYA 4Q21A 2PEZA 4FMCB 5FOSA 1JPNA 2UVQA 4JL6A 2JLSA 2PMKA 1KOFA 2DR3A 2ZRLA 2WWXA 4QRHA 3KZ1E 3QUSA 4O3MA 3UKDA 1GL6A 4OQMA 4TL9A 3EIHA 2GKSA 1F2TB 5JI3E 2YC2C 1YJ5A 2R6CA 1CR2A 2OXCA 4LX0A 2O52A 4ASUD 5L3VA 2QRZA 3LQQA 2YINC 3LBHA 1G4UR 1P5ZB 2ZANA 5M04A 4P0TA 4V0NA 3WNDA 4G5RA 2MMCA 4DXAA 1XCMA 3U3MA 1Q20A 3T61A 3W34A 1E1RD 2X8AA 3QBTA 4DBLC 4RJLA 2W0MA 2FU5C 2IT1A 3FPAA 1R6BX 1JAHA 3T5DA 3AVWA 2WICA 4OHXA 3SBDA 3SJBA 2P5TB 2RGDA 3SNHA 1IXZA 3ZDQA 4DUGA 3RS7A 2BWJA 2JIZD 1KI7A 2GCNA 5L3QA 4KV9A 1BMFA 5FBLB 5KUTA 4Q7JB 1MOZA 3IO5A 3RAPR 2IS4A 3TSWA 5H8WA 3K0AB 4M9QA 4PHHA 4Q48A 2MSCB 3QPUA 1GIAA 3U7EB 1OHHD 2IF0A 3L82B 1WMSA 4QBHA 4TT3A 5SZIA 4QGGA 2N1BA 1D8TA 3NC1C 3PJRA 4LYFA 1NKSA 1F6BA 2ANCA 1CR1A 1N6RA 2JJ1D 2NO7A 4XH9B 3CF6R 3NC0C 1ZM7A 2RGNC 5CJPA 2NOAA 1XFAA 1P9NA 4G5QA 4W5HA 1SVMA 3PXGA 4BLQA 3P32A 5AJVB 2HXSA 1DADA 4RFVA 5LBIA 1NLZA 1LS1A 1N5KA 2GCOB 1MO5A 4HSEA 4IW3B 5FOTA 3TQCA 3U7GA 1ETUA 1XEFA 3FVQA 1CRPA 1AS3A 3TKLA 1Q1QA 3WP1B 4H9GA 4A0HA 3J81k 1XD2A 1S2MA 1E2QA 3MMPA 1X1SA 1Z0JA 4ON9A 3JVUA 2P67A 4M2LA 2JLYA 2EWWA 1RJ9B 3IIKA 2ZRFA 4G5SA 1NBMD 1NG1A 2VF7A 2ZRMA 3GJ6A 4KFUA 1W4BA 3OEHA 4JLJA 1GRNA 3Q9LA 3Q8XB 2FFAA 4QXAA 4ZCIA 3W5JA 3VR1A 1GL7A 2AWNA 1XJCA 2ZE7A 521PA 2VHJA 1T3HA 1D5CA 4URWR 4IHQA 1KAOA 1SVWA 1XJ0A 5FUYA 4F4JA 2QT1A 2GDJA 1FTSA 2WJGA 2R65A 1LV7A 1T5IA 3QPWA 4KVAA 4MGKR 2H17A 3PEUA 2QBYB 2QL6A 2FPLA 4GPTA 3KKMA 5JJKA 3HU2A 2WJIA 2AD1A 5DHFA 4ZCLA 4C30A 4OHYA 3AV0B 3L8ZA 3PCRB 2IYTA 3BRWD 3E1SA 2ZE5A 3K0FB 4JL8A 4C4PA 4YMVA 4GRAA 2AWOA 4C3ZA 2YVUA 5BN3A 5JBQA 4GL2A 2ZQ5A 4U5XA 1OXTA 1TQ4A 2CCGA 2CLSA 4DDUA 4YQFA 1A82A 2ZSEA 1I4TD 4JT4A 3ZS8A 1EX7A 3LAWA 1G3MA 5L8VA 1G17A 5TY0A 2AL7A 2C98A 3LW7A 4PTLA 2ZSAA 5DGXA 1KJYA 2WPDA 3SHWA 1ZU5A 3A4LA 2GBLC 5C1BA 5CB8A 3O8CA 1NBMA 1OIXA 1OXXK 4OK6A 1E9DA 5KDLA 2O0HA 3ASZA 3PEWA 4DLRA 2BCGY 3FHCB 5J5CA 3ZLJA 5FPTA 2IXFA 2V4ZA 1YZQA 2YWHA 3KJEA 4Z54A 1G21E 1E9SA 2V1UA 2EFGA 4C0HA 4YMUA 3K70B 1YZKA 1AGPA 3SI7A 1T4GA 1XD8A 1ZVQA 2N42A 4C0KA 2ZI3A 3G0HA 2ZRJA 3QKRA 2GJ9A 5KOYA 2YOFA 2BMFA 1G16A 5IT5A 1U8ZA 4NDZA 4DKXA 2QM8A 2J7PD 4EFNA 2YKGA 1NMZA 2J59A 2JDID 5P21A 4LY6A 2ZR9A 1XPOA 1G19A 3HDTA 5CJ2A 2VP0A 4PPFA 1XEXB 2JATA 1QZXA 4TTQA 4D4MA 1VHTA 2WWFA 4M9ZA 2IHBA 1JXOA 3NBFA 1FFHA 1P2UA 2QGZA 3QKSA 3REGA 2OBNA 2FV8A 4JVLA 1CJTC 5IF9A 3SHFA 1W47A 2ZJBA 4DLUA 4DCNA 3BH0A 3N2IA 4G5OA 5EZ6B 4PPQA 4IEIA 5CIWA 2WKRA 1I4LD 1LS6A 3IHLA 1UBCA 5KYKA 1E2HA 2ZI7A 1R4AA 4HB2A 4TYYA 2ZYUX 1NY6A 4EKDA 3LLMA 4KYUA 5J4VA 5AJZA 3THYB 5SZHB 1E2MA 1P2TA 1ODFA 4EPTA 4F38A 3U61B 4L9SA 3BORA 4I1UA 2A7QA 4MYTA 3C5HA 4RD3A 3VKHA 4NCHA 4PAOA 4DLVA 2HCJB 3TW4A 1AM4D 1DAIA 4B3BA 5H1YA 2AK2A 3IPYA 1H8EA 4M1YA 3IEVA 3DKVA 4CEHB 4MUBA 2IYQA 1FNNA 2BMJA 4MKIA 4Q9IA 5AR1A 2O8EB 1ZM9A 4TMWA 4AYTA 2Q21A 4PO1A 3BXZA 4M22A 3W90A 1OPXA 4M1TA 2EFEB 2F9LA 4Q5IA 1T3SA 2C8VA 4B3GA 2ZTSA 3L0PA 4JLNA 3RABA 4FXPA 2J45A 1EWQA 2GJ8A 5JEDA 2ZJ5A 1Z5ZA 1W0JD 2IHYA 2GTPA 3S1AA 3T1TA 1RC8A 3QY0A 4GOXA 1UAAA 3VR3A 5C46F 3U3JA 4WVFA 2J41A 1IY1A 2QP3A 1BS1A 1DAFA 4MUAA 4DJTA 2FJUA 4JS0A 1KSHA 1ZUNB 5K8LA 3CR7A 1IJFA 2XAUA 1JPJA 4QM7A 1EX6A 5FOUA 3SU8A 1H65A 1BKDR 4QG7A 1JB1A 2QORA 4MKGA 1NN0A 2GZAA 1Z6GA 3OZXA 5EUMA 2V55B 1ZIOA 1X8LA 3R9XA 1JBKA 3WHLA 1HT1E 2PZGA 5DI3B 4M0LA 2RAPA 2QPAA 3CX7A 4BFSA 4PC3A 4M9SA 1GNQA 4JZKA 4NCJA 3LXXA 1XTQA 4HUQA 5D3QA 3R9WA 1OB2A 4KLNA 4WBSA 4PC6A 3HYTA 4XVUA 1G6HA 1GITA 3LD9A 2ZRDA 1E98A 2QP9X 5FTLA 2O0JA 3AGPA 4D2IA 3V4RA 4IDPA 5JSZB 4LYJA 1Q0UA 3DZ8A 2C5LA 3TMKA 3GLFE 2WWYA 4M4SA 1FQJA 3TW8B 4KXFB 3IUYA 3C5CA 1DAKA 2IEZA 5AUNB 4R71A 1CR0A 2Q0HA 1NKTA 4B47A 1XD9A 1OSNA 3F5FA 4AG5A 5DLQC 4HDCA 4AD8A 4G0NA 5F98A 3LWNA 2QAJA 2FZ4A 4UXJA 5CK5A 5G41A 4DIDA 1V5WA 2QPTA 4R2HA 1B0UA 1SXJA 2P5SA 3CNNA 4DUGD 4BFZA 1Q1BA 2FSHA 4CW7A 2QA5A 1KK1A 1XMIA 4AK9A 1ZAKA 2QROA 4G01B 4BFUA 4TMXA 3U5ZB 1GOTA 4Q66C 1QHSA 3AB3A 3RRZA 3VU9A 1ESMA 3EAQA 2PL3A 3EIEA 3NBXX 4LV5B 3RNLA 4TMVA 2ZRCA 2XTZA 4FMDF 1ZNZA 5JS8A 1YRBA 4OHWA 2GEUA 3DEFA 3OE7D 3O8DA 2ASEA 4FD2A 5TV2A 3WBKA 5B64A 1QHNA 3K70C 2J3EA 4TL6A 4KITB 3RHFA 1ZYUA 4HAXA 1YHNA 3ZIAD 4DIEA 3TBKA 4BLRA 3KUDA 5C2JB 2Z4RA 5E95A 1E9FA 1KO5A 2CLCX 3AGQA 4TZ0A 1XXHE 3EG5A 4BFTA 3P4XA 1E2JA 3AVYA 2LCFA 3TNFA 2Z83A 2OT3B 4DRZA 3SQXA 2IYWA 4C7OA 4Q7LA 2R44A 1IM2A 3JZAA 3PEVA 1SVSA 3WXMA 2QM7A 3HU1A 4LJ7A 1Z0FA 4A82A 5LB4A 3NEJA 2AHOA 2FWRA 4Q19A 2HXYA 2XTNA 2W6IA 2YYZA 4LSGA 4PPNA 2J46A 1JR3D 2C78A 4B74A 4TSFA 4RD4A 1Z47A 3MCAA 3LQRA 3M0EA 1HE8B 1X8KA 2WWHA 3SJZA 4EQ6B 2WSMA 3QPVA 1T91A 1UEJA 2XB4A 1A7JA 3TR0A 4P32A 3QEOA 4D82A 1AKYA 1G5PA 2FGJA 3CRMA 1ZIPA 4V0LA 