3X1MA

Crystal structure of phosphopantetheine adenylyltransferase/ppat from pseudomonas aeruginosa with coa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
158
structure length
158
Chain Sequence
MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa 2192
total genus 55
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3x1mA00
2HGZA 5F23A 3IH5A 4HJXA 1G8GA 1ZH0A 2BYTA 3G5AA 2DETA 3ZJTA 3N9IA 2DR2A 3MLBA 3K32A 1F9AA 2QTRA 3ND7A 3COYA 1WQ4A 4K0RA 4MUFA 4PBSA 2PZ8A 2RE8A 3LOQA 1BS2A 3AFHA 1JGTA 4JFAA 3GMIA 5KHAA 4DE5A 1J1UA 2QJFA 3FG9A 4ZT5A 1EUQA 5HUHA 3CVVA 3UY4A 3CLSC 1H1TA 1EXDA 2D54A 4WSOA 4MW1A 4KR9A 4NX2A 2IJGX 2Z08A 2Z3VA 3FWKA 3PNYA 4MUHA 4HK4A 4ZCSA 1O94D 1K92A 2JANA 4OUDA 1VBNA 3SEQA 3UC5A 4QRDA 1IQ0A 2QUHA 2NSYA 3PNVA 1NZJA 4MUJA 3SDBA 1TYAE 3QTTA 1O6BA 5J5AA 3KFLA 1EFPA 1WXIA 2PFSA 3A4IA 4KR6A 4EG1A 1K4KA 1M8FA 2WQ7A 4KKVA 4MLPA 4ZT6A 1M8PA 3PNBA 1O97D 5FNZA 3UOWA 3IMEA 2VXOA 1GTSA 3PXUA 1J1ZA 3UK2A 1NUSA 1EFPB 1JILA 1Q19A 1IVSA 2V0CA 4X0EA 4CDMA 2QUIA 3COVA 1KP2A 2HZ7A 2QJOA 3HFJA 2CV1A 1N2JA 1TFUA 2PZAA 1EFVB 1GLNA 3AIIA 2DERA 2WSIA 4JYZA 4R0NA 3JXEA 3AG6A 1UFVA 3IDFA 1NI5A 3Q10A 4JXXA 1QU3A 3M5WA 1B6TA 4NAUA 1U0BB 3IMCA 2J07A 4WNYA 4ARIA 2YWBA 2QUJA 1F7VA 1I2DA 1TEZA 2B7LA 1KQPA 3U1VA 4MWDA 4MW5A 4XFDA 1T9GS 1WOYA 2NZ2A 1O95D 2QTMA 1U3CA 3D6UA 5TGTA 1H3EA 2V0GA 1OWMA 1XNHA 4KPUA 1T9GR 1X8XA 4XSVA 2E21A 3HMQA 3NBKA 1QJCA 1G8FA 1U7XA 3FH0A 2A88A 2CFOA 2HMAA 1JZQA 2X1LA 2JAXA 1QTQA 3S3TA 1KAMA 1O96A 2CT8A 3X1MA 4MW0A 3K9WA 4KPUB 4MWCA 1SURA 2E18A 1IQUA 4R2LA 3N8HA 5LM3A 1NUUA 1J20A 1R6TA 3IVXA 1I6LA 1ILEA 2CV0A 2J4DA 1PFUA 3G6KA 4NATA 3Q12A 1Y42X 4H3SA 4I6JA 4HPWA 1O96B 3UMVA 4GRIA 3TZEA 2CUZA 3CLSD 1KQOA 3FETA 2QJTA 4PBRA 2D13A 2J08A 5KWVA 3L93A 4NZPA 1I6KA 3HV0A 4L2IA 5LFAA 2DXIA 1O95C 5LLTA 1WKBA 4ZCPA 3KT0A 2CYAA 1WQ3A 1MAWA 1JEDA 2ZUFA 3GUZA 1KQNA 1MAUA 3P0HA 2DEUA 4L2IB 1WJGA 4DJAA 1V47A 4I6EA 1WXGA 4MW7A 1O0CA 3IOBA 3AKZA 3QTBA 1NURA 2C5SA 3ZIUA 3ND6A 1LI7A 3MUEA 1VLHA 3ZGZA 1J21A 3FIUA 3IODA 1EE1A 2OV4A 1OWNA 3HZRA 3ZXSA 5FO0A 4ZCQA 3VU8A 2JA2A 5IJXA 3G59A 4GU5A 1KORA 4FZJA 1KP3A 2ZUEA 3KT8A 1NUQA 4EG8A 4Q93A 4G5FA 1N2IA 3MMXA 4ZT2A 1T6ZA 3KT3A 1N75A 1ZUNA 4QREA 3F3MA 1N2BA 2ZP1A 4ZT4A 2PZBA 1GTRA 4DDMA 1MJHA 2R5WA 2X3FA 3AG5A 2X0KA 4OUDB 3H05A 4CDNA 2RD2A 1IHOA 1M1ZA 3RK1A 1XNJA 1G8HA 3VRHA 5EKDA 4YMIA 3X1JA 2A86A 4J76A 4MUKA 4ZCTA 5BNZA 1H3FA 1Q77A 1M83A 3DPIA 3D6VA 4XFJA 2WQ6A 1LI5A 2PIDA 4U7JA 1KR2A 3C8ZA 4UZFA 1Q15A 1XJQA 4MUEA 4MUNA 1COZA 2E89A 3A05A 4NDAA 4EG7A 4DLPA 4YP6A 3FY4A 3ELBA 1U7DA 3COWA 1S4MA 3H9CA 5J59A 1OWPA 1JEEA 2WB2A 1OBCA 1IFXA 4MW9A 1QQTA 4ZT3A 2IP1A 1MB9A 3I05A 2I1LA 5DASA 2XRZA 1NSYA 5IHXA 1MB2A 2AZXA 5DEOA 1WXEA 1GAXA 1JHDA 3RK0A 1TYCA 1M8JA 3IVGA 3CVWA 4K03A 1PG2A 1N1DA 2DLCX 4OJMX 3SP1A 2GM3A 4CQNA 1O5TA 2XRYA 4U8HA 4EF6A 2YWCA 4MWBA 4S1OA 2QTNA 4JZYA 4MULA 4DDHA 3CVUA 3IOCA 1GZUA 3RFFA 4ND6A 1N2EA 3H9BA 1QRTA 3TQOA 2A7XA 1EJ2A 4U63A 1OBHA 1JIKA 4NAHA 1MRZA 4HJRA 1F7UA 2GKSA 1VBKA 4MW4A 4R2MA 1M8GA 5DB4A 2PXHA 1WXFA 1M8KA 3ND5A 2OQ2A 4BWVA 1MBZA 3VGJA 1K4MA 5H16A 5HUJA 3FOCA 3FDXA 4G5YA 1JECA 2H2AA 4KR7A 3KT6A 2CV2A 3MLAA 4Q16A 3RJZA 3RHSA 3IOEA 4ZT7A 4F3RA 3INNA 3TS1A 4MUIA 2E0IA 4MW6A 3CLTD 5K0SA 5AHWA 4MVYA 1YULA 5H7XA 4J75A 1FYDA 4P2BA 3IUEA 4ND7A 1K97A 3HL4A 1N2HA 1G59A 3ILVA 2YY5A 3CLRC 4AS1A 3GLVA 3DV2A 1IQRA 1WZ2A 1JIJA 1NP7A 2EJCA 1TYDE 3A04A 1JIIA 2O8VA 3NBAA 4ZCRA 3AL0C 4EG5A 4E1AA 1ULHA 4YP7A 3FNRA 2BTEA 1YUNA 1D2RA 4MW2A 1R6XA 1LW7A 1HYBA 5TEWA 1TYBE 1QU2A 5JBNA 1YI8A 1FFYA 1ZH6A 1X6VA 1A8HA 3P52A 1P7PA 4YBRA 4PBTA 5J58A 2AKEA 1T6XA 5K0TA 4AQ7A 3RBAA 1J09A 3CLTC 4QBTA 4YP5A 3DLAA 2CSXA 3FHJA 1OWOA 4EFKA 1N2GA 5KCMA 1PFWA 1T6YA 1U3DA 1GN8A 1IRXA 3ZJUA 3SZGA 2QUKA 1J70A 1EFVA 2A84A 3H99A 1N3LA 2D5BA 4TS1A 5TEVA 1PFVA 3ZUGA 2PG3A 2X1MA 3E27A 3CLUD 1N78A 2Z09A 3ZJVA 1WXHA 3TZLA 3DO8A 1PG0A 3PRHA 3CA8A 1KH3A 1NYLA 3NV7A 3ISJA 3A2KA 3CR8A 4MUGA 1CT9A 1OWLA 5TS2A 1YUMA 1O94C 1MOPA 1Q11A 3COZA 2J5BA 1MC1A 4MQ6A 4MVCA 4EG3A 1EUYA 2H29A 1I6MA 2J09A 2A1UA 1IH8A 3SEZA 1XNGA 3BL5A 1N77A 1KAQA 3CVXA 4EGAA 1H3NA 3MXTA 4MVWA 4DDKA 2GOYA 3N2YA 3P0JA 4ARCA 3TNJA 1NUTA 3H97A 1QRUA 2A4MA 3L92A 3IVCA 4RPIA 1WY5A 2CYCA 1O97C 3OTWA 5DK4A 2A1UB 2YXNA 4JXZA 1DNPA 3P0IA 4MWEA 1PFYA 4MAFA 1VBMA 3CLUC 3IMGA 2VTBA 1F4LA 5FO1A 3ZXIA 4PY2A 2TS1A 3OP1A 3HGMA 2EL7A 3LCJA 1JMVA 4I6GA 3CLRD 3FI0A 4UZEA 1R6UA 1RQGA 2CYBA 3CVYA 2DPLA 2G36A 2VTBB 1KH1A 5HG0A 1N2OA 1TQ8A 3SYTA 1QRSA 2A1TS 4CT0A 4F4HA 1VL2A 2O5RA 3QE4A 2IELA 1NUPA 4EG4A 4DNXA 1V8FA 1ZJWA 1JZSA 4EG6A 1OD6A 3Q4GA 2A1TR 3SZ3A 2AG6A 3X1KA 4A91A 4MVXA 1YIDA 1QNFA 3TQIA 4RUKA 1GPMA 4G6ZA 3IUBA 1O0BA 1YIAA 1KKUA 3N05A 2DUMA 1KH2A 3LE8A
chains in the Genus database with same CATH superfamily
