3X1MA

Crystal structure of phosphopantetheine adenylyltransferase/ppat from pseudomonas aeruginosa with coa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
158
structure length
158
Chain Sequence
MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa 2192
molecule tags Transferase
total genus 55
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3x1mA00
2CYCA 4JZYA 4UZFA 3CVUA 1K92A 2A4MA 4EG6A 4MVWA 2R5WA 2QJOA 2A1TS 2YWBA 1NUQA 2WQ7A 1J1ZA 1FYDA 1MRZA 1XNJA 2VXOA 3G59A 2DR2A 2XRYA 4QBTA 4MQ6A 2PZBA 3IOEA 4NDAA 3IVXA 3CLSD 3A05A 4J76A 5TS2A 3COVA 1H3FA 2I1LA 2PIDA 3CVVA 1PG0A 2GM3A 3GUZA 1P7PA 4CDNA 2E21A 1OWNA 1H3NA 2C5SA 1WXFA 3CLRD 1S4MA 2X1MA 2Z08A 4Q16A 1JIKA 4DE5A 4G5YA 1COZA 4L2IA 5J59A 1QJCA 1I6KA 3HGMA 2QTMA 3H97A 1X8XA 3HL4A 3IODA 1YUNA 4MUJA 3RBAA 3TQOA 1M8KA 4I6GA 4YBRA 1O0CA 4OJMX 1IVSA 3CLTC 1U3DA 3FETA 3H9BA 2D13A 3D6VA 5DB4A 3VGJA 4MWEA 3TS1A 1TYBE 1T6ZA 4MW2A 1U7XA 2NZ2A 3PNBA 3CLUD 4XSVA 3F3MA 4HJRA 3IMCA 4E1AA 1QNFA 2CYAA 3P0IA 1KQPA 3L92A 5AHWA 3IVGA 4DDKA 4ZT5A 3SZ3A 1F4LA 1EFVB 1KR2A 1M1ZA 1IQ0A 3CLSC 1HYBA 3FOCA 3ND7A 1FFYA 3LE8A 1LW7A 1WJGA 1RQGA 4MLPA 1Y42X 3RHSA 1DNPA 1GTRA 3AKZA 2BYTA 1LI7A 2QUJA 5H7XA 3FNRA 2QUKA 4ZT4A 1JEDA 3SEZA 1R6XA 4R2MA 1VL2A 1IRXA 5FO1A 4YMIA 4I6EA 4YP6A 1H1TA 2DETA 1R6TA 3CLRC 1N2EA 3ZXIA 1J20A 4A91A 1M8GA 5TEVA 1JMVA 1WZ2A 4R0NA 2A1TR 1ZUNA 4G5FA 2VTBA 1NZJA 4FZJA 1N2BA 1Q19A 2YY5A 1M8FA 2B7LA 1XJQA 5KHAA 1OD6A 1OWPA 4ND6A 3AL0C 2OQ2A 3U1VA 3A4IA 1TYDE 2PG3A 3QTTA 2D5BA 4MW9A 3CLUC 1V8FA 4MWBA 1K4MA 5KWVA 2CUZA 2CV0A 1TYCA 4KR9A 1T6YA 2E18A 1KAQA 2A84A 4F4HA 5JBNA 2X0KA 1BS2A 3IDFA 3ILVA 1ZH0A 5EKDA 3GLVA 3HMQA 4EG3A 4K0RA 4F3RA 3MLAA 1X6VA 1M8PA 1IQRA 3G5AA 1J09A 4EG7A 3COZA 4ZCRA 4MW6A 3ZJUA 4MWDA 5FNZA 2Z3VA 3IOCA 3PXUA 4DJAA 2Z09A 1QQTA 3AFHA 1N2OA 2E89A 1NUUA 3TZEA 1J21A 3A04A 3CVXA 4AS1A 1KP2A 3N05A 4RPIA 3ISJA 4XFJA 4DDHA 2RE8A 3CVYA 1NUPA 1YUMA 3SP1A 5DK4A 1QTQA 1D2RA 1GPMA 4TS1A 5HG0A 1OWOA 1O94C 2IP1A 3G6KA 2E0IA 5K0TA 1WXHA 4PBTA 3FH0A 1N75A 2DPLA 3TQIA 1EJ2A 1OBHA 4UZEA 3E27A 3GMIA 1VBNA 1WQ3A 3ZXSA 2CYBA 1GAXA 4EGAA 5F23A 3AG6A 4ZCSA 1EXDA 4MUHA 4MVCA 1GTSA 1QU2A 1VLHA 5FO0A 3D6UA 1G8HA 2RD2A 3L93A 3X1MA 1XNHA 2WB2A 1QRSA 1EFVA 4MVXA 1MAWA 2GKSA 2AG6A 4HJXA 4NAUA 3TZLA 3FIUA 1ZH6A 4HPWA 3MMXA 1OWLA 5LFAA 3CVWA 1WOYA 1J70A 1U0BB 1QRTA 1U3CA 5H16A 4H3SA 1K97A 5HUHA 3ZIUA 3OP1A 1MOPA 4BWVA 5LLTA 1IHOA 2OV4A 4ND7A 2CV1A 2A1UB 5J58A 1MB9A 4GU5A 2IJGX 4MW7A 4Q93A 3Q12A 4YP5A 5J5AA 1QRUA 1MJHA 3LCJA 5DEOA 4ZCPA 3DPIA 2O5RA 4KPUB 2ZUEA 4EFKA 1O96B 3ND5A 2EL7A 4JYZA 3IUBA 4MUKA 1F7VA 1O95D 4WSOA 4K03A 1H3EA 2ZP1A 3H9CA 2GOYA 3SEQA 4ZT2A 1KQOA 1G8GA 3AIIA 3ND6A 3S3TA 2DLCX 1IQUA 1WY5A 2JA2A 4XFDA 3MLBA 1PG2A 1G8FA 4ARCA 1NURA 1WQ4A 2QJTA 3FHJA 3RFFA 1B6TA 3FWKA 2D54A 2X1LA 2DXIA 4JXZA 1KAMA 1JEEA 4ARIA 1OBCA 4EG5A 4MW1A 4ZT3A 4KR7A 1J1UA 4ZT6A 2CV2A 3IH5A 2HMAA 4MVYA 2J5BA 1JZQA 4YP7A 1R6UA 4DNXA 3ZJVA 2XRZA 4OUDB 4EG4A 1GZUA 3COYA 4NAHA 2AKEA 4R2LA 1ULHA 1WKBA 2A88A 1VBKA 4MWCA 3ZUGA 1GLNA 4CQNA 1TYAE 1I6MA 4MW4A 1N3LA 2CFOA 2AZXA 2TS1A 3NV7A 4CDMA 1EFPB 1TFUA 1O95C 3INNA 5BNZA 1YULA 1ILEA 1TQ8A 2EJCA 4JXXA 1V47A 1PFUA 3Q10A 4PBSA 1F9AA 3PRHA 3SZGA 3RK0A 1ZJWA 3NBAA 2JAXA 3M5WA 3UC5A 3IUEA 3CLTD 1PFVA 1KH2A 4MULA 3FI0A 2A7XA 4NZPA 1EUYA 3HZRA 2QTRA 3FY4A 3OTWA 3ZGZA 3DV2A 5HUJA 2JANA 1SURA 1NI5A 5K0SA 4EF6A 1N1DA 4KR6A 4MUFA 1NYLA 1VBMA 5KCMA 3X1JA 1NSYA 1O97D 4QREA 1KP3A 1T9GR 5IHXA 3CA8A 3KT3A 1JECA 1I6LA 1G59A 3C8ZA 1EE1A 1WXIA 4NATA 1NUSA 5IJXA 4U8HA 1WXGA 1F7UA 4S1OA 3IOBA 4J75A 1KORA 3ZJTA 3UOWA 1OWMA 2A1UA 4JFAA 4EG8A 2V0GA 3ELBA 1JHDA 2H29A 1NUTA 2CSXA 1I2DA 2HZ7A 4P2BA 2J09A 3A2KA 4KPUA 4MUEA 1JIIA 2G36A 1O5TA 1O96A 2WQ6A 3MXTA 4WNYA 3KFLA 1YIDA 2J07A 2QJFA 2X3FA 1A8HA 1MB2A 1TEZA 1YI8A 3JXEA 4ZCQA 1JGTA 2YXNA 3Q4GA 1LI5A 3CR8A 5TEWA 4QRDA 1YIAA 1JZSA 3H99A 1M8JA 1UFVA 1O0BA 4MUGA 3PNYA 1IFXA 1XNGA 3DO8A 4KKVA 2CT8A 1M83A 3UY4A 2NSYA 3K9WA 2J4DA 3PNVA 4L2IB 3IMEA 1N77A 2ZUFA 1PFYA 1T9GS 4ZT7A 4EG1A 2DUMA 5DASA 4MUIA 4DLPA 4I6JA 1MAUA 1O97C 1N78A 2BTEA 4PY2A 3RJZA 1T6XA 3RK1A 1JILA 1KQNA 2DEUA 1K4KA 3UMVA 2HGZA 1KH1A 3IMGA 1KH3A 3X1KA 1JIJA 3SYTA 1NP7A 3K32A 3FG9A 4OUDA 1CT9A 4AQ7A 2O8VA 3N2YA 4ZCTA 3HV0A 1KKUA 1Q77A 1N2GA 4X0EA 4HK4A 4RUKA 3P52A 5LM3A 3SDBA 3QTBA 3LOQA 3N8HA 3DLAA 3IVCA 3KT0A 2PFSA 3KT8A 3UK2A 2H2AA 2QTNA 2V0CA 1EFPA 4MUNA 2PXHA 1N2IA 1O6BA 3TNJA 2J08A 1N2HA 4G6ZA 3I05A 3KT6A 1Q15A 3NBKA 4U7JA 4MW5A 1O94D 2QUHA 3MUEA 1WXEA 2YWCA 4PBRA 3VRHA 3COWA 5TGTA 2PZAA 3BL5A 4GRIA 2A86A 2PZ8A 4U63A 1N2JA 1Q11A 2WSIA 1MC1A 1U7DA 2DERA 2VTBB 1EUQA 3P0JA 3FDXA 4CT0A 3N9IA 2IELA 3P0HA 1QU3A 1GN8A 4NX2A 3AG5A 2QUIA 1IH8A 3H05A 3QE4A 1PFWA 3VU8A 4MAFA 4DDMA 4MW0A 3HFJA 1MBZA
chains in the Genus database with same CATH superfamily
