3COJA

Crystal structure of the brct domains of human brca1 in complex with a phosphorylated peptide from human acetyl-coa carboxylase 1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
208
Chain Sequence
b'KRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Breast cancer type 1 susceptibility protein
publication title Structural evidence for direct interactions between the BRCT domains of human BRCA1 and a phospho-peptide from human ACC1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein/ligase
total genus 55
structure length 208
sequence length 212
chains with identical sequence B, C, D, E, F, G, X
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3cojA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3cojA01
1OQAA 4XPZA 2HTFA 2INGX 3L40A 4XQ0A 3PA6A 3K15A 3T7IA 1T15A 4OFBA 1KZYC 2XNKA 4IGKA 3UENA 2R1ZA 3PXAA 1T2UA 2COKA 2DUNA 3U3ZA 4Y18A 4BMCA 2LE0A 4JLUA 2JW5A 3EF0A 3SZMA 2EBWA 4U4AA 1T29A 3KTFA 3PC7A 3PXCX 3K0HA 3OLCX 1CDZA 3SHTA 3HUEA 4ID3A 1IN1A 3T1NA 2D8MA 2ETXA 1T2VA 3L46A 3T7JA 3FA2A 3PXEA 2L42A 1N5OX 2K6GA 3JVEA 3PXDA 3K05A 3PC6A 2NTEA 3K0KA 2K7FA 2COUA 3QVGB 4BU1A 2ADOA 4BMDA 1Y98A 2VXBA 3UEOA 5ECGC 3QVGA 2E2WA 3SHVA 2M2IA 3PD7A 4N40A 3L41A 1L7BA 3AL3A 3I0NA 1Z56C 1JNXX 2COEA 3AL2A 2XNHA 3HUFA 4IFIA 2AZMA 2EP8A 3I0MA 3II6X 3PXBA 3COJA 4BU0A 4Y2GA 2VXCA 3SQDA 1IMOA 1WF6A 2WT8A 2EBUA 3K16A 3T7KA 1L0BA 1GZHB 3EF1A 3PC8C 3PC8A
chains in the Genus database with same CATH superfamily
2IYNA 4W1QA 5C5IA 3U44B 3HUUA 2FWPA 4G4IA 4EFKA 1AQIA 2X8AA 3R0JA 2O8DB 3LA6A 2ZLBA 3Q85A 1DRKA 3DOOA 1ZVKA 2IYYA 3PDCA 1UWLA 5BNTA 4LY0A 1JHVA 4Q9KA 1DFGA 3OQJA 4RJLA 1YDFA 2NT4A 3GQBA 4EIWA 3G5TA 4NMXB 1USUA 3NHMA 1Z0UA 1GNQA 1Y9ZA 2NSJA 3TAUA 3CNNA 3W3ZB 1B8NA 1R16A 1TUBA 1SFRA 4C30A 5EIWA 1Q3KA 1R74A 1SXJD 1UBOS 2QL5A 3DP9A 3P9NA 1PDWA 4DMKA 1W581 4LWZA 2P5SA 1UBJS 4IUYA 5T3YA 1US8B 4GOOD 4CV2A 4C7KA 1X38A 1KOLA 5FTLA 1QGAA 4PG4A 1G5IA 5JQGF 3QI7A 4DCSA 3WO0A 5A04A 1NKVA 4KK3A 3L77A 3U3MA 1THGA 2PZJA 3GLHE 3HB1A 2RAUA 3K09A 3E1GA 5DNYB 1GFSA 4I36A 3IP9A 5KAMA 1UDCA 3AY3A 3CRQA 4NULA 4QUJA 3K9GA 4UBIA 4W82A 1I51A 5AVVA 1BDJA 2FG6C 4MCAA 4WXEA 1AB5A 3KDAA 3NQ41 4R9UC 2WYUA 4G0MA 3RBVA 4P31A 4NY1A 5JAMA 1SUIA 4GYYA 4LDPA 3M5PA 3WHLA 4DMMA 3G23A 2O0KA 5CD9A 2Q1TA 4AO7A 3JYPA 1Z9BA 2AUTA 3VYTB 4MGZR 1RPAA 2DT8A 2LRHA 4MUEA 2G9UA 4ZRMA 5J9FA 1GNVA 1MV8A 4YYZA 1J49A 4FD2A 4Y8VA 3MRXA 3RHTA 5A1TA 5KJFA 1N3LA 1M7BA 1PFQA 2XVYA 3PNBA 2JCVA 5JCOC 3ONNA 3QPWA 4XCVA 4Y6LA 1DKMA 1M1NA 3CW2A 5HVNA 2LV8A 3V9AA 3OEYA 1B1AA 1Y80A 2XYPA 2ZPAA 1VG1A 4CGZA 2PZFA 1ZMRA 3C48A 1OF1A 4JZYA 5CVJA 2FJUA 4WTOA 4TLDA 4RQTA 1CB0A 2D2FA 2E4XA 4GU5A 4ZOBA 1YFJA 3ELUA 3IBCA 1T4DA 2C94A 4MYDA 4WDQA 5FHQA 3E1SA 2Q4OA 4EKEA 5JC8A 2NUPA 4GQAA 1SBNE 4NYIQ 1P0IA 2FXVA 1PLLA 3AJRA 3PRJA 3EEYA 4DQDA 5K3BA 1M7HA 2PUVA 1CE8B 1K2VN 3U80A 3CR7A 3C7KA 3BFKA 3EW7A 2WTEA 3MW8A 1N0UA 2R25B 1UJCA 3HJCA 3GMTA 3DQQA 2ZXEA 4L7VA 3RSGA 3L8FA 4ZEOA 4DR2B 1QS0B 3OPMA 4LY6A 5LNK1 1XAGA 1VBMA 3UOWA 4LRUA 1K98A 1U9CA 4ZO7A 4O3MA 4M9QA 4ZAXA 1SKQA 1E59A 3UH0A 2K7ZA 2WWFA 4GOLD 1XN4A 2RH4A 2WU8A 3MBOA 3QF7A 2VSFA 4JT9A 4OP1A 4ER3A 1N7HA 4B43A 1QDEA 3SC4A 3HRIA 4L4ZA 3N0WA 4Q4AA 5D3QA 1YBAA 3BSYA 1V5IA 2PEYA 3PNOA 3RBZA 4MZXA 2GXSA 1L4HA 2HA5A 3GJSA 1E6EA 1S3GA 2D1RA 1W29A 1X9HA 2QE7A 3TQFA 1N36B 4CN8A 4REOA 3AF1A 3BK1A 3M7IA 2VHTA 3AL0C 1CRLA 5AKJA 1YVRA 3FAKA 1RJFA 3BIOA 3WBFA 1LDMA 5D6OA 1F3OA 3OICA 3PIRA 3AR9A 4K81B 2OB1A 5G0VA 1I0IA 1J39A 3IGFA 3IMFA 1BXRA 1RYYA 2YZGA 2XODA 1HT0A 4YJFB 2G4VA 4PZLA 4QT0A 4OB8A 4R9RA 2ZI4A 3QSGA 4INOA 4H7FA 5EKDA 4P7KA 1UXGA 2WTAA 3PPWA 1V8DA 4EB6B 2I87A 3FW1A 4Y2HA 4TTSA 3BWEA 1ORWA 2JF0A 4MQ5A 3USZA 2A0UA 2J30A 4G67A 4LOJA 2F3PA 4UM8B 1NXPA 1Z22A 2P27A 4Y67A 1V16A 1VL0A 3EQ7A 1Z75A 1Q50A 3T0IA 3UUGA 2Q45A 3VR2A 1OFTA 5JCJD 3N2IA 3H1PA 4JP8A 4IMRA 4QQRA 2C7RA 3EGIA 3C8ZA 4XUCA 3SU8A 2OA0A 2YFYA 3Q0TA 1N2GA 2VIIA 3SKYA 1UDAA 2AR9A 3F8SA 4YT5A 4S04A 3ZD6A 1RI4A 4D42A 2AZ4A 1QIMA 4YIHA 2IDMA 4CYMA 1GTVA 1KR5A 2VT2A 4WZAB 3WB9A 1AQUA 1L7OA 4QOSA 3EWNA 4FE3A 1GUBA 1E7WA 3N86A 5F1YA 4I6EA 5LZ5A 1RFLA 1M1ZA 1Y82A 4YS6A 1UDRA 3V1KA 1DO0A 1T2FA 3BVPA 1ZRMA 4GPIB 1KEEB 1R66A 4NATA 4YQZA 1H4QA 2H85A 2W37A 3WBBA 2C99A 1DEAA 1Q7EA 3GMSA 5G3YA 1YQ9A 2O6HA 4DYDA 3BUSA 4DC9A 4GKVA 3AZOA 1NF3A 3I3OA 3LC2O 3OZTA 4RXTA 1B6TA 4UU0A 1P2BA 3HU1A 5K9ZA 3CE6A 3Q7EA 2CFTA 4WADA 2O2GA 1EXNA 1IDN1 1STOA 3JYQA 1SZJG 2FGKA 1WNTA 3ELBA 2FPMA 1T9DA 3IVAA 3MINA 1F5NA 3VO2A 4BTLA 4UJ5A 3B52X 4J4BA 1Q1EA 2H1FA 2O4CA 3ZGZA 3K1YA 2GJ8A 4P2GA 3KHTA 1K6EA 2C78A 4IW3B 1X3SA 3JQFC 3RNOA 2J0SA 1Z0KA 1BU8A 4P92A 2IXEA 1M34A 2W2PA 3N6XA 3WLPA 4W9MC 3VYRB 1E2BA 3DF7A 3N6VA 3IRVA 4D8VA 3BXFA 3CLKA 3C87A 2BR4A 3EPKA 4PAQA 4QOHA 5KTPA 3PSHA 1CUDA 2HA3A 4KN6A 4DV1B 3AG5A 3NCTA 3P52A 4Y0AA 4ZVLA 3GLGB 4GAEA 3OZWA 2M32A 4BZZA 3DCNA 5CG1A 1KPGA 3A26A 4RPHA 4X1YB 2BEJA 2WM3A 2BFEA 2R8RA 3I32A 1SD5A 4YQFA 3PQ2A 1K5DA 1X7YB 2W7TA 3DE2X 3ZJ5A 4D0NA 4JZKA 5K0EA 1M1YA 4UHCA 3F6EX 1KMHA 3I58A 3L2OB 5DGXA 3IKTA 3OUUA 3FGNA 1GCOA 