2QSZA

Human nicotinamide riboside kinase 1 in complex with nicotinamide mononucleotide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
188
Chain Sequence
VPRGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Nicotinamide riboside kinase 1
total genus 55
structure length 188
sequence length 193
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qszA00
4LHVA 1Q0UA 2ZJAA 5L3VA 2FV8A 2GEDA 2D74A 2VTKA 4TMZA 4NKRA 1XDBA 2XXAB 2JDIA 2CNWA 2DCUA 3RS5A 4P33A 4Q4JB 4CDGA 2IYUA 4GNKA 3GFPA 5JFGA 1XXHE 2QE7D 1KZGB 3TQCA 4IDQA 4WOPA 1KI9A 3PVSA 2GVDC 1PVOA 3ZIAA 2MSDB 5CITA 4V03A 1AN0A 4XH9B 5CB8A 1D2EA 5DSZA 4OJQA 2VP5A 1GRRA 2WJIA 4R2IA 3KQHA 1VMAA 1VHLA 3LBIA 4YONB 1DO0A 2GJ9A 3TR5A 3KKQA 2IL1A 1JI0A 2CJWA 2H16A 4PHFA 5CYOA 1DEKA 4IOMA 1HE1C 4U7DA 4HZUA 4LJ9A 2E1RA 4YXWD 1E9FA 1I2DA 4ABYA 3Q5DA 1VCMA 1OPXA 4JBYA 2F3TA 1SHZA 1ZCAA 2XZPA 1ZNYA 4HUQB 2BCGY 1T91A 1E2JA 3PEYA 2J7PD 4B76A 2C2HA 3MAAC 4P4UA 3G82C 2ZE7A 1F2TB 1IN4A 1S3SA 4UNNA 1NIPA 2XITA 4TMVA 1Z08A 1C4OA 1FP6A 2QMUA 1B23P 1VIYA 2BMDA 2FEOA 4HDOB 4DIEA 4W5JA 2BMFA 3T06B 2AKAB 1QVAA 4ARZA 5G40A 2GJAA 4DCSA 3CPEA 2MSCB 3NDPA 4Q7KA 2ZS7A 4WBSA 1TTTA 4TYYA 4UXHA 2EFDB 4OK3A 5FPYA 4BGDA 1E4YA 1AQUA 2Q9CA 1YZUA 4UQOA 4A0FA 2WJHA 3DZDA 1COWA 5DNYB 4G5RA 1TEVA 4RD2A 4QL3A 2A30A 2XXAA 2QGZA 1WMSA 1VPLA 2A5DA 4OQFA 2W00A 3CWQA 1WXQA 1YR7A 4Q7LA 4Q4HA 4A6PA 3TRFA 5IHPA 3N70A 2V3CC 2RGNC 2BOVA 1G5PA 4O3MA 5FTJA 2Q0HA 3DL0A 3L0IB 4KYUA 5DHAA 3TUIC 4B2IA 1G8PA 3V00A 1FUUA 1E1QD 5KSOA 4ZIRB 1NJGA 1FNMA 4K8OA 2YC2C 4XD7A 2G0NA 3ZVRA 4I1SA 4B6FA 1N6NA 4G5OA 5F98A 1E2HA 3IQWA 2CLDX 1NN0A 2IF0A 3GEIA 4IJMA 4KI0A 1RYHA 2EYQA 1HUQA 4M21A 1E2PA 4PO1A 1Q1QA 4ITRC 4P3YA 2XGJA 4HAWA 1DPFA 2QI9C 4MKGA 4X8HA 2WHXA 2QBYB 2A2ZA 4B2LA 3QY0A 2ZITA 4Q18A 3EXAA 2PZEA 3C41J 3GP8A 4QM7A 4J0QA 4IDNA 3FMFA 4TYNA 2CMKA 2O0JA 3DPUA 2C96A 4PTLA 3CUEF 1XCPA 2VRWA 4DCVA 2CE7A 2X77A 4NL4H 1Z0IA 4MGIR 1KI7A 4XTCS 5M04A 3D6TB 3BB1A 2J45A 1HV8A 3FFAA 3H4MA 5TDHA 2ZE6A 2ODWA 4YC7A 1UDXA 1J2JA 4N3NA 3OIVA 4PPGA 4QJ4A 2IS4A 2IYTA 3T1QA 1T8UA 4E09A 1QHXA 1BIFA 4Y0VA 2Q3FA 1NMZA 1P9NA 3IIMA 4LSGA 5BWMA 3CWZA 2SHKA 4Q4HB 4UNRA 2QA5A 4AYWA 2FSIA 4XSHA 4M2LA 2AWOA 2VSOA 2V54A 1R8QA 2NQ2C 2VO1A 3FKSA 2BM1A 4MGYR 3L8YA 3ZZTA 1W4BA 1XMIA 3VKWA 4ZPXA 2PT5A 1IY2A 4LBZA 5ELXA 2X19A 2EFHB 3BS4A 3ADCA 4DBLC 4IDOA 1WBDA 2GAAA 4LPSA 3GLFB 2QQEA 1VG1A 4CRWB 1IN8A 4QGFA 1HEIA 4WZBE 2YINC 2B8WA 2XZLA 1QRAA 4DCNA 4WA7A 3VQTA 2RGEA 4A15A 3VR1A 2KSQA 1CLUA 1Y63A 2GXUA 1LVGA 3A4LA 4C7OA 1JJVA 1NBMD 3IQXA 5JS8A 3ZVNA 4BZQA 2IXFA 1UEIA 1ETUA 1KK1A 4JLDA 2NO0A 4LGMA 5GADl 4XWOA 1FTSA 4JJKA 4Q4JA 5DI9A 3AKEA 1R10A 1T5LA 3ZD7A 1CF4A 1WBBA 1L2TA 1LTQA 3KXKA 3SE0A 2F1JA 3NTUA 1NKSA 2HJVA 5KYKA 1D5CA 3TH5A 2Q9BA 3UG7A 4D6PA 3PFIA 3U3RA 3U60B 2ZUDA 3VU9B 3LLUA 3UWOA 3EPKA 3PEVA 1MO5A 2GILA 5JWRA 1KDPA 1KSGA 3ETLA 3KKPA 4GRAA 1OSNA 1E79A 4Q21A 2GVZC 3FFBA 3K1JA 3LLMA 3MGCA 4GMXA 3EWSA 4DT1A 1E0JA 4ZKEA 1F2UB 1X8KA 3HDTA 2RGAA 3QE0A 2MSEB 1SKQA 4NYJR 4XOIA 4BFYA 2D7DA 1OXXK 4MGKR 5CLLA 3CM0A 4PPQA 3VHLB 1FQJA 1YRAA 2D4HA 1AGRA 1ELOA 3Q85A 5TB5A 1A2KC 3Q72A 1LB1B 1MH1A 3W3AA 1G21E 2NTYC 4NE2A 4GDFA 3I1FA 4JJZA 3TUJC 4TMKA 5L8VA 4IRUB 5LBIA 2ZRLA 3GFTA 3VNUA 2J7KA 4PC2A 4OHXA 2P2LA 1KI6B 1TL7C 5KHOC 1CS4C 5FOUA 3AVXA 3O8BA 3RS7A 4DVGA 2IEZA 3B78A 1J70A 2IYWA 1RJ9A 2JA1A 2ONKA 3CPJB 4RCYA 3QXSA 1XEWY 3SI7A 3REFA 2JLZA 1I4LD 1XX6A 1GKUB 1KO7A 3IGFA 1E3MA 2UKDA 4LBWA 2O8CA 2IYLD 1XTIA 2CK3D 3CRRA 3E1SA 4NU0A 4AKIA 1SVKA 2F1RA 4KAXA 4WAUA 1R6BX 1VIAA 2W2TA 3LV8A 3RRZA 4G5QA 3PUVA 2C5LA 5C2JB 1Z0DA 3NBXX 2BDTA 2ZIAA 1P2TA 1JXOA 2XZOA 2F43B 2RHMA 3CONA 3NVAA 2HXSA 3BOSA 4H9GA 4IW3B 4L4UA 1W2GA 3PUWA 1VHTA 2RH5A 3IO5A 1SKYE 2BHRA 1U81A 3S1AB 3LAWA 1CP2A 4TLBA 4WXRA 2JLRA 3ZZ0A 2CHQA 4C0KA 1UEJA 5C1BA 4KCGA 1EX6A 3RABA 4Q66C 1T0JB 5DHFA 1J7KA 1KAOA 2ZI7A 3FOZA 2J0QA 2QP3A 2DB3A 4NYJQ 4DJTA 2ZUCA 1U8YA 4AWXA 1G18A 3IPXA 3P4YA 4D4KA 1GKYA 3TNFA 4BLPA 2PJRA 3SJBA 2D62A 3R20A 5J4KA 5AUQA 2EWVA 3RS2A 4TL9A 2CDNA 2A5GA 1BMFD 1OXVA 2FU5C 3CR7A 4JLAA 4RD4A 3LY5A 4UJ5A 4I1UA 3WRXC 1G5TA 2WMNB 5IK2A 1R0WA 5FBWB 3O8DA 3KXLA 3B1XA 3P4XA 3KFVA 3GD7A 5BYJA 4E5UA 1I2MA 1ZNXA 2GBLA 2YOFA 1DOAA 4D4JA 2ATVA 4M1YA 5G53C 5KU1A 2QUZA 4JKYA 4DLSA 2C95A 1X86B 1XZPA 1GIAA 3NBZC 3K70B 2JDID 4DRZA 3C4JA 2F1HA 2XOKA 1DELA 2XSZA 2ZSAA 1GAJA 2ZSFA 1R8SA 4PSVA 4ZI2A 3DM9B 2O8CB 2R6CA 1IN7A 2HF8A 4LHZA 4JSYA 5FBQB 2GZDA 3AV0B 3BXZA 4XJXA 1GP2A 4RJLA 1G8HA 1LS6A 2WJJA 1MKYA 4HAYA 2QMEA 2RCNA 3VFDA 4B34A 2J0SA 2QAGB 1EFCA 1FUKA 2QBYA 3SBEA 4PHHA 4C3ZA 1QF9A 4NYIQ 3H84A 4B48A 3Q7PA 3CNOA 3TW4A 1P3JA 3TSZA 5B57C 3RS4A 2JLXA 3IUYA 4NCJA 3W5IA 1U8ZA 4FMCB 3MWLA 3C5HA 4DEXA 2QSZA 3UATA 4F38A 4AURA 2B92A 3VR3A 4MYUA 1F6BA 1E2KA 3OZXA 4YMWA 1H8EA 5JBQA 4C7OB 1KDOA 4BLSA 4LZZA 4OYHA 3QXHA 3T61A 4BFTA 4S35A 1U0JA 5EE9A 1KDTA 4M8NE 3HWSA 1QHHA 3VKHA 2QTFA 2OFWA 5CK5A 4M1KA 3FVQA 1IN6A 4FN5A 2RGDA 4DLXA 3MWJA 3GJ8A 3Q5EA 3A1WA 4IOLA 4NP6A 4FXPA 4PAQA 2IUUA 1XMJA 4ESHA 2O8FB 2F3RA 