3X1MA

Crystal structure of phosphopantetheine adenylyltransferase/ppat from pseudomonas aeruginosa with coa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
158
structure length
158
Chain Sequence
MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa 2192
molecule tags Transferase
total genus 55
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3x1mA00
2DEUA 1F9AA 1PG0A 1O94C 3AIIA 4MUJA 3X1JA 4HJRA 2PFSA 5FO0A 1Q19A 1ZH0A 4XFJA 1QQTA 4I6GA 1ILEA 3CVWA 4MVYA 3TZEA 1BS2A 3L92A 1COZA 4DDHA 1XNHA 3VU8A 1JIJA 1SURA 2A84A 3A2KA 1K4KA 1WZ2A 2TS1A 3ND7A 4YP5A 2IJGX 2PIDA 4EG3A 2QUHA 1DNPA 2JAXA 1K97A 2D5BA 1TYBE 4MUIA 3Q12A 3SZ3A 1U0BB 3QTBA 1WJGA 3RBAA 3SZGA 2DETA 4FZJA 2CV2A 1K92A 3CLSD 1R6TA 1OBCA 1G59A 2DPLA 1M83A 1JZSA 2D54A 1O0BA 1N2GA 1NUUA 4K0RA 3NBKA 2PZBA 4EG4A 3KFLA 3N2YA 2YWCA 1O95C 1JZQA 4E1AA 1O5TA 4CQNA 2QJFA 4ZT4A 2XRZA 1OWPA 1KH2A 1X8XA 1N2OA 4PBRA 2CYBA 4U63A 2E0IA 4CT0A 5TEVA 2CT8A 3HV0A 3PNYA 3ELBA 1TQ8A 4MW2A 3LE8A 4MWEA 1TEZA 3IUEA 1ULHA 2H2AA 2J4DA 3PNBA 1NZJA 5J5AA 3G59A 5K0TA 3MUEA 4MUFA 3MLAA 3DV2A 3SEZA 2VTBA 2H29A 4J76A 1TFUA 1O6BA 3IODA 2HMAA 4EGAA 2HGZA 4JZYA 1NUQA 5FNZA 1EUYA 5KCMA 2QTNA 3AG5A 4ZCTA 3CLRC 3HZRA 1VBKA 1QRSA 1YULA 2QUJA 2EJCA 1OWMA 3ZGZA 4DE5A 3IUBA 3ZJVA 1U3DA 1VL2A 3FH0A 3COZA 4ZCRA 4NAHA 1KH1A 3FDXA 5F23A 3E27A 3FHJA 3ZXIA 4PBTA 3SYTA 5LLTA 4KR7A 4YBRA 4MW7A 3COVA 3IVCA 2A7XA 3RJZA 3UY4A 1EE1A 4DDKA 1HYBA 1ZJWA 4JYZA 4XSVA 1QNFA 2C5SA 3PXUA 1YIDA 3CR8A 3PRHA 4R0NA 1EFVB 1PFWA 3CLUC 3HMQA 2O8VA 3NBAA 5IHXA 1U7XA 1F4LA 5DB4A 4OUDA 4ZT6A 4KR9A 3COWA 3GLVA 4MAFA 3KT0A 5AHWA 4GU5A 3ILVA 4P2BA 1VLHA 3SP1A 1TYAE 1J1UA 3IOCA 1KP2A 1NI5A 3DO8A 4JXXA 1JIKA 1B6TA 1H3NA 2QJTA 2IP1A 3D6VA 4ARIA 1O97C 3OP1A 4NZPA 3VRHA 4HPWA 2E89A 1NSYA 4F3RA 4MULA 2J09A 2YWBA 4DLPA 3AL0C 2ZUFA 4WNYA 4QRDA 3H05A 3D6UA 2IELA 1EJ2A 1QRTA 1TYDE 2CV0A 1PFVA 3CVVA 1N75A 3H97A 1VBMA 1PFYA 3AFHA 4NDAA 1YIAA 1YUMA 2CSXA 4K03A 1IH8A 1U7DA 3UOWA 1EFPB 1LI5A 4ZT3A 4JXZA 4L2IA 1J1ZA 3RHSA 2NZ2A 3TS1A 4MUHA 1T9GS 1N2IA 1V8FA 3JXEA 1M8KA 2I1LA 4EG8A 1KAMA 4MVWA 1V47A 4MUKA 4MW5A 4XFDA 3CVYA 2A1UA 3COYA 1JIIA 1P7PA 3CVUA 1WXEA 1T6ZA 3LOQA 1N77A 4MVXA 1N2EA 5HUHA 1Y42X 3H99A 1PG2A 1N2HA 1YI8A 3K32A 1GTSA 3IMGA 1ZH6A 4KPUA 5H16A 4Q16A 3IDFA 1OWOA 1U3CA 4U8HA 1FFYA 3Q4GA 1WQ3A 1H3EA 3HGMA 2RE8A 1NUTA 3K9WA 1T6YA 2E21A 3CLTD 4OJMX 3CA8A 1Q11A 1ZUNA 2DUMA 4KKVA 5TEWA 4EG5A 3RK0A 1F7VA 1J21A 2WSIA 3H9BA 4ND6A 1XNJA 1T6XA 3ND5A 1G8HA 2V0CA 3CVXA 3FG9A 2A1UB 3F3MA 1KQOA 3FIUA 1KH3A 2WQ6A 4MW4A 2CV1A 3RFFA 1XNGA 1NUSA 4YP7A 1NURA 1XJQA 3TQIA 5LFAA 3P0JA 4KPUB 1X6VA 2ZP1A 3M5WA 5HUJA 4DJAA 2D13A 2A86A 3I05A 1RQGA 3UK2A 2HZ7A 4I6EA 1LI7A 1G8GA 2J07A 3MLBA 3RK1A 1EXDA 3VGJA 3ZIUA 2DR2A 4MUGA 2JANA 4NAUA 4UZFA 4I6JA 1I6LA 5TS2A 2OV4A 3HFJA 5IJXA 3FWKA 5LM3A 4NX2A 4PY2A 1QJCA 2CUZA 4ND7A 3INNA 2PXHA 5FO1A 4EF6A 2VTBB 4MQ6A 1QTQA 4MW0A 2VXOA 1O96A 1T9GR 1KQNA 1KQPA 3IH5A 1M8FA 2CYAA 5KWVA 2AKEA 1PFUA 5DK4A 2GKSA 1OBHA 2CYCA 4YP6A 2QJOA 1MB9A 4ZCSA 1IRXA 1GZUA 3CLRD 3U1VA 2QUKA 1MJHA 1WXFA 1F7UA 3G5AA 3AG6A 1K4MA 1WXHA 2O5RA 2PZ8A 4S1OA 2EL7A 1TYCA 4G5YA 1MB2A 1EUQA 3OTWA 4QBTA 1N1DA 5EKDA 1I6KA 2DERA 3IMEA 3IMCA 1WXIA 2Z08A 1YUNA 3C8ZA 1R6UA 2GM3A 1JEDA 4X0EA 1GAXA 1OWNA 3CLUD 4G6ZA 3CLSC 3A4IA 4MW1A 1IFXA 4OUDB 2A1TR 4GRIA 4JFAA 2DXIA 1O96B 3MXTA 4G5FA 1GN8A 1JMVA 1JILA 4BWVA 3ISJA 2J5BA 4KR6A 2YY5A 3TZLA 4RUKA 2R5WA 3S3TA 3FI0A 1MRZA 1OWLA 4NATA 3IOEA 1MOPA 4ZCQA 3ND6A 4MWCA 4MW6A 3P52A 4DNXA 4HJXA 1WXGA 3ZXSA 3N8HA 1O97D 4MUNA 3FETA 4ZT5A 1O0CA 1O94D 1KR2A 4MUEA 1I2DA 2YXNA 3X1MA 4A91A 2X1MA 1J70A 1G8FA 3DPIA 3ZUGA 3Q10A 3CLTC 3UC5A 2E18A 2B7LA 3SDBA 1R6XA 2RD2A 2A88A 1IQUA 1H3FA 3KT3A 3ZJTA 1WKBA 4MVCA 3N05A 4CDMA 4ARCA 4EFKA 3P0HA 3FOCA 3GMIA 1QU3A 1JHDA 4RPIA 1QU2A 3TNJA 4CDNA 1JECA 5JBNA 2PG3A 3KT6A 2QTMA 2J08A 1KORA 3QTTA 3IVGA 4ZT2A 4U7JA 3IVXA 1H1TA 1VBNA 1KAQA 3FNRA 1Q15A 1MAUA 2XRYA 5TGTA 1MAWA 5H7XA 3ZJUA 4L2IB 1IVSA 1WOYA 2A1TS 3A04A 1M8JA 1Q77A 2JA2A 4PBSA 1IQRA 1N3LA 5K0SA 1N2JA 2GOYA 2WQ7A 1J20A 1M8GA 3HL4A 1MBZA 3NV7A 2ZUEA 2PZAA 3FY4A 4HK4A 1OD6A 3QE4A 1O95D 3MMXA 1D2RA 1GLNA 4ZCPA 4MW9A 3DLAA 3H9CA 4TS1A 1FYDA 3LCJA 4H3SA 3GUZA 2WB2A 1MC1A 2CFOA 1I6MA 1NP7A 5DASA 4AS1A 1IQ0A 4EG1A 1EFVA 4DDMA 1LW7A 3BL5A 2QTRA 3AKZA 3P0IA 4Q93A 1WY5A 1GPMA 2NSYA 5BNZA 4WSOA 4ZT7A 2AG6A 3G6KA 1IHOA 5KHAA 3SEQA 4R2MA 1M1ZA 5J59A 2G36A 2OQ2A 1WQ4A 2AZXA 1N78A 3A05A 4MWDA 3L93A 4MWBA 2BYTA 4AQ7A 1J09A 1N2BA 1S4MA 1JEEA 1QRUA 4F4HA 4QREA 1M8PA 2V0GA 4R2LA 3N9IA 1GTRA 1UFVA 1KP3A 3UMVA 5DEOA 4MLPA 4J75A 2Z09A 4UZEA 1CT9A 2Z3VA 4EG6A 2BTEA 1NUPA 3TQOA 1JGTA 4YMIA 3KT8A 3X1KA 2X0KA 5HG0A 5J58A 2A4MA 2QUIA 4EG7A 1EFPA 1KKUA 2X3FA 3IOBA 2X1LA 3PNVA 2DLCX 1NYLA 1A8HA
chains in the Genus database with same CATH superfamily