3B82A 5EXXA 2J0VA 4AIIA 3A1WA 2EVWX 3RANA 1VCNA 1COWA 4PSKA 2ZM5A 4BZQA 4XVRA 3QXJA 3SDZA 1KZGB 2VRWA 4S35A 1UDXA 3HR8A 1SXJC 3BFKA 5KSOA 1GKUB 4NYIR 5CLLA 3UWKA 5JCPA 3F0TA 3VNVA 1XTRA 3ZVRA 3T34A 2ZR7A 1G291 2WAXA 2NTYC 2CE2X 4XTCS 3R7WB 1R7RA 2ZI5A 2KI5A 4JSYA 4HATA 3VR6A 4Z1MD 3K0SA 4OHZA 4EUNA 2OCAA 3ICEA 4LHZA 2XTMA 4W7SA 5CLQA 3WNBA 4UJ3A 4A36A 3E2IA 4W5JA 2JDIA 4PSAA 1E4VA 3AP1A 4N1AA 1J2JA 2HEIA 2Q9CA 1P2VA 4QM6A 2QT0A 2EFHB 1AGRA 3GJ4A 3BB4A 4L9WA 5DN6D 3FFAA 3QJYA 1S9HA 2C9OA 3IBGA 5JRJA 1FMLA 5EP2A 1OH6A 2O8BB 1G5RA 3VHLB 4NHOA 1GZSA 1UKEA 4V0ME 2PJRA 1KNXA 4GNKA 5E7MA 2ERXA 2MMGA 3ZGXA 4QBGB 2JLWA 2IEYA 1CKEA 4I99A 4I1SA 4YDHB 3R8CA 1ZJ6A 2G0TA 4WZBE 1US8B 2X77A 3RVBA 5HE8A 1NMYA 1Z2CA 3UANA 4UNNA 2CE7A 4QFMA 5EJEA 1OH8A 2BMDA 3I92A 1P3JA 1TADA 4LJ5A 1XTSA 4PC2A 5DO9A 3U3OA 2JLQA 1A2KC 3C4JA 3L8YA 3QOFA 2OBMA 3AF0A 2F55A 1ZBDA 2WM9B 5EP1A 1F2UA 2A2ZA 1OXUA 2H16A 4CT4B 1KO1A 1KZ7B 1P9RA 1GAJA 1CULC 2K5UA 3B1XA 4AG6A 3QSYA 1ZUIA 2F43B 1WXQA 2QAGB 3EPKA 5FPSA 4QNMA 3K0CA 3VR5A 1UBEA 2QMEA 3K0CC 1GUAA 1T0JB 5J47A 1MH1A 2IW3A 1Q22A 2BMEA 3LVQE 4ACAA 2HYDA 3THWB 2Q9AA 4IJMA 3FMIA 1IN5A 5HCNA 2PLRA 1P73A 5J4HA 3TUZC 4A8JB 4IVQA 3WNCA 2J7PA 1GVNB 5JJIA 4LJ4A 3NEYA 4PO8A 4MKHA 3IILA 1E9CA 4B3FX 5JLJA 1IXSB 1M34E 4EJSA 4K8OA 2BVNA 3KXIA 3TUIC 2H1LA 1R5OA 3PUYA 4DSOA 3U7FB 2ZEJA 3NIBA 1KKMA 3ZS9A 1E0KA 2EFDB 4RZ2A 4XVQA 1W5TA 3HWSA 2J1LA 2OXRA 2GZDA 5J4KA 5CK4A 1IN6A 1N0WA 3C16C 3FGNA 3MWLA 4ZDWA 3EZ6A 2QMUA 1FUUA 1Z08A 4WOPA 3LXRA 2XNDD 1FL9A 4H1VA 1C4OA 1SXJD 1II0A 2C04A 1T8TA 2GA8A 3OF5A 4WW0A 5IHPA 1DBSA 1U94A 1XEWY 2VHUA 3IGFA 1KI6A 4P4TA 3T35A 4TN1A 3TIFA 3QKTA 1RPZA 2IWRA 5D3MB 2ZJAA 3SEAA 1NBME 3Q5DA 4RFSA 4P4UA 1IQPA 2GJKA 5LD2B 5CM8B 3T5GA 5KPDA 1CIPA 1TEVA 3WRYC 3TR5A 1GSIA 4LZZA 4A6XA 4Q03A 3FB4A 2HT1A 4ACBA 2QPOA 1GFIA 4BLPA 4F93B 4E03A 3GD7A 3FHOA 2V54A 4IOLA 2ZRKA 1UPTA 1G9XA 4NH0A 2QEQA 3A6PC 5FBQB 2QSYA 4GI7A 4OI1A 3LV8A 4PQYA 4BASA 2Z6VA 4JLKA 5KTYA 2DCUA 3RWMB 1Q1ZA 3OHMA 4DSNA 4EPVA 2QSZA 3QEJA 3VMFA 2OE2A 3VAAA 1R8QA 1Z6TA 3AVPA 3IO3A 5C18A 1A4RA 4Q9HA 1FX0B 2FMXA 2OG2A 4JBXA 1OFTA 2J0QA 1P60A 5FUVA 3A1TA 1E32A 1CLUA 2ZJYA 1A2BA 3D8BA 4Q01A 4R7ZA 4TQAA 5FL3A 1W7AA 1RZ3A 1MT0A 1RW4A 3OIUA 4MRPA 5L3RA 1G8YA 5JCZA 2N46A 3CWQA 4LPKA 4XD7D 1YZGA 1Z0IA 4DLWA 3RSOA 3HPQA 4DEXA 3U44A 1T0HB 2FSGA 2BJVA 2R6AA 4XTRA 721PA 4AY2A 5HR5A 2DFNA 3A8TA 1KMHB 1OKKD 4QHTA 5FOVA 1KI2A 1UJ2A 2AXNA 3BK7A 3B60A 1L4YA 3I32A 4Q9JA 5B2ZA 3A1UA 4D6PA 2HLDA 5F3WB 1GRRA 3T1OA 4TMKA 2YWGA 1F5NA 4O2RA 4URXR 3X2SA 1CJMA 2NO9A 4A2WA 1DS6A 2JIZA 1H8ED 1HTWA 2R62A 4PXAA 1JR3E 821PA 5G3ZA 4AKEA 4OQLA 1AQYA 2ATVA 2E1RA 1G8GA 3K9NA 3V4FA 2IS1A 3P27A 1N6LA 1AJEA 3SFVA 2VLIA 2G9NA 3MAAC 1RVDA 2BKEA 4LOAA 3T15A 2V7QD 3QXCA 4MKFA 1NLFA 2AFHE 1PJRA 4CF7A 3T12A 4ZI2A 2PX3A 4LV6A 4DDTA 4EPXA 2GXAA 2ZJOA 1U99A 3DVLA 3KQNA 4D26A 1G7RA 4OJQA 2QE7A 1IOZA 3CWZA 5AUQA 1KI3A 3U2QA 4B44A 5LD2C 5EQTA 1IAQA 3KFVA 1VCMA 4DB2A 4Q1FA 4TMZA 2GNOA 1XMVA 1N5IA 1YR7A 2DFTA 2GWHA 3B13B 5JWOA 1BH2A 5EE0A 4LJ6A 1TF5A 4EJSB 2C2HA 1Q3TA 3GLHB 3SQWA 1TUIA 3NDPA 1Z29A 2OZEA 1RFLA 1AA9A 4O25A 2GXUA 1D2MA 3H84A 2ORIA 4LHYA 3WMFA 4Q1EA 5TVKA 3RWOA 3ADCA 4P4SB 1MABA 1XF9A 5JI2E 3H86A 1SVOA 4UNRA 1N6HA 3SZRA 2JEOA 2EU8A 1HEIA 2CNWD 4JT2A 2IYUA 4MRRA 4C0LA 2P2LA 2IS2A 1N0UA 4IDQA 3Q7PA 2ZRPA 3M6AA 4DLZA 2Q6TA 4C9BA 3ZZTA 1G8HA 4FWIB 1EGAA 1KY3A 5EXPA 4B32A 1F48A 3MJHA 2VP2A 3GLHA 1KI8A 1QF9A 3I72A 4P33A 5FBRB 5HKKD 1OT3A 1QHXA 3EC1A 3M4YA 1EXMA 5F2EA 2CVHA 1EESA 2YV5A 1SVKA 4QNRA 4MYCA 3QQ5A 5CYPA 2WOOA 1Q57A 1Y3AA 2C9CA 4OK5A 2BHRA 1BYUA 4ZPXA 3H4MA 5FBVB 3QF4B 3U3KA 1ZC4A 2WOJA 4DCVA 2BEJA 4DT1A 2G83A 3LO5A 4KFTA 3R20A 1NNEA 1L8QA 2DFLA 3D6TB 1GWNA 5L3SA 5BW8A 3UG7A 1EFTA 1U81A 5BN4A 3THXA 1M7BA 4Q4JA 3L0IB 4LUCA 3W6PA 3RS2A 1QVAA 2GK6A 2J0UA 4EAQA 5K8TA 2CJWA 2OLKA 5CDFA 4TL7A 3RC8A 1DOAA 2BM1A 4I81A 1XCGB 2GAAA 4YMSA 3MWKA 1LNZA 1E2IA 1M74A 3QG5A 4JBWA 5CM9C 4DZZA 2DB3A 3PFIA 1YR6A 3SBEA 1E99A 1T6NA 1RE0A 2F6RA 4OKSA 2KJQA 3QKUA 3KJIA 4KU4A 2AKAB 3FMPB 2ZU0C 1OIVA 4P3YA 3FMFA 4B2PA 1R5BA 3TVDA 1JJ7A 2REBA 3GLIA 1IN4A 1P7CA 1CBUA 2REOA 4V0KA 2D4HA 2V6JA 4HLCA 1VTKA 1MO6A 1BOFA 3SFZA 4AURA 1KK0A 1PVOA 2SHKA 3MLEA 4Q4AB 3REFA 4Q4HA 4DSUA 4US0R 4EPWA 1KI4A 1WCV1 2QRNA 3EW9A 4B3XA 3WBJA 2P0EA 4RCZA 4E5UA 2G88A 1OFHA 3OIYA 2YC4C 4URUR 2O8FA 1J70A 2PZEA 4PANA 4KODA 4MYUA 1J90A 1IN7A 1ZW6A 1DVRA 3GLIB 3EPJA 1CU1A 1R0WA 3BBPA 2FPKA 5FTMA 2GEVA 5KSPA 4RZ3A 3AVXA 1NN5A 1X1RA 2IUSA 1WE2A 4K81B 1Q1EA 4YC7A 3I61A 1Q12A 3QNUA 4Q1AA 3MFYA 1OFIA 4FMBB 3GJ0A 1XDBA 3GCGA 5EE1A 5EZ5A 2I1VB 5SZKB 3G82C 