3L3BA

Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from ehrlichia chaffeensis at 1.90a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
210
Chain Sequence
LNSAVILAGCGHMDGSEIREAVLVMLELDRHNVNFKCFAPNKNQKQVVDHKKKESVGEVRNILVESARIARGSVYDIEQIRVEEFDMLVIPGGYGVAKNFSNLFDEDNDYILPEFKNAVREFYNAKKPIGAVCISPAVVVALLKDIAKVKVTIGELIDKMGGVHVDCPTIKSVKDDVNRIFSCSAYMRNDSLYNVYLGIQDMISSMVNYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from Ehrlichia Chaffeensis at 1.90A resolution
rcsb
source organism Ehrlichia chaffeensis
molecule tags Biosynthetic protein
molecule keywords Es1 family protein
total genus 71
structure length 210
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l3bA00
4BTEA 1KXJA 1VCMA 1CS0B 2NV0A 3TTWA 3UGJA 4L8FA 1KWGA 4AULA 3MIIA 3B3AA 3N7TA 3SF8A 4QYXA 3CYFA 4ENUA 1T36B 3CNEA 1KA9H 4OJYA 4AUNA 4P36A 1C30B 1GGFA 1Q7RA 1QWSA 1GG9A 4B40A 1N57A 3KKLA 3PQ8A 2NV2B 4ENQA 4UOQA 3CZ9A 2R1VA 3B36A 1JVNA 4L7QA 4E5VA 3UJNA 1J42A 4GE0A 3TTYA 4ENPA 4Y1RB 3D54D 3NOQA 3P9QA 4LGYA 4Y1FA 1I7QB 4I2NA 2W7TA 3P9RA 3TTTA 3NOVA 1A9XB 1PV2A 3VU3A 1T3TA 4N0MA 5SYAA 3TQIA 3ER6A 3BWEA 5SY9A 5DFAA 2VXOA 2RK4A 3UK7A 1GGHA 3PQ7A 2R1VB 3F5DA 1QDLB 4L8WB 2ZUSA 4L78A 3M3PA 4B5KA 4PXYA 3PQ4A 3F71A 3R75A 1I7SB 1P80A 3EZGA 4Y1GA 2VKTA 3B38A 3EFEA 4OFWA 3R76A 1IZZA 1WL8A 2ISSD 4ZDIA 3PQ6A 4UCFA 3GRAA 3L7NA 3P9SA 1IZYA 1VCOA 3FSEA 3TTUA 2FEXA 2A9VA 1GGJA 4I4NA 4S0ZA 4B31A 1UCFA 4Y1EA 2R1UA 3SOZA 1L9XA 4ADSG 4D1YA 3CY6A 1OX6A 2XF2A 1OX5A 4Y1RA 5LIRA 2YWBA 4QYTA 4B7AA 1PE0A 1QVWA 2R1TB 2YWJA 4OGGA 3WFZA 4ENRA 1G2IA 1P7YA 4ZGGA 4AUMA 4MNTA 3EJ6A 4AJ9A 1OI4A 1GPMA 4UOZA 4N12A 3P9PA 4OIFA 3NOOA 1SOAA 2ZUVA 4UZSA 2D7JA 5JZMA 2YWDA 2GK3A 5E9AA 1CE8B 2VRNA 4OQ4A 2GHRA 1P81A 3NVAA 3PQ2A 4JQSA 5SY4A 3RHTA 1R9GA 4ENVA 4B2YA 4ZDJA 1SY7A 1PDVA 4WINA 4P35A 1GPWB 4RKWA 4GE3A 4Y0NA 3L4EA 3R74A 3ZJ4A 1PDWA 4LRUA 4MGHA 1BXRB 4XLLA 4ZDKA 3TTXA 4P2GA 2ZUTA 3L3BA 1FYEA 1OX4B 4ENWA 1GGEA 1QVVA 1QF7A 2RK3A 1GGKA 1JDBC 3EWNA 3NORA 3OT1A 4HCJA 4BFLA 4R7GA 3CZAA 3UMMA 3PQ3A 1VCNA 4L8YA 3ZJ5A 4ENSA 3OT1B 1Q2UA 1OX4A 1ONSA 1P5FA 1M6VB 5SY6A 3EN0A 3TTSA 4K2HA 2IUFA 4OGFA 4BIMA 4ENTA 1IPHA 2H2WA 1OY1A 3UOWA 2WJZB 1FY2A 2AD5A 1O1YA 2VDJA 1CF9A 2AB0A 2V4UA 3ZR4B 5K4AA 4P34A 1KWKA 2LXNA 5IP5A 3SF8B 3BHNA 3L18A 1C3OB 1K9VF 1KEEB 1QVZA 4L95C 1U9CA 2YWCA 4P5PA 4UNIA 4RKYA 2OR3A 4WXYB 3FIJA 4E08A 3PQ5A 5BV2P 2VPIA 1VHQA 2ABWA 4AUEA 2ZUUA 1T0BA 4MTCA 2RK6A 1I1QB 3NONA 4I46A 2ZUWA 2R1TA 3MGKA 3TTVA 4GUDA 5JZOA 1P7ZA 1S1MA
chains in the Genus database with same CATH superfamily
3B89A 1LPSA 1CS0B 4DT1A 1ZKMA 3S2YA 2R62A 1QP8A 3ZCPA 4NXNB 1Y7LA 2G5TA 5KNCD 3THWB 3F6CA 1HT0A 4YRNA 3GPLA 2YBEA 3GFTA 1PP4A 3KAJA 4ZO4A 3X1WA 4MDEA 1NX9A 3L9WA 4OHFA 2V65A 4BTVA 1T4GA 3BXPA 1JG6A 4CDRA 3D6FA 4OHKA 4P36A 4BKUA 1VPVA 4V38A 2XCLA 1MN6A 3AU9A 3TINA 2C9BA 4AY4A 1SVNA 1RQGA 3MOGA 4RYLA 2HRCA 2O52A 4PQYA 3NHSA 8ABPA 1XJ0A 1TKCA 1AHHA 2HCTA 1EQ2A 3CCFA 1F8FA 3OE5A 1QNFA 2OVBA 1LQ2A 2QTBA 2WU1A 3UGTA 4DF3A 1DEOA 2A3NA 2QVBA 2BAGA 2CHUA 4I1VA 1GP2A 3IJ5A 1YCDA 3SJZA 4MRMB 5I48A 4LTMA 1TZJA 2BISA 3KV1A 4E94A 5GJBA 5AKGA 5FBWB 1B23P 3CEPB 4FFLA 4DJDC 4KQ9A 4ND1A 1U8EA 3K96A 4BRSA 1HX7A 1L5VA 4MWZA 5TB5A 1J06A 3VZPA 5TQ2B 5J1TB 2VEOA 3B6EA 1IM8A 1XNGA 3ORSA 2XWBF 3OSUA 3WGTA 4F4CA 2FDRA 2OFFA 1IHYA 2A4MA 3GD5A 4ILEA 4LRWA 2EGGA 2B9EA 2PWBA 1AKRA 3I04A 4FN4A 4YPFA 3T9AA 4J0QA 3S70A 4E33A 4N47A 3EMBA 2VRCA 3BDAA 5YASA 3T54A 5C5EA 1EBBA 2Z3WA 4DC9A 1J49A 1NY5A 1VGQA 4JLVA 3HUDA 4AJLA 5FBLB 1VSUA 4QGFA 1H9BA 1T8RA 5JSKA 3I2HA 2XZDA 1IOVA 4LKRA 1YQWA 4MH0R 4XB1A 4F9FA 3BGVA 2FG7C 2HD4A 2QZSA 1NBEA 3U3ZA 2HT6A 2VCYA 5C18A 2AWOA 4J4BA 1RXVA 2A0UA 2J33A 1K7XB 1NKTA 3URKA 2C20A 2WHEA 4FUQA 4WCVA 3FDIA 1QIFA 5F9MA 5EWLA 1NMSA 5L4LA 2Q49A 1R6VA 1PFYA 4IIUA 1FP6A 4IVRA 4Q3BA 3ACBA 1K6JA 3GNLA 4JGBA 4OB6A 4K9NA 1VMIA 2O2EA 2UUPA 4PPQA 2A9KA 4ACAA 3VR2D 5HX7A 1GQQA 3OPNA 1ISJA 1GILA 1ZL2A 3SSAA 4B3CA 5K0FA 3T1TA 5J2TA 5K0GA 2YIDA 2FLVA 3BDVA 4UU0A 2JCVA 2WWXA 3X2SA 5FWYA 2CVHA 1SKMA 2F67A 4ER0A 1QVRA 1GQYA 3GBSA 2HJ9A 1TVKB 1U0TA 4LYJA 1MO4A 5BOSA 3L6UA 1Z28A 1H2AS 2R8XA 3ZWNA 3RODA 3VOSA 1Y42X 2HIGA 2OQIA 2A2ZA 3MUOA 3PPXA 4G8DA 3GARA 2GZRA 4X7RA 4TSFA 5FNVB 3SX2A 4BZZA 2G9VA 1AS2A 3DOEA 1NJ2A 1Z7YA 4MUFA 4QQNA 3NTLA 4NATA 2SKEA 1ZO8A 3KKQA 3ZQ4A 4F56A 5BR1A 4D97A 3W3ZB 3U1BA 4NDZA 3F0TA 1OGYA 3ILSA 1Z0FA 1FFCA 1QKJA 3BGDA 3OHMA 5AI6A 1PGOA 1UFRA 3CLSC 4LYYA 4MRVA 5IANA 1OZAA 1YRQA 4MI6A 5J43A 4YLYA 5DNCA 2PZFA 4IH4A 5JXJA 5EEGA 4RQAA 1UBEA 2FPLA 3S2SA 1V35A 4GF5A 4HUQA 5BQ3A 5A4FS 4WBXC 4ZCMA 3RCBA 4MTCA 3P4YA 2EJWA 2WZQA 3KSAC 4X3CA 1FTYA 2Y9MB 3USES 5JFTA 4PZEA 5FPQA 3BDIA 4QJ3A 2K2QB 4PPGA 5BR4A 1KNQA 3RF6A 3QUTA 2C78A 3NTRA 1D1TA 1ORTA 4NHOA 4PAQA 3CX4A 4KXYA 1JFRA 1PS0A 4HSGA 4JEMA 4YRJA 1Q50A 5TGZA 4PRZA 3CNNA 1X7XB 4DV5B 4M87A 4OFZA 3GL9A 3PDHA 4YB8A 3N07A 2KLBA 1UIMA 1Q77A 2BFDA 4Z4IA 1A8QA 5E1OA 4F9EA 3P2JA 2PX3A 1PZEA 3JSXA 4KTVE 4JJKA 3M8KA 4Z4QA 4TN5A 1NP7A 1EFHA 3EXHA 4GSYA 2C2YA 4MJXA 1ECLA 4TV8A 1OWOA 5EIBD 4F06A 5ADWA 3BCSA 