3X1MA

Crystal structure of phosphopantetheine adenylyltransferase/ppat from pseudomonas aeruginosa with coa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
158
structure length
158
Chain Sequence
b'MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
molecule tags Transferase
source organism Pseudomonas aeruginosa 2192
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
total genus 55
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3x1mA00
3UOWA 1NUSA 1N1DA 1G8GA 1N2JA 3FH0A 3H99A 4OUDA 3IUBA 1N2BA 4DDKA 5J58A 3LCJA 3AG6A 1O0CA 3VU8A 4ZT3A 1U3DA 1J21A 3H97A 1YI8A 1FYDA 3CLRD 1EFPA 1BS2A 1WXIA 4ZT4A 3FWKA 5KCMA 3JXEA 3Q10A 3IOEA 2DEUA 1M8GA 1U3CA 3QTBA 1Y42X 1PFUA 2E89A 1NYLA 2IP1A 3ND5A 1GN8A 4ARIA 5FNZA 4MUNA 1RQGA 3BL5A 2QJOA 3G6KA 1KH1A 1KQPA 4H3SA 1CT9A 1NZJA 3CVUA 3QTTA 1GTSA 3ZXIA 4NAUA 2QUJA 3TQIA 4NDAA 4EG8A 1WXGA 3RJZA 5TEVA 2J09A 3GMIA 4EFKA 3CA8A 1JEEA 5TS2A 4MVYA 1EFVA 1F9AA 1Q11A 1OWOA 1K97A 4BWVA 5TGTA 1TFUA 2IELA 4R2MA 1WZ2A 4G5FA 3N8HA 1YIAA 4XFDA 2QUHA 3CR8A 1KP3A 1UFVA 4QRDA 1IQUA 3X1MA 1QU3A 1TQ8A 1WXFA 4PY2A 1U7XA 1M8KA 1PG0A 3A05A 1KP2A 1YUMA 1X8XA 2ZP1A 3PXUA 4GRIA 4DE5A 1WY5A 4K03A 1WQ4A 2GOYA 2Z3VA 4I6EA 5FO1A 2CV1A 3P0JA 1D2RA 4DDHA 4G5YA 5DK4A 1JEDA 2DERA 3C8ZA 3ISJA 1IQRA 2HMAA 2D13A 4MW9A 3G59A 3PRHA 1QTQA 4AS1A 2EJCA 3IMEA 2V0GA 1LW7A 4HJRA 4QREA 4RUKA 3VGJA 1QRTA 2PG3A 1B6TA 5DEOA 3D6UA 1EFPB 5J5AA 1N75A 2AKEA 3CLUC 1XNHA 1MRZA 4XSVA 1I6MA 1KQNA 2IJGX 2JAXA 4MVWA 2NZ2A 1YIDA 4TS1A 3DV2A 1NUTA 1WXEA 1EXDA 4NAHA 1P7PA 3SZ3A 3HZRA 1JECA 1Q77A 1OWLA 2J08A 2ZUEA 4WNYA 1H1TA 3ZXSA 1N2IA 1H3NA 2QUKA 5DASA 4U7JA 4CDMA 1Q19A 3AG5A 4FZJA 1V47A 3TS1A 2PFSA 1M1ZA 2DUMA 4EG1A 2X1LA 1KH2A 2QUIA 4ZCSA 4ZCQA 1U0BB 3U1VA 4G6ZA 1OD6A 5K0TA 2AZXA 4JZYA 1COZA 3IMCA 5EKDA 3RHSA 4MW1A 4YP5A 3K32A 4PBTA 4QBTA 3CLRC 3UC5A 4JFAA 3PNBA 3MUEA 3H9CA 1KR2A 3FETA 1H3EA 1MAWA 3IVCA 1KQOA 4MUIA 3LE8A 1OWMA 4U63A 2Z08A 3N2YA 1O97C 2HZ7A 1ZUNA 1VBKA 4EG5A 1TYBE 2YWBA 2J07A 1JGTA 1NUPA 1S4MA 3CLUD 1GZUA 2DR2A 5DB4A 4MW2A 3IODA 2A7XA 1M8JA 1VLHA 4ZT7A 3SEQA 4MQ6A 5BNZA 1IRXA 1GLNA 1N2HA 1OWPA 1YULA 3ZIUA 1T6XA 1WQ3A 4ZCRA 3RBAA 3D6VA 2D5BA 1T6YA 1MB2A 2VTBB 2XRYA 3QE4A 4KPUA 1TEZA 3X1KA 2A1UA 3KT3A 1ILEA 1KAMA 3FG9A 3ZGZA 4MVCA 1EUQA 3LOQA 4KR6A 2WQ7A 3ILVA 2BYTA 1NUUA 1JIKA 3GUZA 1N2EA 3MMXA 3MLBA 3HL4A 3MLAA 1VL2A 3KFLA 4NATA 1TYAE 2JA2A 1JHDA 2VTBA 3ZJVA 4MUEA 1KORA 1J70A 2Z09A 1QRSA 1O6BA 3FI0A 4AQ7A 1MBZA 1MC1A 3N9IA 5H16A 3A2KA 3COYA 2CV2A 2OQ2A 2HGZA 4MULA 3HFJA 4MW6A 2DETA 1G8FA 2GM3A 1N3LA 4EG3A 4J76A 4CT0A 2JANA 4U8HA 4ZCTA 3CVYA 1G59A 5JBNA 4F3RA 4YP6A 2DXIA 1HYBA 1PFVA 1SURA 3SDBA 3Q12A 1I6LA 1VBNA 1M83A 4UZEA 5KWVA 4MW0A 3CLTD 4DJAA 2O5RA 5LFAA 2BTEA 3RK0A 1NSYA 3DO8A 1T6ZA 2A1TR 2QTNA 4NX2A 3TNJA 2CFOA 3AIIA 4NZPA 1EFVB 1MOPA 1NURA 2WSIA 2AG6A 3GLVA 3ZJTA 2CYBA 4HK4A 4MWDA 1ZH0A 1O95C 1IH8A 2H2AA 2A86A 4KR7A 4K0RA 1O96A 3H05A 3F3MA 4CDNA 1N2OA 1IHOA 3AFHA 3HV0A 3DLAA 2NSYA 2PZAA 1R6TA 1H3FA 2E18A 4MAFA 4PBRA 2QTRA 4JXXA 4ZT5A 3PNYA 5F23A 1XNGA 4YBRA 1K92A 4DLPA 4KPUB 1R6XA 4EG4A 4MUKA 2PZ8A 4MUGA 3NBKA 5IJXA 4ND6A 4A91A 1O5TA 3COZA 1J1UA 4ND7A 4KR9A 4MUFA 2A84A 2E21A 3ZUGA 1O97D 4OUDB 3CVWA 3VRHA 4R2LA 4PBSA 1M8PA 3CVXA 1WJGA 2WB2A 1MAUA 3TZLA 4ZCPA 2A1TS 1WKBA 4ZT2A 3COVA 1QNFA 4JXZA 1MJHA 2YWCA 3ZJUA 3SYTA 2X3FA 1EE1A 3HMQA 2RE8A 1VBMA 5TEWA 4YP7A 1JIJA 3IDFA 1NP7A 4MLPA 3OP1A 3NV7A 5HUJA 3I05A 4Q16A 3X1JA 1JZQA 2EL7A 1V8FA 3IMGA 1O94D 3INNA 1PFWA 3FIUA 4EG7A 3AL0C 1LI7A 1T9GR 1KH3A 4MW7A 2O8VA 3M5WA 4DNXA 1T9GS 1J20A 2CV0A 1XNJA 2A88A 4E1AA 4Q93A 1ZH6A 1WOYA 3CLSD 3COWA 4MUHA 3SP1A 3UY4A 3P0HA 4X0EA 1GAXA 3KT0A 2CYAA 5K0SA 1PFYA 3ND7A 1F7UA 4YMIA 3SEZA 1F7VA 2R5WA 1G8HA 1JZSA 4R0NA 2A1UB 1M8FA 1NI5A 4HPWA 1O96B 1DNPA 2G36A 3NBAA 4S1OA 4EGAA 3IH5A 2CYCA 3ND6A 1X6VA 1J09A 2QJFA 3UMVA 1TYDE 4P2BA 4MWEA 2E0IA 2I1LA 4JYZA 3IUEA 1XJQA 5HG0A 2TS1A 4XFJA 1N78A 4KKVA 3CLTC 2PIDA 1IFXA 3KT8A 1O0BA 1O94C 2PZBA 3UK2A 1YUNA 2CUZA 3FY4A 4RPIA 3IVXA 3RK1A 3P0IA 1Q15A 2QTMA 3A4IA 2XRZA 3FDXA 4DDMA 5IHXA 2CT8A 3Q4GA 5FO0A 3S3TA 1O95D 1GTRA 1TYCA 3KT6A 2GKSA 1I2DA 4EF6A 1J1ZA 2VXOA 3CLSC 5H7XA 1MB9A 4MVXA 1OBHA 4CQNA 1IVSA 4L2IB 1F4LA 1QQTA 3RFFA 2B7LA 4MWBA 3IVGA 3TQOA 1QRUA 3H9BA 3G5AA 3L93A 2DPLA 2DLCX 2X0KA 1I6KA 1N2GA 3DPIA 3IOBA 3L92A 2RD2A 1K4KA 3N05A 3P52A 4MWCA 3MXTA 2PXHA 4WSOA 4ARCA 4EG6A 1R6UA 3K9WA 3FOCA 4I6JA 1FFYA 1NUQA 3IOCA 1GPMA 3SZGA 1JILA 3TZEA 1KAQA 1IQ0A 2YY5A 2QJTA 4OJMX 1ZJWA 3PNVA 2D54A 4HJXA 1EUYA 4ZT6A 2C5SA 5HUHA 3CVVA 5LLTA 1ULHA 5J59A 4J75A 3FHJA 1EJ2A 1QJCA 2J4DA 3E27A 4MW5A 2WQ6A 1OWNA 3OTWA 1OBCA 2YXNA 2V0CA 2H29A 4UZFA 1JMVA 1JIIA 4F4HA 2J5BA 4MUJA 3HGMA 4GU5A 3AKZA 1U7DA 1PG2A 1KKUA 1QU2A 5AHWA 5LM3A 1N77A 2CSXA 2A4MA 4L2IA 3A04A 4MW4A 2X1MA 4I6GA 1WXHA 1A8HA 1LI5A 5KHAA 3ELBA 1K4MA 2OV4A 2ZUFA 3FNRA
chains in the Genus database with same CATH superfamily