2VL7A 3SQWA 1UF9A 5EE3A 1G41A 4WRRA 2Q45A 4I3GA 4NV1A 4D9HA 3ACDA 1A5TA 1HTWA 4GOND 5JJBA 5D1HA 1FYXA 1JNYA 1Z08A 3HWWA 1WQ4A 3R5TA 3GIWA 1YCFA 3WYGA 4ILKA 4R01A 4KE9A 4OYHA 4OKNA 3WJ7A 4UHCA 3AY7A 1FXUA 1N2CB 4OXXA 4ZT5A 3ADPA 3BORA 3Q7IA 1Z75A 2XR1A 1QX4A 4O4HF 4L3WA 2YMQA 4AJ9A 1H4VB 5SY4A 2Y77A 4J0FA 5F33A 4BWFB 1EDOA 3FSGD 2NU8B 2A9RA 3ZZ0A 4RTRA 1G60A 3GA5A 3C6QA 4WK2B 3C87A 2OC4A 1EQ2A 1K92A 4OUDA 3O8RA 3GUVA 1AH2A 1NY6A 4OP1A 3MA0A 5HJ7A 5TVKA 1JA0A 3DV0A 2GF9A 1DXHA 5CD1A 1FSFA 1LJ8A 1T9AA 3QX8A 5C18A 4B7CA 1WWKA 4Y9UA 4HO1X 1BSVA 1JQDA 1YVDA 4EG1A 4ZAVA 2J45A 4RDHA 3FMFA 3O8LA 2Q07A 2BGIA 2Y0DA 1UJCA 3AHJA 4CT4B 5FTLA 1EFUA 4GX1A 3T3HA 4DCNA 4R71A 1GA1A 1UBTS 1THTA 2QGZA 1XQ9A 4MB2A 4YX9A 1T1IA 2ZRHA 2HBZA 1J39A 5IT9A 3G0HA 7YASA 4ZVKA 4N49A 3BD8A 4JT4A 4B3DA 1NUSA 1JILA 3UV7A 1Q0TA 2COKA 3KSZO 4X0EA 1BN7A 2RHWA 3GAAA 4DSTA 4HQFA 5BV7A 2A5DA 5AIAA 4LYEA 3DF9A 3GGSA 4ND1A 3UOGA 3VR4D 4P4TA 3EGXA 4JEMA 2JFNA 1H8HA 2XQIA 1Q0SA 1M10A 2RKOA 2YMLA 4BNLA 4E08A 4IOLA 1NNEA 2Q6KA 2GDZA 2IGTA 1SUSA 1R27A 2D4HA 4P36A 1XN4A 3EDCA 4CI0B 1GZVA 2WAYA 1B6TA 1DKMA 3JQ7B 4XX0A 3KKLA 2O8DA 2GESA 5HGXA 3ST7A 3V4PB 4ARIA 1F7VA 2AJCA 1XRNA 5F9HA 1SC9A 4XLZA 4XCVA 4H1HA 1NU6A 3BXOA 1A9ZA 1U7WA 2BZGA 2ET6A 2QRLA 1QUEA 1T8TA 3TD2A 1UMKA 1PDVA 5F2OA 5KTYA 3FCSB 4MR8B 2B4TO 4QUIA 3S6JA 5F9FA 5I7SA 2YJTD 3B1XA 1J4AA 1Z2CA 2GX6A 2ZTMA 2NQ2C 4AO8A 4Z8XA 2QTMA 4JIMA 3K2EA 4OAOA 1U3CA 2M9MA 3HC7A 3X43A 4BVFA 2ZM5A 2XZLA 1HYGA 5HKKA 1V41E 2QRVB 2Y3IA 2ZB3A 4XSVA 4ARAA 1Z29A 2J3JA 3KYCA 3ABIA 3DYIA 5F7OA 1QJCA 2IYNA 4EPVA 4RPHA 2P40A 5FEMA 1DQSA 5C80A 2IOYA 3U4GA 3OP4A 1OTYA 1K88A 1CG6A 1U3FA 1L5RA 1TRKA 5LZ5A 3FPLA 3HFRA 5A3SA 2IYRA 2X86A 1THMA 1XJ5A 2X4LA 2AG8A 3KKMA 3A1FA 3N8NA 3P9KA 4LECA 3FF4A 4V38A 2PYDA 3W5DA 2E18A 2IQ5A 3N8HA 3F1KA 4FWTA 2QUBA 2MOKA 3DXYA 4N6OA 5REQA 2GK6A 2ZJAA 5JATA 2AI2A 3FDZA 3QVJA 3VVMA 5K0ZA 1GILA 1JAIA 4PG7A 3O84A 3IC5A 2X2FA 3O3NB 2Q5FA 3UMVA 3UB3A 5LMUB 2CUZA 1ZNXA 1QHIA 2V65A 3BB3A 2ZI6A 3GN1A 4IDDA 4YBZA 4GVPA 5L53A 3HRIA 3I28A 5E1DA 3NMUF 1G5HA 3GJ3A 4HNHA 1HI9A 4PTLA 4Q05A 1OXVA 4RKYA 2OV6A 1CULC 2JGKA 1DU4A 1B0PA 3KAPA 4W63A 4ARZA 2IEIA 4Y7DA 5AW4A 1PNRA 5I3CA 2RJOA 2NO9A 3A31A 1UQTA 2Y8EA 1KQNA 3VR5H 1NVBA 4M8LA 1CR4A 1J1IA 1ADBA 2OBYA 4C7XA 5I7UA 3I30X 3IP9A 3H5LA 4L4UA 1T2DA 3CH6A 2IIPA 1EP9A 1T4CB 3HH8A 2DUNA 3CF6R 5C1BA 3UK1A 4LF8B 3ONNA 1V47A 1OZGA 2JBHA 4M2LA 3TQFA 1O0CA 4DAOA 3SIRA 1E2KA 2HO4A 3G89A 3GGDA 4R84A 3JQPA 2XVYA 1EESA 3RBZA 3WGZA 1OB5A 1U3TA 4E7OA 1D7OA 4WOJA 1E8MA 3V2HA 3VO8A 1N3IA 1C80A 1UPXA 1NW6A 2KWIA 3N6XA 3T35A 3T7TA 3ZV7A 4EMBA 1ZBQA 5IMSA 5SZKB 4BAUA 1V7QA 4Y67A 4B35A 1IHUA 1OMOA 2ZREA 3ZDFA 1YZLA 4D8UA 1YXMA 3A3KA 3BDIA 3DULA 1VL1A 3KE8A 4GU5A 2O07A 4HDOB 1HBJA 4DS3A 1GPJA 3P9YA 1IZ9A 3EB9A 2CNDA 2Q4EA 3GH3A 4Y2GA 1OGJA 2PMKA 2AUNA 3K0SA 1X19A 2REOA 1P81A 3FKJA 4COKA 1G4UR 2ZS8A 5CW1A 5SZIA 2SBTA 4B0OA 1M6VB 2RONA 2QV7A 5E3JA 4HOYA 4EITA 3AFMA 4QUKA 4CNQA 5JPDA 5HDBB 2X0JA 4Z9YA 3LT5A 1JB1A 3PDCA 2E4VA 3GZJA 2YOGA 4OUDB 3NHKA 1RAIA 4O4JF 1EK0A 1JKJA 1NRIA 4DJEC 1TDJA 5CB4B 2XXBA 5FOTA 2VRBA 2P41A 3QF7A 4IHQA 3TVTA 2YYYA 3TTVA 1Q1GA 3DV0B 3HADA 2C1EA 2VYCA 3ZD9A 4QTTB 3VRHA 1VMDA 3OQVA 1SZDA 2ZYVX 3LY7A 3TLGA 1GITA 3QVUA 4FGKA 2HA4A 5LD2C 1FMJA 2HJGA 1DQZA 1QWOA 5ED4A 5AO9A 2DQKA 2VQEB 4C7MA 2MTBA 2NVWA 3B13B 4IINA 3GFGA 2V98A 4FOOA 4LYJA 1FU4A 1PEKE 1E6MA 2PZJA 3QSYA 3QMPA 2L82A 2HQRA 3TSAA 3GEGA 2PWPA 4LY0A 5CLHA 1PHPA 4JDUA 1YH3A 3HA3A 1CR1A 2NYVA 3RUDA 5CCEA 4C7VA 4RETA 2VWQA 4QM7A 1HOTA 3EGXB 4OK3A 4CXMA 1Q2UA 4MHTA 2P9JA 4ABTA 1X2EA 3VKGA 4AAYA 1MXFA 1JEEA 2WB2A 2NSLA 1MVLA 1OBCA 4OHXA 1VL0A 1J9EA 2FLKA 2Q4DA 2PT5A 2XMSA 3B6JA 1ZXXA 4Y2HA 3WZ2A 2PUCA 3BMOA 1FTGA 4KIFA 1XDGA 2DC1A 3H9JA 2VJMB 1MB2A 2AZXA 3IAUA 5EWJA 2DH6A 5GV7A 1E18A 3RK0A 2JCBA 4MICA 2UYYA 1K2VN 5EJ2A 1ONSA 4ARSA 1PJZA 1D4AA 3FA2A 1UP7A 1M67A 2IQIA 3EXIB 3KS9A 1KK3A 1NPYA 4B6OA 3KRTA 4R9VA 3QPDA 4REQB 3WK6A 1OXTA 3UWOA 3AOEC 3E4CA 5A3QA 1ARZA 3BWDD 3WB0A 4L15A 1ZL2A 3CE6A 3EYAA 3H9EO 3NVDA 1SMKA 4FP9A 4PZLA 5FOWA 3GJYA 4BJ3A 3AKYA 3WZLA 4EFLA 1PV2A 4P5PA 2JK1A 4BRSA 2WT9A 3T7AA 1WZUA 2GEFA 2Q3JA 3K2QA 1WTAA 1NN1A 3MLEA 1W93A 1I3MA 5BO5A 1UDCA 1YSCA 3DE2X 4JI8B 4DA8A 1XKXA 5KMGA 5CFRA 1NA5A 4YACA 3AVTA 4AC9A 3UPDA 1VBKA 4RSGA 4LJAA 3OQBA 3UA3A 1EWKA 2C54A 3F3KA 2H9IA 4MW4A 4XSHA 5DOVA 3C14C 5BRNA 1EXNA 5REQB 2D1QA 2YVUA 3O4JA 3HWX1 4UDYX 1ZGAA 2D0DA 1M8KA 5AI5A 4YIHA 3M5CA 2FJ0A 3OF3A 1RJ9B 4MJLA 4QM6A 5BSKA 2Z58A 3HJUA 3MT9A 3RVSA 5C8DA 2REXB 4YRKA 2ZBRA 5IXSA 2F1OA 1QRRA 5JXIA 1GXSA 2MU1A 4YV7A 3B8EA 3QITA 4XWYA 3NRCA 1YJ8A 3NTOA 4EI8A 1CNMA 1HC7A 1CUFA 4M86A 4ARZB 3GLIA 3THYA 4MRMA 4RDCA 1W4RA 4C0AC 5DULA 1L5FA 5DGDA 4F3RA 5K1ZA 2Q6LA 3W9YA 1PS9A 2JCYA 2PVSA 2QIPA 1GUYA 1XZEA 4UASA 3RHTA 5L51A 3H42B 4RY9A 2IF2A 3BK1A 3PFIA 4FEGA 2ZYSA 4J75A 5CURA 4RDXA 4TYNA 2QVYX 3DMNA 3FMPB 2PSHA 3H5OA 1YL5A 1P4JA 4PIVA 3C70A 2NO6A 4LKRA 1E3JA 1DAGA 2VP9A 2HRCA 3K8QA 4DANA 1CJTC 1RQXA 3M33A 1UBJS 3QMVA 4CKEA 5JO9A 4E15A 2PZEA 1K8QA 1MA3A 1YD7A 2VEOA 4FPXA 3A2NA 3KLMX 2WJ3A 1VIVA 2J7PD 5CLLA 1USGA 4O25A 4EHBA 3RSQA 3TFQA 1BVYF 4ZDWA 4ZU6X 3PUWA 4LQ4A 2C20A 3SMQA 1HT0A 1C0EA 2MINA 2DPXA 3AZQA 3DCYA 5K6TA 2Q6IA 1NXXA 4J3FA 