3L3BA

Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from ehrlichia chaffeensis at 1.90a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
210
Chain Sequence
LNSAVILAGCGHMDGSEIREAVLVMLELDRHNVNFKCFAPNKNQKQVVDHKKKESVGEVRNILVESARIARGSVYDIEQIRVEEFDMLVIPGGYGVAKNFSNLFDEDNDYILPEFKNAVREFYNAKKPIGAVCISPAVVVALLKDIAKVKVTIGELIDKMGGVHVDCPTIKSVKDDVNRIFSCSAYMRNDSLYNVYLGIQDMISSMVNYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Es1 family protein
publication title Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from Ehrlichia Chaffeensis at 1.90A resolution
rcsb
source organism Ehrlichia chaffeensis
total genus 71
structure length 210
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l3bA00
4I4NA 3TQIA 3D54D 3EN0A 1R9GA 1OY1A 4Y1FA 4E08A 1P81A 4P35A 2RK3A 1VCMA 1U9CA 2ZUVA 3NOVA 3MGKA 3RHTA 2YWCA 4R7GA 4E5VA 1P5FA 1BXRB 2YWBA 2V4UA 3CNEA 3PQ6A 3PQ7A 4XLLA 3SOZA 4P5PA 2WJZB 1QVWA 1I7SB 1A9XB 4P2GA 4QYXA 3UOWA 2NV0A 3F71A 4B5KA 1VHQA 2W7TA 2GK3A 4MGHA 1KWKA 4ENUA 4L8YA 4RKYA 3GRAA 1GGJA 4GE3A 3TTSA 4K2HA 1OX4B 1QVZA 1Q2UA 1S1MA 3EJ6A 3FIJA 1GGKA 4I2NA 4Y1GA 3NOOA 4MNTA 3P9RA 1KEEB 4Y0NA 1QWSA 1VCOA 4AUNA 1M6VB 3B36A 3B3AA 3WFZA 1T0BA 4ENPA 3TTTA 4B31A 4UCFA 2R1TA 2XF2A 4GUDA 5BV2P 4ENVA 2NV2B 4OQ4A 2IUFA 1GGFA 1PDVA 3UK7A 4B40A 1C3OB 3TTXA 2R1VB 3FSEA 1KWGA 1CS0B 2YWDA 1O1YA 4ENWA 1CF9A 2VDJA 3NVAA 5IP5A 1IPHA 2AD5A 1FY2A 2ZUUA 3UGJA 4ENSA 4UZSA 2GHRA 4N0MA 3EFEA 3SF8B 1GGEA 1PDWA 3EZGA 4P36A 1GG9A 3L7NA 3L18A 3OT1B 4OFWA 4L8WB 5SY6A 1C30B 2R1UA 4L95C 3MIIA 3PQ5A 3ZJ4A 4P34A 1G2IA 4ENTA 2FEXA 5SY4A 4S0ZA 2D7JA 4I46A 1CE8B 3BWEA 3N7TA 3TTYA 4Y1RB 3PQ3A 5SYAA 4AJ9A 1P7ZA 4PXYA 4BIMA 1OX4A 1PE0A 2ISSD 3B38A 3CZAA 3TTVA 4AUEA 1T36B 1SY7A 4D1YA 5K4AA 1OI4A 1L9XA 4OJYA 5JZOA 3P9PA 4UOQA 4B7AA 4LRUA 5E9AA 1GPMA 1J42A 1P7YA 3L3BA 2LXNA 1QF7A 1QDLB 3EWNA 2AB0A 2ZUSA 4UNIA 4AULA 3P9QA 1VCNA 1UCFA 4OGGA 3ZJ5A 4UOZA 1GGHA 3BHNA 1KXJA 4LGYA 3VU3A 2OR3A 3P9SA 2H2WA 4N12A 4ZDKA 3UJNA 5JZMA 1FYEA 2R1VA 1IZZA 2ABWA 2YWJA 2ZUTA 3M3PA 3ER6A 3F5DA 1QVVA 3PQ2A 4WINA 4L8FA 4ENQA 4Y1EA 3CYFA 4ZDIA 4QYTA 3TTWA 1I7QB 3SF8A 4ZGGA 1IZYA 2RK6A 1I1QB 1ONSA 2VPIA 3OT1A 3KKLA 4L7QA 1T3TA 2A9VA 3UMMA 2RK4A 4OGFA 1N57A 4BFLA 4AUMA 1WL8A 1SOAA 4ZDJA 4HCJA 3PQ8A 4Y1RA 4ENRA 5SY9A 4RKWA 1P80A 3PQ4A 3TTUA 1K9VF 5LIRA 4L78A 3NONA 1Q7RA 4JQSA 4MTCA 3L4EA 3R74A 1JDBC 3CY6A 2VRNA 2VKTA 1JVNA 1OX6A 2VXOA 3CZ9A 1OX5A 2R1TB 3R76A 3R75A 4ADSG 4GE0A 4B2YA 5DFAA 3NORA 4OIFA 2ZUWA 1PV2A 3NOQA 1GPWB 3ZR4B 4BTEA 1KA9H 4WXYB
chains in the Genus database with same CATH superfamily
1JBQA 1S6YA 2FW9A 2AKYA 1P45A 1TGYA 1OY1A 1R7RA 3WX0A 3KYJB 5K0GA 1MG0A 1BE6A 5HVNA 3HA7A 4BNDB 3B48A 1JQDA 5HDQA 5KYWA 5UKDA 4FX5A 2TSYB 2ERYA 3LTNC 4KXYA 3RBAA 2E1RA 3CNEA 4GWKA 2DFPA 2HV8A 4Z4QA 2QD4A 1Z4OA 1P9WA 4X1OA 1XRQA 4LX8A 1Y34E 2QJOA 2FF5A 5COQA 5C51B 4OXIA 4XGQA 3RS2A 1GNPA 4EYEA 4JLWA 4P31A 2V8BA 2PD4A 2AQIA 4XOUA 4RZQA 4LUCA 4QNRA 5DU2A 1RHRA 1O6GA 4C4XA 1Q2UA 4QJ4A 5T3UA 1TA0A 3VZSA 4Z1MA 2LVBA 2XMZA 5GWXA 2H6EA 3TW8B 2IPXA 3KVNA 3LRXA 2C2KA 4DPKA 1FS5A 3NFYA 5ITZB 1HFEL 4OHBA 4C2AA 3MUEA 3DUWA 3ETLA 5JNLA 1UJ6A 1L5LA 1A7AA 1H05A 3O94A 4HNRA 2RGRA 4P7GA 1VYVA 4QA9A 4XSGA 3G13A 5F4BA 2AXPA 2OZLB 3DMYA 1E9AA 3B9PA 4R40A 2EIHA 1PHRA 3QKSB 5KTKA 1VSVA 2LW7A 1M73E 4YDSA 1D6JA 3NKFA 2R6HA 4YRCA 1GL7A 1HZZA 3CO0S 3V6LA 4DB2A 1ZH2A 3EC2A 5HIMA 1RWQA 1BHJA 1W1WA 2UUPA 2V3VA 3O8OA 4L57A 3LY7A 5SY6A 4KH0A 1OVGA 3U26A 2VH2A 4KXFB 1JJFA 3Q6NA 4CV3A 1LPAB 2C4MA 3CLRD 1CYEA 4S0ZA 1E4YA 3PPIA 1XTKA 4MQ5A 2O2EA 4WVLA 2DXIA 3CEPB 1EM6A 1PO7A 1VIAA 