2GRAA 3UOWA 4CIBA 1N1DA 1B1CA 1I9CA 5AHRA 1YQQA 2R7AA 3JTMA 3KQWA 3L8MA 3ABOB 2CLFB 4UEQA 3UKOA 4CI0B 1M1NA 3LCJA 4CM6A 3QMPA 4IWNA 4ENVA 1FYVA 4INPA 3R74A 2R00A 3IBYA 1RBYA 2A9VA 3LZ6A 2CFSA 2JLAA 1WCIA 2H9YA 3UB2A 4UAVA 3IILA 3NKLA 1FSGA 2QHXA 2CCGA 4UUPA 1CDOA 4CF3A 3LQFA 4OVKA 4TXJA 3WP0A 3CX4A 3RLIA 1U6IA 1BS1A 1JA1A 2VH2A 3EZ6A 2OA0A 2XNCA 1BXGB 4JI3B 5E2IA 2FWPA 4RTKA 1WB9A 1OTXA 1F8GA 2HMTA 1B2RA 2X13A 1IYZA 4ZTUB 1A8QA 1NQWA 4B2PA 1HRKA 3KYIB 3UOAB 2QD3A 2PMKA 1FX0A 2ZYSA 1C1DA 3KSUA 4CM8A 1N6RA 3EZXA 1GTSA 4BFSA 3T9FA 2VHZA 1XXLA 1HLGA 1OFVA 2OBNA 4EF4A 4E12A 3ZIAD 3F4LA 3GCDA 3KVNA 4P3KA 2VDUE 4K6KA 3KFXA 4UDXX 5AOAA 3EEYA 3HNOA 4JLKA 1F9AA 1Q11A 3U3MA 2EU8A 2OSVA 3C98A 1XJCA 3AJEA 4TS3A 3OQHA 4X6YA 4PZ9A 2XAUA 2B3DA 1VE3A 1XR3A 3Q7RA 1XL1A 2JK1A 3KFVA 1ADJA 2K7FA 3O73A 1J5PA 1KMHB 1PZMA 2PQ6A 3M5DA 1BC5A 4CTJA 1Y5LA 3SC3A 3KR9A 1GTG1 3V4PB 2D2FA 4DDWA 1I2ZA 4TWJA 4YUZA 1NN0A 4O2AB 4F5EA 2HZBA 3QSYA 3MIIA 2VYCA 3WFJA 2F1KA 3I45A 4EB0A 2POQX 3C97A 1HH4A 1IN6A 4DUGA 3QU4A 4M22A 5BUZA 1SVLA 2JFNA 3MB5A 2J31A 1UAGA 4LYJA 3GW8A 2PR7A 3R23A 3LO8A 2RH9B 2BGMA 3UCEA 4TSRA 2FRXA 4C7BA 5DBIA 2WHXA 5T4HA 2R8RA 3IEXA 5AW2A 1V1MB 4HWRA 2IHBA 1IUKA 1FJHA 3MNFA 2OUIA 3O4JA 3ONEA 4ME6A 4OK6A 2WJJA 3JQGB 5DK4A 4D3XA 1CUJA 2JZNA 3DXYA 4HQRA 4HN9A 4H6PA 3EAQA 2AEMA 2G9ZA 1JTEA 3C8ZA 3A25A 2V5AA 4KWHA 3TN7A 3OPYA 1KIFA 4MW9A 5E1MA 3RF7A 4ARZB 4AU1A 1HG0A 1IXKA 4BV3A 5K8LA 2JW5A 1CS0A 3IKMB 4DSUA 3PFIA 4MV5A 3BG5A 2WY2D 1NRXA 2XDQA 2ZW9A 4QREA 1XF1A 2P5YA 4P7GA 4RUKA 4AROA 1QNLA 2IA5A 1T8TA 2VTDA 1DUIA 4XVQA 4ZVQA 3SKXA 3NETA 4A8PA 1QRTA 4CTNA 1M1YE 5DSZA 4P58A 4X93A 4O4IB 3VC3A 4EJSB 2WILA 3LXUX 3NHKA 1G38A 1H1LA 3UAXA 3D8HA 2V8OA 3FBTA 2ODWA 3SX0A 1J8FA 2GN8A 1Z74A 2NV0A 4P8RA 4JL8A 5AT1A 3H5TA 1BVUA 1KO8A 1RQLA 4JLMA 3SYRA 4P3XA 4B85A 3WGQA 3V8BA 1Y1PA 2WTUA 4FE4A 3F5SA 4K88A 5DO9A 3F3YA 4C4YA 4OFXA 1EP3B 4NDNE 5BYKA 4IIJF 2Q2NA 1T2EA 3I5MA 3BD9A 2FDXA 4P4TA 4UKDA 3UFXB 4A8HA 5IDQA 1ANKA 1D9ZA 1W6RA 3H1TA 2HXSA 3A9CA 3JQAB 1XAJA 4FCWA 4J1NA 3VJMA 3ZDRA 3L7LA 3O74A 4CQMD 2VQEB 1U0BB 1ACJA 1ACMA 2WZBA 3U1VA 1THTA 2V59A 4OP3A 1Q22A 5KJFA 3GMDA 3P9NA 1VFPA 1VL1A 2JH9A 4ED9A 1Z36A 4QBTA 4KN9S 1FMFA 4J2TA 2G71A 3CF2A 3G0HA 5FOTA 1S7CA 4MKZA 1A4RA 4PQGA 1U8YA 2D0DA 4WV3A 3DJYA 4RPCA 3C4VA 4TMFA 1R2QA 1ML4A 3I6BA 3JSXA 4IUYA 1LY1A 4MR9B 1O97C 3RABA 3ROFA 3QI2A 5EUCA 1WMDA 1CEXA 1I51A 1ZIPA 3IEIA 2GO7A 4C08A 2OZLA 4UOEA 4BP8A 4GR5A 1Y6QA 4JYCA 3VAYA 4MI1A 2DR2A 1N92A 2ZPTX 4I1OA 4WA8A 5EIHA 2NXNA 1EUCB 3BD7A 1NPTO 1G7RA 3G88A 4LIPD 4RLFA 4TMTA 4ZT7A 1XO1A 3H13A 1PJCA 2FQXA 3ZWMA 1XJ5A 3GRPA 3EB9A 3JYHA 3QV2A 4HVTA 2GZ2A 2C9MA 4ND4A 1KKLA 3QFHA 1E79D 3E5MA 3L4BA 1QJ4A 4L3VA 4RA9B 4ERNA 2BEWB 2FN8A 1AQ6A 2AN9A 5EWJB 5L4NA 2RGEA 1KDRA 1KZ1A 1R8XA 1MB2A 4B43A 4LCJA 3O8DA 1NMQA 3Q7TA 4UDYX 1O6CA 1YDHA 4PPQA 1HYEA 8ATCA 1GU0A 4PSCA 3DUFB 3VR6D 4GBGA 3EFHA 2VRNA 1ZONA 5DCLA 7YASA 1EG7A 3KM0A 2K5UA 1WPRA 2IIVA 4KQCA 4ACBA 4LF6B 1T0BA 5JNRA 5CX1B 3E3AA 2DE0X 1USKA 2IZ1A 3NWOA 1LKZA 3DWIA 1QWSA 1VG9B 3BFXA 4UXIA 2B6HA 3NHAA 4H0NA 5BR4A 1JR3D 3D4PA 3DZJA 3LQ2A 1ECCA 1KORA 2JGDB 2UZ1B 3PEYA 5EWJA 2BUAA 2QY9A 2OP1A 3FYUA 4P3OA 3QVKA 1SBQA 3A2MA 4E07A 5KYUA 2B61A 4GIBA 5H16A 1YBVA 4GEGA 1TCVA 1YU6A 4JC5A 4BFLA 4D02A 1H1DA 2JARA 2OQ2A 2N47A 4Q03A 5FBRB 1U1EA 4GOND 5KTSA 1UIMA 1YQWA 2Q2QA 4DSTA 3H2SA 5FBWB 1M2OB 4EG3A 4UAGA 1Q44A 4HAZA 5AM0A 2EJVA 5ADWA 4S05A 3CVYA 1G59A 4MR8A 3OY2A 3W79A 1KWGA 1HNWB 5JU6A 5TSDA 3ERCA 4MVJI 1HYBA 1IY1A 2QR3A 1XTQA 3BWBA 3IUPA 1G8YA 1QHXA 1QS0A 1R0ZA 2E6UX 3E7WA 4JCOA 4JXJA 4ZAGA 1NYQA 1UKEA 1XWIA 4G1VA 4LGYA 4QXMA 5L4LA 5A2QA 2BJVA 5DGCA 3NH9A 5G1NA 2AYYA 3CLTD 5K0JA 1LBTA 3KR0A 2P9QA 3TK1A 1GN9A 2XCSB 2AZ4A 2JNWA 4C30A 2QM3A 5JXHA 1ZNXA 2I22A 4YXWA 3RVBA 4Z49A 4KYTA 3RRJA 1EVYA 1KVSA 1O89A 3NASA 3T7EA 2D5CA 1EP1B 3NKFA 4HEQA 4YONB 1N5OX 3TRJA 4BJ1A 4HH3C 5NLLA 4S2UA 1RKVA 1ZD4A 1QF7A 3H5VA 1PJ8A 1ID8A 3AERB 2PKWA 2PGOA 4XIFA 4K0RA 3ZBPA 3QPBA 3OWHA 1UK9A 3F3MA 1QF6A 2OVBA 3G7SA 3NEJA 3QZUA 4EW1A 3M81A 3D6AA 4LYEA 2I67A 2J3HA 4MXDA 1JVBA 2X42A 3AILA 3VKUA 1PVVA 2C3YA 2UUBB 1JAYA 3PDUA 1KU6A 3KOXA 5FB3A 3STHA 1KL7A 2QG4A 3ESCA 3E8MA 1PEDA 1GYQA 3LYUA 4V1CB 5DYIA 1K92A 4RK4A 3OCVA 1RZRA 2VL7A 4Y3UA 1NQOA 4X1KB 1ISJA 3NBKA 4RLHA 4EEXA 4ZU1X 1O5TA 4U7FA 3GZNA 3FUUA 1NDUA 4D44A 4DHWA 1TVMA 5AKEA 4GO1A 2ERYA 1LPNA 3DMRA 4JLDA 1XZDA 5JXWA 5G1OA 1TJYA 1M76A 3NBUA 3E8XA 4TTPA 4B47A 1P91A 2PTGA 1P80A 4Z8XA 1EP2B 3OQ1A 2KLBA 2QTFA 3WLEA 4UMFA 3E9QA 5DMXA 5KQPA 3BJEA 2DBYA 4DC1A 1H69A 3IO3A 1X8JA 3H2JA 2YN0A 3LGAA 3UJ8A 5IMSA 1EB8A 1R9MA 3RBZA 1IONA 5JECA 2DLDA 4JX9A 4NSNA 3AQ4A 2X9QA 5L3RA 1T4BA 3SR0A 4PYOA 3GLFB 4JKYA 2I2AA 1ZX1A 1U7PA 3R0VA 3SS9X 1NP7A 3SF0A 3QENA 1Y3CE 2GEUA 2HBYA 2XA1A 3P2OA 3I05A 1AKRA 3ZLTA 1W59A 2C8KA 1J9EA 4XQ9A 5JSHA 3W3AH 2PS0A 4OJYA 1P17A 3ESYA 1N3BA 5DX0A 5C37A 3LSTA 4D25A 1AQNA 1P33A 3FGOA 5B1EA 4CQMA 3OEEA 4N7RA 4OK3A 2R1ZA 4RACA 2QRGA 4DNXA 5A0TA 1CUDA 2IC5A 3CRRA 2CNNA 2B78A 3I32A 3TE6A 3ESXA 4X7PA 4H7EA 5IVDA 3QU5A 4E5VA 4ENRA 1C2YA 1T9ZA 1WOYA 4Y2VA 4LNUB 1ODSA 1ZR4A 2CCKA 1PSWA 4LDQA 4V1CA 4BQEA 1RJ9B 1U5AA 