2QSZA

Human nicotinamide riboside kinase 1 in complex with nicotinamide mononucleotide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
188
Chain Sequence
b'VPRGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinamide riboside kinase 1
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 55
structure length 188
sequence length 193
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qszA00
3T5GA 1YJ5A 3BGWA 1XTIA 3G0HA 2G88A 4KXFB 2NPFA 5TB5A 4LHWA 3EPKA 5FL3A 3CPEA 2OSBA 1ZM3A 4HUQB 4AY2A 4IFEA 4Q4LA 4MRNA 3NH6A 2IT1A 4TYNA 1SVSA 3M0EA 1P5ZB 5FI0B 1G20E 2BDTA 3L82B 4HLUC 5C2JB 1TF5A 1CR4A 1TAGA 3IIMA 4TWZA 3RDPA 5FR1A 2FDCA 4QBIA 1YKSA 4EPTA 2HT1A 1OIWA 4M1WA 3U7GA 4NMMA 2B7BA 1II0A 2IBMA 3KL4A 4EJSA 2O8EB 1VTKA 1KJYA 1SXJB 2CXXA 4C30A 4U5XA 3HDTA 4D0NA 2GJSA 1GNRA 1KI6B 4LHYA 1XCMA 5JFGA 1M2OB 4YMVA 1HQCA 1ZP6A 2D7CA 4DIEA 4EFNA 2XSZA 3B5JA 4PHHA 2O8FB 3N2IA 3EAQA 2YKGA 2AD1A 1Z83A 4C2UA 1G3MA 1NG1A 2J7KA 5EZ6B 3TIFA 1NVUQ 3AF0A 2V1XA 2W2XA 4BECA 1UBEA 5J47A 1KSHA 1ZCAA 2G77B 2IC5A 4POAA 5FPKA 1JR3E 3WBJA 2BCJQ 1UDXA 2OXRA 1II9A 2R6FA 3ZDQA 4C2TA 2WOJA 1LS1A 3T12A 1XU4A 3VAAA 4YMWA 3AUYA 4MGZR 1KI3A 3QF4B 3IQWA 3WYAA 1Q0UA 4TYYA 2XZLA 1LNZA 1KGDA 4DZZA 2EWWA 1KK3A 1Z47A 4Q4JB 5GVRA 4IVPA 5JEDA 2W0SA 1KO1A 1IQPA 1W5SA 1E3MA 5JJLA 2AN9A 4PHGA 1X86B 4EPVA 5GVSA 4TMTA 4EQ6B 2AFHE 2J0QA 3GJ0A 4URWR 3RS0A 2JLQA 4B32A 3DOFA 5CDFE 3HR7A 1XZPA 2D2EA 3K70C 2FSFA 2G83A 3PXGA 2FZLA 1XEWX 2ZJBA 2ECKA 4LJ4A 3THYB 2A5JA 1UAAA 2FGKA 1WQ1R 4L9SA 2FSIA 1VG1A 2DYKA 2RGNA 2ZIAA 3LH5A 1C4OA 1A5TA 1OYWA 2VYFA 3BOSA 4IEEA 3REFA 5FUWA 1XXHA 1E2HA 2B92A 2IYYA 1KI1A 4URXR 5KUTA 3KKQA 1OT3A 3AGQA 4B75A 2VP4A 2C99A 2VQSA 2IUTA 1W7AA 4OK5A 4MYCA 5TMPA 1D6JA 1QDEA 2VSFA 1HURA 5K8UA 4AKHA 3P20A 1Z0JA 3AVWA 1AGPA 4X8OA 2HLDD 3LQQA 4MYTA 1V43A 3V00A 1P60A 4PX9A 3FKSD 3R20A 3RSLA 2GESA 3ICQB 5ANRB 4JZKA 2WSSD 1N0VC 5G3ZA 1ZM4A 1GVNB 2OBNA 3SNHA 3IIJA 5JCZA 1QHSA 1ZUNB 2BC9A 1Z0KA 3A6PC 1E9FA 3X1XA 1XF9A 2ZS7A 1BS1A 4IXNA 3O8CA 3GLGA 1G7RA 3MWLA 3PEWA 2JIZA 4MUBA 2W2TA 3K0FA 3UK6A 1CJKC 2EU8A 5HTKA 3W5IA 4Q4AB 3LDAA 1FQJA 4HB2A 4RY2A 4F4CA 4LC1A 2HF8A 4G3XA 3K0CA 5DH9A 4XJXA 2P5TB 1J8MF 1NVWQ 1XJCA 1TF7A 3LW7A 1N0WA 3B13B 3RS2A 1DTSA 4MKIA 1J70A 1F3OA 5L8VA 1NVVR 5G53C 4H1VA 1XTSA 4PZLA 5CK5A 5JI3E 1N6KA 4DXAA 3H84A 1PUJA 2KI5A 5FOXA 1K5GA 1XRJA 1IJEA 3FE2A 4V0KA 3RANA 4AD8A 1SKYB 1IONA 4C4PA 3U4QA 1I4LD 3FGNA 3G82C 1IHUA 3KUCA 2WIAA 4IDQA 4WZBE 5GJWC 3J81k 1W2HA 1XXHB 2BBWA 3TW4A 3B1YA 5KPJA 4K8OA 1TEXA 3QBVA 1HY3A 4YMUA 2J0UA 4JBWA 4S35A 1N6LA 2ZRNA 1I4DD 2IK8A 1E9BA 4W5JA 3N5CA 3AF1A 5KPDA 3WMFA 1JQJC 4ACBA 2EFGA 5E95A 1FX0A 5JHHB 1RPZA 4D80A 4F4JA 4PPGA 1XJ0A 3HJNA 3NC1C 1Z29A 3KKNA 2NMVA 4OQXA 2HJGA 1KMQA 3LFUA 4QL3A 5FTJA 3U44B 3PJRA 1VDZA 1A7JA 1NMZA 2R6AA 1GKYA 1LS6A 3QKUA 2ZYTX 1O3YA 4TLDA 2YYZA 2A5YB 4NHOA 4B6EA 4D0GA 2FV8A 2J1LA 2H57A 2QQ0A 4HSEA 4NL4H 1KMHA 5SZJA 1U8YA 2EFEB 2P2LA 2WKPA 2ONKA 4FMCF 2LCFA 1E96A 4M1OA 2UKDA 3WHLA 3FFAA 3GLGB 2REXB 1E1RD 4M1MA 3FMIA 1U0HC 2IW3A 3K0FB 1P2UA 2GAAA 2OV2A 3THXA 4DBLC 5J4HA 2NG1A 1KOFA 1NVXQ 4O25A 3SFVA 4DT1A 1OB5A 2ZU6A 1FNMA 4OKSA 4ARZA 3T1TA 2VHCA 2IYVA 2J0SA 4M0LA 5AJZA 4BEJA 2QSYA 2ODWA 1GNPA 2WPDD 3X1ZA 1M1YE 4QM6A 4MITA 1OH6A 3DVLA 2QMEA 3T61A 1GKIA 1GDDA 3KB1A 4RSGA 2ZE8A 2G9NA 3V4RA 2GCNA 2KBFA 2O52A 2ZJYA 1K6MA 1R0WA 1E79A 1QHXA 4HATA 4IDHA 4HAUA 5GJCA 2AX4A 2QA5A 1KSFX 4A2WA 1ZM2A 4O2RA 3HU1A 4D25A 1XXHE 1XBTA 1TUIA 3AVPA 4ESVA 1VHTA 4JBXA 4RZ2A 5B30A 2J0UB 2DB3A 2ZI4A 1E1QD 4CEIA 3K0SA 3R9WA 1E2EA 4PPFA 3EIQA 2IS1A 2GJKA 1NN0A 2QAJA 1I4TD 2HLDA 3LXXA 1LTQA 4ILEA 3CRVA 1FX0B 4WZ6A 1UEJA 2FNAA 2JDIA 1DADA 2EFCB 3CH4B 3FKSA 2GBLC 3MJHA 1Q44A 2I3BA 3A4MA 4I4LA 3ND9A 2XEXA 1ZINA 2WSSA 3K70D 1BOFA 4V0MA 2H18A 3BK7A 3GJ7A 5KU1A 4MDEA 3RWMB 2R6DA 1CR0A 1KO7A 2CJWB 2F3RA 4QFMA 4KSCA 5DHFA 4EJSC 1WE2A 4C0KA 3KKMA 2FFBA 4IRUB 1QVAA 1HE1C 4GOKA 4NCNA 3TSWA 2BIFA 3OHMA 1T3SA 1TTTA 1ZVQA 4KODA 4B35A 3QXXA 1RVDA 4C0BA 2GHIA 4BFTA 1KKMA 2VPPA 2WWXA 1Z0AA 2WAXA 3PQCA 1AM4D 3CB4A 3GLGE 4BLOA 3Q72A 4EIWA 1W44A 1BMFD 1TPZA 3IO5A 2BCGY 1TU4A 3P27A 2GJAA 2QQEA 4DT1B 3MCAA 4ARZB 3X1YA 1Z28A 1NY6A 4M1SA 2GCPA 3DHWC 3OIUA 4TN1A 3QG1A 1ZBDA 3U6KA 1MH1A 5EJEA 5HKKD 1SULA 1QG2A 3W90A 4DCNA 2XJ4A 2Y8EA 1G8FA 2FEMA 2IXFA 1WF3A 3L8YA 1J90A 3N70A 2ZETA 4PTLA 1OH8A 1RYFA 1SKQA 3BFVA 3VR5A 1R0XA 2RHMA 4C0LA 1II8B 2E87A 5EUMA 4YMSA 1CTQA 4Q02A 1FMLA 3LD9A 2QMUA 4A6XA 5KHOC 2GK6A 3DKPA 2VO1A 1ESNA 1ZUIA 3GEEA 4CEJB 2WWWA 3ZZUA 5CYPA 2WVJA 1T8UA 2YC2C 2QM8A 2XOKD 3BFXA 3BH7A 4JL6A 4URYR 1WBDA 3MMPA 3QEJA 2PH1A 4PO9A 1BH2A 2DFNA 4KBFA 1L2TA 4RD4A 4BGDA 3K9HA 5TY0A 1E2LA 4HLUA 4WOPA 421PA 1PLLA 2XTNA 1Q3HA 2QTVB 5FUYA 5BN3A 2PCLA 5HCIA 2C04A 1OF1A 4BFUA 1E4VA 5DLQC 3EARA 4Q7JB 1TADA 4JMPA 2X2EA 5G40A 3ZS8A 4B3BA 2X77A 3P4YA 2A5FA 3M6AA 4UNPA 4IW3B 4MYHA 3CZPA 1YZNA 4FCTA 4KFSA 2VEDA 1E2IA 1VG9B 3CW2A 2PJZA 1FOEB 3BIFA 4QC2A 1DELA 2QM7A 3MFYA 2WPDA 4LGMA 3U6BA 3IEUA 2QNRA 4Q7KA 3U3RA 3SEAA 2JASA 3T1OA 5AWFC 