3MWKA 3CW2A 1SQ5A 1ZCBA 2GK7A 2HXYA 4C4PA 2ZRPA 1GVNB 2ZJ8A 4LX0A 3CRW1 4ZCMA 3LQRA 1G7TA 2ZI9A 1GM5A 1UF9A 3HR7A 1NP6A 2VQSA 4BE7B 4A4DA 1IONA 3IDQA 4A2QA 5HR5A 2NO6A 3I92A 4WZAE 3RVBA 4F4JA 4F4IA 1XEXA 2XX3A 4MRRA 1M7GA 4KSBA 3MFYA 2CCKA 3BD9A 3A58B 3BE4A 4P4TA 2VSXA 3H86A 4HZIA 4YDSA 5HCNA 2ZRJA 1YRBA 2NPFA 1DAMA 3D8BA 2YNMA 2VA8A 4PAMA 2FX3A 2HYDA 5CYPA 5BN4A 1Z63A 2HT6A 4MA4A 5GJBA 1DAKA 4KLZA 5DN6D 1ZM3A 5EQTA 2WKPA 3I62A 4B75A 2IA5A 4POAA 3SYLA 3D31A 3U3KA 2RAPA 5AUOB 1M2OB 1FFHA 4KFRA 1E99A 1UKVY 3X1YA 1N3BA 1SXJC 3OHMA 4V0NA 4JLMA 1GNPA 4KYIB 4L16A 4BEBA 4TTQA 2O8DA 2CHVA 2QRNA 2V55B 1UKEA 3SNHA 3MSXA 1DG3A 3DHWC 1KK0A 3GLIB 1ZRHA 3NH9A 3SQWA 1IM2A 1US8A 3TJZA 2ZJBA 4EFLA 2FA9A 5D3QA 4D4LA 2ZU6A 3MLEA 4ZDJA 1MABA 3RRMA 1XEWX 4LI0A 5K8UA 5D3MB 3MMPA 1W49A 1TAGA 2AD5A 1Q3HA 3TK1A 4M9SA 1EXMA 5JHGB 2Z4RA 3KKNA 3KQUA 3GJ3A 4LUCA 2N46A 3QVUA 5P21A 4Z51A 4NMMA 5AJZA 5EP2A 4V0LA 2ZR9A 3R9IA 2R62A 2JLYA 5E7MA 3QKRA 3T5DA 1G3IA 2BBOA 4HB0A 4IFEA 3WMEA 1I4DD 1W36B 2GEUA 1FP7A 1OW3B 4UXJA 1RC8A 3RC8A 1GOTA 1E2GA 3NXSA 1KY2A 1XTJA 4QGAA 2QP4A 5JWHA 3W6OA 3KTAA 2IS2A 3LNCA 2WWGA 3OIWA 2FPMA 2WJVA 2YV5A 1QZXA 5LB2A 5EUQB 1RRCA 1DS6A 2XNDD 2VHJA 4KJZA 3QSYA 1DAGA 1G1MA 4LYJA 4Q1FA 5EE1A 4HEJA 2ERXA 2JJ2D 1OHHD 3QKTA 1OH7A 4CEHB 1J90A 2BBSA 1JAHA 1Q20A 1W0JD 1NVVQ 3KKMA 5FBLB 1YE8A 3IBGA 3QIAA 3TQFA 4AG5A 3F5FA 2QTVB 4FWTA 5HZHA 4I99A 3IHWA 1GITA 5CIWA 5EXSA 1Z29A 4FW9A 4RZ3A 1UJ2A 3TKLA 4B6EA 4G3XA 3BB3A 4EFMA 2UZIR 4ILEA 2JIZD 1TQ6A 1W4RA 4BQSA 3SC3A 3TVDA 4FMDF 4S2EA 2C98A 4A2WA 5B30A 3GJ5A 3WP0A 3MUFA 3K9HA 1TEXA 1IQPA 4DLWA 2ATXA 4BFSA 2ODBA 3U4QB 3FGNA 1IXZA 3GLHB 3NH6A 3DZ8A 3WXMA 1F60A 4I1VA 4A92A 2WSMA 3B9PA 1X6VA 1Z0JA 4K46A 4JMPA 5FUXA 4W9MC 4Z1MD 1TU3A 4EPRA 3K53A 4KLNA 4JVLA 3X1DA 3AF3A 3EIQA 3CH5A 6Q21A 4IVQA 1D9XA 4LBYA 3IIJA 5CB6A 1XEXB 4HAUA 4G01B 3PUXA 1R4AA 1VYVA 3CZQA 2JASA 2QY9A 1GL7A 5HKKD 2NPIA 2QN6A 3RRNA 3P20A 3V4FA 1G41A 1SVIA 4X8LA 3QEOA 4DSUA 2YHSA 1OB2A 1KYIA 3ZYCA 3TW8B 1XD2A 4C2UA 2PH1A 2QT0A 5E7JA 2F1IA 1A82A 5FPTA 2OHFA 4KHZA 3OIYA 1EWQA 2B7BA 3L82B 3PUYA 1N0VC 3CH4B 5KOYA 1EFRA 1KI1A 5JCZA 4CEJA 4M1TA 1VCNA 2CE2X 4P0TA 5DYIA 4A0GA 5L3QA 1GWNA 3F0TA 3DOEA 3QENA 3HYRA 2V6IA 3B8HA 3LFUA 4EDHA 3TGPA 4M1OA 4FCVA 1CBUA 3GPLA 1D2NA 1JR6A 1XJQA 2JAQA 5HE8A 1CRQA 3NWJA 1JNYA 4HLDA 2N1BA 2A5YB 5JEEA 1II8B 3NBFA 4B43A 1PZNA 3NC0C 4OI1A 5EJEA 4US2R 2BMJA 1IOZA 2XTNA 2XB2A 3ND9A 1H8HD 2ZRGA 4C30A 4AYXA 1YU9A 1EWRA 2OFOA 1TX4B 1TNDA 4XVUA 1BYUA 4OL0A 4LK2A 4HUTA 2Q21A 2ZYWX 2WWYA 4ZI3A 4GOJA 1H65A 4B3XA 4HB3A 1FMLA 1E2DA 4URZR 3AGPA 4P31A 4DKXA 1NVVR 4ZCIA 3HP1A 2WICA 2QSYA 4PC6A 1AM4D 2Y8EA 2ZRBA 5BN5A 4QHYA 2FGJA 2OM2A 3TUZC 1US8B 1HT1E 4WVFA 3WYGA 4AIIA 4CIDA 2VP2A 3KUCA 3UMSA 1KGDA 5EP1A 4EPYA 1OXTA 3QXJA 1E6CA 2XOKD 4E07A 1HTWA 5DGXA 1KKMA 3I8SA 1Q1EA 4WZ6A 2EYUA 2ZPTX 5JJLA 3K70D 3T15A 1OLOA 3ZJYA 1M7HA 2RGNA 2W6JD 4TWZA 2PX3A 1COWD 4A8JC 5BYKA 1E2NA 4XWAA 1GRNA 4EJSB 4O2RA 3DMDA 3F3YA 4HAZA 2PCLA 3WRYC 5IDVA 3OFNA 4XVRA 3N2IA 3KZ1E 1WA5A 3PG5A 3A37A 4LJ6A 3K0AA 1OT3A 3B60A 4OHWA 1XBTA 3U7FB 1BMFA 2I4IA 5E4FA 5SZJA 4D26A 1KNQA 2H1LA 1ZVQA 4OHYA 1GKIA 4D0GA 4MDFA 1E69A 1OXUA 2B7CA 1WB9A 1WCV1 1KI2A 2B21A 3X1WA 1Z8FA 1LF0A 2QNRA 5G3ZA 4URVR 2HUPA 2IHYA 2IS1A 2NIPA 1Z0FA 5SZIA 3K9GA 3EZ6A 1HQYE 4US0R 3HU2A 4CVNA 1E32A 3TVTA 3I72A 1Q21A 2HJGA 1E9EA 3GLHE 4B44A 3K9LA 5IRCD 1ZU4A 2VSFA 2OBLA 2ZS8A 4AY2A 5BN3A 2Z43A 3LW7A 1KNXA 2XJ9A 5KTYA 4DUGD 1TQDA 2YJTD 3PENA 2FG5A 4TSFA 2AN9A 4RKFA 2NZ8A 4M9XA 2ZVQX 1ZM4A 3EIEA 1NN3A 1G4UR 2F43A 4AG6A 4TLEA 3ND8A 4JZKA 3SEAA 4OHZA 2WKQA 1XXHB 3LVRE 4H1VA 3TLXA 3PIRA 4IVPA 3U4QA 4A36A 1AGPA 1OKKA 4CEJB 1K6MA 2R6GA 5KSPA 1D2MA 2FWRA 1MT0A 1NF3A 1HQCA 2VP9A 3B1ZA 3QQ5A 4L9SA 3LWNA 4Q1CA 4EQ6B 3QVVA 2F9MA 1AKEA 4IDPA 1CJKC 3KKOA 4C0AC 2IK8A 3I32A 2P6RA 3EA0A 2CL6X 2Q6TA 1NRJB 1ZD8A 3EAQA 1XF9A 3ADDA 4DT1B 4JLJA 4LPKA 4RFSA 2OE2A 5SZKB 1E2FA 1R0XA 2O8BB 1KSHA 2GXSA 1V5WA 3LX5A 3SFZA 2XAUA 3AEZA 3TR0A 3QKSA 4HDQB 1G3RA 3NG1A 4UNPA 2NO7A 2NGRA 2IYZA 1X8JA 4A6XA 2OCBA 1P61B 2PLFA 1ZD1A 2AD1A 2CL7X 2Q3MA 1ZUIA 4MYTA 3K0FA 1NVXQ 5C46F 1E2MA 1RW4A 5KPDA 3BERA 3TMKA 3B13B 1UAAA 2BC9A 1GZSA 3NHBA 4LWZA 4FI3C 4ASUD 3WYAA 4LC1A 4LBVA 3CIOA 2I1QA 4JVMA 5CIQA 3C7KA 1IY0A 4ASUA 2CK3A 2WBLC 3WMGA 3DMNA 1WQ1R 2K5UA 2GESA 2LWIA 2QENA 3FYHA 1YR9A 2FNAA 2BBWA 3HU3A 4NYMR 4JVNA 4Q1BA 4QBIA 1TU4A 2PEZA 4RFSB 2PMDA 1IXSB 1NN1A 3M6AA 1CJVC 2DHRA 4HLUC 3IILA 3CB4A 1OHHA 1JR3A 1YHNA 4PC7A 3RS3A 1T3HA 1G7RA 2Q3HA 2V8OA 1LS1A 3QPWA 4A0HA 3R8CA 3GLGB 1VDZA 3T12A 4UNQA 5C4MA 3V9PA 3I73A 3SJAA 3KTAB 1ZM2A 5TVKA 1N6KA 3T1VA 4PFSA 4RZUA 4E03A 3U61B 3ICEA 1DE0A 4QG7A 2HT1A 3QXCA 3BFVA 3RDPA 1NSTA 1KI4A 2FPKA 3WP1B 2O0HA 3LD9A 4RY2A 3SJZA 2IUSA 2O8DB 2EFCB 1OKKD 4GOXA 3R8FA 5TY0A 1SVSA 3HR8A 5KDLA 3OAAD 3KQKA 1HH4A 4JBWA 1DAFA 1KAGA 2GZAA 4KVGA 3C14C 4URUR 3GJ4A 1P2VA 1N6OA 3K8YA 3NKVA 4Q7JB 3HYTA 4HLQB 4BRUA 4D25A 3KJIA 4V0OA 5E3HA 3SQXA 1C9KA 3K0CA 3DM5A 1O87A 2C78A 1XD8A 4Q00A 5GJVC 3AVYA 