2YWRA 1YB1A 1IZ8A 3D5EA 1FZQA 4LMPA 4LF9B 3MAJA 4V0KA 1F9AA 4YJ3F 3QX7A 1B2RA 4NOLA 4Y1FA 1ETUA 2AX3A 4KTTE 1R0LA 2QGFA 3EA0A 3OD5A 4BQSA 4KRFA 3REOA 3BF7A 1NIJA 3FKJA 2OBYA 3ND9A 5EYPB 2WYHA 4QX6A 3JQDA 3SI7A 3AY6A 1EG7A 2EX1A 3TB6A 4U3JA 4AM8A 5JH7A 4D3SA 1U9YA 4ZU3A 2L2QA 2TMDA 2RB5A 4AVYA 2XOKD 3QFFA 3X1YA 3PQEA 4FONA 2O1XA 4QU9A 4RBNA 2J30A 5EJIA 1GPUA 1K4KA 3NWEA 4XDZA 3HXKA 4S0ZA 4NU0A 2IJGX 2O59A 3M5DA 1EEHA 4M99A 4OMCA 3PGKA 3U4HA 4AK9A 2BSXA 2CVZA 4DA8A 4E07A 3C4VA 4WEOA 3RAJA 3WQQA 2YHIB 4AKEA 4TVOA 4Z0TA 1M1UA 3DT8A 4UVDA 1GZHB 3T3GA 3U7FB 1B42A 1BRTA 4QE3A 3T7KA 4F1JA 4IJMA 2UYYA 2FX2A 3K05A 1HT2E 2PUAA 4NEGA 3I9V1 1RNLA 4FE4A 3CLSD 2O2EA 3H0KA 4DPMA 2ARKA 1Y1TA 4YRMA 1B1CA 1SXGA 2JH8A 5L40A 1ZW1A 3HDGA 4GMGA 3WSWA 2FPWA 3DLHA 2D54A 2TRSB 3EZFA 3VR3D 3Q7RA 3KIPA 2G25A 3BKXA 4D6XA 1B3RA 2GD0A 5LU8A 2BGUA 5AI5A 4W5NA 1GIAA 1R88A 2ZJ1A 4GSKA 1RKBA 1RRFA 2FDXA 3D6MA 3WBBA 4URWR 2VXCA 5TQ0B 1GGNA 4E1AA 2ZUTA 1NWHA 1TQ4A 2ZU0C 1O6CA 3VDMA 2JL1A 3CR3C 1V45E 1YCDA 4EDFA 2IW3A 3V80A 1XZPA 1EJ6A 1P9OA 1X38A 4XPIB 5B1IA 2VJCA 1MAHA 3GP3A 2RIRA 1F20A 1UJ6A 3MMNA 4L72A 3BA6A 3SM3A 4J0EA 3G0HA 4D9KA 1D7AA 1N2CA 1S3IA 1XAJA 1TEZA 3UG6A 3SX2A 3E58A 4GP6A 3ZN2A 4JFRA 3REFA 5LKAA 4B87A 2RGCA 2UVPB 3PNBA 3ICQB 1C7EA 3A7EA 5LJLA 2HA2A 4JJFA 2ISSD 3W6NA 1KSFX 4K9QA 1CU1A 4TLEA 4ZV7A 4ZFNA 5CDSA 4LNAA 1IDN1 1V71A 1YJQA 2ZS9A 5MN4A 4IIBA 1NPYA 4CV3A 2XQJA 3QU5A 4J76A 3WHLA 2LR0A 1TFUA 4NOJA 1W44A 4P34A 1EGVB 5DT9A 2Z0MA 5JQGF 1WUJS 4AULA 2PUGA 2FG7C 4ID9A 1RAFA 3VV3A 2MYNA 5KCMA 4LJ5A 2RI0A 3K6JA 1XZDA 2BFMA 3G5LA 2YV2A 3W1EA 5KS2A 2X3YA 5D01A 2FEOA 4OBXA 1ZK0A 3AEUA 4LNUA 1E32A 2RFLA 2BR5A 5T3YA 3COZA 1E79A 4FNAA 2AFHE 1YBMA 3ZJYA 2PANA 1XCOA 4KQMA 4D81A 4PBTA 1NLFA 1WMEA 3NHRA 4YBRA 3COVA 1MAVA 1GGEA 1WUHS 3I2JA 1WPGA 3IUMA 4HY3A 5A6VA 1XRQA 2JLAA 3E35A 1E7WA 4JYZA 3CS3A 4DFDA 2DULA 1KYTA 3GLTA 3OPQA 1EFVB 2B2XA 1ISFA 3NBAA 2FSVC 4FJ1A 4NOKA 1M9NA 3OQIA 4FC6A 1NQUA 3RFVA 4F11A 5I4IA 1GDHA 1PR3A 2J3IA 3FPEA 1F4LA 5JAIA 4RVDA 1ACLA 1GA1A 1U5AA 1D07A 1NXOA 3FRIA 1EP9A 1L9XA 1SR8A 2HRQA 2RSLA 1OREA 1KPGA 4MAFA 3DHWC 3GRAA 3D3NA 4GQIA 4OPMA 4OXYA 4M98A 5H02A 3IDSA 3IRUA 3FTQA 3GAFA 4K6HA 2W83A 3PI7A 5AO9A 5EG5A 4EO7A 2FSSA 4NOMA 5HKKD 4FR0A 2YW9A 1JIKA 3D3WA 3AQIA 3LZDA 4CTJA 1ZUIA 4GHWA 1OZAA 2FN9A 1K6EA 3OY2A 1OC4A 3K6SA 2GFHA 4W1QA 3D1LA 4YCMA 3W05A 2Z58A 3CX4A 3GU3A 3M8KA 4NZPA 3DF7A 5DNWA 2BY4A 5L3ZA 4NJOA 3VRHA 4C1BA 4PLGA 1Z73A 1P5JA 1M76A 1NQXA 3FPAA 5B3AA 5C9ZA 3SSAA 1AHPA 2V8OA 1LVGA 2ZTHA 3EWAA 3QXJA 3NX4A 1YZKA 4KQWA 1QH8A 5CNKA 2ZYDA 4QVKA 1JDBB 1DJQA 4QDTA 1CJBA 4ZOLA 1BWSA 5U9CA 1EFTA 4D57A 1GCGA 5J5CA 1EJ2A 1FA9A 3RFTA 3K35A 4MV6A 4MZXA 1QRTA 3DGFC 3I3SR 5IKXA 1NKVA 4FFMA 2WPNA 4GBJA 4WOBA 1CULC 4ZEWA 1YQGA 1KMHB 1UQRA 2WPDD 1PZMA 1U28C 4C0KA 1JFFB 1VLJA 2GBGA 5D6NA 3WFIA 9ATCA 4G5QA 5IJZA 4FHZA 2G7ZA 1MGOA 4XVQA 3D02A 3AM1A 4R3WA 2CMDA 3ZW9A 2WG0A 5I9MA 1EBUA 2P8JA 2GM4A 1TJ4A 2F9FA 5CD9A 5ICFA 3NHBA 2LCQA 3R5SA 2WZDA 3N58A 3P9SA 1KI3A 4QPPA 7AT1A 5KYYA 4KR2A 3ZV5A 3M4NA 2CLEB 2XMDA 2XSZD 1J56A 3EXIA 1FS4A 2UYCA 5C4GB 2EHJA 2XUDA 2ORVA 2WWRA 4UHEA 1OBFO 2DLDA 2I67A 3DDCA 4W7SA 2NYAA 3R76A 2ZXUA 3R74A 1YOVB 3DWGA 3UHAA 2OORA 1DS6A 1T6ZA 4XIIA 3LT4A 4ZQIA 2OB1A 1R0CA 4TL8A 1ECFA 1T2FA 2RIPA 2WOJA 3AMVA 1Z0ZA 3FUTA 1NNI1 5D6OA 4YONB 3CO0S 1T3GA 2A9PA 1QG6A 1RIIA 2QAGA 1JJAA 3BICA 1CE8A 4ALJA 4C7XA 4YWHA 3UMMA 1AQUA 1NMQA 1OWOA 1PGJA 3K9FC 2B9VA 1LPNA 1LDNA 1SCQA 2H63A 2J33A 2BFWA 3JRXA 5ALLA 3TSZA 5LQUA 3T1VA 5AW3A 3T1NA 3R09A 4ARBA 3P96A 2OLEA 1Q0ZA 1GSHA 2I3AA 1X1DA 4IQGA 3WGKA 2FQQA 3AR7A 4BTEA 4DV0B 4DV3B 1USWA 1KO8A 4DR6B 3EA4A 1SU8A 2C2OA 3HXMA 1E4EB 4CKBA 2FRDA 1KMIY 1NBMD 2PRJA 1Q11A 3CA8A 3D0OA 4P92A 4I66A 4LJKA 4D0GA 4NBRA 3LCCA 5DX8A 4BFZA 5I9IA 2DTDA 4YO7A 5DOVA 3UJNA 2D8MA 3ND5A 3BBLA 2MSNA 2HLHA 4MIEA 2P4HX 2X76A 4MJ3A 2JAUA 2A1UB 4I1YA 4Z9YA 3SYKA 2I71A 3THRA 5I9LA 4B3GA 3MRXA 1NG9A 3WAKA 1YBFA 1F60A 4P38A 5FI3A 2P6UA 3F9RA 4G9BA 4QDZA 1R37A 4K9SA 2R6AA 5B1EA 4CKWA 3NANA 2C5EA 5CTJA 1UWLA 2EFDB 2BBTA 3L7JA 1CZUA 4LHVA 5G53C 5E3HA 1NAHA 2AF3C 3JCZA 1P72A 3SIRA 1MRNA 1QGOA 2R84A 3QBVA 2EDCA 4ND1A 4I6EA 3K9HA 3W4JA 2P6NA 4JLUA 4QNNA 1ZCAA 3ROMA 2MSDB 3MCWA 2JANA 2CSUA 4AO6A 3RC8A 4YRZA 4RIEA 5GADl 1PZHA 4FYVA 5CFNA 2Q5EA 1CQJB 5IT5A 2XYQA 1W6UA 4HWKA 5K51A 2JC3A 3KO8A 5JEDA 4M8IA 2PSHA 2I1WA 1F3OA 4DZZA 1FVFA 1OBOA 1A8QA 1PDOA 3JWEA 3L7AA 5HMLA 5SZHB 3EH1A 5HIJA 3VX4A 1OJ7A 1X9HA 3QVWA 3KEGA 4ARVA 4OIMA 4UFPA 3F1KA 3UMCA 4B71A 1VBFA 5A9TA 4IHQA 1K2WA 4QUBA 2CVPA 4JN6B 5G4LA 2B3TA 1PFUA 1S3SA 2BHRA 2FPIB 2OE2A 2X13A 1T9ZA 4WFKA 1QGZA 2R4TA 3TR0A 4R71A 3HXQA 1QXSA 3AERB 3UTCA 3I6IA 3REQB 4JI3B 1JHZA 1XJCA 3PS9A 4QPCA 4ROSA 1M0SA 1I1OA 1NBOA 3BWMA 1FLDA 3FAKA 1SC1A 5DDIP 1L8LA 3L02A 4B09A 1TC1A 3TQHA 3QLVA 4CV2A 1FSFA 1S2OA 4GL4A 1CR1A 4MCJA 4WNCA 4YGXB 4JLOA 4Y9SA 3NNDA 3OZIA 4H6VA 4CMEA 2V7BA 5AW8A 5I9SA 3S29A 2HA0A 4FW9A 1Z8FA 3X2FA 4BWYA 4XB6B 3O8QA 4LWOA 1E2EA 1EVLA 4FQ5A 5KVVA 3O73A 1MB2A 3OTWA 1UWCA 3G85A 3PUKA 3OIFA 5TMPA 2O7RA 4IYJA 1YUNA 5GAJA 2GQ0A 4X0EA 1W5TA 2R7MA 1GAXA 5CB6A 3T61A 1JI0A 3VYWA 3I04M 4OUDB 4KWEA 1ACMA 2A1TR 2FEAA 4WZZA 4F72A 4Q1VA 1TLLA 1XLWA 2CHGA 5I7OA 3SLGA 4Z86A 