3L3BA

Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from ehrlichia chaffeensis at 1.90a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
210
Chain Sequence
LNSAVILAGCGHMDGSEIREAVLVMLELDRHNVNFKCFAPNKNQKQVVDHKKKESVGEVRNILVESARIARGSVYDIEQIRVEEFDMLVIPGGYGVAKNFSNLFDEDNDYILPEFKNAVREFYNAKKPIGAVCISPAVVVALLKDIAKVKVTIGELIDKMGGVHVDCPTIKSVKDDVNRIFSCSAYMRNDSLYNVYLGIQDMISSMVNYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Es1 family protein
publication title Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from Ehrlichia Chaffeensis at 1.90A resolution
rcsb
source organism Ehrlichia chaffeensis
molecule tags Biosynthetic protein
total genus 71
structure length 210
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l3bA00
1OX5A 1QF7A 3EFEA 1J42A 3FIJA 4OIFA 4PXYA 4GE3A 3RHTA 4UOZA 3TQIA 1VCOA 1R9GA 2XF2A 1C30B 2IUFA 2V4UA 4RKYA 1KXJA 2VPIA 1T3TA 3PQ8A 3BWEA 4D1YA 2YWDA 3B38A 2LXNA 4GUDA 4AJ9A 1U9CA 3CZ9A 3FSEA 4LRUA 5K4AA 1PE0A 3KKLA 4B40A 1KA9H 4ENSA 3L7NA 1M6VB 1G2IA 3TTSA 4MNTA 4B31A 3UJNA 1JVNA 3SF8B 3MIIA 3N7TA 1ONSA 4ENWA 5SY6A 3GRAA 4MGHA 3PQ5A 4ENVA 1KWGA 3NOVA 1VCMA 5DFAA 3UGJA 1IPHA 2ABWA 3ZR4B 1FYEA 4P34A 3SF8A 4MTCA 1P7ZA 1CE8B 4B7AA 3M3PA 1I7SB 4BFLA 4I46A 4N12A 4OGFA 4JQSA 1P80A 1IZYA 4L8YA 1SOAA 3F5DA 4WXYB 3OT1B 1P81A 3P9SA 1I1QB 2AD5A 2GHRA 3NVAA 4B5KA 4L78A 3R74A 5BV2P 3R75A 1C3OB 1S1MA 2YWBA 1L9XA 3PQ3A 4ZGGA 1Q7RA 3L3BA 3ER6A 2FEXA 5IP5A 3OT1A 4Y1GA 4AUNA 3NOOA 3CZAA 2ZUVA 4L7QA 1I7QB 3ZJ4A 3L4EA 4RKWA 2ZUTA 1SY7A 4N0MA 4AUEA 2A9VA 4OGGA 4ADSG 4QYTA 1PV2A 3PQ4A 4UOQA 4Y1RB 3UMMA 4L8FA 5SY9A 4S0ZA 1Q2UA 2AB0A 3UOWA 1GGKA 4P35A 1GGHA 2D7JA 1O1YA 2NV2B 1WL8A 3NOQA 4K2HA 4ZDKA 3EN0A 2ZUUA 1A9XB 4Y1RA 2H2WA 2RK3A 3PQ6A 2R1UA 4B2YA 4OFWA 1OY1A 2VRNA 1GPWB 3MGKA 1P7YA 4LGYA 4ENQA 1BXRB 3F71A 4Y1FA 3WFZA 1PDVA 2YWJA 4Y1EA 4P2GA 4UZSA 4UCFA 1QVZA 3B3AA 5JZOA 3P9RA 2OR3A 3NONA 1K9VF 3R76A 4AULA 2ZUWA 2WJZB 1OX4A 3SOZA 1QVVA 1QWSA 3D54D 3NORA 3TTXA 4BIMA 4BTEA 4OQ4A 4E5VA 2NV0A 4L95C 4WINA 1CF9A 3VU3A 3P9PA 3PQ7A 4XLLA 3TTWA 3TTUA 1T0BA 1IZZA 4P36A 4OJYA 1GPMA 3TTTA 4P5PA 2RK4A 3PQ2A 3BHNA 4HCJA 3UK7A 1FY2A 3ZJ5A 5JZMA 1P5FA 1UCFA 1KEEB 4R7GA 2VDJA 1GG9A 4I2NA 1VHQA 1GGJA 4ENUA 4ZDIA 4L8WB 4E08A 2R1TB 1OI4A 2W7TA 1GGFA 1OX4B 2VKTA 4ENPA 5LIRA 4ENTA 1OX6A 1JDBC 1N57A 2YWCA 4ENRA 1CS0B 1KWKA 1QDLB 1PDWA 2R1VB 4Y0NA 2ISSD 2RK6A 3EWNA 4ZDJA 3L18A 2R1TA 3CNEA 3EJ6A 4UNIA 1GGEA 5SY4A 3CYFA 3P9QA 2VXOA 1QVWA 2ZUSA 5E9AA 3TTVA 5SYAA 1VCNA 3TTYA 1T36B 2GK3A 4GE0A 4QYXA 4AUMA 3B36A 3CY6A 4I4NA 3EZGA 2R1VA
chains in the Genus database with same CATH superfamily
2ORVA 5GONB 5J4VA 3EG9A 3UB2A 1NJGA 2F3SA 4NJEB 5FWDA 2XWSA 2GXQA 2C9MA 3CV3A 1ITZA 3EXEB 3B38A 3OWXA 2ZS7A 2HRDA 1RM3A 3G82C 4PLFA 4JI1B 3H1FA 1E1LA 5GAJA 2I91A 2F8SA 5A04A 3AEQA 2VCHA 4EG4A 4WI1A 1T4CA 3QMPA 3FY4A 4ML3A 1Z5OA 1YI0A 1OPRA 2ZANA 3DJFA 4BQPA 4RTMA 3T7DA 4V1CA 1SZJG 4AZ0A 3RJTA 1KZ9A 2GN6A 3F5SA 4EYGA 1TCCA 1JA1A 1WVIA 3KKKA 3ETDA 1K1EA 3RKUA 3EXHB 4FHEA 5AI6A 4BWFB 4UASA 1TLFA 4LGCA 4D97A 3VDQA 3T0GA 2Z3WA 4QEKA 3QE3A 4YBRA 2Q46A 3GBVA 4YXWA 5B6JA 4HGYA 2HF2A 2QDXA 3HNPA 1ZY2A 5EQTA 1PFGA 5CD1A 1IY9A 3A1NA 2GNPA 3OD1A 2FFBA 3OTHA 1GPYA 4UKDA 1CJMA 4BAUA 5CA0F 1IATA 4F71A 1WDLA 3VYWA 3THRA 4BVKA 1UFKA 4L73A 4IHAA 5ITZA 1T8YA 1JR2A 4O2BA 3FI0A 5JJLA 4EB8A 2WSYB 121PA 1P2VA 1GAEO 2JH9A 2WB4A 1OI2A 3OWHA 4AJLA 4D0LB 5IYZF 4P84A 2J0UA 3P5BA 2ZK7A 4DBZA 2PR2A 3M89A 4WCVA 3ZUPA 2Y1EA 2WMYA 3COYA 1XCJA 5CLLA 3RBAA 3VX4A 2Y0CA 5KB3A 1SZDA 3QMMA 1NY5A 1TZ2A 3KR9A 3KSDO 3N8GA 4WOPA 5DCWA 3Q7PA 1F6WA 2GAJA 3UC9A 5AFSA 3UOGA 2Q5EA 2R8RA 3WYGA 2EARA 3I3OA 1N2BA 4IDGA 3VJMA 4F1WA 5JFTA 1CF4A 5K09A 5TJ9A 5JAZA 3WIVA 4UZSA 1GNVA 3PNKA 3EOAI 3RARA 1JHZA 4RACA 3DBHA 3O75A 1N7IA 4QXRA 1SKMA 3LP5A 2YOHA 3O90A 2XCSB 3U7HB 3AIMA 1Y6ZA 2ZB8A 1Z68A 2EL7A 3SCZA 3SOZA 4DILA 5K0CA 4YP6A 2Q1YA 2RGDA 1B1AA 1RPAA 5AI5A 4DJEC 4X00A 3WK5A 3D6AA 1X1CA 1OTXA 4OLFA 2W2LD 3RWBA 3WMEA 3LPLA 3WLIA 1AZSC 2GN4A 2PO5A 1AQJA 3PC7A 2QRKA 1CULC 1HDZA 2Y4OA 1O6GA 2VYNA 4XTCS 5KNDD 1OKKA 4A27A 2YOFA 3G0HA 1BKDR 3DVRX 2GFQA 1OX4B 1OUMA 1G0OA 2ZRBA 3LYAA 3WO1A 1S1CA 2C20A 1BDMA 2FFJA 4JBGA 4JFAA 2RI6A 1G8PA 4JLSA 3WK6A 1GPBA 4ZCMA 4BO7A 3DULA 4ZQEA 5HS6A 3FDIA 4I8XA 3LIIA 1KEEA 4DQ0A 3QXHA 1QO0D 2EQ5A 3BE4A 3EWNA 4G4SO 1P91A 2KJQA 1T2DA 4HFRA 3TNDA 4O63O 2HK6A 1N5MA 1X3LA 2W11A 2HTFA 1N1GA 2JEYA 3A31A 1GQ2A 5JSZA 2H9YA 2JCBA 2QJRA 1S8NA 6YASA 3K09A 4WOCA 2P0YA 2XF2A 1FX1A 4MI3A 4NZNA 2GGSA 1BJKA 2Z5FA 4MK4A 4QUBA 1NM5A 4F6RA 5HKKA 1T8WA 2BMWA 3F8TA 1HYHA 5A7HA 5KOHB 4G37A 2G36A 5JS7A 1YMQA 3DVQX 3AIIA 1OBVA 1Y6JA 4HDKB 1XWIA 3PJRA 2Q3EA 5IXJA 3L46A 3RSSA 3LVBA 4DSNA 3LYLA 1QFXA 3Q40A 4NPHA 4RYDA 2BKLA 4KNWA 3C6XA 5KREA 3OH8A 3ASZA 4LYJA 2WAMA 1F8GA 2ZAOA 1HX7A 2X0RA 4A6EA 4E70A 4Q3EA 2IYLD 2Y1CA 2ZKIA 3ZWAA 1XL1A 3DBLA 4HN2A 3SHFA 3L1VA 4KH1A 4F2WA 4JBNA 2WJWA 1WCXA 4OHPA 3VHRA 2QAGA 4DUZB 4D4MA 2AMYA 1H1LB 4H7HA 3F49S 2A92A 2HPZA 4BXOA 1I8TA 4LRQA 4R1PA 5K3OA 2QQ0A 5EMMA 5I45A 1T5HX 3V6LA 1I5OA 4D3FA 1RU3A 3NOOA 4DHEA 3EIXA 