4KC0A

Msting
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
185
structure length
182
Chain Sequence
LNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stimulator of interferon genes protein
publication title Novel c-di-GMP recognition modes of the mouse innate immune adaptor protein STING
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 53
structure length 182
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kc0A02
4F9GA 4F9EA 4QXQA 4JC5A 4F5YA 4LOKA 4KC0A 4LOJA 4EMUA 5CFRA 4YP1A 5CFQA 5CFMA 4QXOA 4EMTA 4QXPA 4LOHA 4QXRA 5CFLA 4F5DA 4F5EA 4EF4A 4F5WA 5CFPA 5CFOA 4LOLA 4KSYA 5CFNA 4LOIA 5BQXA 4KBYA 4EF5A
chains in the Genus database with same CATH superfamily
2BFNA 3T7RA 2EC5A 3KS9A 4IQ4A 5KCZA 3FUXA 4DSAA 2WW8A 1M7GA 3RSHA 4F5YA 1WKCA 1EUDB 2G4CA 3DFFA 4D0GA 4IEFB 3H4VA 1D5WA 4LC0A 1WU7A 4EGFA 4E7PA 3K0HA 1W88B 3B8HA 5FDFA 4GM0A 4RGQA 3MTBA 4D0NA 4DBLE 2D54A 4QXMA 1Q74A 3O9VA 1Z6PA 4RNDB 5H68A 3ZW8A 4PGAA 3A9RA 5I9NA 3BX1A 3AFNA 1DG1G 2Z2JA 3F9CA 1Y0BA 3GAMA 1FRZA 3BMQB 3JQBA 3PA8A 4ER7A 4QHYA 3CUVA 5CFNA 4WLEA 2WD7B 2Q8NA 4JQOA 4D43A 4FDAA 2WJYA 3FDFA 4O0LA 5G3ZA 3BORA 1II8B 4GPIB 5B1EA 4LCEA 2G9RA 4RHUA 1F2UB 1UC8A 3N2EA 5J4HA 1O97D 4AS1A 4WZAE 3GGPA 1CRPA 1U1CA 1ISRA 1XI2A 5EHIA 1V37A 2AZXA 3TZ6A 4RM2A 2GYUA 4DFDA 3ISTA 4HB3A 3ZV3A 1G3MA 4G41A 1YZFA 3OE4A 4EITA 2NO0A 2Q3DA 3BK1A 5T6MA 3WSWA 2HYIC 1LW6E 1BFKA 1WCXA 5BMVB 3DAPA 3LFUA 3PJFA 2GNOA 3K5WA 3EXIA 2P78A 2C88A 4V1CB 1Q3HA 1BZYA 1OBVA 1Z17A 4E31A 2CL5A 1J21A 2B5VA 2WU8A 3N8NA 2C3UA 3MMZA 5CRIA 5KYUB 3SVLA 1CS4C 4LMRA 4V0ME 4PF1A 4Y0NA 4V0MA 2VBGA 4UARA 4QU8A 1LJUA 4H0NA 3RU7A 3WGGA 3EASA 1I7NA 4NG4A 5A5VA 4G9BA 1E9EA 4ASUA 2X8LA 3VVLA 3WWDA 2Q5IA 1Q17A 3Q0IA 1DEOA 4LG1A 1ML3A 5K20A 3EIXA 1GV1A 2FWJA 3ZHOA 1T9GS 3PITA 1ZC4A 3L7IA 5F23A 5PNTA 4EQ6B 1V8PA 4YBRA 4JHLA 3SC2B 3R5HA 2JAHA 1P4JA 5CA0A 3DW1X 2UYHA 2UYQA 4HVAA 4U8HA 5E7QA 4BCCA 1HE2A 2WFMA 1IRIA 3BXOA 3G2PA 4KBFA 4QPNA 1F0NA 1KOLA 4CHTA 3ZKWA 1F5NA 4CIYA 1DGQA 1E6UA 4Y1RB 4C7OB 3KXLA 4CUJA 1OA0A 1OH6A 2Y6VA 2QT9A 3E9EA 3GBVA 4JCOA 3RS0A 1ILEA 4WKNA 4E7OA 3H05A 3W2GA 1GZSA 2W22A 4II7A 3UXEA 2FQQA 1IN4A 3TD2A 3A2MA 5K0NA 4GE0A 2A59A 1ENZA 3GJXC 5DNAA 4E33A 1AIPA 2R6GA 4IV5A 2YIMA 4P3NA 4LPSA 1A04A 4QJIA 1X13A 3UAXA 1IG0A 1M8FA 1VKNA 5GOZA 4R1MA 1JQKA 3C4JA 4BFCA 1QPGA 5EIHA 3KELA 1FA9A 5A2QA 3ROGA 3BZWA 1RM5A 3DLIA 3MWEB 4P38A 4TL7A 5JMTA 2DULA 1E5QA 5DIZA 5B3JA 3VQTA 3WNZA 3ZW7A 4ENTA 3ZYCA 4XGRA 5DYIA 4TV8B 2MSNA 2P69A 1L8XA 3COPA 2P62A 3HJTA 3OZTA 4FYHA 4R54A 4AZ0B 3SVTA 2J0SA 2EHJA 3MGCA 4Q82A 2FMUA 1L5ZA 1VG9B 3CG4A 3ZJ4A 1ZGJA 2RBKA 4KDRA 3IAS6 2IYWA 1IHXA 4GX2A 1PI3A 5HR5A 1AK1A 1OIXA 2IOHA 1G98A 1PYOA 1P4GA 2OMEA 4WLFA 5NULA 4UEWA 3A06A 2PH1A 3CISA 2CV0A 1YZLA 2ZTHA 2VNAA 4TM7A 4DNFA 4K1LA 5CDGA 1GEGA 2DQSA 1AQ6A 4WESB 4KIWA 4CFZA 3PLAE 1YULA 5K3SA 1PR0A 2IF0A 3GJ0A 1Z7WA 3IOCA 1H93A 4QULA 2QQ0A 2W2PA 1ZH8A 4P4SA 1C7ZA 3VYRB 4JY7A 2HK8A 4KQGA 3WB0A 1L4YA 4G0MA 1W94A 5EYPA 3TZBA 3UAZA 5BN1A 4BTVA 2NU7A 3B1XA 3P20A 4UNSA 1W19A 1IJFA 3CRQA 3W9SA 2XF8A 3LGXA 4ZQFA 1OV6A 3BGOS 1ENPA 4B2LA 1UAAA 1GARA 1SURA 5F35A 3PFNA 3ELDA 1ISGA 3D3JA 3A9SA 4DY4A 4PHTA 2VHYA 5AW8A 4K6FA 3N59A 3CUKA 1B15A 5AKJA 2DTEA 4H4CA 5FD8A 3ICOA 3C98A 4NV3A 4L3OA 3HKCB 5EUCA 3INNA 4U63A 2CJFA 4DMLA 4EFKA 4EMSA 4HNUA 3THXA 2OFPA 5JJIA 4LA4A 5IW8A 2OWDA 2AFIE 2GCGA 2GZ3A 4M0CA 1P4AA 2NADA 1C29B 1CRQA 3TCNA 5DN6D 2AFIA 2NIPA 2HU7A 4ZOLB 1RCUA 3AR5A 5K0JA 1KEPA 5EKSA 4LOKA 2JIMA 4B7CA 4TX1A 4LWZA 2XNJA 4DR4B 3JYHA 1ETHA 1LA2A 2VHXA 2PLAA 4BNJA 2IYXA 4KGVA 3IVGA 1Y3HA 2B8WA 3GJ6A 4F4DA 5AJYA 4C7BA 1UQUA 2AJBA 3MSXA 4B3JA 1IBMB 1TCBA 1D5CA 2AKEA 4YEDA 1JAHA 1DFGA 2X0RA 2Z2ZA 3B8EA 1R4AA 3OTGA 5B1IA 4O29A 5J3JA 4IRMA 2JAWA 1XZEA 3L7LA 5REQB 3W77A 5EKTA 4FW9A 1Y5RA 5C4IA 3B6KA 3I76A 3AHDA 2EP7A 4G07A 1UBTS 1QYCA 1XR3A 3NNSA 3ZWKA 4UHEA 5GADl 3MJRA 1U0NA 3MS7A 4HN9A 3LY7A 4J0EA 2TMGA 1IU9A 1KKLA 3AEYA 2OBBA 3DCJA 4TL9A 1RQRA 3W90A 3I01A 3AYZB 1QU2A 3K09A 4IJVA 4ZJUA 1CK4A 1SU4A 4LZJA 1N2BA 3LPAA 3VSBA 5L3ZA 4I4TB 3R9WA 1OGYA 2YV1A 3NWEA 2YDYA 3RGGA 3QTBA 1MJ5A 1N3IA 3TNJA 2ALJA 3T3OA 2KBFA 1PFVA 2WE7A 4B09A 4QM6A 1AQYA 4LJSA 3KEGA 4WOPA 4AM8A 4BHTA 1FDRA 3COSA 5HOEA 1YDEA 1M2GA 1OCEA 4TXJA 2J6IA 1HDXA 3R3ZA 1U2SA 1AQIA 4CT5A 4UOQA 3DMRA 3TUJC 4AP5A 1JH9A 1Q91A 4JJZA 3KPYA 3ESAA 3WIDA 3PQ6A 1JJFA 4QDJA 1UZLA 2IL1A 5AVWA 2BCGY 4MWTA 4ND4A 4C2UA 2PO7A 1L5MA 1TIKA 4Z7JA 1HFJA 3B6ZA 2XI4A 3TGLA 3WYEA 2FXIA 1Y6JA 2ZRLA 1V9CA 3IOMA 4M0MA 3SJAA 1E6LA 1M75A 1C3VA 1J20A 1OUMA 1Z26A 3FWKA 4JJGA 2RH4A 1ZOLA 4X9XA 4MKZA 1TX4B 1JUDA 2ZSUA 3T4PA 3MXTA 2NUPA 1GQQA 3TB4A 2BH2A 4XPZA 4RTRA 1QTNA 1QV9A 5AKGA 4O3FA 3OD5A 4JOCA 1D7OA 3HCNA 3HZZA 4F56A 4I2NA 2YMQA 3RIGA 3ZDXB 2ZZNA 4I1YA 1RYEA 3C5WP 3CMMA 3OG9A 2F1KA 2JFHA 3O8LA 4BP1A 2LDBA 2ZR9A 2DGDA 1JLHA 1XZGA 3GRUA 1PG5A 2R4QA 2XE4A 3CY6A 2Y0EA 4KSCA 5EZYB 4NAVA 4X62B 4FYWA 2ZJ0A 4UBKA 2H2GA 1H66A 1FSSA 4QOEA 3U5ZB 3E3AA 1U3DA 4OHYA 2O7QA 3COWA 4EW1A 1BH2A 1YCHA 4V1CA 1DUSA 2VYND 2HHLA 