3K53A 1UBFA 3CR8A 3HYRA 5TXGA 2RGCA 4HDOB 2JASA 5BQ5A 4O2LA 2IK8A 3IHWA 4QGFA 4UNQA 1ANKA 3DDCA 3ZVMA 3UG6A 4EFLA 2V1XA 2WIAA 4RVCA 2BIFA 4KJZA 4CYMA 1G6OA 2P65A 4NKRA 4TLEA 4BRWA 3ND8A 2ZRBA 4G5GA 1I4DD 2RH5A 1EG7A 2FEOA 4AKGA 3KKNA 5FPKA 4GOJA 2A9KA 3KQUA 1QBKC 4BZPA 3CIOA 1SHKA 1DO2A 1UM8A 4JLVA 2DWQA 4HZUA 4A0GA 2H8KA 1KY2A 2UZ3A 3GEIA 1Z3IX 4OL0A 4JSTA 3MGCA 1D9XA 4MDFA 1XXHB 1MR3F 3BOSA 3EA0A 1XTIA 1E79A 3ZZUA 4Q47A 2XXAB 3TE6A 1ZM4A 2XOKA 5DISB 1VCOA 1SKQA 4DC9A 4NCKA 1ZINA 1E2EA 4LK2A 4AWXA 1N6NA 1Z8FA 3I8XA 3QVVA 1Z2AA 1SKYB 1TL7C 2NZJA 5AJXA 3EZ7A 4KBFA 4QHYA 2C99A 2OAP1 1E0SA 1JJVA 5SZJA 5TMPA 2JLZA 2KE5A 3BFXA 3NKVA 2JLUA 4Q1BA 2PBRA 4C0BA 3ZD6A 2OFXA 3ASYA 1NLYA 4DWJA 1HV8A 3I4LA 1MABB 4A1FA 3RC3A 2IX3A 3BERA 1UADA 3CNOA 2Z43A 5HTKA 5K8UA 1AS0A 2VIIA 4NYMQ 1Z83A 4LV8B 2QAGA 1W36C 4ERNA 1FZQA 2DPXA 2PZFA 4BWYA 3EPLA 5AWFC 1R0ZA 3UIEA 3NVAA 4MITA 1XZPA 4HUQB 3GJ7A 3RS3A 4FCTA 1L7VC 2XXAA 2IXEA 5DIFA 1NVVQ 1R0YA 2PEYA 2IYSA 2WBLC 2YWEA 3LH5A 4C0JA 3GFTA 1XXHA 3TSOA 1OW3B 3UMSA 4F7WA 1N6IA 1NVXQ 1W0KA 2RGBA 2RHMA 1Q21A 1XZQA 4ZV4A 4FCVA 1QHHB 4JVSB 4OQNA 2J0SA 2REXB 1M1YE 3IDQA 3PUVA 4ARZB 3GLHE 1MO4A 3Q3JB 2WJJA 4UJ5A 4P31A 4TLBA 1E9EA 4OJKA 5FUWA 5E4FA 3T06B 1FMJA 3D3QA 3CB4A 4LHVA 1P72A 2AD5A 3VFDA 3C41J 2ODNA 4KHZA 1IONA 2J87A 2GAOA 3IPXA 1WQ1R 4B76A 3AF1A 2FOLA 4KSCA 4FI3C 3G5UA 2IF2A 2E87A 2OV2A 1H8HA 4A0FA 4GP6A 2O8EA 2IYLD 3R7WA 8OHMA 2CK3D 4MA4A 2FH5B 1F3OA 4HLDA 5FPHA 2LKCA 2W83A 2W6JA 4FMDB 1IJEA 4BPBA 3BAFA 5CDFE 4BFXA 1W49A 2ZJZA 3RS5A 1EFRD 2KBFA 4D4JA 4D0GA 1IN8A 3DZDA 2CL6X 3KTAB 3THYA 5FFMA 3TVTA 2OBLA 1IXRC 2VHCA 3D7MA 3FTQA 4HUTA 3C14C 3BH7A 1YZUA 3OAAD 1QRAA 2Q3HA 2HT6A 4Q4HB 1XTKA 2C95A 3ONWA 1U0LA 4DLTA 1GTVA 3RRYA 3WYGA 1JR3A 4Z8YA 4E07A 4CT5A 2CL0X 5K8IA 5KSZA 1P6XA 2UKDA 2ZJ8A 1CJKC 3SYNA 3A58B 1P4SA 1TF2A 1ELOA 3W5IA 2IL1A 4HYYA 4N0DA 3KQHA 4LC0A 4B6EA 2FN4A 4EIWA 3DMNA 1DEKA 4A2PA 1G7SA 1OV4A 1JEDA 2FZLA 3AF2A 1K6MA 2F1HA 3QI2A 1VKJA 2OO7A 2VL7A 3GPLA 1XNJA 5GVSA 1N6OA 2PX0A 3LX8A 2WWGA 1M2OB 3GFOA 2OHFA 3KKOA 3VKGA 2XB2A 4EPRA 4UNPA 4RFSB 1JALA 1E2DA 3EZFA 2XSZD 5EXTA 2VQSA 1KO7A 1HURA 4WZ6A 5GJVC 1KI6B 1GNPA 3AP2A 1NP6A 1BO6A 1QG4A 4V0OA 2CNWA 2P6RA 3KTAA 2YHSA 2ZU6A 4JYCA 3QF4A 4HZIA 2EFCB 5FI0B 4PAQA 1U8AA 1SGWA 2NO1A 4M1MA 3SJCA 1OB5A 1RIFA 3SR0A 5HE9A 2QMOA 4EJSC 5G40A 4AKHA 3DM9B 2VHTA 3P20A 2QUZA 1VYUA 2W6ID 2HV8A 2Y8EA 4MGYR 2ZRIA 1ZM3A 2G0NA 2QI9C 3GJ8A 4WXRA 1CR4A 2F9MA 1P61B 2GESA 3E5HA 2D7CA 5DH9A 1HQCA 2OCBA 3ZVLA 4TZ6A 5HZHA 2J0UB 5EE3A 4BQSA 4TYWA 4Q4JB 3IIJA 2VBCA 1HT2E 4LHXA 1LF0A 2ZR0A 4NONA 4TLDA 3GEEA 1X8JA 4DT1B 2WJVA 5C4MA 1TU4A 2F43A 1P62B 1W4AA 4X8MA 5BXQC 2OESA 3B1WA 3DPUA 3LNCA 4X8LA 4BEBA 1T5LA 1YR9A 2FFBA 4XWOA 4M1WA 1DAEA 2VP9A 3TAHA 3LRPA 1EFCA 3Q72A 5DI3A 4A2QA 1U90A 3PQCA 3CBQA 3UMRA 1Z22A 4NMMA 1WA5A 5CITA 3CRVA 4NBSA 3QE0A 3B9QA 4TWZA 1US8A 4DDWA 1TMKA 3MJRA 2V3CC 4L16A 3RRNA 3U4QB 4RCYA 2ODWA 1YU9A 1KI1A 1FOEB 3LX5A 2JLXA 1FW6A 3K0EA 1N5JA 3HJNA 4Q9KA 1KYIA 3NHBA 4IOMA 3S1AB 1NY5A 2ZYWX 2EYUA 2R6FA 4Y0AA 5JJLA 4YDSA 3KJGA 1J8MF 1DE0A 4M9XA 2B7CA 2F3RA 4PSVA 1PV4A 2JCSA 1Z0KA 5EUQB 4HB3A 2VSOA 2BDTA 4A9AA 1P75A 2DWOA 2JA1A 3AKDA 3KUCA 1WB9A 5CYOA 4YMWA 3I73A 3NH9A 1YKSA 2LWIA 4PC1A 3RDPA 4LDJA 4RZUA 1W36D 5GJCA 4A0RA 1OYYA 3TQFA 3L0SA 4IDNA 1P2SA 5FH9A 1W2HA 1FP6A 2PJZA 1ZU4A 1JXMA 4G1UC 3P4YA 4IFBA 4Q7MB 2NG1A 3L2OB 2FEMA 3KXLA 3PENA 5KSYA 3PEYA 1G3UA 3EZ2A 2RMKA 3AF3A 3NBYC 1G3RA 1RKBA 1U0HC 4XSGA 4GFDA 4HAYA 3CRQA 4UNSA 1HA3A 3AF4A 3HPRA 3LLUA 2GZHA 2YZ2A 3X1WA 3CZQA 3KFXA 3Q85A 5BWMA 2ZI4A 2G1KA 1ZM2A 2GK7A 1U8YA 2ZSDA 5A0FA 2CMKA 3E70C 2FSIA 3P26A 2BBWA 3NH6A 3MWJA 2MSDB 1Q44A 1AS2A 1W48A 5FR2A 3W8NA 3FDIA 4US1R 4BLTA 2RKOA 2GF9A 1KIMA 1XP8A 3B85A 2XZLA 2RB4A 2IS6A 2GJAA 4Z1MA 4HAZA 1HUQA 2XZOA 3BE4A 4Q1DA 2G1JA 1Q3HA 1E2GA 4HLUC 4Q4LA 3U7HB 1UKYA 4TMTA 4C7OB 4L5BA 1T3LA 2W2TA 4MDEA 1S1CA 3H1TA 2VEDA 3LA6A 4OK3A 1KDPA 4V03A 2ATXA 2I1QA 1KKLA 2ZIAA 4KVGA 1JEEA 2J7KA 1LTQA 3KKQA 4KAXA 3EWSA 3L43A 3MWYW 4CEJB 3EC2A 3SYLA 1G20E 2ZYTX 1UEIA 3RRMA 1FX0A 2ZYVX 1R2QA 1J8YF 4CGZA 3I62A 4Q4AA 1GG2A 4BUJA 1JQJC 3O8RA 2FFQA 1HY3A 2BM0A 4LYHA 4LHWA 4GOKA 2NIPA 2DFKB 1ONBA 4IDHA 2BBOA 3QG1A 1JECA 1T9HA 2VSFA 2WMOB 5J40A 4LRWA 4DCUA 5KHOC 1CRQA 1NVVR 3WY9A 4C0SA 1DAMA 1XPUA 2IXGA 1KDTA 4RSGA 1YZTA 1G3IA 1WF3A 5EP4A 1QG2A 3CUEF 1N6PA 3TH5A 3WHKA 5HPYB 1S3GA 1A1VA 3FHTA 1GILA 1PZNA 1Z07A 1LB1B 5KO2A 1LW7A 4NU0A 4ZKEA 3BH6A 2BCJQ 1J99A 3H0KA 1OFUX 3OEHD 3QXHA 1U9IA 4GZLA 4HAVA 2Z5FA 5A5GA 2QY9A 2W58A 1SHZA 2OEPA 3I1FA 3AVUA 5DSZA 5IDVA 3K8YA 2HJVA 3UATA 2A5JA 4KYIB 3Q5EA 4NTZA 3THXB 