1SKUA 5JAZA 1OLXB 1DINA 2OUKA 1ZBDA 3H2KA 3LVFO 4H27A 4XFKA 3K1TA 1FRQA 3ZU5A 4IY1A 1E4EA 3NYWA 4LGCA 4FILA 4UDXX 4A82A 2FV8A 5F77A 1JT9A 1Z38A 3PFBA 9LDBA 5F98A 2OZPA 1OTHA 5ALLA 4D4HA 1EJ6A 1YB6A 4LF4B 3PNMA 3RFTA 3LTEA 1R9MA 5JAIA 4I4CA 2VYCA 4OU5A 4DANA 5ICFA 3H75A 1V7QA 2Q0QA 2RJ3A 2VDLB 1FFGA 2X3FA 3OFKA 3S2UA 2VYNA 4GMFA 1PDOA 1Z45A 1QZ3A 2J6HA 2WFZA 3AI7A 4LY0A 4Q4HB 1AA9A 1RYDA 1O5TA 3N7UA 4WK0B 3QIAA 1L7BA 1OWNA 2Q9UA 2WVHA 3ZWXA 5C5DA 1PEYA 4MIYA 5BNWA 2XF2A 3U4QA 2AKEA 3LBAA 1XZFA 4AF6A 3C87A 1ZRMA 2NVUA 1YZQA 3U7QB 1ID1A 1J8VA 4ZPJA 4BV3A 1WB5A 2BGLA 2NV6A 4N40A 3BL5A 3PEVA 5IT5A 5HPYB 1WEHA 1SBQA 2I3DA 3MWYW 4PIMA 2VDOB 4M9SA 1VZ2A 1RFGE 1DFIA 5JSQA 4G0VA 4RFSB 3C7CB 1Z62A 2O2ZA 2IDMA 3LQ4A 4YJ2A 2OPBA 2CJWA 3TDMA 1GGMA 3B3FA 2TSYB 4XWYA 5G40A 1Z3CA 3M6IA 2NP7A 3O9VA 2GX6A 1G5HA 2F43B 1MC5A 5AHRA 1C3EA 3JR7A 4Z0NA 5F4BA 4DEYA 3MMPA 4DE5A 3C3CA 3ZIAA 1TD1A 1TMYA 4BMCA 2QHXA 3GVXA 4E14A 4HWKA 3BCHA 3CJTA 4HGZA 4EPTA 2OECA 4G1UC 4ZU1X 1WEKA 1WO8A 4WY2A 2J59A 3QMWA 3VC2A 1RQ7A 5JWRA 1O6BA 3C98A 4BFUA 1U7UA 4KX3A 3I09A 5GZ3A 5FNZA 1DBIA 1M76A 2REBA 5K3FA 1PFVA 2JH8A 1PSWA 3LP6A 2J87A 1SKYE 4KRYA 4DRZA 1PJQA 4Y30A 4Q03A 3ZR4B 2X2OA 4OX9Y 5HF9A 1J0EA 5DM70 2NTEA 1QU2A 1E1RD 1G2OA 2TRSB 3RG2A 4J0GA 1ZXLA 5CHYA 3ZCSA 2W48A 2EFHB 3DYIA 3LWBA 3SSOA 2X0KA 1KYWA 2XMQA 2BKVA 3ZWMA 3D0OA 3IQXA 4MGEA 4XQGA 4ZEWA 3GP8A 2VP5A 4I8XA 4LDZA 3OLVA 3HVJA 3G2PA 4E2ZA 3O8QA 3E7WA 2HUPA 3NHMA 3C0KA 1JA0A 4M86A 1SOUA 1G8KA 3MERA 4YMUA 5H82A 4LRSB 4YCLA 1NBIA 1B2LA 3H7IA 3UENA 4B6EA 1CRPA 3N7TA 2QRMA 2MYNA 3KOZA 3PTLA 1WU8A 4QYXA 1CWUA 3OBIA 5FT9A 2A9RA 2Z0MA 1Z4LA 1VKJA 5HE8A 4E7OA 4B3MB 2FSIA 1NNLA 1ESDA 1E5DA 3D2CA 4H18A 2GUWA 3VR5D 5IX8A 3SYTA 3RSQA 2OHJA 3LUPA 5EL0A 1DUVG 3FUTA 3I9NA 4DA8A 4GVLA 3S1AB 3GZJA 2F6RA 1QGUB 2ZBGA 4GGOA 1VB5A 4AS2A 5CFNA 3BZUA 1LS6A 2YV4A 3C45A 3AV0B 4YECA 2QJFA 4KQCA 2H1OA 2L19A 1XPUA 1SUPA 3JVIA 4JVOA 3EDRA 4C5BA 1NHWA 4OLAA 3OE7D 3GEMA 4QGAA 2VJAA 3OCZA 2ISQA 2O3RA 5EHIA 4E2FA 4EI8A 1Y33E 1GPAA 1Z08A 2WM8A 3JQCA 2E89A 3OTWA 4MO2A 5BNFA 4AT1A 1ZK2A 1TL7C 3A4IA 1IUPA 4BWFB 4PZCA 1GQRA 1NRWA 1XU7A 1KMHB 5BN5B 3EUWA 4EJMA 3UMVA 2Y92A 2O8FB 1POXA 1MX5A 4PQGA 1B3RA 1V5FA 5CDGA 3IAAA 4G5FA 3C3XA 2VP9A 3X1MA 2FLKA 1ZAKA 4BV9A 2HHAA 1HBJA 1ORRA 2OVFA 1SXJC 2XUHA 2W2KA 1E77A 4A36A 1XWFA 1WW3A 3NV7A 1P7PA 3N8HA 4MKHA 5LA6F 4DGQA 5JATA 3UHAA 2XRZA 2Y1EA 1RJGA 1H8HA 4F2PA 5IU6A 3PEEA 1EGQA 2GRUA 3B3GA 3JAKA 1JWBB 3NPAA 1JL3A 3UJ3X 4BXOB 4YCAA 3WLNA 2V9PA 3VHRA 4K9PA 3OLZA 1ISFA 3HFGA 4G67A 3RVSA 4KI0A 1DPFA 2P6MA 1YJAA 2VN8A 3I01M 1Q0RA 3A27A 2WSIA 4ZI7F 1FJGB 3K0HA 4ILKA 5EE9A 3OCUA 5HGJA 3R74A 3EY4A 1BEUB 4PTZA 1L3CA 1N2SA 2V5AA 1U7HA 2F3PA 2HF7A 3WLOA 1FIUA 4XUEA 4YBRA 1OPRA 2F8SA 3OQJA 3PT5A 1M8FA 1VKZA 1QG0A 4XWTA 5DNYB 2OORA 3OJFA 4UHCA 1E2BA 2HA5A 2B6NA 1R0ZA 3BJRA 3HNPA 3JYHA 1BC5A 2FUNB 2VH2A 3GRRA 3ESYA 3RU7A 5JNSA 2OXIA 3UKOA 3IUQA 5FOVA 3BS4A 4QNMA 1EKXA 5BT9A 4CIXA 3ZW9A 1X7HA 2BR3A 2GM5A 3N28A 5TSDA 4BX3A 4DNXA 3KWMA 3UOWA 5TMEA 3SG0A 3B1KA 4BX2A 1OLSA 1EWKA 2V59A 2RJNA 3RVPA 1GSHA 3HBJA 3BHMA 3GLFE 1V8OA 3VH2A 1J8QA 2W9XA 5IHPA 1DQZA 1KK2A 4G1BA 5ICCA 4ZZ1A 2B20A 4OKSA 3NTXA 2BMAA 1V8DA 2Z6UA 4ZMRA 3I52A 4CT5A 4FDLA 2QTGA 4OUDB 1PR1A 4YI5A 3FCCA 2WFLA 4CU2A 4NCHA 1ZIOA 5IDYA 4HDKB 3FY4A 3GP5A 5JI2E 2GETA 3EH2A 1SHKA 4OHUA 5I47A 1TEHA 3HJNA 5HM8A 2H92A 4M38A 2YH2A 2C1EA 2Z43A 5G0WA 1NBOA 1SRQA 4LA4A 3N3AC 2ZR8A 5EZ6B 4WOPA 5HFNA 1YZ3A 1XX6A 4NBUA 3Q8KA 4XIJA 3U62A 4YCSA 1E89A 2FUG6 1F2VA 1NVUQ 3FWNA 2BEVA 1IDOA 5BURA 3AZPA 1H2WA 3TCXB 3AP1A 4CL8A 5KSZA 1KDPA 3U13A 3ENWA 3C3JA 3PIRA 1U99A 5C5CA 5L3QB 5JG7A 2X4GA 3PYLA 2G70A 3HUUA 4UMEA 3DA8A 2C58A 2Y0PA 3AEXA 3ZWDA 1C81A 4YIKA 3CF4G 1J42A 1NONA 1XZMA 3T35A 4MS1A 4UBLA 2O8DA 2VWPA 1NT4A 1WMEA 4LOKA 4EAQA 2BRUC 1YKSA 1W76A 1ZNXA 3HNRA 4Q3KA 4U2FA 2ZU0C 3RBVA 1ZIPA 1XYVA 3ZDZB 4OBXA 1UP7A 3H2ZA 3UA4A 3WOHA 1CZOA 4BNNA 1K97A 3K31A 3R7NA 3TKYA 4PCLA 4BCDA 2C99A 3CW2A 4MI1A 4TMZA 4HGPA 4MEJA 4BU1A 2CDAA 1YZHA 1E2EA 1X8JA 1NVMB 3DSRA 1JH9A 3VH4A 4ZT5A 3M6WA 5GM2A 4ZO6A 4J16A 4AZTA 3FR7A 3G2OA 1Y0BA 1YUNA 5JOQA 4C6HA 2WU4A 2V9ZA 5DO9A 4Z3OA 4QQ8A 4V0KA 2VP0A 1GFWA 2FWRA 2VK8A 2HK6A 3S5UA 2CCGA 2W2QA 2X0IA 3OEHA 2FZ4A 2DH5A 2HJRA 1BQEA 3AF4A 2XD4A 2VNKA 1IN8A 4LWOA 1R6XA 2ZQZA 3LLCA 2OFPA 3I2IA 4GUAA 2AJ8A 1LSSA 1R37A 4JLWA 3GJZA 5DZSA 1BEEA 3IT0A 2ZK7A 2WIKA 2WVJA 2I7CA 2VCHA 1WCV1 3GJ0A 1DC5A 2O5RA 1KJQA 5HDBB 4L8GA 2CWDA 5K8JB 4XSVA 4N9WA 1QG2A 1KI1A 3H3FA 2IV2X 2ZYWX 1U7WA 1FNMA 4UTRA 1HOTA 1OAOA 4Y18A 1Q0ZA 3ESQA 3MWEB 5EVCA 1S2LA 3IUYA 4A8JA 4DMUB 1C9MA 1ZHOA 5JD3A 4U2EA 2PZKA 1F3LA 2DJIA 3BHJA 4L57A 4ZXFA 2BEKA 1BMTA 3MTGA 4CN8A 4L5IA 1VIAA 2FEMA 3GN2A 4WNAB 1AK2A 1G5IA 1CRLA 1U8AA 1K98A 5IDXA 1P4JA 4LMAA 4FLFA 3SE7A 5AMXA 4E2XA 4BFLA 4C4ZA 1YD7A 1Z47A 3TEJA 2BW0A 2FEKA 1J0DA 2C5HA 1W4CA 4OGWA 3U49A 2YY7A 1SGWA 2UVQA 3BD6A 1E1LA 2HQRA 5CA0A 1YR2A 4TV8B 3PUVA 5LZ7A 5JADA 4UUBA 1PBTA 4K9DA 1NZFA 4RHTA 5E9WA 3UAVA 2HJHA 2WTAA 4MS4A 5J2TB 2DPGA 3MRTA 2PMCA 3VFDA 3PGA1 1ZJJA 4GMHA 