1N1EA 2XTJA 4KN5A 4MUYA 4N5NA 4C0SA 5L53A 3KJFA 5ITVA 4WAUA 5I8ZA 1CUSA 3GLTA 3KAKA 4LZNA 3UWSA 3DTVD 4EG6A 5BN5B 1WB6A 1BDMA 1CQXA 7REQB 4M6WA 5TIIA 4IDHA 2ZUEA 1EX7A 5HR5A 3TLYA 2DJIA 5AYVA 4MA4A 1K4YA 3OA2A 4TV9F 1OAKA 2PVPA 2HBYA 1Y33E 2AG8A 2ZTVA 3S1AB 4D57A 1JMKC 1NBHA 2VLIA 4DNFA 4XGKA 5B3JC 3EZLA 4ZZ0A 4QQFA 1NJSA 1VGRA 3IUYA 4M87A 4P4LA 1YI1A 3RFFA 4NJEA 4Z3KA 2NO9A 2IUFA 3EMKA 4FSHA 4DNOA 3U81A 2VPTA 1U0SY 1YRYE 1Z7WA 4LNAA 2ZXUA 1LWNA 1UEIA 3B48A 1KS2A 2WHQA 1RIIA 3SIXA 4K9DA 5LOVB 4WXMA 1C3LA 1OXMA 4FYVA 1EDOA 4G5HA 1KA9H 4KIWA 4EPVA 1DAFA 1ZCJA 4TXLA 4Z99A 5DYYA 2PLRA 3F74A 3E2IA 5H16A 1T2UA 4PN7A 2EHDA 3VHXB 4DZZA 3BXHA 3ANMA 2P2LA 1D0SA 3Q9LA 3U13A 4H3HB 4CKBA 5A2GA 2NP7A 2QZZA 3UYKA 4O29A 5AM2A 3A9UA 2P2YA 2EW2A 1T9GR 1YNOA 4MVJA 1JHMA 5EP2A 1NQVA 3ANNA 5DTQA 4BC0A 3QF4B 3UN1A 2O8BB 3EWSA 2B6HA 4DQXA 2RG7A 4RJJA 1MFZA 5ELLA 4C0AC 2BHTA 5H83A 4EJSB 4QM7A 4HAVA 3GLIA 2G67A 3CLHA 5K0BA 4HV4A 1P9LA 1CQIB 1SB8A 1FIUA 4K6MA 1T29A 4HFJA 4X44A 2NU8A 2B37A 1CYEA 3I5AA 1E2HA 1E3IA 2CZCA 1G21A 1U7WA 2IEBA 2IOQA 1T5IA 5J2UB 1R2QA 3HCFA 4OFWA 1MQ8B 1UBLS 2II6A 3HJTA 3V8EA 3R9XA 4Z0HO 1QFJA 3QQPA 1R5NA 5ILQA 4C0WA 4C22A 4W6QA 4DAOA 4AS1A 4AY2A 1IY2A 1K8ZB 3ADBA 4GIBA 1MIOA 1IBLB 1WMAA 4K1LA 2FW1A 5DN9A 3HR7A 1ULTA 3ZWCA 4BFLA 1P7CA 2YN4A 5D51S 1SOMA 1ZCZA 4H18A 3V2HA 1RMYA 4AX4A 1QOZA 5AVYA 4E5NA 4IILA 1OY1A 1T35A 5K2MA 1TE2A 3L4EA 4EDHA 4O2AA 1Z0IA 3H4MA 3G89A 3I28A 2FPOA 4CMIB 5F98A 7MDHA 1Q16A 2F64A 1KZ6A 3PEVA 5KPDA 2PT7A 3NNNA 4ZOCA 2BR5A 2Z6VA 3TR0A 3VZPA 1ILEA 4B81A 2J9FA 2C2OA 3WLSA 3MPUA 1MBZA 3RJMA 4CV3A 3DR3A 3FDFA 3NBMA 3TPFA 3L02A 4LCBA 2HN9A 4OKIA 5B12A 1HDGO 2GUGA 3MM4A 1VP9A 2O4UX 2A5DA 3J80A 3OEHA 2N1MA 1E1RD 1AG9A 3B9PA 1XYGA 1KK3A 1O9BA 1JDSA 1MORA 1ZIPA 3JD3A 5CFQA 2QRJA 2G4CA 4OF4A 1CUAA 4OJQA 1G20A 1A5AB 1HE2A 3L7BA 1N77A 4BNZA 1TA9A 1X7ZB 2P8SA 3TINA 1OBFO 3MAAC 1XZQA 4HUJA 1QO9A 2FTKE 2O5EA 4LNUB 3LP6A 3AY7A 3ZGVA 2J9YB 1OXKB 3FPFA 3UPTA 1O6ZA 2DT5A 3A6DA 3HFGA 3TSZA 1ZAYA 2I33A 5DBGA 4ZEWA 5HM8A 2HWXA 3V7UA 1B42A 4M7OA 4DNQA 5JDIC 3NORA 2OHXA 4EYKA 4A0FA 1I1NA 3FZEA 1PSWA 1CIJA 2EYUA 2V6GA 1P5JA 1YZQA 5K4GA 1V71A 1TU0A 3IKMB 3PIDA 2XB6A 5TQ0B 5F3DA 4K6FA 4AN1A 2EKLA 3RW9A 3VC2A 3ABQB 3Q88A 1YQEA 2WM9B 2A6PA 1GUAA 2R48A 2MWMA 3MUNA 3NHZA 4O08A 3BJIC 4V24A 5DKFA 4N6NA 2GBLA 3HKDA 3WAKA 1YZVA 1NE2A 5DOZA 4INJA 1G8AA 1T6BY 1J2EA 3EMBA 3K32A 4J29A 4NDZA 5TVGA 1RC1A 2VP6A 1USGA 2OXIA 3SVLA 3CVYA 5JY6A 5E6UB 1QO0A 1QVVA 1JRLA 1U11A 1ZD4A 1KOFA 3VDMA 2X5JO 1H2AS 3KB2A 1EG2A 1W2WB 4M8KA 1MW9X 3QFCA 5H70A 2ISQA 1PGJA 2WT9A 1IZ9A 3NKLA 4MQFA 1BQEA 3P71T 1V3VA 2XRYA 5DX0A 4HHEA 5ALOA 3G7UA 3GBVA 3JWJA 1MH9A 4ES6A 2OZLB 1QORA 3DDZX 1TUGA 2JIOA 2ZIEA 4TKLA 4IJUA 4OVKA 1OV6A 3M4XA 3QFSA 1P1HA 3JQ8B 2PLAA 4JIMA 1TQ8A 4RKEA 5LUBA 2WMDA 4YPFA 5T67A 1IIRA 4CKBB 4TYYA 2FX2A 3EGVA 3WLNA 3ASZA 4L9RA 5KDOA 3KXPA 4Q3KA 4LYAA 4XI9A 1C9YA 1WSDA 1YRHA 2DFTA 2PKRA 4CMEC 2HMTA 1B2LA 3JATA 3ICCA 4M0UA 1YAJA 3TIFA 5LQDA 4DIDA 1SH7A 3Q8XB 3U3DA 3ET4A 4WKGA 3KZNA 2WJ6A 2QVCA 2CF5A 3BEOA 3HCEA 4HEJA 3V2UA 3V8VA 3DUFB 1JT9A 1KK0A 2B69A 1Q0UA 1YWGO 1YNSA 3AR6A 3KOXA 3TOZA 1W75A 1P80A 2GCOB 3EUAA 1G21B 2V4UA 3RJZA 2VNSA 5DEIA 4LRWA 4R8LA 3UAXA 4DBLC 3R9XB 3Q0EA 1FZQA 1GCUA 3UAVA 4QDZA 4DCTA 2W6CX 3ANXA 4QXOA 3UMMA 3WKBA 4KQ9A 3FLBA 1AGRA 5HXAA 4FE7A 1UP6A 4OREX 5CYOA 4FYWA 5J4HA 3ODGA 2HHLA 4PCLA 1Q6ZA 4YAOA 3FFBA 4DZTA 3BE6A 4DB4A 4NI5A 3OTOB 1G5HA 3TNLA 1Y0BA 1YUMA 2EX4A 2IX3A 3OP4A 1V45E 3DMTA 3ADDA 2BHSA 4BZXA 3SZUA 4UTPA 3OE7A 2PKQO 4HWRA 2DFPA 4TMFA 1NUTA 1WXXA 3OZSA 4HTAA 4B7ZA 3T5PA 4URYR 1KI2A 1HE1C 1Z0JA 3RK4A 4DWVA 3HA5A 5AVQA 3FMFA 4RK5A 3MXTA 1GO2A 1NI4A 4QJIA 1L7AA 4UUNA 4AMVA 1L1FA 2X9NA 3QV1A 1CY0A 3MJVA 3NWBA 5D3ZA 1VRVA 2HX1A 2OCGA 1HYGA 3WRYA 5C3UA 4M4SA 4MW7A 3GLGA 1YOBA 2LKDA 5ELMA 1EYZA 5LIPA 2A5LA 3AGPA 2WOOA 2WM2A 4NE7A 3GDFA 2VDJA 1MT3A 3OWHA 3OE5A 5B1DA 4J7UA 3RAGA 4EYGA 2KBEA 2PANA 3LOQA 2FPIA 5CLLA 4MW2A 1QV6A 2BY4A 1N1DA 5F2OA 3ES9A 4BYMA 2AX4A 4CG1A 5FDFA 5J4VA 5CX1A 1F6BA 2FN4A 3QIAA 4IIJA 1HYHA 3GFFA 3R8XA 4F2DA 1SUAA 1CY6A 3NTUA 2OESA 2PV0A 3ESYA 4XVHA 4OJTA 1NNEA 5FOTA 1ZCFA 1Y1LA 3AMVA 1QHHA 2ZYTX 2QI9F 1L5ZA 2ZIFA 2XAAA 3PRHA 2JD0A 2ZBFA 3KKEA 4HLDA 1HBJA 3WLTA 4BJHB 5JCPA 5JNSA 1ONOA 4D8TA 5HBGA 1O97C 3GCGA 4KPGA 1GQRA 1KK1A 1KH1A 4OM8A 4R8MA 2YIMA 3CC8A 1SUFA 4WFJA 2GHIA 1ULBA 2C83A 4B2YA 1N2CB 1QG6A 5G40A 4EKYA 2O3UA 1DX4A 3T7SA 3LBIA 1E94E 4MRSA 4TXMA 2OBYA 2JB9A 3R6TA 3C7AA 2EKBA 2WFZA 3DBRA 1JALA 4XEUA 3H18A 2IPLA 3GCWA 4N1AA 4HDAA 2RBKA 3T5DA 1SC4A 1XSEA 3E5RA 2A78A 1YACA 1EWQA 1XEFA 1TF5A 4CQNA 2CHQA 3OX2A 3EPLA 1KI6B 4M89A 1GQQA 1CUUA 1K89A 1QHEA 3A04A 3KWMA 2RC6A 3L1IA 3LBYA 4EFMA 1VB5A 3DO5A 4PAMA 3IP7A 2D1YA 1YSCA 3IXLA 5DTRA 2YBEA 1GTJ1 3P9CA 4I4NA 1OLSA 1HDCA 5JQGB 2I29A 3K0HA 1SHLA 4MUBA 4H7JA 4A0SA 4B3CA 4KP7A 1VE5A 2ZYDA 3JPWA 1P8AA 2C2XA 2RCYA 5D8DA 2ODTX 2ZXFA 3O92A 4B3XA 1CF4A 1LVUA 2ZRHA 3O8OB 4ZVOA 2DR3A 3WNZA 5C8YA 3Q1KA 1PFVA 2OHIA 2WD7B 3B1KA 4EYOA 5LU8A 5JV5A 1P33A 1P7PA 5KYXA 1TM7E 3KZOA 3BG5A 4OFXA 1K9VF 