3USCS 4K28A 3RTCA 2AUTA 3KXKA 4LZJA 4GM4A 2QTZA 3CN9A 1CY2A 2X1HA 3EQ9A 4AC9A 2I7DA 1ZA2A 1XMJA 2YY5A 3V4LA 4ECAA 2Y27A 2NXCA 3UV6A 3GUCA 4LOLA 1K0FA 2POQX 2X23A 1U02A 1DVRA 4BKPA 3GLGA 4ZO9A 1AVTA 4ZCQA 4D79A 3ND6A 1UFOA 2AF4C 4JL8A 3Q6MA 4NE7A 4QHYA 3S2ZA 4EPTA 3TOXA 4PQFA 5K0NA 3TDMA 4WNAA 2VCHA 5DIFA 1KARA 3ADOA 3OM9A 3AONB 4IDGA 5DIZA 4Z1MD 1H1LB 4PR3A 2FFBA 2O57A 3NIFB 4TS3A 2OFFA 3W9UA 5IN4A 4MUEA 4DY4A 2YXNA 5GJBA 1HTBA 1E58A 3DOOA 4I4TA 1EUCB 1SUDA 5FHRA 3SBOA 3B6KA 4J7XA 4UTNA 3PNLA 3WL6A 1VLMA 3TUZC 2GZ2A 2WC1A 4BX9A 3IJ5A 4D4LA 2PGJA 2YL2A 1XC7A 2O7SA 2Q1XA 3ILHA 4WQMA 3VO9A 1NNEA 2AZTA 3GBVA 2J0EA 3JYLA 3ZE7A 4RK4A 5AI6A 1E9BA 1DMRA 1I5EA 4AZ3A 3EY9A 2BJHA 4OJYA 4GGOA 2V7VA 4HZGA 3TNJA 5C80A 5CDTA 3L5OA 5JBNA 1JDNA 5K3AA 3IALA 3LVRE 3NONA 3ZTWA 4UU0A 2W6NA 2XRYA 2PWAA 2VZLA 5DM70 1HGXA 1OVGA 2Y0PA 2Q99A 3DDNA 5EXDA 3U31A 3DE6X 4DG5A 4ZQBA 2P9HA 1BWRA 2ZSAA 2JCSA 2IV3A 5FBHA 4NNPA 1M0TA 4B33A 5BY2A 4HXGA 3R3SA 1ZVJA 5LQSA 1N8NA 2WMDA 4EUHA 2GN4A 1Z7WA 1QR6A 5CT8A 4ZHQA 3PFGA 1DL5A 2EAUA 1XK7A 4GZMA 1MB4A 1OX4B 2XE4A 4Q1FA 3KUUA 1Z6AA 3RT9A 4LC9A 1J7JA 2QRMA 1RC0A 2AE1A 2QOEA 2WKSA 5INTA 3B3QA 3VNVA 4MGIR 3G1TA 1E1LA 1NC3A 3QPDA 3H2HA 1P5HA 3LPNA 4DREA 5JCOA 1BHJA 1Y6RA 2D2IA 3LKVA 3MTDA 5FF9A 4JV5B 3RCBA 3NHMA 3VPXA 2C5FA 4A7PA 3GARA 2ZITA 5IX8A 1INLA 1DT3A 1E60A 5EFOA 5AOCA 2I2XB 3VC2A 3KFXA 2HQBA 2QU8A 4UEJA 3ZV4A 1ZJZA 4Q93A 1B43A 4WBXC 2OHVA 3EDMA 4RY8A 4DSAA 1BFDA 2CXTA 1N92A 3HWX1 3LBYA 4RK7A 1NY6A 1GDDA 1IOWA 4RGVA 1N7IA 1GP2A 1EGHA 4FOOA 5DTQA 2OXFA 3OURA 3W77A 3U9LA 1A69A 3A05A 3DFUA 1DKNA 2TSYB 5IVIA 4EHAA 3C2QA 1MJFA 1ZD4A 2FPSA 4TXNA 1Y7TA 2LBPA 3SC3A 1EA5A 2HTEA 2VDVE 3OZDA 3B3JA 4MR7A 5AKHA 4UC0A 5DLQC 1O5IA 1RWQA 2AC2A 2IGBA 5EN4A 2BPOA 3I76A 4QM6A 2AZ4A 3ND8A 2EKLA 2B4RO 1N5KA 5C4MA 4QYMA 5ECWA 1K1EA 2NXEA 2BWJA 4B2YA 3V8RA 1FIUA 3AVUA 5LQRA 3KUXA 5KC8A 2MINB 1V9SA 2W4IA 1Q1BA 4XQ9A 2PJZA 3GLIE 2QLJA 2QTBA 3WIDA 1N1EA 2D8AA 3FZEA 4CETA 4NECA 1DG3A 4J0DA 1JJIA 1RLTA 4QPDA 3FTNA 1C1DB 3RRMA 5CX4A 4B75A 2AMLA 2G0NA 1XRRA 3RT1A 3B1XA 2X0KA 3EEIA 3LDHA 2YVQA 4Y2SA 2G28A 1ZEMA 3KVVA 2V9ZA 5A4FS 1Z2CA 5MHTA 3LPMA 3I09A 4EG7A 1D4ZA 1QTNA 3ESCA 1F51E 2DLCX 2X42A 3KBBA 3NETA 2I78A 2GZAA 2ZBDA 4RE6A 5TARA 2ZS7A 3C3CA 5KTOA 2ZRDA 3BMQB 4ENUA 1XCBA 2Q3JA 4REQA 3VKFA 2AOTB 1KIFA 4B0OA 4ER5A 5LOVA 1E9FA 3VDNB 4HJRA 1H5NA 1KMNA 2AEMA 3PB3A 3EIFA 3LLVA 5FO0A 1TGVA 3TW8A 1DX4A 3K0BA 3W5HA 3HKEA 4MCHA 1NRXA 4M8KA 4BDSA 3NHJA 4OHPA 3GP8A 4I1VA 2P4SA 5DW3A 3EGDA 2ZWPA 5IWAB 2CE7A 4GVXA 4PYRA 1PT9A 2WHPA 1X1EA 4TLBA 1QCDA 3QIVA 1MDBA 2QROA 3VJLA 4YP5A 4BNMA 2VA9A 4R9VA 4BCBA 1C30A 1Q3TA 4U2EA 3CY6A 4CU5A 5M7EA 3BVPA 1CP3A 1H9AA 5L51A 5H1YA 2A5GA 3IBFA 4Q4HA 1CRLA 4HWGA 1G8JA 4G65A 2IIBA 4OBEA 3EPHA 3K30A 5TGTA 4PG7A 1OV6A 4Z0PA 3IUYA 1OI7A 1UBMS 5GOTA 5J4YA 3WA7A 4P6VF 1ZHFA 1NG1A 3WIEA 3MRVA 3OIVA 1V3TA 1WEKA 1R6TA 2O3TA 3GLIB 5JARA 1FMTA 2AJBA 2DPLA 4ZO7A 4DCJA 1DAOA 1GRNA 1LLCA 3LBIA 3G23A 1E3MA 2XB8A 4PRYA 2WM9B 4MRRA 5EJ8A 2PZBA 2DFPA 3OKCA 2PMBA 4J91A 4LKOA 3N2YA 3DPUA 3NHUA 3RIYA 5IEJA 1U94A 3E3OA 4IIHA 1JZQA 2PVSA 4JH0A 4BLTA 4AQYB 3AETA 4UCXA 5JCJA 5L7TA 4EW3A 3TAXA 1KK1A 2NNWB 2XRZA 2AOWA 2NU7A 3RIEA 1RADA 1M0WA 4LOJA 2B82A 4CCYB 2P7IA 3ROTA 2G1PA 1JEYA 2X58A 5LP1A 2WAOA 3DDHA 1ZVVA 8OHMA 4FGSA 1LQ2A 2AL7A 2WUWE 3K1JA 3WAJA 3HN2A 3RUFA 1G3IA 1Q84A 4FBLA 2XTZA 3M3HA 4HRVA 5KYNA 3CJRA 1DOHA 2OM6A 1VFPA 3TLBA 1PVVA 2GNPA 2ZSUA 1DC6A 3EJ6A 3LE8A 3M7IA 4MV5A 3UV3A 4D80A 2XCSB 1X1SA 3MTEA 4XJSA 4OQ4A 3I58A 3MEQA 1SZPA 5J5AA 1NOKA 3UK0A 2XNJA 4ESVA 3G59A 4KFUA 3G2HA 4MUFA 4MIOA 3WGTA 3B36A 1MFZA 3RSOA 2CHQA 5D00A 2D7DA 3WOHA 4QOEA 1KAEA 5K9ZA 5MFPA 1KOFA 1Y3DE 4CFSA 2CGEA 4FGUA 1A98A 1ZGAA 3O2SB 4E03A 3DNPA 1GPAA 1P1RA 5FQNA 4FDTA 5JJCA 4N5DA 4F5EA 3B6MA 4H6WA 3EC2A 3ML1A 2FPOA 3H19A 3AKDA 3VSBA 5FNZA 1Z82A 2CWDA 1JG7A 1AGPA 2BDEA 1I3OA 3W3AH 3B6EA 3DMDA 1F48A 1HRDA 3LZ6A 2ZJ8A 4O1IA 3VZPA 3SHTA 2XCLA 2OILA 2VBIA 3FD8A 4QYTA 4DBVO 1DOZA 4G0XA 4QIHA 1IU9A 1PVDA 1FQWA 5FKJA 4EHJA 2UUCB 3CMCO 4ZI7B 1K7FB 2QAIA 4M36A 1KNQA 1VC2A 4PLZA 3HJTA 3PIDA 4MS1B 2XODA 4NJMB 4YPVA 3AVPA 2HLDA 1G20A 4I81A 3ZHSA 4EY6A 1U0EA 5DYTA 4A15A 2G8NA 2X0EA 2BFDA 2QIPA 5A7HA 4KNYA 2QT0A 4RAOA 1OTHA 5FPYA 3PX2A 1JDUA 4YNBA 1Q7TA 1ECJA 1GNQA 3UCEA 4RMNA 3EFOA 5AHRA 3HC7A 2W0MA 2ZROA 3D4PA 4JP3A 4ZT6A 4RLQA 2EKPA 2FSGA 4N0QA 4QJ3A 1AGYA 3COWA 4CCAA 3TTWA 2HIAA 1XTSA 3VC1A 1KVQA 4TUYA 4OHOA 3X44A 3NLLA 4FU0A 2RKOA 3ESAA 4QNMA 3E05A 1MJ5A 3DW3X 1IHYA 4Q34A 5TGZA 3HJRA 4PVDA 4IKPA 1B6TA 2WTBA 4C4PA 2XA1A 2BTQA 3QVGA 4B6QA 1TMOA 5AM0A 1H3NA 3CXUA 1P9WA 4ARIA 2QRJA 2H17A 3UMRA 5JNUA 2YZ2A 1ZOIA 3ETEA 5CRIA 4B5LA 1HTTA 2FSUA 3F7OA 4B3CA 3FRJA 4LMRA 2I4LA 2ZUCA 1GNVA 2OCLA 2PJUA 4F3RA 1OF1A 1Q1ZA 4Z0HO 3F5DA 2REXB 3QA3E 2ODAA 1CP2A 3Q8WA 1MMFB 3KB6A 3JRWA 3RS9A 4YB8A 3RB8A 4P0QB 3HDHA 3KKQA 5E9QA 5EHXA 1FDSA 1TNDA 3JZFA 3R3HA 4M53A 1ZRHA 4Y8VA 4JQCA 1TT7A 2XVYA 4LJLA 4AI6A 3RV4A 2ZTSA 3A32A 3F78A 1YHYA 2CV0A 4BN5A 1I7LA 2BSQA 1SRRA 