2GZHA 2P5SA 4DCUA 1JAIA 1M7GA 1E99A 1QF9A 5E7IA 3QIAA 1DG3A 1VKJA 1XD9A 2VL7A 2XZPA 2NZ8A 2ZU0C 4EPYA 3C7KA 2ZREA 4ZIRA 2CCKA 3NHBA 5AUOB 3K8YA 2QMOA 2XNDA 2UVQA 4Q9IA 3FOZA 5HZKA 1CP2A 4HAXA 3FMFA 4PHTA 3CM0A 2BEJA 3QSYA 3GJ3A 1YRBA 3GLFA 2VSOA 2JJ2D 3EX7C 4TYQA 1ZUHA 2OBLA 4LJ7A 4DDWA 2ZRJA 1OE0A 5DYGA 5GJBA 2Q3FA 5F9HA 1E1QA 4WW0A 1GP2A 4FMDB 1KAOA 2C95A 4C0QC 3UWKA 3AVYA 1W5TA 3IPYA 1JBKA 4S2EA 1G291 5C18A 3ADCA 1CRQA 4Q5IA 4QGFA 4RD6A 4LJ8A 4HZUA 3K53A 4IDPA 3H1TA 4LYAA 3ZYCA 1S3GA 1EFHA 1X3SA 2QMHA 4KSBA 2ZAOA 3KJGA 1OFHA 2KE5A 4LJAA 4JJKA 3GJXC 2P6NA 1VYUA 3MJRA 2O8DA 1NNEA 2GXUA 4Q18A 4GPTA 1GTVA 4V0ME 3FHCB 1XPRA 2DBYA 3F5FA 4L9WA 4TSFD 1TU3A 2JGNA 4NONA 3X1DA 4DLTA 2D3WA 4JVLA 1I2MA 4G5QA 5A5GA 2HDNB 2IS2A 2OLKA 1W2GA 5FH9A 2I4IA 1U9IA 4RD0A 1BMFA 2JEOA 3WMGA 1U2RA 2CVFA 1ZIOA 1IY1A 4UQOA 2O5VA 4V03A 2PZEA 3Q7QA 4WZAE 5J5CA 4TTRA 1A82A 5JRJA 3AVOA 3K9NA 4BFVA 3QPVA 3PIRA 5HKKA 3A4LA 3SBDA 1RRFA 2EVWX 3C15C 3KUDA 2PJRA 4ZKDA 1CF4A 1J8YF 4ZIRB 5JWOA 4R7ZA 3B1ZA 1VG8A 1AS3A 2QTFA 1S9HA 4PAQA 3WP0A 2QROA 4DLZA 3LX8A 2VH5R 5CK4A 3CNLA 1QVRA 2A9KA 1MO5A 1XTRA 3U3JA 1DAHA 3PUXA 2IYRA 4AG6A 3GLFB 2CHQA 2YINC 4KV9A 5H8WA 3L8ZA 5AK0A 4B74A 1KI8A 2LKCA 4EFMA 1ZCBA 2WWIA 1ANKA 4ZDKA 1PZNA 3NEJA 2ZANA 3AH8A 1P2SA 3AVXA 3VR4A 2QGZA 1W4BA 2GJ8A 4IOLA 1E9DA 4HYYA 3K9LA 1CULC 3I5YA 2XOKA 1KK2A 3AF4A 3A1WA 2IWHA 2XJ9A 1K5DA 2O8CA 2VHJA 1ZU4A 3BJIC 3X2SA 4BLSA 4CT5A 2W00A 1Z0DA 2OAP1 4HZUB 3SQXA 1DAIA 1KAGA 2H17A 5AUPB 1NF3A 3S1AA 4M1YA 1VMAA 1ZM7A 1R2QA 3OE7D 1T0JB 3I1FA 4D81A 1N6NA 1KI2A 1GG2A 2Z5FA 1H65A 3SC3A 2O8DB 2VF8A 3JZAA 4US0R 1YZKA 1QHGA 1TQDA 2Z4RA 4YC7A 1SQ5A 2GF0A 1ZYUA 1E94E 2R8RA 4QHSA 3R8CA 4NKRA 4ERNA 4C3ZA 5EXTA 1E0SA 5JEEA 4NDZA 4NYJR 3I92A 4JLJA 5E7JA 1NIJA 2AK3A 2F1JA 3D8BA 3WNBA 1UBCA 2ZRPA 4D26A 1GILA 2H5EA 3NKVA 1W4CA 3RS4A 2ZJ2A 3QKTA 3AVVA 1FNNA 1G6OA 2GZAA 2BV3A 4OQFA 1UFQA 4RD2A 4PZYA 1KNQA 1NMYA 5FUXA 3HP1A 4OK3A 4PPNA 4B3GA 4OHXA 2N42A 3KB2A 1N0UA 4LX0A 4V0OA 4HLDA 1F6BA 4F93B 2J0VA 2GEDA 1MV5A 5FOSA 3L43A 5E7MA 4US2R 2OLJA 2W58A 3CPJB 1YQTA 3DKVA 4YDHB 221PA 3GLFE 2GEVA 4DDUA 4PC2A 3A8TA 2WMOB 2ZPTX 1M8PA 3PUWA 3I4LA 4E07A 3AP3A 1XCPA 1OH7A 2OFOA 1N2CE 3RS3A 3LLUA 3DM5A 1CJVC 2A3RA 1VPLA 3NBXX 3B9QA 1VIAA 3AUXA 4UJ3A 5FR2A 4BRUA 2J9RA 1P75A 1Q22A 2O8CB 4TL8A 3QENA 3THWA 3QXHA 3CKLA 4JLAA 3U3KA 2ONJA 4FWTA 4HZIA 3S1AB 3O8RA 1N6OA 3U5ZB 2HYDA 4URUR 1HV8A 4TSFA 4XH9B 1RIFA 4RVCA 4MDFA 5AR1A 1WCV1 1XDBA 2GAOA 2IYXA 2JIZD 1RJ9A 3UMRA 1GZSA 4DEXA 5KO2A 2GK7A 4LY6A 1M74A 4AC9A 4ASUA 5J4VA 3DDCA 3CR8A 2PZFA 1W0JD 3AB3A 2KB0A 5FBVB 4L8GA 4AKGA 3Q5DA 1Q3TA 2ZRKA 2BJVA 1UF9A 1G8PA 4HDQB 1JAHA 1NIPA 2YJTD 5EP3A 1IY0A 1E6CA 2XTMA 4H1UA 5LDDC 4LBYA 1NY5A 4RCYA 2ZJ5A 4M9SA 2GBLA 2RGXA 4MKHA 4N1AA 2LKDA 3EWSA 4JT2A 1EK0A 3SQWA 1W4RA 4CZ2A 4A15A 1PUIA 3PR1A 4YMTA 4A4DA 4FMBB 4CDGA 2IYUA 2FWRA 3QE0A 1UKEA 2ZI7A 3OAAD 3QXSA 5EE1A 3WNDA 3AKDA 1GOTA 2GDJA 4QNRA 1KZ7B 1ETUA 1L4YA 3PEVA 1GL9B 4LJ9A 2WMNB 1G4UR 2HF9A 2XGJA 2IX3A 3LX5A 3PENA 1W49A 5CLLA 1XNJA 1AQYA 5GJVC 4CT4B 4DLYA 2RGAA 5IF9A 3P4XA 4KCGA 4BPBA 5F9FA 4O2LA 1JJVA 4ZCMA 2DWQA 3SYLA 3TSOA 5B58C 1Q1ZA 4Z51A 4IOJA 2ZVQX 1NVVQ 1XEXA 3GFPA 1G5PA 4QJ4A 1RRCA 1HQYE 4GI7A 2V6IA 4X8MA 2V9PA 2HT6A 3D6TB 1E2KA 1P61B 2GXSA 4JSYA 4PANA 3OE7A 3NBZC 1IN4A 3THWB 3KX2A 2OCPA 5KSYA 1EWQA 2HV8A 3B1XA 4TQ9A 4QNMA 3FMPB 4G5SA 1UKYA 3ZIAA 4HDCA 4RJLA 1OXXK 5SZIA 1NMXA 3TBKA 1RJ9B 4FMDF 2KSQA 3VR2A 1XTQA 1FP6A 2Z4SA 1LW7A 2QE7A 3R7WA 4W7SA 4BLQA 2JLXA 3ZD6A 4MUAA 4NU0A 3EC2A 4LHXA 4X8LA 3A36A 4KYUA 1E9SA 4BFYA 1FMJA 5JCPA 5DISB 2RAPA 3K9GA 5C4GB 3M1IA 4ZPXA 2IYZA 3CH5A 2PL3A 1P9RA 3D3QA 4TL6A 1XWIA 4B3DA 5FL7D 4EPRA 1C9KA 5AJVB 2QU8A 5H1YA 2HEIA 1UBGA 3BAFA 1Q20A 4L5BA 1NL3A 3B78A 2ZI9A 1E79D 4AYTA 1XMJA 2ZRDA 4ZCIA 5CITA 3T1VA 4LHZA 3B7GA 4BQSA 3ASYA 4KYIB 2SHKA 2F55A 3IBGA 4EJSB 3KFVA 2J5XA 5JJKA 3NEYA 2D62A 3RC8A 1U9IC 1OLOA 4UKDA 1R5NA 4WXRA 1YZTA 3L0PA 1KI7A 4KVAA 5FFMA 2NQ2C 2AXPA 3CRMA 2G1KA 3ZLJA 1KDTA 5G3YA 4FW9A 1MR3F 4M9QA 3HPRA 2QT1A 2JLVA 5KDDA 1MT0A 2QPTA 3CIOA 3UKDA 1VCIA 2DPXA 2W83A 5KSOA 3QPWA 3ZZ0A 3LRPA 5ELXA 3KFXA 1Z3IX 3TQFA 4BZQA 3CRQA 4M1TA 2IF0A 1TNDA 2JDID 3VR3A 3VKHA 4ZDJA 1R0YA 3NH9A 2X19A 4Q19A 2GXAA 2V7QA 4Q48A 2GCOA 2J46A 1G16A 2NPIA 3CRRA 4IOMA 3TE6A 2D4HA 1Q57A 5EP4A 3NHAA 4BLTA 4OQMA 1ZJ6A 4R9UC 2V8OA 2AFIE 1HT2E 4WXPA 1A1VA 5FBRB 1AS2A 1OPXA 1U94A 3BWDD 2C9YA 4QG7A 5DI3A 3KKPA 5J4YA 1M7HA 1VYTA 1E2MA 2WV9A 4J0QA 4RKFA 5EQTA 1GKUB 1DARA 1CJTC 1DG1G 1MKYA 2P0EA 1ZM9A 1NSFA 1W0JA 4AG5A 2ZSDA 1P7CA 1VCOA 4P32A 4JVSB 3VR1A 3R7WB 2BMJA 2ZS9A 2GVZC 3GD7A 1IM2A 1OFIA 1W48A 3EPLA 2GZDA 3PUVA 2YV5A 1Z22A 1Z0FA 2RGCA 1DS6A 5CM9C 4BZXA 3OIWA 3OF5A 1NKTA 5HR5A 5TARA 3WMEA 2VP6A 4KBGA 3SYKA 1D5CA 1WMSA 5CIQA 2WOOA 4PQFA 3QXJA 3FFBA 2FE4A 2QP9X 4MGYR 1P6XA 2C77A 3GEIA 4I1OA 4EKDA 4URVR 1DO2A 1U90A 5JSZA 1X8LA 1G9XA 2ZRAA 3OAAA 2YOHA 3T5DA 2VP5A 2EW1A 4Q1DA 3VTKA 4WA7A 2B6HA 3E2IA 1F48A 5KNDA 2QGNA 5C4MA 2HCJB 3VX4A 4HB3A 2CL0X 3UANA 2ZRBA 3SE0A 3VU9A 