3COJA

Crystal structure of the brct domains of human brca1 in complex with a phosphorylated peptide from human acetyl-coa carboxylase 1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
208
Chain Sequence
KRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Breast cancer type 1 susceptibility protein
publication title Structural evidence for direct interactions between the BRCT domains of human BRCA1 and a phospho-peptide from human ACC1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein/ligase
total genus 55
structure length 208
sequence length 212
chains with identical sequence B, C, D, E, F, G, X
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3cojA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3cojA01
4OFBA 2XNKA 4BU0A 2COKA 3K0HA 1IN1A 1JNXX 3K05A 3EF1A 2K6GA 2ADOA 3L40A 4XQ0A 2E2WA 2EBUA 4BU1A 1N5OX 2INGX 3L41A 3PXCX 3SHTA 3PC8A 2JW5A 4Y18A 3K15A 3SQDA 3PD7A 2XNHA 3K16A 2AZMA 2HTFA 4BMCA 1Z56C 3II6X 3PXAA 3U3ZA 4JLUA 3L46A 3OLCX 1IMOA 1WF6A 1Y98A 2K7FA 3UEOA 4BMDA 3T1NA 1L7BA 2COUA 2EBWA 3T7JA 1CDZA 3COJA 2D8MA 2ETXA 3HUFA 3PXDA 4N40A 3AL2A 1OQAA 3AL3A 3K0KA 3T7KA 2R1ZA 5ECGC 2NTEA 1T2UA 3PA6A 3T7IA 2VXBA 3I0MA 1T15A 2WT8A 3PC8C 1L0BA 3QVGB 3PC6A 2M2IA 2VXCA 4Y2GA 1GZHB 4IGKA 3SHVA 1T29A 3PXBA 3FA2A 2LE0A 3I0NA 3QVGA 4IFIA 2DUNA 4U4AA 3EF0A 1KZYC 2COEA 3JVEA 3KTFA 3UENA 4XPZA 3SZMA 3HUEA 3PC7A 2L42A 2EP8A 4ID3A 3PXEA 1T2VA
chains in the Genus database with same CATH superfamily
4M6WA 2FSSA 3KJNA 1PWEA 5TS3A 4PZLA 1SHZA 1VHTA 4PC6A 5CBPB 1I01A 1RP1A 3N8DA 5GP1A 3FGOA 3DDZX 1D1SA 2PR7A 2V3WA 2ZUWA 3G9ZA 5F73A 2Q7OE 4JBGA 2IV2X 4EL0A 3STHA 3AUKA 2A67A 1V71A 4Q4JB 4DB4A 2B8JA 3TRKA 4W5HA 3OZCA 2HMAA 3B1FA 4PLPA 3ZZNA 4A5SA 5KTOA 1MEEA 4Q15A 1KMQA 4IJUA 3HTXA 1AS2A 2RH9B 1KKLA 1F17A 4P34A 5B6IA 1T91A 5AJTA 4F3KA 1QRDA 3WGGA 3SQWA 5G4KB 2D3TA 2AN3A 1GPH1 3FB4A 2D2EA 2UZ3A 4H0FA 4OAQA 5GTDA 1M34E 4K9NA 1RM0A 4PYRA 3ENVA 3LF2A 1S9DA 1USVA 2H4XA 3IAAA 4BO9A 5IJ9B 2HEGA 3DXXA 1OGYA 4M1YA 5KCZA 3W8RA 5BQ5A 4A10A 5FWNA 4L9WA 3VOTA 1RC0A 4G4SO 4G8CA 4OJMX 1Q7EA 3KLPX 4EKNB 3KE9A 4RU1A 1OASA 3DBHA 1LTHR 5C18A 5T8KA 2X8JA 3IKVA 3RQIA 1XWIA 4OAOA 4CW7A 4Z4CA 4CEIA 4D96A 5HCNA 2VNIA 3B8HA 4B3TB 3E5MA 2V65A 1T2EA 1FRNA 5EY5B 1I4OA 3FVRA 4URFA 1R15A 2YWFA 1KRXA 2AT1A 2NO0A 3O3CA 4QBHA 3T52A 2J5RA 3BYZA 3LUCA 1NKTA 3I2IA 4TZ0A 3VR5A 1CY4A 2ZRGA 3JYNA 2WWGA 3BDVA 2WWVD 3VDQA 2VDVE 2P9FA 1D9ZA 1EVLA 2CXHA 4C76A 4D3SA 4Q7QA 5B7NA 5JJ5A 1JHVA 2ZUCA 5FBLB 3NGLA 4A3SA 5BQ3A 1N6RA 2I2FA 1MQ8B 1XCPA 3DLCA 4WADA 5AVZA 4B7UA 1Z0DA 2QYHA 1RYBA 5FKJA 4A8PA 3KFXA 4RABA 5FOQA 2ON6A 3KXKA 4W6QA 1WEKA 5HOEA 2XDQB 2ZZKA 4EG7A 3Q1KA 4ERNA 1T3LA 3EXG2 3NBUA 3WA6A 2QAJA 3NTRA 3QM1A 4F9EA 2BI7A 7AT1A 3O31A 2VJMB 3C7CB 4YNBA 1U8ZA 2WF9A 2BWJA 2JH8A 2WUDA 3DTTA 2Q99A 1LKZA 3L1UA 5EUBA 3OTWA 2X14A 2XD4A 3A9WA 3IUNA 4M1OA 3ADBA 2DFDA 3BGSA 4JCCA 3WNVA 2W9XA 1DKQA 2HFJA 4PFQA 1AKMA 1EGAA 1XSEA 1QQ7A 2XBLA 2HD4A 2FXIA 4B5KA 5DNCA 4TYQA 1JTEA 3U5TA 1WZEA 2WV9A 3MRSA 4NBTA 4P36A 1H2YA 1XCJA 2J6BA 1GZ6A 2HMWA 2NO1A 1QQAA 1XXHE 1SKMA 3T7EA 1IJEA 3NBAA 4TTQA 4XQCA 3H5TA 5LWHA 4BPBA 3C8MA 2VJNA 3UICA 1LLQA 1Z34A 1EFPA 1KZ4A 2C4WA 4Y1EA 4IDHA 4UE2A 2XXAB 2DWUA 4G1EB 4LAFA 4LZOA 1RM5A 4BIMA 4W8OA 4AN0A 1TE2A 3KELA 2FI1A 5E4FA 5IASA 2D0OB 2KI5A 4RA6A 4IICA 4LY3A 4M1ZA 1NM5A 2G0AA 2Z56A 3VU3A 1HV8A 2RJNA 4K9OA 1GPJA 5KYXA 3KD2A 1EHYA 3A27A 3R7WA 3VNRA 4DPMA 2VT2A 4DTIA 3UKJA 3M5DA 1HNZB 4WASA 1KSJA 3B89A 3EIHA 3KOOA 5CLQA 3WMWA 1EFVB 1V8PA 4HDSB 4A92A 1N7GA 2BCJQ 1XG5A 3WRVA 4AMVA 1NVAA 4KX3A 3MOSA 1Q0HA 1SNYA 4AUNA 5FUWA 5A06A 2X40A 4JA2A 4AZVA 4FNGA 4QG7A 5HG0A 1C1DB 2F1KA 3KT3A 5JI3E 4MI6A 3L06A 3CM0A 1XROA 2Q0XA 4URZR 4N8DA 5EP1A 4YUVA 5LDHA 3ZLJA 2OUIA 2RB5A 1KQOA 3KKQA 4HGPA 1YRAA 4C0WA 4DDWA 5B6PA 1W36D 1XZCA 4C04A 1PG2A 1XTIA 2NGRA 3GEEA 1VCNA 3B5IA 4LMAA 2OHJA 2F9LA 2Q3CA 4G07A 5ISMA 1L5ZA 4G23A 2SHKA 1OSNA 2A9KA 5C8VA 5JH7F 3VV2A 1PKEA 4XIFA 4F3NA 5EZ6B 3MLEA 1TCVA 5EQFA 2I55A 2J3KA 3D6JA 2OV3A 3KEOA 5BN5A 3MPUA 2XY4A 4IXDA 4GYJA 1L5NA 1CV2A 1NJ2A 2DWQA 4EW6A 1JU4A 2G1UA 3INNA 2J32A 4RV5A 1MIHA 1Q1BA 4F6CA 5HF6A 2GUGA 1DL5A 2AFHE 3R5XA 2HO4A 5EJ2A 1P7ZA 3K1TA 2C5FA 2FZCA 3ND6A 3CCCA 3PRKE 3SVLA 1WEHA 5KREA 1P29A 1RZRA 4NQZA 5DCWA 3MUEA 1U7OA 3VR6D 3FNBA 2H29A 3ITKA 5T6BA 1NP6A 2JFBA 1KK3A 5FWAA 4J1NA 4EM6A 1NA5A 5BV1A 2V0GA 4MQBA 2WFLA 1PVDA 3AIKA 1C8KA 1MJGA 3FCSB 3QH4A 5ECGC 1UBEA 3D81A 1HUQA 2N0SA 3NVDA 1DC7A 3KVVA 5FBRB 3ZE2B 4LDPA 4HAOA 5TMPA 1ULTA 3WK6A 1T2AA 3LPDA 4OJYA 4MRAA 3QG1A 2OXEA 2ZBUA 2O8EB 5M29A 3OQMA 2ZS7A 3DXYA 4KN5A 5DHQA 1Z5GA 2ZB7A 2AMJA 3Q6IA 1I4TD 2G5PA 3RC1A 2FZWA 2DQZA 3F1LA 5JPDA 4UCFA 3E2IA 1EDZA 4II3A 4E1BA 2P2SA 5EP2A 2DFPA 1RHJA 2YUTA 4ZO8A 1PZHA 1SKQA 2E5WA 2JFZA 3F5SA 3EEOA 1CNFA 2OOSA 1QZ3A 3CVJA 5BOVA 3ZU6A 3F7NA 3DMFA 3DE2X 1CEQA 4E1AA 1MNQA 3MWYW 4HQ0A 5D6OA 3QLVA 4GICA 1KR2A 3AF2A 3DKRA 3H2SA 3WWEA 3BK1A 3NEJA 4AZ3B 4HAWA 1R4MA 3WRYA 5ICGA 5GM1A 1K5HA 4XYGA 4QPCA 4XRRA 1EFCA 3RYTC 3B5JA 4WE3A 1YDWA 1QHFA 3G89A 4ME6A 5BURA 1XTPA 1B8VA 3BXOA 