3RYHA 1JQEA 1G4UR 5HGXA 2FZ4A 4OAQA 1V48A 2PZKA 4RK5A 5BW4A 5AO9A 1RYHA 3DL7A 2VATA 5HTKA 3IHTA 2QTCA 3Q3EA 4WZBA 2C88A 2Y0PA 4WESB 4G0UA 1QZXA 4RVCA 3T5MA 4CW7A 4E3WA 3KQPA 1PFQA 4P5PA 4TWZA 3FHTA 1U11A 3L0ZA 4FEEA 3TTTA 2O3TA 1IN8A 2QTAA 4BBJA 1J0AA 4N0DA 1D1QA 1PEYA 3BBLA 3G13A 2PK3A 1DWPA 2VTKA 1JIUA 2A9OA 4EHHA 4M21A 2GK7A 2AJLI 3KCNA 3M9LA 4U5XA 5I45A 3R6WA 4Z8YA 4L6IA 3ZBTA 2XDAA 2ZYRA 3KYJB 4OU4A 3LLUA 1DI0A 1FUYB 1T2UA 1I3NA 2PIDA 5PNTA 4OHMA 4C78A 1G0OA 3OJEA 1KVTA 2DUJA 2GAFA 4XD7D 1Y6JA 5IKOA 4DA9A 1GA4A 3RK1A 1SFRA 3B7WA 3I9KA 3KBBA 3RU7A 4PNZA 4QEZA 1EFKA 4DJJA 5JMWA 1VHJA 5LU8A 2ABWA 5FUMA 2GBGA 2IS4A 2ZAMA 1H2RS 4M8NE 3LP8A 3TMYA 2Z3ZA 1UK8A 2LIVA 4UMVA 2KWIA 4TX1A 4B3XA 5CX4A 3W5AA 1UBKS 4D4JA 4LYYA 3C85A 5ECWA 1AXGA 1JRLA 3KV3O 1QIFA 1Y1KE 2EV9A 5LMUB 1W96A 3ONFA 1Z4JA 1RHRA 2QP3A 4MYUA 2F3TA 3RFXA 3KHSA 4DIDA 3TSWA 2Q3CA 3PQCA 1M7BA 1EDDA 3KAQA 1N6IA 1C9EA 2QZZA 1WXDA 1QRRA 3RAJA 2WA2A 2H4WA 4FHZA 2EF1A 2FE1A 1E7WA 3G5AA 2J4FA 2R2GA 1ZW6A 2C5AA 5IAGA 1T5SA 2V7WA 1ZJJA 1E1RD 4AQYB 2FJUA 4BB9A 4KFCA 3F6BX 3QJYA 4OKSA 2Z5GA 3L77A 4WECA 3RUHA 2OCGA 4RDIA 3SMQA 1AZLA 3TOXA 3ZWBA 5FTLA 4I7EA 1EZ4A 4IFEA 3C45A 5HZHA 1R6UA 5IHPA 2NW6A 4QAQA 2EBUA 3V9AA 3CRMA 1LC3A 3A26A 4BNHA 1Y3HA 1ZZEA 4HDRB 1UKYA 5K0FA 5JJIA 2IDZA 1CUUA 1Z56C 4OCZA 4DYHA 3HO8A 2NVWA 4JA2A 3AVVA 2VK1A 3PCTA 5H0IA 4QRHA 221PA 2WMOB 3BCUA 4GYKA 5MN5A 4K28A 1PI3A 1RJ9A 3EZ2A 4J3FA 4IWYA 3SLRA 3ORSA 4BO6A 4GSYA 4U3JB 2W98A 3Q9SA 1T0PA 2X8JA 5JAIA 3K15A 5C3MA 4AKIA 3PD0A 4BFVA 4AKHA 1T36B 1AKWA 3KAKA 4YUWA 3B53X 3U7FB 1KY5A 1C29B 1H5UA 3EWSA 3IIKA 4L16A 2UKDA 2WSBA 3OCJA 4KRXA 1DL5A 1MA3A 1W4CA 4J6FA 1Q2UA 1YRWA 4KIFA 4NCNA 1II8A 4UZFA 5IM5A 3GJ3A 1DAKA 1JLLB 5I5GA 1YDMA 3RT9A 2BGJA 4D9FA 4MKHA 1PR9A 1IRIA 1I5EA 1SVNA 4PTZA 1KKUA 4UAUA 3RV3A 1XP5A 3UOGA 4HBGA 5H9VA 2YHBA 4IVRA 1MX3A 1RYMA 2MSEB 1QV9A 1ZP6A 4YCDA 1ZLYA 4Z5XA 4IUBS 5JHGB 4Q3EA 4LF9B 1OAOA 5B1IA 2QRMA 1USUA 1FZTA 4OXKA 4AZ3A 2H11A 3PT9A 3W6NA 3HI4A 3NHMA 4MYTA 4XOIA 1PBNA 1RHKA 1B3BA 4K1LA 3KAJA 1P45A 3FPLA 2H63A 2Z5VA 5IJWA 1IMJA 2JLXA 1FS5A 1QRAA 3F7OA 2HIMA 3U3RA 2FFRA 4AUMA 5FNVB 5BV2P 3HXQA 1J5XA 5IEJA 3DAOA 3EUEA 2J41A 3FNRA 4RGVA 3SIWA 3VPDA 2C3PA 2X8AA 3BB3A 4W8OA 2P2GA 4YLGA 5LP6C 5C4IA 4GBMA 5JMOA 2XDYA 4CIDA 5LR6A 3G82C 1CZLA 1V3QE 3DVLA 1R6BX 5C5IA 1CKEA 3MA0A 1CUBA 3D1JA 3WIUA 1GGKA 2Q5OA 2PYZA 4FYXA 4KFSA 3PX3A 2BGWA 1H4SA 4NYMQ 4NENB 4FQ7A 3FCXA 3V8EA 2QBYB 1PR4A 3U40A 4BLSA 2VCHA 3PUIA 4Q3OA 3RS0A 3ZKWB 1ZESA 4IYRA 1U8TA 1OXMA 1R50A 3OC6A 4XCXA 2XF8A 4ZOEA 2ZI7A 4CLOB 1ZBDA 1CT9A 3EVTA 1UBGA 1Z0SA 3NBZC 4CEJA 2ZCUA 3QUBA 1ADCA 3ZXIA 1Q1QA 4TLMB 1RLOA 2PUWA 4F3KA 1YR1A 2V55B 5F76A 1AUVA 4O33A 4I1YA 3CQ9A 2G1JA 4NBUA 4BU0A 4PHTA 1JQBA 3WZ2A 1TZMA 3MAJA 1K97A 2JFOA 3QQ5A 4Q3NA 4I5GA 1MD9A 3RS7A 2IELA 1L6RA 3MTBA 2O7VA 3M4YA 3FFBA 3ZZUA 2C2GA 721PA 1I94B 1AC5A 4NTZA 5CIQA 5LMCA 4TYPA 1X92A 4MJLA 1LB1B 3UBMA 4DLAA 1SHJA 3CBGA 5KYNA 5F52A 3FHLA 4NU5A 1DO2A 1MOQA 5G4LA 1DBSA 4MVJP 3SDZA 1D0IA 3LHDA 4ZKDA 5B3JC 2LPMA 4WKPA 5DN9A 1TTQB 2FNAA 1LRJA 4DE5A 5I51A 1CUAA 1OAKA 4QLOA 1I2BA 4Y30A 3RSFA 2NZ8A 2Q50A 4DUPA 5D00A 4MUMA 5CT4A 1JBQA 3AYZB 4W1RA 4IHAA 3SU8A 2B8WA 4UBNA 5EESA 4EY6A 2OCBA 1M2HA 4ETWA 5JI3E 4QNRA 3VPCA 5B1SA 4RPLA 1DJNA 5GJVC 1OBOA 1JEDA 3CT6A 3DLTA 2QYOA 2ZJ6A 4RVUA 1AUPA 4NV3A 1RLIA 4MGEA 3ZE0B 2QRZA 3ED1A 4NEQA 1KZ7B 1UFKA 3OQBA 5F33A 1HOTA 2Q29A 1G0NA 1M54A 2AJBA 2QTTA 2HPVA 4GDMA 4XX0A 1GFWA 5JS7A 5L3VA 2I55A 3BL6A 1E1YA 2PX5A 3G17A 1TO2E 1RC8A 1OKKA 1HE3A 1RRCA 3DUFA 3OMWA 1AMOA 2V98A 4Y7CA 2YRWA 1Z18A 4ESEA 4DWVA 1H2WA 4G0WA 1ZA1A 4NJMB 2YZKA 1WCIB 3L8ZA 4RANA 1KARA 2FZKA 2IJGX 4G5HA 4RLQA 5AXBA 4B6SA 3RAEC 2P90A 4HDCA 3PX7A 1Y9EA 5EJEA 5JJKA 2FSPA 5KVVA 2FMUA 4DBLE 4E22A 2VAVA 2AQKA 2X22A 4QBKA 2ZUEA 2GERA 5CUQA 4NP6A 4ZVLA 3S1LA 2QBYA 1N2IA 2JJ1D 2GO1A 3AH8A 3JD1A 4RF4A 1AQJA 3NRCA 2CLIB 1GQSA 1XSEA 3MTEA 2IODA 2R5FA 2XT9A 3WL5A 2OZLB 4L4YA 2FH5B 1KH2A 1TYZA 1Y80A 3ZU2A 3DVRX 1W0JD 1SXJE 3VKGA 2ODAA 5BRNA 1B43A 2Q0QA 1ODKA 4F3TA 3LCCA 3HC7A 3VZDA 4B1FA 2ZJBA 1G8AA 1SD2A 4RH3A 1CZHA 4CIAA 1VE6A 2WINI 3UC5A 4HDQB 3VM6A 3RHTA 4M1KA 1SXHA 2IZ6A 3A36A 3BXXA 1V7CA 5CFMA 3NOVA 3TQSA 3H9CA 3FZQA 3CYFA 1RTKA 1WW8A 3O94A 2WBLC 2BRUA 1DCFA 2DTEA 1FVHA 3KV1A 5K0BA 2XNDA 2D3TA 1OWMA 5DF1A 5DI9A 1H66A 4TQ9A 1MTOA 1NBIA 3BERA 2I7TA 4KSBA 3WQRA 4CUKA 1UXIA 2J9XB 2LDBA 1HE2A 5JROA 1K6IA 2HNKA 4X3CA 4YJHB 1N1GA 2YINC 1QGDA 2JJYA 4WNAB 5EJGA 4UOQA 4GR4A 2FP4B 4Z1MA 3PGXA 1M8JA 2X0NA 2W2QA 3HP7A 4UQOA 4YJ3B 4RJKA 1XZCA 1WETA 1UBOS 2XB6A 5ICEA 3VAZA 4BLOA 4M76B 3HZZA 1I7SB 3N6RA 1OWPA 1XCMA 2QTBA 3U17A 5F9MA 3V42A 4E3ZA 4KE9A 4FR0A 1RJGA 2HSWA 4U2GA 4IICA 3VAAA 3T9CA 2FPRA 4OSEA 4ZO4A 3A3KA 1O9HA 4AG3A 4X1KA 4B31A 3FKJA 1I8TA 3A58B 5EIOA 1RPJA 3E9RA 3U16A 2IYYA 5K09A 4PX9A 2BFPA 4QGSA 4C01A 1TK3A 3OQVA 1N0HA 1R37A 1X42A 3GXBA 1ILWA 1MXHA 5IPFA 1KFKB 1EUQA 4B2IA 3MQ4A 2Q45A 3WBBA 1FDWA 1JE0A 3ENQA 4HXFB 3I4FA 3QU7A 3WDLA 1JH9A 3GWGA 4UQPA 3EGDB 2A2ZA 1BWPA 1HKUA 1G5HA 