2ZJZA 1U94A 2XB4A 3UWKA 2H7VA 1F2UA 2ZE5A 3NIBA 4Q48A 4EPTA 4DUGA 4CGZA 3BWDD 3FHCB 1JB1A 5AJVB 3FMOB 1NI3A 2CXXA 5BW8A 1PLJA 4QFMA 4R98A 2O8EA 2GK6A 1RRGA 4TL8A 4OI4A 5L3SB 1IY1A 1MO6A 3A4NA 4DC9A 2VLIA 2VYFA 3ZZUA 4C0BA 3SZRA 1IAQA 4MKIA 1W4CA 3N5CA 5FPHA 4DLZA 2RGCA 5CM9C 4G0NA 3QF4B 2YC4C 2NO9A 1N5KA 4EJSC 1J8YF 2BJVA 3LW8A 1LNZA 5DYGA 4PHTA 2V6JA 1TUEA 1CJMA 2O8FA 2H17A 5JSZA 1P9WA 3THWB 2W0MA 2BVNA 3E5HA 1Q22A 4B3GA 1UDWA 1QHHB 1F3OA 1P72A 2LCFA 4PANA 3VAAA 1R5OA 4GPTA 1II0A 2GCOB 3L0OA 4AYTA 1VG0B 3SHWA 4NCHA 3OEHD 2WWHA 2BBTA 4CEIB 2A5JA 4IEEA 1R0YA 4KO8A 5FI1B 1FX0B 4XSGA 3ZGXA 1CR1A 1SXJD 2CLCX 3QBVA 3HU1A 3BFXA 5JCPA 2CL0X 1E0SA 1LFDB 2ZRHA 4JYCA 1G16A 2J41A 4KODA 3L0SA 3LVQE 2F9LA 1D6JA 2W6ID 3BIFA 1NNEA 2P6UA 1ZM7A 4G5GA 1Z0AA 4Y0AA 1YZNA 5EUMA 4M9QA 4TYQA 1YJ5A 5B58C 3LX8A 3GCGA 2Q9AA 2JLVA 2P5TB 1Q1ZA 3Q9LA 4OHVA 1MO3A 2FH5B 2ZRIA 4ACBA 1GFIA 2RGXA 3ZVLA 2YZ2A 4Q47A 2OESA 1XFAA 3EZFA 3NDBB 3AKYA 4NONA 2ONJA 4KITB 3TE6A 4Q1DA 2J59A 1KMHB 4AD8A 2QEQA 1H8ED 1UM8A 3W90A 4TLDA 3A4MA 4P4SB 3Q8XB 3OE7A 2WJYA 3C15C 4C2TA 3I4LA 4D0LB 3CRVA 3UIEA 1QHIA 3H1TA 3CZPA 4R71A 5KUTA 1P62B 1DVRA 4P4SA 2OCPA 3QBTA 4XIGS 1TQ4A 3TSOA 1RZ3A 5JLJA 2VEDA 1G8YA 1R5NA 5FL7D 1N0WA 1OFUX 4Z8YA 2Z6VA 4LHXA 1YKSA 3U44B 5F3WB 2G1KA 2JLQA 4Q9IA 5J47A 4JKIA 3LXXA 1EK0A 1JPJA 2ZRCA 2BIFA 2PLRA 2YOGA 4K81B 3T35A 1KDRA 4JLBA 5L3RA 1AS0A 1GTVA 2G0TA 2R44A 2XSZD 5EP4A 2ORIA 1SGWA 4OQLA 3SOPA 2NG1A 2KJQA 3DO6A 4OI2A 1KJZA 4HB2A 2DWQA 2VP0A 3FPAA 4NH0A 4QOSA 2AWNA 2QP9X 4H1UA 2Z5FA 3THXB 1G6OA 4KVAA 5GVRA 3K0AB 1RPZA 4HUQA 2V9PA 3GJ7A 3AF4A 4KSCA 4TLCA 2J46A 4II7A 2CLSA 2YKGA 1K5DA 1Z47A 4PPFA 4DSOA 721PA 3GLHA 3LRPA 4JBXA 4BFUA 5G3YA 3BH6A 3PJRA 3AVVA 3FDIA 3PXGA 1W7AA 4B73A 4B3CA 4HZUB 4L9WA 5BQ5A 1P75A 1RKBA 4IKEA 5B2ZA 4AI6A 2FF7A 4IEIA 5EXPA 3EARA 2WM9B 1JR3E 4LV6A 1TPZA 1HYQA 2ZJOA 3CNNA 3VX3A 4LV5B 2ZANA 1HY3A 3QUSA 3WNCA 4FCTA 4TMXA 1N6HA 4TT3A 1OH5A 1W44A 2OUKA 5K8IA 3NBYC 4A1FA 3O47A 2EQBA 4OBEA 1E9RA 1TADA 2W83A 1KHTA 1UBFA 3F8TA 1ZMXA 2TMKA 1Z06A 5CK4A 4OQNA 3GLGA 5AK0A 3AUXA 2X1VA 3AVPA 4GOKA 1GRQA 2ZRDA 3U44A 3RANA 4B3FX 4CEIA 4O25A 2PX0A 2QM8A 1ZP6A 1ZYUA 4QRHA 3B85A 5F9HA 4L5BA 4B3BA 3EZ2A 4PO8A 5AJWA 5JS7A 3SDZA 3UMFA 3UXMA 4BFXA 5EZ5A 2REXB 1J8MF 2FSFA 2VF7A 4GL2A 1UPTA 3RHFA 1VG8A 1VYTA 3RAPR 1YVDA 3QOFA 5A0FA 1QG4A 3IKJA 4MH0R 2JEOA 2P67A 3WNDA 4EFNA 1EESA 1DTSA 4PAOA 1X1SA 4EAQA 1CXZA 1G3MA 5AWFC 1R0ZA 4DDVA 2ORVA 1QDEA 1U2RA 1EFUA 4URWR 3GEHA 4LJYA 4D0NA 2ZETA 2IYVA 3K0FB 3GLFE 4LJAA 1E9BA 2ZAMA 1BH2A 2FZLA 5EXTA 2GCPA 2IS6A 4QHTA 3WHLA 2QMOA 4F92B 2CCJA 1FTNA 1X8LA 4OK5A 1T9HA 1VYUA 4AK9A 2O0KA 1U0LA 4Q9LA 3SHFA 2R6AA 4OK6A 5H68A 4DZZA 4KU4A 1XRJA 2IYSA 3T34A 2WV9A 4DLVA 3AKCA 2R2AA 2IYQA 3EA5A 3QG5A 3RWOA 1AZSC 1S1MA 1NMYA 1AS2A 1ZD9A 1T3LA 3A6PC 5D3MA 2ZQ5A 3QKSB 2KWIA 2W0SA 5HTKA 3IHLA 1YZLA 2HLDD 1H8HA 1EGAA 5DH9A 2AHOA 3I61A 5IT5A 3L43A 2AKYA 2PMKA 1IHUA 3BAFA 1G8FA 5K8TA 3K0EA 2ZE8A 3RRYA 4L15A 5DN6A 1PLKA 3GLFA 2FPLA 2AK2A 2OILA 1W36C 3MJRA 2P5SA 4BFVA 4KXFB 1S1CA 4DDTA 5DO9A 4M1MA 4JT4A 1U99A 1DO2A 4F93B 3B6EA 3OF5A 4TSFD 3OEHA 3ZQJA 1AK2A 4PC3A 5LB4A 4DXAA 1GG2A 1CR2A 2V4ZA 1ZU5A 3FMPB 1D8TA 3B9QA 4X8OA 3KDSE 4KFUA 4Q4AB 1G17A 2D2FA 3U3OA 2CEAA 3KJHA 2DWPA 3WMFA 4DWJA 4B71A 2YVUA 3OAAA 1NBME 1T5IA 3PR1A 4BECA 3CPHA 2EFEB 3IBYA 1DAHA 2WJGA 4A2PA 2LKDA 3KL4A 2HDNB 4LYHA 3WNBA 2C99A 4DSNA 5J4VA 2F55A 2J0VA 2R6DA 1ZUHA 4QBFA 2A78A 2IYRA 1R5BA 2QAJA 4TTPA 5IF9A 1CKEA 1JEDA 1E1RA 1G7CA 2BV3A 3OIUA 2VP6A 1JR3D 4YMVA 2OAP1 4ON9A 1PUIA 1YZKA 4NYIR 1NY5A 4PO9A 5FOWA 4GP7A 4PZZA 3LDAA 3P27A 4XWKA 2ZRNA 3I5XA 2QROA 2QL6A 1HA3A 1TF5A 4N0EA 4PR0A 4JLOA 2MMGA 4BFWA 4NPHA 4DDWA 3EIHA 4Q1AA 3CRMA 1MRSA 1OIWA 1SXJE 2ECKA 5FPKA 5JZVA 3B82A 3RSLA 1BS1A 4EPXA 2BM0A 1CU1A 2V7QA 1KMHA 2JATA 1CR4A 1JJ7A 3CF0A 4B2PA 2Z0MA 1E9DA 4ZCLA 4D82A 2R6FA 3EZ9A 4BZXA 1YZTA 4RD0A 2ZSBA 5JHHB 4M1SA 4TLAA 2OO7A 2QPAA 4PHGA 5FOVA 4B33A 1AIPA 1Z3IX 1FQKA 5F2EA 3UANA 2WSSD 4A8JB 1P73A 2IC5A 4EUNA 3THXA 4QJ3A 3K0SA 4R9UC 3AVUA 4B3DA 1N6RA 1WP9A 3D3QA 4PZLA 4LJ7A 2ZI6A 4HB4A 2WAXA 4ZO4A 5EXXA 2AR7A 1F2TA 4JYBA 3VMFA 5KDDA 1HURA 3U7EB 2FFBA 3AF1A 4Q9KA 3IPYA 1KIMA 2XTZA 2ZRFA 4R7ZA 1XMVA 2AL7A 1XP8A 2GBLC 2ZRKA 4ARZB 4BASA 5KSZA 1HT2E 3C16C 4DLUA 1ZUNB 2J3EA 2AX4A 1W2HA 1BOFA 1OYYA 3K9NA 1G9XA 1ESNA 2J7PA 3PEUA 5EP3A 2PCJA 4CT4B 1A5TA 1GL6A 1DBSA 3THOA 3IEUA 1WRBA 3FB4A 2FMXA 4MUAA 4QGHA 2ANCA 2GNOA 2ZR0A 4TN1A 1Q3TA 3OEED 4R2HA 2GXQA 1M1YE 2PJZA 3VR2A 2VH5R 1UBCA 3U6BA 4TZ6A 4Z8XA 1ZBDA 4FD2A 2RB4A 3UK6A 2OAQ1 2WZQA 5J4LA 2QM7A 4IXMA 2NZJA 4JSTA 4TQUS 3VHXA 1N5IA 1IBRA 3C5CA 4YLGA 1UFQA 1FL9A 1OXSC 3B1WA 5AR1A 1G20E 4IFBA 4Q9JA 1JQLB 1EX7A 2G1JA 2ZEJA 4Q5IA 4YXWA 2L0XA 1IJFA 3W3ZB 4GT1A 2FSGA 5LDDC 4PQYA 2O8BA 4FMCF 3LXRA 1XTKA 2E9SA 1X3SA 4BEJA 2VBCA 3ZLJA 2CNWD 3JVUA 1KY3A 4IDHA 5CJ2A 1NVWQ 4LHWA 4FCWA 3OFND 3TAUA 1JECA 4BFZA 5JWOA 1W0KA 3FWYA 4O2LA 3ONWA 4Q4LA 3ZH9B 5LD2C 1DAEA 1S8FA 2JJ8A 3SU8A 2GF9A 1EFTA 1S2MA 1GNQA 4LJ5A 3ZIAD 3WHKA 