4KC0A

Msting
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
185
structure length
182
Chain Sequence
LNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Stimulator of interferon genes protein
publication title Novel c-di-GMP recognition modes of the mouse innate immune adaptor protein STING
pubmed doi rcsb
source organism Mus musculus
total genus 53
structure length 182
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kc0A02
5CFNA 4EMUA 4KBYA 4KC0A 5CFMA 5CFRA 4LOJA 4F9GA 4EMTA 4KSYA 4QXOA 4F5YA 5CFOA 4JC5A 4F5EA 4F9EA 4EF5A 5CFPA 5BQXA 4EF4A 4QXPA 5CFQA 4F5DA 4LOIA 4LOLA 4QXQA 4LOKA 4YP1A 4F5WA 5CFLA 4LOHA 4QXRA
chains in the Genus database with same CATH superfamily
3PNBA 5AW8A 1OCEA 4QUEA 4PSAA 4ANFA 1IBCA 2BGMA 1CY2A 1RPJA 1R6UA 1OFUA 4LA4A 3T7CA 3SYLA 1G20E 1X1QA 5EWLB 3UANA 4MCJA 3RTGA 2DJ5A 3M6FA 3MXTA 4HXFB 3RVDA 2GVDC 4AJJA 1QZ3A 1XCPA 3FUUA 1EGQA 2VNAA 5K4AA 4GM0A 5DI3A 4EFLA 1J5EB 2X9NA 1TGVA 2J6IA 3AP2A 4B8YA 2VCHA 3NBZC 1C29B 5HK8A 1QIGA 2F2TA 4D97A 3IE0A 3C7DB 5JCJA 1O7JA 3BB1A 1ZMTA 3E22B 5I7RA 4EPTA 3ET5A 3ZHSA 4CM7A 1T13A 2SBTA 1MP0A 3LC0A 1KMHB 1Z0AA 1H4TA 1E3WB 3QVSA 2O0JA 1SG0A 3IQIX 4MWZA 4AJEA 5E6UB 2ZZKA 1YB2A 2HMSA 4KDRA 4Q00A 1ZBQA 3FVWA 3Q3EA 4W82A 1QCCA 4DLLA 2B61A 2Q28A 5EIHA 3HKEB 4DGQA 1BXKA 3ZGLA 5KSWB 5KX5A 4GI2A 4DLWA 4KTVE 1XIVA 1DKNA 1Z73A 1VHTA 1XHFA 4GOJA 5LBIA 3PFGA 1M1XB 3UK1A 4F5EA 2ZWVA 3QEKA 4G8DA 5K0LA 5DK6A 3ROQA 1CEXA 5AVYA 1NVGA 3P45A 5K09A 5FBRB 4YALA 3DLCA 1QHHA 2FWPA 1UFOA 3NHAA 1M1YA 2ONCA 3B51X 3KB2A 3G5UA 3OJWA 5DN6A 1II8B 1RPNA 4F72A 3GLIB 1QE5A 2J5RA 5IVIA 1T36B 3OP1A 4GPZA 4XQ0A 4S35A 2WYUA 1KYWA 1PE0A 3EXG1 4LDQA 1M9NA 4ZHQB 4E1BA 1QYCA 3ANSA 3FRIA 3O4RA 4Z9XA 3V2HA 3LHFA 2B1QA 1LPAB 3I2KA 1S8NA 4A23A 2FQYA 4BFXA 2P1RA 2Z9DA 3OM8A 4OOFA 1P2GA 4IUDS 2HQOA 3ZWBA 3M0EA 4MJ7A 3EGIA 4QUAA 3L3BA 2E4WA 3IJEB 3DO6A 5HF8A 2VYCA 2JBHA 3UH1A 4NBRA 5ECGC 1C9DB 2IF2A 3G5TA 4LVOA 2ZM6B 1N6OA 2EX1A 1JB1A 2NU6A 3GEBA 5KSPA 1DMSA 3V1KA 1BVYF 1B6RA 1VBNA 1QG6A 2I0FA 2OG1A 2P2SA 4RD2A 1IU9A 3E0QA 2WG2A 3C16C 2ZYHA 3MM4A 1K8YB 5F5LA 2HGZA 3VTKA 1NF3A 1Z6ZA 4IGFA 3K9LA 1TADA 2EATA 2X1HA 2GAIA 2ZSJA 4M8IA 4PICA 2H9AA 2WWFA 3M89A 4B6QA 1PR2A 4RHCA 3KQVA 4Y6LA 3TD9A 5L9AA 2WI8A 5JPIA 5F7JA 3IB6A 3NAZA 3ZHQA 3EVCA 1A82A 1NZDA 3D5EA 3NUZA 3DBRA 1BWQA 3CF4G 3ESXA 1WLYA 1RJDA 3DBOB 4BBAA 4BB5A 4HH3C 3S0JA 4US2R 5JPDA 2AQ8A 5HGXA 3NCHA 3OAAA 4HYEA 4GC9A 2FPSA 2C83A 4KKVA 4Q1CA 4JCOA 1OGJA 1Q14A 3IBTA 5ES3A 3R7BA 1FFXB 2JGMA 3MCAA 4KO8A 4CEIB 3QLUC 5M2QA 1VRWA 3TR5A 3DYVA 1JDNA 1GU1A 1SU6A 3KLPX 3NM5A 3S27A 2FZVA 1LV8A 2YV5A 3LQ1A 4K6MA 2CGEA 4MIEA 4FDTA 3AESA 4LQCA 4WZBA 4TKVA 5KTPA 1J1ZA 3CX7A 2H51A 4B81A 2DRIA 2WD9A 3W6OA 4X62B 3HJCA 3HVUA 2C7OA 2HBYA 3CRZA 1TCAA 1EUCB 4H7EA 2AJCA 2J30A 3HB1A 1NXXA 3SF0A 2YJ4A 3U9TA 1F14A 3EVBA 1JDSA 4LSWA 1IWBB 2CFCA 2EV9A 3CG4A 4CTJA 1J7KA 2NZXA 3D8BA 1Q1AA 2FVYA 3H9CA 1EX9A 3JQ7B 5EGNA 3ZD7A 3OPMA 2BRUA 3CPJB 3FVVA 4BATA 1TJYA 2N75A 2BELA 4NU8X 1YH3A 2D2EA 3FMGA 4IJ5A 3AGPA 5ELMA 4MUHA 4EQ6B 4DA4A 3GCXA 2YHUA 1G3MA 1OPXA 2P0AA 2WWWA 3RI3A 1OXXK 3FTCA 3NBFA 1Z7YA 3GJ0A 3WWEA 4EEXA 1G42A 3N74A 1T25A 1O0BA 2PGLA 2FAXA 2O8DA 1QRAA 1XZDA 1TW3A 5DGXA 1VLLA 1XCOA 1Q74A 4GXTA 3TAHA 1M1NB 4ARIA 1OHHA 2ZEJA 1TKRA 1NFFA 1ZH2A 2HGSA 2QUKA 4FKMA 1RI1A 1ST3A 2VQSA 5CH3A 1MRSA 3UTDA 1KI6B 1ZMRA 3O8DA 5BUZA 3QYPA 1BCSB 4PFQA 4IDQA 1N5DA 5HIIA 2X5KO 3N0VA 3V4LA 2OBYA 2FZGA 5D7NA 3UY4A 3VVBA 3WGQA 2P30A 2XDYA 4U2GA 2CB0A 2OCBA 3R2JA 3RFVA 4OYLA 5ALIA 1YZHA 1O5TA 1VSVA 1OFUX 4CIWA 2NXWA 5B2EA 2I2WA 5ALRA 2BM0A 1LLDA 2NVOA 4IIJA 2X5JO 5TGDA 4ZYVA 4LYFA 3IUSA 3PVZA 5CHYA 5AWFC 3T7IA 1I7LA 1GZSA 2KW5A 2A4KA 4REOA 4EBFA 1E1DA 1Y9EA 2PPVA 1WXHA 3CH7A 1OZHA 3DOJA 3Q72A 5A9RA 5BRNA 2YVKA 1SOUA 2I3GA 2PH3A 4UAJA 4WNCA 4BPRA 4TQGA 4GP7A 1X0XA 1SCKA 4QHSA 4FOOA 4TGLA 3SAJA 3LVQE 2FK8A 1SELA 4GEGA 2A0YA 4RPJA 1DG9A 5JBIA 1ZSNA 2ZULA 1QFYA 4TS9A 1L7AA 2J9FB 2Q3DA 3DXZA 3O3CA 3QG1A 5FNVB 3RYIB 2CL5A 1EJBA 3QOXA 1RP7A 2X9GA 3DDZX 4FNGA 4HDAA 4AJIA 1AMUA 1YOBA 4Y2YA 1ESNA 3GDFA 1U8AA 3N3BC 4KWHA 5EIAA 1I6WA 4Z0NA 7MDHA 3Q7IA 2AOUA 3U4QB 1D0IA 1N2SA 5A6SA 4YBRA 1NZJA 1HL3A 1CXZA 1T5LA 1GTVA 1UK7A 3K05A 4QFDA 5IH3A 3VU3A 2HHHB 4JSYA 2Q4RA 5BPFA 1AMNA 3VUEA 3KQHA 3R3UA 3ETEA 3L7JA 2RI1A 1YC2A 4BO3A 4OXQA 4UCQA 3I2IA 3FYCA 3QU5A 2QM7A 2FX3A 4FHFA 1SC6A 3JARB 3WV5A 1NWHA 1QWSA 2W42A 3L7BA 5G41A 1YVRA 3ZWOA 3COVA 3U6BA 1ZOIA 3JQQA 4BGVA 2DHRA 2K7ZA 4CKXA 4QRDA 2J59A 2FH5B 3U26A 1JLSA 1GWNA 3MAJA 3ZLTA 2B20A 4B48A 4RDCA 5H4HA 1R12A 2TECE 3GJ8A 4AF6A 5K4HA 3WWPA 4EFDA 1J97A 2L2QA 4TS1A 3WRXC 2ZYTX 4C4TA 2OOKA 2XT0A 4DFDA 1BE8A 1F2TB 4RA6B 4YUVA 4DIKA 1FTSA 1ZI8A 3MUOA 4FLMA 4M99A 2XCTB 3EIWA 4TMTA 3RK0A 4A0RA 4PC3A 3HFSA 4HKTA 4BMZA 4R81A 3VDRA 2NZ2A 2V0CA 1PFUA 3TTVA 1PQPA 2BLNA 2XNJA 1KZ4A 1SB8A 2AOTB 2DP4E 3CYFA 3EGOA 1ONNA 2E18A 3H16A 3MYRA 3NH9A 4HZUA 2HI0A 1E3IA 4O2AF 3WVNA 4BIMA 1CHNA 2MSDB 2R79A 4INPA 4V0NA 3EZ7A 5TF4A 3D7KA 2CMGA 4FYMA 4IIFA 3VBEA 4S1TA 1IMJA 2A1UB 3ILHA 