3L3BA

Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from ehrlichia chaffeensis at 1.90a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
210
Chain Sequence
LNSAVILAGCGHMDGSEIREAVLVMLELDRHNVNFKCFAPNKNQKQVVDHKKKESVGEVRNILVESARIARGSVYDIEQIRVEEFDMLVIPGGYGVAKNFSNLFDEDNDYILPEFKNAVREFYNAKKPIGAVCISPAVVVALLKDIAKVKVTIGELIDKMGGVHVDCPTIKSVKDDVNRIFSCSAYMRNDSLYNVYLGIQDMISSMVNYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from Ehrlichia Chaffeensis at 1.90A resolution
rcsb
source organism Ehrlichia chaffeensis
molecule tags Biosynthetic protein
molecule keywords Es1 family protein
total genus 71
structure length 210
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l3bA00
3CZ9A 1OI4A 1GGJA 3PQ5A 4OJYA 3L3BA 4AUNA 3EFEA 1FYEA 3TTYA 3OT1B 2GK3A 3MIIA 4RKWA 4GE3A 1PDVA 2D7JA 4UZSA 5K4AA 4AULA 1L9XA 3CNEA 5JZMA 1U9CA 3BHNA 2R1TB 2R1VB 2VDJA 1KEEB 4WXYB 2IUFA 2H2WA 4P2GA 4WINA 1BXRB 4L78A 1G2IA 4I4NA 4ZDKA 1WL8A 3PQ6A 4QYTA 1C30B 4GE0A 3SF8B 3ZR4B 3GRAA 3EN0A 3FSEA 3NORA 4ZDIA 1QVZA 3CYFA 4HCJA 3NVAA 3MGKA 4E08A 2ISSD 4ENTA 2OR3A 4OQ4A 1N57A 3UOWA 4QYXA 1K9VF 4OGFA 4P5PA 2VKTA 2VRNA 2RK6A 1P7YA 4Y1RB 3L4EA 2AD5A 1I7QB 4RKYA 1ONSA 1OX5A 1OX4A 1SOAA 4ADSG 4B31A 3NOOA 4UOQA 3SOZA 1Q2UA 4PXYA 3EZGA 5SY6A 3TTXA 4UCFA 4ENQA 4BIMA 4ENVA 4UNIA 2YWBA 3P9QA 3TTUA 1QF7A 1C3OB 4Y1FA 1JVNA 5E9AA 4BFLA 3R75A 1S1MA 3P9PA 3UGJA 4L8YA 3B36A 3TQIA 2V4UA 3L18A 4OFWA 4MNTA 5SY4A 3WFZA 3SF8A 4OGGA 1SY7A 4XLLA 5JZOA 4I2NA 3P9SA 1KXJA 1Q7RA 1P81A 2R1VA 2GHRA 1A9XB 4N12A 3TTSA 4B5KA 4ENPA 5SY9A 3PQ7A 2RK3A 4L7QA 5IP5A 4ZGGA 4LGYA 3ER6A 3EWNA 4R7GA 4OIFA 1OX6A 2YWCA 1P80A 3N7TA 4B40A 1VHQA 3ZJ5A 2LXNA 4L8FA 3P9RA 2ZUVA 2WJZB 1JDBC 4JQSA 1M6VB 3R74A 4AJ9A 1R9GA 3F71A 1VCMA 3PQ8A 2YWDA 2FEXA 1QVVA 1IPHA 3R76A 1P7ZA 3EJ6A 4LRUA 3M3PA 2ABWA 1T3TA 3NOVA 1GPMA 3F5DA 3UK7A 1I1QB 4MTCA 3UMMA 1OX4B 3B3AA 1GGKA 1QWSA 2YWJA 2RK4A 3FIJA 4S0ZA 4B7AA 4E5VA 4BTEA 2VPIA 1I7SB 2A9VA 5DFAA 1GPWB 2NV0A 1IZZA 1OY1A 1PDWA 3NONA 3OT1A 4K2HA 4MGHA 1PE0A 5SYAA 5LIRA 1UCFA 2XF2A 3UJNA 1T36B 4L95C 1KWKA 1GG9A 4B2YA 2R1TA 2ZUWA 3CZAA 4Y1GA 1FY2A 3BWEA 2R1UA 3PQ2A 4P36A 1GGFA 1O1YA 2NV2B 3KKLA 4P35A 4ENUA 3VU3A 3TTVA 4ENRA 1P5FA 2ZUSA 4GUDA 3RHTA 3TTTA 4ZDJA 4ENSA 1PV2A 3TTWA 4UOZA 3B38A 2W7TA 3ZJ4A 1VCOA 2VXOA 3L7NA 4P34A 3NOQA 1GGHA 1CE8B 2AB0A 3D54D 4I46A 4AUEA 5BV2P 3PQ4A 1KA9H 1VCNA 4Y1RA 4Y1EA 4AUMA 1T0BA 1QDLB 2ZUUA 4N0MA 3PQ3A 3CY6A 2ZUTA 1QVWA 4D1YA 1CF9A 1J42A 4Y0NA 1GGEA 1KWGA 4L8WB 4ENWA 1IZYA 1CS0B
chains in the Genus database with same CATH superfamily
1H93A 4PNPA 4B35A 3GAFA 3SX0A 1GPYA 4Y0AA 4YCJA 2ZREA 4MQFB 4QATA 3YASA 4FYVA 3AIKA 3ZH9B 1H2FA 1KY4A 4GOKA 1WPXA 1RLOA 3JQEA 3IX7A 3ZDZB 1SG9A 3RUDA 1ODKA 5ICSA 3COSA 5ALGA 4CCWA 5AH0A 2OP1A 4TUYA 3P2EA 4EYOA 5JS6A 1A5AB 3JALB 4W1QA 1EX6A 2HK7A 2D1FA 1PNTA 2YC2C 3H5WA 3JRXA 3M4NA 4HGNA 4AJ4A 1AS3A 3L8ZA 5DK6A 4BKRA 2JL1A 2HMUA 2ZPAA 3PUVA 1Z9BA 4KVAA 3QJYA 5HM8A 2ON6A 4UHKA 1EFTA 3LU1A 1UT6A 1WCIA 2VNKA 3O2JA 3BSWA 2PLNA 2X8WA 4Q9LA 3I32A 1SQ6A 3G0HA 2HKIA 1D1QA 1DRUA 4EB8A 1OTXA 5EJ2A 2QGZA 4OXYA 1JECA 3BT7A 2PKWA 3L6RA 1CXZA 5DX8A 3ZZMA 1UKEA 3HY6A 4Y8VA 4EITA 4IAOA 2BFEB 2FMUA 2W8BA 5JS7A 5KTOA 3K5WA 3T1TA 4F1WA 2QKYA 1ZMXA 5AKLA 5F3WB 2GPNA 2G9NA 2E87A 1WEHA 3CT6A 4KLRA 2FMTA 4QDXA 1NBME 3EYWA 3JYNA 5DNWA 1EIWA 2P2ZA 1YXMA 2QL6A 2INGX 1XD2A 2VIIA 2O8NA 4UUAA 1E77A 1XZPA 3GLHA 3LDFA 2C5GA 2O2IA 3I6MA 2LDXA 3NI2A 3OX2A 3ZGOA 2V98A 3OG9A 2JJYA 1T1SA 1XTVA 2OGZA 3FPSA 3I4CA 4HATA 1XXHB 3M2TA 1KZHA 3U44A 4FC6A 4Y9RA 2EG9A 1C8VB 3I8SA 5BNFA 3ESRA 3RWMB 1YJBA 2J5QA 4XVHA 4D42A 4HLQB 3RSOA 3L4KA 1KK1A 2NYUA 3VYRB 3F96A 4E22A 1L5SA 3E84A 1KVQA 3HDTA 4JT9A 1FQOA 2XA1A 5C7LO 3AR6A 5A7GA 1EWKA 1IPHA 4ZT6A 1Z83A 1VL8A 1KEVA 2CXRA 2PX2A 3BZWA 4EA9A 2IP1A 3O03A 5EKSA 3ZD8A 1LFAA 2VYCA 2IU0A 3O8OB 1NNSA 2E7ZA 4W5NA 1JWBB 4K28A 5ELXA 2QY9A 1O4VA 3OD1A 3HB4X 2G77B 1A8HA 2R6HA 4QNMA 1J8YF 3RJ9A 4JLKA 4LRYA 1TECE 3KNZA 3F9IA 3FPCA 1T2NA 1F8FA 2OHXA 4HNHA 2C1EA 3RJMA 2R1TA 3NBMA 1QWOA 5BNWA 3IVMA 5COAA 3N9IA 5BSEA 2A2ZA 1L4HA 1ACMA 1KI9A 3OE7D 4MUEA 5KVSA 4P35A 4NPHA 3D7KA 1XDZA 1PYGA 2WG1A 4JKIA 2JGEA 4G0QA 4IJWA 2HSJA 4MUBA 4E5KA 2B1IA 3AM4A 4Q82A 2VNAA 1BXGA 2OM2A 5IF9A 2CMGA 1P0FA 3O4HA 3ZGXA 1I3LA 4D25A 1VSVA 3GFFA 3FH0A 2XDQB 3PNBA 3O5AA 4MRMA 2JGNA 1PBTA 5BRAA 2HUNA 5DM2A 1V6CA 5K09A 4YHHB 1M0SA 3ZWOA 3H8WA 5FDFA 1ATZA 1JHVA 3GG2A 5L40A 4OXKA 3LLUA 1VJTA 2HJWA 4N0MA 4W5HA 4YJFA 1UM9B 1BFDA 2A0WA 5AJHA 5G0SA 1UBGA 5JALA 1G1MA 2H1WA 2O3RA 4NMWA 1NUSA 3K0CC 1H2RS 1T8WA 1ZU5A 2WTMA 2RG7A 4HEA1 4JUFA 1ZC4A 3STUA 2E4UA 2ZDQA 3QBDA 1SQ5A 3H1GA 3I76A 1K4KA 3CNHA 3IJRA 4CCYA 4EVRA 1U2QA 2QTTA 1KJYA 2Q99A 4LSWA 4MRRA 3RIGA 1TJPB 2P8SA 4PWZA 2GPYA 2IHTA 4K88A 5JHGB 5L7WA 1YI0A 4BATA 2XNDD 2C7OA 4C2UA 3WGZA 2JIQA 2NUPA 3TQSA 2BKXA 3G0GA 3UB3A 1Z6XA 3BTUA 3JQAD 3OKPA 5GZ3A 3KE8A 1YT5A 4AKSA 1M2KA 4CGYA 1YASA 4REQB 4UVGA 1H85A 2HREA 4O4IB 4YR9A 2JFQA 3T9AA 4DVJA 1X9HA 2XUAA 4FOOA 3SAJA 2P2DA 2B7BA 4FWBA 1VKRA 4DCSA 1DCKA 4A91A 2VZLA 1K8RA 2HN9A 3JR7A 1FA9A 