1V8DA 2JFXA 3FPKA 2FSVA 3IMKA 1GN8A 3KUDA 2FYTA 3O95A 5HMLA 3VUEA 3VX4A 8ABPA 5HSGA 2X7HA 3PGVA 3ZS9A 2N42A 3QNUA 1Z4JA 3LA6A 5FX2A 5J43A 1K8YB 3MWFA 3U31A 1IN5A 3H7AA 1CUVA 3NUQA 2X4IA 2NU6A 1NC1A 5DX1A 5BWCA 4IVNA 2B82A 4JL8A 3A7DA 2R6AA 3HS3A 4J90A 2ZK7A 2F6RA 5B7GA 1HYHA 1ZJJA 1SB9A 4H60A 5FBZA 3GGOA 4I1VA 2VO1A 4CF3A 2VKTA 4BMVA 4P3KA 3DOJA 4GZ5A 4ZCIA 4WCFB 1YB2A 2GCPA 4EQ6A 3OUUA 1KHHA 3TO5A 4YIKA 3FTNA 2HN9A 3OEHD 2PGAA 1XTIA 3H2JA 1Y4SA 5CFLA 3ONFA 2ZE5A 5EMMA 4L8GA 2BGTA 2C8KA 4IIJF 4WK2B 4QT4A 5JYEA 3NTUA 3VU8A 4ACAA 2FK7A 5G4KA 1VHWA 3RVMA 4PSUA 4RXTA 1N3LA 2HJGA 1ZGBA 3ND8A 1SKMA 4MV7A 3G2OA 2JD1A 2VHEA 3GFQA 1FYDA 4GWKA 2XA1A 5LMCA 3DG9A 1WABA 2HF7A 3AESA 4L0DA 4UUPA 4NVRA 4F6CA 4M1MA 4G2TA 1DAMA 1CZNA 1EVZA 4QAQA 2XMDA 4LGVA 5CLIA 3KQWA 4MUFA 1QZZA 1Z2AA 4QOSA 3R8XA 1XA3A 3PEUA 3RVPA 2BF7A 4V03A 2OXTA 2OBLA 4CEIA 4YP1A 2PZEA 3AHJA 5GJWC 2NXJA 3MWEA 1MO3A 1JA0A 1VMAA 1LTKA 2O1XA 3E22B 2FQXA 2V96A 1P1JA 2AFHB 4I5GA 1SR8A 2HI0A 2MYPA 2VJOA 2J3QA 3OKAA 1U2DA 4PGFA 1QF6A 1ESDA 2IVZA 3IA7A 4HLDA 1TYEB 4G0OA 4KXVA 4C5BA 5CA1B 1J2EA 4XZ3A 2FWAA 2OHOA 5CGQB 1SHTX 3F8TA 3DAYA 3WKAA 1WDWB 2AD5A 1KAHA 1UZMA 5EKUA 3BSSA 2I2WA 4CMEC 4XDYA 3SJZA 5EMHA 5A0TA 3UWMA 1A9RA 1OI3A 5C8YA 1T1IA 1RC8A 3TXXA 1U6IA 7AT1A 3C7TA 3GOQA 3L7KA 3CRZA 3O8CA 1NVUQ 7REQA 2H07A 5I7RA 4JC0A 3MBOA 1YVRA 1ZK0A 1OROA 1P80A 3BB4A 4W7IA 5NLLA 1PZMA 3A4TA 4YALA 5KDOA 3JPYA 1Z6AA 2AMYA 1A8IA 1SOWA 2A8YA 1G16A 4EO7A 1ZMRA 3SSAA 3DJYA 4UVDA 4KPEC 1VPWA 2JD2A 1XVAA 4RM3A 3AB7A 5JHGB 2JGRA 3ZX4A 4MI3A 2WV9A 3KETA 4ETWA 4LOIA 1EWTA 2PKQO 4KW7A 1HYEA 3BRWA 3PVZA 4MITA 5MN6A 3BXFA 2UXCB 2EQ5A 2ZBUA 3GEEA 4L4UA 3GLGB 1M8GA 1BW9A 3AM1A 1F60A 1EJ2A 1PWYE 4QU0A 3PGXA 3R0VA 3RVOA 3PNKA 4BVBA 2MYNA 3D2AA 3LIIA 4GVXA 4XXHA 5CCBA 1XZQA 1IEVA 1X0VA 2WIBA 1FTSA 1NDUA 2F1HA 2H3HA 1WUJS 1XZCA 1U90A 1FFEA 2BKUA 3V2UA 3OWOA 4KV7A 2GVNA 5MGBA 1GWNA 1E3QA 1KMIY 4M1KA 4RJLA 5CD9A 1X74A 4B7ZA 2VP5A 4PFKA 2BSQA 4IBOA 1E2HA 1W581 1WY5A 4O33A 2O5VA 1OX6A 3ABRB 3T1TA 3RARA 2J6CA 4AS3A 4BX8A 5AIBA 5ICFA 2XUJA 2NTYC 5D3ZA 4JDPA 4UMDA 5FAXA 4LI0A 1B6RA 5GVSA 5I7UA 3B36A 3WLLA 2N75A 5E2AA 3WDKA 3DC7A 1H1LA 4P92A 2KW5A 1OLUA 3V97A 2AFRA 4M9XA 3WBFA 3KJXA 2ZJOA 1R5JA 2GCIA 1GG9A 3VFDA 2PRKA 1I9GA 4TUYF 3ZGOA 4OYRA 3MILA 4EBFA 4YRBA 2MINA 4XIYA 2G07A 2HSJA 1DKUA 1NDHA 2QN6A 1R8XA 1NAIA 1JJ7A 4JLOA 5B30A 1X7ZB 2CXTA 5TV2A 3KTOA 1SHKA 4PGHA 4U2DA 5AVZA 3KPWA 1BXRA 3B38A 3VJKA 3DVAA 1CP3A 1UP6A 2HAEA 5E9QA 1LZLA 1TT5B 3KM0A 3HRIA 3RYHA 4B45A 4TVSA 2DMRA 3AR7A 3I6QA 3PWZA 2QLNA 2HF9A 3F2IA 3UJCA 4I4TA 2FPMA 2WYVA 3BWEA 5KTSA 1P18A 2JJ1A 4AECA 1XXHB 1Z8DA 1YA4A 2C2YA 2WFAA 5KX5F 1U02A 3R41A 3ZE1B 2YXDA 2ZU0C 4R6WA 2OVFA 3WWYA 1AUXA 4CW7A 1NXVA 4J3NA 1ODKA 3HQ4O 2QW0X 3MQ4A 1VCNA 1T0JB 4Q4JB 3A28A 2BJVA 3DBLB 4LKOA 4ZK6A 2R8EA 2ZI9A 3KQQA 1JFTA 2FDXA 3W3AH 4B4DA 1Y8AA 1DHRA 4KVFA 3CSSA 4JLJA 2Q0QA 4ZAZA 4KLZA 4BNTA 1YDHA 3CG0A 5IS2A 4DV1B 1PG0A 4US2R 4COOA 3IA2A 4HB0A 3BTOA 1Z6QA 2JK1A 4RVSA 1FMLA 4MP6A 5JTUA 3KVOA 1AKEA 1OKKA 4UBJA 2VDMB 3NONA 3REGA 2BYTA 5C4GB 2X0EA 3QP9A 3ESYA 1LBIA 2G1KA 4RW0A 1CNFA 3IIEA 1RAGA 3BL8A 4ILEA 1XCGB 3OX2A 4D6XA 5L3SA 2VDLB 3JQ9A 1T8WA 1MJHA 5C80A 3GP8A 2AW3A 1SZDA 1U9IC 3QEMA 3UT5B 4JI6B 2O8FA 2E89A 2P6UA 3OJLA 2AF3C 2A84A 4C2BA 1JDVA 1WVGA 1VSVA 3IGFA 1PGQA 1YQXA 2ZU6A 3L6DA 4B80A 1H2XA 2XZTA 3FBTA 3N8GA 3FLAA 2FWPA 3D8SA 4L4SA 5JRZA 4G8CA 4NV0A 2JLYA 4BPBA 2ECQA 1FUKA 1UBSB 5COBA 1B16A 1CZLA 3NDJA 2QLFA 1FRVA 3KWJA 3IDAA 4NOKA 2NTVA 3A31A 4JT9A 4QQNA 1RLMA 4QXAA 2QAJA 1Y9ZA 4GOOD 5LBIA 4OK5A 3VYTB 5BT9A 3D81A 4N0PA 2PT6A 4G97A 3ZHBA 4MYDA 3C3DA 4IIUA 1L6IA 2IE0A 3MWLA 4Q21A 3W5DA 5JANA 1HPLA 3JQRA 4J16C 3DC2A 1S6YA 1R0YA 4KGXA 4P4NA 4DPLA 3CRMA 1FQKA 4WK6A 4UNRA 4TYNA 2C2HA 2LVBA 4LY6A 4MUYA 4MV4A 2PPVA 3A6JA 4EB6A 3B70A 4JHXA 3JAMA 3W8DA 1GRNA 1W1IA 5CVJA 5L4NA 2ATVA 2V5AA 1R0LA 3PCXA 4KQEA 1QUEA 3G9QA 1NQVA 2PYZA 1ZY2A 4H15A 4WZBB 4HSEA 4HNVA 2YYSA 1XCBA 3AEUA 5IJXA 3HCRA 4ZFNA 3EXHC 2Z1MA 3JQ7B 1X8JA 4JB3A 3LQRA 1U94A 5DM2A 1GKIA 2O1SA 4F71A 4BE4A 2QLJA 1SB8A 2OBXA 2HK9A 3BH7A 3LOQA 3V3KA 4EARA 4CETA 1VMIA 4ESHA 4JI0B 1EAYA 2YJNA 2P2SA 1RCTE 4HHEA 4FILA 4ZRDA 3JW8A 1AGPA 5C3MA 3LNCA 5BNZA 1BQEA 2ZIAA 1U3UA 5E9WA 2J7PA 2OAP1 1J4AA 4HBZA 4MR9B 3OPVA 2J0UA 4FMCB 2AG8A 1KZ1A 1UBHS 4CLEA 4XW2A 3VOAA 4BNFA 2RIPA 1I4OA 2IYSA 2OPBA 2XOEA 4FOOA 4H7HA 1TK2A 2XVYA 4LJAA 3JQ8B 3GLIA 4LECA 1A71A 4Q7EA 4IS3A 5HKBA 3C4QA 3V32A 5IVHA 3JASA 3PR2B 4BNDA 1P3JA 5ILGA 4R68A 2FVYA 4KFSA 2BMAA 2O05A 5ECGC 1T8UA 4MQ4A 4B4UA 3ZHSA 2ID9A 3UHAA 3IT3A 4YDQA 3KLMX 3ZWBA 1YACA 4CEHB 2OXEA 4S35A 2TS1A 5I48A 4A23A 1N8NA 1NQUA 3I8OA 4MMXB 2OHFA 1LQ2A 4OKIA 3PC8A 2GBLC 5A9SA 4FR2A 2EP8A 1TQ8A 3BMCB 3ROQA 1UBOS 1TRHA 2Y93A 2DR2A 3LP6A 5BN4B 3AI7A 4QL3A 3SSOA 2UZAA 5E4YA 1NF2A 3KB8A 3B52X 2J9FB 4G5HA 4BQSA 4CFSA 5T5QA 2WPDA 3DZJA 1AZSC 4XSVA 3IUJA 1GL7A 3DOHA 4KVAA 4MQLA 5JZSA 3W5AA 4G5RA 3TE6A 4UDXX 4K3UA 2QA5A 3I9FA 3BXEA 1F4PA 2IYTA 2X0NA 3CLKA 2IRWA 2XRYA 1KIMA 4HMOA 4TTAA 4X94A 