4XWGA 3EVTA 4PFKA 4N1AA 5DZSA 2GCGA 4MUYA 4HLQB 1MG0A 1ZMTA 2Q4EA 4KSCA 5TGDA 1NR7A 1V8ZA 1JR6A 1H94A 2OPHA 2I7VA 3C85A 3N53A 3UPUA 2IEGA 1LVUA 2BTOA 1UM9A 4M87A 2ECQA 4EJ0A 4IVNA 4DN6A 4TV9F 4E32A 1NC1A 2QTGA 5J40A 2F6RA 3LVQE 1U94A 4KUEA 4PLYA 1LEHA 1PGQA 4DJTA 1AOXA 2FN8A 2PR7A 1YZYA 2BBOA 1U2QA 3H2IA 5I7WA 2PM8A 3K5WA 2CV0A 5E6SB 1I5RA 1BXKA 3IFSA 2WQ7A 3KQYA 4PRKA 1TMOA 4QIHA 1JG3A 3UB4A 2CKMA 2PU7A 1B6SA 2ZBEA 5JOQA 2MJLA 2GHQA 2A67A 1TD1A 5EESA 4HTAA 5FLYA 5C8ZA 1PL8A 2JFXA 2LCFA 5JTTA 1C4XA 1UPCA 1W5FA 2MU1A 3B5EA 2XGGA 2BMDA 3NXSA 4V02A 1QU3A 1XAIA 1PNTA 1NUQA 4F2DA 2VATA 5C35A 4F60A 5U9CA 1CETA 4L95C 1H4TA 2ZG6A 4NMLA 4KBGA 1BD3A 1ILWA 1M3SA 2MSLA 3AV0B 4JJEA 1R0SA 1VPEA 1TJ4A 3BIJA 3UIEA 4RM3A 3TM4A 1O87A 2CLFB 1SFRA 4RF2A 1U2GC 1HYGA 4ZYVA 1K3TA 3OOSA 2QRQA 3C87A 5DX0A 1C8VB 2LCIA 3P2KA 3S1SA 1BN7A 1R6XA 1YZQA 3T5CA 1XZEA 1P1JA 1QK3A 1TGYA 2AE1A 4UM5A 3W5IA 1TECE 3D8NA 4KO3S 4OHWA 1V8FA 3L7MA 3OIVA 3GDOA 2NPOA 3QLJA 3WXBA 1CX9B 3CEPB 4M7WA 3KZXA 1Z0ZA 1AD2A 2GBPA 4UNNA 4BNLA 1MAAA 2MDTA 3CRVA 2XMDA 2BW0A 4JT2A 4CKEB 1G59A 1PFKA 1GZ4A 2WPDA 2EW1A 4AFNA 3C1UA 1LV8A 3GVHA 3G2PA 3P9QA 3QFCA 4JC0A 3CZRA 4ENTA 1YCFA 4P54A 3EBOA 4B3MB 3A4MA 3U60B 3DYBA 1NMEA 4J43A 1VDZA 3PXUA 3WDSA 4D4KA 1TIBA 3CXUA 3NJRA 2ZTMA 1FDVA 3ASYA 4HUQA 4ZYTA 1L7DA 2X7JA 2XUIA 5FEMA 1E98A 4E14A 1M8KA 1HEYA 1MVOA 3FSEA 4LRUA 4Q12A 4GVLA 3ZWOA 1DC4A 4TS3A 4POAA 3MTDA 4P4GA 1XALA 2DCUA 2IODA 1Z0UA 3EFOB 1AKYA 3MCTA 3QEMB 1F8FA 3V4LA 5KJ6A 3DMTC 3GC6A 3DOIA 3WLRA 3IO3A 2GPNA 4RTNA 2Y6VA 3O8OB 1V3VA 1JH8A 2UYQA 2B69A 3GFSA 3TLJA 1PNVA 3UPDA 4XASA 3V1NA 2ROQA 2XNSA 3SDBA 3WC4A 4R8VA 3M33A 5DF1A 4QDJA 2RHBA 4UHEA 5CA1A 3VZBA 3WGJA 2J45A 4IVQA 3BK7A 5LLDA 4PQGA 2E18A 4L0MA 3B3GA 4J2HA 3IEXA 3R75A 4F9FA 1DWUA 4IS3A 1L7RA 1T1IA 4K6HA 1POXA 2OENG 3EW9A 5BO5A 1GPJA 3OE1A 3BH6A 2AWOA 4PTLA 1PJ2A 4OQPA 3QVJA 3F7TA 5A6VA 4KQGA 1V8DA 2VHTA 3SKYA 3RG8A 4EHDA 1TGVA 1E77A 2AXPA 5IT5A 4AWXA 1LLUA 1K2WA 2Q4DA 3AU9A 4X3OA 4F04A 1MOZA 3BMNA 1JYFA 1KDRA 4C76A 1ZSVA 1TM4E 4R05A 2FN4A 3WMXA 3ZY2A 4XTRA 2OXCA 1US8A 4V0ME 1TL7C 2I7DA 5GADl 4QG7A 4LV6A 3Q7TA 4MB0A 4B44A 2X2EA 5TQVA 2WJYA 2H7VA 2J5BA 4MJLA 1FYVA 4LRWA 1XXLA 4ZQGA 4OQXA 4BWGA 3T0IA 2NAFA 1I3OA 1N6OA 4OUDB 3SC2B 5KOJB 4L4YA 2J0SA 1DAOA 3SFZA 3C7KA 5FT9A 4EX6A 4EBFA 4QUAA 2VF8A 5TPWA 2L0XA 4PNPA 4WFJA 4W7HA 4DCOA 3I37X 2UU9B 4YS6A 1RWNA 3GAMA 3FWKA 4DCNA 5HMLA 5EEGA 3TSYA 3S2SA 2AOUA 2VA9A 1PL7A 3DZCA 3IAFA 4HDMB 2YCBA 3S0JA 4K86A 4BGUA 3PKIA 1ISGA 1CFJA 2VR1A 2OLKA 2VBFA 3TZEA 3V8QA 4YCNA 1XXHA 2RAUA 3KLOA 1ZKMA 3TLGB 3P2YA 4I9HA 2EYUA 1SBZA 3C7AA 5AM3A 4BAGA 1QFSA 1YQTA 2V54A 1JPUA 4TYYA 1EWRA 1NDHA 4Q37A 4Q4DA 1DWPA 4MRRA 2YUIA 4B47A 4YJ2A 3LZDA 2YL2A 2VHVA 3NIGB 5A9TA 4BBAA 2J9GA 3LKDA 1WV1A 4AI6A 1XG5A 2D62A 3C3WA 1XWFA 2GJ4A 3G59A 2BKUA 4WN9A 1JJBA 2DH5A 2JIBA 3L84A 1E0JA 2D54A 3C39A 4MW4A 2IY9A 5FLXA 3MINA 3R20A 2GM3A 1R7RA 3GJXC 3IAAA 4I2VA 4NPAA 2QVYX 1KYWA 2KPOA 1M2WA 2JB9A 4GI2A 4OP2A 3BUSA 4ACAA 1E9SA 1T4MA 4A5OA 4ZDJA 4AW9A 1KF0A 3FRJA 4FLMA 2FEMA 4XI9A 2IIPA 3IQHX 1GQQA 3GD7A 4UTVA 4YJ3B 5ILQA 2HD4A 4LCBA 4B4KA 5FL3A 4GL2A 1PR3A 4XA8A 3BB4A 4X90A 3U40A 2I6FA 5K05A 3R0VA 1W36B 1TUGA 1IZ7A 2UXBB 5D00A 4O2LA 4YRCA 1CRWG 2EWMA 5KTPA 4YPFA 2VPIA 2YMLA 1U9JA 1XD2A 4RIGA 5GZ6A 3BMCB 2ISQA 2Q07A 4LBWA 4MJXA 3HI6A 2C2KA 5AO9A 1WMBA 5FTLA 1NW4A 4GIBA 3KIPA 4YRMA 1TUBB 2CGEA 1AZWA 5T4EA 3WQHA 3RUEA 4ZHQB 4FYMA 3C70A 3IHWA 3RU3A 3WYCA 4YACA 5JSUA 2IH4A 4CTKA 3QVVA 3OQJA 1J56A 3ZQ6A 2ABWA 2VAMA 3ROGA 3ZHTA 2WWWA 3A14A 1CEYA 5HP4A 3H9EO 3T3HA 1VCIA 4ZVOA 5K2OA 3BH0A 1IQPA 4XVUA 1VMIA 2AJTA 3BEOA 3LC7O 1S3SA 1E8NA 5E2IA 1YIOA 4NBKA 1ZDMA 1B4DA 2OB1A 3MK31 4X6LA 3VSBA 1OWMA 3GPDG 4DIKA 5HTOA 1S2DA 5B3LA 5EP1A 4DIDA 2VXYA 1JXMA 2ZIGA 4HEA1 5FAXA 3EPRA 3VKGA 621PA 5IP5A 1CRLA 1L4BA 1FPQA 2PH7A 3LUHA 4QXOA 3A0RB 1J22A 3AETB 4ROTA 4UFPA 5JECA 4WECA 2OHFA 3KOZA 1T5TA 4EK9A 2I2XB 1C3OA 1XT6A 5JBNA 3KKQA 1NWCA 4MLCA 2WFLB 1OTHA 1Q22A 3A6ZA 1Y9EA 4B73A 4UHDA 5EJ4A 1XSEA 2XTNA 3LW8A 2JHCA 2ZZNA 1XR3A 4RHCA 3KHTA 3L9WA 1USVA 1W52X 3N2GA 1XU4A 1J7KA 4M1ZA 4NCNA 5FIUA 3AINA 1JLSA 4OYYA 5AI9A 4CMKA 1N7HA 1Q2XA 1FVFA 3AM5A 4FFPA 2ZIAA 2P9HA 4YLGA 3ZCVA 1L5QA 1UK8A 3MT9A 3N2IA 4YRPA 3PR2B 4QU8A 3LTNC 5B3AA 2MR6A 1RR6A 3I0NA 3KR0A 3MWKA 4YWJA 1KSGA 4WADA 5BWBA 3MUFA 1JEDA 3L93A 3FAKA 4KQHA 4A9AA 3INGA 4AQYB 2P0EA 2FEKA 2BFPA 1T25A 2ONZA 1UMBB 3NIWA 1MN6A 4LJ4A 4OB7A 5J63A 4ZMBA 3L8DA 3VR3A 5EL0A 3SZRA 3QU5A 2VHUA 1A5AB 4KQKA 4WOKA 4XLTA 5I7SA 4X66B 2RJNA 2IP2A 2CL7X 2PBZA 2ZWAA 1X7DA 2O52A 5CGZA 4II3A 1K8XB 1K5GA 2O4CA 4CLHA 3WB0A 3CZCA 4MS3B 4TTSA 4OJYA 3PNOA 4WUVA 3OMLA 2WHXA 3JRXA 3VM6A 1I2BA 3JAKA 2VPTA 1V1RA 1YB5A 3I0MA 5EXDA 4IR7A 4YCAA 1OH8A 2C1EA 2V7PA 1QGUA 3M1IA 4QTTB 1CCWA 2IYUA 2Q0QA 1OI4A 2D5LA 2PYDA 2W6JA 1T2EA 3HR4A 4UDOA 3BCRA 4CETA 2A33A 2YWRA 2HH9A 3DHEA 1LV7A 1M7BA 5ALGA 1N5IA 5A5FA 1Z13A 3MBOA 3UKJA 2CZGA 2EBUA 3HL0A 3ZH2A 3NBZC 5IYZB 3C3EA 2XB2A 1U99A 2IYFA 2AR0A 5FYDA 1CQIA 4XSHA 4MW1A 5JJ5A 1Q14A 4NG5A 3SJZA 1MAUA 3P9ZA 3D2BA 1P74A 