4O4JA 3UT0A 1JL3A 3S5JA 4NECA 3KS9A 4KMRA 2AEMA 2YRXA 5BWCA 2A4MA 4ND8A 3FZGA 1DFGA 3U0BA 1K7SN 4LVUA 2W6JD 3KVNA 1P4RA 1Q92A 1ZHHA 4S1WA 4WDQA 2R5WA 1MKYA 2HYDA 2MDTA 3HNPA 4C07A 4MHOA 2I78A 1EWQA 3ZY5A 1NUQA 3FYUA 4OAPA 3B5JA 4OJYA 1EWVA 2YR0A 4JJAA 1KMHB 2XBMA 1D8TA 1G3UA 1HG1A 2VXOA 3LKZA 5A62A 5F3WB 3HS3A 4S1TA 4L3WA 3AP2A 4PANA 1CG6A 2R8PA 4M83A 3TOCA 1Y5IA 4ER0A 3CXUA 3CLSD 5KDDA 3KETA 1P4AA 2QQ0A 2FR1A 2IXDA 3LYHA 4MA0A 1FRZA 2J0UB 3P9PA 4YACA 3COVA 3FPEA 4JA2A 4AWBA 2HWYA 3D8TA 5HWSA 4ZCIA 5JCZA 3DWIA 4UREA 4FT4A 2JI4A 1I2ZA 2I1LA 3A6KA 4P86A 1M2EA 5LB4A 2G08A 3M8KA 1C3VA 4OXIA 4ZYVA 1VYVA 1KERA 1UBCA 3E3LA 4I8DA 1D04A 1E99A 1NZFA 1ULAA 2YWGA 4FBLA 4MPRA 2E55A 1NBMA 2FEKA 2KBEA 3AY3A 3BHJA 3UXHA 1QS0A 3RTAA 1A1VA 3RC3A 1A3CA 3VSEA 4D56A 3OD5A 1FJXA 3GIDA 3I9NA 2VF5X 5SYMA 3I9LA 2PT7A 2Z83A 3N0WA 5DDIP 1VTKA 3VU3A 3UQZA 3U3JA 3KL4A 1KPIA 4OQZA 3BDVA 6CHYA 1UP4A 4MQUA 4B83A 2HW8A 4L7VA 5CDYA 2O8DB 1UZMA 2GO1A 1YOBA 4G8CA 5L7YA 4DCGA 1YNSA 1NQVA 4GZLA 1SOMA 1HNNA 2VPTA 5AXDA 1SQ5A 4C3ZA 5FI0B 4B3BA 1K63A 1L5QA 1JDZA 1SVUA 1YBVA 4JCOA 2VT2A 4V2UA 4DV1B 2FW6A 3LFTA 4B6OA 3A1VA 2NNLD 3D6VA 1W8DA 3WX0A 4DCCA 1I14A 3K92A 4CQLB 4N18A 4Y98A 3GJQA 5KREA 1S6YA 1HT0A 2OXEA 3AEZA 4CCYA 2G06A 3UUWA 1PAUA 2G6BA 3I4CA 4FNAA 1D0VA 3TDKA 2B1GA 2CUTA 2O1SA 2C77A 4MINA 1W5EA 4BP8A 2HF9A 4GI2A 3M6AA 4Y9RA 3VOSA 3PLAE 1MHPA 5FR1A 3QG5A 1CWUA 5C8ZA 2XGMA 1EGHA 5AKZA 2ZUCA 5A2QA 4F6RA 4G1VA 1PYGA 5ER6A 2H2IA 3BMOA 1WJGA 4XW2A 4DQKA 4UUQA 1T0HB 2FRXA 3H04A 4GE3A 4YC7A 1KMQA 3UXYA 1T3TA 1M2VB 4D46A 2QKYA 1ECFA 3FNRA 1NATA 1PJSA 3SEZA 1MOSA 1R6XA 3UF0A 3OLCX 5D87A 2J0VA 2CXSA 3V55A 1CE8A 3SFVA 1AHHA 3WNBA 4F84A 2JAHA 3L0OA 2VCYA 1PI3A 1AMNA 1H4TA 3NWEA 5GONA 3EXHC 5CXQA 3WKEA 1QCCA 1SKUA 3ZTWA 4DARA 2IYNA 2NV6A 2J59A 2W9XA 2GNOA 3FCUB 3FZNA 3K2BA 2J48A 1IJBA 1E0SA 2ZRAA 3ICOA 3L8GA 4O02B 1PDVA 2UDPA 2ZCVA 3RKRA 4JYMA 1LD3A 3AM5A 3TEMA 3O0DA 3TTYA 3VZDA 4N41A 3LP5A 1MC4A 1VYHA 3BXPA 3U3DA 1YE5A 2B20A 2PPLA 4J4TA 1DCKA 2XXJA 4RF2A 1NL3A 3I6IA 4DRYA 5K8CA 4QUKA 3FMFA 3O2SB 1OWPA 2ZFUA 2C29D 3A4VA 3O0TA 3VR5H 4CTKA 5AIBA 1JSRA 5JYDA 4YFVA 2AZDA 4BMDA 1OGJA 1V3UA 4UW9A 5IU6A 3B1JA 1FFCA 5EKSA 1TYDE 2RGWA 4QPCA 3HCAA 3MWKA 4CUKA 4F3KA 1I0ZA 1RWXA 3CLUC 3K16A 9ABPA 1J0DA 4Q5IA 4GZ3A 4TMZA 2P41A 3VSAA 1O89A 3GQBA 3ORYA 5IABA 2ZROA 5B36A 2M6SA 2CVQA 2PKEA 3L84A 4X85A 1L8AA 3I37X 2DAPA 1YJQA 3V46A 1LV8A 1P7CA 3AYXB 1JLLB 1CU1A 1AH2A 5EKDA 3KYCA 5BMVB 4EG3A 4TZ0A 1AZLA 1C4XA 3ZI0A 2RH4A 3EBPA 1JHQA 1V48A 2BGIA 1E9DA 3HDQA 1VLJA 4UAJA 3WMWA 1IQRA 1PQYA 2VPIA 2A0KA 4CM3A 4IHAA 4YFYA 2VHCA 1TB4A 4C5CA 3N07A 4CKEA 2QMUA 3GT0A 4E5MA 1WB6A 4IDFA 4ZANA 3EOZA 5JCJD 1AZWA 3LLCA 1TJPB 3B51X 3G68A 3IOCA 3MHPA 1OBOA 3OM9A 1YZUA 2Z09A 4Z99A 1A50B 5JMWA 3ZQJA 2H2HA 1QANA 1XD2B 2VS1A 4HNAA 3K1JA 4NE9A 1ES9A 2OCDA 4J1QA 2AJLI 2RGNA 1ZX1A 1PNOA 3KB2A 1U0HC 4RXTA 5T64A 4LJAA 2VT3A 1G4AE 2NLOA 3RC1A 2ZRLA 4A26A 4YRIA 1UM9A 4IIHA 2LRHA 1A7AA 3ECSA 1TVKA 2A9QA 1U1EA 1VPTA 2Z2YA 1C9YA 3KJZA 3NRCA 4PQFA 4M0CA 2VHVA 4EMSA 1ZH2A 5KYWB 1DL5A 4GKAA 4FHCA 4FN5A 3SN6A 3OCUA 5K0TA 1R8SA 1B2RA 3ZDAA 1JB1A 4Q4CA 3QVKA 4CKCB 2QIPA 2P3QA 1Z5NA 1ZFNA 1XVLA 1EJ2A 3JSXA 3LP6A 3TPCA 3ZUPA 4BLTA 4OXKA 3IA2A 4RD2A 1TJYA 4LYDA 3C1UA 1O6FA 4LWOA 2K5UA 2XQJA 3KQSA 1JQDA 5EJIA 4Z4IA 3I2JA 3G49A 3VO9A 3DZCA 1JHAA 4QTZA 5CFLA 3HJFA 5BSTA 4B6PA 3DLPX 4RIIA 1VLHA 2FZKA 2RG7A 5EZSA 2FZWA 3ITKA 1TM5E 4CEJB 4P3KA 2JH3A 3L93A 4ROSA 2OHOA 1E5LA 3KJGA 1RCTE 3ZGOA 4YAWA 4UBIA 5E9WA 4Y2HA 1TJ4A 1YK1A 4IJMA 5H82A 1YZHA 1WSAA 2AVDA 4L0DA 3RG8A 2HQBA 5JXJA 3TOSA 2NXJA 2H1SA 4A5OA 5ILQA 3IJ5A 4N7BA 1SRQA 2ENWA 3ESXA 1B76A 3MMXA 1SWVA 4CKXA 3CVWA 4ERXA 4AZVA 1SHUX 3MJFA 4LMBA 4C2UA 1QRTA 1QIKA 1WEKA 4O63O 3LOPA 1XRRA 4PLYA 3X2SA 4DLBA 1KC3A 3T9AA 3E7XA 5C31A 3L43A 3UAYA 1PEAA 3TD6A 1A76A 2CMGA 4DA0A 4UNSA 5LZ8A 4DCNA 3WHLA 2Q6TA 1SAYA 2ZYHA 3SG0A 4GI3A 1V1MB 2XTAA 3SIWA 2CLHB 4NYMR 1YZNA 3QYFA 1E7YA 2GEBA 3L1VA 2WPDD 4FDTA 4N8DA 1WD5A 4IJ5A 5INTA 4E51A 4ZCPA 4JR0A 5I9TA 4KEAA 3RWBA 1H5UA 3GUVA 1FPMA 1Z4PX 2VWPA 1R4MA 1ZMTA 3OPVA 4ENVA 4Z4HA 1ZXBA 4V0QA 4L5JA 2O57A 5EMJA 2HMTA 1LK7A 5IBRA 4CLRB 2ZUEA 2XZTA 3TTVA 1IL0A 3C6YA 4HWRA 3V48A 4Y0AA 4E5DA 1NMQA 5BR7A 5KNBH 1U9IA 2EBUA 2OPHA 5KJFA 2NQ2C 3C6KA 1GY8A 4HAXA 3IBGA 4PGMA 1OILA 3GB9A 2P9JA 3TVTA 4Z4EA 2B3DA 4YASA 4GYKA 2GAFA 1ZGCA 3NDBB 2HRBA 3EIEA 1RRFA 5H4HA 1HSZA 2FA9A 2JIOA 2Y1KA 1QVZA 3BCHA 1L7MA 3QX7A 4HD8A 1P18A 3PFGA 4JQZA 4RCVA 4W9RA 4XFDA 2I4MA 4G85A 4ER3A 5C5CA 3DKKA 5LKAA 3QPUA 1G1MA 4B2IA 3L0DA 3BQMB 1XHFA 2GBGA 1TCAA 2OCAA 3AHIA 3KKNA 1XP8A 2QJTA 3FKSD 2BBOA 2L69A 3NI2A 4GVXA 5I7FA 3I9JA 1JVBA 4RVUA 2JD1A 4DUGD 3CU5A 1QFMA 3P19A 3V1LA 3X44A 1T1SA 2L0XA 1XTQA 2FQYA 2GXQA 4ENTA 4RSGA 1KYZA 3C3AA 3G0BA 4CDRA 4EB6A 4N82A 1R0SA 2OZPA 3OLZA 1QLWA 2QW8A 3I8SA 5FOVA 3ZZ0A 4AUEA 1V4BA 2FF7A 3DTVD 2AWOA 1AKRA 1BW9B 3OIDA 1BQ3A 4KQEA 4MR8A 5U4QA 4BGIA 3AFNA 3CZQA 3UKJA 2YJ5A 3C3MA 2C00A 5HJ5A 4MQBA 2G5TA 2NUTB 4F21A 1DCFA 3RWOA 1J23A 1UBTS 2GXSA 3C7AA 1SXPA 4OYLA 3NAZA 3LK6A 2XODA 3K05A 5DN6D 3T4EA 1J33A 1F4VA 1FS4A 2A0FA 1ULHA 1UPBA 2MYNA 3ZD9A 4JVNA 2I22A 4W1RA 2QVZX 4AZ3B 3JZMA 4D9JA 5CDSA 1MO3A 3UTDA 1HX7A 3E03A 3MT9A 2ETVA 2IUYA 2H2DA 