3H8VA 1RI2A 5CT4A 4NJEA 1M3SA 1UXKA 4N7BA 5C2JB 3KKPA 3M9WA 4IJ5A 1T9KA 2D2FA 3N7AA 4L4XA 3ZQ6A 1G6KA 5EHZA 4CETA 1VL0A 3PR3A 3S2ZA 3ZLVA 4CQMB 1HBJA 4M99A 1G21A 4IHQA 4RWEA 4CKEA 3QX3A 1K5GA 1ISPA 1E2IA 4MA4A 13PKA 3MJFA 5B7QA 4DSTA 3GFSA 4CGZA 2EW8A 5EHIA 2EC5A 5FYQA 4LYEA 4DE5A 2WK1A 1F17A 2VUSA 3E2PA 1I7PA 2C5AA 2VPXA 4Q37A 2DG2A 3UG6A 4FHDA 4HPJB 3PX3A 4E33A 1AMUA 3IALA 1HT2E 3WQSB 1NMYA 4TXNA 2C96A 3L0OA 4UFPA 4NBWA 1DELA 2XWPA 4RD1A 3ZVRA 1B6SA 3TNYA 3COPA 3ZBQA 4BFZA 1RHUA 3QUAA 4JS0A 5HFAA 2ZE6A 4BMYA 2JEOA 3LG2A 4YDSA 5CFZA 1G0NA 1E1RA 2C2HA 2Q3MA 4CM9D 2O7NA 4YAOA 1A8IA 3H3FA 1JT9A 5AJWA 3GH1A 3DEJA 1EJ2A 4DQKA 2CJFA 3VSAA 1U8EA 4KGVA 1DAFA 5EHXA 1GKLA 4PZ0A 9GPBA 4QTZA 5CUQA 1CCWA 1E5QA 1H4QA 3EVCA 3VZQA 4OUDA 4KQJA 4GKAA 3T5PA 3PICA 4LMPA 2W6JA 4TYWA 1H0SA 1JKJB 2R8YA 2C2MA 2AXNA 2B30A 3R9XA 2P5UA 1OJLA 1FDWA 1G2PA 4QC2A 4YWHA 1RAIA 3PQ2A 5HDBB 2LPMA 3EMBA 4DR2B 5D5QA 4H3HB 5BURA 3PC2A 3S44A 1BX1A 3GEHA 4C5AA 2BZ0A 2VK1A 2BJVA 2DOKA 5HBRA 5KJ1A 2QVZX 4ENSA 4A0SA 1JYEA 2BFNA 3QLUC 1CY6A 3VZPA 1DJPA 1O58A 2B21A 3W9UA 1Q1EA 5JDIC 4FYIA 4CN8A 3NOQA 1GNTA 1YI8A 3QHAA 3ZTWA 3HEAA 3ZU6A 4C7OA 1JU3A 2P68A 1I3KA 1ZGAA 2YNMC 3IOEA 1O97C 2WM8A 2PUHA 1RFGE 1UFOA 3ESBA 4RTPA 1VPWA 1WS6A 4O4JB 3AZQA 4OHVA 1ZVKA 3E7XA 4OBXA 1MX9A 2OAGA 4IG9A 3U1TA 5H4GA 3BXGA 5EWLB 1QMGA 5T4EA 2BTOA 3ZY3A 1I6KA 3M1IA 1D2HA 2ZRAA 1DAEA 2X8AA 3KSZO 2E37A 3GNQA 1CR2A 2CV0A 3QVTA 2VK4A 4BB6A 4W9RA 1EVKA 1TKRA 2HH9A 1D07A 3HKCB 4GRDA 1W87A 4WWHA 2A9FA 1P74A 3ANNA 3NRJA 5I4CA 5KSYA 5CNIA 4D5GA 4Q1VA 4B3BA 2PU7A 5IF3A 1WLYA 1JSRA 3BMNB 3K15A 5GMOA 1AV6A 4KFCA 2B36A 3AQ4A 3GK3A 3I9LA 3PKJA 5CVUA 2WEKA 2CXSA 4HH1A 5DNCA 2OV8A 3FCYA 2FPPA 2ZRKA 1U2TA 2IXGA 5C46F 3NYRA 3OUUA 3SQOA 1EQAA 2DU8A 3OX3A 1OPXA 3A2NA 4Q9NA 2ZCUA 1R5BA 1YGYA 2F17A 3AWDA 3ITNA 4E3ZA 1O0SA 2IVFA 4BS9A 2JFYA 1BKDR 5DULA 3C3YA 5CCDA 2RK6A 4X20B 1IHPA 2PJZA 4FR5A 3BPSA 4JNCA 1SOAA 1IN6A 1N8NA 2GTIA 3IAXA 1MAVA 1GFIA 1YIOA 3DBRA 4MRAA 4OXRA 4OP3A 5LQJA 1VZ2A 3UH0A 1G5TA 1T8YA 2OESA 4GI1A 2OO3A 1U2DA 2CMDA 3KS9A 4GPIB 2OXRA 1Z68A 1ADJA 4J9UE 4BNDB 3H0CA 10MHA 1NW5A 3JR3A 4DV2B 1T5OA 1OU4A 1W46A 2DBZA 4JX8A 4BAZA 3TQIA 3L01A 2GF0A 1YSCA 5BPFA 4CMCA 1P2FA 5KKAA 5LZ4A 4MO2A 1Y81A 2WVJA 4MV4A 3K6RA 4BPBA 2WKRA 4D81A 2GA9A 1Z88A 4AZ3B 1NU8A 4KTVE 1KH2A 3SC3A 3DV9A 3V8MA 3BGDA 3ND7A 2J9YB 2KMLA 2YY5A 1WULS 2C2ZA 3GJYA 4MW1A 2PCJA 1L8XA 2HF9A 4LV6A 4ZVOA 2BT4A 1TVCA 3DP7A 2C4UA 4DA7A 2PQ0A 1V3UA 1Y8RB 2CUKA 4YAIA 5EJ7A 3HUEA 1Y1TA 2BFOA 1NNEA 3ZJVA 3NHRA 2SCUB 3FFAA 1KC1A 5JVDA 2XQVA 4AJPA 1ZIDA 3EPHA 4C6HA 5DEOA 2X2FA 2D06A 4AU1A 3GMSA 3A6KA 3VU1A 1ODLA 1ST2A 5EZ6B 3B3AA 1SIUA 1YS6A 5J1TB 5AW5A 2QM0A 5B1HA 3A6HA 5F23A 5KJFA 1CK4A 2A9VA 2QP4A 2D13A 3LIIA 3A7EA 3WB9A 3GD7A 1V16A 3HJHA 4I9NA 3MRXA 1MB3A 3OZVA 3I04M 4F4IA 3UAGA 3O83A 1XKLA 4IIJA 5ICMA 4Z3OA 4XQGA 2CVQA 3R5HA 2IUSA 4ZOAA 5IWAB 2EYUA 3CONA 4FD2A 1PX2A 3AZPA 5ITSA 4Q12A 3FDJA 1BMDA 1F38A 1TEXA 2I5PO 1Z6PA 2J9ZB 5BN5B 1IHDA 3ZHZA 4M0KA 5F3DA 1FXWA 2OP0A 5FO0A 6PFKA 3IUEA 5J5CA 3ZLJA 1NQAO 3HU5A 4PZYA 4QU0A 5FUWA 2FSGA 3S70A 5K8IA 3IE1A 4MR9A 2CMFA 2GWRA 1NV8A 4YONB 4ID3A 2JI6A 3ENQA 2XTMA 3GRPA 3TOZA 4UXIA 3W0LB 4FIDA 4NOKA 1OLOA 1U0FA 5BW4A 1YUNA 4AYTA 3B5IA 1AUQA 5EXPA 2HWYA 1PR1A 4KPYA 2WP8J 5ALIA 2DPLA 3KWMA 5IYZF 3IHTA 2XWSA 3VTAA 4YN3A 5JNVA 3K6JA 4HNSA 5CEFA 1MXHA 1EQUA 1TC2A 1X0XA 1L5HB 4JDUA 1P0PA 2BLLA 2OFPA 4BXOA 2V3VA 2HI0A 1JNXX 1H94A 4RQTA 4DDKA 4EA7A 1GNVA 3TIIA 3I9V6 1DIBA 1DJLA 3OE5A 3I8OA 5C4GB 5U4QA 4P81A 4CKXA 3RIXA 3WYAA 3GUYA 1G4HA 4P92A 1E2NA 4QYTA 1DKOA 3AUAA 1Q21A 3L43A 3C4VA 3E9DA 3SY8A 1R6VA 3IP8A 1NNLA 3U4DA 3CYFA 4FE3A 1G9XA 4MAMA 1BO6A 1U3VA 2FN7A 3NV7A 5TC4A 4C30A 3UYKA 2ZJ3A 2ISSD 2XVAA 5FL7D 2I03A 3W5BA 4B3JA 2RHDA 2ZJ4A 3LWBA 2Y76A 1W88B 2KM1A 4BFWA 1T5IA 5FV4A 5JEDA 2IH4A 2QK4A 1E64A 4ILKA 2YWGA 4Y2GA 3J7AC 1IPFA 1XAGA 3G2PA 3UA4A 1CJSA 2ODBA 4DFDA 3TRKA 2N47A 2H92A 2OSBA 3GLUA 2IYFA 3OCUA 1XIVA 1W75A 3AFGA 2ZIGA 2PH1A 4PYRA 1Y6RA 1A4XA 1HE1C 5JSQA 1FFYA 4EPXA 1K89A 2VP4A 3M34A 4S1NA 1H6CA 1ODSA 2PKXA 2VVTA 1TLLA 1HDRA 4TLEA 3KKQA 4UU7A 3Q41A 4RTQA 2ZS8A 2ENUA 1YE5A 2J09A 3MGBA 4K46A 3SZRA 3UW3A 5FHQA 3GPLA 1HFJA 5FOVA 1XCPA 3LXMA 4FS8A 4XIJA 4DLNA 4R1UA 4BVAA 1GSAA 2WWVD 2PWPA 2W42A 3ROTA 1QP4A 1ZH6A 1UJ5A 1N3BA 2GBCA 3M8KA 2E5WA 3KP1A 4KNWA 4OI4A 1WR8A 2F90A 4NYJQ 2EJBA 3A6FA 3IP3A 4WT7A 2FEOA 2YL2A 4FFBA 1H3EA 3GROA 3VC1A 1NHWA 1V7QA 1W1IA 2AFIA 4N7JA 3WNVA 3HK2A 4MW4A 3CLTD 4QG7A 3ZK7A 4FCCA 4K0RA 5IXYA 5IKEA 1CQPA 3E9MA 2JK1A 3TQTA 2Z5LA 1F8UA 3KJEA 3VZSA 1SCUB 2B6NA 4Q4CA 3AIMA 1K6MA 4TZ6A 3EZNA 3C6YA 3KUUA 1ZD3A 4Q01A 1NJ2A 1NXPA 1L7OA 2WLSA 3CCCA 3T0GA 3HBJA 1ZW1A 4TTAA 1UBOS 1ZA2A 3HL4A 4QQFA 5DT9A 3E3AA 3K5PA 4EI9A 3EMDA 1OH5A 1C30A 2B37A 3EQZA 4NEHB 3E3MA 3HXTA 4MAAA 2X2PA 3QOXA 4KQGA 5JI3E 3PHLA 4MVJE 3I05A 2PVCA 3K32A 2C29D 4DLLA 5B30A 2IKQA 2QGFA 1JVBA 4FGKA 1T4DA 5FOSA 4EHKA 3EVEA 2I1QA 4KMOA 5TS2A 1QYXA 4ZOLA 2O3SA 1E1LA 4PYLA 1CRPA 1CUEA 1CRWG 2VOJA 3DEFA 1YUBA 1MAUA 4Q39A 2VDUE 4XCQA 5BUCA 5C7OO 3FZNA 