3E7PA 3I5UA 3E9CA 3IOEA 4G0ZA 4CMJA 2PZJA 4DZRA 4YMHA 3U0BA 3G7NA 2R79A 3EXG2 3O5AA 4ASUD 1KY5A 1JLKA 1SUCA 1ZGAA 3V33A 4IIXA 2Y68A 4ZEWA 3I9FA 4UU1A 3ER8A 3RIGA 1RTTA 2Q2QA 1ISPA 1E9DA 4KFRA 5IJZA 1XA0A 1S3IA 2CNDA 1X6VA 2WFAA 3DO5A 3DUFB 4LHEA 1VRCA 2J5XA 3ZWPA 4AO7A 4DJFC 3E5NA 1FP7A 5E4YA 2DETA 1SA0B 3GZTB 3LGAA 1EUCA 4MUGA 4TGLA 5C1OA 5IJ0B 2I6SA 3GZJA 4JI2B 6PFKA 2OB2A 4UFNA 3UJCA 1WXIA 3ZCXA 4X8HA 2Q3FA 5FUQA 1MRNA 4G8CA 4UUBA 4MRNA 4O02B 5FWNA 2KLBA 1VRVA 1L8OA 2WSIA 3AVVA 4M98A 1IMOA 2O8CB 1HOTA 1YASA 2XVYA 3MG9A 4LG1A 3OQBA 5IXSA 2VQFB 2DEUA 2QW1A 4YPVA 1BOFA 2XOKD 3FVVA 1QHFA 3JQQA 4XWAA 2X8JB 4G81A 1E20A 3BJZA 3AX6A 4IV5A 1PGNA 1TU3A 1WHSA 5FOSA 1XP8A 4E1AA 3CF6R 1PSWA 2OP1A 3EGVA 3VR0A 2DF8A 4MUMA 3Q2KA 1PR0A 2B8WA 2MSKA 2QN2A 2N42A 3VAYA 4WJLA 4YVFA 3ROTA 3Q85A 1CZLA 3ZHCA 5IEBA 4RKWA 3M1AA 4YJKA 3HACA 3R77A 5CG1A 4Z2YA 2H29A 2YJNA 3MC1A 1MX3A 4Y1RB 3M4NA 2RHJA 3HVHA 3AVXA 3BFPA 1QP8A 1RJFA 3LD9A 4JR1A 1SIUA 1Z82A 4QJ5A 5DX1A 2A35A 2VSNA 1WUJS 1QRTA 1ZINA 1GLNA 1KMQA 2X19A 4GYJA 2J7PD 5DXJA 2DQZA 5KX5B 1GUZA 4TKVA 4M7PA 3BXXA 1OY1A 2EHDA 3BD6A 3QU7A 3Q3IA 4IL5A 2X2OA 2BKVA 2P9CA 3B6JA 4CF3A 1EG2A 1K27A 1QV7A 2ONYA 3KUXA 4XFKA 5DHAA 2G70A 1J25A 3G79A 5FNZA 4CLXA 2ZS8A 1K8QA 4IXDA 5HQJA 4HNVA 2BP7A 4QWWA 1PBNA 5LXTA 4BO1A 3HI4A 1OZ0A 1QWSA 2A7QA 1VTKA 1BDJA 3T9AA 3U81A 2JATA 4PHHA 3QE0A 4U2BA 2FLWA 4DM4A 5BV0A 1FW6A 1QG4A 4CM6A 4QREA 3UHJA 2IYZA 1YJ8A 4GRAA 5J5AA 3D6HA 2JJQA 1OXKB 3IAM1 4Q4JA 5IK2A 5LBIA 3U4QA 3RIXA 3A1DA 4YONB 3RC8A 1NU8A 1JMYA 2WSMA 4MJ3A 4OAOA 2B1RA 3CXRA 3H9BA 3IQFA 1MB0A 4H1VA 4GX1A 2ODWA 3T15A 4A3SA 1KY3A 1YL5A 1J2EA 1NXOA 3G88A 3NKLA 4BX3A 1AV6A 4EB6A 1ESDA 4LVOA 3J81A 3P19A 4K6GA 4MVJD 4NMXB 4OSPA 4OATA 1PTJA 4QARA 3S4YA 4E46A 2ZTSA 4TV9B 1QQ5A 2R8BA 3L8EA 3GB9A 4ZD6A 5EJ9A 4F91B 1CSEE 4PGGA 5A0TA 3A6EA 1E1YA 4CG3A 3KBOA 2UUOA 4GNKA 5ICMA 4YY3B 5EIOA 3EY9A 5F23A 2JDID 4C4OA 1QYVA 1PD0A 2VWQA 2AUNA 4YROA 5DNVA 4FYPA 3NHJA 4GGMX 4TZKA 3C3AA 3RS9A 4MV0A 4MS4A 1GAJA 3MTIA 3KSUA 4MIOA 1RLTA 4B2IA 3DAGA 1MD9A 1MC5A 1JHRA 4NEQA 5JADA 4IWXA 4XGQA 3UKDA 2XUPA 2FUEA 1OVMA 5IBQA 3WLNA 4NAUA 3W5SA 1SUAA 4CM8A 4F4JA 2QXYA 3M6MD 3N3AC 2Y67A 4GF5A 2D0IA 2RH9B 2ZPUA 5DISB 1AKWA 1CKEA 2C4WA 2CSUA 5AM4A 5BW4A 3R8FA 3I58A 4CQNA 1VCMA 3IP8A 1REQB 1VG8A 2PRJA 5AW6A 3OQIB 4FC6A 1CQWA 4QTUB 1K8ZB 3AR7A 4Q3NA 3EDCA 4UMFA 3SG0A 2I4RA 1BWQA 2O8NA 3FYUC 2LDXA 4C0HA 2JGRA 2VF7A 3JX9A 3BERA 4G09A 4BNIA 5KNCD 2WWGA 2HUPA 2TMDA 3S2FA 2C7OA 3QHPA 1E79A 1CY0A 1GTVA 4JR2A 1ZUHA 3SMQA 4KPYA 5JH7A 3RTEA 4DDKA 4BE9A 5JUWA 3W1WA 4DV6B 4DLAA 1WQ3A 3TVTA 5IVKA 3BMQA 4UNSA 1W0KA 3SC3A 4PO1A 2V8BA 3MB8A 2WG2A 1USKA 3DL7A 4V0SA 1RP7A 3GFQA 4DJDC 4CEJA 3WAGA 1YUNA 2XOEA 2IEIA 4WXMA 4ZIRA 4ZYZA 5KX5A 1C8BA 4K9KA 1PIWA 4JT4A 4WFQA 3UYLA 5IWCA 1HOXA 4Q4LA 1GAXA 4H6VA 4L8FA 4LJ6A 4MI9A 3ZD7A 1BFDA 5AJVB 3JYPA 3DGFC 3B6MA 3Q0EA 3W3ZB 1WCIA 2K2WA 3NOQA 3BMOA 6ABPA 3EAGA 1PFYA 1QVRA 1V16B 5C4MA 1Y6FA 4G0WA 5FOXA 1NJ1A 1HYBA 4M49A 2ZUUA 3FNGA 4YQZA 2XB9A 5DTQA 3M81A 4ZRMA 4U1RA 1FEZA 2OORC 5BSUA 4HZIA 3K53A 4M4SA 1O89A 2OUKA 3BG5A 2QD2A 2DKNA 3IMFA 3KOWA 1LU9A 1I3MA 2I4TA 2YWJA 4J0EA 5E95A 4EYEA 1A8HA 1QAMA 2CDRA 4KK4A 4DOMA 4PU0A 2VQ6A 2IKSA 4DJJA 3ZY6A 1YU6A 3R76A 4AAYA 13PKA 3ZIDA 4FGKA 2FJ0A 4Q15A 4TX1A 5TVKA 2J7KA 2YWEA 3RKSA 4LY0A 3T12A 4BRUA 4I9GA 3BRWD 4K9DA 5TY0A 3LY9A 3I1IA 2FSIA 4R68A 1T2UA 2MOKA 3KPJA 3ZLVA 3C2QA 3GJRA 3MPUA 1GU0A 1R6TA 2PGAA 4M83A 3I53A 2M6LA 1HDGO 1XNJA 5FFNA 4JLNA 2VBGA 1A5SB 4R7GA 4MRVA 3T9FA 1NX6A 4BNUA 2XGMA 4GMKA 4JB3A 2ZXUA 1NFFA 1HL3A 5LMZA 1HT1E 3O2NA 2H2GA 3OX3A 1E92A 3Q7IA 4D9HA 1GCUA 3FETA 3O8LA 1J8YF 2ORIA 1OMOA 3VKWA 5EJ7A 1Z08A 5AVKA 3JQCA 4FMBB 4MYDA 3VZDA 5B2ZA 2AOWA 1JR3E 1TTQB 4P92A 1V26A 1VLHA 3EFBA 2PMWB 4EHNA 1I6KA 1XU7A 4EJ6A 1TZMA 2BF7A 4LFBB 2XCIA 5CHEA 5IDYA 3OPXA 1M0SA 2IUTA 3UG7A 2OHOA 3NYIA 1P8AA 1DXQA 4OP3A 1VJ5A 3VDRA 5AI8A 2X9NA 3GVCA 2OCGA 3VTFA 1FJXA 4BATA 2XQGA 2CVZA 2HMWA 1N6LA 1M2EA 4B82A 3CPHA 2IOQA 4X0EA 1XHFA 3CJRA 3SVLA 5G4KA 1ZMBA 1ZXBA 2Q4OA 4YRQA 1VLZA 3SBDA 2PEZA 1CDZA 3SHVA 2I66A 3M1LA 4ESEA 3RHFA 1I4DD 1QZTA 3MOSA 3NEYA 3V1YA 2CE7A 2HIAA 1KEPA 3SAJA 1G9SA 2PANA 4Z9BA 3A11A 1B16A 5TS2A 2I8LA 3D7SA 1IHPA 4MS1B 1LDEA 3BF7A 3SX4A 3F9IA 2OCPA 3CNNA 1MQAA 1GN9A 1QKKA 4L2IB 4ZU1X 2VYVD 2ZJ8A 1NUAA 4QOGA 3Q3HA 2W0MA 3RTGA 3RRFA 3HDVA 5AW4A 3F2VA 4DY4A 5BN4A 1R18A 2IEBA 5DNAA 4P0PB 2CJXA 5DU2A 4CM4A 1DFHA 4ARAA 1M0EA 1E7SA 5DBOA 4D26A 1EXNA 2JS7A 1SM4A 4QHTA 2PWZA 4B6JA 1V9SA 2Y92A 1BJRE 1Q92A 2CJPA 1U3CA 1N25A 3IUYA 4FN5A 4HMOA 5L3RA 4EMBA 1CZHA 3T1OA 1PG5A 2H17A 3L41A 4KACA 3ZS9A 1I7DA 1WB9A 1XQYA 3UKOA 2IPMA 3JV7A 4HNTA 1EFVB 1TDJA 4MJ7A 5C7IO 4UUPA 4QM7A 1IB6A 3KR2A 2B7BA 1Z2EA 2O7VA 4XUGB 2PMKA 4YUXA 2A9VA 4TTJA 3J7AC 1ADFA 2AUTA 3KO8A 3K9GA 4OFXA 4XLZA 4RY9A 5BQ3A 4JX8A 4LKOA 1ONPA 3ND9A 4JUAA 3GNLA 4G23A 1JLLB 4RHFA 3MS4A 5IUKC 3ZVLA 5HOQA 1A82A 3NDBB 4C7OA 2BFCB 3PPXA 2G8NA 4FE3A 4RETA 1P2SA 4FPXA 5I5EA 4NENA 1FX0A 1EGAA 5KQPA 4BWYA 3IUPA 5A9SA 3HKCB 1ND6A 2Z3ZA 1OBOA 1M54A 1TT7A 1UKCA 3IJPA 