5EZSA 5B5SA 3O8CA 1M2JA 3HB4X 4WCVA 2XTJA 1OF1A 3CNBA 3RB8A 1V41E 1JJ7A 2QR2A 3R75A 3BMNA 3C3DA 3RFTA 2IHJA 4X41A 5A9SB 2F90A 1ODLA 3BYZA 1IOLA 5FIUA 5M7EA 2FW8A 2HK7A 3M2PA 1J5EB 2JH3A 1REQA 2Y0EA 4M53A 3WGUA 3MJCA 3A6KA 3ASZA 4Q7EA 2PJDA 2ZI5A 2DR3A 2G6TA 3BMOB 3HFJA 4MW6A 4NZ9A 4CM5A 1WCV1 1QIGA 5BORA 1X1AA 2FPGB 2QZJA 2XYPA 1OLSB 3ND9A 5A7FA 3C87A 4PSUA 5KQMA 2GILA 3V7UA 4P32A 2HDWA 3UJPA 1GRQA 4ZV7A 2PDAA 4CHGA 2PX8A 2QE6A 4E31A 3LUBA 1U3VA 5C4GB 2DFVA 2QX8A 3DE0X 1GQOA 2GGSA 3QEJA 4GVLA 1Q7BA 2PNJA 4UCXA 4W4TA 1SVWA 2PJRA 1COWD 4EY7A 1XDUA 2VHUA 4FHDA 4J7XA 2M6RA 1SD1A 3AESA 5GJCA 5BV1A 1LTKA 4X8HA 3BSWA 3AHIA 2J9ZB 4DKXA 1T6ZA 4K6GA 3UXHA 3GFSA 5KSZA 1L4NA 5EAIA 2BZ0A 4MH0R 3SC2A 3WGNA 5B3LA 4TQAA 2BFDA 1GSHA 1VMAA 1BX1A 1OC4A 2HO4A 3D4OA 1EFVB 2ZRNA 5EZYA 4N47A 4ZYWA 3N58A 5KVQA 3R77A 1NOIA 3LRPA 4WKGA 2B0JA 3FYUB 1P6UA 5ARCA 5FXMA 2XMPA 1BQEA 4DV7B 3I2JA 1QBKC 3LY9A 4Z0HO 3EVAA 1TM3E 1NF2A 2PWPA 3P71T 4CKYA 1NZFA 3E03A 3GJ8A 1KI6A 4L7QA 3RS2A 5KTMA 4QUBA 1KXJA 5LC1A 3MOSA 4MAFA 2GAOA 2UVPA 1P4JA 2IYLD 3X44A 2YFKA 3Q8MA 4ZICA 4UW9A 4M83A 3AF6A 1VCHA 3UNXA 2C00A 2NU6B 1HDXA 3F4KA 3IP8A 1QOQB 5DX8A 3RYFA 4EW6A 2R87A 3LTEA 1YAJA 2AUMA 3OM8A 4KFRA 5IVHA 4RCYA 4WCFC 1K1EA 1QP0A 2F8MA 5JAOA 1UBSB 2YDYA 5EXDA 1AZTA 1V6AA 1JIXA 4G23A 3K6SA 4LQDA 2IXDA 2ZIVB 5ILGA 1A8IA 1VLQA 1J97A 2W0MA 1E3JA 3O4RA 1M8PA 2A0YA 3PTLA 1WTCA 1WJGA 3DVQX 3H11A 3EDYA 5FL7A 3MOGA 4BO7A 4RTPA 2WB2A 1E2LA 1FS4A 4NR0A 5FUYA 4FT2A 1MZVA 1E20A 1T26A 5FR2A 1EFTA 3VDQA 3LHSA 4AMUA 5CVEA 3MT7A 2AK2A 2REXB 4AYWA 5TVKA 1GA1A 1QNFA 2PSSA 3R09A 4X62B 4TLCA 2AJCA 4AY3A 2Z6UA 1F60A 5CB4A 4YCAA 4DL9A 2DUUA 3SVLA 3RYIA 2FPIA 2J85A 3LVQE 1SOMA 5DPMA 5GVSA 1T5TA 1H4TA 2C77A 4NU0A 5FI3A 2HEGA 5MDHA 3AVXA 2CB0A 2AOTB 1E9FA 3A1SA 3GFPA 8ADHA 5BSGA 1DZIA 1OLSA 4QDJA 3RHZA 3R9WA 5F78A 4EJ2A 4LKRA 3RC9A 1SHLA 1VCOA 3R1IA 3DAPA 2WLSA 1IDN1 1KY3A 2V7BA 4OGWA 3K9GA 4D4HA 2JFVA 4ZQGA 4EUFA 4EG7A 1OBVA 3DBIA 1TOAA 2V6IA 5IVPA 1YKFA 3L05A 4QJ3A 3FNHA 4IJVA 1TK2A 2CHUA 1DG1G 3IV7A 1Y63A 4GBED 4PNHA 5JCOA 2FWIA 2G8LA 3VR4A 4RVGA 4N9WA 1GT6A 2KLHA 3REFA 1H0SA 1TT7A 2FTKE 4X92A 3UFXA 1EVLA 4TLEA 3RS5A 3K2IA 4PYNA 2ZBVA 1KPHA 3COWA 4MZDA 1P61B 3MWLA 5T4FA 5TQJA 4BP9A 1F8FA 2I29A 2VYNA 4X1YA 3QOXA 3S99A 1SELA 5KAMA 3IIEA 3MRTA 1G21E 1K6EA 4XLZA 3PR1A 4REMA 2OHHA 3G2KA 4BGUA 1AGRA 1MRSA 3SJAA 3SEZA 2VRCD 1R5OA 4OGKA 3B1FA 3EXG2 1NI5A 1C0LA 4KRYA 1VKHA 5HIMA 3I83A 5JEEA 1ZC4A 3IBSA 5FI5A 4U7PB 1JU4A 4RCVA 5FOQA 5LOVF 4EUKA 3CW9A 3F8SA 3HB5X 4JSRA 5KYVA 3OPNA 1K0FA 3H5IA 1MX5A 3IKLA 1JR2A 1DC4A 1PD0A 2QVGA 2RHHA 3I1IA 4LXHA 2MSLA 3RRFA 5GOZA 1JU9A 1P3DA 1RIIA 2IHTA 5FA8A 1G6OA 5FQNA 2XCOA 1CS0B 3IUEA 1P0CA 2JLQA 3MELA 4KK4A 2IBMA 4NARA 5CVJA 3TRDA 4DLNA 4KIGA 4PX2A 1X7XA 4I0WB 5DCWA 1US8A 2QPTA 3HB9A 1W5EA 3I76A 4HB2A 4YB8A 3PDWA 5HYVA 2V3VA 4N3AA 1PZGA 4M7OA 3ILSA 4HZUB 2PZBA 1U0JA 3VPXA 1MW8X 1Y1TA 5G1PA 1MFZA 5TC4A 4ZHQF 2F9LA 3KPYA 3L1JA 5AK6A 3W90A 1FSFA 5IH3A 1W44A 4O29A 1OT3A 2IUFA 1HTTA 4DDMA 3BZBA 5JWOA 2HWYA 4AAYA 3CF0A 5JY1A 5KU7A 1V6CA 2IYEA 3S5UA 4FHFA 5F7XA 1WG8A 4KQJA 3SBDA 1CPYA 2NTNA 4KODA 3L7JA 2IEBA 5KOYA 3WLNA 2JIMA 4UCQA 4PC7A 1SZJG 2B4RO 2Q5IA 3RC2A 1QS0B 1E60A 1XCPA 2ODQA 4X7MA 4YAGA 2FU5C 3RRBA 3ETJA 3ANYB 1H4VB 4PGHA 3AKYA 1OX4B 2QLTA 1KMHA 5EP2A 3FMOB 2XYHA 2CDNA 2DRIA 3ESAA 4CDRA 1KGDA 3UQZA 1ZJ4A 4N39A 3QXCA 4HZGA 5ENZA 4YUYA 4F7DA 4JLVA 3ZGNA 3WZLA 3WBFA 2D5LA 1VJRA 3TW6A 4LYAA 4ARCA 1P2UA 4OI2A 1QQ6A 3D0QA 4LV5B 2WNHA 4RY8A 3H1GA 3Q9NA 5JZ9A 1CRPA 1ZCJA 1G2OA 2GN2A 1QYXA 4FU0A 3UA4A 1XZLA 4CM8B 4QODA 3ZD7A 2CLHB 3RODA 1ODJA 1CY6A 5BOSB 3OE4A 1KAQA 3D0KA 5FPQA 3N39C 3NGXA 5JT1A 4Q3LA 1OGJA 1JJAA 3JAWB 2QXYA 4WEQA 2GM9A 3O3MB 4YQYA 3DBRB 4E5DA 4G1BA 4XD2A 5EP3A 4HHEA 4IIGA 2NN3C 3VPHA 2JIZD 1OAAA 3BH6A 3FHJA 5D51S 2RJNA 3V4FA 3COSA 2AR0A 1SXJC 4IP0A 3PYLA 1QGUB 2X76A 3AK4A 1CZRA 3FYUC 1M33A 1PGPA 4X90A 1Q95A 1Z5VA 4JFRA 1ZISA 2X0EA 4YUAA 5DLQC 2WHRA 1PVDA 1IJEA 2DWOA 3AINA 3O9MA 3ONWA 1XBTA 1DJLA 1WA5A 3GGGA 4MKIA 5AMXA 1O4VA 2NYUA 4AKSA 3DYVA 2QJWA 3WLFA 1BN6A 2H7XA 5G3ZA 5LN1A 5EJ5A 1M6WA 1UBLS 2R68A 3DOCA 4CLRB 3LQ4A 4BMYA 4EMBA 1E3SA 4CCYB 3E9CA 1UQUA 1WBJB 1X86B 3KZMA 2V6BA 1MO4A 4FDLA 1ENZA 2IX9A 5GJWC 3B38A 3UMCA 3HN2A 2NX2A 1FMJA 4YNBA 4J1QA 4NZOA 5HM6A 2W4MA 2OORC 3PQ7A 3E7XA 2EFHB 4V2IA 1BGXT 1EDEA 1F14A 2X3UA 4G0MA 1T5BA 4ZDKA 3ELBA 2BFCB 3SEFA 4A15A 1NJFA 3BCRA 4IGEA 3C8HA 1E5QA 2HJHA 1IUPA 3IR5A 3F7TA 2GRUA 2Q2OA 5KAPA 4S1WA 3HJBA 2BOVA 3N0WA 5DM1A 5JVDA 1D7OA 2ATXA 3W5DA 5L6LB 4IIHA 3IUJA 1ZJ5A 1E7SA 2BI7A 4X94A 3ZG6A 2FZWA 3ST7A 1LSOA 2J7PA 2ZROA 3A4VA 4MV3A 4PRLA 3TQTA 1TAGA 3LUAA 2NV2B 4JEIA 4ZQCB 3ROMA 3G8DA 5T8KC 3GDWA 3FBWA 1A98A 5EZ6B 1LJ8A 5ICMA 1H0RA 2E4UA 2O2DA 5IW8A 1ZOSA 4S35A 2AOVA 2VJCA 3C7AA 4NCIA 3ZY4A 2QD5A 1DG3A 3GN2A 3JXEA 4X85A 1CF2O 1A27A 1ZINA 1XAGA 3P9IA 3WK5A 2P2ZA 1HKHA 1I3OA 4YQZA 2GWHA 3O4IA 2J6CA 2O14A 2ZJ4A 1IWPB 1I1OA 1R4NA 3OZEA 4RM2A 2J0UB 1Q91A 5GAJA 1IB6A 3CF4A 3BEOA 2O23A 5IUJC 1T4MA 4C0BA 1RLTA 4J7UA 