4JL6A 2CVFA 2DFTA 2GCOA 1NMXA 4HATA 3DVLA 1P2SA 5CJPA 2V1XA 4ZDWA 1ZC3A 3CBQA 1FNNA 1OFIA 5C18A 2ERYA 2FEMA 2WOOA 1LY1A 1Z22A 4U02A 1KO8A 4JLPA 1G6HA 2G3YA 2OZEA 2FSHA 1XCMA 5HZKA 2DYKA 4QC2A 5AUPB 1L8QA 1PV4A 1XD9A 1SXJB 1LF5A 2GKSA 1PJRA 1DAIA 1JAIA 5B64A 2VHCA 5FL7A 2ZI5A 1II9A 3WY9A 3FKQA 3ZS8A 5H1YA 3GLGE 3AVOA 3OEEA 1QHGA 2V7QD 2ZUBA 2OCAA 2ZTSA 2G6BA 2PBRA 2CCGA 2YWFA 3RWMB 2LKCA 1KO1A 2ZJYA 4DSTA 4OKSA 5FTNA 3FTQA 1JXMA 1BYIA 1KO4A 5DI3B 3RYTC 3FHTA 1M6NA 1E4VA 2QPTA 1KO5A 3SYKA 2G77B 1G4AE 3BRWD 5GJWC 3U3MA 2H57A 1Z6GA 2GWHA 2DFLA 1S4QA 4RD3A 5J5CA 4TYWA 4U5XA 4V0ME 8OHMA 2ORWA 1XD2B 1G3QA 2AK3A 2BWJA 4CF7A 1XPUA 4C0SA 5E95A 1E98A 1VTKA 3AQ4A 4M53A 121PA 3KFXA 2OBNA 4QXAA 4LCBA 4M0LA 4A82A 2KBEA 4YQFA 4AKEA 2IX3A 1XPRA 4RZ2A 1WE2A 2WWFA 4CEHA 3KQLA 3CNLA 3VNVA 4Z54A 2DY1A 1EFHA 2BJWA 1NLZA 2A3RA 3I8XA 2B6HA 1J99A 1RJ9B 2EFGA 3RSOA 1EFRD 5FBRB 2JLSA 2DFKB 3A1UA 3AH8A 2ZVPX 2HV8A 3KJGA 5DLQC 1KKLA 1XZQA 3D7MA 5J40A 2EVWX 3J81k 2GF0A 3R9XA 2XNSA 2ZREA 3Q7QA 5TARA 3BGWA 2O52A 3PCRB 4TQ9A 4W5HA 3RS0A 2ODEA 3B1VA 1N6PA 2WVJA 2RGBA 3VX4A 3LBNA 1G19A 5EE5B 3BBPA 1UKYA 4DB2A 2GETA 4GI7A 3IO3A 3P32A 1M8PA 1SVWA 1U9IC 2IYXA 2KB0A 3ZVMA 2ZROA 2AXNA 4Q1EA 2UVQA 4U00A 1XB2A 4DHEA 1CULC 5FTMA 2C77A 2WPDA 3A8TA 4PC1A 4EQ6A 1RYFA 4WIAA 4Q7MB 2N42A 4C0JA 1JEEA 2IUTA 1E2QA 1ZNWA 2VIIA 3DEFA 3CLVA 2A7QA 1S0UA 1TUIA 2QQ0A 4LHYA 2W2VA 3THYB 3AB3A 1W47A 4FWIB 3JZMA 3MD0A 4PX9A 4TL7A 1CR0A 4A9AA 3W5JA 2ZSEA 1AKYA 1CJUC 4URXR 5A5GA 3QPUA 3T1OA 2OG2A 1K8RA 4Q19A 1AS3A 2XEXA 4MRVA 2H5EA 2CBZA 4XTRA 2JIZA 1NY6A 5FI0B 5UKDA 2G9NA 5TMPA 1E94E 2J87A 5FOTA 1VCOA 4N0DA 3SN6A 4RD1A 2DWOA 4QKQA 1O3YA 2XTMA 4FMDB 4WXPA 3MJHA 5AJYA 3X1XA 4DDUA 4GZMA 4IXNA 5JJIA 4DCUA 4RKEA 5FUWA 3ADKA 4PPNA 3LA6A 4NTZA 3S1AA 4LYAA 1UKZA 3HPRA 3GEEA 3UG6A 1GILA 3WBJA 3A1TA 4HDCA 4C0LA 5JRJA 1U98A 2H8KA 4LY6A 1G291 1HE8B 1E9SA 4ZDKA 3B7GA 3VR5A 1S3GA 2C9YA 2FFQA 3QG1A 1WDTA 3R7WA 5GVSA 2ZRMA 3ADBA 4PZYA 5A4JA 4Q9HA 4JS0A 1KSJA 3R9WA 1R7RA 4Z1MA 2ZJ5A 1Q1BA 4EIWA 2OLKA 4HAVA 2FZ4A 4DLRA 4B74A 2D3WA 1Z6XA 1ONBA 2R9VA 2CHGA 5HPYB 4JLNA 4GFDA 4NZYA 5JEDA 1XPOA 1N5JA 3PEWA 1KTVA 2QU8A 5CDFE 1B0UA 1UBGA 4LYFA 2OLJA 1OJLA 2WIBA 2WAYA 1E0KA 3W6NA 3BFKA 2GTPA 2IF2A 4PQRA 3ZS9A 4E22A 2PL3A 3AGQA 2FDCA 1P2UA 2WWWA 4NCKA 4EPVA 3THYA 3G0HA 2AFHE 4CT5A 4TYPA 621PA 1ODFA 1E79D 1TF7A 1KK3A 5AUNB 2BEJA 4YMUA 3U7GA 1OF1A 3FE2A 3AP1A 1QG2A 3EPHA 2J5XA 3CF2A 3H2YA 2RHDA 2F7SA 2XNDA 3BC1A 4GP6A 3A1VA 2X2EA 4PSAA 1L7VC 1T6NA 4KBGA 3AVTA 4CW7A 421PA 1NSFA 5H8WA 1BKDR 2DPXA 3P1JA 1VCIA 1XJ0A 2WIAA 1XXHA 3DDCA 5KO2A 2VPPA 3M0EA 1VKJA 3N2EA 3PQCA 3GJ0A 4Q01A 3EZ7A 2IEYA 1KJWA 1JPNA 1E1RD 1EG7A 1FX0A 2D2EA 2FGKA 2HEIA 3E70C 4BZPA 2WPDD 1NN5A 4CYMA 3AVQA 3T5GA 1Z2CA 1AJEA 1U9IA 3QF4A 4QBGB 4NCNA 5FTLA 1XCGB 3VTKA 1YR8A 2VL7A 1E0AA 5CDFA 2P3SA 1W0KD 3ASYA 1ZNZA 2G88A 3CO5A 4I4LA 2J0UA 2PZFA 3QNUA 2BKUA 1V43A 1S96A 3Q3JB 4A0RA 3W34A 1SULA 1XTRA 3KB2A 3VR6A 3THWA 3AP2A 3HJNA 4MGZR 1T4GA 2HCJB 1KJYA 4Q03A 221PA 2ZAOA 2C8VA 4MYCA 2W58A 3UPUA 1Z5ZA 1RRPA 2C9OA 4KFTA 1KZ7B 3WYFA 5H70A 1ZIPA 5FH9A 5FUYA 5ANRB 4MDEA 2NOAA 3ZDQA 1MRNA 1KI8A 3H0KA 2ZI4A 4C0HA 1OH8A 5TV2A 4NHOA 3FHOA 1AQYA 3PUZA 1KK2A 5E7IA 1OH6A 4BWYA 4ZIRA 5CM8B 4XVQA 1ZAKA 1VG9B 3QI2A 2GA8A 3AP3A 3GMTA 1M7BA 2GJ8A 2GJKA 1L4UA 2X2FA 1G7SA 2FFHA 2UZ3A 2C9CA 2FN4A 2QAGA 2PT7A 1FOEB 2H92A 5KPJA 1BO6A 4ERNA 1M34E 1NKTA 2VF8A 2PEYA 1DARA 1ZIOA 2ZYTX 2Z4SA 2ZXUA 3ZD6A 2ZM5A 2QT1A 3EASA 3TSWA 4UKDA 2IYYA 2W6JA 4BLRA 4JLVA 2RMKA 1Z2AA 1CIPA 4FIDA 1NLFA 1U0HC 5KSYA 3X2SA 3AM1A 3DKPA 1CJTC 2MMCA 4TMTA 1OFHA 1ZW6A 1RFLA 2GZHA 4QHSA 4Q4AA 2WSSA 4M1WA 1UADA 3BH7A 1GUAA 1NG1A 5DE3A 4EPWA 3BH0A 3EPJA 3C8UA 1OFTA 4TQAA 4BPBA 2RGGA 1P60A 1S9HA 2A5FA 4FINA 1A4RA 4V02A 2V1UA 5FBVB 1NIJA 1G8GA 2BEKA 3MRSA 821PA 4ZDIA 4TTRA 3ASZA 2AFIE 3WBKA 5LD2B 3FMIA 4F4CA 3W6PA 1E9CA 1W46A 2P6NA 1C1YA 1P6XA 2CJWB 1MOZA 1Q57A 2OEPA 2GEVA 4KBFA 5DI3A 2IXGA 3GQBA 1DG1G 5L3SA 3B5JA 3ZQ6A 1X1RA 2AXPA 2D06A 1JBKA 1QVRA 2JGNA 3REGA 5FR1A 3L8ZA 1OV4A 2ZRAA 4GBMA 3X1ZA 5EZ6B 4QNMA 2C03A 3PITA 1LW7A 2YWGA 4GSYA 1SZPA 1W1WA 3EWAA 1F5NA 4HI0E 2IWHA 1QHNA 2IBMA 4V0KA 1YQTA 5HE9A 1KMQA 2OT3B 2GXAA 1U90A 2QGNA 2F6RA 3U7HB 4MRSA 1W4AA 4BLQA 3QJYA 1FMJA 2NMVA 1GDDA 1GSIA 3MCAA 3VU9A 1AA9A 1Z83A 1IN5A 2VP4A 4RD6A 2O8EB 1FPMA 1MR3F 2G83A 3TIFA 2RKOA 5JI2E 1OYWA 4TMWA 4HSEA 4W5WA 4IVRA 4MITA 2WWIA 3QF7A 4YMSA 4TT3D 4X8MA 2QZ4A 4KFSA 2WKRA 4CZ2A 2DR3A 4IOKA 2R65A 2WOJA 1DADA 2QTHA 2QG6A 1XTQA 2ZYUX 1CEEA 1FZQA 2QPOA 1Q12A 1E2IA 1G3UA 5F9FA 1TMKA 2BCJQ 2OV2A 4QM6A 5HKKA 5TXGA 2OCYC 4IHQA 1OIVA 1ZINA 1TQ2A 4B47A 2IHBA 1XMSA 2JJ1A 2EU8A 1ESMA 1OE0A 2DBYA 4A8JA 1OB5A 5IK2D 3TBKA 4QGGA 2VHQA 3EX7C 3VR4A 3U6KA 5JI3E 4MQBA 2H18A 4F7WA 2QORA 3AKDA 1FW6A 4KV9A 2X8AA 3O8CA 3K09A 1YR6A 2HLDA 4UJ3A 4NBSA 3EPLA 4OJKA 3KJEA 2KI5A 3MWYW 4M22A 1U8AA 3MG9A 5FOSA 4URYR 5FTKA 4NYMQ 2ZU0C 3BJIC 5SZHB 3A36A 1KSFX 3LH5A 1AZTA 3GLIA 4BUJA 4BRWA 4DB4A 4HAXA 3AVWA 1MO4A 4PSKA 1A7JA 1N6IA 2JLWA 3QXXA 2B8TA 