2HC9A 2Q9AA 2QRGA 4R2JA 4Q01A 2Q1UA 4MW4A 4Q7JB 2VP6A 1OXVA 3MGCA 4B45A 3FGOA 1C3OA 1NRXA 4TVKA 4W1SA 2EKBA 3W8NA 4DLAA 2I8AA 1ZM7A 1SC4A 3EDQA 5FBLB 1M1NA 1V47A 1NPTO 4L0CA 3Q10A 1ZOLA 3CX7A 3DOOA 1Z6GA 2BE7A 1R88A 1A9TA 1S9HA 1U98A 1U7PA 4KMMA 4B44A 3GT7A 5B6PA 5E1BA 1NN3A 1RWMA 1YH3A 3GP3A 4IGKA 4LZOA 4WCDA 1B6SA 5FUYA 1F60A 4P9NA 3SZGA 2EZTA 4XGIA 1XAGA 2QENA 4A2CA 4FB5A 2JZNA 1XO1A 2JAXA 1YKFA 2VRCA 2XQVA 3JQ8A 3SVTA 1XFAA 4PNPA 2GN9A 4X3CA 5HSGA 1JDBB 4ZWNA 3U4MA 4GL4A 1N1EA 2QOEA 2PKQO 4XIJA 4BRWA 2Q4OA 2QROA 3L2OB 3FVTA 3FUWA 2C9DA 3FY4A 4RMIA 1C7JA 1VDZA 2G07A 4I5FA 5DIFA 5CYGA 1VIVA 1RYZA 2YIJA 3VYUB 3ELYA 5CIWA 4GNRA 5A4IS 4EF6A 3DO5A 3VHLB 4ARUA 1YDFA 3SC2A 1BHJA 3SJAA 4LISA 4XWGA 1AQ6A 5KCMA 2Q3LA 5KOHB 3AM1A 1K7EB 3WB1A 4DDUA 2LWIA 5IJZA 1O97D 4WFKA 1JE0A 2QR2A 3NTRA 4MAMA 4XOIA 2SCUA 4IIGA 1UJ4A 1SHTX 1IULA 4N4AA 2PL5A 4QXPA 1UBKS 1T8UA 3ONWA 4AIIA 2QXYA 3WDKA 1Q2UA 5LL6P 3T7CA 1E64A 1ESZA 2A1UA 1ESCA 3LBFA 5KJEA 4PLVA 1YKGA 4UMFA 5AT1A 4W1QA 5IARA 1U5AA 3FBGA 3PYLA 3W79A 5B1YA 5JH7B 3AF0A 2BEWB 4DG9A 5T4FA 4WBNB 2ORIA 2IH4A 2AHOA 1U2GA 2I3AA 4RE5A 1XCLA 4UUBA 4DLZA 3FPJA 4W5NA 1O5TA 3DONA 2AI3A 4BNTA 3U3ZA 3PA8A 2ILTA 3K53A 4CM4A 3G5LA 2JCBA 4MTCA 2JPDA 4DSUA 4E5YA 4G63A 2QYTA 3C3PA 3CKMA 4OBWA 3M9LA 3KJXA 3BZBA 4BKOA 1VL1A 4DA8A 1VSTA 3QENA 3NEPX 1N2CB 1Y7LA 3IP5A 3PLNA 1DTEA 1YMUA 1A5AB 2Z9CA 5D7BA 3MS4A 5TGDA 3WGGA 4P4GA 2FE1A 3IP8A 4QJ3A 5JSHA 4F1KA 2X76A 3LUHA 1PL8A 1R74A 4N6OA 4EFLA 3K9WA 4XM2A 3IB3A 4EUEA 4L2IB 5FUBA 4B4VA 4U7TB 5H80A 1G4HA 2I2DA 5LZ2A 4BP1A 1F6DA 5L53A 1DZ3A 2REBA 2WUVA 5JVDA 1O8CA 2YNMA 2VP0A 2QTGA 3IT2A 5DASA 5KAPA 2G0TA 3FPFA 5AKGA 5SYNA 2JC3A 1B73A 2Y76A 1N78A 1SXGA 2HJ9A 5FUWA 4ZDKA 1S2NA 3ZR4B 2C7GA 3VNBA 1Z8DA 2DEUA 1KZ4A 3MINB 2XYPA 5KINB 1GL7A 5EKXA 1AU9A 4G9GA 5LIRA 1IJFA 2R9VA 1TFRA 4H7FA 3GGSA 5FOTA 1RLMA 4EJ0A 3KO8A 3K32A 3PF9A 4CIYA 1CT9A 2R6FA 1GPUA 1MQSA 4TWAA 1FTYA 1CULC 1QIMA 1SIUA 1XR3A 3PZRA 4OUKX 1BDHA 2WD7A 3MPOA 1L4NA 1E2JA 2GR9A 1DWPA 1UPTA 4I9GA 3IPXA 1OX6A 1H8EA 2VVTA 5IW8A 3RHFA 4B79A 1YMQA 3E48A 1LXCA 1IY8A 4HZGA 2IYYA 1KY3A 3GLIE 3VYVA 1UANA 1YU6A 2ZPTX 2AR7A 3AJDA 4PW0A 4UFNA 3VR6D 4C1NA 4XWTA 2BISA 2PJUA 2CLKB 2ZRHA 5K20A 2J08A 2ZSEA 3QVOA 1BMDA 2P77A 2YJ4A 3LLUA 1JA0A 3OOHA 4KBGA 4N0QA 1DKUA 2F64A 4Z9YA 4ZKDA 4EGCB 1Q0TA 2PH3A 1ZZGA 1XTRA 5KTRA 2RJNA 2A9OA 3Q40A 1RKBA 3NZEA 1E9RA 3NW9A 1DO0A 1H9AA 2YWCA 1BFUA 1SKYE 4YMWA 5KJ6A 2EZUA 2NIPA 4FYYA 3LSTA 3TI9A 2V4UA 5DCWA 4QBIA 2PIAA 3MUNA 5D51S 1WTCA 1GKUB 1XZJA 4AM8A 4AO8A 3GPCA 3VDXA 1M2WA 1WX1A 1LJUA 4CT0A 4PZLA 4F8EA 4IDEA 3R2JA 3T3DA 1HYEA 2E4ZA 4EUSA 2B2CA 3H5AA 2QJRA 2VHZA 4D45A 4HS4A 3EXG1 3HL0A 4AZ0A 4DSTA 2Q62A 3LM8A 5IAKA 3HRIA 5EZ5A 4PLFA 2R7NA 4P92A 3PJDA 2DCUA 5IBPA 1X42A 2P4HX 4KMSA 4P3PA 4Q7LA 4C0KA 3FDFA 1L7OA 4NH0A 3VC3A 2QLLA 4M4SA 2W2TA 1UPCA 3KXDA 1GZ7A 4FB4A 3VAYA 2XCRB 1ZMRA 3C7CB 2QNIA 3OJFA 3VO2A 1A9PA 3GLGA 2H06A 4M9SA 1J1ZA 1T4CB 1KL7A 2HDNB 3T4UA 4KQ1A 1WXDA 1WV1A 2QTBA 1AHPA 4R41A 4IDBA 4FONA 3HB5X 1AA9A 2QT9A 1L4BA 2O8CA 4IWNA 4X84A 4Y7CA 1NI4A 3IVXA 1U3VA 3UXEA 3M6FA 4QOFA 4BMOB 1EDEA 1GFIA 4UHCA 5ICMA 1AN0A 3NEJA 4REQB 3O4VA 4RKRA 5CMLA 4HLQB 2H5JA 3DE4X 5IAJA 3S8EA 2DFPA 1TRHA 1ZA2A 2Z4RA 1POXA 2GZMA 2WTEA 2L42A 2W2KA 5CRIA 2ZZMA 1D8AA 1Y4SA 5IJAA 5JSUA 1U5BB 2II6A 3ZV3A 4YJ3A 1RKVA 3F5DA 3ON5A 3EZYA 5DZSA 4C3OB 4RFLA 7REQB 1ESDA 3AK4A 1KJQA 2BKVA 4YO7A 3QXSA 3KHSA 1WF6A 2CSUA 1XPUA 1G18A 4GC5A 4NMMA 5J4VA 1P5HA 1OI7A 3LX6A 4P4NA 4BV8A 4Y7DA 1M8KA 3FD8A 3TLGB 3WJAA 5GIOE 3JVIA 1O0CA 1ADJA 4QVKA 4ZMRA 4INOA 6ABPA 4ZDJA 3BWDD 2XVMA 2DR0A 5ICEA 1CJCA 1CY8A 4QULA 5C5IA 2XIQA 1Z12A 3I23A 3L79A 1UC4B 1WEHA 4B6JA 2D13A 3JPWA 3WWOA 2VJMB 2NVBA 4UCFA 2P6NA 3C4QA 4UBJA 4WKOA 2GSDA 3NXKA 1QX4A 3OLWA 3PNBA 4RZXA 1GN9A 2NUBA 1I94B 4BO0A 3CIOA 3EQ7A 3MT7A 4FSHA 5I7VA 3FUUA 4F1JA 4Z3KA 3MQ4A 5ALRA 3IVGA 4CVNA 2YHIB 1GPKA 121PA 3EJ6A 3GZJA 3K31A 3SZ3A 4KXYA 1XJWA 3AJAA 3GA0A 4OBXA 4JITA 4B2YA 1AQIA 3Q9UA 3VNRA 2VK1A 1EQ2A 1NFQA 4OHBA 2X4GA 2C5HA 1FQWA 2C7PA 4XX1A 1IMJA 1VCOA 2HWKA 1QGOA 2QYSA 1WDKA 2UAGA 2QI9C 3ND8A 4OB6A 1Z45A 4EB0A 1JMYA 2X2OA 1WPQA 4OJTA 4HV4A 1PQWA 4NXMB 1W49A 2GN2A 4RJIA 3OBIA 1J8MF 1WHSB 2BMFA 4ZVMA 2FQXA 3ZNPA 1C8KA 1X19A 5G1PA 1UIRA 1VSVA 1X14A 1X74A 2I2AA 2MSKA 1J20A 2W93A 1CZNA 4ETWA 2BFBB 4XEUA 3VDRA 2A57A 3MJHA 3OZSA 5JS6A 4WLVA 5TRTA 4R0NA 4IOLA 1SZCA 4P2GA 4QGHA 3CFYA 2CXRA 4E09A 1V41E 2A0YA 2XIJA 4RHTA 1I7DA 1I7QB 1Y1PA 2ZAIA 1QO9A 2R6GA 3FDIA 1Q17A 4Q37A 4D0NA 3TUZC 4DQ0A 4P3XA 2R8YA 2QXUA 3KAJA 4AY4A 4KQXA 5DOZA 4ZI5A 1L5VA 3WNQA 2V6BA 2UKDA 1ZP6A 3I9KA 2P2ZA 4JWKA 5F2EA 4EA9A 4PCLA 2XMPA 1SXHA 3NRJA 4HYTA 3QVGA 3RS3A 3JQ7B 5ECDA 4ATNA 2PBZA 4MO2A 4R7GA 4IKEA 4MW9A 5G1OA 1NKVA 3HC7A 3JQAA 3TX6A 4BO5A 3GLRA 4ID3A 4M54A 3WYNA 2B3TA 2VDWA 1M6WA 1NXVA 2E18A 3R75A 3OQVA 4IS2A 3IEKA 4JL6A 5AUNB 1L5MA 5CHEA 4QBKA 3V8PA 4UE6A 1V8DA 4FFBA 3OM8A 4M86A 2F62A 2WRZA 3HCOA 2FW0A 4BP3A 1TTTA 4IRMA 3FTNA 2ET6A 1Z2CA 1X38A 1HEIA 4GOLD 1YS6A 3U4DA 4C22A 