2A14A 4Q3EA 1IUPA 4K6FA 4CG3A 1LB1B 5TPWB 4RTQA 2WAMA 2C2XA 2A35A 1YDFA 5BYKA 5CT6A 1N33B 1R16A 2VHWA 3BTSA 5DXJA 3RJ5A 2F4NA 3UAYA 2VYFA 4YCNA 3AL3A 4A23A 4F5DA 5HJ2A 3SSNA 3JQFC 1UM9A 4K7JA 4RQBA 4JYAB 5J4LA 1SU4A 1Q7BA 5F73A 2BZ1A 4JZKA 4QUKA 3JZIA 2Y6VA 1GUYA 4LUCA 4MVWA 4S12A 4UVGA 1RMYA 1HOTA 1ODIA 1VP9A 2OO5A 3UT6A 4PZDA 2FA9A 3L4EA 4JODA 4B4WA 5HUHA 1H2YA 2X7XA 4ZCIA 3A58B 2V58A 3NVAA 5WRFA 1N2HA 3CRZA 2EYQA 5I8ZA 1V0JA 1XMXA 3EZ6A 1PYDA 2PGXA 1V95A 1GPNA 2P9YA 3LRXA 3QU2A 1A88A 1U31A 1QKJA 1Y8QA 5LDDC 1FFYA 3L6BA 2II6A 1FFAA 2F17A 2PL9A 4II7A 5JS6A 1I5OA 1PS8A 2FN8A 1CZRA 3LPAA 4BO2A 2ECQA 3M81A 5DE3A 1TRKA 1UJMA 1B3BA 3SFVA 3LVQE 2O8BA 1SCNE 3ILYA 2P0YA 2PGLA 4ZAVA 3VR4H 3ZHCA 3ZY3A 5BMVA 4OJMX 3UGQA 1OB2A 4OI0A 1RQNA 1KJZA 3F8SA 4GVLA 3UYLA 3WJAA 4C78A 4DN6A 4EG5A 1TF2A 4ZI7F 1JEQB 5ICCA 2B5VA 5A9SA 2NMVA 1QORA 3ZNNA 3K8OE 2IV2X 2OSBA 4UQOA 1W5BA 2VHZA 3MIIA 3IUSA 3ZKWB 1BOFA 1R15A 4RORA 3PC2A 4UBMA 1KRHA 5AVJA 3DZIA 3U7HB 5HCIA 4ALMA 2I7TA 1O57A 3R0XA 1NUHA 4DQKA 1XTIA 5JR3A 3PQDA 1RBMA 3OZAA 4EH1A 1UJ4A 3TQSA 4YPFA 3AOEC 1G21E 4L73A 1C0KA 1XZ8A 1CQIB 2NSDA 3HVUA 2QN9A 1DAGA 2HU5A 2QS9A 2VHXA 3WWZA 2O3JA 3EG5A 4M83A 4TMKA 2HXGA 2JK1A 2WVAA 3LBHA 5TGDA 1EX1A 4XIFA 3IEIA 3K8YA 4AY6A 1TADA 2LP4Y 3VGJA 3DM5A 1ZESA 2OYRA 3ZDQA 1QNLA 4NAUA 4Q12A 3H9JA 1IMOA 2GXQA 2JIQA 3BK2A 4CM6A 5CB0A 2ERYA 1DWOA 4JSRA 1OT3A 1QC5B 4INAA 6ADHA 4WBSA 2B99A 2A8YA 2JIDA 2I8CA 2ZXFA 1GVHA 3C8DA 5CFZA 2HX1A 5IT0A 3IDZA 4CIDA 3B5IA 3FVRA 2C77A 2PWYA 4CG0A 4TQAA 1QTQA 2CBZA 2HCRA 3KQVA 4AJ9A 5JO0A 2HYIC 2OXEA 2H7YA 1YAHA 1HQCA 1T9GR 2GM9A 4PS1A 4PS0A 5H9VA 4CJXA 3FLEA 2NU9B 1B0AA 1ZDMA 4GOOD 4HADA 1KEZA 4B4OA 5ADWA 4YP6A 3A27A 4WKGA 2BKVA 2GTIA 2EHDA 1X7WA 2NSLA 1MB9A 3KU4A 4XD7D 4YAJA 3AEQA 4BKOA 1Q3HA 3L07A 3I42A 2DFKB 2BFOA 1TC2A 4IMRA 1E7QA 4QFDA 1C0PA 3IAFA 4X1IB 3WLTA 3KOUA 3AIOA 1K4MA 4RIGA 5DM4A 1VG0B 5IARA 4DLLA 3EZ9A 3GJ7A 4HMPA 4YJHB 3MS7A 4B4KA 4H7IA 4R3NA 4DYDA 1WTAA 5CBPB 1KRWA 3TJRA 5J2UF 1ANKA 1CJTC 1SIOA 3AVTA 3K7EA 2XX3A 1T0IA 2UUBB 3HP1A 5C3UA 3CNNA 3SKVA 5JYCA 3R9WA 1NBHA 1G21B 4TSKA 3N8NA 3FWNA 4HYYA 2GCGA 1HFWA 3AUJB 2F3RA 2CHEA 1JQBA 5T6BA 3KDAA 1IN6A 2O7VA 4UD2A 1GRCA 1D2EA 4E4RA 5LZ9A 2RK3A 4OP1A 4CIAA 1JILA 2MT9A 2IV7A 3E53A 1A4XA 1Q6YA 1XLVA 1ZMBA 2NAFA 1EH5A 3I4FA 3WL5A 4JD5A 2R5WA 3F2IA 5DCUA 5BSGA 1SG9A 1ZNXA 3TEMA 1Y8CA 4PC3A 4L3WA 3EN0A 1EVYA 4NKRA 4MB6A 5KNDH 1OLXB 1P8JA 2UYQA 3KHKA 3BL6A 4HEHA 5DTEA 5SZKB 3I9NA 4AF7A 4H1TA 4DDVA 2M32A 3ZXSA 3ROGA 3GQBA 1WUIS 5CLGA 2VKTA 4MQFA 3E0XA 4V1CA 2HK7A 1PS0A 4IFBA 4X24A 1DE0A 4ZT5A 3SQDA 1AKEA 1GXSB 3FHLA 4PO1A 1I2DA 1Q0PA 2HD4A 1IB6A 1WEHA 4BMCA 1OVMA 2ADMA 3L1KA 4XDYA 4XIGS 5GJVC 2DCUA 3WLPA 3NDPA 1JKJB 3VC3A 1XVUA 2PXXA 2V4MA 1A8SA 4IXTA 5TC4A 4OJNA 3ZUGA 3IGFA 4ZVTA 5AVKA 3DEIA 1PZFA 3U13A 3PG5A 1FXUA 1PJZA 3EEBA 4QDOA 5HQ3B 3OKFA 3HJNA 5B7PA 5TX7A 4IHKA 2Q3FA 4K40A 3AW8A 3SXUA 4AXBA 1QU3A 4LYGA 2PSSA 3HI4A 2Z5GA 1QPGA 3GY0A 3O84A 3IVGA 5JAZA 4CIVA 5CYGA 1GNSA 2Y9MB 4QAJA 2HSDA 1ZHOA 1MAUA 4JP8A 1PEKE 2OAP1 5JAQA 3WNZA 5IM4A 4M7RA 4DQLA 1GV1A 4M88A 5KTMA 3ILSA 4GPAA 2OXTA 2BOVA 5K0SA 1US8A 1GILA 1OI2A 5AHOA 3BERA 3TGPA 1ECLA 3DUWA 2AVDA 4XFKA 5ARCA 1NVKA 3HL4A 3Q7SA 4KDFA 1HE4A 4PIPA 4RD1A 1ORRA 5G0WA 3T95A 1RYHA 2JGKA 4FYIA 2WUDA 1FB5A 4GXNA 1O95D 1ZI6A 2ISCA 1K3FA 3G2LA 4M7WA 4ML3A 1Z2AA 4B8WA 2WD7B 4D96A 4P93A 5D3MA 3BDIA 1DQRA 1P9LA 3DTVD 3PYXA 5CGZA 4KR3A 1A1SA 4CT5A 1REQB 2WIBA 1QHIA 2CFOA 3WB1A 4DGSA 1E92A 1W34A 2I2AA 2WJPA 3Q3GE 4XUEA 3UQYS 2BH9A 4TMVA 1Z5GA 5AK6A 2I29A 2YJ3A 5CEFA 4OQFA 4L3OA 1E7RA 1UBLS 1V6CA 1WUKS 2W9XA 3H5IA 2Q9BA 4RY9A 4Y3UA 3T54A 4EJMA 3N2LA 3L0DA 4Z99A 1ND5A 2CB0A 1IHOA 2IPNA 3GCGA 4IH9A 3JQ7A 4XD2A 5KAMA 3UQZA 3WBKA 4COOA 1SNYA 1W5AA 2PIAA 1HE3A 3E3AA 3UAZA 1DKRA 3AHIA 1Y8ZA 4X62B 2AZXA 1O6FA 5E2IA 2VJYA 1YZNA 2CCKA 1M1YA 1AT1A 3V1NA 4NU5A 3MJCA 2YV1A 1J09A 1E98A 5SY6A 3KFVA 3MJEA 5DPMA 4YAKA 3A11A 4DJ5X 5FWNA 3U39A 3IV7A 2NTJA 1LSOA 4M1SA 4J3FA 1M8PA 5CX1A 1CVRA 4G5HA 1J25A 5BN3A 5IHPA 1IXRC 4UOZA 3ZGOA 1ADYA 4DJFC 4BMVA 3VHXA 1KP3A 2OTCA 4R1NA 3AOGA 4JB0A 3IBSA 1L3IA 5LQJA 1TCVA 4XAQA 5ED0A 3AHFA 3ANTA 3VVLA 4DRXB 4JP5A 4G85A 4RD4A 2RGDA 3FSEA 3LYAA 3C48A 3KTOA 5F3WB 1JU9A 1CY7A 3DBRB 4HH4A 3DZGA 4B34A 3OCUA 3VKHA 2N46A 1F4VA 2AKAB 2XQFA 1T4CB 3KQQA 4BATA 2PUTA 3BDAA 3P94A 4TTVA 3NC1C 2LWIA 2YS7A 2B7CA 1DTWB 4PYMA 5C35A 3OAAA 1E8MA 2IVFA 3ZWDA 3WK6A 2W2MA 2QG6A 1L4BA 4HWRA 4MHOA 4OXKA 1J8MF 1GG9A 4WOCA 4AWAA 4D3ZA 3PL5A 4GL2A 2HYDA 1DKMA 1M34A 2RJOA 2VSQA 2ZVPX 3O0DA 4Q39A 4CTNA 2G1UA 3P5SA 2ZUSA 5BN5B 5JXHA 1XSEA 1WIWA 3WDKA 3AY3A 3Q7IA 1WAMA 3NZEA 5FOTA 1QQTA 4I6GA 3RUCA 4CEHB 5DLDA 2ZUUA 5G1PA 2GO1A 1P2FA 3W78A 1RWPA 3JYNA 1HFJA 4R8SA 4BEJA 2GJ9A 3KJZA 3LQYA 4GX5A 3L92A 4QU8A 4XGKA 3U62A 1YV9A 3WP0A 4AP9A 1M33A 2WAXA 3EZYA 4LPSA 4M9RA 3KYCB 1PJTA 2PMDA 3RAPR 1NBEA 1WPRA 2O8CB 3R5FA 2QUHA 3LUFA 1EFAA 4QYIB 2E4XA 5JVDA 4KYUA 4O4LB 2L0XA 3M2TA 1LDMA 3DJYA 3TRFA 5MGNA 4L5IA 5LMZA 4ZDWA 3MTBA 1YI1A 2BHTA 3U26A 