1ZJ4A 4MITA 1O9HA 2HYDA 2PWYA 4OAPA 5JH7F 2H1IA 3PC2A 1VG1A 2PZFA 4AJEA 1NTOA 1G66A 3IEPA 3O8NA 2BSXA 1BMFD 2GYUA 5JARA 4O5AA 2JEYA 3C6QA 2C5EA 1RBQA 2HWXA 1U3TA 2Q3MA 2EG5A 4BN5A 1OVMA 4YAUA 2VAPA 3O95A 2QD5A 4PPFA 2QA5A 2D2FA 3FFTA 4M9CA 3AF1A 2AYXA 4XUEA 3R9XB 2OZEA 1Q7TA 5TQ0A 2Y0PA 4M36A 4P7BA 5D6OA 1H8HA 2C98A 2O2GA 1WETA 1WWKA 4A8JC 2G9NA 4EGCB 3LUHA 1IQRA 3OMWA 1BDHA 4BE7B 5AHXA 1WHSA 4D8YA 4LSMA 1KY3A 2E55A 3EG9B 2X19A 1A9TA 1YE3A 1E4VA 5FUYA 1GPYA 1LPSA 2BONA 3QBVA 5AKEA 3DFUA 4M1EA 3AIOA 3UQZA 4JSYA 5BRJA 2QJFA 5LXTB 3DBRA 1E1CA 4QE3A 4EZIA 2VT2A 3MELA 5EHNA 2WJGA 1LX7A 5SZHB 2QAGA 3RUAA 4CCAA 3TTUA 5IEJA 5BVHB 4YCBA 2KBFA 4MCAA 1NXPA 3ED5A 3TR5A 4WT7A 2CLEB 2DY0A 1YFJA 3OM0A 3LPLA 4XJVA 2ZEJA 1JA1A 1UMDA 5K3DA 2A5YB 2VS1A 1XMSA 3GA0A 4K1LA 1OKKA 5P8WA 3T5CA 4D3XA 2PMCA 3PNPA 5HS6A 3W6NA 2CMKA 3TUZC 6ADHA 2VT7A 4GR5A 4GIBA 3FYDA 1P0CA 4LXXA 4Z4CA 3PI7A 4HTFA 1Q0ZA 3GDFA 2WMDA 2YWCA 3GVXA 3IAAA 3O1HB 3TFWA 4C43A 3OX2A 2O8DB 1P74A 4JBHA 1D07A 1YD7A 1U6IA 1VIYA 4P5PA 1U0NA 3VU9B 4AKHA 2IOFA 4LY3A 3L6CA 1N5JA 4OVKA 4P4TA 2FWPA 2I62A 2PRKA 3GG2A 4ZVRA 2BE9A 4JI5B 5FPKA 4J07A 4K9QA 3N2LA 3DYVA 4JR1A 1JT9A 3TG8A 2WKRA 3P20A 4HQRA 1U2QA 3A27A 1OX4B 4BXOA 1TCBA 1JDBB 1VMDA 1VL5A 3RYTC 3GLIB 4Z3OA 2NZVG 1GD1O 1SVIA 3PF8A 1Z0AA 4BUZA 5JBIA 1XU9A 1HFJA 1G6HA 1K27A 1NLUA 1QWOA 3K0HA 4GXNA 4PNEA 5IBCA 2ZDGA 1TKAA 2A4KA 2R00A 3Q3CA 4YQYA 3WFZA 1USUA 3TTTA 3KKOA 4UFOA 1Z26A 4QQFA 3O47A 1FB5A 3QBEA 1THGA 5REQB 2GEKA 1DU4A 2I2DA 1Q1BA 4B6JA 3LC1O 5ICGA 2A0XA 2O0MA 2ZQ5A 4JH0A 4KXMA 4Z3DA 2DWCA 3V7YA 2HADA 4B6PA 2PRYA 4L4ZA 5K6AA 2ZT7A 3OFSA 5E1OA 1J22A 2OV2A 2R11A 4MWBA 5K9ZA 4I50F 4EEZA 1QO0A 3H2GA 4HWSA 2VYQA 4NBWA 1MXFA 2LUOA 4EF4A 3M8KA 4AJ4A 3QUSA 4I3GA 4E22A 4PFJA 1C30B 2HY7A 3H8VA 4UUNA 4JWKA 4WGFA 5ALYA 3RFTA 3TF5A 1TAHA 1ZGZA 1DBWA 3N2KB 3HJTA 5IWAB 1II0A 5B4VA 3IAFA 1VKZA 3CUEF 1ITZA 1CUJA 4D8VA 4L4XA 2HHHB 1PFYA 4CM8B 2ZU6A 3WRXA 4JLSA 2QL5A 3C5VA 1TEHA 3NTXA 3STWA 1UK6A 4Q3DA 3B1VA 4R01A 3BH6A 5DN6A 5AM0A 1IWPB 1K8YB 4LYDA 1XPJA 3CT6A 4R8VA 1I7PA 3RT9A 3V3TA 3I5YA 1WBDA 1V43A 1V45E 1X2EA 4P5EA 3SN6A 3LLUA 3D8RA 3BGVA 4RIIA 3TWOA 3WWDA 3RUEA 2GBFA 4R8KA 4C03A 5BURA 4WXRA 4OMFG 5FCDA 2BFFA 3INGA 2OO5A 3TGPA 4FIDA 1X1QA 3ZQ4A 2JFVA 1IDN1 2AQKA 2XOKA 3I04M 1T1SA 3QX8A 4DMHA 5KYNA 2BMVA 2GM9A 2BTQA 1ABBA 1XZDA 2VJBA 4Q9NA 4LWOA 5GINE 4Z9BA 2VJAA 3DP9A 4HPWA 1Z22A 5KYXB 3ENVA 1SHKA 1ENZA 3GLFB 5G4KB 1J23A 1NG9A 2VP9A 4G01B 3K0AB 1AVTA 3HM2A 4RKWA 4BP3A 3AJDA 4O2RA 4YTEA 1FDIA 1KMNA 4E0BA 2IH2A 4AKEA 3K2EA 1S4QA 4HUJA 3GDOA 1Z88A 3UG6A 1H9AA 4QSHA 5IABA 1E7MA 2VJNA 2JZCA 1SVSA 2ZTUA 1AHIA 4RM2A 2B34A 4EA9A 5AVYA 4Q7LA 3DOIA 1U7OA 3L7YA 1DC3A 3JD3A 2FF7A 3D9QX 4LMPA 3DBHB 5C1DA 3DV0B 2VK1A 5A3QA 3UJHA 2FFRA 1EB9A 5EZSA 1I7NA 2GILA 1H2FA 1FS6A 1SXJD 2DR2A 3K9NA 5IAEA 3JTEA 4OU5A 2V7VA 2FGKA 3DO8A 5B1EA 1JR3D 3EDQA 3O6VA 3GZTB 4C21A 2G76A 1HORA 3AL3A 2G09A 1GILA 2AC7A 2IS1A 1N8NA 1TQ8A 3R9WA 4DR6B 2IE0A 4RTOA 5KAMA 4PU0A 3AF4A 1KI1A 2IDJA 4MJLA 1MJNA 4ZOCA 1T15A 4EKGA 4KMMA 2FG5A 4QEZA 1Z18A 2FFAA 2NTYC 3A6ZA 1P1BA 1G9XA 2EIXA 3V8NA 2BFNA 3AUKA 2W83A 3JYHA 4OHWA 2DAPA 2NV2B 5FI1B 4K9NA 1FMLA 1MC8A 2B3DA 2IYAA 5E1MA 3GUVA 4L15A 3NBAA 3DTVA 1FS4A 1H94A 1PX2A 1RXUA 2E3JA 4B6SA 1MABA 3THOA 3BWYA 4JWTA 5IRCD 1RABA 1GU1A 2D3WA 2ZUUA 2FQ1A 1BMTA 3Q9NA 5JLAA 2XZOA 1ZC3A 3BB3A 4R3NA 1NF8A 4N0EA 3QKRA 4DJTA 3Q72A 1U0EA 4NCKA 1KY2A 3KQYA 4R5MA 1JEDA 2EWWA 4E70A 4E4RA 1U9JA 2IYTA 1M54A 2DC1A 3KVOA 4IZ6A 2EEZA 2ZQYA 3M2PA 3E1KA 1HXHA 4M8SA 1Q1QA 2YKGA 1O0CA 3FZYA 5I7RA 3ELYA 4RTPA 5JCZA 