1S01A 3BGSA 4JC8A 1U98A 3LT4A 3Q3GE 2G3YA 3V4LA 3FTNA 4JU8A 3IUSA 4KYVA 4R41A 4C21A 4MV9A 2W2KB 3C4QA 4PQEA 2GCOB 5CNJA 3UH0A 4B8WA 2QX9A 1TM5E 1PKXA 1IAQA 2ZIXB 2G4LA 3H65A 3WGKA 3R7WA 3G3EA 1SBHA 4OA5A 3CKMA 1C7IA 3H8VA 3KC2A 2O3QA 2PO7A 1HI9A 2EWMA 3JQRA 2Q1WA 4POOA 1HNNA 1M6HA 2G76A 3CUKA 4FDUA 4RVFA 1KY4A 3DOFA 1XA0A 3F6YA 4MKXA 5I4CA 1Y7HA 4KXNA 3I1FA 3WK7A 1RIFA 4ZYXA 3UWSA 1Y5IA 3WGMA 4QJ4A 3JRNA 4K81B 1QO0D 4CKXA 4YMVA 4MRAA 1LJUA 2VF7A 3OURA 1BS9A 1CZOA 4P38A 3GUCA 4MO2A 3Q2KA 4Y18A 1KP2A 2YV3A 3V5NA 1JTVA 2H3HA 3MK31 2ONZA 1QHEA 2PRKA 3BQNB 3IKVA 3KSBC 4MS1B 4CEHB 1AQUA 1JLLA 3A10A 5TMDA 4XVUA 4EJMA 3VTFA 1RJEA 1HM5A 3QF7A 4P80A 3VU9B 1UP4A 1BKSB 4BE9A 5ICCA 2UZAA 2Q3LA 3RTBA 1YFKA 3HACA 1NC1A 1QYRA 3ISVA 3MGBA 2WIAA 3P9KA 4JVSB 2O2XA 2OAEA 2VZ8A 1ZR2A 3ZNNA 2OK8A 2HMSA 4X91A 4BKMA 1GNVA 3VYTB 1IHPA 1JDSA 2DJ5A 2P2CA 1KSJA 1T36A 5AD1A 1I30A 4BNLA 2PRJA 1EGQA 2C2XA 4YPVA 1DTWA 4WCDA 5BWMA 1YB7A 3OPYI 2EX4A 4MQ5A 4Q15A 5AHOA 1S2NA 3EZ7A 3S40A 4KKXB 5BQOA 5FV7A 2ZE8A 3JZIA 5CA0A 1XGKA 1E77A 1KYWA 4BEBA 1U0NA 2HA2A 4IXMA 1VIVA 2HLDD 3SC6A 4QYWA 2XD9A 3DQZA 5EYPA 2W6OA 5DEOA 2H1HA 3OETA 1JHOA 3WGLA 4UTPA 4ETNA 1N32B 2HX1A 4ZYVA 4XSVA 5LQMA 1FLDA 1JDNA 4PRKA 2XMRA 5REQA 1EFHA 1CY0A 5EJMA 2R0QC 1LVUA 4LCEA 2GMWA 2QI9C 1H2XA 1HDCA 3ETLA 4PPFA 5B3KA 4DLWA 3HZRA 4ZQHA 4B82A 2J9RA 3JTEA 3FTPA 4U0JA 4UU8A 1TF7A 1AMUA 3WYNA 1Z15A 1SMKA 2RGCA 3I01A 4M0MA 4L78A 2IU0A 1X9GA 2X9VA 2BFCA 4QFCA 4UVDA 1GM5A 1O9GA 5C8XA 2A0FA 2O8EA 5EFOA 1ZD8A 3V1LA 4IW3B 2CHVA 4RSHA 4IOKA 5AKJA 3ROGA 3VUFA 3ZCSA 4LVOA 1L5GB 1JEYB 2XA2A 5HJEA 1XE3A 1PW5A 2GTPA 4L9WA 2J46A 3VVCA 1ZWKA 2IZZA 3FFAA 1PJTA 2WWGA 4B6OA 2VN8A 3QWIA 2VZEA 2BF7A 3E35A 2G77B 1PLJA 5BSVA 5BT8A 3K0AB 4JFAA 1V8PA 5MF6A 2GNPA 4A5OA 4BJ3A 4B4DA 2GAJA 3LKVA 2P68A 3IVCA 2H2WA 3B5EA 4JP8A 4A6DA 2GPYA 3LE8A 3N5KA 4DCPA 2NPIA 4DY6A 4JI4B 3MMZA 1LLFA 3U3KA 4EM6A 2HZ7A 3BMXA 2W71A 1VBKA 3HM9A 1D4FA 3NOXA 1PJZA 3ZE8A 3LUDA 1M72A 2R6R1 3CZ9A 3G0IA 1S4MA 4JB8A 4LF4B 3LT0A 4MRSA 4MW2A 3TIIA 3I39X 4AY2A 3OM1A 3D6HA 4G0NA 4FKZA 2VF2A 3PIRA 3L46A 3T7SA 3ZHCA 3ZY5A 4QICA 4CR7A 4DN6A 1ATZA 1N5RA 4HTFA 4L5BA 3EQ9A 4WJLA 3P9RA 1MJGA 5JZVA 1YULA 1V8BA 2PV0A 2PUTA 2X2PA 3I28A 4HFMA 5G0SA 4WLEA 2UYCA 3OT1B 4ID3A 4AJEA 2IFTA 3KEMA 3IALA 4YT5A 5E9QA 4Y2HA 2D5BA 1C1XA 3VO1A 4WK4B 2VCEA 3GVIA 1BDMA 3IQEA 3ZGOA 4II7A 2R6DA 1N9KA 1PP4A 3FDZB 4L3OA 4GX2A 5FPTA 1E63A 4BJHB 1AG9A 1Z39A 2BGLA 2D1FA 2QZ9A 3KQTA 5I8PA 1SXPA 2BBSA 3QK7A 1HE1C 4OQLA 4YXFA 2I66A 2IIPA 3HBJA 4X97A 3VBCA 1A9TA 3TNFA 5A5FA 2HJWA 1BMDA 2OXCA 3UAGA 2XKKA 3AVOA 3IUMA 4GGPA 5LJIA 2Q41A 2VTBA 2P7HA 2JRCA 4MUEA 3HS3A 4YI5A 5K8CA 2JKYA 2H00A 4LHXA 2B35A 1D8AA 5FL7D 1QC5A 3IAHA 1QDLB 4PSVA 4A2QA 1IOWA 1AU9A 5EN4A 4QQNA 2B3TA 5F73A 4EFMA 1E9BA 5LQNA 1XU9A 5K3AA 2LNDA 3GQVA 1NVGA 1RP7A 3GLQA 4L0QA 3VVLA 2CV2A 1E7YA 3S2ZA 4BVFA 2HA3A 1RHMA 3AR2A 4MA4A 1ZNQO 1AK9A 2W2XA 4WBXC 4V0QA 4YBZA 5KTPA 2AWNA 2H1SA 4R3UC 1N3LA 2QDXA 2VUHB 5CVDA 2C2OA 2R4QA 2XPCA 3OZAA 4WUVA 4DB4A 3HP1A 4LE1A 3ITNA 4PGGA 5JBNA 3QLEA 4IDOA 4X95A 4YP6A 5LZ5A 2FN4A 3MT8A 5K4HA 3V1TC 1ULAA 2JGFA 2O57A 2EX1A 5FA5A 3E2PA 3PWTA 4XJVA 2C61A 5U9CA 3U3ZA 2BCJQ 1NY6A 2MYTA 1CBUA 1X7XB 2M1ZA 2HRZA 1YB1A 3T1YB 3NHZA 4GC5A 5KYYA 2V7UA 3VZSA 3MTJA 3AWIA 1T9KA 4IF6A 4J0JA 4M6WB 4YROA 3VJKA 1NUAA 4HPJB 3R6GA 4II3A 3TJRA 4XTRA 4M99A 5F4ZA 1N7HA 4BGIA 5CHEA 5DN6A 1RPTA 1YQXA 2UZ0A 4FC6A 4JP1A 4BUZA 4D45A 5CFNA 2WZQA 4DV6B 4IL5A 2YBDA 4AMZA 4DAEA 4G5OA 4NG5A 1OGIA 3GPDG 1NR5A 3H05A 3JV7A 4G8DA 4PFSA 1RQNA 3OEYA 3ORFA 4I66A 4ZYYA 3GR6A 3AFHA 1J0CA 4QUKA 2BEVB 2O1SA 1ZOLA 3TLKA 3I34X 1LNZA 2J6IA 1PSZA 1JEJA 4P34A 3ZUPA 2NO0A 1B3RA 1IZ9A 2Z4TA 1BRTA 3I09A 3S7TA 1U9ZA 1BXRB 1DDOA 2AMFA 4U9HS 5TQVA 2XGSA 3O4HA 4AJOA 5ALZA 3DBHB 4AN1A 1M6YA 4N03A 1QIHA 2C2KA 3U13A 5CU7A 2X2EA 1F38A 3FDJA 3PC2A 5EVCA 5FORA 2FR8A 2IW1A 4OUDB 3TKLA 1WSDA 3OWXA 5AM4A 4D43A 5JVDB 1W1IA 3TVYA 2JZCA 3M3HA 4PC2A 5F7JA 3VMFA 1MB4A 3WE7A 1TCUA 3DWFA 3P20A 4UNSA 4U0KA 4XARA 3DOUA 4EW2A 1RAHA 2CNWD 4ZT2A 5K4AA 3A9SA 3ZY6A 2ZUBA 5BYBA 3RTDA 2CNLA 1FNBA 2LKDA 4HN4B 3F47A 1GHTA 2X3FA 4UNQA 4DBVO 1OJLA 1PFKA 4D46A 4EDFA 3GBSA 2XZPA 3SYLA 4E4TA 3IDFA 2J0SA 2HXGA 4D0SA 5K6AC 1T5OA 1CUWA 1OU0A 1T2FA 2JBHA 2CFIA 2W6JD 4G0XA 4JR2A 3R3WA 4N7JA 3U3XA 3WGTA 5HUJA 4Z3OA 1DU4A 5DLDA 3QFTA 5AJHA 2CY0A 2TMDA 4PHCA 3LRXA 2ENWA 5FBQB 1XA4A 2OC9A 4B71A 1ICEA 1Y6GA 2IF2A 1Z6QA 1WZEA 1ORHA 1TLTA 5E1OA 5AFSA 1YR6A 1UBMS 4D42A 2AJDA 1CIJA 1FNMA 3OEED 4OQQA 5L7YA 3NRBA 3L0CA 1LV7A 4KXXA 3KUCA 1R64A 4MQMA 4DZZA 1C80A 1T5HX 1ITZA 4BFZA 8ABPA 1I4LD 5MFZA 1L4BA 1NN5A 3L3BA 3SP1A 2A9KA 4E6PA 1GEGA 4BX9A 1D09A 2R47A 3EH2A 1UC9A 5DT2A 1EJBA 3PTZA 4ZK6A 1A04A 2C4KA 3R5TA 3PB3A 5T5QA 3SOZA 3T3EA 1H2BA 1CFJA 5EPOA 4LVCA 4ZMRA 4H35A 4G0OA 3OJOA 4Q37A 1K7XB 2OORA 2WICA 5DTJA 3W1WA 1MC5A 4LEIA 4M89A 1ESNA 4K6CA 3KLBA 4ODIA 1H22A 1KKMA 1H9AA 4H59A 1PWZA 1BYIA 2C2MA 2R3SA 1G41A 1D6NA 3I9OA 4CMEA 1Z29A 1FFXB 2RHWA 3WNDA 1SQFA 4JLBA 1M1NB 4WESA 1M0TA 3WLOA 3CVJA 