3G82C 3GW8A 4UMVA 1GFZA 2Q1WA 4XUCA 1PGJA 2XVYA 3COZA 2CVPA 1CJVC 5ELMA 3FM9A 3E53A 3EUWA 3PHLA 2JI9A 2PUJA 1KETA 2EFCB 2EFGA 3QHPA 4BDTA 5E2AA 5LD2C 2IZ5A 2V5AA 3B82A 1P2FA 2NYUA 5IVPA 5CH8A 1ST3A 1EUDB 1A8QA 2Q5FA 5E9QA 4TKLA 3NIBA 2OV1A 4D98A 4CEIB 4B5KA 2ECFA 3PL5A 1XMOB 2NU9A 5HDBB 5EXSA 3O26A 4RPKA 1KP2A 2BZ1A 4YUZA 3ICEA 3FKSA 3FTFA 3UG7A 3KUKA 5BUZA 3N5CA 2RAPA 2X9QA 1WCIA 1IEQA 1US8A 3C3DA 3IV6A 1KMNA 1KIMA 3DNFA 4DUGA 4DV4B 2OXRA 4Q9DA 5FJIA 3DBLA 1VSBA 5AH0A 1S9DA 4GP6A 1XTSA 4TS1A 3WWPA 2FFBA 3H1AA 4P0PB 1OWOA 5CLJA 3S70A 3WWEA 1JDUA 2JHFA 3DBRB 1WNTA 1ACMA 3EY4A 4EZBA 1WDWB 2C98A 5D5QA 2O2GA 3PFNA 4YBZA 2IEGA 4XYBA 1LBSA 1OBHA 3ZWCA 3R76A 2NU8A 5D85A 2OMKA 2V6GA 2ZYWX 1W6UA 1ZCBA 3LECA 5HPYB 5KTSA 1SC3A 2I1QA 4NXNB 1C7RA 3WNCA 1U2SA 2JJ1A 1V9LA 2IYUA 3H1EA 4HMOA 1IPFA 2CNWA 3TQCA 4KR2A 1GNRA 1EMDA 1L3IA 1X2EA 1HE8B 2COKA 3OE4A 4G0XA 4F2HA 1NR5A 1V7ZA 5ILGA 2QE7A 4CMJA 1EFVA 5FYDA 3A1WA 2PEZA 2AOXA 3UKDA 4C06A 1Y4ZA 4H0FA 1NVDA 1J97A 1DTWB 3IQIX 3SYRA 3OQIA 3FSRA 2JHPA 2QRVA 3TZLA 5A5EA 3HXQA 3RF7A 5EL0A 1XI2A 5FX2A 2QRPA 4DXDA 2WBLC 3FPSA 1Y1RA 1KJWA 4Q1DA 3QU2A 3OHSX 1WOYA 2I66A 2NVOA 3D2BA 3PXEA 2PLFA 4PF1A 3ZEAA 3ZWKA 5H8WA 1U3CA 3BXHA 3WLPA 4I08A 4ZEMA 3H9QA 2O3UA 1KVUA 2PL9A 3AI1A 3CH7A 2BP7A 4LJ9A 1UMCB 4Q39A 2ZBEA 1PJLA 3RREA 4GHWA 1EWTA 2H4WA 4EO7A 1A96A 1ULTA 3GD7A 3UAZA 4EJSA 4LYAA 3K9FC 3R9XA 1JIXA 4X8HA 3QVMA 2IJGX 2QUAA 2IOQA 4GU5A 4MV5A 1JLHA 2EG5A 4OH1A 4QXRA 1XVVA 3AKYA 3RD5A 3A6GA 3NU1A 1PTJA 4YDRA 2H85A 2XQIA 4E4RA 1YOVA 1QZUA 3NWPA 3IT3A 2V5UA 4V38A 1OGYA 3ROXA 2FW9A 3OT1B 1JP7A 4PG4A 3GUCA 1F12A 3CX6A 2H9IA 3PQ8A 4RVHA 3EG9B 2X9NA 2WFLA 1KVTA 1CQIA 4TV8B 2AFHB 1BA3A 1U8EA 3HRKA 2XYHA 3EW9A 1IZ9A 3LHIA 2SBTA 3LZ6A 3EXIA 3H3XA 4PS0A 9LDBA 4IVNA 1VI2A 5KNCA 5BV1A 3G85A 1YHNA 4MGHA 1LS6A 5UKDA 4QU8A 2XMSA 4D1YA 4AZTA 2FX5A 3H1PA 1PVDA 1QRRA 2ZBDA 3MD0A 3PFIA 4EYQA 1R16A 2TECE 3R77A 2YFHA 1FFBA 4P84A 5EVCA 4HBZA 5K0CA 1Q22A 3E9QA 3QKRA 3UHJA 2H1CA 4ND4A 3ZN2A 4FSXA 3BSYA 5AFSA 3FHJA 3OOSA 3RFFA 3M82A 3QH4A 2MIIA 5EIFA 2VO1A 2IHJA 2V6MA 1TAQA 5LXTF 3S40A 2D7JA 3T7IA 2AN9A 2XB9A 4YUVA 3V1KA 1YVRA 3RSHA 3Q5GA 2W2PA 3E5NA 1PBTA 1UJBA 4JP1A 1TC2A 3NDPA 3TINA 1BX1A 4ARIA 2RGYA 1RWWA 4G1BA 4I99A 4L5CA 4QYIA 2VLIA 3D7RA 4L3VA 3ZHSA 1PV2A 2AC2A 5I9MA 3RVKA 2W70A 2C3YA 4YRTA 4FGLA 5TQ2A 4QELA 4CTOA 4RZ3A 3H8VA 5HFAA 5GP1A 1JLSA 1KJJA 4OUDB 4M7WA 1BVRA 1GU0A 2DHDA 2OCKA 2G0NA 3PFWO 3R5JA 5TQJA 3RUCA 4V3CA 4TWIA 4R9NA 1CY4A 3DL2A 2WJHA 1NBOA 1H2XA 2YJTD 4OQ4A 4QA9A 3OM0A 2AZMA 3O91A 1D9ZA 2G40A 2D1FA 3C4VA 3I9V6 5FI3A 4E4YA 2PWZA 1P1HA 1R0BA 1ECGA 1NMEA 1XXLA 2FPLA 2AZXA 1V7PC 1NVGA 3GRYA 1LFAA 521PA 4YNBA 4A82A 3QFSA 3W3AA 2IA5A 2WJIA 2BH2A 2M9MA 4XUDA 2O8BA 2EERA 3MTBA 4L4RA 4A2QA 2D74A 1N2XA 2PZFA 4KJXA 1J25A 1TU0A 2DU8A 1OT3A 3QQ5A 3G79A 1UFKA 3HPQA 4FYMA 4XX0A 3SX2A 3CXRA 5DNDA 5CITA 2GZHA 2CEKA 4LOAA 2WTXA 2XITA 4B87A 4ZGWA 3LD9A 1QZZA 2B98A 5JECA 4QUHA 1QMGA 3HEMA 4Y6SA 2QW0X 3UHPA 3OC0A 1XNQB 4A27A 1OKKA 4LRXA 2XBUA 1QTIA 1QBGA 2DC1A 2Z56A 5LZ7A 1HDEA 3X3HA 4PFKA 5A4JA 4JBXA 1RYNA 1ZESA 3OURA 2BGUA 3DV2A 2R97A 3AR3A 2FXVA 4BO3A 1E9CA 2AL7A 3LQKA 4GC9A 4FMPA 4AUNA 3B9PA 3MJCA 4RK7A 1WB4A 4QPNA 1WABA 1XZNA 3ZCVA 1L7BA 1JECA 5SV2A 4UUAA 3C8ZA 3GCDA 4WCVA 3OP4A 2IEZA 2AOUB 3DWFA 4H1HA 5TIIA 1EX1A 5TE9A 2Q2VA 1AQNA 1T1EA 2PRJA 1UIMA 1OWMA 3PDIB 1N7HA 2QTHA 2WOJA 4XPZA 2AJDA 1C9JA 3MBIA 1JWAB 3UB2A 4EKYA 1WWKA 3HCBA 1SCDA 2V0GA 2PFGA 1W6RA 2KJQA 2QVGA 4E2YA 2ZZKA 5AKYA 1P81A 2AS0A 3HYSA 5EUMA 3ED5A 3SI7A 5I01A 3L3BA 3PPVA 2QG4A 5F4ZA 3I2KA 4J4HA 5GVRA 1TT5A 2HN9A 1J22A 4WK2B 1XJCA 2OV3A 4ZHQB 2ZUSA 1RRCA 1Z7EA 1Q91A 2GKGA 2PQ0A 2ZJ8A 2ZB7A 3CEJA 2CZCA 1RI5A 1U63A 1A8HA 4RFSA 1ECPA 2LXNA 2EKPA 2OK8A 1A1SA 3AJEA 3Q4GA 4BLQA 5CT9A 3HXLA 5LBUA 4C88A 3CUVA 2EDAA 3IBTA 4OI1A 2QPOA 1JRLA 4NABA 4U8GA 4BWGA 4K8RB 3DKVA 3ED1A 2C31A 3K0CC 3PFFA 4J43A 3ANNA 1LTHR 4GPAA 1J2UA 2I6SA 4H3KB 2GK7A 4JQYA 4N9QA 1N6NA 4NI5A 4QVGA 3F8SA 2BDUA 3A1DA 3L7LA 4MMZB 4XWKA 5JBQA 2IBMA 3KK0A 2V4MA 4W5RA 3NR2A 2PUEA 3QU9A 4OI0A 3HO8A 1JSZA 3H1FA 2JD0A 1G3MA 4TL9A 3G0OA 4YAFA 1P61B 3EVZA 4B80A 2PSHA 3MTEA 5CU7A 3IJPA 2AJTA 1SK9A 4HFJA 2Z8ZA 3U56A 4YXWA 1QKIA 4CF5A 2WSBA 3FOFC 2P3SA 4KXVA 3VSCA 3CZCA 4NHOA 4KRYA 3CUUA 1GTL1 2J9XB 2OCXA 4OHCA 4HLDA 4HF7A 3UBMA 3OIUA 5TR9A 2WKSA 1ILWA 2W37A 1UZAA 5COAA 3TCKA 1NIJA 1Z4OA 2WF5A 3FOBA 3O9MA 4EELA 1PL0A 3AUSA 1RE1A 5F3DA 4D02A 4B3MB 3GFVA 3ZE7A 5CA1B 4UQPA 2BEVA 4ZJZA 4QJ4A 4XPIB 3USES 4HK4A 3D0KA 4RUKA 3D8RA 3L05A 4IDOA 4MAAA 1XCOA 3A31A 5IZ4A 3EPJA 1YFKA 2HY7A 3GFGA 4GWKA 4Q03A 4JI1B 1FW8A 2I2CA 3V4SA 1DG3A 3VZQA 5L3SB 1AS2A 3IP6A 2ASVA 2PH5A 1CTQA 2V0CA 3QFCA 4G01B 3G8BA 3MWDA 4J4BA 4MUNA 2IPLA 5DSZA 4C6HA 5JS1A 2WZCA 4Y30A 1ZI8A 2CGEA 1N2HA 2JAOA 4UOEA 3KSAC 3QTLA 2CNNA 5CA0B 1LJLA 2HSWA 8OHMA 4HDAA 2G1KA 2PYDA 2BF7A 4MS4A 1QDUA 2IFTA 2QUHA 2PANA 4U0KA 4U7HA 4ZIRB 1RMYA 1WXEA 4PO1A 3IUMA 2H92A 2A9KA 2EBHX 1E3DA 3FNQA 3SC6A 3UT5B 3ZJ4A 1LVGA 2WJGA 3MWYW 1X7XB 2XVAA 2Z2KA 