4RDIA 1RXVA 1CE8B 2FI1A 5JRDS 1A2QA 3OZRA 1Y4SA 1Z4QA 2CNWA 2QS9A 3N0XA 3MERA 4JCOA 2XCSB 1U63A 3C85A 2MSCB 2QLFA 5CX1A 2W2TA 3BMNB 1MTZA 3VDXA 5B3JA 3OUTA 4QU5A 2PM8A 3PQCA 4TL8A 3JRWA 3PCXA 5COAA 4LF6B 4MDHA 4CHGA 3A6EA 5AKIA 4KMRA 3COJA 1NOJA 4PG6A 3RHZA 4YRDA 1N2GA 1SVOA 1I14A 2GCNA 1QHHB 2F59A 3DVAA 4OXKA 3S2GA 1EFVA 3TLGB 3KZVA 1V5WA 4I2VA 2PKYX 2WTAA 1XZAA 3M82A 2Q49A 1IHYA 4BTLA 5IMBA 1OFTA 1B8UA 2GCOA 3UHJA 2VSNA 1OU0A 2CHUA 1YR1A 4RZSA 1F06A 2OCXA 2FWPA 4S1WA 2BDEA 4B6SA 1FDUA 3IEMA 3PS9A 4FE3A 1E1MA 2NGRA 4EG0A 1KAEA 3BQ9A 2O05A 3ZQUA 1NXOA 5EI5A 5ES3A 1W2GA 3QW2A 1GGFA 2AZTA 1FXWF 1PL0A 3I64A 3H1FA 4B44A 4LSMA 3VZSA 1XDZA 1A9QA 2CFTA 2GN9A 3G9ZA 4U7FA 2WAOA 4XD2A 2NZYA 3SMVA 3B5EA 4GQBA 2G6TA 3ER9A 1BHO1 1C9JA 3QNUA 4EGAA 3KYIB 9ABPA 2D6FA 5E4JA 3KR0A 1H23A 3AFIA 2D59A 2VHZA 2DBQA 1PQWA 1HFWA 4IFEA 5DDIP 4L4XA 1JEYA 4IIXA 3UAXA 4RZHA 2V1XA 3I58A 2DBYA 4O4LF 3GT7A 1FBNA 2P9BA 2QQEA 3D3WB 2J5RA 3PXBA 4X93A 1OX4A 3KUCA 4CMCA 3GY0A 4R3WA 5AOVA 5K6AC 2Y1CA 3S81A 2BT4A 5C4GB 4DT1B 2V96A 5JIBA 2D7JA 4BLTA 3KPWA 3RYCB 2WWIA 3PXEA 2VTBA 2FSSA 1V1RA 2FV8A 2VNJA 1VJTA 2B2CA 1QORA 2ZYAA 1RBZA 3BRSA 3PDIB 5DXAA 3SBXA 4WBXC 4EY8A 4YV1A 5BNTA 4ZRMA 4ALLA 1LLUA 4AO6A 1SQ5A 2QMOA 3O9MA 1L1QA 4KQKA 3NC4A 4HFMA 3FWHA 1KOLA 5GIPE 4IKEA 2PYZA 1TF7A 1U7TA 3NGMA 1WZCA 4GZ3A 4JL6A 3U4HA 2VVTA 3WV4A 3E7PA 3TMAA 4BZPA 1OH8A 3HO6A 3GNQA 4OGGA 2ZS7A 4Y1RA 2YJGA 2ZYIA 1JR4A 4DEXA 3ZE6A 2VHYA 1VL2A 5DMXA 3F8SA 4X20B 5FBZA 2AQKA 1RP7A 1BH2A 2ZWPA 1NONA 1J90A 1N34B 1BXRA 3FYUA 4YQZA 4WESB 2WA2A 2ZIUB 4X6UA 4MLCA 3Q4GA 4PQGA 4BEJA 1T4MA 3RNOA 2XGMA 3U61B 2PFGA 1V3UA 2WG0A 4P86A 1CQZA 3CH5A 1Z3IX 3E03A 4GECA 4MS1B 3F46A 4LQLA 2VTEA 2B1QA 1IZ7A 3A37A 3HGQA 3L02A 4BB9A 4DWOA 4OBWA 4RD6A 1GXSB 2CVZA 3ED5A 4IVNA 5G1PA 1ZD2P 1XZGA 2CJXA 4IZOA 1Q1NA 1ZRSA 1RAAA 1L7OA 2IH2A 1L3IA 1ULZA 3A3PA 4MRMB 1USUA 2GLXA 3O1HB 4PRZA 1E9SA 2QPOA 4C88A 1VCOA 2EDCA 4IV5A 4PZCA 2O57A 3I01M 3GG2A 3FWZA 3CNLA 5EXEA 5H83A 4Z1OA 3PJRA 5B4TA 4K0RA 3ZOZA 5JZOA 4C0JA 1A7KA 3QNWA 5T6BA 1IHDA 1F1JA 3GRKA 2FZWA 4U2GA 1ZK2A 2QL6A 3WKBA 3CQ9A 2VF5X 3FHCB 1I5EA 1OCEA 1GOTA 1CDOA 4TGLA 3EUAA 4DB2A 3BH7A 1NQOA 4BMZA 1QF6A 1UXIA 2Z8ZA 2ZSJA 2Z6AA 2V58A 3WIVA 1R10A 4M53A 3K1JA 4JUCA 4WECA 4Z53A 3DDSA 5SZJA 5DCUA 2FUNB 1BS9A 2VK8A 5JZ9A 3PNYA 3PSAA 2AMFA 3HBMA 3IIJA 5C1DA 1E2NA 5EIXA 1J0DA 4HFRA 2BMAA 3O8QA 4BGVA 3SFTA 5GADl 4D6PA 2YJ4A 1V3TA 2CWWA 3C3PA 2V55B 2QZPA 4UREA 4KVFA 2VQ6A 1F38A 5L7TA 2ATVA 1EVYA 2HFKA 1PS0A 1Z07A 2JZCA 3WAJA 2ERYA 3KJGA 4QFBA 4JKOA 1U8XX 4UAVA 4B4DA 4EK9A 4MGZR 3ZBQA 4MLPA 4YPVA 4OQYA 3WG9A 2HU2A 1M72A 2PX5A 1F4PA 3BL6A 3QOFA 3OOSA 1EQAA 4XRGA 5BORA 1P9WA 1SEVA 2GZSA 3VTKA 1RBQA 2XGJA 5C7YA 4CDMA 1Z0AA 3B5IA 2ZRQA 5ALKA 2JEOA 4FXPA 3UWDA 3FHLA 3LCCA 1XXHE 3SICE 1WHSB 5JS7A 5L3ZA 4XOIA 1H8HD 1YRQA 1R3UA 1U99A 3U4CA 1EFVB 1EM8A 1Z13A 4KC0A 1IBRA 3G02A 5EY5B 4YC7A 5A3VA 3JXEA 3ZW7A 2QUAA 3ED1A 4KSBA 3DEYX 4C4TA 4EYSA 4L6CA 4YLGA 1QU3A 5AXAA 1GDHA 2CLOB 4GI7A 2JHPA 2WSMA 3V4LA 1CRQA 2HBQA 4F60A 4MQFA 2FPGA 2VSYA 2A3NA 3I1IA 5B7QA 4D8VA 1V9SA 2HK7A 2PBRA 3F8WA 2OLEA 1DX6A 3L4BA 4L27A 1ZI9A 1E2UA 2EEZA 1VJ5A 4CF6A 3OKFA 5KTKA 4V0SA 2O59A 4JVNA 3THXA 1F2VA 2VNAA 1E9DA 2PYIA 1UFOA 3B3AA 4EHHA 2QTBA 5EWLA 1ZJ4A 5BRAA 4XWKA 2BCEA 3NBUA 2BONA 1A97A 8ATCA 4LJLA 4ZOBA 5FXMA 3TR5A 2PE5A 3A6FA 1C9DB 1PWHA 1ZQ1A 1O95A 3D6UA 4LCJA 5HKKD 1GPNA 2R8XA 1OA1A 5THXA 2B5VA 2Z8YA 3BWEA 1FFXB 3C5EA 4F8JA 1AV6A 5KNLA 3EQ7A 1Q83A 1VSVA 4C21A 1LLFA 4CI9A 4J29A 3KSMA 2RK4A 4X64B 4KBGA 3AOGA 4PS1A 1OX4B 3UG6A 3ZWDA 1M5UA 1DI0A 1YZHA 3MG9A 4MOWA 1OV4A 4D3ZA 4DFDA 4PYQA 4RZ3A 1ZOSA 2ACKA 4HDKA 1RQRA 3NTQA 2F6RA 2MSWA 4J6EA 2Q1SA 2BLNA 3IQIX 1AS0A 4H0FA 4XUCA 5F12A 5KSPA 3RABA 1ESZA 1KEVA 1RHJA 4KIGA 5J2TA 1HKUA 2ZJ1A 3P4XA 2IT1A 1GDDA 4X6LA 4EH1A 5IM4A 3VI4B 1P0MA 1PZEA 1T9HA 2Q1XA 2W4IA 3CRNA 4HB2A 3U3KA 3G0CA 4LDRA 3MOGA 4UOEA 1AB6A 4FGSA 1L1FA 3ROQA 2NUBA 1AXRA 3HXPA 3IV9A 2AV6A 4ZQGA 4QSMA 1M2HA 4NZPA 1AKEA 2Y4NA 3K05A 4P7BA 4G86A 3ZBTA 2ZZMA 1F9EA 4BUZA 2WWHA 2VUSA 1JEJA 1CY8A 1RMYA 4JSRA 2O54A 1KO8A 2V7GA 1KK2A 2XKBA 3IQFA 3KT0A 4KH1A 4CKXA 2G5CA 2POQX 1TMGE 3CR7A 1SCAA 3OD1A 5LA6F 3SX2A 1U9JA 3GUZA 4NU5A 2OWEA 3ANTA 1I5RA 2YQ5A 3HA2A 2PU5A 3L43A 1YQGA 3EZNA 3TL3A 3LC1O 3D81A 1T2CA 5DHSA 1U1IA 2BBTA 2DEUA 1NF3A 1XEWY 1XT6A 2B92A 2BEUB 4E3WA 5TX7A 2K7FA 5FPQA 1Q3TA 5EVCA 5JANA 1ZCZA 5EZYF 2R1VB 5FYQA 1RFGE 3B48A 3RD5A 3CNNA 2C7VA 3H8VA 3MUEA 4IWXA 4JLAA 2XZOA 1J21A 4I50B 4Z2YA 2P9TA 2UUPA 1WDMA 2H2IA 3PWKA 4DDUA 3L7CA 3SDSA 2JFGA 1OROA 2JJ2A 1AO3A 3OCCA 1F20A 1WPQA 2V9CA 4JLOA 5DTJA 4ZCQA 4CM4B 3G1WA 1H9AA 1Q50A 2FN3A 3B51X 1TPZA 1IDN1 3G59A 1MEOA 4FQ5A 3W1VA 3HCBA 4DBVO 3MINB 2V54A 1B6RA 5K03A 3C1UA 3EHEA 4F6CA 2WAXA 2P9GA 3O4IA 4ONEA 3K9NA 3TRFA 1VE5A 1YC5A 3A14A 3NHYA 2WM8A 4AF7A 5HE9A 3CZAA 3V7YA 5ICGA 3WHKA 2MYTA 1CPYA 1YS6A 3C2QA 3ENVA 3F3MA 2FRVA 1FUEA 3VPBA 4ZO7A 3ZCQA 3L1IA 2BFEB 2Y2UA 4K6FA 1KJNA 3H04A 4M7RA 2AD1A 1B26A 4HBGA 1KK0A 3H05A 4G67A 3CX3A 