5AKHA 2VI5A 4KNWA 1PV4A 3THOA 3MCUA 3FETA 1CVIA 2VK8A 4RJKA 1XRRA 3AT1A 3ODPA 4IIDA 5FHRA 3WSVA 4COKA 2BSQA 4KO3S 4QODA 1TZKA 3C3WA 1AK9A 4XSHA 1NW7A 4G5XA 1UJ6A 4U7TB 1SWVA 3SSMA 1IZ8A 1OTXA 1CERA 3RRJA 1QMPA 3PS9A 1FMFA 4G5YA 1GAXA 3PHIA 4EG6A 3GC6A 1EK1A 2ZJBA 2NU8A 2G1KA 5CJPA 4DEVA 4OI0A 4GKKB 4A6EA 2CLDX 2Z6AA 3WIOA 3WKCA 3RHTA 1S3GA 4EY5A 1W93A 4DWWA 5BR4A 2WJYA 2W6JD 3A8TA 4MVJH 1AKUA 4AWXA 2XNCA 4JFAA 1J2YA 3DZIA 2W71A 1VBMA 1ZS9A 2CDAA 2JFYA 3QG5A 5FIUA 2PH5A 4EUFA 4BIIA 5CFQA 3BJEA 1SKUA 3NHZA 4E3ZA 2PS3A 1W75A 3SMQA 3WLQA 1X19A 1HQCA 4DQUA 2IXEA 3FHCB 2R6R1 5A3QA 3BEOA 1D1TA 1XWFA 1KJ8A 1QHSA 1Y8RA 1CUZA 2EWVA 1Q0UA 4MGKR 4Z3DA 3X1YA 3WYCA 4RTQA 3VOTA 2JAUA 5KSOA 3KS9A 4I5IA 3Q3CA 1KI4A 4GKVA 2ZE8A 4L1KA 3SXUA 5L4LA 1UMKA 1PTJA 3QEMA 3CV3A 4WAUA 3INRA 2AGVA 1XAIA 1PIWA 2FEKA 1P7YA 4BNVA 1C7QA 3B2QA 3KXPA 4PPYA 3CKMA 3QPBA 5IG2A 3PPVA 5FR1A 5T57A 2X13A 4QHYA 5KJFA 2OV8A 1TCUA 3AIMA 2N1MA 3N8KA 3G89A 2VHWA 3GG9A 5JQWA 1FDSA 1UPCA 1LLQA 4NBSA 3MQ2A 1ZM2A 3USZA 1SVNA 4X20B 1Z25A 3NBXX 1NPTO 2AH5A 3OTWA 4DMKA 1TO6A 3IIJA 4AN0A 2Y3IA 2IA5A 3M5DA 3A1DA 1USGA 4AXXA 5J4HA 3H0EA 3S5JA 1POXA 1JKJB 1R8SA 2IYEA 5TSDA 4BEVA 1ZXLA 3LUCA 2B1RA 3HLYA 1D8AA 1QH9A 3I61A 5JMPA 1C4KA 4RV9A 5JZSA 4GICA 4DCGA 2WJZB 1HORA 1I2ZA 1ZK0A 4JX9A 1NATA 1UC8A 4K40A 1CZKA 2P90A 3LY5A 2WZBA 1M1YE 4D9CA 1W5SA 1QOPB 4EABA 2W37A 3NOOA 4LXGA 3HVKA 5ALWA 1QYRA 3JWPA 4DANA 3H1BA 3L1UA 1YMVA 1G8JA 3HC7A 4HP8A 1KQOA 1KR2A 3CLKA 2BHRA 3FNHA 1CJBA 2GZHA 3NETA 5F21A 4YP7A 2AD5A 3RIGA 4BFUA 1IBMB 1I2BA 4KQGA 1P6UA 3N2GA 2QN8A 4WLUA 1IBLB 3NTOA 4XSVA 1EUDA 4ZRMA 1SVOA 4A5SA 4NJEB 4INZA 3KYIB 5KQMA 2K6GA 2WYIA 4PWZA 3WGUA 2BTQB 1A2OA 3B5JA 5K8VA 3LHIA 2CBXA 2JEOA 1P1HA 2X40A 3RTEA 2BOVA 1YHNA 2GEUA 4HNSA 3UJ3X 4Z54A 1L7OA 1RWVA 3W7AA 4DW8A 4D9IA 1JFFB 3INNA 2Q5OA 1Y8CA 3OIVA 4DJAA 2YVAA 4CN9A 4MS4A 1ADYA 2V3WA 1L7MA 4NHOA 2ODBA 4OQQA 1NNSA 2Z8ZA 4LJ9A 5KKAA 3QPWA 4KR2A 2IKSA 2H7XA 2Y9MB 1ABBA 5ALYA 1GV1A 1FU4A 1VHDA 4L9AA 4WKGA 3EHDA 4A2WA 3CR3C 3U1VA 4G0MA 2GYWA 3QTTA 1U6IA 2AZTA 4U0KA 1ZH6A 2QQ5A 3HJGA 2IEZA 4IDGA 4NF2A 4Y7DA 4YRSA 5TGZA 5CVJA 4UBLA 1NN5A 4RENA 4ZOLF 2NP7A 1ZUHA 2C99A 2FW6A 4KR3A 3NS7A 5TEWA 3BMNB 1T15A 2E6KA 4EG4A 4BY9E 3Q1KA 2P8SA 1SD2A 3QJ5A 1K63A 1TOAA 1JDJA 1T8YA 1N0WA 3MFQA 3PITA 1YVUA 2HREA 1N1EA 1V11A 2WSBA 5CFRA 1GCUA 3EFOB 4FM9A 4TTIA 2WFLA 3PQFA 4RC9A 4C87A 5K0SA 1B3BA 4J0JA 2BE9A 2JJ2D 1UR5A 3I6YA 2VQDA 1IH8A 4WZBE 1W46A 1MR3F 3TIIA 5C7IO 5HUHA 3G9TA 4IM7A 2VC2B 3PFKA 3ZXXA 4JP1A 5LZ7A 4X1IA 4AMZA 4OQYA 1P4JA 3ZHZA 3U7FB 3BREA 4F8YA 1VI5A 2VHTA 2Z3ZA 3KM0A 4DLTA 3GRCA 3DVAB 1P9NA 3KO8A 1FZTA 3KOMA 4HFJA 2QTFA 4GLBA 4JQZA 3O8NA 1WDWB 1EFDN 3LLMA 1DOAA 2BHSA 2BMAA 2M9MA 3D59A 1WKBA 1BRMA 3BAFA 3ON5A 2CJPA 4NBWA 1NY6A 4ZWNA 3ENZA 4RV5A 2A7QA 2ZIXA 1ADFA 3M6XA 4ECEA 1QU3A 3NH6A 4I8IA 5KKCA 4ENVA 4EY8A 3HR4A 3W79A 4IDPA 2I3AA 1V9SA 1YB4A 4W5NA 1E64A 4I81A 5GJVC 3UJPA 2JIBA 2C57A 1YS6A 5F7ZA 3T1NA 1GGJA 4WVFA 4WXYB 2NO9A 4D5EA 4JXXA 2UVQA 2QE7A 1N1GA 3WX0A 5JCZA 5JNUA 2WP8J 1HX7A 2IL1A 4IDFA 2H59A 3OC6A 2JS7A 4JJEA 2RKOA 2EAUA 2X2EA 2P79A 4R4JA 4YHHB 2REOA 4I36A 1E6CA 2BEKA 2IHUA 2IF0A 3RFCA 4Q12A 3T0IA 3I6BA 4KK3A 3RARA 1XHEA 2WG0A 4DJTA 3M3PA 5H3HA 1QB8A 4DDVA 4W7SA 4NV1A 5LN1A 3CNLA 3QYJA 5EE9A 3E1SA 5IANA 4E2YA 4JKOA 4CEJA 2AMVA 3DTYA 3TBHA 1CK4A 1T2NA 1OLUA 1Y34E 1DBVO 3CCBA 3EISA 1KOJA 1QFSA 1ZD3A 4CKZA 5IASA 1EUQA 1CQXA 1T9KA 2MDTA 3HNRA 1KEZA 3CR8A 4LRQA 3WDSA 2JGKA 4YCLA 1JQLB 3GAFA 1WPGA 1VMAA 1WMFA 2Z58A 4LXQA 1E6UA 3PP8A 5T64A 2E3JA 3U39A 5KPDA 1HV8A 3CT6A 3KQLA 1T4CA 4DR1B 3ZZNA 3ZHRA 3ICWA 4JNCA 1E1CA 3T3MB 3LVFO 4QU0A 2G70A 2C5LA 4HWKA 1Q7TA 2JLRA 1XNRB 5D6OA 3UWSA 2FX5A 4HAZA 5CT5A 2FY8A 4UARA 4BZXA 1OX6A 1DIAA 4AXBA 3HA2A 3N2KA 4ND8A 1PG5A 2G0AA 4PSVA 1BHO1 3CRMA 4FYYA 3TOZA 5C1OA 5K2MA 2ZBGA 4ZZ3A 4OUDB 4AKSA 1XDGA 3D6NB 1K1EA 4DWJA 4TYNA 4LTNA 3OPYB 2O0LA 2O2JA 2BF4A 1ZJ5A 3MERA 4G0NA 5DU2A 3OZDA 1NXTA 4PS1A 3TSAA 4ID9A 4KZKA 3DMDA 1P19A 2ZI3A 3L8MA 3GLGB 5J1SB 1VKRA 2VDUE 2GESA 2RG1A 3BFXA 2O5RA 3NRJA 3ER9A 1WEKA 2OEPA 4Y9TA 1LK7A 2UVDA 4LW8A 3RJTA 2YDYA 2X14A 3E84A 3I1JA 4Q3AA 1NYQA 1Z8DA 5C52B 4JZYA 5IC4A 1C4OA 4AG6A 3THXB 4Q4CA 3CBQA 3B82A 2C4HA 3I34X 1DCMA 4GGMX 4JIGA 1OSNA 2F3PA 1E94E 2PWPA 2Z2YA 3MA0A 2ZPUA 1QIEA 3CNHA 4UW9A 2GJKA 3W5JA 2PS1A 5IKMA 1QE0A 1S3IA 2G63A 3MIZA 1V3TA 3G2OA 3OICA 3AMVA 3M4JA 4WFJA 2ZUSA 1TT5B 3BMOB 5FJIA 1SXJC 2ZT5A 5IN5A 5GONA 2D6FA 1VKJA 1IDOA 2JHCA 1QCZA 4ETNA 2DTXA 1FTWA 3TLZA 4BVKA 1UOEA 4XOUA 3Q3IA 3ANMA 1XRLA 2QN2A 3D7NA 3IC5A 3PNQA 2IUEA 2YOGA 2WJGA 2OKGA 3R44A 5JWRA 5K3CA 1HK7A 2BEVB 2O19A 2GHTA 1C8VB 4QXOA 3A7DA 4GLOA 3F73A 4HVLA 1H9BA 4UTXA 2WDPA 1UBEA 5BWMA 4I4IA 1UIMA 3LDGA 3OCUA 1A0OA 2C29D 3GDOA 4YDSA 3G0DA 5DCLA 1SBHA 4B3RB 4U3JB 4PX2A 1DC6A 1KOGA 1MCZA 2HPVA 2VHQA 1VSQA 4CG2A 1LK5A 2VOEA 3EZ9A 1ZW1A 4Y9RA 4CQMD 1MB2A 5I45A 2FDCA 1DQNA 1MC1A 3UWDA 5TJHA 3BWCA 1KE1A 2PGXA 2KE5A 4JWKA 1BN7A 4MQLA 4NG5A 3S4YA 4NNOA 4RHFA 4DEXA 1YGPA 3FTEA 2HRBA 1IUKA 5JAOA 3ABQB 5IKOA 