1YZQA 2A9KA 1W5SA 4TZ0A 2EWWA 1E2LA 3CKLA 5AJXA 3K09C 4OI0A 3GJXC 4Q02A 3IEVA 1W0JA 1P7CA 1KI6A 3IIKA 4ACAA 4MRNA 2JJ2A 2YWEA 4XD7D 4UXIA 1XJCA 5FPSA 1ZJ6A 1E1QA 1QHYA 2QRZA 5FOXA 2OFXA 1SKYB 3BORA 4RCZA 1CRPA 1Z07A 1JQJC 2ZJ2A 4RFVA 4O0MA 1N25A 3AF0A 2KBFA 5L3QB 1NVUQ 1N0UA 2ASEA 4PXAA 1NJFA 3QKRB 3JVVA 3ECCA 4YDHB 4LOAA 1RVDA 4HLCA 4DIDA 4JIMA 4D80A 2GAOA 1I4TD 4MKFA 3U2QA 3UMRA 2IT1A 1NBMA 4LJ8A 3KQNA 2NO1A 1UBEA 2J1LA 4ZKDA 3I5YA 4OQMA 1XU4A 1GNRA 4P32A 1VECA 1II8A 5FUVA 3KX2A 1XWIA 2ZI3A 4M4SA 3AUYA 3RLFA 4ZV4A 4JL5A 2HF9A 2W6IA 1W48A 3QKUA 4LV8B 2GJSA 1Z6YA 2IWRA 1SHKA 5FL3A 3EC2A 1XTSA 2R8RA 1SVOA 3ICQB 4YMTA 3L2OB 2GCNA 2XJ4A 1LV7A 3SS8A 1OIXA 2JJ1D 4RZXA 3CRQA 1E2EA 1Z28A 3FKSD 4OQXA 1A2BA 1TF2A 3GFOA 4I81A 4C0QC 3KUDA 4L8GA 1N6LA 3DKVA 2ZS9A 1RRFA 3NEJA 3U5ZB 4LJ4A 4ESVA 4M9ZA 4I1OA 4PQFA 3KXIA 1PLLA 2BKEA 3GJ6A 1P4SA 2P65A 1ANKA 1T8TA 3HPQA 4BLTA 4EKDA 3T1TA 4LRWA 3CX8A 2D7CA 1ZM9A 5EE3A 4B35A 3SYNA 5EE0A 1G64A 4HLUA 4HYYA 3SBDA 1A1VA 2IW3A 4B32A 5KNBA 3V4RA 4MUBA 2J0UB 1KI3A 1N2CE 5CLQA 2ANBA 4QJ5A 2IXEA 5BXQC 3BB4A 5JSZB 1YZGA 1R2QA 3QPVA 2QE7A 3SFVA 2REBA 2I3BA 3K70C 3LBHA 1NG9A 2BMEA 4JVSB 3L0PA 1T3SA 1MV5A 3LO5A 4G5SA 2ZSDA 2EW1A 3SR0A 1Z6TA 2O5VA 5J4HA 1GL9B 2C04A 2GDJA 2I1VB 1P5ZB 1RE0A 4GMDA 4RSGA 5GJCA 4V0MA 1F48A 3EG5A 1NL3A 2REOA 2CVHA 3AF2A 2QAGC 3G5UA 1S9DA 3CF6R 2J9RA 2OBMA 3W8NA 3KB1A 4FMBB 4MKHA 3GLIE 1XNJA 2YOHA 3O8RA 3SJCA 1E96A 5JMTA 3TAHA 3K0CC 2OXRA 1ZC4A 2FFAA 2ZYVX 3E2IA 5FR2A 4EJSA 4D2IA 5KDOA 3M4YA 5KNDA 1IXRC 3EC1A 4AKGA 2DFNA 4US1R 1M74A 1W5TA 4TL6A 1T0HB 3VKGA 2GRJA 4DLTA 2YYZA 1L4YA 3OE7D 1W36D 3CX7A 3NHAA 5DISB 2E87A 5HCIA 3U3JA 1SVLA 5G41A 2FE4A 4N1AA 2FJUA 3B2EA 1K5GA 1QHSA 1SVMA 1KOFA 3W8RA 2HYIC 3I3SR 2PZGA 2VHTA 4JLKA 3M1IA 5JJKA 4JL8A 3LQQA 1CTQA 3NC1C 4AKHA 2QMHA 4G1UC 4NDZA 3QEJA 2OXCA 3OESA 2VHUA 3BK7A 3W9YA 3CR8A 4QBHA 4DLYA 4JT2A 1IJEA 3R7WB 2JLUA 4GZLA 4F91B 2ZR7A 3A1SA 3CX6A 3NEYA 1D9ZA 3RC3A 5K8LA 2WWXA 3PV0A 5JECA 521PA 1RIFA 2GHIA 1Z6AA 4BLOA 4UNSA 3JZAA 1XEFA 4DCTA 3B1YA 4MRPA 1P9RA 1G5RA 4RVCA 5DIFA 1SXJA 2JCSA 1Z0KA 4DEYA 1JALA 1QBKC 4D4MA 2WMOB 4C9BA 4NCIA 1PUJA 5KNCA 4QNRA 2WTUA 5C4GB 3DOFA 3EW9A 4IOJA 1MABB 3RNLA 5LPNA 2HCBA 4MYHA 5J4YA 5JRZA 3UKDA 4AC9A 1Q44A 4W7SA 5FFMA 1E9AA 2OSBA 2YWHA 2P0EA 4LDJA 3P26A 4D81A 1NLYA 2Z83A 2W2XA 2ODNA 4LC0A 4WW0A 1N5LA 2FOLA 2KE5A 1Y3AA 1WF3A
chains in the Genus database with same CATH superfamily
3PB3A 4LTDA 1AUXA 1Q0UA 2I78A 3A31A 5G0SA 2ZJAA 3TLZA 4ND8B 2QR2A 1JNXX 3WKDA 5KNBH 1XDBA 2WE8A 1QPGA 2CNWA 3O92A 4P33A 1MJGM 2AS0A 3V7FA 3VZRA 3GFPA 3M6MD 2QE7D 3QFTA 3R75A 3IVRA 3PFWO 3TX2A 2A7XA 3RKUA 2H3EA 4HNVA 4FUTA 5F1KA 2PGNA 4N8EA 5D01A 2MSDB 2I4RA 3T5TA 1GU7A 2DKNA 3JR3A 4QOHA 5BSFA 1SBCA 3TZ6A 1KWGA 4WA8A 4BNHA 4TKVA 5ETJA 4B6QA 3KQHA 5BYAA 1VHLA 5I4KA 4IJ5A 2IJGX 2B20A 3BBLA 1BVYF 3AONB 1N2BA 3GNSA 1N7IA 5CYOA 1DEKA 3GIWA 4IOMA 4XCXA 4ZJYA 1HC7A 1KZ4A 1CEYA 1JWLA 3F6RA 4LJ9A 5K3OA 1EGQA 1GYRA 1E9FA 1QH8A 2YJ6A 2ZULA 3K31A 3SZUA 4ABYA 5BUSA 4NCXA 4IYJA 1QQTA 3DDZX 3RSGA 1OPXA 4BJHB 1FCJA 4OFWA 3RW9A 1QF7A 3LE8A 3TPFA 1UXKA 3NJ8A 4HUQB 2G5PA 4FSHA 1E2JA 3O8QA 4P7JA 1RQNA 5FNVA 1HLDA 4B76A 4EF4A 4P4UA 5AW7A 2ZE7A 4R3NA 3HDHA 4XA8A 4CBVA 3JQ9A 1IN4A 3PNYA 3WWYA 4R1TA 4UNNA 2Y1EA 5LC1A 1ULSA 1NIPA 2XITA 1Z08A 3ZWMA 2EAUA 1BVUA 2O1SA 2Q6KA 3OCJA 3QPBA 4QWMA 3TS1A 2BMDA 4AZ3B 2PZKA 3DAYA 4DIEA 2ADFA 2GPNA 3TJRA 4OJTA 4TWJA 3X0DA 2Q1XA 5LKAA 1SEPA 3SQMA 1SZCA 1X7ZA 1T4CA 1YS1X 2YS7A 2YXEA 1JDVA 2I6UA 5CT5A 4GKKB 4L2IA 4M0FA 3ELDA 3NDPA 2DHDA 2ZS7A 3H4VA 4TYYA 5CT8A 4O8CA 1UCFA 2Q9CA 1YZUA 3S2EA 1RM4A 4AL4A 4EP1A 1MAHA 1P91A 3DZDA 1J0EA 3TLKA 1TEVA 3HEAA 2QGZA 5TQ2B 5KVCA 1VPLA 2F1KA 5IUJC 4MLZA 2AFIB 3E9YA 4Q7LA 4CKCB 1XTPA 1E2BA 1K3TA 3DXXA 4AS3A 1MXHA 4CI0B 3FUVA 3DE2X 3WYCA 2IZ5A 1MN6A 5BSEA 2BOVA 1CETA 1GPMA 1ONNA 2Q7XA 4HXGA 1G5PA 5FTJA 5CVCA 2I66A 2PFKA 3GCDA 5DHAA 4B2IA 1G8PA 1TFUA 1FUUA 1UZLA 4P98A 2HW8A 5KSOA 2AFVA 1ORTA 2M6SA 5HFJA 4LI3X 5A6SB 4ZI7F 3WAGA 3QU7A 4XD7A 3B3FA 3OBIA 1QZZA 1WW2A 1V8BA 2FDXA 4NV0A 1NXOA 1UZUA 4RV4A 5AQEA 1JHVA 4ONEA 1J1IA 1M2FA 2D1RA 4BFSA 2HPAA 1E2HA 1XVAA 3D0OA 4WSOA 2X5OA 4X0EA 4XAQA 3GEIA 3AF6A 1NUSA 1SKMA 4KI0A 4YP6A 2HEGA 4C6TA 3M9WA 3UN1A 4OSPA 1BA3A 2HIMA 2IUFA 1Y98A 3IT2A 4MX8A 2QI9C 3KNZA 4MKGA 3RKSA 5KOHA 3ZJUA 1GTMA 2BD0A 2ECPA 2OPHA 2WZDA 2BTQA 2HHHB 2IEGA 4F60A 3DAGA 4MQFB 3VGJA 5A5VA 4Q18A 3EXAA 2PZEA 2RK4A 1Z8HA 3EGCA 3U40A 4DJJA 4KQJA 4DV7B 3BJRA 1KYTA 4DMFA 2FZKA 1BWQA 3TPZA 3AHIA 1R6UA 4HC4A 4MUMA 4WNIA 4TYNA 3EN0A 5EKSA 2YWJA 5ALJA 1XQ9A 2WF9A 1HDZA 3IV7A 1GUFA 3CUEF 1GYQA 1KI7A 3I83A 3VSDA 1S02A 1N2JA 1KVUA 3BB1A 1HV8A 5A1TA 5I47A 3FFAA 1VSUA 4RKWA 4HX9A 4X3PA 1VJCA 2QJOA 4EBFA 1A9RA 4XWWA 1VDMA 4QU0A 4PPGA 4QJ4A 5JD6A 2IYTA 1KKUA 4Y0VA 3LMKA 2Q3FA 5BWMA 2LIPA 3CWZA 2Z1DA 2AZTA 3T7SA 3R7SA 2OMKA 3JD1A 3ELUA 4LYGA 3U31A 4M2LA 2AWOA 5CPFA 5F64A 1QYXA 1YB1A 3TDKA 1JSLA 2D1FA 2V54A 2Z57A 1L6IA 4RPLA 4D9JA 2NQ2C 1FSFA 2VO1A 3BDAA 5GGXA 2BM1A 4MGYR 3L8YA 4NDNE 