3CZRA 2B21A 2FMHA 1FRVA 2PUJA 1A27A 1NLUA 3QKRA 4H60A 4KQKA 1HZZA 1Z4KA 3QJYA 4OYHA 4D8UA 3N2GA 3SZGA 1FDRA 1UBSB 1K92A 3DEFA 4NCHA 2HMTA 7REQB 1RSZA 2X6QA 5K3DA 1IBMB 4NCKA 1SA0A 1T3LA 4E2XA 3CH5A 4XB1A 1I4OA 1Q92A 2VNKA 1XMSA 1VYHA 4MICA 4XB2A 2FZ5A 4DCGA 3FUXA 3M4XA 4HLQB 4W4TA 1TTHA 2BGIA 3DEYX 1K6XA 1TW3A 2IUSA 3KQWA 5EVCA 1ODJA 4AKSA 2I7CA 4B3RB 1XIVA 3G9TA 3MCVA 4WW0A 4JJZA 4LBYA 3IT3A 4JT2A 3P0EA 4IDCA 3V8PA 1BJRE 4NG5A 3R9KA 4DXHA 3RVPA 1W30A 1M2FA 3V6MA 1TVEA 2FEMA 4RD3A 1V3QE 1N0IA 4BRUA 3H7IA 2BP7B 4D9FA 1JHUA 3E8SA 4EKEA 1EGAA 3HCEA 4QYWA 2PKQP 3BA1A 3W9BA 5JMWA 3ONWA 5AIBA 4MUAA 5CCXA 3V2IA 5L3SA 1BCSA 2E0IA 1EM8B 4TTAA 2WY2D 4CT0A 4RTSA 5E9WA 4PCLA 1TK2A 2GZDA 4M4SA 2IP4A 5A3VA 2W70A 4EVQA 4B1FA 2JGAA 1XT6A 1N3IA 1K7YA 1TMGE 2HMVA 1TQ8A 2JVIA 5CXUA 5LQCA 4RENA 2ESRA 1M2VA 1JKXA 3QUAA 2O4UX 4B7UA 1UAGA 3PKJA 5KI6A 2QRGA 4YYZA 3MUEA 3EG9B 1U1CA 1R64A 1Z9BA 1VE5A 1WSAA 4PFQA 2WF9A 3IELA 1WE2A 2YJTD 2AX4A 4QTXA 5JDIA 4BKMA 3RRZA 5F2NA 5JC8A 2QUZA 2GF0A 3LP5A 4J94A 2IU3A 4QJ4A 3C74A 4DUGD 2C31A 1AGNA 2AQHA 2DBQA 2YXDA 3HJAA 3LOPA 3N1UA 1T6NA 5JZBA 3R6GA 3CEPB 2O0KA 4MJ7A 2FP4B 5LYJB 1PQ4A 3ZUPA 3KETA 4GX2A 2BCJQ 3O03A 2H1VA 4JJAA 4YP1A 3DFZA 1UBHS 2HF9A 2V6FA 5CVJA 1QIEA 2IYSA 1TX4B 2P5UA 3UJHA 2GUGA 4B6JA 3KVYA 1PNOA 3KLPX 3BZWA 1E96A 3DAFA 5LZ5A 4DE5A 3KAPA 1CEQA 4U00A 2CF5A 6LDHA 1F8XA 3Q9UA 1ZD3A 4YT5A 3QXXA 5AW6A 1V11A 2J3DA 3CZPA 1FFDA 3CH6A 4L9RA 4TX1A 5FWXA 2WDZA 3ZU2A 3CTPA 3FHJA 4GRAA 2QPOA 4EFDA 3ZU6A 4BJ5A 2J45A 3KYDA 4HWPA 4BVBA 5AK5A 3B20A 5JRDS 4OFBA 3IILA 2IYAA 2H1OA 2W5UA 1SBYA 1G6Q1 2AN1A 4PZ9A 2JJQA 3PXUA 4JI1B 4HDRA 1BMDA 1I4EB 3C97A 3ICOA 4DSNA 4L78A 1CJKC 2G88A 5GPBA 1Y6GA 1O9HA 1FSGA 1XU4A 1ZVMA 4RKEA 2P3LA 2V0NA 3ZE9A 4JI0B 2G77B 3TGWA 4RY0A 3EGCA 1XG5A 4FOSA 3FTDA 1MABA 2CHUA 1J1UA 4OD0A 1SXJE 2GEJA 1A9PA 2VDJA 1AX9A 1GTZA 4KQGA 2XCIA 5ALKA 3RTAA 3KELA 2HHHB 1JR3E 1OGIA 2CUNA 3MFYA 3EFHA 4KGDA 2GCOB 4J4BA 2WIDA 4G1VA 2Q1SA 2H1LA 2J9ZB 2XDYA 3W6OA 3T7CA 1LPOA 3MWGA 1N9GA 2JVKA 2XGOA 1H9BA 1ZY2A 3WGMA 5E4TA 5F7XA 2R65A 1U4OA 1G18A 3CG4A 5BVGA 1AKYA 1ZOSA 4C07A 2IGTA 2GLXA 3EZ7A 1YRBA 1GTMA 3AVXA 1HF3A 3DH0A 3DCIA 3G0CA 3IQZA 4E08A 5LR6A 1C4OA 2C58A 3CKMA 1B8PA 5BNFA 3KJIA 4JGIA 3Q15C 2WP8J 2D5IA 1AKUA 3SQLA 4DSUA 4IJQA 4UKDA 5HKKA 4K0KB 2OVFA 4IEIA 1QHHB 4BLRA 2ZTLA 3GEDA 4QOFA 4RPHA 2JFXA 3X2SA 1SY7A 3TJMA 4E13A 1WRBA 3UMGA 1N7GA 1Y1SA 1YQ9A 4HEQA 3EXFB 3RNOA 5F7OA 1E7YA 1XN1A 1N75A 1TZJA 2AXNA 5B6JA 2YJNA 3G68A 1RXYA 2FETA 4P32A 2R6DA 3OU6A 1DB3A 1U7DA 4KEAA 4TV8B 2HHCA 2BEWB 5ITSA 3VPBA 4G26A 4YROA 4BX3A 4QJ5A 1IXSB 3VYSB 2G9NA 3DD1A 4V0QA 1NQOA 4XM0A 2P90A 1KJIA 2FKAA 4UMFA 2B3DA 3DAOA 1UOPA 4L22A 1E4YA 1V43A 4BMPB 1T5SA 3FYCA 4XRRA 1GUZA 3I2KA 4L6AA 1U04A 3EVAA 4IVNA 1Q12A 2VXYA 5FTJA 5FWYB 4E5MA 3EGXA 3QEMA 1NYTA 4K9LA 1H2ZA 4QXAA 2X0RA 2AN5A 1I32A 2DUNA 3V1KA 3HWSA 1HPLA 4LDPA 5AK3A 2XI4A 4UM9D 4YUVA 2OQVA 1SIBE 4YQFA 1WXEA 5FWAA 3LOQA 2Q5LA 3BCSA 4GBMA 4OHWA 3QV1A 4YJGA 4AYTA 5BUCA 1AD2A 1PG2A 5T4BA 1QO0A 1SXJB 2J5QA 4DV7B 4TM7A 3Q9NA 2CC2A 3G88A 2CDAA 4NBNA 3GLFE 3Q3IA 1GHTA 4CKZA 2WM8A 2CXXA 4TWIA 3QGMA 4KC0A 5AM4A 4IO1A 1UP6A 4AUKA 4YRTA 4KPEC 5KYUB 2HQOA 1S7CA 1PNRA 2YV4A 3M6AA 3ESBA 1AOXA 3HGTA 1O9BA 3HWRA 4O3FA 3FB1A 3PF8A 1CK4A 5U4XA 1BEZA 4RL6A 3D4NA 1KZYC 3HA5A 4C88A 2O5EA 3WADA 3E18A 3CCFA 1HI9A 2HNKA 5F33A 2FEWB 1QWSA 5J2TB 4ES6A 3FCUB 1Z0DA 3KVRA 13PKA 2AEEA 4O59O 4X93A 3TW0A 5IASA 3P9CA 4G0QA 2P4EA 2VQ6A 2ZATA 5IUKC 1ZNYA 3FG9A 4OCZA 2N42A 2YCBA 5CEJA 4AY2A 5KNBD 2OP0A 4IOKA 1MB0A 3KXLA 3EMBA 2IXAA 3FZQA 4MW4A 3STHA 1I3LA 3MUOA 4F06A 2XOEA 1G2IA 4YP9A 1XJQA 1L4LA 3HHPA 1L2TA 5A4KA 3GCDA 5ESDA 3T38A 4B3MB 1Y8RB 5CVVA 3ZD9A 4ESEA 3EB9A 1C2TA 3NGMA 3P97A 4OI4A 4EJ6A 5ELMA 5IDWA 3GJRA 3RANA 2ZBGA 3STXA 4UUPA 2N75A 2OGTA 1XUOA 1BVRA 1SC9A 2EBHX 5K6AA 3U5ZB 4QQFA 1OXKB 5F35A 4YQZA 3G8YA 4DSTA 1HSZA 1QHYA 2FX3A 2FZEA 4I6JA 4OQQA 5ETJA 3CF0A 3VH1A 4BNJA 1E2KA 4XSGA 1QO9A 4LJ7A 5AIAA 1DHRA 2ZJ5A 1R0YA 1X19A 4RMJA 1AN9A 1G63A 4O2BB 1GNPA 4DBZA 3LX8A 2FCAA 3IP1A 1KI2A 1SQ5A 4EF6A 4EW6A 1SD5A 1VI6A 3GLFB 1UKEA 3EFEA 3PHLA 3Q6IA 4H6XA 3ICVA 1TIKA 1F6DA 5AI9A 1JKIA 1FXWF 4AMVA 5K6RA 4O08A 1Z5WA 3FN4A 4RACA 3NJ8A 1Y4AE 4IIEA 4ZVNA 3WNQA 2AKEA 1EK5A 1DIRA 3AQ4A 2W98A 3FKSA 3OX1A 4C1NA 1GL9B 3S44A 1GZUA 3T9EA 2DKFA 4A5OA 5HIAA 4QUAA 5A0VA 1N8TA 4OFXA 1WXFA 4E4TA 2BCGY 1AZTA 2XZOA 2WTUA 4BRZA 1L4MA 2JIMA 1ADCA 2P5YA 4MVJG 3ZWAA 5K8IA 3EDQA 5C51B 1ZO8A 4MLZA 4TZTA 1IWOA 4BP8A 1XALA 3M83A 2VVTA 2IBTA 1IUKA 1YOBA 3A1CA 5BRNA 3HDTA 1KI7A 3D2AA 3L79A 4MCAA 4L5BA 2D2EA 2ZSFA 2P0AA 3OX2A 1PSZA 4UD6A 2YHIA 1W4BA 2QXYA 2ISQA 4UAJA 2PX5A 3WHPA 3PEVA 2RGNA 1JEDA 2G71A 4I8DA 4RTPA 3PFIA 1OASA 4DLWA 4GYJA 2X2OA 1ZHHA 2RGUA 5BSVA 2VF2A 2ZE7A 3JQ8B 4QJBA 1EE9A 3W2FA 4E2WA 5EE1A 1YF3A 2FU5C 1AS0A 3WR5A 4HDMB 4QXMA 3BCUA 3TNYA 3NFRA 3Q6NA 4PU0A 1PJ4A 3TTUA 4BWVA 4YYEA 3K2QA 3PNQA 2V4ZA 3RF7A 1YFZA 3QIAA 1AGXA 2XVXA 4KWTA 5T41A 4JNKA 5CCEA 4FS3A 4JEHA 3HL0A 4M1WA 1MIHA 4NJEB 4TLLB 3GEEA 