4QU8A 3FPSA 2PUFA 3BRWA 4WLOA 4B83A 4N54A 3WQHA 3HCFA 3ZV6A 2G28A 2RHLA 4NY1A 2NTNA 3A11A 4YCMA 1Y4DE 1D2HA 5BXYA 1E7YA 3MLAA 2GM4A 2Q4TA 2GN4A 2J6IA 2PTHA 4RMGA 2PX6A 1JKFA 2EJBA 4QDOA 2R1ZA 1P72A 3COWA 5CJJA 3V8PA 5BP7A 5I4KA 1DB3A 4F2DA 5LOVF 3B48A 2Y0DA 1WD7A 3TW8B 1NYTA 2P3LA 4KSBA 3NHLA 3RTAA 3DEZA 3D4NA 1NVWQ 1ZJ5A 3F6BX 1JAZA 1HDEA 1ODKA 2G8LA 2AI2A 1R4MA 1RBMA 1G42A 1Z2NX 1Z5PA 3G2IA 3KZ1E 1RLJA 2LCFA 2XKKA 1IMJA 1L4LA 1DE0A 1A4IA 4H35A 4IJKA 2Q5JA 4R3NA 1Y3HA 2QN2A 1DOZA 3MZ0A 5ESDA 3RASA 2AZMA 1ODIA 4AUNA 3SXPA 4M0CA 1MU0A 3SBEA 4BO2A 3CN7A 4MITA 4ZAFA 4ENQA 2RHTA 3M9XA 3IVXA 5TVGA 3Q11A 4OP2A 2XT9A 3KYDA 3D2BA 1E2FA 3WSTA 3OKCA 4QJIA 4AMUA 3V4LA 2EFEB 2KWIA 2QGZA 3GLGE 5L51A 4G5QA 4KACA 2ZJFA 3CF4A 3VO2A 4NZZA 1XKQA 2FE4A 3TTTA 4LF5B 2VBFA 4E4TA 1QORA 1RRPA 4IMIB 1YTUA 3LW7A 3G17A 3IMEA 2XCUA 1V3QE 1Q0HA 3LF1A 3PUXA 1PG5A 5E0KB 3F73A 1V8FA 1FVXA 3L5KA 5D01A 4CM7A 2F43A 3QV2A 1P8JA 3ZZNA 2PNJA 1BX3A 2INGX 4GWGA 2OT3B 4PXYA 1J24A 1TU3A 1M8GA 4HDRB 4IM7A 1TADA 1ZD8A 4JL6A 3RH0A 3L8GA 3WP0A 1BCRA 1VBNA 5AW7A 3TR5A 5CFOA 1UZAA 2BDTA 2A0KA 3WTCA 4KITB 2PZMA 4AIRA 3PEYA 1QYVA 3VR5A 2XNJA 1RXUA 4GKBA 4MV9A 3HCAA 5JNRA 4A8TA 1YC5A 3E03A 3E3AA 1TYCA 1YCHA 4ZO9A 4ESOA 4QIHA 2YR0A 4C20A 4W1QA 2NTVA 2C5AA 3CUSA 3I6MA 4I2VA 5GPBA 3TSAA 3ZW7A 4QYWA 4UTPA 5IVDA 1KMIY 1B1CA 1K5HA 1FBNA 5LJLA 3DF7A 5EUQB 1GARA 5F7JA 2B4YA 2WIBA 5CFRA 4TTIA 1ZN2A 4WKBA 1C3OA 1ZZEA 1P0QA 2B34A 2G3YA 2XYPA 3R3SA 3TOVA 5CEEA 3LCRA 4BBPA 1KC1A 3OE7A 5B30A 1QLHA 5IAAA 4JI1B 2DFKB 1OSNA 3N0TA 4G1MB 4W5WA 3KJXA 3GLGB 1Q0QA 4DR6B 1WA5A 3MQ2A 4ISBA 1OX4B 3ZHUA 2HHHB 2NU6B 4DCNA 1KETA 3RRMA 4E4RA 3ZHYA 2XOKD 4QICA 3PQ3A 3RS9A 3RQIA 2YVKA 3K1AB 1OZ0A 3DTVB 4RVUA 5D7NA 2J48A 3ZBQA 3IQWA 1FP2A 5CLJA 3B13B 1U0RA 5AW8A 2GRJA 2H2AA 1AN0A 1KZHA 3G1WA 4PG5A 2UXBB 2VHQA 3FETA 3KALA 2FFHA 3ITKA 2P9GA 3FFBA 1E3LA 2A59A 2VDJA 4MUMA 2ZW9A 4KR6A 2RGCA 4OK5A 2V1XA 3PX2A 5AK5A 3UA3A 2XGOA 2CVQA 2YZNA 4R5HA 3JY6A 1C3OB 3OOJA 1HDXA 4H7DA 5AI5A 4HRAA 1ZGHA 3ASVA 4CV3A 4D9MA 4DMRA 1BA2A 1T9DA 2D5AA 2ERCA 4WZ6A 5IJ0A 1QO0D 1YXMA 4K87A 1KOGA 1WPQA 5BSUA 1PN3A 3DDZX 2O57A 5IM4F 3VOAA 5KTNA 2NLOA 5KKNB 3BYZA 2WG1A 3WRYA 4ZCRA 4D8VA 1WXDA 4P7FA 3A2NA 1HFEL 2OCGA 2ON6A 2RAUA 3K1YA 1VLLA 1A9OA 1CJBA 2CMKA 2WWFA 3L07A 4ZODA 3HCRA 1BHSA 5AUPB 3JAMA 4U9IS 4R0NA 4MQEA 3ZI7A 2BFOA 3UW3A 4EHHA 1T3SA 16PKA 1W36D 2UUCB 1K4MA 1E6KA 1M74A 3HZRA 1HQCA 4DC1A 2ORIA 5LYYA 2LIPA 3D02A 3O21A 2ODQA 4EA6A 1G20E 2GF9A 4P3NA 9ABPA 5CIYA 2XYRA 4JR0A 2O20A 4XRGA 2GXUA 3T4EA 1W1WA 2GZAA 2JFXA 2QJRA 3Q3JB 2ASVA 2E85A 3KTAB 3NT2A 1KL7A 4KH0A 4B4DA 2RH9B 3FROA 4ZZ0A 1J90A 4C5CA 1X1SA 1G4AE 2Q6OA 3CO5A 1Y9AA 2ARKA 3DC7A 2IU4A 2QPLA 3R4VA 4M9CA 3U26A 4KAJA 4Q3DA 1RZRD 3I2JA 1L9KA 1RZRA 4P81A 3HPQA 2HMYB 4QGHA 1BJRE 3LPCA 1WVGA 1AKQA 4ND3A 4EUHA 3P96A 1ODCA 5BYKA 3CX3A 3R9IA 3V7WA 2RGRA 2OMKA 2JD2A 4TVSA 1X1EA 2A33A 5I7FA 3A9RA 2XOKA 3UXEA 5JAPA 1Q1ZA 1TT5B 3DZ8A 3QWAA 1EBUA 3B51X 2H0RA 3HY3A 4F2HA 3EQ8A 3WNQA 2IPLA 1OWPA 1IQUA 5KWIA 5G2OA 2IPMA 3VPBA 4BIIA 3HA7A 1ELOA 2PZLA 1IUOA 2SCUB 1GYQA 3E70C 4KZKA 3JASA 4PX2A 1UPUA 1PR6A 1A95A 2WIFA 1SWVA 4WLEA 1IH8A 3DVLA 2O2HA 3RYTC 1LSJA 4OBEA 3QF4B 4M36A 4WPGA 2YVQA 2UZ3A 1Z36A 3OTQA 4AZ3A 2JB9A 3RTCA 1N6HA 5ELXA 3QHAA 4QWMA 3VPDA 3SBDA 5ICEA 4BNTA 3O2JA 2H1SA 5KTOA 4D25A 1T9GR 3ZPXA 1KO8A 4HGYA 1U7DA 2HF2A 1CDDA 4KBGA 4Y0NA 2HQ1A 4F71A 2DWUA 3HR4A 1IRXA 2C4VA 4R51A 2V7EA 4WERA 5KNBA 1N1MA 1ZOIA 2P9ZA 4LC9A 1NN0A 3AY0A 3WWOA 1Y1LA 1SB9A 2P6OA 4J7AA 1JBQA 3KQWA 2RC6A 4R41A 1U8CB 1MNAA 1XCOA 3AGPA 3A1FA 2JFQA 2EARA 3PJGA 3MQFA 1X0VA 2CNDA 2H63A 3ROGA 3BJEA 4K2HA 9ATCA 3REGA 4PRYA 3ROTA 1FDTA 2HHLA 2QD2A 1E62A 1IC6A 1MAVA 2GDJA 2TMKA 2WAXA 4HDSB 3TNLA 4Y2VA 5AW2A 3COZA 1ZOPA 1AM4D 1BU5A 1PD1A 4TMKA 3UCEA 4ZMSA 2AFHB 5F7OA 2ZANA 2UV8A 3TIXB 4ZK2A 1MJGM 1T8SA 2PWZA 2WJJA 4V2UA 2C92A 4JOSA 2PVSA 2QL6A 4RVOA 4OU4A 1E1CA 2JA2A 2PGXA 1AE1A 1FRNA 2XVXA 2W70A 3RC9A 4CR6A 5IZCA 1H4SA 2FDXA 1HF3A 1CF2O 1TO2E 3R3UA 3ECCA 4ZHQF 2HB6A 3EGOA 3QLJA 2P68A 2VPQA 4IDDA 5FFNA 4KPGA 3MS4A 4GUDA 1PJ4A 3QV1A 1J00A 1PZGA 5C0OE 4CU5A 5B4UA 5LUBA 1R0YA 4Q01A 1EK1A 2PH7A 3MIZA 2VDWA 5HNKA 5ESWA 1WBBA 2QBYB 2JI6A 3WAKA 3LFHA 2PU7A 1UBFA 3HZZA 3GW8A 3IDQA 4AJNA 1JU3A 4BLWA 2B36A 2FXIA 4ZC1A 5TQJA 2NYVA 4D9JA 1ZH2A 3L7BA 4Y2GA 4ZU6X 4LDQA 3MTBA 4JLBA 1JAYA 1UZMA 2BMVA 2FPIA 3NS7A 1UADA 4FEYA 3W5IA 2QLTA 4O4IB 3JS5A 3O3NB 4GE0A 5LNK1 3HKBB 3RR2A 1YZLA 2WWRA 4YP6A 4BZQA 1PJBA 1ZJ6A 2YNMA 3IQDB 2RCYA 3L6EA 4LZJA 2W58A 2QVYX 2GSWA 3UAWA 5IHXA 1CQJB 4JJIA 4N0MA 4I1OA 2OCPA 1DIHA 3BRWD 3O73A 3L7KA 4H4CA 5HSGA 1UXOA 4X93A 2JC3A 5FOWA 4HNHA 1NPTO 3WLTA 5AO9A 5JMPA 2PT6A 1D5WA 4KUGA 4CKWB 3SDZA 5CA1F 2VQ3A 5L3QA 1RBZA 2DU8A 1ZM2A 1VIVA 3TW4A 4IFEA 2XCSB 4XR4A 1NU6A 4PLTA 3IDFA 2HF8A 1GFZA 1Q19A 3FYCA 1U02A 2XOXA 3KU4A 3G85A 4QD3A 3LW8A 3A4VA 4IXMA 4UE2A 2R96A 3AY6A 4YR7A 1VA4A 3GOHA 3VYSB 2J5QA 3PXAA 4TMFA 2PXHA 3MUNA 2XAAA 3RTDA 4YXWD 5JRJA 1QH9A 1OILA 1WUIS 1Q0UA 1D1SA 4B17A 2DLNA 4I3HA 2IF0A 2QMOA 4ZYTA 4DJTA 2A57A 2A67A 4UTXA 3INTA 