4DV5B 1CE8B 5KIAA 5K0JA 1N36B 1G98A 3ZDFA 4GSYA 4CNBA 3D6TB 3CX6A 2R6FA 3EUEA 2DBVO 3EBPA 3B1XA 4YTEA 4Z1MD 4UDYX 1CRPA 1HDRA 1XRJA 5CMLA 3FPBA 1PEYA 2IK8A 1AVTA 4DZRA 1F48A 1MB9A 4GO1A 1HEUA 1UMBA 1KNQA 3WZMA 1GUFA 3EGDA 4S3MA 1QO0D 4ZA2A 3S2FA 4ZOAA 4TSRA 3VAZA 2QR5A 3UV3A 1MHPA 4DQDA 1HNWB 4FGSA 3VR3A 3COYA 2Z6VA 3PUHA 1DWPA 4RTSA 1LLFA 3HVIA 4AQYB 3G0HA 3HJUA 3L46A 5F1YA 2DLNA 4QUHA 1KS9A 4FUTA 5CB4F 3QBTA 2AVDA 2V54A 4G65A 3ZHYA 5GTDA 3GPLA 2CXQA 2ET6A 3EAFA 1YNSA 2FEMA 1GARA 2C4VA 4U7GA 4UUNA 1L8QA 3BXFA 3KJNA 4UXHA 2WOOA 4B4DA 1AKRA 3I09A 1P1CA 4Q3EA 2BJHA 2PA0A 2ZSIA 5FUXA 5KHOC 2AC2A 2R2GA 1AKNA 3JTEA 4Y7CA 1O9GA 3EIQA 3NPAA 3LIPA 2QQGA 4IHJB 4L0CA 1QIFA 5ERGB 1Q3KA 1XFAA 3YASA 2HF2A 3ZDXB 3O2NA 5K7SA 1DARA 3GXBA 3WO0A 5EXXA 3AEQA 4I46A 5EFOA 4AL4A 1WB9A 4HEA1 4D96A 5CB0A 2Y1KA 3ZQUA 3OLXA 2BF7A 1CB7A 2FV8A 2VYQA 4H3SA 4C01A 1B6TA 3NOXA 4RABA 3QUBA 2RH9B 2UAGA 4G0WA 3JWJA 3UAWA 2C03A 1RHMA 3H8VA 1R5JA 1WXFA 2HA6A 3KR0A 2O3JA 3KQSA 3LT5A 1EDDA 1XLUA 1AKVA 3COWA 3G2PA 3KYDA 3SI7A 1MVLA 1O08A 2I1VB 2O1SA 2EQAA 2Y2UA 4ZD6A 1VPDA 2DHCA 4ZDWA 3UYLA 1H69A 1Q6YA 3WL6A 4N3GA 2XTMA 5DYGA 1TQHA 5EZSA 4OKSA 3WI7A 1IWOA 1I0ZA 5BQ5A 1RXYA 1ZM7A 3LA6A 1Y7IA 4OQ4A 1B4DA 4QICA 4EY6A 1K5PA 1EWRA 1PDVA 3B5IA 3CEAA 4P54A 3MJCA 2DBRA 2P6PA 3DCJA 4I8DA 3ITDA 5D1NA 3I5AA 1TMGE 3H8JA 3SF8B 2IV3A 1FUUA 4AF7A 4D3ZA 4Q6WA 5LOVB 2D2VA 2FFQA 2PCJA 2QN3A 2PSSA 1TEHA 2KI5A 3JAKB 1ST2A 4QTTB 4KN9S 2IH4A 5KOJA 3BQNB 4DQ0A 4L5IA 1PGPA 5FX2A 1KJIA 3MCWA 1KAEA 3X2FA 1FFWA 2PZEA 3KAJA 1EG2A 1G19A 4Q03A 3B53X 2WHPB 4G8JA 1FUIA 2OP1A 2PU7A 2RKBA 3I2JA 3R9KA 3W77A 3G7SA 4HAOA 4LS3A 3TR0A 3IVXA 1JFTA 1F2VA 1QS0A 2R1TA 2NPFA 2ID9A 3FPGA 1M6YA 1KFKB 1TYEB 4ZV4A 5JAPA 2YJ6A 2H52A 1A9XB 1X87A 2SECE 4IH9A 5DW3A 2ZVJA 3WRVA 2VBGA 4LC1A 1ZJZA 5I9LA 4PCLA 1R8XA 1I80A 4JVOA 5JATA 4DG9A 4M9SA 2X6RA 3PD1A 2JGRA 1RKBA 3WMRA 2QD3A 1YFZA 2XDAA 2RJNA 3MILA 4OCZA 3EC1A 2PMWB 2PH1A 5DKFA 4TTPA 4CI9A 3JQ8A 2D1SA 2J4FA 2HV9A 4LYGA 4TPKA 1RWKA 3DZJA 3K2IA 3ROPA 5WRFA 2EP8A 3EF3A 1D2AA 3HO6A 3DFFA 4LZPA 3G0IA 3KQYA 3AEXA 3NW9A 4Q7EA 3C3BA 5J2UB 1KKMA 2R68A 1YBHA 3O8OB 3FTDA 3WISA 1QLJA 1O87A 3IIKA 1ATIA 4UZEA 3E23A 1KI9A 5K3DA 3TNFA 4Q3KA 3IVMA 3VZQA 1QH0A 1VYVA 1XQVA 5KHLB 4XJVA 2JGFA 3EG9A 2C42A 5ALVA 4TLDA 3PLAE 3LCRA 4HS9A 5AW6A 5KWSA 5ISMA 3LQKA 1A5AB 2JFOA 1VKZA 3FZGA 1G7RA 3JQGB 4XGKA 4EGQA 5CCBA 2P6UA 3LRTA 4QXPA 3B7PA 1USIA 4P92A 2XWSA 4E15A 5I48A 3RS7A 4KPEC 2GXUA 1QZUA 3RYFA 3BPSA 2D4AA 1ICEA 2FA9A 2A4MA 2V65A 4EYQA 4D98A 3N7AA 1Z8FA 4Y2RA 4XDYA 5AMXA 2Z2XA 3RQSA 4R7ZA 3CZCA 3ZVRA 1A69A 2WFAA 4XD7D 2HK7A 3TGLA 1BVRA 5CH8A 5FF9A 4IEFB 5LOVF 4ENTA 2V55B 1YCGA 3LL4A 3LFUA 5E6RA 1MA0A 1Z4LA 2Q27A 1BFDA 2P69A 3PPWA 4S2UA 3VR4H 4PAMA 4AVYA 2GLTA 3P96A 1CRWG 2DULA 4NLLA 5E3IA 3I5YA 3RADC 3WK6A 1FP2A 1K8XB 2PVPA 1QVAA 4EHJA 4EYOA 2AOVA 3H11B 5I9NA 1C7RA 1I24A 3LDUA 3OQPA 1W94A 2FGKA 4P58A 1NYLA 1WMBA 4J7CA 5ED4A 1PEAA 2XF8A 1BW9A 3ST7A 4K6KA 4DYDA 3VDXA 1EHIA 1VL0A 1Y4DE 1ZICA 2Y4OA 4DV4B 4JIMA 3LFTA 3HM2A 3WGTA 2Y2VA 4W1SA 4B47A 3KSZO 1CCWA 3EZGA 4IJKA 5A7GA 1A8QA 1JEEA 3D02A 2Z56A 4OQXA 2OSVA 3IP9A 2JFFA 1Y80A 4YJ3F 1MX9A 4QUGA 2RC5A 3COZA 3GT0A 3LBYA 4JVSB 4AKIA 4N5NA 4NIMA 1PD1A 1JW9B 1PNOA 3QPVA 3S8YA 3JV7A 5F5NA 4GSKA 1ZH8A 4ID3A 4IGEA 5KC8A 4DNPA 5C1BA 1RM0A 5ALXA 3OQ6A 3ESRA 4MICA 3H5OA 6YASA 3E5RA 2I4RA 1EK6A 5DTEA 2ZI9A 4YR9A 4F91B 1GEGA 3B8HA 3PGMA 2H5LA 3IOYA 1OLXB 1NE7A 3RE1A 4GM4A 5HJ2A 5I7FA 4HY3A 2UVPA 1SNYA 1HA3A 3LUGA 5JYEA 1FDRA 3MJRA 2F4NA 1ZESA 3DEKA 4KW7A 2ZJ8A 4K81B 1CUGA 3EEQA 3H5NA 3A6HA 1H2AS 4P4SA 3P0RA 4BAZA 5I7VA 2CN1A 1U04A 1EUYA 3K9WA 2C92A 3REQB 4AJ9A 3I2YX 5L3QB 5F76A 5T3YA 5DM4A 1QKKA 4BLTA 2PA3A 4REQB 4UNSA 1DEKA 2GXAA 4JI1B 3V1YA 3B6KA 3QNUA 4N12A 5IVKA 4CNQA 3G2LA 2C96A 4PZ9A 5FR2A 2UZ4A 5JFOA 3F8SA 3U13A 2CHFA 1Z0IA 4QQKA 4LTDA 5A4DA 1N2ZA 1MAWA 3BD9A 2ZU0C 2FZCA 1VC2A 1AGYA 1G7TA 1T1EA 2JCBA 3BH0A 4MWTA 5C37A 1CUEA 2QIPA 3ANLA 2PFGA 1WXGA 4TT3D 2X42A 4G4GA 4CGYA 3NT5A 1A9YA 5C2JB 3NWOA 1P62B 4WPGA 2G17A 2YIVX 4FDMA 2AWOA 3GNQA 1GG5A 3GRUA 2IU4A 1H1TA 2Z2JA 5CG2A 3TPZA 3S2SA 2CZQA 4E4TA 1G16A 5JH7A 4MGHA 4XIYA 1U7ZA 3O8QA 3U48A 3WK9A 2I78A 4PN7A 5KMGA 3OQHA 3AM5A 4O4LB 3GWZA 3I2GA 1K8RA 4N7BA 3HPRA 1MX1A 1N6PA 3FUWA 1E3QA 4I55F 1K27A 2OBXA 3TLBA 4E2XA 2FLKA 5EJGA 3SFTA 1B0UA 1UEIA 2K5UA 4OFWA 3HDTA 3VQTA 3A06A 1Q7EA 2ZSHA 3CX3A 3ETJA 1HDGO 1GOTA 4IJQA 1E0DA 1V3QE 1XYVA 2BFCA 2QLJA 1VCNA 3OE5A 3PXXA 1BROA 3DEHA 5JSQA 1AA6A 1ISGA 1DWQA 2VT7A 4PXYA 4M89A 5FTLA 1EP1B 1UMCB 2AN5A 1KR5A 2OGSA 3OF3A 3DD5A 2VAPA 4PTZA 2NUTA 4F4JA 1WEHA 4UJ5A 5EJ6A 2FFHA 1N2JA 1YJCA 1YRYE 3KIPA 4CXMA 3I53A 5B1DA 2PMFA 3VKFA 1Y1LA 2DWPA 1WZUA 2VLBA 2H1WA 3GDWA 4OA5A 4DVJA 5B7NA 3EIOA 5DYIA 4MKIA 5TQJA 2JF0A 1HFJA 4HVCA 1I5EA 13PKA 1IOZA 1QHXA 1X7WA 2OT3B 4ACAA 1UODA 1F8GA 3FPHA 5ICMA 3DL7A 4RCZA 4RHEA 3VSAA 4H18A 2VQEB 2XVAA 4MB6A 1T5SA 4GX1A 3MJSA 1JDBB 4B44A 1A76A 1WNFA 2GDZA 3ABIA 4XRRA 5DGIA 2A7XA 2FPOA 2GO1A 4Q4AB 2GN1A 1GPH1 1CRQA 1SVMA 4ZU3A 3HDJA 1TECE 