3L3BA

Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from ehrlichia chaffeensis at 1.90a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
210
Chain Sequence
LNSAVILAGCGHMDGSEIREAVLVMLELDRHNVNFKCFAPNKNQKQVVDHKKKESVGEVRNILVESARIARGSVYDIEQIRVEEFDMLVIPGGYGVAKNFSNLFDEDNDYILPEFKNAVREFYNAKKPIGAVCISPAVVVALLKDIAKVKVTIGELIDKMGGVHVDCPTIKSVKDDVNRIFSCSAYMRNDSLYNVYLGIQDMISSMVNYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from Ehrlichia Chaffeensis at 1.90A resolution
rcsb
source organism Ehrlichia chaffeensis
molecule tags Biosynthetic protein
molecule keywords Es1 family protein
total genus 71
structure length 210
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l3bA00
2R1TB 3PQ5A 1A9XB 4HCJA 4L7QA 2YWCA 3L7NA 3NVAA 4OGGA 1CF9A 1OX4B 1J42A 4P5PA 4RKYA 4ENUA 2ZUVA 3NORA 3EN0A 5SY4A 4E08A 1Q7RA 1VCMA 1P5FA 2VRNA 3BWEA 1VHQA 4LGYA 1JDBC 4N12A 1IZZA 2NV2B 4P2GA 5BV2P 2AB0A 4L8YA 3RHTA 4AUEA 3UGJA 4B40A 5JZMA 4S0ZA 5JZOA 3OT1B 4P34A 4ZDKA 4GE0A 4ZDIA 1UCFA 2YWJA 4ZDJA 1S1MA 1GG9A 3PQ4A 1CS0B 5E9AA 4AJ9A 1FY2A 1QVVA 3MGKA 1PE0A 2VKTA 3F5DA 3N7TA 3TTTA 1PDWA 2NV0A 4MNTA 1P7ZA 1T0BA 3R76A 1I7SB 2AD5A 1PV2A 3UMMA 1R9GA 4P35A 1P7YA 2RK4A 3CYFA 3P9SA 3SF8A 4ENPA 1WL8A 2IUFA 3TTVA 1M6VB 3CNEA 2WJZB 1IPHA 3KKLA 4Y0NA 3B38A 3R75A 4B31A 1I7QB 3M3PA 4I46A 4UZSA 1PDVA 3D54D 3L18A 4L8WB 4Y1FA 3WFZA 3R74A 2RK3A 3EWNA 4ENSA 4WINA 1GGEA 4MGHA 1Q2UA 1OX6A 1KWKA 4AULA 2H2WA 4D1YA 2A9VA 1IZYA 4UNIA 3F71A 1I1QB 1C30B 1P80A 1QVWA 3CZAA 4ENWA 1QVZA 1CE8B 4R7GA 1N57A 3TTSA 4QYXA 2V4UA 2ZUWA 3P9RA 2ISSD 2ZUSA 2YWDA 1KEEB 3L3BA 3SF8B 4AUNA 3TTWA 4ENRA 1KWGA 4UCFA 5SYAA 3NOVA 4PXYA 4B2YA 4GUDA 1GPWB 2OR3A 1SY7A 4E5VA 3UOWA 1T3TA 4UOZA 3NOOA 4L95C 1C3OB 1GGKA 1KA9H 5K4AA 4OFWA 3FIJA 4GE3A 1FYEA 4Y1RA 3PQ2A 1GGJA 4I4NA 1GPMA 3VU3A 2FEXA 3P9PA 3PQ6A 4Y1RB 2ZUUA 1QF7A 3NOQA 1O1YA 4I2NA 4JQSA 3UJNA 3TTUA 1ONSA 3FSEA 1QDLB 2VDJA 4ZGGA 4BTEA 3TTXA 3EJ6A 3EFEA 1G2IA 4P36A 1GGHA 3SOZA 3ER6A 4OQ4A 4AUMA 4BFLA 5LIRA 1VCNA 1T36B 3UK7A 2R1UA 3ZJ4A 1P81A 1KXJA 1OX5A 3NONA 2VPIA 1OX4A 2GHRA 4XLLA 5IP5A 5SY6A 3B3AA 4BIMA 3EZGA 4Y1EA 4ADSG 4B5KA 3MIIA 3ZJ5A 3BHNA 2LXNA 3PQ8A 4L78A 2YWBA 1L9XA 3CY6A 4LRUA 4Y1GA 3PQ7A 2ZUTA 4WXYB 1SOAA 2RK6A 4ENTA 3TTYA 1OY1A 4OJYA 3ZR4B 3TQIA 1K9VF 1BXRB 1QWSA 2R1VA 1JVNA 3OT1A 4ENQA 3PQ3A 3GRAA 3L4EA 1OI4A 1VCOA 2VXOA 2D7JA 1GGFA 2R1VB 2W7TA 4OGFA 4UOQA 4MTCA 4K2HA 3B36A 4L8FA 4QYTA 2GK3A 4OIFA 5DFAA 4B7AA 4ENVA 2R1TA 3P9QA 2XF2A 4RKWA 1U9CA 4N0MA 5SY9A 3CZ9A 2ABWA
chains in the Genus database with same CATH superfamily
4ER5A 4YXWA 1N78A 1Z56C 3O8DA 2GTIA 5EGSA 3F2IA 1RAAA 1RYMA 2X2OA 4JBIA 4MA4A 1KK3A 3A06A 1FLDA 4L22A 5J2TF 2ZPAA 1QYCA 2DR3A 3SCZA 3KIPA 5L7WA 5EZ5A 4UQPA 4I4TA 4DLKA 2RGYA 2Z2ZA 3DDWA 4ZREA 1O0CA 2GD6A 3G02A 5FHQA 2CYBA 3FVVA 1XN1A 4NMMA 3CNBA 2XLCA 3BTUA 2N0SA 1JSXA 3S1LA 4COKA 5JAUA 4GZLA 4DA0A 1G7RA 1WZIA 2IKSA 4JI5B 1CIJA 2BFDA 2ZJ4A 3DEZA 3FJYA 4OY3A 4P5DA 5GONB 4COOA 5LUAA 3E35A 5CM9C 5DNVA 1OB5A 3KKLA 1YCFA 3KM0A 4RK5A 4YJGB 3LZDA 3IO5A 4I8DA 3UBMA 3TD6A 4V0ME 1NVTA 2OV8A 4RD3A 4YCDA 4BEVA 1E1QA 2R44A 3AUSA 3CKLA 4ALMA 3EWNA 4NS4A 4CQMB 2ZVJA 3G8YA 4F3NA 2XHEA 1EK1A 1VG1A 2QVGA 2W2VA 4RTMA 1RLJA 2HV8A 3C3BA 3MUFA 1CUYA 2Q3FA 2KJQA 3L06A 2OHOA 3Q6IA 3V8QA 4AWXA 2W2OA 4HGNA 4IOJA 1F7UA 2PWYA 3AJAA 3STUA 1MDFA 4ZHQA 1HQKA 5FNVB 1LDEA 1OR8A 1SC6A 2DSTA 3UAGA 5EHIA 3H42B 2HLPA 3GJ0A 3ODPA 2BGKA 2ZULA 1E69A 4MW9A 3U7EB 4KFSA 1AXEA 4P32A 1VDMA 4DV5B 3OP4A 2HJ9A 3ITKA 4ARZB 4FHZA 4CCYB 4HWKA 3DT6A 1C3OA 5CH8A 4G09A 1MVNA 3L0BA 4A5OA 5CB4F 5K0EA 4JBWA 4I9GA 5F7XA 1TJPB 5EWJA 5LKRA 2H4YA 1YFLA 4RPJA 1E2EA 3JPYA 3KKPA 1OTYA 4O4LA 1Y9JA 4GZ5A 5HTKA 2GVDC 1SU6A 3CUYA 3E9MA 4C6HA 1PLLA 4Z4GA 3W5SA 5EE0A 3HC7A 1KR2A 1OTXA 2VDJA 2BSXA 2QUZA 4JROA 2OV4A 3PVCA 4DGQA 2BM8A 2A4KA 2HK8A 2IA5A 1QUEA 1POWA 4KLNA 1G4AE 3VYUB 2X7HA 2BMEA 2ECQA 3OPMA 3CSUA 3TOXA 1CQIB 1Z45A 4QDJA 3DNMA 4D3SA 1GQ2A 3VXKA 4TUYA 4HWSA 2XCLA 2X1HA 2HF7A 4KQIA 2EL7A 2PAFA 3VV2A 3LX4A 4R1TA 3IOCA 2J6BA 3CHYA 3D7NA 4R2KA 1A8UA 4GR4A 4R1MA 5FWYA 1EFPA 1S2GA 1WG8A 2CBXA 2X22A 5A3RA 3KQKA 3AU9A 3LPNA 1Y8QA 1YQUA 5B4TA 1CQXA 1ISJA 4Q1DA 1JJAA 1KAQA 2W00A 3WGIA 2OGSA 4B47A 4CF6A 4YRSA 3L1UA 3KDSE 1Q83A 2ATIA 2DT5A 2XNHA 4L4RA 1HX7A 5HYVA 5KYGA 1YA8A 2WYUA 2ZSDA 1V5FA 1WXEA 3FMIA 4L7QA 2PS0A 5AVJA 3RYTC 5CAEA 5JSUA 4JT2A 3D5QA 3BTVA 2VK1A 2WU4A 2YN0A 4UNNA 5IHXA 3TLBA 1R5NA 1UWKA 3GLTA 2O8CB 3D3KA 3MTIA 4UUAA 3E3LA 3NWBA 2PBRA 1XDDA 5CDYA 4YI5A 1YKFA 4BATA 1RVV1 5HZGA 3ZD9A 3PDWA 3OVMA 1KI8A 1YBVA 3JQAB 3P2KA 4YRNA 2ZI5A 3AR9A 5A4MS 4DJJA 3QVTA 2NZXA 4NBWA 1QCCA 1LLFA 2P65A 2EEPA 2PO5A 2V7EA 1Z5GA 1P45A 5DLQC 5EPOA 4ZAWA 2OCPA 3NV7A 2J9XB 2BGIA 3MBKA 3AERB 1DAPA 3NWPA 5ICEA 1Y4AE 2QL5A 1PK9A 4MRNA 5FI1B 3JQ9A 1GSOA 4FXPA 1BWRA 2GTHA 1VDZA 1ENPA 3FN4A 1XXHE 2C5EA 2OQRA 3EIQA 1C3XA 4UZFA 5LA6B 1DZIA 2PN1A 2TMYA 1QTNA 1RYDA 1UBGA 4G25A 4CQNA 5K0NA 4CI9A 4DCNA 1KP2A 4MEJA 4DW8A 1L5ZA 4EG7A 5CB0A 2NO6A 5KX5A 5B1IA 1N6RA 2H9IA 2EJVA 3UWKA 4B3XA 4A7PA 1HT1E 4L07A 3VZRA 4FYJA 1ZL0A 1JP7A 