5BVHA 1W94A 2YMMA 3I37X 1JX6A 1NDUA 1PL7A 1BX3A 3N0RA 1DO0A 4Y8VA 4YRTA 3ZIAA 3COYA 5KJ6A 4NS1A 3QKRA 2V7UA 1IN1A 3PFHA 4EBFA 2CCGA 1RQRA 1I80A 4BEWA 1XPRA 2ZJ1A 2R11A 3PUZA 5JAOA 2ZRQA 1YB6A 1H8ED 3DAPA 3A2LA 3C3WA 4GMFA 1ORDA 4HDKA 4TTJA 1DQNA 4EB0A 2OTCA 5B7PA 5KOIA 1C4KA 2GGSA 2PZBA 3V1LA 2PQMA 1FSGA 1RQGA 5FLEX 1O95D 4EOGA 1M33A 3TLAA 4PONA 3WNCA 3TLYA 2IS4A 4QOJA 5ALUA 2F8LA 4OMDA 1JWAB 4JIGA 3MCWA 2M1XA 3MGAA 5EMHA 3EZNA 4IVPA 1MD9A 2GEUA 1ENYA 1QX3A 4LEIA 1DWPA 4YHHB 3MT8A 1AGPA 1D07A 3I4FA 4AJ9A 3C3YA 1JG7A 1AV7A 1VOTA 3W3AA 2FW9A 4GZLA 5EJMA 2QUKA 4HUQB 3I2KA 1FX0A 2WHQA 3II6X 4G2TA 4PSUA 4V0MA 2A5JA 3LY9A 5GY7A 3GJXC 3VPFA 2NZ2A 1SHLA 1JVSA 3R75A 1LPBB 4JJKA 5REQA 4CL2A 1J70A 2AJDA 1L1RA 1PTJA 4WY5A 1F0YA 2DJIA 5JD5A 1QH1B 1RE0A 4RTPA 2IU3A 5FTWA 3HKBA 1E1CB 2P6MA 2QAGC 2FGKA 3E48A 1NXWA 4ZCMA 1G6Q1 1O5TA 1UZLA 3F0TA 3OCWA 3DMGA 5ALWA 5TE9A 5CYPA 3ROEA 1XDSA 3KQOA 5C37A 1NMXA 1SCUB 1ZW6A 1KZ7B 4Q1AA 4BZPA 5B5SA 4E12A 5JXIA 1GR1A 2IDZA 3PNSA 4KQCA 1NJ1A 3NCHA 5B2EA 1E2BA 1YOVB 3INYA 3A1NA 2WYWA 3BBPA 3O4HA 3K72B 4IVQA 1X2BA 2TSYB 2XE4A 3TGLA 4M8LA 3QX9A 3ZHXA 4KMOA 1U9ZA 1L4MA 2H1OA 4ZZIA 1XELA 1YIAA 3K5HA 1YJQA 4KXFB 1AG9A 4O1MA 5A0VA 3FGZA 2RGNC 2QTLA 4N7MA 4E5YA 1ZBDA 1AH2A 1M6WA 1J42A 1S4MA 3DMYA 2O7VA 5JAHA 3ROTA 4CT0A 3U0VA 3D43A 1SBNE 4N1AA 4J3JA 1U9IC 3N2IA 5DGTA 3A2KA 3GI1A 4ZAXA 1CQWA 1MO5A 2IZ5A 3QVGB 4GD3Q 5AKZA 1OC2A 5B2ZA 4DCMA 5CFZA 3EPLA 2HU8A 4E5NA 3VQTA 3TMKA 1Y3BE 4W5NA 2BMDA 3U48A 3R8FA 3PU6A 4IJKA 1LGYA 3BCRA 1M1YE 1BH2A 1K8YB 3HB4X 3BPSA 1FA9A 1XVAA 3BA6A 3K5PA 1JH9A 4KQKA 4OQMA 1LPPA 1UQRA 2A4KA 3JQ9A 2FE1A 2FQ1A 2ABWA 2WIJA 2YMLA 4DNQA 4ZHQA 1ESCA 2WKPA 5IKXA 2N47A 3FTQA 3W5SA 1ONPA 1GKUB 3PTLA 4NDNE 2Z2JA 5E7QA 2BONA 1OIVA 3DTYA 4G0YA 2Q6IA 4GFDA 4ETWA 2OC4A 3R7DA 2QM8A 1I2AA 1CJSA 1STOA 1OBFO 4IIGA 5EP4A 5A7GA 1WXFA 2VKQA 1GITA 3R4CA 2QVZX 2DETA 2BH2A 1JR3D 4NH0A 4FLMA 3BJEA 4G0ZA 1NN1A 4PTLA 4TRRA 3U39A 4UM9B 5LQCA 2PRZA 3SYLA 2XTZA 4YCDA 3E4DA 2ZXFA 3AETB 3G49A 2V6JA 4MW5A 5EHXA 4OB6A 4GWKA 5B1HA 5JNUA 1T5BA 3AUJB 4IDGA 3B7PA 2C9YA 2NSYA 3DQPA 3HLYA 3LPAA 2GJ8A 1T8WA 2GF0A 4XQ9A 1SKBA 3WMRA 1BC5A 3KUDA 1B3RA 1Z6XA 4PBRA 4QQNA 1YE5A 4YBRA 5EXTA 5IYZF 1KDVA 4Q4CA 3D59A 3DAHA 5DYGA 4J0IA 2HXGA 1EVKA 2OAEA 3LUKA 3QFCA 1A04A 3D4LA 3SOPA 1NPDA 2FR8C 2CGEA 1YVEI 3OM8A 4XD7D 5F4BA 2R7LA 5K2MA 3CRMA 4JK3A 4KQXA 2NUAA 2OKCA 2BFEB 3UCFA 4M36A 2TRSB 4IDDA 1JDUA 1O57A 2C2MA 2W8ZA 4JNKA 4O4IF 5CCDA 1QF7A 4MI3A 3PD7A 3F3SA 2NU8B 4E5KA 4GMGA 1RC1A 2RHMA 3T15A 1Z8DA 3WJ7A 4YAJA 5GV8A 5TJHA 2QRMA 3OPYA 3AVTA 3ZOKA 4TKUB 4NMWA 4LOJA 2Q9BA 4UD2A 4BNKA 1EESA 2HCJB 1KU6A 1FB5A 2IS1A 1PN3A 2CZCA 1B8OA 2HM7A 1ZI6A 2BUBA 1E0DA 1OLOA 1WRBA 3LUPA 1R74A 4MMXB 3ZV5A 1ND5A 3DV0A 2C98A 4GM0A 5B55A 1H0RA 2NZJA 3ISTA 1XQXA 3RREA 2FRXA 4IQGA 4QVGA 4YJDA 3ZD8A 2Z6AA 1SXIA 2JI7A 1JXMA 1TC2A 3OFNA 1PFKA 5EIHA 4BZXA 5EJ5A 5L3VA 5LMNB 3THWB 2QDXA 3G7NA 1JT2A 3EDMA 3F5QA 3KE8A 3L18A 4OF4A 4RXTA 3UWDA 4QVIA 1N5IA 1XVIA 1FPQA 3RSFA 2BGNA 3FUXA 3K2BA 1UC8A 3PUVA 1JJVA 5IH3A 2BFPA 3LA6A 1YRBA 3OQ1A 3S1AA 5DLQC 4R2IA 2R79A 4K3VA 2VJKA 4BFCA 3BGOS 1E66A 3BH7A 4CCYA 3DMDA 5KX5B 2EJCA 3LPMA 3D3NA 2PAAA 3D8NA 1EMDA 4N0DA 4W7IA 2AXPA 2B4RO 3RU7A 1Z4QA 5DOVA 5SZIA 5BN3A 5DNDA 5HSGA 3KG2A 2D1QA 1QG2A 1SVIA 1Q0UA 1FTYA 2GBLC 1GPNA 1QHHB 5NLLA 2EF1A 1GUFA 1OBVA 3ZXSA 1LQ2A 2Q2QA 2EW2A 5DYTA 3M2TA 1KI2A 4X45A 1FFBA 3MTEA 5LR6A 1WS6A 3DEFA 2GF2A 1DG9A 3TQOA 4UEQA 3UXMA 2I62A 3LT1A 3RT1A 1CJMA 1PT5A 3AW9A 2PO7A 1BKSB 3GLKA 3Q7RA 3ILVA 1RI3A 3RT7A 4BNIA 2JBAA 2AOUA 2CNBA 4N7RA 4URUR 4DGQA 1F8GA 3WG9A 2H3EA 2VN8A 2Z1DA 3CRNA 3WGJA 4EHJA 4PNHA 4RTJA 2OHIA 5IW8A 3V8VA 3L7DA 2G9QA 3FI9A 4I0WB 2I2CA 3FHTA 3OIUA 4IPTA 4KR2A 4U7FA 3PSAA 1IBMB 2NU6B 4HFRA 2FPPB 4R1QA 1DKMA 4L8VA 5AW5A 4R0VA 1L1QA 2AJ8A 1EFAA 1IULA 2QMUA 2J8ZA 4DYHA 5IJ0A 2CMGA 1Z2AA 2GEKA 1VGRA 4F91B 3RH0A 3WK9A 3HEMA 1G17A 4R8VA 4KLNA 2ORYA 2BVNA 3DHNA 4N3BA 1JKFA 3TSCA 3LX5A 4BNVA 2DG2A 3NC1C 1QZZA 2RBEA 3DFZA 4M9XA 4XFJA 4FDVA 4ZGGA 4C07A 4CMEC 5EERA 3SXUA 1E6KA 3GLIA 3ONEA 4D57A 4RVNA 1N2ZA 2XUDA 2XUGA 1MQAA 1ZK3A 1KJ9A 2ZJ5A 1Q7GA 1CUSA 2Y2VA 3BE4A 1U2EA 3KOZA 1VI2A 2XCLA 4H0NA 4YJFB 5G3ZA 5K8JB 3QGMA 1X7WB 2HLHA 4J7CA 3PX2A 5EN4A 2PMBA 5I7WA 5IKMA 2IEIA 4W1SA 5A05A 3HCPA 1QRRA 4BLUA 3N2NA 1CY6A 4E22A 1EFRD 1RT9A 2ZCVA 3CZCA 3DCYA 4O8CA 2P4EA 1U0SY 5C8YF 1V4BA 3G2OA 2WDZA 3ANNA 2ZTHA 2FE4A 5ARDA 2QV0A 2PJUA 3EZXA 3A32A 3HZHA 3GRYA 4M1MA 4U9IS 5G0TA 4MLCA 3RABA 4OX9Y 3SOZA 4GBMA 3VISA 1MABB 1PYDA 3VKGA 2BEUA 2X9LA 1QP7A 4XOIA 1DPGA 1NF2A 3LC2O 4BUCA 4DHWA 3KLNA 4ZYLA 3AESB 1SCIA 4LKOA 4WFKA 4KLCA 5C8ZA 2CNKA 2EWWA 4YCLA 4AUKA 5K3BA 2HJGA 2CJXA 3ZW9A 1JKJB 1M2EA 2ZM6B 2FFRA 3G9TA 3UOWA 4O2AA 1PJ3A 2QG4A 2O1XA 1MIOB 3OAAD 1R6AA 2FWRA 3NASA 1OFUA 4O2BF 3AB8A 2FP3A 4EF6A 5BNZA 4ZYVA 1NT4A 5JVDA 1TGYA 5FR1A 1Y3IA 2JLQA 2YCLA 1YJBA 3A1DA 1EWKA 3MUNA 4QNNA 4P35A 4D4GA 1XTKA 2BE9A 1QH9A 2CXXA 2VHEA 3PWKA 4HQFA 1MX5A 2IDJA 2PKCA 1NAIA 4OTZA 1U80A 4A2WA 2BZGA 3THSA 1WU8A 2ECPA 3KYIB 2ZJ0A 3ULKA 2PYIA 4R7GA 2PT5A 4C7JA 4HSEA 