3GRRA 3U19A 5K3EA 1RNLA 2XYQA 3VDMA 4TSKA 3LFTA 1C7QA 2FK8A 4O2BA 5HG0A 5BQXA 1QK3A 1EFUA 4PO3X 2BEUA 3NW9A 1VDZA 2BM8A 2X7HA 2FPWA 5FHQA 4BKRA 2ZYTX 2IBTA 5SYNA 3RFVA 3A4NA 4JLUA 1QYIA 4B6RA 5H8WA 3HA5A 1BX0A 2QD4A 3LPMA 1P6XA 1AKYA 3TRKA 3DHEA 2XT6A 2NZUG 3WNQA 2JI6A 3DHVA 5FFMA 3D8NA 2R6FA 5NULA 5TF4A 2OMEA 3F6PA 3UIEA 3WLLA 2EXXA 3I2YX 2P3OA 2O20A 1K08A 2Z58A 4DPKA 4J16A 2WNIA 2I9KA 3QOFA 4PZUA 3LS2A 4ZCMA 5EXXA 3NFYA 4DYVA 2MMCA 4LBWA 4OV6B 1PWHA 3B1ZA 4RF3A 1U5BB 1W94A 2EJBA 1A9OA 1I10A 2BDUA 4MVJE 4F7WA 1SQSA 1E6UA 1NR7A 4Y98A 5KNCD 2AIRA 3TQFA 2X58A 3AF0A 2D06A 2G4VA 3T9EA 2WDPA 3E61A 3O21A 4CCAA 4EKEA 5IZ4A 3BSYA 3EULA 1ZI6A 2WM2A 2RK4A 2AFHB 3B6ZA 3K0EA 1P77A 2B7LA 4P5EA 4PYMA 3D6TB 2C7VA 2ET6A 3WLAA 3D31A 3G2PA 3QVUA 3I52A 4DJTA 1JG1A 3OLXA 1PR1A 3P2IA 5ENVA 1S02A 4KN5A 2D1TA 1Y8ZA 4HAWA 4JT2A 1ZD2P 4B74A 5MGNA 3FFXA 1P5FA 3NNDA 1ZHOA 2IS6A 1X0VA 4G4SP 1N3IA 2J7PD 2DKNA 2OCKA 3K96A 2CDCA 4LPKA 5IAAA 1KZ4A 1U2QA 2FR1A 2J3JA 3FSGD 2FOIA 3D7KA 4MVJD 1AO3A 3ONVA 1JHAA 3V1NA 1VYTA 2I7VA 5AW7A 1S2MA 3H16A 4OD0A 3EXFB 5HILA 5DBFA 4B4OA 1D0SA 1FFYA 4C7MA 2RDMA 3ZD6A 2YQ5A 1MIOB 4GC9A 4GHWA 3S5JA 1VMEA 1YZGA 4HUTA 3RWBA 5DMHA 2CXSA 1Q0QA 2BV3A 2CCJA 1IQ0A 1AZSC 1GEEA 4G56A 5ALSA 2I7XA 3IAAA 4MB0A 5DBGA 1XN4A 4EX6A 3BTUA 4BQQA 1FP4B 3EC1A 5EJ6A 1XQWA 3GJQA 2D54A 4HJXA 1JZTA 3SVTA 2FQ1A 1RS0A 3CVVA 3AL3A 3AWDA 3JZMA 1ISSA 3ZZTA 2XCTB 3QEOA 1PL8A 4A0GA 4NZMA 1TO6A 2JEZA 2KE5A 1YMVA 3NRJA 4FI3C 4YMTA 5EJ7A 2G7ZA 3DTTA 5CYFA 2YKGA 1Q3HA 5JH7A 2AW5A 2MT9A 5ALRA 1NW8A 3UPDA 4FPXA 1X1CA 5J2TA 2YHIA 2KMLA 3KKMA 2FUCA 2JI7A 2RBGA 4FFLA 2V0CA 4BRWA 2NMVA 5B2ZA 1BFKA 4C1BA 2P75A 1QVVA 5DLPA 2HK6A 1F5SA 2QSUA 2CZGA 1E7MA 3FJYA 3PEEA 4QECA 5KQLA 5KVSA 5ENDA 3USCS 3JD0A 3B2EA 1GAWA 4HT3B 1NVWQ 1AF4A 4KWIA 5KX5F 5CDYA 4EUEA 1U2TA 3ZV5A 3WSWA 4QKQA 1HZZC 1Z7BA 3LA6A 4RGQA 4KP7A 1J25A 2YV4A 4PN7A 5BYAA 2CSXA 4MR8B 3PUYA 4YN3A 2UYHA 2R85A 2Y1CA 3AR5A 4M1MA 1GRNA 2OXTA 3K4HA 2JCYA 3ILHA 3RYCA 4HG2A 1VB5A 4IDNA 2O1EA 3FCOA 4I6GA 4DYDA 2BFNA 3CMMA 4E2YA 1XDSA 1SUEA 5CLLA 3VR2D 4HBZA 1K4MA 5INTA 2FXIA 5MHTA 2W2VA 2C98A 4DWWA 3TECE 4ZVPA 3ZY2A 3KQHA 3DZIA 4WLNA 4PLGA 2ADOA 3T15A 3P2JA 3V4ZA 3QVGA 3MGCA 1C7RA 4KSCA 1U9YA 3N8KA 1E3DA 1UIRA 1PUIA 1XTVA 3A4TA 5J40A 3WKCA 3ID6C 2CLEB 2W2MA 2QQFA 1Z7YA 2HN9A 1TIKA 4RWZA 3GEHA 3VU8A 4ZT3A 1OV4A 1QVRA 1U31A 2I03A 2GCIA 3H97A 1C1DB 1GADO 1SXJD 2F1OA 1BN7A 2RBKA 3ETDA 2YWDA 3HBNA 1QFYA 3T7AA 1K3TA 2D1SA 4IJ6A 5DJ5A 2IU6A 1M8GA 1SC3A 1U3CA 4H7HA 1A5AB 1TZKA 1HLDA 1U94A 3CKKA 3FJ1A 5CLQA 3WDKA 3EIOA 1X9HA 1FDTA 3CKYA 3UYLA 3MRXA 2YRFA 3EEBA 3QIVA 5K5EA 4HS9A 1KH1A 2R8ZA 4MRNA 4U4AA 1U0FA 3UB4A 2I6SA 2NAPA 3QTTA 3WRVA 1GRRA 1B8OA 4WKOA 1PO7A 1JBEA 5A3JA 1DC3A 2ZWMA 4U7WA 3VNVA 1WXGA 3RJZA 3W7AA 5A3SA 3A1WA 1PWXA 3VYRB 1EWTA 2ARKA 2WJ3A 2XH8A 2YXDA 3I9JA 4FT4A 5CPFA 2Z6VA 3BVPA 1CZKA 1L3BA 3TUJC 1UDAA 2PA0A 3FOBA 3HZHA 4Y6LA 4D99A 4IVPA 4D7AA 1EIZA 4YCNA 4RZIA 3PFNA 4R2MA 4D6YA 3TX6A 4RKWA 3VA7A 2G1AA 3CSDA 4JMPA 2N42A 2IHYA 2SBTA 2RHCA 3V8RA 2BLNA 4PCUA 1BVHA 3ADOA 2E5WA 3PDIA 3Q6IA 2X77A 4HDOB 4HUQA 5K6TA 5I5EA 5F21A 5J1TB 1MABA 2L82A 1T3LA 3R40A 3FROA 1NY5A 2WRZA 1E3LA 3MMSA 2XMSA 1U7XA 4B6JA 3I92A 3CRW1 3L6RA 5K1ZA 5TGZA 3DYBA 4EBFA 3GFOA 5BN1A 4CUJA 3GYBA 3ZCTA 1YR7A 5JS6A 1R8SA 1G20E 4DXAA 2X4DA 1ZBQA 3IHLA 4YHBA 2QN7A 2WG1A 5FTJA 4BKOA 4NXMB 1M2VA 1WEHA 4U2EA 5H3CA 3ZY3A 5LP1A 4KO8A 1DXYA 2OV2A 3RRZA 3SBXA 1GZ3A 3R6TA 5H3HA 1U1CA 2FSHA 2QK4A 4P4LA 2BDEA 2JGJA 4WKNA 4BNFA 2PKYX 4JIMA 3TEJA 1E3WA 5ADUS 4X3PA 1F2VA 1W5TA 3HXLA 1D4ZA 2FLKA 2CKMA 1MGOA 3IFSA 4HDSA 2BI4A 1HR0B 3OLQA 5G2OA 2PCLA 4JU9A 3JPWA 4CCSA 2OYSA 2HDNB 2EERA 2QDKA 2YHSA 3F96A 4YWHA 1VMIA 1U0LA 2WI8A 1VGRA 3OLWA 5G0WA 4Y1RB 4LY9A 3T0FA 5EHZA 1ZAKA 1CLUA 2OP0A 3PWKA 1WMBA 1P73A 5A7HA 3OM0A 3GV0A 4ZAYA 4BN0A 2IDKA 3W8RA 3SMVA 4F8JA 5A1TA 3E1SA 1Z07A 3D6UA 2KPOA 4FR5A 3GZTB 2Y2UA 1JT2A 1YOVA 3WGJA 4AW9A 2NQ2C 5E7IA 4KNWA 4Q05A 1V7PC 1C0PA 1FFHA 4XYLA 4AMGA 2GETA 2VPQA 1LBIA 5ALGA 1NUTA 2O0HA 3TLJA 2WWYA 4LMPA 5YASA 3DL2A 2IHNA 3ZK8A 4G26A 5CDTA 1X1DA 1OYOA 2C7GA 1Y5MA 4RAOA 4AMVA 2XDQB 4C4OA 5KZMB 2DX7A 3LZDA 4HDMA 1E2DA 2J08A 3N3BC 4O8CA 2Q4DA 5DV9A 4FSDA 4U2KA 3WWCA 4ARAA 5KYYB 2IVFA 4URXR 1CUHA 4G4JA 4AZVA 1D9XA 3PGJA 2QL7A 3ASUA 3PUXA 3HSKA 3PVZA 3SHFA 2FA9A 4CL0A 2X2FA 2OCIA 1WULS 4LHZA 3VH2A 1ZGCA 1XTIA 1XZPA 3EGOA 4P7JA 4WCFB 5IMBA 4EENA 4HAOA 1NPYA 2VJLA 3AU9A 2OG2A 3ELYA 5AVKA 4AZ3B 4RK6A 2HD4A 4LRXA 4YECA 4QU9A 1WUIS 1CQZA 1BW9A 2A58A 3FD8A 2J3MA 2Z8ZA 4RY0A 4E5NA 1XMSA 3B60A 3BMQB 4NBRA 2D8AA 3CCCA 3MCWA 4YP5A 5DYGA 1SKMA 1L4YA 3TGPA 3CO0S 2EKLA 3CIOA 4UU7A 3H84A 3NHLA 2VQ3A 1NRJB 2QI9F 4R84A 1XCBA 2WYWA 4R51A 5DN6D 2Z2JA 1IBKB 1RFGE 4O2AA 5IJAA 2QX6A 4YRJA 1NHWA 1IK4A 2JKVA 1PV4A 5JMTA 4CDGA 1RR6A 4BO0A 3RFUA 1O6GA 3O26A 3JU3A 3GJ0A 3GDOA 3MTQA 3OFKA 3PFFA 2I4LA 4H0FA 4EG5A 5HJ2A 1BOOA 4F21A 1U04A 1JGTA 1PW7A 2AN3A 1WS6A 4WN9B 1YV9A 4UOZA 5KNDA 3ADDA 2KI5A 2W4IA 1U8ZA 1X13A 2HCJB 3DFFA 1F48A 3LI2A 3PUHA 3X43A 3DBOB 5BRJA 