2AMFA 1GUFA 5DRTA 1KMIY 2IXBA 5JROA 1GNPA 1NQAO 1XD9A 1SUPA 3EQ7A 5D8DA 1GU0A 3AONB 4UW9A 1WBDA 1P7WA 1U2RA 2JIBA 1C7ZA 3SF8B 2D0OB 1NE7A 1Z36A 1TEZA 4KGXA 3OLYA 5FA8A 3C85A 5C1OA 3W4IA 2IHYA 4UDYX 5BR4A 3BB1A 4M0FA 2F3SA 1UL1X 3CVWA 4CEJA 2I6TA 2C7PA 1FQKA 6PFKA 3U7JA 3HI4A 1J2EA 3DBRA 1JHYA 2QMQA 4IZ6A 1UXIA 2BLLA 4FSHA 4EHIA 1JXMA 3D6HA 3FIUA 4G4JA 2GAIA 2C0PA 5KOHA 2QRVB 3AR5A 3HJRA 2I91A 3PRKE 1SOVA 1B0UA 2H00A 4FSXA 4NMWA 2AJTA 3EMVA 1KE2A 4XWWA 4QVGA 4R8KA 1G5QA 1OVGA 2AEJA 2XYPA 3LL7A 5EKXA 4L51A 1Z0IA 2P40A 4OX9Y 4DV0B 1BCSB 3M81A 5ALGA 3INGA 4QUEA 4EG4A 2JFUA 2Z5VA 1X7XA 1BX0A 2BGTA 1AZWA 1NVEA 4EG6A 1P0FA 2WIBA 3X44A 5TPZA 5ALQA 1QKJA 1X1TA 3FSJX 1NUQA 5GM1A 3QFTA 4RHXA 3JQ8B 4EL0A 5IABA 4F2HA 1KJQA 5IASA 4MWEA 5CD9A 4UBKA 4JITA 1ZCFA 5AKYA 1ISSA 3WKEA 2JLYA 3OT1A 4HNGA 2PGJA 3PR1A 4G5QA 1V25A 2A3NA 4KO3S 4I9FA 5HF9A 4QUGA 4E30A 1DEAA 5LZ9A 1T0JB 3K0FB 3KXDA 1QCDA 1EQAA 2Q3JA 4N82A 4RH0A 2RGCA 1HWYA 1ISMA 2YX1A 4B3BA 1L7BA 2C9BA 3P0FA 2PKEA 4Q02A 4BV3A 1C3EA 3UV6A 4CQMD 3QLJA 2Q7XA 4HQKA 1NW8A 3KO8A 2C8JA 4RLHA 1X87A 4K6HA 3GCGA 5T57A 1XF1A 4JI0B 4PLZA 3AP1A 2NU8A 2FVYA 1B41A 4BO8A 3AVYA 1TTPB 1SPXA 3OZ7A 1D4AA 1X80A 2JFVA 2NVWA 4KGDA 4MCIA 2OOKA 3SR4A 5CDTA 4Y9RA 5DTRA 4FLMA 2P9JA 5B30A 2OENG 4BPRA 1VA4A 4DJTA 4CI0B 3WISA 4XFJA 1IPFA 3NBMA 1ECPA 1XT6A 1FYWA 1EFVA 1RADA 3RARA 4Y6GB 2ECPA 4WCDA 3OD1A 3K96A 5D2CA 5I9MA 5KHAA 2FMKA 4DIMA 1UJBA 4PAGA 5JRJA 4MWCA 2C03A 3MINB 2BGJA 4P0QB 1C2TA 5FJJA 5E38A 1SHLA 3P19A 2P4SA 2VLIA 1P6UA 4UAUA 1F2DA 3QKTA 3SIWA 3T15A 3FUXA 3VVBA 4RBNA 3PC8A 4E5SA 4YMUA 2F8SA 1NRJB 1X1AA 4TOIA 4XJXA 1XSEA 4G1BA 1W5AA 3TX2A 4INZA 3LFUA 4HUQB 4CL8A 3RF6A 1UWLA 2OWDA 1NVVR 3JZAA 2OCIA 2NQ2C 2IH4A 2IXEA 3KPUA 2JIDA 4WFKA 1ZK0A 1P4HA 4YMLA 1PWEA 2OESA 3GZNA 3WGUA 2B20A 3GAZA 3WL3A 4GSLA 4RZUA 3U9SA 2L18A 1VSBA 3M6AA 4YV2A 4RACA 4UPVA 4LOLA 1O3YA 4MPTA 4FFVA 3A2LA 4DV4B 2Y0BA 1MNQA 4D9EA 4AKTA 4EHJA 1PJ4A 2YVUA 1PQWA 4Q66C 4JB0A 4E09A 4E5DA 1C3OB 3GUZA 4LYDA 2HQ1A 3EGDB 4L57A 3SLKA 1R16A 3CKKA 3LAWA 2D8AA 4EJSA 2J9RA 5CFNA 1WCV1 3SX2A 4OQZA 1JH9A 3T35A 3UJBA 3E1GA 3A9RA 2XAAA 4RV4A 4FSDA 1RWXA 3GT0A 1M8KA 4MB6A 5IC4A 3S2EA 1V1MB 1KU6A 1OZAA 2W43A 3QFHA 1SB8A 2O7VA 1NVVQ 3JYHA 2I4NA 2RGGA 3RFFA 3ITEA 4MDHA 2Z4TA 5DH9A 3KYCA 2ZRNA 1AVTA 3GV0A 5JSFA 4JAVC 3FUWA 4HBGA 5D3MB 2XUKA 5IP5A 1R6TA 4D80A 2HU5A 2AZ4A 4ZHSA 1MCZA 5CA0A 3RUDA 5DDIP 2FUCA 2LXNA 2FG6C 4EPRA 3OM0A 4M1EA 3EMKA 1GV1A 1YULA 1K9VF 2O7NA 3TZEA 3W8NA 3A32A 2ODEA 3C39A 3GIWA 1N5JA 2RBEA 4TKZA 4QLBA 3KEOA 3R4CA 4KE7A 5L8VA 1CHNA 3KT3A 3ZX4A 3HBLA 3SHTA 1FEZA 2B2NA 4OL9A 2WF6A 3DNFA 3ZD8A 4DNOA 3GAMA 1GFSA 2WF8A 1G42A 3OPVA 4EPTA 4XFDA 3VMFA 1DAMA 7GPBA 1QH1A 2O3TA 4MPPA 3EUAA 3SQLA 1KE1A 2WFZA 4V0RA 1AHHA 3ZKAA 1J20A 3P32A 4KBFA 2FG5A 4O8ZA 5CAEB 1LK7A 1X0XA 2QWXA 1ZGGA 1LQ2A 1JF8A 2IYRA 1XJQA 1P1RA 3RS4A 5JD6A 3VI4B 2DHDA 5ISMA 3Q41A 3ZI4A 1XXHB 1O0BA 1GZ5A 1QHXA 2H1LA 1L1EA 3T3IA 1C1HA 3RSZA 1ZR4A 2QE6A 1JBKA 5I8ZA 1ZRSA 4ID9A 1EE1A 5EPUA 5CFOA 2V96A 1N6NA 2XY4A 3RASA 4B35A 1Y5RA 3TTTA 2IGTA 2JH3A 2QW8A 3CZPA 3ZGYA 2H1FA 1R66A 1MG0A 4L3OA 4GSKA 5DWDA 1QG4A 2OUIA 1ILWA 3QU2A 3FCUB 3V8EA 5ITVA 4DDVA 4UU0A 3DXZA 2FMUA 2NSYA 5HGXA 4B31A 1TVEA 3KZ1E 1IU9A 1EDDA 1M6VA 2HSJA 2QR2A 3KJEA 2BR4A 4D5GA 4DM3A 5KSZA 3N0VA 1QS0A 5C35A 2B4KA 3ICQB 3FBGA 1M9NA 2PFKA 3ONVA 3MWLA 3MJFA 1NHGA 5DISB 2CBZA 4ZT2A 4ARSA 4BP8A 1ACLA 1IZ8A 1IZYA 3PKJA 4ODIA 4D2IA 4G8DA 2HMWA 1L8OA 4EL5A 3V46A 1W87A 2OP0A 4MCAA 1TTHA 2ZBQA 3ZKWA 5KYNA 2H63A 1USGA 2BEJA 1R74A 2B8JA 1T15A 4PZCA 4KXVA 2WPNA 4L27A 3S68A 1K6JA 3CWCA 5EIAA 1UC4B 1Y1TA 3G2JA 2PWAA 2I71A 1H6DA 1FDVA 1SUBA 4YNBA 4WNAB 3GQBA 5K3BA 4GC5A 2GA8A 4EITA 5JQWA 1BYIA 3HJUA 3LY7A 3NDRA 3H6GA 2CF6A 2H4ZA 3QU9A 4HYYA 5HILA 2PZFA 3EVCA 3OWXA 4ZEMA 1UMBB 5IVKA 2RHWA 3UCEA 1UC8A 3E3NA 3TLKA 3VOTA 3RH0A 1Q14A 2WOJA 3RJ5A 2WKQA 3IAM6 4M49A 5AM1A 5JMPA 3UYLA 2E5LB 3OCUA 4GE3A 3JQ7A 1A98A 2Q1UA 3EVGA 5J2TB 2O4UX 3QH4A 3QXCA 1V8ZA 2PAAA 3NOQA 2QE7A 4I2NA 5BWMA 3QYFA 1TAHA 4JJ4A 4EHBA 2R68A 1OXXK 2EYQA 2RAFA 3A58B 3IAFA 1O0SA 1D4OA 1Y80A 1C2YA 4HB0A 4TT3A 4Q4AB 3FTEA 3FROA 5MF6A 4DIKA 2ZAMA 1QBGA 1WCIA 3HFRA 1BHO1 4G1UC 4UBIA 4DT1A 1ZM7A 4XM1A 4Q34A 5TARA 5AT1A 2CL7X 1XZHA 2HNAA 3NV9A 3K5HA 3OMWA 1HH4A 3ROEA 5LP6B 3V3KA 3FPAA 4ZKDA 4F3YA 5AW6A 2WIKA 3ZXYA 4O63O 4IXNA 4YP0A 1VE3A 3U4DA 4LE2A 1TF5A 1XTJA 2VJQA 1ZWKA 3BJZA 1EA7A 1QHFA 3MJHA 4IH9A 2V98A 3R9KA 3T38A 4CM4B 2WHPA 4OHZA 1WP9A 3RJ9A 3X1JA 4UHBA 1S7GA 5EY5B 4A1OA 5H3HA 4C0WA 2O2YA 3E82A 3WBFA 5JXGA 5EXSA 5IUJC 1PFKA 1XVIA 3DE2X 3ZTYA 1KNQA 3U7RA 2IKQA 3AY3A 4L8YA 3LWNA 4LRQA 5EHQA 3ZBTA 1NUSA 4NL4H 1E2GA 4OMCA 5IM4A 3TLZA 4MPDA 3VDXA 4H77A 1UF9A 2DUNA 4OB6A 5DV9A 4EYOA 4CN8A 4RMHA 1IXKA 1HLGA 1Z5NA 2C5HA 1U3DA 3NHFA 4AZ0A 1EGQA 4EB0A 2GARA 5EIHA 3SZRA 4EMUA 3R3WA 1YZQA 1OFGA 2IZ0A 3PC3A 4BMPB 3M8KA 3L1JA 1HNNA 1CR0A 3RS8A 1H0SA 1ZD3A 4KDEA 1EUCA 3WTBA 3QVXA 4PN7A 4FP9A 1NW4A 2Z5GA 2AJDA 1PE0A 1CE8A 4BVJA 3L7IA 3JALB 3BJRA 3MWGA 2SCUA 1MT3A 4D9NA 4D8TA 1XN4A 3Q5EA 3OO0A 3I52A 1NN0A 1P19A 