2AFHB 4L9SA 3E2PA 1Z4QA 4FSHA 3UV7A 3ES9A 4JC4A 2PUJA 4GX2A 4GECA 4ND2A 3MPUA 4DMMA 1SQ0A 5DX1A 5GZ1A 1F4VA 1CJMA 4M0KA 4OPMA 2JGNA 4EHIA 2ZVQX 1DEXA 1HYBA 5LQAA 4NZNA 4BV8A 2RGEA 3Q0IA 2CYBA 1ZEMA 2C9CA 2O2ZA 2PYIA 3IDSA 3QVXA 2HA4A 4GH5A 3DR3A 1JG1A 3INGA 3LWZA 4XDZA 3BF7A 3CZ9A 4DWVA 4X8HA 2WF9A 2XKBA 2QUAA 2YWDA 3DD1A 1N0IA 3LUHA 2C00A 2ENWA 2GRJA 2NIPA 4RF5A 1IAVA 2Q0SA 5FYQA 4ARAA 5EEHA 1NRIA 3AFOA 3BE5A 4PSUA 4FYWA 2WF5A 1S1MA 3GP3A 4HF7A 2NVUB 2LWIA 3EVTA 5IAKA 1YQTA 1OILA 1XROA 1PZMA 2O23A 2P3QA 2YASA 4LMBA 5DHQA 3UEOA 3K9QO 5FWXB 4L5AA 1IMOA 1GKYA 5CEJA 5LZ5A 2HU5A 1WR8A 2XQIA 1JTFA 4G1BA 4E30A 5KQPA 2O8FA 1L1RA 3E9QA 4ETMA 3GF4A 3ZE7A 3PR1A 3LUBA 1PTKA 2PQ6A 2IU3A 2FETA 4I7EA 1L4HA 3AR3A 4Q1VA 3G7UA 4P3YA 1SVWA 3A1EA 1HZZC 4RQAA 2B69A 3OX3A 2HCRA 3AHEA 5AHWA 3HVJA 5CXQA 2VXCA 3RRMA 2M1XA 3DONA 4AUNA 1ZGBA 3WXBA 3TUZC 5FUMA 3I8SA 3LLSA 1RYYA 4LX0A 2C78A 4BQOA 1MQAA 1YZNA 3KOOA 1W76A 4DLVA 4ZANA 3GMSA 4XB2A 1ESEA 2WTBA 4OM8A 5G53C 1PX2A 5LZ4A 3ORHA 3N2ZB 5AVTA 5LMCA 1R2QA 2L17A 1AQUA 4LJRA 1DBQA 2O4CA 4ZO9A 1IEXA 1EFVB 1F4LA 3B1KA 3L0ZA 4ZCTA 1D03A 1OFIA 1T9HA 2ZUWA 1X1EA 3IT1A 4AB1A 4C2BA 1A7KA 1M67A 3ORFA 4DCSA 1Z5NA 3O8LA 3LOUA 3UKOA 3DZBA 3BL5A 2VPYA 5BP7A 3W05A 1UPUA 1SA0B 2OHIA 2LBPA 3OJFA 4PXAA 4YO7A 5DBHX 1Y6JA 5AVOA 3QXHA 2ZSFA 3ZKWB 2AMYA 1UZLA 5J2TF 4LYJA 3HA7A 4RORA 1SO8A 5CFLA 4GLJA 1QFXA 2X0KA 3LO5A 5CVCA 1OT3A 1Y3BE 3S3TA 4G9BA 1NQWA 2Q1TA 1DAGA 5L95A 1P7PA 2B30A 1LBSA 3R5SA 4FFOA 1IY2A 2ZBQA 5JAQA 3SNHA 1ZCFA 4MP6A 3KZ1E 4O1MA 2WF7A 1DTWB 1CY7A 1P8JA 3H6HA 5HG0A 1PI3A 4F85A 4KX3A 3W2TA 5IHXA 2PD3A 4CJXA 1AS0A 4QG7A 3NASA 1KZHA 3CZRA 2WSLA 3S55A 2XKJE 1YBMA 3G2NA 4FMPA 4I1UA 1IXKA 4FR5A 3HRHA 1U65A 3MOGA 1OI2A 3OKAA 1E7WA 1J0AA 4DA7A 1T1JA 1E4EA 2Y68A 3O5AA 2BMEA 1ACLA 5JO9A 4CQJA 4ABYA 3RSZA 5FKJA 1U1IA 4AKHA 3GMDA 3SEAA 3Q87B 3IRUA 5COBA 4UHJA 1UP7A 4CEHB 2DR3A 3EQ8A 4YHBA 4RWEA 2YKGA 3F7MA 1OJ7A 1GLVA 4WV3A 3TQQA 4GBMA 3FW1A 2PX5A 1QIJA 4IUYA 4TS4A 3D5TA 4LNHA 5LQUA 4ZT6A 1GXSA 4RSRA 1JIVA 4WGGA 1DHRA 2I3DA 2Q5EA 1ZD9A 2G8LA 4YS6A 1O94C 4F3KA 4NU6A 4MIYA 3GVPA 2HYDA 4K1LA 3G0OA 3W2FA 3OOYA 4ZYTA 2FN4A 1VL8A 2XZLA 5F73A 1GTMA 2ODQA 2G4LA 3AEKB 3BGSA 4QVIA 1X13A 4JI7B 2YJZA 1EDBA 4QEZA 2W5UA 3WJAA 3HUDA 3A9WA 4I2VA 4AS3A 2NACA 4FMDF 4ZI5A 3BOSA 3OPNA 4XWTA 4HWPA 2E5FA 2QZZA 1F8XA 3GD7A 5J5VA 2O2GA 1MABB 3BIJA 3HU1A 1AHIA 3ZDEA 1E1MA 4XPIA 2QTZA 3ZV5A 4M1TA 2OORA 3Q7TA 5BRJA 4XLZA 4ZK2A 1JR2A 2WYHA 3HRIA 3N2IA 4PZ0A 1UKBA 4MHSA 4FYJA 4KLNA 3V4VB 3H3JA 3W34A 2UKDA 3NVDA 3KWMA 1BQ3A 1RI5A 2V6FA 3VSDA 3G17A 5E1OA 3MCVA 3WQSB 4E11A 1NUUA 3PXGA 3OE1A 2OC4A 1KHTA 2NQ8A 5JI2E 3EXAA 4KQJA 4KQXA 1BHJA 1EDEA 4PQYA 3AKCA 2H6EA 4YVFA 4CM9A 1BDHA 4KQWA 1X7YA 1ZN8A 4P31A 5FBWB 6REQA 2DECA 4CLOB 3MC1A 2VH5R 1XMJA 2HPHA 4EI2A 3NTRA 5HS6A 1RZVA 4TVSA 3G1TA 3DLPX 1HQYE 3R7FA 2RHTA 1OC4A 2QD4A 4WWHA 5AJWA 4N5MA 3UUGA 2V7WA 3TGPA 1WVGA 4O1HA 2QVCA 2CW5A 4EKNB 3OJLA 4LY0A 4B33A 3HUEA 1Q1EA 1JBQA 4URUR 4XJSA 3U81A 2AUNA 2W2VA 2ZXFA 4NABA 2QN1A 4WKCA 2GM4A 2RAVA 3E7DA 3JALA 2BFEA 1VCMA 4UM9D 5CNJA 1BVHA 2HBRA 3I42A 2ZDHA 4XWWA 1GGVA 5FPSA 2LCQA 3IKJA 2GEBA 2YXDA 3IUQA 4JOCA 3LGAA 1CZLA 2GNPA 1BJKA 2FDXA 3DV0A 4BNGA 1OQAA 3NAMA 4UBKA 4GPBA 4R1SA 5K3EA 4GC5A 1C1DB 4LAFA 1YK0A 5KTSA 2AX4A 2X0IA 2A9RA 1RDFA 1D09A 3D1VA 5KQSA 1E1QD 1TM1E 4PAOA 1ADBA 4LK3A 5FQNA 4CWAA 5LP6B 1U8FO 4OJMX 3SGLA 1QIHA 3PX2A 3C5HA 4KU4A 4EA8A 5FRDA 1NKSA 2ID8A 3PE6A 4J03A 1WBDA 2HU8A 3C1UA 4RLFA 4UVHA 3IEXA 3FKJA 4GOND 4J7XA 3JXEA 5JQGB 5ER9A 2C59A 3MAGA 1VE1A 4ZP1A 2J9XB 1I3LA 1BQEA 3IH5A 3E22A 4IRMA 5JMOA 1NMYA 1KMHA 2C8KA 1EQUA 1LBTA 2P9GA 4RETA 3CEPB 1E3WA 1U63A 4MWSA 2IXFA 1L3IA 5E6UA 5AUQA 3VV2A 1NV9A 1Z47A 1XAHA 4XCQA 4XJTA 4YRCA 3ADPA 4EFNA 4B84A 4F5ZA 1IC6A 1E2KA 1GITA 3HKEA 1WSAA 3SD7A 4TQUS 3IIMA 3THWA 3HO1A 5TPZD 3UICA 1U9JA 1UDRA 5ER6A 4ZO6A 5CDUA 1ESMA 1V6SA 2IZ0A 2IYSA 3C3JA 2E82A 1Z83A 3A1UA 1M6HA 3AR2A 4GGOA 4HQ0A 4KXMA 1N6LA 4BFYA 1YDEA 4BU1A 4B74A 1H2FA 2NW6A 4TVKA 4CMEA 3HJFA 3G8CA 3DLHA 1H2XA 1DCTA 2VQ6A 2CVFA 2QX7A 4EX7A 4KYTA 2FQQA 1NKTA 4G0QA 4MUFA 1NR5A 4MYCA 4QUDA 3C45A 2B7LA 3GLIA 1II8A 3ZBQA 4M60A 3HU2A 3MGGA 4EEKA 4N5HX 2XUKA 2Z98A 5CM8B 1Q84A 1T36A 4MRPA 4UHBA 2VNKA 1VE5A 4JKYA 4C7XA 2EF1A 3JWGA 1XMVA 4ZHQA 1ZBDA 2YXPX 4OXIA 3X1DA 4L95C 1XRNA 4F04A 1U0SY 4B8ZA 1XTRA 2PYDA 1H2BA 2QRVB 3GA7A 4WCFC 3EQ6A 3IO3A 4W1PA 4ZT2A 3DV2A 1Y7PA 1DCFA 1ZIPA 3C5EA 2PGJA 1I5OA 2XA9A 3LX8A 4XYLA 1IG0A 1D6NA 4AICA 5F78A 4DJDC 4K8RB 1KZ9A 5EMJA 3RB8A 2IV2X 5LUBA 1U31A 4N3BA 1G9SA 3CBGA 3E6AA 3PE3A 4M1OA 2FN9A 2YMMA 3IRVA 5KU7A 3AF3A 3GT4A 1RHQA 4DCPA 5G02A 3EARA 1DELA 2ZIFA 3JRNA 5H82A 2VAXA 4LJAA 5GY7A 4MV5A 4QUIA 3VNQA 3T3PB 2H8GA 2WU4A 3C1OA 3C6KA 4KN5A 4LXXA 3KKKA 2Y0DA 1MB0A 4GT1A 1ECJA 2X8LA 2DQSA 4HSGA 1PEKE 1W5BA 3TI7A 2OILA 2XA1A 3A6PC 2MCFA 3HJAA 1AHPA 3TL3A 3U49A 3O3MB 2Q0QA 2E21A 2IYYA 5D5QA 3ROEA 2HF9A 1Z7GA 4IJVA 1II9A 4ZYLA 2C3PA 3IS3A 5JAHA 4YRBA 3GA0A 1S1CA 2YXLA 2GPBA 3NHBA 4TSKA 4GBJA 5TJ9A 1PWEA 2X6QA 3R0QA 3KE8A 