5ERGB 4I55B 2GN8A 3AHEA 1Q7TA 3IE2A 4OHXA 3RFXA 4HUTA 5E7MA 4LFCB 3L5OA 4LYFA 5CXSA 4U7WA 4YAKA 3A32A 2Q5QA 4UJ5A 3SHTA 1PSWA 1R00A 1TCAA 3NH6A 4X9XA 6REQA 3U7FB 4RK5A 3D0OA 2QY6A 3VXKA 1VSQA 4F11A 3EQ6A 2YW2A 1XCLA 2BP7A 1FP6A 3F90A 2BV3A 4YMVA 1AA6A 2OD7A 1E3WA 3N2NA 3G8YA 4RS3A 5F4ZA 2BHTA 3FLMA 1A97A 1Q7CA 4E21A 2CFRA 4GLFA 4RKRA 3SE7A 4XDYA 4M8SA 1EK1A 1D0IA 5FBKA 2NOAA 1V37A 2QRVB 1YBVA 5IEJA 2IE8A 4URXR 2RI0A 3L04A 2QS9A 1A88A 4L1KA 3TRDA 4E5UA 1QH9A 3W8EA 4BKUA 2NXWA 5TY0A 2NU6A 2EX4A 2YWXA 3GRUA 1UPUA 3BSFA 3HBLA 4ZQCB 3V48A 1EDZA 1EIZA 3PI7A 4D3YA 1DJOA 2N1MA 2PNJA 1JQ5A 5DHFA 4N8SA 3ZPXA 5EJEA 1ULTA 1WX1A 2TSYB 1RIFA 5JYEA 3MQ4A 2CVZA 5LZ2A 1ZN2A 1A7UA 2O57A 4BFUA 3Q5GA 3EZ9A 5JCOC 4X7BA 2WF9A 4L0MA 5INTA 4MHTA 1PR6A 3DQZA 4I19A 1NRJB 2ATIA 2C92A 2UAGA 4GZLA 1QRUA 5EIFA 1E18A 3OTQA 1HKHA 1NR5A 3ASYA 4IDOA 4ZO7A 4BLWA 1JJIA 3VZDA 4HEA6 2G9RA 1KHHA 1JSXA 1Z15A 3JQBA 3LQKA 1LBTA 4IDFA 4MS4A 4PW0A 1AGXA 3JQAA 3KJGA 2XT6A 2JLYA 1C8KA 3OZXA 3S2IA 4KPUB 4RYDA 1A5ZA 1E1QA 3NALA 1LSUA 4HYYA 5JATA 3FWKA 3OZTA 2P4UA 3STTA 3H19A 4FS3A 2FXVA 1QWSA 5L3SB 5CLJA 4Q4HA 4U6QA 3ZX4A 4ARAA 2VHCA 2QAJA 2I6XA 3F6RA 4U2DA 1L5FA 1OIVA 3E0QA 1PTJC 1CUFA 2VG8A 3RT7A 3SJCA 4CZ2A 4P80A 4R05A 1XJ0A 3W8FA 1UWCA 2DKOA 4X41A 4EHBA 2ZUWA 1U0TA 1KKLA 1QCYA 1E89A 2QXTA 1YJ8A 4LC9A 3ADOA 3EZYA 1QK4A 4WLVA 1UJNA 4ZYLA 1QO0A 3IIEA 3WP1B 7MDHA 2RH4A 4YRSA 1QPBA 4YRQA 4Z49A 3W06A 4B3SB 2OHHA 3KSUA 2ZJ5A 1U2PA 4G26A 3CW2A 5G0TA 2ZWVA 3VM6A 4DV1B 1B23P 4B7XA 2PGDA 1TCVA 4MPTA 4P0QB 4BHTA 2YHIA 2UKDA 5JIBA 2IEGA 2PZJA 1LA2A 2IP4A 4MCIA 4WTOA 4Y1EA 3A2KA 1FX0A 4UFNA 3LOUA 2GEKA 2B7LA 1AT1A 1O6ZA 3NAMA 3SYTA 1TTPB 2OO7A 1TQHA 4FW8A 3AR5A 4MUKA 5LWHA 4DXAA 1VPEA 3NNNA 1UEIA 2WU1A 1DRKA 1SD1A 2GEDA 4KR0A 3KRTA 4OQFA 3RUFA 1ZOIA 2JAHA 3NWEA 2OG2A 1SCDA 1HTTA 4UPDA 2FFQA 3MFYA 2DXIA 1AU9A 4EO7A 4WAUA 3N0TA 2XYHA 4C0HA 2GGSA 3ADPA 4ZAYA 5JMWA 2GVNA 1R18A 1F4VA 3AINA 4QO8A 4TWRA 5TEVA 2D3WA 2PDAA 5MN5A 5GJCA 2AOWA 1CUJA 2VAPA 2VNHA 3BL5A 5BSFA 4RIEA 4WPGA 4CM7A 5K8LA 5LXTB 1Y80A 4OQQA 4CEHB 5K5EA 1I6WA 5CG1A 1J5XA 3TLEA 4RQAA 3GOQA 3W2EA 1Y7HA 4JK3A 4ZRDA 2JLUA 3HY3A 3UOWA 3B2NA 3HEMA 4O2BF 4EGFA 2C57A 2YIJA 2OZKA 3N2EA 1MHPA 4Q3CA 4ZYWA 1TVEA 3ILVA 3UK6A 3IOCA 1XU9A 2RJOA 1WXIA 4B31A 5KDDA 2F8LA 2OVBA 1WXXA 5DM1A 4UM5A 3BGVA 4YEDA 1XYYA 1WO8A 2YOHA 4RMGA 1XZGA 4S12A 2WU0A 1SA0A 3N0XA 3VUFA 1TRKA 3T1VA 1ISFA 2I78A 4KTTE 1PZMA 2PBLA 3AQIA 4KYIB 1ORHA 2VAWA 1YZGA 1SC3A 3O8OA 4WZZA 3U48A 1SHTX 1E9EA 2IKSA 2GYUA 3ZTYA 1VJ5A 4ZI3A 1EXVA 2O2GA 1GZHB 3HCOA 5DNVA 4L6IA 1MABB 3A37A 4Z0NA 4I2NA 1A8SA 1AS0A 1XZFA 5BVHB 1TIPA 1ZXXA 1LJ8A 5MN4A 2I4LA 1FFXA 2BAGA 4KJZA 1RCTE 2XD9A 4M1KA 3AF2A 4B6FA 3MD0A 3VTZA 2ANCA 1QK3A 2FRDA 2QQ0A 4Q9JA 1WW3A 4I4TA 5CJJA 3T41A 3HYTA 1XRNA 4L0QA 3UZUA 3QYAA 3WMXA 4E2YA 3TLXA 1JHRA 1EXDA 3PDJA 3JWHA 1NVVR 2W98A 3LE8A 3OZWA 4MR7A 4MRMB 1F20A 3N87A 1UJCA 1XJWA 4F04A 4G8DA 1HF3A 1QFZA 3ONWA 4MQLA 4AG5A 3UJ6A 5KEIA 1T9CA 2CN1A 1VL1A 3NV9A 4GWGA 1C7JA 2CV1A 1R66A 2BUAA 2IBMA 2QTVA 3NM6B 1NQOA 3OICA 4HHEA 4IWNA 4XDGA 4NCAA 1N2OA 4FYMA 4MVWA 3ZHBA 2VBFA 4IV5A 3BMCB 3WLPA 2V3CC 4RVHA 3TNDA 5K0LA 3LTEA 3FNFA 5CDYA 3N1UA 2ZSEA 3D4IA 2GUGA 3NPMA 3Q2OA 1J4AA 4UNNA 4E5MA 1QAOA 1VZ3A 5FLEX 3MXOA 2DPGA 1KJZA 3O6VA 4H7JA 2JLQA 4NYIQ 4DQ0A 2VO1A 5E7IA 1NJGA 4EDFA 2FETA 5FUXA 1F2TA 2V7PA 2XEDA 2Z2XA 3D3WB 5LQSA 1DKQA 2J5BA 3HCAA 1M2GA 1RM3A 2JDIA 3O38A 1KRHA 5DF1A 3IEVA 2BE7A 4HDSB 4LJSA 2Z4RA 4QXRA 5JXHA 1WJGA 2NZUG 2FP4B 1ZXBA 2WB4A 5DM70 1Y48E 2JIOA 2M2IA 2F55A 2OD9A 1KPHA 4WY8A 4EENA 3ZWBA 3SLKA 4V1CB 3E2MA 4XTCS 4LHEA 2XHEA 3ZU3A 4F6LA 2O7RA 4UDOA 3JS5A 1Z4NA 1LLFA 2BL4A 1VXRA 3LLSA 4BO0A 4IIJB 2YXDA 2ZRMA 1PFQA 2QN6A 3DOFA 3PWTA 1LW7A 4Y9TA 4D43A 4JZKA 1QJCA 3C74A 3NGXA 4PZLA 5D5PA 4ZAGA 3V1KA 4UUBA 5BMVF 5HKBA 4U9UA 5J1SB 1QIEA 1H2BA 4NRDA 4QXPA 3VI4B 2OCLA 2I4NA 2QI9C 4TMTA 3B8EA 5IKPA 5THQA 3JARB 2Q3DA 4GUAA 4V0KA 3AEXA 4FKBA 2D3TA 1MOPA 1NTRA 3DEAA 2SCUA 1N2GA 3HGMA 4OQYA 4UBNA 2NU9B 1JEOA 4E7OA 1ENPA 4UHDA 1BVYF 1Q7EA 1CJBA 4LSMA 3PXCX 3UK2A 4MICA 3NIFB 3F4BA 1M2EA 3AY7A 1JR3A 1CUUA 4COKA 4NCIA 4O4HA 4R84A 1WTAA 1ID8A 4Z86A 2L18A 4BBPA 5FNVA 4Q9KA 2JFPA 1FE8A 2ZULA 3DT6A 2H7XA 5EIAA 3AI1A 5DTEA 1W8IA 4IINA 3THWA 2PJRA 1WXEA 4KUGA 4C0XA 1EAYA 4FEGA 4V24A 4JWKA 4IQGA 1ZDMA 2AR0A 3W04A 4QU8A 2PUEA 2H5JA 2PMKA 2XE4A 4Q3EA 5CIYA 1LC3A 1XB2A 2AN4A 2BPOA 4G5HA 5CM2Z 5HGXA 4PNZA 2G9UA 3KKZA 5EJ6A 4EX6A 4L50A 3T3PB 3FGNA 2AEEA 2JHFA 4HN4B 5KREA 3JQ7A 3V46A 4BY9E 4HR7A 4WOPA 1TOAA 4NZ9A 4DXHA 3OHSX 2UUAB 1D5WA 4BKMA 1R2QA 2BKAA 2DULA 4XGNA 5DMHA 1K98A 4BFYA 3HXPA 4KAXA 1JMKC 2BUBA 2D1RA 2H06A 2QTZA 3P2MA 1GSOA 1LWNA 3K7EA 4OHPA 4HZUB 5T8KA 2IUUA 1PE0A 1BS1A 3SQLA 3CZAA 3KYCB 4L3VA 4WKOA 4HX5A 4LMAA 3WMFA 4AECA 2DQZA 1T0UA 4E13A 3P5SA 3RU7A 1RBYA 3LHDA 3O7WA 5AM2A 1LSSA 1P5FA 3K09A 2P9FA 3MQFA 4N01A 2QZJA 3OFNA 1X9IA 1XQVA 3DTVA 4RM2A 2YIMA 4QGSA 2GZ1A 2OK8A 4R69A 5LXTF 1JDSA 2PY6A 3X1XA 1SZCA 3U5ZB 5ADUS 5CPFA 4JJEA 3MJHA 1HPLA 3VDQA 7YASA 3ZQKA 2IDZA 1FQWA 1DT5A 3TZKA 3O8LA 2IZ5A 2EGHA 