2ADMA 2RGGA 1DAEA 1KRHA 3QX9A 1XDBA 3BWVA 3P9SA 3NDBB 4JENA 4PWYA 2JIPA 4RELA 1ZZGA 5IDXA 3R4VA 4CCAA 3KPVA 2YMMA 2J09A 1UBNA 5HX7A 3A6PC 4AZTA 3HSSA 1O8CA 3NC1C 4ARSA 1T9KA 3AHFA 2PRYA 3U7HB 1RM5A 2WK1A 2XR1A 1B15A 2QIPA 4MKIA 4W63A 4Q9AA 2G28A 4Q9DA 1BYUA 1Z5PA 4YV7A 2GBFA 2IDJA 3DDCA 4B73A 2FN9A 5TMBA 5K05A 3CTPA 1H5QA 2VSQA 3WGHA 1MOQA 3U26A 4Q9IA 3NHWA 3UMFA 1J0XO 1E2DA 1SZCA 2V55B 2DBRA 4L27A 4L8FA 5T41A 3S8MA 4BNHA 1TI7A 5IYZA 2IFTA 1DGQA 4FJ2A 2ZIXA 2DFDA 2RKWA 2QW8A 3X1DA 3OT4A 3I4FA 4ZVTA 3LUHA 4QZVA 3LTNC 3EDRA 3FOBA 2C8JA 4YO8A 2V7BA 1UM9A 4DEYA 3S2GA 4CEJB 1EWYA 2X7JA 4JASB 2KHZA 5G2OA 4G09A 4V0RA 3BDVA 1FW6A 2I3DA 3CG0A 3CH5A 3FVVA 4NPHA 3EODA 1E18A 4GP6A 2D4HA 5KQLA 4G2TA 5DULA 1BXZA 4M2LA 4NVRA 2WUDA 4BWVA 5EMNA 3BXPA 4BZQA 1FL9A 2P35A 3K5PA 4N47A 3FTDA 1YFLA 1VJGA 2EFHB 4HX2A 4LHYA 1ZD3A 3JAMA 3RLIA 4YT8A 4DT1B 4RW0A 3DOUA 4GWLA 5AIBA 3OMXA 4GT1A 2Q3JA 3NANA 2KPOA 4UOZA 2UVPB 2W4IA 1E9EA 1Z8FA 1AK2A 4M1QA 4PYQA 5AHXA 4L8WB 5GJCA 1L8LA 1ZISA 4BQNA 1E3JA 1E6LA 4NJMA 4OAQA 1BOOA 1ZVJA 3TZEA 4KACA 2NQ2C 4FOOA 1FFSA 1YB4A 3GBSA 5GJBA 1Q21A 1PZXA 2BH9A 3A9RA 3OZIA 3OOYA 2HHJA 4HOYA 1U2ZA 4JROA 2PKQP 1DE0A 6REQB 3KSRA 3A1SA 3X1XA 3E2PA 3B36A 4N5IX 4CMBA 1TUIA 3JPYA 1HYBA 3BE4A 5J4LA 3IILA 3SDZA 2HTEA 3CCCA 4J2TA 5EOVA 4DA0A 3AETA 1BRTA 5E1MA 3WQBA 5HPYB 3WHPA 1AS2A 2R8BA 1ZGGA 2VDMB 1XQ6A 5D3KA 3WGGA 5JFTA 3K2EA 5IKEA 2D2VA 4KTVE 4ILEA 1QDUA 5I5GA 2I6QA 3G3EA 1CP2A 2LNDA 3MVEA 2D5AA 4MJ7A 1DC5A 3ZK9A 3TFQA 3ZH2A 5C5EA 3VYUB 3KM0A 1IJFA 2IXGA 3S1LA 2VPZA 3F2VA 2A9QA 1JLHA 2ZYIA 3KE8A 1PT5A 2HDHA 2ZU6A 2QAGC 2ZT8A 3KOUA 4OP3A 1XWWA 2YYSA 3DZCA 1Z5UA 3ROGA 2VT7A 1DAPA 4DUYB 3TQSA 2NT3A 1WW8A 2ZTLA 2LCFA 2W5UA 4Q1DA 4S3MA 4D45A 4PQRA 2QTMA 1M1UA 4Q0MA 1BO6A 1G9TA 1Y7IA 2H5LA 1P77A 3WLAA 5J5CA 1ISMA 3IOBA 1E1CB 2GD0A 4NLLA 4PGHA 1ANKA 1VCMA 5IVKA 1BWPA 1G9XA 5JNUA 4YCMA 4OD0A 4RPCA 3C3WA 4P3NA 1U3UA 3P45A 4UVIA 5IAAA 3LIPA 3N53A 4UAJA 2P41A 3GLSA 3KQSA 4KR3A 5ITWA 3F3KA 2CJWA 1C0PA 2O1SA 1NVDA 2C2ZA 3PR3A 3UV6A 3UPUA 1WUIS 3V48A 4JUDX 3KQHA 3TLXA 1BGWA 1Z83A 5F35A 1X1CA 4PFSA 3U40A 4EUKA 4FIZA 4HQRA 3A6JA 4RHYA 4F0JA 3IR6A 4LNHA 4MV7A 1XCPA 3RIYA 3V4PB 1V5FA 1W35A 2DJ5A 3HABA 3QU2A 3Q7QA 3ZKWB 2C4MA 3IAS6 2VTKA 1ZXXA 5H8WA 1ONBA 4Q6BA 1S2DA 4RWZA 3SYTA 5B58T 4IMIB 4YECA 3A1VA 3IXQA 5GGYA 1CZNA 3I76A 3KQWA 2X0NA 5I9NA 2VUHB 3K8YA 4JYZA 3W8EA 2OHJA 2BJVA 4EF5A 3V46A 1Z5OA 2VTEA 5G4LA 3II6X 4V03A 4EI7A 5A6SA 5B4VA 2G1PA 1MX3A 2ZJFA 3AESA 2RG1A 3EFBA 3ZQ4A 3F5QA 4C0LA 4EJ2A 2P0YA 1VMDA 4UNPA 5CVVA 1T5TA 4IP0A 4TV9B 4BLSA 3L6CA 3RC3A 4F71A 3CY6A 2F1KA 2YN2A 1UC9A 4R41A 2X76A 3LZ6A 3OMLA 5DZSA 3ADPA 4EBBA 1NVAA 2C0CA 3HXPA 4Q82A 5I6DA 4XD2A 1KERA 1WSAA 4P08A 2XKKA 2PBZA 5A0FA 4IDQA 5FBWB 1J8VA 1MR3F 1YS1X 2FF7A 3WL6A 5BW8A 1PUJA 3VR5D 2PMDA 1PD1A 1ADYA 2O8EB 2ORIA 2Q99A 2LDBA 4MP8A 1BMDA 1JFVA 4JGGA 4JQZA 4LSWA 1Y6ZA 3F67A 3U56A 3V4OA 2X14A 1EU1A 2CZQA 5JU6A 5CB6A 2EZUA 4U9UA 2H9YA 2V98A 3KEQA 1C7JA 4TKMA 5CVTA 2E4VA 5CB8A 1NM5C 2IBSA 3IPRA 2H1HA 4DKXA 4XQ9A 5E2IA 3AVWA 1JDTA 2DMRA 2C3YA 3JQEA 4G0PA 4XR4A 6CHYA 4QREA 4OLFA 3ULKA 4FHEA 4P22A 3NMUF 4JUIA 2HK9A 3FUUA 3GEGA 4AO6A 3QVMA 4ARBA 5C81A 4KIFA 2XRMA 1W9MA 2FDRA 4LJLA 1Y1PA 4MQ4A 1EXWA 3CCBA 1KDRA 1SKBA 1Z7GA 3AYZB 3PQFA 4YI5A 1CVLA 1GA6A 4B8YA 4K9OA 4ZKEA 4R3UC 3JRWA 1ZMXA 1K7YA 3GT3A 3WQRA 5GTDA 3V4VB 3NUQA 8ADHA 1WSWA 1NVKA 3P9YA 4J1TA 1QRTA 3VO1A 1AURA 4MROA 2GEKA 1SNYA 4CF3A 3R5KA 1ZBQA 4D5GA 2R1VA 1JPNA 4BRUA 2P9TA 4MB2A 4D9FA 3U31A 2LKCA 3PFGA 3DYVA 4KQWA 4NPAA 3WSWA 3KEMA 2IYLD 2AHRA 5BN4A 3JD4A 5GONA 4DV2B 3QWFA 2AN5A 3RKSA 4B4DA 2BZ1A 3KIPA 3EZ6A 1B00A 4A1OA 4YAUA 4UMVA 3ZDRA 3GGDA 1CZHA 5J23A 5BQXA 2QRZA 2DVMA 3F6YA 1W76A 2QYTA 2QP3A 2YHIA 1OC2A 3ESAA 5TRTA 1CR6A 3VFDA 1XQ1A 3EXG2 4MHTA 4ERNA 2CCGA 4DAEA 3FTNA 1HE4A 1X94A 1NGSA 2UUPA 3QMMA 2B5VA 2Z4RA 4JLBA 4RKRA 2PZLA 1PRYA 2VJNA 4BZPA 1DFHA 3QENA 1NYRA 1TC2A 1U0GA 4ER5A 3N0VA 4H59A 3AHGA 1EZ1A 2EHJA 2HH9A 1C0LA 1RJ9B 1FSGA 2VTBB 5BSUA 1J70A 2OCXA 3WO1A 5KOJB 2Z9CA 1NW4A 3LVFO 4RZXA 3KDPA 4QPPA 2W2KA 4OA8A 3O38A 4FUQA 1C9MA 5J58A 2FEPA 2XT0A 4OSEA 4HNGA 1IEWA 1XTPA 1W9HA 1P6UA 2J0UA 3HU3A 1G0NA 1RI3A 1V6CA 2JI6A 3DCJA 3NYWA 4LOIA 1Z29A 3ELDA 4J03A 4F1JA 4EYEA 3AL3A 3HGTA 1ZLXA 3PFBA 1PBTA 3UC5A 5LQRA 1SBCA 3GZNB 3AF6A 1GTSA 4D44A 3AFGA 1CP3A 3NDPA 4JD5A 4KV9A 3DVRX 4ARIA 1DRUA 2C4HA 3G2JA 5KJEA 3GR6A 3C4JA 1O9GA 4W5HA 2ADFA 1OH8A 3L79A 3QEJA 5K7SA 2C7VA 3ICWA 3QYFA 5I3CA 2BUCA 5L3QB 1OUMA 5AOBA 3ZLJA 2GVDC 2VH5R 4KH1A 4TLAA 1MX1A 2QT0A 3KT6A 3M70A 2QEQA 4QUHA 1CQJA 1G8YA 2XA9A 1RRGA 3JALA 3NHRA 2PKCA 3GVIA 2DXIA 3EXIA 3N0TA 5BVHB 3VKGA 1K5PA 3HKCB 3OFND 2JLXA 3HE3A 4R0NA 4O25A 3ORRA 2EF0A 3W4KA 1U8YA 3S3TA 2ZJ0A 2OGTA 4JL8A 2P4EA 3WDKA 1AKNA 1UJNA 1C7FA 1I3OA 1KU6A 4OI1A 1P5RA 4GECA 3WJ7A 4DA8A 4YDQA 2ZM6B 3GRRA 1CS0A 3AESB 1R0WA 4JHLA 4HYYA 2C5AA 1QH1A 4M37A 3WWEA 1N0VC 1UANA 3WGIA 4WK0B 2V59A 4J2HA 2C31A 4P4NA 1PYGA 3MPOA 3PDUA 5EP4A 3RSOA 3BHIA 1RBZA 1OXSC 4CEHB 5D6NA 1JA0A 2OL4A 2ZYVX 3BMXA 5CTAA 4C87A 3N1UA 2DFKB 1R12A 3KLPX 5DYNA 2H7CA 