1I7PA 3DAOA 3UK2A 1L1QA 4CM9A 5KNCH 1D04A 2Q6IA 4LBZA 4EX7A 2V4MA 1OLUA 5ELXA 1NMSA 3D6NB 4MR8B 4ZICA 1PS9A 1Y4SA 1B14A 2HO5A 4DBLC 1REQA 3RSFA 2GAAA 4KQHA 4BGUA 2BGWA 1J0XO 5LBUA 1VSTA 1U2GC 4MI1A 4BJ1A 4BNGA 1WCXA 1E5VA 4LW8A 1HEIA 4QGFA 1D8AA 4WZBE 2B8WA 4PWYA 3HB5X 3FR7A 4JBNA 2OKGA 4EI7A 2VSQA 3NBUA 3L93A 2P62A 3RVDA 1CLUA 1Y63A 2GXUA 3B6JA 5E8RA 1JJVA 1TGYA 1CERA 1OVGA 1RJDA 2FZGA 3FOCA 3DUFB 5HKAA 1Y37A 3AWIA 2GARA 2UYQA 2PQMA 4RY9A 4HGZA 2IPAB 1ETUA 4JLDA 2NO0A 3QX9A 1TAHA 2HSWA 3BWBA 5C37A 5GADl 2ZCJA 4JJKA 4JJAA 1WZCA 4Q4JA 4YCSA 3AKEA 3M89A 3UUGA 1IZ7A 1R10A 4EKIA 1WBBA 3FDJA 2WFZA 3KXKA 2F1JA 1E8MA 3LCCA 1IH8A 2VT7A 5CX1A 5DN9A 1D5CA 1UPAA 3PCTA 3L7YA 4Y2PA 4D0RA 2PZMA 3DE1X 3YASA 4D6PA 1TW2A 2ILVA 4OLBA 4V3BA 4W8OA 4DDMA 3LKBA 3ETJA 4L4YA 2FSVC 1MO5A 5BNIA 3INNA 3C24A 3IQGX 3ETLA 3DOOA 3EF3A 3FPJA 3KKPA 3L7OA 2I8LA 3PKIA 4ZT3A 2O1XA 3STVA 1WHTA 3LLMA 3MGCA 3H0EA 4IJ6A 3V1MA 3KSMA 2AV6A 3DA8A 4FNGA 1DMSA 4XYBA 3HDTA 1O6GA 2OFFA 4NYJR 3BIOA 4XOIA 1H69A 1Q15A 2D7DA 3KQMA 3OT1B 5I7OA 5CVDA 5CLLA 3TW8A 1XKQA 4OVKA 1FQJA 1PSDA 3CINA 4N5MA 4F6LA 3L1VA 2IEIA 4TZTA 4EB6A 4ZYYA 4W9NC 3Q0EA 1AGRA 3FPGA 1P1IA 3WA6A 1H66A 2E37A 3GNLA 3W3AA 2NTYC 1LZLA 2WYIA 2Z4TA 4JBIA 3E84A 4NE2A 1XWFA 4TMKA 4X44A 1BCSB 1VJDA 4IRUB 4MGHA 3VNUA 2J7KA 3BGIA 4OHXA 4S1NA 3CR3C 3M6WA 2JW5A 1TL7C 3P9SA 2VOEA 4H6XA 1DRVA 1XA4A 3D6MA 4TKUA 3AVXA 1X8XA 5DRYA 1JDBB 1BCSA 1J70A 4YRGA 1WD7A 2JLZA 4RCYA 3SI7A 2B34A 5LSAA 3C3MA 4IV5A 2D1TA 4Q9DA 3R5KA 4UTOA 4HQ0A 1T1RA 1LPMA 2IYLD 5EIHA 2WY2D 2HN9A 4H0FA 3LTNC 1QYDA 3E1SA 3PNVA 4NU0A 5K3EA 2YXDA 1CLEA 4KAXA 4NH4A 1INLA 1R6BX 1EX1A 1J25A 3W06A 2BFAA 1PEYA 1RWKA 1ZOIA 5B3KA 3NDJA 1D1PA 1M6VA 4CLEA 2PLWA 5A5EA 4RY8A 1FC0A 2ZP1A 1DJOA 2MIIA 1T8WA 4TXJA 3EUAA 5ESXA 1M6EX 3E9QA 1X94A 3FPFA 1DC8A 1Z34A 2P6PA 3DMYA 3N8IA 3QLJA 1A7AA 4FOPA 4L4UA 4QTUB 3DB2A 4TKVB 4NC9A 3WB0A 1YS6A 1V6AA 3G79A 4YAKA 1U81A 4MMZB 2I7VA 2CNBA 3LAWA 1JQDA 1WMDA 2WSYB 3FB1A 2WNSA 4FR2A 2YRFA 4C0KA 3A28A 1AY0A 4I66A 1EX6A 1EWVA 4RPHA 5DM70 3RB8A 5AVZA 3MFQA 3KPYA 3G2IA 3MXTA 2RHOA 1KMMA 3BGOS 3UAGA 5DPMA 2PJRA 3RG8A 4BLPA 1ZRMA 5EINA 3SJBA 1XQYA 3KDPA 4GI3A 5GV8A 4K86A 1JF8A 3RS2A 3UCXA 1RHMA 2BFWA 1E8NA 5CG2A 3DTYA 4A0QA 3CR7A 2X5JO 3LY5A 2EGHA 4I1UA 4PAGA 4V0QA 3WZLA 2YFYA 2IOQA 3V4ZA 1V6SA 5FBWB 5A4AA 2CNOA 3GD7A 5BYJA 4TVSA 1I2MA 5BSHA 4WLEA 3UMMA 2YOFA 3PNOA 1HSOA 4DMKA 3U13A 2PMCA 3S8YA 2XUQA 5KU1A 4M1YA 2QUZA 3F8WA 5U9CA 1E1MA 1X87A 4RK4A 3I2FA 4DLSA 2PZ8A 1PT5A 1ZISA 4FR5A 1XZPA 2EOAA 4HEA1 4JHLA 2ZQZA 4G0ZA 5TMEA 2JDID 4DRZA 4PFKA 4DY4A 3WRXA 5MGNA 2F1HA 3D6HA 3KZKA 3SG0A 2HPZA 4OFXA 2UYGA 3F7NA 4B9AA 3AOEC 3I9KA 3TIIA 1KFKB 4IGKA 5EY5B 4PSVA 3WMWA 4AUEA 3R7DA 2O8CB 2R6CA 3EZYA 1J8VA 2Y1OA 2HF8A 2Y1XA 1P3DA 1PR1A 3B7PA 3BXZA 1GP2A 1X42A 4MUGA 5DYWA 2PA0A 3VKUA 2WJJA 1C8LA 3G7UA 4HAYA 4RKYA 2YX1A 3AIKA 3FVVA 3RR2A 4I5EA 3CNBA 2QMEA 1KS2A 2WVAA 3GGOA 4G24A 4KR2A 2J0SA 2FSVA 1FUKA 2ZJ7A 4RSHA 5BV1A 2G9QA 1O0BA 1R1DA 2AFRA 3HKEB 3DL2A 4RDXA 5C7IO 4C3ZA 3DKKA 3H84A 3Q7PA 1G9SA 3LYHA 3ME5A 1IHYA 2A67A 4B3IA 4CJXA 2C59A 2XMSA 2ZZNA 4H4EA 2WC1A 1U8ZA 1Y8RA 3DP9A 3KD3A 3C5HA 3OQ6A 2F3PA 4FMCB 5TJHA 1B8UA 4DEXA 2P0AA 1NXXA 1Z13A 5ENZA 3PX2A 4B6JA 3VR3A 1FYXA 1H05A 3GWGA 1F6BA 3SMQA 2DP4E 3HY6A 3U48A 2ZSHA 7MDHA 2C3PA 4NESA 3UT5A 1GFWA 4KTVE 5AVUA 2X9NA 5JBQA 4C7OB 4LZZA 4QVKA 1U5BA 3PPVA 2BFEA 3O73A 1L7BA 4WCDA 1CRLA 4G23A 3VHQA 1XALA 2GM3A 1FYDA 1NXVA 1S6YA 4K1LA 3MLBA 3I23A 4IKOA 1H2YA 5FUMA 5C35A 5CA1A 1F2VA 2H1RA 1MEJA 2RGDA 3QY9A 3MWJA 1AQ6A 3HABA 1X74A 4NP6A 4WDQA 2IUUA 4ESHA 4O4JA 5LXTB 1L5YA 1Y8QA 2XWQA 3OQPA 3CW2A 1SQ5A 1ZCBA 2CUTA 1KPHA 2GK7A 4O4LA 2HXYA 2YUIA 3FM9A 2CD9A 2BELA 3EOAI 2WVHA 4LX0A 2B1QA 4ZCMA 2QN2A 2VK8A 3G2MA 1X2EA 3AJEA 3D2CA 3LQRA 3RV4A 3WISA 4Z4HA 1P74A 1GM5A 5I9BA 4PLHA 1NP6A 2C8KA 2VQSA 3G5LA 2A9JA 4A4DA 3E15A 5DCLA 4BE7B 5HR5A 1DIHA 3I92A 4LZLA 5FNVF 3ED1A 3UA4A 4KPFC 4RTRA 3PF9A 1NF8A 3FAZA 1NC1A 1UFRA 1UPUA 2CCKA 3A58B 3G0CA 4GXNA 4P35A 2H85A 5GV7A 3CE6A 4QDOA 2XDAA 3H86A 4E15A 2PUEA 5JQWA 1JEJA 1G59A 4JR0A 4HH3C 2OD7A 1CZRA 1Y1KE 5HF5A 4J91A 5D5QA 2YNMA 2NPFA 3SIXA 1E4EB 4CETA 2KQUA 4I4TB 2HYDA 1AG9A 5BNFA 4KN5A 3OQIB 1CQJB 2FP4A 5HF8A 4JUIA 1EUDB 1WD5A 2HT6A 3NRCA 4FGSA 5AIAA 5GJBA 4BX3A 4KLZA 5DDIP 1XLUA 4KK3A 4AP6A 1ZM3A 2Q1YA 3PQ5A 5DN6D 5WRFA 1KBOA 1EP2B 1RPJA 5EQTA 1FDOA 3DHVA 2AOWA 5JXJA 3D31A 2VZEA 4LHEA 1L0BA 5EFZA 3DTVB 3WGKA 5LM3A 1F9AA 3EDRA 2PUVA 1U7TA 3HLTA 2QS9A 4JU8A 4L16A 3T8YA 4BZWA 1UXOA 2CHVA 3RUHA 2V55B 2HDOA 4AZSA 2E4UA 1K2VN 3DOIA 2Q9UA 3DHWC 4CU5A 3GLIB 1ZRHA 1O6CA 2FEKA 1DOHA 2ZJBA 1BFUA 3FNGA 4GX5A 2GYWA 3AMVA 1J24A 3UYKA 4D4LA 2IZZA 3LT4A 1VSVA 1PJQA 2MR5A 1CF2O 1MABA 1PEAA 2O2DA 2RH4A 3FNFA 2QR5A 3OOWA 3MMPA 1AB5A 2VDUE 4HEQA 3AEUA 3LQKA 4X93A 2G70A 4FYHA 3TK1A 3SBXA 4Y67A 3N7TA 1TFRA 4MVJG 1E1CA 3RKRA 3ZIDA 4G0XA 3HJGA 3KQWA 4J1TA 1Q1AA 3ELBA 2N46A 5B1SA 1FTQA 3QVUA 1QGZA 5IWAB 4ARIA 4P3XA 4Z51A 1U7WA 3ZN2A 1VLZA 2Z09A 3JV7A 3PGJA 4URFA 1Y1TA 3QA3E 3OQJA 