4DSNA 3ILHA 2W2VA 2YWRA 4HNAB 1P1BA 1GYPA 2IP2A 4Y98A 4U2BA 3VU9B 5IDWA 5IUJC 5MN5A 3RODA 2PD4A 5C5CA 4CLRB 1Y80A 3IR7A 1CVIA 4DMFA 5JCPA 4FLEA 3S1AB 1JSZA 3FJYA 1KVSA 1TU3A 1P31A 5KOHB 1HE3A 1KKMA 5DISB 3FPHA 2ZRAA 3CF2A 2WKSA 3SXPA 1LW7A 2DY0A 2FSIA 3ESZA 2RK3A 3HR7A 1QFZA 1GOTA 1G5FA 4ZANA 2WHXA 1JDTA 3A9CA 5GZ6A 4RA9B 2LUOA 3L4BA 3TL3A 2CYAA 2EGUA 1GCUA 3IS3A 1Z06A 4URFA 3L77A 4LSGA 5AM4A 4A73A 2F7SA 2HHAA 4Q9DA 5K99A 2BEVB 1G8HA 1MVOA 2JRCA 2QUHA 3DV2A 1ZCZA 5H16A 3WK8A 1VL1A 3QX3A 2J3DA 1Y7TA 5C1PA 1I24A 1Z18A 2JB9A 1VBKA 3JQFC 4TV9B 4YCDA 3WIOA 1X7DA 1PZXA 3QYPA 2J8ZA 4AF6A 3EXAA 3TB6A 2WZQA 4MB6A 3IAAA 1NZJA 1R4MB 4Q6WA 5CT8A 3OIVA 4RF3A 4B2IA 1F6BA 3P9RA 3MD9A 4KYVA 3SDBA 2BEWA 3CQ9A 3S81A 1OB5A 2R00A 1LEHA 3IDQA 1Z5UA 4MUKA 2I3DA 2QD2A 3P2EA 3AOGA 1C80A 3U16A 1PR4A 3OHMA 2QU8A 4S1OA 4D0LB 2ZJAA 3RG2A 3C7DB 3T95A 2Z9DA 2PA0A 1BWRA 3HLTA 4F06A 1XZNA 1H9AA 1T5SA 5ENDA 1BXGB 4KH0A 1FNSA 1KBZA 2XZLA 1B0PA 3D64A 1WF3A 4JROA 1YFLA 4E0BA 1Y1LA 2EBUA 3V8EA 4K2HA 1P7CA 1KIFA 2C1EA 2DTXA 4FGLA 5G53C 1D2GA 1NF3A 2IXTA 1W4ZA 3O1HB 3DZGA 4JMPA 2Z8XA 3OZFA 3OLYA 2VNJA 1AQNA 3PFGA 3QXJA 1ECJA 4KKXB 4Q4JA 3NT2A 5CH8A 3VZQA 5ALVA 4BX3A 4JC8A 2W6CX 3WWCA 5JQGF 2HSGA 4ZU3A 4DR3B 5L40A 5ITWA 1NNSA 3MJ4A 5EI5A 4BFXA 4HDSA 2J9GA 3KJFA 1PVOA 4OJQA 3IL2A 1OPRA 1HZZA 2MTBA 3NV9A 1ZUNA 3FHOA 3RCBA 2NP7A 3RE1A 3PPVA 3AXTA 4BMYA 1YTUA 1VL2A 3FUCA 2DUUA 2GSWA 5HPYB 1TKCA 4QE3A 3DWEX 3UKOA 4C6TB 1M0SA 5AM1A 3H2IA 2BDUA 1IRXA 3WA6A 4A15A 2C4KA 4G81A 1T4DA 3VTAA 5BSEA 4EEXA 3MINB 4JI3B 4GKAA 4EUFA 3RC2A 1EUCA 5L95A 4NI5A 4PTYA 5AXBA 3ZWOA 1JLSA 4HWOA 4L9RA 4L5BA 4DG9A 3SC6A 3L7OA 5D86A 3JAKB 3SNKA 4EUNA 1Y6ZA 3N0XA 3R7FA 3W1VA 1WBDA 2HIGA 5LCXA 3UMCA 1B3BA 5CT5A 4BB5A 2XTJA 5FOSA 3AB8A 3SEFA 4EJ2A 1NNEA 4OHOA 5I7SA 4Q9LA 2XYVA 1TLLA 4FC7A 5HF5A 3D4IA 3WZMA 1PTJC 1JKMA 1FX0B 1HFWA 1Z62A 2MSCB 2QW1A 3KDSE 3RUFA 2I54A 3IAM6 3EY4A 2NPFA 2BZ1A 3RRMA 1UJ2A 3ZHQA 5DM70 3O47A 2V4ZA 1P6UA 2ZJ2A 3HCFA 2J67A 2DKNA 2H85A 5ESDA 4L4XA 4O4LB 4U2GA 2IPLA 4ND8A 1TTTA 2JCGA 1NSFA 3DT8A 3FDJA 4PY2A 1JR6A 4I5DA 2FEAA 2O3JA 3FPBA 3FGOA 2DBRA 1U98A 1YZQA 1OI2A 3FUWA 4D8UA 1MH9A 5IJ9B 1VZ2A 4JN6B 5B6JA 4C4XA 2YN0A 4M87A 1DUVG 1V0JA 3E2MA 5CAEB 4OP3A 2O2DA 1EP1B 2P8JA 4F84A 2OCPA 3DMTC 1MO5A 1H23A 4J1QA 1JHQA 3DMGA 3KL4A 3NHBA 1HLDA 3T9FA 2B36A 2R8YA 2I3GA 3TQTA 3OUZA 2YWBA 4GT1A 2ZI6A 3RUCA 4E14A 3NVMB 5JD4A 3F67A 2OLJA 3T7JA 5GONF 4Y2TA 3D3NA 2BKLA 1XD2B 2VNIA 5EJ6A 1MX5A 1HY3A 3WNDA 1EVYA 2V3VA 2HRQA 3TW4A 3LHKA 2QX8A 1ISMA 5JH7B 5KJEA 3F5QA 1TKBA 2AXNA 4YO7A 3GEMA 3ICVA 1CUJA 3FGZA 4KL8S 4RQTA 4GPBA 4RZUA 1ZRSA 5DBOA 3V2HA 1H6CA 5IBQA 4ND3A 1KPGA 2YJ6A 4AF8A 1L4MA 1ODSA 5D1NA 4IGIA 4JEMA 3V4SA 4QIHA 3RW9A 4RV4A 3X2EA 4AU1A 1FE8A 1QHXA 1Q1QA 3QVJA 1IOLA 1XDGA 4X8OA 3WQSB 4HNHA 2IS2A 1Q20A 4MW9A 1PSWA 3KV1A 4U2KA 1G6OA 2C4WA 2Z2KA 2FW0A 4NR0A 4NU6A 4LYEA 2L17A 2GFQA 3CLSC 2JGDB 4JOQA 4RJKA 3WGLA 4AG3A 2WKWA 4CL3A 3KBOA 3SZRA 5CA0F 1KJIA 2V1XA 3IV9A 2LIPA 2Y76A 3P97A 2QTBA 3FDZA 2BISA 3VR6A 3A1WA 3AG6A 3WHPA 2G88A 8OHMA 5JCOC 4RIFA 1W1UA 2V6BA 1Q16A 1ADGA 2R6ZA 5C52B 5IVKA 2W2LA 3HFJA 1E7RA 1UK8A 4WMLA 4R1NA 2NUTA 2WF5A 4DQ0A 2BDTA 2VWHA 2QJFA 4MKXA 2A0UA 1E4OA 1CUCA 1M2NA 2QMUA 1H2RS 4TT3A 4X1IB 3ZHZA 3NETA 1SBCA 1DE0A 2J9FA 3O1LA 3ZLVA 3AHEA 1D07A 1ESNA 2HMWA 1ZESA 7ADHA 3HUFA 2CBXA 3HGMA 1U3GA 3FCEA 4EJSC 4UREA 4QVKA 5JY6A 1UPXA 3OZDA 5KWVA 3VVMA 4MIEA 2TECE 1QXSA 1VQ1A 2UVQA 2ZYDA 2RG7A 2OCIA 1I3KA 5KVQA 1G5IA 1TUIA 3WKCA 2Q6LA 3V33A 3DMDA 4S1WA 5EIWA 1E1QA 5F4BA 5A02A 1OMOA 3D2BA 2XBUA 3GZJA 4V38A 2J9YB 2OHVA 2QAGA 1K2WA 2G1JA 1VB3A 4H4DA 4CODB 3I39X 3ZDQA 3EPKA 4R2KA 3GB9A 3H9QA 3PD1A 1G2PA 3L6RA 3WGOA 1VG1A 5FPPA 2FPGB 4ZVSA 3S99A 2CHGA 1PDOA 4TLMB 1T13A 2VCYA 5IAAA 2BMWA 3DBRB 5LU8A 5DPMA 3ZCUA 4U1RA 4MVJI 2DECA 1M67A 2PQ2A 3KIPA 4FNGA 4V0KA 3K3PA 3EF0A 2F90A 4TYPA 3PJRA 2OXFA 3LX8A 3EPJA 4LCBA 4BNNA 2C2OA 4CLDA 1OH7A 1D2HA 4X41A 1OU0A 2F1OA 5DHUA 5KVAA 1E3WA 1U0FA 2YX1A 3RSSA 4IIEA 2WT9A 4EGSA 5DH9A 5CX1A 5BQ5A 2Q3JA 4C0QC 4F3CA 2VDWB 4A2CA 4ZAYA 3GPLA 2BI4A 4CYMA 3W5CA 4NZNA 1RACA 2ODNA 4FFMA 3GCZA 4GX1A 4N7JA 1CUZA 4KO2S 5JEDA 3O3NB 3T15A 1ADJA 1BXGA 1L4EA 1Y48E 1N7GA 3USCS 4EF5A 3KQHA 2P75A 2QSYA 3PC3A 2VR1A 1ULAA 1QPBA 3I2YX 4FCCA 3J7TA 2FJPA 3OT1B 3QJGA 3ABZA 4JX9A 4UM9B 1ZJ4A 3O2SB 3FSRA 2XCQA 2BTOA 2W2NA 3NATA 2X0IA 4G1CA 4U5QA 4LXHA 4W82A 2EJCA 5EKXA 3O2JA 1LC3A 1N5LA 2GAFA 2NPIA 2XTAA 2RI1A 4XEUA 3LZDA 5EP3A 2QGZA 3TX6A 1E0AA 4HFMA 4BJ1A 1N2GA 1ETUA 4EF6A 3BERA 1L1EA 4EYQA 3VPDA 1N0WA 2OLEA 4W5QA 5J9FA 5FAKA 4PSVA 2E4VA 1PL6A 4F2HA 4YBZA 1WBBA 4PYNA 2WP8J 3CZ4A 4Y2VA 2WKQA 2K4MA 4IGEA 3H8WA 1JQAA 4PZPA 2V7QD 1XL1A 1FBNA 4M36A 2OK8A 3HHPA 3HSYA 1NY5A 3O7MA 2CDRA 2NYVA 3RJ9A 2Q3FA 4CM1A 3BS4A 4QEZA 3KCQA 5FI3A 3KAQA 3A1TA 1XKXA 3SHWA 3PCTA 4UZSA 1WCWA 1AF4A 2C3MA 2PUVA 3GARA 3QX8A 5EAIA 1GQ2A 3A0RB 1FDTA 1FXWA 2AHOA 4FS3A 3TI9A 4US0R 3BJMA 2YXNA 3E27A 3JRNA 4M1EA 5EZSA 4C2TA 4PZEA 3HUDA 3EXFA 3O21A 4G56A 2DFKB 3RK0A 2ORIA 3ZQ4A 2XYHA 2A9PA 1ZM9A 3WMWA 