1J8QA 4WFQA 1QF9A 2AFHE 1JGTA 2VT7A 3ONFA 4RY8A 5HKLA 5K8CA 3FZQA 2WYVA 1E3MA 3QY9A 3L1KA 3RE1A 1Z2AA 1U4OA 4A6EA 1I4OA 1UH5A 2Z57A 5BR7A 4G1VA 2CUZA 3DMFA 5LJIA 2R00C 3CRVA 3Q3CA 3Q85A 4HGZA 1IHOA 1MH1A 4IBOA 4X1OA 5EVJA 4O5OA 4MKGA 2J6HA 3UFXA 1RPTA 3GZJA 3TDNA 3S8MA 4M9ZA 1Y4SA 3KTDA 4CMJA 3O2QB 4IX9A 5JD4A 1NOIA 4U0KA 1EDDA 2NGRA 1PV4A 2Q7DA 1SC4A 2PD6A 1A5BB 1U8YA 5B7GA 2AWOA 3PZRA 4MV3A 1NG1A 2VDKB 5AK3A 1MG5A 2WYWA 4MVJD 3I9NA 3GRAA 4DYVA 1S1CA 4M7RA 3ETDA 1G7CA 4N8DA 4KVGA 2X0IA 3DWIA 5CYGA 4PGGA 1NNI1 1AE1A 3CNQS 4HX2A 4LNHA 4YRLA 1DWPA 4BGUA 5IFLA 2ZUDA 1O94C 3I61A 4A3SA 1U6KA 2NSYA 4YP5A 3VNBA 4F3TA 2XITA 3VC7A 5JJCA 3AYZB 2NZYA 5AM4A 4F96A 4ZEXA 3I01M 3AVVA 2ZXFA 3T95A 421PA 2IPLA 3ABRB 1QV7A 4KX5A 4DNOA 3FCEA 3C3EA 1QZ3A 2JIMA 1UC5B 4JITA 3QTTA 3GA0A 4H7EA 2ZRJA 1UJ4A 2CD9A 4DMLA 1MV5A 2ZJ1A 3DE5X 2WD7A 4XSGA 4BCCA 3D9QX 3PVSA 2XDAA 4PLFA 4BYMA 4OTZA 4QNRA 4ZD6A 1U8UA 3GPIA 1HRDA 2ODAA 3AR4A 2AZDA 4YUAA 3ZV5A 4XPIA 3SKXA 1RWVA 1T3SA 4NU6A 4FPXA 3D4OA 2QBYA 3L0YA 4CKWA 1FSPA 4J0CA 4J94A 2YOGA 4AY3A 1MLDA 2RDMA 1SQSA 3MJTA 3W6OA 1X8JA 2CY0A 1H2EA 1RRPA 4I6JA 4PSCA 1H6BA 3G0IA 3USZA 1WXGA 3GFVA 2F3RA 1OAOC 2YBEA 4PIMA 5ALFA 5JANA 2JKZA 1SH7A 3AM1A 4DNPA 3D3WA 2QN9A 3M83A 2HIAA 3KZMA 4ZT5A 1WTCA 4YR7A 2VSYA 1S8OA 4G0PA 4WESA 3B6ZA 5ALPA 3TRJA 1KR5A 2I2BA 1A77A 2VL7A 5DKFA 3VKGA 3FYUA 3EG9A 2WSLA 5AVJA 2ZVDA 1R15A 4B33A 1N5LA 2I2XB 2QRQA 4AZWA 3O4FA 3U09A 3D59A 2QRZA 3KXKA 2E82A 3RGWS 2FN4A 4ZAXA 3IPLA 3NWBA 3L5KA 3QA3E 2QLJA 2WQZA 3RHTA 4RLHA 2GEVA 3TW8B 3KQOA 2BISA 3WWZA 4GKJB 1ZI9A 1IUNA 1P2GA 2VEDA 3AV3A 3ET5A 5K0TA 4A6PA 3WLLA 2QN7A 3CHYA 3VO8A 1AZLA 3BD8A 3FY4A 3O8QA 3L77A 1LI4A 1R8XA 4LHVA 4K6CA 2RBGA 2C7BA 3A3KA 5J2UB 4F9GA 1E6UA 3PNMA 4E32A 2A6PA 1J5EB 2GLUA 4YFVA 4YWJA 2KBFA 2R7KA 4LOHA 1CQWA 1XLUA 2HSZA 1AIPA 2NZXA 2XAAA 3M6MD 4J7UA 3RSHA 3U81A 1GY8A 1YFJA 4LF4B 3QV2A 2DERA 3Q6MA 4U7JA 3JVIA 4BAGA 4RZSA 4IS2A 4EB6A 3FWZA 2ZLBA 5A5EA 4F71A 4JLPA 5AFSA 4YAWA 1SD5A 3PUKA 1H05A 2X4IA 2Q5HA 2XCIA 3K6KA 5TGTA 3G2MA 2LKCA 3S99A 3TPFA 1RP1A 4XDZA 5CDTA 2G6TA 3OO0A 3EASA 2F9LA 2BGUA 2P2LA 1XWIA 3PJEA 3F8WA 3QFFA 4Q6WA 3EB9A 4AS3A 4LW8A 1H2YA 2ID7A 2PIDA 4NZNA 3CLSC 1PQ4A 3IUYA 3LO5A 3K0HA 2ORWA 2XB8A 2DH6A 2NM0A 4I81A 4WXMA 2QENA 1Z8NA 1FU8A 5FBQB 4CTMA 3NDJA 1Q1AA 3FZEA 4ZDIA 3K30A 4ZK2A 5FH9A 1C4XA 3KOUA 4M1OA 3U2QA 3PF9A 5E95A 3BSYA 3JRNA 3WDMA 4B2LA 4ZAFA 1NRIA 4PRYA 3OE7A 3TJZA 1RPAA 4H31A 3R7SA 2VA9A 1JKMA 2Q28A 1JIQA 1D2CA 3SEZA 1U0JA 2TMKA 2I91A 4RGBA 1WXFA 2PZFA 4D3DA 1R3DA 1OX5A 2PJDA 4RW0A 3CLHA 5A4MS 4MVJF 3GJ0A 4C2AA 3DD1A 5HW0A 3MWDA 1E2DA 3WLFA 5LQNA 3BWBA 1VSTA 1WQ1R 3BIOA 3QVLA 4EKGA 2G9ZA 2JVKA 5EIBC 4LNUA 3NASA 2R96A 3OPYI 4ZN6A 4P3PA 2FZ5A 2HFJA 3I4LA 5GY7A 4ZCRA 4DCJA 4TMXA 1GR1A 3M1YA 2HQBA 3QOFA 3LBHA 4FZRA 1H1TA 5FQNA 2JAXA 5JWHA 1E1CB 1U94A 1X38A 2IXTA 4RD3A 1GYRA 4CIAA 4RTMA 4BV8A 3NT5A 5AHXA 2XUGA 1IUKA 2JASA 3NLLA 2V7VA 4C04A 4XLTA 1JA1A 5A5FA 1WXDA 3K92A 4F2HA 1SXJC 4XWYA 5EP4A 5H1YA 3TNJA 2XY4A 1A8UA 3ESYA 3ZZUA 3K0FB 2A4MA 1XP8A 1VKJA 1TT5A 3TEJA 1R8JA 4HSGA 5HQ3A 3G2QA 1DFGA 3UT5B 4UEWA 2VT3A 3VNRA 4EY5A 3T3NA 1GV1A 2FQYA 4KXLA 4WZBB 3URMA 3K94A 3UMMA 3LV8A 2I3AA 1AX9A 1RRFA 3BRWD 3I92A 3VNQA 3W3ZB 5C32A 5H59A 2CYAA 5JFGA 2AHOA 4BYGA 3DW3X 4QUGA 3V4ZA 1DEOA 4E5PA 3ICWA 4F06A 5ENZA 2RD2A 2NV0A 2AA3A 1W6UA 2V9PA 4DIBA 3A0RB 3ZK8A 4JELA 1MAAA 1A9TA 2FGKA 3HL0A 4JB2A 4O2AB 4XX0B 1AKVA 1Q1NA 1WCXA 3NHZA 3UVEA 2W2OA 3WO1A 1YRWA 2X6RA 4JEHA 2ZSJA 5CBPB 3QVWA 2NV2B 4M0MA 5F7ZA 4PAQA 2CHEA 4GI7A 3X0DA 4F60A 2GT1A 1EFCA 1FUUA 2BRUC 4J9VA 4QBGB 3NXKA 1WG8A 2W6ID 4KKXB 1HO3A 5D3QA 1HY3A 4M9RA 4M37A 1A0OA 3IP1A 5IABA 4L07A 3TIGA 5AIBA 3K0CA 1P2DA 2B4QA 4DV5B 2VAXA 4BLQA 5JJLA 2ES4A 2GYWA 1SOMA 5JRJA 4ZTBA 5F98A 2YYYA 3ZBPA 3AVUA 1LZLA 3T0FA 1V25A 1JE1A 4M89A 3TCKA 1UC9A 4ND1A 4Q1DA 5E9WA 4BN0A 1HMPA 2IW3A 4MLDA 3B5JA 3G13A 3MJRA 1A69A 3KTOA 2E9SA 1ZMTA 2QMZA 5CMLA 4MVJH 4X1KA 4DLUA 5TF0A 4ZVVA 1JIUA 3TW8A 3A3OA 1XMPA 4C01A 4KUEA 1T36A 5JAHA 3PQEA 4B4OA 3MILA 3RTEA 5MFPA 5AW9A 2O3TA 1GPNA 3D6NB 1KTVA 2ZIEA 3CLSD 1F6DA 4YV7A 3O73A 2OORC 1XMXA 2W4QA 1GUDA 2XQGA 1TCUA 3B1JA 4HJXA 3DFIA 4LCEA 3S6JA 5I8ZA 2O48X 1U04A 2EZ9A 3QE3A 1SU4A 3KAJA 4FUTA 3BK2A 4K9NA 5LYJA 3VZRA 4FWTA 2E48A 3WOHA 2ZR7A 1XVAA 3ISVA 2V0CA 4OFBA 1GD1O 3EVZA 3EIQA 1G3RA 1T10A 5CDHA 1BWPA 2ZQ5A 2PMEA 4JEUA 1K4YA 4KBYA 2AE1A 3WYEA 2AN5A 1JH9A 4G36A 5KMGA 4ASUA 4ETMA 3SJBA 1DQPA 3BMXA 1TF5A 5M34A 2NLOA 9MHTA 1JJ7A 3ZOZA 5AW6A 1AKWA 2PPLA 1WKBA 2BD0A 5FWYA 1VA5A 3AOEC 5KBYA 4MIKA 3GWZA 4BFLA 4Z7QB 1HE5A 5A6SB 1AV7A 5HRAA 3NTOA 5DI9A 5TJHA 1Y6FA 5JAQA 3VNUA 1GZVA 1O77A 1WQ4A 2NUTB 2QTFA 1OFHA 4KCGA 4EWLA 1U63A 4M22A 4NDZA 1YVUA 1Z45A 4OP2A 1MRNA 1V9LA 1RRVA 1MT3A 2ONKA 2W2MA 1WXHA 1TZJA 2VP9A 3QKRB 4XR9A 1T2AA 4EHJA 3U49A 4K81B 2J3LA 4GBMA 1H8HD 3KKKA 1VJGA 3T4PA 4D46A 1EJ0A 1GPKA 4IV8A 1YDHA 3VJLA 1KTIA 4KBFA 3QI7A 1L7QA 3O3MB 2ZB2A 3S2FA 1G7RA 3AEKA 3P9YA 3RU3A 3ZU2A 4M1EA 2A5YB 1E59A 4PTYA 1ZICA 1H2XA 1Z35A 4XSVA 4M0DA 3SR3A 4CQMA 2MSKA 1I13A 4YUZA 4G1BA 