4QNRA 3MOGA 4Z8XA 4G4GA 3PTAA 1Q1NA 4ODIA 3QEAZ 1V5GA 1JDUA 1VM6A 4FGSA 5DCLA 4FHZA 1U1DA 2PD3A 1MOPA 3JAWB 5AKGA 1IBCA 4MXDA 3PX7A 3RUIA 1EK5A 2H16A 3BGVA 5AOAA 2ZRPA 4C01A 5FUXA 5JWOA 2F1RA 5F2OA 4ZV9A 2GN1A 3DT8A 3MWGA 2XT0A 4H4EA 3J80A 4MWBA 4JIMA 1EFRA 4AQDA 4J1TC 4WY5A 4Q7QA 2VTKA 3A1WA 3IE2A 2AFRA 3NHUA 4MUIA 4GOMD 4HS4A 4PYQA 3E2PA 2L19A 4G6ZA 4HHEA 1Y5MA 2COUA 4K6KA 3BTSA 1JN0A 3M9LA 1NURA 1KTVA 4FB5A 4PX9A 3P2MA 1WXEA 1E1QA 1MJ5A 2VOJA 3RK4A 3TIGA 3AY3A 1R8XA 4MULA 4RFSB 2EGHA 4OJNA 4N3CA 1IBSA 1KYZA 4C4RA 1S8OA 2WG1A 4JA2A 4DQVA 4QX6A 4X1KB 4OQMA 5C9ZA 4K8OA 3FOZA 3UJ7A 8GPBA 4MOWA 1Y37A 1PLJA 2ZATA 4M9XA 1FK8A 1V3QE 5B4TA 4OTZA 4EFKA 1TTTA 5KQRA 4PXYA 1W47A 3HP4A 4OIFA 3VAZA 4LXQA 3ZHXA 3IT2A 3IDQA 2C04A 3P0RA 1MX1A 4H31A 3FDFA 2ZT8A 3OZFA 4LZAA 1OLXB 5TMPA 5FYQA 1SKUA 4K5QA 2JAWA 1BFKA 1MJNA 1UKVY 3HYCA 4UZFA 3K72B 1P62B 1UBCA 1K3FA 1GRCA 1KI3A 2XPCA 3FX2A 4HPJB 4ZZ1A 1L5KA 1N34B 2C8JA 1JEYB 3LP6A 4W5JA 3I61A 3RS2A 3DE5X 3NOVA 1WDWB 4V0OA 2E4YA 2ATVA 2PT9A 1M6VA 2ZDGA 2PSFA 2ZRQA 4RIHA 3B78A 1E3WB 3WHIA 4CL0A 1ZCFA 2IBTA 5ALVA 3GMSA 3HWSA 2X0JA 1HZJA 1ULUA 1SWVA 2ANBA 3O4GA 4FQ7A 4TKUB 4N3NA 5ICSA 5J5VA 2IYYA 1QCCA 1NBEA 3Q98A 4DQLA 1YA8A 5JSHA 3H8WA 4JHLA 1GU7A 4JJAA 4YJFA 1JDSA 1QRSA 3ADDA 1XTKA 5H83A 1S1MA 1C7ZA 1E1RD 2EJWA 4XPIB 3T34A 5HKAA 4Q05A 4FFLA 1SUFA 2R96A 1V4BA 4C0LA 1NW5A 3OT1A 5F9HA 2YR0A 2YMPA 5I7EA 1OBCA 2Q4RA 2ZUVA 4Z2AA 1G7TA 3JZMA 4L8GA 4PC6A 4W9NC 4C7MA 4MDHA 3H5AA 5BN3B 5JPCA 1EFCA 1EG7A 1KR5A 2QRLA 3CX3A 3HGQA 2E82A 3R74A 3ZDDA 3OLQA 4MITA 4W8GA 1MV8A 1N9ZA 4LY9A 1PJ3A 1QC5A 4R8MA 2F8MA 4I9UA 4OMDA 2HBQA 2BEVB 1DAPA 2SCUB 4PYJA 4X94A 3THXA 1G64A 1XZNA 1Y82A 3DQZA 2OZPA 1DKNA 1KS2A 2O06A 2Y93A 2ZI3A 3IOBA 3KOUA 2Q6VA 2UZIR 1CQJB 2BLLA 1DTWA 2VDRB 1FUEA 2NZWA 3PC8A 4GLLA 5FTWA 4AY6A 2B6HA 3BWVA 3G17A 1SXJE 1SD5A 1X7XB 3F6PA 3WA6A 5C51B 3L6EA 3K2EA 3NTXA 2EWVA 5JWHA 4X65B 1WDTA 2J09A 3L1HA 1GPKA 1EVKA 3OECA 2GKOA 2GRJA 1C7EA 5LB2A 2A5DA 2PX6A 2XKAA 3NBUA 4ZAZA 5HKBA 2PUBA 1NQ5A 3ME5A 4N3GA 4CHGA 3S2YA 3WGGA 3D64A 2QUZA 2AF4C 2WUWE 4ZCLA 3FCCA 2SKEA 4NNOA 4B6OA 2R47A 4ERXA 2ZRHA 1I13A 3WADA 4XZ3A 3KFXA 4GOXA 4BDTA 2HV8A 2I6XA 2Q0HA 2MWMA 3HDGA 4G01B 1IFXA 1R66A 1DQNA 1XI2A 2QEQA 5J2UA 3FDZB 4GECA 2AFIB 4EZEA 2Y1FA 3H0KA 3EVFA 3OE4A 1NP6A 4CUKA 3AEZA 3JQGB 3ZU5A 4B4UA 4G1UC 1D03A 2PTGA 4EVRA 2DUMA 3HVUA 1Q84A 4JL6A 1D5CA 4BE4A 2FUG6 3LQ4A 2FVXA 3C5VA 1DP4A 3VDNB 3ORRA 3SSMA 2N75A 3N5CA 3M6WA 3GG2A 1DBQA 3HSKA 2WM3A 3LQRA 5DLQC 4UUNA 3VTZA 3BXHA 3ZDEA 4BU0A 4J4BA 3TR5A 5REQB 3GLHA 5IMBA 3A58B 4RA6A 3HHEA 4EHFA 3HDHA 5AVZA 2GDZA 4JNKA 4PC1A 5EHGA 3WHKA 3QELA 1TYZA 3N2KA 1MOQA 2NU9A 4BNDB 3VI3B 2VPYA 2VZ9A 1U2SA 5L40A 4RDHA 3O4RA 4S0XA 1THZA 1CG6A 3C3DA 1P0CA 2WIKA 5F3DA 3EGIA 4D8VA 5DTRA 5E3JA 4AJ9A 4DCUA 5I8WA 2ZUEA 2D2FA 4RJLA 1NVUQ 2BH2A 1GG8A 2RGXA 1DAKA 3PTZA 4G5XA 5A2GA 5EKTA 1P61B 3R4VA 5EXTA 1UDWA 1EZ4A 3LHKA 4JY7A 4UAUA 4E21A 1LDGA 5FCDA 3WZMA 4BOYA 1E4OA 4OQEA 4RA9B 3QBTA 1GFIA 5DFAA 3R7WB 3CTMA 4E1VA 1WMEA 2F1KA 2FW9A 1FUKA 5TNXA 2AJCA 4OYRA 2A57A 1Z8DA 5E7MA 4CLOA 3ZWNA 3U9LA 2P78A 1LPMA 3O3OB 1PGJA 4R6XA 1KY4A 4PRZA 3N8DA 4U6SA 4JQSA 2H48A 2W4IA 4E2ZA 4Z49A 3N86A 1UXOA 3ZZNA 1MO5A 4CM1A 1EWVA 4GOJA 4J1SA 2O48X 2Y1WA 2FMFA 2Z98A 2A8YA 2NPIA 1OWNA 4CVNA 5CB6A 1Q16A 3CPSA 3O8NA 3ZEAA 4PLHA 1N92A 1P44A 1MC4A 2ZUFA 4ZAXA 5EUBA 3D8SA 1MAHA 5K6AA 3FRHA 1U3FA 5FTNA 1QO7A 3H0CA 4Q7JB 3FB1A 4KOEC 3ZD9A 3L8FA 3NFYA 3ZWYA 2IHBA 2R8EA 3YASA 4AZSA 5LOVF 1A9OA 2EEPA 2VHEA 4NKRA 5MFZA 3RVDA 2GN0A 3KAPA 3AR8A 5B7NA 1DKLA 3CW9A 3Q4GA 3PGJA 1ZQ1A 1Q2UA 1WXFA 2DWQA 3A9CA 3FVWA 4IEIA 2UYYA 2CDNA 2O2IA 1HNNA 1PR4A 2H5EA 3K0CA 4YLEA 3T9CA 3ZV5A 2V58A 4CR8A 2QJWA 4EG3A 4FE4A 1LX6A 3C3PA 1JQBA 2OO7A 3TQOA 2RK3A 4ZJZA 1A9ZA 5L3SB 1N0WA 3GUZA 3QJGA 2P9ZA 2XRMA 1FFXA 3G9TA 3MGKA 2HWXA 1OH6A 4DABA 3K20A 5EPEA 5JU6A 1FRVA 4AXBA 1O7JA 2FX3A 4ZOQI 4P4NA 2WV9A 3ZWQA 1JIVA 3CMCO 5TQJA 1OF1A 1MQSA 1UMCB 5ARBA 5DBHX 4BNFA 1XPRA 3GA5A 3NT5A 3WGYA 1E63A 1S7GA 4D9MA 5IARA 5HQ3B 4MWEA 3FGNA 3F6SA 4RMHA 3HCWA 3SR0A 2QT9A 3B3FA 4KAAA 1RQNA 2RGAA 3ETLA 4G85A 4Q4HB 3HXTA 4CNQA 1S9HA 2IRWA 2Y0BA 1N78A 3H7IA 1XZHA 1DSSG 5LLSA 2IUEA 3P0EA 3AKCA 1MORA 3VKVA 2IJGX 2XUKA 5DM4A 3JR3A 2C9BA 5JS6A 3UJPA 1CJKC 2DBRA 4NI5A 5ALWA 4NULA 1GWNA 3PUVA 5A4KA 5IN5A 2Y2VA 3NKVA 5LIRA 1IJBA 4ENRA 4LI3X 1Q0HA 1NLYA 4EEKA 5AR1A 2PAFA 3EXIB 5B1DA 3UHFA 3UUFA 3ZXXA 1LBTA 1WIWA 1DJQA 1JZQA 2NSJA 3BRSA 1JHUA 4JKOA 1F0KA 4KGZA 5GV7A 4S1VA 1Z6PA 5KU1A 1Z6YA 3QVGA 4NCJA 3IAXA 1L5ZA 3WQRA 2V9ZA 1M2JA 1V5EA 1JA0A 1YB6A 2NSLA 3DO6A 5F9FA 3DMGA 2X1VA 3EUFA 3GJTA 4CR6A 4KAJA 3U80A 2D00A 1RE1A 1WEKA 2W6CX 3QG1A 2IXDA 2XODA 3EEIA 4YRRA 3UUEA 1K5DA 1LJUA 4BVAA 3WXMA 3RC9A 2DWPA 5GJWC 2Y1GA 4O4IF 3TQTA 1ESCA 2PKXA 4FFSA 3UB3A 2QZJA 4I66A 3ZWKA 1P7CA 2GEUA 2QWXA 2WKQA 4FT4A 3NUZA 4BPBA 4I50F 4TQUS 1CY8A 3ZHZA 4EA6A 1NVXQ 4RLFA 3EEOA 3M3DA 1ZG3A 1DARA 2BV3A 1ZK4A 3TMAA 5BYJA 4DGSA 2WJPA 4U5XA 1TU0A 5D3MB 2X1LA 5TX7A 4X7BA 1SAYA 1H8HA 2O6HA 3ZGLA 2C4MA 4JX9A 2XDAA 5DLYA 4BB5A 3K5PA 5IHPA 3OE7A 1Y1KE 