1F6DA 3D1VA 3ORQA 3WGHA 4FE4A 1LW6E 2IOFK 3BMNA 4BWYA 3GLHE 4J91A 2HBZA 4MLDA 4PONA 4TLDA 2XYHA 1XQXA 2OA0A 3WRVA 3I1JA 5EIOA 5ALYA 1DRJA 1RM3A 4DADA 2EGHA 4M55A 1FMJA 1YIOA 2XDYA 1JPNA 3KHSA 4GXRA 5G0SA 4AMYA 5LQMA 3ROFA 3IAFA 2NPIA 4NYJQ 3CONA 1UKVY 2FSSA 2R65A 3GUCA 4JEUA 4UUAA 4DQKA 3OLYA 4JCOA 1LPAB 3L7OA 1Z0UA 3RABA 1Q11A 4CMKA 3AMVA 4YALA 2VUHB 1ISSA 3AR8A 3NHWA 1ESEA 4M8IA 3UFXA 1KO1A 4TT8A 1XE3A 4FI3C 5B1IA 1Y98A 1FSSA 1VPEA 4A2QA 2GQ0A 5JTUA 1E7MA 2GLTA 1WOMA 4FGLA 1QYIA 3FFWA 4ZZ3A 1ONBA 2I2DA 3CF0A 2UZAA 1OJ7A 1JKMA 1NVAA 4HDNA 4DFDA 1CEYA 3A04A 1AB5A 4BO5A 1M66A 4QLBA 3KJNA 5DM60 4AJOA 2N3ZA 1A8HA 3V97A 1Z0JA 3CW9A 4J03A 5BWOA 3M6XA 4YXFA 1S8AA 1EXNA 4B8ZA 4B2PA 2OV8A 1R0CA 1UMCA 4GBED 2HWUA 2Y27A 2Q45A 1QLJA 2FWJA 1RKVA 2BEVB 3FGPA 3GEHA 1GDHA 3JYPA 3PF9A 3OQPA 2FW8A 1AZWA 4H17A 3V42A 4HV4A 1M1YB 2HDHA 4OH7A 3GFQA 4EO4A 5IKEA 3EVGA 3OJ0A 5D1HA 2JLZA 2OYCA 4MW1A 1NMYA 2WIGA 4B80A 2H29A 2OZLB 1N5OX 2WT4A 3BSFA 4OQYA 3NNDA 3UMJA 4AKGA 3HC7A 4WESA 4X20A 1N2OA 3DAHA 4ANFA 1SU6A 3F7OA 3RS4A 5E6RA 4BEJA 4YMGA 1I2ZA 3H1AA 2R87A 3WGLA 4WQMA 1GTZA 1KDOA 2O2CA 2PUWA 3DM5A 3IKLA 2YZ7A 1YQUA 4Y1RB 5EP4A 3DNFA 5F51A 3V6MA 2IFTA 1ZXXA 4NOJA 4OF4A 1U5BB 2FAXA 2A86A 3E61A 2O5VA 3GG9A 3GH1A 3S1LA 4EECA 1S6YA 2COKA 2IP4A 3DNPA 4X1OA 4XVQA 3W5HA 2K7FA 4OFXA 5DTQA 1GGFA 4DQ0A 4OBBA 3IAUA 1O3YA 4UNRA 1IZ0A 2OGUA 1Y4AE 4NWIA 4PZZA 2QAGB 2BLLA 3O6VA 3JWJA 4FHCA 1FQKA 2VHCA 4K40A 5DX1A 3T52A 2JW5A 3F7TA 4G0MA 4L7QA 3TAXA 1PL8A 5DGTA 3QLUC 4M1WA 1QDEA 1T43A 3OZUA 1CZLA 4CI0B 3R6DA 5KVCA 4P53A 1GU7A 4M54A 3P9KA 2ZDHA 3EUAA 3ZS8A 1XA4A 5FBVB 2VWQA 1TQHA 5J58A 1K2WA 1HA3A 3SQLA 1BYIA 3ZTTA 4A0FA 5C80A 3MM4A 4LJKA 1OGJA 3AEYA 3SIWA 5CCEA 2DHEA 5AW1A 1SK8A 2L42A 2WT8A 3OEEA 5J9FA 2AA3A 1L7OA 5FUXA 1IBSA 2BSQA 3DMTC 3AM4A 1FK8A 2D62A 2H5JA 4IIJA 4K46A 2X76A 5AW9A 2JG3A 1CR4A 3EDYA 4LAFA 4Y9UA 4EW1A 1C4KA 1I3LA 2P2SA 5DGHA 5EJ9A 2IHTA 1EA7A 3OPYA 2ZSEA 2HA2A 3N39C 4YUZA 4N8SA 3QE4A 1SURA 4GMKA 4H1TA 4PZDA 3U5ZB 5IJ9B 2D54A 2GESA 2VTDA 1W1UA 3JVEA 5KX5F 1CK4A 4BGIA 4W9RA 4OMFG 2GGSA 3SE0A 5TXGA 1DLIA 2BM1A 2C4WA 1N2IA 1T6XA 3B1XA 3NM6B 4I3GA 3OQIA 4UZSA 4TMWA 3IQGX 4UHEA 4N18A 1J33A 3TSZA 1I9GA 3A1UA 3M4XA 5JASA 3I1YA 2F3TA 3H9UA 1DV2A 4UBOA 4UXHA 3R0XA 5HTOA 3VMMA 2AQ8A 3A8TA 1E20A 5AK6A 2WZBA 4XWGA 4BASA 2C7PA 1YCFA 4X8HA 5KKCA 3P0HA 3Q2KA 1O0SA 4D3FA 5EJ4A 2YWRA 3A06A 1VL2A 1J0CA 1JNXX 4KSCA 3SS8A 1FVFA 3K1ZA 3JV7A 4BMXA 1SCJA 4QXMA 3VPGA 2HNAA 5JS2A 3B3JA 2DUUA 3EY9A 3K70B 1UKZA 3FI9A 3CLUD 3I53A 1G3QA 2M6RA 4LNHA 1EFKA 4NAVA 2JJ2D 1F7VA 5HS4A 1Y63A 5CT8A 3E23A 2E87A 3H4IA 4V1CA 1VE3A 3FKSA 2CD7A 5FUVA 3OZDA 1B0PA 4J90A 1HE5A 1A0OA 4JROA 5L3SA 3B1YA 4NH0A 4M7RA 2JFGA 1D2AA 2IYPA 2RKOA 3IC5A 2AFHE 4IQFA 3PNQA 1UJNA 2JJ1A 1ZUWA 4ZWNA 3ZJVA 4FGKA 3VC3A 1H2EA 4B3HA 3I2GA 1GD1O 2I8CA 4JZKA 2B6HA 1E9DA 2CLMB 2NTJA 4I8IA 1K2VN 5IMSA 4WNCA 4R9VA 4IJ6A 2VHUA 1G5RA 3SXUB 2EG9A 2NADA 3LPNA 3UPTA 4UVDA 5DB4A 1J1UA 4FMDF 1JEQB 2Y4NA 3KVNA 2KI5A 3AC0A 2AEFA 2ZIWB 4M9UA 4MARA 5DEOA 1N2GA 3V34A 3W5UA 3VKGA 5IULC 3G5MA 1SUDA 4ZRMA 2PGLA 1KYYA 3DCJA 3DZCA 3CPHA 1Y4ZA 2FSHA 2GJ9A 2R7AA 5BQPA 1BMFA 3DWEX 2V55B 4GKAA 1VIYA 2DH6A 3PHCA 3R6WA 2DCMA 5L3ZA 4PE5B 3CLSD 1JG2A 1RWPA 1BMDA 1OFUX 1EK6A 1EWYA 1QZZA 1R9JA 2GZ3A 3M6FA 3Q7RA 4KIGA 4Q21A 1PI3A 2PS1A 1JXQA 4RZHA 2OV1A 5F2KA 4EB8A 5FUBA 3E8MA 3IAM6 1B0UA 2DTEA 3D43A 2ZRGA 4MRPA 3DBLA 4X1KA 2XMCA 1TYAE 3IEUA 1XDBA 1G6KA 1XD8A 5DYTA 3ZHRA 1E0JA 1GY8A 2VAXA 2Z1NA 4CT4B 1YI8A 3L93A 4FJ1A 4DMFA 1LJUA 1J1IA 1SHZA 2IXEA 3T99A 1NF9A 4XX1A 2I78A 4B4OA 1U7XA 4U6QA 3NIWA 4E07A 1AURA 3LOUA 4DBLC 1I2CA 3K4HA 4TYPA 1OQAA 2F3RA 5EWMA 4PHGA 1H8ED 3ZU2A 3HCEA 4FZVA 5ALZA 2NSYA 5TJ9A 3R7WB 1FYXA 1O6ZA 5AXAA 1E61A 2HU8A 3PR1A 3ABZA 3P52A 3F6PA 3D8RA 5ECWA 1IUNA 3SX4A 2ZIVB 1FNCA 3E2MA 4EFLA 2LNDA 1KY3A 2Z8YA 4ZAWA 3LT4A 4D4GA 1UDCA 1E1CB 1KTVA 4AB1A 2WTUA 3V1TC 1T5LA 4I50F 3PLNA 4QYIA 3BPSA 4Q18A 3O4GA 4PW0A 5H7XA 1DCKA 3U4GA 3C7TA 2XE8A 1G6Q1 4QQKA 3M70A 1B73A 4OHPA 1RWXA 3H1TA 2K5UA 1U1IA 3NTOA 1KI9A 4WH0A 3A58B 4OJQA 2ORVA 1V0JA 2QTAA 3CG4A 2VATA 2VJMA 4LYDA 2JFWA 2ZJ6A 3ROMA 3M33A 3ZCQA 3N8KA 5FBKA 5AM1A 2PWYA 4FTWA 4WAUA 2VYND 2B1QA 3CH5A 1ORVA 4KBFA 3CWQA 4NS1A 4EG3A 2CL5A 2JL1A 2MSCB 4PNPA 1LH0A 2PGJA 4LPKA 4ZYYA 4KL8S 1VLZA 2QPTA 1SHTX 3GQBB 4Z7OB 3MTEA 1EB9A 2DPLA 3GRVA 3V7FA 5IN4A 4RA6B 1SXIA 3RFVA 5TT0A 1MB0A 1IN4A 2YMQA 3KG2A 4AY3A 4I50A 3N53A 1N5LA 2PFSA 3NAMA 1K5PA 3CCBA 2WSSD 4G65A 4MJLA 3FCOA 4XIIA 3FHJA 3PLRA 5DYWA 5A0TA 2VSYA 2ZRAA 1GL7A 1XG5A 3GRKA 4P0PB 1T8UA 1GNVA 1NATA 3H5WA 3OCCA 4LHSA 3F46A 3R7DA 5GTDA 1W5AA 4LC1A 4BQQA 3SFTA 2UUAB 2DM6A 2CL0X 3DE1X 4TS3A 4YJFA 2F8MA 2JKYA 3JD2A 3RS8A 4HDKA 1UOOA 3OIVA 2LUOA 1SCNE 2OY0A 2YJ4A 3K8QA 5E6UA 5FFMA 4OAOA 3HDVA 4FQ8A 5A2GA 3QVTA 4P8RA 1QK4A 3HJAA 3OESA 4TZ6A 2CXOA 1JXMA 1YR3A 4QSMA 5TARA 2GEVA 5T64A 4D46A 1FLVA 5EPOA 2OYSA 3WLAA 1TB4A 2JAXA 2NW6A 2ZTLA 1CUVA 3T5DA 3VU8A 4BECA 2BKXA 1NXQA 3KHKA 1SUSA 4BO3A 1T0PA 3EFOB 3W5AA 5ITZA 4XDYA 1R6TA 3SZ3A 4AUKA 2IA5A 2UYGA 3F98A 3OEHD 3MHTA 