4O5AA 5EJEA 2QXYA 2ZSBA 2I4MA 5CTAA 1J9GA 1O87A 3U9LA 3O8QB 4URYR 1BYIA 3TSOA 2DMRA 5JXGA 3KUDA 4OP3A 1GTMA 4FEEA 1TZKA 3E1GA 1PYGA 5HK8A 3KKKA 3RR2A 1MGOA 1YHNA 1MKYA 2EZ8A 4PGMA 3RAPR 1VFNA 5K0EA 4AYWA 5JUWA 3OICA 3KX2A 5IUJC 5HF5A 4B3TB 4CKCA 4HMQA 3AL3A 3EMBA 1XCLA 4DLAA 1EINA 3BX1A 2MHCA 3I76A 1JAYA 3M3DA 2NYUA 3RQSA 4OU5A 2HF8A 4BMYA 1PK8A 3IPYA 1IN8A 2FQ1A 5F78A 2WWWA 1Q15A 2XVMA 3LIPA 1KJZA 3VJMA 1ODFA 1E63A 2YINC 3W9BA 5HE8A 2JRLA 1ENYA 2DFDA 2GZMA 5IF9A 2N42A 2PWAA 4IDFA 5FTWA 4K2HA 2NZUG 2WT4A 2QX8A 3HLYA 4N3CA 1V0JA 3PFWO 1NQ5A 1EM8B 1R4MA 5C7OO 3CZRA 3FTDA 1PR5A 1NG1A 2X40A 2PFKA 4TTRA 3HDVA 3DFKA 3ILXA 4IG9A 1IFXA 4IO0A 5KDLA 5TC4A 3RIMA 3E53A 5JSUA 1CUIA 1J6UA 1U2DA 2HLNA 4G01B 1PZMA 1Y1RA 2C4VA 5L4SA 3R9WA 3TBHA 4MYUA 5B3AA 1I0ZA 2F3UA 4MQFB 3T4PA 4CMAA 5DEOA 4CEHB 2F43A 1IEWA 4OQPA 5LSAA 4Q24A 4LFBB 5LYJA 3U44A 1M5RA 2YYAA 1GPAA 2YYSA 3GHHA 2PKQO 3U5ZB 2QYHA 2H5EA 3DWFA 1VKOA 4UNQA 4BIMA 3E23A 3SVLA 1EDDA 1I3CA 1A76A 1ORWA 1P4GA 3BJIC 2R5FA 1FE8A 3F7TA 3H1BA 4L1KA 4MEAA 4OJMX 1TKCA 5CRIA 3O0DA 3O92A 2Z3WA 4FFNA 1TRHA 5EWLB 5KQGA 1Q0HA 3B78A 3DHEA 1KSHA 2Q2NA 1G1MA 3BRWD 1AV7A 3DP7A 4N0QA 4ZO9A 4TUYB 5DX8A 2VK2A 4GR9A 5EIBD 3AF4A 5AVKA 3NHLA 5CDSA 1SRRA 1JDPA 4FSDA 1IL0A 1OGYA 3K35A 2AW5A 2X8JB 2VF4X 4EW3A 1MIOB 5IXYA 3X1ZA 1I1NA 2GNOA 2RHLA 4MITA 1L5KA 3W6UA 3RYIA 2BFCB 1HURA 1J06A 1E4YA 4MHOA 1GAEO 4GLLA 3STWA 3S1LA 3SKXA 1J9ZA 1Z36A 3TQOA 4AX4A 1GZSA 4I9NA 5G2OA 4M9UA 1UDWA 3H5RA 3SOZA 3A1TA 4QBGB 1UJ6A 1D1TA 1SB9A 1T1JA 3CB2A 3ELYA 3R6TA 5J47A 3ELDA 3KOYA 2HCFA 4I4IA 3BJZA 2P3QA 2QN9A 4LRUA 3ENKA 3JQCA 4GGPA 1FQWA 2QI9C 3PWSA 4K9OA 1JHQA 1ZD4A 4XR4A 2PRYA 1TK9A 1DS6A 2X4GA 1UBNA 1U9YA 2IYOA 3BMQA 4DWWA 2ZZKA 4BFVA 5IKMA 2VT7A 4OJYA 5H5JA 3SM9A 4D8WA 2ECOA 4UZSA 1POXA 4LSWA 1FXSA 2DLNA 5IJ0A 1XCMA 1XVVA 3LUJA 1BGVA 4HSEA 3TOVA 4AP6A 1GEEA 5GJBA 1EQUA 3WWZA 2QGFA 1GLGA 5H3LA 1Y7TA 2EQAA 4LZJA 4ZOLB 3E6AA 4PINA 5AM0A 4YMGA 2CV2A 2FDCA 3H5VA 3MYRA 4GOLD 4ZT7A 3TJMA 3GJ0A 3IERA 3O38A 4RFSB 3JD2A 5LZ8A 4B8WA 1J0AA 4A9AA 4N3BA 4FNOA 1JSLA 1LWOA 2JIQA 3GP5A 4XVQA 5LBUA 5CW2A 4M3NA 5SY9A 5JOQA 2H00A 4TKZA 5CVCA 4IRXA 4RLHA 2M2IA 2AN9A 3A1CA 1G59A 2WKPA 5AW8A 1YZYA 1GYRA 3MTAA 2JF0A 3OFSA 1LK0A 2XUPA 3B20A 5IYZA 2SKEA 4P93A 1RQLA 2HRBA 1EVLA 1KNXA 3PX2A 1Z5ZA 2CCGA 2ECKA 4K6GA 3S2YA 3STUA 3EIOA 1E1LA 4QPDA 1HE2A 4O02B 5JWRA 1GCGA 4UMDA 4E09A 2F62A 3NWEA 4UHFA 3LT0A 2XUHA 3P9IA 1PL7A 4FMCF 3UWPA 4GUDA 3VM6A 4EQ6A 1D2RA 4NZNA 3EODA 2JEZA 1LW7A 5ITSA 3A1NA 4BX2A 2P4QA 3KJZA 4CEJB 1QG4A 2H4WA 3KR9A 4RJIA 2EARA 5TXGA 1U3WA 3L7KA 4F2HA 2GXQA 1NV9A 1IN1A 2CNWD 4EOGA 1NOIA 1U80A 3JQDA 1T1GA 3HKCB 3FJYA 2BP7A 3OFKA 1LNSA 2EW1A 1AX9A 3F98A 3LCMA 3UAZA 2JHAA 2GTPA 1SUIA 4AP5A 1QZXA 1MEEA 2EYUA 2R47A 5EIOA 3ZC3A 1YBMA 3DAYA 2CSXA 1O6FA 1OWOA 1NW3A 1OZFA 3TEMA 1ZP6A 2UZAA 2OV8A 3EEYA 5CT4A 1H6BA 2IHUA 3LPDA 1AKNA 2DH5A 1DOAA 3EEBA 4RKWA 1A9PA 5F35A 2A84A 2C97A 3V1KA 4D81A 5D86A 1L4EA 5K3DA 3WGIA 4BNKA 1F14A 3A6JA 1P7ZA 3OQHA 2ONJA 2GA8A 2E55A 3PPXA 4HVTA 4JWKA 3R4CA 4K1LA 4OJKA 2BSAA 1X3LA 4POAA 4EPXA 4ENSA 4CIYA 1LWNA 4AY6A 1QKIA 3KWLA 4RHCA 3PUIA 3REQA 1WXHA 2YWHA 2NX2A 2V6FA 3KQTA 2W6IA 3DDCA 1PTJC 1JAXA 3DDUA 2E4YA 5ED0A 4X94A 1Q7CA 2FGKA 4XI9A 3FF1A 2GZRA 5IK2A 3AM4A 4ISBA 2FZVA 3COZA 2OE2A 4UU8A 2WIBA 1FW6A 2QG6A 1YB5A 4H9GA 3GLSA 3BD7A 4MA0A 4PAMA 1J42A 3TW8A 4PG8A 1I6MA 4YJ2F 5B12A 1ZN8A 1RHMA 3ECSA 3KVNA 4C7KA 5B1EA 5HQ3B 1XNGA 3QLTA 2AEFA 4QQ8A 1X86B 3RUIA 4WASA 3OKAA 2VYNA 3OQ1A 3PUXA 4CM5A 3ZDCA 1GG5A 1XTVA 3NKFA 1U7ZA 1XJWA 4Q0MA 3IHLA 5HHTA 1R8SA 3THSA 1E1NA 2F43B 3BOSA 2A5GA 3L92A 2A9QA 3K1AA 4GMDA 5CHEA 2OVBA 2GFQA 5CT9A 4YRLA 1NYQA 2V7WA 5KYGA 2ZI7A 1LDBA 1LNZA 2RCNA 3QUTA 4DDVA 4G07A 2C42A 4CCYA 1DNPA 1FVOA 3I0NA 3O8BA 2B69A 2ZAMA 2QK4A 4H2DA 1H2HA 1RI1A 4FYXA 5E7MA 4Z0PA 3ZDRA 4RACA 3QE2A 3TB6A 2CXSA 3GT0A 3LNCA 2AOTA 4N7MA 1LFDB 5CFMA 1KGSA 2JIZA 2DJ5A 4B75A 3CPHA 4DSAA 4JY7A 2FSPA 1TLTA 2P3SA 1ORDA 3KU4A 4HNAA 2VPTA 2HCTA 3L8EA 4NEHB 3RC9A 1ZITA 2A9KA 2GASA 5EINA 1E2BA 2G5GX 2XGOA 1I3NA 3VTAA 4GPTA 4ZU1X 4A8TA 4GBJA 2DJIA 2I34A 4RZ2A 1CJCA 4ED9A 4Z4IA 4JC0A 3K0AB 3OT1B 2NNLD 4HXGA 5IC4A 1MJGA 2Q2WA 1L5WA 1YS4A 3QKWA 3QWIA 4NARA 1RI2A 4QYIB 2QW0X 1Y6JA 1NLMA 3QE4A 5EHXA 2IELA 4WK4B 4XWAA 4Y7CA 1PJBA 1WDWB 4QPJC 1ZMOA 4DNXA 3Q3EA 4ER5A 3OPYA 2ZEJA 4XAQA 2CLMB 4DV2B 3ESXA 1GGHA 3BMQB 2FLWA 5E3IA 3T5GA 2IH5A 2GHQA 5I4CA 1ZX1A 4G5GA 4Q3NA 4GVLA 4RKFA 5JADA 4YRCA 2P2YA 3KQMA 3LHFA 2J9YB 3FRJA 4TL9A 2JHFA 1AC5A 4TTTS 4BUCA 2J3MA 2YY7A 2AG1A 3AESA 2QE6A 4QJ4A 1T6NA 1GTL1 4E51A 4K9QA 5DYYA 5AW9A 3ZJTA 4ZREA 3U1TA 1CLEA 4S0XA 3GLUA 4ZI7A 3ZH9B 3F8TA 3SWWA 4RW0A 1WUYA 4Z7JA 1UC4B 4G3XA 4ZYLA 1GGJA 1F9AA 2LDBA 2VZEA 3LWDA 3QPBA 5H3HA 5C2JB 5G3ZA 4KVAA 4L8GA 4L75A 1EIZA 1RTKA 4Y0NA 4W5QA 5BV8A 2JLSA 1QAOA 3J80A 4H35A 5JFTA 3UXHA 3HCDA 1RAHA 3MOSA 2NZJA 3IR7A 3QJ5A 1BHQ1 2D62A 2HLHA 3K8OE 4JYMA 3RLFA 2IHJA 2WM3A 2VP0A 3P9SA 1IXKA 4WJZA 2HTFA 3ICPA 1F17A 1EXDA 4AM8A 3UK7A 1SXQA 2PL9A 4R5MA 1QKKA 3LVRE 