5EZYB 1II0A 4JB8A 2W48A 2CUNA 1GWNA 1JH8A 3TW4A 3KLBA 3G0DA 3KR0A 4K5QA 1R74A 4C3UA 3JPWA 2M98A 4RK7A 4TS4A 1RAAA 3HI6A 2Z0MA 2YHBA 1AQ6A 1R16A 1YZLA 4JJKA 1DKUA 4TUYB 4E2ZA 4ZICA 4I14A 2IYRA 2BONA 2GX6A 1R64A 3WLMA 4KQMA 5JAMA 1X39A 4ZDJA 4NZMA 4IIVA 2GO7A 2NXCA 2XSZD 4OH1A 5LDDC 2HSGA 3R7DA 1QGDA 1XCJA 3C5WP 3G2OA 4HQFA 5K03A 1HQYE 1VCOA 2FDCA 3FDXA 1VHTA 1JN0A 2NU9A 3ZI7A 3UAVA 4IDBA 3UKDA 3R5XA 1NI4A 4EHLA 4KWCA 3ABIA 4D6YA 1T0BA 3Q0EA 2VHZA 3PPWA 3UV3A 1A9YA 4N47A 1P1BA 4MDEA 3CLRD 1NUAA 3E70C 4YREA 1NNUA 2X0EA 3VAAA 2WQ6A 3PIRA 4DUYB 2XNHA 2NSHA 4FZ3A 1KOLA 5JH7A 5MHTA 4QGGA 1XVLA 5B58T 1OXTA 4J7AA 4PAGA 4PIVA 1PD1A 4ZT7A 1GZDA 2XTAA 2MYTA 3ZC3A 5B57C 3FTNA 1PDVA 1C3VA 4I3FA 4K05A 4KV7A 1KMNA 5BSUA 4EJ6A 5J43A 1EBBA 1KU6A 1W5FA 4QWMA 4D8UA 1EM8A 2R5FA 3NX4A 3PLNA 2BFWA 4BNDA 3KQHA 1P1KA 1E94E 2AEMA 2IPMA 5AVSA 3DAPA 3FN4A 5A2GA 1O7JA 2OK7A 2IXDA 1KYXA 3G2IA 4HB0A 1DIHA 2C7VA 4LEIA 4M7WA 4GXTA 5JSZA 4R41A 4RCVA 3WIOA 2OT3B 4DSUA 3K0SA 3Q9UA 3GJ6A 4QT0A 4GZ3A 4RHTA 3H2SA 1NKVA 3IT1A 2B8TA 2LP4Y 4UM7A 2MCFA 3T5DA 3L40A 1AQUA 3PNSA 1W9MA 4KYVA 4ZAZA 3WMRA 2ZU0C 3AHIA 4BQFA 3HSSA 2H4XA 3TVYA 2F7SA 3CIOA 2OBMA 2ZYAA 4MUFA 4F9EA 1MCZA 1I3OA 1DJMA 1RXCA 3VRHA 1DI0A 3OZRA 3K31A 4Y18A 2VDWA 4P4TA 3VO2A 3LOPA 5L7YA 5KKCA 1UADA 3OBIA 4DRZA 3ZDXB 1TYDE 4DY4A 2RB4A 3E1GA 4Y2YA 3S5UA 1RM4A 4FZJA 1IPEA 2P3SA 4QELA 4QYSA 5ES3A 4DBVO 4UUQA 1UBUS 4KI7A 2C5EA 3NPAA 4YIKA 3T3HA 4CF6A 3SFVA 4RESA 2HDNB 3NATA 1W30A 2BFBB 4OEHA 1DTWA 2R00A 5TQ0B 3AFHA 2FKNA 3UCEA 1P62B 1ESNA 4AK9A 5I9TA 1E5VA 2JGJA 3OHPA 1KU0A 5HTKA 1NMSA 1LF0A 5L51A 3WA6A 3WICA 1ISSA 3HCRA 4XJXA 4BMNA 4DIUA 1MA3A 1PNQA 4P7BA 3DE4X 2ZIZA 1QVVA 5M04A 4YJ2F 1NJ1A 1JW9B 4UEKA 3SICE 1CQXA 1MZPA 3USES 2OQVA 3OY2A 4A15A 1ZN8A 3FNGA 3BK1A 3PEVA 4J49A 3PPXA 3FGZA 4RPCA 4TVOA 4U6SA 2WZDA 4JZYA 1UXOA 1XTKA 2PBZA 2GDZA 5AKHA 4XWOA 3CVXA 2OBFA 3M6VA 2P6UA 2ZBGA 5JV5A 3NDRA 1PGPA 4G56A 3FLBA 5LOVF 1A04A 3SQXA 5PGMA 5ALDA 1N6PA 2PQMA 3EFHA 2FPGB 3AXTA 3SBXA 5C53B 2VYNA 1LSJA 3O2SB 2OV2A 2B4RO 3EHEA 2BZ1A 2ZRIA 1ZGGA 4FBMA 1XO1A 2IYVA 4I5IA 1JSZA 2IHYA 2JF0A 2X1MA 4EYGA 3GH3A 2CXPA 5EJ8A 4OSOA 4KR2A 2ZRCA 4NR0A 3RYFB 4QM6A 2VZ8A 4URHA 1NPYA 2F1RA 2QLBA 3E8XA 2ZGVA 4PVDA 2PWAA 4GXRA 4HDCA 4W63A 3DMRA 3OTHA 5L95A 2HPVA 1ECFA 4C14A 3PD7A 4DV4B 3JQAB 4G41A 1WU7A 5F7OA 1GGEA 3I42A 2YUIA 3ZCSA 4HQ6A 1R9NA 4R9UC 1UOQA 4MYDA 4MUYA 2FJPA 4WCFC 4EM6A 3A6LA 4B4WA 4LHXA 4G0XA 2FMIA 4DVGA 3DYBA 1H23A 3TOXA 5BV0A 2P7HA 2ZPTX 3RVKA 2MJLA 3DMTA 4HEQA 5EMMA 4XRRA 1SIBE 3QF4A 1L1FA 3E27A 3U4AA 5JNRA 1JKXA 4FW9A 3ELYA 4G5XA 2WUGA 2ERXA 1N6RA 4IFBA 1R0WA 5EI5A 3SM9A 1GFZA 1Z4LA 2I4TA 4GZ6A 1QQBA 3WLHA 2XDYA 3ZD7A 1KVRA 5CB0A 1CLEA 3LYLA 4CFSA 1E5DA 2ZRHA 4E2WA 3AB3A 1KZ4A 4D80A 4LJAA 2Q46A 1XL1A 2MR6A 3F6EX 2AOVA 2M9MA 3AW8A 3NAZA 3TAUA 5B7PA 4X7PA 4EUHA 4Z4QA 1NMQA 3D1JA 2OFXA 2P2NA 1BRMA 2VSFA 1UOPA 3CEMA 5KYNA 3MF4A 4HX9A 2VH1A 1Q91A 2CB9A 1D04A 3RASA 3E1KA 3PIDA 2IY8A 1OB5A 3OZGA 4I8IA 3MWYW 5FADA 2HQSA 4QEKA 3IBSA 2W6ZA 4BUJA 1KZ6A 2G9QA 4I1VA 5F21A 4C4OA 5CYFA 4MVJI 5ITZB 2WHPA 1WHSB 3JQ9C 3U17A 1QNLA 3L6BA 3RVPA 1DEKA 2ANBA 3DDUA 4UVIA 5KYWA 2BGGA 2DPHA 3DF7A 2XXAB 2V9CA 1JZSA 1TK9A 3TH5A 3HUDA 5C35A 1FNCA 2PLFA 2IS4A 4DMUB 1QC5A 5AW1A 4OFWA 2R6AA 2ZEJA 2GARA 3IFSA 2R6FA 3U3XA 4LXUA 3VHRA 4K86A 4PS0A 4OV6B 4DIOA 2OFFA 4E11A 5AQ1A 5HZKA 3RBVA 4CT0A 1NZDA 1SBHA 5EMNA 1G291 3FMFA 1YV9A 2GJ8A 3OJ0A 4F38A 3BSSA 1BMTA 2WFAA 4PN3A 3DAHA 3T7KA 4JEMA 1JB1A 2IYZA 4D4HA 1MXFA 2QVXX 3JTMA 4MPRA 3ZEAA 3L49A 4P83A 3T34A 4P58A 3WSVA 4DWVA 8LDHA 4XRGA 1OCEA 1RWPA 5P8WA 1RHKA 5KQMA 3D2CA 3K6SB 4RFSB 5JTTA 2BHRA 2Y0PA 4Z1MA 4D41A 5TT1A 2B7CA 3IMCA 1NI4B 2IRWA 2FZWA 1LVUA 2IQ5A 5EIXA 2BI7A 4L8GA 1G8JA 1HYBA 1Z6AA 2GFQA 2EYQA 3BXXA 4MX8A 5KQRA 3C5HA 4RK4A 5JQGF 3O95A 4XDHA 3GVXA 2O8CA 4BUCA 1O9BA 4BB5A 1A1SA 1OBHA 2BJWA 3R6DA 4I50A 3BWMA 2VWHA 1CR4A 3DAYA 1ZOSA 3O9MA 3O93A 1GGFA 3PC8A 5GWXA 1Q0QA 2IE0A 3GRKA 4JI1B 1WMEA 4DNFA 2HQOA 1XPJA 2B69A 2G70A 1P5RA 1UFRA 4YCAA 1DCTA 3VMMA 1MJFA 3Q3VA 2RAPA 1NLYA 1MJNA 4KRGA 3RB8A 3R3ZA 1MHTA 1WRBA 2Q0QA 2JFFA 2XRZA 1Z6TA 3LMKA 4UMVA 3WKCA 4AO7A 5GZ1A 2H1LA 4HV4A 5LZ9A 3W2IA 3KUDA 3PA6A 4J4BA 1XPRA 1O3YA 1DPGA 2B82A 1QO0D 1NOJA 2G07A 3VU9A 5LC1A 2ZROA 1WU8A 2WTEA 2D1TA 3CB2A 1GV0A 4H0FA 1CS0B 1ZCJA 3PX2A 1Z3CA 3J81A 2CFIA 4LNUB 5DCYA 2YY6A 3MCTA 5JWOA 5TR9A 3B52X 1T8UA 4G01B 5KX5F 1PL7A 2A8YA 5CEEA 4F5YA 1Z7WA 2NYVA 4BLRA 1C0KA 4F8YA 3NJRA 4O2AA 1I4WA 1ZHFA 1BAPA 2FGJA 3KSMA 2V7EA 3ONVA 4LTDA 4XX0A 4RV4A 5AOVA 5HCIA 2I6FA 2PUCA 1BDMA 3K1YA 3U4CA 2JHAA 3I0MA 3IXMA 4BJ3A 4EPYA 1S9DA 2OORA 4LFAB 3IVXA 3I34X 2HO4A 4NK4A 2LWIA 2P9GA 2BI4A 3LX4A 4LJLA 5DJ5A 2G6BA 1YL5A 3A2LA 3UY4A 1L0BA 3LUJA 3QK7A 2MSCB 4F1KA 3TQRA 2K5UA 2XNJA 5JADA 3U56A 3PFWO 4E08A 3HS3A 2ZI3A 4IQ0A 4X64B 3E5NA 5AW3A 1QPGA 3M0EA 1SU8A 1R6UA 2ZSKA 4JLSA 4HDSA 1QGOA 1W0KD 1EVJA 2B8JA 2QTMA 4P5DA 5L6LB 1PEKE 4JL5A 1TMKA 3Q40A 1PUXA 1ADBA 4YUVA 4DUZB 5A9SB 1Y3DE 3PE3A 2X5XA 4RA9A 3CKLA 3Q11A 3RTBA 3TOCA 1IN8A 2WRZA 4CE6A 1LXCA 5I7AA 5B3LA 1P1JA 