3GAAA 2WYUA 1TAHA 5M2QA 1J9EA 3AR7A 3CUEF 4EO9A 5IF3A 3X1XA 2ZRQA 3I6IA 3VSDA 1R66A 1PUIA 2RHDA 2Z2ZA 2ALJA 4OJMX 4CG0A 1PHPA 1KEPA 4Y2QA 1P4HA 2H57A 4BMDA 4OI4A 3UK6A 1JEJA 1F6WA 3EULA 3KOOA 5FIUA 3T5GA 5JJ5A 1L5YA 2X6RA 1EH5A 4OEHA 3DP9A 1R3DA 1V4BA 3HCPA 3HDTA 3LXMA 3UFBA 1JTEA 3HGQA 1W35A 2J9FA 3BHIA 4JLKA 4R2IA 4XJSA 3N9IA 1T4CB 4LBZA 3D4PA 4DWJA 3IERA 2B3DA 5K3DA 3RKSA 1K89A 2QAJA 2GERA 5KQSA 1NVGA 1VG8A 4RDCA 1ZYUA 5EZYB 4MV0A 4YAEA 2CHQA 3ZE6A 3AESA 2W43A 3H5TA 4DWOA 4EA8A 2VG8A 3R20A 5M3BA 3KK0A 3V1MA 4MEBA 1LTKA 2OBLA 3FWPA 4RE6A 1N5MA 1NLZA 2B35A 1CUBA 4J7XA 5DTIA 2IY8A 2ZE5A 1M6WA 4Q1DA 2Z8ZA 2A0FA 2QX6A 1ZK4A 3A9SA 1T6NA 3M4YA 3TAUA 3W79A 4ID3A 1C29B 1LD3A 5AKHA 5I7AA 1MC1A 4YT5A 1N6IA 2I03A 1JZSA 5AKKA 4W6ZA 5CEFA 3B82A 3BWBA 1YZUA 1LLQA 3GCWA 5KVQA 5KJ6A 1SVOA 3RC8A 1L7VC 2PKYX 4M0KA 1PX0A 3ABRB 4WI1A 5AP9A 3FSGD 4KYTA 2Q2QA 1GA6A 5KCZA 1N2JA 1NKSA 5M34A 3VNVA 4BIMA 1QQBA 4BJ6A 4R05A 3MRSA 4JX8A 3TQFA 1RMTA 5BV0A 4IH1A 1NVKA 4U7FA 1GEGA 3GWGA 4A10A 4A91A 1M6VB 5DWQA 1NLFA 4EDFA 4OSPA 3EN0A 2VA9A 2GEFA 5LKAA 4NJOA 3BSWA 4M0FA 2ZPTX 3S2EA 3LT1A 4UNNA 5D3ZA 3RNOA 1D9XA 1Q14A 2X0DA 3OZSA 4X3PA 1QHXA 1DELA 3AF5A 2W4QA 3EWAA 4O5OA 4TXNA 4BLUA 3OOYA 1VPDA 3KCQA 2P0YA 1CG6A 3II6X 4NZNA 5ERGB 5I5EA 4FNGA 2JLUA 1FYDA 1QFZA 4Q4LA 2YRWA 4HUJA 1BN6A 3CTMA 3R5TA 1NUAA 3L8EA 2R11A 4FR5A 3QVOA 1CUGA 5GINE 2B98A 2DE0X 1I8TA 1RSZA 2A1TR 3K20A 3QH4A 1WHSB 3DOCA 3TLMA 1HFWA 2QRUA 3AJRA 5CM9C 1TA9A 1L4MA 4YI3A 4PHHA 3UC5A 5J23A 3S44A 1P7ZA 2WNHA 3DO5A 4L3WA 1XN1A 4ZVTA 4HEJA 5IT9A 4BVFA 2X1VA 3I0ZA 2NP6A 3P2KA 1PGNA 5JVDB 5LQSA 2B4RO 5IVKA 1M8KA 2CVFA 4ES6A 2X6TA 1L8QA 4LF8B 2ZPAA 1JHXA 1GCAA 2IKSA 2WMYA 2IQIA 4IEFB 5AM0A 4LXGA 5L95A 1K8QA 2DWCA 1NU8A 3EF1A 5TX7A 4YCCA 5LP6A 2RHJA 3R3HA 3M83A 2AJCA 4C87A 1DDIA 1F0KA 2V7VA 3W5SA 3TFOA 3S99A 3UUFA 4IUDS 1J0AA 4CM9D 4P58A 1HC7A 4DR2B 4IQ0A 1WPGA 1GG2A 3UJ6A 5HVNA 3OFVA 5A4JA 1VYHA 4V02A 3BOSA 4JSYA 3B53X 3HR7A 3I9LA 1RAIA 4PFKA 1MOPA 4FZ5A 2HBQA 1HUQA 2RC5A 1AD2A 3DPUA 3VPSA 1MH1A 1ZM3A 2LKDA 3FLMA 3OT5A 3RVBA 1IFXA 4WBNF 2QY6A 2XXAB 2R1VB 3JPWA 2CJYA 4R81A 1PL0A 2N75A 3JZAA 2HK9A 4A23A 4JK3A 5AD1A 1ZITA 3SQDA 5C53B 1NTRA 3FW1A 1CETA 1NTOA 3F1LA 5LP6B 1ZRSA 2EFJA 3QK7A 4H6WA 1RPZA 2R5NA 2YCLA 4RXMA 3Q0EA 1L2TA 2C8LA 1TO6A 4EF6A 4CMGA 3KNZA 5DW0A 1U0BB 3AEKA 5BRJA 3ND8A 1XDUA 5C1PA 1S7GA 2XMRA 3TB4A 3ZWBA 2VJDA 1SXPA 3U7QA 3EGDB 3X1YA 5LXTB 3TXYA 3QPAA 3GMSA 1S4QA 2BKEA 2XCIA 4BFSA 3A31A 2G77B 1V8PA 1KFBB 2IU3A 3PGVA 4N82A 4QXQA 2AOTB 4MV3A 4CQMD 1K5GA 1RACA 3ZU4A 4MKGA 1HTBA 4PGGA 5FDFA 1UJ2A 1PJ3A 1MDBA 2A78A 4OQ4A 3QFRA 3SF0A 2PQ6A 5K0BA 2CSXA 1UPCA 3O03A 3QY0A 1U5CA 2NNLD 4QAJA 2OTCA 1RI4A 4QYMA 1W29A 4JBHA 4KGXA 1QF9A 4NNOA 5EMLA 5C7YA 1SZCA 2ONKA 1DGQA 4MINA 4WOCA 2PZ8A 2I8AA 2EHDA 5KVAA 3GFVA 3Q4GA 5GIPE 1VJRA 4LCEA 1JFSA 4G24A 3RC3A 3B6IA 4J9UE 3HUEA 2ZP1A 3CH4B 5CYPA 1DWOA 4YRCA 1FRZA 1B76A 2PKCA 3KZXA 2VXYA 3GH3A 4RK4A 4YIHA 1J56A 5EXXA 5H3LA 3ED5A 2NO0A 1GZ6A 3D59A 1NULA 3V8QA 3DZHA 3ZU3A 4EW3A 4L7VA 4Z4EA 2AYYA 2P35A 4PX5A 5TC4A 3HR8A 3N87A 4B6QA 2G40A 4S35A 1YE5A 4EG7A 4RK5A 4BUZA 3J7TA 3EVCA 5DSZA 1E1NA 1E5QA 3Q72A 4KO2S 3RS7A 3I64A 3HXTA 2Q4BA 2ENUA 1GADO 3G0IA 4EBBA 5A3RA 5KPDA 4ZXPA 4QFCA 3WHPA 3JSAA 1JZTA 3WLSA 4BAZA 2BL4A 3LOPA 4LK3A 1WLYA 1U3FA 4RF5A 2DZDA 4I8DA 4LWPA 2Q6TA 5JAMA 5CEJA 3B7WA 4QJ4A 1NW4A 2OHXA 4TQUS 4C89A 4LFBB 4JYPA 3R75A 1EGMB 2M1XA 2WYOA 4EHFA 4D3DA 4ZYWA 1SHLA 4BKRA 2LP4Y 4DCCA 3OC6A 4WN9B 4L07A 4TRJA 1WWKA 3JZMA 5LC1A 3OPVA 4ZKDA 1JHOA 2E18A 5HBGA 4DBZA 3T4PA 1NUPA 1NX6A 4LJ4A 4IICA 3TR0A 4G0XA 3SDSA 3BWDD 2YJ6A 1J6UA 4XEUA 2JHFA 4MVXA 2C7VA 5BSVA 2IEDA 4J0IA 3FTEA 1SXHA 3CGWA 5FTKA 3LQKA 2C0QA 2QP9X 3KHUA 4TS1A 4NG4A 3QE9Y 3ISTA 2IODA 5FP0A 2H2HA 1RHJA 3HU3A 2PPVA 3EOZA 5IABA 4M53A 1NPDA 1QGDA 5P8WA 3VBCA 3I5XA 2D06A 1YDHA 2IYEA 1MQSA 3CR8A 2BI7A 5IMBA 1FFSA 1G3IA 2HLNA 1ZDMA 3FCUB 5DK6A 1UPAA 3N2GA 4M7OA 2ID8A 3DL7A 1DTEA 3NBXX 4LMPA 4Y6RA 4AQ7A 2VJMB 5I3CA 3QVVA 5L9AA 4WLFA 5CR9A 1X2EA 5CM2Z 1THTA 4ZOEA 3UG6A 1QDLB 4JN6B 3COSA 4L8WB 3TIVA 3MJCA 1N2ZA 1NW6A 4BU0A 1ZICA 2GN8A 2HIMA 3LRPA 1NJ8A 1NL3A 2YV5A 2C2OA 4IOMA 4RIIA 1AHIA 4UUMA 2R7MA 2L18A 3MWFA 2XCOA 3CBGA 5AXBA 2QP3A 4UVGA 4AS1A 1L6IA 2DAPA 1UBHS 2VHXA 4IQ4A 4KAAA 5FULA 1P4GA 3KB2A 5DLEA 2JFNA 1I4LD 3A1SA 4NZYA 1BDBA 3DV0B 1YR8A 3O8QB 5DXJA 1C7FA 2YWJA 2VNJA 3G1UA 4N5IX 4TZTA 4ECEA 2DKFA 1AH2A 2W0MA 3DEFA 3U4QB 1O89A 4YONB 4AROA 3THXA 2G76A 1LK7A 2LCQA 1L8XA 1ZVQA 3VTFA 1SN7A 1UBKS 2IH5A 4QDJA 1GVHA 1XZEA 1KJWA 1SVSA 3EXFB 4XGQA 3FOEC 2GN6A 3WB2A 5EQDA 5ABPA 1XXHE 4FYIA 2J7KA 2E49A 1TVMA 4JQSA 4MGYR 5AR1A 3KR2A 3DTTA 1Z39A 3QWHA 4CKBB 3VKWA 4HFNA 3OECA 2J41A 2IEBA 5CLFA 4YEDA 4UHJA 3AGQA 2ZIXA 3ULKA 3C6QA 4EX6A 1BTOA 4NYIQ 1NYRA 1WMDA 2QY9A 1H2YA 3BA6A 3MFQA 4HDNB 5GMOA 4BVGA 3S7TA 1ES9A 2RB5A 4OMCA 1E32A 1AMOA 4G0PA 3ZJ5A 1A96A 1AY0A 4ENSA 5J2UA 2OHFA 4HX9A 2MR6A 3F49S 1GPLA 2GBCA 4BV2A 2CF6A 1UXGA 1K3FA 2Y1LA 5JV5A 1BXRA 4TWRA 3BB1A 4OGFA 3TUJC 3TXXA 3JYNA 2HXYA 4FOPA 3WMGA 3TPFA 5T4HA 3KOWA 2AG1A 3UWMA 