1D4ZA 4Z9FA 1OX5A 2FEMA 1O94A 1R12A 2O7NA 5A4DA 1A9SA 2TMYA 2ZB2A 2C99A 2GFIA 1F2TB 2YMPA 3I9FA 2AFRA 3IHKA 1J7KA 2ZPAA 3DE6X 4WADA 2YHUA 4C0LA 2ODWA 5AYVA 3VNBA 2Y9PB 4PSUA 4OFZA 2E82A 4IGEA 3O83A 3TIGA 1RABA 2WF8A 5A71A 3TECE 2GCEA 1YA4A 2I62A 3T99A 1Y4ZA 4TWJA 4OOEA 3ROKA 4KKVA 2QD3A 2VRWA 4IEFB 1T8SA 4RESA 2VF7A 4YASA 3NDIA 4JNCA 1M8PA 4QRIA 4XDGA 2J0UA 3UOWA 5DTEA 1KDZA 1NU8A 2YBEA 2C4NA 2YCBA 1A95A 4L6AA 1KHHA 4P35A 3C4VA 4NCIA 1B23P 2QNIA 5CA0F 4FGUA 5B58C 1IRIA 2QUIA 2ANCA 2H59A 5IDQA 1AMUA 5ICCA 3FOEC 2J87A 5A1TA 4O63O 1SXHA 3E2PA 2Y68A 4LY9A 2CSUA 1NNUA 3IBYA 3IOYA 5LDGA 4EPYA 2V7EA 1P2SA 1P17A 3ZWMA 1HQCA 3JYQA 3V1MA 3L0SA 3UAVA 2CNLA 1XLTC 3HBFA 4FI3C 2XT0A 4PV7A 3T95A 2WNIA 3QVGA 1N33B 4C7OA 1XR3A 1ACJA 2W6QA 3D1JA 2V7BA 2ZWVA 4P2GA 5AW1A 1PQUA 4UU1A 5TF4A 2VDMB 3NC0C 4BV8A 1E96A 3OF2A 5DLYA 5HQJA 4GKKB 2OZLB 3QEKA 4TLAA 3Q6MA 3CX8A 2ZRAA 4PLGA 1OXMA 4BNJA 4DV4B 2FMTA 4OD0A 1SELA 4BLWA 1RYYA 1JHRA 4MWDA 4Q7LA 4DOMA 1YJAA 2ONKA 1WOYA 1T0UA 2EFDB 4LC1A 2FCRA 1M7GA 2Q8QA 1UOQA 4MXDA 4R1MA 1FRFS 2C2ZA 3VJKA 4QU0A 3OMWA 3R7WA 1O95D 2C8KA 3WWPA 9MHTA 3HSKA 1QLHA 1JLSA 3DZJA 4KPUA 3QUBA 1LBQA 4CIBA 3C1TA 3QY9A 1XEXB 4NMXB 5C37A 4OO3A 3NBMA 4DXHA 4BAZA 2VDRB 3LSYA 3PLRA 3PV0A 5THKA 3RVRA 1G8FA 1AHNA 4U6SA 4AURA 1I1HA 1Q95A 2X4IA 1QVRA 3K6RA 4HY3A 1EEHA 4D0LB 3X0DA 3U7GA 2VT2A 3C6KA 4U2CA 3DDHA 1KJJA 4J7UA 3X1MA 1GQRA 4KEAA 4IOJA 2QY9A 4UOZA 2EFEB 1HG1A 4MWZA 1JFVA 3WHLA 4AKTA 1IQUA 7MHTA 3K8YA 3I73A 2AOTB 1J20A 3O2NA 2FW8A 3OIDA 4K9SA 4KACA 3VUEA 2RIPA 1ULAA 1EXVA 2IITA 2XF2A 2IZ6A 3WNVA 4HNAB 1BU5A 1IBSA 3UICA 1HRKA 4OJQA 4Z5XA 4GGMX 1O96B 2JVJA 1XQ6A 4D4LA 4WXPA 3OZSA 1PR9A 1VPTA 3U1BA 2IGBA 1K68A 1XXHB 1HQYE 1D2AA 1W8DA 4ENWA 4UFOA 5FTKA 4C06A 2VZLA 3SLKA 1CDEA 4G5XA 4IZIA 2BCGY 1EK1A 4S1TA 4YALA 5AK5A 1WKBA 1FFHA 3FPCA 2CYAA 4LZLA 2OKGA 3CM0A 2QXUA 4CTNA 2ZSKA 3PVSA 2Y0CA 1C7ZA 1CSEE 1KARA 2BGRA 4MCIA 4TN1A 2CL5A 5FPTA 2MCFA 5HCIA 3A2LA 5JV5A 2ZYGA 4BP1A 4FZRA 3WRXC 5ENZA 1OZAA 3MS4A 4L2IB 5ALEA 2OAGA 3WMRA 2EVWX 5ITZA 1G7CA 2H7CA 4HGRA 1W36C 1D07A 4X71A 2R6JA 3LLMA 4GC5A 4EGFA 3ND6A 2AF3C 1LI7A 1OJLA 1R1DA 1T8WA 1U8YA 4G9EA 2AYXA 2PBFA 1Y6QA 4L5JA 5E0OA 3TIIA 2XNHA 4D9CA 4ESHA 3WSTA 3TGWA 1MJ5A 3W3AH 2JJ2D 4XGIA 3JQ6A 4NK4A 4YJHA 4ZMSA 4YMSA 5E8JA 3OZXA 1V16B 2GILA 3AHDA 1WW8A 1P39A 3UJPA 4CF4A 2ZTVA 4M9SA 4OSEA 4OM8A 2FHSA 2MDTA 1KP3A 2R96A 2RI1A 1XLUA 2WVAA 3WGHA 2QT0A 4W1RA 1X9GA 4B2YA 4FGLA 3IJEB 4UUAA 1VKRA 4ZT2A 5I8PA 1CJSA 3NHAA 4A36A 1HMPA 3IEVA 1BH6A 2C9MA 4H08A 4TV8A 3VNVA 1N75A 1XF1A 3U4DA 2OGWA 3KPJA 2XXJA 3ZHZA 1N2BA 5JSFA 5AVOA 5CA1B 3GRYA 3TI7A 1P1JA 2E4AA 1ZK4A 5A4FS 3OQIB 2B78A 2BGTA 2G71A 3DKRA 2VFAA 4P82A 4QXOA 3W05A 3V8NA 1IHOA 3WISA 1Z7WA 5IVKA 3T7RA 4LFAB 4B09A 3DBHB 1IY1A 2ECPA 3OC0A 1DBIA 3KKZA 4I9GA 1JZTA 3HJAA 3IJPA 3RSGA 3ZS9A 3L79A 1RKUA 5KDDA 4KR2A 2NU9B 2MSLA 4J76A 4ANFA 1E5LA 3Q3JB 3EJWA 1H3FA 4WNCA 1JPNA 2BKXA 4G5HA 3LY5A 4FR2A 1R8QA 2WQ6A 4DSZA 1GL9B 1T3SA 2IOQA 5A02A 1TEHA 3DB1A 2HQBA 3DKKA 2R4TA 2QNBA 2WYUA 3TTXA 2JAWA 4K6KA 1Q1BA 3GGGA 1KJIA 3FTFA 2H08A 1SBHA 1GKYA 1M1YA 1Z18A 3DMHA 4EG7A 1KOGA 5F1PA 4XTCS 4HZUB 3JRNA 3MTQA 5IH3A 4O2BB 3IXQA 3RT7A 4DBLE 1U7DA 4JUDX 4P38A 4RH0A 1SCNE 3T3EA 1G7TA 2EC5A 5EIWA 2WJWA 1I1QB 2IODA 1R0KA 3UTDA 2RGNC 3GN2A 4WN9A 5IUKC 2CVQA 1Z22A 1P7WA 2BI8A 1GA4A 1PN3A 2Q3CA 1DG3A 2FFAA 2QSZA 2Y9MB 1F8UA 5F2EA 3T12A 4B40A 5JNLA 4FBLA 4ZT3A 4QL3A 2VJNA 1TQHA 2R2AA 3G85A 4JBNA 4QJ3A 5DCWA 2PWBA 3SIXA 2XRZA 3Q3VA 2F8SA 2Y0EA 2WJPA 4NCAA 1O5OA 2XIJA 1VGRA 3M34A 1U1EA 4L0MA 5HZKA 4E4TA 3VZBA 3UBTA 4L73A 3ZXXA 3PD1A 3ZWAA 3JD1A 4IF6A 1PNTA 4C29A 1UANA 4HS4A 3E3LA 1T13A 3FFAA 2B8JA 1JVNA 3ZHRA 1K7CA 1TUEA 1O5TA 1P4SA 2Q4TA 3EGDA 2CHQA 2I2DA 4D97A 4PLFA 1U8ZA 1KP9A 2HPZA 3H4TA 3JX9A 3LX6A 1YASA 1YMVA 4RCVA 4AUMA 2P0EA 1LF0A 2QMZA 5KWIA 3GBVA 5JJLA 2HU5A 4IILA 4DXAA 3ZW9A 1X1BA 4TSRA 3RFFA 4YCNA 2QT9A 3KSBC 1H2RS 1GVHA 1N2EA 2ZIAA 1L7VC 3EEIA 4ND6A 4GX5A 1QGED 2P91A 1NBAA 4WLNA 5CIQA 4EVQA 3H8SA 2Z2ZA 2C1XA 4D82A 2DCMA 2I2FA 2JFZA 3PXXA 5HMMA 4HXEB 1RLOA 2JI8A 4GZ5A 4LISA 5KX5F 5B2EA 3JSAA 5DM1A 4L5CA 3NS7A 3USZA 3IAEA 2A92A 3SXPA 2YHSA 3V55A 5BR8B 3ML1A 1ZKMA 2W2QA 5F2NA 1Z0KA 3F67A 2HXYA 1LJUA 4O4HB 4FIDA 1XCOA 3RU9A 5IZCA 1TECE 3FNBA 1LSOA 4RD1A 1P5HA 1E1KA 2XYHA 2W2PA 3B6IA 2YASA 3BCSA 3KLNA 3OZ7A 4IM7A 2C07A 5A5DA 2XWQA 1MRSA 3TRJA 3JQ9A 3R23A 1RPNA 1NY5A 4GKAA 4P1ZA 4RAQA 2B30A 3IAS1 4N39A 9GPBA 4CQMB 1KQGA 4EHLA 2ZXFA 2AZMA 3V32A 4OM7A 4BV3A 2X8AA 4NZZA 4RL4A 4LK3A 4RPJA 4MVJH 4RF3A 4IIGA 1BDHA 2W2VA 4GLOA 3ADOA 1DAIA 2Q0XA 3PEUA 4JLSA 3UW1A 4KH0A 5C8ZA 1YDWA 2FMXA 1J49A 4PX3A 4FMPA 4EO9A 3INNA 2XYQA 2YX1A 4B74A 5FH9A 4QU8A 2C5LA 3LRPA 5HKOA 1UBUS 3OA2A 2R0QC 2F90A 3B60A 3H2HA 3VYUB 2WE7A 3HYSA 2CLFB 3LF2A 2VYFA 3NOOA 4IIFA 2VQFB 3AR8A 3MJTA 3TRIA 4BHTA 1EFTA 1CVLA 4BJ6A 4EHKA 4G89A 4R31A 5FBLB 5MF6A 3SZMA 1CEEA 4ZYXA 3PE4A 1JDSA 4GEKA 3TSCA 1K6IA 2ZFUA 1YACA 2H2DA 1BE8A 3OZWA 1RYDA 1RU3A 1L8OA 3A9VA 1NM5C 3R5SA 4OQNA 4Y2RA 3WNZA 