1S8AA 3LGSA 3RDPA 4P5DA 3GF4A 1KEUA 4POOA 1EFLA 3TUIC 4G0QA 5FPKA 1R4NA 4LZWA 3MF4A 4BZQA 5EMKA 1E66A 3WIUA 4I81A 1TC1A 5LU8A 1USIA 3HY4A 4WACA 2PS3A 2VK8A 3AR4A 4G4IA 4XSVA 5EJFA 1VPWA 4MQFA 3RLIA 4A36A 1CB0A 4ITRC 1DXOA 5HILA 1Y7TA 3NCTA 4CT4B 5EJ5A 1LSSA 3UOWA 4HXEB 4P81A 3ZV6A 1I3NA 2FPGA 3HBLA 1KMIY 1YO6A 2ZSJA 1FLNA 4KC0A 4TKZA 3WDMA 3EA0A 3WL5A 4F92B 5LD2B 1FDTA 2P2GA 4ESOA 3OTQA 4IIJF 3ZE7A 2VP5A 5K0NA 1XDWA 1H6BA 3S70A 4UW9A 3Q0TA 3TW0A 2W2XA 2G1JA 3K09C 3DZHA 4Q7LA 4LV8B 4EA9A 3BWXA 2O54A 4BNVA 3LECA 2EZ9A 1UXJA 3NEPX 2QP4A 5J2TF 1MABA 4Q4AB 4QICA 1XAJA 3O9ZA 5ALMA 1OYVA 4EW3A 3G3EA 2F3PA 1JZTA 4FQ5A 4KPFC 3M70A 2WYUA 2A84A 4ACBA 5HF5A 1QQAA 2CVHA 4X41A 3THYA 1APBA 4Y2RA 1Y9AA 4C9BA 4F45A 1W7AA 1KU6A 5LWQA 2ACEA 2I34A 4P98A 4DR5B 1SXJB 3FLEA 3IDSA 5IWAB 1O94A 3LRPA 4KXWA 2JBHA 3PUKA 4NZPA 4D3YA 1JIIA 3CLRD 1A88A 2R8YA 3K6RA 1ORHA 1CR6A 4R0NA 1K6EA 1FVHA 3ENQA 5G40A 3U2QA 2YBEA 3UMSA 3VJLA 1G6HA 2W2KB 2QAGC 2X7HA 4GBJA 4O4JB 3OMWA 4LYDA 5GM2A 3MSXA 1JH9A 4GOLD 1D2HA 1Z73A 3R40A 3MQ2A 4F2GA 1NR1A 2PJDA 3SZOA 1Z0FA 4IJ5A 2YIDA 1FS4A 4RS3A 4MHTA 3IS3A 4MARA 1LA2A 3RROA 1WUKS 1VL0A 3PIIA 1W88A 4TTIA 5DKFA 4DNOA 1GA4A 5FF9A 3DHNA 5LQAA 3CA8A 3UTDA 2IOYA 1OLSB 1P0MA 1I30A 1QIDA 2EATA 1FTYA 2PZGA 5B3JA 1LY1A 1XD9A 5KAMA 3W6PA 5BYKA 5JQGF 4ZAGA 5I4KA 4M1OA 2HRQA 1WSAA 3AHEA 3PWZA 1MPXA 4ZYLA 3D9QX 1WULS 1YZFA 2BFOA 2R7MA 2LIPA 1DE0A 3KP1A 3NQ41 4R7ZA 3WK7A 1L4KA 1Q5PA 1I33A 4V2UA 5HOEA 5K20A 1WOMA 4B80A 2EF0A 1TMYA 2D2EA 4A2WA 1B74A 4OBXA 3H2YA 3WL3A 2QRJA 4Q00A 1XEFA 4UDXX 4C5BA 1DX4A 3GRAA 1MJGA 1T29A 1ES9A 2C57A 3INNA 3JSAA 4C5CA 5JFOA 2XY4A 1BMFA 5JZSA 3D0OA 1H2FA 4ERNA 5IAEA 5IAOA 2QN7A 1U2PA 5IN4A 2I6GA 3KZNA 3L7CA 2WKWA 4CFYA 4UZEA 4MQBA 4C2AA 1DQRA 2PKQP 3ZVRA 3CE9A 1NBMA 4RPHA 2W90A 2JD0A 4YBZA 2IBSA 2PSSA 3ZY4A 4X7PA 4JJGA 3U4CA 2ZRLA 2I4IA 4HRVA 1IN8A 2BHNA 3LPAA 4PE5B 3I6BA 3E3NA 3W8FA 1GTRA 2O23A 3AL3A 3PQ3A 4CGZA 3DZDA 4CT5A 4GZ3A 3B1FA 3EH1A 1CIVA 1WMFA 3QHAA 4J9VA 4XARA 4MAFA 4O25A 1L7OA 4A1FA 5B57C 2DLDA 5L53A 3RFUA 3O21A 2QQFA 5DNCA 3DTVD 3OBIA 4H7DA 5CPBA 4ZU3A 2P4HX 3L4EA 3LDUA 1BA2A 4BRSA 3O94A 4RH3A 4C05A 1T8PA 4FONA 4Q3CA 5AM2A 4AMUA 3LG2A 2VJMA 3KHKA 4YECA 1ZCAA 4JBHA 2IQIA 4QPCA 3VFDA 2YIMA 4EA8A 2KQUA 3OQHA 4U0KA 5DN9A 2HT6A 3ON5A 1P1BA 3SIXA 4H7KA 1G7SA 1OYWA 3EZXA 1NVGA 5JJBA 1ZL0A 2OGZA 3WHPA 3R0IA 5JNTA 5F1YA 4IIVA 3QPAA 1E9FA 3H04A 4FX2A 3WDKA 3E9ZA 3RUDA 1SBNE 3MBIA 1W85B 4NXNB 3B1KA 2ZYVX 1ST3A 4PQEA 4YXWD 1JE0A 2GYVA 2GM5A 4WT7A 1S01A 4BE7B 4OA5A 3BK1A 1S6YA 2DM6A 1YR2A 3A8TA 3HJHA 5DM0A 5FPTA 1DCFA 3L4KA 4IW3B 1KDTA 1ZL2A 4TV8A 3ZJUA 4BFYA 3DBRB 1DRUA 2B0JA 3GP8A 2PUVA 1B26A 4KQMA 1Q6ZA 1NFQA 3JYHA 2GTPA 3KQVA 1T0BA 1U4SA 2YJGA 4L9WA 4ZC8A 3RKRA 2RFLA 3U0VA 3AZQA 2FCAA 1KOJA 3QSGA 3VNQA 4TKMA 4IPTA 2XOXA 4B3XA 1U8XX 2BH9A 1Q7GA 3UC5A 3FMVA 1IN4A 1Q1ZA 1H69A 2UV8A 1V35A 2HY7A 4LNUB 4P80A 4V39A 4DA8A 1J1UA 1OX6A 1A77A 1QIGA 1RRMA 2VBIA 3H5OA 4WXHA 2RHWA 1P4RA 4K26A 2B3DA 4WXRA 2R1ZA 1KSFX 4KTVE 4AROA 8ATCA 1C9YA 3OF3A 4EDFA 4FUQA 1G7CA 2ZYSA 1VYVA 3AEUB 2EKQA 2HPAA 3CSDA 1Q1EA 4XIYA 1T36B 4CLRA 3N2ZB 1YRAA 4KSYA 3CR8A 2G7ZA 4ETIA 4BNGA 3DV0A 3FIJA 1Z34A 2X5NA 4JCCA 3U37A 1VCOA 5L6MB 3LT5A 5B2FA 1BW9A 2JW5A 5IDWA 2ZBRA 2GT1A 5CB4F 3R3VA 4NBVA 4YRTA 5DM60 2R0QC 3B9RA 1UKYA 1KK3A 1AO3A 3GH3A 4NABA 3GEGA 1D2NA 1OI3A 1ULAA 2EBWA 2ZBVA 4GKVA 5C34B 1M8JA 2ICAA 4NYJQ 2VYND 2FZ4A 1O58A 1O08A 1N6PA 4PN3A 3PT5A 4RXTA 3DDUA 3H3JA 5EKDA 4F3CA 2NMVA 1L7VC 2DC1A 4H7PA 5TF4A 5BXYA 4HFJA 4NNJA 3TQQA 4D4LA 2FSPA 1XDSA 3OZDA 5AJUA 3S29A 4ESHA 1QV9A 3PGA1 2RGRA 3D4LA 3C5WP 3JWEA 3NATA 4B87A 2ECPA 3EOBI 3ABOB 3JVVA 2WAAA 3HVJA 4JK3A 4ON9A 1E2DA 1NXQA 4BO2A 1C4KA 1II8A 1WABA 5JS8A 5GOTA 1UK7A 3GLSA 3D7KA 3INTA 2NVUA 4IOJA 3F7OA 3IQZA 5AQEA 1MP0A 4XGIA 4V0QA 1U8EA 1XVUA 2FFQA 4RCZA 3RIEA 4RIIA 1QFYA 3W9UA 3DW3X 1OCEA 4EG6A 4NARA 5CIYA 1Z29A 4IAOA 2Z2XA 2P6PA 1GNSA 2EZ4A 2EVWX 1ANKA 3E9YA 1QF9A 3RVLA 4K9MA 4BYMA 3VMFA 3H4TA 3W4JA 4MYSA 2XQVA 4X8OA 2JVIA 5DGHA 1BX3A 1V8BA 3OX1A 2JVKA 6AT1A 1IEQA 3AUKA 1RPJA 1XQXA 4P7GA 2OBXA 4U9UA 3GIWA 4LYYA 4OMFG 5DM2A 1H85A 2PVPA 2W2VA 1LTQA 4K81B 2QLNA 3QYPA 3TG8A 1VXRA 5H3LA 1IOVA 2CLHB 3UT5B 3SXUA 3B12A 4TM7A 2P5SA 3D5TA 5JW6A 1NX9A 3TFQA 1F2UA 5LJIA 2QX6A 1H1TA 3B3AA 2A88A 3LW7A 3TJRA 1L5RA 3KT3A 5BRJA 3BVPA 1WBJB 4OL9A 3CU5A 4DC0A 3I9LA 5KJCA 4CFSA 3NT4A 3DYVA 5DSXA 3R7NA 1PFQA 4CKCA 1U98A 3R3XA 3MS2A 2QSYA 1A8SA 2QG9A 3Q8WA 1NP3A 1GEEA 3NIBA 4PY2A 5EGSA 1S2IA 1VJTA 2HA6A 3K1YA 5GJVC 5F2NA 1QGED 1KO7A 4R1UA 5AXAA 3B52X 2XWBF 5DH9A 3W5CA 1SGWA 1T43A 2R7KA 1TW3A 3EIWA 4R1TA 4WDRA 4WZAA 3HMKA 3RYHA 4C20A 1P0FA 1PJBA 2HK7A 3R5XA 1G8MA 4DC9A 2PQMA 2EG5A 2PYIA 1EDZA 1UFQA 1V4VA 1I4WA 3R44A 4PN7A 4D9CA 4TN1A 1E8DA 5LOVB 2RHLA 3DPIA 1H2EA 3ETJA 2BE9A 2F1JA 1ZNXA 1PWZA 5IUJC 4BRWA 4YUZA 3LUFA 3M8KA 3ZW9A 4K9LA 3OPVA 5A03A 1NV8A 1RXEA 1Z8NA 2XVZA 3IUNA 1DC3A 4F4IA 1C50A 3MTBA 3GFTA 2WHYA 4PGAA 5FOUA 1OAKA 4YV7A 3VR2A 3OEWA 4DQDA 1BS1A 2FOLA 3OEHA 1K97A 3QPUA 3DDSA 3GDFA 3I04A 1SURA 1WSDA 4AJJA 4EW6A 1EFPA 2AXNA 