2Z5VA 3HGQA 3QVVA 4H0NA 4M9CA 1JEJA 5PGMA 3WNBA 2ODEA 3RQIA 4BNHA 4ZJZA 2BGWA 1W44A 3FPFA 3ZGVA 1S01A 2BFAA 3SC3A 4KPGA 1MO4A 2BUBA 1FFXA 3AJDA 2WSIA 1PUIA 4F7WA 1Q50A 1N77A 4BV9A 5JXWA 1J2JA 3J7AC 3T3EA 3HKDB 1SR8A 4D0RA 4UUAA 1NN1A 4DILA 2AN1A 3N8NA 1M7BA 3FHJA 1NVVR 3UXHA 3ZS8A 3EUAA 1R8QA 2TYSB 3PYMA 1J8DA 2X5OA 1U3DA 4OEHA 2YY5A 3W06A 1NBMA 1EUCA 4PIPA 4JBLA 1YFJA 2G1PA 4C0HA 4F3TA 1FRQA 2OTCA 2HZ7A 3BXZA 1RABA 1XWWA 3IQWA 4M1EA 1DEAA 3T38A 3N70A 4PLFA 1N5MA 2Y1FA 3IOCA 4GPIB 2HFKA 3JQ7A 3C1AA 5AJXA 5FPQA 2C2XA 3KELA 4KDFA 2JLUA 2XUQA 1J6UA 4OJYA 1Q15A 3CF0A 4JBGA 3OOHA 4EQ6A 1JDTA 1KK0A 4TN5A 1JXMA 3E9YA 3K6SB 3LF1A 3PTZA 1OAOA 4K3UA 3RS8A 1NJ6A 5C8ZA 2OAGA 1DJLA 1N2GA 1FQOA 1XTKA 4RVHA 3JVIA 3CVJA 4Q3NA 4ZMSA 2O7VA 3GVXA 5C5CA 3WLAA 4DLKA 3O3NB 1C9MA 2FRVA 1ECFA 1M1NA 2DCMA 3ZCPA 1OXTA 4QECA 1Y98A 4BVAA 1XTJA 3RV3A 1CQWA 1GUBA 2PWAA 1KI6A 2NNWB 4PHGA 4JU9A 2OBLA 3FPJA 5K01A 2PZJA 1BCSA 3CNNA 2B8NA 1EDZA 4C0WA 2QX8A 3J81k 2HSEA 2X5XA 1K4MA 3IAM1 3PQDA 2HLNA 4H1WA 4QUJA 1XRMA 1H66A 4CLXA 1YKSA 4BQRA 4H0CA 2YX1A 2CDRA 2ZJAA 4ND7A 5K3OA 4L8GA 4YMHA 4IDEA 3KAPA 4GUAA 2HHAA 3N07A 5E2AA 3R5FA 5AXDA 4GNRA 3SX0A 3D7SA 1N5IA 2ERCA 4QOHA 4ZYUA 4KQ9A 2XTAA 3Q98A 3U7JA 3VVMA 1P3Y1 2AW5A 1EWQA 3PEYA 3C97A 3QUCA 3GXOA 1GV0A 1Z0ZA 4EPYA 3GBSA 4AJPA 3E18A 3S29A 1W36C 1U8EA 1HDCA 5FNVA 1YA4A 2J9FA 4MEAA 1Z22A 3ND7A 2Q6VA 1IQPA 1G3QA 1DKPA 3RYIA 1LVGA 1T9ZA 2Y1LA 4DRYA 1KBZA 3TXAA 4TMXA 2BMWA 1LX6A 1UZUA 1KH2A 4H7DA 3ZGOA 4D6XA 1C50A 1I01A 3M3DA 5A2GA 3U4QA 4G5QA 4YCNA 2IW1A 3FWPA 1GIAA 2K87A 3IMCA 1FY2A 1I10A 1U4SA 2ZYUX 3GCZA 1M5TA 1E3LA 2J5QA 1SCAA 3CJRA 3IPXA 1VCHA 3KZCA 2E7ZA 3OE7A 4K9NA 5DBOA 2W2TA 2ZI6A 1JG2A 2ZB2A 3HGMA 4PF1A 4RIEA 4I4TB 4XQ9A 3EIEA 4UHKA 5DEOA 4EJMA 3E1GA 3L4BA 2XAUA 2O8EB 3BXOA 5E4JA 1CUHA 4KDCA 3A2NA 4BLRA 3JARA 3KEFA 4AJKA 4C0KA 2E49A 2YOHA 4DMFA 2HBQA 2PSFA 3UBMA 1DAEA 3O9ZA 4ZVQA 3RYFB 4LGMA 2IZ6A 4NH0A 1XDWA 1V16B 2LV8A 3QQ5A 2J3KA 1UZAA 1YRQA 1VQ1A 2PY6A 2R85A 3HABA 3OTHA 4P5DA 1HC7A 3BMQB 2AOXA 5H02A 3GCDA 3U0VA 2DWQA 1F2UB 5DTRA 1F2TA 3L18A 1JU4A 3OZEA 4RA6A 4W5RA 3V33A 2WT9A 2FWRA 4FDVA 5L7WA 3DNPA 1TCVA 2HLDD 3P0IA 1SULA 3KOYA 3MJDA 1MLDA 4YJ2B 1NULA 4A26A 1G0OA 1JIXA 2DY0A 3LQQA 2AOTA 3W3AA 2C97A 2Q0HA 3L5KA 2GUWA 4HNHA 3WWCA 4AQDA 3MELA 5C8YF 4EHBA 4IDDA 2BP7B 1FIUA 2OYCA 4FD2A 3VYRB 2YIJA 4MP3A 3WJ7A 1XJWA 3V42A 3KP1A 2A1UA 1AGNA 4J2HA 1OBVA 2EBUA 3D0OA 1QQAA 1M2FA 2CDCA 2XV1A 1ZAYA 2R6GA 3AHGA 4M9ZA 2F64A 5FBLB 5LNK1 4WA8A 1JECA 3B2EA 3K9FC 5PNTA 4Y2JA 3DBLB 1N2XA 3W5DA 3BE4A 2Y8EA 2QTVB 5H70A 5TY0A 4ZJPA 5J1TB 2OCYC 2O54A 1BGXT 3O38A 1JVBA 4YRLA 2XCOA 2PIAA 1Z6AA 4JMLA 2R8OA 3CJTA 1Z29A 2QP3A 2VP9A 4FR2A 3QLJA 4A6XA 4ZKDA 1AQNA 4GZLA 3Q12A 1PKXA 2QG4A 3TRKA 2ZS9A 1H2EA 3PQCA 3BSSA 2HHLA 2YQ5A 4LCEA 4KJXA 4DJ5X 3OBIA 2CUKA 4WLNA 3TECE 5DT9A 1VGRA 4EF6A 3EF0A 5E1DA 4GDMA 4RV4A 3O75A 2FPKA 2JEZA 3PJGA 5DN6D 2Y1XA 1QM5A 4P83A 4RW0A 2PKQP 3O7WA 1T4GA 5BO5A 4Y98A 4OHCA 3V8BA 4FONA 3TNLA 3TG8A 5CD1A 4Y8VA 2ERYA 2XBMA 2CLOB 2H4WA 3G2MA 2O59A 4D9GA 2G08A 3PHLA 5GVSA 2Q21A 1EAMA 1M8GA 4WRRA 2A78A 7AT1A 4OHPA 5JFGA 2W58A 1L7NA 4TLAA 1DV1A 4ZTUB 3M6IA 3B6MA 1G55A 2CFIA 2XXBA 3P97A 3R3SA 1QCYA 4IGIA 3PUIA 3ID6C 3OZBA 3ZZMA 2FFJA 1MGOA 2ZQ5A 3PHHA 3AEYA 4MPDA 2QL9A 2GN2A 5GP1A 1O6ZA 3TLGB 3HY3A 5MN5A 4OQLA 4B3SB 5GJCA 1YCFA 2FPMA 2IT1A 3KQTA 5EEGA 4QKQA 1CFJA 3OZFA 4OP2A 1QGED 3SY8A 2X0NA 4BC1A 4X20A 3V3TA 1O94D 2ZE7A 3NJRA 1I51A 2P6NA 1DT3A 4HC4A 4HGYA 4NAVA 2Q3JA 2BE7A 2XZPA 3D0QA 1V1RB 3LXRA 1YCHA 3C3EA 4PINA 1JKJA 3F6PA 2W4IA 3L6DA 2ZI7A 4ME6A 4OB6A 3SZLA 4EYGA 5CDSA 5I47A 1T9AA 1OH6A 1QORA 4M7PA 3KC2A 4QSHA 3TVYA 5JDCA 1GO2A 5C5IA 3N6VA 3ZCQA 3OTGA 1ADJA 5HDBB 1WXQA 1NBHA 1V2GA 2JAHA 2ZTVA 3FX2A 4DOMA 1UKZA 1S6YA 1Z75A 2J3JA 3D0RA 4LV5B 4PGHA 3WBBA 3V1TC 3GLIE 2FG7C 1ARZA 2ICAA 1Z5OA 1RLJA 3OAAD 2GDJA 1F0KA 4RGQA 1LJUA 2J6CA 2JIZD 3RREA 4IOMA 1XEXB 2A33A 2LDBA 3K20A 4WA7A 5IKXA 4Z3OA 1V7CA 1N78A 2I7DA 1GZ6A 2H4ZA 3CSUA 3MWEA 1SRQA 2PD6A 4IUCS 4X1KB 2BR3A 1TIPA 2CNBA 2FR8C 3QYAA 3HG7A 5TARA 5IZCC 3LWBA 4OXRA 1N2IA 4QDZA 3RU7A 3OY2A 3WGKA 3HP7A 5DULA 1LU9A 4NJEA 3SBEA 3OU7A 2WM2A 3EFEA 2BTQA 4ED9A 5DCWA 1TQ8A 2VHVA 4D6PA 5L3VA 1VMDA 3LCVB 3BTSA 2W6ID 4JFRA 4DUGA 1JFFA 2WU0A 4XM2A 1OLSA 2H7YA 2EFHB 5EUBA 2C4TA 3NP9A 4EPWA 4L4XA 1DX4A 1CY6A 2ATXA 2IFTA 4FYPA 5AK5A 4LYYA 3L7YA 3CUKA 4YAKA 3FDZB 1WCWA 1B8UA 1QX4A 2R5NA 5DHUA 1GTG1 1LNSA 1G5TA 1MIOB 1J0BA 2PR7A 1GGEA 3KKPA 2IPOA 2NAPA 1BRTA 3I9OA 3M7IA 3OQVA 1LTHR 1QPBA 1AGPA 5LKRA 1T0PA 4S1OA 5T4EA 1VM6A 1QIKA 4OXKA 3K9NA 1GRVA 1SCUB 3DS8A 3NWJA 2JFHA 3EZ2A 3KUKA 4JGIA 4EAQA 5IDXA 3AUJB 3N2YA 4Q7KA 2KB0A 3TZQA 4WLOA 4ZQCB 5EHZA 2ZI5A 1COWA 4LOLA 1QQ5A 1EP2B 1TAQA 2PX4A 1T9GR 1PAUA 1TO1E 3UFBA 1C7IA 3IMKA 4UDOA 4D42A 3TF5A 3BMNA 4L28A 4K9RA 2ZIAA 4XGQA 1AZSC 3UV6A 3VPCA 3K70B 1KVQA 1W35A 3L7AA 1HTBA 4QGFA 4U39A 5KJCA 3EFHA 1J1IA 2CF5A 3EFOA 4HD8A 3BXPA 4OU4A 4UAVA 3AB8A 3QW2A 4B09A 3AVVA 1XXHA 4QJ4A 2WTMA 3RUCA 1UM9B 2WKRA 4IOJA 1GFZA 3WTCA 4P4GA 1G3IA 1WXIA 