3WRYC 1DPGA 5TQ0A 4DF3A 1DHTA 1YB5A 2ZYHA 5DWDA 4DNXA 4KMMA 4BNIA 2WJZB 4HJXA 3UOGA 4EA8A 1UPXA 3N8HA 4WY8A 2LDXA 4DJDC 2EBUA 1NJGA 1WPQA 4UHCA 5B53A 4DB2A 4IVRA 1JA1A 3GAMA 2HZBA 2XVAA 2RJNA 4NQRA 1FVXA 3JVUA 2GN2A 4XPIA 4CFYA 1J0EA 1JHYA 4PFJA 1VKOA 2YUTA 1HWYA 1IN8A 1HMYA 4PX9A 5ALPA 5F1PA 4GC9A 5J2TF 5IKOA 3HCFA 3URKA 3FLAA 3RUHA 4A6EA 5BYAA 4R98A 1TU3A 2OCYC 4UTRA 5AXCA 5CNJA 3R7LA 1AQNA 1RI2A 1TLTA 2PAAA 5BT9A 1IQUA 121PA 1JVSA 1WKBA 1Z5OA 1CETA 1VCMA 2UVPA 2X41A 1T3SA 2VDWB 4IHAA 4QQRA 4EFKA 3TDKA 3EOAI 1XZEA 4ZEMA 2R6JA 3MQ4A 5F9MA 3S99A 5I4BA 3H7AA 2ZBVA 1JECA 1BW9A 1NMSA 2WMOB 4PNHA 5EIFA 2X0DA 3WZ2A 2J08A 4J03A 3ZWMA 1RYFA 3LLUA 2UVDA 5IMSA 2Q4BA 3M9XA 5I4CA 4P7KA 3QFRA 4WFIA 2JLSA 4IIDA 4MMXB 1MAWA 1U7OA 1YRLA 1S4QA 2PL5A 2VFAA 3D8NA 5ICMA 1R8QA 1QP4A 5BSTA 1C1XB 2HJVA 3HHEA 4FW8A 5KDOA 3BMOA 3PSHA 3GVXA 2AIRA 3RYIB 3AUFA 4Q9KA 3UT5B 1P80A 2WIAA 2X8JB 3CWQA 3BZUA 1J20A 6CHYA 1ZU4A 1ARZA 1FMLA 1ODCA 4AP6A 1LCIA 1MCZA 4O2BF 1NNUA 2RK4A 3SJCA 1RWOA 1EE2A 3DOCA 1TE2A 2O2JA 4NP6A 2ENWA 3E1SA 2YX1A 3OZEA 4MW9A 3U3XA 4KYTA 1YS9A 4DLBA 4LI0A 1QOPB 1U0LA 5KB3A 5L4NA 2P6OA 4IHJF 4ZVMA 2I03A 3Q40A 1R8SA 3WGZA 4EK9A 4XIYA 4HB3A 2PBRA 1Z15A 2I4NA 4LRWA 1YDGA 3B1FA 2EV9A 2P8SA 3KQSA 1EFVA 3QVTA 3U0VA 3AFMA 4B2LA 3HM9A 4RELA 3KCQA 4MMZB 3BXPA 3ZE6A 4CT4B 3IE2A 3OZWA 5EGSA 1I1HA 1ECBA 1W75A 1GUAA 3QKUA 4UDXX 3RJMA 4CMHA 5JNRA 1SEVA 4I9HA 4ER6A 1X15A 1KTVA 2SICE 4OHCA 5LD2C 1JALA 4Y2QA 1ZUNB 3BB4A 2RHHA 4Y6PA 5CIWA 4UBKA 1HURA 1K98A 1ZK3A 1QX4A 3Q3JB 2GDJA 2Y67A 1PJRA 4NXMB 1CVLA 1ZOOA 4O29A 3HG7A 1VE3A 3L1UA 2XKAA 1II9A 4W9RA 3WIBA 1LVUA 1QKKA 3LJKA 4Z3OA 1U0JA 2DVMA 2JLWA 2V7EA 4KQFA 3KX2A 5EWMB 5B7NA 1K06A 2V5UA 2BGWA 4MYHA 3BE6A 3C4QA 1IN4A 5FR2A 1WDWB 3AJDA 3PQ2A 3OLWA 5TPZA 5I7FA 4WCFB 4U7GA 1IY9A 1HH4A 2D3WA 4K6KA 5DZSA 3WK4A 3F6SA 3L43A 1RDFA 1W59A 3AF2A 4C2BA 5HR5A 2KS6A 2HCFA 4N03A 1DARA 1FL9A 2WSLA 3P4XA 3WYCA 4URXR 3SOZA 5SYNA 4BFXA 1AUPA 2Z09A 4OP3A 3E3LA 5GQSA 1A4UA 2IEBA 4PSUA 3SSMA 4AQDA 4B40A 1X1QA 3BXOA 3ONDA 4TQGA 1NVTA 1QF7A 1S0UA 2DUWA 1DMSA 5DI9A 1KMHA 3RABA 3FR7A 5ALEA 1JFFA 2VF5X 5FUVA 5GVSA 1AKNA 1RQ2A 4TMYA 4G86A 2RBGA 2J41A 1T36B 1PN3A 2C54A 4B6PA 1KKUA 3IOBA 3O8BA 2X1LA 5KQSA 2GS9A 2J9RA 4D0NA 1EVZA 3HR8A 1L1FA 1U3FA 3GMSA 3D81A 3ED1A 4KFSA 3K16A 4UM8B 3V42A 1OPXA 2ZJ7A 5IANA 2ERCA 1G38A 1TD1A 4BB0A 2J0VA 2WP0A 2ECKA 3OPNA 3AR3A 2VUTA 2OG2A 4U7TB 1W76A 5DBEX 1RWWA 3A9UA 1TKBA 1B2LA 1DBSA 1QGYA 1YOVA 2WD8A 3B6ZA 3BSSA 3BSFA 4G0MA 4ZTBA 5KAPA 1YVPA 2QMUA 2C0CA 2ZRGA 3DKPA 3SNKA 2Y1XA 3MOGA 4MS4B 1B1AA 3SBXA 4W5OA 1COZA 2BBWA 3DFFA 3E22B 4LF6B 1YK1A 3KXDA 1GGMA 1D6NA 1T5TA 3O4GA 1W35A 3M0EA 3Q7QA 1DNPA 2M6RA 2WU3A 3A2MA 4W9NA 2Q6OA 4X9XA 1XAHA 3MPOA 3F98A 3U16A 3D5TA 1E5LA 2X77A 2F8MA 4U02A 4L4RA 5T3UA 3QLTA 5K99A 5C5EA 1NW4A 1NMYA 5H5JA 4AO8A 5HJ7A 1L5FA 4NPCA 5JCOC 1E4EA 5K8VA 3OX4A 1UODA 3JQ6A 1U9CA 1XCPA 2R79A 3ZGVA 4BMYA 4TKUB 1R4NB 4M6WB 3K72B 4N0DA 4Y2HA 3ES9A 1ZAKA 4ZD6A 1KYWA 1COWD 1XWFA 1J5XA 1G8SA 1O94A 3OEEA 2CLMB 4GYKA 4K0RA 5IJAA 4EG4A 1F12A 1I7QB 4U2BA 1X9GA 2P9ZA 4B3IA 4AJPA 3ELYA 3M6XA 5DYIA 1K6JA 1Y48E 4WE3A 3AGPA 4E5YA 1SG6A 1UMDA 4FCVA 4Y1RB 4ZT4A 5ALIA 4EEZA 4BNVA 1K5PA 2I6QA 5DHSA 4BXOB 4WXHA 3RVKA 4EMUA 4DDUA 1OWPA 1CD5A 4K1LA 4ZV4A 3ED5A 1YHZA 4J3JA 1GA4A 3BXGA 2COEA 4I4NA 3ULKA 1NW9B 1J5EB 4YR7A 1GZ5A 4CM1A 2P67A 5FLYA 3L4KA 1Z2NX 3I62A 1U7ZA 3QXCA 4FFBB 3OUUA 4PTLA 2J7PA 3ELBA 3HRHA 3ZK8A 1LK7A 1XDSA 1MA3A 3QOYA 3MMPA 2A59A 4F86A 1TCUA 4W7IA 3DMTA 1CQJA 3UPTA 1QKIA 3CW9A 4QSMA 4QA9A 3GG9A 2O2IA 2VAVA 2IYRA 1E3WB 1ACJA 3BGDA 2KW5A 1UAYA 1AM4D 1GU0A 2NO9A 2VSFA 3IIIA 5E2AA 4F2GA 3EEOA 4PO9A 1ZH2A 1NC1A 1MO4A 2CVQA 1SPXA 4X3CA 5J3JA 1QV6A 3ZNQA 3TN7A 1BMFD 2WFLB 1V26A 3MINA 2HEGA 3LXRA 3NHZA 2FPIA 2H1SA 5A71A 4YBZA 3KDPA 1YZLA 2NNLD 5ES3A 1C7RA 1GL7A 5EKXA 2IOYA 1BG6A 4RZ2A 3UXMA 3U6KA 3AERA 3L6OO 4H0NA 2LV8A 2G08A 3L8ZA 3D3QA 4HEA6 4G1FA 3REQA 2EZ8A 4BIIA 4I19A 2YWFA 3R3VA 1M3SA 2UXCB 1DLIA 3ENWA 2VDMB 5BQXA 3NJRA 5AKLA 3SXJA 3K5WA 4LXXA 1ULTA 5LVAA 4WY2A 3ZXIA 1WHTB 4HX5A 4JHLA 2C4HA 3RPEA 5LLTA 2RH9B 3BJMA 2W6ID 4O4HF 4MPDA 4YJ2F 3RSGA 721PA 3RAFC 4RWZA 1M5RA 4P0TA 3WQHA 1W581 1C1HA 5BV2P 1E2HA 1XHEA 3DA8A 1IWBB 2I3GA 4GI3A 4Q7JB 2FDCA 4CFZA 2J5RA 4KV7A 3NHWA 3WSTA 1EWQA 5LNK1 4OUDA 4A5SA 1FU8A 1XA4A 4LRUA 2BL4A 1M2OB 2FUCA 1A82A 4TSFA 2DHQA 3C3MA 1NL3A 4DAOA 4F04A 1W9MA 5L3VA 2BFPA 2PAFA 1QFSA 4GI7A 4PM4A 1WB5A 4M8LA 1VLHA 5DI3B 3WFZA 3TTVA 2VQEB 1OFUX 1KP2A 5IC6A 3RK4A 5KTYA 4ZMSA 4B3HA 1ZH8A 5IWCA 2CN1A 2FYTA 3AILA 3L9XA 2R7KA 2PU5A 1DQSA 3LIIA 2H11A 3TRJA 4RNDB 3GLKA 3HQ4O 5KNCD 4JB8A 1SC6A 4AZ0B 3DUFB 1WNTA 2R5FA 4IWYA 3C41J 3LT0A 1EGQA 1H1LA 3ZCQA 4BC0A 1UUFA 1Z8HA 1Q17A 2CUTA 2V6IA 5F4BA 2XQGA 4TMFA 4KLAA 2H4WA 1EUCA 1ZLYA 5TQVA 3QX3A 2WF6A 1PEAA 3H05A 5LZ8A 3ROZA 2Q5IA 1E1NA 2JFGA 1W8DA 4MQEB 4NYJR 3RVNA 1YAJA 2Q45A 1XWWA 1NUAA 2H2GA 4CI9A 5L3QA 4GXQA 2J3QA 2FGJA 2D5CA 3CVVA 1NM5A 2R25B 3C1UA 4YC7A 3R5KA 2AMJA 2FR8C 2BFCB 2XWBF 4XRGA 4MRMB 4RKYA 1AMUA 