1MR3F 3BHNA 5E3IA 5BNZA 5I9LA 1XEXB 4FFDA 5KJCA 1C4KA 3V4RA 4KQWA 3C5CA 3NOOA 2G04A 5BVHA 1MQ9A 1M1YA 4M1TA 2XODA 2WM8A 4NS1A 2IV7A 2FW6A 3REOA 4C05A 5CBPB 2C31A 4TLBA 4DNOA 3OVMA 3EC7A 3WL7A 3JWJA 5FPHA 2B8TA 2P5UA 1MG0A 4Q00A 3ASYA 4PXAA 5CM2Z 5CBKA 9LDBA 2O0LA 3R5KA 1GZ5A 1Y1QA 2E9SA 3CXRA 3LL4A 4BFTA 4DMKA 3KB6A 3TIFA 4A4DA 3DLBA 1U2PA 3F73A 1UJCA 5JATA 4EQZA 1N5IA 1P29A 3LOQA 4HTFB 4K26A 4UREA 3U3JA 3WK4A 3HXMA 4FILA 4KR6A 1JAZA 1AXEA 2BN4A 2HWUA 2YS7A 3UVEA 4CF5A 2BYTA 4OXYA 5E6RA 2C1ZA 3SSOA 3T4EA 2LCFA 4ZQIA 1A88A 3ECAA 5ALHA 2Y1OA 1N1EA 2HR1A 2CMGA 3CHYA 5F2EA 1L8QA 4LY6A 2XWJI 3LF1A 2YCLA 4L5AA 2FF5A 1X1QA 2KM1A 4JQSA 3P2MA 4MCAA 1R4ZA 2ZYAA 1Z2NX 4ZO9A 1F2DA 5ECDA 5J2UA 2YASA 1KXZA 3K20A 4JX8A 1MC1A 1HGXA 5AVJA 4JI0B 2Z95A 3COYA 4GI1A 2BFWA 3IEPA 3UWPA 2ID9A 3U44A 3OOJA 4ZOLB 1TXGA 1FTNA 3K92A 5A0FA 3FR8A 1AT1A 5KYKA 2J32A 1L2TA 1L7RA 3OO0A 4PPNA 4ZO7A 2R44A 1Z2EA 1Q57A 2AXQA 2J9YB 4REQA 4DCCA 3TM4A 4FCTA 4QJ5A 5IXJA 1BE8A 1KEEA 2AS0A 1GIAA 3TSZA 1V35A 1FX1A 2A67A 2YZMA 3WRYA 3CVOA 3VR3D 2GK3A 3PF8A 2HMYB 1UP7A 2IDJA 3MHPA 4F2DA 4EA9A 1VBNA 3JQCA 1J8QA 3O91A 2VJYA 5A4FS 3TL6A 5K3FA 4LJSA 4B3GA 2PFGA 2B8EA 1WHSB 2AG0A 2R6JA 1GITA 3C70A 1YGPA 4BX0A 3HU2A 1NQTA 2PIAA 3GLUA 4GT1A 4OQPA 4GGOA 1JKFA 1YQUA 2WAYA 3OQMA 3B5IA 4E70A 1PZNA 2FV8A 4XJTA 3AUKA 1ZH0A 4JLWA 3TGLA 4J4TA 1I1HA 1N5LA 1YDFA 4AF7A 3PNOA 3HKBA 2FB9A 2H2AA 3UUFA 2DUWA 3O1LA 4N82A 1GGEA 4UUBA 3TQCA 4I36A 4HADA 3Q1KA 1NVBA 1X7ZA 3TLMA 3LUKA 4ALKA 2ECQA 4W5TA 1E8NA 1OSNA 3ITKA 2R6AA 1X87A 3HWRA 3Q98A 2QTRA 1CHDA 3T7DA 2XGGA 1PQYA 4YBRA 2Y1GA 4YMSA 1S3FA 4LSZA 4BFXA 4DCNA 2BCGY 2B2XA 3H2BA 3O8OB 1X7WA 1L5YA 4LJLA 4EG4A 3CNEA 2H5LA 2XZLA 2V0GA 1WM1A 2YJ5A 3THWB 3AMVA 4RESA 4F2WA 1USWA 2C9BA 4QJIA 1OFUX 1C4WA 3G9ZA 5A5EA 3CVWA 1XWFA 2GNAA 5LXTA 4XQCA 2IPOA 5CDUA 1I7DA 4R5MA 4DS3A 1PL6A 1L5FA 1XZ8A 3A37A 5JAQA 4TKVB 4ARUA 2OHOA 1A4XA 3CJRA 2FWMX 3AKDA 2DPHA 2UYOA 1EK1A 2CF5A 4GNKA 1PTJC 2DFPA 2Y6VA 4IG4A 3U61B 3HFRA 4R69A 2ZYHA 3IAS6 3U62A 4AUKA 3GRCA 1ZMRA 4YV2A 2WF7A 4IDQA 3OZSA 5JSZA 4ANFA 1F3OA 4Q39A 4R9SA 1VZ2A 3FE2A 4ZQBA 4DMCA 2ZRJA 2Q8PA 4JA0A 1IIBA 5LQKA 2P2YA 2EL9A 1Q1AA 1S9DA 1UZLA 2J3KA 4TOIA 4MEBA 4BL5A 2A9QA 2BKEA 4OI4A 3VNRA 3IQGX 3K5IA 4YHHB 3OQIA 2AC7A 4LHSA 4AJ4A 4YJ2F 1U2ZA 2X0IA 4CLEA 3PWSA 2QR5A 2QRHA 3ABZA 1ZCFA 3AR8A 4FGSA 1U6JA 1DJMA 2O2ZA 4CFSA 1MF7A 3QLUA 2D2IA 2C7OA 2BGRA 3QOWA 1PNRA 1UK6A 3ENZA 5KDDA 1S6YA 4KCGA 3WLIA 1EDBA 2HQBA 1DAEA 3E2IA 1JYEA 2QRUA 2J7KA 1I2CA 3TD9A 3JQFC 1UDXA 1QKIA 2B2CA 3V2GA 4RK7A 4H3KB 1UMDA 2GVNA 1G8HA 3CR7A 1CX9B 4BBAA 2I1VB 1YMQA 1BSVA 1CJVC 3DTVA 2DZDA 4BNMA 4IIXA 2CXRA 5CTJA 1GUAA 1JU3A 2CYCA 3ND6A 2WZCA 4HEHA 1XKQA 3E53A 2QJFA 2A5YB 4JYAB 5JQGF 3IPCA 2HUNA 2LW7A 2E0IA 2X23A 2GJ4A 4V39A 5IN4A 1A7KA 5ARBA 3IIIA 4Y0AA 3DFUA 3HV2A 3D54D 4QOHA 4UTVA 5B2FA 1RRFA 3E6AA 2QZPA 4FUQA 1D0VA 4Q01A 5CIWA 3KK0A 3RR2A 3AC0A 1OLOA 2OD2A 3H9UA 4Q1DA 1SHKA 3UMMA 3YASA 3B9QA 1R6VA 1W88A 3DE5X 2O1XA 4Z7JA 2BTQA 1U3WA 4F04A 2HF2A 3K8YA 1OW3B 4IOMA 4YJDA 4Z51A 1PG5A 1ZJZA 1ZUNB 1LD3A 2AXPA 3FPFA 3FDXA 3NWJA 3M5CA 3Q5GA 3TW8A 5JR3A 2QE7A 4JENA 2R7MA 4BXOB 2OSBA 2G67A 4JBNA 1D2GA 2VXOA 3L82B 1VRCA 2OE2A 3PXCX 1NKTA 1UBTS 4X63A 3DF7A 2C8JA 2QWXA 2ZSAA 5KYWB 1XMQB 3HYSA 1CR1A 3HLKA 4G84A 1QX3A 1R6DA 1KJYA 2V65A 5ALWA 3SLGA 4OHZA 4JOSA 3JARB 4ILEA 2WJZB 4JI1B 4MQFA 4H3HB 2H2GA 4RAQA 5DHQA 3IELA 1VPLA 1VHWA 2JGDA 3EZFA 1UPFA 2JFQA 3H1PA 4FDTA 1N4DA 1UWCA 2QSJA 3MC1A 4NYIR 2F1JA 4KU4A 4QARA 4W7HA 4YJGA 3ANNA 3RUDA 4W9RA 3LHIA 5CX1A 2E49A 1H05A 4BQOA 1BMTA 5CDGA 1W0CA 2ZCJA 3HM2A 5L3SB 3VNUA 3LPDA 2C2BA 1OVGA 2B83A 2PQ2A 3UO8B 3WL6A 3F8WA 3AONB 4LXUA 1ZOPA 1GU1A 3BK7A 2ZDGA 2D4AA 3SXJA 1O5OA 3AM1A 4TYYA 3BUSA 2VSOA 4MYDA 2ZAIA 1AUQA 3BK1A 4GI2A 3K31A 16PKA 1DKQA 2R96A 3H2ZA 3O1JC 4BMXA 2WTBA 1PR0A 3BQMB 1GCAA 4BRSA 3CPSA 5K05A 3PNLA 4ROSA 1XTUA 3U1TA 1POXA 4DQ0A 2P40A 4WTOA 3HJUA 4AMYA 1JWBB 1CLEA 2I8CA 4O6VA 3VYWA 5CD1A 3EXHB 1A9QA 5JIBA 5LP6A 1GTVA 3MT0A 2CFTA 2JFFA 3LDGA 3HFSA 4LNAA 2O2SA 5LLTA 1R0RE 4UVIA 5LZ8A 1JEQB 3NIFB 4PSKA 4IFIA 6YASA 5EMLA 1DAOA 1KK0A 4OYYA 2PRIA 2BKUA 2C2ZA 4MWOA 3C5EA 2W42A 2TMGA 4D26A 1BO6A 3HADA 4O2BF 4P22A 1YS4A 4PCAA 4BV8A 4YMGA 5GADl 3R9XB 1N6LA 3GNQA 3PA6A 3W5JA 3B52X 4JBXA 1LVGA 2JFXA 2H29A 4MI6A 1BGVA 4KMRA 4HWGA 1A97A 2I99A 1II9A 3C8DA 2VT2A 3EWIA 1LU9A 4G8JA 1ABEA 2B1IA 4HGOA 4HRYA 5IC5A 1U8FO 4JI7B 1UBFA 4RV9A 4ZJYA 5EXTA 3U4QB 3SR4A 1SBNE 1L7OA 2J0VA 5LM3A 5FUQA 1Y1LA 1YJXA 5HNKA 3OA0A 1JDJA 3T0IA 3DAHA 2DFNA 2VH5R 4Q4JB 3BXPA 4Q02A 4QDXA 4RQUA 3ZWYA 3UJDA 1DOZA 2PZMA 3WLTA 5F5LA 3GZJA 5KHAA 2E1RA 4KHPB 4N0QA 2OV4A 4DVGA 3H87A 3RC3A 4F9FA 2G9VA 1QIKA 2O3RA 1OQAA 2VHTA 4Y2PA 3BXGA 1Y8RB 3H3JA 4ZVKA 2C5GA 4CM9A 1VYHA 3L7OA 1JB9A 3DT6A 4IDDA 2ZRGA 4ZFNA 2Y1KA 2IY7A 4HYQA 2JBWA 2IZ5A 1J21A 3PXDA 3THWA 2CXPA 3T7JA 4OQXA 4YCLA 1UC4B 2PO5A 4XRGA 2ZXUA 2YBEA 1BH6A 1V2GA 1YL7A 1TKAA 4B6QA 5HKKD 2O1WA 10MHA 4IIEA 4ALJA 4BC0A 2WJGA 5M29A 3UICA 2D0PB 3G5MA 1I0ZA 2B21A 4EECA 4QM6A 3VTZA 1P9OA 