3LBIA 3VZCA 4KNVA 4MV8A 3SIRA 1Z5NA 3ONEA 4IHKA 4OXKA 3HKCB 3TRKA 2FY8A 3UXMA 1W48A 2LBPA 8OHMA 2YHIA 1KWKA 4RK7A 1QBGA 4L4RA 2WW8A 4C07A 1IAVA 5LOVB 1UWCA 1R8QA 1CQWA 2PK3A 3JQFC 4G2NA 2E21A 5AJZA 2RIRA 3VR4D 4E08A 5M04A 3QSGA 1DJNA 4H3HB 4JC8A 4RMHA 2WD7A 1FNNA 2IK8A 3AHGA 1K08A 4HFRA 1G9SA 2GKOA 5AW5A 3UJCA 3WV5A 1KQNA 1P2UA 2EERA 5LQAA 4Y67A 3A4LA 1T9GS 4OXXA 1R4AA 1VJ5A 3L2OB 3QWIA 4FP9A 4W9NC 3ZG6A 4G63A 4TTQA 3JVVA 5KNCA 2F3QA 2RI1A 1Y9JA 1I01A 2QZJA 4X6XA 4G86A 4PYRA 5L53A 4O6VA 4K05A 1ADCA 2EYQA 3KELA 2EBWA 2IV7A 3OCYA 3ZLUA 1RYZA 3ITEA 3QE3A 3IEIA 5DIZA 2EG5A 3ZJTA 3RV4A 4Q4JB 3ZDCA 4CLHA 4TRMA 4E5YA 1X80A 1JZQA 3AHHA 2WJWA 2FFJA 4XZ3A 2BBTA 1KC3A 2I22A 2HU2A 4WY5A 2HA6A 4B87A 2ZJ8A 3ILYA 3NTUA 1GAQA 1U2EA 3ANXA 4YYEA 5KYUA 2BCJQ 4PPNA 1NW5A 3INNA 3SC2A 4DB4A 4AJIA 5KQGA 2AQIA 4CEIB 1H0SA 4O5AA 4PFSA 1JMKC 2BZSA 3MK31 5C8YB 3QBDA 2EX0A 3QRWA 4ERNA 1THMA 2HDWA 2EOAA 2B1RA 3ML1A 2I7VA 4N5HX 4LISA 3I0NA 2VAPA 2AT1A 1BFKA 3FPJA 2IXGA 4P3YA 5CXXA 4HTFA 3M1AA 4IRMA 3TECE 1XZIA 3CLTD 1S3GA 1IZYA 4KZPA 3C1OA 3OQIB 1P5ZB 2ECQA 2FMIA 4I4TF 4LHYA 3R8FA 4AZ0A 2O2JA 4DL9A 4NK4A 2XB2A 2PLFA 3PTZA 4QWWA 3LHFA 1R0XA 4BVJA 3IIJA 4GH5A 1JWLA 1PQUA 2WQ7A 3B7GA 2O3SA 1N5IA 5H9WA 3HKDA 5IASA 5FYDA 3SYRA 3HA2A 2NZJA 2OO5C 3QYPA 4J1NA 4MJ3A 4R0VA 4WEOA 3WJ1A 3ADCA 3D4BA 2AJDA 3QG5A 3GDWA 1EJ2A 4V0LA 4M6WA 2I62A 1DQRA 1TX4B 3V8MA 1GL3A 1QS0A 3G8AA 3RGGA 4O4HB 1WSDA 5KINB 1M1NB 3F6SA 1IMOA 1D0SA 2PMEA 3LYHA 2DY0A 1HYEA 4MPTA 3GFBA 4JJ8A 4UM5A 1P5JA 4FSDA 3DAYA 4WLNA 4F5DA 2GAJA 4J2OA 1L5QA 3I9V1 1GQSA 1RRGA 3E1SA 3MEQA 5JEDA 1JF8A 3B60A 4LJYA 3VKUA 2A0XA 3UAZA 1B41A 4JLUA 4QXAA 4Y2HA 5JO9A 1NKVA 3W1WA 4MR7A 1XCJA 4O4IA 1FDUA 4WN3A 4ZCPA 3U4CA 1CTQA 2Q3LA 5AI4A 3V4SA 2VPZA 5D1NA 1KY2A 4GM4A 4OAQA 3CSUA 5KDDA 4FD2A 4DBLE 4OJTA 3CNQS 4O3FA 4F8YA 2WR8A 1OUMA 4KREA 1XZGA 4QULA 1CSEE 1CFJA 3CEJA 4J0FA 2NMVA 4S2UA 2ZRPA 1NUSA 2EWWA 3NC1C 3FIUA 1JAIA 4IDBA 2NUTA 2BGNA 2ZB4A 1IEWA 1K7YA 2H7VA 3NOXA 3P9CA 2Z83A 2WHQA 3DXYA 3HP4A 1DEKA 3PSAA 4CCSA 4EUNA 3I72A 2D2VA 3VKHA 4L73A 1IQPA 4US0R 4HH4A 4TL8A 4M8NE 4B8WA 4YAOA 1JJBA 4WESB 4X20B 3H04A 2WFLB 3EDQA 2AKYA 5CLQA 5FO1A 5CIWA 4EVSA 2OV4A 4REQA 5AVWA 5EYPB 2D5LA 1FSGA 2X2EA 3KL2A 4MUNA 4AULA 4YMLA 1L4KA 2R44A 3Q2IA 4YT8A 4RPCA 5KYYB 3GWZA 1NQVA 2CLEB 4MCAA 4OQNA 4ZOLF 5T6BA 4F3TA 1EU1A 3GC6A 1XI2A 3CM0A 1J2UA 1JLMA 2CVOA 3OJOA 4HG2A 3X1JA 1N6KA 4FX2A 4P3XA 3IP3A 2CZGA 3PNSA 5AHXA 3CZ9A 3GNTA 1KBOA 4M8SA 1AOXA 3H2HA 3MT8A 3VGJA 5HJ5A 5FNVA 3W4JA 3IEVA 4O2BF 5BSWA 1WKBA 1F2DA 1JSXA 2WMDA 2DR3A 5EZQA 5EJEA 3TCNA 4MTLA 3MW8A 4MUIA 3UHFA 5BNIA 7ABPA 5TV2A 2CW5A 3A6ZA 3LI2A 5FWXB 2RD2A 3K2EA 4UM7A 4IJUA 4KRXA 4HNTA 4R8SA 1A8IA 2R8OA 3FSRA 1HEYA 3NBUA 4NKRA 2C61A 1S9DA 4EO7A 2QZ9A 1NDHA 3OZVA 1OREA 5LQCA 3QIVA 2V3WA 2IBMA 2FMUA 3MBIA 5TRTA 3UVEA 1H9CA 5JS1A 1E7RA 3PI7A 4X54A 1F1BA 3EXHC 5TEVA 4JIGA 4EKGA 2YN0A 2QA5A 2GN2A 2JHPA 1OH8A 3EBPA 3M9WA 4L4YA 4LDNA 3ZTYA 4D8YA 5BY2A 1KI6B 3GBPA 4PU0A 2G4CA 1L4FA 2R3SA 2V74B 4PZ0A 2B4TO 2Q5FA 2VI5A 2YJ3A 4AJ9A 4RVNA 2XMGA 2IX9A 1KJ9A 1YQGA 1GLNA 3NBMA 1WXEA 1BS1A 2F90A 4GX1A 3O4HA 3DE2X 2EBHX 1G3MA 4X97A 2XKBA 2QOEA 3FCYA 2C7RA 1ZNZA 1O4VA 2G71A 2VLIA 5B3JC 1U6JA 2YRXA 4PWZA 3AR9A 1ZUD1 4KFRA 3KOXA 1H4TA 2XMBA 1JFFB 4ND6A 3V1YA 1CJUC 1TD9A 1ODLA 3Q3GE 3P2OA 1ZA1A 2QSJA 1A4UA 2RHBA 2VT3A 1JDBC 1L5OA 1KVRA 2OBXA 2VSOA 3DBLB 4X1KB 1JDZA 1GNRA 1Z8NA 3IP5A 3U0BA 2EBFX 4Q39A 5E95A 4JYZA 4EJFA 4KR9A 4HRXA 5AT1A 3TFQA 5LL6P 4JQZA 3QE2A 4LTDA 1PR5A 2XYVA 2ZBVA 2C9ZA 2CJPA 3NUGA 4I55F 3L05A 1KZ1A 3ZX5A 3L4KA 2PAAA 4ZQGA 3PX7A 1FMFA 1UKYA 5ADVA 1QIIA 1CC1S 1I6MA 1P0FA 2JAUA 4OREX 2X7HA 4K8RB 1A5ZA 2QUZA 4YA6A 3U6BA 2QUIA 3U40A 5IARA 4WMLA 1HL7A 2OD2A 3PXDA 4KWEA 4Y6SA 1ECBA 3ROEA 4XPIA 5IEBA 4UM9B 4TKVA 5CLHA 1H93A 4BQNA 3NAQA 4OHOA 4JDPA 3QF7A 2WD7B 3PPYA 4D6XA 1H69A 2Q41A 2W2LA 4IIHA 3RSFA 2OXEA 3SVLA 2VYFA 5ETJA 1KYQA 5FADA 5F5XA 1YFJA 3H16A 1VI2A 3OTHA 3HADA 1UBMS 4EHLA 4BNKA 1PZFA 4A6XA 1QIEA 4XOUA 4W1PA 5ED4A 5CU7A 3N8GA 4HAZA 2Q7DA 2PXAA 1JN0A 1DC6A 1XDZA 4R8KA 4LFCB 4WCFB 2B37A 3RBZA 1P0CA 3CKMA 1Z18A 4IUBS 2WTBA 1GU1A 3DPSA 1IBKB 2WUEA 1P2VA 2CF5A 3NTQA 1UL1X 3O4JA 3PGLA 4IZHA 4PZAA 4IWXA 3V1LA 1HGXA 3VNUA 1Y80A 5CD1A 2B7CA 2C2HA 4EY8A 1MJ5A 3TE7A 5CVVA 3VNAA 1MO3A 4HPJB 4BOYA 2SBTA 3DO8A 3BCRA 3K1AA 3PKIA 5K4GA 3LX4A 4LBWA 3Q3IA 1QFJA 4RGQA 2C0CA 1FX0B 5ISMA 2FPUA 3D1LA 2SECE 3K9NA 3D6HA 2H4JA 2PD3A 2XVMA 2HK8A 3K0EA 3F5FA 5HCIA 3T15A 1CP2A 4ECAA 1H8HD 3ZQ6A 4ND2A 4ZN6A 2HBYA 3A9UA 4RZSA 2BKLA 5ENDA 4FBGA 3W2FA 3PA6A 2OUIA 5C5IA 4FB5A 5DULA 5L6MB 1UMDB 1ND6A 1F9AA 2EFGA 2F00A 2O7QA 3H11A 4QFDA 1OI3A 2GB4A 5B1SA 3TNDA 3FZQA 3QMMA 5FTNA 5IM4A 1YRYE 4GBGA 4D1YA 2VJKA 1U1DA 4JC5A 4JP1A 5LB2A 3V46A 3J81k 1K4KA 1ESCA 2QM3A 3GZTB 3QKRA 4J6EA 1QB7A 3IQZA 2G4VA 2QRLA 4UU1A 4B7AA 1DHTA 2NVUB 2EF0A 3PHJA 1QIMA 1QQAA 3RIYA 2HYIC 4TM7A 4RTJA 1M9NA 2DPHA 3RVOA 1KYXA 2A5JA 2J9RA 4HUQB 3Q9NA 4I6GA 3CVXA 4M99A 3PRJA 4JYAB 2EIXA 4BATA 5EZSA 1JYEA 3LUJA 1CQZA 1JVBA 3WWZA 5B6PA 4Q6WA 3H1FA 3CU5A 3TJRA 3JQAD 