2BMWA 4LDQA 3GZ4A 4BYGA 4IV8A 1T4BA 2EFCB 3LC7O 4TMWA 5AJZA 3QE3A 4Q03A 4LK2A 3AF5A 3WI7A 4C6TB 5ISMA 3VNUA 1T15A 4EAAA 1T9GS 2EQ5A 2OP1A 1K0UA 1T9CA 2FWAA 5JY6A 1Z7GA 3VR4D 3E9RA 2VJOA 4XLTA 2JNWA 1TKCA 4MUKA 2B0JA 3EXAA 3G2NA 3MT0A 5THKA 2ZKIA 4CE6A 1OX4A 2XF8A 4BC1A 4FFOA 1G5IA 3KV3O 4WZ6A 4ZV9A 3PR3A 3A0RB 1W73A 4HAVA 1VHQA 1EWKA 3LYUA 2C7BA 1CQWA 3L1VA 4IX9A 2R1TB 4Z2AA 5AW1A 1BHSA 2XCUA 4RCYA 1E4OA 4C04A 3D3JA 5JQWA 2F1JA 5H16A 4NBVA 4U8HA 1XK6A 2GAAA 5IFLA 1KFCB 1RXCA 1XN4A 1T6BY 2JJ2A 3RSZA 2B6NA 3WYNA 2GN6A 3H16A 1AB6A 1FJ2A 2JGDB 1SB8A 5FRDA 1TYZA 4PQEA 3GYGA 3GUHA 3DB2A 1OE0A 2K6GA 1S5PA 5CM2Z 4COKA 7GPBA 4XWWA 3U19A 4JMPA 4JBIA 4QLAA 2CNWA 4RTLA 2FZ4A 1U2EA 1C3LA 4QL3A 2GBLC 3AW9A 4UPDA 1T9DA 3PRJA 1I94B 4ZYLA 2G1AA 5J4HA 3N0WA 4FHDA 1EUDB 4KKVA 4KW7A 3KB8A 3IPYA 3PXAA 2Q6IA 3LY8A 4NFYA 4J4TA 4DUPA 3T7JA 2VSYA 1FUEA 5GM2A 2FUG6 3UMJA 1N6OA 1W0JD 1HKUA 3ZY5A 1XL0A 1I3CA 2BHNA 4MRAA 3P32A 2NYRA 4GR4A 3EGIA 4JXJA 2XRFA 4FVTA 4U9IS 2I6UA 3IYLW 4QBGB 4FEAA 4W1RA 5EIHA 1G19A 1KJYA 1R0WA 1XD2B 1CXZA 3C7TA 2P3QA 3ZDFA 3GGOA 1JG6A 3W2GA 1MAAA 3GNQA 5I8WA 2XWPA 2XNSA 2EW1A 1M7BA 3WQRA 1OGJA 3RSHA 4KLCA 1NVBA 3GRYA 3KE9A 2EFEB 1RQGA 1YVUA 5MFZA 2MINA 1HM5A 2HU2A 2OLJA 4C0XA 1Q91A 3KS9A 4MPPA 5AVQA 5DNEA 3OQVA 3WGHA 5E7QA 1T43A 3LG2A 4PR0A 4CMCA 2AC4A 3KPJA 5BXQC 1BX3A 1A95A 4FKZA 3MSCA 1SCBA 1ONSA 4KE9A 2V3WA 2JIOA 4NX2A 1YJAA 4IF4A 2JLUA 2A9JA 1M2WA 4LRYA 4LYFA 2FZVA 2DR3A 2WWTA 2P2LA 5BR1A 3O6VA 4DLRA 5IAAA 3KOZA 3VJRA 3LCMA 1IQPA 1O96A 4TRMA 5HMMA 2G40A 2VF7A 1XZHA 3A1UA 3LV8A 4CLEA 2GTHA 4EYKA 4GXRA 1Z4NA 2DUJA 3BMQA 2VP4A 1T5IA 2QG4A 1I36A 3IHKA 4UVEA 2NUAB 1C9JA 2AOTA 2WU1A 3TE6A 4AJNA 4GM0A 4QGSA 1CWUA 4ISCA 1R0ZA 5CW2A 4D56A 2MOKA 1I3KA 1OI3A 2W8BB 3I2FA 4RPLA 3RRNA 1V8PA 4F92B 1AA6A 1ESNA 1N2ZA 3FYUB 4R1PA 3U4AA 3SKYA 4Z8XA 3G0BA 2C7RA 2PMWB 3O7WA 3HH8A 3MTIA 3TG8A 2V7UA 2HHAA 3NEAA 1TK9A 5EIBC 5FBLB 2Z6UA 1Q74A 2ZI9A 4M1OA 5KNDD 2C0PA 1K5GA 3PDCA 4NCXA 1Z6QA 1ZWKA 3H1EA 2X5XA 1N1DA 1X1CA 3HVHA 3MVEA 1W5FA 2PR7A 3NI2A 4L3VA 5JDCC 4D43A 2H31A 1Y7HA 2WUFA 2WSYB 3H11B 2M98A 2OHIA 1VIDA 2BFAA 4M0LA 4E21A 2Z57A 4AY4A 3THOA 4UBIA 3TLEA 3GLIA 1H2WA 5LA6B 2KE5A 1WD7A 2EEZA 2J3MA 2AMYA 2YRXA 1C4WA 2VATA 4XTCS 5KJEA 5HGXA 4KR6A 2Q2WA 4YXWA 1N4DA 2J87A 4RUKA 4KGZA 4UBJA 1MRZA 2Q5QA 1Y6JA 1BDJA 1I8TA 2OC9A 3VSEA 4H59A 1J0DA 2AYYA 3DFMA 4OVKA 1PI3A 2H7VA 2L42A 4GD3Q 5DBIA 1DC5A 1SB9A 1DRWA 1ENPA 1SIUA 1V3UA 4F8EA 4O8CA 2B8TA 4RDCA 2XF2A 5JO9A 4CCYA 2QQGA 1VSUA 2GBCA 4GE3A 4ZKDA 3RFCA 3LQKA 4ZMRA 5JZVA 2MDTA 3K8ZA 4RF4A 1NI4B 1IYZA 2F62A 3OFJA 2IUEA 5BORA 1NZDA 1P4GA 4UBNA 3FSGA 3OOYA 1NBIA 1EBBA 2XZDA 3UC5A 3ZC3A 4NZMA 4B8ZA 3O74A 1YS6A 3F6BX 3ER6A 3G0DA 3QE2A 2E4YA 4V0SA 2MSLA 2BM1A 2R96A 1D1SA 3AEKA 4BZWA 5J4VA 1ZYUA 4JUAA 3AVVA 5HSGA 2JGLA 2WJ6A 1H4VB 2J3HA 3KT6A 3S5UA 4Z7NB 3HBJA 2VHJA 2HV8A 2B92A 4MKIA 1Y6FA 5JSFA 4L27A 4DC1A 2WM2A 1U9IA 2W2VA 2PMCA 3LCRA 5TT0A 5CIYA 1Y9AA 3A04A 1JSCA 5TRTA 4REOA 521PA 1W0KD 2RHCA 4MVJH 2GUWA 5AM3A 4DLSA 2P9JA 4KSYA 2IHUA 4AU1A 3A6ZA 1U65A 4RZSA 2XUIA 4D41A 3IIEA 3TPZA 2OK7A 4L6IA 3KV1A 3JX9A 4EB8A 1E5XA 2HI0A 1XEXB 4DDWA 4ZI7A 1NT2A 4HQ6A 3H18A 1X1RA 2HR1A 2OA0A 4S3MA 4OEHA 3V4VB 1LF5A 1R8YA 1XZIA 2BUBA 3C3PA 1ETHA 2DGDA 4MA4A 4MS1A 2G9ZA 2J6BA 3GEHA 1S2IA 3TTXA 3K0HA 1K75A 4KN5A 4LS3A 4JJKA 4PSCA 1MGPA 1EX9A 5J40A 2AN9A 1W5SA 4BPRA 3FVWA 4AS1A 1ADFA 3JD1A 1XRMA 1F2UB 3RWBA 3ZWVA 1DBVO 2QTRA 2ZOSA 1NPDA 2K7FA 1PO7A 2P9BA 3MWEB 2V7TA 2YQ4A 3MJFA 3SQMA 5KNCA 1WKCA 1E0AA 3C24A 1C3OB 5J47A 4QEKA 3UO8B 1V37A 3LHKA 4PNEA 3EC1A 1ZONA 4PAWA 1V5FA 2ZVJA 3KZVA 2IYQA 4MYUA 3OEHA 4WTOA 4XTRA 1XTBA 4UTPA 4ZVQA 3UAGA 1QH9A 2QL7A 2RCNA 1LRJA 2OZLB 4QOJA 3HSSA 3U7IA 4DLTA 1KJQA 1GT6A 2RG7A 2XD9A 1ZA1A 1YKFA 1G42A 4TROA 4FYKA 5JWRA 3AFGA 1O4VA 3RYCB 4TYYA 3WVNA 2LGJA 1CJVC 4CM5A 2YHAA 3K6RA 1ZQ1A 1R12A 5AI4A 4CUZA 3UAVA 3NH6A 5JFOA 1PZEA 2OAEA 2FQWA 4YP0A 3A6PC 1HNNA 1U2GA 4JYPA 4DJTA 5D3QA 4HYTA 2GPBA 2GWHA 4JBYA 4XYGA 1USUA 1MX5A 2ZRKA 3BULA 3TAUA 4B45A 5LA6F 1CPYA 1UPCA 2EJUA 3IQDB 5AKEA 4LZPA 2D2FA 2RHDA 1DBIA 3Q3EA 4ENTA 2IODA 3PUZA 4FHEA 4UDYX 4AL4A 2J6IA 4EG6A 2ZGVA 3B48A 3E9EA 4QLBA 1MO3A 4MPRA 1C9YA 4XE5A 2PCJA 2D7JA 3OM1A 3LW8A 1J0AA 1HYEA 1SRQA 3DTTA 5TPWA 2FW0A 1WZUA 4HVAA 3CUVA 1T1IA 3E9QA 2G70A 1P75A 1WV0A 3WLOA 2M1XA 1H42A 3MG9A 4KBYA 5SYAA 5J43A 4AROA 1ZD2P 4B76A 5J2UA 5CAEB 2P9GA 3S28A 1A2QA 5DCWA 2R00C 1RYDA 2ZT5A 3LO8A 2PD3A 4GOMD 5C5CA 3NIWA 1M1XB 2YC4C 3E2PA 3SJUA 1XZBA 4GVPA 3ZLJA 3GELA 1N3YA 3F8TA 4B79A 1LKZA 1LSSA 1U6KA 3BXZA 1F2DA 1PZXA 3O21A 2C03A 1OXUA 5DYGA 2ZVDA 4BIMA 5EFZA 5UKDA 2I3DA 2CXQA 1M73E 4BY9E 4H35A 3E7PA 3IAS6 3PUWA 4GBGA 4LWZA 4QUDA 4YWJA 1RHUA 6AT1A 1SVNA 2FN7A 4GBED 4PEVA 5EMKA 5FPSA 1WMBA 1QO7A 1GTJ1 2QAJA 1RWNA 1UQTA 3JZMA 4TTSA 4FI3F 2JEYA 2IUUA 5HP4A 3EH2A 1AV6A 1WA5A 4QATA 4URHA 3U80A 3RRFA 4X1KB 2F2TA 4AX8A 4LMBA 4RH3A 3DW1X 2HA4A 1XZFA 4DYHA 1PRYA 3VZRA 4ZAZA 2WJHA 1A71A 1NR5A 1VCOA 5D1NA 2DETA 1KAOA 1J00A 1Q2UA 3IR6A 1O8CA 1CUCA 3ZS9A 