3KZCA 3ZDFA 3ZJ4A 1GPNA 4E4RA 3C6KA 1A76A 2VF5X 5JSFA 1BQ3A 4L5BA 5ENZA 3R7WB 3ROZA 4ZQFA 3PJDA 3TFOA 2HF7A 1TD1A 3VU3A 2C57A 5LQCA 4AKGA 3I1IA 2OQRA 2MSEB 4YHHB 3BMNA 2ZZMA 3KKZA 3TPZA 3I9KA 4R0MA 1J8MF 4OQXA 1NVTA 1Q57A 3QKRA 1QUFA 3RTEA 8LDHA 1W36D 4QA9A 1H1LB 4R16A 3NT4A 4R1QA 1TW2A 3CLUC 3QE2A 2OAQ1 3VUEA 4D0LB 1A8IA 1TMKA 3FHCB 3R7DA 3CEJA 5I7UA 3DV0A 4WW0A 5AJYA 4Y9RA 3UGTA 1NMEA 2PVCA 3HHPA 4OBXA 2AL7A 4ETWA 3HJGA 2WJYA 3F9CA 1M2GA 4L76A 3TMAA 5BSMA 4G6ZA 1KYIA 1SXJA 2CKMA 2JS7A 2PGJA 3MYYA 4CM3A 2C3MA 3INYA 5I7HA 4EPXA 3MWGA 1PJLA 2BGKA 1HOTA 2I54A 3CRZA 2VRCD 3FLMA 4P6VF 4RD0A 4EG8A 2NXCA 3CW9A 4KYUA 2FI1A 2Z6UA 2X6RA 2JK1A 2Z3ZA 3FCOA 1N75A 3H1AA 4PGAA 1GL9B 3WG9A 4TS1A 3QKUA 2VT3A 1G60A 3KFVA 2Q6VA 4UUBA 3I4LA 1TJ3A 1H0RA 2F9FA 5DB4A 3WYAA 4TKVA 2BTEA 4TZ0A 3ITDA 1TIBA 3OAAD 1XRMA 4NFLA 1VA4A 3MJHA 4LV8B 4H9GA 4MGYR 3OY7A 4RTLA 4F84A 1T26A 2VXBA 4IY1A 1VL5A 4J75A 4HH4A 1E8DA 3C0KA 4Y9UA 5BQOA 3TD6A 3CURA 1HRDA 4G86A 4LDRA 1N1GA 1QIDA 5HIJA 4CM8A 2HZBA 1SU6A 2Z4TA 1QFYA 1PFGA 1EQAA 1S96A 3AGQA 3HO8A 4US1R 3RGGA 2V6BA 2LCIA 3FOWA 2WZDA 2AZDA 2ZVJA 5DSZA 3KYIB 3B78A 3AV3A 4J2OA 1Z2CA 1IXKA 1LBEA 2E4YA 3A4TA 3DDHA 3Q72A 3QU9A 5C9ZA 1JIVA 1UXJA 2BFAA 4CIAA 3R7NA 2XVXA 3SS7X 2SICE 1QBKC 4TV8A 5BT8A 1Z73A 3BREA 1ZNXA 4EMUA 1DO8A 2XDWA 2GA9A 2AFIE 3RUFA 2XGOA 3OQ1A 1YFZA 3QXGA 2QAIA 3AERA 4QOJA 5CDFA 3R6LA 3KYJB 3BDAA 4F7WA 5HUQA 3QU5A 4OX9B 3FZYA 4QM6A 2QZJA 1A95A 4DLZA 2WVJA 2Z3VA 4DE5A 2AK2A 3ZHYA 1HUQA 2GBCA 4MR9B 3LT5A 1UXIA 1ODTC 3MCTA 3PI6A 2HU2A 3SJUA 4XQ0A 1MDFA 3M9WA 3AV0B 1M54A 4IIHA 2SCUA 1QAQA 3NOOA 1VFNA 3W2EA 5GQSA 4GF5A 4MI1A 1UZMA 2GXQA 1XAJA 3CUEF 3DHYA 3VHLB 4EG1A 1IOZA 3G6WA 3GLHB 1D6NA 3GN2A 4O4JA 3RHZA 3OLWA 4R31A 2DUNA 1J9GA 4O4LB 3UY4A 4TKUB 3U09A 2JKVA 2ZUSA 2O7NA 1T4GA 2PRKA 3JALB 5LWQA 3KKKA 4G5QA 4U2DA 4W5TA 1HDOA 2X7XA 1OU4A 2O9JA 4EDFA 3WBJA 3QYAA 5IJ0A 3K0AA 4I55F 2BH2A 1P29A 1AKYA 2ZKLA 5F3WB 1CUHA 4FHDA 4LVNA 4H27A 3PITA 4MW9A 3TM4A 1YMVA 4ZN6A 3NEJA 5A3JA 3BT7A 2YNMC 3DE5X 3LLMA 1JKJA 4Z2YA 3ZU2A 5KYYA 2XQFA 2ZBDA 3O0TA 5KNDH 2CLOB 1R00A 1YUNA 3ILVA 3GLVA 3RS9A 1IFXA 3UZUA 1UBFA 4EMSA 1P2DA 1JIQA 3O83A 3ID6C 4JJIA 3ZZ0A 4E33A 3KR9A 2PMFA 2ZAYA 3EFOA 3TIXB 1NUUA 1B2RA 4UM5A 2WU4A 1LNZA 3TEMA 3V5NA 5IHXA 4JVLA 1G1MA 3THRA 4N3GA 2PJRA 3TCNA 3M2TA 5I7EA 2J45A 5JCJA 1R4MA 2PQ0A 5AJUA 4WMLA 3PLNA 2G07A 3R3JA 4ND2A 3M4NA 4JS0A 2YWCA 4Y2SA 4C03A 3WKAA 3O8DA 4HFRA 3D7LA 1PL7A 1NW7A 2VHJA 3EUEA 2YFHA 4MP3A 3OWOA 4ZC1A 4Q9JA 2IOYA 3UANA 4E21A 4ZZ3A 2QRNA 1IUKA 5IZ4A 4Q3EA 5PNTA 2A0XA 1JG4A 4RPKA 4U3JB 1JWAB 4HPWA 3T41A 1WZIA 1FDRA 1H6DA 2WWRA 3F9RA 3PCTA 4OXNA 2WWVD 5KYWB 1ENPA 2LIVA 1J97A 3BM5A 1CKEA 3GW8A 4PAGA 2WUVA 1H2ZA 3BXXA 4TN5A 5LXTF 3VTFA 4ZIRA 2XXAA 4QWMA 4G26A 1C8BA 1EBFA 1IPEA 1HT2E 3F7NA 1JEOA 2KI5A 4Y2XA 1XCJA 1ONPA 2CLEB 4KPUB 5FBKA 1K92A 1WDTA 2QLNA 3K6SB 4N41A 3RJ9A 1NXWA 4FLMA 1Y98A 2DQYA 3E1KA 4QLBA 1VSVA 7ADHA 4L08A 2FP3A 3C3EA 2Q5CA 4KDCA 5KYTA 1U2GC 4TVBA 1W85B 2E1RA 4D9GA 3W79A 1TA4A 1ML4A 1Q2UA 3LCUA 3TO5A 3VDNB 3THWB 1N9KA 2XCUA 3AF3A 1E66A 2QSZA 3S29A 4P5PA 1CZRA 2ACEA 4BGUA 4HH3C 4Q5IA 4KO1S 4QNRA 1Z3CA 3DMYA 3QGMA 1RWBA 4X54A 4AMYA 2EJTA 3AJ8A 5JPIA 1CB7A 2PQ2A 1U2DA 3BKWA 4MR7B 4Q4DA 2COEA 3RHFA 1B76A 1RWPA 1G291 2PX6A 3HDGA 3I0MA 1DADA 4XX1A 1RAIA 2PX0A 2IU4A 4N0DA 5JXHA 2H4ZA 5A5GA 3QVSA 3A9TA 1LPPA 1IZ0A 3VI4B 4KVGA 3WZLA 4P0QB 2H0QA 3QPVA 5K45A 3LDUA 2QX9A 1DB3A 1EM8B 3V1TC 4IZOA 1GZHB 1H9BA 3DE0X 3EF1A 3UA3A 4XWTA 2OVBA 2QUKA 2XTAA 4PVDA 4EY6A 2D2EA 3FOEC 2FN7A 1U9ZA 2VYCA 4J43A 1X1RA 3WMEA 1EGVB 5KNLA 2D8AA 3ORHA 4FQ5A 1WX1A 5CXSA 5K1ZA 1OE0A 1N5RA 3D31A 1FNMA 1XTQA 5JWHA 3OJFA 1XUOA 3STXA 5HILA 4QUDA 2WTXA 5EEHA 3TD2A 3V8RA 2H1RA 3D8TA 4JNKA 1JKXA 1V4NA 3NEAA 1UFQA 5JMTA 3JZAA 3DTVA 1KIAA 3OCUA 4EG7A 3OPXA 2ORWA 3NKFA 3R2JA 1YB5A 3C6BA 2WR8A 1XKLA 4L5CA 4E5UA 3JZMA 3HLTA 2VQDA 2A0KA 5JZOA 3WIEA 2W6PA 3C8UA 2GAIA 3MS2A 1C9NA 3WIDA 2SCUB 2REQB 3FSJX 4MMYB 1JB9A 1X42A 3I37X 3QXJA 3LSYA 4HNUA 3ZDBA 4WSOA 1WOMA 2BJWA 2I4OA 3ADKA 1M67A 3KOWA 4I6GA 5AXDA 2H4FA 4UD6A 5C8XA 2XX3A 2YIJA 3FKQA 3OJEA 4LSGA 1JIUA 3SIPA 3DWEX 2D5IA 1C3VA 2H65A 3LHSA 3DP7A 1NPTO 5E1BA 3GHYA 3KV3O 5F4BA 4P32A 2ENUA 4BP8A 1DPFA 5F5LA 3W5AA 1QR6A 5EJGA 2X3UA 4OHOA 2CD9A 4V0MA 3QKSB 1FTWA 3W8NA 1QCDA 4MKHA 5FA8A 1R6UA 3OO0A 1CEYA 1E92A 2BP7B 3G0GA 1R9MA 5COAA 4LXIA 3DSRA 1TD9A 3WHIA 2FW9A 3NHKA 3NJ4A 5HWSA 4GI7A 3NRBA 4LPKA 2VHXA 3MEQA 1M6VB 3EZGA 4KNWA 3TECE 2EZ4A 5A4AA 4ZAVA 1S02A 4HWKA 1AM4D 1E9DA 1AKEA 3ESQA 4Q9HA 4F2GA 2GZDA 1XPOA 4RQUA 5FUWA 2G04A 3ZX5A 1R4AA 1VE1A 2QL7A 3DMPA 4Q03A 3V1MA 2AJBA 5FLKA 1ECJA 1H94A 2FU5C 2H7VA 3O4FA 4FZJA 4MKXA 3BGOS 4PQGA 2O50A 1A4UA 2EU8A 4DCGA 1SAYA 1S8AA 2FNAA 4NQRA 1L5KA 2J3MA 3DBLA 4HYTA 3RDPA 3D59A 3K20A 3L7DA 1DIAA 2YWDA 5BOSB 4YJ3F 1RKUA 3N39C 4O8ZA 2IPXA 4BNFA 4FMPA 4HMQA 3RVKA 3KT3A 3FYSA 4N9QA 4A36A 4QRHA 1II0A 1RPJA 4XWGA 4Q4HA 2I67A 3GD5A 4FTWA 1VHWA 4WN9A 1PR9A 3RFUA 1OX4A 4OGGA 2Q6TA 3GVPA 1T5OA 2ZBVA 4B0OA 1PZEA 2ECFA 5KWEA 1NATA 3IMGA 2X1MA 4BN0A 1W6UA 4DCMA 5KZMB 1I7DA 4KAAA 