1Z2OX 2QLFA 2ZB3A 3MYYA 1E5LA 8OHMA 4Q7EA 5J4LA 2JKVA 5KJCA 4IZOA 4FYKA 2XV1A 1AUPA 1GUZA 3EUWA 1EVZA 3H84A 3L0PA 3W5CA 4QXQA 4YCBA 1LB1B 1QH0A 1RWQA 3BXZA 4BLPA 4WLNA 3EODA 4OAPA 3ZKWB 3PQ7A 2NQ2C 4HEHA 3UJDA 1GYPA 4FU0A 3O82A 4DUPA 5CD1A 2ZWMA 1B43A 1UBLS 4LXGA 2HPZA 3PLAE 1U4SA 1E1RD 3CRQA 4MUGA 1ZVJA 2GYYA 4U0JA 1NA5A 3TX6A 2DLNA 3IRVA 4ROSA 1KNQA 3UMYA 1RRCA 1JFTA 4D97A 1U2RA 1L5YA 4U8GA 3INYA 1Y5MA 3F2VA 4C3VA 4OHFA 1HKUA 3A31A 2R84A 4ECAA 1L5NA 2GKSA 2R86A 3V7NA 1H0KA 5BN4B 1SC9A 3QEMB 1I7SB 1G42A 4KLCA 3EIOA 5CAEB 2J3IA 4N3NA 5GJVC 3FFWA 3KB2A 5K0SA 4TYQA 1TTTA 3CRZA 1ZHHA 8AT1A 3IULA 2RKBA 3K9HA 4Y9DA 3NRCA 5JXGA 1NJ5A 5BW6B 2YVAA 3ZKAA 2Q1XA 3UT6A 3QWBA 5GTDA 1ONPA 1TA9A 5TB5A 4N7MA 2P78A 3OD5A 2H52A 1AB6A 3PGMA 4LWOA 3V00A 4JXZA 3FMGA 2A9KA 1NULA 4LYGA 2JNWA 3L9XA 2BBOA 1HETA 2NU8A 5GM1A 5BWLA 5A0VA 4RFSA 5H5JA 3T3GA 3TIXB 3W3AA 1JAZA 4NMMA 4RJ2A 3TUIC 1OXVA 4M7PA 4MW9A 2WP0A 2GYVA 4US1R 6LDHA 2ID4A 3HLYA 4N1AA 1B73A 3BS4A 3DLAA 1LDYA 4MHOA 1JKJA 3HUTA 4PYKA 1KWGA 3CX8A 3C1AA 4J1TC 4AN1A 1WMSA 2NSLA 2QD1A 2V74B 1U1FA 2M1XA 1HDIA 4QFBA 3ROQA 1C3XA 3L0IB 2XBMA 1GTSA 2QGNA 3D6FA 3O9VA 2DE0X 2G83A 2JVIA 2P4HX 2ZCVA 5D00A 1PO7A 1CS4C 1C1DA 1UBCA 3GD5A 4IDQA 2F8TA 3DWFA 4EHDA 1AXGA 4YRNA 1Q5PA 3KWFA 3TECE 5I51A 2DHEA 1JALA 3JQRA 1FVXA 2CSUA 3BL6A 4R1OA 2FA9A 1UJ2A 2FG5A 1CNMA 2ZG6A 3CSDA 3RROA 2O8DA 3UAXA 3BB3A 1Y9EA 3LBIA 3FDFA 4BEVA 3KO8A 1C9NA 4NESA 2ZB4A 5I7HA 3ZDEA 4HDAA 4ENTA 1EUCA 2J30A 4YUYA 1T9GS 5JD6A 2XTNA 1SOWA 2O2YA 4GI5A 3WL5A 3Q3EA 1SHLA 4BNKA 3AF3A 2ZSAA 1V4VA 2FX2A 2F8SA 2FVXA 3ANLA 4ENQA 4IDCA 4HNTA 1Y3HA 1JAHA 4LZPA 1DARA 5IZCA 4P4SB 2H0RA 2V97A 5G4KA 3RRZA 3R0VA 2DFTA 1KZ7B 1HDOA 2VCYA 2WOJA 3P7MA 2GS9A 3KOYA 3NEYA 3PYLA 4YUWA 5TX7A 4MLZA 4OHMA 2C4KA 3R75A 3QWAA 3U7HB 1D8AA 3BGSA 4MS3B 1NWHA 2YVUA 1F6BA 1CVIA 2WFLB 4AB1A 1Y3IA 2Y71A 4XLLA 4C7KA 4CEHA 4O29A 1VJDA 2SBTA 4C7XA 2HA0A 1QE0A 4FDAA 1ECJA 1G2OA 1NVFA 4MWGA 3ZGLA 1OH7A 4MEBA 4O2RA 3CX4A 1KJ8A 5CFPA 3ZLBA 3JVEA 3NUZA 4J2HA 1B1CA 1GL6A 2RIPA 4JT4A 3HYCA 1IK6A 4A26A 3B13B 3FMOB 4WKCA 4R1TA 3MTGA 3FRHA 3FUVA 5F2EA 4IJ6A 2QM7A 5AI0A 2P9HA 4TV9F 3EULA 3R3SA 3SHOA 5KWSA 3WGLA 1RYYA 1JDVA 5TJ9A 1MDBA 1RI3A 2ZT7A 3AETB 4FMCF 5GOTA 2I2FA 3ZBTA 3RAJA 4EMSA 3GELA 3H2KA 2XAUA 3CE6A 1M2OA 1CZKA 1ZO8A 4YY3B 2YZGA 2H1HA 3C5EA 2J0UB 3DXFA 2AD1A 3R7AA 1T3HA 2Q3EA 2EQ5A 2DLDA 2WJ6A 4RK6A 4YJHA 1M10A 3CKYA 1ZGBA 5DHRA 2QIPA 5ER6A 1E1DA 4NL4H 3UOAB 4P9NA 4DM7A 1X7HA 4B8WA 4U39A 3WB2A 1OQAA 4PX5A 1ZSYA 2XVMA 3N2ZB 3WKBA 4PTLA 5BSMA 4JJZA 5DTQA 2GMWA 4WASA 3OOWA 1J23A 1ZSNA 1I32A 4DR4B 3A4LA 5IAJA 1KBQA 1U5AA 3KLOA 1BH6A 2DBYA 2I6UA 2OFOA 3B38A 3CJQA 4MDHA 5EIWA 2DHQA 2VDNB 2XIQA 5HUJA 3QSGA 2HBRA 3GUVA 1IYZA 3DKIA 1DG3A 4PWYA 1K63A 5F9MA 1NC1A 3TB6A 2OBBA 2Q07A 4AUEA 4AUMA 1OUMA 3CLTC 1U7ZA 1N75A 1OXKB 1Z0DA 2F3PA 1AKEA 2BCEA 3GJZA 1MEJA 3IDAA 3TKYA 3RVJA 3HUUA 1E60A 3MMZA 4DNQA 1OHHD 1J22A 3MERA 3R7WA 4DW8A 1RJ9B 2RH9B 5JNWA 3I5XA 4I6EA 4LJ6A 2SKEA 3VKFA 1FLVA 1VG1A 2B0CA 2P69A 3AH8A 4RVNA 5EKDA 4KQ2A 3OPQA 5GIOE 3H13A 4KO1S 4OUDB 3TDKA 3V34A 5AHOA 3KHTA 4ZYUA 1QFJA 2R25B 1CETA 4JROA 4CDGA 4DAOA 1MP0A 1NQ5A 1GA1A 1U0SY 1ZD1A 1QG6A 2XMDA 3IE0A 1FDUA 3MUFA 3P0JA 3ZH2A 4CLOB 3FD8A 2OHJA 3BHNA 5E2IA 4TVSA 4E88A 1PD0A 1O9HA 1JE0A 4P4UA 4F86A 3ZDBA 2IS2A 2JI9A 2WYUA 4FCVA 2FVYA 1UMDB 2ZSDA 2VN8A 3IP5A 3R3WA 4XD2A 5K3AA 4NBSA 3FSJX 5ABPA 3NYQA 3ELDA 2ZBVA 1YL6A 2OCBA 3PE6A 1A2BA 1IWPB 5F33A 3U26A 1QTRA 5HA5A 4H15A 1VPTA 3FSEA 3IODA 3IQDB 3PR1A 4JVSB 5B36A 2JGFA 1EWTA 2BZGA 4JYMA 4ESOA 4UE2A 3LCJA 5E8RA 4EGCB 1RMTA 2XMRA 4MS4B 4JLMA 4ZVUA 1EXMA 1WSDA 1VMAA 3P9XA 2PUFA 1V7CA 4KACA 4QYXA 3JQFC 5LOVA 2HIMA 1C2YA 2YRFA 1R0CA 2NADA 4R6WA 3MFQA 2E5FA 4CTOA 1OFUX 5JAPA 1G20B 3GDGA 3K3PA 3LY7A 2CDRA 3B51X 5E0KB 1XEXA 1C9DB 5T5QA 3W6UA 5DM60 3TO5A 3LKBA 3TSOA 2YUTA 4OJMX 4D8XA 1G3UA 4EMTA 4FFLA 3GLIA 2XZTA 3IDFA 1N8TA 4P32A 5DNAA 4O2BB 3WBBA 1YDWA 4Z9AA 2P62A 3AI2A 4NICA 4TXMA 5DYIA 2DUJA 3I1YA 2UYCA 1L1EA 1JEYA 4TS1A 5WRFA 2JH3A 2GFHA 1BE8A 1BKYA 2J07A 5EQFA 2VQFB 4QBFA 3MA0A 3TTSA 4KODA 3AERA 3JWPA 2A0YA 2QX8A 3CA8A 3GUUA 3PQDA 1TVKB 2OPBA 1KJQA 4QZVA 4S0XA 3EWNA 3D3KA 4NQZA 3G5MA 2CYCA 2FUCA 4HWRA 1LDBA 3KAPA 3KG2A 3P4XA 3T61A 2EFEB 1XHFA 1WZEA 5FI5A 1DINA 3ND5A 4OFZA 3ZNOA 3QE9Y 1CUVA 1TQ2A 2PX5A 2Q8NA 2X14A 2ZB7A 2RHMA 3AKCA 3FPAA 3FPFA 4JJAA 4QX6A 4N41A 3GRYA 5CH8A 1AHPA 2DWPA 1BW9B 2O5EA 1LRLA 4GF5A 4KXMA 4W5JA 2PA0A 3VKVA 2O5RA 3WRVA 4BQIA 3G9ZA 3S8YA 4AFNA 3ZGNA 1BWSA 2WSYB 3UWKA 3RRMA 3E58A 2VHUA 2A88A 4U63A 3TG8A 1MJHA 4NBTA 4GPZA 4J0IA 4AMUA 3T9DA 2REQA 3R3JA 1N0HA 1R0LA 1XGKA 3PKZA 4GQAA 1CNEA 2PK3A 2HK9A 2Q9UA 4AJNA 2B83A 2FE4A 1MABA 2H59A 1BN6A 5FUQA 5K99A 5B1EA 3I3OA 4QT4A 3T5BA 4HBGA 1FYWA 3RTCA 4B74A 4E6EA 4AMYA 4PZCA 5DP1A 4B6QA 5KHOC 4DRXB 1XNQB 2JJ2D 1ONBA 4DY6A 1YHNA 1ZW6A 2PLAA 5EYPA 2ACWA 4C4AA 1X7YA 2CHQA 1NVVQ 2N46A 3CPSA 3Q3HA 2O8EA 1R10A 2E89A 3CBQA 3E15A 3H87A 2RBEA 3PQ3A 1JEQB 1KI8A 2X9QA 3NHMA 4KFTA 4WL0A 3RS2A 3RYHB 1O0BA 2C94A 4BRWA 5C8ZA 4RHYA 4YMGA 2VJMA 2W70A 1IB6A 