3L3BA

Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from ehrlichia chaffeensis at 1.90a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
210
Chain Sequence
b'LNSAVILAGCGHMDGSEIREAVLVMLELDRHNVNFKCFAPNKNQKQVVDHKKKESVGEVRNILVESARIARGSVYDIEQIRVEEFDMLVIPGGYGVAKNFSNLFDEDNDYILPEFKNAVREFYNAKKPIGAVCISPAVVVALLKDIAKVKVTIGELIDKMGGVHVDCPTIKSVKDDVNRIFSCSAYMRNDSLYNVYLGIQDMISSMVNYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Es1 family protein
publication title Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from Ehrlichia Chaffeensis at 1.90A resolution
rcsb
source organism Ehrlichia chaffeensis
molecule tags Biosynthetic protein
total genus 71
structure length 210
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l3bA00
3SOZA 3EWNA 1Q2UA 3UJNA 1WL8A 3SF8B 4WXYB 5SY4A 3TTUA 4XLLA 3NOQA 4L8FA 1PE0A 1P7YA 2R1TA 1JVNA 3L18A 4L8YA 4N0MA 3UOWA 1VCMA 4ENUA 4AUEA 2ZUUA 3B3AA 4ZDKA 1PV2A 1O1YA 1GGEA 3NONA 4WINA 2IUFA 2RK3A 4Y1EA 4OGFA 1Q7RA 3L4EA 4RKYA 1KWGA 3PQ7A 2ABWA 2AD5A 4Y0NA 4ENSA 3FSEA 2ISSD 1S1MA 4GE3A 2YWJA 3MIIA 1KXJA 3OT1B 1IZZA 1T36B 4I2NA 4BIMA 2VDJA 2NV0A 2W7TA 3L7NA 1GPMA 4P36A 1OX4A 2VKTA 5SY6A 5SY9A 3CZ9A 1IPHA 1QDLB 1OX6A 3WFZA 3R74A 1VCNA 3FIJA 4Y1GA 5BV2P 3SF8A 1SY7A 3ZR4B 2OR3A 3N7TA 4UCFA 5DFAA 1J42A 4B2YA 1N57A 3TTSA 2FEXA 4MGHA 3KKLA 1IZYA 1CF9A 1KWKA 3UK7A 1G2IA 1QWSA 3R75A 4ZDIA 1FYEA 2RK4A 4OIFA 5E9AA 4UOZA 3BHNA 3TQIA 1P5FA 2VRNA 1FY2A 2A9VA 2ZUSA 4P34A 5K4AA 4LRUA 4AULA 4ZDJA 1I1QB 1VCOA 3GRAA 4N12A 4P5PA 4L78A 4AJ9A 5LIRA 3OT1A 3EFEA 1I7QB 3MGKA 3UGJA 1CS0B 1KA9H 3UMMA 1C3OB 2VPIA 1A9XB 3EJ6A 3ZJ4A 4P35A 2GK3A 3NVAA 1L9XA 4Y1FA 1I7SB 1C30B 2ZUVA 3TTWA 3VU3A 1T0BA 4HCJA 3P9QA 4JQSA 3EN0A 2D7JA 3P9SA 1GGFA 4ENPA 2ZUWA 1R9GA 1QF7A 2RK6A 5IP5A 4BFLA 2V4UA 1PDVA 1BXRB 4RKWA 4Y1RB 3ZJ5A 4I46A 2YWCA 4E5VA 4ENRA 3TTVA 4UZSA 2YWDA 3R76A 3NOVA 4MNTA 4L95C 3CYFA 4L8WB 5JZMA 4UNIA 2YWBA 3PQ3A 2ZUTA 1OX5A 4OFWA 1T3TA 4OQ4A 1M6VB 4S0ZA 3B38A 4R7GA 2NV2B 3CY6A 3CNEA 4P2GA 4B31A 4AUMA 2R1UA 3P9RA 3PQ2A 4QYTA 4B7AA 3F71A 3EZGA 4B40A 5JZOA 2R1VB 1QVWA 1OI4A 2WJZB 4QYXA 4E08A 2LXNA 4I4NA 3M3PA 4ENWA 4PXYA 4LGYA 3B36A 1CE8B 3CZAA 4K2HA 4ENQA 1JDBC 3NOOA 1GGHA 1P7ZA 4Y1RA 4B5KA 1OY1A 1VHQA 3RHTA 3PQ4A 2R1TB 5SYAA 1GPWB 1SOAA 4BTEA 1ONSA 1PDWA 3NORA 1U9CA 4L7QA 2AB0A 3ER6A 1GGJA 4OGGA 3PQ8A 3PQ5A 1QVZA 3TTXA 4AUNA 3L3BA 4MTCA 4ADSG 4D1YA 1GGKA 1KEEB 3F5DA 3BWEA 4ENVA 1QVVA 3TTYA 4ENTA 4GE0A 1P80A 1GG9A 2VXOA 2H2WA 4GUDA 4ZGGA 4UOQA 1K9VF 1UCFA 2GHRA 2XF2A 3D54D 3P9PA 3TTTA 1OX4B 1P81A 2R1VA 4OJYA 3PQ6A
chains in the Genus database with same CATH superfamily
2C2YA 3V32A 4E5MA 2HREA 1CERA 3I6QA 4R1SA 4X1IA 3OFND 4DAOA 3OIFA 2I4OA 3NDJA 4L15A 3MFYA 4PC3A 3KHKA 4TSRA 5AJHA 1R0ZA 3TSZA 4HEA6 4Q4HA 5AM5A 3DF7A 2NZYA 4O4HF 1SA0B 1ORDA 1C0KA 1L4FA 2PU7A 2RKWA 3A9CA 4ZU1X 2VSOA 5KS2A 1KFBB 3CNNA 1QAMA 4NCHA 3KQYA 4UEWA 5I8WA 1YZLA 3KZOA 1EM6A 1T2NA 1UPUA 2AZMA 4H1HA 3G2NA 3OTWA 4IUDS 4TLEA 2BZ0A 2P4EA 3F1LA 4IUBS 3GWZA 3FPSA 4A8JC 3GUHA 4XI9A 2CV2A 2B4KA 3SIRA 3BHIA 3IFSA 3T4PA 4DR7B 1OX4A 1Y8CA 3QNWA 4GLJA 4K46A 2UYQA 5ALPA 3V9AA 3JQDA 1G8MA 3TUJC 1MMFB 4P1ZA 3MMXA 5E4FA 3JWHA 4CG2A 3CF2A 3ODGA 4UUOA 5L3RA 3FNFA 1CVLA 2F2TA 3TSCA 2OD7A 1NBMA 3BK7A 4YRFA 3VMMA 4B81A 4D6XA 5IK2D 1K1EA 2X5KO 1ORRA 1U3VA 3QFHA 5EP2A 1PGNA 1MJFA 3VPHA 2HU2A 4P3NA 2YYSA 2A35A 1D04A 2QRVA 4G5XA 2NQTA 4S35A 3FUXA 1EX7A 1YZKA 4QUHA 1BA2A 1FPMA 1MDFA 4CUJA 1SCQA 4XDZA 1Z63A 3VGPA 3V4LA 2VLIA 3MD9A 3TLJA 3MPOA 3GQVA 4BL5A 1M33A 4CLOA 4HEJA 5ALTA 3KYIB 1CJCA 2QJTA 1K88A 1NMQA 2WVJA 2ZRIA 2JJ2A 4INPA 4WKCA 5AUQA 1XJQA 1GRCA 1EXNA 5HCUA 2PV7A 3W8NA 1JH8A 1J2TA 1T0BA 4MV0A 4DILA 3E2MA 3GRVA 2ZWPA 3OCXA 3AERB 4QGAA 4C01A 2B8NA 3KLNA 1AMNA 3NHBA 4F4FA 1N75A 4TTPA 2AOVA 1R2QA 2KLBA 4MYDA 2FWPA 5FO1A 3U4GA 1YF3A 2BSAA 2ADOA 3HUUA 3IRUA 4KH1A 5CYFA 2W6ZA 5FOQA 4MRVA 1F8UA 4EB3A 2FP4B 2RHLA 3LPDA 4Q3KA 4DF3A 2WUGA 2C9ZA 2Q2WA 1B73A 3TTVA 3B5JA 1ZK2A 2YYYA 2V6IA 4A5SA 3Q3IA 4BV9A 2AMLA 2H9YA 2XQIA 3MT9A 3IMGA 1IUPA 4OXNA 1L5SA 2BR3A 5G0TA 4CF5A 4OJNA 5BN4B 1ND6A 3A0RB 4FCWA 2IYYA 2B30A 4NNPA 1AKVA 4V3BA 3T7AA 5AJTA 4A8JB 4DADA 2F62A 2Y9PB 3PQ2A 3LDAA 3WB0A 5CT6A 3DTNA 3L7IA 1P1IA 2SICE 3TKLA 1A4IA 1CQWA 1NMYA 3GCGA 2FI1A 3HUDA 4PXSA 2IW3A 4QSHA 3ZH2A 4K6OA 2OZLA 3WICA 1KDZA 1NA5A 1LLDA 1DHTA 3NBAA 3B1YA 2JIOA 4IFIA 2FMTA 3HMQA 1O54A 4IDCA 2WG2A 2WQZA 4UVGA 3TLAA 3THYA 2JFOA 1FBTA 4C22A 1ZOOA 3QMVA 3IJPA 2V6JA 5DVZA 4RORA 1GN8A 4K9KA 2ZYUX 4ZODA 1FDRA 2HRBA 1E9CA 1FFWA 1OA0A 3AHHA 5T6BA 3WL8A 4ZGGA 1YKGA 4UOQA 1DJPA 2J4FA 3C3EA 4KXLA 4J8PA 3UJ3X 1C2TA 4NEQA 5IWAB 1GT91 3G2KA 3H9UA 2J48A 3PQ6A 4XPIA 5E38A 4BNMA 2A1TS 1ZVVA 4S12A 1IWOA 1OJLA 2BH2A 1L1RA 3FRJA 2XMZA 4I1YA 1XZAA 4YMVA 1BMTA 4Y9UA 1G8AA 4IJVA 4X5OA 3BERA 1J97A 2QTCA 1T4MA 3ZNNA 3L0PA 4YMSA 3S7TA 1F14A 1NLYA 1FFAA 1Q7BA 2OLJA 4WKOA 2BGMA 3TQRA 5BWNA 1RZRA 1JQEA 2VHEA 4W5WA 1QV9A 4B7XA 1Q7CA 2L82A 2YXPX 2YZGA 3HE3A 1KYWA 1E79D 1W2HA 3GT4A 3ZIUA 2P77A 2YDXA 3FMFA 5ALSA 4I2NA 4ALLA 3N70A 4P53A 3GA0A 1QH8B 1QHIA 1QNLA 4YAFA 4XVUA 