1E1YA 3A4VA 3WKEA 1X0VA 2QRGA 1KMIY 4R2KA 3PA8A 2A0YA 2N9UA 2C3PA 2YWHA 3IE2A 4UJ5A 3DQZA 1OV6A 4OAPA 4B3DA 5K45A 3D3JA 1YOBA 1G20E 3E3NA 3C8DA 3IV7A 4E88A 1A5BB 3EPRA 5KZMB 4QJ4A 1J7KA 5DYYA 2QTBA 3AVYA 3FMPB 2HGZA 2ZYHA 2QVGA 5T4HA 4TV8F 1Q74A 1QCZA 4WD3A 5TB5A 2XKBA 1XNQB 4CMJA 2GM4A 1J39A 3LYUA 4QGSA 3GEPA 1UMKA 3HKDA 5AI4A 2WA2A 3QXJA 3EF0A 3TZEA 1H6BA 1B8UA 2E37A 1I2CA 1FNMA 1USIA 3ST7A 4P58A 4MXDA 4EG1A 4CTOA 3GGSA 3P20A 3LQRA 2GFQA 1G7TA 4ISCA 1CKEA 1Y4AE 1YZQA 1L4UA 3DT8A 2HB6A 4K40A 3LUGA 1W96A 1CQIA 4D56A 1GOTA 1FXWF 1P60A 1L3IA 4B3CA 4EQ6A 2W90A 1XNRB 2B8EA 2YW9A 4WY8A 3JQAD 4C4OA 1I0ZA 3MCAA 1QZUA 2A92A 3BMXA 4KQFA 3A36A 1P0QA 1A96A 5J4YA 4QHSA 3U44B 1NYQA 2LRHA 1JJIA 5HJ2A 1HO3A 3GG2A 5DBGA 5BYKA 1O6FA 3IDSA 1GZ3A 3AVPA 3C4JA 2REBA 1BW9A 5LA6F 5U1PA 1CP2A 3CXUA 3K0EA 4KN8A 1Z4IA 4GYWA 1D5WA 5L6MB 5C52B 3IQHX 4IYRA 1SUIA 2PSJA 5AM4A 4DT1A 5FADA 3U6BA 2PL9A 4AZ0A 1YL5A 1E2GA 5EE5B 3RFXA 2HQ1A 2GPAA 1CUFA 2EDCA 1MB4A 1T0JB 3PITA 5FQOA 2RI0A 1WZCA 4TZTA 4XASA 1PV2A 2GEFA 4MAAA 4UHJA 4DXHA 2VYCA 2GPWA 5EMKA 3SHQA 3F7TA 4JLPA 1DTEA 3QFRA 4OUDB 3ZDAA 4YQFA 2O2HA 3H86A 2J9FA 3KPJA 1MAUA 1HQDA 2I78A 3DTVA 1A1VA 2ZRIA 3HWWA 1UP7A 4BATA 2Z9CA 3B6MA 2ZQZA 4MS3B 3KJIA 3SKVA 1GG2A 2HN9A 3ZD7A 4MLPA 4B7ZA 3CPJB 3R3XA 2WYVA 4B3SB 1QB7A 4J16A 3MVEA 2EIHA 4B2PA 3LO5A 3KS9A 5ENZA 1JTFA 1Z5VA 3LA8A 4HNGA 5F5XA 3B12A 1TUEA 1GN9A 2QA5A 3QBVA 5KDLA 2IZZA 3LWNA 1RWBA 2WWRA 3BXPA 4GM1A 1VMIA 5CGQB 5TY0A 5LSAA 4DADA 1P2SA 1L5VA 1Z6GA 2EFCB 2K2WA 4B8YA 1F5NA 2JGLA 3IKJA 4QE3A 5K3CA 4D74A 1CJTC 4NK5A 1QPZA 5A3VA 1YNOA 2YWCA 3OPQA 4B3MB 1N0VC 2CMDA 3I1JA 3V1MA 2AN9A 3T7JA 3AV0B 4LZPA 5H70A 4RTOA 3EEBA 2A59A 4OBXA 3MIIA 3CURA 1D4OA 1CYDA 1ZZGA 1ZRNA 2DPMA 3H5VA 4Q4HB 5E3IA 3S7ZA 2CJPA 1BAPA 1BMTA 2FVXA 3Q7QA 4Y98A 5FL7A 3WGVA 3S8EA 3DL0A 4BDTA 4EKGA 3EPHA 4JI4B 2BMVA 3HJTA 4Z3KA 2O4CA 5CVCA 3NOVA 4DV7B 4H17A 3USES 2Q46A 1NDQA 4YAOA 2CLLB 3A6KA 4WXEA 5E0KB 1GNTA 5A4MS 1CCWA 4UXIA 5CVTA 1NV9A 4KPUA 3QNWA 4QULA 5E3JA 1K7FB 3K20A 2VSNA 5GVSA 1WX1A 4NZZA 3JQ8B 4CL3A 5FPPA 1PAUA 3LRXA 2G71A 3R3JA 4MPJA 1IN5A 3N39C 4WBSA 2AUTA 2R2GA 3RG2A 3MB8A 1F8FA 2ZE5A 2ZRKA 4HXYA 1F2TB 1UR5A 4E30A 1E18A 2NVUA 1JN0A 3UG6A 3HEBA 3DDOA 5ESXA 3RBAA 2I91A 1CYEA 1QM5A 2MINA 3BXGA 4UZFA 3ZXYA 4DCGA 4NJEB 3QEJA 3L49A 1N2CE 1XEXB 3QW4B 1L4LA 4JOCA 1Z0UA 2ICAA 2O2XA 1IUOA 2P2ZA 2Q41A 2QLTA 2WHRA 2QG6A 4FNAA 3TX2A 3ZLVA 4AWBA 3ERCA 2OCLA 1YBHA 3N53A 4NENA 3I45A 4WFQA 2W6NA 1FYFA 1HEUA 5GV7A 5T8KC 1RE1A 3ND9A 1B8NA 1TF2A 2H06A 5IK2D 5LQJA 3GN2A 4WZAA 1YSCA 3PI6A 4HTFA 1YQWA 2ODAA 4Q3CA 3OE5A 4MR8A 1QK4A 1DIAA 3UJ9A 1NBOA 2ODQA 1KJIA 2VNAA 1KO5A 2X5NA 4COOA 1YS2X 2IYWA 1Y7IA 2QAGB 3GFSA 5CU7A 1ML3A 1HLGA 1A4RA 1QVVA 2Y1FA 3BEOA 3IT1A 1SAYA 4I50F 1WV1A 2W4QA 3K6JA 5I51A 4RIFA 2PZEA 1C4WA 3PEFA 1KZ6A 3C5VA 1VKHA 2WD7A 3K1AB 4JD5A 4BU1A 5L4LA 3FCYA 4RD2A 2PYDA 4B7CA 1ZVJA 4CKEB 2Z43A 3TL6A 5JASA 3U9TA 5BPFA 4MB2A 3RF6A 2A1UA 1OX5A 2GPTA 2VBIA 2DFLA 4S1WA 4WEOA 4Y7CA 5MGBA 5F4ZA 5DI3B 2RGBA 1Q3TA 4JB3A 4H7KA 4JWTA 3ZHYA 4Y0AA 4Y9RA 4WBXC 5JU6A 3QKTA 4MAMA 2J6CA 2GF9A 3E5HA 4IDEA 5SZKB 5CEJA 3FLBA 3KRTA 1UWLA 2EZUA 3IIJA 2GESA 1JHQA 1UC9A 1D09A 2A33A 4JUDX 4X6XA 3WLLA 3D3WB 3GN1A 1KFBB 1P2UA 4ZZ0A 1HOXA 4IIEA 3N0WA 1DXHA 1EBFA 1H1LB 2PVPA 2Q21A 4OUKX 4ALNA 3R5SA 4KQ2A 1UWKA 4XTRA 1JZQA 1ORIA 4I1PA 5BV7A 3KOWA 1NVUQ 5D8DA 5D51S 1I3NA 1QFZA 3CIFA 3GO4A 3UTDA 4F2HA 4ENSA 1AVTA 3X44A 4FNMA 4ZT6A 1WUHS 1A77A 2IIVA 3IAM1 3SF8B 4J6FA 2LD4A 3RYFB 4RBNA 1I2MA 4RJIA 3SJCA 6GPBA 1HRDA 2R9VA 2XYPA 3LCUA 2C78A 3ZHUA 1MC1A 1F14A 4MYSA 1WMSA 4G0PA 4N0QA 4PRKA 1TUBB 4JVNA 3PGMA 5C4MA 4BN5A 1SC9A 4DR6B 4OSOA 1RYEA 3H9JA 3C7DB 3TLJA 1HE5A 1NM5C 2WR8A 2DTXA 1JW9B 4J6EA 4INJA 4W5OA 2QN8A 2XA2A 3AFIA 4G5SA 4RJLA 4X3OA 2BFBA 1NI3A 4Y9DA 1Z4PX 2B1IA 2XHZA 3EQ6A 2NVOA 5JQGB 1FJ2A 3JWHA 3PS9A 4KFSA 4PXSA 5DRYA 4Y6LA 2Z6UA 1DWQA 2VOJA 1ZFNA 2D6FA 2Y3IA 4FT4A 2PGDA 4O4HB 4B6FA 3BTSA 4UUOA 4WBNA 3N2LA 2GA9A 1EXWA 2CLKB 2EGUA 1T15A 1JIVA 4R5HA 4WW0A 3T3OA 3CINA 4RWZA 1C9YA 1E64A 3KXPA 4LJ6A 3M3PA 4FJ2A 3DZJA 4PZYA 5AI6A 3SAJA 4FE7A 2CBXA 3AB7A 4LJAA 4OXIA 4M86A 5F2NA 1U65A 1IATA 2XYRA 3HO1A 4MCAA 1RI1A 1UPXA 2HZBA 2YJGA 3H2HA 3LC7O 4U5QA 3IP9A 4KNVA 3K9LA 1LRLA 4HRYA 2G08A 4R3NA 4RTLA 4K2HA 3V8MA 4R83A 2A35A 3EZ9A 2P2NA 3U3XA 5ALOA 1G6KA 1RZ3A 1IZZA 1EBBA 3UBMA 4R54A 4R1SA 4K0KB 2HH9A 4DGSA 4D0LB 1UKZA 4HXEB 1R0WA 3A6EA 1PK9A 4FYVA 4I1SA 4IVNA 4KIJA 4MQEB 4P3KA 3SYKA 9ATCA 1R0RE 1EWVA 2BLLA 1YZFA 2QRLA 3MD0A 4P2BA 4CKBB 4JIMA 2V97A 3EQ8A 3GRUA 3UMGA 2G1JA 4FR0A 5K3DA 1D2EA 1QO7A 4AYTA 2YMPA 2BEKA 3SQMA 4YCBA 1EM6A 4PINA 4DG9A 5M5BA 3O1IC 1XTVA 3D7MA 5GIOE 4WRRA 3ED5A 1FP7A 3GL9A 4C87A 4DM3A 4C3ZA 1U6KA 4MMYB 3W4JA 1VDMA 4HY3A 3TJRA 2HQRA 4M8KA 4BX0A 2X0DA 1KJYA 3C14C 3PBKA 4U2KA 3VSEA 1KSFX 1PL0A 2O5RA 1HY3A 3X1MA 1QIIA 2Z57A 1X19A 3FPGA 3CA8A 4WNCA 5ECDA 5EGSA 3GFVA 1WKBA 3I6BA 3I8OA 1MDBA 1J49A 4QEDA 1NKSA 4UBOA 1CUGA 2J9YB 2H92A 5KYTA 2J5QA 3KTDA 2IH2A 1NFFA 2YXLA 4L08A 5EEGA 4OMCA 4XWTA 4M37A 3LYHA 2PXXA 4JLWA 2ZRNA 2CUKA 3A3KA 