3A36A 1UFQA 1U2RA 3U4QA 4ASUA 3KKPA 4I1OA 5CIQA 1TTTA 2KWIA 4NP6A 2QBYA 2XNSA 1BYIA 2NPIA 4B73A 2W0SA 4URZR 1OYWA 3BS4A 4TTRA 2Q3MA 4JKYA 4ILEA 2HF9A 5GJBA 4GP7A 2BV3A 2D62A 3PITA 3VHXA 3AUYA 4H1UA 1QHYA 1F2UB 2Z0MA 2ZJ2A 4MYHA 4DEYA 4E22A 4C0QC 4LPSA 4KFRA 1S0UA 1TQDA 3JZMA 4NYJQ 1XB2A 3AH8A 5KDDA 2A78A 2GF0A 4N0EA 4URYR 1E94E 4ZKDA 1RJ9A 1KTVA 1MRNA 2EWVA 4OHVA 4IOKA 3TK1A 3UK6A 3HU3A 5EE9A 1VECA 5BYJA 1JQLB 1XD2B 4F91B 3EXAA 3EWAA 5AK0A 3AKEA 3ADBA 1VPLA 2O8CA 3OIVA 2OCPA 1HYQA 4EPYA 3KQLA 3ZVNA 1D6JA 1Z63A 4LJ9A 3NG1A 2IC5A 2O8BA 2JAQA 4R2IA 2GCOA 3GLIE 1XCPA 4LYAA 3CX6A 4TYQA 5IK2D 1E2FA 1GKIA 1W0KD 4QHSA 2ZRGA 1WDTA 2CHGA 4OQFA 1TU3A 4MGZR 4BLOA 2V7QA 1BIFA 1ZC3A 2VA8A 5FPYA 5H68A 2QQEA 2ZROA 3B7GA 3Q7QA 4TSFD 2ODBA 3CRRA 3W3AA 4I1VA 5DI9A 1WP9A 5AJYA 1SVIA 1GDDA 2IUTA 3N5CA 2WZQA 1NSTA 1E0AA 4BFWA 2QMHA 3FKSA 3DKPA 3ZH9B 2NQ2C 2HF8A 1DO0A 2V8OA 4IXNA 5G53C 2JJ2A 5JZVA 3JVVA 4Q9LA 1FUKA 5J4LA 5E3HA 2WSSA 2ZITA 3CRW1 4EFMA 2YOHA 4BLSA 5FL7A 6Q21A 4M21A 2GJSA 4AC9A 3AKCA 2IYZA 2ZUBA 3CLVA 4YXWA 4N3NA 4LBYA 3VR4A 2ONKA 3CH5A 1S8FA 4JBYA 5TDHA 2IBMA 2DWPA 1DELA 4ZDIA 1X6VA 4WXPA 1NVUQ 3VTKA 1PUJA 4KSBA 2F7SA 4XD7A 3VNUA 2WWWA 2F1IA 4UXIA 2WJHA 1UBGA 4B3CA 1PLJA 3AUXA 4RD6A 2FX3A 1T8UA 5H70A 4CRWB 1OKKA 2I4IA 2OFOA 3HP1A 1ZNXA 3IQWA 4LJ8A 4PO9A 5JWRA 1VG1A 4II7A 1JR6A 2XZPA 1UKZA 3EZ9A 4QOSA 2AR7A 1G8FA 2XX3A 2IYVA 3KJHA 1E9AA 1HH4A 1AK2A 1XTJA 2QQ0A 1VCIA 1Z6AA 3N70A 5FUXA 2ZRHA 5EE5B 1AZTA 4DLXA 4PPGA 5DE3A 1TEXA 1Z06A 1ZD9A 1JNYA 4PZYA 4RY2A 3GMTA 2X2FA 3FKSD 3DOFA 3AVVA 1KK2A 3DM5A 2B7BA 3A4NA 3BGWA 5J4YA 1OXVA 4ZIRA 2WSSD 4B71A 1TX4B 5KNDA 1VYTA 1C9KA 3PUZA 1BMFD 4JLAA 3CZPA 4PHGA 1ZD1A 3OEEA 1G4AE 3CF0A 1Z6XA 2W6JD 4B35A 5DNYB 1R5NA 2QTFA 1RYFA 4UKDA 1G3QA 2EYQA 4IRUB 4LCBA 4QGAA 4XSHA 2CVFA 3R9IA 3NDBB 4DCTA 3VU9B 2P6NA 4PZLA 1ZNWA 2RHDA 2GBLA 4D4LA 1RYHA 2D74A 4NE2A 1W2GA 2C96A 3LFUA 4TQUS 4Q00A 5HZKA 2OUKA 2GHIA 1IHUA 1SXJB 2CLDX 3A1SA 3AM1A 2IYXA 4ITRC 2R9VA 3QVUA 4NL4H 3X1DA 2VPPA 3I3SR 4HI0E 3SC3A 4MRVA 2P6UA 1RRCA 2ZI9A 4DLSA 3U6KA 1AZSC 2VHQA 3RS0A 1KMQA 1DPFA 2OLJA 2ZPTX 2ZS8A 1L2TA 3KX2A 1S9DA 3EASA 4IXMA 5FTJA 4B33A 2H57A 1KO4A 1CJUC 2OILA 5GJWC 3SN6A 1M7GA 1Z0AA 2ODEA 2L0XA 3O8BA 4ARZA 1XMJA 4A92A 1KAGA 221PA 1W1WA 2F3TA 2CBZA 4W5WA 1TPZA 2RGAA 1QHHA 3AVOA 4HB0A 4TLCA 3CPJB 3ZIAA 3ZZ0A 5CB6A 1ZNYA 4IVRA 4YONB 2JLVA 4A6PA 3FWYA 3OEED 1U0JA 2AKYA 3B1YA 4B48A 1VMAA 4RZXA 2YNMA 1NN3A 4NCNA 3A4MA 2YWFA 3FKQA 4QBIA 2ZSBA 1YR8A 3ICQB 2BBSA 2O5VA 2VP5A 1RRFA 4CIDA 4QKQA 3CONA 4HAUA 3PIRA 2QNRA 5JRZA 1N3BA 4A8JC 1KGDA 1W5SA 3I5XA 3VX4A 3BD9A 5IRCD 3FE2A 2IA5A 4L4UA 3OFND 2B8WA 3WP0A 1GL9B 4CDGA 3THWA 3K9HA 2B8TA 3DOEA 3F3YA 4GDFA 4BRUA 1E2LA 4M1OA 2C9YA 2RGGA 3MG9A 4QGHA 2FFHA 1IBRA 4ESHA 1XMSA 4AI6A 4I4LA 1SKYE 1UDWA 1VIYA 3B5JA 3DMDA 3QIAA 4KLZA 4P4SA 4XIGS 1QHIA 2PT7A 3L0OA 5JSZA 2BOVA 3DO6A 2FA9A 1E1QA 3B9PA 4GMXA 4D25A 2AFIE 2ZI6A 1W0JA 3FOZA 3LBNA 3UMFA 1G41A 4RD2A 1WBDA 4NYIQ 1CJVC 4CEHA 1VG9B 2XEXA 3CX8A 2BBTA 2EW1A 1S1MA 4BEJA 4QL3A 1FPMA 1DG1G 2DBYA 5KNCA 1CS4C 1NN1A 5KPJA 3K0AA 4HZUB 3TSZA 4W9MC 3LW8A 1N2CE 2B6HA 1ZCBA 1KHTA 1Z28A 2BEKA 2GCPA 1RRPA 1ZCAA 5GADl 1IY0A 2V6IA 2OM2A 1E2PA 5E7IA 4PR0A 4U00A 4KI0A 2V9PA 3B1VA 3EA5A 2GXSA 2ZUDA 1R10A 1VDZA 3K09A 3W3ZB 2JJ1A 2PLFA 3CNLA 4QJ4A 2ANBA 1ZP6A 3FFBA 3K1JA 3VQTA 5JECA 4DB4A 1NG9A 2WVJA 1M6NA 1MO3A 3K09C 3W8RA 3W6OA 1X86B 5B57C 2FDCA 2WKQA 1C1YA 4HLUA 1EK0A 2A5FA 4OQXA 5LB2A 2W2VA 3T1QA 5FL7D 3ADKA 2QTHA 2R8RA 1XX6A 2DHRA 4M1KA 3BB1A 4EDHA 2OAQ1 2ZRAA 1FNMA 3GFPA 4FCWA 4YLGA 1E1QD 5IK2A 5JMTA 3QXXA 2QE7D 2IUUA 4LGMA 4WZAE 2NMVA 1Y63A 1WRBA 3U44B 2XGJA 3U3RA 1I2MA 1CXZA 3TLXA 2NO6A 3GJ3A 3WMEA 2WKPA 1GP2A 3HR7A 4Z8XA 1KDOA 4NYJR 1OF1A 2FSFA 3ZYCA 5BN5A 1G1MA 1KO8A 2CHVA 2H92A 2QENA 2ONJA 5KDOA 1FTNA 2O8FB 3IKJA 4WA7A 4JJKA 3MRSA 4U02A 4GZMA 1SULA 2R2AA 3K9LA 2CCJA 3AKYA 4FIDA 3V00A 1NJFA 1OXSC 2MSEB 2DYKA 4GMDA 2PT5A 2Z4SA 4MQBA 4YXWD 5F9HA 1QVRA 3KB2A 4R9UC 1FQKA 4G3XA 1XBTA 2E9SA 2D06A 4RKEA 1W44A 1OHHA 2H5EA 1U98A 2C03A 5FBWB 1D2EA 4M53A 4DSTA 3LY5A 3BIFA 1Z6YA 3GJXC 5DYIA 3OESA 1E9BA 3ECCA 4DHEA 2R6GA 2F1RA 2X19A 2D3WA 2WTUA 3KB1A 3UXMA 2XOKD 1G8PA 5LPNA 3B2EA 3SOPA 4X8OA 4DVGA 2ZAOA 1XEXA 4Y0VA 3KDSE 1K5DA 1E2NA 2PCJA 2ZRNA 5KNBA 1G5TA 4CZ2A 4OBEA 1M8PA 1N0VC 2G77B 2ZUCA 5LDDC 2AN9A 1G7TA 3VR2A 2CJWB 4JVMA 4D80A 4O0MA 621PA 1ESNA 1Z0DA 1ZUHA 3K0FA 3N2EA 5D3MA 4CEIA 2O8DB 3QKRB 1EWRA 3NHAA 3IBYA 3QENA 2QGNA 5FTKA 1NSFA 4JLOA 4XWAA 4PX9A 5L3SB 3PUWA 3TAUA 1TF7A 3X1YA 1TAGA 1W46A 1N25A 3GP8A 1E79D 4JLPA 3MD0A 2J9RA 3EPHA 4LJYA 2ZE8A 5JS7A 1N6KA 2H7VA 1MV5A 1GNRA 