1DBSA 1OHHD 4GZMA 2BM0A 1G5TA 3B9PA 4NBSA 1A4RA 3QI2A 1W36C 4B48A 2ZI6A 3VFDA 1G6HA 3H2YA 1KDPA 1L8QA 4CGZA 1DO0A 3FHOA 1YZQA 4M22A 2FFAA 4Y0VA 2QZ4A 2GCOB 1XTKA 1TEVA 4C0HA 2OAQ1 3VHXA 1CBUA 2ANBA 4HAYA 4GP7A 1P9NA 5DGXA 3PUZA 4NCKA 1XTJA 1DE0A 3QF7A 5DSZA 5BN4A 2OG2A 4CF7A 3WY9A 1GFIA 2WIBA 2Z83A 3E70C 2F1RA 3BBPA 2W0MA 1SZPA 5DI3B 1F2UA 1YRAA 1R5OA 3EWAA 5FBQB 3THOA 5F2EA 2AL7A 3UG6A 3WRYC 3UATA 1AZSC 2R65A 4ACAA 1ZD1A 1Z6TA 5A4JA 2VHTA 3R9IA 4KU4A 2DR3A 3Q3JB 3TVDA 2JLYA 2JJ1D 3VMFA 4WIAA 1IXZA 1SXJC 3A58B 4PSVA 5KNCA 3RNLA 2OZEA 1K8RA 3VNUA 2CE7A 2VA8A 3NC0C 4QGAA 2DFLA 1Z6AA 5FL7A 1F5NA 3O8BA 4I1UA 3VNVA 2FH5B 4D4MA 5EZ5A 1ZNYA 1Z5ZA 2IEZA 3H86A 4BWYA 4DHEA 2ORWA 2XNDD 4N0DA 4AYWA 3U4QB 5SZHB 4G0NA 4A0HA 5JSZB 4CEHA 2D2FA 3LBNA 3TAUA 2A7QA 1VCNA 3UWOA 1E0KA 3FWYA 2C9CA 2KBEA 121PA 1VG0B 3BB3A 2BMEA 4KLNA 4A92A 4Y0AA 3U3MA 3ZJYA 1UBFA 2IHBA 2TMKA 4KFTA 4OHVA 5DIFA 1CEEA 1KTVA 1YE8A 4E03A 2AHOA 2C8VA 4Q4HA 4QRHA 2N46A 4WVFA 4DDTA 4I1SA 3VU9B 1G3UA 1YR7A 2CEAA 3D7MA 3QKRA 5LD2C 4GOXA 3GEHA 2FFQA 4B2PA 3ZQJA 2ZR9A 2P6UA 2ZRGA 2YNMA 5L3SA 4UNSA 4XTRA 3ZVMA 2IUUA 5FBWB 4LWZA 2RKOA 5E4FA 1XPUA 4LPSA 1CKEA 5M04A 2ZXUA 3MWJA 1N5IA 1RE0A 2FZ4A 2OESA 4HUTA 4URZR 1E9CA 5KSZA 1UDWA 2ZTSA 4LYHA 2JLWA 1KMHB 4GT1A 1E2PA 2WSMA 3TR0A 5C1BA 2J3EA 1AK2A 1JALA 3GJ8A 4DUGD 2UZIR 1BKDR 1Q1BA 3EA5A 1GRNA 1NLFA 3RWOA 3U7HB 3THXB 4OI2A 1TL7C 4FINA 2FFHA 1PLKA 1QG4A 2BBOA 3OIYA 4TMKA 5IK2D 1VHLA 4KLZA 3KQNA 4Z8YA 2ZYUX 3QJYA 1EXMA 3MWKA 2H1LA 4A8JC 1U0JA 2BKEA 2REBA 2R6CA 4U7DA 4TLAA 1WRBA 2NO0A 1RYHA 4DSOA 2CVHA 1GUAA 1E9EA 1TX4B 4JL8A 4OYHA 3TJZA 1JJ7A 4K46A 1X1RA 2J7PD 2XNSA 1UKVY 2XX3A 3ADBA 3ZH9B 3D31A 3CX8A 3L0SA 4RZ3A 4DLWA 3BXZA 2B8TA 5FTLA 1G7SA 4MKGA 2Z0MA 1ZNWA 1G1MA 1S1MA 4IKEA 3NBFA 1S96A 5DI9A 4TQAA 2F1IA 1A2BA 1FPMA 2ZI3A 4NCHA 1SGWA 4LJ6A 4DLVA 3QVVA 5EXSA 4KAXA 5CYOA 1P3JA 1G3IA 3VQTA 1JB1A 2VBCA 2AR7A 3WYFA 4CEIB 3KXIA 4DCSA 2HCBA 1OHHA 3EIEA 3GJ5A 3U3OA 1Q1EA 2VHQA 1HEIA 5FOTA 4O3MA 1T9HA 4Q4HB 1KSJA 1QHHA 2Z6VA 2IA5A 1GIAA 2F3TA 2CCGA 3C41J 4MKFA 1WDTA 4X8HA 3QKRB 2RGEA 1Z2AA 4XSHA 2ZI5A 3GP8A 3FMOB 2PLFA 1YHNA 4LK2A 4P4SA 1OXTA 4C0JA 2ZRCA 5D3QA 3K09C 3W8NA 4Z1MD 2NGRA 1QRAA 4UNNA 3LXRA 1U98A 5B64A 1BO6A 1TUEA 1ZIPA 2XAUA 1DVRA 2QPAA 2PX3A 4M4SA 1HTWA 5BWMA 2GTPA 4BRWA 4F92B 3LBIA 5JS8A 4R71A 3RAPR 3B82A 3QVUA 4Q00A 2B7CA 1V5WA 2EYUA 1AA9A 2O0JA 3HR8A 2JJ1A 3F0TA 3CF2A 1W36D 2CK3D 4NH0A 1XPOA 3AQ4A 5JMTA 5JRZA 1F60A 2CNWD 3BFKA 3A1VA 2PEZA 4TYWA 4MRRA 4TQUS 1AS0A 4B3FX 1NN5A 3TUIC 4JJZA 3QXCA 3K0EA 3T34A 3SI7A 4XIGS 3LBHA 1COWD 1QHYA 3CX7A 1N5LA 1NBMD 4LYJA 3BORA 3BRWD 2JCSA 2OO7A 3BB1A 3DPUA 5HCNA 2YHSA 4ZI2A 2WKQA 1DAKA 1JPNA 1YR9A 2HXYA 4HLQB 4NYJQ 4TMZA 3NIBA 5K8TA 2OFWA 3PITA 4F38A 1IJFA 2FG5A 3OESA 3RRZA 4GSYA 4AKIA 2ZM5A 2P65A 2Q3MA 3WHKA 3ZS9A 4EPWA 2XXAA 4Q7LA 3UIEA 4OJQA 2IHYA 2Z43A 4FD2A 4EUNA 5FPHA 3FYHA 4MRSA 1QHHB 3GPLA 1KIMA 4OQNA 1OYYA 1SXJD 1X8JA 4ESHA 4LCBA 4PO8A 3K0AA 4II7A 4TTPA 3GLIE 4Q1BA 2R44A 2AKYA 3QQ5A 4NP6A 2ZSBA 3NDPA 4V0LA 2ERXA 2J41A 2WKRA 2DWOA 4Q03A 3WRXC 1UADA 4G5OA 4Q1AA 3R8FA 3FTQA 3SZRA 4P31A 1MRNA 1S3SA 1IXRC 4ASUD 1XMVA 2W6ID 2ZE5A 4DUGA 2O0KA 4TL7A 4GRAA 2JLZA 3LQRA 1FQKA 1DAFA 4R98A 2RGGA 5CIWA 2VP0A 2C96A 3I3SR 5DN6D 4UXIA 1W0KD 2ZSEA 1QBKC 1W1WA 3DEFA 5DE3A 5IK2A 1OV4A 1BYIA 4Q1EA 3B85A 3TH5A 3ETLA 3LAWA 1H8HD 2YC4C 1Y3AA 4ZDWA 1SHZA 4M2LA 5HPYB 1EX6A 2O0HA 3TQCA 2J7PA 3HYRA 1YR6A 3PFIA 1S4QA 1B0UA 1T91A 1S2MA 3CONA 3KDSE 5JBQA 3ADDA 2FN4A 2PEYA 1NI3A 1J99A 4PQRA 4A9AA 1H8ED 2A78A 1LVGA 1PVOA 1I2DA 2QT0A 2BHRA 1UEIA 3SHWA 4KITB 5EE0A 4DB4A 1N5JA 3MD0A 4LV6A 2A5DA 5LB4A 1OXSC 5BYJA 1GITA 5EE9A 3CNNA 3ZGXA 5SZKB 3P26A 5K8LA 4NYIQ 2X8AA 3FVQA 1GL7A 4DLUA 5FI1B 3TRFA 4EFLA 1R10A 4KFUA 2XXAB 1P72A 2NIPA 4OJKA 3RS7A 1P4SA 1X6VA 1AIPA 2ODNA 3K70B 2RCNA 3KQHA 4OBEA 3IBYA 1FFHA 1T5LA 1XJQA 4C7OA 2BJWA 4QKQA 4B43A 1GL6A 4Z1MA 3MG9A 3EZ9A 3LVQE 3ZIAD 3CWZA 1LFDB 3PG5A 4MA4A 1MRSA 2UZ3A 1KZGB 3TAHA 3JVUA 2DFKB 1KK0A 1HUQA 4QJ3A 3KXLA 1JXOA 2QE7D 4A82A 3GLHA 5BXQC 2C98A 3AKCA 3JVVA 2IYSA 4AIIA 5J4KA 3SYNA 1SVKA 2AXNA 3ONWA 4LPKA 1ZU5A 2DCUA 4XOIA 2B8WA 3RYTC 4ZDIA 2LWIA 1O87A 2ZJZA 4QOSA 2CK3A 521PA 1QHNA 1VYVA 2E9SA 4NCJA 5L3QA 1UPTA 4P33A 2FPLA 2CNWA 2C78A 3LY5A 2V4ZA 1EG7A 2JAQA 3AM1A 5JI2E 2BM1A 2CLCX 4PFSA 1ZMXA 2ODEA 4YXWD 4MRPA 3T35A 1COWA 1LF0A 2WZQA 4HB4A 1IY2A 1G18A 1KYIA 1XD8A 3AKYA 1NBMA 3EPHA 1JEEA 1JNYA 3SOPA 2V55B 3HPQA 3SBEA 2ZRHA 2J45A 2OHFA 2DY1A 2WJYA 1D2MA 4MH0R 1US8A 5KDOA 3ZVNA 5B57C 1J2JA 5JJIA 1T4GA 2AWOA 2IEYA 4B33A 4EPXA 1EWRA 3NBYC 5KOYA 5BQ5A 3LW8A 2FJUA 2DWPA 3OFND 3TW8B 3IPXA 4KVGA 2RGDA 5KDLA 2WTUA 3ECCA 1M7BA 3TKLA 2V7QD 1SXJA 2AK2A 1RFLA 4F7WA 2ANCA 1AGRA 3MLEA 1E2JA 2NO6A 3Q9LA 3EZ6A 1KI6A 1LF5A 4Q1CA 2JA1A 1EFCA 2FOLA 3WNCA 1HT1E 3BD9A 3DMDA 2GETA 3TUZC 3SS8A 3U7EB 2IWRA 4HAWA 4NTZA 4IFBA 5C46F 3B2EA 2X2FA 1EFUA 4QJ5A 1R7RA 3KZ1E 1A2KC 5JZVA 4JKYA 3L0OA 3Q85A 2GNOA 5EE5B 4JVNA 2W6IA 3B1WA 1MO3A 4XD7A 5CB8A 4O0MA 5HE9A 1VECA 3GLHB 3PCRB 2J59A 5DN6A 