1F9EA 4S1NA 3QQPA 4ZXFA 3JQBA 3TTTA 1SHUX 4F3YA 5A5EA 3QHPA 4MUXA 1JJFA 3PRHA 1U5CA 3FYUB 3L01A 2VO1A 1AV7A 1NBME 1E2IA 1EVKA 2I4TA 3RW9A 2ASEA 2DFVA 3V4SA 2MT9A 2ZIUB 3Q7EA 4G4SP 3W0LB 4CKCB 1YZYA 3DVAA 3PIRA 4UE2A 1G4AE 3IPRA 5SY6A 2YWXA 2JIMA 1DBRA 2WUGA 4EGSA 1PS0A 4F60A 4XYGA 4D3FA 1VLHA 1XCBA 2GZ2A 2VCEA 1GTZA 4AW9A 1I0IA 4N0PA 4DJJA 1G8SA 2XMQA 3DMYA 4YXWA 3V32A 2V6JA 4GE0A 3IJ5A 1P4GA 1WMAA 2VJNA 2Q1SA 5COAA 3U6KA 1F8FA 3B1WA 5JADA 2FDRA 2YC2C 3HB4X 2OV4A 2PUFA 1U2TA 3M49A 2ZIWB 4JB0A 1Q0HA 2FQXA 1WX1A 2Y71A 1NMQA 1XQXA 4M1KA 4ZOQI 2JW5A 1NT2A 1JF8A 3AUAA 2ODTX 4Y2PA 1DI0A 2WAOA 2I91A 4L5JA 2QSZA 3MG9A 1ECLA 1HNNA 3V2GA 1OD6A 3KSDO 3I5UA 1TZBA 2O4UX 4WFKA 3AU8A 3L7KA 1U4NA 2L18A 1Q0LA 4DYVA 5DNUA 1T5BA 2UYHA 2OGZA 1K7EB 2FB9A 4YXFA 3AOEC 5CDGA 2W2MA 5DHRA 4RIGA 3TS1A 1D9ZA 3UMGA 1KOLA 2PUWA 4RXTA 3DF7A 1VPEA 2XB9A 3EH2A 4XFDA 2VXOA 2WIBA 3LOPA 2DE0X 3A11A 3WHKA 5E38A 2CBGA 3P2EA 1O57A 3QBJA 3I32A 5DX8A 3RHFA 4BASA 3UJBA 4NSNA 4R2LA 5IBRA 2HWKA 4EFMA 2Z6UA 2PL1A 3EOAI 1GGKA 3KB8A 1DZIA 3LUPA 5CM9C 4ZAGA 3UWMA 3VKHA 1SBNE 1PSZA 2Q0XA 1TAGA 1KK3A 1L4YA 1NTOA 2BEJA 5KKNB 3A2KA 1B73A 4TUYB 2I3BA 1Y63A 3CVOA 3QMVA 2FXVA 4HAUA 4IF4A 4K2AA 1WXDA 5CGQB 1NSFA 1ZOLA 3N28A 3Q3GE 1ZU5A 1P9LA 4K9SA 5TVKA 1F3OA 2R751 3UMVA 4ACBA 1VBKA 4Q3LA 5LB4A 1IPFA 4YMSA 4AG5A 1J7JA 2HUPA 4LDNA 4D5GA 2TMKA 2DHQA 2WJAA 3OJEA 4FFMA 1G7SA 2DWOA 3WJ2A 1QF7A 1R8JA 2ZTMA 3U17A 4OUDA 4AMGA 3OPYA 3IESA 5LVAA 2GCEA 4MUEA 2PXAA 1EWYA 3B1YA 1G4HA 3G5AA 2QMHA 5C8DA 4CMKA 4KQIA 1N34B 3DE0X 5E9QA 3GLGA 2AXNA 4B76A 4E03A 4ZI2A 1IEWA 4M9UA 4EG1A 4TYWA 4PCAA 2VYNA 3B6IA 2X4LA 3B36A 9ATCA 4K6GA 4I4LA 3AEUB 3T15A 3PC2A 5FOUA 1MDBA 1VYHA 4A8PA 4AY2A 4CMCA 5DHAA 3VHXB 1BHQ1 3UUEA 5IK2D 4WERA 5BN3B 4URXR 2CXUA 1EVIA 3LFHA 1YS7A 4TMVA 1Z7WA 2ZTLA 1SM4A 3N9IA 2RJ3A 3VYWA 4EJFA 1WB4A 2XUZA 2Q3FA 2LIVA 2A1TS 2ZVDA 3AYZB 3O1HB 2Y0EA 3TGWA 4QQ8A 3VR6A 1AKEA 4C0BA 4DMLA 5I5EA 3THXA 3K0FB 2GI4A 3FR8A 2RKWA 1AO0A 2P1ZA 2FZWA 3L0SA 3AHCA 4Z0PA 5JZOA 1PO7A 1Q1GA 1QV9A 1EJ6A 1T1GA 3GUCA 3MJ4A 3VPFA 1QGYA 2IEBA 4E13A 3E3OA 3L8EA 3BMOA 1XA0A 1ZUWA 3EPHA 4KO4S 5JPCA 5BW4A 4WKOA 1ODLA 4B3GA 2V9PA 5HUQA 4LJLA 3R3VA 1NM5A 3H97A 4TV9F 4B71A 5EMKA 1NXVA 4HZIA 5B53A 5J5CA 1B1CA 2V1XA 4Q01A 4R2MA 1C1YA 3THYA 4AURA 5BVHB 1EBUA 2G72A 2G88A 2Z83A 4LYEA 3QY0A 3UT0A 3FOEC 1VDZA 4J7UA 2J3IA 4BECA 4R05A 4ZJUA 1ECGA 1M0WA 4C5CA 2BEVA 1AMOA 4PCUA 1XC7A 2YWHA 3STTA 3EVFA 3OIWA 3W9BA 4BTVA 3CT4A 2FOIA 3SPXA 1EU1A 1OKKD 4DE5A 4DCJA 1Y9AA 1ZKDA 3R7AA 4JR0A 2VT2A 4GMXA 3VU1A 5DI9A 1FJGB 3IALA 3UPDA 1V8OA 2GPTA 3I12A 4U3JA 4O29A 3U16A 1H0KA 4HWGA 4AYWA 4EB8A 1KVSA 2GPAA 2QUIA 4HK4A 4QEDA 2FW0A 4JEMA 3GP8A 2JZCA 3RFXA 1GILA 5CT8A 2AVNA 2PVSA 1Y5LA 3NIDB 4YMGA 5LLTA 4AMBA 1JFRA 2JC3A 1ULUA 3K8QA 3WRYA 2G5GX 2R9VA 4RACA 2X0RA 4EZEA 4HN9A 1I2AA 1JFSA 2DPLA 4OB7A 1QNFA 4L74A 1JL3A 1N57A 1RM5A 1ZGGA 2VF2A 5TF0A 2ECKA 1GQFA 1CE8A 4L2IB 2X58A 1GFSA 1I33A 1ONOA 1QG0A 1SH7A 3S81A 2GARA 4LRWA 4A8JB 2O8CA 5HQ3B 3WKEA 6GPBA 5FTMA 3LTNC 4MK4A 2Z2KA 3LUAA 1W36D 2B94A 5DP2A 4XJXA 1JBEA 3RO7A 1R64A 3E35A 2XDWA 3MIIA 1MOZA 3JYQA 1P0MA 2YMLA 4JJAA 1LZKA 1XJ5A 4GQAA 2AYZA 4PZZA 4KH0A 1ISIA 1JIKA 3TJRA 4E88A 4YDQA 2GHRA 5A02A 3IHLA 3K35A 2ZJZA 4FHZA 3VPGA 1FNSA 1PRYA 2G7ZA 2CEAA 1R0XA 2P2ZA 2FX2A 1OXKB 3ONVA 4UQOA 5EE5B 3R9XA 1BOOA 2BCGY 1OU4A 1GQRA 1C14A 4JB8A 5DASA 2FP3A 3RABA 5C7YA 4ZQEA 5I8PA 1MW8X 4JROA 2C95A 4YLEA 2ZRNA 5GJWC 1QP7A 2CKMA 3GA5A 2CMDA 5IX8A 5J47A 3LZ6A 2ZBFA 4LOIA 3KU4A 4RE6A 3ZY4A 2D3WA 3G0GA 1ZMBA 2PSDA 3VOAA 1ODCA 3VU0A 1NQ5A 3OUUA 2BFBB 2ZAYA 3OKCA 3QLVA 3L0DA 3A3NA 4RPIA 2WM8A 2VPPA 1NF9A 3C5WP 4C4SA 4IHJA 4E5YA 1JDUA 5JWOA 2G07A 3EQZA 3NBAA 2BSAA 3IJPA 1H2RS 3RRZA 3NEJA 5IULC 1X1SA 5JLJA 1F8UA 4YRPA 4R2HA 3FGZA 3JD3A 2R2AA 2RARA 3KAKA 1OYOA 5TR9A 1GGHA 1WQ3A 3OCCA 3QGMA 3UHJA 5JSYA 4F4UA 4EZIA 5LU8A 5ADHA 3L0PA 3JYNA 1XB2A 3ZI0A 3QNWA 1IK4A 4MV8A 2G9UA 4PLGA 3T99A 1PQWA 1YVEI 3ASZA 3OESA 1QANA 3UB3A 3P2JA 4XA8A 2XMSA 4LECA 5B58C 2Q3BA 2IZZA 1U0FA 4G1FA 2A5FA 3HXOA 3FA2A 1KPGA 1WPXA 2DZDA 2H31A 3K0AA 5L51A 2RC6A 5LBUA 3KK0A 4S04A 2J7KA 3DO5A 3H2GA 3LGXA 7ADHA 3ZDDA 1G8FA 3H4MA 2EQ5A 4B7AA 1VJDA 2IY8A 3M6UA 3PD7A 4Q9HA 1TUBB 1JXOA 3IEMA 3GVHA 2GM3A 5E95A 1DLJA 2WFMA 1MHTA 3DM9B 1HDEA 4BUCA 5DNYB 2BH2A 3SF8A 1LDNA 5BUSA 4DA0A 1TD1A 4NONA 3DVLA 5LXTF 3FNEA 5LOVA 2IHNA 4Z99A 5H80A 2VUTA 4O1IA 3U4AA 5KOIA 4ENSA 1E9VA 3JAKA 3PX3A 5AW1A 1P3JA 1T34A 2BBOA 3RTDA 3VZPA 4NCBA 2O9JA 4AF8A 1MO5A 2FFAA 4E5UA 1XVIA 1DIGA 2WHPA 4G5FA 1F60A 1C8BA 5JZ9A 4NOLA 4GU5A 1E9BA 1F5SA 3NHUA 4MPPA 4D92A 1SOMA 3F46A 2KJQA 4Y2SA 3RSOA 4F9GA 3LKZA 1I13A 3T9FA 4B6SA 2DF8A 1A9XA 3FBWA 3KPVA 4P2GA 2Y77A 1KBQA 3RG2A 3K0SA 5BYKA 2UYYA 3EGEA 3TQRA 5ADUS 5C5EA 5KOHB 4ZV9A 4BNDB 1I6MA 1EP3B 3L8CA 4B3FX 2Q3HA 2ZPAA 2AE1A 2HCFA 2O3RA 3NEPX 4DAOA 4W9MC 3QEJA 2O06A 1XKQA 3T4PA 4OH7A 4QT0A 1P1JA 4HGPA 3TH5A 1P4AA 3ZV4A 4JA2A 3IAUA 1VMEA 1C7ZA 2VHZA 5D6NA 1SZPA 2P5YA 2IIQA 2IOHA 4XGIA 3O8OA 2JK1A 5J2UA 5JXJA 3ZN2A 3PR2B 3A26A 2EZTA 