1FOEB 1KNXA 3VR4D 4FC6A 4HAOA 2W2QA 4F9GA 3OU6A 3CJTA 3KZNA 1W4CA 2FV8A 5FTJA 3F8TA 4AWBA 1WXDA 3AHHA 4PXSA 5B53A 2AOUA 4WCFB 5KINB 4AMYA 2HJGA 1JV2B 4FYPA 1R0RE 3WQBA 2H63A 3I6QA 2NSDA 2CGEA 3T5AA 1E4EB 2CD7A 4AJHA 2BDEA 4HTAA 3FOFC 1E1KA 2W48A 2FUG1 2P90A 3OCVA 3PLNA 4HO1X 4ROTA 4LXIA 4YN3A 2QPAA 2E4UA 4NU6A 1SXHA 2OXTA 4G3XA 5E4YA 3TCKA 5FD8A 1BNCA 3KUUA 2LKDA 1XI2A 1VSUA 1QQTA 2EARA 1S01A 4WKGA 3WZMA 1G8HA 3OUUA 4LYHA 5LNK1 4YAOA 2HSEA 3UH1A 4DUZB 3PXUA 2Y76A 2O2JA 2GN9A 3RUFA 4XWOA 1R64A 3DYBA 1UH5A 2G9RA 4HYQA 4B6QA 4ES6A 4DMLA 3HN2A 3IBYA 1PQYA 3N76A 5F3RA 3I61A 3QV2A 2GWHA 3ONWA 5DHAA 1HT1E 2IITA 4UBKA 3WGHA 1ATZA 4JC8A 4D0RA 4EJSB 1SBHA 4QIHA 3DO6A 5E2BA 3TLEA 3MWEB 1AURA 5DXAA 4M76B 4RZHA 1JE1A 2YCBA 3KEOA 5DFAA 3VI4B 4KGDA 4J8PA 4RV4A 3ES9A 4EY6A 3H3JA 1ULAA 5A6VA 3NEPX 4WJKB 5DSZA 3VNSA 1E0DA 3K35A 4ERNA 3MRSA 5ALSA 4K7JA 2WG1A 1I7DA 1U9IC 3F46A 3I6MA 4GVLA 1ZONA 5A7GA 3EEQA 3P2JA 5EFOA 2OHOA 3RLFA 4CMEC 4PSDA 2HGSA 2OGZA 1SCIA 5F5XA 5HK9A 5JASA 1NSYA 4QM7A 1CQZA 4LDZA 3FTFA 4EX6A 3DOEA 1TVEA 1XQ6A 2PBLA 3AL0C 3UAYA 4Z51A 3CPHA 1E5DA 3EQZA 3ZDQA 2YQ5A 1A8UA 2ZDHA 4QJ3A 3FFAA 4TQGA 3H65A 3ZZ0A 4JT2A 3ZWMA 4A1OA 4W1RA 1OV4A 3CNBA 3W1EA 4TKMA 3AG5A 2WB4A 5ENVA 1PR1A 1WCXA 3A1UA 2J30A 3P9RA 4FUTA 3KKKA 4PRKA 4TPKA 5KOJA 2NYVA 4KR3A 3EA4A 5GONB 1J24A 2AJCA 3H5TA 3LFHA 1HG1A 1T0BA 2FPWA 3WMGA 4HJXA 4HQOA 4ISCA 1DWOA 5BV2P 3OPXA 5B3JC 2OMKA 1X7YB 2OHXA 2APJA 2EGHA 1F0NA 3W79A 4Q1CA 1P7VA 1U5BA 1EHCA 1Y6QA 4ZO8A 2QV0A 3P2OA 5EAIA 5EMJA 3UK6A 1SKQA 2I3ZA 4RVSA 1UEIA 4ZGWA 1KIMA 4HLCA 1UPTA 4I5GA 5J1TB 3VXKA 4Q3NA 3E9MA 1YR3A 4XGRA 1KK3A 1VA5A 4U7WA 4XIFA 4O2AA 1G3RA 3TFOA 1MZVA 4GX2A 4J91A 1VBMA 3KSBC 4D56A 8ATCA 1RM5A 3V4SA 4D92A 5A3JA 2FWBA 4GEGA 3ZS9A 3GJ4A 2YMMA 2PZLA 4TV8B 3R0XA 3AK4A 4UNPA 5KX5B 1X8JA 1M7GA 3ESDA 4Q02A 4JJIA 1PL0A 1DJOA 4AQ7A 1VKRA 1X8KA 3SBDA 4EYGA 1DEKA 4MLCA 4JN6B 3RUDA 2UV8A 3DZDA 1POXA 1V48A 3PFNA 1UCFA 4XD2A 1NMEA 2H1FA 5E6UB 1MRSA 5F2NA 2R3SA 3BHNA 3ZWCA 3ND7A 3GL9A 3P9SA 5I4CA 3KJXA 4Y2TA 4WXEA 4AQDA 1URPA 3AVXA 4YJGA 4FW8A 5CLHA 1NPDA 3R7BA 2H9AA 1DAHA 1NVAA 4H3KB 2CSXA 4MOWA 2EFCB 2C2WA 3K1JA 3U7RA 5JQWA 4N3BA 3NTVA 2H2HA 1Z0UA 1V1MA 3QXCA 4HWKA 2FZGA 1FDVA 4ZO4A 2OYSA 5BYJA 4HGRA 3RSLA 3E84A 1Z13A 1T9AA 3LBAA 4YMVA 1FRVA 1WOMA 2VJYA 3WLAA 2I03A 2Y2UA 1YNSA 3PWTA 3MQ2A 4TT3D 4UJ5A 4PC7A 5J4VA 1GQ2A 3TNLA 1L1FA 3VNUA 1SU6A 5E1BA 3DW3X 3OQIA 3RRMA 2ECQA 2F3RA 3OC6A 2JLRA 4LXTA 4EHLA 1OGJA 3ELWA 1XPUA 1FSFA 3Q3EA 4JEIA 2O3UA 3TJRA 3P0RA 2E4VA 4RS4A 2FEKA 2X9NA 1GGMA 4ZAZA 2DHCA 4Y7CA 1KFKB 1CB0A 5FWDA 1WEHA 3ZHVA 4EP1A 2QLMA 2QMZA 4WXHA 5DJ5A 2F4VB 1E2PA 1GTL1 1XZIA 4NSNA 4UOEA 1KIAA 4HQLA 4HWPA 1W94A 2PY6A 2BMWA 4R8RA 4PZYA 2ZVQX 1CU1A 4XR9A 5EN4A 1R00A 3OQ1A 2VNSA 1LPOA 4LN1A 2Q29A 4B87A 2IGTA 5CA1B 3Q40A 1QS0B 1MGOA 1SCAA 2XLCA 1ODJA 3CUTA 1VE3A 2I80A 2IP2A 3PSAA 4H0FA 4TT8A 5T4HA 2FSVC 5AHKA 5JTTA 3A2NA 4IJ6A 1IEVA 4PICA 3NZEA 4MNTA 3I3OA 2LDBA 4YRKA 3AIKA 1RC8A 4WTOA 1M34E 2GYYA 3B5JA 4LX0A 3VHQA 3E18A 4DWVA 3VDRA 1U3UA 1OI2A 4ENPA 3C1UA 1NQUA 4J1NA 1JSZA 2R6GA 4UHJA 1DSSG 4IHKA 2HNAA 4RV5A 2VZ0A 3D6NB 2QMHA 5B58C 1OH6A 2BMAA 5EJMA 1Z2AA 2XMBA 3PIRA 3O2NA 1ZD4A 2PTHA 3JWHA 5H9WA 1E98A 1U2TA 2YBEA 2IV7A 1SN7A 3P4YA 3SF8B 1W46A 5TVKA 1K6JA 1EH5A 2RIRA 4P1ZA 4LF5B 3UPTA 2NU9A 4IG4A 5J2TB 1QUFA 4FUQA 1ZOSA 3WLNA 2IXFA 3EYAA 2WMYA 4Y9TA 3R5FA 4YGXB 3KT3A 3R5XA 4OQDA 1CQJA 3WNDA 3NBZC 2Y67A 5FTWA 2EJVA 2WIJA 4R05A 4AJ1A 2H7VA 3M5DA 1OXUA 2C5LA 4Q9KA 4D0NA 4MSUA 1G2OA 5FBVB 2JARA 1RYBA 1ZIOA 4UQPA 4XGIA 3ZWAA 1LPNA 1UIMA 2W11A 3RABA 4AL4A 4UNIA 