4EPWA 2NP7A 3LF1A 3HP1A 3PF8A 3VPXA 4L27A 2ZDGA 1A8UA 2B30A 4I46A 2J4DA 1D9XA 3I4LA 3PXAA 4UPDA 3ZU3A 3CY6A 5A9SA 5EXSA 3VR4A 4I7EA 1U3GA 2HA0A 1E8DA 3UIEA 1GFSA 3C1TA 3GBVA 3UMJA 1W46A 3LVBA 5ESDA 4FGUA 4HWTA 2O3SA 3SMVA 3QLVC 4YJ3B 2O4UX 2AC7A 1UFQA 1DKPA 4RSHA 1T4CA 3WRYC 4DE5A 2RI6A 2XOEA 3KQNA 1V5IA 2EZ8A 3KALA 1RACA 3I5UA 1DO2A 1GSOA 5KMGB 4EGAA 1Z22A 3G3EA 3AM5A 5I4KA 1FMTA 1E5DA 1X1DA 1JIXA 1W73A 5D3MA 5JBQA 1N2IA 1RTKA 2BELA 1VBMA 4BNTA 1IHUA 1V26A 2NUTB 4EVIA 4BBZA 3HUDA 4C3OB 1OTXA 2GD2A 4KYIB 3JYPA 4MW1A 3W06A 5HRCA 4JA0A 2BTEA 2QROA 3NTQA 3GLGA 2QL5A 1GRVA 4JB0A 1RRVA 3SIPA 4DQUA 3LUJA 4O0LA 1LTQA 3H8SA 3TG8A 3RIYA 4CM9D 5HQ3A 1P5RA 4Q47A 1TM5E 4RZSA 5TSDA 1G7SA 2VSOA 1XDUA 1ORVA 1SGWA 3LBHA 1LD3A 3BMQB 4KL8S 1DOZA 4B9AA 3B60A 3K1ZA 4C0LA 4DIBA 2BFWA 4B6JA 1TMGE 2Z04A 4HVTA 1UJNA 3DOUA 4B4OA 1P9NA 3PENA 4QQKA 1C9DB 4IJVA 1M6NA 4V24A 2EHDA 3HDTA 3B3GA 2ZI7A 3EQ9A 3IT3A 4U7DA 5ADUS 2VBFA 4H31A 3CN7A 1E5TA 3K09A 4IZHA 4OQNA 3C2QA 2C96A 5EUQB 2CDRA 1MAHA 1NGSA 3JVEA 1MO2A 3M6MD 5E1OA 1TX4B 2ZROA 3D1JA 1YZ3A 2AMVA 4EX6A 3VH1A 5FUMA 1RZVA 3DULA 1PTJC 3KNZA 2R6JA 5K05A 3PJRA 1EP9A 3ZDXB 5CW2A 1U1IA 2CVHA 3SDZA 1JYFA 1DEKA 4MICA 4OV6B 5DHAA 1RXWA 1MC4A 3HI4A 4FW9A 3BD8A 4MYHA 3H6KA 4C1NA 3ZHRA 3FHOA 1YA8A 4ZEXA 3M6VA 1WL8A 4UC0A 1VKJA 3GT0A 4Z8XA 1I5EA 1EK5A 4DQVA 2GOYA 2WJGA 2J0UA 5AOVA 3FTCA 5HA5A 3RTAA 4H3HB 4K9MA 4F4IA 3I92A 4L76A 4AQDA 3UXYA 4W5JA 4UU1A 1MB3A 4DC0A 3RRJA 4LBWA 4EY4A 4LGMA 2GCGA 3R3UA 4RCVA 4HZUA 2BLNA 4S0ZA 2C8JA 1HDIA 3Q3VA 3DLIA 4JDPA 2Y67A 1LI7A 4MV3A 3NTLA 3H9UA 4K6OA 1QTRA 4LMPA 3DONA 1IOLA 5JS7A 4JKIA 1OZAA 5AKYA 2P91A 4ZI2A 1NN0A 2ODBA 2YOGA 3DUWA 4UTZA 4CF3A 5IXJA 4M49A 3VC3A 2JH9A 2PUBA 1ZZEA 4RZQA 3OKPA 3IHWA 5CLLA 5FP0A 4BNWA 3VH3A 5HR5A 4D82A 5K4GA 4U6QA 1QQTA 2EG9A 4G1MB 1RRPA 2VHTA 2FHPA 1T0BA 1XGKA 2JZOA 4KJXA 3G23A 3LOPA 3C43A 2GM9A 4JP1A 2Y76A 3G5LA 4I3GA 4LV8B 2PZLA 3K2EA 2F1JA 2W2OA 3JQ9C 3U1VA 3UKDA 4F9TA 2QRQA 1OVGA 1GQFA 4LCJA 5KO2A 2P8SA 3V4PB 4O6VA 3FCAA 2OCGA 2YYSA 2P41A 2XVZA 3PL1A 4I4TA 4WGGA 2OLJA 5B4TA 3AHEA 3WAJA 3H84A 1VLZA 1WETA 2QPLA 3EULA 3KSMA 4CI0B 5C5EA 4F4CA 3A9RA 4MQ5A 4JUBA 3NPAA 4IQ4A 5BP7A 2AOTA 3NMUF 3G17A 4FTWA 3R7NA 4EDFA 5IN5A 3JPWA 3U4QB 4GUDA 2ZRBA 4GOXA 1KI4A 2C5SA 1OHHD 1U4NA 1EP3B 3NWBA 4CZ2A 5K0TA 4R4JA 2EERA 1A72A 2ID7A 4H4DA 1X80A 1F6DA 2JFOA 3IV6A 4HGZA 2IZ7A 3MUFA 3NYQA 1ABEA 4N3GA 4RHUA 2BKAA 4UAVA 5LZ5A 3TL2A 4GT1A 4JASB 4XAQA 1TM7E 4DF3A 2D2XA 4BFUA 4GVLA 1J7JA 2WAAA 1XYYA 4PAMA 3E61A 3VX4A 1GM5A 4BO0A 4UBNA 1TEXA 2Q1XA 2W6JA 3MLAA 1WHTA 4WKCA 1YK1A 3MTQA 3VPAA 4TYMA 4PFKA 1BOOA 1Z0AA 1JIUA 1SU7A 5E9AA 3UW1A 1FYDA 1IG3A 2XNJA 1KJNA 4L85A 1LBHA 2XA1A 2JJYA 3EW9A 4DJ5X 1AHIA 1YJ5A 5F33A 2W48A 3CISA 4F1WA 4GP7A 4TVKA 1V1JA 1YE8A 3RR2A 1QVWA 3OBIA 4F5DA 3IAS6 2GAAA 1L4KA 2WHPB 1T1GA 2NSLA 2FMUA 2YV4A 1ESMA 3T9CA 2JGDA 4UAUA 4A2CA 2A58A 1ML4A 4FE3A 5KBYA 3R9XB 3RU3A 5EJ9A 3WDSA 3P94A 4Y1RB 4AG5A 2GD1O 3IS3A 4V3BA 3X1WA 5JD3A 2YHIA 4OPMA 5KDDA 1DI0A 3JXEA 4B47A 1U0HC 3KOYA 4KQWA 2Q5LA 4MW0A 4Y6GB 3HB1A 2CW5A 3SJAA 3B1XA 4PZAA 4CHGA 1BA3A 5KWSA 1S3GA 4HPWA 2FDCA 4H6XA 5IPFA 4PCAA 3ZJ4A 1F8UA 3E3LA 3I83A 3WTBA 3UAVA 1IK4A 2BDEA 2O0HA 1P1BA 3ZHVA 1TGVA 1OBOA 4V0SA 3QEKA 3SX0A 5FEMA 2BEVB 3E0XA 4OHXA 3O8NA 3Q40A 3UHPA 5ILOA 1WSDA 4MINA 1IN7A 4RZXA 1DXOA 3VHXB 3TZHA 1MFPA 1K2WA 4CNQA 1YS9A 3ENQA 4R1PA 4AKGA 5EIEA 2PDAA 2EFHB 4LQLA 1GZDA 2B4TO 1Z38A 3HL4A 1HQKA 2ZJFA 2IY7A 3KYDB 3NIWA 2XTMA 1V1MB 3HJRA 3EGDB 4KIGA 1U1CA 4LZAA 1OJ7A 2C9CA 5JS2A 1QNFA 2P1RA 2PUWA 4JI3B 5KNCD 4JI7B 4G85A 3IKLA 3QVLA 2ZWAA 1RYNA 1AB6A 2R8EA 3FKJA 4ZTZB 3O2SB 4MUEA 4NV0A 1RKXA 4L4UA 4C0XA 3FLEA 4XX1A 3GXBA 4ZYTA 3U80A 4CLHA 3FYSA 3FNIA 3P97A 3VNSA 2NYVA 5FH9A 4DV5B 3A6GA 1KFEB 5DSZA 1MO4A 1NUTA 3U7FB 3L8DA 3RQSA 2B92A 2Z4TA 1K7SN 4EUFA 2IYOA 4WESB 1E0JA 1D4FA 1JJAA 2CF6A 3DHWC 3GUCA 4ZOEA 2WWIA 3M5WA 4HK4A 5CK5A 1BZYA 1GPAA 1VSTA 2H4ZA 3B2NA 3KP1A 1Z0FA 3BKXA 1KC3A 4DR5B 5A62A 2WSMA 4A6XA 3B1YA 1PEAA 1YK0A 1PV1A 2WDPA 1JLLB 4U2FA 5KDOA 2FUCA 1WMAA 2KPOA 3TN7A 3HUUA 2HRQA 4QBTA 3S2GA 3VO9A 4YDQA 1UM9B 2J9GA 1R7RA 4YRQA 2UXCB 2X77A 4LDAA 3OZUA 4LNHA 2HBZA 5GZ6A 3THYB 2ZI4A 1UXGA 4DC1A 1FSFA 5ICFA 1ILWA 4YRDA 3BILA 2WKQA 3AL0C 2B78A 3TQCA 3EVAA 1LSUA 1XZDA 4NATA 2QF7A 2YFYA 1SM4A 1NTOA 3JAWB 2HEIA 3IPCA 5EC8A 3C97A 4GI7A 3RHTA 2JF0A 2NV6A 3L7OA 1A7JA 4KWHA 5DHSA 2EYQA 3WMXA 4BB6A 2BW0A 1UBCA 3IDOA 2Q4DA 4TLBA 2MU1A 1CRZA 1ZGCA 1TM2A 3GQBA 1TVMA 2NT3A 1CIPA 2Q9CA 3FUVA 3ENNA 4XR4A 4RKRA 2DHDA 5JG7A 1M8PA 2IBSA 1ZJJA 5JMOA 5KNBH 3PDCA 2Q50A 1I24A 4HGQA 3M1IA 2XWPA 3HR7A 4UHBA 3TTTA 4BCCA 2HHAA 2WJ3A 1KU0A 3OLZA 3QV1A 1DJQA 2QX9A 1K92A 3S3TA 3CPEA 3VVBA 1F6WA 2XWBF 4GZ6A 3V4ZA 2P2LA 5D3ZA 1E1DA 1G8SA 3CR3C 1WW2A 3MMPA 5LLTA 2ZYIA 2ZYDA 5FPHA 2UZ1B 4G26A 1PEKE 1WVGA 2PSHA 1RXVA 2VDRB 1NJSA 1RSZA 3K0AA 1UBLS 3OKAA 3NP9A 3I9JA 5DMHA 4FK8A 3RUIA 3V8EA 721PA 1FUIA 4M8IA 4CFZA 3K6SB 1Y6GA 3WLIA 1EINA 2HYDA 3BJRA 2V0CA 2Q5EA 1E77A 4NAHA 4IEEA 4V0LA 3VKVA 3FX2A 4BQOA 4D8XA 1C1XA 1BEEA 4RK7A 4A23A 3SG0A 5K8LA 5BT9A 1S4QA 