3R3YA 4MPJA 3HG7A 2V4ZA 4QLBA 2EYQA 4I5FA 2VFAA 1GZSA 2F00A 2XI4A 4K9LA 1H5NA 5IP5A 3DB1A 4R6WA 1UXJA 5JLAA 3Q3IA 1C7ZA 9GPBA 3LHFA 3QEBZ 5CURA 1E1RA 1GZ4A 3IRUA 4FIDA 3GMIA 4OHWA 1J39A 3U7IA 2WT9A 1JEEA 1V3UA 1OIVA 4E0BA 3ZZ1A 2W43A 1FTSA 2VBIA 2ZWAA 2E4YA 4NCAA 2Z83A 2CZQA 3FMIA 1CE8A 3DLPX 4LUCA 1FDRA 4YK7A 4C2TA 5JRJA 5KTKA 2JEOA 3OZTA 4D9BA 2H4ZA 4EELA 3ICOA 3SZUA 3M1LA 3HWX1 3A1EA 4XFDA 5JAHA 3CR8A 1H42A 5SZJA 5G4KB 4QULA 3GT4A 4P1ZA 5BN3B 2FSUA 2PKRA 3EBLA 4XYMA 2JPDA 3AUSA 1MV8A 3PJEA 2EWWA 1WXWA 3U4GA 5K01A 4G67A 1KEEB 1PG0A 2P65A 1M2OA 2ECPA 3C15C 3E22A 5FTMA 2OBLA 1U5CA 3KEQA 4YRRA 1Y9ZA 4EHKA 3MCTA 1XKTA 2C99A 1JKJA 1VB3A 1HEUA 4NOMA 1GCUA 2H59A 1MORA 1QYVA 3M1YA 5I3ZA 4CIWA 3T0GA 2L19A 4JCCA 3G6WA 3KPVA 3ZHZA 2YFQA 3H11B 4J0IA 4POAA 4QO8A 5J4VA 1ZD5A 1GXSA 1EFRD 2FHSA 5AHKA 5CM8B 4S1VA 3UMBA 3FCUB 1QAOA 2P6MA 3M8KA 1M2WA 3DOHA 3ZZNA 5FO1A 3K6SB 4L22A 3U3OA 3TW0A 1K8RA 1Z5NA 3CJQA 5F77A 3HPQA 3LWNA 2DERA 2A3RA 2C1EA 2C4HA 2IYXA 3WIDA 3OE1A 1T4CA 2ZTUA 4UHCA 1JKXA 3OHSX 2XUQA 4NABA 4NG4A 1VI2A 1C30B 1NNLA 2ZRMA 3A2NA 2HPHA 2NO6A 3IMEA 4TWAA 1ECJA 4U2CA 3K70B 4ERXA 3JYOA 4HP8A 1QKJA 4AZSA 3FGNA 3MTAA 4F1KA 4WY2A 3O8QA 3OWOA 4OFBA 4KO2S 4BE7B 3I37X 4XCVA 1E64A 4U02A 2NZ2A 2PD3A 1D4OA 2YJGA 3QY0A 4TS1A 3WB2A 5I7OA 1MQAA 2PFKA 3W5SA 1A4UA 3QUQA 3OIVA 3TNYA 3KQLA 5IJ9A 1XRPA 5IC6A 3I6IA 4UBLA 4NMHA 4HAUA 1T1SA 1WO8A 3FPEA 5JFTA 1PKEA 2WABA 1TVKA 2VHEA 2FSSA 3HVHA 3BEDA 2Q4OA 2VSNA 4QOEA 4RQAA 4X61A 4DGQA 2PHZA 5FPYA 4H2DA 1E2GA 3R3VA 4N18A 3DGEC 4ZCQA 2B1GA 5KWEA 4EGFA 1YDWA 1T4DA 2YHAA 2AKYA 1V16A 2J59A 3PIDA 4MV8A 3STWA 3VDXA 4B80A 1G8SA 5ILOA 1UWKA 1WPGA 1LTQA 3DF9A 2QPOA 2COKA 3HKDA 1P7VA 1JL3A 1I14A 3L8HA 3HXOA 3GLIB 4IF4A 3RQIA 5IARA 3W2FA 4ZGGA 3BPSA 3MUEA 1ARZA 1AZWA 2PVPA 4YO8A 2VPTA 5DNDA 4JOCA 1MRNA 3MZ0A 2IBSA 3EXEA 4LBZA 1HDIA 2VRCA 4GWLA 4F5WA 2D2XA 2HT1A 1D07A 3GA5A 1FBTA 5ALMA 4EL0A 2LZ0A 3UJHA 2RHMA 2VNSA 1MDBA 3BMNB 2H2FA 4MUAA 2QL9A 1KYQA 1W85A 2XYVA 3JQ9A 4G0ZA 5ETJA 2EGUA 1WPQA 3B7GA 1MHPA 2J3IA 4MYRA 2OESA 5FNVF 3SX4A 2E82A 2IUUA 4B84A 1YL5A 2N0SA 4NMWA 1QKKA 5HBRA 3SEQA 1SCUB 1XVUA 4WWHA 4Q1EA 1RC0A 3FGZA 3H86A 1ESCA 4EAAA 5K8TA 4EP1A 4HDMB 3GLIA 1OYYA 3FVQA 2V6MA 3ZIUA 1UQRA 3G1WA 3H2HA 3NR2A 1CJBA 4IIYA 1GQFA 1CUIA 4E1BA 1CVRA 2VDWA 3BSFA 1DQPA 3FUXA 4TTIA 3VR2A 3AVYA 4WZZA 2M6KA 4G9GA 3QFCA 3RVPA 3BJMA 2WP8J 3G8AA 3M83A 3FZYA 3I1YA 4QYIA 5GGYA 5PGMA 1KAMA 3PPYA 3KTAA 2E55A 4HSGA 3N2IA 1Q7EA 1R7RA 1JG7A 3LY7A 5CLGA 2GESA 5KTTA 3DC7A 4Y1RA 2DFKB 3GWZA 3OIWA 3ORQA 4M0DA 5BNFA 4DILA 3G79A 1RXCA 4CM9D 3BULA 1Q7CA 1K7SN 4MB2A 3P97A 3ZJVA 3WDMA 1VIYA 4CCWA 4TUYF 3G0DA 3A9UA 3EIQA 3LPAA 2CWWA 4OBBA 3W8DA 1KDYA 5BSMA 4DCUA 3GEPA 4UPEA 3RGGA 2JCGA 1W4AA 1GSAA 4PRYA 4C4RA 1LPBB 4TLLB 1I3MA 3KYDA 1R6AA 1XLWA 3AKCA 1J23A 3IVRA 3OICA 4RA6B 1RYEA 3ZBQA 2GXAA 3F1KA 1XVVA 5GQSA 1E1CB 2F2TA 4IDEA 1ZLXA 1I0LA 2WHPB 3PRKE 3DB2A 5J1SB 5K8UA 1H2AS 1E1LA 3AUYA 5KSOA 3PUJA 1M34B 3LDHA 3VR5D 1U0TA 2A0XA 2YIDA 5AOVA 1B8NA 4GGMX 1WMFA 2DWCA 3D4BA 2OBXA 3VDRA 1H65A 1ZUIA 4UZEA 2XUKA 1TO1E 3EGIA 2BISA 3F6CA 4MROA 1LDNA 1NSYA 1L7EA 4LNHA 1LQ2A 1M73E 1Q84A 2C78A 2I3DA 1QCZA 1V4NA 3H6HA 3HDVA 4KDRA 4L8GA 1BAPA 1YJBA 2JVKA 4ZVOA 1N6PA 1AUOA 3EIHA 3CU5A 5KO2A 1IXZA 5AUNB 1E1DA 3BGDA 1EEHA 5IJ9B 2PWAA 2DUNA 3OKPA 4BKQA 2CYBA 2FGJA 4JLNA 5K6AA 2C20A 2QQEA 3WISA 1G21B 1VLVA 3ZLJA 1RCTE 5AJXA 4B73A 1Q12A 3INRA 4PAMA 1U2GA 4EB3A 1LSSA 1YK0A 3LG2A 1E2NA 1KZHA 3HVRA 3F6EX 4PC1A 5JJCA 4YY3B 3VX4A 4RD3A 5FWYB 2XR1A 4IMIB 2IYTA 5BPFA 2F8LA 2XUIA 1XZBA 1LCIA 1V5EA 2WFZA 1WV0A 2XUFA 3BX1A 3DNMA 3VDNB 2Y0DA 4E7PA 3UC9A 1E3EA 2J3DA 5D7NA 4ZA2A 4ZT5A 3TD2A 3IRVA 1G7CA 4FDAA 4JZKA 2W83A 1NLUA 4PSAA 5GGXA 3RRYA 4KPUB 2IYQA 3OJWA 1G4HA 1C1HA 3Q9UA 1GKYA 4MWZA 2AE2A 1FYXA 2IPXA 3OAAA 1Z0FA 4W5WA 3U31A 2NT4A 5CFZA 3F3KA 2D1YA 4F71A 5I9NA 4N65A 4FM9A 1CRQA 5M04A 1NDHA 5B12A 3GJRA 3UV7A 1X80A 1MAUA 3UK7A 1TK9A 2I6FA 4K87A 1HL7A 3WQQA 4F5YA 2ZUDA 1BIFA 1LPAB 2VJNA 4K6HA 1YGYA 1ZGHA 3IKJA 5ITWA 4KUEA 4RULA 2B4YA 1IG0A 1SBZA 2BKAA 1XD2A 2V4MA 2WWRA 2ZDQA 5HW0A 3SQDA 2Q5QA 4JVLA 4CGYA 5BRAA 4LJRA 2I4NA 3HDQA 1UZMA 1GGMA 5F2OA 3IQXA 3J7AC 4BMVA 2MTBA 4XKJA 1GU7A 2REQA 2Z9CA 3AR4A 3D1LA 3TLXA 3GPBA 1JF8A 1RTTA 1Y3AA 1AB6A 5TQ2B 5KTOA 1VDMA 5DTRA 2CNKA 3I73A 1W7AA 1ZM4A 2IUSA 3X1JA 1RWQA 4PNPA 4EH1A 3NCHA 1QZTA 1AK1A 3T3MB 1SXJA 1THZA 4DG5A 1I4OA 1MFPA 1L8XA 4FHEA 1AKEA 3UV3A 2DR0A 3N59A 5ALTA 1VECA 1LI7A 3KPUA 2BE9A 3NT5A 1P81A 4ZOBA 5DBHX 1ISPA 5KHOC 1DUVG 1EZ1A 1LQTA 4IH9A 4YJ3F 1R5JA 1OTHA 3SY8A 4BX8A 3SS7X 3IB3A 4JS0A 3VNAA 1HDGO 4OF4A 3M89A 1G20A 2PSJA 4Q34A 1HO3A 3WO1A 3HLYA 2CVZA 3IJRA 3JQAD 4IHJF 5B7PA 2C5EA 4L07A 4LC1A 2I7CA 2ZIWB 3H5NA 2F9FA 2JZOA 2G07A 2IP2A 3GJZA 2YOGA 1NF3A 4GOLD 3RSQA 2JRLA 2ZULA 4RD1A 5FF9A 1BZYA 5BVGB 4ABTA 2GXQA 3ANMA 3CWZA 2GS9A 3GEEA 1ZN7A 3LUJA 3OFVA 4LJ8A 4O2LA 1EU1A 5DGIA 1MP0A 1CQJB 1SK9A 2NQ8A 2XWPA 4P7FA 1O96B 1JR4A 1NNI1 4OKIA 1DNPA 2AXEA 3NBAA 4EGAA 3IH5A 4BFYA 1G3IA 5E7JA 3K1YA 3JQBC 1J09A 3FPCA 5LQA