5E9JA 3VUEA 4DSOA 4ZYLA 1HKUA 1CZHA 3QPAA 4WWHA 1NG1A 3GEBA 4MCAA 3LQ4A 1QJ4A 1FC0A 5AKEA 4P7JA 4Z0NA 4IIXA 4EAQA 4JY7A 1QLJA 3H7AA 3R3XA 1ICEA 2P0YA 5H9VA 3VAZA 1A8SA 1DAPA 2I0FA 2PX3A 2ZB8A 3OSZA 2QR3A 4WIAA 4Y2SA 2Q6LA 3SSNA 3UJCA 3F4BA 4I9FA 4HQLA 1J5EB 2Y0PA 4JJKA 5CTJA 1PQPA 2IEYA 4MAFA 1QIIA 3KLMX 2DFVA 4MW0A 4Q4DA 5BV2P 2I8LA 1RACA 2VYVD 2ZSDA 2A4KA 4EL0A 3SLKA 2PUTA 3IKJA 1NXSA 4PFSA 1K92A 3IAHA 1VOTA 5CB4A 1X2BA 4UXIA 2FSSA 1H2AS 2F9LA 2CXTA 3GVXA 1D1TA 3GZTB 4Q3NA 4CL2A 5LQMA 2BY4A 2VIIA 2CJWA 2Q0HA 4FBMA 2BEUA 5DHPA 1P0MA 2IX9A 1NASA 2YV5A 3RSQA 1IK4A 4YONB 4BJHB 2JFNA 4IW3B 3PVZA 2RGGA 3BRQA 4MX8A 4AN0A 2DR2A 1E5QA 4FN4A 3O8QA 3ZDYB 3DMNA 4MQ6A 1W0CA 1JAXA 1XTZA 2EIHA 3OQ1A 3TX2A 3B2EA 1N32B 5JC8A 2Y68A 4OL9A 1PJCA 3Q6IA 1Q12A 2J3LA 3HFGA 1L7PA 3BXZA 1GZ3A 5DBGA 4DSAA 4Z5XA 5KYUB 5EY5B 1P17A 2IYRA 3CEAA 1C4KA 1LEHA 4FNGA 4S2UA 2C07A 3A4LA 4DPKA 3LUFA 4S1VA 5BN5A 1NXWA 3NTQA 1Y8AA 4CDNA 3KDAA 5DTQA 1PG5A 4KXNA 5IH3A 1NX9A 3VTKA 5BXQC 4GNKA 2ZM5A 1CJMA 4RLFA 3O31A 4WL0A 5AI5A 4O4JF 4FILA 4L4ZA 4GWLA 4AWAA 1ABBA 5CR9A 5F9FA 2BH9A 1YCDA 2UYCA 2GTPA 1T2AA 1E2EA 2ZQ5A 4K9DA 3TUIC 3KEOA 4CLDA 5TX7A 4ZA2A 2NW6A 2XNSA 5LZ9A 3EBLA 3OT5A 3DE6X 4MPJA 4BRUA 5A7FA 5JROA 1I1NA 4YJKA 1USGA 5D8DA 2P3OA 3JVEA 2V7EA 3AI3A 4D42A 1M34E 1EEXB 3Q9LA 4D0RA 2VNIA 1FLVA 1GILA 4OO3A 4UVDA 4UUMA 2VHWA 2JL1A 1Z38A 3I45A 3EUAA 2GCNA 3CTPA 2ICAA 3CIFA 3R3SA 5HF5A 3T7DA 1RTTA 4TQUS 3TS1A 1XDZA 2JCSA 1E6LA 3SYNA 4B2LA 1NQUA 3DVSX 3PQ4A 2V58A 5AM4A 4ZHSA 2IRWA 2CHFA 2QM8A 3OZEA 4X3OA 4DR5B 1XVTA 2HT6A 1Q20A 1HOTA 5BV0A 4RF4A 4F56A 4GPBA 1JR3A 1KR2A 4Q4AB 4JUBA 4KPYA 5FTKA 4HVLA 1Q0RA 5IXYA 4OSPA 3ZNNA 4JGIA 4ALLA 4AK9A 3CZMA 3LHSA 2POCA 4UNRA 4GYWA 3E61A 2FPSA 2XY4A 3EOBI 4ZREA 2JS7A 4WPGA 1G8SA 1U1DA 3LTEA 4QYWA 4WNCA 3GELA 5DGTA 1GPLA 2OV8A 5AHRA 1Z0ZA 4EP1A 1CRWG 1JXAA 3WK9A 4I6EA 3WGVA 2C4UA 2Q1YA 3MERA 4L5BA 3W9UA 1ULZA 2GTHA 4AJLA 4EQ6B 3RTCA 1Q7RA 3D6NB 1QB7A 4O2BB 4KIGA 1GXSB 1BS9A 5KYXB 2HO4A 1NBWB 2PLRA 4PG6A 4AJIA 2ONZA 4B32A 2J87A 3R9WA 3EZ7A 1PNVA 3IVRA 4FIZA 4CM6A 4DZZA 5IN4A 1ZK4A 1Y9DA 2X2EA 3KJIA 2I7CA 4GF5A 5TSDA 3F5MA 3KZNA 4ER5A 6YASA 1XN1A 4TV9B 1U2EA 3FB4A 1ZGJA 3L6UA 4P08A 5ERXA 5HGXA 1BWRA 3N87A 2W2NA 1J0AA 2OQ2A 2W71A 1EKXA 3CRQA 1F0NA 3OTIA 4JC5A 1UOEA 3TE7A 1GGMA 3PYXA 2QAGB 4IDAA 2AEJA 2IU6A 2PA3A 4FFMA 4LDJA 1Z4IA 3NTOA 4RJKA 1EM6A 2R2AA 2Q29A 3NORA 4RZ2A 1QGUB 1R7RA 2CUZA 5MGBA 4KR9A 3PT9A 4M0MA 4OB8A 3UN1A 1QCDA 5HTKA 1ZCFA 4F4HA 2Z6VA 2NZJA 4AULA 5FLKA 3DEFA 4R7ZA 1SRRA 1G8YA 1SVSA 2VUSA 3LLSA 4RVNA 4D0GA 1HNWB 3CRVA 2HDHA 4EY6A 3S2IA 2IUFA 4LFCB 4DBZA 2QNRA 2PNJA 2WOOA 1QWSA 1P8AA 3HCRA 5FLXA 2HBQA 3LF1A 3HACA 2V59A 4GIBA 4BKMA 3AH8A 3WFZA 5FOWA 3KEMA 3L1UA 2Z3VA 1PUXA 3ZHXA 1PZHA 1ECBA 4RZHA 1UCFA 4PG8A 1DZIA 3P32A 4YAKA 3KQWA 1EE2A 4O2AA 3EWIA 4XDGA 1QYIA 4RYDA 1J21A 4X1IA 2ZUWA 1K86A 1VJDA 2A5DA 2NPIA 2C58A 1WV0A 1TECE 4NBKA 1XE3A 4XZ3A 2I67A 4LOLA 3TZQA 1YUMA 5IYZB 1IXRC 1ND6A 2GYWA 3PQFA 4P38A 5DK4A 5GM1A 1HRDA 5AVVA 3DDHA 5FP0A 4C30A 3KD3A 3V6LA 1I1HA 3FNEA 2E37A 5KYKA 2J85A 3U44A 2Z9BA 3HA5A 3ASYA 1MX1A 3IQZA 3X1DA 3KD2A 5C9ZA 4MGYR 3GGDA 4XARA 2B8NA 3EZ9A 3K71B 5KKAA 3WADA 4AKTA 4LA4A 3NHRA 1II0A 1SPXA 2ZBVA 1U11A 3V2IA 4CZ2A 4RK1A 2IHZA 3HSSA 3VKUA 2XDAA 1D6NA 4G4GA 4Q3DA 2CC2A 1HUQA 1ZINA 4J7XA 2E9SA 5JUWA 1NVAA 5HCNA 3RHTA 4EGAA 3BFXA 1H5QA 3AG6A 4ZCSA 2GVNA 1GTSA 1QU2A 1GR1A 2VHTA 2BVNA 3OPNA 4P5EA 3HJAA 1QTNA 2HNBA 4KLNA 3WBKA 1ORDA 3RU9A 3K09C 3CC8A 2GN6A 3GRZA 3H1TA 4AMBA 1C81A 4MVJD 3Q8MA 1D3AA 3QXJA 3WYBA 4Q1EA 2B83A 3WLJA 4EEZA 1SU4A 4EHAA 5BT8A 4FE7A 2M98A 1ZN7A 1NLZA 3JAKA 1I1OA 4N01A 2FK8A 3NAGA 3UKOA 1LTKA 4DCPA 4ZVKA 2P9QA 4RD6A 2V3CC 3FWPA 1JQ3A 4IP0A 4DV7B 3LPMA 3H0CA 3LY8A 3ZU6A 2QBYA 4F92B 5KX5B 1NI3A 3F6EX 3CEMA 1RT9A 2VSFA 3IVMA 5LOVB 4I2NA 4V1CA 2PBFA 2IYXA 3MOGA 4HYYA 2OV4A 3PI7A 2XEDA 4E12A 5C53B 5DLPA 3JQGA 4WTOA 1NE2A 1TD1A 3FDZA 3B5IA 5DNCA 1Z68A 4QGSA 3NUZA 1N5LA 3B3FA 3PXCX 2HBYA 2HCJB 2VL7A 5JFTA 5DEOA 2HMSA 2WF6A 1CQZA 1C4OA 1Z7WA 3GVCA 1QAMA 1IQPA 1YZQA 1W94A 2BGRA 2ZR8A 3WK8A 5ADWA 2WHRA 2D0PB 5L4NA 2P79A 3B5EA 4K6GA 1YZFA 5DWQA 1ZDMA 1XWWA 2I6GA 1PSZA 1PL7A 2P2CA 3SKYA 1PDWA 2P5YA 3WKBA 4R5HA 4GE0A 3IUBA 2O2CA 1GLGA 5TQ0A 4YX9A 4QJBA 3A6HA 3SIPA 1N0IA 2WNIA 2R48A 2V7BA 3FLMA 3H9CA 3AXTA 3QF4B 3WNDA 1GPYA 4ZT2A 3I0ZA 3JSAA 1T3GA 4DWOA 3FLEA 3BHNA 1OIXA 1XTUA 5EE5B 1YACA 2FOXA 2OGWA 1W87A 1UJNA 1KFJB 2WW8A 2VDKB 3ACCA 5EJ2A 3I58A 3ZGNA 4G4IA 1H5NA 5MGNA 2B4QA 4AU1A 1GQOA 1UAGA 4NENA 3PC8C 3AU9A 4KNVA 3DMTA 2FETA 2AX3A 1HFKA 1U2DA 1WQ4A 1R12A 1UL1X 2FEWB 4GVPA 3OZ7A 4QDKA 3ZZNA 1U1CA 4PCAA 4ZKEA 5LP6B 3ZDZB 3A6EA 1QQ6A 1V6CA 4AP5A 1UBFA 3I04A 5B12A 3S29A 2R8OA 3MGAA 5EZQA 1UOPA 4B3CA 4DB2A 2WG0A 1Z7BA 4K46A 3A1FA 4OG2A 1EYZA 2OB2A 4PNEA 4KR7A 4WAUA 1RZ3A 3PD0A 4GX2A 4B7ZA 3N2GA 1NT2A 4CEHB 2E4AA 4I1IA 3DMGA 5DM1A 1UK9A 4PGHA 3V8VA 4Z49A 4GBJA 3NT4A 5BW8A 1RJWA 1Z4JA 4L28A 1PIWA 5DK6A 3TEFA 3WYAA 4TLMB 3O90A 2FVXA 1L5YA 2NU7B 1NFFA 1JFSA 1IN6A 1K5PA 2KM1A 