2H18A 2I03A 2QX6A 1S1CA 4N7MA 3R7LA 3GJ3A 1YBMA 1S8FA 4Y2GA 3TBFA 4CTKA 3NHBA 2P9CA 1CUWA 2D7CA 2RC5A 1WHTB 3BWDD 4Q1CA 4QBKA 3QWAA 4OMUA 2VPYA 3AM4A 2H1OA 1AMOA 1JXOA 3C8MA 3FCXA 4L4YA 2NU6A 3LRPA 3Q5EA 3NI2A 3FOCA 4JITA 1PJCA 3EZ9A 1FFXB 4D74A 3SE0A 3DOHA 4RLHA 3WJAA 1EE1A 1OMOA 1GRNA 1GZDA 1JR3D 1CK4A 2QLJA 3H8JA 2W0SA 3PFKA 1E1RA 2I6SA 4C4OA 3V4LA 5JAIA 5CAEB 3THXB 4PZCA 3UA4A 1MX5A 1IUOA 1YOVB 3WP0A 4NONA 1GZUA 3VVLA 5JSZB 3VOSA 4D8YA 2CUNA 2ODAA 3A9CA 4GI2A 2BM8A 4JSRA 3MJ4A 2HI0A 2R44A 2IYZA 1E2FA 3N8DA 3MWDA 1GRVA 1LDGA 1Q19A 3HYCA 3SF0A 3BMCA 4A6EA 4FT4A 4DV4B 1K8XB 1FRNA 4JKIA 1NP3A 4X3OA 3HDJA 4N3AA 2Q0QA 4Q37A 3VKFA 4H7KA 5LUAA 3AVYA 4OG2A 5DLPA 3T3HA 1NBMD 4D0SA 3WNCA 2V5AA 1R0KA 3SHWA 2FA9A 2P6OA 1IM8A 3ORSA 3A4LA 1Z5VA 3GVCA 4OP2A 5FL7D 1IN4A 4EUSA 3QY9A 5JJKA 1PGQA 3K0SA 1A8SA 4Q4CA 2DFLA 3IQDB 4F5YA 1DEHA 4M7PA 1RXCA 2E4WA 4ZP1A 3H1BA 2P6NA 1UBUS 3BIXA 3GBPA 4WOJA 5ESRA 4CKYA 1KH2A 1E62A 1OZHA 3VO8A 4BO5A 2WNIA 2R6ZA 4J9UE 2FQQA 1PSZA 5DK4A 5EPOA 2QN2A 3IT0A 1FJHA 1T4CB 3BHJA 1SBZA 1MO4A 1JHRA 1FYEA 1H2RS 5IAJA 5HF6A 4G1VA 4Z3DA 5JLAA 1Y8RB 1N5OX 1VSBA 5FPTA 4PLYA 4E30A 3DBHA 4WLFA 1AKUA 3T3EA 4YONB 4YRBA 1TQ6A 4G24A 3L8HA 2PGLA 3DMRA 4GXTA 4Q1VA 2QPAA 3FGOA 5BORA 3NNDA 3DBIA 1M83A 4OMDA 2DERA 4N5DA 4TTVA 5IDQA 4Q16A 2C5EA 1JFFA 5L3SA 3K0KA 3SLKA 4BMPB 1CJUC 4PW0A 1E1NA 1YMQA 1C1XA 1BYIA 2IT1A 4I50A 1N2JA 3CR3C 1IL0A 2VHQA 4INAA 5ALSA 4B3BA 1DCTA 4LHVA 3UK1A 4RM3A 4AVYA 3PCRB 1DUIA 2LUOA 5BWMA 3PENA 4X8HA 3CTMA 3DVQX 3EX7C 2AXEA 3M1LA 4FYPA 1AS3A 2AG6A 4W1PA 3EGWA 3O5AA 3G2MA 3KL2A 2C4NA 1RHUA 4WCFA 3O0DA 3M82A 4HQLA 4AMUA 4TXJA 4C7JA 1RWOA 1FX0A 4KQJA 2QLLA 3FWNA 1W93A 3KOYA 3VPDA 1IN7A 5JNVA 1BWSA 3KELA 4GUDA 3UKJA 4NHOA 3K4HA 4F4FA 3I9V1 3BWBA 1MW8X 1G63A 2P2CA 4NBUA 4IJ6A 4JODA 5ED0A 4B7UA 1X13A 1U0OC 5FB3A 3HP7A 3VAZA 4XYLA 2L0XA 1HEYA 2MSCB 4IWYA 5L3VA 2PUBA 1N8NA 4C7OB 1SQSA 3H9JA 4Y98A 2RHLA 3SFVA 3STVA 1X8JA 4R3NA 4XOIA 2ZDQA 2H4JA 3E9RA 1XLTC 3BXEA 1FMCA 1M0SA 3I52A 3KXKA 4KYTA 4WN9B 4NZOA 4X65B 1MOZA 2DWCA 2ZSDA 3PXUA 4L2IA 2OSBA 1AQJA 1EFPB 3EY4A 4FYIA 4G1BA 4UHFA 5EZQA 1KDZA 3MUFA 1R27A 5JARA 1NJ8A 1XRPA 4RYLA 3I83A 4AF7A 1OB5A 2A9VA 1NV8A 3M4JA 3TLMA 1YA8A 2KE5A 2QW0X 4PLVA 5FI5A 1DTEA 2V8BA 1KU0A 1E5QA 1TZCA 4L6IA 2OOSA 4UE3S 3TQIA 3RSFA 3B1ZA 4BNGA 4L5JA 1G7RA 3PQ8A 1AQ6A 4H08A 3O4IA 1QZUA 1UMDB 2VRWA 3DZKA 4D81A 5AW4A 4RCZA 5AM1A 2RBEA 3MGCA 4RANA 2C1EA 2K5UA 1QYCA 3DDUA 4OB6A 5KOIA 1YTUA 5FFFA 5TPZD 2QYHA 4WECA 2IBTA 3I92A 3ZCSA 3PR1A 4CN9A 1PX0A 2HPHA 3FY4A 1ADJA 3K0CC 2PH5A 1Z6TA 3NALA 4Y0VA 5TR9A 4ZEMA 5JHHB 3OP1A 3RU7A 2O2JA 1JA9A 4GOND 4B4WA 4PHFA 3TG2A 4LKOA 4PNEA 3H84A 3OMWA 3TKLA 3BMCB 3ZCRA 1I33A 3N2LA 4BNKA 5KBYA 1RRKA 1J9EA 4H15A 4M1SA 1X8XA 2I71A 1JN0A 1S2OA 3JYHA 4R69A 2O48X 3RH0A 4TYNA 1FLVA 1IC6A 2C7GA 3GJQA 1XZFA 4FSDA 2WNSA 3H16A 4AULA 1HTWA 1I3KA 1ZK2A 3EB9A 1HDRA 3JR3A 4G0QA 4R05A 3RS5A 1VMAA 4DOMA 2XZOA 2OBXA 2O2ZA 1SIBE 1EFKA 4MW5A 1C4WA 1FB5A 1IZ7A 1KH3A 1SBTA 3AUYA 1R0CA 2F43B 3EIOA 2IZZA 3G1TA 1KVQA 4IX1A 3FAZA 4L22A 3K71B 1ZGJA 1P72A 1LI4A 4CQMD 4WGGA 1J0DA 3PKZA 4HS9A 3U4GA 4LJYA 4D96A 3LNCA 1MPTA 2DULA 2FEXA 2RHDA 3PV0A 4HG2A 4BBAA 4IHKA 3CSDA 2OV1A 3KP1A 1C8KA 3A25A 3UMVA 2EQ5A 2HQSA 3AHJA 4EUEA 3P2EA 4E14A 4PAWA 1KMMA 2Q27A 3SBDA 4EG3A 4ENUA 1GT6A 1D9ZA 1NNI1 2BPOA 2ZJBA 5LVAA 5KO2A 2AOTB 4M8SA 3K9FC 3C4QA 1ZXBA 2VK2A 2R7AA 4M1ZA 2OVFA 1YL7A 3AY0A 5FR1A 1PUXA 2NYUA 3OIGA 1HWYA 2G6BA 3DMHA 3Q3CA 1YO6A 3G49A 3UEOA 2VJOA 1P60A 4BVKA 3HACA 2C3OA 5KYVA 5G0UA 4NCBA 2QXUA 3ZDEA 2LZ0A 1V5GA 1WKCA 1XDZA 1NJ6A 1V11A 2NZJA 1WV0A 2C95A 2I34A 3NIGB 2GN1A 2O2YA 1CJSA 1BJTA 1SBYA 4I4TF 3FOZA 1E0AA 1ACJA 2GZSA 2OCLA 5DHRA 5L95A 1YZTA 4GH5A 5HGJA 1JSRA 2A9RA 1UPFA 1TEXA 4P82A 5GZ1A 1XVTA 1UINA 1LBSA 2XV1A 3DD1A 1L4UA 4F56A 1P4AA 1GXSA 4RM2A 3BULA 4MDYA 4H7HA 4MPDA 3U4AA 3UATA 3GUUA 3PG5A 1PT8A 3GOHA 2O05A 3H13A 5A9SA 4ZVKA 1F8XA 3H6HA 1WSBA 1Z37A 3NBKA 1XNJA 3RTGA 5CXXA 2L19A 1FMFA 4N7JA 1GTG1 1WKBA 3HKBB 3ZN2A 4AZ3B 2OZKA 1WUKS 2LW7A 4I1IA 1JVNA 4NBLA 3OQHA 2J0VA 2YXNA 1ULZA 3FWKA 2ZR9A 2LIPA 3KQMA 4JYCA 1W49A 4LDZA 1R64A 4ETNA 4PCVA 3AM1A 3RTBA 2JVKA 2QRUA 4F1WA 5EXXA 2DECA 1ZEMA 5LL6P 3C5WP 2I3AA 1Z4NA 1VLJA 3FIUA 2YUIA 4D4KA 2CY0A 5C1OA 2Y92A 1H42A 2MSWA 1UBCA 3C5CA 1KRXA 4QXAA 1GUDA 1AXGA 2XAUA 1ZGBA 4W5WA 2WSBA 5IKPA 1Q95A 2YBDA 3JQDA 1UAYA 4PR3A 5TC4A 4G0VA 2PK3A 2AKEA 3SSNA 3HGQA 4URZR 5IZCA 1ZOPA 2GJAA 2MINA 4OHWA 2P0AA 2HJ9A 2I1VB 3H19A 4I55B 3THYA 1Z68A 2V9ZA 4B2IA 2PZBA 1JZTA 1ZC4A 2HUPA 1HMPA 2NPOA 4F97A 1B8PA 1H2YA 1V3QE 3HPQA 4HRXA 3F46A 1WW2A 2P4SA 2WAOA 3G8AA 4IFEA 3D0OA 1RTKA 3ZBQA 5T7BA 4R1OA 1WDKA 5E9QA 4DIUA 2E37A 4ZK6A 3BA1A 1DCMA 1JG1A 2EATA 5JISA 3IEUA 3A0RB 1WLYA 2E87A 1WHSB 4FCVA 2X2FA 4WT7A 3F71A 3KQVA 2AQ8A 2C00A 3PXEA 4WOBA 5J2TA 1EFDN 5TEVA 1WXQA 3EHEA 1TFRA 4ESOA 2R5FA 4TMZA 2BFDB 5E0OA 2G88A 1J2YA 2G8NA 3HBJA 2CC2A 2D5BA 4B85A 9ATCA 2XZLA 3DGFC 1QHIA 4N01A 4NHEA 3BGSA 4E1AA 5ADWA 1IY8A 1OXTA 3BGDA 1RSZA 4X24A 1Y6FA 4G81A 1UL1X 5IDWA 5CBPB 1SCBA 1YJXA 2TYSB 1FNNA 2WFMA 3A1FA 3IDZA 