1TEXA 1XMVA 3H87A 3OJEA 1M0WA 2FPWA 4NU5A 3NHPA 3HCPA 4TQ9A 1UXKA 2GKSA 5EY5B 4XDHA 3H83A 5LQNA 1NUUA 5ENZA 2EKLA 2RGUA 4JB2A 3GRRA 2LE0A 2PMEA 1M3SA 1R88A 2VDRB 5CU7A 1USWA 1YE3A 2QUJA 4H31A 4CTKA 3O6VA 4PXSA 3GZNA 4JKOA 4AJOA 4DUGD 5ALUA 4UVIA 5CM8B 4MUGA 4BMZA 2NP6A 2VHWA 4Z4GA 1VG8A 4CFYA 2YZKA 1MIOA 3L4EA 2H17A 4F4FA 4QTUB 3FPJA 4KHZA 4A0GA 4BKOA 1X80B 2YS7A 1E1LA 3C1TA 5FIUA 1V45E 2OYRA 2Q6IA 2QI9F 2HGZA 2EBFX 2OYCA 1Q1ZA 3I34X 3UMSA 3OE7A 2VL7A 1G19A 1TDJA 3P9KA 4M6WB 5AHRA 4Y2PA 3C6QA 1XU4A 3MUEA 2OHXA 4IMJB 2AF4C 2XEXA 3MMSA 1XWIA 2VKQA 4QBKA 3U3OA 3T3HA 1HDEA 2HBQA 1AV7A 2I2AA 2V7TA 3PTZA 1R4NB 5TE9A 2DKOA 2XCRB 3PUIA 3AVXA 4BEWA 5EIXA 3OD1A 3RRZA 3QKSA 1PEAA 1ILWA 1G9XA 1Y3BE 2YZ2A 3IT0A 3Q2IA 1TAGA 5ALRA 3OQIB 9MHTA 2PUDA 2ZWPA 4MV1A 1OYYA 2G8LA 2RFLA 4HL6A 1WUTA 4BWYA 3STTA 2I80A 3JALA 2X42A 4B3IA 3FROA 4UEQA 3RF6A 4JQYA 2RGGA 1NOKA 2F48A 1JKIA 1FJHA 1TM1E 2ZAMA 1O94D 1JS1X 3R0JA 3LG2A 3LHDA 4TXHA 3BK2A 1NJGA 1VSBA 2RGYA 1Z2CA 3K96A 3MERA 2X6RA 5DCWA 3T3EA 4F97A 5BMVF 3M0EA 4PZLA 2PH5A 2V6FA 4JP1A 3MHPA 4DQXA 2FEMA 4KFCA 2WDPA 2Q5OA 1TM2A 1SXJD 2VUHB 1JDBB 4KLAA 5GM1A 1GKLA 4F85A 3WO0A 1I1NA 3U61B 1H6DA 4KN9S 4L8LA 2ID4A 4DMGA 1UBKS 2OUIA 5A3RA 3UKDA 4F2DA 3UMMA 3EMKA 4R0VA 1R3DA 3GMSA 4BB9A 2CUKA 2V9CA 3SHVA 4UCXA 4C4YA 2C97A 3NPAA 2P7HA 5J2UB 4DSZA 3DNFA 1OBHA 4PYJA 5JVDB 2OENG 1IBCA 3OQHA 1VE6A 3IJPA 2UDPA 4LJ8A 3N2IA 4CDMA 1QLWA 3AERA 4F46A 3GAFA 2WHPB 5L6MB 1L7BA 1OFHA 1A8UA 2Q3EA 4OGWA 1Q22A 2C0QA 1DKPA 4MCJA 4QUDA 3SC4A 3SZGA 1EG7A 3VNBA 4DGSA 4EZEA 3U44B 4MMYB 2AYYA 3QUBA 2ZJ3A 4G0UA 1YCGA 3NRBA 3PYLA 3I0MA 4GXNA 1F0PA 4FE7A 1AHNA 4HDOB 2VF7A 4RKRA 3EDRA 5SICE 1Q57A 2A7XA 2RGEA 2X8JB 1JVBA 2ZRDA 4ZGBA 2JVJA 1UKEA 1VSTA 2XIJA 1RBYA 2IP1A 1BC5A 1MC8A 3PF9A 1CUFA 1JU3A 1RPJA 4DRXA 3WRVA 3KYDB 4J29A 1CQIA 2YN4A 2QN2A 2CLHB 1F8UA 2OC4A 3U3KA 3LLVA 4G8JA 4BO6A 1R3UA 1Y5LA 2HQ1A 2PS0A 4RWZA 3VYSB 1ZD8A 3L2OB 5BSUA 1QVVA 1QKIA 3OMWA 2OFFA 3U9TA 3X1DA 1V7PC 1MC4A 3ZLBA 3P4XA 4J0FA 4OO3A 4GI5A 3VKVA 3NYQA 3WGNA 3HCDA 2Z4TA 1KI3A 5DSZA 1J09A 4AN0A 4ID9A 3PX2A 1W48A 3OC0A 2CL7X 3GK3A 4B5KA 1G1AA 3BWMA 4RESA 3C0KA 3BB3A 3GRAA 4NL4H 4RK7A 1SVLA 3UIEA 4C0SA 3ROEA 1T5LA 3DBRA 3EGXB 5ALTA 3QLEA 3M8KA 1E1RD 1ESCA 1UXOA 2CWDA 2EX0A 2VPZA 3TKLA 3I1FA 1PT7A 3W7VA 3CNOA 2C82A 4BYMA 4PPQA 5J2TA 1CUGA 1W0JD 4TTPA 721PA 2QDXA 4G0PA 2GYWA 2VH5R 5T4EA 3EJWA 3VX3A 4CTJA 2B4TO 2RK6A 3COYA 3T1YB 4DA4A 4CCYA 1KVQA 4D6YA 2LV8A 2Y0BA 4KK3A 2CEAA 1V16B 3ZV6A 4HCJA 2ZIWB 3N1UA 3R9KA 3G2HA 3PKZA 5FLKA 3SX4A 3ZY5A 1DOAA 4EFLA 1S9HA 4NDAA 3OF5A 1N6IA 1BQ4A 1NVWQ 2VDWA 3SIXA 1FDUA 2HJSA 4YCBA 4C0JA 1YBFA 4M49A 1J8MF 1N0VC 3E23A 2IYYA 3O8QB 1YAHA 1ZVVA 4UFOA 2GETA 1MB3A 1NU6A 4BBZA 2ZWIA 3OJWA 1RWMA 3ANMA 1XYYA 1CQJA 3MWGA 3SEZA 5C7OO 5C1DA 4LDPA 2BKXA 3L79A 2B3DA 3OT1A 2J09A 1E77A 4UTNA 1HQCA 1TFRA 1KI1A 2W0MA 4M21A 3K35A 4ZOLF 3TM4A 1OLXA 1X7WB 3K6JA 1ISJA 2AX3A 2H7YA 4LFAB 3SXJA 4B8YA 2O8CB 2O8EB 3BQNB 5F9MA 4PYKA 2IUUA 4WN9B 2ECFA 2IZ1A 3PIDA 1X14A 4QWWA 4TN5A 3I4FA 1EU1A 1MT3A 2EG9A 1J7KA 3GYGA 3PRJA 5ADVA 4CCWA 1QYVA 4YONB 3JD1A 5EP2A 1KY3A 1ZUHA 1M54A 1QC5A 3LQ4A 3B3JA 4Q4HA 3QEBZ 1UBMS 3EYWA 1GADO 1V1RB 1J5EB 3T41A 1GCOA 1NBMD 1UIMA 1YRAA 5BQPA 4Z2AA 5C18A 1JXQA 2GPBA 4HLCA 3N2KB 2GDJA 2JFFA 1FDWA 5IXJA 4HO1X 4IXDA 3EQ9A 4TTRA 3WB9A 1O08A 2C7BA 1M0TA 2I3AA 2ZVPX 3WYNA 2HA0A 3HMKA 1PVVA 1KC3A 1O58A 2JGJA 3ANXA 2ZE8A 3P71T 3EPHA 5M34A 5KKAA 2DU8A 3OBIA 4ALLA 4Z9XA 1WVIA 3OFKA 3JZAA 1DLIA 4JP8A 4DUZB 3RVSA 2I6QA 3OCYA 2QXUA 2VJLA 4I4TF 1Q0PA 5AQ1A 3T38A 5JJBA 4C4PA 2D7CA 1IN8A 1RI3A 1JEJA 3FI9A 4UHFA 3UGQA 4RE6A 1V43A 3LQFA 2VQEB 4R5MA 2IYOA 2PKWA 1C14A 1E96A 5CEFA 1KEVA 1G5PA 1C1DB 2G70A 4UOZA 2ZRMA 4FB4A 3U3RA 5A06A 3KR0A 4UBOA 1Y7HA 1G21B 2QJRA 1V4BA 3TMAA 3CVVA 1JFFA 1P7ZA 4N3BA 5E6SA 4I1OA 1NMZA 4PIPA 4Q9HA 5AXDA 4JU8A 3SS7X 4OAPA 4F4UA 5AJVB 5BN3B 2ZFUA 5JASA 3NGXA 1CIPA 1SY7A 4KWIA 5AM2A 3PHHA 5LP6A 3NXKA 1Z7BA 3L41A 4D57A 2XGSA 1FFWA 3CVJA 3EVTA 3H9CA 4L4ZA 4PHCA 3HPRA 4HNSA 2D1YA 1Q7TA 1HGXA 1S2NA 3N2GB 4Z7NB 2BC9A 2NUAB 3SEQA 4AZTA 2OD7A 2WSIA 4MS4A 3T7EA 3H5TA 5AD1A 1PK7A 4WFKA 2G5CA 2HM7A 3UB2A 4TWBA 2QRKA 1GILA 3LUGA 2G25A 3E9QA 4MR7A 4D25A 2YVUA 3R5JA 4RVDA 3VNSA 1TYZA 3NHUA 3FH0A 3ZLUA 4C4ZA 2CBZA 3EE6A 2G8NA 4Y2UA 2E6UX 1I33A 5IJZA 5BUCA 4G4SO 3V7FA 2FN4A 4ITRC 4NYJQ 2ONZA 4YPVA 1GAXA 4L76A 4ND7A 5EZYF 4DXHA 1TJ3A 3WJ1A 2H51A 1JR2A 2VJBA 3DD1A 4K3VA 2IW1A 3Q72A 2BP7B 4U4AA 3VU1A 5LYJF 3UJHA 1OLSB 2IXDA 2Q29A 1RQLA 3F3SA 3WNCA 4BMNA 1GGMA 5EIBC 3HY3A 4RL4A 2QNIA 2D0DA 3DKPA 4K7JA 1HDZA 3CW9A 1X9HA 1CWUA 1YOBA 1EK6A 1T2CA 4P58A 4LGCA 2GEJA 2ZIXA 3GU3A 3LPMA 3O8OA 3JQBC 3AKDA 5J2UA 3MS2A 1FVXA 1QB8A 4OXYA 1GKUB 3GEPA 2FRVA 3JYLA 5JVDA 1PWXA 2GEDA 4UE3S 1A7JA 1CUWA 4UNQA 4GYKA 2HMAA 3B3GA 1SG0A 2Y92A 3O93A 2C5EA 1P6QA 1GIAA 1W4CA 3WL8A 3NORA 2GN4A 5ERYA 2QGFA 2OCLA 1Z2PX 5FLEX 3UFXA 3BJRA 3NHLA 3P8ZA 5FNVB 2F64A 2IZ5A 3CIFA 3OE1A 4HDRB 4PVCA 3IPLA 4ZCPA 3SFZA 3AF3A 3ORHA 5HIJA 5JFTA 4A4DA 2Y1GA 3TSZA 5KREA 4XJSA 4WNCA 1YRWA 