1D03A 3UMCA 5IRCD 3I04M 5AVSA 2WAMA 3OT5A 3S68A 5TVKA 4AJOA 4PF1A 5AQ1A 5CCXA 4DV3B 3GGDA 4CLDA 3UPUA 3P9YA 2FZKA 4KBYA 2QBYA 3EBLA 3OESA 3WFIA 2XB4A 4FP9A 1J8MF 1Q7TA 1WPXA 5I7SA 3A8TA 4D4IA 2V6IA 1NVXQ 4EYQA 2C07A 3O4GA 4IAOA 4MUHA 4LXIA 5DYWA 4C0SA 4DIEA 3K32A 4PG7A 5AKEA 4P4SA 3RHZA 1ADCA 2RGCA 5KX5F 1Z62A 1P2VA 5TPWA 1DBSA 1YUNA 1BYIA 1ZK0A 3ZX5A 1W5TA 4ECAA 2QJTA 4QBFA 3R7WB 2O0JA 2PUHA 3I53A 5LMUB 3JTMA 4FM9A 5AWFC 4M9UA 2Q6VA 2ZTLA 3V8RA 1XE3A 1GQOA 1K4KA 1X42A 2WVHA 2A5FA 4RD3A 1CZKA 4FNOA 1QVRA 1VC2A 2B4KA 1MB2A 4UHFA 1H8HD 1V1RB 2BEWB 1YD7A 3FPLA 3UK1A 2XWJI 5AICA 3WHKA 4AS1A 3LQQA 1E6UA 2CHFA 1VPTA 2NVBA 1BWSA 1JG3A 1P8JA 2AXEA 4GP9A 5KAMA 1Q7RA 2WTMA 3W1WA 2WPNA 4WA8A 4N0EA 4UUPA 4IFTA 1KOLA 1NX6A 3KZVA 3UB4A 1MH1A 2QJWA 3AOEA 1YZUA 5IDWA 1U0RA 4DLRA 1RRKA 3FZEA 1R66A 3LIIA 4FUTA 1EDEA 4G4IA 3EIFA 3IL2A 3VYVA 1GUDA 1M76A 3I9NA 5A4AA 1ZUNA 1OYVA 2GERA 5FI1B 4A36A 5BYJA 4MHTA 2ZTSA 5G53C 3TSWA 2RMKA 1X1RA 3R24A 4L2IA 2R4QA 2NTYC 2W6PA 1BXGB 4FKZA 4N40A 3NNDA 2P78A 3PQ5A 1XLWA 5BSGA 4YASA 1HE3A 1IN6A 1M10A 1UK6A 2HADA 2ZU6A 3ZE0B 1U7UA 3W9BA 3N2KA 4Y2VA 4NOJA 5H5JA 1LH0A 3LUDA 2ZYRA 5BQOA 3SSOA 1VHQA 3MELA 1Q92A 4LYFA 4QREA 5DW0A 3O3NB 5A3SA 1R5OA 4DBLC 4EYEA 5CIWA 2YNMA 2XRFA 2PV0A 3HN7A 1Y82A 1T26A 2IPXA 2R8YA 2ZSJA 2IEBA 5EHQA 4BN4A 5EWMA 3O8BA 3T4XA 1Z29A 4F5YA 4RD6A 3D4IA 1T9HA 2WFLB 2CXOA 1EJ6A 1DLIA 1ZO8A 4X60A 3NANA 3WOVA 3W5DA 4E09A 1MLDA 3JTEA 3TZ6A 2JIBA 1FTQA 3WLJA 1BWPA 2ID9A 2JHFA 4AYWA 5IKPA 1ZD8A 3A1FA 5J2UF 1O0BA 2I65A 3B6JA 3N28A 2G9ZA 2AFIB 2YS7A 1XJ5A 4J16C 4JUCA 3ZHSA 1ZN8A 4DSOA 4CXMA 4TLAA 3DKPA 3JRNA 1X38A 3WIOA 3I09A 3VO1A 2AD1A 2MMGA 5DO9A 3VR1A 1BVHA 3JVVA 1K86A 1KEKA 2BUAA 2O8BB 4FN4A 2H54A 4X3CA 5CFNA 2Y4OA 3GJSA 1RRFA 4IMRA 5G02A 3TKLA 3R0IA 4D4MA 2Z9BA 1N8SA 1RXEA 1DUVG 1KDPA 1Y3AA 2NO5A 4JN6B 4A0QA 1X8JA 3EMVA 5DASA 5JXWA 3NG1A 2O06A 4X7MA 4F2GA 4JROA 5KTYA 4TYNA 5AVTA 3BDAA 3CJRA 4K6KA 1E1QA 3B1WA 1Z5UA 1ZXBA 1GQQA 4ZU6X 4P7GA 3A6DA 4PGFA 1TA4A 1YU6A 4QRHA 5A2QA 2IZ6A 4IM7A 3S40A 1GYPA 1II0A 1VJ1A 3JARA 4EHBA 1JT9A 4B4WA 5BVHB 3SJ7A 4XSVA 1Z82A 1SOUA 2C61A 1Q14A 1ZIXA 5FBQB 1OWOA 2XE6A 3I2HA 1FRVA 4B3RB 3EWNA 4RY0A 3W2EA 1HMYA 4LDNA 4AKSA 4FKMA 5KKNB 1J6UA 2KBFA 3P9XA 3SM9A 4FILA 3GDWA 3Q3HA 3RIMA 2IZ1A 2ZAIA 3VBEA 2J3DA 4C22A 3CMMA 2F9MA 3PGJA 2UXBB 1E94E 5BW6B 4BZWA 1AK1A 5J5VA 2VF7A 1TKCA 1KYIA 5EIBC 4CMCA 1J9GA 1T8UA 1X7GA 2I34A 1L7MA 2IRWA 3BBLA 1A4UA 3EASA 3IMCA 3QENA 1VPDA 1DC8A 2IEZA 2B7BA 2HL6A 3MYRA 4TWJA 3RVDA 2JKVA 3HEAA 3PDIA 4NU8X 2PYZA 4LSMA 2A78A 3Q7TA 5GGYA 1Y8QA 3OCYA 1WDTA 2AYZA 1BHO1 1C7ZA 1E63A 3C4QA 3PHGA 3H9GA 4WSOA 4HDCA 3KDPA 2V1XA 4WZBA 3WWPA 1J0DA 1VLQA 2ATXA 1ZOSA 4KI7A 1QH8B 3TH5A 3ZQ6A 3CUYA 1TKBA 1BU5A 2TMKA 4PNPA 4ZV7A 3UMRA 3OOSA 4MW4A 1UBRS 4CT4B 4DV6B 4M9RA 1FDWA 1ONSA 4JMPA 4FPXA 3SLGA 2VSFA 3IXMA 4F2PA 4B2LA 4DIDA 3FTEA 1MHPA 2OUKA 1T6BY 2H08A 1PS9A 3G0GA 5EZYF 1DMRA 4EMSA 1PQ4A 2AC4A 1DKNA 2WFZA 3BK2A 4BWFB 1SBZA 3F8WA 3GA5A 1G9XA 1KGSA 5I5EA 2VDQB 5P8WA 1C30A 1JMYA 1JPNA 3IBGA 3VFDA 3UT5B 4BX9A 4RULA 3QNUA 3G2NA 4OQQA 4NZMA 3HKEA 2CEKA 4DCUA 1J0XO 3JZFA 4JL6A 1NPTO 2BJWA 4IJMA 4TWBA 2GLUA 3BC1A 3R8CA 4N5DA 4P80A 4TVOA 2FPLA 1ZP6A 2OORA 2EX1A 5K3EA 1ID8A 2Z8ZA 4NMMA 3MTDA 5HF8A 1MJNA 5LZ4A 1TTHA 2CNDA 3IBFA 2NU9A 4HWSA 1GRQA 3OOWA 2A5YB 1UZUA 3TJZA 3L6DA 4LVCA 2GPYA 1XL1A 3O8RA 1FYEA 4U7GA 1V7PC 4B4DA 4HNVA 2PRSA 5M34A 4W5TA 1K63A 1RQNA 4MX8A 4KRGA 2O23A 5BSEA 5IC5A 4JSYA 1QWOA 3I9FA 1D5CA 3GEMA 4R8KA 2EKQA 5IDYA 1MOZA 4URHA 5KQRA 3KLOA 5AT1A 4FXOA 2KBEA 1DV2A 5KYNA 2JGIA 1LF5A 1VBNA 1IDN1 1TEHA 2E4UA 3SQXA 1VHWA 3F71A 2B8WA 1LDYA 2H6EA 4UXHA 1ADGA 1JQEA 1BCSA 2LDBA 1WZUA 5LKRA 2C2YA 4JP2A 3SR4A 3FFBA 2G04A 3AJ8A 4K8RB 4ZHQB 3T3NA 4KQJA 2PGAA 3EODA 3FGPA 1QO0A 1DIHA 4ND6A 5IS2A 4BO1A 1Z73A 4JAVC 3KKNA 4HEJA 2YVLA 2CCJA 5AKXA 1C3LA 4HWRA 4YRMA 5IAOA 1EUDB 3T4UA 1D4ZA 1RW4A 2C2HA 5DLYA 5KPDA 3SEZA 3OIYA 1G4AE 3O2JA 4BP9A 4R9RA 4XTCS 1E9EA 3EPPA 2NYRA 3VR2A 1EG7A 1VSQA 1SXJD 4CL0A 2WM3A 3EWSA 3CMCO 5AXDA 5G1OA 4EZEA 4UTOA 1I6WA 4LFCB 3CIOA 2AZTA 4ER3A 2JRCA 3OEEA 3SDBA 2O1WA 1T4GA 1HNXB 3HSKA 3E53A 4JY7A 3A3PA 3C3MA 1XUOA 1YRLA 3ZWPA 1FTSA 1R9MA 2VYND 3PQEA 4MWBA 5JY1A 2XMSA 3IJPA 3VR5H 4PQGA 5LQKA 3RJMA 1U0TA 3SCZA 2QJOA 4ZEVA 1B93A 3PKJA 2GD6A 2A3NA 2C4MA 2NUAB 2DM6A 3AF4A 1GL6A 3SLKA 4DM7A 4I1YA 2W6ID 4JS0A 3O26A 4K0RA 4PYQA 3AKCA 4J1TC 1DQPA 5KNLA 1KVUA 3BT7A 1SKYE 1Y98A 2ZQYA 3DCNA 3VTKA 1Y80A 1Q20A 1WWKA 2V98A 1HDGO 1A3CA 5GPBA 5C5IA 2Y77A 4B3JA 3ZCVA 4JX8A 3RD5A 1ZG3A 2A0KA 1I2ZA 2KQUA 2SCUA 3OPYB 4JEIA 4OHKA 4S35A 3O03A 3A9SA 3LY8A 3OQ6A 3DF7A 1OYYA 4KQGA 4MJLA 1WXDA 3I12A 5BQFA 4YV2A 4BV9A 3WBFA 4KHPB 1TZ2A 1NOJA 2PL5A 1EKXA 2VP2A 5D87A 6CHYA 4RDHA 5L7WA 4KSYA 3IKTA 2DWCA 3BQ9A 5K6AA 5AW4A 5IJWA 1N3BA 2FYTA 4GLFA 1ZVMA 4F4UA 1PX2A 1GV1A 1A50B 3QLUA 1RU3A 4Q4DA 1JRLA 5HGXA 3P0RA 1FDTA 1SZDA 3NAGA 3C24A 1W52X 4MUAA 3R0QA 1F2VA 2EFGA 5CTJA 1CZRA 1KH2A 1BNCA 2F3RA 2D54A 2QP9X 2W11A 3CLSD 3K8QA 2WT8A 4G8DA 1KS9A 3IEKA 3AFOA 2PS3A 2P3LA 2Z8YM 1HL7A 1NASA 2XI4A 4NU0A 4D9IA 4C4XA 