3UXMA 3AF3A 1W0KA 3W6PA 5LB2A 5CB6A 2F7SA 3I8SA 1Y63A 3I72A 4NYIR 2ZRMA 4TZ6A 1RKBA 2GILA 4DRZA 4TL9A 2Q6TA 1H8HA 1L7VC 5DHAA 3C4JA 4UNQA 2ASEA 3N2EA 2MMGA 4XWAA 5L3QB 5CJ2A 3SR0A 2Q0HA 4NYMQ 1N6PA 2H16A 3OZXA 4DSNA 4PO1A 3Q5EA 1FTNA 4EQ6A 1P9WA 1H8EA 4GFDA 1NRJB 3TLXA 1OXVA 2CCJA 2F6RA 2C9OA 3LV8A 1OFUX 4JLKA 3THYA 1JXMA 1EESA 1SVOA 1T3HA 2ATXA 1G3QA 2EQBA 3C5HA 4JLPA 4M1KA 1WB9A 3V9PA 4B76A 1ONBA 2WJJA 4K81B 1US8B 1CR1A 3CF0A 1W4AA 2CHGA 2OM2A 2JLRA 1W47A 3GCGA 4D6PA 1DEKA 4A36A 2ZR7A 5BW8A 1C1YA 5HZHA 3FPAA 3B8HA 5F3WB 1CS4C 4A8JA 5KNBA 1R8QA 4YQFA 2B21A 1RZ3A 4HI0E 1ZC3A 1XCGB 2BKUA 4L4UA 1BIFA 4B6FA 3EC1A 4DB2A 4IJMA 1F2TA 2CDNA 4KI0A 4LJYA 4QHTA 1E0AA 3NWJA 4JSTA 4N3NA 5JLJA 2ZQ5A 3GQBA 4HDOB 1CLUA 4YDSA 2FX3A 4PXAA 1YZLA 4DEYA 1KI9A 4EDHA 1R6BX 1ZNZA 1CXZA 4M9ZA 4A0FA 2REOA 5JECA 4BFXA 4JLOA 3GMTA 4AURA 4Q9LA 2OILA 2ZUDA 4JKIA 4D2IA 1XMIA 3MGCA 5EXPA 4C9BA 3CWQA 3GLHE 3GFTA 4DDVA 4XWOA 2OXCA 2OE2A 4RKEA 1G8YA 2KWIA 3CPHA 8OHMA 3I32A 3IHLA 3EA0A 3W9YA 4B2IA 4ON9A 4M9XA 2QPOA 1ZNXA 5AJXA 4QM7A 5LPNA 1GRQA 1CIPA 4Q4AA 1JECA 1SHKA 5LD2B 5JHGB 1KO5A 5IDVA 1AN0A 2ATVA 4TLBA 4YXWA 2IS4A 3K09A 3O8DA 5UKDA 2YWEA 4C0SA 3W34A 2EWVA 3IUYA 1GSIA 2YOFA 4PAOA 1XP8A 1GRRA 2H8KA 1NBME 2BMFA 1KJWA 4PAMA 1XB2A 5CM8B 4EAQA 3P1JA 3TVTA 5H68A 1ZD8A 4AWXA 2GWHA 4TTQA 2BMDA 3EASA 5E3HA 1E98A 4Q21A 5JWRA 3SJAA 4BLPA 4N0EA 1CRPA 3OFNA 2W6JD 2W2VA 1IBRA 3SN6A 3PV0A 1XEXB 4M53A 3K1JA 3TSZA 2EYQA 3VKGA 1ZD9A 4LI0A 1T8TA 1DOAA 4LV8B 4XSGA 2P67A 4M21A 4Q01A 4A8JB 2GEUA 3B6EA 2D06A 3TR5A 1EFRD 4HEJA 1SXJE 2GKSA 3CNOA 4TYPA 4NYMR 4W5WA 4E09A 4QBHA 4IHQA 1G41A 1R8SA 2ZITA 4ZCLA 2BBSA 5FTKA 2IYTA 2HXSA 4LV5B 1F2TB 4A6PA 4YLGA 1MO4A 1P2TA 1UM8A 2F43A 4LHVA 1OKKA 1D2NA 3BH6A 1MABA 3U44A 2ZSAA 1Z07A 5JWHA 4LOAA 4DLRA 2G6BA 5EP1A 2D7DA 1RW4A 1Q1QA 3CBQA 2F9LA 3BH0A 2YWGA 1G7TA 4FWIB 2AKAB 3TMKA 2RMKA 4KHZA 2NO1A 4BASA 1P62B 3QUSA 2QAGC 4UJ5A 2NO9A 4JIMA 3W3ZB 4OHYA 5CJPA 4E22A 4QGHA 3FB4A 4DWJA 3QPUA 4MQBA 2FMXA 1SVLA 1Q21A 1WXQA 1ELOA 1G21E 1R4AA 5DNYB 2MMCA 1U8ZA 3W3AA 2IXEA 721PA 1JI0A 2V6JA 2ZRFA 1FTSA 3FHTA 1IOZA 3NXSA 1KY3A 5A0FA 4I99A 3RC3A 4JLVA 4XVQA 3ZD7A 3A4NA 4TT3D 4ABYA 4FXPA 2ZROA 2A2ZA 2RHDA 4LBVA 4FIDA 5FPTA 3MAAC 3RRYA 2I1QA 1N6RA 4HB0A 3QNUA 2VHUA 5FOWA 2QP3A 2WJGA 1OB2A 1IN6A 4PSAA 4XWKA 3ZVLA 1DPFA 3C5CA 4Q47A 2GVDC 2BBTA 3EZ2A 3OEED 4DLSA 1IN8A 1X8KA 4FI3C 2CL7X 1GWNA 4QHYA 2H92A 4Z8XA 4XTCS 1FW6A 2PZGA 1E2FA 3DZ8A 4KJZA 1G64A 1VIYA 4L15A 3AKEA 4A0RA 5EP2A 5CLQA 3EZ7A 3IQXA 3E1SA 1IAQA 3EW9A 2A30A 1KK1A 3F8TA 5G41A 1LV7A 4DCVA 3ADKA 3VHLB 2CLDX 2YWFA 4Q7MB 1R5BA 2EFHB 2L0XA 4CYMA 2F43B 1S9DA 4GL2A 3GJ6A 5TVKA 3UMSA 2YVUA 4QXAA 1CJUC 1MABB 1N25A 2QN6A 4ITRC 3E5HA 1MO6A 3BERA 2QL6A 4WBSA 2CJWA 1XZQA 2CMKA 2Q21A 1GAJA 2QSZA 3FDIA 3NTUA 4CW7A 1TQ4A 2IYLD 1ZRHA 1ODFA 3ASZA 2OCBA 1LB1B 4XVUA 2GJ9A 2Q3HA 3IILA 3AVUA 4JT4A 2WJIA 4QGGA 3VR6A 5AJYA 1E32A 2GA8A 2NZJA 5GADl 4LBWA 4LUCA 2ZE7A 5EE3A 3M4YA 1E2NA 5KYKA 3EPJA 4D4KA 5LBIA 1KDOA 4ZI3A 3MUFA 3TGPA 1U81A 1PV4A 2HJVA 4W5HA 2R2AA 3PUYA 4NPHA 2G0TA 3IO3A 4GBMA 4NZYA 5L3RA 2GF9A 2ZE6A 4IDOA 1FZQA 3P32A 4NCIA 3KXKA 4JBYA 3KJEA 1YVDA 4US1R 1VCMA 5IRCD 1CR2A 4G5RA 1IXSB 4HLCA 2QTHA 3LNCA 2P3SA 4LYFA 3MRSA 2DFTA 3B1VA 5JS7A 1DAMA 2KJQA 1DAGA 1IN7A 4HAVA 4RCZA 1NN1A 1SKYE 2W6JA 2XTZA 3EG5A 2A5GA 3OIVA 1II8A 3GLIA 2VTKA 4QBFA 1E69A 2FA9A 1Z63A 2XITA 3SDZA 4JLDA 3C14C 4A2PA 5FPSA 1NP6A 4CEJA 3EZFA 1G8GA 1EFRA 4R2IA 2WM9B 4PSKA 2ERYA 1PLJA 3ZQ6A 1AKEA 2FPMA 3T06B 3PEYA 3QEOA 1XEFA 4RFVA 2VP9A 4D0LB 5BYKA 1W46A 4LC0A 4DC9A 2QRZA 5FOUA 4B73A 2Q9AA 2JJ8A 2F9MA 5FTNA 4MRVA 1FUUA 1NLYA 2ORIA 1F2UB 4OI4A 3NG1A 3U61B 3IEVA 4Q1FA 4OL0A 2IYQA 4AI6A 3LA6A 2V54A 1HYQA 3U2QA 2PX0A 4A0GA 1KNXA 4JYBA 4YONB 4ZV4A 1XD2A 2OEPA 4JL5A 5J40A 2QY9A 2RGBA 2WWHA 4NE2A 4AYXA 4JS0A 5J4LA 1SVMA 2D74A 1N6IA 4DIDA 1G17A 1G4AE 5FUVA 4IDNA 2JLSA 3IIKA 3QG5A 2OBMA 3HYTA 4UNRA 2VSXA 4GNKA 1EX7A 3DL0A 4FCWA 2QI9C 4BZPA 4JLNA 2FEOA 1KI4A 4D4JA 2P6RA 4CEHB 1E4YA 4BFWA 4OHWA 1SVIA 2R62A 3CO5A 2FSHA 1PJRA 3C8UA 4WAUA 3NDBB 1ESMA 3RABA 3FKQA 4TT3A 3DZDA 3A37A 3DMNA 2WWYA 3QBTA 5DO9A 2XZOA 2R9VA 4B3XA 3H4MA 4KO8A 3R9XA 2CLSA 3AP1A 1G19A 2EFDB 3OEEA 4UXHA 3IGFA 1BYUA 4RD1A 4GOJA 3GLIB 1OIXA 4P0TA 2IYWA 4I81A 2ZYWX 4D82A 4DVGA 2YZ2A 5L3VA 1U0LA 4DJTA 1FL9A 1EFTA 3CX6A 5L3SB 1OH5A 3W6OA 2QBYA 3KJHA 4ZO4A 2F1HA 3KQUA 3UPUA 2QP4A 5AUQA 2VRWA 1HE8B 1XEWY 3IHWA 3WBKA 4B34A 4AKEA 2AWNA 4P4TA 1JR3D 3JZMA 1ZC4A 1KHTA 4H9GA 4I1VA 4BFZA 1Z6GA 5TDHA 3OEHD 4PR0A 2J87A 2NTYC 2X1VA 2BOVA 3CUEF 4CRWB 4MYUA 4G01B 2RGNC 2OT3B 5BN5A 2OCYC 3QKSA 1P73A 4A1FA 1E0JA 3LLMA 1RRGA 3ND8A 3KTAA 3MSXA 3VKWA 1Q12A 2OUKA 2QEQA 4IEIA 4XVRA 1DAEA 5EUQB 2BWJA 1XD2B 2AD5A 1E1RA 3Q7PA 3KQKA 2WWFA 4Q9JA 1ZW6A 3W5JA 3MWYW 1JQLB 1XFAA 3KKOA 2FSGA 3T1QA 3L2OB 4U02A 4B3CA 4B71A 3B60A 1X1SA 2E1RA 2ZUBA 3A1SA 2XB4A 3SJCA 3KQLA 4JLBA 1D9XA 4JVMA 5FPYA 1Z06A 2RH5A 4IXMA 1E2DA 1N3BA 2OFXA 4ZKEA 2WJVA 2ZYVX 4BE7B 4TMXA 2V1UA 3RLFA 1UKZA 3HU2A 4BFSA 3W6NA 2WICA 2HYIC 4F4IA 