2GASA 2WZQA 3VR5H 1Z29A 3D6MA 3NEJA 2CLLB 4YO7A 5DHQA 2LKCA 4K86A 1P4JA 1TKCA 1DIHA 1P9RA 1QYIA 1SD5A 1SXIA 1ZHFA 2GRAA 2E82A 2GZ2A 2OHHA 2WSSD 3O4VA 4K9MA 1L7VC 4ZANA 2NAFA 5BY2A 2DPMA 3SZMA 3CVVA 1Q0SA 2CBGA 1ONNA 4EEKA 1YV9A 4AZ3B 1RW4A 4DNXA 2XE4A 2NUBA 1VKZA 2F43B 2QP3A 3Q0EA 4NJMB 1G8FA 2Z4SA 4B3DA 4V1CI 4O2BF 2PGDA 4G5SA 5AKGA 3R09A 2BKLA 3TLCA 3UKDA 1U1GA 3CWQA 3A04A 1FMFA 2OV3A 5GWXA 3T3PB 4MHTA 3L7JA 1LSSA 1YDWA 3BJIC 2HWWA 2ZTLA 4GX1A 1Q3HA 3A8TA 1XTQA 4LHZA 1FTWA 3QY9A 5EL0A 3RTDA 3ENWA 4C4XA 3IMKA 2JW5A 4P4NA 4LCEA 3KPVA 3BB4A 2ZEJA 4YAGA 3G2LA 1RU3A 1IYZA 1FVHA 1ZD8A 4DJFC 1LK5A 3RS3A 5E6SA 3NP7A 2OFPA 1DHTA 3HZHA 2MMGA 4M36A 4ZCSA 4D9JA 5I7OA 2JG3A 1IIBA 1M34E 4KWEA 1USIA 3G1WA 1G2IA 2QUJA 3PGMA 4Q4LA 4TTVA 5A2GA 4DZZA 1RTTA 5LIRA 3KKNA 2AXNA 3E3OA 3RIEA 3S2SA 4BIIA 5AVZA 2VDWA 1MGPA 2R00C 3A4NA 2A67A 2HSZA 4BYMA 1DAIA 4B83A 4R6WA 1E1QD 4TXJA 2O4CA 1JA9A 3CG0A 2VAXA 4NKRA 1D7AA 3I72A 3WGVA 1SVOA 2BAGA 2WSMA 2VTDA 1T2NA 3LLSA 1K4KA 4BX2A 1JHZA 2O1XA 2VN8A 3MWJA 4D0LB 1UR5A 3JZDA 1H69A 1LJLA 4CQJA 3KX2A 3GT3A 4WNIA 5EE9A 1ZOLA 4FWTA 3H1PA 2WWGA 3V1TC 4V02A 3HNRA 3CNLA 2IYUA 3V34A 3D6NB 3RC7A 1SNYA 1LF5A 2QUAA 3IAAA 4O4HB 5I5GA 4S0XA 2O19A 1II0A 3VPHA 1VCHA 1A9OA 1OILA 3IAM1 3TINA 3EH1A 4W63A 1KO8A 2IYYA 4OM8A 3B2QA 2OQVA 4E70A 4B2LA 2XYRA 1SA0B 3S8YA 2NW6A 2WYHA 3RC2A 3ORQA 5BWBA 1CYEA 1EUDB 2ZQ5A 4UARA 1LY1A 3RYIA 1IXRC 1ENOA 3TSCA 5IKXA 5HFAA 4YUXA 4LCBA 3FYUB 4AO8A 1B23P 1NASA 1PS8A 3F5DA 4I5FA 1M2HA 5FUYA 5H8WA 3UT0A 3FCXA 4K03A 2M6RA 3DBHA 3E2PA 2CLDX 3RIMA 2IUEA 2PL9A 3WMGA 2VTBA 2F3QA 2C54A 3QBTA 4BNZA 2OQIA 1N9GB 1UFVA 3BIOA 4B34A 1XNRB 1AJEA 3ZLUA 4QBKA 4XSHA 1I6MA 1T4MA 1L8AA 4NFSA 5BURA 2VYVA 4D8WA 4OHUA 4YUYA 4RGBA 1Q0HA 1A5BB 5BRAA 3NIWA 4MI1A 2NO5A 4B3IA 3NHPA 3B60A 2IPXA 3CH7A 3IXMA 5KREA 1JAXA 2VUSA 2DBZA 1VIYA 3PF9A 1F0KA 4QXRA 3BEOA 2O6HA 3ZKWB 3B2EA 4R81A 1J0DA 1K8QA 1O94D 2JFQA 3WDKA 3ZOZA 3PGLA 3HP4A 2PRJA 5JCXA 2QUIA 2VAMA 1SG6A 5AKKA 1YVUA 4W7IA 1XZKA 4MV3A 3TM4A 4KXYA 3IULA 1VL6A 3BGVA 4MLDA 3F49S 3ZZUA 4BFVA 2YNMC 1RXSA 4DA9A 1Q50A 1UBNA 5JXWA 3U7GA 3N7UA 3V80A 1J9EA 1UPAA 1GAJA 4LPSA 4R7ZA 3RG2A 3I9OA 5HR5A 6NULA 2DBVO 4PRLA 4A5SA 4DLAA 5ITZB 4GPBA 3W1WA 2A5DA 4YMGA 5FR2A 1UJ5A 2IZ1A 4MDEA 4N8DA 4DXHA 1U2DA 1YJQA 4K26A 4R1LA 4ASUD 5K3EA 1LDYA 1SRQA 1LJ8A 2DKOA 3QF4A 1WU7A 3LNTA 4YO8A 7ABPA 5J4KA 1COZA 1EK5A 3V8RA 1JHQA 3MMXA 2FFAA 3CZQA 4BFLA 2ODPA 4K6CA 5CT4A 4LSMA 1E4EA 2QVZX 1O95C 2W2LD 3QE2A 4IIDA 1NMXA 3TLGB 1DC6A 1XTVA 1P74A 2GHRA 2J09A 4Q4AA 2J3IA 4N0EA 3F7MA 3OHPA 4B4VA 4DF3A 2AX3A 1L7PA 3VC1A 4E1AA 4O2RA 3DXFA 2PSSA 3EA0A 4BZQA 4D0GA 1K08A 3CINA 4EMBA 1SUWA 4UMVA 4Q39A 3VR2D 4AN1A 3HXKA 1PR5A 3DLAA 1J23A 2V03A 3OQ6A 4M54A 5FI3A 3ELBA 3K53A 3O9MA 1I14A 2WHPB 2OFWA 1VPVA 1Q6ZA 4F6RA 1DGQA 1M7HA 1CR6A 3O3MB 2XZPA 2IIVA 1IMOA 1XLUA 3TEFA 5BN3B 2CMKA 4J07A 1W44A 2GEBA 3HMQA 3IOEA 3K8YA 3PWKA 4RY8A 1KARA 3N6RA 3NORA 3L0OA 1XE3A 4GAEA 4PCUA 1NQXA 1LWNA 3AILA 2O2CA 1SCIA 4UEWA 3NGXA 2PR2A 1SVWA 1F0PA 3MEQA 3HLKA 1RC0A 1MVLA 2B7LA 3L82B 1FU8A 2ZKIA 1P9LA 3R0ZA 4FK8A 4XZ3A 3OTHA 1R6BX 2OTCA 2GJ9A 1G59A 2HRQA 3D59A 2HBRA 1TFUA 4C3VA 5E6RB 4LY0A 2YZKA 2GFIA 2HSDA 4ZDJA 2AH5A 4TWIA 1YTUA 1S2IA 4CRWB 1LPAB 3RKUA 5JBIA 2HPVA 2BHNA 4HS4A 5THQA 4JGGA 2Q0SA 1I7SB 1TMYA 1Q21A 2OAGA 3E9DA 5FPSA 2HH9A 3QUCA 3NHYA 4X20A 2QT0A 2W11A 4LZWA 3SF8A 4YJFA 1IM8A 1ACMA 1X0VA 5A5DA 4R9UC 2AJLI 4ND4A 3VAAA 2VJCA 2W83A 5JASA 1TUGA 3PYXA 2H29A 1II8A 3PWZA 4QASA 2PUCA 3FOAA 2OCLA 4FGJA 1PR2A 1EFAA 2O06A 4JLWA 3GPCA 4E12A 4Y67A 4DKXA 4POOA 1QSGA 2BJVA 2HA0A 2G1JA 3DP9A 4EYSA 4YCAA 2GO7A 1BGXT 5GV8A 4K81B 4K9LA 5H4HA 8ABPA 3L6BA 3NS7A 4TTAA 2V3CC 2VHEA 3JWEA 3AT1A 4ALLA 1RT9A 3B82A 5KOHB 2WYVA 4PQRA 3SVLA 2WAXA 3EQ8A 3M5WA 1JTFA 3O95A 3R7SA 4ZGWA 5KJFA 3ADBA 4ZKEA 2VA8A 3H5IA 1VKOA 1CHDA 1E99A 3ANTA 3LCVB 4QOJA 3OU7A 2Q2OA 1KZGB 2WTMA 2UAGA 1GN8A 1S8OA 2VSQA 2R6GA 3RFXA 9GPBA 5I4CA 4MB0A 5J23A 5ALFA 3VDMA 3L7DA 3N70A 2BD0A 3QU7A 4HAYA 2DBYA 3N0XA 3A1VA 3IUSA 1VI6A 3A11A 2X0KA 4W1QA 4JB8A 1Q44A 4XWTA 5HCUA 1I3NA 4ZYVA 3D1JA 5EHNA 5AKEA 1ONOA 1KFEB 4JUAA 2C7GA 4DMUB 4RY0A 4UPDA 2RKWA 1NW7A 1T9AA 4II3A 1N2CE 3LVRE 2C2WA 5FPTA 4EK9A 4XX0B 1TC2A 1SULA 1FP6A 1VLLA 3OZFA 5EUBA 5D5HA 1K97A 3FUVA 1EKXA 1ECGA 1O2DA 2BI7A 3A1FA 3Q0TA 4GGOA 5F2OA 4F9EA 1E6EA 4MLPA 4IKEA 1JZTA 1XTBA 4CG1A 1VBFA 2EIHA 2A5GA 4KWTA 5D3MA 5AVXA 3I04M 3KQUA 3ZZ0A 4H18A 3WBJA 4E7PA 2IYOA 3T9CA 1BA2A 1YNSA 3WDSA 2G8NA 3T7AA 2OHJA 3TFWA 3GHYA 4CM1A 3CX4A 4IFIA 1W75A 2GLUA 3VVLA 5K6RA 2WHRA 3FTCA 3PWTA 3RVDA 3LV8A 3SYNA 3N53A 4F2GA 5KOJB 1XU9A 2CEAA 4L0QA 1DTEA 4PZPA 3PQ3A 3GRAA 1GILA 1FMJA 3TIVA 4EJSC 2RI6A 4UTRA 4GXTA 4UM9B 1J99A 4Z3DA 1Z4LA 1SU7A 3AFMA 3FRHA 5IEJA 1RR6A 2HXGA 1Z15A 3DZKA 1PRYA 2BWJA 3FCAA 3AK4A 1PEKE 5KTMA 2E49A 3WYDA 1RKXA 1IDN1 3TE6A 3LOQA 4KQKA 4R54A 2QBYB 1G60A 2H1RA 1E66A 4MEAA 2II6A 3ZU5A 3A3PA 3SKVA 2Q9BA 4MK4A 3M9WA 1D6MA 3T5TA 5LC1A 3CXUA 2D2VA 4N76A 1DG9A 1UEIA 2PX3A 3PJFA 3T12A 1YNOA 4CLDA 2HTEA 3E58A 3KJNA 2OV1A 3IDZA 3F73A 3LT5A 3GU3A 3WNDA 1DOAA 