3RUIA 3ON5A 1L4NA 1SVWA 4A1OA 4EKIA 2E37A 2V7GA 3DBHB 5GMOA 1YDMA 1BMQA 4DXAA 3MXTA 4EBBA 1E94E 5D85A 1TM5E 3NGMA 3GDOA 4D3ZA 2Q8NA 3R8FA 3ONNA 4LDPA 4G0YA 1VBMA 4K6HA 1TGVA 4AF8A 4O0MA 1N6NA 2VJMA 2FWMX 1P2BA 1NQVA 4PAGA 3W8RA 4EY7A 1AQ6A 4NZOA 3OH8A 2CZQA 4D99A 4DJFC 4RZSA 1DO8A 2HXSA 1N33B 3QNMA 2QZZA 3KBOA 4PYNA 5CBPA 4RD2A 4ND3A 1CS0B 2E4ZA 1KA9H 2HAEA 2OAEA 2R97A 3BDAA 3KLPX 1U0JA 3VISA 3EJWA 3VR5D 4EBFA 5IF9A 2AS0A 1G3RA 1GZSA 2NX2A 3KB6A 4ROSA 5T3YA 3T1QA 3U7IA 3WGNA 4YMUA 2AR0A 3QQPA 2H48A 4ZMBA 2QK4A 1I4OA 1CQIB 4BVKA 1HE2A 2H5EA 2I65A 2IXAA 2O7NA 1KXZA 5HDBB 2GHIA 3EOBI 3B89A 1V48A 2HLHA 5M34A 2JHGA 4GBED 2CEKA 1QORA 4R98A 3AILA 3RRYA 5B5SA 1SCAA 1FSSA 1TD9A 1OREA 3AZQA 1B41A 4OL9A 1GUAA 3VYRB 1XA4A 3AESA 3DCNA 3G8BA 1O08A 1B6SA 3PX3A 2A1TR 3QKUA 2CXXA 4WFIA 1G20B 3D8SA 2Z98A 4L8WB 4QHYA 3QTLA 4X20B 1H93A 3PHGA 1UZMA 4I5FA 3OA2A 1OBOA 3QUBA 4G4SP 3B6MA 4Q9AA 1OXSC 4RA6B 1P2DA 4L73A 4TL8A 2YBEA 3DDNA 5IXJA 1HF3A 3NHSA 5JAIA 4HFRA 4JXJA 3VPSA 1KVQA 3A9UA 1QYVA 2F3PA 4HZIA 1G7SA 2QN7A 2A5GA 3DE0X 3TE7A 1QPBA 5BT8A 1DNPA 4OHBA 4OM7A 2ZJZA 2BF7A 3SE0A 3UY4A 4KXWA 1FMCA 1G17A 4H7KA 3L7CA 4HAZA 4BTEA 1SKQA 1V11A 4HGRA 1RTKA 1SKYB 4OFBA 3ZDBA 2O0LA 4I55A 1RI3A 4JBWA 2VATA 5ELXA 1U8FO 1JW9B 4N5MA 4PONA 3G6KA 2C8JA 4EL5A 3QELA 1YIOA 1SCNE 2WJ4A 4JUDX 3W90A 5EUMA 3CO0S 1XV5A 4B73A 1MAWA 2XUGA 3IP9A 4C1NA 4BNYA 1XOIA 4RZHA 2BP7A 4FKBA 2C9MA 4I5DA 2FWJA 3L0OA 1Y34E 4J4TA 5E9AA 1RXWA 4BNFA 2E49A 3TBFA 1J0AA 2E7ZA 1FDSA 1X2EA 1NSYA 1XZMA 3U9TA 2I9KA 2I4NA 1UC9A 1Y4UA 3NOQA 2YYAA 1TVKB 3RSHA 4O4LB 2VSQA 5EA2A 3B5IA 4AUEA 3DLBA 1H8ED 4OHYA 2CZGA 1OFIA 3KU4A 2PEYA 1VL1A 4ZN6A 4AS2A 4F7DA 3GLGB 1KI6B 2HK9A 3OC0A 3QXXA 1PEDA 1YZNA 3PJEA 1ZWKA 2XB2A 3F9IA 5CAEA 1P7CA 2FGKA 3K1AA 2P1RA 1PL0A 4REOA 4F2WA 1S9DA 4BO6A 4JBYA 3NJ4A 1CUCA 4MWGA 4NE9A 1V2GA 4EI8A 5A1TA 1KSHA 1W5BA 5T7BA 4B3RB 4UZFA 2DY0A 5B6PA 3G7UA 1D6SA 2ODEA 2PMCA 2WU8A 5FR2A 2H1WA 1XTJA 1U4NA 3MJEA 3QVOA 1JTFA 5EHZA 4PX3A 3QVJA 4YAGA 4RD6A 2A5DA 1Z7BA 2ZIWB 3BSYA 5TGZA 3HXOA 3OM9A 3BRWD 2Q9UA 3GY0A 3PFIA 1VYUA 2MWMA 5HK9A 4UOZA 5A3JA 3FUUA 4ZAXA 5D7BA 4C0BA 5L3QA 5IHXA 2VRNA 3LQQA 4KX3A 1VE6A 5JE8A 4REQB 3JD4A 2FE4A 3AHEA 3I8SA 5JJKA 1Z0IA 2H52A 2AD1A 2G09A 1U5BA 1LC3A 4OJQA 2WIGA 4RPHA 1MC5A 2XT0A 2RAUA 3U7FB 4D8TA 1YU9A 4Q39A 1RVDA 1EWKA 4FGKA 1I7SB 4C6TA 1ISMA 2Q0XA 4KACA 3VUEA 4F4DA 4BFZA 4E1AA 1EFKA 3FHJA 1DUVG 3OX2A 1W44A 4FFBA 1C1XB 4EHAA 1KBQA 2JFNA 1RIIA 2A84A 3H5IA 4JBNA 1O96B 3GFFA 3HBAA 4ZZ2A 2PDAA 3PFGA 4IIJB 4U39A 4AJPA 4AYWA 2FW8A 4PAOA 1EFHA 5BVGB 3HWWA 4KFRA 3OKFA 2FFAA 4QBHA 2GLUA 4HS4A 3NXSA 5E6UB 5KINB 2EKQA 3P7MA 3QXSA 2XZTA 5CIYA 1EM8A 3FCYA 1S7GA 1I4TD 3CZ5A 2CY0A 2XUKA 4GVPA 1ZSVA 3D4OA 3PQDA 4Z3DA 4CTJA 1POWA 2GGSA 1X7YB 5KKAA 2O6HA 4QVIA 4MUMA 4BPBA 5IAEA 1XWFA 3GEDA 3LC0A 2XEXA 4QOEA 1CEXA 5DM0A 1FVOA 1N8SA 1WUIS 4B7AA 2V6GA 4MDYA 4FNGA 3RRXA 4HQRA 4TUYB 2UUBB 3JVIA 4XIGS 2WJZB 3RFVA 1PK8A 1ZKDA 2R5FA 3HKEB 2N46A 1PWZA 2I3BA 4GFDA 3K0AA 1RI1A 1BE0A 3AY3A 1AM4D 4NJEA 4N8EA 4DLKA 2GVZC 1PR0A 3HDTA 4P32A 4AJHA 1OXMA 1M67A 1ZK3A 3DTYA 1M2WA 1SUPA 2C7VA 1SQ0A 4RMGA 3B51X 3WRXC 4CNBA 5KKNB 2DOKA 3R0ZA 5ALGA 3TF5A 4GR9A 1SUWA 3ESCA 1HYBA 3T61A 3TSOA 2OGSA 3HVIA 1X1DA 1TCVA 4WXMA 3WHKA 2DU8A 1ULBA 2C3YA 5EESA 3IPCA 4WN9B 2B2CA 3HR4A 1P2UA 2CE7A 3PCRB 1VHJA 4RMIA 3P1JA 3C41J 3AGQA 1BCSB 2WHRA 1J1IA 3WFIA 3OPYI 5DISB 1Y48E 1JKJB 2G1PA 2RAPA 3ETNA 4OJYA 1E4OA 1SUFA 3LLCA 3RWMB 3SOZA 1SNYA 4I7EA 3AFNA 3EG5A 2QW1A 3MWDA 2HLPA 2PRYA 3QEBZ 2ERXA 4ONEA 1MAHA 1WW3A 3A1EA 1PD1A 1LWOA 2ZU6A 1UIRA 4KQIA 2ZIFA 4DQKA 2FZWA 4YREA 1HE5A 5LPNA 2IHNA 2FSGA 3B60A 3VO2A 3G5LA 1T2VA 3BJEA 5JDCA 3KM0A 4L5IA 1K98A 3FD8A 3I62A 1Z82A 3LKZA 2XRFA 4ZI7F 5D2CA 4C0XA 4BJ1A 1RR6A 1M7BA 3I9LA 5HGJA 5FWXA 2CNLA 4X85A 4KR2A 3HZRA 3Q3HA 2Y1FA 4KWEA 4CTMA 1STOA 3RVSA 1XIVA 3P9ZA 4O0LA 3TDMA 4OBBA 4PLFA 1NQAO 4MQFA 2FSVC 2CXSA 2WMOB 1MG5A 1W9MA 3FMOB 4UM7A 3PYMA 2WZQA 1GUFA 4N4AA 5A02A 3PEWA 1QLWA 1ZGJA 1UK9A 3HWSA 3LBNA 3N3AC 3RO7A 1PSDA 4A0FA 1UBJS 1J8VA 2PXCA 3L84A 1BVUA 1BQ3A 3V1KA 2B1JA 3ZY2A 3M83A 1XTQA 4X6YA 5KNLA 2PXXA 1WBJB 1T8RA 3C6XA 1CUFA 1T1EA 3MJRA 3I5YA 1TJ4A 4ZDWA 1MZPA 2PX0A 1E1CB 5THXA 1FYFA 1QTNA 5SYMA 1CLEA 1P60A 1LPPA 3C24A 3E61A 1EP2B 5E9JA 4NCBA 1QC5A 4GXRA 1FFYA 3OZEA 1Q74A 1R0BA 3JYQA 1W75A 2WP8J 3ABZA 3LVBA 1DMRA 1QBKC 2GN8A 3VGJA 2C7QA 1RLIA 2L42A 3AKDA 5B1IA 1U2TA 1MCZA 2YQZA 2IXEA 3BIJA 3GFOA 1BCRA 2EX0A 3H17A 3IIMA 4G4SO 4HX9A 4QPDA 4UM9D 1KAQA 2QYOA 5F51A 4FZRA 2CL7X 1RU3A 3A1WA 3KYJB 3ZHZA 2ZSIA 4IGKA 3FPBA 2C3OA 2QLFA 1JQKA 3MCZA 4OCZA 1CRPA 5FWNA 1P0IA 1X7XA 2Y9MB 1Q0HA 4U6SA 5KWEA 5KWIA 3MTIA 2PJUA 1PDVA 4NMHA 2I55A 2ZP1A 3RYFB 2AC7A 3DAGA 3MF4A 5CPFA 3WSVA 4AZTA 5HYVA 1M34A 4H7IA 4N3AA 2G04A 1ZITA 2I3DA 1F8GA 1FTYA 1W1UA 4JU8A 5ESXA 3ZLTA 5KOIA 2LR0A 3KETA 3CRMA 5K6TA 1V6SA 2V58A 2QQFA 4JELA 3W8EA 1A50B 1WXWA 4LXGA 4WMLA 4ZC1A 1SCJA 4N01A 3ZVKA 4PPNA 4MXDA 2ZRNA 2FF5A 3NNNA 1NUPA 1P5HA 3ILVA 1JJBA 2VH1A 4ND8A 4R31A 1X7GA 3L2OB 4L07A 1EJ6A 3DFKA 4PFQA 4BNDA 5H4GA 1XVVA 5KNDH 2CXPA 2GZHA 