1OXUA 2CL6X 4DLXA 3DO6A 821PA 3GJ4A 2QRNA 1Z6YA 6Q21A 2PLRA 2G1JA 1YU9A 2G3YA 3DM9B 5D3MA 3O47A 3K0CC 2WAYA 3AF2A 4RFSA 4P4SB 3RSOA 3L0IB 2VLIA 4P3YA 3UG7A 3W8RA 4RZXA 1U8AA 4V02A 2QBYB 3SJZA 1OIVA 3LO5A 3I8XA 2YWHA 1R0ZA 4XD7D 1NJGA 3TK1A 5TV2A 3BS4A 4FN5A 1N5KA 5KTYA 1L4UA 4Q66C 3U60B 4OQLA 3SHFA 1UJ2A 3HU3A 1GM5A 1P2VA 1E2QA 1U99A 2BVNA 5AJWA 1NN3A 1TMKA 2IXGA 2C5LA 5AUNB 2CBZA 1FUKA 2HUPA 5FBLB 2ZJAA 2ZVPX 3V4FA 1NJFA 3EXAA 3QKSB 3WXMA 4AK9A 2CE2X 2ZRIA 4GP6A 3I62A 1AZTA 3KTAB 1FP7A 4RD3A 3BB4A 2CHVA 2N1BA 5F98A 2BEKA 1WP9A 3SFZA 3X1WA 1YZUA 5EXXA 1T6NA 4LBZA 4LRWA 4MGKR 3U7FB 3ZZTA 3WP1B 2FU5C 2ODBA 1KY2A 3BC1A 3SU8A 4RZUA 4DSTA 4F91B 5B2ZA 2C2HA 2VIIA 2YOGA 4IVQA 3CF6R 2ZJ8A 3WYGA 1D9ZA 3AEZA 2IS6A 3BE4A 4TLEA 4TMWA 5KSPA 3AVQA 2FF7A 1D8TA 2ZSFA 1E9RA 4Q9KA 2PMKA 1JEDA 4GMXA 4G1UC 2I1VB 2PBRA 1KO8A 2QUZA 1IN5A 4M8NE 2WJHA 2PMDA 3C16C 5DYIA 3RHFA 5K8IA 4DSUA 1YZGA 1E9AA 1TF2A 4IOKA 2WBLC 3I73A 1NLZA 2H7VA 3HWSA 5IHPA 4OK6A 2QAGA 4GDFA 2MSDB 4E5UA 1QHIA 4W9MC 1CU1A 1J7KA 3GFOA 1AJEA 3K0AB 4U00A 4P4UA 2R6GA 2G0NA 1OW3B 4PHFA 5D3MB 2ZJOA 5FOVA 1JPJA 2WHXA 1EGAA 2XSZD 4RFSB 3QOFA 3RRNA 1TQ6A 2GXQA 2ZEJA 3F3YA 4GZLA 3LVRE 1AQUA 2MSCB 1JR3A 2O8BA 2GRJA 1G3RA 3OEHA 4Q9HA 4UXJA 3PEUA 2IL1A 3AV0B 4MGIR 4B2LA 4G5GA 3ICEA 3AVTA 2PT7A 1S0UA 3AGPA 5TXGA 4L16A 3VX3A 4HAZA 1Z8FA 2K5UA 1KJZA 1S1CA 1Z08A 3KJIA 4OHZA 1OJLA 3PVSA 4R2HA 1S8FA 1Z0IA 3ZVRA 4IVRA 5FTMA 1AKYA 1RRPA 3EIHA 5P21A 2ZR0A 1G5RA 1GNQA 4DCTA 3Q8XB 2Q9BA 4LJ5A 1QZXA 4A2QA 1WA5A 1G7CA 4V0NA 4CVNA 2JLUA 5H70A 5CDFA 1M6NA 4HUQA 4PQYA 1M34E 3IKJA 3TNFA 2QG6A 2PCJA 4QBGB 1Z2CA 3CR7A 2XB2A 2DHRA 2QORA 1T5IA 3CLVA 4KFRA 3RRMA 4PC7A 4OI1A 3T15A 2ORVA 1OFTA 2WWGA 4DKXA 621PA 1JR6A 1LY1A 2ZUCA 3H0KA 1NG9A 4TLCA 2ZAMA 4B47A 1E2GA 2RB4A 4LSGA 4BEBA 2MSEB 2O8EA 1T3LA 1NKSA 4Z54A 1MOZA 1T0HB 2JJ2A 4OI0A 1YR8A 3AP2A 3LWNA 3CRW1 4FMCB 2QAGB 1XX6A 1NSTA 2QENA 2ZRLA 3G5UA 3IDQA 3UMFA 1B23P 4CIDA 4C7OB 4BLRA 1HA3A 1SVWA 2Q9CA 1KKLA 2O8FA 1D2EA 4JYCA 4TMVA 2NOAA 1CJMA 1TQ2A 2IUSA 4PZZA 3TUJC 3RVBA 2IF2A 1OKKD 4BUJA 3A1UA 1KSGA 3RS5A 2JATA 4C0AC 2O8BB 2ZS8A 3QY0A 4FCVA 4PC1A 4PPQA 3REGA 3I61A 1XMSA 1N6HA 2NO7A 1KDRA 1HH4A 4PC6A 4B44A 3SJBA 2FGJA 1WBBA 3CZQA 3NVAA 5IT5A 3QF4A 3DOEA 4LDJA 2V3CC 3A1TA 4JLMA 1OSNA 2PT5A 4TZ0A 1Z6XA 1W36B 1ZAKA 4Q4JA 2C03A 4GMDA 4D4LA 3I5XA 1RC8A 4PC3A 4LZZA 2VP2A 2VF7A 2OCAA 5HE8A 1G8HA 1KO4A 2FPKA
chains in the Genus database with same CATH superfamily
1SOMA 2D5LA 3T3HA 1AT1A 1YJ5A 3T5GA 3S1SA 4JK3A 3ZVKA 3EF0A 4TRNA 5F7XA 3RQIA 1JSLA 1VBFA 1J23A 3M2PA 1SZJG 2TSYB 5MDHA 3CPEA 2OSBA 4E0BA 5HM6A 2VG8A 2IEBA 3CRZA 4JDPA 3RRXA 1CJCA 1IBCA 2IT1A 1V5FA 2NVUA 4IDDA 3T7AA 4TYNA 1X7GA 4RF5A 1BCSA 1E6LA 1SVSA 1TT5B 3ABZA 3M0EA 4KXUA 4M7PA 5MHTA 2GSDA 3PU6A 5C2JB 1P8JA 2QGFA 2CLFB 3ZDEA 1BD3A 2JRCA 4R9VA 4WZBA 5BVHA 4LNAA 4KDEA 5FR1A 1RLOA 4ZD6A 1LZKA 3D7RA 1UBUS 1W94A 1H85A 1QIHA 2WTMA 4D1YA 2VSYA 5ENDA 4E30A 2YVLA 4F72A 4D57A 1PBNA 1IPEA 3BXFA 3O4RA 2JGKA 2HK8A 3IAXA 3O9ZA 1P5FA 5A62A 4QVIA 2PUAA 4YRAA 3BDAA 1G8SA 3D2AA 3ZEIA 1JFRA 2CXXA 2X0KA 1VBMA 3AUJB 3R8XA 5KVCA 2C31A 3GEPA 1YO6A 4U5XA 2GJSA 2D0OB 1KI6B 4DUPA 4F8EA 3RR2A 5JFGA 1HQCA 1SWWA 3ZTWA 4EFNA 5IYZB 1DJMA 4EGAA 1PE0A 3B5JA 2CF5A 3Q1LA 3RIYA 2PRJA 3WYNA 3MPUA 1H94A 4PHHA 1L5NA 3OPVA 5M2QA 3DL7A 2IV7A 1E3WA 1NG1A 2J7KA 2V74B 3CF4A 1NBEA 4UDNA 3MCTA 1EFDN 1NVUQ 3TIFA 3V8QA 4NOKA 3JD3A 2W2XA 4O02B 5KIAA 2ZT8A 1I3LA 3TNDA 1ZCAA 2ZTVA 3OOHA 5FPKA 2BCJQ 3QFHA 5LSAA 2DECA 2OXRA 2WUVA 3P9ZA 4NBKA 3ZDQA 2LPMA 3GYGA 1LS1A 1PJ3A 4RTMA 4HXFB 1EZ1A 1S2NA 2FEAA 2RAFA 4LVUA 1ZMBA 3T12A 2CB0A 4E1VA 2JGDB 4UBMA 4L1KA 4XJTA 2IU0A 1W96A 2REQB 3VPGA 2JK0A 3M1LA 2ZBPA 1Q0UA 1G21B 1LNZA 2YVAA 1L4EA 1KGDA 4MJ7A 5CFRA 1SURA 1YXMA 1JDTA 3SDSA 1JDBB 2J3MA 4Q4JB 4TXNA 4Q05A 2YBEA 4QOHA 1ECJA 4BS9A 4DNFA 5JXHA 1H0RA 1GLVA 4YREA 5JOQA 2FZKA 3C6BA 3RUAA 4EPVA 1I13A 3G9UA 4EO7A 5EZYA 1G8JA 1V6CA 2X7XA 5J2TA 4URWR 3EHDA 5JLAA 3G7NA 1GGEA 4ZALA 2AUMA 3PXGA 1KBQA 1XO1A 2X23A 4DQ0A 2ZJBA 4LJ4A 2CJXA 5FWNA 3KSBC 3THYB 1UAAA 1ECLA 1SCKA 1X94A 3DHNA 4ZTBA 5EIAA 4UPEA 3H42B 1SIUA 1SRQA 4D46A 2BLLA 2NYRA 3WGNA 1R4ZA 5IZ4A 2PS3A 1WQ4A 1E2HA 3A04A 1CRLA 2TMYA 3A3KA 3OG9A 3HRKA 3ISJA 4H60A 4LYGA 4RJTA 1K6IA 4S0XA 4URXR 1V8OA 2FOXA 3PVZA 4U7FA 4B75A 3UPTA 1PFYA 4DLLA 3LGSA 3UJ3X 3ZBUA 3EXIA 4DEVA 5E1DA 2IUTA 1N2OA 1A9QA 3LHSA 4CMGA 3TFOA 2UYHA 1ARZA 1T2VA 1U9JA 3DCYA 2JEYA 4ZCRA 1KH2A 1HURA 4DGSA 1DCMA 5LOVB 1ES9A 2RK4A 4YAJA 1M3SA 2IXTA 1I10A 3B5IA 3W4IA 3MTIA 1Q3KA 1WW8A 3MTJA 4HWGA 2J8ZA 1P1KA 2HBYA 4G6ZA 5K7SA 2WYHA 4EJ0A 1GU1A 2PBZA 4X60A 2BH9A 5F1OA 3FJYA 4EY7A 4P7GA 3FKSD 4YJFA 1Y4AE 2ACKA 3ICQB 2IJGX 2G9QA 3PFNA 1EFVA 2WSSD 1SCDA 4KPEC 1B8VA 1KDYA 5EQJB 4R0NA 3ZH2A 3ZOZA 3RI3A 3KWMA 1RM3A 1P0PA 5EIXA 3IIJA 2IX9A 1QHSA 4WK2B 5G1PA 5C31A 3SHTA 5JCZA 3U19A 1DWQA 4W8GA 1KRHA 1ZN7A 5CB4B 2FEXA 1FE8A 3I34X 2HW8A 1BS1A 4CN9A 4LRYA 4IXNA 4CIYA 1LX7A 4GPBA 1AGXA 2IPXA 5LQMA 3O8CA 1LLUA 3MWLA 2B7LA 2HDHA 4PGGA 2W2TA 2OYRA 1Y1RA 1T9DA 5HTKA 