3N8GA 3QLVC 3QOXA 4PWZA 3RYIB 2YICA 3W6UA 3BRCA 1X74A 3H5AA 1KEKA 1C9KA 4Q66C 1M6YA 7AT1A 2Z08A 1J4AA 1EVYA 1J09A 1GN9A 3AK4A 3MSXA 1TZBA 4MRMB 2MHCA 3C45A 1VI5A 5LXTB 4KSCA 1SUCA 5E8RA 5ETJA 4HY3A 5LDHA 1OT3A 3OWXA 3UMYA 4RTPA 1Q0LA 2NO0A 4RJKA 1Y3BE 5C53B 3X43A 4LDNA 1H4VB 3I1YA 4JK3A 4PS1A 1O97D 1WCIB 3MB5A 2ZRGA 2DFVA 3FSGD 3QEAZ 3U0VA 4ND7A 2IEAA 3LC1O 5FO1A 1ZOSA 1SD1A 4A6XA 3HWWA 1BDIA 3OEWA 4DDUA 4DIKA 4WKPA 1L4EA 1S3IA 3NBZC 2J5BA 2RFLA 3PZRA 5CNMA 3MTQA 3H4TA 5DX1A 5FWYB 1Z2NX 5TGTA 2UV8A 3JQBA 2P9EA 1GTRA 3OURA 1UZLA 1JP7A 1XTIA 3OFSA 1P3Y1 1E9SA 3SOPA 4JLVA 4QVIA 3CEAA 1T2DA 3JQ7B 4GX1A 5DF1A 4TWJA 1QH8A 2QJOA 3VKVA 1BHJA 2E4AA 1N0WA 3GMIA 3L82B 2C2KA 4V0OA 5EWJA 4YGXB 5D7NA 1R6VA 1SXGA 3K9NA 3M83A 4FCTA 1XCGB 3S99A 3M1AA 1BWRA 2PKYX 3LKVA 3STTA 2F62A 1C14A 4B31A 4Z4FA 1B1CA 4P0TA 4OYLA 5BSFA 3QWIA 3PXAA 1GTL1 2D62A 3STUA 3G5LA 3CF6R 4W9NA 5CFPA 4KMSA 1WWKA 1SC6A 1X15A 1JJAA 3LC7O 1EBBA 2H1VA 3IEXA 3QA9A 1W2GA 4BLPA 1ZM2A 1VYUA 4YJGB 1LI7A 2W6MA 5CA1A 5AW7A 1RXYA 2WYWA 4GZMA 5ECDA 5HZKA 1T8WA 2GPBA 4Q7LA 4GEKA 5K3EA 4P5DA 2F9MA 4TZ6A 1KZGB 1DBVO 1FSPA 1QC5A 5FJJA 3B13B 3D6FA 3LNTA 3I45A 4RLSA 3T3IA 1XC7A 5F51A 5ICCA 1IN6A 2JIBA 3HSYA 1H9CA 2J48A 5GOZA 4AKEA 3K2QA 4X1OA 1EGAA 1K3TA 4YRMA 2BKEA 4B83A 3IP6A 1I6WA 4PFQA 5BRAA 5KJ1A 4LOKA 5CNKA 2GD6A 2GTPA 3DLPX 3B7PA 3QYPA 1DDGA 5KYUA 2JJYA 3EG9B 5JUWA 5LMNB 3VR5A 4RIEA 1HNXB 4JLAA 4B3TB 1QO7A 1U94A 4WIAA 3TK1A 4AX8A 5K5EA 3EMDA 3GA5A 3V4SA 3C14C 2IZOA 2OK7A 5K3FB 4BO6A 4RJTA 1PFWA 2QVZX 3KS9A 1BAPA 1N8KA 3F49S 2Y76A 4L8LA 5DIFA 2AOUB 4RXUA 2FUG6 2XQIA 4A3SA 1VMEA 1PZNA 5ECWA 3QEMA 4IKEA 2O3QA 3RYFB 1EHCA 3RV4A 4ATNA 4XGRA 1A1VA 3ZLBA 1M5UA 1MOPA 1VJ0A 1MGOA 3E9CA 4GUAA 4KQHA 3T9CA 1TVCA 2IU0A 4MW0A 2ROQA 2VJBA 3L7IA 2J3JA 1Z15A 1TA0A 3N2EA 2JFQA 3IC5A 3ICEA 5A05A 9ABPA 1U7TA 3D3EA 1R10A 2FFJA 5DBIA 4QPZA 5EGNA 3WDLA 2Q0HA 1PQUA 4XIYA 2GKSA 3QVGB 3AKYA 5A9RA 2LCQA 4FWTA 4Q3DA 4A4DA 3ZWBA 4B6OA 5SZKB 2GCEA 3B53X 1M2VA 4B3JA 2EQBA 4Q3CA 3ZVMA 1MDBA 2W4QA 3NHJA 3P97A 5KVSA 2CCJA 1AZSC 3GJ4A 1VKOA 3Q40A 4YJ3B 1AHHA 2ZS9A 3FR7A 1Z08A 4A92A 1NG9A 5DM1A 1KKUA 2OR3A 1SG0A 5SY6A 1PEKE 2DUJA 3EZNA 3NASA 4CF4A 4UPEA 1NQ5A 1P7YA 1Z06A 1U28A 1P7ZA 3GGGA 3K2BA 4WASA 3UC9A 4DJDC 4DPLA 1C5KA 1JVBA 3WYDA 1IN5A 4RX1A 2PO5A 2R1TB 4AZWA 1ZKDA 4KR9A 3LI2A 4TVKA 5JAQA 3F0TA 4A1FA 4E11A 2VSOA 4JOCA 5TF4A 3KTDA 5B36A 1QZTA 5HJ5A 2PCLA 4R0VA 4F5DA 3CX3A 3USES 3M6VA 4YUXA 3ILHA 4CMHA 1T0IA 2XDQB 3D6MA 3FUCA 1JQDA 1O77A 2OWDA 4L74A 2FN8A 3LY9A 3I2JA 4ZTBA 5JY1A 3BZWA 3HCDA 5ITZB 2Q62A 1UWVA 2XD9A 5KNBD 3WAGA 4L0QA 4RE5A 2RGUA 1U7HA 2OO5A 1WQ3A 2WBLC 2ZYHA 2R2GA 9MHTA 2QKYA 4BO1A 1YRBA 1JYFA 1MNAA 3OCXA 1YI8A 2ZTHA 5FT9A 4Z9XA 1T10A 1LNSA 2NZ8A 1CNFA 2WSSD 4IIYA 4YQEA 3WTCA 2TMKA 1U1EA 1LY1A 1MB9A 4WZBA 5DNWA 1Q0RA 3FCCA 1A72A 2W2XA 4B09A 4I9GA 4X20A 3P4UA 4XEHA 1F6WA 2JASA 2GILA 4X3PA 3SVZA 5J4YA 1JDZA 1KARA 2DH6A 2RJNA 4M0KA 1SVLA 4YRSA 4OI2A 1FVOA 4HO1X 2ZBEA 1X1DA 5KINB 5IVIA 4LRYA 1L7XA 1MRNA 4F5ZA 1IBKB 1RT9A 3OFNA 1LJLA 1QTIA 2XUOA 2WI8A 3B82A 1M10A 1XDSA 4WLOA 3RYTC 1IXSB 2YOHA 3NBYC 4RF3A 1EGQA 3HYRA 4X84A 2DWOA 2WLTA 3DL7A 4H0NA 5IBQA 3VVBA 4DM7A 4OK3A 2GTHA 2Z9BA 4PHGA 1BW9A 2JPDA 4GPD1 3NAQA 4YRNA 4BFUA 3F4BA 2ZBQA 4QATA 3CUTA 3DC2A 2CZGA 2WSYB 3E7FA 1Y42X 5HQTA 2X0RA 1FBNA 2HNAA 1ZN9A 3K4QA 4GQBA 3H5LA 2NUAA 1JHPA 5F9HA 3VHRA 4S05A 5T4FA 2FZLA 3LQYA 4NJOA 4WKOA 4CLOB 5JPCA 4MLCA 3TL2A 1GFWA 2XVMA 2YHUA 2CNDA 3E3MA 3GG9A 1PWEA 2CXQA 4PC3A 4DV5B 2XMCA 3HN7A 3QTBA 1TFUA 1UXOA 4MV3A 3S6JA 4CKCB 1JLLB 2HZ7A 1D4OA 4CLXA 1XHEA 4EUHA 4HUTA 5K6AA 1BCRA 5TV2A 3HUTA 2UYHA 4A0RA 2C8VA 4BBJA 3IO5A 1PUIA 4IIGA 1FP4A 1YS7A 4LYJA 1SIUA 2HJGA 1BKSB 4DNPA 3CVXA 2ZCJA 1P9NA 2I4IA 3I42A 1E99A 2A14A 4M0MA 4ZT7A 3OQOA 2PLNA 2WUGA 3PYXA 1TK2A 1T9AA 3GEIA 1G38A 4YFYA 1OU0A 4HVAA 2VVTA 3QW4B 1Z45A 5HP4A 3IPXA 1OAAA 4NWIA 4PFJA 5JZVA 5HKBA 1R4NB 1T3LA 4AY5A 3ND8A 1E4YA 2DUMA 2Q0SA 2JBHA 3DA8A 1E9BA 3FYUC 1RCFA 3H2GA 2Q4BA 2D6FA 2GR9A 1WUJS 2YVLA 4WDRA 4Z4CA 5ABPA 3EAQA 5AW1A 2IYTA 4GOJA 2MYNA 2VRCA 5IK2D 3JQGA 4US0R 3WGKA 4BO3A 2Y1GA 4G8CA 3BTSA 4OXXA 5FBLB 4ZVRA 1G9SA 1V9SA 1Y8QA 2PWPA 2XF8A 1EUQA 2CNLA 1YBVA 5GM2A 1T0HB 5I5EA 2NV6A 3DVSX 1GADO 3T7KA 3GZTB 4TROA 1GZ6A 1ULSA 3OAAA 5JBNA 2J46A 1AZTA 3MTGA 1WZNA 3A05A 4FI3F 4M55A 4DDMA 4FILA 1S8OA 4Q48A 3OQ6A 3OESA 3G2NA 2RHTA 4IXTA 1LRKA 3ZY5A 3PBKA 5DJ5A 1J2RA 2OM2A 4KXVA 4QYSA 4MV0A 4QDXA 3GLRA 1MOSA 2CXHA 1W88A 5IM5A 2BTQA 2R60A 4KZPA 2AYZA 4PO3X 4AQ7A 4BNDB 4DWJA 3FUTA 4IIUA 5DHTA 4QKQA 3AW8A 3HBNA 3QJ5A 4G5GA 3TPCA 3UJ9A 4TPKA 4PC7A 4YACA 1NW6A 2PUHA 3COWA 3OOHA 1XLVA 4X97A 4QVGA 1ZXLA 4DSTA 1PX2A 4JA0A 2PFGA 2XNCA 2MCFA 2O0JA 5KJ6A 3DFUA 2O3RA 4NFYA 5JSYA 3Q8WA 3SI7A 1W4ZA 2FZ4A 5EPEA 3T61A 1SGWA 2BUBA 2F9LA 4WNAA 5REQB 4M9RA 3W5CA 1CHDA 4BCBA 1J9ZA 4D6PA 2JH3A 3QNMA 1E8MA 3CINA 4AIIA 3A8TA 4TUYA 1LDEA 2RH8A 4JCOA 1L8QA 3IBSA 5ARDA 3UB2A 4O0MA 3DB1A 3IT3A 3ZKAA 3ZU3A 5L8VA 3COYA 1WZ2A 3NM4A 2O2IA 2VSNA 5AHWA 1QANA 3E0QA 3OQIB 4XVQA 2WAXA 3G8DA 4DRZA 4NBVA 5JNWA 1TT5A 4QG3A 3T9AA 1RCTE 