3NM6B 1T9GR 4QPZA 3D0QA 4HUQA 3TMYA 4AYWA 4WN9A 3RYIB 1SBTA 4IEEA 5I7FA 4XUCA 5KWIA 2BKXA 2P6NA 3TIFA 3SZLA 1YH3A 3CLTD 4MQ4A 4ZQHA 5IVIA 1H9CA 3H2ZA 1R9GA 2G1PA 4V39A 1DU4A 2WE8A 2W2MA 2ZRIA 3A6HA 3NC0C 3T34A 1U8XX 4AO7A 4CG0A 1MOSA 1Z22A 4O2BA 2HQSA 4CL3A 3P7MA 4TLCA 4AAYA 5BSRA 2C4KA 3BMCB 1MAUA 2P5TB 4MVCA 3UJHA 2JI4A 1QR2A 1RE0A 3EGEA 1SXJB 1NBAA 2I80A 1YSCA 2BONA 4TXLA 2DHCA 2ZBDA 3IKTA 1VLHA 4G1FA 3WL5A 2OZPA 3L6UA 1XMJA 4BGVA 3N6XA 3QHPA 1WEHA 4CTMA 6REQA 4TWAA 1RS0A 1O58A 3ANYB 4QTXA 3T7TA 3OM8A 1WV0A 3U19A 3TR6A 3RFCA 3W2TA 1FC0A 3GIDA 1GARA 1ZD1A 4WA8A 1SC9A 5DM1A 5EIWA 3T9FA 3BSYA 2MDTA 2PS3A 3UMVA 1PSWA 1PZHA 4B6EA 1NW3A 1HSZA 1N1EA 3FPEA 3W4JA 4ZCIA 2XT9A 4OYRA 5A7GA 4DNPA 1LW6E 3HS3A 3G17A 5C1DA 1AGRA 4CF5A 4AUKA 4MS1A 1G1AA 1KA9H 3USCS 3QEMA 5HKKA 3LFTA 2AFRA 1KTIA 4FBLA 2IDZA 2X0FA 2P1ZA 1QX4A 3VU3A 5CCXA 1A88A 4Q3EA 4KR3A 1UOQA 1QYRA 1YHZA 2HMTA 3CX7A 4DCMA 1RP1A 5HM6A 4F11A 1FMCA 3OLZA 1JJVA 4LJLA 2R751 4ND6A 3CVYA 1DQNA 4UVGA 1QH9A 1TIBA 2CHFA 2XNCA 2WMOB 3SOZA 2CJPA 1JJFA 1YFKA 1Z12A 4REQB 1U3GA 4QARA 5IJZA 1BQEA 2DFDA 3PNKA 4AZTA 2FETA 4R7TA 2ZAIA 1HOTA 1KETA 1OIXA 2Z8XA 3MFQA 4NYMR 3VKFA 4GPIB 3W2FA 2NYRA 1PVOA 4MLCA 5D3ZA 2APJA 1I7LA 4QFCA 1EIWA 1HYQA 1YDGA 2R1ZA 3CEPB 2G1UA 1VFNA 1Z2AA 3C6YA 4MROA 4LHWA 1UBJS 3BCSA 3G79A 1RI1A 4L3VA 2G9RA 3R44A 2GZAA 4UU7A 3ZBUA 4EFKA 4CDMA 4P31A 3U6KA 1CUSA 3L6OO 4MKGA 1JALA 1FRFS 3NU1A 4R69A 2P6RA 1RCFA 8OHMA 3VKGA 2QZSA 2EIXA 2YASA 2YHSA 4L5IA 4Z99A 3VZDA 1L5NA 5JNLA 2CSXA 3AR7A 4TRNA 1IXSB 4KK3A 2ZJ0A 1PYDA 2VXOA 4LBYA 4MWSA 2Q6KA 3RSOA 3IDAA 3I8OA 4MQFA 3PUYA 1QFSA 2CVFA 4CFYA 3LK6A 4G8JA 1I5OA 3WICA 3WNCA 3AM5A 5AJWA 5A0TA 4O2AF 2YNMA 1N3IA 3F8WA 1J5XA 4FNOA 3H7IA 4UE6A 4CETA 1J0XO 1R2QA 1TCUA 3K05A 3N76A 3MOGA 1I1HA 3TLMA 4C4SA 5I51A 1BHQ1 1I3OA 1X1RA 3MNFA 3N8GA 1CKEA 1JV2B 2PU5A 1GQSA 1U8CB 3GLHA 3ILVA 3PXEA 2PZJA 4REOA 5G40A 3AHHA 5JADA 2VYNA 1KPHA 2Y93A 4DQ0A 4EZEA 3QA3E 4MYDA 5IJ9A 5AKXA 5LVAA 1TVKA 3A37A 2B1GA 3KKOA 3LJKA 2DOKA 4GBGA 4RPLA 5PGMA 1PG0A 4EHFA 1ND5A 4Z54A 3VC3A 1WB4A 4R1QA 1DHRA 1N2HA 1PZEA 2VXCA 4OUDB 4BFWA 2YVLA 3SBOA 1DG3A 1M34A 1MN6A 4XD2A 1ZVQA 2HHCA 1MU0A 4OMDA 5BQOA 2GCGA 3Q40A 5ALEA 5DNCA 2KLBA 2PUWA 1TZ2A 2EATA 1KMHA 1PFQA 1EBUA 5BMVB 4NFYA 1HYBA 2HWXA 5JPCA 4IIBA 4NG4A 3MHTA 2IYVA 3HXMA 5B1HA 3OU6A 4LV6A 3UMRA 1V43A 5AW5A 2ZCUA 4MVXA 3IP1A 1XG5A 5LU8A 3CO5A 2HXYA 3GEMA 5J2UA 3A27A 3N6VA 3C8UA 3COJA 3ELWA 3FTPA 1PNOA 5FRDA 2YBDA 1SZJG 4HKTA 4X6LA 3SHFA 1EAYA 3QEAZ 3VR1A 1MO4A 2EZ4A 2WQ7A 1VL2A 3IESA 3PTLA 2B78A 5AW9A 4BJ6A 1WZ2A 1OMOA 3KOYA 4MO9A 1HEYA 1YTLA 4M1ZA 4AL4A 1JB1A 4OXNA 1J2RA 4X7BA 5M34A 4R8SA 2HNKA 4PLYA 2M1XA 3S5JA 2QJOA 3NM4A 2AXPA 1WCIB 2Y0DA 2ZJYA 2EQ5A 4ED9A 5BNTA 2J0SA 3Q11A 2Y0EA 2KS6A 2O14A 1IMJA 4GIBA 5IF3A 1YIAA 2HLDA 1J70A 4YP6A 1FYEA 5DB4A 1HYHA 621PA 3SC3A 4JC8A 4YQFA 4B5LA 1U0EA 3MTGA 1NNUA 5DBHX 2OYRA 3A05A 4D8XA 3FTDA 5CH5A 4Q3BA 1IPEA 5J59A 4IQ4A 2XMBA 2JHPA 3W9YA 4EHDA 2CWDA 1D2HA 3LQ2A 4Y6PA 1II9A 4RKRA 2ACKA 3P0EA 4K7JA 3LVBA 1TJNA 3ELUA 4KO2S 1ZJ4A 4QFDA 1CP2A 4S1NA 4XGRA 3S2FA 4NCHA 5CXQA 1KTVA 1N2BA 3BWVA 2EKLA 1XL0A 5HRCA 1DCFA 3WSWA 3I8XA 1SKAA 3OCCA 3DOFA 4UU1A 2H0QA 2H1HA 2GEKA 1N8NA 3FZYA 3OZXA 3OPXA 4PLHA 3PQ7A 2FP3A 4BXOB 4US0R 4PQEA 4ARIA 2JFHA 3MTDA 3DJFA 1A71A 1KPGA 5TQ0B 2DPGA 5H83A 2R87A 3FNFA 3BMOA 3OOEA 4NJEB 2WUFA 4P7KA 4KDCA 1KKLA 1KVRA 5FYDA 4QELA 2WKPA 2YR0A 3ZN2A 4DILA 1GEGA 1T36A 4BNIA 3EY4A 2WJJA 5DM4A 1IBMB 3GJYA 1F2TB 1U2ZA 1BX1A 5F98A 4OGGA 4RJLA 2R6ZA 3D6UA 2NIPA 4DC0A 3WKCA 3OFVA 2FPKA 4HBZA 4HEHA 5K0JA 1O08A 5F7ZA 2WTNA 4JC0A 2RHDA 2FDXA 2QY6A 4ZT4A 4CM4A 1AO0A 4ZC8A 2EBUA 2Q5EA 3ZU6A 1GEEA 1XJWA 2OT3B 2ROQA 2CYCA 2HMVA 2PJRA 3BC1A 4MUHA 4RVSA 3ZBQA 1XZGA 1F2UA 4TKUB 1JJBA 3CTPA 1TZMA 2XYGA 4AMYA 1U2SA 2O52A 1TQDA 1W48A 3HWWA 2K2WA 3INTA 3RADC 1X7WB 2BI8A 3KLMX 4PNPA 2YS7A 1SQFA 4P7JA 1NUPA 1IIRA 3VKUA 5LN1A 1C41A 1NX9A 3FKSA 2WJZB 1KO1A 3AJRA 3EDOA 1M6EX 1XA4A 3H11A 1E94E 3S5UA 1Y1QA 5LQUA 5GIOE 4Z53A 5F4BA 3U48A 3I2JA 2J3LA 3IBGA 3L6CA 4TTJA 4X93A 3RIYA 2YV5A 6AT1A 4L15A 4WV3A 3UXMA 1G2OA 1TAGA 4BB9A 4K9KA 4EW6A 2LW7A 2ECOA 2HOQA 4QWWA 3RDPA 4EYGA 4KITB 2QRVA 3NANA 2Q9CA 3L7CA 4MAFA 2F43A 4Q12A 1ARZA 4P93A 4UM8B 3TZKA 1AN0A 2WMNB 2Q1TA 4FGZA 1M2VB 4Q1AA 4UXJA 3RVOA 3SFZA 4NWIA 5JWRA 2ORIA 2NGRA 3OC0A 3HK2A 3TKAA 3DAPA 1GLVA 2J4CA 1XVUA 3UA3A 2Q3BA 2IYPA 2DE0X 2OECA 4YA6A 5C51B 2ZSEA 3FIJA 5ADVA 2LGJA 1ICEA 4QVKA 1FNNA 1LBQA 2PMCA 2FK8A 3NIGB 3FPCA 3CNHA 4PEVA 4Y1RA 4XQCA 2ZE5A 1Q20A 3BMXA 1ES9A 3FGZA 1FDOA 5JFGA 3DEIA 2QROA 1FJGB 1GTZA 4WLFA 1DNPA 1ZNQO 2VYQA 1Q7EA 4ZFNA 1Z0SA 5DI3A 1ZM3A 4Q9JA 2ZUCA 2W6JA 2FSSA 5HMLA 3BMQB 2JIZA 2EBWA 5D51S 5HGJA 4IO0A 3F6CA 5KNBH 4X1YB 1ECFA 4KXQA 3KCNA 1N7JA 2PRIA 3WIBA 1UC9A 3QWBA 3IA7A 4M21A 1B4DA 1DELA 2M6LA 1U0FA 1ZPDA 1GZ4A 2JLAA 3BN3A 3MOSA 4PPFA 4PX3A 4OHBA 3ZCSA 5B6JA 1XWIA 2VXBA 1JKIA 2EG9A 2R7KA 5I7HA 4YJ3B 1H2HA 3WTCA 1IH8A 4BXOA 3MIIA 3L84A 5JS2A 4TKMA 1G5TA 5AW3A 2GN0A 1H1DA 2DKNA 1U2GC 1XEXB 4TL7A 2FPMA 2PX5A 2W5UA 1Y34E 2ZJFA 2AZDA 3G5MA 