3QMWA 1AHNA 4M9UA 3SSMA 3COJA 2O1WA 4U39A 2VNSA 3MCUA 4RVNA 2H9IA 3M34A 5AKIA 2ADOA 4EG7A 1LVUA 3K0CA 1RAIA 3KUKA 1J8MF 3K1ZA 5LYJF 16PKA 1T34A 3OZSA 4F2HA 2IHVA 1MOSA 4FDTA 3RS2A 4Z2AA 3PE6A 3WLHA 1B4DA 1RBZA 1M1YB 2XYGA 2FR0A 1DKUA 1YGPA 3IVGA 3C8DA 5B2FA 3AJRA 5F5XA 5FV7A 4DXAA 2Y1WA 2CNLA 3NHJA 1TVKA 5FOXA 4DHEA 1OQAA 1YL7A 3FE2A 4D9MA 1IONA 2Z2ZA 3BCHA 2WNHA 3PRJA 4LDQA 1P77A 3EVNA 4PHCA 4BV9A 2CVPA 3DF7A 1I3NA 2WIAA 5KYVA 1PG2A 3IESA 3MF4A 2EKZA 2QQFA 2P4EA 5IXYA 1XXHB 2BBWA 3TW4A 4FYWA 1E1LA 4J4TA 3STXA 4ZJUA 2J0UA 3OWHA 5IJ0B 5LU9A 4JBWA 3H2ZA 4S35A 1O96A 4CR8A 1RJEA 3KYJB 1MA3A 1YD7A 4W5JA 3G2PA 5HJ5A 4GKKB 2AYZA 1TMGE 2QN8A 4NAVA 4Y3UA 3WMFA 2EFGA 5AHKA 1PT5A 1VSUA 3UV7A 1BHQ1 1FFBA 2PYIA 3IRUA 4D80A 4F4JA 5F4BA 1DMSA 3HJNA 3OZWA 3GP5A 1JSCA 2GBGA 4CM8B 3KKNA 5JAIA 3HXMA 4OQXA 2HJGA 2AEEA 3LFUA 1UFKA 3RTBA 3ELDA 3JQ6A 4QL3A 3ZI4A 4DBZA 2BYTA 2P2CA 2P75A 1N9KA 4EENA 1VDZA 4HGZA 1PTJC 5K6AC 2EJVA 1V7CA 2QJRA 3F4LA 1GKYA 3S8YA 4R2MA 2ZYTX 3VH4A 3CH6A 4KZKA 3DEIA 3JARB 2YYZA 2A5YB 4TLDA 1LPAB 2J0EA 2V6FA 5I9NA 4WKBA 3T5BA 2J1LA 3WMRA 2J4CA 3QY9A 5SZJA 4ME6A 2EKBA 2WKPA 3EOAI 1ONNA 1JWBB 1NBAA 2LCFA 4L3VA 2V0NA 2Q0QA 3WHLA 2KYRA 3DT9A 3GLGB 4M1MA 3FMIA 3OTHA 4ZO8A 3K0FB 1ZGZA 2YJ5A 4WVLA 1P2UA 5BXYA 4JXJA 4OMCA 2NG1A 4PFQA 4H77A 4YRRA 1GAEO 4DT1A 3KJFA 5HDBB 4ER3A 2CF6A 2OCGA 4OD0A 3ZDDA 2J0SA 5AJZA 3DTYA 3MWDA 3U7JA 4AMBA 4EITA 1DWUA 2WILA 1KETA 2R25B 4JP2A 4LQDA 4E31A 1GNPA 2WPDD 5EESA 2C3MA 4Q3KA 4QM6A 1M54A 3MINB 1Z5PA 3DV0B 5DF1A 3RCBA 2KHZA 3TLGB 4FP9A 2HA5A 1OH6A 1WLSA 4RA9B 3KB1A 2ILTA 2OAGA 1OYVA 2JAPA 2OV4A 3H18A 4TZKA 3AIOA 5JZSA 5LZ9A 1EFPA 4HATA 3V8EA 4EHKA 5GJCA 2YN4A 4R1NA 2AX4A 2EFJA 5BW4A 2BL4A 3SF8B 2HQSA 2O23A 1GCGA 4P0QB 2BTOA 1OR8A 3OT4A 2JCGA 3MUOA 4D25A 2UZ1B 4QWWA 3BXPA 2YJNA 1D0VA 4MWTA 4AROA 4ESVA 4GXNA 4MWCA 2QPLA 3K15A 2ZI4A 4DR4B 4W7HA 2Z8YM 2P7IA 2ZWAA 3FRJA 3FWHA 5JR3A 3R9WA 1E2EA 5KQRA 2VKQA 3AZQA 4ALIA 3BMNB 3D5TA 3CJTA 2F00A 1N2JA 2HU8A 1RADA 1FX0B 1UEJA 2VHXA 2V7TA 2EFCB 3CH4B 3FKSA 2GBLC 4YJ3B 4I4CA 4MI6A 1G2QA 3V48A 1J0CA 2ZFUA 2WSSA 3K70D 4V0MA 3ANYB 3BK7A 4PCAA 3O92A 4BKPA 3B48A 1FF9A 3OQPA 4DIBA 4EX7A 2VJAA 1GSOA 3GRRA 2XUKA 1TM3E 4ARCA 3UV3A 2BGKA 2R4QA 4KSCA 3U7IA 4KQMA 2D6FA 5IG2A 4IV8A 4GOKA 1CJSA 1MHPA 3TSWA 4H3HB 5K9ZA 1BAPA 1T3SA 3SVTA 1QBGA 3VDQA 3UTDA 2WAMA 1X1AA 2IZ1A 2WSBA 1KYWA 1QLJA 2HRCA 3OBIA 4KXLA 3W9UA 2VPPA 4KQGA 2WAXA 3LQ2A 2P35A 3OA2A 3Q5GA 2NQ8A 4IJ6A 3COVA 3ZIDA 4DREA 1X8XA 3Q72A 1SBIA 2YVKA 4CIWA 1WBJB 1BMFD 1I30A 5JCOA 3CVUA 1FRVA 3CE6A 1M72A 2GJAA 4BO0A 2W43A 3X1KA 4Y1RA 2WJPA 1UKBA 3KEFA 4NS4A 4KE6A 1WUKS 3FOWA 3LCRA 4WD3A 1JTVA 1Z28A 4F0JA 4PVDA 5BVGA 1YNOA 2P9HA 1C0IA 3QG1A 1ZBDA 5E4JA 4C3VA 5C35A 5KMGB 1MH1A 4LRTB 3T54A 5ESDA 1ZIYA 5LBTA 4F2GA 4RNDB 4FFVA 5HKKD 3TW6A 3LJKA 4TS4A 4L4ZA 2GLUA 5I7VA 3ROQA 4O8ZA 3U49A 3W90A 3NETA 3K92A 3SX4A 5H9WA 4ESOA 1G8FA 3L8YA 4IWXA 1WF3A 3CTMA 1J90A 3IV6A 1UMBA 1UPAA 3OCZA 1RYFA 3PC3A 4ID3A 3LY9A 1R0XA 2JBHA 3QOWA 4HSGA 4KWEA 2ETVA 4HWPA 1EDEA 3JY6A 5DYTA 3RC2A 4D8UA 5DNUA 1K7YA 3ETEA 3NX4A 1EUCA 2QMUA 4J6EA 1TD9A 1XELA 1U31A 5T4HA 4A6XA 2BGNA 4AZSA 2ZBVA 1YVEI 3GEEA 5I9SA 2WWWA 3ERCA 1I7QB 5A7FA 2GFQA 3AZPA 3L8EA 1T8UA 1V3VA 1ATZA 1T43A 3FVTA 3KVOA 4AMGA 1N4DA 2YC2C 4RS4A 5EL0A 4KPGA 4HBZA 3BFXA 3LC7O 3DVQX 4URYR 3C6MA 3RSHA 1V2GA 4OGLA 2DFNA 3SZLA 4KBFA 4BO4A 1TM2A 3WWOA 3F8SA 4QSHA 3DVSX 5IBCA 4FHCA 1E1CA 2WYOA 1LX6A 3HHPA 1GYPA 4RE5A 4YK7A 1MOPA 1L5HA 1OJ7A 4DARA 2XTNA 2NUPB 4QELA 2QXUA 1MC8A 4P3NA 2H1FA 1QK5A 4J3NA 2RHBA 3D3JA 4NSNA 3LUFA 3LC2O 4NNJA 3RBZA 3V8RA 4UZEA 4JBNA 1SN7A 1A9SA 4OHUA 3EARA 1XK6A 1IMOA 5CMLA 4H0NA 1DJOA 3ZCPA 3ZS8A 4OPMA 1OLXA 4MCJA 5EHIA 2X77A 1X7YB 4HYTA 1I1QB 2OECA 4MYHA 3JQGB 3CZPA 1CZNA 3B7WA 5D00A 1LNSA 4FCTA 1VL0A 2LD4A 4KFSA 4YRGA 5LNK1 3TZQA 1L5MA 1TTQB 2VEDA 3CW2A 2MWMA 3BIFA 4KVZA 4QDTA 3MCVA 2V03A 2V45A 3PQ3A 2QM7A 3MFYA 3PFBA 4DNPA 4GIBA 2WPDA 5D01A 3U6BA 3IEUA 3AINA 2Z1MA 4CMAA 3RU3A 1WXWA 4OREX 2QN1A 2GZHA 3GL9A 3HVKA 3DNFA 1IHXA 3MA0A 5AWFC 3A11A 5HF8A 4E5VA 2HBZA 1WNFA 2VL7A 2SCUB 3C7KA 5AUOB 2CCKA 1LA2A 3IAS1 4HWSA 4MUNA 4CGYA 2DPHA 2UVQA 2HB6A 1FSFA 1WG8A 5HZKA 5BSFA 4PHTA 4WCDA 2ZIEA 4EOGA 3CM0A 4IIGA 3MPOA 1PGNA 1IK6A 2QUIA 4G89A 3TLBA 4BQFA 4YRBA 4MUEA 1R6AA 2I4TA 4FFNA 3EX7C 1CUGA 4GZ6A 3D0KA 1ZUHA 2OBLA 3NEAA 1AHPA 4ND7A 2YRXA 2DHCA 1UC8A 5GJBA 1IEQA 1HG0A 4AZWA 2FZWA 4FMDB 3PCXA 3H3XA 5JG7A 4C0QC 3CW9A 1LBSA 2R8YA 3PQEA 1JBKA 4O63O 4HWRA 4JOCA 3ZWYA 1G291 3UV6A 1UCFA 1W85B 2OL4A 4O4JB 2DULA 4OSEA 2JK1A 3AXSA 4RD6A 1NF8A 4CCSA 4LJ8A 5BQFA 2J9ZB 4PQEA 3RW9A 3NBAA 3R5SA 4PLPA 4QTUB 3H13A 4GP9A 3W5BA 1GCUA 4I2NA 5AVUA 4TVOA 1V48A 1AB6A 2JFNA 2QMHA 4KSBA 4C6TB 1IB6A 3WMWA 1OFHA 4EBBA 4DWOA 4JJKA 4ZCSA 1YR1A 2J9FA 1BKYA 3PKJA 4IG4A 4MW0A 4AUNA 3GZNB 2IQ5A 5ARCA 2GXUA 4JI3B 1N8NA 2W48A 3WSWA 3WSVA 1Z2NX 3FA2A 1SBQA 4L9WA 5BN3B 4ER5A 3EG9A 2R6R1 4JJAA 1XRMA 2QLFA 5AJTA 3DCJA 2RHLA 3LDGA 4G5QA 2IS2A 1MAHA 3M4ZA 2VXBA 1CY7A 4QAJA 3O90A 1J2YA 4NU5A 4B4UA 2F64A 