4CF4A 3CX4A 1JNYA 4IINA 3VNBA 2RG7A 3ORFA 3AB8A 2WHYA 5CLJA 2VSQA 1MX9A 2UVPB 5K3SA 2MYNA 3LXUX 3K0KA 3SZMA 2Q49A 2QDKA 2XIQA 5C8YA 2P7HA 5FTMA 5LQKA 3KETA 4CM3A 1RWBA 3QWAA 4UCWA 3AEZA 4XX0A 2PSHA 5FFNA 5KJEA 5JALA 4PC2A 4DCMA 3M49A 3MOSA 4KWCA 4Y9DA 3RBZA 3K1ZA 2YY5A 3VKGA 3NVMB 4OB8A 1EP3B 2VDLB 2FN4A 2JVJA 5FV7A 3CT4A 3DMDA 4LSZA 1LDEA 1IOLA 4H0NA 3LZCA 1LS1A 4QOGA 5CTJA 1A50B 1D6MA 4YQFA 1HKUA 4MWGA 1VJ0A 1WXEA 3AEXA 3ZWOA 2KPOA 4PFSA 3EIUA 1B6RA 1N0UA 3OIYA 3KUXA 2H08A 2H2DA 1AN9A 1N2CB 2A6PA 4FHGA 1T6ZA 3FBTA 3QHQA 5LQNA 2JIQA 3LPAA 4JKOA 5CBPA 1U7XA 3DMNA 1BSVA 1FJ2A 3GGPA 4KAXA 1N7GA 4LWPA 3L0YA 2ZYUX 3IOYA 2BFWA 2H0RA 1YDFA 2XYRA 3DS8A 3L49A 3B53X 2OG1A 3LHIA 2WZCA 2IUEA 3PHGA 2CJWB 2GRJA 1RQNA 3AQIA 3H05A 5G1OA 4C0AC 3I9LA 1IRXA 4KWHA 2IXBA 4CTMA 4RK1A 1O8CA 3EA5A 3X1WA 1JUDA 4DNXA 3GLGA 1XEFA 3E35A 2XKAA 2WSSD 2ZYAA 2CLCX 4FT2A 4BO3A 4BQNA 3SG0A 1LK0A 3WWZA 2AFHA 2HCBA 2BBTA 3I6IA 5KVSA 4EM6A 1R0KA 1WP9A 4E31A 1FNSA 1EVKA 1I24A 1KK0A 2BEJA 3A2LA 3C24A 4I4IA 4BRUA 2ZRAA 2XUPA 3H5NA 3RIMA 3TTSA 2GO1A 4OSPA 3W5UA 4U2BA 4DZZA 2F8TA 1JMYA 1D2GA 5F7JA 1TVMA 1LU9A 3E53A 2IV3A 1JTEA 5AOAA 3B9RA 2P5TB 1OXTA 4BOYA 7MDHA 5BSGA 2VDNB 1YFZA 1LRLA 3HCAA 1VJDA 3OUTA 1VJTA 3GELA 1J0CA 1XMQB 2BLLA 4LVUA 3UMFA 5ER9A 3WGJA 2RARA 4H6PA 2M6SA 3PFCA 1YS2X 3CISA 2QYOA 3PUKA 5CM8B 3WMFA 1DV1A 4BAZA 5M2QA 1XEXA 1KWGA 2X7HA 4BN0A 2G70A 3DDWA 1FW6A 3TOXA 4H08A 3AEUB 1Q3KA 2ZS8A 2ZYGA 4N0MA 3COJA 2X5NA 3ZBQA 4BYGA 3K9LA 4X1KA 4CETA 1GG9A 1L5SA 3WS7A 4G81A 2CUTA 1QHHB 4F4UA 1RPJA 2JJ8A 2VF2A 5IT4A 1QE3A 3NEYA 2NZUG 4Q3BA 3STYA 2D7JA 3WHLA 2E37A 3M89A 3LUDA 3I1IA 1LXCA 1JKXA 5JDIA 3AF3A 5L45A 1J1ZA 3PICA 4AUEA 1E0JA 3DHYA 2C7QA 2FZ5A 1XD9A 3MBIA 4DVJA 2FUCA 3CIFA 1YH3A 3SC2B 2ZRDA 4LNHA 2FSHA 4IIHA 5EE1A 5BQFA 5L3QB 2C5HA 1EZZA 1RHQA 3LGXA 2ZR0A 3N2IA 1VSTA 1WU8A 4LYGA 1KHTA 4B3IA 2GCGA 4KB5A 1KC1A 3KU1A 4PCLA 1MO6A 1JSXA 5I9SA 4BNZA 5TIIA 3TNFA 3HO6A 5I5GA 1ZXBA 3KOYA 1KAMA 5A3SA 5IM4A 4MRAA 2FY8A 3WZ2A 4MDYA 3GRFA 4MRRA 1F1BA 2IHNA 4URVR 1RP7A 4EG8A 4MGYR 3OQOA 1FFXB 1UZMA 2W6JA 5JAZA 2ZJ6A 3I2YX 2CNLA 2O0HA 5ELMA 4R9UC 4BLRA 3RQSA 4X61A 5AI5A 4IF6A 3ZXYA 4YRBA 1JQJC 1VBNA 3AI1A 2FW6A 4U1RA 1NP3A 4J2OA 1E20A 5DHRA 4QOSA 4MUIA 5AH0A 3PZBA 5DM0A 3OZUA 1Q1NA 4FJ2A 2GTHA 3E9QA 3KXLA 1YQWA 3FPCA 3IJ5A 4P38A 4DILA 1YQDA 4MKRA 4W8GA 3KE8A 3UJDA 3R75A 4JI1B 4CN9A 3ZK8A 2OL4A 5LD2B 2I1VB 2GPWA 4HDNB 5B1YA 2OUKA 1NI4B 3TI9A 4CL0A 3UJ6A 3NJRA 2FPIB 3G89A 4DOMA 2LE0A 2AD1A 3PNYA 3PFKA 4YV2A 5IVPA 3RRJA 4EG1A 1HRDA 5T3YA 4KG7A 4PAWA 1F2VA 4JCCA 1TZKA 5CEJA 4LKRA 2ZE7A 1BQ4A 1L7VC 4KYIB 4TTQA 4CF7A 3GJTA 3BJIC 4Z4GA 4AS1A 3IL2A 5ALOA 3G2PA 4RJLA 3LM8A 5A7HA 3VR3D 4Z7OB 3KQWA 4U39A 3SZUA 4ESVA 3P0FA 1X0VA 1E2UA 1XAGA 3ZD6A 2OGSA 5HRAA 1EFAA 3C3DA 5TPWA 3ZOKA 5KU7A 2PZAA 2EKZA 1QIIA 2JFZA 1NLFA 5BT8A 1BE8A 3CF4G 1NF2A 1GUAA 1G6Q1 1RM3A 1GGKA 1NX9A 5FNVB 4LRYA 3CBGA 3PUHA 1XXHE 3WQSB 1NUUA 3OJCA 2RJ3A 4GNRA 1QRRA 4KFUA 9GPBA 3DZHA 4N8DA 3RYFB 1JFLA 4JV5B 1E2GA 1SJ9A 1EFDN 2QJWA 4PRLA 3OM1A 4BZQA 3AI3A 3QM1A 2BMDA 3I01M 4MVJP 2JLUA 3JQEA 5K8CA 1GKUB 3DZCA 5IEBA 3IDSA 2XHZA 2BKVA 4QQKA 1XL1A 4BNDA 4E21A 3BJZA 2AIRA 3ND6A 1HI9A 1C3XA 3K8ZA 3DGEC 2CCGA 1B15A 1B4DA 1NGSA 1V8OA 3CUYA 3CEMA 1WDLA 1XU7A 3QLVA 5KVQA 2QUZA 5KVVA 3Q8LA 2DGDA 3IV7A 4LF4B 4IIYA 2IHYA 1IVSA 1QVAA 4ZMBA 3FX2A 1R10A 2NYRA 2WK1A 4AN4A 5BW4A 3G7UA 1UJ2A 3LIPA 1SG9A 1R16A 2GERA 2PH3A 2XSZD 4U2DA 4YONB 5G0SA 2J59A 1UJBA 3CN9A 4IPTA 1YBVA 1EAMA 3N2GB 1YJ5A 2EHDA 1ACMA 3H2HA 1CZRA 4OTZA 3EVGA 1X87A 4DE5A 4DIFA 2MSDB 4TRMA 5PNTA 3TW8A 2O1XA 