3L82B 1QGED 4QBTA 3NH9A 1BX1A 1DAOA 1M2VB 3DULA 1O5OA 2WWVD 3EA5A 5CDFA 2J5XA 2VL7A 4JUDX 2HBRA 4IWYA 3ZBUA 1B16A 4WXPA 5GJCA 1GGEA 3NV9A 1Z3IX 2ZE7A 4I5FA 4MW6A 2F8TA 3L1JA 3M6AA 3TNYA 4X0EA 3ZBPA 2VZEA 1MH9A 4LZLA 1GNQA 2C5EA 2OD7A 2V6IA 3J80A 5G02A 1JA9A 2Z6AA 4GI1A 3RAGA 3DDWA 4X6UA 6ABPA 2I2CA 1RKUA 1TAGA 2DQZA 1KE2A 3T5BA 4TTAA 2ZWAA 1BRMA 3S6JA 2OORC 4DRYA 1CNMA 4YUXA 1CHDA 4XYEA 2OFXA 4HQKA 1GZ3A 1V11A 4B85A 2J0UB 4FNMA 2QNBA 1XVIA 3HV0A 2W6NA 3ZHCA 3WLMA 4OCZA 3BKWA 3DC2A 4KC0A 4G4GA 1CB0A 3HEMA 1S1CA 4FJ2A 2X3UA 1GNTA 2DFVA 4NV0A 2Y6VA 2QR5A 2ZITA 3BB3A 3OURA 4C0BA 4B3TB 1VE7A 3U3XA 4G84A 4YAIA 4DJ5X 3FUXA 3NXSA 3E3MA 3FFTA 4OM8A 3DQZA 3FJ1A 3BEDA 1M33A 3O3MB 4UD2A 4R1MA 2IZ6A 2NACA 1JDSA 2XGSA 3OEWA 5K3AA 1UXHA 4MKIA 1E0AA 5EWMB 2ZBPA 3ELYA 5TY0A 1KI2A 3U5TA 1N5DA 1PK9A 2A0YA 2R48A 2QXYA 2W2VA 3NJRA 1NI4A 4YRQA 4EFNA 2E7ZA 2GCNA 2P9HA 1SOWA 1ZJYA 5GQSA 1XSEA 3VR3D 3HO6A 2JVIA 3EPRA 3SNKA 5AJTA 5CB8A 4B33A 1E3WB 3GFOA 4RHXA 3SI7A 2IHBA 2BFFA 3OLCX 4LIPD 4LZOA 4JU9A 4W82A 3V48A 4D8UA 4AG5A 3BMOA 4YJHB 5C7OO 5BYAA 1I2DA 3TTYA 1JE0A 1DAEA 1JDTA 2GPAA 4XE5A 2P27A 4K5QA 3O1IC 4YAJA 3B52X 4URHA 2BR4A 3EXAA 4GI7A 4LYHA 3GG2A 2C03A 2C31A 2G5GX 3BD9A 4P93A 2O5EA 3X3HA 3GLGA 1M3SA 2WVGA 4PCAA 2HHCA 3FYHA 4Z1MD 1LDYA 2YINC 1U4OA 4MCIA 3E58A 1Y6QA 3LDFA 4EGSA 2CNWA 4BZWA 1IATA 5GJWC 4GPTA 1O0CA 5DT2A 1A04A 1A9YA 3M4JA 1PEAA 2MU1A 1Z34A 3L8HA 4X7PA 3TNFA 1EX6A 1M2EA 5B36A 4LE2A 4LRXA 5JWHA 1ZM7A 2YTZA 4HMPA 4LDPA 4TMVA 4OA5A 2A5DA 3F9RA 4LK2A 4X7BA 1B93A 3AUJB 2DHDA 4MQFA 4CGZA 1CRQA 1WV1A 3I28A 5EZYA 1BVUA 2PIDA 1OWLA 1U0FA 5ITWA 4JP2A 1EFAA 2V54A 4US1R 5DBFA 5H3CA 3HP1A 2AHOA 5HYVA 3ZZMA 1N0IA 3IUNA 1E64A 1WSAA 2WVAA 3AUAA 3QVGB 3WYGA 1T6YA 4F86A 1A76A 3FOBA 2EAUA 1XAGA 4XM2A 4AU1A 2AF3C 3FPLA 1XAJA 3PA8A 4HR7A 3I32A 3R3XA 1Q5PA 4TLBA 3LLMA 5KWEA 3B9PA 2H1FA 3L0BA 2CN1A 4Y2YA 1FU7A 1M6HA 3DE3X 3R40A 1FFAA 1PQWA 4OHYA 4DJJA 1VDZA 1HI9A 4KDFA 2FMXA 3CZRA 4DLKA 1T2CA 4MYSA 3U7JA 3VZRA 5FLKA 3Q8MA 5TGDA 1FLAA 4JLAA 4QLAA 4DDMA 3BE4A 1JBKA 3K0FA 1XZDA 4G37A 4HBZA 1NZJA 1P9LA 5I4BA 1GPBA 1ZW1A 1YRAA 3Q85A 3WA7A 1O1YA 1VJTA 4M1TA 3CRQA 2ZYSA 1YJQA 2C98A 4ZAVA 4Q3EA 1EWTA 5EPEA 5CTJA 5I4CA 2IYYA 1HEIA 1K7CA 2A1UA 2VC2B 3DXFA 4JI6B 3S7ZA 1SKQA 3TD9A 4MK4A 1WIWA 3F7MA 4EYKA 4TS4A 1NV8A 5CX4A 4EGQA 4LNUA 5E1MA 4C0QC 3LDGA 3FKQA 3VYVA 5ILGA 4LXQA 2A8YA 3E22A 1UM9B 2VDUE 1NVTA 3C41J 3DBHA 4EY6A 3KQNA 4L8FA 2V8OA 1X92A 2XGGA 5HUHA 1TT5A 3SMQA 4L75A 2PUGA 2I2BA 4U8HA 5BWMA 2CL6X 2W8BA 4MWEA 5IWCA 4I08A 5JJIA 5I9IA 5KC9A 3OA0A 1E6LA 3NNNA 5EA2A 1Q16A 3KD2A 4MYCA 5FWNA 1E3EA 2QT9A 3KLBA 5K8LA 3S2GA 1R16A 5C31A 1ZUHA 4WIAA 5HKBA 3QOXA 2QM7A 2O2GA 2AE1A 2W6ZA 3CUTA 4Z3KA 3B6KA 5C7LO 3D8HA 5HWSA 3PIIA 1XQYA 1EIZA 1JXAA 3FDXA 1W85A 2WG2A 5FQOA 2R6R1 2YFYA 4ARIA 3IURA 3VUFA 2ONZA 2AZ4A 1VKOA 2IHKA 2RK4A 3PUHA 5D3MB 1JQKA 3A4MA 2RAVA 1VOTA 2G67A 3T1NA 3QYAA 1B6TA 1JHZA 1HQYE 3ME5A 4F8EA 5C37A 1RYMA 4YQYA 4RTMA 1X42A 5A4KA 3U17A 4CGYA 2HXGA 1ORDA 4NTZA 3ZLJA 2BFDB 4M22A 2JIPA 1YU6A 1GPDG 4NE7A 4IPTA 4BNGA 4LG1A 5IUKC 1JX6A 1TYBE 4JOCA 1U1CA 4YP0A 5EWLB 2P9BA 1JDJA 4RD1A 2QM8A 3KYIB 3RFXA 3SOZA 4Q34A 4IZIA 3U4HA 1M2KA 1XEFA 1W5FA 5F1KA 4KWTA 3U9TA 4ZVOA 4BO1A 4IO0A 3V6LA 2XE4A 4X7MA 3MLBA 3BILA 5G0UA 2I99A 1SUEA 2IPNA 2VAVA 2ZRJA 3AL3A 1UDRA 2J3LA 3L5OA 4JT2A 3TLKA 4RPJA 2DWOA 4GOXA 2DFPA 2R9VA 2X0NA 2PU5A 4PANA 3DQPA 1SQ5A 4RFLA 1T1SA 4BNVA 4DM3A 3I4LA 1TRHA 2ZDQA 4WBSA 5EOVA 1LRJA 2JD0A 3IRVA 1TQ8A 2E9SA 3FX2A 1AU9A 4ARUA 4QVIA 2ZM6B 4A0GA 3KL4A 4LJ8A 4CF6A 4W7HA 5BNTA 3FM9A 3QLTA 1BXRB 1W9HA 3M3HA 3L8YA 2XTJA 5AK4A 4EA7A 2A94A 3CRVA 3DHYA 5AJXA 4V0NA 1MOQA 3IIEA 4LOJA 4JJ6A 1YU9A 5CDTA 1JW9B 4CLEA 1ZW6A 4MVJA 3CVUA 2GEBA 1S2DA 2GAFA 4MS1B 4ZCTA 2JFYA 2HV9A 2UYOA 3HVHA 1ZJ4A 2QW1A 3K9GA 4WFQA 5K05A 1TKBA 3FOAA 3EA4A 5JCXA 4UATA 2R751 1IXSB 2UVDA 3LGXA 4JP5A 1Q7BA 1JILA 5DGIA 5IUJC 1PBNA 2QRJA 4D26A 3NHFA 4R9SA 3WL6A 2R5FA 2PLWA 2H4HA 4FT4A 1EZ4A 3VV3A 3HJRA 1EDEA 5GOTA 2N0SA 1J23A 4ZOLA 2FGKA 3O93A 2C4NA 5DNUA 1WTCA 1SVIA 5AKIA 3ZKAA 1YF3A 1FMLA 1HZJA 2OEPA 3H13A 3H5OA 4HXEB 4COKA 5IJ9A 1ISRA 2ZWPA 5CCDA 3MT0A 3PZBA 3GAZA 1LDEA 4PG6A 1ZMTA 5CCBA 3AI2A 1M6YA 3DD1A 4LY6A 2QTRA 1S1MA 4Q9LA 1BXGA 4RKEA 3JR3A 4RY2A 1E63A 1P17A 5FPTA 1QHYA 2IXTA 3LBNA 3KP1A 1CKEA 2WAAA 1ZMRA 3QENA 3UMBA 3WGYA 4CLDA 2BM0A 3A1WA 3BTOA 3LQRA 3CVVA 2R00C 3QELB 2XLCA 2OAGA 3O8OA 1BG6A 2BM8A 3GCGA 5KNDH 1GG9A 1OH6A 2ETXA 3BD7A 3PNYA 3M82A 3CNBA 1U80A 3V8RA 2QIOA 3NDIA 1V9CA 5JZSA 3G7SA 1SD1A 4MPRA 4UEKA 3STWA 4UMDA 5DCWA 5I9MA 4CUZA 2XCRB 1ICEA 1RXIA 4BJ5A 1RJFA 3FYUB 3LHIA 3NWEA 3P9QA 1CVIA 4I2NA 3OQHA 1U0HC 1XYGA 3UF0A 3ZZ1A 1BZYA 1FFWA 1ZSVA 2PSEA 4P32A 4X24A 2XWSA 3VHQA 3A2LA 3CXRA 1ZG3A 2X41A 3CB2A 1E9FA 2BZ1A 2C7GA 1UC8A 2IDZA 2J45A 3H0EA 3C85A 2SKCA 4PC7A 4OUKX 1OFVA 4FDUA 2W22A 3G0DA 1X2BA 3CX8A 3MRVA 2QXUA 1YDMA 2H0QA 4ESHA 1TO1E 4BUJA 2IS2A 4IOJA 1RAHA 5ILQA 4YPOA 2OHGA 2WSLA 5SZIA 2A9FA 5EFZA 2CYAA 2NQ8A 1HDRA 3LZDA 2IT1A 3OE1A 5IZ4A 4IGKA 4WXMA 3HKDB 2Q1UA 1GPH1 3V3KA 4PZ9A 4J29A 2Q3DA 5DNEA 