5LBIA 4ZTZB 4ER7A 2GCNA 3AT1A 4FZ5A 4ECEA 4WXHA 1U3VA 4L72A 4X7BA 4HDRA 4WY8A 1T3GA 2IVZA 3U17A 4UM9B 2B7LA 1GM5A 3I6QA 3FPKA 2FPSA 3VU8A 3VNSA 4A26A 5CG2A 3IOCA 3S2UA 2Z5LA 1JQKA 4J0FA 5K8VA 3EXEA 5TNXA 3I64A 4AD8A 5FV4A 2RGAA 3N70A 1INLA 1WXDA 1T8TA 1VHLA 1GAEO 4R9NA 3L01A 3KSZO 1YKFA 4I46A 3VSBA 3RQIA 2BCEA 3ELYA 2X13A 2OV6A 1ULHA 1LPSA 3F8TA 4PIVA 3PFWO 2O2XA 4GLLA 5AM0A 4BB9A 1AO0A 1E89A 3MILA 3MERA 4N0PA 1XPJA 1MXFA 1ZH4A 2F8LA 3P2OA 3TD9A 2FMTA 4DVGA 5CRIA 5EJ6A 5A0TA 4D9JA 1GD1O 5GY7A 3D54D 3HVUA 4HAYA 3NFRA 2EF1A 2C82A 3BJRA 3A2MA 1U0JA 1L4NA 4QXQA 4RYDA 5TB5A 2V54A 1GSAA 3IOMA 4H1UA 1EG7A 3O7MA 1JEQB 4XM1A 5F1KA 3SFZA 4KNVA 3QFTA 4NDAA 5FADA 4X6LA 5I7OA 3K30A 4FC6A 4Z86A 4F6CA 4DV7B 1KS9A 3ZK7A 3USCS 2REXB 1D6MA 2YQ5A 1YRQA 2BHNA 4Z4HA 5KX5F 1YL6A 4FK8A 4YTEA 2IJGX 2WB2A 3CT4A 3H5NA 1NVWQ 5L51A 1FPMA 1PZFA 4DA9A 3T7RA 4RTKA 1PCXA 1ZCBA 2H4XA 1PDVA 2QMEA 4FP9A 4I4TB 4RVOA 5DBOA 5ILGA 1OLOA 4PGFA 4NNJA 2IHTA 3WNQA 4BFTA 3LDFA 4ZJYA 4HWGA 5D2CA 1P73A 5HTOA 4YMGA 4NCXA 2P5UA 2IK8A 4OXIA 2QD1A 4L9WA 5LYJF 2QY6A 2D74A 2H00A 2R8OA 2JZOA 2WSLA 2P2SA 3A10A 3F90A 3OTQA 3P19A 3SX0A 3V55A 3N0XA 4ROSA 1XA0A 4OFBA 3LBAA 4EO9A 2P9GA 3I5MA 1VCHA 3CLUD 4XDHA 3E4CA 4JYAB 1XRLA 4V39A 2W58A 3K8ZA 1S2MA 3NHSA 2X8JB 2X40A 3EBPA 3P5BA 1JSXA 2MYTA 4C43A 5KTOA 4IO0A 5K0FA 1XZDA 2UAGA 2EERA 4Y2PA 1OC4A 3F6RA 1E63A 3HWX1 2GGSA 3KB1A 1YT5A 2ZWOA 4AS2A 1TRKA 3GOQA 3MNFA 4D9IA 3UHFA 3PC3A 1QG0A 3QVVA 4EL5A 4CMAA 1C3OB 1GL7A 2B1RA 3NJ8A 3OIWA 3UJCA 2QMZA 1K5HA 1VCOA 1V7ZA 1VLLA 3A32A 4CI0B 5TGDA 1ECGA 1IM5A 4X62B 4WNAB 2ZIUB 4JUCA 4JU8A 1J7KA 1ONSA 2A1TR 2JATA 2VTVA 3JZIA 4G25A 4NRDA 4ENQA 2PX5A 3MMPA 1YMUA 1IEXA 5LP6C 4PRYA 4EECA 5KU7A 1F7UA 2JRLA 3GIWA 3I2IA 3RSQA 5CA0F 4GLFA 3LH5A 1G59A 3N2KA 1DWUA 3PQCA 4YASA 5C7IO 2DUUA 3RV3A 2ZVQX 1IY1A 1QHSA 1KAMA 4UDXX 1VTKA 3TQHA 4WJZA 2DETA 5EPUA 3TDNA 2AW3A 2XHZA 4CCYA 4PBRA 1EWRA 4BQOA 3UICA 1T2VA 5KU1A 3R4CA 1JKMA 2B4TO 1OAOC 5CYGA 5D86A 5CT4A 2CVZA 5JCOA 1JG3A 4FM9A 2WWYA 4WRRA 1ZICA 1W7AA 3U4MA 3LVBA 5KQSA 4XOUA 5TMDA 2B6NA 4RQBA 4DCNA 5TMEA 2QLMA 3T3GA 4WJLA 2EFDB 4C88A 3AOGA 4K9PA 5AD1A 1NZJA 3ESRA 4ZAYA 3M81A 4LW8A 3D5QA 3DD5A 3CONA 3JWIA 5GJWC 1A7KA 3VZRA 2G71A 3L7YA 4IQGA 3QTTA 1EE9A 2V9CA 4TM8A 4CR7A 2O7QA 4QJBA 2ID8A 3S2IA 1G5RA 4HDRB 5P21A 2CW5A 2VQSA 3JVDA 3IPLA 3KR2A 4RMNA 4OFZA 4AFNA 2JFGA 3D6TB 2VN8A 5CDGA 1X39A 3O9ZA 5F7JA 4C5CA 1HEUA 2GD1O 1E7YA 4DMRA 4KRGA 4ZHSA 3E03A 1ZDMA 1TM1E 2EGUA 4HAOA 3GLFE 4FGZA 2GSDA 3ZGYA 4RGBA 3M9LA 4QD3A 4LQDA 2RK3A 3TTUA 5HOQA 3NWEA 3QMPA 1GSOA 5SZIA 3UGJA 4BRZA 1L5RA 1ZGAA 3NX4A 4UCXA 5CIYA 1PL0A 5BPFA 5B1YA 2AJTA 4L28A 3UV3A 5HDQA 1GNTA 4PLCA 4NH4A 3ABRB 1CY7A 3I05A 3SJCA 4C2BA 3RS8A 2ONCA 4UBLA 4C0BA 5CJJA 3UH1A 5BN1A 4Y1RB 3E23A 3OIUA 3ZHQA 3D1VA 3LPAA 1LGYA 4RK4A 2VDWA 3DDOA 4OXYA 1XFDA 2W0MA 2G72A 1YU6A 1ZI8A 1JQAA 2YNMD 3A6ZA 3C15C 4BIMA 1LNQA 3FHTA 1RAGA 3EZ7A 4BVEA 3FFTA 5EKUA 5B4UA 3K96A 3EVGA 5F23A 3IAM6 3K9CA 3RAPR 1WXEA 2XEDA 2NVUB 4A7PA 4UD2A 3C98A 3A70A 5K3DA 3HM2A 3PQ3A 5ER6A 5J40A 2IV3A 4RENA 2OAP1 4HXGA 4BNYA 1J06A 4EPWA 1KIMA 3L6OO 1GDTA 3SBXA 3KD2A 4PYIA 1U0LA 3FB4A 1KVRA 1IK6A 3MHPA 1RQGA 2FPUA 2CMHA 1DMSA 2COKA 3NVMB 4RKFA 4GZ5A 1Z2DA 10MHA 1JJVA 3O26A 4IOLA 2ECKA 3AW9A 4HJXA 1H8ED 1RJDA 1W1UA 4CNQA 2NGRA 2A1UA 2GN2A 3HG7A 1QG2A 3EAFA 2Y8EA 2ZWMA 4HX9A 2NU9A 4WOCA 1IY9A 1FTYA 5JMOA 3BHNA 2OGZA 4MCHA 2QTBA 5FNVF 1A9ZA 4JLMA 4LXQA 4IIVA 4AZ0B 2JLYA 4MPPA 1OD6A 4IG4A 2XVZA 5IT4A 1K8YB 2WMOB 1N2IA 1JR3A 1Z4KA 4ITUA 3AF5A 3IKJA 5K0CA 2NZVG 2JI9A 2PNJA 2PUCA 1B0AA 3IOEA 3LGAA 4C2TA 4ME6A 2PV7A 4DMUB 1Z0SA 2VP4A 1WO8A 3ITEA 1BGXT 3O74A 3QHAA 2BR3A 2K4MA 2FPLA 5K09A 1DAHA 5CFZA 3HNOA 3ZGOA 1ODFA 1Z6YA 4QQNA 1NDUA 2YJ4A 3DXXA 3A4YA 2Q2VA 3B20A 4YMSA 5BR1A 3T7JA 2TSYB 4BDSA 4CM4A 5L3ZA 1DELA 3EFHA 1UBHS 4RSHA 3URKA 1B0PA 3I8XA 2QU7A 3L7NA 5DVZA 4ZHQF 5ALKA 4HGNA 4YRFA 3NDRA 3ZTTA 3HH8A 1NBMA 1R4ZA 3T9EA 4F9FA 3KJHA 3TAHA 2XCRB 4G1EB 2D7JA 3JQFA 4L0MA 1RAEA 4DUPA 1UZUA 3BCUA 1NBEA 1A5ZA 5HQJA 3DWIA 5FL7A 1NAHA 4LMAA 5J63A 1GLNA 1BCSB 4YAWA 1GG9A 4ZAZA 3L92A 5EWLA 1A96A 4FGKA 4L75A 4CHGA 1RYDA 3QE3A 1G8KA 4YX9A 4BLVA 4EFDA 1TLTA 1R0SA 4N49A 4EW1A 2EBHX 3DKPA 2DGDA 2C9BA 1YJAA 4QDOA 5U1PA 4CR8A 2JANA 4Q02A 1EUDB 2O7VA 1ONNA 2J0EA 2PMCA 3MTIA 1DAMA 2VZ8A 4G1FA 1NJFA 2Z95A 5FLEX 3DWFA 4DQVA 4PYMA 5IDVA 4Z7OB 2KLBA 2WIKA 3AI7A 1YZLA 3RFCA 2ZSAA 2ZTUA 1ZJYA 2YRWA 3ZTWA 1WOYA 2VJLA 2YXLA 4L5YA 1VBNA 4PNHA 3F5DA 1YS4A 2ZJ3A 2GI4A 2XQGA 1HDYA 2PEZA 3TSYA 2PUWA 2JH9A 4DXDA 1GAWA 1K6IA 7ABPA 4IXNA 2FOIA 1U0RA 3GAMA 4O5OA 4PBSA 4U6NA 3TYXA 4PYNA 5JXWA 5HG0A 1V8OA 4F5EA 3CUKA 2VOEA 5M3BA 2HRQA 1J5XA 3AF2A 2EP7A 3PF8A 1GPUA 4Q7EA 4LX0A 4MQUA 3P2YA 4PXYA 3MGKA 2BELA 3PDIB 4HDSB 4W8OA 1NUQA 4D79A 5B3JA 3CPHA 4PSDA 2R6DA 4PIPA 3TX2A 1A2BA 2R66A 5H80A 2QRGA 3SZLA 2PMBA 2VHYA 4RH3A 4HNAA 2O8NA 4GMXA 3H0EA 4Z54A 1MP0A 4Y2RA 1DNPA 4XTRA 3FMGA 2O5VA 3D5EA 1YJ8A 1QOPB 3R3XA 1FXSA 4YIKA 4H7DA 1U6KA 1J7JA 2P9JA 3AU9A 4WXPA 2WT4A 4JKOA 1T8YA 1CJCA 1V2GA 1ECBA 2CHFA 3K15A 1LC0A 4C4ZA 4E88A 4B76A 3GEPA 