1DLJA 2ZCJA 3AVYA 1BXZA 2PKXA 4GMFA 2MSWA 4JN6B 5BT9A 1BSVA 3V3TA 1UMKA 3T7KA 3H11A 4MLDA 3ZYZA 3U7GA 1G38A 1O95A 3JAWA 2PVPA 1XEXB 2G67A 3LPNA 5DMHA 1XEAA 2OLEA 1RQ7A 4GPTA 1G20B 2WKQA 4L9RA 2XUAA 4FOPA 4TQ9A 4IDPA 3L8EA 2NTJA 2JEYA 2OLKA 2XVZA 3KPJA 4J03A 4KHZA 4UOQA 2KLHA 4WZBB 3D2CA 1HTWA 5E6SB 3N53A 4ZQCB 3UA3A 5EIWA 1N34B 4U3JB 1I6WA 1PQ4A 1QYRA 4ZI7B 3T1QA 3UO8B 1A8IA 2CHUA 1EIZA 4LNUB 3EC1A 3I28A 1IM8A 1LRKA 3MT8A 4QNRA 4YTEA 3BIWA 3OE7A 4J29A 3S2EA 3UC5A 1PFVA 1H6AA 3AFIA 3CBQA 1IXYA 3FB1A 3V1MA 3P2YA 2G5CA 4PTZA 3WFJA 6LDHA 4CHGA 4EITA 1YR3A 1SCIA 4JMPA 5K3EA 5DHAA 4J8PA 4UCQA 2GN1A 1RKXA 4CIWA 4JYCA 1NF9A 4AJHA 4XIIA 5FHRA 3S44A 1R0RE 4BEVA 1CXZA 1YR2A 2CXUA 4I55A 1U0JA 1W2HA 1G21E 1OGIA 2AYZA 3ONEA 3WO1A 4DLWA 4DQDA 2DT5A 4R54A 5A5VA 2R8ZA 4DR7B 1AXGA 2J4FA 2DKOA 2OY0A 4A8HA 2JK1A 3C48A 3U7FB 4L8YA 1EE1A 2NG1A 5JLAA 1C7ZA 1T10A 3F49S 2R79A 2JFPA 3WL5A 2PSSA 2GA8A 1FP6A 3B8EA 3RTBA 4DMMA 3I6BA 2QV0A 2C97A 3BFVA 1L7EA 1F5SA 2EX4A 3TNDA 3AEYA 4B0OA 2EEPA 4CU5A 1NJ5A 3VKHA 1SXJD 4J16C 4ML3A 3S28A 1YJ5A 1EXWA 4P2BA 2BHNA 4A5SA 5TPZA 5AKIA 1V8BA 4FEEA 1M3SA 1JIIA 2AQKA 3UPUA 3C3KA 1PR9A 2RGAA 3U0VA 4NG4A 5JWHA 2QTWB 1UZUA 3FN4A 2QJFA 3QW2A 4FFLA 2IYLD 2X41A 5DGHA 5GTDA 3D4BA 4YP1A 1XLVA 1DAKA 2J5QA 3R3ZA 2PX0A 1G5IA 4INPA 5ALUA 5FRDA 1T25A 3ID6C 4EHBA 1O77A 5MN4A 3DT6A 2Y3IA 2QNBA 5JH7F 4F11A 5EE1A 2ZSKA 1Z25A 3ZXYA 3KOXA 1Y9ZA 4WBNF 1AKUA 3D6MA 4Q3KA 3VPCA 1LSSA 1UFVA 3TMKA 2JBHA 5DLEA 1DG9A 1E94E 1UODA 1XNGA 4L8WB 4MQ4A 4KB5A 4RFVA 2ACWA 2Q0QA 1L5HB 5DTIA 4RTKA 3ICQB 4FW8A 5EP4A 1NVVR 1E20A 1UT6A 3MF4A 3EVEA 3CS3A 1FP7A 1FNCA 1JNYA 4CRWB 1PJRA 3EA5A 4RV9A 1PQUA 3W3ZB 3EHDA 3H6HA 4Y2PA 4U1RA 4JLJA 1RJ9A 4I6JA 2XCQA 1SK8A 1K6JA 2BMJA 4QO8A 2B1RA 3EZXA 1TC1A 3QVXA 1RI3A 2CCJA 2WJ6A 5DYNA 4EVRA 4QPPA 2Y2UA 5BVHA 1O5OA 4NYIQ 3P4UA 2EQAA 1Z15A 5JNTA 3M3PA 3MJRA 4I5GA 4NSNA 3CPSA 2I2XB 3D4OA 4JD5A 1YBAA 4BVGA 1CJUC 5A06A 3EMBA 3VZRA 4TKZA 3TTTA 2UZ4A 1QKKA 3RVPA 4CKWB 1MEEA 3RYTC 1P9LA 1U2RA 4BP9A 5B2FA 2PLNA 3NYIA 4H4CA 3S2FA 4F4CA 1ADCA 1D0SA 3M6UA 3ZX5A 4RTLA 3KT8A 5IP5A 3AYZB 3TKYA 3OO1A 2YY6A 2YW2A 3DULA 3KZVA 1ISGA 3H5TA 4Q66C 4D3ZA 4B3IA 3E9RA 5KBYA 1KI6B 3ZPXA 3E9EA 2NQTA 4TRRA 3D5TA 2J3EA 2O2XA 2A7QA 2CB9A 1KK3A 1VIMA 5HQ3A 3CX8A 1W88A 1LF0A 1O94D 2M32A 2YIDA 3L18A 4PAWA 4ILKA 1FFWA 2Z8YA 3T3IA 5K6AA 2J9FB 4M49A 1CUSA 3JQEA 2BTQB 2Q8NA 1BU8A 1MP0A 1ZD9A 3GFQA 4P36A 2IDMA 3BIFA 1FXWA 2QN7A 1UJMA 3M7IA 3SQNA 4D4MA 2B6HA 2VTBB 3FDXA 3NAMA 4TMYA 4N7JA 3VZSA 4O4IA 4WBSA 1Z0FA 1H4VB 3CRRA 4PSAA 1U0FA 2WI8A 2R7KA 2Z2ZA 3FYCA 4WDRA 1M2OA 4CQMB 5D01A 1T2DA 1ZONA 5CW2A 3WYCA 4BWFB 5LKRA 3G2HA 3FRJA 1HFWA 3HNOA 4K5QA 2OQVA 2CYCA 3KPYA 2V97A 4UZFA 4QSMA 4P33A 3U9SA 1CQJB 2R85A 4LYGA 2ZTVA 1DKRA 2ONJA 4C4OA 1UMDA 2BHSA 3E70C 5CCXA 1SGWA 2Z98A 1G8PA 1YZKA 4I1OA 4NCJA 1IYZA 3ICPA 1WVMA 3RRNA 4B9EA 4F2PA 1MRZA 3VU0A 3F97A 3RU7A 3U3OA 2GBIA 3O74A 4I1SA 5HM8A 2C1XA 2C5LA 1C41A 5IBCA 1S3IA 2NAPA 2W2VA 4U5XA 4HHEA 5FA8A 5KI6A 4A73A 5EJ5A 1AO0A 4NG5A 2B9EA 1KMCA 3K1AB 3R3WA 1PK8A 1UBOS 1JG3A 2XRFA 2ODBA 1DXOA 3KV3O 5E7MA 2XUJA 1YIOA 3R0XA 1ULBA 2AJBA 3DL4A 3N8NA 1PWXA 4PPNA 2ID7A 5DIZA 3RH0A 4C4AA 3K6SA 4L50A 4J7UA 5K3FB 1W7AA 4P5PA 2XXAB 4L4SA 5GIPE 2FFJA 4OTZA 4XGRA 3NJ8A 5F4BA 1GSHA 1T4GA 1SELA 1T4MA 3VSBA 5GZ1A 1D2MA 1XK6A 4IH1A 3TZBA 4XCVA 1DJPA 3MCUA 3UWMA 2C3PA 2HA7A 5JEEA 4IINA 5A2GA 2HTFA 1S4MA 2IPAB 2RCYA 1LPMA 1JIKA 1W4RA 2UZ0A 3K9BA 3PHBE 4G5YA 4H4EA 3A0RB 4KRGA 2G1UA 4MXDA 5HEKA 3DXZA 1XT6A 3ICWA 3L07A 4M3NA 4UD6A 4M7OA 1A7KA 1RQ2A 4PQEA 1MW9X 3HDYA 1RBZA 2FPGB 2Q3BA 5K8TA 4YJHA 5JZOA 1X1RA 3RUAA 3OOYA 2ZSUA 2D5CA 3SZUA 4OATA 4IIFA 3QSYA 3KJHA 2MHCA 4P1ZA 3ZDBA 1W4LA 4S04A 5A4KA 2CHEA 3PZBA 1IOLA 1CIPA 2R5NA 2UZAA 5ES3A 5F78A 3LTNC 1GKIA 4AC9A 3VGJA 4OLJA 1Y6RA 3I32A 3ZS8A 5IDYA 1JHYA 3G89A 2A94A 4J91A 1F06A 4JI3B 2YZ2A 3CLUD 4P82A 3DDNA 5HIJA 2PX4A 5AIAA 4QVIA 3JARB 2PTHA 1T24A 2KW5A 1AA6A 1OXMA 3STXA 1CPYA 3OM1A 1F4LA 4HDRA 1EJ0A 1I8TA 1QOQB 1RM0A 3UMBA 4E2XA 1HYBA 3DWEX 4YCJA 1H2WA 1F38A 1L6RA 2F4VB 3BEDA 1J06A 1F14A 4A6EA 4F3YA 3LCUA 4NOLA 5KNDA 1YRHA 5TF4A 4N5DA 4D80A 5KNLA 4FM9A 1PUIA 1XVAA 2QUJA 4PTLA 2QUKA 1DEAA 4JT8A 3QUCA 4HQOA 4KO3S 5JWOA 1ORVA 1R0YA 4INZA 4QDTA 4V1CI 1C0EA 2JATA 4TL7A 2VWHA 1UT5A 2EXXA 1T8PA 2W48A 3FFBA 4HSGA 3LWBA 5BWBA 2HPVA 3GAZA 3SHFA 2G6TA 5HGJA 4RZUA 1ITZA 3ILSA 2GRUA 3CW2A 1A9XA 3OIYA 5LVAA 1JBKA 5EOVA 3QFRA 1DT3A 1I24A 4NBTA 1ZUNA 4P4UA 4MVJA 3W6OA 4YIKA 1AGRA 1IWOA 2DTXA 4DPLA 2JHAA 3C3WA 4IJUA 2IQ5A 1N2BA 3DHVA 4ZMBA 1X3SA 2YUIA 4MQFA 3W5SA 3VVLA 3EGVA 1F6BA 4LF4B 1WETA 1YQWA 3RSGA 4JQCA 3FA2A 3RV4A 1L8QA 4LVNA 4BQPA 5D86A 1K75A 3A4IA 4PPYA 1N8KA 2XGOA 4FYIA 3EYWA 3D8HA 1KZGB 1RWBA 3F8TA 4DMFA 5FOQA 4TTSA 3NAQA 1OUMA 3B6KA 3W06A 3C3EA 4H7IA 2P65A 1WL8A 4XJXA 3HYRA 3LGAA 1LDBA 5ICSA 4EHLA 2VAPA 2HLHA 1ENPA 3OOJA 3QELB 3ZBTA 2XDWA 2IZ6A 4BNYA 5EJ9A 2HXGA 3IV9A 1R6VA 1ZM9A 2JIZD 1LNSA 1RXUA 2CHVA 3F9IA 1OI3A 2VHYA 4C76A 4PRZA 5JPDA 1U9CA 4HNUA 3L41A 4PEVA 3CNQS 2VDPB 