4DR2B 1Y6RA 1Y3CE 4QU0A 2ZJ1A 1R6UA 4R1SA 1BMFA 3OQIA 2V98A 3JYQA 4FB5A 2VQ6A 3D81A 4UQOA 4KXYA 4V03A 2PZEA 3Q7QA 4WZAE 5J5CA 1N2BA 2YZKA 2FVXA 4D6XA 1MC1A 5IEJA 5ITZB 3CJRA 4FNOA 2XCTB 1QM5A 1RAAA 2ONZA 1NNUA 3PIRA 1MJHA 3H9CA 2ZSKA 3ORRA 5BSVA 5HKKA 5ALDA 1LW6E 2NXJA 4YCSA 4JQZA 5K99A 2PJRA 1D2RA 3N8NA 2WWTA 3ZY2A 2HMVA 4PX5A 3QWAA 5JWOA 1X0XA 1B8PA 5DWQA 1VG8A 2GTHA 1AKNA 1B1CA 2CL5A 2NUTA 2PO5A 3WE7A 1BGVA 3H5LA 3HA2A 3N2YA 4RHUA 5EKSA 3PX3A 1XTRA 2P1ZA 3EDRA 2G8LA 3LF1A 3LVFO 2FP4A 1ZH0A 3PCTA 2WUDA 5IAJA 5C8YA 3UT0A 1ODSA 3CKMA 4UUMA 4B74A 1YAJA 4S05A 2DSTA 2LKCA 4L7VA 4OLBA 5AM3A 1ZCBA 4MI1A 4FJ1A 1JR2A 5DTJA 4CG0A 4MR7B 3AM5A 4M89A 2H00A 1E5DA 3AH8A 4R1OA 1U7WA 1FDSA 1V35A 2PL9A 3AVXA 1PW5A 4COKA 2GJ8A 4IOLA 1QU3A 1NBIA 3A0UA 3AF4A 3A1WA 2D5IA 2XJ9A 2ZIUB 2O8CA 2VHJA 2DZDA 4KMRA 4BLSA 3FYUA 4EA7A 1Q0HA 2W00A 1E8DA 1G0OA 1ULBA 2OAP1 2XMQA 4HZUB 5COQA 4LSWA 4OXXA 2H17A 4C43A 4M3NA 5JZ9A 3S3TA 4BQRA 4QPJC 3P94A 3COSA 3TCKA 3U26A 4LI3X 1JAZA 4NX2A 1R2QA 4C4YA 3VO9A 1V7ZA 5DGHA 1N6NA 4FPXA 5BUQA 4A6EA 2AMVA 4EM6A 3RKUA 1UBMS 2O8DB 4V2IA 2VF8A 4US0R 3IAEA 1YZKA 4Z1OA 1QHGA 2Z4RA 1SQ5A 1H0SA 2VJLA 2WYWA 3GCXA 4QYWA 4XQGA 1EX9A 4ZQBA 4EP1A 3R8CA 1PDWA 2IXBA 1RQ7A 5DB4A 1HRKA 3H8VA 4AP6A 3UWSA 4BP3A 1SOUA 2G82A 2HZBA 2JB9A 2MR6A 3TTUA 3VDXA 2YJ3A 1E1YA 2F1JA 4F9TA 3GVPA 4JB0A 2MCFA 3G2QA 4M1ZA 1IZZA 1GILA 2H5EA 5COBA 5GGXA 3SZOA 3WQRA 3NKVA 1W4CA 1VPTA 3CEMA 1XZHA 3KOWA 3RS4A 2PY6A 7YASA 5IVPA 5IPFA 2LZ0A 3CZ9A 2KLBA 1FNNA 1M10A 3NC4A 3ZJVA 1KEUA 1T9KA 5EI5A 4KQXA 2YNMC 2CV1A 1GPJA 2DH5A 5ALOA 2LIPA 3PHJA 5K3AA 2ZUTA 3HP1A 1RM5A 1IM8A 2Q46A 4UTZA 3B6JA 3K5IA 1N0UA 2FLKA 3ADOA 4LX0A 4V0OA 5DNEA 4CM3A 4F93B 1F6BA 3QLVC 4EW2A 5L40A 4CG1A 1NW4A 3I0MA 3FY4A 5FOSA 5E1BA 3ZE6A 2Q5QA 3FSEA 4DIKA 3L43A 4YMLA 1T9GS 1UBJS 3CPJB 5D8DA 3VSAA 2XUFA 1YQTA 1CUFA 3DKVA 2FB9A 4YV2A 3GLFE 3KD3A 1Q92A 3K5WA 3LC1O 1U7OA 2WMOB 2ZPTX 2C4HA 1DLIA 5ALGA 3R5FA 2R8EA 5ALEA 2D1TA 1D4ZA 1Z6QA 2ATIA 1EA5A 1XCPA 5DNCA 2GD2A 1IUOA 2C92A 2OFOA 4EABA 1YQUA 1ZHHA 2EZ8A 1AUOA 4FEAA 1P0QA 5JS2A 3DMGA 2VH1A 3VR3D 1VIAA 3OJLA 2B78A 4LMAA 1IY9A 1JJFA 1WMBA 1Q22A 2H1CA 4UJ3A 5CT4A 2AOWA 4BRUA 3OUZA 3QENA 3THWA 2Z04A 2AFIA 4EZIA 3R23A 2FETA 1VLQA 2Y9PB 4HXEB 4JLAA 4ND6A 4WFQA 5DIZA 5IVHA 3RT1A 3O8RA 1WB6A 1N6OA 2HUNA 3LO8A 4KOAA 1C0LA 1PCXA 5ETJA 3G6WA 1ESEA 4XH9B 4RVCA 2Z6UA 2HRDA 3Q9UA 1T2FA 5KWIA 1C41A 3D1JA 3DEKA 1WCV1 2AG0A 5AR1A 4Q9NA 2JIZD 5LQRA 3ZX4A 3HY4A 5J5VA 4DEXA 2CHFA 3LUBA 4LY6A 1M74A 1Q7CA 4UD2A 1AF7A 1MIHA 2ZYDA 2CYBA 2D2VA 4L8LA 1X7ZB 3WWPA 4Q3OA 2AFHB 3WICA 3GHYA 4F3CA 2BJVA 1UF9A 3BXHA 3LQFA 4BBAA 1G8PA 2WKWA 2YJTD 2YV3A 4LECA 3KVVA 1DEOA 3MWEB 1O8BA 5EP3A 2PL5A 3GEDA 5AICA 1E6CA 1RWWA 2XTMA 4H1UA 1VIDA 1K89A 4D5EA 4C07A 1OC2A 4N5DA 3U4MA 2EW8A 3HS3A 2PD3A 2B2XA 1W4RA 2D54A 3WAGA 1LDMA 1W0CA 4YMTA 4A4DA 4FMBB 2FPUA 3NFYA 3M6VA 1B73A 2FWRA 1EWYA 3QE0A 4G84A 5GGYA 3QXSA 4OLAA 3O0DA 1CD5A 1DKOA 2Q3EA 3AKDA 1V37A 3OP1A 4A5OA 3LBFA 2Y2VA 4QNRA 5JALA 1C1XB 6ADHA 4GC5A 1K7SN 5HJ7A 3RVNA 4PGFA 2CZCA 4GRDA 2VHYA 2VXCA 2DE0X 3LYUA 3WMXA 1A98A 1XZGA 3PENA 5IF3A 4ITVA 1XNJA 1AQYA 4LNUA 3T7RA 2WIDA 4ZOLF 3KTOA 5EY5B 3WWYA 3PGKA 4FU0A 1V8FA 2JIMA 4J4HA 2AKEA 4OH1A 1EM8A 1Q1ZA 5GZ1A 1HKUA 5K0GA 3FLAA 3QWIA 1E61A 3URMA 3SS7X 2VEOA 3SEZA 1RRCA 1HQYE 2Z5GA 4X8MA 1YJ8A 2V9PA 3V2HA 1L7XA 4DM3A 1P61B 3ZUPA 4ISCA 4AVYA 1RI4A 4GC9A 3NBZC 1IN4A 3QVKA 2OCPA 3BMCA 5KSYA 1SHLA 3JQFA 1EWQA 1O03A 2A14A 3B1XA 3MBKA 1NGSA 1GPLA 1QF7A 3AHJA 3FMPB 3D8UA 3Q3GE 4HQ6A 1SUAA 3EE6A 5K45A 3C3XA 4DYHA 1CIVA 4RJLA 5T6BA 4CIBA 3AFHA 3VSBA 1X13A 1NMXA 5JTTA 2AW3A 3LY7A 2Q2WA 2VDOB 4FMDF 3VR2A 1LW7A 2PMWB 3CVVA 3RVMA 3DL2A 1L4NA 1PX0A 3MSCA 3VPAA 4ALNA 4X8LA 3HB0A 3IKLA 1IPFA 1BGWA 2XT6A 5LMNB 5JCPA 1EWKA 1EAYA 4WK4B 2EIHA 1HE2A 5DISB 4AUMA 5KVAA 3RASA 1Z4IA 2FX2A 4JU9A 3GRPA 2C1EA 5CX1B 2QMZA 4LY3A 5NLLA 1YMUA 4CV3A 1X7WA 4ROTA 4EF4A 4D5GA 2PL3A 3RV3A 4Y7CA 3DOOA 2X7HA 1QTQA 4Z4CA 4GF5A 4M9RA 5H1YA 2HEIA 1NZDA 2EF1A 3FDFA 3RU7A 2ZRDA 3SSNA 5CNIA 2WFLB 3CH7A 1J0BA 1KFEB 3U1TA 4D99A 3T1VA 3M3HA 4TUYA 4G4JA 2A5LA 3MAJA 3HDVA 1QYVA 4KYIB 1U1CA 4ZQHA 2V7EA 4EY8A 4KRXA 3NEYA 2D62A 2QYHA 1EXVA 2I1WA 1ZRNA 1R5NA 4BXOA 3L0PA 1YUNA 2NQ2C 3I0NA 4X71A 4EL5A 2WPNA 3F67A 2MYTA 3I01M 1MR3F 1YDWA 1NRIA 2Q3CA 3A3OA 3DXYA 2XGSA 3HPRA 4J29A 3CIOA 3TPFA 3UKDA 5JSUA 5KDDA 5DJ5A 1EB9A 3LRPA 4OIFA 4R1MA 1VE5A 4BZQA 4IX1A 3GBVA 3QX7A 2B0JA 4ZOAA 4BQEA 2PUDA 3KEQA 5JYCA 1DBVO 5LUAA 4M1TA 2IF0A 2YRWA 3ESAA 3VR3A 3C24A 4O4HF 1JEQB 3NH9A 4JOQA 1SVUA 3WYCA 4BTLA 1KAMA 3NHZA 1Q0RA 5J2UB 1DWOA 1G16A 2J46A 1RWBA 2NPIA 2RGUA 3EC7A 2D4HA 3N8KA 4RF4A 2ZVDA 1WEKA 1HNXB 2CW5A 5L4SA 4RY8A 2CEKA 4R9UC 5HJ2A 2GARA 1TO1E 2AQHA 2A1UB 4OBBA 3AR9A 2HO4A 1M8FA 1TJ3A 3HY3A 2PUFA 1QWSA 1V4BA 3L93A 1JHUA 1M7HA 1UOOA 4RKFA 5FNZA 3INRA 3E8SA 4P22A 3S44A 5H9VA 3SKYA 3ZYZA 4BO5A 1MKYA 4F5WA 4K05A 4YO8A 1A1SA 4E4RA 1DU4A 2ZSDA 2X1LA 4MJXA 1HGXA 3RUCA 2BMJA 3C3JA 4GOLD 2YUTA 4KAFA 1OFIA 1W48A 2MU1A 3A70A 3I5AA 4LJRA 3CUSA 4KGZA 3L07A 