1DTSA 5DYGA 2CL7X 3RS4A 4AYWA 5HKKA 4E09A 3OIWA 1W4CA 3QBVA 5JHGB 1GRQA 1LY1A 1AQUA 1TQ2A 2IYRA 2BJWA 3GEHA 1V43A 2NZ8A 1WBBA 4B6FA 1EFUA 1P9WA 2QZ4A 1YQTA 4BFVA 4A8JA 2R6DA 1S3SA 1OLOA 4NCIA 4F4CA 4IKEA 3AEZA 3H2YA 4JIMA 4DDVA 1MKYA 3EX7C 4PC7A 2ZSFA 1SVLA 3SE0A 4FW9A 4XJXA 3ADDA 1II8B 4LBVA 3B78A 1E6CA 4HAWA 3C7KA 3QXSA 2FGKA 2OCYC 1KJWA 1LFDB 4US2R 4FMCF 3AQ4A 3EIQA 4IOJA 1K5GA 4LJAA 2PMDA 4OI4A 1VYVA 1FP7A 3IQXA 3CM0A 3CPHA 2ZETA 3K9GA 4QJ5A 5A4JA 3C8UA 3NTUA 2ZXUA 2UZIR 1HQYE 2VF8A 1II8A 2W00A 4Q1CA 2Q3FA 5FOXA 4B2IA 1CEEA 1KJZA 4PQRA 2B21A 2WWIA 3RSLA 5B58C 2WIBA 3WRXC 1QHGA 1COWD 4PQFA 4DLYA 4L8GA 3TGPA 2F1JA 1KI9A 1I2DA 3LDAA 3GLGE 1S96A 2O0KA 1YRAA 2KSQA 3PVSA 2CCKA 3VKWA 4KO8A 4X8HA 1KSJA 1ZMXA 2P3SA 1MRSA 2WAYA 2FPMA 2AK3A 4D81A 1R8SA 4TYPA 5FTNA 2HLDD
chains in the Genus database with same CATH superfamily
3BF8A 1CP2A 2FEPA 3AHIA 5K6AA 4GWKA 4MRSA 5DHAA 2G6BA 3PRJA 4UC0A 5I6DA 5LYJB 5EJFA 3VRHA 3PDJA 1RT9A 4OUKX 1P8JA 4G4JA 3KV3O 3VZRA 3W2EA 2HOQA 1J4AA 4BFYA 2XMPA 5CDTA 1O0CA 4OHBA 3B9BA 1SZPA 4RY9A 4M0DA 5J2UB 3AFGA 2WQZA 3EA4A 5F4ZA 1HE4A 5TQVA 4FWTA 4LF9B 2IY9A 1B14A 3CC8A 2JF0A 4GI1A 3T1VA 4C14A 1KMHA 2O1SA 2PWZA 3DL4A 4HPWA 3DFKA 4OAQA 3BJMA 3EULA 3G9UA 1F2TA 4K6HA 5JOQA 1YONA 1DKPA 1Y89A 4A15A 3T1NA 2Z2JA 3QF7A 4G07A 4AZ3A 3CLTD 1CUBA 2PVSA 3KQSA 4LS3A 3KLNA 4N3AA 2BKXA 2DAPA 2BGGA 4DCOA 1IY2A 4O2AF 1X9HA 1U63A 2ZKIA 1NI4A 4TV8A 3BKWA 5K99A 4ZXPA 3L5OA 3IVXA 3CBGA 2IYYA 5L3QB 2XMGA 3VV3A 2ZWAA 4QYIB 1SIUA 3MF4A 4BNIA 1VSUA 4MQ4A 2QP4A 1JG6A 2RBKA 3JYNA 4IICA 4ARAA 2B1IA 4C2TA 1ATZA 1N2XA 1TI7A 1NRWA 4MVCA 2D5LA 3BA1A 2GD2A 4JYBA 1PHPA 1M73E 1XVTA 3L7YA 3IH5A 2XRYA 3NFYA 2AMJA 3N3BC 2CDNA 3PXBA 1NHWA 1P74A 1TYDE 3TIXB 4YT8A 1JHPA 3DTVD 4MUKA 2QSUA 3R3YA 1XMPA 2AUTA 4HVAA 4QUHA 4D8UA 4F9GA 5A4AA 1BCSA 3U4HA 1TJ5A 1B00A 1SXJE 1NOJA 2I2BA 4KXLA 1WKCA 4P5DA 1KNQA 2NACA 2LXNA 2QUAA 4ZIRB 2NTJA 1MHPA 3UT0A 1HF3A 1P4GA 3S40A 2C7GA 2P9YA 4C2UA 1OYOA 4J76A 4LEIA 1NI4B 4I5GA 3FPHA 3LDGA 3LGAA 4JB3A 4MWOA 1SQFA 3GZNA 5B7GA 1NYTA 3OFKA 1B1AA 1DAGA 2FG5A 3CH4B 2QX9A 2VAMA 2P9FA 1DWPA 3HP4A 4JLBA 4NOLA 2ORVA 3WOHA 1MA3A 3C24A 3T9AA 6ADHA 2NV6A 4KFSA 2QYHA 1R6UA 5AOAA 7MHTA 3DHVA 3D8NA 3NOOA 1RZVA 1UJMA 2CVZA 5CW2A 3TCKA 1J39A 1L7BA 2AHRA 3GYBA 4ETNA 5IW8A 1PRYA 4F92B 1IYZA 1VDMA 1YU6A 2VF4X 2A1UA 5IKOA 3D4NA 3CV3A 7REQA 1R4NA 1W75A 1YZLA 5E1OA 2G63A 3GEBA 3GD5A 5EP3A 2JARA 3I8SA 2VK4A 1XWWA 5EY5B 1PJ4A 1J7KA 4TMYA 2M6LA 5CITA 1KYQA 3ED1A 1HO3A 2GPWA 5JNVA 4F4FA 2RGNA 3ISJA 3IMKA 4GPD1 2OKGA 3QPAA 1XRPA 5JJ5A 4PLWA 5IXYA 4XGIA 1B2LA 2M32A 2ZVDA 3WWPA 2X23A 5DTQA 1DJQA 3S44A 5BSHA 5LP6B 4WESA 5EJ5A 2FPIA 2PUVA 1JMYA 2QTLA 4D4KA 4IIYA 1QIIA 5FOWA 4BB9A 4RV9A 4YXFA 5G3YA 1ZONA 2YJZA 1O8BA 2QAGC 4OVKA 3G1WA 2GVZC 4FQ5A 3FZQA 4ZI3A 2NT4A 2R4TA 1NM5A 1QDEA 3THSA 1O0BA 3HY3A 5KVAA 1V3UA 2CNKA 3VR0A 1OGYA 1GU7A 2OLEA 3ZZ1A 4R0NA 4RK5A 1NBWB 2POCA 4GE3A 3TXYA 4RNDB 1CF4A 5LXTA 1JU4A 1NIJA 1QNLA 4PYMA 5EL0A 3HTXA 2VP4A 1AZWA 1JA9A 2HJ9A 3GK3A 4L6AA 1N2JA 2JGLA 3NYIA 4DQXA 4C21A 3AQIA 4DTIA 3OQIB 2JPDA 2OOKA 1Z9BA 2QTVB 3WGJA 2I7CA 1L7PA 4AJKA 1R74A 4RPKA 4JMPA 1PJQA 5K0TA 4M1SA 5B1YA 1KY5A 5JAPA 4V02A 2NO0A 3X1XA 1UWKA 4AYXA 1L7NA 4BGDA 4W7IA 3U7JA 1H8HD 2A5GA 2VNAA 2GEDA 4IILA 4V0MA 3SLRA 4OOFA 3WYDA 3HN7A 2CUKA 3B8HA 3LT5A 4TL8A 1JG1A 3UMVA 3NLLA 2B82A 4HDQB 5EQJB 2JA2A 2QRKA 5C34B 2Q1UA 2HCBA 3N7UA 4WZBA 1D6NA 1XNQB 3HMQA 2VH5R 1QK4A 1T6YA 6REQA 1M75A 1EFRA 1PJSA 2EERA 2KS6A 2YJGA 4O3FA 5MN4A 1UFVA 4RHUA 2YJ3A 3NB0A 2QZSA 3M34A 2WVHA 2VTKA 4MYDA 3GQBA 3CW2A 3HDHA 2ZUVA 1HXHA 4LGYA 1T5HX 4D42A 4F8JA 1B2RA 3WYFA 4ND1A 4MI6A 2P90A 3VHXB 3DL0A 4X60A 1MU0A 3FYHA 2UU9B 3AHHA 2W37A 2PGIA 3BWYA 4HNTA 1R9NA 2SECE 3VPXA 2COUA 5KYYB 1ULUA 3GWZA 2G1UA 4TSKA 1SD1A 1OI3A 4BRZA 4E15A 2D2EA 1JHZA 1IRIA 2E1PA 2RCNA 3TOXA 4XWKA 3TNDA 3DE2X 1CFZA 4LKRA 4TWJA 3ZDYB 3M81A 1XWIA 1ZZEA 1Z6PA 3GLFA 2R8EA 1K3UB 2VYFA 4G97A 1ODIA 2JFUA 2MTBA 3GFVA 4KIWA 1FP4B 2JGNA 3AJAA 1GADO 4Q02A 9GPBA 3O8LA 2GCIA 1U7XA 4TM8A 2PKRA 4ZO4A 3ED5A 1F60A 1UZUA 4GT1A 2V97A 4PZEA 5DMXA 3RFXA 1YJCA 1UJ4A 3I23A 2XCQA 3NBZC 4Q7KA 2BKUA 2C4UA 3I8OA 1DBWA 1J6UA 5C1PA 4JYAB 1SU6A 1I6WA 2XITA 2HUPA 5JWHA 1C0KA 1IQUA 1IOVA 3U37A 4YR9A 3D9QX 1OPRA 5KNDH 5HF6A 1OAOC 3NTQA 5CMLA 2P5UA 3FJYA 4OHRA 3RRJA 1MH9A 1VE9A 3GVHA 3KEGA 2AE1A 4X44A 1C30A 4NYMR 4UCWA 2P2GA 2IOFK 3P1JA 1UBUS 4EEXA 1PGOA 4UTNA 3ZDBA 1DJPA 1CDOA 1R4NB 2GVDC 2BGIA 1FUYB 5GVRA 1G6Q1 2ORWA 2D2FA 4RHTA 4XPIB 1EAMA 2AVDA 2ZVQX 3WGMA 4DTCA 4FR0A 1N5LA 3SR4A 2QG6A 4CEJA 4QVIA 3NOQA 1VJ5A 4DV4B 1I30A 1RU3A 5FOSA 4EG1A 4XQGA 4KQCA 3E2PA 