5F21A 2P9FA 1DQZA 3S5UA 2ZJOA 3I34X 3LFHA 4PZEA 4ZYTA 4ZYZA 5F7OA 2CLSA 5FNZA 2NM0A 4ZARA 2VNSA 1GL9B 1AUQA 2BZGA 4S0ZA 2Q3MA 4X9XA 4ENSA 1IE3A 3MRTA 4IKOA 3RUPA 4DA7A 2PL1A 3AL2A 1G3IA 2ZRMA 4MYTA 2EQBA 1GA1A 2EJVA 1Z5WA 5JANA 5HJ2A 4M7RA 1M2FA 1YZGA 2W6ID 1OCEA 3N70A 1L1FA 1NR7A 3UEOA 4CPDA 4EX7A 4X20B 2JLWA 3OECA 4GDMA 4RPLA 1KNQA 2O7QA 2JLZA 3CVYA 2D3TA 3SICE 2G17A 1DIGA 2Q8PA 1R6AA 5HILA 1QTQA 1IBCA 2GLTA 5EWJB 1CR2A 5IK2D 2P1ZA 3CUKA 2VOJA 4K6HA 1V4VA 4E1VA 1DDOA 1KIFA 5FOUA 4TZTA 2W22A 4DCJA 5HQJA 5BSFA 4EKDA 3C7KA 2YJZA 3PTAA 4KQ6A 1VG0B 2BHTA 5CFMA 3TG8A 1CC1S 1P75A 1UBGA 1Y4DE 1PGPA 4CF3A 3EEQA 3RM3A 1T8RA 2JAWA 4OGFA 3LWNA 1S5PA 5HBGA 1VGVA 2Z5VA 4MVCA 4P32A 3E9MA 3W9BA 5B3JC 3U19A 2GESA 4NK4A 4YRNA 1XHLA 1G8HA 2RD2A 3T6KA 4HKTA 2QD5A 1QG2A 4IDCA 2ADFA 3DG9A 3HP1A 4J07A 4F4UA 2KBFA 3DBHA 5I51A 3DHNA 5JMPA 4RHFA 2FSUA 1VJ1A 3IBCA 2G72A 4S35A 4Z86A 4C03A 1WXWA 2VP4A 3RNLA 2HWWA 3VR5D 1VL5A 4GYJA 4O2RA 3DTNA 1T34A 5SZIA 5HA5A 1T3SA 3U4CA 3ZIUA 4EHHA 3ULKA 1U8UA 4BZZA 2I7DA 1NKTA 3PK0A 4LZLA 1JQAA 3JQFA 2DPHA 1TUIA 3KZCA 4H3SA 3TTXA 1GU7A 3O1IC 3R24A 4XWYA 5KMGA 4FNMA 4EX6A 4LOIA 2GBLA 1SD5A 4DIUA 3MAJA 4EYSA 1TZJA 3VR1A 5JY1A 1VG1A 3MAGA 4UZSA 3Q8KA 2ZE5A 3ZK8A 5CG2A 4D0LB 3LPDA 1LQTA 3B9QA 1EVEA 3M81A 4LZZA 1U90A 5FPTA 4KX3A 1WP4A 1IB6A 1S7CA 1OPRA 4NPCA 4F4JA 4I2VA 4QEDA 4WFJA 4Q6WA 1UMBA 1DOAA 1T9HA 1W4BA 4JLWA 3KEGA 4MB0A 1BMQA 4LHEA 4KXFB 3AKEA 5K8UA 1SKAA 2ZP1A 4RLSA 2R1ZA 1RYBA 5B57C 1KK2A 2HPZA 1CSEE 2JLAA 3DDZX 4CKZA 1R9GA 5ARCA 3BSSA 4GMXA 1U9IC 3V6MA 1W44A 4AS2A 3KPVA 2E4VA 2ZQZA 4TKVA 3NVMB 5EHQA 3H19A 5BN4A 1HEYA 1UAAA 3RJTA 3MCWA 3YASA 4KI7A 2IBTA 3L6DA 1PD1A 4KQFA 4QC2A 1EK6A 3A7EA 1NULA 1TEHA 4TV8F 5TPWA 3SJZA 3ANYB 2NVUA 5EEGA 3GJYA 4URWR 3TL3A 2R86A 5JOQA 1NOKA 2A0XA 4D6XA 5LQDA 1HT2E 4KQIA 1VLQA 1CZOA 3P9NA 4EG5A 4MW1A 1RI1A 2A92A 3TPFA 5JARA 4N9WA 4EJ6A 3B1XA 2J32A 1T2CA 2ZJ3A 3ZVRA 5EYPA 4EPRA 2CV2A 1TAHA 1ECJA 1JWLA 1ZQ9A 1QHYA 2ZUDA 3SZOA 3ZWYA 3U6BA 3QLEA 5E6UA 1WNFA 3ABRB 1CDZA 3PD7A 2QL7A 4DF3A 4BX9A 4WASA 1E6CA 1JU3A 4QQFA 5D1NA 2QX6A 1SOWA 3PIDA 3V2GA 5AQ1A 1AXRA 4X8MA 3ZY6A 3WWCA 3EASA 4YRJA 4L08A 3A1NA 4HAYA 2IUUA 1IRIA 4FU0A 1RKUA 3ZUGA 1GLNA 3DEYX 4PC6A 3STUA 4B7AA 1SUWA 3LCRA 1B74A 2CVHA 4J2OA 1Y5NA 4K2AA 4EUFA 4E33A 4TZKA 3CN7A 4Z3DA 5D3MA 4RELA 1ZNZA 1X1SA 1LPNA 1TQ8A 4QQNA 4Z9XA 2PLWA 3JYPA 1E3SA 1YONA 4QUBA 3WMGA 2DQKA 2GZ3A 4HDNA 5AM3A 5HIAA 5F35A 5K0ZA 4KGZA 4O59O 5HHTA 1KTIA 1BDIA 1FSZA 1DAOA 1FY2A 2UYQA 4NYJQ 3ZU3A 4FGZA 2F48A 1QV6A 2IEBA 3HDJA 3STHA 5C8VA 3CLTD 5JCXA 1N7IA 1I3MA 1M2HA 4RDIA 1P0PA 3SBOA 3TOVA 3D1JA 5AVXA 1P1JA 1E1KA 2HPHA 3WA7A 1RJDA 1CB0A 3QNUA 2I9PA 3EB9A 4IIBA 4ZQEA 1E69A 4LRSB 3UJ3X 1X13A 4C87A 4R1NA 4CR8A 3F3KA 4OQMA 1E77A 1P5ZB 1XMXA 1L1EA 1ZGBA 3DMDA 2R87A 5KNBD 1N1DA 1E4OA 1GD1O 1HF3A 5DE3A 1E3QA 1GQ2A 5K7SA 1DINA 3T7RA 1NSYA 3EE6A 4G5QA 4LI3X 3EXEA 1NQXA 3Q9SA 1KXZA 4LQDA 1ZJ5A 3ZWDA 3L7OA 5TC4A 1SBNE 2Y99A 3DDOA 4LWZA 2C82A 1EDDA 4HPJB 3KPWA 1DB3A 3DTTA 1GAEO 3IV7A 3K5IA 3E8XA 3THXB 1N6KA 2CL0X 3DFIA 4UTXA 5EZYA 3ZVNA 3EFEA 2WJZB 2I55A 3HBLA 2Z6AA 4E7PA 1T2VA 3K9LA 2ZSIA 4X6XA 4X94A 5CPFA 1IHUA 4XQCA 1Z4MA 1UKBA 2VAWA 1OA1A 3KB6A 3RKUA 4QM6A 3GDFA 4I1RA 4O5AA 7YASA 3D3NA 2RHHA 5K45A 2FWIA 2OFWA 4KREA 2Q45A 3NKVA 3P9IA 4D3DA 1C8LA 4TKMA 2HHHB 4HFRA 3CNOA 4CFYA 1Z13A 1E1CA 3DH0A 1YRQA 3CCFA 5AM2A 4XB6B 3WRYA 3WIUA 3KELA 2J3IA 1KFEB 2PX2A 4B40A 1U2GC 3ESAA 2JI7A 1LI5A 3FNFA 4KGDA 1E7QA 1QORA 4LQLA 2B94A 4FCTA 3GEDA 4RHXA 4BVHA 1TZ2A 3W4JA 4JKYA 2GBPA 3U6KA 3OF2A 1A9OA 2I7TA 1K27A 3OJXA 1ZW6A 4H7HA 3RJ9A 3PNOA 3WSWA 4ZHQF 3RJ5A 4RY8A 1YTLA 1M83A 1QE5A 2H8KA 2HDWA 1X80B 1ZMOA 3L7JA 1X1BA 2MYTA 1MNAA 3PNVA 3VH4A 1AF4A 1PTKA 4ER6A 1RP7A 4BO4A 2J6BA 4EUNA 1BROA 4GBED 4JLNA 1OU4A 4GH5A 2PV0A 3G2PA 3JQ7A 3OG9A 5JJIA 1MGPA 3FNGA 1ESMA 2DUMA 3PC2A 1ISMA 4MUIA 2FFAA 3ROGA 3KWMA 1JA1A 4ZALA 4DLKA 4EI9A 1OLXB 3D8UA 1YAHA 1VMDA 4AYTA 2OB1A 4W6QA 1QZ3A 2FW1A 4LSMA 1QYCA 2R47A 1ML3A 1F1BA 2PYZA 3QKUA 1C1YA 5LYJA 1C7EA 4FYHA 2LKCA 4N5NA 3N7AA 3KXKA 3RLFA 3DLBA 1Y6ZA 4H1WA 1CDDA 3TW6A 4BXOA 4JYBA 2OHXA 3FG9A 4EA6A 2HYIC 3EXHA 3LBNA 5GJCA 3AETA 4JUDX 1E66A 1ZHFA 1SBIA 2C96A 4UTPA 1BE0A 4ZZ3A 2YV1A 4DVJA 4ZVQA 4RF3A 4F6CA 4RIFA 3FWHA 2IT1A 4JLMA 1Y8RB 2BBSA 4YJ2B 5DEIA 3DS8A 1BJKA 4M0LA 1EQAA 3IVCA 3KT0A 5HS4A 1FJGB 5JADA 1EUDA 3O8OA 4XJTA 3N39C 2FEXA 1OFHA 1Y3HA 1Y1QA 3SYMA 2IUEA 5G0VA 3TW8B 5B4TA 3KQLA 3EZFA 1KPHA 1Y1LA 4R98A 5CA1F 2ZSHA 1IBMB 5GZ6A 1WLYA 2IXTA 2JIMA 3NBKA 5BOSB 1GG8A 4J49A 3ZWOA 3GEEA 3RYCB 5I5EA 3W5CA 3LP8A 2ESRA 1B26A 1ZY2A 1QG4A 1HLPA 4GRIA 4EW6A 4S0XA 1HE1C 5A0VA 3DOUA 3ZE6A 1CVLA 1H8HD 1IG0A 1GQSA 2YHAA 3DE2X 3FVRA 4IXDA 1TKCA 4LS3A 1T4BA 4ALIA 4G67A 2C0CA 4MH0R 4RLQA 4ZVVA 2NO6A 3DBRA 3PUZA 2YS6A 4U2EA 5CA0F 3TECE 3BXEA 3F6YA 2OVBA 2ZWAA 3KUXA 4Q12A 4D97A 2BKEA 4EGQA 1MHTA 1TM1E 3BBPA 3DL7A 3MS2A 1JJAA 4B4UA 1GUYA 1T3HA 2WWRA 3B13B 4QHSA 1XU7A 2DYKA 2FX3A 4LX0A 4TN5A 3ZHTA 1LVUA 5TF0A 3ZY2A 1E2IA 2HA6A 5KYYB 2LW7A 1R4NA 3H2BA 