2JGKA 3KWLA 4L51A 3Q3GE 1RVDA 4I2VA 3IMCA 4EW6A 5ITZA 5E95A 1TC1A 3HCDA 4G1CA 3Q4GA 3Q2IA 3LK7A 4B34A 2PU7A 3JVUA 4P7JA 3WYEA 1ZH4A 4W9NA 3VU3A 5B6PA 3KLMX 2OZLA 1L4UA 4C08A 5C1BA 1JE0A 3QKSA 3OWXA 4NFYA 4C6SA 2QI9F 2XYVA 2P4QA 4O4LB 4OHXA 4PSVA 4BRZA 4YRGA 3C1TA 4REOA 1C9DB 1ORTA 1KH3A 3U4IA 3VBEA 2WTXA 3I83A 5FPYA 1QZUA 4HWTA 1JWAB 4D5GA 1J2TA 3H1GA 1X14A 3CV3A 5HKBA 1OXMA 2YZNA 3DCNA 2WWGA 3MUFA 4UW9A 4XTCS 4Y2JA 4W8HA 3HUTA 1F8GA 3FKSD 3NW9A 1AHNA 3W2EA 3QVMA 4IFTA 1RWMA 4W4TA 1P91A 1SVMA 4G36A 4UU0A 3QXJA 1D7AA 1DVRA 4IKEA 3S81A 3P5SA 3WG9A 1B76A 2I29A 4IIJF 3E2PA 5EYPB 1QVRA 1UDXA 3B12A 2PE5A 3CCFA 1GTSA 2VTDA 1VLMA 2DPMA 2HZ7A 2VWHA 1U11A 1DEHA 1HTBA 4FYXA 1RU3A 1NNI1 4GI1A 2CDBA 4KNVA 3KAPA 2BDTA 2GS9A 1EXMA 4E5UA 2FVXA 3DNMA 2I3DA 4LJ8A 5C8YF 4KYVA 5BWNA 4KAAA 4C5BA 2X86A 2OQ2A 3D8BA 1XRSB 3VHRA 3AI2A 2RGCA 1KF0A 5IKPA 5JJBA 2C8KA 3BA1A 2GOYA 4L0MA 4BVBA 4CDGA 3R9XA 3GLRA 2XJ4A 1I3OA 1I8TA 4V1CB 2VI5A 2DFDA 3HKBB 2C2MA 4KQJA 1A7UA 3V46A 1V3QE 3VVCA 4C1NA 3E82A 1DJMA 3HPRA 4UQLA 2V4MA 2R8PA 2G1AA 2XNDD 3EG9A 4OHRA 5T67A 4F9FA 4IDDA 4QYSA 4JITA 4MB2A 1RC0A 4WD3A 3PTLA 5LXTA 2QZPA 4FSHA 3DKPA 5KQRA 5BVHA 2FEWB 1XRNA 3U31A 2PRJA 4MIYA 2YVQA 4ZU3A 1UWVA 4ZQEA 1KEKA 3IEKA 4MV3A 1J00A 4RVFA 1YXMA 2HRCA 5E7IA 1X8XA 3TTXA 3RE1A 1BN6A 1THTA 5LYJB 2KLBA 4POAA 4D4KA 3VKVA 4ENWA 4ZQCB 1BMQA 2QRNA 4BNMA 1GWNA 3MFYA 3KTAB 3OF2A 5B2EA 4WBXC 4LV8B 2JH8A 1GTJ1 1FFWA 4LFCB 1Z73A 2O8DA 2AJBA 3PFFA 3QITA 4FFPA 2GM5A 4EHKA 1PQ4A 2EERA 3VU9A 4HAXA 4EWLA 1OB5A 3ZDBA 4OQFA 1O8BA 1I6LA 4GI5A 4OLJA 3DQZA 4R5HA 4R7TA 5JQGB 3IMGA 3LY9A 4ZCPA 2V9PA 5J59A 3GPLA 1T1GA 2A2ZA 3WZLA 1UBTS 4JBGA 4BGVA 3Q1KA 1HH4A 4MGKR 2PS3A 2XQIA 3OJEA 1LK7A 2PZGA 2BHSA 1ZN8A 1OX4A 3ZGYA 3G3EA 4DCVA 1AKRA 1SOVA 3GLIA 2WE7A 2N3ZA 1JVBA 3EH2A 1DQNA 1GCAA 2ZK7A 3SZGA 3L07A 2I9KA 1J0XO 4ARSA 2AUTA 1E1QD 2KQUA 5EIFA 3OCCA 3N59A 2ATEA 2A9PA 5TMPA 1GGHA 3T4PA 4D82A 4U2FA 2XCSB 1XJWA 1L3BA 5REQA 3KFVA 4PQYA 3GRCA 4QU0A 4W99A 4U02A 5L53A 3LUKA 1TIKA 1YZFA 2DKNA 2N47A 2IS2A 2CLLB 4KQFA 1C3JA 3TSWA 5JSHA 1QGZA 3HBMA 2I33A 3RYIB 1G21E 1TDJA 3C98A 1CDDA 2ENUA 5I9TA 2FOLA 3LYHA 4P81A 1YDWA 1C30A 2YC4C 2PMKA 3VKFA 3DE5X 3IP6A 3TFQA 4YCNA 3MBOA 4NBVA 1QMPA 1R4AA 3T12A 3GJYA 2QTRA 2ZIFA 3N2KA 4RHTA 4WOKA 2OHGA 3FOBA 4XH9B 1O95D 3E03A 3HHPA 4UTRA 2EOAA 5LZ5A 1Y1LA 3DC2A 2ZSJA 4IOLA 2G04A 2MCFA 4ZQFA 2ZB2A 4ARBA 5IU6A 2VXOA 1U31A 5CGQB 4G67A 3RFXA 3WI7A 4TYYA 2RAPA 3LCCA 2J85A 1CT9A 5BUSA 1SQ6A 1MNQA 4TVOA 3QOXA 1QLWA 1IN8A 3ESZA 4HNAB 3H5VA 4ZPXA 3D59A 2JI8A 1Q17A 3AVWA 2I6GA 5KOIA 4JJZA 4FJ1A 2F8LA 3GLHE 1R3DA 4YROA 3W1VA 1RKXA 2QW8A 1CIJA 1NZFA 1QBGA 1A9XB 4IO1A 3S44A 4AY5A 2IE8A 3F1KA 3FCSB 4GI2A 5IK2A 3MD9A 3FPGA 3L41A 1JYFA 2EL7A 3LK6A 1Y8QB 3H5AA 4RZ2A 3QWIA 5FQOA 2XNJA 4UHCA 2AC2A 3V2UA 4O02B 5KYXA 3WV4A 1QRAA 3GLFA 2WUFA 3AW9A 3QMPA 3E7WA 4HAYA 5G4KA 3TUJC 2HBRA 5FYDA 3K0AA 1IN4A 3THYB 1EFHA 2X4IA 4GMKA 2HHAA 1QYRA 3L8GA 2VZ9A 5DWDA 1ZYUA 4FS3A 4BWGA 2G5GX 3DM9B 3PDCA 1T4DA 4EI7A 3HWWA 5IDWA 1UXOA 1TEXA 2X0IA 3KR9A 2QRZA 3I6ZA 5SYNA 2XCRB 3OZWA 2DG2A 4QU9A 2P6RA 3WHIA 1RTTA 1U81A 2D0PB 5IMBA 4EUHA 4HDSB 5IDVA 1OV6A 1NYTA 2PXHA 2VDJA 3IPXA 4F8JA 5LOVF 5JMOA 2W2TA 3DBHA 1KERA 1K7SN 1PR6A 3FR8A 3DV0A 4LOJA 2IHVA 1AJEA 2C4KA 4LNAA 2WJJA 5F7XA 4ARIA 1AUXA 3AOEA 4B79A 1D2AA 2F3QA 2J4FA 3AJ8A 3QOYA 4HB0A 3U7QB 2I6XA 3FPJA 1KY5A 1Y8RB 2WVAA 3IBSA 4B0OA 3GQBB 3G1WA 3EVFA 2B4QA 1JKJB 1GPAA 4RNDB 2QN7A 5E9JA 4ZT6A 5LDDC 1VG8A 1ZKMA 3LLVA 4BPRA 4JOSA 3VMMA 1UEJA 5L4NA 1NUAA 5HA5A 4DYHA 3C3PA 2BHLA 2Q50A 3KVVA 4H1VA 3LBYA 5FLYA 4ME6A 4FYIA 