4C0HA 4E3ZA 2QAIA 3K0CC 3DEFA 4LMRA 1M1NA 2QP3A 4ZOAA 5CXQA 4EUSA 1T29A 1ZH8A 4LJ7A 4RVNA 4KXQA 1ULHA 2R751 2VZ9A 4BJ1A 5K20A 1I4WA 1ZL0A 5IF3A 1XMXA 4BO1A 4KNWA 1BMTA 1XZNA 2ARKA 2YOFA 3OLYA 4YROA 3RWBA 4D5EA 4DBZA 4L9WA 1X1QA 4C2BA 1T0JB 3AF2A 4BNNA 5JBNA 4RULA 4MKFA 1N6HA 1NZDA 2ESRA 1E5XA 3NWJA 1DINA 1R5NA 1SH7A 4QAJA 5A05A 3ZV6A 3RVMA 1P7PA 4CLEA 1U2SA 3L1JA 4MVJI 1T3HA 5IC6A 3O26A 4TWRA 3KSAC 4HTFA 3N87A 4ZYWA 4DV7B 4XPZA 2QRHA 1DBPA 3DEIA 1JLHA 2D2XA 4PVDA 4D79A 4NCJA 1Z7YA 2YJ3A 3KALA 1MOZA 1XLVA 3I9OA 5CXSA 3G5LA 4EMTA 5IFKA 3EJ6A 1KE2A 4JKIA 4AJNA 3IEIA 4BVHA 4MDYA 1KMNA 4EIWA 4CG0A 1OLOA 4Z9AA 3WNQA 1AVTA 1L6IA 3GQBB 1QFZA 3P2IA 3OLXA 4RGVA 5K8TA 1WF3A 3PKZA 4JB3A 4NEGA 5J2UB 5IDVA 4CVNA 3E27A 4LDNA 3WLNA 3DEHA 2O3TA 2WVJA 3LQ1A 3O1IC 1TYZA 2VZ8A 2B1RA 5D5HA 5FUMA 2C58A 4NFYA 2NADA 5EPOA 2W6ID 2ZIEA 4NU6A 4HDMB 1Z0UA 3LP8A 4GYKA 1ZESA 2QW8A 3KTOA 2GVDC 1NMXA 1S8NA 2GPAA 1TU0A 3CR8A 4KUEA 4MUGA 4ABYA 1NX9A 2C4HA 4KQ1A 5GONF 4EVRA 3AR6A 1XZMA 3P0FA 3CTPA 4MV6A 3U7RA 3DBOB 5TQ0A 4XIIA 3WL3A 2XE7A 4JGGA 1J2JA 3V4SA 4I1RA 4WN9B 5I7WA 1J2EA 2AXNA 1VIAA 2FDXA 2XOEA 4EMSA 2VYND 2QRPA 4ZVPA 2ZITA 4BQNA 5LNK1 5TE9A 4R1LA 3RIEA 5KSZA 4NDZA 1XNQB 5L3VA 2W6CX 3DOHA 1UL1X 2V6MA 4W7IA 4Q21A 3FPHA 1ML4A 5IJ9A 3I8SA 1VP3A 1RM4A 5J4YA 1T5DX 2FZGA 5DK4A 5HZMA 2V0NA 4IRUB 4I7EA 1G3UA 1ML3A 1JTEA 3A4VA 3R7NA 5C5CA 4F04A 4ZDJA 2G4CA 5JNVA 4JN6B 4IEEA 1EGMB 3G7UA 1VE9A 1NP6A 1FYWA 1FTWA 2O2ZA 4CN9A 4KQEA 3T1TA 2XMDA 2JIZD 1P44A 3OIYA 3M4NA 4LOHA 2BGNA 5EWMA 3QPUA 1JWLA 1ETUA 2FPSA 2ZWIA 3TIXB 3D7MA 4AQDA 4KV7A 1KZ9A 4X1YA 1GCUA 4P3NA 1JMVA 1CUHA 1IMJA 3QKSB 4NI5A 2PBZA 2QTVA 5JRJA 1SK8A 2LIPA 5HPYB 5JI2E 4P80A 3IEUA 1GZ5A 3U13A 3CV3A 3WKDA 2ZLBA 1L4LA 4LJ4A 3WA6A 2G25A 2I67A 3R2JA 4Q00A 3G8AA 4UMEA 1NBWB 3INGA 1IQPA 4MNTA 1R0XA 4NOJA 1T4BA 3JSXA 5SZHB 2OXEA 1UJ5A 4N01A 1FUYB 2JD0A 2V4ZA 3ICVA 4C20A 1ZJWA 4N8DA 3HVUA 1WPRA 2JVIA 2CJPA 3A27A 3R44A 1Z4LA 4C43A 1IB0A 4WPGA 5GJWC 5KKNB 3IQZA 5LOVF 3U3RA 4OGWA 4W6QA 5CIWA 4ESVA 1J2YA 4EB3A 1IZ8A 1QCZA 1B41A 1YQXA 4O4JB 3CXRA 1KKUA 2OQRA 1BD4A 3QOYA 3T7SA 1G6Q1 1YRBA 5E9AA 4CFSA 3RVJA 2DG2A 2EV9A 4NJMB 5CAEA 2GF2A 4Q6WA 3JVIA 2W2OA 4FFWA 2GYUA 3OC6A 4MS4A 2BM1A 1FNDA 3P7MA 5JG7A 1DC7A 1BFDA 2FHPA 2G1JA 4LE1A 1JE0A 4NV3A 2E49A 1I1OA 1MAVA 3V1TC 1ZDMA 4A6DA 1P5ZB 2A0UA 3LP6A 1PNVA 3SHVA 3LOQA 5HRUA 4O4IA 4EHNA 3AFGA 3EQZA 4XSGA 3VVLA 5ES4B 4KPEC 3EW7A 5DHRA 1N5OX 4P3PA 3ICEA 2HZBA 3OHMA 5DT2A 3ZVMA 3OHSX 4ZKDA 3PENA 1BWSA 1QFMA 2H54A 3I23A 3AUKA 5AJYA 3LX5A 2C5HA 3ZE1B 1ZSYA 2VCYA 2YOHA 1NNI1 1U2GC 2BDUA 1IY9A 1LPSA 3FLAA 1PZXA 1CNEA 5DO9A 2P62A 1KEPA 1E2QA 1N9ZA 5CB0A 1PSZA 1YTLA 2FSIA 4KWIA 3ENNA 4KWCA 3TJZA 3WAKA 1YJ5A 1O94D 5EPEA 5EJIA 1Z73A 3QLUA 2JRCA 2NSYA 4MA4A 4ID3A 1L4NA 5JT1A 5FD8A 2PS0A 4W5TA 2G70A 4LYFA 3CEAA 1Q0QA 3ZQJA 3E5MA 3H9QA 3V8PA 5AKGA 2AG0A 1DEXA 2IYLD 3PF9A 1AE1A 5CD9A 3NTVA 3HYTA 4GI1A 1QBGA 3CSSA 1JR6A 1V4VA 2VTDA 4GICA 4UC0A 2FVYA 3KPVA 4WZ6A 4BLPA 2GO7A 2X9GA 4FFBB 1Y3BE 4QDOA 3KJQA 3TGLA 2DRIA 1X92A 2BUAA 3LAWA 3UV6A 4HFJA 2I6XA 1NWCA 2CXRA 3UK2A 1JXAA 4D0GA 3FBWA 5EXPA 3I5XA 4R0MA 3L0CA 3WO0A 2JGJA 1GR0A 4Q3DA 5JEDA 5A0VA 4BEBA 1LDEA 1DQPA 5ICSA 4M0KA 1ESMA 3VC1A 1NMQA 3ENQA 4I1IA 4A03A 3RSSA 1T5OA 4JYZA 3IB3A 3R40A 1KEZA 1FDTA 3IP6A 1TUIA 2QUZA 3CCCA 4FOPA 2ORWA 1VSTA 2CE2X 1DC6A 2H1FA 1TOAA 3S44A 2G9NA 4IIEA 3WLKX 1VHJA 1KMCA 2Q9AA 2BE7A 2NM0A 3IMCA 5FWYB 1XSEA 3QGMA 3MWYW 1CVRA 1G2PA 4JELA 1I33A 3M7IA 1GUDA 2QUJA 2XB4A 4NLLA 5TV2A 1FRNA 5A6SA 2QBYB 3LHIA 3KJNA 4BVEA 4NXNB 1ES9A 4J1NA 5JMTA 3FB1A 2ID9A 3QP9A 4R05A 3IOMA 2M98A 2ZSIA 2WFLA 3CEJA 3I9V1 3TLKA 1YS2X 3HP4A 4P84A 5BQ5A 4RZIA 2VJKA 2ZRNA 3HVJA 1WNFA 3RFUA 2GRJA 1OTHA 5IX8A 1FS4A 5BN5B 3S55A 1BRTA 3NAQA 4NABA 1RVV1 3PC2A 3TPCA 4YCJA 2AI1A 2OLKA 3AILA 2O9JA 1T9GR 1X8XA 4QOSA 5F5NA 4YRJA 3HZOA 5A7HA 2C82A 1HEYA 4Y3UA 3KV1A 4IVQA 4JSYA 2PCLA 2WPNA 1G0NA 3ASUA 4PSVA 4BVBA 1T9ZA 1SQ6A 1X3SA 4IJMA 3OJEA 2P7HA 5IBQA 2RBEA 2XTNA 4GBGA 2JC3A 1MPXA 1RXWA 4C87A 3HN7A 2MYUA 2HV9A 3AB7A 3K9WA 4Q18A 4UUOA 4WT7A 5CYOA 1YZVA 2HT6A 1PGPA 3E8XA 1C4XA 1JMKC 6REQA 5DVZA 1M1XB 1PFKA 1FOEB 4QEDA 1JSCA 3WLJA 4A4DA 1YE3A 3F0TA 1PVDA 3WLIA 4KYIB 1GKIA 1TEXA 1NDUA 2CXHA 4EB0A 4LDJA 1G8JA 4QXRA 1BXGA 2X0EA 4AJKA 2QTVB 4HRVA 2KM1A 4IFIA 1R0LA 3CZ5A 3IVAA 4ZHQA 1Q7EA 3HV0A 3WOVA 1V71A 2A57A 3IBCA 2BGKA 4B0PA 2NXCA 2CDNA 1QHYA 4KQ9A 4ZANA 4A10A 4DHWA 4G97A 1MX9A 1E1CA 1R8XA 1W0CA 2QQFA 1UAAA 2O1XA 3VBCA 3DJFA 3DZCA 4YDRA 4U2BA 3TDNA 4D5GA 1TF2A 1WHTB 4UBMA 1Y8ZA 2Q3HA 1V26A 3BK2A 4F4DA 5AW7A 5JD4A 1WJGA 2X5OA 3MILA 1XCBA 1ZCFA 4PXYA 4XCQA 3V4FA 1QK3A 3SSAA 3ZE2B 3AKZA 1MO3A 2DGDA 2FYTA 4L28A 2QTLA 4R81A 5ALNA 1GTG1 1R6AA 2IV2X 4K0KB 1HDEA 5T4FA 4OUKX 4XDHA 5C8VA 4ISCA 1WX1A 3WB2A 1IZ0A 1LDGA 3QXCA 4AFNA 6LDHA 2ZT6A 3KO8A 2OO3A 3MGAA 3W5SA 1I7QB 4YJ3F 2D2VA 4IFTA 2FEAA 1GSHA 2HN9A 2JGAA 1TI7A 5K0LA 2NU6B 3WHIA 3R6DA 5D5QA 1F8YA 1KAHA 1JU4A 3G3EA 5A4IS 2C5AA 1SC4A 2B6HA 4X7RA 4ARVA 1IPFA 5KNBH 3N8KA 2Z6VA 1K5DA 