3TG8A 3MOGA 4WASA 1FS4A 3ENKA 4PYJA 3O94A 1E2EA 3DEAA 1TTQB 5TVGA 2QUBA 5JLAA 5EINA 4AZ3B 4D0SA 1EB9A 4I50A 4PFJA 1JHZA 2EW1A 2O3JA 4XLTA 3BPSA 5EGNA 3RHTA 2JJMA 1RRCA 3MHTA 5ARDA 3JQBC 4BMSA 3AEKA 2HMVA 4ED9A 1MOQA 2XVMA 3IVMA 4LDQA 3KU1A 4M0UA 3KWLA 3EUEA 3E0XA 2FETA 2Y2UA 5IJ9A 4DIBA 2VUTA 3KVNA 1E92A 3V8BA 1X94A 1XNGA 2XAUA 4YECA 1NYQA 4V3CA 1ORWA 1QCYA 3ICPA 2HF8A 4KRGA 2AEEA 2A2ZA 4OBEA 1ADGA 2OGZA 1L6RA 4NU5A 5EIBC 4QJ4A 2GBFA 3OPNA 2YMQA 1KQFA 1Y3FE 2LBPA 4UREA 2D54A 2GQ0A 2H8KA 3AFHA 1MQAA 4LE2A 4KOEC 3EPKA 2YMLA 1YS2X 3C43A 4J2TA 3U4MA 3TB4A 1UMKA 3V97A 5IKOA 1RWBA 4URWR 2ZB7A 3HCCA 1CY7A 3AL0C 4QUIA 2W22A 4R5MA 2VDOB 3VPAA 2NQ8A 4G0XA 1FZTA 1JR3D 3G2HA 1BD4A 4G5HA 2ORYA 4PHFA 5THKA 3MWKA 4WBNF 1JFRA 5K0FA 2GJ8A 2OFOA 2I2DA 3EFOB 5HKLA 4AN1A 4D81A 5C3MA 2GCNA 3HJBA 3USES 4O6VA 4NONA 1FMJA 5JSKA 4CMBA 3NW9A 3TBKA 4ETIA 3AOGA 3IBYA 4QYWA 2GJKA 4ZT7A 1ZJ6A 4W8OA 1ZGGA 2XTZA 1B8PA 2I5PO 5AKJA 1PGOA 3JD2A 4BU0A 5MFZA 3U6BA 1US8B 5DNEA 4Y6QA 4S1PA 1VHLA 3GVCA 4BU1A 1TKRA 3ZWMA 4AULA 2G6TA 4G0UA 2G76A 5EHGA 3CRNA 4CM4B 3NV9A 4XYEA 4LQ4A 4ACBA 2I4IA 1UZNA 5D84A 1UBTS 4L0DA 4GICA 4HNRA 4J2HA 1OASA 2DHEA 3K0EA 4LJ5A 4RWZA 4RHUA 2XLCA 4OSEA 2GD0A 2GZSA 5JSFA 4DLNA 2P9ZA 2BD0A 4RA9B 3A2NA 3FR7A 1ODFA 3JYHA 3BEOA 4QO7A 4GEKA 4NCNA 4Z9AA 2CJPA 4UVDA 4YJHB 1ZUIA 2W43A 1SUEA 3NAMA 1Y9JA 4JD5A 3AF1A 3O73A 4P7KA 4YCAA 1VBFA 2YOHA 1GT6A 1FSZA 2GERA 1S2OA 2OQRA 5ULLA 4BFLA 4TMFA 4UEQA 2YOFA 1Z34A 1O6GA 1XVUA 4RKEA 3FA2A 4YWJA 3F9RA 4FPXA 1QYIA 1SUDA 1KVSA 2JGDB 3H7IA 4C0KA 2YHBA 5IHPA 2WHEA 3R3YA 1QZ3A 4HLDA 4TXHA 1VGRA 1XLWA 2I7XA 3HCFA 1NVFA 4O63O 2JBHA 2P3SA 3K09C 5B3AA 4EB6B 4P22A 2WQ6A 1QYXA 2O8BA 4CTNA 5BSHA 1E6EA 2JGLA 1FFEA 1CZRA 4YPFA 1NVKA 3VVBA 3BHJA 1D3AA 2R11A 3PJRA 3EAQA 1YR9A 2EP5A 1J5EB 1OLXB 2YY7A 4Y2UA 2X6TA 3ZWCA 1IZ7A 3R3ZA 1SVKA 2D74A 4BQSA 1OXVA 3O74A 1RP7A 3QPDA 4FIZA 4XD2A 5HFAA 2YIDA 2HY7A 2XWSA 5I6DA 1RRGA 3OURA 5TLSA 5TGTA 3ZY5A 1AZTA 4ETWA 2QM3A 1MV8A 4QGGA 5LDGA 3VTFA 3CJRA 1XZEA 3P4YA 1QYCA 1E63A 1NXVA 3NIDB 3FPFA 2WUDA 3LHDA 4HNQA 3RT9A 3EUWA 3OZSA 1JHQA 1B2RA 2OUIA 2EERA 4G0ZA 4JLMA 2OKGA 2IIVA 3DV0B 4V0MA 5BW5A 4MIKA 2YNMC 4KG7A 4AB1A 4PLVA 3QKIA 5K9ZA 3KZCA 2A0XA 1I3OA 4LQCA 2WC1A 1SU4A 3E27A 4G81A 5EKUA 5TS3A 2YZNA 4BN5A 1PJCA 1XD8A 3P0JA 4GLBA 1ZIOA 4C4PA 5IVIA 2Y1KA 1E8DA 3HCBA 5EJIA 4HAIA 4HWRA 2HWKA 4HNSA 4OHXA 1EGVB 2C1EA 2Q4RA 4TKMA 3V6MA 5L40A 4EATA 1NF8A 2J0UB 3OOSA 1L5FA 4J4BA 4YIHA 1N0IA 1S8NA 1JXMA 4LC1A 4PR0A 3GRKA 3N0XA 4TRRA 4B6SA 4CQMB 1EXDA 1YZQA 3HUEA 1Y8RA 4U3JB 3CRQA 1E18A 1FYXA 2VYVD 2ZBFA 3ESXA 1TYCA 1DTWA 4MB6A 4QU8A 3IELA 2WJGA 3WNDA 1TO1E 4CHGA 4C4AA 4KR7A 3L7OA 2Q99A 4OMUA 4E4TA 3RFCA 4NDNE 5B37A 2FWRA 5CLFA 2IW1A 2ZULA 4RF4A 5D6NA 1IOLA 2XMPA 4BBZA 5JT1A 1RM5A 1ND5A 3DOFA 3ZBUA 2ZTHA 4U7WA 4X8LA 4YHBA 3H19A 3LE8A 2BCEA 5DWVA 3FH0A 2A4KA 3RV3A 3PPXA 2AF4C 1GPLA 1U2QA 1F2TB 2CD7A 2E4UA 2HGZA 4M6WA 3ZDDA 1YFLA 5FA6A 4ZYVA 5LM3A 5CK4A 3DBVO 3I5AA 1N2SA 1PV4A 3JX9A 3NHZA 1UANA 4Z49A 1IY2A 1Z6GA 2AG8A 4H4DA 4R8SA 4XFJA 4YCLA 1WWKA 1D4ZA 2VTVA 4N6OA 4EZIA 5FWDA 2XR1A 5JCXA 5JSZB 3JWPA 3TSAA 1ZIYA 4F9FA 1PFYA 5FR1A 2FEMA 1YACA 1P4JA 4DV0B 1JILA 3FSGA 1SUBA 2W98A 3IKMB 4ZZ3A 1M0EA 1SBQA 5EIOA 1TI7A 2W4MA 2QRQA 1VSBA 3ABIA 2X0NA 5JRDS 1ZCAA 1YR3A 1TQDA 3UM9A 4DMGA 3EDQA 2GASA 3IB3A 3KEOA 3LQFA 1KI2A 3LGXA 1S8FA 3ONVA 3N6RA 1DGQA 1KMQA 4D0LB 1D2NA 4FDLA 2QPAA 2Q0QA 1ENOA 3AB7A 3DEIA 3OQPA 4J1TA 2P2NA 4ZQGA 1EA7A 3QVKA 4W7HA 5EVJA 2XADA 5F77A 2WAYA 2DTDA 1U7UA 1VDZA 2WIAA 4ZO6A 1EVKA 3NVMB 2DF8A 1K92A 4NMMA 4ZPJA 1PQWA 1L0BA 4E2ZA 3LBAA 1KPIA 2I03A 3VV2A 2OCGA 3HRKA 2Z83A 1UK8A 3TKYA 4IOJA 3NBKA 3BMOA 2GFIA 3HY3A 3TQTA 1E2MA 4CL3A 3QE0A 2QI9F 5AUNB 4ZTZB 3VI3B 3D0RA 4GL4A 2X8JB 5BNIA 3CIFA 2CNNA 4DL9A 4HL6A 3PJDA 5K0CA 2Q5JA 3QUCA 2QX9A 1DT3A 3KEQA 1EGMB 3FLEA 2FUG6 1NW4A 3PPWA 4UEJA 1MVLA 2C8LA 3I28A 1JAYA 1H0HA 1QFMA 3PQ8A 2BH9A 5CB6A 5E4JA 4EUNA 2GNOA 3K16A 3G79A 4BE7B 2IYOA 3NUGA 3Q11A 2XYHA 2X8WA 5AKKA 1TCCA 5CJPA 4YRKA 2RHTA 1JT9A 2QVBA 2UVPA 3L8FA 3VHLB 4Q9IA 4FE4A 3R6WA 3RYCB 2YMPA 2PGDA 1PV1A 3UOGA 1ONPA 1U7HA 2QN1A 2DBVO 4H7JA 4DQLA 1C5KA 3CUVA 5BWCA 3VJRA 3SIWA 4YGXB 1RC8A 1LQTA 4D8XA 4KQMA 2WV7A 4BLRA 1G55A 1G21B 2JIQA 3AOEC 4Y30A 1ZUNB 4MGIR 2WF6A 2WJYA 3AKZA 2WT8A 2R6GA 1MX1A 3AVOA 3PQ7A 1UPFA 2YJNA 1ADCA 2D00A 4MKZA 4KLNA 3K35A 1ZD4A 4QOSA 1NG9A 5K7SA 4O4JF 2WSIA 1IY0A 4JI2B 2AKEA 2XOKD 3DFIA 4FNAA 1UM9B 1WG8A 3P2JA 2EKPA 4Z6KA 2G6BA 1QE0A 3UAXA 4F84A 2DH6A 2GD1O 4FC6A 3VZDA 1ZFNA 5FOTA 3AF2A 3PL5A 1CLUA 1HXHA 1O77A 2KBEA 2Y1CA 2ZXEA 3LCCA 4I55F 1S9HA 3BRSA 4CDRA 5BSWA 3ADPA 1FB5A 3ORQA 4L4ZA 3SC2B 3HNRA 4CKEA 1XNRB 4WGGA 1SCBA 4Q18A 3ZCRA 4CV0A 1Y9DA 1G20E 2BKUA 1NOKA 2OAQ1 3AM4A 3ZHCA 5AW2A 4CCYB 3NETA 2HEGA 3FB1A 3C6BA 3ZKWB 4PV7A 5E95A 1C1DB 1EK6A 3C4JA 4NYJQ 3H1BA 2X9LA 4I6EA 1Z0KA 1ZRHA 2NW6A 2Q2VA 4GW3A 4LWZA 1L8QA 1QKKA 1P17A 2B0CA 2R9VA 1J1UA 2SKDA 1SC9A 5JZVA 4GZ6A 4LG1A 1WQ1R 5REQA 1TZ2A 4ZI7B 1MGPA 3PC7A 5E0KB 1BOFA 3BX1A 5LWQA 1QP0A 2JHPA 1Z74A 3LMKA 2G06A 4LJKA 4BIIA 5FTNA 1IN8A 3UWPA 