4I5FA 4WXEA 3T3OA 2OM6A 3FYUC 3R5JA 3T7DA 3IBCA 1SD5A 4E3ZA 1TYAE 1NRXA 1QX4A 2ZQYA 1DS6A 1W5AA 2VA9A 3H16A 1JHDA 1QGAA 3L8MA 3GFBA 3OIWA 1DV2A 2Q4BA 1NKTA 3RTGA 3OCJA 1GT6A 5TARA 5HR5A 2VP6A 1GYRA 5C5CA 4RDIA 4PQFA 3MJFA 2QVBA 5KYYA 5H83A 2I6FA 4MGYR 4A2CA 2C77A 4I1OA 4KXXA 1ISMA 1ECPA 2A9VA 2W2QA 2ZRAA 3FCOA 3UAZA 4H16A 5NULA 1BZYA 4L5YA 3H1BA 1QWOA 5EJ9A 2ZYIA 4H7JA 3VTKA 1ULAA 2W22A 3G7SA 1R88A 1ZI8A 3K94A 1JJAA 4ICIA 3U1BA 3QZUA 1G6Q1 5A4IS 3ONDA 2HCJB 1IATA 1L4KA 1ZVKA 1E60A 1S7GA 2X2OA 5IEBA 5AKHA 1RTTA 3SE0A 3NHWA 4ZZ0A 3NIGB 5AJUA 1PWYE 2Q0SA 4ZAVA 5JO0A 3TUIC 1Q2UA 3ETNA 1ENOA 4EHNA 4NBSA 2D0PB 1E1DA 1PT7A 4O4IA 4RVGA 3UT6A 2YFQA 4JFRA 4KSYA 2HY7A 2YRFA 3H2YA 2AMYA 4PNZA 1SR8A 1Z0UA 4GX5A 4RJKA 2NP6A 2DRIA 1P7YA 2JJYA 3NNSA 3A2KA 4FMPA 3WLKX 1JE1A 2OAQ1 4Z9XA 2ANBA 2Q3BA 4C0HA 3IIEA 4GP7A 1E0DA 3PUZA 1KZYC 1P2DA 1T1RA 4NCKA 1DE0A 3CG0A 3QF7A 4JBHA 5DSZA 3S2SA 5FO0A 4Z3KA 1TMYA 1U7HA 1Y98A 5BN4A 2OG2A 4D8WA 3WY9A 4MMZB 3NNNA 4YO7A 3HGQA 2HC9A 4KWHA 4UULA 5IBPA 3GUYA 2F1RA 2HK9A 5MF6A 5DI3B 1F2UA 2BZGA 3ITDA 1R5OA 3KLNA 2Y1KA 3EWAA 3HWWA 3Q98A 5DRYA 5FBQB 3T7JA 2C7RA 5I9LA 2AL7A 3UG6A 1UQTA 3V4PB 3FPGA 1TYZA 1KYXA 2FY8A 3DKIA 3TCXB 4ACAA 1ZD1A 4PSCA 1Z6TA 5ALTA 3TB6A 2VHTA 2YDYA 4H6VA 3TVDA 3LUKA 1SQSA 1F8XA 4D0RA 2JJ1D 3VMFA 5IULC 1IXZA 3A58B 2D2IA 5FYDA 3UT5B 4F11A 3OPYI 4Y0NA 2I8CA 3SZMA 2CE7A 3FUTA 3JZFA 5CFPA 3EZGA 4PIPA 2YHIB 1DUVG 1Z6AA 2Q1SA 1F5NA 1JWAB 3O8BA 2AJBA 3QSGA 3I05A 3UHAA 3K1AA 3P2MA 3QE4A 2OHGA 1CIJA 3VNVA 4BWYA 3H86A 3QW4B 2ORWA 3VMMA 4AYWA 2XKKA 1JT2A 1VP9A 4AJNA 3U4QB 4B3SB 4M86A 4BZZA 2D2FA 3OJOA 1QE0A 3LBNA 4BNNA 2A7QA 5ITVA 1VCNA 3UWOA 1E0KA 2ID7A 121PA 4Z51A 2JLAA 2FYTA 2L18A 1JAYA 3S2IA 3GUCA 2XTJA 2Q1XA 3BMQB 1HE3A 4Y0AA 5K0BA 4RK6A 3U3MA 1WULS 3BSYA 3QVGA 2DUWA 3CEPB 4RABA 1ECCA 1QS0A 4XB2A 3Q7IA 5AK4A 2W4QA 4I1YA 2AHOA 3R09A 4K6OA 4Q4HA 2N46A 3A2MA 4WVFA 4FX5A 5TQJA 4C87A 4YGXB 3VU9B 4YBRA 3MJEA 1G3UA 2IP1A 3G9TA 3OHPA 2AI3A 3ESQA 3ACBA 5T3UA 3HZZA 3L6EA 3QKRA 2PE5A 1GHTA 1JDBC 1JN0A 1QMGA 1U1IA 2V6MA 3BG5A 3KQMA 3NASA 3ZQJA 2ZR9A 1FEZA 2EL7A 2VAPA 1ZL0A 3AR7A 2LCQA 1SFRA 4QG3A 5ITSA 5HNKA 2X6QA 4WASA 3T1HB 2WD7B 3FBGA 4B31A 3EY9A 4Q9DA 4UNSA 4XTRA 3ZVMA 4U1RA 1J8QA 3HKEA 1DFGA 5FBWB 2RKOA 4MTCA 1GTZA 1UEXC 2XXBA 2G0AA 1YK0A 3FLEA 3I6ZA 3MWJA 3WLPA 5A5VA 2OHOA 1GV1A 5ALNA 1U0BB 1KMHB 3ZBTA 5C1BA 1YKGA 3R5KA 3U0BA 2YW2A 3N9IA 3X0DA 4AY3A 3DWGA 1ISJA 3A31A 3ND7A 1WXEA 1F20A 1BNCA 2VUIB 2Y1OA 4R84A 2I65A 4DJDC 4BOYA 3OCYA 1NLFA 3RWOA 1I94B 5HRAA 4FINA 2FFHA 1GTMA 1PLKA 4OLFA 1IBMB 2WJZB 1ICEA 2W6OA 3OC6A 4TMKA 1SOAA 1VHLA 2WFAA 1O77A 2XNJA 3KQNA 2HRRA 4K03A 2GR9A 3K5HA 2OB2A 3CU5A 4Y18A 3QJYA 5IM4A 3MWKA 1FSPA 2V5AA 1NHGA 4W5NA 1A72A 4E32A 2FZEA 4TLAA 1NLMA 2PL1A 4JX9A 1NI4B 2HBRA 2QLNA 5D87A 1RYHA 4UU1A 3V1MA 2IYFA 3K9QO 4YAGA 3TJZA 3BWBA 4K46A 5K3SA 1H4VB 2J7PD 2XNSA 1UKVY 1JIJA 3E5RA 1MJNA 3E7WA 1FNBA 3L5OA 4ZOBA 2UU9B 3FOZA 2B8TA 5FTLA 3LCJA 2ID9A 3MGAA 3AHFA 4IDBA 4IIUA 1G1MA 3NBFA 1JILA 1QCDA 4A8PA 3DG9A 3WOVA 4IUBS 5DI9A 4CBVA 2F1IA 1ZW1A 1VE6A 2ZI3A 3GF4A 1SGWA 3BQNB 4NCHA 5DOZA 5I9MA 1YZFA 2O5CA 2Q5EA 4PX2A 4LYEA 5A5DA 1BDBA 2WHRA 5FEMA 3AY6A 2YMLA 2HWYA 3CLKA 3NP9A 3EWIA 5DHTA 1TPYA 2ZT7A 2XMDA 5EGSA 3FIUA 1TUGA 4YAFA 4BX8A 5FOTA 4IQ8A 1ISGA 1T9HA 3LLVA 3PQ6A 2WSYB 4ARSA 2B9VA 3CNQS 2COUA 1GIAA 4EGCB 5CLFA 1K4YA 2V6GA 3C41J 1U4NA 3PC2A 4MKFA 5BO5A 3HCBA 4O4LF 3AV3A 4XSHA 4XUDA 1HTBA 2B8JA 1EZZA 5DTMA 4V1CI 1YRLA 3IP5A 3HJCA 3HM2A 1YHNA 5H80A 1I4EB 4P4SA 5H4GA 4C0JA 2ZRCA 2H5JA 3VOTA 1QE3A 4UD6A 3W8NA 5I6DA 4C14A 5LLDA 2TYSB 5B64A 2B1JA 1T3GA 1Z7YA 4CM9D 2B3TA 3WR5A 3LYHA 2QPAA 5DYYA 3GRAA 4J91A 4DS3A 2SICE 5BWMA 2OCXA 5B53A 4BRWA 4ZHQB 1XVIA 2OXEA 1XWWA 1NFFA 2J5BA 1EMDA 2R00C 3LBIA 4DJ5X 5JS8A 3BMXA 1BWRA 4C4AA 3O2NA 3ZHOA 3RAPR 3B82A 3ZWAA 1AA9A 1Q7EA 2QUAA 3HR8A 3IULA 1RI3A 2JJ1A 1LFAA 2ACWA 2LXNA 2ZDHA 2V4UA 3ZU5A 2XWSA 3WI7A 4NE7A 1R4MA 1P39A 5JMTA 4WINA 3KQYA 2FPGB 4MW9A 3BFKA 3GX1A 3FH0A 1JXAA 1T9GR 3A1VA 5LQNA 4YRKA 1IEXA 1Z25A 3JQ8A 1O58A 1JV2B 3HACA 1MX9A 1LWOA 4KE8A 5KYXA 1SU6A 3K0EA 5IVDA 3RC7A 1NUQA 2BR4A 4HQFA 1Z7BA 4MGEA 4OATA 1SM4A 4UE6A 1PFQA 5A3JA 3NNDA 2VAMA 1NBMD 3ENWA 3TKAA 1Q7RA 2H5IA 1RKUA 3BRWD 1UXHA 1FDRA 4L8FA 2HR1A 4TMZA 1WS6A 4MZDA 4M0DA 2I7VA 3RRZA 4B87A 1QKIA 1X1TA 1O6GA 5DBIA 4IJWA 5DV9A 5H7XA 3A6ZA 4EPWA 3DDHA 4B1FA 3PS9A 3V7YA 5HKBA 1GFZA 3B7PA 1J5XA 1GARA 4OJQA 2IHYA 3UIEA 5ISMA 2WZCA 3IDZA 4JNCA 2ES4A 5LP6B 1QHHB 4EW3A 1SXJD 1XFDA 3CZ5A 4OLJA 2DUMA 2Q50A 1Z75A 1XZIA 2DQ4A 1MDBA 1JYFA 2VK4A 4EO4A 5L95A 3B3JA 1UJ4A 1UT6A 4IHJA 2XGGA 3KXDA 3QQ5A 4OXRA 4NP6A 4B7ZA 2IP4A 5I8WA 2ZSBA 1L7OA 5DOVA 1PS8A 3KZXA 4XYBA 5E6RA 2J41A 2WKRA 3I2IA 3I83A 3WDKA 3ZDFA 4BAZA 2G1PA 2NTEA 3MLAA 5AK6A 3CCBA 4G5OA 5J5AA 4PM4A 3RSSA 3UCEA 1Q15A 4QUEA 3L6UA 4P31A 1MRNA 4FBGA 5AKKA 4F86A 2W6ID 2X5KO 1J39A 2O0KA 4TKVB 2JLZA 3GRZA 1W5BA 1YFKA 1FQKA 1AXEA 3HKDA 3UQZA 4H6PA 3BHNA 1SG6A 3C8HA 1ZGCA 3H5OA 5A71A 1QTRA 5JD6A 1W0KD 1W1WA 1ADCA 5DE3A 3AUUA 2C7BA 1Y1KE