5K4AA 2X5OA 1PFYA 3ND6A 4RXTA 4XX1A 3ASUA 4IGIA 2ZBPA 4ND3A 3K6RA 1L7QA 2BYTA 2WV7A 1YS4A 1KOFA 1ENOA 2GD1O 3HI6A 4I46A 3UFXB 4ERXA 1L8LA 4BBPA 3QUSA 1KE2A 1T9CA 1PKXA 2QYSA 2XUGA 2LW7A 3Q41A 4OQMA 4TL9A 3RUAA 2GKSA 2QX4A 3T6KA 3SZGA 5JI3E 5H7XA 1T0UA 1C9NA 1CR2A 2OXCA 3ILVA 2AOTB 3CLHA 1TVKB 4ASUD 3KUUA 2YINC 3OY2A 4HNAB 1PZEA 2HIAA 1WSWA 5M04A 3NGLA 1BCSB 3A9RA 5H81A 4V0NA 1QHEA 3BIJA 4G5RA 2Q0SA 3WNDA 3TFOA 3DPIA 4B3MB 4L08A 3DOJA 4ND4A 1H94A 4G36A 1E1RD 2D13A 4H7PA 5CDGA 1ILEA 3FVTA 3H5TA 4RJLA 3F4BA 4CTKA 2I87A 3WYCA 1U6IA 3FPAA 3T5DA 3RO7A 1R8JA 4P9NA 2WICA 4GVPA 4OHXA 3CXRA 4I1IA 4G1VA 5TMBA 1F17A 1ADYA 3WDLA 2VUSA 3ZDQA 3TMAA 2Z5LA 2LUOA 2QTGA 1CUYA 4EUFA 5L3QA 4OHUA 5IKXA 5FBLB 2EJWA 4Q7JB 4RS3A 5EMHA 3VGPA 5KUTA 1NVKA 1Q14A 3IO5A 3R7BA 1HE3A 2AFIA 2V7EA 5H8WA 2WJZB 3W4KA 4PHHA 1DKMA 2AYZA 4R2MA 5EJMA 5LLSA 4DBZA 2G9QA 4Y7CA 1IHPA 4ZOQI 4YAUA 1CY4A 2YQ4A 2A9QA 1SCDA 5HRUA 4GYJA 5DP2A 4HH3C 1U9JA 5AK5A 2RHOA 3W8DA 1PQWA 2QR3A 1PG0A 2VPIA 3MWEA 1JE1A 4WXRA 2D1YA 4NNPA 4EJFA 3L4KA 3ZI7A 2IUFA 4ZYVA 1HDCA 2C5HA 3C7AA 1EFPB 1EINA 4OFXA 4W5HA 1SVMA 1RHQA 2JGAA 5I7AA 3ZE0B 4KMOA 3A1NA 4O4JB 4O59O 2EIXA 1V16A 4P7JA 2HXSA 1DADA 2IVFA 2R97A 1LSUA 1LS1A 3OG9A 4GM1A 1N92A 3CTPA 4TUYA 1EXWA 3LJKA 4HSEA 3T7JA 3U7GA 5JD3A 5JNTA 1XEFA 1TLTA 2PUTA 1AS3A 4FDVA 4U1RA 4JI6B 4ETWA 1C0IA 3A6JA 3I1YA 1F2DA 3MRXA 3J81k 3KWMA 4DG5A 4P93A 1S2MA 1U0GA 3MMPA 2YVKA 1Z0JA 4INPA 1K9VF 2X5XA 3FSJX 4ON9A 2WINI 1OASA 2P67A 2LPMA 4IKOA 2EWWA 1SBNE 4CL8A 1CE8B 3I1JA 4G5SA 4BNTA 4FZRA 2RHGB 2VTEA 4KFUA 3HO6A 4XVHA 3VU0A 1UJ6A 3JAWB 5L7YA 1GRNA 3Q9LA 2LCQA 4QXAA 4TV9F 2WFMA 4BNLA 4RKYA 4PSUA 2XV1A 1G8JA 1XJCA 2JHAA 2WABA 3DVSX 521PA 1T3HA 3B1KA 1N36B 2Q5IA 2FMIA 2G72A 1XJ0A 1XV5A 2XR1A 3PC2A 2VSYA 5ER6A 1WBJB 3WDSA 4AY4A 4F4JA 1GPYA 4QAJA 2WJGA 2R65A 1LV7A 3EQ9A 4WXMA 1FA9A 1OI7A 3L8HA 3U31A 4QOJA 5KWSA 2QBYB 1P45A 4ZOLA 4K9DA 4XLLA 3KKMA 3HU2A 4KLCA 4EI9A 2X3YA 3H7IA 4WMLA 3PCRB 4HO1X 5IBPA 3T0GA 1QYIA 2IYTA 3E1SA 1RRMA 4FYWA 3TTVA 4DQLA 1A9XA 2Y1FA 4MK4A 1DWOA 3LYAA 4JL8A 4MB6A 5JBQA 1V11B 2YVUA 1B8PA 3GBPA 4OB6A 4GL2A 2JKVA 1MQSA 4FHCA 2DFPA 1FRQA 4AJLA 1TKAA 3GXOA 1TQ4A 4YWJA 5BXYA 4YMLA 3WLFA 4RE5A 2LTAA 3WIEA 1STOA 3LHKA 2BHSA 2HR1A 1G17A 2AL7A 2JANA 3LW7A 5CJJA 4BFLA 5SY4A 3SZOA 1KJYA 1BAPA 2CB0A 3SHWA 3WQHA 1FLDA 1ZU5A 5C1BA 1UBLS 2CXSA 3BCHA 1QF6A 3U3DA 1JFRA 1MCZA 2V9CA 5KDLA 3CUSA 4RKQA 1LKZA 3CZ5A 2RC5A 5FUBA 1S2DA 4DLRA 3QPBA 1PR5A 5C51B 3AI7A 3RT9A 2V65A 4DIFA 1MJGM 2IXFA 5EUBA 1MORA 3GDOA 3L6RA 4G81A 1ODKA 4B3RB 1O6GA 1TYBE 4WJZA 3V8MA 4I4NA 1WW2A 2V1UA 3UAWA 2GAJA 2OK8A 2ZB4A 3F4LA 3IX7A 3UJHA 2DHEA 2IZOA 4LWPA 1XVUA 1ZL0A 3KQPA 2ZPAA 4C5AA 1JHQA 3DLBA 4RUKA 2P0YA 3ETCA 4PAWA 4MV3A 3OPYA 1B4DA 4LRQA 4C4TA 5BQ3A 3G0HA 1XZIA 3SC2B 3QKRA 1A2OA 2TRSB 3TLJA 1XNHA 3RS8A 1G16A 4OHCA 1QRRA 3SBOA 4NDZA 4MPTA 2FKAA 2NYUA 4RXUA 2EATA 3PQFA 1UFOA 2X40A 1A98A 2J59A 2ZLBA 3KOWA 4V0QA 5AHXA 4KQIA 5TX7A 2XEDA 2P3OA 3AYZB 3PXDA 4A0QA 4XX0A 1H2AS 4W1QA 1XEXB 2JATA 3JQ7A 3RKSA 3SG0A 5ENZA 4L4RA 3MTJA 4HX5A 1BX1A 2NT3A 2V7WA 2BISA 13PKA 3KCQA 1VKNA 3QKSA 4HXYA 1YR3A 4P7GA 1KQNA 4AJ2A 4AWAA 2FV8A 1JHMA 3FCAA 4JVLA 3S8YA 4MV1A 5JASA 4LE2A 3SHFA 2WEKA 3BGDA 3AWDA 4DLUA 3U80A 1SCNE 3N2IA 4KNVA 3G88A 2QD4A 3H1EA 1ZI6A 3ZU4A 1KPGA 1OZAA 4ZAWA 3UAYA 1VMDA 3X43A 2ZIVB 4PXYA 1H1DA 1R4AA 1HNXB 2PGAA 4IIHA 4U4AA 3HY4A 4AMZA 2X22A 1CHDA 3NM5A 3QBJA 3I9V6 2WTEA 4HPJB 4KYUA 4LOIA 5AJZA 3MIIA 4YJ2A 6PFKA 5ALEA 3E53A 2B36A 1LBHA 2YN4A 2C54A 3GRYA 5AOCA 4I1UA 2A7QA 5GOTA 4DR5B 4IIDA 3RYCB 4NCHA 2ZOSA 3H5RA 2PXXA 4II2A 3S68A 2QTZA 2QE6A 1K89A 2DG2A 3E5NA 4FQ7A 1RI2A 4EW6A 4I50B 4B3BA 2VH2A 3IPYA 4GRDA 5TLSA 3QWBA 1XQ6A 3ZU2A 5H4GA 3DKVA 2BGTA 5JC8A 4MUBA 1U0BB 1HDZA 5DYWA 3DWEX 1CERA 1DDIA 1ZM9A 2Q21A 4ZAVA 1XCBA 4I4IA 5BORA 2R4QA 1DPGA 3W90A 2V59A 3CWCA 1G8MA 3OZTA 4MXDA 2EFEB 1ZH8A 3KYDA 3WK8A 5JAHA 3I04M 2C8VA 3OP4A 2ZTSA 4GUDA 4W1RA 3LQKA 5AW7A 3QHQA 1JFFA 4XM2A 4ANFA 4EMBA 3BMQA 3H1BA 4WE3A 3FMGA 1U4OA 3H16A 1W0JD 1R1DA 1S4MA 2GTPA 1J8QA 2R79A 3C43A 4UARA 1SG6A 3T1TA 4D79A 1RC8A 2O2HA 4D9CA 3VR3A 1UAAA 3C5VA 5DVZA 3U3JA 1NXSA 2E0IA 2QP3A 4M46A 1BS1A 1D7OA 1DAFA 4MUAA 1QAQA 3ZCVA 4AJPA 2AA3A 4I66A 4ZI7B 3W3AD 1IMOA 1KSHA 6GPBA 1NW6A 2XAUA 1JPJA 5A3VA 1KR2A 1H65A 2GH1A 1MQAA 1M76A 4WNAA 1ZXXA 4KC0A 4OU4A 4RHEA 5CR9A 5E9JA 1NN0A 2IH5A 1NXQA 2O3UA 1LK7A 2MU1A 2V55B 2QLMA 3GRVA 2HMSA 2R11A 4M8LA 1XQWA 3R9XA 3DOOA 1JH8A 3DAOA 2PZGA 2WU3A 4BX9A 4CCYA 5JXHA 1OILA 1Q2XA 1IUNA 1SO8A 4HGRA 4FFSA 5B37A 2XA2A 4B4UA 1ULBA 1XTQA 3FI9A 3RR2A 2UVPA 3OLCX 2Y1LA 5EKUA 1OB2A 1HYEA 4KLNA 4PC6A 1M2VA 4JR1A 