1LS1A 3JRNA 1A8UA 3UYLA 1T43A 1NJGA 2R6AA 4KLCA 3T1YB 1QH1A 3FGPA 3N2KA 2PQ2A 4MGZR 5AXCA 1G8AA 3VVBA 5BUSA 1KDZA 3OZXA 1EG2A 3ZW9A 1PCXA 2J31A 3C16C 3RRBA 1G8KA 4PHTA 4RA6A 4DNQA 3WGTA 1X7HA 1DC5A 4AMZA 4RKFA 1ANKA 2B5OA 3IPRA 1TA0A 3GJSA 2OGUA 2G1AA 4N8EA 4P7BA 3LH5A 5P21A 5TV2A 5TMPA 1KO7A 1SHKA 4BAZA 3S2GA 1KNXA 1Z33A 2BDTA 4M38A 1UBMS 1H2FA 4LXQA 4GO1A 4KK3A 1X1AA 3BPSA 5C32A 2A5JA 2J9YB 1I3NA 2YXPX 3L7AA 4C43A 2C4HA 3ELDA 4MPPA 5KWSA 4HFMA 2H8GA 4DM3A 2IYFA 4ZYWA 1RXWA 5D3KA 3KDSE 4QUEA 2F90A 4W8GA 1JAIA 1LX7A 1XL0A 2VPQA 3B1KA 4OEHA 2EVWX 2FDRA 3RBVA 4B75A 3RU2A 3JU3A 1G66A 4HWPA 4LRTB 1IM2A 4IG9A 5KOIA 3VQTA 1DC7A 4MQ5A 5CEJA 3QEMA 1WBBA 2PWBA 5E2BA 4CLXA 4CL8A 4IIJB 4CWAA 2H7CA 2VBIA 4OXQA 3DL0A 4ZVPA 2FUG1 2WHEA 3HCWA 2CJXA 1J8QA 4KUGA 4P58A 3TK1A 4M36A 2G8LA 5CB4F 1FFXA 3EG9A 3THRA 5IFLA 2BGWA 3DF7A 2RHGB 4BO1A 4I8IA 4BMVA 3WP0A 3NIDB 5TQVA 3HB1A 4Q82A 4ZOLA 1OR8A 3UMMA 4HGOA 2D0OB 3PRKE 4MA4A 3F90A 2PRKA 4OHZA 1IVSA 4KE8A 3DEKA 2F1HA 4GMKA 1PGQA 3FMOB 4KSBA 4C9BA 4Q3AA 3TZCA 4ESEA 3ONDA 3IT0A 3UMJA 1KEEA 1KOGA 2W6IA 3NJ4A 3K8ZA 4O8ZA 4RABA 1PJAA 1T0IA 4YLYA 3CZ5A 3NUQA 4IEEA 3GR6A 4YMVA 1DFHA 1KEWA 1M1YA 2BGNA 2OD2A 1M0EA 3ZZTA 4A3SA 4E1AA 1R2QA 2FUEA 1C30B 3CUEF 4XB1A 2C5AA 2EOAA 4JLSA 2PKRA 1GO2A 1X7ZA 5DI3B 3WHIA 1W0JD 2PYIA 4KSCA 4HLNA 3JZIA 4H3HB 4YRRA 5IC4A 3KG2A 3WB2A 1YCFA 4RD3A 1DJMA 2MINA 1D5CA 3WGOA 3P2MA 3RYIA 3RJMA 4FZVA 4FEGA 4GKJB 2KX7A 4EG0A 4LQ4A 1S89A 4QLBA 2P9YA 1X1TA 1N25A 3HCEA 3EEBA 4OBEA 4YA6A 2L2QA 1B42A 2JGEA 3TQTA 2AH5A 4H15A 3G1TA 3TF5A 2YC4C 3RUIA 3M4JA 5CFQA 2BLLA 2XJ9A 4C0QC 4IQGA 3JVDA 4TMTA 4X8OA 5GOZA 4J0FA 4IMPA 1SHJA 3ZE0B 1HPLA 3G2KA 4P0QB 1BCSB 4WNIA 2WUDA 3KYDB 4BXOB 4PLZA 2QX8A 1Z26A 3CWCA 4O1MA 1M54A 4TXJA 1ORWA 1WMDA 1GGNA 2C8VA 1UQTA 2AIRA 2MTBA 3HJTA 3I01M 3NT2A 5KNCH 1T8SA 4W6ZA 3RAPR 1L8OA 3S0JA 1OLOA 2WWYA 2AD5A 3MNFA 2XNHA 1BG6A 2P6UA 4O2BF 2EC5A 3RRXA 1H1LB 2HF7A 3AL0C 2HGSA 2N47A 5BSUA 3GROA 2LPMA 1A82A 4BMCA 5FULA 4F3TA 1ACLA 1TF7A 2P9TA 3GRKA 4HDKB 5DMXA 3FBTA 5DWDA 4IVQA 5J2TA 1IBSA 4U9IS 5ALZA 2CV0A 3F6CA 3G1WA 3KKQA 4U2BA 5AVJA 2W4QA 5DOVA 3TRHA 4IGIA 2RGDA 3NWOA 1MJNA 4D9EA 3Q5EA 3CZAA 4TV9F 5EI5A 1MFPA 3SHTA 4ANFA 1O9BA 1GT6A 2CLOB 4G5XA 5ILOA 4U6NA 1ETUA 2ANCA 5DRTA 2CXQA 4XWOA 2HA0A 2GMWA 3KDPA 4WLFA 5IVIA 1T5BA 4R5MA 5TJHA 4R01A 2V96A 1J09A 4BO9A 3A9CA 1EIWA 1WUHS 2R6CA 3LRXA 4X6YA 1L4EA 1VKRA 4G0UA 2RH9B 1FDUA 3PR1A 1ZC4A 1L1QA 3K2IA 4IEFB 4JC8A 4XQ0A 3ZWVA 3GP5A 4YI3A 2B34A 4U6QA 5CDFE 3W5JA 3PB3A 2RK6A 3NBXX 4COOA 1XX6A 1QAQA 3PHHA 1NUUA 3L0BA 4LCBA 1SCNE 2VSOA 3C3BA 1B8PA 3TIXB 3F7NA 1JLRA 3MWGA 1DBIA 1HMYA 1SQ6A 4OLFA 3N0VA 2VBFA 2I5PO 1X1CA 2O1WA 3ODGA 3W3AH 1LK0A 1BDMA 4AJ2A 5JCOA 1OHHD 1V7QA 1KPGA 3SXUB 4KYUA 4ZYUA 2FUNB 3LDUA 3SP1A 5BNTA 2R62A 3N6RA 4OOEA 3ZOZA 5BUQA 3K0EA 4QU0A 2CJYA 1GGEA 2Z95A 1F17A 2UUAB 4WN9A 4JJ6A 3N6XA 3BGSA 3PUYA 5AVTA 1T3ZA 1Z06A 3SYLA 4A92A 2NTNA 4D2IA 4CIAA 3PDWA 2W83A 3ONFA 4BVBA 5FFMA 5JDIA 2DJIA 3EHEA 2Q6VA 3IQEA 3Q3CA 4OA5A 4Q00A 3UA4A 3WWYA 1VBNA 4Z1OA 1WCXA 1OTHA 5IYZF 3UJ8A 4WKPA 2NZXA 3MM4A 3K35A 1RXVA 4GX0A 5A4MS 1GFWA 1MIOA 2C2GA 2CJPA 3FTPA 4MUHA 3UWPA 2HFJA 3R6GA 1Q50A 5F5NA 3CKYA 5EMKA 3IAXA 2CXHA 3KQTA 4NBVA 3FZQA 1E9BA 4KFSA 3T1TA 1TJNA 4LDAA 3OESA 5TB5A 2BFDA 3CZ9A 1C8BA 3DB1A 2ZVJA 1VXOA 2ZUTA 3G0DA 4GI5A 1V95A 4M6WB 4FK8A 2J46A 2QD2A 3WBFA 3SJBA 5EP2A 1BGVA 3OJLA 3OFJA 4HPWA 4H08A 5SY9A 4AT1A 3C8MA 4AVYA 2BZ0A 2O8NA 1SNYA 3K3PA 1HNXB 2QLBA 2AE1A 5JC1A 4FC6A 1BN7A 2X8JB 4BIMA 4UKDA 4DJ5X 3VAAA 3VX4A 1QR6A 2NPFA 4DLYA 1FTWA 4LSZA 1Z08A 1D2EA 1OAOC 1IXSB 3INYA 4GPIB 4WECA 2NUAB 3DE0X 1P0IA 4HXEB 4YV1A 5JFGA 3SQMA 1DJQA 2RKWA 1D1SA 4X97A 4RGVA 2CVZA 1KSGA 1GNSA 3VPDA 3PHCA 1RCFA 3ASVA 4DC1A 5GOTA 2B9VA 4HNTA 3TG2A 1GHTA 2KB0A 5A3JA 3BT7A 2CNOA 2QTLA 4M1YA 5LOVF 4RA9A 5DULA 3THOA 1NX6A 2EL7A 2GJAA 3CW9A 3G9XA 2EHDA 5ALXA 3Q6NA 5AVYA 1F7VA 1IN1A 1GZDA 4WCFA 2VHJA 4WSOA 3N8KA 1KZYC 3JTEA 2VYFA 1O4WA 3PJGA 5HMMA 5JAHA 5C1IA 1G8GA 3ANMA 1R8QA 2ZB3A 1GT91 3P9XA 4QFDA 3RS9A 1HORA 3GG9A 2BONA 3TBHA 1QVVA 4EFMA 4XOUA 4GLFA 1RWOA 5JXHA 3HCCA 3ZZUA 4D0SA 3ZD6A 3IQHX 2JA2A 4MGEA 4HB4A 1ENYA 1T3LA 3JASB 5LMNB 4RU1A 4RK4A 2XB8A 3BULA 2ASEA 3GLKA 4ZAGA 4KNWA 3ZE9A 2J0SA 3CWQA 1PVOA 3N8GA 4RNDB 1B6TA 3PXAA 4JXJA 4L75A 1DPGA 1XDBA 1Z2EA 1RC0A 3U7JA 1DMSA 1X7WB 5CPBA 1KEZA 2FDCA 2IS6A 5CDHA 3H83A 2YOHA 2AMLA 9GPBA 5SY4A 2CLEB 2DHEA 1THTA 3AV0B 2A3RA 3CGGA 3H18A 2H7YA 4IEIA 4J7CA 4ZT6A 1IBLB 2WWFA 2RGXA 5AW7A 2O5CA 3KVVA 4D9CA 3VVCA 2WZQA 4RCYA 3A6ZA 2B92A 5EKTA 3A9SA 4EYKA 4RJTA 2HJGA 3VPFA 1GZ4A 1EVJA 1TXGA 1IOWA 3UB3A 1NUHA 1HE3A 2C3OA 4MYSA 3TQRA 4Q3CA 1GRCA 6NULA 5HRCA 4LNHA 3HB0A 4JHLA 1WKBA 1VGRA 5BYBA 4GAEA 1JEYB 1X70A 1XTKA 2PWAA 2QLTA 4PTYA 4Q9KA 3UHAA 1HFJA 1UKEA 4CQNA 2L17A 5EE0A 5KYUA 1MPTA 2CDRA 4J0JA 3EFHA 3OOWA 2C9CA 1YVPA 3Q7QA 2TS1A 3A9RA 3E4DA 1Y4AE 4BFSA 1HGXA 3VI3B 2WIAA 1D6SA 4PBSA 1Y3AA 3AWDA 1EM8B 3PRHA 3SK0A 2ZWPA 1GCOA 1QK3A 1O58A 4CCAA 4H60A 4K28A 4B3HA 2KYRA 4RMNA 2AMYA 5C3UA