4P38A 2IZOA 3DV0A 2FWNA 1CFZA 1Z5WA 2BEWA 3CPSA 4MYRA 5H3HA 2WV7A 3TRFA 5DBIA 4ALMA 4F60A 3EIXA 4E4YA 1JQAA 2VPWA 3CH7A 4ABYA 1NE2A 4XLTA 4Y0AA 3RT9A 3VDNB 2C2MA 2VHEA 3FPHA 3H11B 4NFLA 1FVOA 1U3CA 3VYWA 3EPLA 2GHRA 2J31A 1YHYA 2EP5A 3DBIA 2PIAA 2YYZA 4HLUA 4EYOA 2DBZA 4OYYA 1KZ9A 2HLHA 2QNRA 1BCSB 3JQ8A 1LF5A 2CDBA 4V0MA 2IELA 2XBLA 3GT7A 5JISA 5IT0A 1DKRA 3DEAA 4L76A 5E2IA 5MHTA 4L2IA 4QUIA 5DNDA 1BA3A 1XD2A 1JA1A 4XOIA 5HMMA 2XJ4A 4OSOA 5G1PA 5MFZA 4MRRA 1TM3E 3NI2A 3O4IA 2QLNA 4JB3A 4AKEA 3LV8A 2YW9A 4UCXA 3OQ6A 3TLGB 4FQ5A 1IOZA 2R6ZA 3T3GA 3VR6D 3G6KA 4DG5A 3NUQA 4FW9A 4M0DA 2CGEA 3JQEA 3TPCA 4RTOA 4Z6KA 4DG9A 5ALEA 2GJAA 3GJ8A 4CL2A 3O2QB 3VRHA 1Q83A 4LI0A 1G5FA 1RZUA 2JIBA 5EQFA 3UHJA 1EK5A 4CKXA 5JR3A 4GLFA 4J0EA 2QBYA 1F60A 1HYQA 1QVZA 4GOLD 3ILVA 4IIGA 1Y5MA 1Z6TA 4O1HA 4RHUA 5EYPA 2GBPA 4W5QA 4AIIA 3OX3A 4Z5XA 3H0CA 3OZXA 1TZMA 1WDKA 4FT2A 3SGLA 1F2UB 3LBYA 1EA5A 4XQCA 3RVRA 4ZVVA 3GFPA 3EEQA 4DJFC 2RK6A 3FGNA 3D4LA 2FSVC 4MLPA 3W6OA 2HF9A 3D5TA 4E6EA 4TYQA 4NI5A 5U4QA 3T3NA 4PG8A 1B74A 5A0FA 3FVRA 4DRXB 4H16A 3B9QA 1RWWA 3EASA 2CC2A 3F9CA 5IAEA 2NU8B 4LYGA 4BO6A 2Q6VA 3GT4A 2UYHA 4YCJA 4XJVA 3IKTA 1U7PA 2HRRA 2Y66A 3ZXXA 1R27A 2JF0A 4BMPB 4JBYA 4TROA 1GG5A 3FNEA 4CIBA 1CV2A 3H83A 3GJ7A 1P9NA 4CV2A 1DLJA 1LPPA 5K1ZA 2C0PA 3C3MA 4ZI2A 3WYAA 1UBGA 5FOXA 4KPYA 1UK7A 1YL6A 4CEJA 1VLHA 4I55A 2IY9A 3NAZA 5TLSA 4AQYB 1C9YA 2CNBA 2QSYA 2HXSA 2P91A 3I6QA 1JP7A 2QQFA 2IHVA 2F1HA 3GPDG 5JAOA 3V8VA 1S2NA 5LBUA 4Z7NB 3GRCA 2QUAA 2ZWVA 3R23A 1NI3A 5LM3A 2ZUBA 1RM4A 2CL7X 4II3A 5JE8A 4PO3X 4C6SA 4EATA 3D7MA 3JQBA 4N5MA 4OLFA 4ZYZA 2DJ5A 3C6YA 3EUEA 1W96A 3IVMA 3EZLA 2VA8A 1I7SB 1A9RA 3CEMA 5FUQA 4E1AA 3V2GA 2HSGA 4RX1A 1DO8A 2EQAA 5AKXA 3W5VA 5DYGA 4G81A 1SCUB 4MLZA 1DC7A 4OL0A 2X8JB 4ZT2A 3RARA 5EKDA 2FPOA 2YJTD 1CJSA 1FTWA 3HJUA 3I8SA 4LOLA 2XQIA 4S0ZA 1GV0A 1ONNA 1PGPA 2IIBA 1WDLA 3DBRB 4TWZA 3W3AH 5SZKB 4WFIA 2GFIA 1GCOA 3CFYA 5B6IA 4FMBB 2UZ1B 2WTMA 4P5DA 4ED9A 2GYWA 4JLDA 5JRZA 4MLCA 4JWKA 1GTL1 4TLCA 3V4RA 6AT1A 1GIAA 3CRZA 3PNKA 4MS3A 1YH3A 1HFJA 1Z4MA 2GRAA 4V24A 4X6LA 2XUDA 1CW2B 4XW2A 2ECKA 3HI6A 1TPZA 4B6PA 3PQ2A 4GO1A 4QFMA 2WC1A 2P2YA 2XTNA 1V6CA 2BHSA 4ZYVA 1FFHA 2WYVA 4P4NA 3LY8A 2C7QA 1RLMA 1MW9X 1Z29A 5AVKA 5A9RA 3EEOA 4WK4B 4QBIA 1TK9A 3Q1LA 5DEIA 3TMAA 3ZV4A 4K9RA 4L0CA 1F12A 1QFYA 2IITA 2HCFA 1U8ZA 1P62B 1X3LA 5BN3B 3PGXA 1OGIA 1P6QA 1P9OA 2BF7A 3N6RA 3QZUA 4ZO8A 5AQ1A 1YZTA 2P2DA 3LRXA 4GKVA 5KX5B 3K6SA 4GSKA 3U7HB 4FCVA 4BJ1A 1G8YA 4DW8A 4DCUA 1AXGA 1Z15A 3AY3A 1I3MA 4TV9B 2IU0A 2Q21A 5FYQA 4Z9FA 2BYTA 2FWPA 1QP7A 3AUYA 4KN6A 5CLGA 1OB5A 1WF3A 1PQ4A 2GPYA 3PD1A 4HLQB 5JZ9A 1C9DB 2HA3A 2C5FA 4CFSA 2OB1A 3FNBA 2HMUA 3L8CA 2BOVA 1NDUA 1L5NA 2PVCA 4B6SA 5ENZA 1EVZA 5KYWA 2HGZA 1YUMA 2JGRA 2H1WA 2FF7A 4F9GA 3ESZA 3SP1A 3BMNB 2NXJA 4QBKA 5FA8A 1K06A 3HJHA 3AM5A 3L6BA 1YO6A 4P4LA 1ADGA 2H4WA 5JSHA 2VJPA 1HNWB 3LU1A 3A6GA 2BMWA 1LPMA 1WAMA 1BQ4A 1XQ6A 1F8UA 2E3JA 2YJ5A 3FTCA 1QHFA 3ESDA 4RE5A 1S01A 4JXKA 4JI3B 1VHTA 4H4DA 4KE6A 1WQ4A 2XB6A 2AH5A 1Q2XA 1Y8CA 2ZRMA 3UTCA 2R25B 3GGJA 3MRXA 1TEXA 5CBKA 1U3UA 3RRZA 3WDMA 3DGEC 3WJ7A 2BJHA 4QHYA 4XR9A 1KPGA 1E60A 1G59A 4OYRA 1I3NA 1ZVKA 4OHRA 5JROA 2DYKA 2ZIGA 4MRAA 2CUZA 4FDAA 1ZH4A 4LXUA 2QVGA 2C57A 4LZAA 3T7CA 3S4YA 3UJBA 1WBDA 3AI3A 1VBFA 1E79D 3IFSA 3OIYA 4FD3A 3UHOA 1EZ1A 2AVDA 1E3DA 3HTXA 4DV0B 3WK8A 3NEJA 3DFFA 1H94A 1PFKA 2W6QA 4P4SB 4ZAXA 5HJEA 1N3IA 1HL3A 1RHUA 1B1AA 3ES9A 4IUYA 3RSSA 5IUNC 2HMTA 4C0WA 3A05A 2WPDD 2XYGA 2ZIFA 1SELA 3I39X 4IV5A 4DUGA 2JK0A 3V9AA 3N8DA 2OHHA 2ZJ5A 4X44A 2XUQA 1XUOA 1DAMA 3AHDA 2A9VA 3KB8A 4DLLA 1I13A 2PSJA 4H4EA 4RK1A 3JQ7A 2JEOA 1TE2A 3KXPA 4BYGA 3VR3A 1VKNA 3K32A 4FGJA 4KQFA 4W8OA 2H1RA 5CG1A 3DVAB 1GPNA 2BUAA 1Y5RA 4WJZA 4PX3A 4COOA 2NO9A 4EYSA 4JUIA 3SBXA 4KVFA 3FPKA 4HMQA 5JNTA 1UPTA 1WCYA 5B4VA 3EGWA 2ZIAA 3K4PA 3RS2A 3WBBA 4ND7A 3U31A 5LN1A 3LTNC 1EK0A 4F1WA 3SCZA 5SY4A 1OYVA 1ESZA 3NQ41 3V5NA 3O4FA 5A02A 3K8ZA 3T7RA 1GV1A 1PFUA 3GJYA 4RKWA 2BRUA 1RWBA 5JZBA 1WETA 2XZPA 4P4SA 1V7CA 4TPKA 2VWHA 4J9VA 2G8NA 2NO1A 3RBXA 2JJQA 3BRCA 4MAMA 1HURA 4KAXA 4U0KA 2RK3A 3BH6A 2ATIA 2MTBA 2JGDB 3NORA 4GR9A 1M2JA 2HLDA 3L7IA 2F48A 4B2IA 3X44A 5AVVA 2AOUB 1PV4A 1W5TA 1XAHA 3U60B 3HKBA 1P5FA 1V95A 4OSEA 4UHFA 4GOMD 3OIFA 5FBQB 4R2WA 5IJ0B 3QU4A 1EDBA 2C4MA 4E5MA 4D9NA 1TTQB 3UGQA 1VSQA 3C3YA 5I6DA 5GOZA 1ZGBA 1VDMA 2B7BA 4HJXA 4NCJA 3U61B 2CNOA 1KPHA 3PE4A 3OJCA 2QT0A 2ZYDA 1VE9A 4DMGA 5J1SB 2ZSIA 2O54A 1SUIA 2HAEA 2F9LA 3GN1A 4IDOA 1XTQA 2XDAA 1C1XB 3DMFA 4GT1A 1PR3A 3RIXA 4WZZA 4FFMA 4GZ6A 3PFCA 4CUJA 2GFHA 3C97A 4S2EA 3E2IA 3QKUA 3DUWA 3OUUA 1W1IA 1TVCA 2XV1A 3TJMA 2R85A 3WJ2A 2DXIA 5P21A 1MX9A 1USUA 1BDMA 3F4KA 1LA2A 3H84A 4TTSA 5CFPA 2VS1A 2FW9A 5D00A 3VDXA 1WXXA 2MSWA 1FDVA 1T4CA 1XFAA 2F3UA 1DTSA 4J4HA 2ZVDA 2GILA 3H5RA 4B46A 1YB1A 4BGEA 1EFPA 1HY3A 1WR8A 3L0PA 5JAUA 4O4LF 4CEHA 2REOA 4QHTA 5ICMA 4PLCA 4HN4B 1A7UA 3OY2A 2PUBA 4JJGA 4O59O 4KFUA 4RJ2A 1NN3A 2IYLD 4HOYA 2BCEA 3KOMA 2FQWA 2G9RA 3QPCA 1TDJA 1BEZA 4HEHA 4NMWA 4XEHA 4ZOBA 2H2DA 3OQNA 2BTQB