3L7MA 3CKYA 4HTFA 4KU4A 1OB2A 4H0FA 2QRVB 4KX3A 4LYFA 2BMWA 4XASA 5FPSA 2H2IA 4IDDA 4AO8A 4EZBA 2LR0A 5TGZA 5I9IA 3C6YA 1E69A 4BVLA 1PNOA 2O06A 1N9GB 2BKLA 4F4UA 5B1SA 1Y9DA 2E55A 3V4RA 2A35A 3P27A 4JBGA 1VYTA 3T7CA 1SCNE 1T9GS 4HAIA 4HLCA 1KYXA 4D9MA 2XUGA 3DZFA 1E3LA 3N8KA 2G83A 4OK5A 2ZRIA 2GJ9A 1Q1AA 2KSQA 2VZ0A 1XROA 5DCWA 2BE7A 4YRAA 1XXHB 4FMBB 2WQ7A 2W8ZA 2YQ4A 3GMDA 2CNWD 2GKOA 1L8AA 4RU1A 4UNSA 3L0ZA 2BAGA 1COWD 1J0BA 4KQKA 1D8TA 2XUHA 3ETGA 4P33A 2QW1A 3WZMA 4FWBA 3QRWA 4LFCB 2IDKA 3UGKA 1II8A 3HZHA 4KVAA 4GI3A 2V96A 2Z56A 2X0JA 4B6PA 1I4OA 3ZPXA 3NB0A 1DX6A 2JARA 3KCNA 4OQMA 3V7WA 4Z51A 1VMIA 2P79A 3JR7A 1I9GA 1FQKA 1TDJA 3VZBA 5H4GA 4V0NA 1SXQA 1QVWA 2OMKA 4AKIA 1WRBA 2WWXA 3PD1A 4C05A 1V1JA 1ZUNB 3UK7A 3VC3A 5JSQA 4JR1A 1GLVA 5T8KC 4KFSA 3O82A 1T13A 1QB8A 1FFYA 3UT5B 5DDIP 3MTEA 4DFDA 4ALLA 3JYNA 3LCMA 3O6VA 5TPZA 2XKJE 3PJFA 3OLZA 5HSGA 3QVUA 4DRXA 1CY4A 5IX8A 2IRWA 1NUHA 3PQ7A 2AJLI 3DOEA 4KUEA 5JJBA 4FE4A 4K3VA 3ZQKA 3CE9A 2B1GA 2QA5A 1JDBC 3CUVA 4FYKA 2KM1A 3AXSA 4HXFB 1V1MA 3L0DA 1FTNA 3SG0A 1JWLA 2QDKA 2WF6A 2WHRA 3B3QA 3DHEA 3U7QA 2ZSFA 1JR2A 1SC9A 4J91A 4J0DA 2GN9A 3ONEA 4CKWB 5EJ4A 4RIGA 3QPBA 1A9QA 2CJXA 1KY5A 5J3JA 1M5RA 3QBEA 4B9EA 3M4YA 4KQ2A 2PSFA 2JDID 5FXMA 3RJTA 4FJ1A 5JAPA 4UREA 2GAOA 3C3XA 4FEYA 5FAXA 4MRVA 1A69A 3F4LA 2H4YA 1ZQ1A 2V7UA 2Q5FA 3OT1B 1DJNA 1LFDB 1UH5A 2HMUA 3JARA 1M1XB 4GC5A 4GC9A 4J0JA 4K6OA 5DXJA 3WYEA 4CQMA 4CW7A 3UFXB 1PJ3A 5AW6A 2GYWA 3JASA 5F33A 1QLHA 3VVCA 4CVNA 5AXBA 5KTKA 4LTMA 3PZBA 1PZHA 1CZUA 5DHAA 1FX1A 5ANRB 2OQ2A 1U2PA 3E48A 5CEEA 3ZVRA 4RTMA 4MIEA 3D2AA 1SOUA 1QGUB 4EHKA 1P19A 3FF1A 1H3FA 1BROA 3ZHXA 4F9GA 4OI4A 5NULA 2C54A 4BKOA 1X1TA 3BRWD 5JDIA 1WXFA 1G64A 5G0WA 1EFRD 4RGQA 1Z0ZA 1G42A 1NBWB 1GPWB 2JAPA 2D13A 3OSUA 1DI0A 4YRGA 2E5LB 2AQKA 1P0CA 3LAWA 4HX5A 1C0KA 1TOAA 3H1EA 3KL4A 1CUJA 2H92A 4ZANA 4YB8A 5LR6A 2QVBA 1E4OA 4QFCA 4R9VA 4PAOA 1D1TA 4LZOA 2QROA 1U1CA 4AU1A 5J59A 3IVRA 3P2KA 2TECE 3IXMA 3MSCA 4LHSA 4O0LA 3VM6A 2HXSA 1AV7A 2H0RA 2N75A 4CDGA 3JAKB 2P3OA 2G9NA 3K73O 2ZSJA 2C8KA 2AMVA 2O52A 4E2YA 4DC1A 2OSVA 1RMTA 1HNZB 1E3WA 1U63A 1ULUA 1UEXC 2GHRA 7GPBA 4A91A 1FVHA 5EXTA 4UC0A 3VR6D 5G4KB 1D04A 1I7SB 3SBEA 1E8NA 5AM5A 3T9BA 2IIPA 5DN6D 1FYVA 1COZA 2XOKD 1R6BX 2IYVA 2GJ4A 1XD2A 3MN1A 4K2HA 4ZRDA 5FFMA 3TLBA 4TSKA 2C61A 3PNSA 3ZY2A 2HMYB 1JLSA 4TX1A 2PMKA 3FSRA 1NBIA 3CVUA 2ZB3A 2I62A 1E2MA 3HN6A 4ZVMA 4C7XA 5BSGA 3I8SA 4KUGA 3CO5A 3T4EA 2C5GA 1OTYA 3SZ3A 1KYZA 1FMLA 1I24A 1OLXB 1VPTA 1ZN8A 2GO1A 2IPOA 3E9DA 3UK2A 1C2TA 4AZSA 5FNZA 5CCDA 3AJAA 2JFOA 4QLOA 4QELA 3RNLA 3EVFA 3B12A 1XGKA 2RGNA 4JI0B 16PKA 4WWHA 3EXHA 1RBMA 3UJ6A 4L3VA 3MCAA 3WYCA 3ZE2B 1M5TA 4DC0A 5KS2A 1RZRD 1T3TA 3TW0A 1J20A 4AJEA 1ESZA 1QMPA 4BLQA 3LCVB 4DY4A 4XIGS 1KMNA 1B8UA 2E3JA 4DTCA 4EY4A 3M3PA 5LBTA 3TLJA 4UTRA 5JVDA 2XEXA 1WBDA 1ZL2A 3E58A 1GARA 3PRYA 5JLJA 3IMKA 4YJHB 4PO9A 3PSAA 1KAOA 2GHQA 4HZGA 2B8TA 3HNPA 2K6GA 4X6UA 4K8OA 4F3CA 2A0FA 5EXDA 2RI0A 3ZHRA 2Q4EA 3IAEA 4QPJC 2FG7C 4X66B 1DJQA 3PQEA 2PL5A 1FJXA 1T6XA 2JG3A 4QDTA 3N3AC 2VXYA 4RA6A 3ONDA 1U2DC 2FJ0A 2Q4TA 4X90A 4ZZIA 1P31A 1Z5NA 5IXYA 5LQUA 1QJ4A 5JZMA 2PIAA 4O1HA 4RNCA 3H3XA 3C6XA 2RHMA 1VDMA 5DH9A 1DQPA 1IQ0A 2GH1A 3G8CA 3MWJA 5FOSA 3GA0A 4NQZA 4EQZA 3CS3A 2W48A 4PZPA 1UIRA 4PSKA 5I8WA 1KJIA 1YAHA 4NBKA 1FFDA 4XLLA 2O14A 2CJFA 2EG5A 2FQ1A 2ZJYA 3WIUA 1HLDA 4E2WA 2CDNA 2CDBA 4XPIB 5EGSA 3ZGLA 3ROMA 1DXHA 4DCCA 3GJ7A 4ZYWA 1GGVA 1NPYA 2X2EA 1TO1E 4MYRA 1PYDA 2JGDA 4N40A 3FX2A 1BKYA 3D9QX 1DIBA 1FCJA 1NN3A 1SD2A 3G17A 3P9RA 3QOYA 2VWPA 4X93A 3RYHA 3ICOA 2FEMA 2J0QA 2XUPA 2HRCA 2Q6KA 2J3DA 4AP6A 1AB6A 2BI4A 3BCHA 4P8RA 4X00A 1GDHA 4AJ1A 3SNKA 2JH8A 2CGEA 3H11A 4U8HA 2WT8A 1FFGA 4KB5A 5IAOA 5SICE 4DQKA 2AXPA 3D64A 4PPFA 5KX5B 2HCJB 1DJMA 3EIXA 4B2PA 3MBIA 2NYRA 2IYWA 1NTRA 1KL7A 4KH0A 3OJOA 2BGUA 3QYJA 1FMTA 1NJGA 1H4SA 1KZ7B 1C7ZA 1AX9A 1OLUA 1MPXA 4LOAA 4JXXA 3OPYI 4LGVA 3FSGA 4HN4B 4CLDA 2VHWA 3FPBA 5LYJB 4F93B 2YY5A 1HG1A 5LQAA 2OG1A 5DHFA 4EVSA 4OHFA 4P80A 3S27A 1E5XA 2A5JA 3VMFA 3WK7A 2AGVA 3ZEIA 3PJEA 3ITKA 1T34A 5DCLA 2EFYA 3LM8A 2OHVA 1E2EA 1GGJA 4FQ8A 3TNYA 2WTUA 4WZAE 1G3IA 1ZOIA 1SU4A 5MF6A 3BK2A 3LWNA 2AIRA 5K3CA 5HZGA 4MUAA 4Q24A 1KJYA 3NBFA 4G5YA 2BMAA 1RBQA 2FSVC 3CUWA 3W8FA 2OE2A 3T4PA 4U2GA 4WEQA 2OUKA 3NAGA 2B1JA 2QM8A 1RQ2A 3ZK8A 1V47A 2A7QA 3GP5A 3JYOA 3CH6A 3FDZB 2ANCA 3LP8A 3GLKA 3V6LA 3WRVA 3HADA 3ZQ6A 1QQ5A 1XPUA 5EAIA 1JBKA 1OYYA 4IZHA 5JNTA 3ZXSA 1MX9A 4BP3A 3FWPA 3KEFA 5AOAA 3SD7A 5JR3A 3KJGA 5BOVA 3Q2IA 5KNDA 4WBNF 1J90A 1G8MA 3R5TA 3CWQA 5CNIA 3T4XA 1U1IA 4PLFA 3W5UA 3P5SA 1A4IA 1NXVA 4XFJA 2GSWA 1A8PA 5CA0B 4HQFA 4YC7A 3E2MA 2OD9A 2IELA 4IM7A 3EK2A 1R6TA 2RHCA 3WLOA 3BMQB 2C04A 2CLHB 1ZGZA 2QQ0A 3MK31 2XJ4A 2PH1A 4GGMX 1ZL0A 3LUAA 3VAAA 3QJGA 1A9SA 3P0HA 1ZSYA 2V7VA 3MZ0A 3QVOA 1REQA 5IVHA 1Z6XA 2AR0A 2Q1XA 3OPYA 2VP9A 3EZXA 4Q1EA 4IH9A 3GFGA 3LRXA 4HDCA 4LQ4A 3RSSA 3IQGX 4KAXA 1PL8A 4AJ2A 4YP5A 3H6KA 1RRMA 3Q0IA 1MJ5A 2GF2A 4M9SA 3CSUA 3V2GA 1HM5A 5I9LA 2WA2A 3GGPA 4ND8B 4TWBA 5ALHA 5E9AA 4YAKA 1KI8A 1O4WA 4DUZB 2NTNA