5AJZA 1N7JA 4ZV9A 3DTNA 1WETA 4NABA 5E7MA 1YCDA 4WD3A 1G3IA 1NVTA 3V1UA 3WMEA 2YHIB 1GTL1 3V32A 1BA2A 5F73A 4CQMB 1TTTA 1W4ZA 2HFJA 2AG5A 1RWNA 4ZVQA 4BKRA 3KSUA 2Q5JA 3SF8B 1HNNA 2CV1A 3P2EA 1D0SA 5I8PA 2XUFA 1XCOA 1CZLA 3OIWA 2VQ6A 3KT8A 1H0KA 2W2LD 3KZCA 4XUDA 3B6ZA 5EUQB 1MC5A 3I76A 4AFNA 4LYJA 2QRVA 5EE1A 4D98A 2Q1WA 3PWKA 1ULAA 1NTOA 1OHHD 3SGLA 4GR4A 1J90A 4AUNA 3GP3A 5I9NA 1Q20A 1K6IA 1FDRA 1YE8A 3IBGA 3CUUA 3LPLA 3R5JA 4YECA 4N82A 2B1IA 4BFLA 2P5YA 4C76A 1BC5A 1QIDA 3DLAA 4M0KA 5EXSA 3UUFA 5JNWA 4RZ3A 3TKLA 4B6EA 3GVXA 3BB3A 4R3UC 5B3AA 5C5IA 2F9FA 1J8FA 3EFHA 1PT9A 3C3WA 4HYEA 5AJTA 3JQ7B 3TM5A 4CXMA 1CPYA 4H35A 1CQXA 4LOJA 1SD2A 3SC3A 5DLEA 5JVDB 5BUCA 4FMDF 4ZOLA 4S2EA 4A2WA 1DV2A 4D9MA 5FB3A 4C7VA 1JA1A 2P35A 1B1AA 1TEXA 1FY2A 1GAEO 1Q0HA 1OROA 1YOBA 3BCRA 3CLSC 3CLUD 3FYCA 3GLHB 2AE2A 3NYRA 2HD4A 3DZ8A 4HG2A 4I55B 4F9GA 3A9SA 3DDHA 2R68A 4WOJA 4A92A 1J39A 5FO1A 1Z0JA 4QRDA 4LXTA 1WB5A 5CTJA 1R9GA 3JSXA 5B36A 3UCFA 1IHXA 4NMWA 1TU3A 4LEIA 3CS3A 3K53A 5KWVA 3KM0A 3X1DA 5I7FA 5MN4A 4MQ5A 1JR2A 1YR1A 2QSJA 3D7RA 3EIQA 4QXQA 4XFJA 4Z4IA 1XRLA 2CMHA 3WLRA 4WAUA 1H3NA 1VB5A 4JUAA 4IDCA 4NBUA 4G5XA 1R4AA 1JBEA 1W4LA 3GRYA 4N0MA 2XUDA 1GL7A 2Y4NA 5HKKD 3UAXA 2FJ0A 3OD5A 2FUEA 3R4CA 3QYJA 2YHSA 4X8LA 3KQSA 4I36A 4BO9A 1KYIA 5D5HA 1XD2A 1GZ6A 2PH1A 1NV9A 2Q3DA 2IYPA 2VHEA 4S12A 2YMQA 4XIIA 5AK3A 5BN4B 3U7RA 5FPTA 4FFOA 3WO1A 3MS4A 3WG9A 4DR3B 3ZWWA 2JBWA 3DWFA 4KHZA 3PWSA 4YUXA 1EWQA 3O21A 3CH4B 5DBIA 2DPYA 2ZYGA 1RXSA 5B12A 5KOYA 2AZXA 3L6OO 1KI1A 1J9ZA 3LLCA 3BT7A 2CE2X 1U6JA 4P0TA 3RYFB 5DYIA 3KRTA 1HYHA 4TXNA 1U1EA 1ZA1A 2MSWA 4OX9B 5TQVA 3G9QA 3EVAA 2P75A 2C5EA 2V6IA 3SXJA 5E2BA 3UJ9A 1LFAA 2BZ1A 2ZJ6A 2IV3A 3WZ2A 4A6DA 1SH7A 1SHTX 3AJ8A 3CZRA 3GQVA 3IX7A 3T3PB 5ECDA 4A73A 3ZW9A 4BP3A 1T9DA 2HZBA 5EJ4A 3N28A 4MTLA 1YBVA 1JR6A 3ZPXA 4PZEA 1O54A 2P11A 2FVXA 5HE8A 1CRQA 3PHIA 5JAZA 4FE7A 3TTTA 2N1BA 5FEUA 1ZESA 5IT0A 2A5YB 3GN1A 5IG2A 4OI1A 5TS2A 3IXLA 1GPNA 4M99A 1IOZA 1ZUD1 2J6HA 4BB0A 2ZRGA 4O4HA 3C3PA 1QP8A 3PHHA 3VSEA 3MVEA 2OCGA 4XVUA 3T38A 4HUTA 4JI6B 3SLKA 4N7MA 2Q21A 4J1TC 2IW1A 2C94A 2ZYWX 3ASUA 2D0DA 4BN0A 4BQEA 4B81A 2A9VA 1QR6A 1X38A 3AGPA 4P31A 1NVVR 5EMMA 2X0IA 4NU5A 3U4AA 2IIPA 2O5EA 3H3JA 2Z3WA 1EUYA 1M83A 2ZWVA 2IYNA 3HXPA 3HYLA 1NF2A 3MS7A 1V9CA 4NZZA 1P45A 1AM4D 5HIMA 3RSHA 5HW0A 1FP1D 2GBGA 5D86A 4QE3A 4RAOA 4KUHA 1QCZA 3PDWA 4YRNA 3TUZC 1US8B 4BNKA 4AIIA 2QOEA 1M5UA 3ACCA 3VJRA 1BQEA 4LY0A 3UMSA 2HX1A 2B9VA 2QGFA 1OXTA 3DZHA 1E6CA 4WZAA 4EYGA 2D0OB 1HTWA 4RMGA 5DGXA 3D7KA 2PRSA 3G2LA 1C7ZA 3I8SA 3QFCA 3KPUA 5FT9A 4NWIA 1YB7A 8AT1A 2JB9A 5CDYA 3ML1A 3GAZA 4JBGA 1GG8A 1UP6A 4DGQA 2CZCA 1I5OA 1M7HA 4GXQA 1H1TA 5PGMA 4LZOA 4KRFA 1F8FA 3A6ZA 3NDRA 4A8JC 4B4OA 5C5EA 5ESWA 3VZQA 2C9ZA 3DMDA 4TRJA 3F3YA 3NDIA 1WMEA 1IBSA 2QWXA 4BQQA 3OFNA 1AHIA 1RLIA 1UBRS 1VIMA 4M0UA 3N2IA 1JYEA 4B0PA 1FUIA 2JFOA 3F7MA 3A37A 4I4TF 4EMSA 3VPHA 2B4QA 1OT3A 1IB0A 2ZWPA 3B60A 1XBTA 3K0AA 1SCBA 2WD8A 4IUYA 1AVTA 4XEUA 4II3A 5SZJA 5KYWA 5ALDA 3FUTA 2QRJA 4JOQA 1ZVQA 3BD7A 1UK9A 2B7CA 1TCCA 1YZHA 1HT0A 1QQ7A 2NYVA 2CYBA 2H2IA 1FFCA 3CG4A 2ISSD 3MOIA 2B21A 3P19A 4K1XA 4Y2GA 4ZZ2A 1PZGA 4M3NA 3K20A 5G3ZA 3S44A 3HCPA 2HUPA 1W5EA 1XTTA 4J43A 2Z56A 3CX3A 2JIPA 2ES4A 3BWVA 1HQYE 2Z8XA 4ES6A 4L22A 2FE1A 3PQ8A 1MX9A 1E32A 3TVTA 2G9VA 3I72A 1Q21A 4JX8A 3GLHE 1HEYA 1AUQA 4CM9D 4DADA 2PT9A 4RIHA 3TL3A 4UUAA 1ZU4A 3CGWA 4UVDA 5JBNA 4AY2A 4Y2UA 3NFYA 1X1CA 5HZMA 3LW7A 3ZGYA 5ICMA 3KYJB 3V8QA 1DKNA 1AGXA 5KTYA 3CF4G 5B7NA 4Z0NA 3W2FA 1L8AA 1TQDA 1PBTA 2NAPA 2R66A 1RXCA 2YJTD 3PENA 5BSUA 5ALNA 4DV2B 1KYZA 1ULTA 1Q95A 2NZ8A 2EQAA 2OQ2A 3KJZA 4RH0A 4BMPB 5I9LA 1L4KA 1NASA 2XUOA 3EZXA 1NN3A 3OQMA 3O9MA 3SEAA 2V59A 3INRA 5CT9A 1AKTA 2WKQA 3LVRE 4H1VA 4MS4B 2HZ7A 3PIRA 4JEHA 2RAFA 3U4QA 4O33A 5IJ9A 4OXQA 3TINA 4PG4A 2YWDA 4N18A 3V4LA 1K6MA 3HFRA 3NT4A 3PDIA 4JQYA 3EB9A 4X90A 1S8OA 4L9SA 5AKIA 2HMWA 1ESCA 5H5JA 3WYNA 4C14A 2F9MA 1AKEA 4IDPA 4C0AC 5GTDA 2IK8A 1QOPB 2VQFB 1XDUA 2P6RA 2Q6TA 5JU6A 2UUAB 2IOHA 5AIBA 4KGXA 3EAQA 4CM7A 3GAFA 3ADDA 4DT1B 3HSSA 4YV0A 4RDIA 2OXFA 2QUHA 4KOEC 2GHTA 4D9GA 5SZKB 5I3ZA 5C52B 1QGUA 2C54A 2DH6A 1X70A 5JDIC 1I5RA 4EFDA 3AEZA 4DMHA 3I8OA 3TR0A 1GT91 3K4PA 4HDQB 4LJRA 2F8TA 1G3RA 1HXHA 1YR3A 4DIBA 5JROA 4WZBA 3B48A 2PLFA 3BMQB 1ZD1A 3BWYA 2VC2B 3LY7A 2ZT6A 1SKBA 2CL7X 4N3BA 4GSLA 1Q84A 3WLAA 2P9JA 5ADHA 1E2MA 4ND3A 1KH1A 1GPKA 4KXXA 1GNVA 4PXSA 4QQKA 1SIUA 4WKNA 5KPDA 4RESA 3RSZA 1UAAA 4FI3C 5BWOA 3SYRA 3BMQA 1SG6A 1U7UA 4LC1A 4WV3A 4W6ZA 2IDMA 4U0JA 3WYAA 1M67A 1WU8A 2I1QA 3GLRA 3UH0A 2H2GA 2X8JA 2ZAYA 3JWJA 3PXAA 2C2MA 3BDVA 4I2VA 5CIQA 4C7MA 2O57A 1DI0A 1JDZA 4QOEA 3WMGA 4L5JA 4NU8X 2K5UA 4HBGA 4O4IA 3RO7A 3TIXB 5LU8A 4Z4EA 3LIPA 4NYMR 1JYSA 2Q07A 2X8JB 4Q1BA 1UWLA 1IXSB 2RK6A 2XDQA 1GTSA 2QDKA 2Q5OA 3IILA 2R1ZA 5K8VA 2ZBDA 5BWLA 4PAWA 1CQIA 1G7RA 1RZVA 4AQDA 1EFKA 1WUJS 1X77A 2EX4A 3QPWA 4A0HA 1KEKA 1EUDA 3GLGB 4AKTA 1VDZA 4HWGA 1RYNA 3Q6IA 4UNQA 4YT8A 1GQYA 2LUOA 5TT1A 1HM5A 3SJAA 3TLEA 1ZM2A 