3IH5A 1FW6A 3SEZA 5E1BA 1RJ9B 3T7IA 4JXZA 3L7MA 2O8FB 3ZGVA 3VO2A 1EFCA 3H5WA 1GTRA 3TGPA 4I1IA 1H3FA 4LY9A 3OCVA 1YBMA 3WGHA 5B55A 2JLUA 4WX2B 1JFVA 3JQAD 5HUHA 3FHCB 1PG5A 2XF2A 4NONA 3BK2A 5FBZA 4LJ6A 3JYNA 4I6GA 1ZBDA 2GZHA 1B0ZA 2D6FA 5F1PA 5BSEA 2QG6A 2V6JA 2HDNB 2BE9A 2JD1A 3DE4X 1H3NA 2HC9A 3SC2B 2KWIA 3AR8A 4CKYA 2PUGA 2XMRA 4BNFA 1LSOA 4IIUA 2AB0A 1H5UA 3OLXA 2TYSB 2C94A 4MKXA 3RYHA 3R41A 3ZV4A 3GLIB 4ZTUB 4CBVA 1QZTA 3EVNA 4O4IB 3E7WA 4N7MA 4R9RA 3VZCA 5C8XA 5CDUA 3GLFE 2IBSA 4UHKA 1QZUA 5E9AA 2I7XA 1XRJA 3WLAA 4RC9A 2DEUA 4JT4A 1E7RA 5FBKA 3STYA 1S2OA 5UKDA 5IDXA 1MAAA 1PJ2A 1E0SA 2X0EA 2IS6A 3OZTA 1AOXA 3OAAD 4PRKA 2FP4B 4QUHA 5FTWA 4F7DA 4B3CA 3UT5B 5IT4A 4NZPA 3TTVA 1T4CB 5TJHA 1VTKA 4Q3NA 1VIDA 4PW0A 4RYDA 4GS5A 4HC4A 4Q1EA 3GCXA 4G5YA 1SEVA 2VH5R 2CKMA 1DUIA 1U31A 1XAHA 3A1EA 3JQPA 3TLEA 3DM5A 4WGFA 2W6NA 4N3BA 3H5RA 1XNQB 1L8LA 4WINA 4DRYA 1K5DA 1KDZA 2D54A 2X8AA 2EJWA 1DEKA 2GCEA 3QEJA 1XUOA 3F71A 1C30B 1YB4A 2JZCA 5LXTA 2CMDA 1IY0A 4LY6A 2VAVA 1D5WA 1DKMA 3C8ZA 4J7CA 1ZJZA 2A33A 2YXLA 4ZVUA 1JHUA 4IHJB 4LXHA 2W6PA 2HIHA 1ZUWA 4EABA 3UMYA 3DBLB 1R5JA 2C3YA 1O9GA 1KMHB 5HBGA 5KX5F 1YJBA 3TF5A 4NAUA 1XNGA 4TYMA 1C9MA 3IE1A 1R64A 4YACA 4DUGA 1ST2A 3ZV7A 1TKBA 2H2IA 5BWNA 4N65A 5FKJA 2QRKA 4ZI7A 3UOWA 4E4YA 4DLZA 1HNWB 4X54A 1MD9A 1XZAA 3HA2A 3PGVA 2Q6TA 2HYIC 2RAVA 5CVDA 3WL7A 1UUFA 3U40A 3PPIA 6CHYA 3LRPA 4ZVMA 2FWIA 5LQCA 1VKJA 1GL7A 1RWMA 1O94A 3WP0A 1CP3A 2VDVE 3IALA 1JU4A 5B3JC 1VJGA 2GETA 4B75A 3DMFA 3TYXA 1Z0JA 3LIPA 2ATXA 5A9RA 4AJOA 1WPRA 1EVIA 3PDCA 5DN6D 3HJFA 1RMQA 2E4ZA 2JAPA 2P2NA 5DX0A 3WGTA 1IHYA 1V4NA 2FLVA 5C32A 1PR0A 1B6TA 2JJMA 2QAGA 3G89A 4KN5A 1LC0A 2W98A 3U49A 1GUBA 3AXSA 4P83A 1KXJA 4X61A 3F1LA 1E32A 2JCXA 3KUXA 3KJHA 1ZZEA 3WIDA 2FOIA 2ZE7A 3EJWA 3P9KA 2ZBVA 3U56A 1FU4A 1E9FA 3HKDA 3U6BA 4OQPA 2MIIA 2GJKA 1EXVA 1DWQA 2FZ5A 1Y6RA 4J7XA 4G4SO 4YAWA 4QAJA 1Z7BA 4KYUA 1SGWA 1WXXA 2A94A 1RQ2A 2VSOA 4R83A 3U4CA 4C0LA 1KJ9A 4WVFA 2GCIA 3RTEA 3GYGA 1YFZA 2BL4A 4HDNB 3JWJA 2DECA 3OEWA 4RV9A 1TO1E 3TLAA 1I10A 1LBHA 2O2EA 3WKAA 4DJ5X 1EZZA 1FFAA 4H16A 4HZIA 4Q19A 5AKJA 1ABFA 2JBWA 4MYSA 5AM0A 2RIRA 3BH6A 4IVNA 1M2OA 2C1XA 1OCEA 2R60A 1HE5A 3KSRA 3B48A 3IBYA 3EC7A 3R0QA 4FIDA 4HDRA 3I58A 3GFTA 3STVA 4BMDA 3QV1A 4FCTA 3AINA 3G5UA 3LGAA 3PHJA 1EINA 4DR2B 3SKXA 1BE0A 2XA2A 1LTKA 4RMIA 1JE1A 1AKEA 3EVTA 5EINA 4QYWA 4ARUA 3E9QA 1Z0UA 4R5HA 5CBPA 5CDGA 4BLWA 4GYJA 4HLDA 3SDZA 3ZJUA 2R84A 2W71A 3HCCA 4FMCF 2VAPA 1V9SA 5KNCH 4XVUA 2XXBA 2OLEA 1HL7A 2Z08A 4EI9A 5F9MA 1EWKA 2C4TA 2V9PA 4G81A 1YMQA 2WMDA 3HXLA 1ID1A 4MW7A 3RK4A 3D6FA 4DYHA 2V9ZA 2C2BA 4HDMA 1AKNA 2EP5A 4Y0VA 1DOZA 3IIKA 2OAQ1 4I14A 1GZDA 4ZRDA 1N5MA 2VQEB 4TS4A 5CJ2A 1P7YA 1G9TA 1MAWA 1WKVA 1ZC3A 3SIPA 2PUJA 4ZMBA 5JY1A 2WFMA 4HDQB 2Q6OA 2IVZA 3RT9A 3UAZA 3KHUA 3K9GA 5C2JB 3R9XB 3IMFA 4LSWA 4M1OA 5GOTA 4OA8A 5BQXA 1N0HA 3QFFA 2EGHA 1OT3A 3IEUA 4I4TB 1L3CA 5KI6A 1W25A 2FH5B 2X14A 4DLXA 1OC4A 3A70A 5IZCC 1AD2A 1IOWA 2FU5C 2W8BB 4IVRA 1ZK4A 4BFYA 5DEIA 5KQGA 2BGWA 3ZJTA 3PXBA 2RIPA 2I9KA 1Y42X 3IL2A 1VP9A 1ZOSA 2XR1A 1JDNA 2VH2A 3RNOA 4EA6A 3VQTA 3GOHA 5A1JA 1A96A 4LHYA 1UPUA 4Z86A 1Y1SA 3F6PA 1J2YA 3RBVA 2BFPA 2AE2A 3AETA 1S2LA 1XCGB 4LQ4A 3ZCXA 4FUTA 5C8DA 1B2RA 3DULA 1S01A 4KN9S 4QUBA 5IN4A 2RCYA 3O8OA 3E7XA 4PWYA 4BMSA 1HPLA 3GVXA 1ZD9A 3PIRA 5C37A 1A8IA 3UJDA 1OYVA 3Q15C 1QFXA 2R8XA 2WWTA 3IVRA 1OXTA 3RK0A 4EVIA 5J4HA 1Z62A 2VPXA 4GOXA 3T9DA 3KUCA 1CQIA 1B6GA 4FMDB 5LB4A 4NG5A 4AF8A 2MSWA 5AUOB 3T1NA 1CCWA 1KJNA 1N2ZA 1GVNB 1Z4IA 2I5PO 2CLIB 1FDWA 4CU5A 1ULTA 1QO0D 3SM9A 1BN6A 1FFXA 1W47A 3U3XA 3F5FA 2EZ9A 3WGKA 4KQCA 3RS9A 1HRDA 2WT4A 3GMIA 5KOJA 1OAKA 1U1DA 3ZD7A 3U4QB 1CETA 1D1SA 3HGTA 4GOND 4HQOA 4OSEA 1S3FA 1U11A 4MWOA 3RRZA 3ZHSA 1N2CA 4AX8A 3KB1A 4DLYA 5K3OA 4GP7A 4N1AA 4EB6B 1K0UA 4RD1A 3UUWA 1U8TA 4A8TA 1KS9A 5H1YA 1SVLA 5K4GA 4HAZA 3K6SB 4I4TF 1JR3D 3V1LA 1D2RA 3A9TA 1T1GA 1RHMA 3FETA 4A0HA 3VKHA 1NQWA 4YUVA 5L3SA 3TS1A 4DIUA 1PUJA 4WEOA 1XXLA 3O8BA 4KO4S 1NNLA 3T5DA 1JFRA 4LDZA 1AU9A 2TS1A 2WI8A 4ZVVA 4P3XA 1EP3B 5H3LA 2QK4A 5U9CA 2ATCA 1OTHA 2GD2A 1YASA 1DDIA 4LOHA 5HA5A 1E2JA 3KTOA 1MIHA 3OFSA 2C4WA 1CZOA 2BEUB 3L0DA 4GGPA 1ULUA 4H7IA 4R2WA 4EMTA 3BD9A 1JUDA 4F8EA 3D81A 4NCAA 3AKDA 1P75A 1GYQA 2VHVA 3M6VA 3OG9A 4BFSA 5JS1A 1WR8A 2DLNA 3SQWA 2O07A 1JDBC 4IDBA 5TV2A 1ZYUA 1WSWA 1H1LB 1PN3A 1KH2A 3W06A 1FF9A 2BZ0A 3DTNA 4M4SA 1RQPA 4ZIRA 3ZIAD 2VP9A 4EWLA 3GJQA 4NCKA 3QXXA 4WCFB 5DHFA 5KEIA 2VHTA 3RYHB 2Q4RA 5C52B 1S8FA 3QPDA 4PSAA 3ZIUA 4M3NA 1ZUNA 3N58A 4MDYA 4C4AA 3FDZA 1CPYA 3B3JA 3NYQA 2CXRA 3MCVA 3BCUA 4QBFA 1UDRA 5AJUA 3SY8A 1QOPB 3B53X 3SR3A 1CVRA 1ENZA 4CV3A 3PL5A 3V48A 5T6BA 2FCRA 1LVUA 5I7EA 3VRHA 1VYUA 4D81A 1B1AA 3CLKA 4ILKA 3VNVA 3QLEA 4UHFA 4W9MC 1NG1A 2C07A 3LG2A 1XAGA 3DAYA 4XYBA 1SD2A 3D02A 2E4AA 4CEJB 1GUDA 1UEJA 1ZC4A 3AIKA 3HSKA 3LVFO 5ITWA 2AJCA 2R5WA 3MRTA 4UASA 4UVDA 1Z5UA 1OZ0A 1MB3A 2IZZA 3PNMA 2Q5QA 4P7BA 2OK7A 1A9PA 2A5LA 3EISA 1I2CA 3B6IA 4JDUA 4BKUA 3QVGA 4R1PA 4ZOBA 1BDHA 4QM6A 1YD7A 2D3TA 2H0AA 3GMSA 4JQCA 1X74A 1XZCA 