3GHYA 1MZPA 3REQA 2O2HA 4FSDA 3NHAA 4P82A 2LCQA 3PKZA 4AMZA 5GONA 2ERYA 4GW3A 4QQFA 3H4IA 4YAEA 1UR5A 4NJEA 3P5SA 5MFPA 1T6BY 1FW8A 3EYWA 2J41A 4GRDA 1ZJ4A 2H65A 1QDUA 3ILVA 4MGHA 3PQ5A 1NJ8A 3PUIA 3TIIA 3PEYA 4IJVA 1F0YA 4BN5A 1H6DA 2X4LA 2QY9A 1TCUA 3FAZA 1FIUA 1R27A 1P60A 3U4HA 5CFMA 2YRXA 2J32A 3OA2A 3M0EA 5LDHA 1HKHA 5I3CA 3I4LA 3SFVA 5HR5A 2ODPA 4JBLA 2D2IA 2NP7A 1QM5A 3MLEA 3FYTA 3P9SA 3TI7A 3AVQA 1UXGA 3B2EA 2J4DA 2AMJA 3NP7A 5H7XA 2AWNA 2P4QA 5DM1A 1UBKS 1U65A 2AOXA 2DPGA 3EXHA 3SE7A 1J0DA 1W8DA 2ZWMA 4FN4A 2FMKA 2VHQA 2FWIA 3PLAE 3EDQA 5L7TA 3ITDA 2A0YA 4JJZA 3UFBA 3LZ6A 5LZ4A 4UTRA 1NPTO 4GOND 1L5MA 5DSZA 2EP5A 1QP7A 3AVTA 5A0FA 3FDJA 3ND8A 3I62A 2JRCA 4R1LA 1UBJS 3EWSA 4EG0A 3WSWA 3EDOA 3R41A 5A4AA 4HZUA 1CRZA 3NWOA 2NYAA 4CM9A 1OXXK 2GETA 3CX4A 1BWRA 1UJCA 3MRSA 4K3UA 4G1CA 1Z74A 2JGAA 1U8UA 3CO5A 4HSGA 2RJOA 1SPXA 4WEQA 4F5EA 5BSGA 2Z6QA 1KHHA 2MYNA 1MIOB 3O47A 2O2SA 3B7WA 5CR9A 5KVQA 1NUTA 2QZ4A 3CRNA 4EW2A 2ZEJA 1P9LA 4ZRNA 1NC3A 1R50A 3ESQA 3LF2A 4H60A 4EHIA 4DBVO 5I9IA 2ETXA 2ON6A 4RJ2A 3KKZA 1QZ3A 1HLFA 3D8UA 4G9BA 4BBZA 4RK0A 2I4NA 3OPQA 1Q11A 1X94A 1DPGA 5LBUA 1PEDA 3EVCA 4HADA 2LW7A 2PZ8A 2QGFA 4I50B 3RABA 3REGA 3A10A 3FCUB 2ZJ1A 4N18A 2YQ4A 2HRCA 5AD1A 2YZ2A 4JSYA 5KVCA 2I1WA 2IIQA 3IE0A 3WLQA 3FPSA 3H86A 4LJ9A 2XW6A 2RH5A 3HVIA 3P9IA 1VPVA 4JZKA 2Z9BA 1RJ9B 3CKKA 1KK0A 2SBTA 2FFAA 2OXFA 1QS0B 1P0QA 4MB2A 1LX7A 1C9DB 1D5WA 1E7RA 1EXMA 2I0FA 1DIGA 3KJGA 1PYOA 5J59A 4XM0A 4MCHA 4Q3AA 2XQJA 4WNAB 9LDTA 5KYXB 3GLIE 2WJJA 5CVVA 1LH0A 1KAQA 4GG1A 3BREA 3AHIA 4L5BA 3FHCB 4OHBA 4OHOA 1O96B 3K0AB 1B0AA 1PVDA 2Q62A 2Q9CA 4R31A 4RENA 3B6ZA 4IH9A 1H4QA 4JB8A 4X95A 3TTVA 3R3YA 3WLPA 1H6CA 4RMNA 4ARZB 1AKQA 2C5GA 1HLGA 3KXLA 2O1EA 1JQJC 3ECSA 5HG0A 3U5ZB 3MAJA 4IHJB 3OCZA 4XEHA 5JSFA 3K32A 2NUAA 4H59A 4KXUA 2N46A 4OQFA 3RWMB 5LKRA 2IE0A 2WP8J 5HSGA 5J2TB 1XUOA 3EQ6A 3EGDA 1D04A 5CEFA 5IF3A 5KTOA 4ZVUA 3HBJA 5HZMA 1W5BA 3WWCA 5EINA 2JBAA 3BS4A 2P2NA 2B5VA 4B3FX 3DUWA 4R41A 5EIBC 5B36A 3KDPA 1JHMA 4RXUA 1R3UA 5HRCA 3Q3GE 4PWYA 2J9YB 4YYEA 4ZXFA 1JNXX 2XMPA 1J0EA 1E7YA 4HDKA 3WGHA 5AVSA 3I5XA 1RM4A 1YBVA 1Y5IA 1B2RA 9ABPA 1QK5A 1VE3A 1C14A 4LC1A 5CPFA 4MDEA 1X39A 2F3TA 3VKUA 4XWTA 2PJRA 5F52A 2BDEA 2GS9A 4R81A 3OIGA 2DPXA 3CB2A 4QECA 2QTLA 5CVEA 1DINA 2EU8A 1RI2A 1W9HA 3OURA 3IPAA 4I19A 1JHVA 3WL4A 1Z2DA 2IVZA 1W5SA 1HBJA 1SU4A 4O3MA 5K51A 5LQDA 4WRRA 5LP6F 3C8HA 3UMVA 1EWKA 3EZNA 3HXKA 3PDJA 1XBTA 1HNZB 1H1LA 1PCXA 1UP7A 3KKEA 1N9GB 1T9DA 1I6LA 4G9GA 4ZOCA 1Q15A 3N0TA 2AN1A 3ZGZA 5CNIA 1KPGA 5IKPA 4BNJA 4C7VA 1E2KA 1WZUA 1C8LA 2CHFA 3KYCB 4NJMB 1MGOA 2PMDA 5JQGB 1KDZA 1MLDA 5SY9A 1PTJC 1RQ7A 3SHWA 4K9QA 4MV5A 4QUKA 4UBIA 3A4VA 1JFSA 3OFJA 3D6JA 1VBFA 2DE0X 2HQOA 3VR5A 3C24A 3JW8A 1KJ9A 3RODA 3ONFA 1LLQA 4QGBA 1WX1A 4G5SA 1IN1A 1G42A 2R6DA 4A6XA 1B6TA 3CUEF 3D5EA 4BHTA 4E2YA 1VCHA 3D8RA 5A3VA 5K8UA 3DDCA 1FTSA 3M4XA 1NQWA 3F7MA 2W8BB 4DA6A 5ES4B 4KXFB 3TZKA 4URVR 1C0KA 1HSOA 2DFTA 1J1IA 4NC9A 5IULC 2Y1XA 3DPSA 5DNUA 4NESA 5FH9A 5E6SA 4M36A 3QJYA 3THWB 5DDIP 1L5SA 5A4IS 1LF0A 2AHOA 3E5RA 2VDUE 5EXXA 1CZKA 1W44A 4U6QA 4F6LA 2FSUA 4UVIA 2WAYA 2FG5A 1P1HA 2QSZA 5CH3A 2B7CA 1KKLA 1XDBA 3PWTA 4IJMA 5JZMA 4QASA 4RZXA 4YR7A 1T9GR 1USUA 2I78A 1NZFA 2GJ9A 3NHFA 4CLDA 4V38A 2DJIA 3BTUA 3T0FA 1XZPA 5IG2A 4URWR 3ZS8A 4JEMA 1RXCA 3KLMX 4XOUA 4EI2A 2ET6A 4NAHA 4EI9A 1RBZA 2O2ZA 5DYTA 1V8PA 4BO3A 1RFGE 3G9UA 4JHXA 5KKNB 3K71B 1RWMA 2DHDA 2FWJA 4X1IB 4Q19A 2JFHA 3C3CA 5FAKA 4BVFA 2OV3A 3ASUA 4UBJA 1NVVR 4A0RA 1F14A 2PUHA 4DLBA 1EWQA 4B6PA 4PPNA 4IWYA 2QW0X 2QLMA 3VR3D 3RVOA 3TI9A 4CKEA 3T3OA 5CB0A 3CLVA 2IXGA 5HGJA 1KETA 2H31A 1BH6A 2ZB4A 5JS2A 5K01A 2GA8A 2OBBA 3UAXA 5JS1A 2IZOA 2YFYA 3DT9A 3BGIA 4W5RA 2AZMA 7AT1A 2QLFA 3LX6A 1MB4A 4B3CA 3ZKAA 2OQRA 1X9HA 1C7IA 2VDVE 4XQ9A 4IIFA 3PG5A 3AW9A 4KNYA 1N5KA 5G1OA 1VJ1A 4NYMQ 1L4LA 4O2AF 1PTKA 1GRRA 1F20A 3THSA 2VP4A 1R88A 1QE3A 4XB1A 2MTBA 1KVTA 1N8SA 3EFOA 3QEMA 1R5OA 4MW5A 2Q5FA 3CW2A 4EBBA 1CUGA 1ZI8A 1FDSA 4M9ZA 4RPCA 2BN4A 5BV7A 2BPOA 1Q83A 2PD4A 4KO1S 2YVKA 4JAVC 4KBFA 2OXIA 4L4RA 3I45A 1SCDA 4DXAA 3WIEA 1GZHB 2FYTA 1E2UA 3O8OA 2JF0A 3T9DA 4QLBA 2O8EB 3LOUA 1JAYA 3OZVA 4JI5B 3TPFA 5H9WA 3FPLA 2ZTLA 4GX0A 1NULA 6NULA 5DN6A 3EC1A 1KH2A 3QITA 4QDOA 1IY8A 5F76A 3TK1A 2Y1LA 1T8UA 4WZ6A 1U31A 2O07A 4L7QA 4JYCA 2DHQA 4DR4B 4G0VA 4UVHA 1CU1A 4KOAA 3JQ7B 4PYOA 5LN1A 3TB4A 4NZMA 1Q21A 3BPSA 3OM1A 5JNRA 4Q9LA 4DYHA 4WN3A 3H5WA 3TSCA 3UATA 5KCZA 2WLSA 5CB4B 4UBOA 4P08A 3AB3A 4WW0A 4PCVA 2E4VA 2Y9PB 4HAYA 1NBIA 2CVPA 3UYKA 1MKYA 3K0EA 1L1QA 3SYKA 3GXOA 1N4DA 4OBEA 4HX9A 3ODGA 1E96A 3EK2A 3JXEA 1E1DA 2YXLA 4JVSB 2CJWB 1HDEA 2F43B 1IE3A 3X1MA 2H2IA 5KOJA 3ANNA 1LCIA 2AZDA 3BZBA 2KM1A 4I9FA 3FCEA 4LA4A 4OUDA 3DB1A 1O95A 4HDRB 4KP7A 3IELA 4M0MA 4Y2TA 3PE4A 2PUJA 2P7HA 3DLAA 4FEAA 4TXMA 2VF5X 3JY6A 4I1IA 5DGXA 4BRZA 1A27A 2WU1A 3C15C 4L85A 4NV0A 4WWHA 2ZI9A 5EZYF 2OAP1 2I7TA 4HDMA 5THXA 1BXGB 1VGQA 1QYRA 1UDCA 2V9CA 2VXCA 3QOXA 4OM8A 3QWFA 1RNLA 1QWOA 3GARA 1X2EA 1R74A 2OBMA 3TLGA 3O0TA 4BZZA 4YDHB 4ZDIA 2QM0A 4AVYA 3N39C 2ZQZA 