3HS3A 4DR3B 2CFTA 2XDYA 3T35A 4ILKA 2C5BA 3O8RA 2Y99A 2W4MA 3EYWA 1RRKA 4WK2B 4YMIA 1R6VA 4PFKA 4GM0A 2IV2X 1XRJA 4UM5A 1IATA 3FNBA 5CFLA 1YZUA 3H2BA 4NONA 4JJ6A 4M0DA 4AK9A 1L5VA 3R77A 2VDMB 1GKLA 3C48A 4LMAA 3R3SA 4Z9YA 4C88A 3T7KA 3D8SA 4DSOA 3ONEA 4X62B 2GCOB 4HMQA 4QATA 3RIHA 3BX1A 4MHSA 1Y6RA 1W0JA 2CYBA 2ZKLA 4UBLA 1EVIA 1PL6A 1XL0A 1QG6A 2XE6A 4PGMA 1Y1RA 5EJ7A 3P1JA 3ONDA 2H0QA 2BY4A 4BLOA 3PDUA 4KWEA 1UOOA 3WL8A 1IG3A 4EBBA 3WA7A 1SBTA 1VL2A 1ZUWA 3OI7A 4DSUA 4ER3A 2FMTA 1YONA 6CHYA 2VCHA 3DAOA 4QG7A 1NVUQ 4NAVA 1JDTA 1CERA 1Y1TA 1P1RA 2DECA 2P8JA 5KCMA 3ZVNA 4F7WA 1A82A 1ZEMA 1HL7A 2E89A 4M86A 3RVDA 5C4IA 1F3OA 1ZN9A 1DG1G 1Z9BA 2H2IA 4WCFA 5CG1A 5F51A 2JFPA 2DJ5A 1CKEA 2VHJA 1TL7C 1RHJA 4BV2A 4PC3A 3TQIA 1E4EA 2BGJA 4GLFA 4H17A 4YCJA 5BW5A 3WYAA 3O2JA 5E38A 3CVWA 1IHYA 2VHYA 1JDUA 1L7NA 2VPWA 4L5AA 3D2CA 2PL3A 2XNHA 4R2LA 3FYUC 5DGTA 5F73A 1XCJA 3GEEA 1HV8A 3K09C 3U4MA 4BZZA 1CRPA 4KQCA 2CXOA 2C2OA 3H2SA 3ICVA 3F6EX 3N5CA 3W4IA 1RE1A 2EBHX 4AY3A 3FE2A 3WGUA 1NYLA 1EFKA 1FP4B 1JR2A 2QP4A 2YZKA 4MAMA 2B1IA 3JYLA 4HSEA 1C80A 1TOAA 3HU3A 4ZEVA 5KQGA 1N33B 4QNMA 1GRVA 2JW5A 4CCYB 1ZAKA 4CLEA 3K6JA 2XYHA 2BSAA 5EXEA 5CCXA 3OMLA 3SSAA 2IBMA 1AZWA 4HN4B 4HT3B 4I8DA 4A2QA 5L3SB 4XIGS 3EEIA 3MWKA 1QV7A 1Z5UA 2NZ2A 3BILA 4EJSA 1BMDA 3G0HA 3CLUD 1EZ1A 1WKVA 3MWEA 3PXBA 1KAHA 3VR5H 3NGLA 4NMHA 2Z3VA 4ZOQI 1X7WB 1KK2A 1Q6ZA 4HNHA 5FOUA 3HKCB 3HXQA 1VPTA 2WUVA 1T24A 3KXKA 1V8ZA 4O2BB 2CB9A 3VC3A 2WBLC 3RASA 1VXOA 1FTYA 3CSDA 3E9ZA 1CF2O 3E5MA 2O6LA 3UIEA 2YX1A 2R4UA 1D03A 1MV8A 2V6JA 2VHWA 2ZB8A 1P1JA 2ZYVX 3E1GA 3L9WA 2AN1A 4OBWA 3SHQA 3CG4A 3WJ2A 2UZ4A 1SCKA 3E61A 2KW5A 2W8ZA 4NCAA 4UUAA 1UJMA 3ANMA 4DB4A 1IONA 3LL4A 1IBRA 4OSOA 4G0MA 5ALGA 2CF5A 3FJOA 4LE0A 821PA 4H16A 5TS3A 2JBAB 3FCAA 3I9OA 5E7MA 5DLYA 5LXTF 5JSZB 5KNBD 3FROA 1J90A 1D9ZA 4R6WA 1T4CB 3T94A 4YHHB 2PH7A 1ZU5A 1ORHA 2VRWA 4H6WA 1P2SA 4PLPA 3OZFA 4NS1A 2H3HA 2IIVA 1GPH1 5GONA 4A0GA 4MCIA 4DQDA 2V45A 3PT9A 1LB1B 3QOFA 4RFVA 3KOXA 5CVEA 4OQQA 2XWPA 4MKXA 1KJ8A 3LT5A 1AGNA 1OU0A 1WG8A 1X7YA 1XE3A 2WUWE 2ZYWX 1HC7A 1JQAA 3PFBA 5AW9A 3ZX5A 7GPBA 1Z4KA 4BFSA 1M1ZA 1XZCA 3F5DA 3M3PA 1MEJA 4TSRA 1VIMA 2XBLA 3FVTA 3A9CA 1LEHA 1XRRA 1ISRA 3AF2A 4FSDA 4WNCA 2OLKA 4L6IA 4XRGA 2OP1A 1JZQA 4GBGA 2J45A 2PWAA 4I6GA 4OY3A 1OFUX 4MUXA 1RPTA 2D1TA 3O4FA 3G0DA 1QP0A 3TDNA 3I45A 1IXRC 4ZQIA 1LVGA 2X2OA 1E79A 1ODCA 3SJCA 4KYTA 3ZCSA 1MAAA 3GHHA 4TV8A 3VC7A 1CP2A 4N65A 1APBA 3B3QA 4GLLA 5LPNA 2XD9A 4K9MA 4PPGA 3HXOA 2YJGA 3EVDA 2R6CA 1DNPA 5AMXA 2VRNA 2WZQA 2VQSA 1E9BA 3UCFA 2DERA 4GGMX 1GLVA 1BDMA 1PV2A 1ZOOA 2HUPA 3P45A 5GM2A 2HOQA 4CKWB 2DQYA 4QECA 3TYXA 4INJA 4HXGA 2OT3B 5AI0A 5E6UA 1QJ4A 4OP1A 4F92B 2W43A 4Q03A 3ACDA 2OAQ1 3ECAA 3BWMA 3RCBA 2Q4DA 2QXYA 2MIIA 5AJXA 3MTBA 2ZAYA 3JQ7B 1JLMA 5H70A 2DPLA 4ETWA 2FQXA 3ZX4A 4FR2A 4KW7A 5FPTA 2NADA 4O3FA 1G19A 3K92A 3JY6A 2XZTA 1KRXA 5EQTA 3HDTA 5ALMA 2KYRA 3UPDA 2I8CA 1Q1EA 2AG0A 2JH9A 4KP7A 4MKZA 3B9QA 2FFHA 1U6JA 4MVJI 1M8KA 4UAVA 1HSOA 1KBQA 1PEDA 5LDGA 4X44A 2C0CA 4UHFA 4NZOA 1GGJA 5BOVA 3TJZA 2C29D 1EBFA 4CODB 3IIEA 4V39A 3HA2A 2B6HA 3ZK7A 1CJUC 1NR5A 1V5EA 3IDOA 4H7IA 3O8BA 3B36A 4MP8A 2OPHA 3RV3A 1R5JA 4YYEA 1N34B 2I4LA 5ILOA 1R6TA 3FFXA 3KP1A 4K6OA 2K4MA 4F2DA 1EDDA 4Y8VA 2XF2A 4YA6A 2B6NA 4KAJA 1VYUA 3ME5A 4TLDA 4WW0A 3KTDA 3KXDA 3KXIA 5JROA 2V9CA 2BEKA 2AKEA 5LKRA 2Y66A 2YRXA 5EIAA 3FUUA 5F52A 1XLTC 1X9GA 4EVQA 3OU7A 1L5YA 2NLOA 2J07A 4F5EA 4WV3A 1LJ8A 4NFLA 2CE7A 4MUBA 3H6GA 5E3JA 3AQ4A 1OR8A 4N8SA 1U2ZA 3TRDA 1W581 3UM9A 4OBEA 1COWA 4UBJA 1Y7LA 4TL9A 1EKXA 3KBOA 4ITVA 5FIUA 