2O14A 3RIXA 1JDUA 3ZCTA 1GITA 5B12A 5AW1A 3LD9A 4M1EA 1D0VA 2ZRDA 1GPJA 1UOPA 2NU7B 2QP9X 4DG8A 5M2QA 4XWWA 1KZYC 4BJ1A 4EHNA 5JSZB 3R6GA 1CZOA 4LYJA 4NE9A 1P2GA 3M6VA 4GXQA 4YP6A 5C1IA 5TPWB 1QIJA 2IW1A 4M4SA 4JODA 2GN2A 4OHMA 3TW8B 3O4IA 1TZ2A 1GZHB 1X1CA 3EGCA 3IUYA 1T1RA 4PYLA 5DYYA 3PQ2A 3VZSA 3DNPA 2IEZA 1JLKA 5AUNB 5K8CA 4NS4A 3HBLA 4NG5A 5EZYB 4I4TA 1EEXB 2CD9A 2X4LA 2O2GA 3DMHA 3NBMA 1IEXA 3LWNA 4H31A 5F98A 1IC6A 3NHKA 4PBRA 4UXJA 3L7CA 1TT5B 5CK5A 3S2FA 5GINE 1D09A 2X8JA 1BE8A 1V8BA 4R2HA 4CETA 4FHZA 3TG8A 3CNNA 1BHQ1 3UW1A 1KK1A 1XMIA 4AK9A 1ZAKA 2GHQA 1WTAA 2GYVA 4JT9A 4DQ0A 1RWMA 4BFUA 2O7VA 3U5ZB 2C2GA 4LRTB 4OP3A 1JQBA 1PSWA 1VRVA 2FZEA 2I0FA 2Y92A 3L02A 3M9LA 3UT6A 4C01A 5JQWA 3KHSA 2J8ZA 1Y1SA 1MA0A 3ON5A 1Y6GA 4LISA 3HJBA 3BJRA 2W6ZA 2NVBA 2XH8A 3EAQA 3NBXX 3G59A 1W581 5BOSB 1MHTA 2JGFA 1F7VA 3DLTA 4K9LA 4OHWA 1XTVA 1P6QA 2CBGA 1GARA 1XCJA 2J3EA 2RAFA 4OKNA 3WGTA 4KITB 1QLJA 1PWZA 1ZYUA 3RHFA 1YHNA 2BP7B 3IUJA 4GD3Q 4JP5A 5HM8A 2PFKA 3QWFA 4YA6A 4LF7B 1T5OA 1DV1A 3U17A 3NXKA 1E9FA 1KO5A 3AGQA 4WUTA 1CCWA 3KUKA 1D0IA 2NPOA 5GZ6A 4TZ0A 3PYLA 2R0QC 3C3JA 3EG5A 3GGCA 3L6CA 1BEZA 1L7AA 3AVYA 2Z83A 2OT3B 1WHSA 1UH5A 3PSHA 4Q16A 4QELA 3SQXA 4DL9A 1I1OA 1WXEA 4XSVA 4GZ6A 2R44A 3ANSA 1IM2A 1VBFA 3JZAA 1Q7GA 2IKSA 3I9KA 3TJMA 5D1NA 1Z0FA 3N8KA 3IQEA 5LB4A 3DDHA 2ZBFA 3NEJA 3QXGA 2FWRA 4ROSA 3AU9A 4DOMA 4K9KA 2XTNA 4UFPA 2XBMA 2WWRA 2YYZA 4FHFA 4PPNA 4TRNA 1JR3D 2C78A 2JIRA 4HRVA 1EK1A 1QFSA 2HNBA 3OQ1A 4B4WA 3FUCA 3QX3A 1FZTA 1V7PC 3GAMA 4KO1S 3GP5A 3VC3A 1XDUA 2WWHA 1W93A 5BNIA 3P2IA 3R8XA 4ZEMA 2BMVA 4P34A 2XOEA 1P80A 1UEJA 4MYRA 4DA0A 3LYLA 2WF6A 2HJHA 2R85A 3R1IA 4G1BA 1RC0A 4HBZA 5EZSA 4D82A 4FEGA 3GP3A 4XLZA 4WVLA 3ZX5A 5EXXA 4EJMA 5IJZA 4ME6A 2IHJA 3QMVA 1COWA 4CQMD 4KUHA 1N5DA 2Q46A 2PMEA 3ABRB 4BZQA 1O1YA 1CHNA 1EG2A 1UAGA 4URHA 4L1KA 4INAA 4FXOA 3ZBUA 3A10A 2IYNA 2YIDA 3KAQA 1SXJC 3VKFA 5D6OA 3SYRA 3UF0A 1GKUB 1T8PA 4MVJD 4KQXA 5CLLA 3FFXA 3KQOA 3UWKA 5DBOA 1ENPA 1QVWA 4V1CI 5HA5A 3BHJA 1FP1D 5M3BA 4DCPA 4K1XA 3A4YA 2NTYC 3OUUA 2BMAA 4OP2A 4XTCS 3R7WB 3V42A 3RFVA 4YYZA 3EY9A 3LK6A 3SDSA 3QVMA 3WGLA 4I4TF 4EUNA 3ICEA 2CLMB 2C2KA 4L3WA 5CLQA 4BTVA 4WOKA 1B3RA 5TQ2B 5EFZA 3S7TA 3G8AA 1N77A 5J2UF 2IOQA 5DF1A 1TVEA 3A1CA 1X7YA 4QM6A 4B0PA 4Y30A 3FUTA 3FCOA 3BB4A 4L9WA 5GM1A 1P7VA 1NZJA 3FFAA 3QJYA 1S9HA 3E9CA 1P5HA 3MQFA 1M2KA 5ALWA 1XALA 1E5TA 3D7KA 1BS9A 1TM3E 4AKTA 3R0XA 1JAYA 2Z30A 4QBGB 1W85B 2ZJ1A 5JW6A 5H5JA 1QKIA 2OWDA 1GQOA 4FJ0A 2G5CA 3T9BA 2C2ZA 4B85A 5HVNA 4ZQEA 4NAHA 1NMYA 5HE8A 2Q2OA 1I3CA 3D6AA 4QFMA 1JYFA 5H4HA 2R68A 5EJEA 1CV2A 1T2AA 2G09A 3A4VA 2Y77A 1U2PA 1TADA 1Q83A 2OCLA 2REQA 3UPDA 2CUNA 1A2KC 1DJOA 2G25A 3PXAA 3C4JA 3L8YA 5IDQA 5JY6A 3WZMA 2OBMA 2F55A 5KYUB 2Q6VA 2PFSA 2J3KA 3BMNB 1CR6A 2WM9B 3IVRA 2A2ZA 3QTTA 1P9RA 3L1JA 3UENA 2FWPA 4KPGA 4ZVPA 1SVNA 2QNBA 3VR5H 1ZUIA 1NHGA 4F1JA 3D4PA 4QDUA 4ZI7F 2UAGA 4KQMA 1SEVA 5ECYA 1MVOA 3WGQA 4G1MB 1TA0A 1M66A 4QNMA 2O1XA 1UQTA 2QMEA 3A28A 2ZULA 1YS9A 1UBJS 1MH1A 4PFQA 2IW3A 3DEJA 4X97A 2HAEA 3U0BA 2RKBA 1HYHA 4DMFA 3H2ZA 2I8AA 3ANYB 3LVQE 5HFAA 3KT0A 2IP2A 1U8TA 2Q9AA 3DTTA 4IJMA 3PNPA 1IN5A 5CHEA 3RJ9A 5I3CA 3H99A 4RVGA 3T95A 1OFUA 1PNQA 4A8JB 3TUZC 1ZWLA 1HTTA 4IVQA 3MCVA 4CM1A 2J7PA 1DOZA 5JJIA 4GMHA 4GWLA 3B3JA 2P6MA 5LDHA 4B4OA 1OAKA 3S2GA 2R6JA 2BR3A 3B48A 1M34E 1OLSB 4BN0A 3WADA 2BVNA 4X1OA 2JAHA 2W98A 3NV9A 3TUIC 3IRUA 4L8YA 2ZEJA 4YJFB 1CF2O 1PQUA 3NIBA 1E0KA 2EFDB 1RWOA 1PT8A 4B4VA 5CLIA 2UV8A 5MF6A 1W5TA 3HWSA 3K35A 4Q0MA 3W3AH 1F20A 1ODCA 2NU8A 4KAJA 3QWAA 4RJ2A 5J4KA 1IN6A 1N0WA 2EJBA 3C16C 1EH5A 4ISBA 3WWDA 1JEYB 4BRSA 1X0XA 5JT1A 3FTFA 3H8SA 4G1EB 5AM3A 4HDKB 5JD5A 3VNRA 4GLBA 3UXYA 2Z9DA 1SXJD 1II0A 2GA8A 2GEJA 2GBPA 1PS8A 3L0DA 1DT5A 4BV3A 3HFJA 5B3JC 5IHPA 1ISPA 1DBSA 1U94A 3IGFA 1ZGHA 4P4TA 3ZWNA 3U5TA 3TIFA 3CNHA 3ILXA 1MPTA 3RUFA 2YV2A 4J0GA 4PGAA 1CEYA 2JZNA 3Q5DA 4RFSA 2W2KA 3TTXA 1H2HA 2IXDA 5G4LA 2ENWA 3VDMA 3MMZA 3T5GA 4IMIB 1F5SA 3L6OO 3MJFA 5DNUA 1TEVA 1N2GA 2WRZA 1L8AA 3P94A 4Z0NA 4JV5B 1S7CA 4HH4A 4YHBA 1DFIA 1O89A 5HDBB 1Z6ZA 1PR0A 3FB4A 2E4WA 2PL1A 4GL4A 4XCQA 2QPOA 3I64A 2NW6A 4BLPA 4LY9A 1M1NB 4F93B 2DFVA 2PGNA 2QS9A 3R2JA 4V3CA 3GD7A 4Q3KA 4E03A 1NT2A 3OCVA 4IOLA 4JDUA 3RFFA 4B40A 3NUQA 4FYYA 4XIJA 1KF0A 1FUIA 1A8HA 2QEQA 3A6PC 1ZK0A 4GBED 4OI1A 3UAXA 3FPSA 4CQLB 3DDNA 3QI7A 1E6UA 2VHXA 2VRBA 3DE1X 3IUNA 1H42A 4JLKA 4OBXA 3ZLBA 4UU0A 3ZCQA 2DCUA 3RWMB 2QZJA 4RSRA 4E21A 4EPVA 3B3GA 5FQNA 3QEJA 1CY1A 1TM5E 2MYNA 3VMFA 1DMSA 2GPBA 4K87A 1Z6TA 3TI9A 5C18A 1ZUD1 5KQMA 1JDVA 1A96A 2VDRB 3WGZA 2KHZA 2OV6A 3WISA 4QJIA 4Q9HA 2C31A 