2IPAB 1GD1O 2AG0A 3AFOA 4H15A 2VK4A 4LEIA 3W7BA 4RTOA 2E0IA 1X9HA 1VHDA 1QYDA 4V0NA 1WU7A 4CMIA 4URHA 2YWCA 3AG5A 1SKMA 5JY6A 3TPCA 1UKBA 2ID9A 1FP1D 1T5DX 3EF3A 1C3OA 1ZM4A 2OSVA 3NASA 4UZEA 3WJ1A 2BEWA 4BXOB 3M5PA 1ENZA 2ACVA 1QPGA 4LYDA 4NICA 2NU8A 3VYUB 4DA4A 1MJHA 2CB9A 3GEHA 3M6AA 4QYTA 3LCUA 1H6DA 5GZ3A 2CXHA 3IAS1 1MN6A 2FXIA 3QPWA 3A2LA 4KYTA 5HE9A 3ZHTA 3KTOA 4EYEA 1E7WA 4G07A 1F3OA 1USVA 3DTTA 4GOMD 1E64A 5B57C 2QE6A 2OESA 3UAOA 4IJ6A 5AHKA 1A72A 2VP4A 1DTSA 2G5GX 4GKBA 2HX1A 4RELA 4XXHA 1KU0A 1S2GA 5AOAA 2PNJA 1JPNA 2R1TB 2QT0A 3CMMA 4CPDA 2VQEB 3ER8A 4GM1A 1DEKA 3KAPA 3O38A 2WP0A 1VL2A 3U4DA 3LXRA 3IT3A 1A7JA 1UMCB 1GPH1 2CL6X 2HUNA 2P41A 4NR0A 3I9OA 1MH1A 2PUBA 2C2GA 3KXDA 4BNXA 2N0SA 3N2YA 4R1QA 3ZOZA 2ZSBA 2E21A 3HVKA 3C85A 4NFSA 2P90A 5FL3A 4RHFA 2V7VA 2BGJA 3T0FA 1KMIY 1RBYA 4DKXA 4NC9A 1DC5A 3X1JA 5LLSA 1JHAA 2VSNA 3C3CA 1CYEA 1DDGA 1L4GA 2FZ5A 4V1CI 1XRQA 5FPKA 1H9AA 4OK3A 4MI3A 1P5JA 4LMAA 1R27A 5F3RA 3A6ZA 1C41A 1X8KA 2H4FA 2WLTA 3HN7A 4WXHA 3VOTA 1V9SA 5DX8A 3NIGB 3EQZA 3SN6A 1Z4OA 1RRPA 2P2ZA 3AJ8A 1HV8A 4GDFA 4S2UA 1UMDB 3UB4A 4B2PA 1NUAA 4BQNA 2XMBA 1CZHA 4CMAA 2VDJA 2NV0A 5DMXA 2JLQA 5BN3B 4IXDA 3A1DA 4QKQA 4RTJA 4AXBA 1PFKA 2VHXA 1A76A 1OXTA 2FB9A 3QXGA 3ULKA 1J8MF 1QCCA 4J7AA 1U8EA 3MVEA 4TZ0A 2C4NA 2IPLA 1CIPA 2JEYA 3CW9A 3UH0A 1AOXA 5FL7A 3FGOA 4LFAB 3MOIA 2BFCB 3K1JA 4MR7A 5L3ZA 5G0VA 4DIEA 5JAUA 2JJ1A 4DV7B 4PCVA 4TTSA 2EQ5A 2QP4A 2X7JA 2GUWA 5ED0A 1T8WA 3V80A 1FNCA 3N59A 5IDXA 5H1YA 2XTMA 1H2AS 4KFCA 4U9HS 3UUWA 4F91B 3MQFA 4WN3A 3GJRA 2O48X 2R751 3NT5A 5DW3A 1E5LA 4OAPA 3MCTA 1SG9A 1RPNA 3ITEA 4DJDC 1HI9A 3U0BA 5EIBD 1RMQA 4KMMA 3F8TA 4AI6A 4I6GA 4YJFB 5MFPA 5JNUA 2X1VA 4OLBA 1XEXA 1CJTC 4C7VA 3ZWPA 4ZGWA 3U4IA 3KXIA 4GL2A 4WBNB 2D4HA 1KJYA 2P69A 5DXAA 2DKNA 4ER7A 4ZEVA 2BHLA 3CM0A 1KF0A 3I9V6 1BIFA 3KSMA 3LO5A 1OFHA 4I46A 1NW7A 1DFHA 3DA8A 4RPGA 5F1YA 2ZPUA 1FE8A 2GVDC 4LJSA 4W4TA 3KTDA 1TM7E 1XXHE 2HIHA 3QMPA 5CW1A 2HO4A 4LZAA 2H1CA 3OEHD 4C87A 4KE6A 4TTRA 3ZTWA 5F7OA 4RPKA 3ZHUA 4NAUA 3DONA 3L6UA 1TJYA 4X00A 2GLXA 3F8SA 1QCDA 1T3GA 1PZXA 4ALKA 2B25A 1AB5A 4Q24A 2WTMA 4R2IA 4EAQA 4AMYA 5AFSA 1JEQB 1J99A 2JLSA 3D6HA 3NAZA 1CUZA 1S7CA 2WF8A 4DARA 3HU2A 2NIPA 4X1IB 4N8DA 4YNBA 3T1YB 2DKFA 1X1AA 4ZD6A 4OQMA 3V4RA 3DBRA 4HNAB 3WK6A 1RWKA 4KRFA 4NPCA 5JU6A 1OV6A 4Q4HB 1CP3A 3QMMA 2H7XA 2WQ7A 1TA0A 1E0SA 4FGLA 4J4HA 2VTKA 4XKJA 5BR4A 5F1OA 1FUEA 1GNPA 2J3DA 4O08A 3UMGA 1OLSA 1ZRNA 2OC4A 5DYGA 2VJCA 3C3YA 5EHIA 1ACLA 3IUMA 3TTYA 1D5CA 1Z75A 2VXOA 1EAYA 5ECYA 4OSPA 1OA1A 1PJAA 1H0RA 1OX4B 3P2YA 3DTVD 4OHUA 4WOCA 1JJ7A 2I4MA 5KU1A 4ZI2A 4X1KA 5TF4A 4CQMD 5ILQA 1QH0A 3A58B 4JR0A 4MKIA 1FUIA 4CDGA 3L49A 4GLOA 1YS1X 3B9RA 4YCMA 1OWNA 3WHPA 4MV7A 3OTOB 2BR5A 5FAXA 4CF4A 1AZWA 4MVXA 1CUJA 2G88A 1KDOA 1U90A 4MVJH 1A88A 1KO7A 2QRVB 4M0FA 4MUIA 3DYVA 1MQ9A 5H9WA 4WBSA 5AVXA 1WSDA 4KAJA 2P9GA 4RD4A 4OJMX 3UMBA 2A0YA 2ZT6A 3GD5A 1KH2A 1N32B 4NZMA 2WEKA 1ZJYA 5F9MA 3S2IA 4I50F 3ANMA 4CLOB 3ANXA 2P6MA 4TYQA 1IVNA 3K8ZA 3I6MA 2D0IA 2C5SA 3KKKA 3EA0A 2PMKA 3AK4A 2O0JA 3Q72A 5IZ4A 1NXSA 5BSFA 1V3VA 3MTQA 4JB3A 5HKKD 3V2HA 1GKIA 3O3OB 3G2JA 1QWSA 2O0MA 1QHYA 2BHRA 2BM0A 3WS7A 1NKSA 1NYTA 3OBBA 1SC6A 4OG2A 4BP3A 2BGWA 1GYQA 4JGIA 2BFOA 1I1QB 2XQKA 3AL2A 1XEWX 3IOCA 3PXCX 4MS1A 4EG1A 5ALNA 3MWEA 1UC4B 5JAOA 5G02A 2I4RA 2YNMD 1Z5GA 3DHVA 2Q1YA 4CF3A 4DR6B 4CW7A 3KVRA 4EKEA 4ZYTA 1T9DA 3BIOA 3F2VA 4V0KA 3T5BA 4AKTA 2I6QA 2K6GA 2G80A 1HDRA 4ZYWA 1V4VA 3B1FA 3LFTA 4GXTA 5AVKA 3UHAA 3V55A 3GA5A 2QI9C 3BJIC 4QULA 1HLFA 3WLKX 2OZLB 3BJZA 3ZU2A 4DNFA 4I0WB 1RLOA 2J67A 3N28A 4LOIA 4NAVA 1WP9A 1ZW6A 3F2IA 1E2IA 1I5EA 2VHCA 3BFPA 3Q10A 3RC9A 3CU5A 1R9JA 2NAFA 1P8JA 1NF9A 2QS9A 3THYB 1Q0ZA 3LUPA 4TX1A 1AKRA 1XBTA 5EIWA 1DWOA 1JG4A 3LF1A 1WXXA 2CXUA 4S1WA 2Z43A 5L4SA 1BN7A 4Z54A 3PUYA 2CVZA 1PKEA 5B6IA 1G41A 4XPIB 1CEYA 1IOWA 1H1DA 2PEZA 3L7DA 2ZE7A 1RMYA 1ABBA 1V8BA 2JD1A 1V45E 3HJUA 3WNQA 3H9BA 4ENQA 4GOOD 3S99A 4F9GA 2ATEA 2GESA 5JC8A 1V3QE 2QM7A 2ZI9A 3LRPA 3T3NA 1PJRA 2VUIB 3HCAA 1OAOA 2ZIGA 3TQHA 4F6LA 1Z2NX 1P29A 1A5BB 1GGKA 1NRXA 4ZT3A 1SO8A 5EMKA 2HRQA 2X2PA 2A4MA 4ZWNA 4B76A 5I4KA 5FB3A 3EA5A 4BYGA 2B2NA 4IR7A 4J0HA 1NVEA 3VJMA 4A15A 1XO1A 4HWTA 4FZVA 4MWSA 4WOJA 3RYIA 2DC1A 1WB4A 4DR3B 3FTEA 1F12A 2JCVA 2GWRA 2PWYA 3DZIA 3F74A 1BZYA 1DJQA 2JFQA 3BE6A 3CR8A 2H54A 3A9RA 2G70A 1HFJA 1SBNE 3IMEA 1T1JA 3KTAA 3GFSA 4R6XA 4PIPA 4ZQBA 5JFGA 4M8KA 1B6GA 1MJGA 2LIPA 3K1ZA 1OE0A 5LQMA 3SS9X 2QU7A 2VJMB 4JENA 2QA5A 2I34A 2NXNA 4GI1A 3PRJA 2W2KA 3MXOA 3M4JA 1LJUA 2BYTA 4R2LA 4JP3A 2Q1XA 5CBPB 4LISA 2QP9X 4DCTA 3WV5A 3RAGA 2OG1A 4OIMA 4WKGA 2ZVPX 1H9CA 4ZEMA 1TUIA 4TKZA 1F51E 1E3EA 3LP5A 4L22A 3VDRA 2WAAA 1QFXA 4P3KA 1KARA 2W6QA 3DMNA 1DAPA 3FWPA 1NVGA 3P9NA 2CCKA 3EK2A 1DB3A 3ZK8A 5CXUA 2FMKA 1XGKA 1JKXA 2R2AA 2VAXA 4MIYA 4RXUA 3TNLA 4WCFA 3EVGA 2VPWA 1PT5A 1TECE 5FOVA 4ECEA 3SIPA 4DA0A 3SEAA 3P9CA 4IEFB 4LVCA 5C8VA 2EG5A 1MAVA 3AESB 1JEEA 2FPUA 5HS6A 5FI5A 5K3OA 5H68A 4RGBA 4OK5A 3TL2A 1HLDA 3ZJ4A 3MBOA 3KXKA 5IT0A 4BMNA 3QKTA 1AVTA 1Z35A 1DBIA 3RRMA 3U3OA 