1GG5A 4Q1CA 2VF4X 4TTSA 1ARZA 4JJAA 1GV0A 2JIOA 2PHZA 4TKUA 4FKMA 1BX0A 2ZPUA 4GLOA 1K3TA 1MIHA 5TQ2A 2FHSA 3PHJA 5DO9A 4PG8A 2AZ4A 2R79A 3OCVA 3K6SB 1L5VA 1GTG1 4MQFB 2WMDA 2CKMA 1D4FA 2FB9A 2QL9A 3WAKA 5T8KC 3QWAA 3CURA 4JI5B 1KH1A 5A5EA 4XSGA 4C0XA 3PUYA 1TQ2A 1EEHA 1XQWA 2QE7A 4ZO9A 2IDZA 1ZPDA 4I81A 4CG3A 3TLXA 4P3XA 4YJFA 2ADMA 3ZK9A 1THZA 4B3FX 5CNJA 3A4IA 3REQB 1PD1A 1TM5E 3TLMA 2RMKA 3EZNA 2YY5A 3KJEA 1TEVA 3MOIA 4CWAA 2F8TA 4Q9IA 4C78A 5CFOA 4KR6A 1S3GA 2OD2A 3RUEA 5LZ4A 3V4RA 1FFCA 1K5HA 2GOYA 5ALLA 3LRTA 3N8KA 3Q0EA 5E4JA 3U17A 4YRKA 5C7YA 2BGGA 1C4XA 3P9YA 3NASA 2DF8A 1ZN2A 5FBKA 1A3CA 1PF7E 4WUTA 3A2NA 1HDRA 5LJLA 1CJCA 2LIVA 2PS9A 5BPFA 5I9LA 5KMGB 3H5IA 1UOQA 4CQJA 4E46A 4WJZA 3D7KA 1MG0A 3K30A 3D7RA 3DPIA 1I7SB 4QNNA 2VSYA 1NZDA 1EFRA 2HV8A 4J0IA 4B73A 3AF1A 5DOZA 4YP7A 5I9TA 2F9MA 1ECPA 2ANBA 2C2ZA 3KZKA 4TWJA 4Z86A 1ULBA 1Q44A 3AUSA 1VPDA 4H0FA 1P2GA 4Z9BA 3VNRA 1U6KA 3E5MA 1IYZA 2DBVO 2R6JA 3RYFB 5FA6A 3U40A 5I4IA 5IASA 2CXNA 3KVNA 3X1ZA 2WVAA 2APJA 3WJ2A 4F60A 4ABTA 5D00A 2ZT5A 4DYHA 1MAVA 4B4VA 3PHBE 3VHXA 2GR9A 1W0KD 5B3JC 3CVOA 5FFMA 3VR0A 3OURA 1QORA 3QELA 3KOYA 5I7VA 2A5GA 1XNQB 1M2HA 3B1KA 3HA7A 3MN1A 2PGIA 1QP8A 2X1LA 4LRXA 3X1JA 4BNVA 3THSA 2Q6OA 5IBCA 4LXUA 1PFGA 4HDKB 3FFAA 2MU1A 5AJWA 1O1YA 4YCLA 2M6SA 1RABA 4HQKA 2JAOA 4LTNA 1PT9A 2ZR0A 3P0HA 3ZBTA 4WNIA 1LS1A 2XECA 1A4UA 1GGNA 1OT3A 1X19A 1QIMA 1IZ7A 4YJ2A 2JGKA 1SQ0A 2J5BA 1XQ6A 2WILA 3B6MA 4I9NA 4MVJE 4WN9A 2QY6A 4U7GA 4BATA 4QGAA 1JW9B 2J3EA 3A1UA 2MSWA 1D0IA 1W59A 2G08A 2PNFA 4WH0A 3TTSA 1X6VA 4BMSA 3CKLA 2B98A 1G8PA 2I8CA 4J1TA 5E0KB 3E9NA 3GLFB 1CW2B 2CMDA 3NOOA 5C8DA 1V6SA 4ZXFA 1E1DA 1ST3A 3QXXA 2X2OA 4QYTA 4LHEA 2CLCX 4WEOA 4AK9A 4PNHA 1B42A 2LTAA 3C1AA 3Q2OA 2HWWA 2X5XA 3MTQA 3MG9A 3RS8A 4E5VA 4IFTA 4G1UC 4MKIA 3DZDA 2GBPA 1BE6A 4BMCA 4NPHA 1P9LA 1FDVA 2R6FA 1W36D 3CEPB 1HYBA 4I08A 4IGFA 3OHPA 4LE0A 4PO1A 1FSZA 4DPKA 5ED4A 3OZUA 4PC7A 1PV2A 3RI3A 3SHFA 1GTSA 3ZDCA 2P0YA 5HQJA 3HE3A 3P27A 4WI1A 3NM5A 2Q5EA 3CZCA 1DBVO 5EEGA 1FDOA 1G9TA 2JEYA 3TZQA 1G20E 4NC9A 3NBZC 3RANA 4FWTA 4PLGA 1E2IA 4LDQA 3UHFA 4LK3A 3NBYC 1DBRA 5K3EA 1PO7A 2E6KA 1NN0A 1ISFA 4NOJA 3UA4A 5BSFA 3OQ6A 3UPUA 4B74A 4D4GA 5G0VA 1W2GA 1E2DA 1F1JA 1Y8QB 3EA5A 4DCUA 1NXPA 2E5FA 1YF3A 4HMQA 1Q1NA 1T9GR 2PLFA 1YJQA 4B3SB 3F5SA 5A6SB 3HYNA 2B61A 4PWYA 1U7XA 2JFBA 2ATEA 4Z0TA 3RB8A 3CCFA 3DUFB 4ERNA 1LU9A 1X1EA 5ERXA 2AQKA 3W7AA 1X1DA 3ZXIA 5CEJA 1FDSA 4DANA 2KQUA 1VJ0A 4FNAA 2PH3A 3EULA 5F2EA 1DTWA 2DBQA 2WINI 4QYSA 4UVHA 3D6JA 3E48A 4QYXA 3CLUD 3C7AA 2GN6A 2HXGA 3PIIA 4ZYLA 1GFIA 1J99A 4URXR 2NZXA 2A88A 3F2VA 1TA4A 3A1NA 4EJ0A 5L45A 1UMDA 4QDXA 3VSAA 1BYIA 3K09C 4BKMA 1P0QA 2QRJA 3IOYA 4RPHA 3IIIA 2D1QA 1P0IA 1SCUA 2D2IA 5E9AA 5EC8A 1QBGA 3E9CA 3RIHA 3ZHTA 1T2VA 1YK1A 5ESWA 1EA7A 1MGPA 3PDIB 3NBAA 3U81A 4LTMA 2FUCA 2J48A 4YAOA 3EAGA 5DYYA 4CQMB 1SRRA 1T5OA 2BP7A 1TM4E 1XRPA 3M6LA 1Z2OX 2ZXEA 4IX9A 3NR2A 1Y7IA 5H80A 2BCEA 2OQ2A 4QBHA 4Q02A 2D5AA 3EGDA 1NBAA 5BUQA 2JLQA 3HPQA 1C9DB 4NONA 4F86A 1YFKA 3VAZA 4E03A 1GGFA 1BVYF 5BSKA 2X0DA 1A5ZA 1AQLA 5CB8A 2QI9C 3BHJA 5EUBA 4YCMA 2YHUA 5IUNC 1QGZA 4LS3A 2I99A 4FHZA 4K6CA 3K2IA 3NC4A 5FOXA 3WTBA 1GAEO 2PD6A 4DR2B 1NF8A 1FP7A 2B5OA 4W9NA 1RKVA 2JAPA 1V48A 3MRTA 3QKUA 5LIRA 3T1QA 1MU0A 3QHAA 1UADA 1TB4A 2IHZA 1XTJA 4PANA 4MUHA 4H7EA 4MRNA 4X1YB 4EG4A 5FNVA 2E37A 2F8MA 2PMCA 2VIIA 5A3QA 4X85A 4E4TA 4MGYR 4JITA 3E53A 1JDPA 1RJGA 2JARA 1SQ5A 4L8VA 3JX9A 4XAQA 2ZE7A 4NABA 1BVUA 1L5KA 4BAUA 1ZD4A 5AVSA 2HREA 1A9YA 5K5EA 2QU7A 4UQLA 3FZNA 1LK0A 1Y3CE 1PJBA 1GQFA 4ZOEA 1P7WA 1DQZA 2E48A 3H1TA 1MA0A 1Y89A 5CX4A 3QWHA 4JLWA 3MK31 1Q83A 2EDAA 3SBEA 3L8CA 1A50B 4KFTA 3O4VA 1O95D 2LKCA 1MO2A 5K1ZA 5BWOA 1UM9B 3QPWA 2G1UA 4FMCF 2M6KA 2F4VB 3VKGA 1JPUA 1WCYA 5A4DA 1KEKA 5GAJA 5DN9A 5B37A 1N5DA 2GBCA 2XB4A 1HFEL 3VTKA 3IE1A 4NCAA 3I5YA 4FYPA 1XJ5A 2H7VA 2NUBA 2OFWA 4FQ8A 3DMFA 4IDBA 3AIKA 3QIAA 4OQFA 3ZJUA 2Y1CA 1W4AA 3NCHA 2GF2A 1T2EA 4QOGA 1JVSA 4X8MA 3FR7A 3ONEA 3REQA 2IS1A 3I01M 1H2HA 1NQWA 3BULA 2XE7A 5KEIA 2W6PA 4TRNA 4M1OA 1V3TA 4O2AB 4JT8A 2P90A 1WCV1 4KYUA 5CDFE 1V5GA 5CJJA 4EFNA 5TF4A 5CDFA 3DLTA 2W2KB 5HM8A 2GF9A 1ZM3A 3K9GA 4YJHB 3AHGA 4BL5A 3ZH2A 1Z16A 1PJ4A 3ABSB 4DIUA 1T1SA 2O23A 2YZ7A 1XPUA 3DSRA 1W0CA 4IUYA 2EBWA 3S55A 1L3CA 2YKGA 1DJMA 1X87A 3R2JA 2Q5JA 3O4RA 5D7BA 2HA6A 1Y4UA 2JNWA 3BWBA 2GSDA 2ZBRA 3GX1A 3IPRA 4X7RA 4XWKA 1NVTA 1C4OA 2UZ0A 3GLUA 4DLUA 4ZVTA 1ZKMA 3W8FA 4AD8A 3DOCA 1N1EA 3NHZA 4MV5A 1E4EB 5E95A 1NI3A 3NEYA 4HDNA 3QFTA 4LX8A 4W63A 4AN4A 3AEKB 4G67A 3A6EA 5FTWA 2BUAA 2YY6A 3I9JA 4A6XA 4KMRA 3GH3A 4Q4CA 4URYR 1IDN1 3O8BA 1VG0B 5BY2A 1RVV1 1U2DC 5DE3A 3PQ2A 1O0SA 3GJ5A 5AI6A 4D3XA 3PQCA 5JSHA 1UINA 3I6BA 1Q1EA 2OG1A 1LV8A 4DT1A 1EB8A 4B35A 2WQ7A 3V8RA 3BE4A 2IBTA 4D9CA 2CHQA 3GPDG 5LFAA 2FPIA 4KXUA 3CBGA 4HWKA 2O3SA 3RVLA 2G1PA 5H3CA 4YV7A 3CUUA 2R6DA 1GYRA 2IKQA 2REBA 5FULA 3DLCA 4H3SA 3M3HA 1DG3A 1DIHA 2QIOA 2DZDA 2XMGA 4UAGA 4NE7A 1ABFA 2JHPA 4LDNA 4BNYA 4CKXA 4D81A 2FY8A 1MX9A 1EMDA 3IMGA 2PR2A 1SVNA 