4L7VA 4PZYA 3SLRA 4ALKA 1KMIY 4OGGA 1MO3A 1SN7A 3UHPA 1SVSA 4EW1A 2C2BA 2K4MA 4HAYA 4X60A 2BV3A 4EKIA 5L3SB 4IW3B 4N65A 2GCPA 4R7GA 2G28A 1X0VA 3AUKA 4QELA 3RYHB 4F1JA 4ENUA 3BCSA 1T0UA 3T7TA 1FDVA 1W1IA 4D8VA 4V1CB 3IQXA 1T43A 3U4CA 1IL0A 2RB5A 3JQGA 1PNQA 4TL6A 1QFZA 1NT4A 1PDWA 1EQAA 1VMIA 2YCLA 3ZV6A 1USWA 4RKYA 4TM8A 1F4PA 1ODSA 4LWQA 5LLSA 1P7ZA 1SUCA 1B14A 1WMSA 2BI4A 4I1YA 4C4AA 1UCFA 4PE5B 1K0FA 3W9UA 2VPQA 1CRZA 5J40A 4QREA 2YN4A 1XNJA 3R0ZA 4LY6A 5TQ0B 3AI1A 3QEAZ 3GZNB 4OQNA 2I7VA 4DPKA 2GAOA 1SU7A 1W19A 5AKIA 5EE0A 3FF1A 4KTTE 3DYBA 2C2HA 4YRJA 2BMDA 1T6NA 1J2UA 1YS9A 2W2OA 1JALA 1CIJA 1YQUA 2B3DA 3D6FA 5E1BA 1X7ZB 2NSHA 4MARA 2AA3A 4P5PA 1EB9A 4IS3A 4U7FA 2ON6A 1V8PA 3X1JA 4IVQA 4ZO7A 4EKYA 3H11A 4ZYXA 5GM2A 5JO0A 1RRKA 2Z5GA 1FBTA 4IXWA 3IHWA 1M6NA 4RHUA 3EQ9A 1YQXA 1KQ3A 1QZZA 2F6RA 1QK4A 4HMOA 1JSLA 1NQUA 2FEWB 3I01M 3QPCA 1BHSA 2GEKA 5T67A 3W4JA 2MSNA 4KK4A 2PLAA 4KC0A 1E5QA 1RCFA 5CVTA 4S0ZA 3FYDA 5KYUB 1RFGE 5HBGA 3JRWA 1TM2A 1MNQA 1HXHA 2G4VA 4Y6PA 5B1YA 3C24A 1Y1PA 4K8OA 4IILA 4BJ5A 3O03A 4D4MA 3RT7A 2BTEA 1EWKA 2DYKA 2NPOA 2ONYA 4IIGA 3RUIA 1E1RD 3G2QA 4MS3B 4DF3A 4OK3A 2X1VA 1L2TA 4TM7A 2HIGA 3A2MA 1IEQA 2RB4A 1UPFA 1ZITA 3ELYA 4EATA 3FZNA 3TMYA 3R41A 1H4VB 1Y5RA 4JBYA 1SD1A 4N9WA 4QTXA 2K2WA 2BKEA 4W9RA 3EJWA 4K46A 3GLGE 2VTBB 1TLFA 3DDNA 1JG3A 1GA6A 1J25A 4R8VA 1ZHFA 5B6PA 5BOSB 1GM5A 4MRMA 4JZKA 1EFRD 4IZIA 4DXAA 2B1IA 2BMFA 5AKZA 4D4GA 2Z6QA 5IT0A 1B00A 1Q2UA 1SHZA 1OLXA 5ADVA 1AUQA 1H6AA 2ZROA 3HHPA 3L8HA 4QGAA 2PAFA 3KXIA 4BAGA 4FE7A 5FFFA 1U6KA 1C81A 1NU8A 1YA8A 3G23A 1I4LD 2QRPA 3K0CA 4ROTA 4XVQA 1N7IA 1R6TA 1E32A 5BXQC 2GBGA 3HB9A 4WK6A 3WTBA 5BSVA 5IJ9A 5IT5A 4CGZA 4IBOA 1V6AA 1NRWA 3GVCA 5HNKA 4HN2A 3AL3A 2D1RA 5D1HA 1XV5A 3RYCB 5B4TA 5DCUA 2OAP1 3LUDA 4FYKA 1F51E 4H9GA 1KJ9A 1H1LB 2FG6C 3ROZA 3H75A 3REQA 2MMCA 4QNMA 5L3QA 5IVPA 2V8OA 4DLBA 4REQA 2QS9A 4WCVA 5COQA 4JI4B 2PQMA 5DP1A 1MPTA 4DLUA 4MGEA 4OI2A 5AVXA 4LXYA 6CHYA 3CM0A 3MW8A 3KXLA 3CONA 3QX8A 3OOWA 1AKYA 1QIDA 1B2LA 2QAGB 1XCGB 2X23A 3I73A 4H1TA 3CLRC 3EIFA 4NEGA 4I9FA 4ZZ0A 2HMWA 4B3TB 4S1PA 3OT1B 5DGCA 3KTAB 2OGWA 3WWYA 1PSWA 2C4KA 2R8XA 4C05A 1SIOA 3AB7A 4NE7A 5A4AA 5JNWA 3KDPA 9MHTA 1B6SA 2D54A 3CUYA 1R37A 2J6BA 3ETDA 4C21A 3LQYA 1UUFA 1Y4SA 5FL3A 3TW0A 1EHYA 1P39A 4HUTA 1N7HA 3HCRA 3E61A 3DPSA 5JZVA 2HM7A 2P2CA 3AFHA 2R1ZA 4RPGA 1CUBA 2QT1A 2EEZA 1JPJA 3DOHA 4G01B 4CDMA 4FGWA 4J1NA 2EKLA 1U8UA 3SQXA 5ALHA 2CCKA 3PQ2A 2DGDA 2VUUA 1INLA 2HX1A 3HJTA 5GMOA 4O4LA 4WXRA 1ENPA 3C7TA 1DJQA 1P0PA 4DSNA 5BNIA 2JLBA 5IJXA 2P7IA 9LDTA 4JQYA 2AS0A 3NEAA 1XZJA 2ZE6A 1XO1A 5ABPA 3PDHA 2XWBF 5D5PA 2Q5LA 3SHTA 3VC3A 2J3LA 2GAAA 3PBKA 3ZHTA 3DTVD 1R0SA 3OCXA 3T1QA 1H8EA 1K6EA 2AX3A 3IFSA 3ME5A 4U2CA 2BFOA 5IBQA 1RLUA 1AN0A 1HE1C 1E3SA 5CBPB 3VKWA 4LF8B 3SC2B 1U9IA 2P5SA 2J0UB 1RKVA 1W4BA 2O2SA 3FNIA 4KBYA 5CDFE 2YFHA 4CF4A 5JMTA 5F2OA 3EWAA 3CW9A 5G4LA 3X2SA 3EX7C 1NOKA 3L8YA 1QBKC 3T7RA 4FFSA 5FOVA 1P8AA 2D00A 5AI5A 2DBYA 1G4UR 3QP9A 1D2CA 4ZCSA 4HRVA 2O3QA 2QZ9A 3TINA 5MFPA 1D1QA 4KO1S 2W6QA 2OORC 2W6ZA 2LDXA 1X74A 4RTOA 4YRFA 3ABSB 1BTOA 3JW8A 4Q4AA 4NATA 5TE9A 2OLKA 2GWHA 4BGDA 1J42A 1OFHA 3EZLA 3I6IA 1TC2A 5ENZA 4LJ5A 1C7FA 4OVKA 2AFHA 1F0YA 3EOBI 2PNJA 2UUAB 3H4IA 3RDPA 2JL1A 3MPOA 1KEPA 3RSFA 4R3UC 4TLMB 4P86A 2QD2A 5KBYA 1KYZA 4O0MA 5IFKA 4RNDB 1ML3A 2FSFA 4V0SA 2XZOA 2WYWA 3GJ5A 4TWRA 2QYSA 2BKXA 4FR0A 4WLVA 2AUMA 3GFGA 1ORRA 3MOIA 1NQVA 4X3OA 1EGVB 2GASA 4UTOA 1CUDA 1P2TA 1VKNA 3KYBA 2IHZA 4KR9A 4QWWA 1C0LA 2YV2A 5I7WA 1N2BA 2ECOA 3HYTA 4HEHA 4HDCA 4JASB 4QDXA 4Z9BA 5HYVA 3GOQA 3K4HA 5KX5F 2NGRA 3HCOA 4HDSB 2G04A 1EDOA 2KYRA 1SZCA 2BCEA 5D3MB 5HIKA 4YAGA 1KYVA 4H7FA 4F86A 1S02A 3ND5A 3AESB 2NO5A 1L4FA 1NW8A 1J5XA 1T8TA 1DPFA 1JXQA 3QU4A 4JUIA 1QC5B 5FWXA 2IU6A 2DR2A 3TLXA 3GX1A 3ISVA 1I7QB 1AO3A 1QAMA 1AC5A 1TEVA 2OA0A 2YZGA 3U4IA 2I6UA 4AKGA 4R8SA 1EVEA 1XE3A 5FA6A 1DC3A 4J91A 3GEHA 2FZ4A 4EENA 2O2DA 4UHHA 3WGOA 2XRMA 1L5NA 4QPPA 1WXEA 2E37A 3Q85A 5CYFA 3T3IA 3SICE 1EWVA 5CDYA 1TCBA 1PR6A 2AB0A 1EKXA 2EFCB 3OSUA 4HGRA 3UM9A 4YRAA 3KG2A 2HMAA 4GMHA 1JI0A 1VE9A 1JB9A 1T35A 3NXKA 2HF8A 1VECA 2B4TO 1KDZA 5ESXA 1CUFA 4M7OA 2QLFA 3I4LA 3IBYA 4R3NA 4H7IA 2HD4A 4UAUA 5DMXA 4LKRA 1JNXX 3SZMA 4GMGA 4YP0A 1GZDA 1YV9A 3Q7PA 4B80A 3KSAC 2JI6A 1TVCA 2NO4A 3EODA 1EFVA 4U2KA 4Z4IA 2FEAA 3CZ5A 5KSYA 1ATZA 1ZGZA 2RH8A 1L7PA 5ICSA 4UE3S 4GR9A 3NGLA 5EZ5A 3ZEAA 3Q8MA 1DKUA 1QHEA 2JKVA 3A9CA 3ZNOA 2IHBA 2WQ6A 1FP1D 1SA0A 1KH3A 1XZFA 2UZ1B 4JELA 4R1OA 4BFLA 5BWBA 1U8ZA 2X3YA 4UUQA 3OIUA 3ZKWA 2AOWA 5A9SB 1DPGA 3KPWA 2IYUA 1OTHA 4RMIA 4O6VA 3DB2A 4YPFA 3SKYA 1NN0A 2BZ0A 2BTOA 4RM2A 3AXSA 3ZLJA 3LY9A 4ILEA 4DR7B 2PZLA 3DUWA 1BJTA 4Y6QA 3V1NA 3AR4A 2WHEA 1DTWA 1D4OA 5ALDA 1QQ6A 3UT6A 4CN8A 1DX6A 3RCBA 1M83A 3L06A 5H83A 4HLUC 2FMUA 4YACA 1G9XA 1RWNA 2IZ7A 3MSCA 4MHOA 2FRDA 4Q82A 1R0YA 3RS0A 5I7EA 4LXUA 4NZMA 3O47A 1SEVA 4C0QC 4HDMB 1HT2E 4MW9A 3T4EA 4XWKA 2WZQA 5AESA 2V03A 3WIDA 2XOXA 4V24A 5A7HA 1TA0A 2PV7A 1UPAA 4B0PA 1VPVA 4YMIA 3A4NA 2D5LA 4M1SA 2CHGA 