3O4HA 1QJCA 4IF4A 4O3MA 4IDBA 4UNSA 3VX4A 4XWOA 2R3SA 1CJMA 1JRLA 4QM7A 4DLWA 1KYYA 4CM7A 3G89A 1J90A 4ZCQA 3SSAA 2A88A 4OHKA 4EG8A 1CZKA 4JGBA 5K2OA 3ZD7A 3PUJA 5B1HA 1NRWA 3TEMA 2WJ6A 2CLMB 5GPBA 2ETXA 2CKMA 4NE2A 4YAIA 2YXEA 1V11B 2GLTA 5EN4A 4X6LA 3QWBA 4I55B 3CEMA 1XTUA 3D6UA 4H6VA 4WHMA 5EPOA 1U2EA 2DBYA 1Q0TA 1DCTA 2PUAA 2H29A 4H60A 4PS1A 5K0GA 2G0AA 3QELB 3QSYA 3SK0A 2ZRJA 1YT5A 2P68A 1SPBS 2F43A 2V7TA 3K92A 3PPVA 1I7DA 2I4LA 1EFAA 4US0R 4B2LA 4MLDA 2BP7B 4RFSA 1JJAA 4KAAA 2F9FA 3PNQA 4I5GA 1KZHA 3CGGA 2V6FA 1X9IA 2G4VA 3GIWA 3H18A 1LDYA 4X1OA 4G5SA 5JAQA 4BNGA 5C81A 3I53A 4JLPA 1XI2A 3PDCA 2R68A 3C5CA 4Y1RA 1W4AA 5A4AA 2C3PA 1NW8A 1YZGA 2LD4A 1C7FA 2A3NA 3CFYA 1WAMA 2WA2A 3MQ2A 2VC2B 2HO5A 1JR4A 3OI7A 3TEFA 3NFYA 3DV2A 3PQ5A 4RQUA 1EXVA 2FDCA 3H8JA 2BF4A 3T1OA 2O7RA 4H0FA 1D0VA 2PFKA 1K0FA 1YSCA 2JI9A 4I1VA 5CAEB 1KAEA 1I01A 1ZU4A 2KB0A 3K1AB 3NTQA 4Z7JA 3KL2A 4J94A 4C0QC 3E5NA 3FFWA 4TWIA 1I13A 1LFAA 3FWHA 4KW7A 5F33A 4NCJA 3TM5A 5A7FA 4P4SA 4PNZA 1X1BA 2E4YA 5JARA 1GG8A 1RCUA 2GK4A 4M1ZA 3EARA 5L4NA 3GJXC 10MHA 1NF2A 4YJ2A 1JWLA 2OP1A 3BICA 2YXBA 1I4WA 1MO5A 3I23A 3NDIA 3PEEA 4JJKA 5E1OA 4K9NA 4I99A 3J81k 2HLDA 3CN7A 1SUCA 2IVFA 4CIVA 1Z0ZA 4AP9A 3BOSA 3F96A 1BHO1 3LC7O 4W1PA 1NMSA 4BX2A 3L7YA 3LX6A 2NXEA 2XOEA 4KGZA 4AF7A 4CIWA 2C77A 1P4SA 1IBSA 3VR5H 3VBEA 5L3QB 3DBOB 3HFRA 1OROA 1ZX1A 5HM8A 1KY5A 3DMYA 3G2MA 2V7UA 2Q6LA 1IHPA 1RIFA 3O9VA 3Q15C 4J07A 5LYJA 4AN0A 5LKRA 2I2BA 1U5BB 3ZE1B 2PL9A 1W47A 4GNKA 2NO0A 2QMHA 3REFA 1NLMA 4C6TB 3QOXA 3NIFB 4DTIA 5C8DA 2AW5A 2O5CA 1UOOA 3SEFA 5JJLA 1EA5A 2AW3A 3EDOA 3RCBA 3QYPA 4FFBB 2EF1A 2FEXA 1IJEA 3AC0A 3NRJA 4GI3A 3UGKA 1EWYA 3B3FA 5JDCC 4G8CA 1DIGA 4A2QA 1YJQA 3ZJYA 4M1TA 4Z1MD 1GZVA 1U0EA 3F1KA 4KGXA 3AF3A 5AOCA 2A94A 1YDGA 3ADDA 1SD1A 1G16A 3BGOS 2C2XA 1XZPA 3PUXA 4WRRA 4AS3A 3U44A 1VL5A 1WCV1 2BWJA 2YV2A 3BM5A 3DXXA 1I4DD 5KOJA 1I36A 1JDJA 3PWTA 1FQOA 2WA1A 4TKLA 3Q6IA 1P9LA 1RXYA 5LNK6 1F20A 2ODPA 3EOAI 4H7FA 4HWPA 3GGCA 1R00A 2RHWA 4K9SA 5DB4A 3GLKA 4U63A 3MT0A 3NHJA 3P9QA 4GX0A 4JJ6A 1UJMA 4NZYA 1ZC3A 1HTWA 2J9XB 3N6XA 3QI2A 2QN3A 3O2SB 4WY8A 1XAIA 1QF7A 3D6MA 4BO3A 4NJEB 2IQ5A 3K0AB 4GPZA 3TCKA 3ANTA 5EFOA 1SEPA 5ALIA 4J3NA 3ZJTA 4R6WA 1M83A 6YASA 2J3MA 2IHVA 5DHAA 2IYPA 3T3MB 1T9CA 1TO6A 1XTPA 4I5EA 2CK3D 1WXIA 3QHPA 1VMIA 2FZCA 3MILA 2RGDA 4KN8A 4MUYA 1ZGCA 3B13B 3A28A 4IOKA 4OHPA 4S0ZA 5IS2A 2AFRA 3VH1A 1IMOA 4ZT6A 4Z0NA 1URPA 1MB9A 1NPTO 2HNAA 1PW5A 1L7MA 3EISA 3LRXA 3W9BA 1G21E 2VF8A 4I1RA 2JJ8A 1UBUS 3U60B 3KUKA 3CEAA 3MWDB 4LY6A 4OYLA 2RHBA 4MS4A 2GBLA 2PWAA 1PUJA 4A4DA 1OY1A 5C8ZA 1DTEA 2FVXA 3D3KA 3KYBA 1RLUA 2PWBA 4IRUB 5T64A 5CIWA 2UXDB 1ZUHA 4F0JA 5CITA 3VH3A 1P74A 2DFVA 3DFZA 1D2HA 5P21A 1VKZA 3P52A 3M5WA 3H11A 4MVJG 3IUQA 2XNHA 1Z37A 3WP1B 2YZ7A 1DZ3A 5FWXB 4DBLC 3U39A 1VL0A 3K4HA 3O31A 3LKBA 4CU2A 2WTUA 2PSEA 1M8GA 2XI4A 2ZCVA 4F2GA 4MQFB 2PVSA 2DHDA 1NBMD 3HEBA 4FBMA 4QNNA 5B3KA 4IDHA 3WIEA 2WHYA 2YZKA 5EZ6B 3COPA 3BRCA 3F3KA 3EB9A 3SVTA 5HG0A 4ZQIA 1RRVA 3HGQA 1G2PA 3FBGA 1VB5A 2I6XA 2QZJA 2EJBA 4TQUS 9GPBA 4E6PA 5KZMB 4F12A 4DC0A 5MN6A 2KJQA 4MYHA 3FSEA 3WWDA 3ORRA 3IR7A 4FS3A 3EGCA 4EI7A 1SIUA 4YCNA 1U81A 1E66A 1LDMA 1ZA1A 3PE3A 3V8MA 2QV7A 3ESQA 4MVJP 5KWVA 4B7CA 3ZV7A 1HFEL 2PGNA 1BCRB 2HF9A 4CIDA 4PU0A 2X86A 1K6JA 2UYYA 4EHFA 2I3ZA 1WPXA 3EC2A 2JGKA 4YLEA 5F2EA 1JEYA 2P9JA 1EG2A 2PGXA 3SBOA 3FWNA 2MCFA 3FMPB 4H1VA 4DEVA 1X7XB 1UQRA 4RJ2A 1ZM9A 4RHXA 2YRXA 1M34B 1PS8A 3HDVA 4MI6A 5CYOA 4N12A 1QR6A 2DFPA 2QTZA 4G4IA 3TN7A 1NKVA 2WM9B 3F8WA 4JLOA 2F55A 2B0JA 1F2DA 3I9JA 3MELA 3R0QA 4IGIA 3BA1A 1S01A 2ECPA 3HYNA 1UBRS 2DFNA 2QX6A 4JROA 4UAGA 3AUTA 3VZPA 3CIOA 2PVCA 3AJRA 3DKRA 4Q9DA 4XSGA 1EJ0A 4BRSA 4DBZA 5AVRA 3IERA 1Y98A 2Z3ZA 3KZNA 3OE4A 1ZXBA 4PINA 4BPRA 5JYEA 2DULA 2P67A 4ND8B 2IV3A 1EBBA 1TEVA 4K3VA 4R1UA 5J40A 4BNDB 2K2QB 4UBMA 2VK2A 1YQDA 2Y0EA 3HDYA 6PFKA 2J1LA 1S3GA 3IDFA 1MT0A 2HQ1A 4EY4A 4RD3A 4I50B 3UHOA 5BURA 3D6VA 3NH9A 4AK9A 1GO2A 1GYRA 1HOTA 2FAXA 3DEZA 1PZHA 3D8HA 4FD3A 1WUKS 1WMDA 1WU8A 3IR5A 4QOHA 1XHLA 5FYQA 3AEKB 3D64A 3IEPA 1NJ2A 4HAOA 4EJ0A 3H2HA 4E12A 1GL3A 2VDQB 2OA0A 1NFFA 3P5SA 4YWHA 4K03A 2FHPA 5IJ9B 4NV0A 3LUBA 4WZAE 1LDGA 1M3SA 3LOUA 3MFQA 1EFTA 4Z4QA 1FLVA 3M6VA 5C32A 4YR9A 4FONA 3VOAA 1II8A 3SR3A 4HEA1 4JVMA 4QDOA 5LN1A 1ZBDA 2QY6A 1JIQA 5FFMA 2HQBA 2VHUA 4JGGA 1EQ2A 1NJ6A 2O05A 5JAZA 4Q9KA 3I45A 1F8YA 4IXMA 3ONDA 4Q3CA 3HJCA 2FLVA 1RZRD 4TMYA 3ANYB 1NUHA 1RHJA 4QRHA 2Y93A 2BHSA 1SC3A 2GCPA 2E4VA 1BKDR 3AR9A 5B7NA 1CJSA 3SIXA 4BHTA 4D96A 2O59A 5KSPA 1J5PA 4PSDA 3S70A 1N6IA 3K2QA 3P9IA 1AUXA 5BV1A 5DULA 2F1IA 1Z56C 2FMHA 3FYHA 1E9AA 1D6MA 1NSFA 1YI8A 2HIMA 4WT7A 3T9DA 4W5QA 2JGEA 2FN4A 2VWQA 3NQ41 3D3JA 2AK3A 4I4CA 2KLHA 1JWAB 1RFGE 3S6JA 4LBZA 4XQGA 3QLVA 1W4CA 4DUYB 4E46A 3DZJA 3G85A 1P0QA 2P5UA 3A4VA 5DK6A 5FULA 3NMUF 2OGWA 2J9GA 4RULA 4IY1A 4F4CA 1ZW1A 4JKOA 2HN9A 3QVWA 3NX4A 5K03A 3UMVA 2G71A 3TR6A 4PLTA 4UUBA 5KJCA 4ZVTA 2VDVE 1E3DA 3ADKA 3VHXA 1AK9A 3ED1A 3JQ9C 4TZTA 3H42B 3RSZA 1FVHA 2C2BA 3UW3A 4LRXA 1MXFA 2J0VA 4L0MA 4X71A 3LT1A 4MQEA 