3LAWA 2WIBA 2PZKA 2CJWA 2DP4E 4U2EA 4BZQA 4B3IA 3EZ6A 1DHTA 4I1RA 5DZSA 2J33A 2XQIA 3E3MA 4JT2A 5E6UA 3QPBA 2XZPA 2HJSA 1EHCA 1HI9A 2GX6A 1DBIA 1J97A 5HIKA 1ZUIA 5TQ2B 2AQHA 4TSKA 5CAEA 1U5BA 3RI3A 2CMFA 3ICOA 2FWJA 3TIIA 1Y3HA 3QKUA 4PFJA 4EELA 4ZZ1A 2B7CA 4YQZA 1JHZA 1W5BA 3KWMA 2HJWA 5LP6C 4OIFA 5IYZA 4O08A 1CZUA 4H27A 1YCDA 3DWEX 2WLSA 1RWVA 3DEYX 3HCRA 5AKGA 1E69A 3AM3A 3LL7A 2IYLD 3ILSA 3IAXA 1P61B 1KFJB 4RAQA 5B1DA 3U26A 2WM8A 4TKLA 1QIDA 2V59A 4B8ZA 2WZDA 1CUBA 2UYYA 4R9SA 3PQCA 3I39X 3MBOA 1XN1A 2L19A 5AW3A 1ZVVA 3DWGA 1QLJA 1QYRA 3EGXA 4PCUA 2C92A 2K6GA 4ROSA 4MS1B 4MR7A 3C74A 3ZDCA 5E0OA 4UBIA 2FRVA 1JEQA 3HS3A 4MCJA 4QNMA 1L1FA 4DWWA 1PSWA 3G8YA 1V6CA 4Z3OA 2XMDA 1FSPA 3R0JA 2WVJA 1LZLA 1YDHA 4WK6A 3BQMB 4K9RA 3KUKA 2B9EA 5AI5A 4DUPA 1XTJA 2FZGA 1UK9A 3A11A 4PYMA 2E48A 1CQPA 1OFGA 2PO5A 4BVEA 5ALEA 2QSZA 4Q7MB 5JQGF 1VCOA 3T0GA 1GRCA 1G5FA 4R1UA 4P86A 2AK3A 3INTA 3LTNC 4WDQA 2P7HA 4O4HF 1PE0A 4TWAA 1VMEA 3IEUA 3K09C 3BXHA 4K88A 5IBRA 2H1RA 3EYAA 4RK4A 4TTVA 4CG2A 2B94A 4DA7A 1Z0KA 3EAFA 3S28A 1KI3A 1UBNA 2H2HA 4WLVA 1WXHA 1HFWA 2D2IA 4QIHA 2JIQA 1JQBA 3WO0A 4AMUA 1NI5A 2PWYA 2DVMA 1Y81A 2FPKA 1DFHA 1CRPA 5ICEA 1X1TA 2EL9A 3H5IA 1AUQA 3TZCA 2FSGA 4FXPA 3TOZA 3I30X 4M87A 2JCVA 4PYKA 2ORWA 2N75A 3EK2A 1P3Y1 2ZXEA 4RS4A 1BS1A 1JV2B 2V0NA 2OWEA 3IMEA 4U02A 1AKEA 1SHJA 4D80A 4BGDA 4W63A 1SXQA 3KSRA 3T1HB 3WL3A 1TA0A 2YBDA 1V6AA 3ABRB 4PHHA 3K0KA 4U7JA 4LV5B 1ADJA 4QDXA 3WWYA 3EVZA 3W5BA 3KQWA 2NQ2C 2OG2A 4QYSA 3ZS9A 1UJMA 1B0AA 4Q9AA 2GBPA 1LS1A 1W2HA 2UVPB 4P4GA 4D98A 1G8JA 4MQFA 1G3IA 5JCPA 3EVBA 3VJRA 3LQ4A 1H3FA 2O8CA 4F11A 3IESA 1E2NA 4NZPA 4F4DA 5CGZA 4XWWA 1UM8A 4OJQA 2UZAA 1UINA 2VXCA 3EMBA 2BKEA 2HT6A 2XVAA 3M4ZA 3QYPA 4IUYA 4AX8A 2ODWA 4BNYA 4ZI7F 2CE2X 4JC0A 4KIUA 3X2SA 1UC4B 2QW8A 1GNSA 3ROPA 1PJRA 3OT4A 4L8YA 2R7NA 4D8UA 2O3TA 4MRMA 4RZHA 4HGOA 2JASA 1ZGJA 3IP1A 2VP9A 3H75A 1FEZA 2GEVA 1AHHA 1SR8A 1F20A 4NSNA 4G36A 4HAVA 1RJ9A 5K8UA 2J41A 4DLNA 2ALJA 3BCSA 4DLYA 4X6UA 1G291 1K6EA 4U6SA 4FS3A 4ZGBA 3GZTB 5IC4A 2H7XA 3B3FA 4TLCA 1P0CA 1OH5A 3DGFC 1HG0A 2PCJA 3GA7A 1OB2A 2DTDA 3VH4A 4JP3A 3NYIA 1EAYA 3E7DA 3GPDG 3CJQA 3LCCA 4I14A 4J0JA 4PZUA 4QDZA 1AY0A 1FFXB 3P0HA 1WSAA 2IC5A 1G5QA 5KKAA 3SP1A 1VRVA 3FSEA 3TX6A 4YJ3F 3W3AH 3GCWA 3BWVA 3WXMA 5JNWA 2WIDA 5G41A 3THOA 3MN1A 1JDZA 2EKZA 3A4NA 4QO8A 2PH3A 1CY8A 3AHJA 3LGXA 4OY3A 4EENA 3VR6A 1ODTC 2RK6A 4MWEA 3VZCA 2VPZA 3EXFA 4CM4B 2EQ5A 2BDUA 4IDOA 4GNRA 3TFQA 1DJLA 3EUEA 1ZN9A 4RADA 1JXAA 1PLLA 3L7KA 2G4LA 2MHCA 3E35A 5B58T 3U3JA 1DADA 4MV4A 3OTOB 3HPQA 1D2CA 2E6UX 3QKWA 2VIIA 4V1CB 4CMIB 4TTPA 4KMRA 2BSQA 4NYIQ 3TIGA 4EHLA 3C16C 3OLXA 4K6FA 4R7ZA 2A9JA 3IPXA 4IQ0A 2YFQA 4DEYA 3N9IA 5BNFA 4HZIA 5J1TB 2OFPA 1P4AA 2XGOA 4BMCA 2AFHA 1LC0A 1TL7C 1QLHA 3GDFA 2R6FA 1PQPA 2P0EA 1NNSA 2ZWVA 4XB1A 1KE1A 4MV0A 1XDDA 3FSRA 5EOVA 4PLZA 3RGGA 4EA6A 5CCBA 3F9RA 4PHTA 5L95A 2I9PA 4M1TA 1C81A 3W79A 5ANRB 1YBVA 1DBQA 1Q16A 2M98A 2YR0A 3QITA 1W5EA 4DQ0A 4HDRB 1IJKA 1O94D 1EXMA 1QUEA 2PS1A 1DQYA 5KYUA 1SD5A 1BMFA 3KZOA 4IKPA 3CUEF 2PRKA 1G19A 1VYTA 3M6AA 4X97A 5I7HA 1OXVA 1JHOA 1WCXA 2O3RA 5F3DA 1K06A 1SU4A 3K5WA 3NBQA 2PMWB 2PFSA 4LZZA 4XM1A 3UCEA 3D2AA 3D8BA 1E6WA 3RIXA 4YUXA 1QDUA 3ZU5A 3M4YA 4TMXA 1PLJA 3STWA 2OHXA 3FBGA 4NDZA 4BNZA 3NHRA 4F6LA 1OLXB 2GN4A 2BF4A 2MDTA 3AF5A 3IHLA 3IHKA 4ARCA 2ZCJA 4RFVA 1VSUA 1ZOOA 1P2TA 5GONA 4DB2A 2Z9DA 3G85A 1H8EA 3MT7A 5BVGB 1J2YA 5C8DA 1KETA 1G2IA 2JK0A 1ZW1A 3E9DA 4DCSA 1KO8A 1A7UA 2J9XB 2BTQA 1NYRA 2PMDA 5A5FA 4HX2A 4TV9F 1N2EA 1UDRA 1UOQA 3RSQA 4HAUA 1BJRE 4FI3C 4AM8A 1E0SA 5FFNA 1E9BA 2XKJE 5AHRA 1UANA 4EFKA 3M6LA 4RSMA 3GMSA 4WK0B 2GB4A 1I4DD 2XAUA 2Q5FA 2VDJA 4JJGA 1NLUA 2D74A 3CRQA 1L5QA 3BJZA 5AW2A 1Y9DA 2GO7A 2P6UA 4KPUB 5E2AA 1WKVA 3PFWO 4J1QA 1ESDA 5FWDA 1DBPA 1LDEA 4GKAA 2VPXA 4EGFA 4PQFA 4KIWA 1PK8A 3PPVA 4IIDA 1E9VA 2HJHA 5C51B 1W4LA 3IQFA 5CB8A 3B36A 3NVMB 4MDFA 4TTAA 4RDXA 1E1NA 4ZOAA 3KU1A 4PZ9A 3RVRA 2P68A 3M4NA 3H2IA 2NU7A 5IC6A 5T41A 1OXSC 1PD1A 1SO8A 3FAZA 1JDBC 3RFVA 221PA 2CL7X 1C41A 1IRXA 1HM5A 5JRDS 2KLBA 3CZPA 3LBAA 2PTHA 2X5OA 5COAA 1NW3A 4NPCA 3F4LA 3GLTA 5D7BA 3DUFB 4HFNA 4P3NA 1XVTA 4GLOA 4CU5A 4NENB 2PD3A 3K35A 1AMNA 2PHZA 2Y1LA 1F1JA 4HVAA 3WB2A 4CM8A 4WZAB 1UDXA 5DTQA 4EHNA 1E0AA 4AP9A 4ZANA 2C58A 3MBKA 4IW3B 5IJXA 1JJ7A 1G2QA 1JZSA 1H2ZA 5A02A 3I62A 1LLFA 4EI2A 4PSVA 1GGHA 3CKYA 3A31A 3MG9A 5FPYA 5C32A 4RXUA 4MQUA 1BX1A 4R40A 3T5BA 4B73A 4F6RA 3PDWA 5JC1A 1E2MA 4KSCA 3LW7A 5KU1A 5DULA 4MO2A 2Z5LA 4UBLA 5D2CA 2BGWA 4XIGS 4ZVSA 3PR3A 1SOAA 4ALMA 4D26A 3DLAA 1LK5A 1J0CA 4JGIA 2ZE7A 5GINE 2PS0A 2HRBA 2QP4A 1Y8RA 4YMIA 3AGPA 2O2JA 4R3WA 3T5AA 4UBMA 4ZDWA 3LCMA 2VL7A 3ZLBA 1JPJA 4CLEA 1FQWA 1M6YA 2IOFK 2VEDA 4HN9A 4C5CA 4ZQFA 3L8FA 3DR5A 3ZE6A 2FW8A 1LBEA 1V7CA 2R4UA 1G59A 3PHIA 2I4OA 3GJTA 4RE5A 5CT6A 4ZVPA 1P75A 3O8QB 4A0RA 1U0OC 1XKLA 4KO2S 4H1WA 5JXGA 5F7JA 1D0VA 5JDIA 4MNTA 3TGWA 3GWGA 4EUHA 3J81A 5DI9A 1JR3A 3H83A 5CB6A 1UXHA 2I8LA 4C30A 1GNQA 4QYIA 5A5GA 4G9GA 3G0HA 3AZPA 4OBBA 2AF4C 2IXGA 4B2YA 2QUBA 4WI1A 2NN3C 2XW6A 3L0BA 4GDMA 2V1UA 