3HBMA 4QYXA 3WMRA 4BQEA 5K7SA 5CEEA 4P38A 3HMKA 3O0DA 4RMNA 3UT5A 5REQA 1ZCJA 4N6OA 2XHZA 1KJIA 3A6KA 3W5BA 5JJKA 3S81A 4WBNA 4C2TA 1E4OA 1OAAA 3IP7A 3VPSA 2Y6UA 4ZJZA 3QVUA 3EXFA 4X1KB 5HIJA 5KX5B 5JQGF 1JMKC 4RFSA 2CL0X 3JAKB 2FYTA 3VDQA 2YWXA 3IIEA 1K7YA 3JQDA 3OA2A 4E14A 3ANSA 4EENA 4R98A 4U8GA 4UFPA 1OU4A 1UKZA 5IWCA 1JBQA 1YZFA 1MABB 2QG9A 5EQDA 1DS6A 2SECE 4MVWA 4O4LB 2PUHA 4XX1A 5AK5A 2ZW9A 5BSFA 1U5BB 2HJRA 4N5MA 2AQHA 3B1FA 4R3WA 2NYUA 4HTFA 3PPWA 1M2EA 2VCYA 5FQOA 3B5EA 1OQAA 3ZX5A 2EJBA 4W9RA 4I9HA 3Q9UA 3A7EA 3SHQA 4BWGA 1KI4A 2NVOA 4Y2RA 1Z4KA 1IB0A 4E3ZA 4NOJA 4Q3DA 1DKQA 2AKAB 2PH7A 2WJ4A 3AP3A 3SSMA 1H9BA 4C3ZA 1K9SA 3B3AA 2WU8A 3CG4A 3EZGA 2XT0A 3JR3A 3VHXA 4F4CA 4C0HA 2P2SA 3GLHB 3P4YA 2HHAA 2UVPA 4GPTA 1ECCA 5KYYB 2H8KA 4G86A 1E89A 5EE1A 4RTLA 1J9ZA 2FSHA 2RH4A 4JENA 2HDHA 4BX8A 1E1NA 1HYGA 1VCOA 2YWRA 1BDBA 4D46A 5B7GA 5I45A 3SE7A 2AR9A 4CR6A 1KP9A 4I2VA 2Q5IA 4XSGA 3ZWDA 1K27A 4BLRA 4EW2A 2J9YB 4C6SA 1TX4B 1QAMA 2H54A 3MWEA 3M5DA 4URYR 4ZYUA 4TL9A 3B85A 3RBAA 4PZ0A 5F35A 1GGNA 4IW3B 3I9V1 1P5ZB 3EN0A 4P3OA 3DYVA 4DDKA 2WB4A 1SHUX 5K5EA 3M83A 4O2LA 1AUXA 4ZVOA 3AQ4A 4I50F 1PLJA 2G08A 1NZDA 5G0UA 2NXEA 5IYZF 4HWGA 1VRVA 3FPKA 1NY6A 5I7VA 4PIPA 2NU7A 1F14A 4KDRA 5KS2A 1GCIA 3NHMA 3GEBA 5DSXA 1YUMA 3TNYA 5IK2A 1NFQA 4YRFA 1ZSNA 3U3ZA 4ZI3A 5C53B 4JX9A 1YGYA 3B6MA 2DF8A 4LJRA 2PRYA 2IZ7A 1LV7A 2GRUA 2WIJA 3FKJA 1PLKA 1JGTA 1JHDA 2ZIFA 3DZIA 3GFBA 2JS7A 1DI0A 2QYSA 1FK8A 3F67A 3QKUA 2P4EA 3STWA 3UMMA 4YUWA 2R0QC 4DLTA 3N8IA 4BP9A 3BXZA 4TYYA 1P61B 2P5SA 4G85A 4PFJA 1U7TA 1O96A 2IUFA 1RI3A 1UMKA 2OD9A 2QTHA 5JAIA 1VBMA 3AI1A 2JRCA 3GLVA 1IVNA 3TNLA 4U7TB 1I7QB 4Q1CA 1H1TA 2G4LA 1TT5A 3PBKA 1I4WA 4IG9A 3GLFB 4UQLA 2RHGB 4H15A 4EG8A 1HV8A 2EWVA 3CBQA 3HSSA 3PFGA 3J81k 1EUDA 5DLPA 4DQLA 1VB3A 2ZZKA 3MWFA 2P9TA 1JG2A 3T7SA 3FHOA 3UICA 4LZOA 3C45A 1PV1A 1NRIA 2VSNA 3FAKA 4MRMA 3OKFA 2X58A 5H9WA 2E3JA 1EK2A 3L92A 4JYBA 4BLOA 1H9AA 4AP9A 1HKUA 1RWVA 1ZUIA 2VF4X 3ET5A 4MV4A 1E62A 3IB3A 5D5PA 3NXSA 4FX2A 1PJ3A 3LUKA 1ZW1A 5GJWC 1XR3A 2CNOA 1PJBA 3T9BA 2G7MC 2QGFA 1Q1QA 1F0YA 4IJQA 2M6KA 2P69A 5KYTA 2QQ0A 2XCOA 2AC2A 2OZLA 2CC2A 4AICA 1L4YA 2Y9PB 1SKYE 1XRPA 3O1HB 1TADA 2JK1A 4UHHA 4DV3B 1S96A 2CHVA 2JCBA 3G5TA 1UBLS 4RA6B 4UE3S 3H5NA 1A4UA 4MQ5A 3URMA 1JYEA 5DO9A 2PKCA 4MMYB 1P3DA 4JBNA 2PEYA 4YAFA 3EFEA 4ATNA 2OBXA 4R71A 2FAXA 1E61A 2HUPA 3LBHA 1TLTA 1PZGA 3NUZA 1IK6A 2QSYA 1WJGA 1N5LA 3K8QA 5AH0A 3E18A 4JP8A 3ADPA 5HS6A 4QLOA 1LJUA 1G20E 1Z6GA 3ZWXA 4X85A 4DR4B 3D8SA 3JATB 2FCAA 1ZN8A 4JELA 3WNZA 4DHWA 4LVUA 3HJAA 3PUJA 5EEHA 1YA6A 3I4FA 1TNDA 1DADA 1FUIA 4HN2A 4ZEOA 3IVGA 4ESOA 2XH8A 1JVNA 1BS2A 2GXUA 4UE2A 4KAFA 2DPXA 4X7RA 4H0NA 1XZLA 1Z83A 4A9AA 4JLJA 2QLFA 4JSRA 3VBEA 3IVXA 1PUXA 4KPUA 1XYVA 2J7PA 1XDSA 1I01A 1FDTA 2SKEA 2WICA 2OO5C 3DWGA 3LP6A 3NT2A 4NBKA 5ELLA 1MQAA 3H83A 4JEHA 3WLSA 3M7IA 1BWSA 3I6QA 3SEQA 3GJ6A 2ZUVA 5GIPE 5F3WB 1V4BA 2RONA 5TT0A 3V33A 3LT4A 1T5LA 1TUEA 4RIEA 4JYAB 4L9SA 4PAOA 2A0WA 1JFFB 5JRDS 3H7AA 3SBEA 3F7OA 3QWFA 2GLXA 2Q2WA 4GNKA 3BMOB 5LZ4A 4YHHB 1W36D 4YJ2A 1OREA 3L0CA 4I8XA 2JA1A 3K1ZA 2JC3A 2VKTA 3LWZA 3PSAA 3ZY6A 2Y68A 3JRWA 3ELDA 1H65A 3P0RA 1I32A 2REQB 2JF0A 1LV8A 3DV0B 3Q4GA 2VC2B 4DPKA 1MJ5A 2F9FA 2FTKE 4C6TA 4XJSA 1T0HB 3W5VA 1NJ2A 3PRHA 2PS9A 1I0LA 5H0IA 3V1KA 2GPWA 3CNEA 3ITDA 4YHBA 5D3KA 1HA3A 3I37X 3L49A 3AVQA 3OOSA 1Q19A 2QRJA 2PLNA 1W85B 2MINA 3IBSA 4ROSA 3RWBA 3P2OA 1ZOPA 3ZVMA 4D57A 5DJ5A 5F2EA 3RJMA 1UPTA 2YY6A 4QRHA 4YRKA 5EUCA 3T3HA 1EPUA 1PHPA 2PKWA 2P2CA 4BAGA 1YOVA 4BGUA 1YK0A 2XUZA 5FIUA 2X8BA 3C24A 2XQKA 3TRHA 3DZFA 4EY3A 4QBHA 3I2FA 1Y4SA 4KWHA 2EWMA 3GGOA 3SAJA 1Q77A 3J81A 2CJXA 3GP5A 5BWOA 4IYJA 2ZUWA 3G8CA 3RAFC 3C4VA 3TZBA 4HAIA 1CV2A 2YWHA 3QLTA 1NF8A 1KEPA 1WDTA 5DM60 4WL0A 5AQ1A 4D8VA 3FM9A 2BMFA 1L4UA 1FL9A 1P0QA 3SS9X 4BVHA 5JZVA 2WFLA 2JLCA 2G9QA 1TZBA 2VQSA 1QQ6A 4GKAA 2XDAA 2WF9A 3IP8A 4RY9A 3ZDCA 1V41E 4J91A 1JEQB 4NARA 1TA0A 3O4HA 1YMUA 3TOSA 3QWHA 3U9LA 3Q9LA 5CHYA 3KU1A 5F73A 2AJBA 4J2TA 2QVBA 1EFUA 1FNSA 1ZA1A 2NU6A 2ZJOA 3KJQA 3DMYA 4AJIA 4O3MA 2I29A 5EJ8A 1EWYA 5K3SA 4NABA 1I4OA 1VRWA 1ZX1A 4JVMA 2AN5A 2KI5A 3HB0A 1A5ZA 1UFOA 2I2XB 2WAAA 3O75A 4YRGA 5HKBA 5DKFA 5L6MB 1ONBA 4N39A 4B3JA 3G3EA 3MD0A 1BW9A 2YCLA 3OLCX 3KTFA 4LF5B 3RROA 5KZMB 1HBJA 3D0KA 1SVIA 4PGAA 5CITA 1G0OA 2Z58A 3KT0A 4DADA 1C9NA 3HR4A 5EE3A 5INTA 1XCOA 4X1KA 5B1DA 1HLFA 1T43A 4NMXB 1WULS 2WYIA 3HBJA 1U94A 4TYPA 3C8DA 3DFZA 5FA6A 4EY5A 2ZZMA 1XZNA 4WFIA 3GNTA 2QOEA 2P7IA 3L6DA 3BXPA 3BE4A 3TQCA 3U3DA 4BP3A 4D3DA 1SOAA 1QOZA 2CNLA 1Y8QB 5JEEA 3IR5A 5LP6F 1VL1A 1FSPA 2BFEA 2Z1NA 3NMUF 2FWAA 2ZRFA 3TEJA 2DLDA 3E27A 3GXBA 4LDRA 4WWHA 1RXIA 3IERA 3PDHA 2B1JA 3RE1A 2A9PA 5AWFC 1JHXA 1HKHA 1MJNA 4G9EA 3EW9A 4PLFA 2H06A 1U8AA 4CL0A 4AMUA 2I67A 4FHFA 2I7VA 3KWLA 3NJ8A 1PWYE 1PFWA 1ZNWA 3IGFA 3TRJA 3AERA 5B64A 1O6BA 1E9DA 1ZIYA 2XDQB 3ZWWA 4HEA1 3SP1A 4RIGA 1GAQA 2AN1A 4HJXA 2HKIA 1XHFA 2ZBUA 4GLOA 4MV1A 1CR4A 2IHZA 3JWIA 4HWOA 3RSQA 4P34A 1DBQA 3HADA 5JFTA 2WWIA 1YA4A 1XQYA 2Y66A 4CHTA 2LZ0A 4JEUA 3O4GA 