5DNYB 2FN9A 4AQYB 1D2CA 3HDGA 2VQFB 4MQMA 4E4RA 4WJKB 3W9UA 4IX1A 2QM8A 1N2CA 3RADC 2IP4A 1X14A 2AJTA 3ZWYA 5HF8A 2PV0A 2QTRA 3AHFA 4PC2A 4OP2A 3VSCA 4NBTA 2HQRA 2H0AA 3N2ZB 2VT2A 2ZIVB 1JHOA 2P8JA 1J49A 4MR8A 1G8FA 1NUSA 1LV8A 4MTLA 2BFBA 2AC2A 3P8ZA 3WDKA 1ORIA 1JN0A 1RE1A 3N2LA 2WPDA 5TE9A 3WDMA 1MPXA 3FI0A 3VVMA 3JVVA 4A1FA 2HHJA 4PFSA 2E1PA 3ZBQA 2WPNA 4QUBA 3DEHA 1BGWA 2F3UA 1FQKA 2VTEA 3N58A 4R0MA 2XKJE 3QTTA 2P1ZA 2O8BB 1EFVA 1HDXA 2ZRCA 1ISPA 4J0KA 2YV5A 3IMKA 1OZGA 4JBLA 4J3JA 1IHOA 4INAA 4NOKA 1UZUA 5J4YA 4BO5A 4S05A 1USGA 3BUSA 4OYRA 1GLVA 3H1EA 4QDTA 4D43A 2PLAA 3IAM6 4A73A 5EKXA 3LT0A 2MSEB 5KWSA 1CJBA 4O8ZA 3HA3A 4IQ4A 2XUQA 3IYLW 3U19A 2GXSA 4ZRDA 3RWBA 3ID6C 2ID7A 4GO1A 5IM4A 5AJYA 4EMSA 2ONYA 4M37A 2OFPA 4MLZA 1NJGA 2BDEA 4OP3A 2XDQA 2XY4A 5J63A 3HKCA 2CDNA 4M8LA 2ZAYA 2VWGA 2DUNA 3S1AA 5E7QA 1R3UA 5KCZA 3QPVA 3E5HA 4LWOA 5HQ3B 4DJAA 3U09A 3WRYA 3U3KA 5E2BA 3PFKA 4EQ6A 3I42A 3IIKA 3D43A 1CZLA 3FUWA 1KZ6A 3ZW9A 2FFJA 5HHTA 5JHHB 5F7XA 2P0AA 4MAFA 2X3UA 1YDFA 4UQLA 1M6WA 2LRHA 2BLLA 2XYPA 3NTOA 4MVYA 3EEIA 5A05A 1T5IA 1UK6A 1M1YE 2WRZA 3INNA 1ZD8A 3COZA 3G0BA 3DVSX 1X7DA 1XDSA 4J1TC 4OQPA 4R0VA 1WDMA 3A3OA 3QY9A 5ALXA 4XQ0A 5AP9A 1TIBA 4Q12A 4B3BA 3DXYA 3WGYA 4QGHA 1PEYA 4TTAA 5FX2A 1YFZA 2E55A 3A04A 4RESA 1JNYA 2TMGA 4NZNA 1GFZA 1Y8RB 2NACA 4DC9A 1H2FA 5LMUB 3IVXA 2WD7A 4QPJC 4CMGA 1DTWB 1DXHA 2X5XA 1MEEA 4CLHA 1DHRA 2JC3A 3S5UA 2Z1MA 4NMWA 4X63A 1FMTA 2HLNA 4UNQA 3SYKA 3W5BA 2ZR0A 4NYJR 2Z3WA 3LUKA 2WU4A 3TH5A 3D7SA 3ZCVA 5AVUA 4RVHA 5KQMA 1RHQA 3ROFA 2EARA 2P9HA 5LP6A 5B3JA 1CF4A 1E3TA 4IIEA 4D56A 1A95A 3ZJVA 1KFCB 3A27A 3GN1A 2JFZA 3AW8A 3P27A 4LA4A 4RYLA 5BPHA 3M5CA 4U7FA 3JZAA 4M6WB 3DAFA 3W5VA 1VGQA 3I9MA 3WWYA 3FFBA 2IH2A 2H2DA 1ZVMA 1ZIXA 2W9XA 1LY1A 1HDYA 4R41A 2WVAA 5LZ8A 3T7IA 5K6RA 1L1FA 2O5EA 3ZXXA 4DLUA 1XU9A 1I2MA 4OQDA 1IY1A 1V8ZA 3SQOA 4DIKA 4KI0A 3TMYA 3T7RA 1E6WA 2PR2A 3FAZA 1XC7A 2VNAA 3C0KA 3GQBA 3ILSA 4YIKA 1KYVA 4J0FA 1L5KA 1TUGA 2HWYA 3EC1A 1B0PA 1QV7A 3INGA 3N1UA 1XQWA 4K6CA 4P86A 1A3CA 1ZN8A 1BWRA 4PTLA 4FYHA 3AF4A 2RHRA 4DQDA 1WD5A 3DZHA 1M10A 1ZLYA 4DSTA 5BP7A 4GKVA 5GVSA 4P54A 5EJ2A 2GEJA 5L7YA 2YC4C 3O4VA 3QM1A 1BN6A 1L5HA 4EUSA 1SG0A 5CLJA 2ZOSA 3MLBA 4IIVA 3NH6A 1KNXA 1SB9A 2JGMA 3WY9A 1NPDA 1RACA 1GPKA 2WFLA 4BMZA 1YGYA 2G36A 2W58A 1Y3AA 4GDMA 4Y2YA 5CM2Z 5EJ7A 3VR6H 2QRLA 3E3OA 4B17A 1UADA 1QRAA 3IUEA 3SQWA 1PR6A 3DLHA 4DXHA 5GIPE 3PFNA 1YQQA 1U8CB 4Q9HA 5IANA 1L3CA 3G1TA 2GZ3A 3BMOB 4RENA 5I7EA 1ZQ9A 1QP8A 2GYVA 1JIXA 1YAJA 3R5TA 2J41A 1PTJC 3HCRA 3TGWA 4A6DA 5DRTA 3AXTA 4ZT2A 2BONA 2JH9A 4JI5B 4KXUA 2CFOA 4J03A 4MOWA 4JJEA 5I7SA 2COKA 1UC5B 5EWMA 3M81A 5AW9A 2DM6A 1U0GA 4DV3B 2XLBA 5CT8A 5EVCA 4A6XA 5I4BA 3P5BA 2IYLD 2J7KA 4X84A 1YWGO 1K27A 4QAQA 4TV9F 4UVIA 1OT5A 1PLJA 1MV5A 1QAOA 1VRWA 4QXRA 5KQLA 5TDHA 3CVUA 1JSLA 2YRWA 3IDZA 1CUYA 3QUAA 4M89A 5THQA 1Z29A 1ZCJA 1I10A 1C4OA 1PGQA 4BCCA 1M74A 3SS8A 4UUNA 2UVPB 1N8KA 5CH3A 1ZD3A 5FBWB 1SC1A 2W6CX 4GMDA 2NGRA 2R6HA 3LP6A 3JTEA 3LCJA 4OATA 3SYLA 2ZIEA 1FW6A 4MRPA 1RE0A 2QN2A 1QM5A 1UBGA 1C14A 4IIYA 3UQZA 3AI2A 4LMBA 4LGYA 5PGMA 3ROZA 3ZW8A 5JNSA 2LIVA 1GP2A 4JLVA 4JJIA 2XNKA 1W5EA 4ALMA 3BD6A 4ZI3A 1GV1A 2PANA 4XWKA 4KTVE 1GCUA 3UJ8A 4UFNA 1AHHA 1W30A 1USUA 4WZBA 4WNIA 5F4ZA 4HH1A 4ZICA 2WU0A 4Q3AA 4JCCA 3O2QB 4JHXA 2ONZA 1SQ5A 3O4GA 2ZT7A 1W35A 5JFOA 5I5EA 4LJ8A 4QVKA 2R8RA 1YUMA 4QJIA 4RGVA 1HR0B 3MCVA 1Q21A 1TKCA 3W1VA 2EGUA 4LZNA 4DBVO 4UVHA 5FUMA 2DFDA 4KK3A 2DYKA 2XPCA 4Q7MB 3BH0A 3T0IA 1T3ZA 2M2IA 5I9NA 3PNVA 4RJIA 4YUXA 2WIKA 3WWCA 4EPXA 1SBZA 3CG0A 3SOPA 3UANA 4AYTA 2OEPA 3BL6A 2VPQA 1X7WA 1DRUA 2AQKA 1Z4KA 3AX6A 3T3DA 4CKEB 4YPOA 3L46A 2WU3A 2ZQYA 3QFRA 5DPMA 4Y2PA 3UK2A 5TQ0A 3GP5A 4D57A 2W70A 4FFWA 3Q3JB 4L1KA 2H00A 8ADHA 3KX2A 4KR0A 1HLPA 3JD3A 4Q1BA 3E9RA 3I12A 2QPTA 5CGQB 3NBXX 2Y1EA 3PG5A 3FTCA 4RK6A 3V48A 2X23A 2GAFA 2XOXA 1QOZA 1CB7A 2NO4A 3WFZA 5CUQA 4HWOA 1GSAA 2ZBVA 5IBCA 3SNHA 2EOAA 2E82A 2FX5A 2ZRLA 1HMPA 3H2BA 5DTIA 4BB6A 3AR5A 2Q5OA 3R0JA 4B85A 1CW2B 1HSZA 3QX9A 1KSFX 5REQB 1HDEA 1UT5A 2H1FA 2W6IA 3NBQA 3BQNB 3LU1A 5C3UA 2XWPA 4KAFA 1YFJA 1ZZGA 1CUDA 3I64A 1VLVA 2JHCA 5AW5A 4D3DA 1PLKA 4XIJA 4KQFA 1Q2XA 1Y4AE 3D2LA 5C51B 2PAFA 4IJQA 3RSFA 4IDQA 4JJ4A 3FNHA 4CMIB 2XJ4A 3BG5A 2ZW9A 1LF0A 3EFEA 4YJ2F 3WI7A 3T7SA 5BNZA 2OHFA 4MHSA 1C3OB 1L3IA 2BT4A 5A0VA 3EIFA 2BEWB 2PU5A 2R62A 1U2PA 3FCXA 5KTPA 2WW8A 4HDQB 2CVQA 3A3NA 1TKAA 5CIQA 2PVPA 2JZCA 2IZZA 1OBVA 2PSFA 2Q41A 2IUTA 3KVOA 2NU8B 3TXYA 5FEUA 4D8WA 3ZDFA 3ZV6A 4JOCA 2WABA 3CC8A 2LWIA 1OH5A 1M75A 4A2PA 4O2RA 3RK4A 4W82A 1K9SA 3ETEA 2VDNB 5COBA 3ZWNA 1PNTA 2VBCA 1A69A 1IUOA 3W06A 4DDMA 2CKDA 4F11A 2R8YA 2JKYA 4YXWA 1XNJA 3QWFA 2CSXA 3BYZA 3U81A 3ZIDA 3N7UA 3ZCSA 1EWRA 3HB0A 4MUAA 2OHGA 1WXDA 3OJ0A 4DQ0A 1K4YA 5B2EA 3ZU6A 4DM7A 2QRMA 4RLSA 1IBLB 5ALDA 3EWIA 4TVKA 2CLHB 3DWFA 4BECA 5T8KA 3B7PA 2GM4A 4FGSA 1C8BA 4DQXA 3TLEA 2R4TA 2GNPA 4X0EA 4B45A 1SHLA 2GBIA 2GPSA 1QP7A 1L5LA 1DCFA 5HIMA 4A16A 2EBFX 2VS1A 3CBQA 1NX9A 3DVAA 3BJRA 4A5OA 4PEVA 4NE7A 1W9HA 2V97A 3CA8A 1IULA 3CRRA 4U7JA 