4RLFA 1T2VA 2V7QA 1QS0A 3U7IA 4EVIA 3O2SB 4N3GA 1E6WA 1P7ZA 4EFNA 4BECA 3CPEA 2CUNA 3D43A 1JXMA 1SKYB 4F4IA 4E2XA 3C7CB 5JY1A 3IS3A 4NQRA 4B45A 5A05A 2J0EA 4E5YA 5AM2A 3DHVA 2IUUA 2FMXA 1MPXA 1QF7A 2ATCA 3E5RA 2IEDA 3ZCXA 4KDEA 2AR0A 1FP2A 4II2A 5I7EA 1CS4C 5JCJD 4MEBA 1IHXA 1I3MA 1FMFA 3L1VA 3K5WA 4OQNA 3U4GA 4IG9A 2ZWPA 4IIBA 3SR4A 2VSNA 1JPJA 3M6XA 3TKLA 3NHLA 4MW9A 2FXVA 4ZVSA 2NUAB 5HUJA 1FQWA 2JCYA 3SKVA 3K30A 3SF8A 2R7MA 1FU8A 1GGNA 1ZA1A 1FXUA 2B25A 3NHJA 5BNTA 1PQWA 4EHIA 5IDYA 5J2TA 4PG7A 3F3MA 2AI3A 4J0CA 1MFZA 1AF4A 4RFLA 1IAVA 5JJCA 3AXTA 3IKLA 5KQSA 1R74A 1QRDA 1X9IA 4GKAA 3PENA 4PANA 5TPZD 5EIEA 2NZ8A 4EX7A 1BQ3A 1Z8HA 2CXXA 4FILA 5AQ1A 3TL3A 3LX4A 4BKQA 1LY1A 1V9LA 1W29A 2OV8A 2XCQA 4RCZA 4WKBA 5HMLA 3OQMA 1T34A 2BGRA 4G0OA 3I92A 3IAS6 4ND3A 4L6CA 2KBEA 1JG7A 2QROA 1N6LA 3CH7A 2WM8A 3QY0A 5ECWA 5ESRA 4B43A 4AX4A 4BN4A 5KSPA 2UVPA 1M5RA 3FZEA 2CLMB 1ARZA 3X2EA 2C92A 2ID7A 2GN8A 3QLVC 4FGKA 2QUHA 1VGQA 2ZB4A 3IXMA 3DBIA 5CVUA 3AKEA 1YUNA 4MJ7A 4Y6LA 1C7ZA 1F0YA 1H3FA 3FGPA 1HEUA 1BXGB 1TJPB 3GJ7A 1NW9B 4G5OA 5E4JA 5H59A 4JMPA 4ZHSA 2HEIA 1QIHA 4PX3A 5ILQA 4RDCA 4MS4B 3Q5EA 4NZPA 4XDGA 4H7DA 3I42A 1E9SA 2ZI5A 2RGXA 3KKEA 2OGTA 4LGVA 1A9RA 3AU8A 4JASB 1G8KA 3SJZA 1N2CA 4A6DA 1H4VB 2JIDA 2Q4TA 3O1JC 4JP2A 2V7TA 1W0KA 4R2XA 4UTNA 3OFND 1LTHR 1VYHA 1G3QA 3VH4A 1ZWKA 4JD5A 1NE2A 1YIOA 2G9VA 2JCGA 3LFTA 3NH6A 1FMCA 5C8XA 4IQ4A 2X3YA 4XUDA 5F21A 2F4NA 5JRDS 1GCGA 1EXDA 2F62A 1U2DA 3IYLW 1YIDA 4DDVA 2JKVA 1U3WA 3NP9A 2TMKA 3KB2A 1KPHA 2IW3A 1NATA 4PQGA 3U62A 4Z7JA 4XUCA 3WNQA 1TVKB 3I2JA 1BDIA 4HQ0A 3G0IA 3JWJA 5IXSA 1M2VB 1E2IA 1QHGA 3R0VA 4PYLA 1YAJA 1OFIA 3GJ6A 2XDAA 5J63A 1C8VB 5EZYF 1BVUA 2E0IA 3S1LA 4O0MA 1OHHA 2Q6LA 3G7NA 1XIVA 4PYQA 1ZK1A 5A9RA 3HEMA 4ETMA 4NDNE 4F46A 2DYKA 1P8AA 3SVLA 3A25A 4KIGA 3WYCA 5YASA 3SYTA 1E6LA 3DV9A 2FZ4A 4YRTA 5BW8A 2J5KA 2EXXA 2OTCA 1NC1A 1ZVVA 1R0SA 1T4BA 2LKCA 4YRFA 3I05A 1FFGA 4IIEA 3D6UA 3KWMA 3KXPA 1QO7A 2WT8A 1QTIA 3A6DA 3JPWA 3MLAA 4QAQA 1CUFA 2IPLA 5KVAA 1LBIA 1EK0A 2PIDA 3OHPA 2AB0A 2R7KA 4AZVA 1EU1A 1K5DA 2QR3A 1TCVA 3LQ4A 3GJ8A 1Y3AA 3GPBA 4YMWA 3BXGA 4QLAA 5JC1A 2E4WA 3AV0B 2BUAA 3GH3A 1JXAA 4IGEA 4M0UA 4GQIA 4GL2A 1GT6A 1KYQA 1LW7A 3UFBA 4MUJA 1M0EA 2FRXA 2A9JA 2PEZA 1MIHA 5EGSA 5HFNA 3AEUA 2FG6C 3JQ8B 1Z8DA 1MAUA 5DNYB 4D8WA 2BGUA 4HBGA 3DSRA 5DBGA 2C1EA 1ECPA 3BBPA 1QHHA 3KZCA 1F20A 2FWMX 4JLKA 2X5KO 3VAAA 1YDMA 5A6SB 2BD0A 3TLZA 2GRAA 4YAFA 3CVOA 2PAFA 3IOCA 3GPDG 4X5OA 1Z25A 4XD7A 4BJHB 1RWPA 5LIRA 4LV6A 2AOWA 2W2PA 5HBGA 3KZXA 4MULA 4BQOA 3NYIA 1TTHA 3QPUA 3OOJA 4HR7A 3G0OA 4ZVLA 2C00A 3TXXA 4JYMA 3SC2A 4EMBA 4PQFA 2AYZA 3QPDA 3ZXXA 1XSEA 5L3QA 1SUAA 5LB2A 3IV9A 4PVDA 4N41A 1LBEA 4B2LA 5H3CA 3T95A 4N4AA 4MQ4A 1KYVA 3OF5A 4GPTA 5DULA 1ANKA 1E9DA 1JB9A 3I9V1 4IM7A 1XXLA 4EKEA 3U44B 1P6UA 4C0LA 1VCMA 4QKQA 2WICA 4XJXA 2RGWA 3W0LB 3KZKA 3C3WA 4YUZA 4DA7A 1PVOA 1RQRA 1XTSA 3D6VA 2ZRCA 5B3KA 4ZGBA 2Z6AA 1ZBQA 1YS1X 4OQXA 1EFRD 1T8PA 5EMNA 2JGRA 3IVCA 4BMNA 1TZCA 4BHTA 3HJCA 5FA6A 3PWSA 1PFQA 4HN2A 1EHIA 3ZY4A 4B3GA 1FFXA 1EX1A 1ISGA 1PFGA 3HJUA 3NOXA 4KUEA 3V7NA 2ZIXB 1K89A 4DM7A 4DCJA 3TMAA 2ACEA 2I6UA 2HMWA 4EPRA 4TV8F 2N0SA 3T15A 4IMIB 1K86A 2X77A 5ARCA 4EO4A 5KX5F 3U3KA 4PY2A 4IWYA 4G0ZA 3V9PA 2NXEA 4I2NA 4PLFA 5GZ3A 1YS4A 3I2HA 4J0JA 1KAOA 4E11A 3TD9A 2EVWX 3L7IA 3GY0A 1QWSA 3CLHA 3N0XA 4WA7A 4LQ4A 4CM5A 3G5TA 2EW1A 3VPCA 1EP1B 4K28A 2FPLA 1C7IA 1I0IA 3CLKA 2HYIC 1V7QA 2I54A 4XB6B 1AQLA 1CZKA 2OHHA 3I6YA 4HDNA 4QUJA 2V5AA 4WDRA 1C3OB 1NI4A 1ZUHA 2DULA 1G4HA 1Y48E 2ID4A 3G9ZA 5FBKA 1E2LA 3WISA 2FPIA 4DLAA 5LFAA 