1RYEA 5KVQA 3T1VA 4ZMRA 4IUBS 4HFNA 4K0RA 1ES9A 4KE6A 3UJDA 2HT1A 2ONCA 4NZ9A 4X64B 2VUHB 3F96A 5EERA 2ISQA 3WA7A 3R6LA 1MVOA 4IIXA 2AI2A 4NBVA 3GCWA 3EQ2A 4XR9A 4F96A 3UMYA 2O0HA 3MPUA 2BFBB 3BHJA 1T2EA 2EARA 1OKKD 2WT9A 3UXMA 2YCBA 3R8FA 5TY0A 1U8EA 1O89A 4KR7A 4GIBA 1FRQA 4O2BA 3GXOA 2ZSKA 2GZAA 3DFZA 3O3MB 3C14C 4F3NA 5HSGA 2Z2YA 1P2VA 1N6OA 4Q7JB 2LD4A 5K3BA 3E48A 1EFLA 1ECLA 1XD8A 2C78A 2OO3A 3Q7SA 2M2IA 1D7AA 1TOAA 1EWTA 3ZVKA 4UMFA 3UWKA 3NIBA 4EPTA 1ISMA 1AX9A 4DUGA 4CGZA 1C8KA 3HVIA 4D6XA 3BWDD 3FHCB 3M4NA 4ID9A 2PZBA 4GYJA 5BW8A 3EIWA 3ZNPA 3D1VA 5EJFA 4BO0A 4XASA 4OQ4A 2VDPB 3K1AA 2GK6A 4Y9SA 2HIAA 1LSUA 4Y9RA 3FOBA 3F9CA 4JP2A 1GGJA 1NVBA 4UMDA 1P0MA 4Z0PA 3Q4GA 4M88A 3EBPA 1IY1A 4GAEA 2VLIA 4D74A 2FZEA 5EGNA 5ES4B 4MKIA 3ICWA 1L7MA 5FPHA 1MA0A 5K0NA 4G0NA 3CNEA 4N5DA 1OV6A 2YC4C 5FD8A 3A2KA 1BHSA 2GZ3A 1N5KA 4D46A 3A25A 2BDUA 4CGYA 3WWEA 1QZTA 1J8YF 2BJVA 2YXNA 1WJGA 1QRRA 5K6AC 3KVOA 4IV0A 1I2AA 2FW1A 2JCBA 1ZK4A 3VA7A 1TUEA 4MUYA 3RGWS 3PGMA 2QTLA 3LSTA 3VDMA 5JSZA 3KSBC 2W0MA 1PNTA 2YZGA 1KRXA 1WVMA 2RHTA 3K4QA 3QNWA 4QDJA 2BMWA 1MP0A 2GPAA 3QJGA 3X43A 3K71B 1C4KA 4QG3A 2YHAA 3UMVA 4FN4A 2W8BA 4PANA 3MB5A 1DRJA 1Z4IA 1H2XA 3SX4A 1T8YA 4Z0TA 5KX5B 1RM0A 4FGKA 3WVNA 1SZJG 2NXWA 4M38A 3RIMA 2GHRA 3OM1A 2P6OA 5FUQA 4KO8A 1M54A 4QT0A 4DBLE 3G89A 1JPUA 5IN4A 1JDTA 4W99A 5JADA 2OHXA 3ZGXA 3LLSA 1SXJD 1KJ9A 2CLCX 3JQ7A 1JLHA 1BX0A 4QTYA 3ANSA 1T8SA 5DCWA 2QG9A 3BFXA 3DVQX 5A9RA 2CL0X 3K6SB 1QKJA 1RP1A 3O82A 1E0SA 1VGVA 1LFDB 4A26A 2ZRHA 1NI4A 2PWPA 4PNPA 4HAIA 1G16A 2NV6A 2XI4A 2A14A 4K6GA 1P31A 5JDIA 1BGWA 1D6JA 4FB5A 1C9EA 3WLNA 5D6NA 1ZM7A 2RC6A 5HP4A 1YZNA 4KGZA 1QLJA 1I6LA 2JVKA 8ATCA 5B58C 2OV8A 3AI1A 2F17A 2Q9AA 3ISJA 4IVNA 4YJKA 1E62A 1O5OA 4CDNA 1S8AA 4IHJF 4OHVA 1BSVA 3UF0A 1ZKDA 5G2OA 3ZDFA 5CVTA 1ODCA 4ACBA 4QPDA 4Y8VA 4F84A 5K0JA 4RTJA 1NNUA 4K05A 5AI9A 2KX7A 1XDWA 4FCCA 4N41A 3WC4A 1R0KA 4CI9A 3OKPA 4QZVA 2BGNA 2ONJA 2W4IA 2J59A 3BXHA 4LZNA 2QEQA 2QTGA 5HF9A 3LJKA 1MJGA 5CVEA 2PSFA 3WRYA 1ZX1A 3D81A 5E2IA 4D0LB 2B4KA 4GPIB 3OSUA 3W4IA 5CW1A 4BB6A 4DW8A 3CZPA 5BPHA 3OCXA 3ZE9A 1DEAA 4R71A 1TCUA 2P2CA 1CUYA 4K9QA 5C1IA 1BEUB 5KUTA 5AW3A 2FWBA 1JN0A 5AI0A 1XU7A 3KSDO 4XIGS 4O2AB 3ONFA 1Z5PA 3TQTA 4CODB 2ZWOA 4QLBA 1O9HA 2GLUA 3ZTTA 1DKQA 3KAJA 1G8YA 3GNTA 1U0TA 1R5NA 3HO8A 4RQAA 4ZODA 3W5VA 1IK4A 4ALIA 4EYSA 4BNDB 4P3PA 1E5DA 5IWCA 3ZY6A 5JJ5A 5F3WB 4BTLA 2CNLA 2G1KA 3E7DA 3D3KA 4NU6A 1JMYA 1EK0A 1JPJA 2HDHA 3OBBA 4K81B 3T35A 1M1ZA 2UZ0A 4JLBA 1WABA 3H9GA 1GTVA 3F4BA 4RPJA 4TGLA 2ORIA 5EXDA 1P6QA 2DTXA 2RHLA 2KJQA 3K1ZA 4M0CA 4MRMA 3CZAA 3SOPA 2BFCA 4KE9A 3FPAA 1T6XA 2VP0A 3H9QA 1U5AA 2YIDA 3QUCA 2WYVA 1ACLA 4KLAA 2CXNA 2AWNA 1O08A 4EAAA 2QP9X 1HG1A 3LHKA 1DOZA 3RBAA 4DANA 4XRRA 1NNLA 2WT4A 3HO6A 1C9JA 1RYZA 4EA9A 1RPZA 3HA2A 4HUQA 2IH4A 1TYBE 2SICE 1ZJ4A 3VR0A 4EW1A 2VPQA 3H5NA 2YKGA 3DD5A 1NPTO 2CLSA 4HVAA 1K5DA 4EL5A 4UFOA 4K5QA 2XT9A 3D2AA 5KVSA 5K3AA 1ZXLA 4JBXA 2COKA 3BH6A 2YDYA 4TTTS 4LNUB 3ZV4A 5CIYA 3JQ8B 5BQ5A 4J16C 1RKBA 5AH0A 4L0MA 3WIBA 1E7YA 2Q3JA 1MBZA 2WM9B 3EARA 3I42A 3LM8A 1F5SA 4FI3F 4EKYA 1SZDA 3FPHA 1JXQA 4NRDA 3LUPA 2ZJOA 2EKZA 3DOJA 3CNNA 2HRDA 1M2NA 2IU0A 5LA6F 4OEHA 3OMLA 4MA5A 3IE1A 2Z58A 3MTIA 4GRIA 3SM9A 5JSYA 1OH5A 1W44A 2OUKA 3MTEA 4HK4A 2HGSA 3HTXA 4DR6B 3NBYC 1P2FA 3O47A 3HMKA 5L3ZA 3CPSA 1CDDA 5JY6A 4RK5A 2W83A 1ZI8A 1MIOB 3BJEA 1PU2A 1RLTA 3IQFA 4ND6A 1Z6PA 3DGEC 3TZLA 2TMKA 3UJBA 2IGTA 3D7SA 4MTCA 1PT6A 4AJPA 3AUXA 2X1VA 3VR2D 4GOKA 1ZEJA 1FLDA 2PUFA 1CB7A 4WN9B 1GCAA 1GRQA 2ZRDA 2EFJA 3OURA 1C4XA 2CUKA 2Q4RA 4J6EA 1YQEA 3RJTA 1CD5A 4S0ZA 2IBTA 1J1UA 3N75A 3L1UA 4ND1A 1Q1GA 2J9GA 3GYBA 3B85A 4ZQCB 5IM4A 4IIJB 4PO8A 3ZXYA 3N8DA 1ZVMA 2Z1NA 1CVIA 5LMNB 2IYEA 4UM9D 1Q7BA 2FEXA 2XDQB 4PGMA 2AF3C 5FWYB 3ZCPA 1UJBA 2FSFA 3UFXB 2MJLA 1RAHA 3QLVA 1VL8A 1VG8A 2DSNA 2V5VA 3RAPR 2ZB2A 1YVDA 3ZDXB 2X42A 5A0FA 1VE1A 4NY1A 1NF9A 1Z38A 2JEOA 3WNDA 4G5FA 4EAQA 2IU3A 2TECE 1V1MA 1PFWA 1CXZA 1G3MA 2QRHA 2V6BA 4PBTA 5EYPA 3V6LA 2C83A 2FP4B 3G88A 1IOWA 5COAA 1W581 5FWXA 3GEHA 4LJYA 3HE3A 5B2EA 5KYGA 1Q3KA 1YQGA 3GY0A 4D9BA 4RIGA 3UJ3X 3FCEA 4LJAA 2NUAB 4MUEA 1A8IA 3Q8MA 5T4FA 5A2QA 1Q91A 5B3JC 4CMIA 3JQEA 1IEVA 1Y89A 4DQXA 2IS6A 4X3CA 3FCUB 1A5ZA 1N1EA 2CCJA 2PGLA 3U0BA 1X8LA 4KREA 1VYUA 3HN7A 3KZXA 2O0KA 4YMIA 4ECAA 5EQJB 5KEIA 1BS2A 2VF5X 1L7DA 1FVFA 1XKLA 2Y1LA 3SD7A 2WV9A 4O5OA 4IR7A 4HBZA 1HQKA 3IBFA 5I8WA 5C7LO 4YRIA 1OYOA 1U3UA 2JHPA 2E0IA 3G9XA 3EH1A 1U2SA 5DWQA 1S1MA 4RZHA 3V5NA 5C8VA 2L2QA 4RTNA 2H5LA 5JVDA 2C8LA 6PFKA 3QUAA 2D1YA 4GOLD 1XDZA 1RFGE 3A14A 5LJIA 2C7RA 4I19A 3GPCA 3L8FA 1XVLA 4INOA 1NXWA 1I1NA 5E4YA 4EHFA 3TL2A 4YJFB 1PL0A 1IOVA 5ALYA 2PMKA 1IHUA 4FDTA 5BV0A 3F5DA 2VTDA 3BAFA 1G8FA 3GI1A 4ZN6A 4GBGA 1CCWA 5AW1A 4BVKA 2VAVA 3IPLA 4FVTA 2HB6A 4FYMA 3TOCA 4PZDA 1CY1A 1TRKA 1PKEA 1JSZA 1L5VA 3CO0S 3A26A 1SC9A 3KG2A 5DN6A 4B3HA 4ENTA 2BEVA 5I8ZA 2FPLA 3OUUA 3MJRA 1QGED 3DBRB 3EA4A 3OUTA 1S1CA 2AJDA 5BURA 3EMDA 3UM9A 3L84A 5BV7A 1W8IA 5DO9A 3KLBA 4JT4A 2YH2A