3FDIA 1VMDA 2NU7A 1D4ZA 4EI2A 5HIIA 2AQ8A 3H0KA 1QFSA 3QWIA 4MKZA 3C16C 5D3MB 1P3DA 2EKBA 2XPCA 2PZAA 3IHWA 2F1OA 2VJBA 5DNYB 4BNWA 2VTDA 2P2SA 2FLKA 4LRXA 4MYTA 5HTOA 2QRHA 5F51A 4RZXA 4ALNA 3E03A 1XCGB 5LZ5A 4D9KA 4AZ3A 4BNXA 2NTYC 2EBFX 2HM7A 3NTVA 1FP7A 4S2EA 3T94A 2WD7B 1C30B 3CQ9A 4BLTA 2A35A 3DE1X 3ZR4B 4NAUA 3RWOA 3ABSB 1WSBA 1H1LA 4Q1FA 1EHCA 2V6FA 2AF4C 3K0FA 4OREX 3OVMA 3UBMA 2IU4A 3DV0A 4MARA 4M6WA 4P93A 4TXJA 1TAQA 2ZTLA 4FC7A 4ZTZB 4IIXA 5HS4A 2RFLA 4FR0A 3WQQA 3WLNA 3LUKA 4V03A 5T57A 4BMPB 1RZRD 4UOQA 3MMNA 1I94B 1JHUA 4I55A 1V11B 3ONEA 4L5IA 3RVBA 2FR0A 2HHCA 1V16B 3R0JA 2PLRA 4PANA 3CZRA 4W99A 5COQA 5IN5A 5EKUA 1NKTA 3HCWA 4HYQA 1LVGA 2WVHA 5E9AA 4HH3C 1WUTA 4I2VA 3KUXA 5A03A 5C5DA 3KM0A 1EA7A 5AD1A 3BFJA 5CBPA 4TOIA 1ZPDA 3QG1A 4B76A 4R31A 3JQQA 4RD4A 1Z0KA 2CC2A 2YMQA 4QVGA 2G7ZA 2LCIA 3B9PA 3CNBA 3CUSA 2EU8A 2YQ5A 3ZCPA 1E79A 2N0SA 2R2GA 1WVIA 3CSUA 3EDOA 3RRJA 2XGJA 1EVIA 1Y98A 4PQRA 3C3PA 5IDVA 2P9CA 1E63A 2OGUA 4GQIA 1ANKA 1CVLA 3C3JA 3GC6A 1L9KA 4F3YA 4B3RB 1YR1A 4Z5XA 2IPOA 2FEXA 2XA2A 3L0ZA 4Y30A 3W5SA 1ZCZA 4WFIA 3ADKA 4YASA 5CYPA 2B4YA 1W5TA 3F46A 4GGPA 4HFRA 4BQPA 5A0TA 1IWBB 3CUVA 2JLRA 3M9XA 5B6JA 2YVKA 4QFDA 4WNAB 1J7KA 1QJ4A 1M72A 1G38A 1DX6A 4L3WA 4WZAB 4RADA 3E53A 2AOTB 3FWPA 3ID6C 3JVUA 3RYTC 5EIOA 4EB6B 1J06A 1OFVA 4GZ5A 5EJAA 2HLPA 4YH1A 2A1TS 1ZRHA 2FW7A 2YJTD 4LSGA 1V9SA 4FLMA 1ZWLA 3RLIA 1M6VA 3NHLA 1CR0A 2I8AA 3II6X 4IJUA 4DARA 5IASA 4M1ZA 2IYYA 4RLQA 1CY7A 3PKIA 4XB6B 3X43A 4DZTA 2ZUEA 4JCOA 2AHRA 2Y05A 4W6ZA 5CM8B 2IOYA 4WCFB 2ZSIA 4ZRMA 1RI5A 3DZGA 2PEYA 1NP3A 2ZFUA 1BIFA 4XI9A 3KEGA 4AVYA 3CNOA 2ZUUA 3BXOA 3IUPA 3QELB 3H9JA 4OHZA 4JR1A 1KKUA 4BBJA 4MW5A 2I2AA 1SD2A 5K3BA 3CEHA 4GOND 4UNQA 1DXHA 2ZSHA 3D7NA 4TKVB 3ZHXA 5TQJA 2HMYB 4Z1OA 5FPTA 3W05A 4HI0E 2Q6TA 2CZGA 1NZJA 4HZUA 4GSYA 4KXNA 2J0SA 1RCUA 5FR1A 3FTDA 4Q47A 2FWIA 3C39A 2W4IA 3AKDA 4RZ2A 5IM4A 2FWAA 3BTOA 5EL0A 1P9OA 4DGSA 4BLSA 1P7VA 2QE7D 4HQLA 1XDUA 1T29A 4P2GA 5T4FA 1GEEA 4GEKA 2ODPA 2X19A 3VX3A 1TE2A 3L7AA 1E2PA 3AMVA 2YV3A 2B98A 1KAGA 3CZPA 3T3IA 3AL3A 5KTRA 4L7VA 3OH8A 3DBLA 3BGIA 1EX7A 2O0KA 1AY0A 4IWYA 1QHXA 4M1SA 4MI6A 4D8VA 2O7VA 4Q4AB 3TUJC 4G5OA 1JHYA 3RS4A 1USWA 2CWDA 3F98A 3HR7A 2BGNA 2PR7A 4B4UA 5HQ3B 3J80A 3LNTA 1R27A 4YJ3B 1HYEA 2B92A 4TKUA 1N3LA 3C6XA 4X85A 5D86A 2RHRA 3NAGA 5IANA 1VJCA 3BJZA 4D8TA 1UWLA 1XD8A 3FWYA 2D1QA 3KPUA 3LC0A 4M0PA 5A6VA 1G8GA 2YQZA 2CJYA 2YH2A 1XRQA 5ALTA 3NJ4A 5KIAA 3KFXA 1E2JA 1AUOA 4OQNA 1ISHA 2WE7A 1EXNA 1ENZA 3DTVB 3HWX1 4YP0A 3OOSA 2NYAA 1U5BB 1RTTA 3WYGA 3OU7A 1KAEA 3LHSA 4U5XA 3N59A 1GZ7A 1R4MA 4WOKA 5B1YA 5IKOA 3I0NA 5HOEA 1HFWA 1G1AA 5LLTA 1X7GA 3QRWA 3NWPA 1SKYE 4YMLA 1ISMA 1DDIA 4HQ0A 5J3JA 1L7AA 4FN4A 3MWDB 4GOLD 4X84A 2BEKA 2ZYTX 3VPHA 4TN1A 2V0GA 1OXXK 2ZRBA 3BMOB 3CTPA 5GONA 5T64A 4I50F 4KXVA 2XGMA 2L17A 1S2LA 3E0XA 2MHCA 3KQSA 3MAAC 3MT9A 2BFPA 2FPIA 2OV3A 1BQEA 3ZXSA 3F5FA 1ZD4A 5HJ2A 5HK9A 4AZTA 1SKQA 2IW1A 3LRTA 5AVKA 1V5FA 4YRJA 2GKOA 3UFXB 2XX3A 4TVKA 2AS0A 3MTJA 4U7PB 3BRQA 4YQZA 5F4BA 2CUTA 2Q49A 3E18A 4B2YA 3IKTA 1QZZA 2DZDA 1RC0A 1WUYA 2G71A 3I58A 4EHAA 3OCZA 2WFLA 3WMWA 4OBWA 3EWIA 3PLRA 3SJUA 3X1KA 3IVGA 4PSVA 1YJAA 1YK0A 4IDNA 5CA0A 2PFGA 3HGQA 1VI6A 3GRVA 2XWJI 3I1FA 4JIMA 1PGNA 3P2IA 4TMWA 1A71A 4FGZA 4R2JA 4RCYA 1PHPA 4WZBA 1YRLA 2C5FA 1QMPA 3IVAA 3HJUA 4OJQA 2HT1A 4HDQB 1KDTA 2FFBA 1H1LB 2PG3A 3N5KA 2F67A 2G4CA 2JIZD 4LQ4A 3FPKA 2WIFA 3HA5A 1R3UA 2VFAA 2ZIXA 3HVRA 2XKBA 4H6XA 5ERXA 4UMEA 1P73A 3JRWA 1TFRA 2W6QA 3WL7A 1OI4A 2HRBA 2E2WA 4KGDA 1NSYA 2QUJA 3D7MA 3J7TA 5DHQA 4FYJA 1KAMA 3S2GA 3DBRB 1IZ9A 4X94A 1ZS9A 4QUHA 4RY0A 1C9YA 1FTWA 4GMFA 5K1ZA 3QKSA 4CRWB 3OT4A 1F8GA 4MB6A 2BFFA 2IHNA 1HC7A 5CCXA 1QCCA 4JQOA 4IO0A 3WG9A 3T7JA 3MCZA 3EZFA 4GE0A 5GVRA 4DB2A 3RFFA 5KYYB 1QRSA 5AI4A 2W43A 2F3TA 3KAKA 1NASA 4HCJA 2VR1A 4NBKA 4ZU6X 4RETA 5ALHA 3EDRA 2PTHA 1PG2A 1SBYA 4IOJA 4IJMA 2XMGA 1FDIA 1S6YA 4P1ZA 2EKZA 1OI2A 4WDQA 3IOYA 1EKXA 2EKPA 2F8MA 1JI0A 3VR5H 2CE2X 3DJFA 3W1EA 3KSAC 3NKVA 1LS6A 3KWLA 1I5OA 3NYWA 3FE2A 4PGMA 3JPYA 2K4MA 2QE6A 5LQAA 3EY4A 2BTQA 4RMNA 2VTBA 2ZYDA 1GPBA 1TYEB 3H83A 3SXPA 1O5IA 2OYCA 1VE9A 1N1EA 5JDCC 2Z4SA 5FTWA 4OK5A 3ASZA 3LQRA 5JNSA 1AG9A 3ESQA 4BP1A 1ZOOA 4UBKA 1LV7A 1RBZA 4DJDC 4E09A 3SF8A 4ZXPA 1SY7A 4A0RA 3LRXA 4YJKA 3ANMA 3S7TA 3C1TA 4BQRA 4CMGA 3KXPA 5LYJB 1JQEA 2C59A 5I3ZA 3HNPA 1X7XA 1D9XA 2VH5R 3RKSA 2C0QA 3DNPA 3A6EA 2YWCA 4OHWA 1NQTA 1IJBA 1USGA 4KX3A 2IEYA 1W88A 3ZJ5A 5JPDA 2X6QA 3LCVB 4K9DA 3HXMA 1TU3A 2I3DA 3FNBA 1R9GA 4DIEA 4KPEC 1L4NA 2YWDA 4GBJA 2PO7A 4O6VA 2Z5VA 1NFFA 4R2LA 3R76A 3N2GA 4UCWA 1A5TA 4LRUA 5G2OA 3IUSA 2WC1A 3RVNA 1KGDA 3C8UA 3OLQA 2YWJA 2GCIA 3EQ8A 3OZDA 4DA4A 2NVUA 5IDXA 3AY6A 4J7XA 2QUBA 3UB2A 3BD7A 5J2TA 2IIQA 3FYUC 4BEWA 4PS1A 4WXEA 5T6MA 3NTRA 4RDCA 3VR3D 4BBZA 3ZCXA 3RC8A 2AEFA 4HFMA 2BHLA 2FCRA 4FMDB 2XCRB 4EJ0A 3ZY5A 1JDJA 2Y6UA 5BWCA 4G0ZA 1JPNA 2GVZC 2P77A 2P9EA 3DEZA 1J97A 1L7EA 4IS3A 5AO9A 3RBZA 3ZZNA 1QAQA 3UAOA 2PKRA 3KBOA 4ZMRA 1KQGA 1CUYA 3AVWA 2B5VA 3AFMA 5ITWA 5KOJA 3AHJA 2GEUA 3UNXA 3RFTA 1FFXB 