2O1WA 1P1KA 5FPQA 3G02A 2C88A 4PSKA 4B3GA 3CZMA 3HA3A 3LU1A 4NE2A 2Z2KA 4DLRA 4CKWA 1E6KA 3BAZA 1JXQA 4PZDA 4WSOA 4KWCA 5IVDA 4QGSA 2G77B 4PG8A 4ZWNA 1CF2O 2Z1NA 2ODBA 1ZK2A 3CF4G 1R5BA 3R5JA 4E7OA 5C4IA 4YAUA 2IYQA 2VXOA 1P1RA 2HDHA 1W4ZA 2V0CA 4W1RA 5TEVA 1QFMA 4IQ8A 3JVEA 5A4MS 2NZUG 3LQ2A 2FQWA 1FFGA 3U62A 1RBMA 4RHXA 3SVTA 1O77A 4KQJA 2H4ZA 4J2OA 4YJ3A 4DNXA 3O4VA 5TVGA 3FKSA 1HUQA 4EG1A 2VP2A 3E03A 1MW8X 5IK2D 4PEVA 2N9UA 2E5LB 4AS1A 1WPGA 3FWYA 2ORWA 3BMCA 3ND6A 4BFXA 2WSSA 4INZA 3AF2A 1LJLA 1RCFA 4B3JA 4HLCA 4B33A 1DB3A 3L92A 1CY1A 4KQ6A 1TUBA 3UMGA 1BVRA 5DMXA 4N54A 3QENA 5K8TA 4N12A 4ZHQA 2HJ9A 3OY2A 1NN1A 4DARA 2Z6AA 1W5TA 1UWLA 1Y7IA 3O84A 4RPKA 2WUDA 1SCQA 1TK2A 1WSWA 2BM8A 1EWYA 4J9UE 4TLBA 1DFGA 1R8JA 1UBLS 1YV9A 2ZDHA 4F7WA 3CR3C 3I9V6 3ZYCA 4KRXA 4CV3A 4UCQA 1QJCA 2VHXA 1KVUA 2J6IA 1GZ3A 4EH1A 4EJSC 2Y3IA 1VHJA 1GPUA 2DECA 2E1PA 2QTBA 3DQPA 4TRRA 2A0XA 2GAIA 1DAEA 4XSGA 3ZK8A 4QE3A 1CUVA 2V6IA 1UAYA 3KE9A 4KH0A 2JKZA 4RDIA 4G5QA 3V4OA 2BGGA 3KC2A 3I73A 1DX9A 3KOYA 4L75A 3UMMA 2BZ1A 1U7UA 3PHIA 1S0UA 3E1KA 2EX1A 2ZLBA 5DV9A 3AETA 2CV2A 4WBNA 5J4HA 2H51A 3WLJA 4C5AA 2NV2B 3O4JA 1O1YA 2G17A 1FSFA 4JA0A 4AZWA 1Q7TA 2GESA 3FTFA 2WFLA 3CNHA 4BMZA 3LUBA 4KFTA 3MMXA 4F3RA 5ALZA 3NWPA 3ERCA 5ADWA 1WXWA 3O91A 5JG7A 3N5KA 1YE3A 2JAXA 4DMFA 1Q0QA 1QIFA 3MEQA 5BYBA 1RJGA 3BE5A 3VR4H 2B25A 4DLPA 3OLCX 1E79D 5LQUA 2V96A 4FOOA 1RLUA 3I5AA 3KJIA 4IHQA 4UCFA 2FDXA 5DTJA 3ZLBA 4ETWA 1FFYA 1GPH1 3RBZA 4ZI7F 2Q99A 1D8TA 4IKEA 3L0DA 4EKYA 4Y6GB 2QTAA 3BTVA 3CBGA 1HFEL 5IVHA 5LQNA 4EWLA 1U7WA 5U4XA 3T5PA 2JG3A 5CXUA 4K05A 3R7AA 2EBHX 3NDIA 4I3GA 4BO9A 3KOMA 2IV2X 3Q3CA 1GPMA 1UMBA 1DWOA 3G5UA 2TMYA 4OQQA 1UIRA 3LJKA 2IZ6A 1RXYA 4JLMA 4I1SA 3MGAA 3MJRA 4EENA 3F4BA 4A8PA 3HXMA 1GG9A 5FA6A 1W5EA 3TBFA 3MWJA 4PO3X 2Y1KA 2QL5A 4L1KA 4MS3A 1LK5A 3ZI7A 5AOBA 1Y3AA 1C7JA 1SXQA 2CF5A 2GK4A 2Z56A 2Z8YM 2N3ZA 3HB0A 4Z7JA 4Y2VA 3CG4A 4M6WB 2FEPA 1IDN1 5JZ9A 4Z1OA 1KI8A 5EIWA 5CJJA 1TB4A 4DANA 2P4EA 5JCPA 2BMFA 4P4SB 2YCLA 3SQDA 2MHCA 3VYTB 4YP7A 4DNQA 2Y66A 3EZGA 4MRPA 1T2NA 4NZOA 5IYZA 4RY0A 2ZSUA 1OYOA 3Q11A 5B6IA 3ZNQA 3NASA 4K40A 4RKYA 1SKQA 2XX3A 3CHYA 3B9PA 2EJUA 1RMYA 3GAFA 3HCFA 4X64B 5CTAA 1ZR2A 1KJJA 2FHSA 2A9QA 2PCLA 3IQWA 3PDIB 4OHFA 3SQWA 2IYEA 3Q8KA 2ZYWX 1MA0A 2HUNA 1LK0A 4ENWA 4H16A 1JW9B 2IDJA 4JJKA 4WAUA 1R0LA 4WA8A 5AJHA 1EZ1A 4GSKA 4L76A 5T8KC 1JQDA 2PA0A 1I2AA 3DUFA 1GSOA 1IPEA 4D9KA 1RFLA 1G63A 2VUTA 1SD2A 1SA0A 3KKOA 1MXHA 3I2JA 4MW0A 5A1JA 1D8AA 3D7MA 4KXNA 1YVDA 3RS0A 4I1RA 5JCZA 1WCYA 2M1ZA 1XAGA 2EXXA 1ZJ5A 1ISJA 1U04A 2AW5A 4LW8A 4UU0A 2IPLA 2QDKA 5EUMA 3S2GA 4CM4B 1U0FA 1BE6A 2BHTA 1F06A 3AGQA 1IL0A 1K4YA 1T8RA 4HDNB 2O8CA 3RAPR 4MVJF 4UHKA 4H2DA 4URFA 2VQ3A 1XEXB 4S12A 1FSZA 1HLDA 3VKHA 4DADA 4O0MA 2X8JA 2EWWA 3P2EA 4RD4A 1C0IA 5JDCA 4BKMA 1H9CA 2J59A 4M8SA 1Q1QA 2W9XA 3IP7A 3H2SA 2BGMA 4GI7A 1KJNA 3DZBA 1H4SA 4KKVA 2WQZA 3PLRA 4FYJA 2J3LA 2ZP1A 4FZ5A 4RW0A 2B6NA 3VHQA 1LBQA 1YA4A 3QFHA 2WT4A 4G25A 1RRGA 1OFTA 4G5YA 1EAMA 3GLFB 4IIYA 1QH0A 4IQ4A 3K0SA 4B6GA 1BEEA 5DGDA 3SR4A 1RLMA 2D7JA 4ZI2A 4ALMA 4PSUA 4KN6A 1QCYA 4PZYA 3W6NA 3HJFA 2AK2A 4BQNA 2AG5A 4Y1RA 5SICE 4QAJA 4NYIR 1HYEA 1RAEA 3JTMA 4IILA 3W34A 1UAAA 1FNNA 1QQ7A 3DJYA 2OPBA 2BGRA 2WNHA 5JAIA 4PG4A 4PZ9A 5A4JA 4KFCA 1GOTA 4H0FA 3E3LA 3QXGA 5E38A 4PRLA 3RTBA 1KRXA 4OQNA 2BJWA 2VQEB 4ZCQA 1XNHA 4EY7A 5KYWB 1E6UA 3R7SA 3WYNA 1SBQA 3DDZX 2O0KA 5FWXB 2F1HA 3DFZA 2C2HA 3TTTA 3W8RA 4IH4A 4S05A 1Z4JA 4V0MA 1VIMA 1DI0A 1QKIA 2IPXA 4NTZA 4F9GA 2WJHA 2A0FA 2VEOA 1A69A 5CU7A 5LP6B 1P2TA 2P91A 2FSVA 1SQ0A 3BIWA 4YDQA 2L18A 2WF9A 1B73A 1HDCA 2OO5A 5P21A 1IWPB 4NDAA 1GL9B 1EGHA 4D5GA 4FDUA 2R6JA 2GD1O 2BGJA 5BSKA 1S02A 1NLUA 1QGZA 1X2BA 2GASA 3H75A 3HV2A 5K6AC 1KZ4A 4HN4B 4AMVA 5JISA 3QH4A 1TM1E 3K1ZA 3DCNA 1UH5A 1UPUA 3TX6A 1W0JD 4IFBA 3V5NA 3A9TA 2FPXA 1NAHA 2C29D 4NOKA 4A16A 1JZSA 4CL8A 3O82A 3NHMA 2XVXA 4NOJA 3V4RA 1OJ7A 3K9WA 2V4UA 2XV1A 3JYQA 3I39X 4TV9A 4WKNA 3DSRA 2OCYC 1ULHA 3VSAA 1WXDA 2FKNA 1YZLA 4QU5A 2BI8A 4LOLA 3AUYA 5DTMA 4C88A 3PX3A 4AKGA 4CN8A 1KA9H 3KWJA 4Y9UA 4YAIA 1VB3A 2JZCA 2ZBUA 4JB0A 4PPQA 4X3CA 5ERXA 3ZD8A 1KGSA 2I2FA 1R5JA 3ECCA 3RV4A 1T3GA 4JITA 4EIWA 5EIEA 4A8JC 4I5GA 4WEOA 3CRRA 1QHHB 1YKSA 2XB8A 3G0GA 4YRBA 3FOFC 2BEJA 5AK0A 2G9UA 5AXBA 3ZK7A 1D0SA 5KJFA 4UBKA 3FWNA 3GHHA 1R0CA 2NGRA 4LWZA 5BN5B 1AGPA 1QUFA 4F3NA 3P9KA 1REQA 3EGOA 1EB9A 3M6FA 4FBLA 2G9VA 3A3YA 4C0KA 2XCTB 1KDPA 1DKUA 2CC2A 1UJ2A 3T3MB 3TEFA 3OLXA 1ACLA 1KQOA 3GEDA 1GUFA 3KL2A 5BPHA 2PZMA 1N1MA 2D1QA 2AUMA 1HY3A 1WMSA 5KDDA 3ELUA 4MWSA 1U0JA 2BL4A 2FUG1 3BGOS 4H9GA 3VU9B 1VYUA 4PYNA 3WB9A 3U39A 4IIHA 2AKEA 5HZGA 5LL6P 1N5RA 4UREA 3JVIA 4Y30A 3PNSA 2C77A 3QVUA 3R3UA 1ESEA 4IDOA 3FNHA 4HAVA 2XNHA 5AUQA 4JD5A 3ND5A 4HGRA 4TT3A 2H5IA 2REOA 3QYJA 5F78A 5DNYB 2CSXA 1GYPA 3K3PA 2ZSAA 1K86A 2GJAA 3BFJA 4IV0A 3U09A 1T24A 221PA 1R1DA 5KHLB 4O2AB 1V16A 3LAWA 3LDAA 2YNMD 3QWAA 3F6EX 3U4IA 2R8PA 4FKMA 4HNHA 5IC5A 2IYRA 1DCMA 2QZPA 3D8TA 2I03A 3KE8A 4UC0A 4ZT5A 2WYHA 4GM1A 3HK2A 4J7XA 2GCOB 4ITVA 3U7GA 3QVLA 5HW0A 1HQDA 