2BLLA 4XJVA 4E88A 1D6NA 1IUKA 3DCNA 3BGIA 3HLTA 4G5FA 2XDQB 2K7ZA 1EIWA 4GM4A 1ORHA 4EAQA 1DC3A 4DA9A 4ZIRB 4EUKA 4RSRA 1BQ4A 1UIRA 2YFKA 5FWAA 3WADA 2RH9B 2HH9A 2PKWA 3CRVA 4HH3C 3AHHA 1RDFA 3FR8A 2FKAA 1ZUNA 2FZKA 2GN6A 3F2IA 2JI7A 3GL9A 4QYXA 3R6WA 5C1PA 2WD8A 3DUWA 3HB4X 3PB3A 4QHYA 4JU8A 4AJJA 2I2BA 2R5WA 2X3FA 1WPXA 3JASA 1GYQA 1XL0A 4BU1A 2FR8A 2Q1WA 4YMTA 2BBSA 1TX4B 4YWJA 4CE6A 5L95A 1RJFA 5AKEA 4F91B 5HKAA 2J1LA 1E64A 4CUJA 2VDQB 1E2LA 4JMPA 4DMKA 5KZMB 4ZGBA 2R7NA 1RLUA 1VIMA 1S7CA 2N3ZA 3D43A 2AKAB 2WT8A 3GDFA 3NYQA 4WOBA 5H4GA 3D5EA 4O4LB 4PZPA 4KDEA 3JATB 3L8HA 1OAKA 5ALDA 4UXHA 5ITVA 4ZCTA 3TFOA 5GJCA 3EPHA 9LDTA 2XODA 2OCLA 3DZBA 1QP7A 1G55A 2CKMA 2VDNB 3HNRA 4DCSA 4C1BA 3H8WA 4GW3A 4K9LA 4NG5A 1Q74A 2Z9BA 3NORA 1V2HE 2I91A 2YZ7A 1KEKA 1SUEA 5K45A 5KU1A 2W8BB 3QPWA 2G1AA 5CGZA 1KVTA 2H2WA 4IDAA 1DFIA 2R68A 1VLLA 3JWJA 4FDLA 1IWBB 1A7UA 1XE3A 1VYUA 3PHIA 2WWGA 2IY7A 3DMTA 3P9PA 2HA7A 1IJBA 2ZTSA 4GI2A 4MRPA 4DLXA 1E5VA 2ACVA 2CUTA 2PD6A 2J3IA 2BKLA 3AIOA 1B8OA 4YH1A 3ZDYB 4XQ9A 3BJEA 2DQSA 2AC7A 3SJ7A 2WTBA 5F5XA 3WYCA 4D9IA 4OYYA 1SC1A 1U2TA 4LJ5A 3JARA 4RSHA 4US1R 5IASA 1YF3A 1RFLA 4LVCA 2NZXA 3VR6A 3GJSA 2OMKA 4KK3A 1QH1B 1U0RA 3Q6NA 1E94E 1GAXA 2P2DA 3HFGA 2XDYA 1V5GA 4QELA 1CFJA 5AM2A 5LA6A 4L07A 3VJRA 5FWDA 5I5EA 3NIWA 3CVWA 4Q4AB 1RYZA 2GJKA 1GAWA 3CT4A 1LLCA 3MRTA 5TGDA 4YT8A 5B55A 5BUCA 1P1BA 3ZVRA 2BI7A 3FWPA 3TTUA 5LP6C 3HXKA 1NVVQ 4FUTA 4HNVA 1GFIA 2C7GA 4B32A 4GVXA 4FKZA 4TLEA 3ROPA 4JJEA 1LC0A 2YWCA 6YASA 1ZONA 1L4BA 1PWZA 3SZLA 1F3LA 2R48A 5LUAA 2NTYC 4FNGA 4JZYA 1E3SA 4IJWA 3RS9A 3KV3O 5CEJA 1IXYA 4PYIA 1GKLA 3WK7A 3OJ0A 1LQTA 3K72B 1WV0A 4X00A 2ZK7A 2C3OA 2FW9A 4J16A 5AHRA 5TS3A 3SXUA 1XDBA 2HIAA 2Z4RA 3H6KA 4KE7A 4JI3B 2RGEA 3UA4A 3A1WA 1EJ2A 2I6GA 4GXQA 2GYVA 2NV0A 4MRSA 1DC8A 5BSTA 3KETA 3WHPA 1MRZA 1HDZA 2OC9A 1C3OA 3DHNA 3G9XA 1MC8A 1XJCA 2CZQA 1CTQA 4HLUA 1WZEA 3AF0A 4NJEB 3K5WA 5KQMA 2GWRA 2A8YA 4AICA 3R7LA 3S8MA 1ZD8A 1B4DA 4TWIA 1E0DA 3EBPA 5DGTA 4PSCA 4DXDA 2DY0A 4A0HA 4I1OA 3IAFA 4K28A 1GY8A 2PD3A 4LHWA 2A6PA 1PR0A 3IPLA 2APJA 5JDCC 2WFZA 2X5JO 5G02A 3NDJA 3ZU3A 3OZBA 5H16A 1I2ZA 4RIHA 3IPCA 3C7DB 2HGSA 2OPBA 3KBBA 3QI7A 5AHXA 1NLUA 3FOCA 3HCWA 2KB0A 1D2NA 5I8ZA 1QTIA 2B34A 3MT8A 1V8DA 4FHEA 1MH9A 4G8JA 5DYGA 4BTEA 4CTOA 3WAGA 3DFIA 5T57A 3O6VA 1GGNA 2DR3A 4Y6SA 3IR6A 4F21A 2YVKA 4TXHA 5TY0A 5BWMA 2AWNA 1DZIA 2R6DA 3TSWA 2DFTA 5T7BA 3SF8A 1GKKA 1TYEB 2P11A 3TS1A 2HHHB 4E31A 5B6PA 2HXSA 3ANMA 1CHDA 4PRKA 5DSTA 3CLTD 5K0SA 1QYDA 1RYMA 1A3CA 1WLSA 1Y5RA 2A30A 2W11A 3EG5A 4M1OA 1W34A 1YDMA 4Q34A 2A0XA 4PYRA 4B82A 4DIDA 5JROA 3AVUA 3A7DA 2J67A 1PNOA 521PA 4QIHA 4Q1AA 3WFZA 2WJHA 1DIOB 3TLYA 3UNXA 3MFYA 3TINA 4LZPA 3HVRA 2H2HA 3MTGA 2RHHA 1VE7A 4EFMA 1WMDA 2F2TA 4AJIA 5B37A 2NMVA 1TQ4A 4MB6A 3E61A 2RARA 2MSDB 1X1SA 3ZHUA 2HCBA 4Y2JA 1XZLA 3EH2A 5G0UA 4X1IA 1VI2A 1CJUC 1CKEA 1D8TA 2QRZA 2HDNB 3JU3A 4B4VA 5KOHB 3I01A 4YAJA 2BTEA 1Z0JA 3WYFA 8ADHA 5AQEA 4MW2A 4M87A 4BFLA 1QH8A 1QIJA 5ERYA 2YXPX 3UAOA 3RFVA 4BGIA 3E15A 2H65A 1P19A 4US2R 1NP3A 4M9CA 3ND8A 2CCJA 1ZSNA 4JBIA 1EJ6A 2B20A 3KZXA 1Q6YA 1ZH6A 1C1XB 1JHPA 3EAGA 3OIFA 1VM6A 2BTOA 3OPXA 3SAJA 3IPXA 4C22A 4D99A 3CSUA 4KQCA 5I9BA 5A2GA 3A6GA 3L0DA 5L9AA 4CBVA 5JCOC 3GFVA 1D0IA 4EA6A 4ZK2A 1IMOA 1PSWA 5B1SA 2IXTA 3L2OB 4MQUA 3Q98A 2FOIA 1G2QA 2C8LA 1T6YA 3AU8A 2Y76A 3R0IA 4Q9KA 1NDQA 1ODSA 5HOEA 5GOTA 2NLOA 4HRXA 1DIAA 5CYPA 3BTUA 2ZI4A 4WWHA 2AK2A 2VAXA 1P8AA 3WZMA 3DPUA 2BH9A 3CX6A 3D0OA 4RANA 1BKDR 2X1MA 4LF4B 1ONNA 4ENQA 4PNZA 4NMWA 2HWUA 4C0WA 2OORC 3FD8A 4KO4S 4YXFA 2VNKA 4IX9A 4R2HA 2P6PA 4X61A 3V2GA 4K87A 3SLGA 3DO8A 3HVHA 4BGDA 4KRGA 2BW0A 1ECPA 2R6GA 3FRIA 3PRHA 4HWSA 4PWYA 4L7QA 4QHSA 2KLBA 2ILTA 4G5SA 5C5IA 2PXCA 5HX7A 1RCTE 2QM7A 3PQ3A 1JHXA 5T64A 4DCJA 1KO5A 4TKUA 5JXHA 3UMCA 1N5IA 4ZXFA 5C8YF 3RRXA 2ZPUA 3H1GA 1FDSA 2G4LA 2YUIA 3QLEA 4RD4A 4EGQA 3D1LA 1HFJA 1UZUA 3IBGA 2IXGA 5AT1A 4YLYA 5JMPA 1ZGCA 3GJ5A 5DOZA 4E5UA 3NDBB 4RX1A 4GO1A 1R00A 4YMLA 3JS5A 5AOAA 4R6XA 2YWDA 4MV7A 3VO1A 2HSZA 2X5NA 3I6ZA 1MHPA 3MBOA 3BL8A 3IV7A 1IJKA 2FKNA 1JTFA 5F3WB 5COQA 4C1NA 5LA6B 4RPIA 2O19A 1EUCA 1GQFA 1UKAA 2RB4A 5JR3A 3MBKA 1QO7A 3DF7A 3ACCA 5AVJA 1JHZA 1YHYA 2X1VA 3MWEA 3OJCA 1NG9A 3GFRA 1X7YB 2AE2A 3ZDEA 4LKOA 4HEA6 3EXFA 2XD4A 4MARA 3DCIA 4TZTA 2M6SA 1YRWA 4YDHB 4EAAA 3UEOA 3JQFC 5EZYB 4R2WA 4GRDA 2BUCA 1D4FA 3X44A 4I1PA 1QGOA 3MF4A 5K99A 1MO4A 2P90A 5JBQA 5FOSA 4UZEA 3MTEA 2W6NA 2BEVB 4IDEA 4I3HA 1UQRA 5EP1A 1KH1A 3LWBA 5DM60 2A9FA 2N47A 2PS1A 4YLEA 4DQ0A 1WCXA 5MGNA 4LJ9A 4N48A 1XDDA 4FYIA 3TZ6A 5C35A 4IW3B 3BB1A 4MGYR 1TIPA 2OY0A 3AQ4A 5TPZA 1W75A 1UMDA 3R0XA 3BHNA 4TWBA 1OD6A 4C6TB 4K81B 1TAUA 1KETA 4UBOA 4RA9A 1Y7HA 4B46A 4ETNA 4BAGA 1XZHA 3NASA 5E6RB 2QL7A 4KQXA 4L8VA 3FVQA 2FN4A 3C6ZA 2F00A 3D8HA 4N5DA 2OXRA 2QTAA 2QG4A 2ZCVA 2ZTLA 3EZ6A 3PDUA 2CNOA 4LJ6A 4PFJA 1VSUA 3CRMA 3KQPA 5E6SB 5EUQB 5BRJA 5TPWB 1G20A 3S7TA 3D4LA 4PONA 2H07A 2R11A 3AGQA 5E2BA 3UJAA 4BBZA 4JOQA 5IPFA 1SD2A 1N8TA 1QKJA 2W8ZA 1ECCA 1OLSA 