4O4IA 2PMKA 3WRYA 1JDVA 4K1XA 3EZNA 1T8WA 3N2EA 1JPJA 1SCUA 2WYOA 1T8SA 1KEZA 2RGXA 2DSNA 2VT2A 2CHGA 1W76A 3UJ7A 1NWHA 1JHVA 1P8AA 4ABYA 4HH3C 4XFKA 3CYFA 3B1XA 5BWLA 1BA3A 2IEZA 3EGXB 5LBIA 1MMFB 5B1YA 3VDRA 1RXUA 2GSDA 1JEYA 5KNLA 3OSZA 1LNZA 4IO1A 3VTFA 4PZZA 2ZZNA 2Z98A 5E4YA 1NQTA 3DAHA 4JQOA 4LGVA 4F3RA 4X90A 1J2TA 2JKVA 4WKCA 2ERYA 2ZRAA 1SBIA 1WUTA 2WY2D 5DGIA 2I66A 1R0WA 4LOKA 4AP5A 4IZOA 3S8EA 3WK8A 4F93B 2FSUA 2XI4A 4AURA 1C7FA 5AO9A 2YJ6A 3QG5A 1T1JA 3QSGA 3N2KA 1HDEA 4LNUB 1W4AA 2V65A 2V55B 2CLCX 4FYXA 4UXHA 2FUNB 1R6DA 1J5PA 2AWNA 3KPYA 3HCWA 3R7NA 2RGAA 4LJ7A 4J0FA 5FP0A 4HUTA 1LI5A 1F0NA 2O2JA 2Q7DA 1Z4OA 2O5VA 3F3YA 3VH1A 4MAAA 1VL5A 3LFHA 4ON9A 4ECAA 2RH5A 1WUYA 3PT9A 1A7AA 4RIHA 4S12A 4JJKA 3H75A 1L5HB 1O89A 4PPNA 5DX8A 3V4OA 4YGYA 4OG2A 2QTLA 1D1PA 1VHDA 3ZHZA 5JYDA 3E61A 3M4JA 3O8RA 4TZ6A 4IFBA 4Z51A 4KB5A 3ZHBA 2IOQA 4G0QA 4J8PA 4G1VA 3C98A 1I6WA 2NXNA 4KRXA 4CF7A 2C5GA 2ZGVA 4I9UA 4IHJA 3L8HA 4PXAA 4ZZ0A 4E33A 3HVJA 1L6RA 3THSA 4M60A 4FKZA 3QU4A 5AIBA 3O8NA 1RZ3A 1T9BA 4V03A 5JTTA 5CUQA 4AY4A 3NHZA 4GM4A 4UHDA 2GHIA 1XVTA 2QD1A 3EZ2A 1L5KA 4LF6B 2WD9A 1L8QA 3ZC3A 4S05A 5CCBA 3LQQA 1ICIA 4CIVA 3P27A 4H1HA 3LZCA 1X6VA 1R5BA 1DTSA 4EJ2A 3I5MA 3EIXA 4J94A 3BJEA 3TO5A 3ZNOA 4C1BA 2ORYA 1SA0A 1UFRA 2HDOA 3J7TA 2ZK7A 3OZBA 5HKOA 4YJDA 3ESQA 1X7ZA 1NIJA 2ZAOA 3HU3A 3IDSA 5FWXA 2G4VA 4JUCA 3NATA 3W1EA 2WJPA 3TPZA 1IEVA 1V5WA 4J0JA 4WSOA 5JXIA 4YONB 1MXFA 1L7AA 4O4HA 3ZNQA 4UD2A 4EX6A 3LIIA 2BIFA 2G28A 4OSPA 3VR6A 4YROA 3UW1A 1Q7RA 1JPVA 2JVJA 4QPPA 4BFUA 1QIKA 2LDBA 3E03A 3K9QO 3SLRA 3WLMA 4IDPA 1YHYA 2H2DA 1YE8A 2XQVA 4IHQA 4NHEA 5F1OA 4E2XA 2OAP1 1AHNA 1WDMA 4F4IA 4ZDIA 4XDGA 3U4AA 3UAYA 3KYBA 3TG2A 4NBVA 2YWJA 3W04A 3OZVA 2G9NA 3MYYA 1WLSA 2R8RA 4WFJA 4ZAVA 2YJ3A 1MPTA 3EDQA 4KPUB 3G0CA 1XAIA 4GLLA 4YBRA 3FLBA 3IEXA 1EIZA 3L6EA 4YVFA 1KHTA 1KVTA 2FF5A 2Q9AA 2QTWB 3WZLA 5KPDA 2R86A 4IQGA 2A78A 4HP8A 4YY3B 5HPYB 3T5AA 2OQ2A 1E2PA 1W5EA 3CR3C 3ZWNA 5JNTA 4G0UA 3OIVA 4CMHA 4HV4A 3MQFA 2CUNA 5F5NA 4KQMA 4HLCA 3U31A 4QULA 4IY1A 5KVQA 2LVBA 3FFAA 3HJCA 2H07A 4D45A 3IRVA 3ZWVA 1W8DA 5LLSA 3LKBA 4B1FA 2CY0A 2O3SA 5EN4A 5FL7A 4OLHA 3FRIA 3S2GA 3ESZA 5AI8A 3QELA 3FYHA 3SKYA 4RTSA 3E9ZA 4DE5A 3DKKA 1H2XA 5KYUB 5J5CA 2A1UA 2J4FA 4G0WA 1Q95A 5CXXA 4DWWA 1FP1D 4MTLA 3K6SA 3EAQA 2E6UX 1C1DA 4L4YA 1WXQA 4Y9SA 5AQEA 1TW2A 1AKVA 1TO2E 5BVGA 3MCWA 1GPKA 2ADFA 3I6IA 1ATIA 2E5WA 1QTQA 1OWLA 1NM5C 4CNBA 1CNEA 3NM5A 4EKYA 5JLJA 1Z82A 2EQAA 3HYLA 1CNFA 5G1NA 3X3HA 3EMBA 221PA 4QYMA 5L40A 3CH4B 2V59A 3BIJA 2NX2A 3F46A 5TQ0A 4CTOA 1SM4A 1V5EA 3L0ZA 1KQNA 2V8BA 4JA2A 1JIXA 1QIFA 2P2GA 2XNJA 3GLSA 4CUKA 4WZAE 4DQDA 2FN3A 3G6KA 3H5VA 4AUMA 1DAOA 2XZOA 4WECA 1P17A 3AMVA 3O3CA 4TWJA 2V7WA 4MUFA 1GKLA 3KJZA 1YZUA 3FBTA 3CRQA 1CUEA 4DCJA 3JQFC 1UFQA 2NTEA 3EA4A 3FMGA 4KFTA 2VUUA 3ZHYA 3LYAA 2NU6B 3L7AA 3PV0A 2ZE8A 3C43A 1SVSA 1ZKMA 1DKNA 2GBGA 2DTXA 2O6LA 1I7PA 3NAMA 5G0VA 1LVGA 3EXAA 4U7HA 1OGJA 2VNIA 3A6DA 3MJEA 3RKRA 2HIMA 1FVOA 2JJ2A 2XV1A 3DAGA 1G8PA 1L2TA 2AK2A 3I4CA 3ILXA 2EDCA 3KFLA 2GK3A 3FVTA 3IVMA 5DU2A 2NZJA 4Q15A 3P96A 1FLNA 1NHWA 3VOAA 1SAYA 3TWOA 1VA5A 4S1TA 1M72A 1M1YB 1B8UA 2NUPA 3GBSA 1FS4A 4NBUA 1AGXA 2ZETA 4TQGA 1OUMA 2G5TA 4IKOA 4CKCA 1YS2X 4B3SB 4FZ3A 4XCQA 4BKRA 1GNRA 3I1FA 3CCCA 5JSZA 1KEKA 3GWGA 5JE8A 1WXWA 3ROQA 4PG4A 2RH8A 4HRXA 3D64A 4RHUA 4YYEA 1J0EA 1LDMA 1FZQA 2V6GA 1B1CA 5CW1A 4B8ZA 1F5SA 5BV1A 2EERA 2O57A 1QRAA 2IU6A 1MA0A 4WKNA 4Z0PA 1S1MA 3EGVA 3CONA 3O47A 5HOQA 1A0OA 4OP3A 1L4HA 2O23A 1FFGA 3HN6A 3L5KA 3QVWA 4LE1A 3AEQB 5TC4A 2ISQA 1OYWA 3G5AA 4U2DA 4B0OA 1DCMA 1SZCA 1EU1A 3FR8A 4QATA 3T5CA 3UIEA 4NDZA 3NH6A 7MHTA 3DVLA 1HZJA 1TYCA 2VJLA 2QL9A 3BE6A 2VBCA 1A5AB 3E8XA 4MKIA 1KSJA 2QLNA 1R18A 4FQ5A 4R0MA 1HEUA 4HFMA 1VMAA 1PDVA 3FTQA 3VNQA 3DFKA 3HVKA 1XK7A 4KACA 4M37A 4AX4A 4I7EA 3ICOA 1QFJA 5A9TA 5K01A 3YASA 5BW6B 2AXEA 5U1PA 5BOSB 4ARAA 4D1YA 1H2FA 3DW3X 3OX1A 4MA5A 2ZXFA 2PQMA 3CW8X 4MQEA 1NVKA 1W4ZA 4P4UA 1FB5A 4QOGA 2RGRA 1AQ6A 1VKRA 3UAVA 3HXQA 3JSXA 3SHWA 3ST7A 3ZDRA 1E3QA 1LFAA 3WGNA 4F71A 4N5IX 3AHJA 2GPYA 2J0UB 3AUTA 4KI0A 3FNRA 1LFDB 5EESA 1BWQA 1D8AA 1PJQA 1ZIPA 2KM1A 2O05A 3JCZA 2NMVA 1UXHA 1ZI8A 5LBTA 1EESA 5JYCA 4D79A 3FJ1A 1VKNA 4B2YA 1MEEA 3R5XA 4MUIA 4JP5A 3CUEF 1P33A 1MB0A 5K0FA 2H3EA 2F4VB 1RPJA 3CKMA 1UT6A 3IRUA 4DSTA 2VDQB 1P73A 1XEFA 3D8UA 1I3KA 3GW8A 3ZH9B 1N7HA 1WVIA 1RQGA 2G9VA 2P2ZA 1LS6A 2ZB2A 3JQQA 3S2UA 1N5OX 3DHYA 3FAZA 1BX3A 1NW5A 4OQQA 5F7JA 3VR3A 2GK7A 3BZWA 3LT1A 3W34A 5KYXA 2Y05A 1D6JA 1Y6ZA 4W99A 5TSDA 1LBTA 1UJMA 1D2GA 1RBMA 3QNWA 4XX0A 4DY6A 4P4GA 4HVCA 1MP0A 2WJHA 3OKPA 2FQXA 4B82A 1IOZA 3IEIA 5TEVA 1G291 2BH9A 1AKMA 1Y9EA 2G9ZA 3Q9NA 5J5AA 3UYKA 4HDSA 2HJWA 2ZBRA 4KMRA 3CUTA 2RHJA 3ORRA 1G5FA 4XIGS 2WWFA 4FYWA 3TG8A 1GZVA 1QLJA 3CEHA 3LUFA 1SVUA 4P7GA 3SFVA 3N39C 1AQJA 3P9CA 4UTOA 3QLUA 2Q4DA 2R8YA 3HN7A 3QTTA 1R0RE 1LDBA 2QMHA 4JUBA 1AK1A 3WVNA 1EQUA 4BFXA 4XCXA 2OCKA 3CT4A 3ZLVA 4XQ0A 2XRMA 1DQPA 1XCLA 4GUAA 1SOUA 3TRDA 3U13A 1BS1A 1WOYA 4BWYA 2C3OA 4QLAA 2GR9A 4OL0A 3VAYA 4N4AA 3WSTA 3KXPA 