2RHJA 3SYRA 3W2TA 3QVGA 3B20A 1Q7GA 4DV6B 4WN3A 2HF2A 2SKDA 4JMLA 1Y8CA 1XD9A 4CVNA 5LA6B 3TQHA 1IHYA 4ID9A 1V1JA 1X74A 1IZ0A 3D6MA 4C4YA 2L0XA 1DVRA 1KI7A 1CDOA 1OVGA 3CVOA 4D26A 3ZWCA 3SC2B 3BDIA 3ZWPA 2PSSA 2H07A 3QUQA 3GFGA 4KSCA 1V7ZA 5TSDA 1PJRA 2HO5A 5DRTA 3MUEA 2PGXA 8GPBA 1FYEA 1NF8A 4WBXC 4IP0A 5CLHA 2QTVB 1BHSA 4AUKA 4C2BA 4UHEA 4DL9A 4K6MA 2DFNA 3BYZA 4RSHA 3TNLA 1L4EA 2UVPB 3OEEA 1U3TA 1EVQA 2GERA 2I8LA 1M2JA 1YQGA 4KR6A 3ZWNA 5CLLA 5DWQA 2Y4OA 4A8JC 2ZWPA 1JG4A 1F7VA 2EOAA 4UXHA 4RQUA 1OTYA 4IRMA 4NDAA 4Q3NA 1MX3A 4TZ0A 4UUOA 3L05A 3GLHB 4DLSA 3TG2A 1JEJA 1XTRA 1M1YB 4ZALA 4C0KA 3ZJUA 1YNOA 3NEPX 4QHTA 1KFCB 3BXEA 4DCPA 5BOSB 2HBYA 1JU9A 4P7GA 2H31A 4RGYA 4TRRA 4X00A 3B9BA 3ER9A 1CQJA 3BCRA 4OMCA 1DRVA 1RXYA 1BYUA 4NWIA 2R8EA 2ZVQX 4MUIA 4BP3A 5KQPA 3WR5A 1ORTA 4KE6A 3B5EA 3HLTA 3OTGA 5J4VA 3OJEA 1GG5A 4KAAA 1YIAA 4B3DA 1VE1A 4GKVA 4AKHA 4AP5A 2X5OA 1GPJA 1CZRA 5FBLB 2GBGA 3ZGYA 5IVDA 1MD9A 1NUHA 4DS3A 1R37A 4RA6A 4PR0A 4B6JA 5ICCA 4TKZA 2REQB 4NATA 3UGJA 3ZG6A 1JTEA 2DP4E 1D7OA 1K3UB 1NKSA 3CZCA 3H1TA 4AP9A 1JFVA 4D56A 5JSZB 1ULBA 1UPBA 2EV9A 5CVDA 3KXIA 1T5BA 2VDRB 2W4MA 4Q1BA 5TRTA 4IGKA 1CP2A 4NVRA 1WSWA 4XZ3A 1V45E 3O1LA 3SDSA 1F60A 2QORA 3RWBA 1N2BA 3MSCA 2JG3A 3WLJA 2AXQA 4HDNB 4URWR 3T7TA 1XRPA 5BSVA 2ATCA 1K27A 3IV9A 2IEAA 1NF2A 1N9ZA 2H9AA 4RTKA 1GKIA 3TWOA 3KPWA 4L2IB 2DX7A 3V9AA 1T24A 1B0AA 2I3ZA 3A9WA 2CKDA 2WJJA 2FZKA 4QICA 3TPZA 3DDNA 4EAQA 5T67A 3MB8A 2PH7A 4U2KA 2IZOA 3U6BA 5GJBA 1GTMA 2PQ6A 1DC8A 2EKLA 1Z5WA 4GVPA 1GGKA 4IEIA 4Y67A 2I4MA 3CLVA 3GLFA 1ENOA 1QUFA 1QH1B 2VKQA 3HP7A 4CLDA 4O3MA 1VI5A 5KUTA 1KI6A 2PZBA 3I2YX 2WWXA 5GM2A 1HG0A 2A7XA 1M2HA 4FUQA 4D9EA 1ZZEA 4E31A 3ICEA 3CRW1 4I5EA 4ZOLB 2JI7A 4P4GA 2QB5A 4BWGA 3V8EA 1KR2A 1NXTA 3BE4A 3K5IA 4RD6A 2JFUA 2Z1DA 4LJ7A 4PG4A 4DJAA 1TIBA 1DBVO 5L3QB 2QTRA 4P53A 1M6YA 2CMHA 3AI7A 5IC6A 3ROZA 1BE0A 2BFFB 2V7QD 2X86A 4HRXA 3PXGA 4YRIA 2IS1A 2XVZA 5ILQA 3BH6A 5C8XA 3P45A 4OGKA 5I5EA 3KQLA 3L7NA 4B3XA 5BMVA 5TT0A 2GPSA 3QGMA 3VR3A 4OG2A 5IS2A 4QNNA 1G5RA 3FKQA 2V6BA 3MLEA 4LYYA 2DTEA 3RGGA 2QJTA 1O2DA 5JE8A 3V8VA 1ONNA 1P45A 4HN2A 4QSMA 4ZQEA 3W5AA 4D4LA 4ECEA 5LP6F 3HFRA 1EP2B 1JQDA 2C2KA 2ZT5A 1OVMA 2ZWAA 4IM7A 4X60A 2OA0A 2XT9A 3UXMA 3UW1A 1BDHA 1GL3A 3EDYA 2ZR9A 3UENA 4D96A 3WMGA 4A4DA 1U28C 4D6XA 1XYGA 1XZIA 4JR0A 1QP7A 1X8LA 2ADOA 5DISB 2FLWA 2R6R1 3THWB 3FJ1A 3AR8A 4BNUA 2LZ0A 2RI1A 3PXDA 4LRSB 5KTSA 3PR2B 2Z1MA 4B6EA 3SVTA 1OAOA 2HRDA 5KX5B 1G2IA 3AIIA 4Y2SA 3SZLA 1JSCA 1PLLA 5G0UA 3V7YA 4GAEA 1XU4A 2X3UA 2E18A 3DDOA 1TZ2A 3LZ6A 1TVKA 3QLVC 4BL5A 3R6WA 1JFRA 3C4QA 3C8MA 1W8DA 1PDOA 3KZCA 3KEFA 3K09C 2PD3A 5CVJA 5EJFA 5IAGA 3SSMA 1XXLA 2WV7A 2HGZA 4I66A 1VLZA 3FDZA 4QGBA 5JPCA 4BX2A 2DF8A 5CDSA 1XP5A 1XU7A 1EFKA 2YOFA 1UBRS 4RZHA 2H1VA 3FXAA 4MP3A 4EJSC 4TRJA 1I2ZA 1T5SA 1VIYA 1HE4A 2Q5JA 1YQQA 3W7AA 4CYMA 5A06A 2P6RA 1E0AA 1FMFA 5C5IA 2BEJA 5I4KA 4ASUD 1N5RA 5CNJA 1ZISA 3UHAA 4UD2A 1GFWA 2FQWA 3RF7A 3EG5A 4RDIA 3DEIA 2JHGA 1T2DA 1JLMA 3OQBA 4FE4A 4Z9YA 2JEZA 1TMGE 3ACDA 3R7FA 1UKYA 3V1NA 4RL6A 2YN0A 4YAEA 3IEMA 1PJ8A 4LZLA 1ZFNA 3B6KA 4LXTA 2HIHA 1EAMA 3PD1A 3I5UA 2A92A 1CF4A 2FMXA 4HNVA 2EL9A 5I8PA 3SWWA 1UBKS 1XWFA 3R5SA 3CN7A 3HXQA 4YAGA 2FN8A 3PFGA 2HQRA 1D1PA 3DOUA 4RH0A 4TLBA 4ZVTA 4DQUA 4NV1A 3BFKA 3PEEA 1W5AA 4PZ9A 1SK9A 2XE8A 2BFCB 4QJ4A 1QC5B 3BTVA 1T26A 4ZEWA 1J2TA 3SZMA 3RS8A 3G68A 2GXUA 4BECA 2EKQA 3L8CA 3I83A 5CFLA 1GUFA 1OBCA 1U7TA 3H8SA 4AY5A 2WJWA 3DNFA 3QP9A 1XAJA 3SIXA 3FM9A 1NV9A 4HDRA 1YGPA 3VYUB 1CJUC 3ZCRA 1PFYA 3KDPA 1DSSG 1JT2A 1C80A 1VRVA 4JXKA 5D01A 5DH9A 3WTCA 4CM6A 3LD9A 3IUQA 4F4JA 1E96A 4EY7A 2NT3A 1APBA 1T0HB 2VXYA 2O8DB 3JSXA 4ZREA 2AX3A 3KOOA 4TWZA 3IAM1 3VNVA 5AK5A 2HHJA 1Y9AA 1WB9A 4XARA 3CLUC 4ZYZA 4QDTA 4GZMA 4N65A 3BX1A 1JFFA 2CHUA 1EUCB 3NBFA 2POCA 1M6EX 2YNMA 3HPRA 3T3MB 3BAFA 3EMKA 3QQ5A 1QDLB 1BVUA 2BFEA 2W8BB 1JEDA 4IDPA 2JFGA 5EMHA 2D00A 1O97D 2BMVA 2O23A 2P0EA 2RGDA 4LHSA 4W7SA 4GNKA 4EIWA 4C6TB 4ENWA 4CUZA 1VLHA 1TI7A 5GAJA 1N33B 1HQCA 1Y1PA 1M8FA 3IB3A 4OM7A 3RSLA 4C88A 4RVUA 4ZJUA 3TRIA 4HWSA 4WHMA 3TLGA 1KH1A 1AUXA 2WWHA 3PT9A 4BGIA 3HU1A 5JCJA 3QEJA 4B46A 3IQZA 1O4WA 4QULA 1JIIA 4EG3A 1EG7A 1LBHA 3TSCA 5JMPA 1M1ZA 2YVLA 2X3YA 4DMFA 4EGJA 4EVIA 5A4JA 3QPBA 4GVXA 3WE7A 2QUKA 1BXRB 1TQ6A 4Q9AA 1PJ4A 1WL8A 2TRSB 3B3GA 3NP9A 4INZA 5A3RA 3RVQA 1U6IA 2VSOA 1QVAA 2BF4A 4XOUA 4UTZA 4UPEA 1WUIS 1E8DA 4GOOD 1HSZA 3CWZA 3M6WA 3MTAA 4WOCA 3ZU4A 1ND5A 2OWDA 4OGFA 4BWFB 1QGAA 3R5FA 4L15A 3D6TB 3EXHB 1R0RE 3RS3A 3T9EA 3MG9A 1EUZA 1AHIA 1LPMA 2QT0A 1AGPA 3PC8C 4A27A 4C22A 4NXNB 1R4NA 3Q8WA 2OXIA 1YKSA 1D4OA 3AP1A 5CT6A 3JQ9A 2A86A 1L5RA 4P6VF 3IHKA 4M38A 5IW8A 2BMJA 3R7WB 2Y4NA 1T5HX 2QNBA 5IUNC 3ANTA 1L4GA 5JC8A 1ZKMA 3P9PA 2GNPA 5E3JA 2KLBA 2PA3A 5IK2A 2JCBA 3GEMA 5A4AA 1S2NA 2CNBA 2TMGA 4XUCA 2V96A 2QZPA 3QNWA 1NBIA 2JZNA 2YINC 4GR4A 4V2IA 2WIDA 1U80A 2HMTA 2O1XA 2QAIA 3FYDA 4UBMA 1P80A 4X7MA 5DSXA 1E9BA 4GBGA 3AB8A 4IKOA 2LXNA 3HRIA 1K66A 3LXUX 3SQWA 1GRNA 1UMCB 4QPJC 3AR2A 2X0JA 4QTUB 3ZQ4A 5GP1A 1D8TA 3A06A 4C0SA 4QG3A