3E2MA 3ENKA 3GJ4A 2P9YA 3EDRA 4Z9BA 4F8JA 4MWCA 1UJ5A 1K6IA 1GPMA 1E7SA 5HTKA 1X7DA 4NQRA 2APJA 4TX1A 4Q1DA 4G37A 3JRXA 4GYKA 1FRZA 1SOWA 2YJZA 1YR3A 5EE1A 3CKMA 2AB0A 3NKFA 1IQPA 3SBDA 3SEFA 2H48A 1FDVA 3CF2A 2RGYA 4FYXA 4XD7A 2XB2A 1QMPA 5KC9A 1Q91A 3L0PA 4M0EA 2HFKA 2Y1OA 1A4XA 4NULA 1ZXLA 4EZBA 2A30A 2BFBB 2XUQA 3EDOA 3N2GA 3N86A 4JWKA 4RHYA 4TROA 5CRIA 4AKHA 1J0AA 2AEFA 1B00A 2RBKA 2VRWA 2W4MA 2QMZA 4IDAA 2AEEA 1LDGA 2WAOA 2C2XA 4RY2A 5F51A 1NT2A 1E2FA 1UXJA 5KTSA 1VG0B 1U5AA 3MILA 5FOVA 4DL9A 4I5EA 2UAGA 2DBRA 3R0XA 4IOLA 3LKBA 1FCJA 4LECA 3O1JC 5GJBA 2VJAA 1Z18A 1GGEA 1DRKA 3ANXA 1TW3A 1GEEA 1GPUA 2HDWA 4BB9A 5HS4A 1WCIA 1YDEA 3G82C 5E4TA 3ZCUA 1ZHOA 3AOEC 1L5LA 2HMTA 5PNTA 4D0SA 1MF7A 3F90A 4CEHB 1YFJA 1RFLA 2IPAB 1LTKA 4FB5A 1M2VA 1EWQA 1VMAA 4JVLA 4KWCA 4O3FA 2D2VA 5FYQA 1ZINA 3WQHA 1P91A 5JSUA 3G2MA 3UGTA 1ND6A 2C4NA 2PLRA 4JC4A 1GT6A 1HYEA 3OLYA 2W8BB 3GEHA 1DC4A 5AK3A 2YMQA 5CP8A 4LSWA 1FSZA 1O03A 3GJ3A 4B79A 4PN3A 1J06A 4RORA 3HYLA 2O8FB 2W58A 1TO6A 4UQOA 3RE1A 2ODNA 4W5RA 1TU3A 2DKFA 1JSXA 2RGWA 4M38A 4OHVA 3ZI4A 2VYQA 4CUJA 5H68A 5LOVA 1EUCA 3EFHA 3JS5A 1B0ZA 2DWOA 1Q1ZA 2QX4A 1DDIA 3ZWCA 4NZNA 1R16A 1KIMA 1NXPA 2JRLA 4TMKA 4LE0A 4LWOA 4BKRA 3A9UA 3TTSA 3C8ZA 2DC1A 3ZE8A 2GEDA 3PLNA 1G21B 1QIMA 1RVDA 4V0ME 4ZT7A 2YNMC 3ANMA 2JGNA 3DP7A 4P08A 4YUWA 3PIIA 1C3XA 4V2IA 2EEZA 1HT3A 5IZ4A 5H3CA 3E22A 3FDFA 1U2SA 4E03A 1QXSA 1MAAA 2WZQA 2ZR7A 1Z4MA 3KSUA 4GLJA 4PR3A 1KAMA 1ZL0A 1IVYA 1YR6A 2O2IA 3CCBA 3NI2A 2R8RA 1TQ2A 2YZKA 1H22A 3CONA 3BTOA 4H3VA 1RBYA 3DLTA 3S2EA 4ARZA 5CD1A 1ZM2A 4RESA 1XF9A 1TQHA 3NHAA 2CT8A 1VL2A 3DVAB 1Q17A 2F1RA 1I3OA 4OU4A 4EATA 4P84A 4ACAA 4EEKA 3BFVA 2WB2A 3Q12A 4HB2A 3PD1A 4NFSA 1N4AA 4MVJM 5BRJA 3QA9A 3L82B 1K89A 3V1KA 1MPTA 2YY5A 2OZLB 2C83A 3N75A 2WHEA 4XGKA 3ZE9A 3OFJA 2B7LA 1L8AA 3ZU4A 1YL6A 1X7YB 1UK8A 2EYUA 3IOCA 3N8KA 4FC7A 5TGDA 1UIRA 3ZN2A 1L3BA 2O2CA 3KVNA 5A9SB 5JLJA 5IFLA 2GBCA 3P5SA 5IANA 1P3JA 4FLFA 4JJAA 4YDRA 2W2LD 3HZZA 5LP6B 3X1DA 4N5HX 4YMSA 3GUVA 3EVDA 3N58A 2CVFA 3TKYA 3UM9A 1OXBB 2JCGA 4P92A 3AY6A 4YUAA 1CF9A 5EIAA 5BSMA 1XCMA 2H31A 2O2SA 4OJTA 4H08A 3T06B 3ECCA 1QGAA 1X39A 1JIQA 1VYUA 5HFAA 5C4IA 4XB2A 2R6HA 4PGAA 4O4LB 3BZUA 3S44A 2GLTA 4OYLA 4CLOA 1TU4A 5A5DA 1QP0A 2G77B 2KM1A 4XD2A 1MH9A 1B42A 2XUZA 3FDIA 3HZOA 1L8OA 4UE3S 4B83A 2DOKA 1RCFA 3OJLA 3F3MA 3L4JA 1Y6FA 5EYPB 3ESRA 3Q3CA 4D8WA 3G0IA 3SC2B 4HYEA 4WAUA 1QYDA 5DNWA 2ZJZA 2O0LA 2DQSA 1T1JA 1SULA 2UUAB 1EFRA 1QUFA 4U8GA 1T29A 2IGTA 2QU7A 2X13A 4TT3D 5ED0A 4AULA 5BORA 5B7GA 2PX0A 1SHTX 4UVGA 3G0BA 5H3LA 3DBRA 1JFSA 3HJAA 1WE2A 2BFMA 1CEXA 3AVXA 4TYWA 4H35A 3Q7PA 4CCSA 1SA0B 3RM3A 4BMXA 4M0CA 3I9KA 3P96A 4UCWA 3OH8A 2OM6A 2WYIA 4IDNA 4YRFA 3ZY3A 5AOAA 1E5QA 4IV5A 1FVOA 2C42A 4IXTA 3P4XA 4I9UA 1SCDA 1RBQA 4N39A 3DXFA 4QBIA 1ZOIA 3KAKA 3WADA 4W7SA 1CY1A 5DRTA 2FOXA 2DFVA 4RK5A 1SEVA 7GPBA 2PU7A 5JAQA 2QGZA 1R4NA 5DHPA 2ZJ7A 3RJ9A 3OAAA 3L8EA 1Z4NA 1OR8A 4OFZA 4KBGA 5JSKA 1DFIA 2FWNA 1B8PA 3C39A 3LPLA 5JZMA 1JNXX 3FZNA 5I7RA 1ESNA 1NW5A 1PGJA 2FFJA 2J3LA 2NT4A 2PBRA 1XDGA 1HFJA 1JIKA 1WXXA 3TLEA 3VHQA 5DYIA 4RTSA 9MHTA 3P4UA 1BN7A 3U4AA 4FMCB 2P79A 1XZHA 4J2TA 5KTMA 1M5TA 1PGQA 1YI1A 2INGX 2PZ8A 4HNTA 1SELA 1PTKA 3H87A 4PQEA 2G63A 4IIXA 4EHKA 2R48A 2J0UB 2Z5VA 3QVVA 2X7HA 3GGGA 1JQJC 4UNSA 2ECFA 3PF9A 4KU4A 3ER8A 2KYRA 2FWBA 3KLBA 4YWJA 2JEZA 1J8FA 5FCDA 1EEHA 2Z2XA 3ASUA 5AD1A 2OORC 5SV2A 4JJ6A 3C1AA 2EHJA 2RHGB 3L7JA 3GHHA 1H2FA 4TXLA 1IXYA 3C3DA 4IRXA 4XYMA 3MZ0A 3D6MA 2XMRA 4D3ZA 5JR3A 2IDMA 3J80A 1ZAYA 3B13B 2H5JA 1FJGB 4G1UC 1DQRA 1OVMA 1MVOA 3C98A 2CEAA 3OPNA 1IMOA 1U2GA 2EFYA 1RAFA 4KFRA 5A7HA 5TS2A 4C6RA 2ZPUA 4N01A 3VYTB 4EF4A 3W7BA 4HD8A 2PT6A 5DSTA 1W30A 3RSHA 2NXNA 5I9TA 2REOA 1HDCA 3C1UA 3C6KA 4MEBA 1M6EX 3M9WA 2YICA 3S29A 3CLHA 5EFZA 2F43A 2CUTA 3RYHA 5DTIA 1ZKMA 2R7AA 4YCMA 4CU2A 4X8LA 1YIDA 3UWOA 1G41A 2ASVA 3VDRA 1I3MA 5KOYA 2ZGVA 1KYZA 2FQQA 3EAQA 1R6TA 1X8LA 3WLQA 3PR1A 4IX1A 1X77A 1PJBA 2WSSA 3HN6A 2R1VA 2RONA 3JQAA 2Y66A 3DWIA 3PWSA 1VTKA 4JEMA 2XQGA 5I4CA 1LLDA 1JAIA 1I4EB 1MOPA 1UFKA 2OC9A 2VJBA 3OUZA 4R68A 5BN4B 4P0PB 3TQHA 4KE9A 3L6RA 1K5PA 3ZI7A 1ZGZA 4DG8A 4BNHA 3KL4A 2I3DA 4OQDA 4EVSA 1Z7YA 2FWPA 2G72A 3JX9A 4YCCA 2AXQA 2ZSKA 3EG9A 1ZSYA 2ZR8A 4IGFA 2MSEB 4JUFA 1SJ9A 4W1RA 3QXGA 2PUCA 1KO4A 4X7BA 1T1IA 3X1ZA 1NRJB 1O89A 4JBYA 2YXNA 5ALNA 3LSYA 5G3YA 4BN0A 1VCIA 3L8GA 2M2IA 4LOLA 1W2WB 3RS2A 1CUVA 2I7DA 3WC4A 2BCEA 2FQYA 2JGEA 4C7VA 4GDFA 4WIAA 5DCYA 1GO2A 3ADCA 1RYYA 4AMGA 1Y7TA 2VYVA 3MGCA 4JT9A 4MVJP 3PTZA 4Q18A 1NU6A 2DUNA 5H8WA 1F51E 2D5BA 3DEJA 3SZGA 4ZDKA 3CEPB 5B3JC 2ZIVB 1XF1A 4RY9A 3DYBA 3HV0A 4Q4LA 4FSDA 5GOZA 3UENA 2PUGA 3ML1A 5KHAA 4IG9A 3TVTA 3GLIE 4I5FA 2G28A 2IP2A 2DPLA 5IUJC 3NBMA 3QPCA 5KEIA 2P9CA 4L16A 2RK3A 1TYEB 2QXTA 3O4FA 3TLMA 3IVMA 1ZICA 3TLXA 1K97A 5BW5A 1WPGA 3IQIX 4FLEA 5D1NA 4S1NA 2ET6A 1RLJA 2Q5QA 2CNOA 2OK7A 3L7MA 3HK2A 3GU3A 2BEJA 2IPLA 2YASA 5ADWA 1AQLA 1P0MA 2VSYA 3IO3A 4C05A 5FO1A 5AKIA 3RAGA 3EEYA 1JDSA 2O05A 1HETA 3KK0A 2J3IA 2YWJA 5ERGB 3TECE 1Y48E 2X8LA 1PG5A 4D2IA 3AU8A 3GCDA 