4YX9A 4N3CA 3MA0A 4KKXB 1DQYA 1E3WB 2OPHA 5IXYA 5KYWA 1MGOA 3ZGXA 1RSZA 3UF0A 3UAXA 3D31A 2BFBB 3DLTA 3LDUA 4QIHA 4I1RA 4YP5A 2BGMA 4ND8A 3ZXSA 2ZYHA 3LLUA 1JQDA 1U8ZA 1J7JA 3F90A 3TM5A 4Z1MA 2GYWA 3V9AA 4DIOA 1GGMA 1SZPA 4ESVA 4TRJA 4BEBA 4URZR 2JH9A 3P94A 1Y81A 1D6NA 1ZRMA 2ZG6A 1T9GS 4AQYB 5HSGA 4C7JA 3GFFA 2IS1A 2O8DA 1XRRA 2ZI3A 2WD7A 1HDIA 4AY6A 2I8AA 2E7ZA 4F2PA 1J1IA 3WB9A 5IAAA 4Y6OA 1BMFA 2R85A 4F92B 2IITA 3UHOA 2O8FA 1KMMA 1NXQA 2FSPA 3R5FA 5CA1A 2VZ0A 3B6ZA 3TSOA 3EZ6A 1JKFA 2X5NA 3AFNA 1P44A 2RGEA 1XIVA 3R7AA 2DHRA 3HWSA 3ND7A 4XDHA 4Y2SA 2C7RA 4QX6A 3I2HA 4BAUA 3OBIA 3QUBA 1CR2A 1XU4A 1IM2A 3DZDA 1S2DA 5L3ZA 2QR5A 1KEWA 3HA7A 1EK6A 3UKJA 3ZW8A 4D4KA 2GDZA 1L9KA 3B6EA 1ANKA 4MS4B 4X9XA 4ZV7A 1ZJJA 4P35A 4EGQA 5GQSA 1TUBA 1GKYA 3LUHA 4MVJH 1X14A 2PUDA 1OZGA 4LWPA 2XTMA 2WTAA 4B09A 1D09A 4BQOA 3PNLA 4ZQFA 5A0FA 4YRJA 4GT1A 2X8WA 2GZRA 3AI2A 3EODA 2YJ4A 2YOHA 2YS6A 2UYHA 1GSIA 3LQYA 4JJ6A 1BH2A 3M49A 2DB3A 3D4PA 1EWQA 3DKPA 4TWBA 3AZQA 4IJVA 4U1RA 5KTRA 4N49A 4URXR 1N2EA 2OVFA 1IN7A 2FFJA 2FKAA 1BDMA 1N6IA 2Y77A 5I5EA 2M98A 1NVDA 3RVKA 3DL0A 4CKXA 2QRUA 1BXGB 2C42A 5EJ5A 1GPYA 1P0IA 2O2SA 2BHSA 2YRXA 3CPHA 3PXAA 5KAPA 1KWGA 2TMDA 3HU1A 1AE1A 1KC3A 3EXIB 5CX1B 2AOTA 3N87A 2ZRMA 3PK0A 3I2KA 1CJTC 4C0SA 3DUFB 2C2YA 1P4AA 2P8SA 3D3WB 3Q5GA 4LGYA 1KDYA 1YB7A 3BK7A 4Y2VA 5FLEX 2ZPUA 3CH6A 3HJTA 2FXIA 4HQFA 4FDUA 1HSOA 3SXPA 4FCCA 5G0WA 3HB5X 1GZSA 4N0QA 4N48A 5M29A 4N5DA 1CR1A 2N3ZA 1QYWA 4ZHQB 3W7VA 1USKA 3VPDA 2D7CA 1A1VA 1NJ6A 1WXFA 2EC5A 4JUIA 4MYUA 2VOJA 5EUQB 5F64A 2YN4A 2P2DA 1E5LA 1SFRA 2GPBA 2O5RA 3GA7A 5DT9A 1NX6A 4JIGA 2HBYA 5E4JA 3M5PA 2GTPA 1NDQA 1NVWQ 5ECGC 2C0QA 3VOBA 4HQ6A 1VIVA 4E5YA 3NAGA 1QKKA 3DWEX 1L1FA 4RTJA 2OKCA 3H2SA 4NEHB 2B61A 2XTAA 2PSEA 5BT9A 2FR1A 5COQA 1QQBA 3VJMA 4LX8A 2MR5A 3K0CC 3HHPA 2KPOA 3JQ8A 5JRZA 1XWFA 2BFAA 5E4FA 3ND9A 1NV8A 2V6IA 2LP4Y 1YACA 3A3OA 3VHRA 3X1XA 3ZU3A 2HWYA 2QZJA 4C76A 1NXOA 4OHOA 3TECE 3PHBE 1G4UR 1KEUA 1P1IA 5JS6A 3VNUA 1JT9A 2DCMA 3FOCA 3IC5A 4Z2AA 3GEPA 2ODBA 3GJ5A 1TTQB 4FT2A 1BXRA 4MR7B 4XR9A 1TPYA 4EARA 1VZ3A 2J5BA 1OWMA 3ZS8A 3U3MA 4BV8A 4F1JA 3G23A 3EVBA 1DRJA 1S8AA 4QGGA 2WWRA 1MRNA 5G0TA 1XMXA 5F1KA 2ZRBA 1U02A 1OIVA 2DTEA 4KR2A 2PIAA 1P9WA 4RK0A 5BV0A 3OFJA 3K0SA 2ZCJA 3HGMA 2B21A 2IPOA 3OJFA 1G8GA 3RS7A 3GGJA 2PLFA 2VATA 3P9YA 2H1OA 3K2IA 2EV9A 1E5VA 1LDGA 2L2QA 3PJDA 4QQNA 2BBOA 4AUEA 3AKZA 3CCBA 1YBFA 1ESEA 1KI2A 3HDJA 3U61B 5ALIA 4RTNA 5FBHA 3DQPA 3QX3A 5DCWA 1XL1A 1RYHA 5HIMA 3UMSA 3VX3A 5C9ZA 3FYUA 1HE4A 4KN8A 5GGXA 4MIEA 3EVDA 3PKZA 5JSHA 4QGBA 2L19A 1ZCAA 1U1CA 1WXHA 3T1YB 1UDBA 3EOZA 2JK0A 1YU9A 2QN6A 1R8JA 1G38A 4KPGA 4FNMA 2Q07A 4NH4A 5IWAB 3O74A 4QEKA 3T4EA 4RK6A 1TGVA 2J7KA 3I5YA 2H17A 1VPWA 3DPSA 4DMLA 2ZRPA 3L8EA 3LW8A 1OJ7A 1NYTA 3I9LA 3P4UA 4J0GA 2IOFK 3IDFA 4EDFA 2BEWA 4HNTA 3LNCA 4IIVA 4EG5A 3MPUA 4XEUA 5FYQA 1GPLA 2GCOA 4HQLA 4RVHA 1KBOA 4AMZA 3WLIA 4JLAA 4QDTA 4X3PA 3OC6A 3M1YA 1CRQA 2WUVA 4YJ2B 2R6JA 1RAGA 2VF5X 1WSAA 1WQ3A 3BDIA 2VZ8A 3I01M 4IJ5A 4MGKR 4A27A 5BPHA 4A4DA 4JLPA 3RSSA 1QANA 4WCVA 1RQNA 3MT7A 5EFZA 4EG3A 3U60B 4FW8A 3S3TA 4KRFA 1KDTA 2DPHA 4I50B 5IYZB 4IXTA 3OZEA 1T2VA 5CYPA 1GNSA 2I6UA 1AIPA 1V6CA 2Q6VA 1TW3A 3MJTA 3NPMA 3PUHA 3RPEA 8GPBA 2VWPA 1LPMA 4E5UA 4N7JA 4IWYA 4MVJA 3CTMA 5ILQA 1U7DA 4IUCS 3SHOA 1PR6A 2INGX 4FFBA 3CISA 4K9SA 4MXDA 1IY8A 3QUSA 4I81A 4QTYA 3TRFA 4FQ7A 5JBNA 3GLGA 1K98A 1GQOA 2DVMA 3M6FA 4JQZA 5EIBC 5J2UB 3T9AA 2PGAA 3I76A 3UH0A 5CVJA 1NKTA 3L8GA 2OCAA 3HY3A 3ELYA 3VMMA 2AW3A 1TYEB 2JFNA 1TD1A 3MWDB 5KNCA 1FS5A 2B5WA 1KYWA 2WVGA 1CJCA 3B1YA 3KP1A 4OJMX 3IB6A 3O3OB 2RHCA 2BJWA 3QF7A 1WXIA 1WV1A 1K4MA 1RMTA 3BM5A 3P5SA 4LTNA 3GC6A 5IAEA 4BAZA 4F96A 2XAUA 4ID3A 4AQDA 1SKQA 1LGYA 4FE4A 3RSCA 1OWOA 3ZTTA 4MICA 1RHJA 4DCPA 4DHEA 1X7XB 1RIFA 4CZ2A 2OBYA 4IIXA 5CJPA 5LNK1 4LXYA 1Y7IA 4FOPA 1HETA 3KOUA 1FFXB 3O84A 5L7YA 5EJFA 1AK2A 1OHHD 4BO0A 4RO0A 2DETA 2H4FA 4P82A 2XJ9A 1K7CA 2QP4A 1SKBA 1K8ZB 3UWDA 1PD1A 1FJ2A 1WB5A 4P92A 3QG1A 1XJCA 1ELOA 3IQZA 1D4FA 5EKSA 4B2PA 2E1RA 2K5UA 3R7WA 3CLVA 5AFSA 1V45E 3NYWA 1HTTA 1HDCA 2GS9A 1F2TA 5BN3A 4I5GA 1U9CA 1XAJA 3HCDA 3MB8A 1DMSA 4UHCA 3QPCA 1P5RA 2PVSA 3MWYW 5WRFA 4LV8B 1MO3A 4JLUA 2NTVA 3CLUD 3ETNA 2GI4A 1K7XB 1QFZA 1SOMA 3JRXA 4TTTS 1L1RA 2NZYA 3BHJA 3U81A 3D2BA 3UK0A 4AWAA 1WKCA 5EP4A 2G67A 2WPDD 3SD7A 3OEEA 5JVDB 1PR1A 1WHSA 1X77A 2NSJA 2JFFA 2X13A 3BRSA 4KX3A 4MWBA 4OYHA 4XW2A 3VISA 2M1ZA 1P0MA 1V7ZA 3M9XA 4LC9A 4D97A 4DDMA 4DNQA 2ERXA 1WKBA 2JIOA 1Y89A 1F6BA 3DQQA 3LOUA 4B6QA 1SCUB 3Q3JB 1MHTA 5JJBA 3IDQA 4G0ZA 1HR0B 3MLBA 3KETA 3MMPA 2HA6A 4JJ7A 1M1NB 4AY2A 4FDVA 2GCPA 3ZUGA 2G70A 4BO9A 1B74A 4G36A 4KQJA 1DP4A 1T9CA 2VNKA 3H65A 3ZK8A 2PH3A 5DNYB 4QO7A 2WNSA 1QE0A 3VM6A 4BB0A 1P0CA 1DAEA 1GPUA 2XB8A 1EVJA 2PUBA 3PYLA 1VQ1A 4ZO6A 1R7RA 1A3CA 1T9KA 2OD2A 3PXDA 4QJ5A 2GNOA 4RVGA 4AULA 1AMUA 3FPLA 1D0VA 3G1UA 1K7FB 1NTOA 4R2LA 5SICE 4Y0AA 2E18A 1YI0A 2B30A 5GZ1A 2NO4A 3NZEA 2CW5A 1JLLB 2I65A 4J6FA 4D44A 1U7XA 2AZMA 1M5UA 1RM4A 2WVHA 1EFRA 4FN5A 4C0BA 1CVIA 4OHXA 3WLOA 3UK1A 3AP2A