1TF2A 3ED5A 2W6IA 3SVZA 3VTZA 4BZXA 3Q0TA 1FP1D 2Q0HA 5FOTA 2H2WA 4EHLA 3O83A 3I45A 1K0FA 3UK2A 1A5TA 4N3GA 3LZ6A 4KSYA 1BKSB 3A58B 1N36B 2G9VA 1QS0B 2PMDA 3GJRA 4FYJA 3TDKA 2XDQB 5LKAA 4K8OA 2VP6A 3ETHA 1XFDA 5CT4A 4I6JA 3FTEA 1G5QA 1JE0A 1Y6QA 4YRRA 1TGYA 2BKVA 3DS8A 3OQOA 2AUNA 3B53X 3HYLA 4MROA 4QGBA 4ER3A 1C7EA 4ZI7B 1GPNA 1DX6A 1N9ZA 2XB2A 2A5DA 4TQGA 3AFHA 2ZIFA 3GFRA 4RIHA 1EGAA 1Q0ZA 4HGYA 3B9BA 4R9RA 2DJIA 5IWCA 2PBLA 2WD8A 5D5QA 3Q8MA 1JU4A 3VR4H 4DN6A 5FH9A 2OB1A 1E4VA 3TW8B 4ZQBA 5HE9A 1NW5A 4XTRA 3ZZ0A 1DZIA 4DLWA 1R64A 1Q0LA 2YMMA 4Q1EA 5EQJB 3L40A 3LX4A 4D8XA 1BWPA 1RHRA 2ZQ5A 1R37A 4BMPB 4HXYA 2CGEA 2BFDA 2OOSA 1M6WA 3BA6A 4NMMA 5FL7D 4YV0A 5A6SA 1JA9A 3W8NA 1SIBE 2OXRA 3F3YA 1IONA 4UZEA 1VJGA 1F8FA 4EB3A 4MV6A 3WQHA 3F4KA 4RMNA 2XLBA 2EWVA 1J2YA 1PU2A 1CR6A 1Q6YA 2HA2A 3A7EA 3D4NA 4B87A 4ZCRA 1JHPA 3AEZA 3DEKA 2OAEA 1BDIA 3GNTA 4JYZA 2JI9A 1PDVA 3UG6A 3A2LA 3LQ1A 3PXUA 2G28A 4MWOA 3JQAB 3WP1B 1FXWF 3WK7A 3HEAA 1E60A 1N8KA 2ZM5A 4RD4A 2ZSFA 4BUJA 5KB3A 4B71A 3TIIA 1Z29A 4GOMD 4YJ3B 5JDCC 1JHOA 1NTOA 4JXJA 2WEKA 3FTCA 3F46A 3PPXA 1MTZA 2PUJA 3FY4A 4I8XA 1RP7A 5G0SA 4AY4A 3MWDA 4DNXA 5A0VA 1HNZB 3DYVA 3JZFA 3QVOA 3QPAA 3BDAA 2JASA 4Y9SA 2Q4TA 4RZIA 2VYQA 4CCSA 1S2LA 2V4UA 4JBGA 1WWKA 1Z0FA 3LP8A 3PJEA 3TN7A 4FXOA 1EE2A 2B0JA 3FLEA 3KOOA 4RSRA 3M1YA 1JJAA 4X8LA 3O2QB 1U0JA 1ID1A 4ZO6A 3H2BA 3WBBA 1YDFA 3E7WA 1JF8A 4O4LF 4UTXA 3GFOA 4B79A 4X0EA 3UWKA 4E2ZA 1QAMA 4V2IA 2Z5LA 3NKFA 1VL6A 4OQZA 3LF1A 4XYBA 4P6VF 4LNUA 4RTLA 4RZ3A 1DBQA 1KPIA 2VBCA 2QTTA 4A8JA 3FGPA 4ZIRB 1WDKA 4DQVA 2A0YA 1FUIA 3NHFA 3EW7A 2WAYA 2VDPB 1GZDA 1Q7GA 1VIAA 2OT3B 3DWGA 4NF2A 5ALJA 4EHDA 1NULA 1NVEA 2BBSA 2XCLA 1YQEA 3GQVA 4AJEA 3LC7O 3QPBA 2JKYA 1CJUC 1HMPA 4UPEA 3MTJA 3AJ9A 4DEXA 1YS6A 2XKJE 4E3WA 3G2MA 3EZLA 2F00A 1EM8B 1ENYA 2ZJ1A 2O2EA 4W5RA 2PBFA 1DCKA 1WCIB 2GYYA 2FMFA 2SCUB 3JD2A 1RXYA 5JH7F 2JKVA 6ADHA 1WM1A 1VHDA 2FZVA 1I7QB 3B13B 1SKYE 4FQ7A 4QNMA 5JZVA 1IWBB 1C7IA 2ETXA 3C48A 2GAJA 3NHKA 3CRVA 2J5QA 4RJTA 2NO6A 5LA6A 2JVKA 4O4JB 1F51E 3UWSA 1Z7EA 3IJEB 3KOUA 4JB0A 1S8AA 1WXHA 2ZQYA 4E1BA 5BW4A 4CN9A 1KAOA 4PLFA 1QKKA 1EXNA 1XEWY 1V25A 2C4HA 2VK1A 2ZYGA 2RI6A 3FTPA 2R0QC 3JARA 3TZKA 5K2OA 4OB6A 1H4QA 4WFQA 1XMSA 3HV2A 4AN1A 4M60A 3S2EA 1N8TA 1YQDA 2HTEA 2HHHB 2HPAA 4INOA 4HYQA 1SBNE 1XRJA 3M6FA 1S8NA 2XHEA 1ZH6A 4Q3CA 1KJNA 1ZI6A 4E6EA 4J76A 4J1NA 3V4LA 1IJKA 3AWIA 1WUIS 3ELUA 5DMHA 2ZZKA 2F8LA 2FWMX 3R0QA 5BURA 1ZOPA 2X3UA 1M2OB 4OHKA 4RA6A 1I4LD 3H5RA 3K9NA 5JY1A 1Y8ZA 1E3IA 4YR7A 4FD3A 4Q7MB 5TMDA 5KNBA 3ZGVA 2R9VA 4LX0A 5DGHA 2PAAA 3L8HA 4ZAVA 2DCMA 4N0EA 4CKWA 5F9FA 1LD3A 2FP4B 2XNCA 2WM9B 3DDHA 1KYVA 2F4NA 5EXSA 4C3VA 3OOSA 1GZ3A 3ZPXA 2R2GA 2Z4RA 3LCVB 1UC5B 3ZGLA 1Z08A 5K3OA 3EZ2A 2R4TA 4JP5A 2XMQA 4MQUA 4BJHB 4HDMB 4QUHA 4HBGA 4OU5A 5I7WA 5IZCA 2CMGA 1T36A 1CPYA 1Z37A 3BSYA 2O3UA 3L0OA 5A62A 1M1YE 4XFDA 3MOSA 3M33A 4QDUA 3R9IA 3D43A 5T3UA 1NQOA 4CKBB 4EPRA 4EX7A 4CL2A 4GH5A 3R4VA 4I55A 1GA1A 3CPEA 3T8YA 3ZNOA 4ER5A 4QBGB 1D0SA 3T3DA 3Q3VA 4W5HA 3HWRA 3R7SA 3UPTA 1DJLA 1C0KA 3EBLA 1KOJA 1OBCA 1QH8B 3E9YA 4IDHA 1J5PA 4XCVA 1ODIA 4W9MC 5K0TA 2WT4A 4YRZA 2HRZA 2V97A 2F67A 1ZISA 2ZJ5A 4JT2A 1MX1A 5PGMA 4JIMA 3I3OA 4G5OA 5J2TF 3OOWA 4H3HB 3RU3A 1WMSA 3DKRA 1EE9A 2Y4NA 2LCQA 1GPBA 4OOEA 1BCRB 5CXSA 1PQ4A 2RGBA 2E1PA 4H6PA 4JLMA 2AFHE 1R18A 3AV0B 3L07A 3JTMA 1Z07A 4K46A 4MEAA 4OHRA 2OO7A 3LW7A 1AUPA 3HVUA 3U39A 3TLGA 4DVJA 5DTIA 2XCOA 2CK3D 1YDMA 2G06A 1UEJA 3GRZA 1KVRA 3OZ7A 4P32A 4JKYA 1U8FO 3MELA 4KWTA 1JKJB 3ORSA 3TTUA 1SGWA 1SC4A 5FPTA 2IXGA 5IVIA 2PZGA 4QAJA 4WXHA 4ZEOA 4JLKA 4IIFA 4Y2XA 4ZVKA 3TLKA 2X5OA 1RWQA 1KYIA 3AJEA 3O8DA 3WRYA 4FE3A 3I12A 1HEUA 1Y33E 1Y6FA 1JQJC 3V2GA 3IP9A 3I5UA 1IH8A 4ETMA 3KEMA 3SM9A 1WQ3A 1PSZA 3C7CB 1XRNA 4G23A 4WT7A 1RPZA 1UDBA 3L4BC 1RFGE 1YNSA 2QVCA 4HRVA 1FMCA 1I5EA 1O2DA 3AO0B 4FYIA 4PAWA 1UT6A 3TOXA 5AOCA 3WHKA 1FQJA 5E9JA 3WA7A 2XWSA 4KK4A 4XYGA 3OM8A 3JYQA 3O9ZA 1DWPA 1JDSA 2YXEA 3G8BA 4AB1A 2ZBEA 3BHMA 3HBFA 1QMGA 1NQXA 3EAQA 3W5IA 3GLGE 2GUGA 5IZ4A 3E4DA 4WV3A 3VRHA 1FTGA 2IPAB 1Z47A 2NSLA 1MABA 1UQTA 3AG5A 4WX2B 3VHRA 3I58A 5DGDA 2Y67A 3SE0A 3FFXA 2B9VA 3EBPA 2QRUA 3CM0A 3I73A 2CVPA 3EJ6A 4UJ3A 4B46A 3D0OA 3IESA 4QG7A 4JAVC 1NI4A 3E03A 2Y9PB 3N86A 4EHHA 5AT1A 5ILQA 4MDYA 5BWNA 4QJBA 3PT5A 3RDPA 5LBUA 1ZDMA 4XX1A 2ZLBA 4CDGA 2EKZA 4C0HA 4AQYB 3NTLA 1WHTA 1Z3IX 2KM1A 3F4BA 3C8MA 2Q7DA 4WXRA 1WX1A 2QSZA 2YY7A 4ZYZA 2V7GA 2EFDB 4EL0A 3KD2A 3PFWO 2BPOA 1B8OA 1IUPA 5C5EA 4H35A 5BSRA 1D2NA 3M6UA 1QG4A 1Y1SA 4HXGA 4NENA 4Q00A 1M10A 4QECA 5EZQA 1CS0A 3R1IA 4REMA 3ND6A 5DASA 3ZU2A 3W5BA 2VTBB 1S1CA 1Y9EA 2D7DA 1A9XB 4UJ5A 1DJPA 3V1LA 1W73A 3LWBA 3CXRA 1CF9A 1EHYA 2CVHA 2L19A 4TWAA 3N0WA 4PQRA 4BFUA 1XLUA 3CVWA 3U3DA 1HZZC 1SH7A 5BXYA 5LP6F 4QJ5A 3VVCA 2IHUA 3ONWA 1DWQA 2K2QB 2Z2YA 2W2QA 2KLHA 1H9BA 3VOSA 1I2CA 3EVEA 4KNWA 1RWWA 4LTDA 4JI1B 3ZUPA 5IMSA 3VGJA 4PLVA 1UFVA 4Y2QA 1Z2EA 3ED1A 1C1HA 5B53A 3VI3B 1XXHE 3KB1A 4X5OA 4ED9A 1YOVB 4Q6BA 4QEDA 3HWWA 16PKA 2CZGA 2Z9BA 2FJ0A 3L5KA 3MXOA 