4Y6SA 4ADSG 4BEBA 2UUAB 5E4YA 5TMEA 1IQUA 5LU9A 3ADBA 2PKQP 1Z4IA 3D3QA 1ECLA 2QLLA 1LW7A 3UWMA 5AQ1A 3SHTA 1FVFA 4FOSA 2DHCA 2P2YA 4ETMA 3DP9A 1C4KA 1NASA 1C9JA 1VYTA 1Z0AA 3GI1A 4HGQA 3MWFA 4ITUA 1WMEA 1DIOB 4JBXA 1ARZA 4QJ5A 3S2ZA 4C4ZA 1I1HA 1XFAA 4DR2B 4P33A 3UENA 1G5PA 1O58A 4UARA 4P7GA 1KR2A 4UFPA 4UDXX 4NLLA 4U2CA 3GCXA 1GNSA 4HRXA 1FYVA 1JV2B 3ECAA 2AZ4A 4MR7B 5CMLA 1THMA 5DWQA 4EVRA 1E32A 3QKWA 3R3SA 5E7JA 2YS6A 3D5TA 2YVUA 5CG2A 1HQDA 4HS9A 1KXJA 4A0HA 4I9GA 3EMKA 4JLJA 1GYPA 4LBWA 1I5RA 5CU7A 4XX1A 5DXFA 4AWXA 1B6TA 4HUJA 4ME6A 7GPBA 5J4HA 4KK4A 3ZI4A 3K70C 1DWUA 1PR3A 1JJVA 3QEAZ 3O9ZA 3Q0TA 4B32A 4RK0A 2CXOA 4YP7A 3OQBA 4OXYA 3K71B 3TZLA 2FSFA 4KO2S 2OV3A 2AOXA 3O92A 4XWGA 1DKQA 2OMKA 1XEXB 3Q0EA 2DJIA 3V4OA 3PGA1 3WB1A 2X7XA 2PO5A 3RFTA 5IJ0A 4S24A 2O6LA 1R6BX 4IVPA 5LB4A 3ZN2A 4INOA 1OAKA 4PLPA 5C53B 3ADCA 1J70A 3DKVA 1GTVA 1GZUA 5DU2A 5KTTA 2EZUA 3VR3A 2RI1A 3EGVA 5AXCA 4Q9LA 3WSWA 3ZLVA 4CQJA 3GBPA 2GK6A 2P9FA 4BUCA 1DG9A 1DO0A 3LQKA 3NP9A 4OYYA 1MA0A 2H7YA 1LKZA 1CKEA 1IN1A 3F7TA 3RW9A 1ZS9A 3BD9A 1R5BA 4UHHA 1XDDA 4MVJI 1IZ9A 1WVMA 5AJXA 1YTLA 3IQEA 1JBEA 4GKAA 4C4YA 2C04A 3LO8A 4RS4A 5C7IO 4P83A 3DBRB 4D9HA 4MMYB 4HT3B 1QQ6A 3I9KA 5TRTA 3AHDA 4EFKA 3S2FA 1LPMA 3HACA 1WW8A 3H0CA 3PIDA 2O4CA 2WMDA 4C03A 3DXZA 1W8IA 3OQIA 2QSJA 5K0TA 5CEJA 1YFKA 1HL3A 2A0UA 4P98A 2G28A 5HS4A 1SAYA 1ENPA 3UNXA 4UAJA 1IIBA 3WMWA 2ICAA 4DYHA 3EZNA 4E4YA 3OPQA 1ONOA 1FFBA 1INLA 4Q1EA 4EKNB 1HQYE 1XDUA 3PJFA 2PL5A 1OT3A 1Q20A 1Q0PA 2Q8PA 4GZLA 5LQNA 3L0BA 5KYWA 3P0IA 1H66A 3COSA 4GR5A 3H2JA 3STUA 2B8EA 4EJSA 4DIUA 2CXNA 2FV8A 5CDYA 2H1OA 3GP8A 3K70B 3QFCA 4O2AA 5EXTA 4YP0A 4KNWA 3VZBA 4E1VA 3LOPA 3WKCA 3M2TA 2XE7A 3WLOA 1ETHA 4TTJA 1OB5A 2QLTA 1LNQA 2MMCA 5H82A 2V9PA 3CW2A 3SE7A 4AJOA 4HH3C 3IV9A 1X1QA 5KREA 1Y8QA 5EUCA 1SQSA 3G0GA 3EGEA 4INJA 5DMHA 2VXCA 3GD7A 2CMHA 2PRIA 1E9SA 4RIGA 5K0LA 4JOBA 4K0KB 1R4NA 3EGWA 4YV0A 4OL0A 3TEJA 4RZ2A 1JB1A 2W37A 5FNVA 2PX6A 3STVA 1XZQA 3DQZA 3V4SA 1UJ4A 3RJTA 2WWGA 5HCIA 3KD3A 5DSTA 2HV8A 1RMTA 3WGTA 4YYEA 2PKXA 5L9AA 4DVJA 2X4GA 1OWMA 3NS7A 3H9QA 4NENA 2XAAA 3OPMA 1JUDA 3TD9A 4FEAA 4KE7A 2X76A 1B2LA 3YASA 1I3LA 1LBHA 5K99A 1OAOC 2A5JA 1HWYA 3T1NA 4DG5A 4Y1EA 3F7NA 1UJ6A 1O94A 3STHA 3I6YA 4YAEA 1CR0A 1ZK0A 1DC8A 1UJCA 3A05A 3BH6A 3M1LA 1AKQA 1XQXA 2V7PA 4IHJF 2F3SA 2ZXFA 3FSGD 1PR5A 5LSAA 4BAGA 4DIFA 4MS1B 5EP3A 4UUAA 2PKEA 4RF2A 1IJFA 5IDQA 4QXPA 3MWEB 2YUIA 4Q4DA 3ROPA 2CUNA 3IAAA 5ECGC 5J5CA 2FCRA 4EPYA 4PC7A 3RC1A 1HG1A 4F56A 1R5NA 1J9GA 4PS0A 4ZYYA 3C3PA 1HFWA 1Z88A 3FVQA 4LDNA 3W5JA 1EHIA 1ICIA 3RU9A 4KWCA 1CUWA 1KETA 4GGOA 3PPIA 1ZP6A 1D5WA 2PWPA 2C4MA 1MTOA 4MUKA 1E99A 2F48A 3H2IA 3HVUA 4MPDA 3RUDA 1OZHA 3X2FA 1MR3F 2X41A 4OGWA 2ARKA 3RBVA 3K9BA 3HWX1 1E1RA 3TI7A 3W3AD 1PZFA 4M8NE 2PUDA 1IN6A 3N0VA 4UMDA 3UJ9A 1AUVA 4JQYA 3PNOA 4PZUA 1DBQA 1JLLA 1V1JA 1MP0A 1WOYA 1K5GA 2H9AA 4FILA 3KQMA 4UOEA 2VCEA 1QQAA 1FP2A 4Y2RA 1ZOIA 4KO3S 1QX3A 1XJ0A 4PAWA 1QHNA 1YZHA 3A1NA 3VKHA 2JFXA 1I94B 4HYYA 3K5IA 4LSWA 3CH4B 4O2BA 4WCFC 1UDXA 3V5NA 3AVXA 1ZJWA 3HLYA 1IL0A 4IOLA 4G5GA 5KVAA 3RS8A 2PT9A 3EDRA 2DEUA 3R5SA 3D81A 1QLJA 2NPOA 3E22A 1CULC 1ADYA 3ENWA 2FJPA 3FFTA 3INYA 2DR3A 4LHSA 3BSWA 3JQFA 5DXJA 1MNQA 4MW1A 4FLFA 4MW6A 5I48A 1BH6A 2O06A 4S0XA 2PKQO 5JW6A 2X9QA 3LLVA 2IBSA 1KC3A 2R7MA 3C8HA 3DL7A 2PQ6A 3K8YA 3RYIB 1M2HA 2XUFA 4B40A 2O2ZA 3LZ6A 4MJ3A 1LCIA 1JSZA 1QVWA 1XZDA 4U0KA 3ES9A 3WBKA 2ZZMA 1LBIA 1QV6A 2R1ZA 5I9TA 1FDOA 2BEVA 1DAHA 3MS7A 1UWVA 3KTAB 3ZU3A 4K5QA 1MPTA 3ZK7A 1T9KA 2QB5A 2VT3A 5KOYA 1DWQA 1IUNA 1L5RA 1KRWA 3PUIA 2A30A 2YFYA 4JLWA 3UJHA 4YDSA 4L5JA 3PE6A 1QO7A 1E5XA 2YWXA 4YQYA 2O1EA 2W2KB 1U8UA 2O3SA 5LZ2A 3TW6A 4KE9A 1U94A 3SP1A 1WKCA 4FK8A 4G5OA 5LIRA 4GIBA 2ZRDA 3DD5A 1G0OA 1IHDA 3M9LA 4DJJA 1VJCA 5GOZA 5TT1A 1IM5A 4E7OA 5IM4F 1BVYF 2PRSA 2V54A 3L8HA 3W7AA 1QRRA 2O3RA 3HA5A 1BXGA 1DWPA 2YX1A 3BZUA 1MTZA 1UPXA 4LHVA 5DHUA 2OQ2A 5GOTA 4IJUA 1ODSA 2KX7A 3PQCA 3QVMA 5FFNA 3DNPA 4F45A 2FZVA 5JNLA 7ABPA 1JNXX 4WCFB 3ZZTA 1O1YA 3WIDA 3KT3A 1E5TA 3MJSA 4HB0A 4HI0E 4JLUA 5FOWA 5HFJA 4YAKA 3HLTA 1KEEA 4LI3X 4Y0NA 3K1YA 4BJHB 3VH4A 2NV6A 5A0TA 3R5XA 4R3UC 3AUXA 3W34A 3A9VA 1IYZA 2ECQA 4JLSA 1VIDA 1GPMA 4LZZA 3W2HA 3RFUA 3RTDA 4URXR 3FWYA 3OQNA 3D4BA 1T4BA 4WECA 1YIAA 2HXYA 2Z8YM 3CBGA 3OQHA 2XMRA 4NJMA 4N5LA 1JDPA 1N57A 3LKDA 2OM6A 4EGAA 1RPJA 4KLRA 3QW4B 1FTSA 3PGMA 5CGZA 3ZQ6A 1Z33A 5DYWA 3ZUPA 5KTKA 4XEUA 1UOEA 2BFFA 5DHSA 3Q7EA 1F2VA 2G72A 3ITDA 1T43A 4DSNA 1DU4A 1ETUA 1N2JA 2C7GA 1TZMA 1UJ5A 2Z4RA 1T4DA 2E87A 1EZ4A 3QUSA 4PBSA 1OLUA 5BSTA 1O0CA 3N5CA 4EEXA 4ZVRA 1QIHA 1AKNA 5LP6F 3JR7A 2E3JA 1RPZA 4KVZA 4OHFA 2E4AA 2WVHA 2J9FA 3PEUA 1EZ1A 3BAFA 1QHFA 3REGA 4EHIA 3QJGA 1PU2A 3IQDB 3AG6A 2F43B 3TR0A 1DV2A 1JP7A 2DRIA 4ZEWA 2HHAA 4AXXA 4RFSB 4J91A 3ZHRA 1K3TA 1KAOA 4TYWA 3ELYA 3QWHA 3R3XA 2D2FA 4F1JA 1SXHA 4OD0A 1BGVA 3OJOA 4FP9A 2H2AA 4IG4A 1ODJA 1FA9A 1R6UA 3RYTC 1XRRA 1CQZA 4Y1RB 4CG0A 3BGIA 3PHJA 4FSHA 1NVAA 3RS2A 4NXNB 3TDNA 4S2EA 3EEOA 3GN2A 2GPWA 3W4IA 3EC7A 3TZCA 1UOQA 2FPWA 4YP1A 5JJIA 4UMFA 2IYEA 