4GUAA 2BD0A 4JP2A 4NCNA 4QKQA 1C1YA 1MDBA 3JQGA 4FOTA 2E2WA 4LJYA 1L7QA 1ZIPA 1VLJA 4CUZA 3SKYA 2QMQA 1WCYA 3LVQE 4X6XA 2GZ1A 4I1UA 4XM2A 3VKVA 3NVAA 4HQLA 3D0QA 3VPFA 4OQFA 4DV0B 3AFHA 3D6TB 2B7CA 5JEEA 1D2CA 5H68A 3RYFA 1DXQA 4JDPA 1XTJA 2P27A 4RWZA 2QJFA 1ZXLA 3ENZA 5H9VA 4EEKA 4BZWA 1N6IA 2XWSA 1AA9A 3SOPA 1GPDG 4XIFA 3DSRA 1H1TA 3PHCA 2PLRA 3DZHA 4WSOA 3JAKB 5TRTA 3T0GA 3VISA 1UK6A 2JZOA 4DG5A 5DH9A 1TQDA 2C5BA 2IFTA 4AWBA 1V6AA 4I1SA 5FF9A 4FU0A 4PO1A 2JANA 1DRWA 4Q4LA 5C4IA 1E5QA 2FCAA 1IQ0A 1LVHA 1P1HA 1RJGA 1G0OA 3KQQA 2Y1KA 1PJ2A 3PNVA 4IRMA 2NO5A 4B84A 1JAHA 4X1KA 3DC2A 3DTVA 5AW6A 1Z0DA 4EARA 2UYHA 1W2HA 4W5WA 4RTLA 4ZZ0A 5AICA 5K8UA 3SSOA 2VLBA 3T9CA 1CS0B 5G4LA 4HXFB 3TQCA 1T25A 1JQ3A 4OGLA 2VI5A 4D6XA 3TLMA 3BXFA 1KTVA 2EWVA 2EP7A 5KYUB 2A14A 3AINA 2YW2A 3L6OO 1NBEA 3M4ZA 1W46A 3PNBA 1ODIA 3VKUA 3C8UA 2IXBA 1M2EA 2IUUA 1BHJA 4DIUA 1V5EA 4PC1A 2ZSFA 3NGLA 3NHSA 1LZLA 4A0RA 3RADC 3AR3A 5I4BA 2J3DA 2V0CA 2VCHA 1AUOA 4UFNA 2HZ7A 3EPPA 1PW7A 2CV1A 1M6YA 2NWQA 1ZC3A 2XLBA 4JYBA 1F48A 1OC2A 1YWGO 1ZD1A 2PZAA 4LX8A 4OHMA 4LCEA 1QF7A 2FTKE 3P9RA 3Q1KA 3AIIA 3U26A 4OK5A 3VNUA 3EUFA 1JT2A 1QSGA 2OCAA 1H5QA 3LBIA 4DLWA 3SZRA 1M0EA 4F71A 1EI9A 5E2IA 5GP1A 2YXBA 1KEUA 3DHVA 3OJWA 4IGIA 5C31A 3ZWXA 5BR1A 2OBXA 4Z4HA 1ZRNA 1GNPA 2TMGA 5CYFA 5DBHX 5CJJA 2VP3A 4LXHA 3QWBA 1AZWA 2WMOB 2YIVX 2PEZA 4KFUA 1P2VA 3HBNA 4JLPA 1JQEA 2WFMA 4LGVA 1YAJA 3LMKA 1WCIA 2CCKA 2Q3LA 5FFNA 1R50A 4TKUB 2O23A 1EDZA 1G63A 3ZXUB 3G1UA 4G0OA 2XW6A 3D2AA 2WJYA 3FCOA 4LRTB 2GN2A 2M32A 1BWRA 5HQTA 2Z4SA 4B6FA 3SYKA 3K15A 5I3ZA 3C8HA 3E9MA 1L4YA 4PX2A 3TVYA 5J4VA 2IYVA 4Z0HO 2ZJ5A 1H3EA 3PDJA 2EBHX 3R24A 4D3FA 5CCDA 3N2ZB 4KQFA 1D6MA 1XRRA 4AMZA 3BDAA 3NBKA 3NC1C 4W1SA 1KVRA 3KP1A 1QS0A 1VPDA 3EIHA 3QWHA 4X60A 2HMAA 1IK4A 2Z5FA 2EQBA 2AFIE 4DNPA 4W9MC 1JFFA 1OLUA 1ND5A 1JHUA 1QDUA 3LZCA 3PG5A 4MYDA 3FZNA 4AMVA 5J3JA 3HUDA 5GZ1A 2CE7A 1XHEA 4UHDA 1DOHA 1W5BA 4CPDA 1USIA 1Y3DE 5TJHA 1KVUA 3GJ8A 4IICA 2LKDA 1S8OA 3DS8A 4V0OA 5IEBA 3TUZC 4KQJA 3A1EA 2JFXA 3N39C 2CV0A 4LGYA 3K0EA 4XARA 4Q9JA 1MQAA 4AMYA 1JNXX 3W8NA 4NBVA 4G1BA 4IDNA 1MR3F 1T2AA 1Y7LA 2X77A 1JQAA 3K5PA 1QGAA 3HTXA 5BNIA 2AFHE 4KO1S 3EQ9A 4RXUA 3NFRA 4MIKA 4QYWA 4ALNA 3L7BA 4C14A 1I6KA 1NVWQ 1YAHA 4WLFA 3GLFA 4FWIB 1K7SN 1UMBA 3MGKA 4FMCB 4C5AA 3ZLJA 3ZGNA 1RI4A 4TM8A 1L7XA 2PJZA 4ENUA 2WJ4A 4KR0A 1NW5A 3FPJA 2YTZA 4H77A 4KJZA 5EQDA 4PCVA 3BRQA 4ZAGA 5KVVA 2C3YA 3UGQA 4W82A 4B3XA 4RTQA 4N4AA 3HN6A 3QV1A 3MC1A 2OV1A 1GU1A 1VTKA 3F9RA 3O3CA 4O2AF 2RKBA 4Q3AA 2FAXA 3AZOA 2B99A 3UUFA 3UGJA 3BBPA 3K70B 4YK7A 1E1DA 1W0KA 5FAXA 1MQ8B 1NURA 2ZRPA 1RQ2A 1NVGA 4H7DA 3ZLBA 2GD6A 3KAJA 1LSUA 1G20B 1VGQA 3O74A 2EATA 2BKUA 3AEQB 1EE1A 2QE7A 1GDTA 3ZY2A 1KDRA 5LZ7A 3GJTA 3NIDB 4UE6A 4UPEA 6CHYA 2QPAA 3JWEA 4P32A 4BC1A 5FNVF 1FJHA 3HO8A 4GOXA 5DISB 5IM5A 2YRFA 1NJGA 3HUTA 2RHDA 3EFBA 2QX7A 5FI0B 4PNPA 2Q2QA 3KT8A 2WKRA 1A98A 3D4IA 4OXIA 2B1JA 2ZYUX 3GA0A 3HJNA 4H31A 5C8XA 1WXWA 2DWQA 4P33A 1C0LA 1W52X 4BQFA 2ZAIA 2HK8A 5KNDA 3C1AA 4PYKA 4V02A 2OKCA 2QLMA 2ZP1A 3OBIA 5JC1A 3R7BA 4B6PA 1J2UA 1YR6A 2Q3EA 2QENA 3PTZA 5KTPA 5JSQA 5JMWA 4YJ2B 2EGHA 3MB5A 4IYJA 3F6BX 1LRLA 4GX0A 2BTQA 1KI6B 1U8AA 1ZA1A 4KHZA 4RVHA 4K9NA 4JI1B 1WB5A 1D5CA 1FZQA 3Q7EA 2XI4A 3PCRB 5EKDA 3T41A 1RRPA 2Y1OA 4WCFB 3GJ4A 5F76A 5DNYB 3K9QO 1FFWA 2A86A 2P2SA 4ZKEA 4D9JA 1YB1A 2FK7A 1VMAA 1CZUA 2FVXA 2GM5A 2LCIA 7REQB 3NJRA 3E7DA 1Q17A 3QI2A 2O0HA 1LI5A 2HUNA 2PSDA 1GARA 4REMA 3IL2A 2FQQA 4HWKA 5BUSA 4I9FA 4O59O 4R16A 3OT4A 4MO9A 4IKPA 4LSZA 4NU8X 4WQMA 2DE0X 3H5WA 2AVNA 1SZPA 3M89A 4KVZA 3UMMA 1PR3A 5PGMA 3TX2A 3ZXYA 1J97A 2XNDA 1ZRMA 3LT4A 1FSPA 2WKWA 3A05A 4D9MA 1OFUX 1SOWA 3RT1A 2VEDA 2JGRA 3KJIA 3QU4A 1X1DA 4RV4A 4GLJA 4WCFC 4O3MA 3COWA 3LUBA 5BV1A 3LCVB 2JLBA 4K3UA 1OXSC 4A7PA 1U28C 1P1IA 3MNFA 3W5CA 3PQ5A 1NJFA 5DFAA 2IIBA 1KVSA 2XYRA 4TKLA 3VR6D 5A3JA 2X3YA 3SS8A 5IULC 1UEIA 1YL7A 3JQ8A 3X2FA 3BGDA 4TYMA 5K7SA 3AY3A 3N2KA 1NULA 1O6CA 1KERA 1C7QA 1ENOA 1UMCA 3RRMA 1PHRA 1JEQB 4I4TA 4B6JA 4DSUA 4XWGA 2B9EA 1XVIA 2IHTA 4DZRA 5D6OA 1G9SA 4IJQA 5EHIA 1PG2A 5I6DA 4AJ4A 2I78A 4C78A 4DZZA 3QIAA 3SP1A 4F85A 5K3OA 4EW1A 4JQZA 1R4NB 1F0NA 1A2KC 5HFNA 4UNPA 4S1OA 1EZ4A 1EM6A 1DWPA 2HMVA 4LDPA 4IL5A 4WZAA 5JQGA 2QTNA 4OB7A 4MKHA 4DKJA 4CODB 3JQBA 3N8IA 4NH4A 3AKEA 3AUAA 3UCEA 3WGLA 1H05A 3QVTA 3JR3A 4Q47A 3N1UA 4EYKA 4R3NA 1E7SA 3QVXA 1E99A 1DDGA 5FIUA 5LDDC 3P5BA 4HADA 3RUCA 4G26A 2XUIA 2I66A 3WWDA 3ZTYA 1MORA 3M6XA 5FI5A 2ZWAA 1S4QA 4RPLA 3Q5DA 4IEIA 3C7AA 1A5AB 1C2TA 2DLDA 4IAOA 1VA5A 4Q1FA 3R8XA 3ZW8A 1FP4A 1Z83A 5FPKA 2JFQA 1EP1B 2V7XA 5HJ2A 5TF0A 2OD7A 1DJPA 1CQPA 2PPLA 4OSOA 1USKA 1GQYA 3MCTA 3DAPA 4M8KA 1OYVA 2DUWA 2J85A 1YI0A 3AR5A 3FMVA 4HATA 1VRVA 4RPGA 2NQ8A 5B7NA 2PUFA 5EGSA 3VGJA 1USVA 2R7KA 2HDWA 3AZPA 3CPJB 5HP4A 1D04A 1JJAA 2FWRA 2IX9A 1MOSA 1J25A 1GPLA 2N1BA 4OHVA 1AMOA 2MYPA 1RWBA 1UMBB 3CG0A 1D9ZA 4INPA 1SCQA 2H2AA 3GNSA 1NUAA 5T4HA 5JY6A 4JJAA 1WVMA 3QX3A 2J3KA 3GD7A 4HMPA 1YZFA 2JGIA 3N74A 5AM5A 2XTAA 4