4ND6A 3I6IA 3GEHA 5FOWA 5BVGB 3THOA 1MZPA 1G6KA 2RARA 3DL7A 1BX3A 4XUCA 4LF9B 3FG9A 3R7BA 4GQAA 4FEGA 1NBWB 3UF0A 3SKYA 1RBZA 5BR4A 3ENNA 1AQJA 5HTOA 4ZVUA 3G7UA 3ZIDA 1TNDA 3A1SA 1ZWLA 2V0NA 1EM8A 2VQSA 3EGWA 1J2RA 1I3NA 1T1GA 1T9AA 5C0OE 3ZLTA 5AVQA 2Q3MA 5AI9A 3U7QB 2W83A 3LPCA 4RMGA 4WERA 3ZDDA 1PNVA 4IHJA 2AQIA 3D7LA 3KE9A 4ZCTA 1A8SA 2JG3A 2O54A 1SM4A 2EZTA 3DO8A 3V34A 3OY7A 4H7IA 4M1QA 4D44A 2A9KA 3FI0A 1QANA 1ZIPA 1D6SA 4D79A 3LT1A 3IIMA 4LJ6A 5FTMA 1DRWA 1NJ1A 3HJAA 4LDRA 3OT5A 4BRSA 2ACEA 4LZPA 821PA 5JADA 3ANSA 1U28A 1E94E 5J2UF 4TZKA 2PBRA 4EI2A 4HH0A 3I6MA 1P1HA 5JVDF 2F1IA 3C43A 3CZMA 1M0EA 2FN8A 1AK2A 1TADA 3I37X 3IVRA 4I5IA 5DM4A 5F2KA 3X0DA 4Q1AA 1VMDA 2X58A 1NTRA 3GLTA 1R0RE 1Q0TA 4H18A 3SBXA 1C30A 2NYRA 4NJMA 1DXHA 1L7MA 1U3TA 1WUHS 3C4VA 4HZUB 2RH8A 5BYAA 2QUKA 3DTTA 2XR1A 3PGKA 4IR7A 2WMNB 3U26A 4DIBA 2WUDA 1K5GA 3H5WA 3OSUA 3PQ5A 4P7KA 3VDXA 3WJAA 1T5BA 2H0AA 3VDMA 1NXSA 5D8DA 4M9QA 4E13A 1ORHA 1C3XA 1NWHA 4RH1A 5GPBA 1ZH0A 5L4LA 1U80A 1OXKB 4L5IA 4MW7A 1XWFA 4W6QA 4AKSA 1LLUA 1RAHA 2XQJA 2FMKA 1DRJA 2KYRA 3N8IA 3OIWA 5GVRA 3UICA 2GVDC 1XALA 2R65A 4NU8X 3HTXA 1X1RA 1I7DA 3FF1A 3KKLA 4C7JA 2VOEA 2B4KA 4OI1A 5GV7A 1SHJA 3AF4A 1LPOA 3CZ5A 2C92A 1XE3A 3K8QA 4G1FA 4QXOA 4IIGA 3IUNA 2RJOA 1XDDA 3AF0A 1JEQB 4Y9UA 1E0DA 5BQ3A 4G8BA 3OLQA 1YVUA 3UHJA 4OXIA 4BS9A 2QAIA 1K1EA 1KDPA 2I2FA 4WZBE 4BQPA 1QTIA 3DFMA 1H5QA 4AJIA 1MD9A 2B4AA 2CL0X 2W11A 3D59A 2VP9A 4M9UA 5IVDA 3TD9A 2KS6A 5G2OA 3JV7A 4FONA 2BY4A 2VHCA 5FQOA 1KSGA 5F2NA 3PFBA 3QNMA 3T35A 1YJAA 4XARA 1V5WA 4EPTA 2UZ1A 2PX2A 5JECA 2ZTVA 4GPEA 2VQ6A 5CM2Z 4D4MA 4NDZA 5FTKA 3WKBA 1AHIA 4ZU1X 1RRCA 1NXTA 2XWJI 4HAXA 1SELA 2F3SA 2B6NA 3I42A 1BO6A 3DKKA 3O90A 1YCDA 2LCFA 3Q2KA 1KXJA 4S1VA 1QRDA 4L9AA 2YJ4A 4ZC8A 4AUNA 4ZYUA 2AEFA 3PQEA 4G36A 4OY3A 1PGOA 4LJKA 4UUNA 3H86A 2QYOA 3R0IA 1RLUA 3F0TA 5DN6A 4K9OA 4HGRA 5DWDA 1NUAA 2QVXX 3R3HA 2FFRA 3U49A 2CJWB 4OV6B 3EG5A 2G0NA 2GS9A 1DC6A 2VPXA 3QEKA 4BTLA 3FNGA 2E9SA 3TTXA 4XWOA 1Y5IA 4AURA 1D8TA 1S02A 1E9CA 1JKJA 3GNLA 3PSAA 1L8LA 4EY5A 1ZW1A 5BT8A 1VKJA 1I4DD 4ARBA 4B9AA 1Y42X 4FFLA 2IU0A 4B6SA 3F3MA 1E6CA 2IHKA 1KF0A 3AXSA 5DI3A 3WSTA 4I9GA 4MUNA 4OOFA 2WTUA 2JZCA 4V39A 521PA 2HA4A 3ZWAA 4CQLA 1MRSA 2R60A 5D51S 1EP3B 4G63A 1EKXA 4OKNA 5H3HA 4JQZA 1DFHA 3X1WA 4D3YA 4X64B 1XFAA 2VCHA 2CHVA 3DBOB 1IVSA 4E12A 1UT5A 4Q1BA 3FCCA 1DRVA 1XTVA 3COZA 3INRA 3KVRA 1PFQA 2I55A 1OV4A 2WUWE 1T8PA 3GDGA 2FUNB 3G68A 1NU8A 2R3SA 1SCNE 2LP4Y 5EJFA 2DHQA 4WAUA 2HW8A 5KDDA 3KYCB 1N2XA 3Q12A 3SZUA 2CXHA 5LL6P 3MTIA 5C8VA 1K92A 4Y2GA 1UT8A 3SYRA 1E7WA 4MYUA 4HQOA 4YTEA 5KYXB 5KTPA 2IPNA 1KQFA 3PNBA 2QK4A 2IEZA 2NVOA 3KAKA 1UMBB 4PE5B 5JAQA 3VNAA 1YGYA 5JNWA 1SBYA 3EA4A 3KQNA 1FUUA 3IMEA 4ROSA 4DMUB 3QG1A 2O8VA 2Q2VA 4R81A 3U4QB 4NNJA 3SQWA 1YS4A 3HCBA 4KNYA 2POQX 1Y98A 1E7YA 1HT3A 1ISHA 4MW1A 4R7ZA 4NPAA 2QRLA 1WG8A 1YKGA 4KAAA 2GH1A 4XTCS 2VRNA 3DTVB 5HP4A 5JZBA 3LQYA 2BFEB 1B23P 3JCZA 3DOFA 4C1NA 2WUVA 1FYVA 2PKRA 2DPLA 4J94A 4BLWA 4D92A 1LDYA 1SD2A 4MVYA 3TLJA 5HUHA 4DKJA 2RBEA 3QLVA 4P5DA 4DQLA 2PJRA 2D0IA 4R40A 4A92A 3R24A 4INZA 4NFHA 3CRNA 4RK5A 3L4JA 4WTOA 3CSUA 4X00A 5AHOA 3W06A 3QVWA 4N7BA 4Q5IA 3GIWA 5CVVA 4ZHQB 4M3NA 2WHYA 3TNDA 1UBJS 1TFUA 4HTFB 3HO8A 5JPIA 5JBNA 3U4CA 1PV1A 3DEAA 4ZV4A 5EESA 2ONJA 3H9GA 3T3IA 2VYNA 4CM4A 3K5PA 2XX3A 3T0FA 5EWJA 2A1TS 5EHZA 4P84A 3HB1A 3NHRA 3UMRA 2BSAA 2CE2X 4TN1A 3AEQB 1R66A 4ZV9A 4ZQHA 5BVGA 3D4PA 1DTSA 3HP1A 3DVRX 4YRPA 2EERA 2UUAB 2B2XA 3QA3E 3NHWA 4LHYA 4D45A 3KDAA 1NC3A 3SDZA 3IEPA 2YMPA 3HKBB 1VIVA 3V00A 1VFPA 4GMFA 4XLZA 4S04A 1U7HA 3MCZA 5HCNA 5DM60 5ITSA 1X42A 1CLUA 1L5WA 1IQUA 1KP9A 3SX0A 4FX5A 4CMAA 5CMLA 4QHTA 4PLPA 2XUOA 4YK7A 1XK6A 3PC6A 1WXFA 2HXYA 3AP1A 3OEHA 4TS9A 1U9JA 2YICA 2Q9BA 2J32A 2AK2A 5CK5A 5FT9A 4BQEA 3U1VA 4BOYA 2WV7A 5FUBA 1PL7A 4BQFA 4F4IA 4FNMA 5KQGA 1YZVA 4RTMA 4JI7B 4DMMA 3L6BA 3Q3EA 4RX1A 1EVLA 1J0CA 3H97A 2FTKE 4I50A 2IODA 4TSKA 3ITDA 2WTAA 4HMPA 4QQRA 2YOHA 4LC1A 2BV3A 4MYRA 1FZTA 2QVGA 4S1PA 1Z15A 3FRJA 5GZ1A 4GVPA 5MFPA 1RWBA 3KQPA 2I4NA 2RC6A 4PGGA 3WDLA 3SQMA 3W3ZB 4BP9A 1M34B 3EEOA 3S2SA 1BD4A 4CLXA 2YC4C 1WLYA 1YIOA 2GXUA 3SF8A 4F9EA 4N0QA 4DL9A 4TKMA 2QN8A 3AETA 3OCUA 1WV0A 2V58A 4KLRA 3V48A 2R1ZA 5FNVF 3CX7A 4HXFB 1E2FA 1XTRA 3HYRA 4CM5A 4QTYA 5IYZB 4ZYXA 3I4LA 2FI1A 2G3YA 2QL5A 2CVFA 1VJ5A 1US8A 4IYRA 3ND5A 3ZVRA 2VJCA 2G7MC 4OUKX 3ZZ1A 1C1XA 4KR0A 1GNPA 5KYKA 1Y8RB 4DUYB 2DBZA 2BN4A 1T6BY 1Y34E 2VQFB 3C85A 1LI7A 1V1MB 1XT6A 5HZMA 3T0GA 3BSFA 3PEYA 1MVLA 1N5IA 3K0FA 3LOUA 4TWIA 4C7VA 2FPKA 4ARCA 1XJWA 1CJMA 3U6BA 1R6XA 1WY7A 5LMUB 4EHJA 1E6WA 4N7MA 2DHEA 1P0PA 3W4IA 4S1TA 1JEQA 4AROA 3WGKA 8ADHA 3RO7A 1JILA 3A4MA 1NQAO 5AK5A 5E6RA 2P91A 2QXTA 3FNBA 3PUVA 4DWWA 2Y2VA 3MIZA 5JDIA 1FYWA 2ZIZA 1TTHA 3ECSA 3V8NA 5L53A 1J22A 5E3JA 4A7PA 5IM4A 3VR6H 5K8LA 1L5GB 3P2KA 1HA3A 3F9RA 1JHVA 1XC7A 3F6PA 1P60A 3D6AA 3GN1A 3QLJA 2PMKA 4AG6A 3KK0A 1Q14A 4U6SA 4J7UA 1PLLA 1UBRS 2O2JA 4HS9A 2DOKA 4JEUA 4R83A 4ZVVA 3TLAA 3LXMA 4UUBA 5ADHA 1QP4A 3SDSA 1E9FA 