4F3KA 4U6NA 1OAAA 4AY5A 4JSRA 4YGYA 5JFTA 3EIEA 3N0WA 1BJRE 2IOHA 2TMKA 3H65A 3HB1A 2ZUEA 5EAIA 5FPYA 1JEJA 4BY9E 2OQVA 3GFVA 4N54A 4ZVNA 3K0CA 4P4SB 1FFSA 5JEEA 3OQOA 2FUEA 1NP6A 2AOWA 3L4BA 1E2NA 4PIMA 5TR9A 2I1VB 4UPVA 3NHRA 3UPDA 5KNBD 5CX1A 1AV6A 1V5IA 4LYGA 4PTZA 4YJ2B 5J59A 5F3WB 3H83A 2QLJA 2OORA 5JO0A 1ZSNA 5SZHB 3BZWA 3H2ZA 4NX2A 5KU7A 4W5TA 2RG7A 1HT1E 1ML4A 2G8NA 3KSRA 2HDWA 4EGFA 4P4LA 1SK8A 3TFOA 2BI8A 4NDZA 5TPZA 3IKJA 2OECA 2W00A 4LHWA 4F5YA 2Z9DA 3UIEA 1U2SA 2DBRA 4PBTA 4QRDA 3BIXA 3PGLA 5COAA 3H0EA 3T3EA 2AUNA 7MHTA 4Y2VA 3JD1A 4GE0A 3PL1A 5CFRA 4M8SA 4LFCB 4D3SA 1Q7EA 1ODCA 2P9EA 4H7HA 3ZS8A 3NVDA 4DCOA 5LYJB 2A14A 4CQNA 2N75A 2YVAA 1KOGA 3MGGA 3DWGA 2I22A 3AZPA 1X80A 3IBCA 2D5IA 4N41A 5TX7A 2D1SA 2I6SA 3JTMA 1W76A 4HB4A 2J30A 2JW5A 1VA4A 3D2BA 2GBLC 2OXIA 2C0QA 2OZEA 3NRCA 5FL7D 4EUFA 4RH1A 3LBYA 4W63A 4N0MA 1V35A 1VLLA 4E7PA 4LRTB 1NZFA 2JJ1D 1NNEA 3HTXA 2G77B 3LVQE 2P27A 1D4FA 3JZFA 1Q92A 4DLLA 2XXJA 3PFBA 4R9NA 1KWGA 5BNFA 1XAJA 2JCXA 1IM8A 4ER0A 4V2IA 4C6RA 1HQCA 1TUBA 1HSOA 3KC2A 2IC5A 4BFUA 2BFWA 2Y67A 3MTGA 3GAZA 1Y0BA 2QRGA 3ONEA 5IH3A 5KOJB 3U44B 4M9SA 4IWNA 5GONA 4C7MA 1RI2A 4XUEA 1EDDA 4NARA 5DNVA 1H2XA 1G2OA 2FEWB 3R74A 1TVMA 4HXGA 5HE8A 2QX7A 3G9TA 1QFZA 4WIAA 5CFOA 1E3IA 5LFAA 4RSRA 5FBLB 4E5KA 3BN3A 2AFHE 2H0RA 2BMJA 1XMJA 2BZSA 2CBZA 4DR4B 4P93A 5F2KA 4B47A 4WBXC 1A2KC 4RBNA 1XMIA 1PUXA 4LVNA 3STWA 5JZSA 3R9WA 3H4MA 3A6KA 4PX5A 1RQRA 4MW4A 2Z04A 1F3LA 5F73A 3N2GA 3EY4A 1ACJA 2DHRA 4YYZA 4KLCA 5HVNA 1ZM2A 4TVBA 2V3CC 2NSJA 1UOPA 3CJQA 1CUEA 1YJCA 3AY6A 3BZBA 3GRYA 2CYCA 1QBGA 2IYZA 3EZ9A 2GRUA 4PO3X 3L93A 1UDCA 4IAOA 1GZ5A 3AIOA 3FPAA 2OK7A 2NTYC 2X2EA 3ZCTA 2FN3A 4L9AA 1NM5A 4WY5A 3WLHA 1MJNA 1W59A 1XROA 3B3GA 5KSZA 4OSOA 1ZNXA 1SD2A 2P5SA 4M4SA 1CR6A 2QORA 3DFUA 4P8RA 4PGFA 1OHHA 5ICSA 4OQLA 3EW7A 4CIAA 1O95C 3QHQA 3VA7A 5M7EA 1S3IA 2XZPA 3OJWA 4JJGA 3FPEA 4MS4B 3LECA 3TINA 3LHSA 1RCFA 1Z5VA 2O8DA 4TS1A 1YNSA 2ZI4A 3L0YA 3V8QA 5ILOA 1UKVY 1YQ9A 3K9GA 3PQ3A 4J90A 3H11B 1W52X 2FOLA 4KRXA 3K70D 1CX9B 2JH8A 4RETA 5HZMA 2NU6A 4BVHA 1GGVA 2DTEA 3IPLA 4R8MA 3W04A 1XRLA 1X3LA 3N8NA 2FG6C 1K63A 3RSCA 1GCGA 1CDEA 1YKSA 2HCJB 4LVOA 4PXYA 3T7JA 3ITKA 2VHVA 4TV8F 1Z47A 5HQTA 5KSOA 3EGDA 2HA2A 4CLDA 1VE5A 5DHFA 1MB0A 2EL9A 2ODNA 1Z22A 2O2XA 1C8VB 5LP1A 1DKRA 3I1YA 1WX1A 4K87A 1KE1A 4QOIA 1V1RA 1Z4JA 3QXCA 3G7NA 1EZZA 1XXLA 1TOAA 2BGIA 2R8OA 3S2GA 4YRTA 3ABQB 3PCXA 4MDHA 4CEHA 2MYUA 1A2OA 4QQNA 4PC6A 3T1VA 4B9EA 1SULA 3KQLA 3GJ7A 4GOJA 3ZGNA 4DNPA 2YVQA 5G3YA 4H9GA 1VOTA 4E32A 2B36A 1XL1A 3K0FB 3UJNA 3ROKA 3T3HA 1YCHA 4MUJA 1U0FA 3ISTA 3CQ9A 1QHEA 3ZY3A 5JYDA 2ZPTX 3WMFA 1JEYB 2XT6A 1ZPDA 3DFMA 4IJKA 3FSRA 1G5IA 3VDXA 1O4VA 4PQEA 1R7RA 1BS2A 2ACKA 4LF8B 2BJVA 1GAQA 3MJTA 5KYGA 5HF5A 4P92A 2REBA 4GYYA 1FRVA 4JFAA 3UMFA 4BKPA 1E9EA 3LK6A 2IH5A 1UMBA 4ZAVA 1I1NA 4QDJA 3GLSA 5AK3A 1D9XA 1X0XA 2NMVA 3Q3CA 1QFJA 3H1FA 3H5VA 4XW2A 3RANA 4YASA 4IGFA 2EWVA 1IPHA 2H5LA 4TT3D 3NR2A 4R2XA 3HYRA 4M1YA 3I9FA 1ZGZA 1N0HA 3QLVC 4FDTA 4IVQA 1LSJA 1XPRA 4XSHA 4PPYA 5DFAA 1OXBB 3DE3X 4B82A 4DM3A 1RJWA 1RZUA 7MDHA 2V7QA 3X1WA 3MMSA 4EDFA 1PEAA 2FK7A 5JJBA 5HUHA 1U0TA 4K05A 3E8MA 3USZA 1JJFA 3EPHA 1XA0A 4JLKA 1U0HC 3G2LA 1AH2A 4EWLA 4R69A 2B8WA 2FRDA 3GXBA 3WB9A 1Z08A 4KQWA 4YVFA 3A4TA 2V9ZA 1RKBA 3MHPA 3PSHA 1SRQA 5JH7A 2GKGA 2YHAA 4PAMA 4ZT5A 3SG0A 2PUEA 4CUZA 1AHIA 1RJ9A 2NVBA 4I4TA 5D1NA 5TMDA 1GIAA 4UPDA 4RTNA 3GF4A 4LXIA 4R9SA 1U4OA 1C4WA 1T6ZA 2C9OA 1K3UB 1A82A 2D1RA 3CLKA 4XQ9A 1L5VA 1II8B 4Q7JB 3R7BA 3P71T 4BFSA 3H9GA 3EBLA 4YY3B 4FDAA 2DQYA 4JN6B 5IP5A 2BFAA 2XNJA 1EINA 4BGUA 2C4KA 4ZO7A 2HDNB 1OTHA 4B71A 4GSKA 4R4JA 1QHHA 2DUWA 4FFNA 1UR5A 2YS7A 4L50A 1VJ5A 2X8LA 4E07A 2Z8XA 1FFCA 3NFRA 1X38A 2C1ZA 1OSNA 4IV5A 4EHDA 3E82A 3NHPA 4ZYXA 2MINA 1Q19A 2XHZA 4TL9A 1N1EA 3GJ3A 1TTPB 3QI7A 3T1TA 5FP0A 4OK6A 4DA8A 1T6YA 1ZRSA 2HA0A 1WPGA 1JAHA 3EPPA 3E58A 1PFQA 2DLNA 4TVOA 1NURA 2D13A 4MUNA 3VTKA 4EL0A 1P75A 2G1AA 1OBHA 3A4IA 2GDZA 2HM7A 2WINI 4DSZA 3GFBA 1FDVA 4P7JA 3KZVA 2NU9A 5KNCA 4EHJA 4B48A 1U2GA 3VYVA 4RY8A 1MA3A 3GJSA 3KAJA 1GL7A 1UODA 5I9MA 3DV9A 3FMVA 1MOZA 4IIUA 4MVJF 4KL8S 1ZHOA 3FOEC 3HCWA 3CKYA 4HQNA 4IF6A 2ONCA 1GQYA 1M6NA 1NFQA 4QQRA 1VPVA 3VHXB 2CVFA 5EY5B 3Q8KA 1P4RA 4AIRA 4JT9A 3PC4A 2Q46A 1UEIA 3JQRA 2PSHA 3LOQA 3WRYC 5KDLA 2XSZA 2QD1A 3FYSA 2EFHB 1AGRA 2Z8ZA 5G1PA 4BLUA 4EPVA 4C89A 4WUVA 3COVA 4N7MA 1N2CB 2CFIA 1UDWA 5DNDA 1QGOA 2ZM6B 2PXHA 2QMZA 1CUUA 3WNCA 1W85A 3OLQA 3GMTA 1NXQA 3LC1O 4B9AA 1EFRA 2ZYTX 4R68A 4AG3A 2XUIA 4AZ0A 1PE0A 1BTOA 2KYRA 4MR8B 4L8YA 4OXRA 1GA6A 2D0PB 1GXSA 2I2CA 1DMSA 1T5OA 1TT5A 2BFBB 3B3AA 3AR6A 1OYYA 3IXMA 1GWNA 4L8LA 5AXBA 2OO7A 4JXKA 4A92A 3WHIA 4M60A 4C1BA 4JFRA 1JWBB 5FD8A 4ZCRA 3FHCB 2IHZA 2VJOA 4GE3A 1YASA 4JHLA 5J5VA 4BNNA 5KWJA 3LPAA 2OHVA 3MB5A 4UCQA 2OZPA 5HJEA 3LX8A 2FEKA 2VDMB 1BAPA 5AW4A 4AD8A 3I5XA 4ZTUB 1JHMA 5K5EA 4TSFA 1EFVB 2UYOA 1EU1A 2DPLA 3V4PB 5LP6C 1OFUX 5B3JC 2FPRA 3Q7SA 2LDBA 2QTGA 4QUKA 3TOCA 2IPNA 1JFFA 4Q3OA 1G8JA 4Q7EA 4D4JA 4E21A 1MABA 2HA5A 1AQNA 3U56A 4FEEA 5LCXA 2P0EA 5FNVF