4YCJA 4HNAB 1TGYA 3GLKA 4CEHA 4LQLA 1VI2A 3OEED 1VL6A 1CD5A 1BE0A 1S3SA 3BA6A 4R8LA 3QKIA 1H85A 5DV9A 2Z4TA 2Q62A 4M49A 3VHLB 1J9EA 1QRSA 3M4XA 3VU9A 2RGDA 8ATCA 4TWZA 4DSAA 6LDHA 3TLAA 4UUPA 2E4XA 5K8IA 1VOTA 2W4QA 4IV8A 5C4GB 5JI3E 4HXYA 2DOKA 5D00A 2Z9BA 2XMDA 1NN3A 3T5PA 1JV2B 4D0SA 3LLCA 3VYSB 2EXXA 4TMWA 4BE7B 2GVNA 4X8OA 4MVJA 3WICA 2LR0A 5KYKA 4GUDA 3LBHA 3AEKA 1V3UA 4EM6A 1S2GA 3OPQA 1CY8A 4E5MA 4OYYA 4MINA 4EJ2A 1UT8A 2G4CA 1JNYA 1ZC3A 2UUPA 4KIWA 2AQHA 3GMTA 5ALFA 1U2PA 3TKYA 4GMKA 2IDJA 3VPDA 3GGPA 1HOXA 1OX5A 2XNKA 1MABA 3SG0A 1J39A 4Q3BA 1G6OA 4YRTA 2C04A 2JFWA 2O2HA 3V34A 3DBIA 1QQTA 2MU1A 3GLQA 3JQ9A 5D8DA 5EE3A 4RK4A 5JANA 2GYYA 1IUPA 3OQJA 4Y2HA 3VHRA 4PLWA 3SK0A 4A0QA 3WA6A 2YJ3A 3OCVA 3B78A 2J5XA 1EZ1A 2ZSDA 5CURA 4DL9A 2CV1A 1QLWA 5CJJA 3R8XA 3WLEA 4CL3A 3COPA 3Q2OA 4WNYA 1UWCA 4EUEA 2HK8A 1SXQA 2PSJA 3NDBB 4CLOA 1F7UA 4N82A 1IVSA 1SBCA 2YY6A 2CMKA 1UJ5A 3CEMA 1NONA 2W0MA 5IF3A 2CLMB 3QKWA 1HT1E 4J4HA 4D9MA 2EKBA 4I6JA 3DNFA 5D5HA 3ZJ5A 3WLKX 1ORHA 1RXSA 1SVLA 2QQ0A 3HKCA 4KLAA 4A10A 3LW7A 1BDIA 1NG1A 1E0JA 2W6CX 4KHPB 1RPZA 1QUEA 1LD3A 2XGSA 1DIRA 3ZGYA 1YB1A 1CJVC 1NUQA 3DVSX 5B3KA 3ZI4A 5JVDB 4Q4LA 3OZUA 1VYUA 2PZ8A 4GYKA 2BGUA 4Y1EA 4YUWA 4TV8B 1GPMA 1PJSA 1N5JA 2AKYA 1JDZA 3D43A 3UQZA 5H9WA 1THMA 1CYEA 5DN9A 4NBKA 1ZCZA 1NBIA 3C70A 1R6AA 2NO0A 1M34B 5DIZA 5MF6A 2DQKA 4K05A 4M76B 4RTRA 2IS1A 2EKQA 3SXUB 1XELA 2A5LA 1TD9A 1USUA 1PR9A 1C1DA 2GN9A 2O07A 4KQEA 2CB9A 2D7CA 3C3DA 3JVVA 3OX4A 1SQSA 3PWSA 4JLAA 1SBZA 4OIMA 3CEHA 4YYEA 4YYZA 5BQFA 5LP6A 1O6FA 2ZCJA 4LRUA 3O0DA 4E2ZA 3WGNA 3E9MA 1UP4A 1TYAE 1YZTA 3GYBA 3QUTA 3P2MA 4LJKA 4OF4A 1N4AA 2YYAA 3ZEIA 3L9WA 4RCYA 3OEWA 4IDHA 5JQGA 3NCTA 2HSDA 4QGBA 3SE7A 2WJHA 4DUPA 4OYHA 3UOWA 2G1JA 1QIMA 2GFQA 3WLIA 2WJ3A 4RIIA 5JRDS 1GGNA 1QYIA 2GPNA 3QOFA 2ZZMA 2HFJA 3UAVA 3FYTA 1JEYB 3HP4A 1XKTA 3NTVA 1XP8A 3OFVA 3Q8XB 1A9SA 3D7MA 2YHBA 3D6AA 3QXCA 4GYJA 4F56A 3JD4A 1T1IA 2O7SA 1TTPB 3KLNA 3NFRA 2Y0PA 1M73E 1RQXA 1WPQA 3BVPA 1MORA 3M70A 2IHVA 1QMGA 4Q3CA 5CUQA 2G1UA 4D9EA 3FNRA 2QGFA 1Q7RA 2ID7A 1Z13A 1RYHA 2GPWA 2JGIA 3LPLA 4FPXA 4QU8A 4UEQA 1JT9A 4CMAA 2CYAA 2IZOA 2R6ZA 4DCUA 4YX9A 1TZ2A 3EXG2 1Q0PA 4NYMQ 1SIBE 3L41A 4NBVA 2I2CA 4DIFA 2WJ4A 3F3KA 4BX3A 1QK3A 3GDHA 4RY0A 4RPCA 2H0QA 1TJ4A 2EHJA 3F7OA 1QXSA 5JD3A 3I76A 1N5OX 4M3NA 4YLYA 2J5KA 3QVJA 4L8YA 2X9VA 1FMTA 1XXLA 1B15A 3N8IA 3FMIA 3OWHA 3FJYA 1BXGB 4M0FA 4YNBA 3BIWA 3NBMA 1DJMA 5A5FA 2Y76A 3REOA 4TTQA 3UK6A 2NV0A 4IZHA 2HB6A 2QRVA 2QT0A 2RHBA 3DOUA 3NYWA 1MKYA 3I64A 3TCXB 1V45E 3MTIA 2WHXA 3JX9A 1DQYA 1XA4A 2VIIA 1FFSA 3A05A 5AI6A 4B3CA 3CVYA 2ETXA 4JYCA 3T06B 3IXLA 4XGNA 2OFPA 2GUGA 2AFHE 3UB4A 1SXPA 2QTCA 4JLNA 4QDTA 2XUOA 4QM6A 1FLDA 1A9PA 1TU4A 4DSOA 2EJUA 1Z06A 2PFSA 1ADCA 2QRHA 2AZ4A 3O4JA 3PJFA 1Z88A 1IZ7A 2V3CC 5AVVA 3ZJTA 1YB5A 4AQ7A 3FVTA 1M0SA 3L4EA 3FUXA 3AWIA 3ESQA 1U1EA 2FN3A 1AHHA 1E3DA 3K94A 3S1LA 2XD9A 3RHSA 4ZVMA 2NV2B 4MR8B 3B13B 4UZSA 3RVBA 2GBCA 2DFNA 1FL9A 2WV7A 2LCFA 4AUEA 1EFPB 1FFYA 1W0KA 4B2IA 2QL5A 1O95A 4NJMB 4II2A 1RS0A 1CWUA 2AZXA 2V7BA 1I2MA 1X42A 3R6LA 2BW0A 2EYQA 3RWBA 2XEXA 4N3NA 1SU8A 1O4WA 2J3EA 3EW9A 4LOAA 1J0EA 5L3RA 1T29A 2Q29A 1TMKA 5LKAA 2M1ZA 3W5BA 1CDDA 3CLRD 3X1WA 2CNLA 3FCUB 3C6BA 4BNUA 3ZH9B 3R5TA 1SFRA 2MSWA 4CG0A 2EW1A 1KSHA 1U0TA 1VJCA 3BIOA 2YJGA 1EE1A 3HKDA 3BK2A 4KWIA 4LSZA 5JE8A 2Q7DA 1JVSA 4BQIA 4LFBB 3AKDA 4Q9AA 3LBIA 2GLUA 4CQMB 3TTSA 5HZKA 1RI4A 2NSYA 3HKBB 3MBOA 4I19A 4NC9A 5EQFA 2VSXA 4F7DA 4AI6A 4DR2B 1E2UA 5JC1A 5E0OA 1K92A 2AT1A 2XGJA 2IH2A 1K6MA 1XWIA 1QUFA 1ZXXA 4H1UA 4ND1A 5K9ZA 3DJFA 4DXHA 1YWGO 3TIFA 2I6SA 2HHJA 2VNSA 3KUUA 3E81A 3ZVKA 1X70A 2J41A 2PFKA 4JWTA 4L5YA 1DO2A 4MMZB 1OWMA 2QMQA 4Z4EA 2Q9AA 1BH2A 1K06A 4CUJA 3WWOA 5T3UA 2NPIA 1BKDR 3STVA 3CUSA 1B23P 4KCGA 2HAEA 3C87A 3KQKA 3ZUGA 3SZGA 1JR3D 2Q7OE 1RWWA 1N2EA 3I2FA 1XTUA 4CPDA 3BN3A 1YS1X 1UQRA 2PLRA 1DBPA 4IIEA 3PWZA 1I4TD 3IV6A 5G4KB 2I5PO 4HQFA 1IULA 3VGPA 5BV1A 2P68A 4LJYA 3M34A 2P7HA 4X93A 3UCXA 3OO0A 3PQ8A 1NQTA 4LGVA 4DCTA 3P5SA 1ACJA 4ODIA 4PIVA 1RKXA 1JLLB 1P44A 2JFXA 1KZYC 4V38A 1RLTA 4E70A 3HTXA 1RHKA 2GKOA 4XTRA 3W6PA 1ILWA 1NVFA 1E61A 2F3UA 3OX2A 5GM1A 2H48A 3N05A 5HKAA 1P7CA 1GPLA 1KGSA 2JCVA 1OBHA 1PUJA 1UK6A 4AKTA 1DXHA 1YRLA 4ZZIA 3PFBA 4R9UC 3C6YA 2E4ZA 4C22A 1TRKA 5DJ5A 3Q7RA 1PDOA 3VO9A 3TWOA 4HV4A 1E2PA 2P65A 3EMDA 1KU0A 2WPDD 3TDKA 2O7RA 1AUVA 2FFBA 4ZVKA 3A1SA 3MTEA 3ZZ0A 1UBNA 4RA9B 4AROA 4Q66C 1LDYA 2RDMA 2YJTD 3QX7A 3OI7A 4K5QA 1F1JA 3T4UA 3LC7O 3DF9A 3L5OA 2P9ZA 1XVTA 2OAQ1 1P31A 4Q1AA 5BQPA 2WR8A 3CX4A 4V03A 5IHPA 3P9PA 5TS3A 4Y1GA 5A06A 1NI4B 2ADMA 4JMPA 4DJFC 3M2TA 4FXOA 1GTRA 3RK4A 5I3CA 3EGWA 4UU0A 2WJJA 1VIVA 4BNXA 1W2GA 3IAXA 3MYYA 3WB9A 4MVJE 4TWJA 4I4TA 4M8NE 2OHVA 2ZWAA 3ZUPA 2FPGB 2X2PA 5ECDA 1CLUA 2O8EA 1G5RA 4HWTA 2DLDA 4CM4B 2ZOSA 4KFUA 4AULA 1U2EA 5LQSA 3R0XA 1QIIA 4AMVA 4JVMA 3L2OB 1T0HB 5CT6A 3ZV3A 4DMUB 1OY1A 1I2CA 1E9CA 2ZTUA 3ETNA 4HNGA 2UUOA 3BCUA 2QX4A 1V16A 2J85A 2WWGA 1CUVA 2M6KA 4BGIA 5FOWA 2OVBA 4XUCA 2OB2A 3WIBA 1TUEA 2C20