1AK9A 1FFDA 1SG9A 3ZDAA 5IARA 2HJ9A 3ZWMA 4GP7A 4QGFA 1POWA 5BSMA 1UZUA 1YMUA 3OPYB 4CKEB 4DRZA 3HZRA 2VS1A 3Q5DA 1NW3A 3QFHA 4TVBA 1ZRHA 4JWTA 2ODQA 1FRQA 3LDAA 3ZCRA 1XEWX 1L3BA 5CBKA 2VATA 1ULHA 5BO5A 1P81A 2ID7A 3E15A 3ZD9A 1W85A 3EXHB 4B6EA 2FW1A 2GK7A 3PFHA 3C14C 5JEEA 4D9JA 2ETVA 4Z4HA 3GVXA 5I9SA 3PF8A 4ZREA 1B1AA 1B3RA 4DLXA 5ALHA 4R1LA 2BFBB 2VQ3A 5H82A 1GQRA 1I4TD 3IMFA 5KSOA 4PN7A 3VI4B 3LSYA 2XGMA 3C3AA 3G6KA 4JBWA 3SR3A 4CKCB 4OFWA 5CLLA 5A1TA 1T9ZA 4G5GA 1X3LA 5D87A 1X1SA 3OFND 2H1FA 1HL3A 3W2IA 4H1HA 4NATA 3JVVA 3KFXA 2FKAA 1LK5A 1ADFA 4RIIA 2I76A 3ZOZA 3I1IA 2PKXA 4RH0A 3RIYA 1XA0A 4UDYX 1BN6A 4O4IA 4B33A 1WQ1R 4NK5A 5JMWA 4Q19A 4HGOA 4ZOAA 3H5NA 3LCRA 1C3JA 2VJKA 3CT6A 3NIBA 1XTTA 2J45A 2K7ZA 2GEBA 1Z4OA 5BYKA 1AKUA 4NAHA 3ADDA 2WHQA 3FWHA 5ALIA 2Y27A 1KEZA 4N3AA 3BGWA 3ZBQA 2GN2A 1LNSA 1AUVA 3JAWB 1CRZA 3PXCX 2JH8A 5LXTB 5COAA 3LHFA 1NONA 2IY9A 2NV0A 5L3VA 4HGPA 4UUMA 5DZSA 3AI2A 1WULS 1A5AB 3IEIA 3FUTA 4DCOA 5JWOA 3Q5EA 1EVEA 4MP3A 4EFMA 5KQPA 2D8MA 3UJ7A 3B2EA 1TD1A 2HWXA 3EF1A 4S12A 5ALZA 1IZ9A 2IWRA 4Y6OA 2R97A 2RHBA 2X6QA 2MOKA 3T7KA 2COUA 4M22A 4R3NA 2WAOA 1USKA 4RTPA 1R2QA 4CIXA 1OGIA 1RKUA 4DYDA 4TZTA 4MGZR 4N41A 1NX9A 2GNPA 2JLRA 2A1IA 4AZSA 1RZ3A 3I83A 3GLSA 4GLJA 4NU0A 4LE2A 5L6LB 4B6JA 3KO8A 4UDNA 3WWZA 1USUA 4ER6A 5K05A 1B26A 2PFSA 4JLAA 3RVQA 3T12A 2N1BA 3CW2A 3B6IA 4OYYA 5EPOA 2DQYA 2R48A 1NXOA 4LAFA 1NJ8A 1ZIDA 2J46A 1EI9A 3K92A 2JDID 5KYGA 1G8AA 4W7HA 3GRFA 1OVGA 1A7UA 2JBWA 2RAPA 2XQIA 1J6UA 1X9GA 2VDVE 3D9QX 3HWSA 3LV8A 3TNYA 3U19A 1PKEA 4GICA 3RLFA 4H17A 1P33A 1Z8FA 4HDCA 2GZHA 2XUPA 3UYKA 1SEPA 3N05A 4HR7A 4P7FA 3ZTYA 4DCJA 4NCIA 3ZZMA 1YU9A 1Q7CA 3FCYA 3PHGA 2JI7A 4P7BA 4Q4AB 1F2VA 2D8AA 3BXPA 4GKVA 3FF4A 2PSHA 1P7VA 2FSHA 2QM3A 2PRJA 4AJ1A 4HTFA 4Y2JA 4XB1A 2GXSA 4XPIA 3HM9A 4O2BA 1FFXA 4PZDA 1YS1X 1SCJA 4I1IA 4PC2A 2IEDA 5AXCA 5BNWA 5HIKA 5SZKB 4ZYTA 3UYLA 1J0BA 3F6BX 2F55A 2Q41A 2HT1A 1BS1A 3MJTA 4TTTS 3L18A 1NN1A 1W49A 2C77A 2EJWA 3NV7A 1E69A 1Q0UA 4NY1A 3ADBA 4AO7A 3KPVA 1QF7A 1VDMA 2R1TA 4EENA 1CJTC 2VJYA 1CYEA 1A72A 1W52X 1BQ3A 2RHCA 3A1DA 2CDCA 2BELA 2OZLA 3DOOA 1MAWA 2ORED 3K72B 3O84A 5JJ5A 3AY6A 4A2PA 1UKZA 4OXQA 4C07A 5I47A 5HDBB 3DYBA 1L4UA 4I8DA 3F73A 2RHWA 5KJ6A 2C03A 3N9IA 3RS5A 4KITB 4MPDA 2QZ9A 1QK5A 1JYSA 5KAPA 1L5NA 3REOA 5ILOA 4LSWA 1CUXA 2YL2A 1CFJA 1KY5A 2IH4A 4JOSA 2L2QA 2MHCA 2IU4A 1RJ9B 2L82A 1PZGA 3IBTA 5B1HA 3R9XA 1OXVA 3D8NA 1P5ZB 4OQLA 1USGA 5LP6C 2G82A 1QQAA 4H7JA 1G8KA 3FWYA 4KQKA 4PSKA 2VBIA 3UK7A 1NXQA 1UOOA 2FMIA 1O6GA 1AMNA 1N4AA 4J03A 3QKRA 3TRJA 2WFLB 3PUWA 1UWVA 1W96A 2BR5A 1O3YA 3Q7IA 3QOXA 2IDMA 3QF4B 3L1KA 3QVSA 2ZI3A 1OF1A 1C9NA 1JG7A 1WP4A 2GZRA 2L18A 3F8SA 3HEBA 4NLLA 4PXAA 4WQMA 4AKGA 1YZHA 3AUUA 3T06B 5DDIP 2QIPA 2WA2A 5AUQA 3TIXB 4D9HA 1OXUA 2C00A 3H1FA 4R2IA 1XTUA 5IKPA 3EFOB 4WUVA 1N34B 3DZFA 5JE8A 1IM2A 1PJAA 1F2TB 4TYQA 4DCTA 1ZXXA 3EEFA 3ISVA 3LFHA 2CXPA 1DARA 3QEOA 5DGCA 1S01A 4C03A 4NWIA 3ETGA 3LKZA 5DSTA 5LWQA 3FZQA 5DW3A 5LA6F 1TZKA 3AMVA 3PPYA 3WLEA 2QUBA 2QUZA 3MSCA 3P96A 3P9XA 3VTFA 2JGLA 2Y2UA 2ZRJA 3IJ5A 3WHLA 4UBMA 1L7OA 1TCCA 4WRRA 2JCXA 3DDNA 2G9ZA 1ESMA 3EBOA 4X71A 3W9BA 3S8EA 3R5KA 4HATA 4Y2HA 2HWYA 3L3BA 1GPKA 3ILYA 2A92A 2OLKA 3MJDA 4IJMA 3UUGA 4CCYB 3G0CA 4CPDA 5A1JA 1KO7A 4Z9FA 2O20A 3H6HA 2ODAA 3DFIA 3HB4X 4MAAA 4NOMA 2IF2A 5I7AA 3HACA 4M7WA 4UFNA 1MJNA 1KEEA 4QATA 4O2AF 3QEAZ 3FFTA 1IMOA 2HFKA 1RBMA 4HRAA 4L74A 4ODIA 3AUTA 4NBVA 5TEVA 4DIDA 3GLHE 1XEAA 5CG2A 1ULUA 1ZM2A 2XW6A 3GLHA 1YE8A 4EO9A 4Z1MD 4OJKA 3ZWCA 2KBEA 3QU5A 4EKIA 2BFFB 2PX8A 2ZIVB 3MJSA 1IAVA 4PAGA 1M5UA 2PR7A 1PZHA 4IRUB 1ZU5A 4XSHA 1AU9A 1EX6A 1T2UA 4FEYA 3E7FA 4LUCA 2I2DA 4ESOA 5TEWA 3FR8A 1LLDA 3KR1A 4CF4A 3TEJA 1NM5A 4W5JA 4L0CA 1OZFA 2H08A 1NFRA 1ZNXA 3CTMA 2YINC 3C5VA 1R6DA 1SZJG 1MOQA 3AIIA 3OFJA 3PNYA 3ES9A 5CVDA 1DAFA 3MRVA 4PC3A 2W4QA 3SK0A 3T1NA 1AZLA 3T7CA 4AWXA 2B7BA 5FOQA 3KLNA 2EJUA 2YZGA 1T2AA 1E5TA 3HH8A 2HX1A 2OR3A 4WCDA 5BV7A 2XKBA 3G9ZA 2JA1A 4QDKA 5EZ6B 2YNMD 4D96A 3MLBA 3EPRA 1B8NA 1AE1A 1Z28A 2FCRA 4ZAGA 4BCBA 3P2MA 4XGKA 4ZI3A 4BKPA 4X90A 3FPAA 3FIUA 1FNCA 1LRJA 1JPJA 1MORA 4J7XA 5CVCA 5H4HA 4DR7B 1RIIA 3QPUA 1KDVA 1ZYUA 1EUQA 5CITA 3K2QA 5U4QA 3B5IA 5C1OA 3BPSA 3GELA 4B6OA 2YZMA 4E51A 3D1LA 3TGPA 1E2QA 3CJTA 4C4TA 5I5EA 1EVIA 1MENA 4CV3A 4L78A 1N0HA 1U8CB 3QMWA 1GZ4A 4ICIA 4PNZA 5ETJA 2LPMA 3RFFA 4I3HA 1ZN8A 3SD7A 3SLRA 2ZEJA 2ZYTX 2G80A 4NCJA 3V1KA 1L3IA 4NE2A 2X1VA 1T1JA 3BWCA 1JQEA 4XEHA 2FR0A 2PUEA 4Y2SA 4QPPA 2FK8A 4IZHA 5KKNB 3T7TA 2IOQA 4RFVA 2J0QA 3IP6A 3EMDA 3VA7A 2YWGA 1FTQA 3VSDA 3ENQA 3NDIA 4Z4IA 4P5PA 1VB5A 1O5IA 4C0BA 3EWSA 4WVLA 4K26A 2XXJA 1JLLA 4DIOA 1P39A 4ZI7F 3I6YA 1Z8HA 3NBMA 1RXVA 2F3TA 1SUAA 3EUAA 2NTNA 2OV4A 1E2EA 4ERXA 2QR3A 3HGQA 3AJAA 3G2JA 3LE8A 4Q9KA 3G1TA 4GDMA 4JR1A 4OM8A 1YTLA 3U2QA 1E1CA 4K9NA 1I0LA 3GMDA 5FPYA 3VH4A 2JLWA 3MBIA 4PSAA 2I6UA 4GOXA 5DK6A 2ZRFA 3KUKA 2B35A 2GJSA 4GSLA 1C9MA 1PR9A 4L4YA 1YBMA 3H1GA 4JYAB 5M04A 2A0FA 2QZ4A 3N39C 5JAMA 1XU7A 2H0RA 3BMXA 4L2IB 2ZTSA 1W7AA 3IBFA