1XMPA 1JEQA 2R1VB 5C7OO 2AG1A 1GOTA 2EWMA 2H1RA 2NQTA 2V7PA 2VHEA 2UKDA 4LSZA 3K0CA 2IYFA 3GJTA 1UCFA 2OV8A 1FFHA 3DVAB 4TTQA 3UK7A 3ZKWA 4IIXA 3K2BA 3PD0A 1AKRA 5D85A 2YWCA 3ZY6A 1D8TA 2VG8A 3TTYA 5JNVA 5JH7B 4LYJA 4BJ1A 4ECEA 1TT5B 4LVNA 5ALTA 3SR0A 4MB0A 4XGNA 1ELOA 4G3XA 1Z83A 5IVPA 3PC7A 5F5XA 2FKNA 1JSXA 1CQIA 2QD3A 4RJKA 5IABA 1N2OA 2Y1OA 3LKBA 1U1EA 4YAOA 5HHTA 4JR0A 1I7SB 2A0WA 4R8MA 1C0EA 2YWGA 3FDZB 2B7BA 4WK4B 3GDHA 2OEPA 3IESA 4WASA 1VKZA 1YQEA 2HJRA 3PNYA 4AUEA 3RVQA 4B4DA 4F3NA 3PPIA 4MWEA 2J59A 4HSEA 3IPLA 2JLBA 1M5UA 1NW7A 4V2IA 4NCNA 2ZTVA 2FZCA 3TSOA 2RAVA 2XMQA 1E5VA 1RP7A 4CHTA 3STVA 1N0VC 5IKMA 2WICA 2ATIA 2DECA 1SUSA 1ZCBA 2HHLA 3MLAA 1OXMA 2HLNA 3CT6A 4IP0A 1KEEB 4MA0A 4ZRDA 3G9QA 3SEZA 1P6XA 4ND8B 1LRKA 3JTMA 4JJEA 4U2KA 1NU8A 4EGJA 7MDHA 4LDNA 1KO7A 3L6EA 3KEQA 1V8ZA 1YGYA 2CK3D 5FOWA 4RTKA 5IZCC 4JZYA 1G0NA 2NU9A 4O2RA 1EUYA 3GZNB 4O63O 3I9MA 3Q85A 4EPYA 2ZJ4A 2C2MA 1Q1GA 1ORHA 1VSQA 1WDMA 1J0BA 3HJBA 3LLSA 4RWEA 3GEIA 2V8BA 4EJ0A 3RVJA 2ZZMA 4FS8A 1XQ6A 3AB8A 4AJHA 2CFRA 3I6MA 4IVPA 4E7OA 4LXHA 4RM3A 1P2UA 1O9GA 1SBCA 4X1IA 5FEMA 1WNFA 2ZK7A 3HB7A 3BEDA 1G8KA 2E4WA 5CT4A 3VU9A 3Q0TA 2VPYA 1UOOA 1G7CA 5DW0A 5CBPA 3PGLA 1R6DA 4MI9A 3LI2A 1D7OA 1ZCZA 4V38A 3B7WA 4EBFA 3QLUC 1DJLA 1UBTS 2R9VA 4JBWA 4XSVA 2XEDA 4JCOA 4CL8A 5BSMA 3IB6A 3CRQA 5EZ5A 4Y9TA 4WCDA 1FRQA 1ML4A 2GK7A 3NB0A 3I9OA 4PWZA 1G21A 3PQ8A 4I9UA 4GFDA 1II8A 2ZB4A 3DVLA 3GVPA 4KIWA 2JVJA 1LI4A 1BU5A 3C3XA 3AF0A 4KYIB 1YBVA 1VSBA 3M6MD 2YIMA 2B36A 5IXYA 2C94A 1HQKA 1WF3A 2DPMA 2DR0A 5BN1A 2B4QA 1K66A 2V5AA 2Y77A 1H05A 1P29A 3EUWA 4GLBA 1ISSA 1XXLA 3DO8A 4IZIA 4KGVA 4PINA 2A30A 2PUWA 4A8PA 2JFWA 1HZZC 4GMDA 1JFTA 1UAAA 1RRKA 3UBMA 5K7SA 4KXXA 1ZM2A 2W93A 1D2MA 2EF0A 3TH5A 5JRZA 1DO2A 3ENVA 3O94A 3PIIA 1OLXA 4MQMA 4HDCA 3ZNPA 4AZSA 1EAYA 1LTHR 2ILTA 4G8JA 3L7BA 1UPTA 4ZVLA 2C3OA 4EENA 3IEXA 3AZPA 3OIWA 3F7TA 5E7IA 1GXSA 4NYIQ 5IH3A 1WX1A 2BJWA 1G16A 4DLPA 4BP3A 5K20A 4AKIA 1MQSA 4E70A 4CG2A 4EUNA 8MHTA 3R5JA 5A1TA 1CV2A 2PX4A 3OQIB 3S2IA 5A5EA 5K3EA 2D59A 5DCYA 3NWBA 5HQ3A 1HDXA 2AJ8A 2X14A 3GEMA 5BSUA 1O0SA 2WLTA 4BECA 3AVWA 1UBJS 5C7IO 2XWSA 5HGJA 1UXIA 3H9GA 4IOLA 2OVBA 4NDAA 2XZTA 4Z2YA 2CSXA 4AG5A 2HJSA 1G64A 1IH8A 2MSEB 2V0GA 4JX9A 1J8VA 3C39A 3HVKA 5DGTA 5FJJA 4L50A 3PXXA 4OOFA 1U7HA 1YS1X 1IJFA 1E5TA 2Z2IA 4DLKA 4L0DA 3NPMA 4FBMA 3K6SB 2VHTA 3NOXA 4M49A 4UNQA 1V8FA 5B1HA 3RS7A 2CD7A 4WT7A 5CNIA 2GRUA 5KX5F 1V47A 5GIPE 4XWGA 4EHFA 2UZ4A 3U7GA 2Z8ZA 4MW5A 4M0DA 1VB5A 3GJ0A 4D6PA 1CJMA 1SUAA 2XOXA 3I04A 3LWNA 4HBZA 1VCHA 1QH8B 1TAQA 2ZTUA 2MTBA 4N41A 1P7ZA 5J1TB 2C0QA 1EGMB 3TX2A 1D1TA 4UCWA 1G6KA 3E9YA 1G9XA 3VR1A 2WD7A 3B7GA 3IQGX 4Z9AA 4BDTA 4R41A 4US1R 1AUQA 1TUBB 1CDOA 5K0CA 4LZOA 2AGVA 4M1KA 1Q0HA 3IRVA 4J8PA 1W87A 4KXQA 1FQJA 2GAFA 5FEUA 3CZ5A 1XL1A 4IZOA 4J29A 1H66A 1Q3KA 3FYDA 1WETA 2Y2VA 1JIQA 3EQ7A 3OPMA 1QCZA 1DQNA 4N39A 2O50A 1PWYE 3F90A 4ROTA 1N5RA 4HBGA 2PN1A 2NTEA 3D4LA 3LIPA 5D8DA 1G9TA 3EW9A 5EP3A 5JPIA 3R1IA 5TJHA 5KYYB 4LGVA 1N25A 4P4LA 1ODKA 3WS7A 4EZBA 1F7VA 1PTKA 3H9BA 3EXIB 1Z6YA 1JWBB 3BE5A 2Y1DA 1YR2A 2IWHA 3CVXA 2HDNB 3BCHA 3EVFA 4OHMA 2GARA 3SICE 2IYXA 4DHEA 3SLKA 4AJLA 2UXBB 1T29A 1YZHA 4YAGA 2WQ6A 1H6BA 2JJ8A 3WO0A 3PNOA 1ECPA 2BJVA 2Q5OA 1OHHD 5CEEA 3VHRA 1IC6A 3FLBA 4Q7MB 4BEVA 4BKRA 1R4ZA 1Q0RA 1G4UR 1VDMA 1VM6A 1ZGZA 2FPLA 2HHJA 2PX3A 3QVSA 3VR6A 4BNTA 3LPDA 4M1MA 2ZR7A 5EJ9A 3SKXA 5JSQA 2XJ4A 1ABEA 2AHOA 3DLCA 4P0PB 2NO5A 1EHIA 5C8ZA 4ZYWA 4DRXA 5HF8A 1D04A 1I6LA 4MV7A 3ZQKA 3Q8MA 3HFJA 2HM7A 3CE9A 4FEYA 3QA9A 5A3SA 4G8BA 3ESQA 4CKBB 4BMSA 3DBRA 1JYSA 2A6PA 5H83A 1BVHA 2ID8A 5LQAA 2PGAA 4RXMA 1T4CA 1KFBB 2C3PA 1VRVA 1FEZA 5H4HA 2ZFUA 3WK7A 4KPFC 1DTWA 4WESB 1P9RA 4BVEA 5ALWA 2FFQA 2PO7A 5L8VA 3FI9A 4C6HA 2BBOA 3H3XA 1PW7A 1TMKA 3SFTA 1WU7A 3B60A 2WMYA 2HFJA 3KZXA 3HDYA 4NI5A 1U7PA 3B6IA 4KN6A 1VGQA 2Z9CA 2QTGA 3E3NA 5FP0A 4US0R 2W0SA 4LJAA 2X0FA 2QVZX 4ZCSA 3JPWA 2XUPA 5AOBA 4EO4A 3KQHA 4CM4A 1XVIA 1CJCA 3KKZA 4MZDA 4CEHA 1UIMA 4LN1A 5EMJA 2Z6AA 2ADOA 2A3NA 1CDZA 3J7TA 3WGNA 5M2QA 3A1DA 3ZWYA 2OYCA 3PC4A 5C37A 3KYCA 4BEWA 4HGOA 4J2TA 2O8CA 3MT7A 2QXUA 4K9DA 4QYIA 5HNKA 1L7PA 1MENA 1DIGA 3LKDA 2NZ8A 4LHYA 2GPJA 4RETA 4HFRA 3RUDA 3ZV3A 2GGSA 2RGAA 4PICA 1KI6B 3RTEA 3K1TA 4EVIA 2KPOA 3SM9A 1C1YA 4QUIA 4F97A 1H2XA 3MJ4A 4JFAA 1H0RA 1WF6A 3B9RA 5FLXA 3EBLA 1GN8A 2PUHA 7REQA 3DLTA 2KQUA 3T15A 2ZRQA 1OAOA 1Q20A 2W6PA 3MGCA 5FA8A 4J2HA 3A9VA 1Y6ZA 3BRSA 3QK7A 2HC9A 3D9QX 3QLJA 3R24A 1JIXA 1C9EA 1T5LA 1GPKA 1Z0KA 1S2NA 4IICA 4MR8A 3JAWB 4PZ0A 3SIPA 3A7DA 3HU2A 4R6WA 3ZQ6A 1E2LA 1FC0A 3A6FA 3TMAA 1VYUA 1ZKDA 2ZYVX 2CB9A 3BWEA 3Q5EA 2BP7A 4K9OA 2NP7A 2JD0A 2WVHA 1FXSA 5SZIA 3RF6A 1K89A 1A5ZA 2X8BA 1KR2A 3PC8A 3VVCA 4BGIA 4HVLA 2Q7OE 4B6OA 1EM8A 2C9BA 3WLLA 1IVYA 3IIJA 1J70A 2C29D 3SNHA 3BHIA 1AXRA 3KJHA 1V5WA 1J33A 1P4SA 3IO3A 3TBHA 4ATNA 3LUAA 1TUIA 4YX9A 9GPBA 2H9YA 4UDNA 1J0CA 3WWCA 4WPGA 3ZHBA 2P2YA 3GFOA 3KT3A 2FP3A 3BK1A 4CDMA 2BLLA 3QSYA 3TKLA 3B9BA 5BP7A 3QNUA 4YMTA 3DV9A 3LZCA 4UUQA