3PUKA 4GGOA 1GUYA 1WPRA 3RBVA 3HN2A 3EHDA 3F6BX 1DQZA 1CLUA 3GFRA 4UHKA 3IELA 1GTMA 2E2WA 2ETVA 3COYA 4TQAA 3LHFA 1M6WA 4FSDA 5BN5B 3B89A 1U4SA 1TTHA 2X0KA 4FYHA 4MYSA 5L3RA 3WKAA 4D3YA 5BVHB 5EIAA 4J94A 4EG3A 4LF5B 3HJGA 1KZ1A 3F73A 3KYJB 4DEXA 4P4NA 3J81A 2OBXA 3HEMA 2PRIA 2TYSB 1H3EA 3U44A 2O8VA 1U9ZA 1YAHA 3TSYA 3UKDA 1KIFA 2LV8A 2ZTUA 1B0PA 2C4NA 2OK7A 3ORFA 3PFNA 4EZEA 4Y6GB 3R0QA 4KZPA 5BOVA 1KTIA 1UJ2A 1I8TA 2AXNA 3BK7A 3I32A 3JQAA 4CLRB 1FJXA 3A1UA 5DHQA 5F3WB 5H9VA 1I9GA 3L4BA 4TMKA 2ZB8A 2FW8A 4FDUA 2XTAA 4JQCA 5JS1A 1N7JA 2NO9A 3X2SA 3HNOA 3MA0A 1VE6A 1RXYA 2VOJA 4LY0A 1HTWA 2OGZA 2R62A 4PXAA 4EG8A 1QGAA 1RPAA 3O4JA 4LSMA 5G3ZA 3X2EA 1AQYA 2F67A 4AKEA 5CEJA 5MGNA 3K9NA 2IS1A 2BH2A 1TA9A 2W9XA 3VKUA 5A7HA 4F9TA 4I8XA 4FIZA 4E1BA 4ZOBA 5LSAA 4WKOA 4FTWA 3OQVA 2PSDA 4R84A 5EYPA 2BKEA 4MKFA 2OV4A 3DBRB 4YRRA 4O4HB 5A9TA 5CYGA 4LXHA 2PX3A 5C7OO 3ZGLA 1BA3A 1YV9A 4EVRA 2X9LA 4DDTA 1U7DA 1L3CA 2GXAA 3C3KA 1JMVA 2I76A 4WKPA 4Z9FA 1G9SA 3I3OA 4ZCQA 5F7ZA 3IEIA 5AUQA 4B44A 4BMXA 5IN5A 1IAQA 5DXAA 4NZ9A 4IQFA 4QWWA 3LC7O 3NZEA 1G5QA 1C3XA 1VPTA 1XMVA 2BGKA 3GLUA 4GX2A 3HCAA 1CYDA 2W42A 1BH2A 1TE2A 4BCBA 4LJ6A 5IKPA 1TF5A 3ZHVA 2Y05A 2ZBDA 4RF2A 2AZXA 4DRXA 3ZWMA 1TO2E 5JNRA 3A2KA 2HWWA 1TUIA 5K0LA 1DEHA 1Z29A 3NDPA 2OZEA 3UJPA 1GNTA 4CHTA 4CIAA 3LCVB 2H1SA 3HS3A 3HWX1 1D0SA 2L42A 3LUFA 4L5IA 4O25A 4U0JA 5TVKA 1RI3A 4M0MA 3ADCA 1EVEA 3E18A 1X38A 1MABA 3GGPA 4JY7A 2FZVA 3QFTA 4KH0A 4QDKA 2BLLA 5BYBA 3WO1A 5JI2E 4MWGA 1FMCA 1N6HA 4F04A 1WETA 2WG1A 4IH1A 4PYRA 3SZRA 2EU8A 1HEIA 4ODIA 4JT2A 2G7MC 2IYUA 2G80A 3DBOB 4CF4A 4TVBA 4I5FA 1TQ8A 1N0UA 3JASA 4AMYA 3KSAC 2GN4A 5CW1A 4FWIB 3MCWA 4E11A 1NPDA 4H0CA 4LYEA 1PYDA 1UPFA 2WVAA 2VP2A 2YMQA 3NONA 1DV2A 4DRXB 1KI8A 4DJFC 2Z3WA 4TXNA 5LYYA 5FA8A 1OT3A 1VBKA 3NALA 4UPVA 5HGJA 1QTQA 4HY3A 4ZQFA 2PX4A 2CBXA 2O1WA 2C94A 2YV5A 1SVKA 2ZP1A 3VAYA 1A7AA 3RAGA 1Q57A 2FLVA 2FPWA 5LDGA 2BHRA 4S1PA 4WJKB 4BXOA 1JHYA 4ZPXA 1R16A 3AFHA 4OHFA 5FBVB 5JAIA 4BV2A 1LTHR 4MWCA 2FUG1 3LO5A 4GMKA 3R20A 2FTKE 2PKQO 3IIEA 1KQFA 4JJ4A 3JVIA 1TCAA 5GP1A 3CSUA 5HUJA 4WT7A 1NVEA 3D6NB 1VSQA 2I6GA 1C14A 2N47A 2XE6A 5BN4A 5LQJA 5JANA 1Y82A 3W6PA 2AYYA 3C8DA 2OLKA 2OO5C 3GLVA 2C5SA 3LWBA 2QX7A 3LO8A 3VR5D 1DOAA 3EFEA 3P9YA 2WUEA 4YMSA 4F4UA 3IB3A 4M1ZA 1BJTA 3AUJB 3M6IA 1DQYA 1XQ1A 3P97A 1X7DA 4JBWA 5CM9C 4Y3UA 4X3PA 5BW4A 1OD6A 1NQAO 1AVTA 1RE0A 3F9CA 3UC9A 4MUJA 3KBOA 2AKAB 1UC4B 2NYVA 3FMPB 2C92A 3LDFA 4WADA 1OIVA 1I6MA 1A72A 2HQ1A 2QYTA 3O84A 2WP0A 1Y33E 5KNCD 3RUEA 1V41E 3EVAA 2E4YA 1BOFA 1KK0A 4Q4AB 4BQRA 2HW8A 1SH7A 4EPWA 5LBTA 3O5AA 3B70A 3BA6A 4HRXA 1SMKA 3LU1A 4LXQA 3CLTC 2P0EA 4EFDA 2G88A 4GF5A 1ZVKA 2Q1YA 3DDZX 4BP1A 4URUR 4J7XA 3ZJVA 4MICA 3DEHA 4KODA 1J49A 4EO4A 3EVGA 1J90A 1JIUA 2HQOA 4NNJA 1V35A 4RDIA 2RE8A 1DVRA 1IQ0A 1CU1A 1ZI8A 3IESA 3FROA 3KVOA 2CFRA 3ROMA 4N5IX 4HADA 2FPKA 2XT6A 4CLXA 2JRLA 1UKBA 1G59A 2B7LA 5JH7A 4DR6B 1SK9A 3C8MA 1NN5A 5ALFA 4OLFA 2HI0A 1PE0A 2ZUEA 2WW8A 1Q1EA 1UPBA 1WTCA 4PU0A 4YC7A 5DNAA 1CUVA 1NBOA 3KLBA 1RTTA 3CX4A 4ND2A 5BSWA 4DADA 4FMBB 1VSTA 4P54A 4B5KA 4EOGA 1XDBA 3GCGA 3GCZA 3I53A 4DYVA 3G1TA 2WUDA 2JASA 3QFFA 1N9KA 3AEYA 2X8WA 4GOMD 1ZGBA 4DNFA 3ZVMA 4KLAA 2H54A 4EG4A 2B4AA 4RANA 5JVDB 2V1XA 4D9FA 2WIAA 4RVCA 5BMVF 1GR0A 2P65A 4CN8A 2RBGA 2WZDA 2RH5A 1LJLA 1SA0A 1LNQA 2EEPA 1EFKA 4RWZA 5C8VA 3KKNA 1VLJA 4I1YA 1OQAA 3Q12A 4U2BA 2XDQA 4GOJA 5FA6A 5I48A 3ZI0A 3CIOA 1SHKA 4X6YA 2I67A 4V3BA 5EOVA 1ZK1A 1UM8A 2PD6A 2IKQA 4ITVA 1T29A 2F3SA 2J31A 5BT9A 4OL0A 3MGCA 4PX2A 1QBGA 3SPXA 1MR3F 2BLNA 3BOSA 1XTIA 4JBGA 1E79A 2HREA 4KIJA 1CLEA 3W78A 3I2FA 3ZZUA 4GGMX 2J6IA 4Q47A 2W93A 1FS5A 5E1BA 2A0XA 4X92A 2CGEA 2IJGX 1U0OC 1VCOA 4A16A 3JWGA 1SKQA 4CG0A 2JFXA 1V5GA 4NFLA 3NWPA 4Z1OA 4MW2A 2YV1A 1N6NA 3QVVA 1EWVA 1YK1A 1Z2AA 1SKYB 4GKKB 4C78A 3JWEA 2BDUA 3TOVA 3DZJA 2H7CA 3LF2A 2OAP1 2ZIGA 4EMSA 1E0SA 2H1RA 4RNCA 2IZ1A 2EX0A 5SZJA 2Q5EA 2Y6VA 3F74A 2JLZA 2WM8A 2HJSA 2EJVA 4B87A 2ATIA 3NKVA 5I9TA 2AX3A 1L6IA 4WLFA 4I9HA 2XI4A 3UWDA 1T8SA 1Z5UA 3NNDA 5D01A 3W5DA 4L0MA 4B80A 4NOMA 1PR9A 1ABFA 1UADA 3BERA 4K40A 1P29A 2Z43A 4NYMQ 3U9TA 3THRA 4HS9A 2PZ8A 4R1UA 4NY1A 1W36C 1BVHA 3LXUX 5AHKA 1NXXA 2IPAB 4HNQA 1D7AA 4CKBB 1JLHA 2DPXA 3T9FA 2RB5A 4BWYA 2PXCA 3EPLA 4XLTA 3NHMA 4D9GA 5KOJA 3DVAB 2XQVA 1XA4A 5E9WA 4D57A 4HUQB 3CZ4A 4FCTA 4B8YA 5LQMA 3F78A 1CQPA 1PEYA 5DIFA 5KYUA 2WBLC 3QYJA 3OCXA 3D3KA 3LH5A 3E1GA 1IM5A 3QHAA 1OW3B 5ERYA 1NV8A 1TCCA 3PUIA 4LSWA 1ID8A 1Q21A 4PVCA 1XZQA 3FRHA 1B8UA 4TQGA 4ZV4A 3T3PB 1VXOA 2Y0PA 2WP8J 2K6GA 3GAZA 1DAOA 1E7MA 4BQOA 3LTNC 2FSVA 1F0NA 2BELA 2IV3A 4C43A 2CXQA 3ZKWB