1SBQA 1TPZA 3GLHB 5AKJA 2QTCA 4ZT5A 1NQAO 2B25A 2ZSUA 1G3QA 4G5FA 5THQA 3BDIA 1RWWA 1JG4A 3QLUC 8AT1A 3ONVA 1NQOA 2D3WA 2B20A 4JQOA 1IHXA 2F3PA 2OXRA 4BJ6A 3VKUA 3FG9A 4DCPA 4V38A 4HRAA 4WGFA 5LP1A 3PP8A 3GA0A 5KVVA 3GY0A 4WOJA 2D1SA 4D9CA 2Z2KA 1ZH0A 3AYXB 2QN9A 3MTIA 3QV2A 5HXAA 1C7EA 4OHCA 3ZBUA 2HXSA 2YWEA 4BASA 5FTMA 2EZ4A 5ECWA 3VI4B 1CR1A 3O8DA 1QR6A 3TEFA 5KVCA 1WMDA 2EG5A 3UGKA 3OTIA 3RWBA 1Y4DE 2C5HA 3Q87B 2GM3A 4MW9A 4RDCA 1CB7A 2NZWA 5FA5A 2QYSA 4YRLA 2CKMA 5BSFA 1DXQA 2FOIA 3CG4A 4YEDA 1FUYB 3K70C 1Z35A 3S0JA 1LJ8A 4E5VA 3BB4A 3NHYA 3DB2A 4JBNA 3CX3A 3W05A 3UQYS 3E8SA 4OXNA 2ZIFA 1UF9A 2FLWA 2PANA 4KDCA 4WNAB 4G0XA 3NC4A 4UM9D 4TTTS 3C5EA 5EIOA 2VAWA 5B4VA 3HCWA 1QRAA 1JEYB 5H83A 3EGEA 4L15A 2PMKA 1AURA 2F6RA 1YS4A 4RVDA 4B35A 2GCEA 2E5LB 3PYMA 2NAPA 5K0BA 3A1CA 2G5CA 1VIMA 1VL1A 2GNAA 4HLUA 4ZJPA 1MT0A 2WM9B 2QX6A 3D7LA 2IS2A 1E5VA 1F4PA 2F1IA 5CA1A 2YKGA 1NQWA 3V9PA 3LP6A 4ZHQF 2SBTA 4QGGA 5DKFA 1EJ2A 1MRNA 4EMBA 3GRKA 3ZQ4A 4AU1A 4HI0E 4BWGA 3WK7A 3G2IA 1J09A 1FYVA 3PE4A 2DT5A 3F8SA 4G41A 1NY5A 2NV0A 2VNJA 1VDZA 4ILKA 3L04A 4L75A 3Q88A 1N2CA 5A9TA 5LWQA 4LOKA 5K0ZA 1CR6A 3ITNA 3WXBA 3T6KA 3NDRA 1N77A 4ZCIA 5KSZA 2CXQA 3D31A 1Q57A 1UL1X 1Q0QA 3KEGA 3GV0A 1VM6A 4M4SA 4BNXA 4US2R 3PEYA 1E8MA 4FHFA 2B1QA 4CQMA 1DZ3A 1JFLA 5CM8B 4IHKA 2O2YA 3HYTA 1FYWA 3D1LA 5AXCA 2WAXA 4G97A 3C1OA 4BZZA 1KMMA 3UMMA 2QVCA 1AHNA 4ETNA 1C9KA 2RIPA 1M66A 1MX1A 1TKRA 2J59A 2I22A 3NHZA 4XR9A 3Q41A 3RDPA 2NACA 4FEYA 3T9DA 1AOXA 3R7FA 4BFVA 3NM4A 5JYEA 2V58A 2PLNA 3PEUA 4OL9A 3ASZA 3TD2A 1N6LA 2F67A 5AM3A 4DS3A 3SI7A 1GKKA 4AYXA 3CWCA 2HLPA 1H94A 1ULZA 3QQ5A 4IWYA 4R0MA 4QTXA 3AEZA 4XDZA 4B8WA 3ELWA 2OV8A 4DBLE 1K7YA 3HXMA 1QQ5A 3U3MA 4BP1A 1OLSA 2XF8A 5ALPA 4BOYA 1D6MA 3BXZA 4RW0A 1E89A 1ARZA 4G01B 1F2UA 2G1KA 2V7VA 5F5LA 1PSZA 3VR4H 3VU9A 4LF8B 4M83A 3F2VA 3CRRA 1YF3A 1J33A 4KFUA 4AY2A 3P0IA 1YQ9A 3F6EX 1B26A 3KQQA 1C1XB 3L1IA 1OAOA 1PQWA 3PXCX 4RNCA 2ATEA 4UW9A 4HX9A 8ATCA 3ZJVA 3QIVA 4Q9NA 3UT6A 1XVUA 1UP6A 3GT3A 1NMZA 4PG4A 3WGZA 2WG2A 3PI7A 1P0PA 1ZUWA 1SRQA 2JZCA 2QVYX 3GNSA 5EKTA 4XUDA 1ODFA 3G0CA 3HRHA 5JCXA 3EVGA 1I9CA 4UQLA 5CA0B 3PYXA 1V96A 2CLFB 4LYYA 4FFDA 4C0JA 4AI6A 1WOYA 3LLUA 4ZVKA 3GT7A 1PGOA 2CVOA 3H42B 2GCOA 1QGUA 2MYUA 2YWRA 2ZSIA 4XQEA 3JWJA 3HU1A 3NUQA 4TN5A 5AP9A 3W5VA 4UPEA 5AFSA 4O1HA 4O1IA 3UZUA 2GWRA 4Q5IA 1CLUA 1W88A 1AGNA 1U9CA 2D62A 3A9VA 1XL0A 4MWGA 1ZK4A 1QG4A 2BL4A 2OE2A 3HWRA 1O8CA 4GIBA 2O2ZA 4L7QA 4LWPA 2CWWA 1Y7HA 1XZEA 2G09A 4UHDA 2EKLA 4ZCRA 1GPKA 4IUCS 2PUTA 1VIAA 2Y27A 3NXKA 1IZ9A 1OT5A 4DXDA 1MAWA 5CXXA 5LFAA 3FAKA 4Y2HA 4RVSA 4TZKA 4MGZR 1QFSA 3RUEA 2OXCA 2XCIA 4I08A 2LCIA 2OCDA 2CMHA 1Y4UA 3T5MA 3MJRA 2ZR9A 4C6TA 1TYBE 2BD0A 2C7RA 1E7MA 1SUBA 3BHNA 3DYIA 1XHEA 5DX0A 3SYMA 4NJMA 3IAHA 4ITUA 1TFUA 3L43A 2HCFA 2NTEA 2WBLC 1FZTA 1PX0A 1HRKA 4L5IA 3G2KA 4OBEA 3QP9A 2R1UA 4Y1GA 2WE7A 3LDGA 3ESBA 5CFOA 1L8LA 3AHFA 4WKPA 4P7JA 4MKZA 1QS0A 3KWJA 3VKWA 4U7PB 4BMNA 4QRIA 4F45A 1J5EB 3NB0A 4EPXA 4QJ5A 5DEOA 4FDAA 2ISQA 3MTGA 1NP7A 2IX3A 2H8GA 5H16A 3K2QA 4WXPA 3GVPA 4PAGA 1TO1E 2F00A 2W2NA 1U8EA 1ZHHA 4Z3DA 4CVNA 1CZHA 3AX6A 4GC5A 4RM3A 1H2RS 2IYXA 4MS4B 1JMKC 2PUFA 3BMNA 1SVWA 1V45E 3LK7A 2AZDA 3BB3A 1WPRA 4K8OA 3JAKA 3I4CA 2Q5IA 4GGMX 5P21A 4EJSA 1OH6A 2B2CA 2JKZA 2FPUA 3DE0X 4UULA 5B12A 3EOBI 1S1CA 2FEAA 1ICEA 1P17A 2NLOA 2G9NA 3RKRA 3T7TA 4EFMA 4GMHA 2II6A 4JP5A 3AEKB 3H9CA 4PRZA 1WNFA 2X9VA 1E3WB 1FRFS 2Q3JA 2XE7A 5LB4A 5SZHB 3BS4A 3ZWOA 3QU9A 3R6LA 1CUHA 4H7PA 1DLJA 4PGHA 4DIOA 2DH5A 3BIWA 1MV8A 1H6DA 3ZQUA 1MEOA 2J9RA 3RK4A 3ZUPA 5KYXB 1RFGE 1O0SA 2RG1A 2VH2A 2VJPA 1YJ8A 2XNDD 1EYZA 3EHEA 1I3CA 1R37A 3OUTA 4TM7A 1ODLA 4Z8YA 3VMFA 1KJ8A 2FCRA 3LIPA 4OXQA 1T1SA 1A9PA 1RQ7A 4MGYR 3B6IA 2PUEA 4J7AA 1H3NA 4N0MA 3RBZA 3SJBA 1X15A 2Q8PA 3I9OA 1U4OA 2CF5A 2XNCA 4CV3A 1RXYA 1FFWA 5B1IA 4O2AF 4Q4AA 1XCGB 2B1GA 2VP3A 2X2PA 4X5OA 4QOHA 2IP1A 4HXGA 1SIWA 4ETIA 3DFUA 3H4TA 2ZR0A 3V8BA 3QELA 2OV1A 5JVDF 2PT7A 3Q11A 4V2UA 1J1ZA 1MKYA 1L5WA 2A7QA 2HPHA 5MFZA 1YS1X 2O57A 3JARB 1T43A 1W5AA 2E21A 5KWEA 1M1XB 3E9MA 3NT2A 1Q95A 2R6GA 2QOEA 3OJEA 2LCFA 4H7JA 1ZY2A 5AVQA 1MFZA 5H4HA 4RF2A 3R09A 5K6TA 1U98A 1R0YA 5HILA 4KYUA 4TS3A 4F9GA 4IDCA 2BJVA 1Z74A 4GPAA 1MBZA 2V9CA 1MA0A 4GNKA 8LDHA 2EBHX 3V7UA 3ZWMA 2ORVA 4L8FA 2QY6A 3QMVA 4ITRC 3L5OA 4EG0A 4X54A 3N7TA 1GZ5A 2OFOA 3IIEA 4KAFA 4KB5A 4ZQHA 1W4ZA 3DCIA 3QA3E 3UAZA 3M9LA 4C01A 4DTCA 4AJHA 3IAEA 4KACA 2PZFA 3DVQX 1K2VN 3O4IA 3D02A 1SUCA 5FNZA 1XZQA 5T3YA 1EK1A 5I9LA 3I32A 5JSHA 1EWTA 3EH2A 4LTDA 4JDUA 2PJZA 1SXHA 3PDIB 1QV7A 1NATA 2WKRA 3A37A 3CLUD 4H3KB 4F5ZA 1NQXA 1RKUA 2QAIA 2QE7D 1NLYA 3K6RA 3Q9SA 4RPIA 1FVFA 1NVMB 3S5UA 3U4CA 3ZTYA 2VH5R 3RRFA 2P69A 4ND2A 1RQ2A 3OHPA 1MRZA 2QZSA 3DDNA 2J31A 5K3FA 2Q1WA 3FHCB 4E2ZA 3E7FA 4XI9A 1ABBA 5BWNA 1MV5A 1Q2UA 4GL2A 1C8BA 3WR5A 3FSGD 1GLNA 3I34X 3CU5A 3O3MB 4Q0MA 4RQAA 4AQ7A 1V25A 5FOTA 1QO9A 3WZMA 3CNNA 3BGIA 5AHKA 2GK4A 2ZRJA 2UV8A 5DBOA 1GG8A 3K0FA 4JEUA 3JQQA 5E4JA 1Y5NA 4JXZA 1SCNE 1D6SA 3Q5DA 1TA9A 2AHRA 1IAQA 3N3AC 1C30B 2P1DA 1L7DA 4G25A 1OFVA 4LDRA