1IVYA 2Y8EA 1NI4B 3RD5A 2DTXA 3Q1KA 4Y2GA 1NMSA 2PAAA 4KIUA 1EGMB 1K7CA 4M1SA 3G7UA 4C7BA 4ETMA 5ED4A 3QX3A 1YXMA 3FUXA 4CQMB 2B61A 1QYWA 1CY4A 5A62A 1ZIOA 3EEQA 4XD7A 2QJFA 3OM9A 4JYPA 3DLBA 2VHWA 4Y6RA 2GPYA 3Q72A 1JI0A 4Q9AA 1QE5A 5BQXA 1NSFA 5I5GA 2X7XA 2IC5A 4TLCA 1UINA 1QDLB 2CLEB 2QM8A 1M0WA 1T10A 3HL4A 3JALB 4ZRDA 5KU7A 4DR1B 3ZJVA 2DWOA 1A04A 3L1JA 4GLBA 4M0LA 3M5PA 3U13A 2JEOA 2UUBB 4BV8A 3A04A 5BVHB 3N8KA 2X0EA 1MNAA 1VDMA 1ADGA 1CUIA 1GLGA 4HJRA 4XR4A 4Z9AA 3SBEA 5BOSB 1OX5A 2JFYA 1W9MA 4TLAA 4WBSA 1HR0B 3RE1A 3E53A 3GFPA 5H3HA 2DFVA 2EX0A 3FZNA 3X44A 3AH8A 4Z4QA 4AZTA 3TD2A 4F2HA 2IUYA 2IQ5A 1NBOA 4I6EA 1XMIA 1WRBA 3TMKA 3EISA 1J97A 1WVGA 2PZLA 4FGWA 2W2OA 3CPJB 2V98A 3NH6A 2JLAA 1QTIA 2ZE8A 2YINC 4LGMA 1PZFA 4C4ZA 1ZUWA 1RE0A 1RWWA 4UQPA 2D8AA 5DI9A 3QSYA 1JDNA 3TCXB 4HOYA 3LV8A 4CT0A 4TWZA 5E2AA 5EZYB 3TRDA 4GKBA 4YCCA 3S68A 1M83A 1N2SA 4UMDA 3AILA 4MS1A 5BSTA 4Q01A 4C03A 5IBRA 2P4UA 3VAAA 2GTIA 1UQUA 3EA4A 1N5JA 4L2IA 4HY3A 2E21A 2BIFA 3NJ4A 2WVAA 3GUVA 1FFSA 5HCIA 3WOHA 3QVWA 1MFPA 1T8TA 3HCRA 4HWGA 3O2QB 1HV8A 4PC2A 3VC2A 3ZIUA 2QL9A 4BB0A 1O94C 3NALA 4P32A 4BMVA 4BS9A 5JAUA 5KYKA 4RYLA 5F4ZA 3G0DA 2FZGA 4XAQA 2QGZA 4D3XA 1GPDG 2LGJA 3L7DA 1W49A 3SLRA 3ADBA 3CPEA 1AUXA 1YB1A 4LDRA 4N0MA 3TLKA 5C37A 3OKPA 3EUAA 1C0EA 2JIZD 3EIOA 2O50A 3HCPA 5C8YA 3RS5A 3TL2A 4ADSG 4ZJPA 4US2R 1W93A 4YO8A 3DV9A 1VKRA 4CW7A 1QCZA 4BKQA 5KDOA 2TYSB 4TS4A 5C3UA 1CZNA 3KYDB 1PT5A 1EFVA 4OH7A 2WUGA 5L8VA 2YUTA 1ACMA 2JJYA 4QDTA 1UKZA 3GEEA 3QUTA 2XHEA 4MKXA 3ICOA 4TL8A 5AI0A 3RRNA 2PN1A 3MHTA 4IRXA 4PHCA 4R4JA 1C2YA 5B3JC 5JPDA 4I4TB 1O6CA 4MDYA 4PLCA 4BTVA 5JXGA 1JLLA 3E5HA 2BFCA 1R15A 3R4CA 4E4RA 3NNDA 3DAHA 3LX4A 2DT5A 3SIRA 1R6UA 2ZVPX 3BORA 4TVSA 2OG2A 1ONBA 4RESA 1XJCA 1C9JA 3FHOA 5J47A 1V5FA 1XLUA 3WGOA 3GWZA 3HKCA 1TF2A 3KWFA 4BQQA 2P79A 1ECJA 3W77A 3R23A 2C2ZA 5HK8A 3KEFA 1EESA 3EF1A 5G3ZA 1KVRA 3CR7A 2NUTB 4QYWA 1FBNA 2FVYA 4TS1A 5F5XA 4B4WA 5JYBA 1JALA 1ULSA 2H4XA 2ZQYA 3BC1A 3E7FA 4HX2A 5HF9A 4ER5A 3JAWA 4HCJA 1GNQA 1UKBA 1X13A 3CIFA 3H7AA 4G1BA 1S4MA 4FFDA 5ALYA 5FA5A 1Z4PX 1M9NA 1CNEA 4DEXA 3RASA 1DKOA 5EKUA 3ZBQA 3KQHA 1FJ2A 3B60A 2XNJA 1MJFA 3UWSA 3EZ6A 3Q7SA 4QUIA 3PGLA 4MLDA 2GPBA 4EI8A 5DNEA 1DT5A 2BR4A 3FSJX 4MAAA 1E4VA 3TIXB 3UXEA 3W6UA 5KSOA 4W7IA 3U7IA 2VSFA 3JQBA 4ZZIA 1Z5GA 5E7QA 2I3ZA 2OV2A 2FH5B 3C45A 1EXWA 2X6TA 2QZSA 4AUNA 1N3IA 2BEUB 1W0CA 4O5AA 1NBWB 3QLVA 1KBQA 2ZYDA 2ODEA 1EMDA 4RFSA 1F8YA 2PKCA 3ND7A 2DR3A 4GE3A 4YH1A 4GP9A 2HQRA 4YYZA 4OXIA 5MHTA 1LC3A 4X1KA 4ZGBA 1OAOA 4P3KA 1C30B 1JQAA 2BHLA 4KE6A 1ZC3A 2NZXA 4XDYA 1J2YA 2LXNA 3D3QA 1XRPA 4JI8B 3UO8B 1DKRA 1INLA 5JE8A 2HJGA 3SKXA 2GZAA 2V59A 4RDCA 3VO1A 5K0JA 5A5DA 1EXDA 1XRSB 4BQEA 1QQ6A 2L82A 1VSVA 1S9DA 1OLXA 5K3AA 3T7CA 2Q5IA 1P2FA 3MWDB 1USWA 1PAUA 4IF4A 3K6KA 2BHRA 2VQSA 2VHCA 4P86A 1NONA 2A5GA 3BDVA 2JJ2D 1JKXA 1TLTA 1N2GA 3PUJA 2B4KA 4YIKA 2QTTA 3PB3A 2ADMA 2VJYA 2OVBA 4ZOEA 5FUWA 4N0EA 5IKEA 4BNKA 1W30A 1JEYA 3NB0A 3EC2A 3PV0A 3ZEIA 1WE2A 3R24A 1FYDA 1MA3A 1QX4A 2QRPA 2XE4A 3EQ8A 4FILA 4HMPA 4NE9A 5ALUA 4DFDA 3EVEA 1MHTA 1E3WA 3D6NB 2PKWA 4OB8A 5CBKA 3LUKA 2PGLA 3KJEA 3B1VA 1ELOA 3AC0A 3QG5A 5IZCA 4F21A 2FP4B 3CRQA 1WXQA 1RVDA 1RYFA 2H7CA 4TKUA 3TOVA 4YRIA 1NUUA 3LPCA 3E23A 1H5QA 3U7QB 2IW1A 2GZDA 2OFWA 1M5TA 5CAEB 3VH2A 4JQOA 2I6QA 4PBTA 4D0RA 3RUCA 1E59A 3W2EA 4RTKA 2FZCA 4GXQA 4XPIA 1YB4A 1X15A 2O57A 1JLRA 2XRYA 1OXSC 3W7BA 2ZCVA 1XZGA 3U9TA 4DLKA 1ZNWA 1B1CA 3MMZA 4IDEA 2AN3A 1FU7A 3TOXA 3DL2A 4EGFA 5BN3A 3DCIA 1LDNA 4FZJA 2R11A 3EN0A 1EK0A 2NZVG 9GPBA 5EJ8A 2ARKA 1RPTA 1J07A 2WWTA 2GCPA 1JAIA 2E1RA 3IP5A 3B1WA 1G38A 1LBEA 1TE2A 1MW9X 2NVOA 2ODAA 2SCUA 3MS7A 2MCFA 5ETJA 3GPIA 5DBEX 1CQJA 1M72A 1GVNB 4JXXA 4LNHA 2WIDA 3L8YA 1G21E 1U9IA 4HGOA 5DT9A 5GV8A 3ZE1B 3PXAA 1BSVA 4C0WA 1P0PA 2H5LA 2Z4TA 3B1YA 3OE7D 1O0BA 1X7XA 3B3JA 5E2BA 4KMRA 1G2PA 1U81A 2FHPA 4G1EB 1YKGA 4KQFA 5FI5A 3HU3A 3D6VA 2I1VB 1Z5WA 3MJSA 4MUBA 2QVBA 3AKDA 1VC2A 1WW2A 3I28A 3QTLA 4DKJA 2PLRA 4XLLA 2CLKB 1R4MB 2OCAA 2ZT6A 2NIPA 3MGBA 2AN5A 4JEUA 3NAZA 4MVJI 2HIHA 2LP4Y 4NRDA 3UY4A 4XGNA 4IGIA 4DDTA 2H1IA 4JUFA 2RK4A 5E1MA 1XTZA 4JQYA 2VDJA 1P5HA 1ZD3A 1Z15A 1JHDA 1PR1A 1TVCA 3F6BX 4H7IA 1SUBA 4HH1A 4J3FA 4EKIA 3TZ6A 4IFTA 3FDZA 2AFIA 4YI5A 1X19A 1X42A 4S1NA 1VFNA 2QMEA 3R9KA 5J4KA 3VQTA 1QU2A 1XCBA 1AUPA 2IL1A 3EVGA 3JQGA 3WLHA 4C4SA 2H9IA 3DC2A 5FPYA 3BGSA 4WK0B 1L9KA 2RK6A 3MWEA 3U31A 1V9LA 1NATA 2B7LA 4E09A 4FW9A 1XTSA 1PW7A 2Q7DA 2RKOA 1NW8A 3GDGA 3KPUA 4V03A 3RFFA 1RIFA 4DPMA 2HPHA 2QG4A 1QH8B 4JVLA 5REQA 4MP3A 4YMLA 2RHGB 4RL6A 1KR2A 2EERA 2R3SA 4LZLA 2YV5A 3G1WA 1MXFA 2V7WA 3V7YA 4MMYB 5BORA 5BVGB 1Q7BA 4QL3A 4BNDA 4YCSA 4WLFA 1EJ6A 1O94D 1XQ9A 3N3BC 4UVGA 5HVNA 1NA5A 2GPJA 2UAGA 2J0EA 4DG9A 2CXUA 2JI8A 3BQNB 2XAUA 2A94A 1Z4LA 4OHYA 4OHXA 1E2PA 2PZFA 4HB0A 3PJFA 3CRMA 3L8GA 4WCDA 3T7AA 1SQGA 5FI3A 1D1TA 3HP1A 3A3KA 1YR7A 3CEJA 1JR3A 1IULA 1WZEA 1E2FA 1KIAA 2AX4A 3ABIA 4K7JA 5A3SA 1X8JA 3M3HA 1BXZA 1EKXA 1U1EA 4NCIA 4RA9A 3FJOA 1RRCA 1SQSA 3H6HA 5ELMA 3ZCTA 5KKCA 1PS9A 1Q1BA 4IZHA 4DLXA