1M76A 2FEAA 2DFNA 3EPLA 3DVRX 1FY2A 4RY2A 5ALFA 4C7MA 4L1KA 2B37A 3N0WA 1UR5A 4WRRA 4B76A 2Q0QA 2XA1A 3TNYA 3WKAA 2XGSA 3TL2A 4E88A 3CM0A 1ZPDA 4EYKA 5EMKA 5H80A 3ZK9A 2SKCA 2C31A 2JFBA 3B1KA 1AHPA 1SZDA 3C3JA 5IVDA 3X44A 3PTAA 1YB7A 4RZSA 2JGJA 2GCPA 1KI4A 1BWQA 4PO8A 2D54A 3WLKX 2XQKA 1HPLA 3G5AA 2XXAB 1P1KA 4C78A 3T4XA 2C9CA 1VHJA 1UBOS 4EMSA 2WC1A 1REQB 1XMXA 3HBAA 2HIGA 4R2JA 3N8HA 4RBNA 1L4MA 1HFKA 1PYDA 5FNVA 3WV5A 1Z0JA 2R8XA 1NVVQ 4TXHA 1H1TA 5TSDA 4UOZA 1RJDA 5KPJA 2C4NA 5AK6A 3RYFA 5BRAA 4GOND 2ZSAA 3COSA 2DKFA 3DF9A 3DFKA 3E6AA 3R5SA 4F3CA 5HSGA 1T5TA 4CMHA 5BV0A 3TJMA 1M6WA 4EL5A 2ZJYA 3CWCA 1EXVA 3WLLA 3DPSA 1AQNA 3J81A 1M0SA 3QEBZ 3PR3A 4MQMA 1SEPA 2GDZA 4H4CA 5CB4F 1PTJA 4OXXA 5A0VA 4KGZA 3R3XA 5G3ZA 2HLDA 5H68A 4KSYA 5JCPA 1WCV1 1OBOA 2O1WA 4JHLA 4ND1A 3ZHRA 4DDTA 3ZNNA 3GZJA 1HYEA 2CXSA 4IL5A 5EHZA 5K8VA 2GVZC 3I9MA 4JLBA 5CA1F 2Z5GA 4YAWA 1GNTA 2OAEA 2OCGA 3N2GA 4ATNA 4DCPA 3IEVA 3ISJA 3NC4A 1P9NA 5FTKA 3L4EA 1S2LA 2YWFA 1XX6A 5JSKA 5JAUA 3G8DA 3E3OA 1RYZA 3R76A 5L7YA 1TNDA 3A9WA 1RWOA 1Q0LA 4C4TA 5AOCA 3N8DA 5I7AA 3OQ6A 4TMZA 4IOKA 1QV9A 4XEHA 2ZW9A 4M9QA 2HCJB 1J5PA 4WNYA 4R0MA 4I9UA 5K8IA 1ZCBA 4G1BA 2IWHA 4A2WA 3RODA 1G42A 3N8GA 2OZKA 3CNNA 3UMSA 3ETEA 3F6SA 3C7DB 1JEQB 1XZ8A 4RSHA 1XDGA 2V4UA 4O4LA 4D9CA 4M0CA 1JKIA 1QGOA 2J9FB 5F12A 4Z9AA 4QDOA 5K0LA 1P73A 4BFTA 3SWWA 1WDMA 4RD0A 4ZT5A 2OYRA 2IF0A 1RWXA 3KZOA 4RD3A 1BJRE 4BO2A 3NGMA 2P8SA 2C9ZA 3FDIA 4YUYA 1WMBA 2J7PA 3UXMA 2YZ7A 2FUEA 5I7WA 5EP1A 3ICPA 2WTUA 2RH5A 3USZA 1TKRA 4RAOA 2ZJFA 1OBFO 4HK4A 4YFYA 5AK4A 1XRMA 2HK6A 1RAEA 3IJEB 1ADJA 2CNWA 3M5WA 3NOOA 4FDTA 1MC5A 2FSIA 4KRYA 4RL6A 4B4WA 4DS3A 4D9BA 5EYPA 3U5ZB 3AR2A 2VVTA 3WGNA 6AT1A 4WLOA 1TMOA 2P78A 1CQWA 4RPJA 2VHUA 1SCDA 1GGFA 4PQRA 2F1HA 3KQUA 3IVAA 4COKA 3VYUB 2W5UA 5D1NA 2CW5A 3CA8A 5L3VA 5CTAA 1YC5A 2XQVA 3MSCA 2XW6A 4TL6A 3M4NA 3DR3A 2INGX 2PGLA 3F1LA 2BJWA 2EP5A 3OEHD 3DKIA 2HA6A 2BGLA 1N6HA 2E6KA 1T43A 4IX1A 4XB2A 5DYWA 1YK0A 3TR0A 4V1CA 2PKQO 5D86A 3H9QA 2IEZA 3HKBA 4ROSA 4YLEA 5D3ZA 3CRMA 3PNVA 5TGTA 1HYBA 3NTRA 2VP2A 3T4UA 4UHHA 1F9AA 3JQPA 2PV0A 3U3JA 2VPQA 5KTPA 2GFQA 2XMQA 1Z2DA 4MYRA 3R7FA 1NSTA 1UZUA 2WAOA 3HXPA 1VP9A 3I2FA 4Y2GA 4ZZ2A 5EXXA 1AT1A 3S68A 4ALLA 3HYSA 5LQSA 2PMEA 3BDAA 3PWZA 1LK5A 4LE1A 2IXAA 2G1PA 5SICE 3B13B 4N6GA 1ZM3A 2B5OA 2Z57A 1A88A 1LLDA 1CEXA 2ODWA 2Z58A 3BJEA 3IVRA 4CT0A 3UPUA 1QPZA 1DJNA 2NQ8A 3L6EA 5LYJA 1UFQA 1F2TB 3ZHSA 4EPXA 4UAJA 4A0HA 4OREX 3VR5A 2TMGA 3LOQA 3KTAA 4NL4H 1IULA 3O74A 4V0LA 5EY5B 2IP1A 1X92A 2VSFA 1DWQA 2G17A 1B1AA 2H29A 3PFIA 4GKVA 4MVJH 4TM8A 4QL3A 4ZVNA 2F67A 4J7CA 3UMRA 1VKOA 4WECA 3R7AA 3ITKA 4JI8B 3AH8A 1ESNA 1VI5A 1T3TA 5JQGA 3P9CA 1J7JA 2F3PA 2RK4A 3TLJA 4ZHQB 1NBEA 1HE1C 2ZUFA 1RI3A 4B5LA 3WL6A 1FE8A 2J0UB 5HCUA 4KX5A 3MMPA 2Q41A 3L77A 1BHO1 1SC4A 2P1DA 5KNLA 1ESCA 4MWDA 1PR0A 1EDBA 3D0QA 1D4FA 2GD6A 3RM3A 3W5VA 3D4BA 2ODTX 3MHTA 1MQAA 2WVGA 2XADA 1XZEA 3WLIA 4JLUA 4BQRA 1ORDA 1NHWA 3PDJA 3M1AA 3WGYA 1QXSA 1WZ2A 1X0XA 5CYPA 5ESXA 5TARA 2C2ZA 1PSWA 2H31A 3H6KA 3KQPA 3H2IA 5L7WA 1OZAA 3EGVA 4KKXB 1KZ4A 2QM8A 1PR9A 4MV6A 3F7TA 3H04A 2IRWA 3KUCA 3MPOA 4KPUB 4BMSA 1T9ZA 3CEAA 4JLNA 1UKZA 4NKRA 1PJQA 2NWQA 4OA8A 4UMFA 3WTBA 3EW9A 3PNOA 3UK0A 4N1AA 5B57C 4X71A 3RYIA 4DANA 1DLIA 1S2NA 4MIEA 3PNBA 4OKIA 1KSGA 4O6VA 4XUGB 1J8DA 1E7RA 3OPVA 4J4HA 1T2UA 1Z62A 4FB4A 1Z6QA 3IUNA 1JU3A 2CXUA 2HBQA 4JELA 3C97A 1W8IA 3IAM6 3G79A 4K6GA 5JD6A 2GT1A 5IASA 4QQRA 1H4QA 2DF8A 4DMRA 2JNWA 4MWTA 4OXQA 4TXJA 4P83A 1D0SA 4U6NA 2RE8A 4FYYA 2AL7A 1VJCA 2QE7A 3HJAA 4HBZA 4R3WA 4EW3A 3CW9A 1JZSA 2JJ1D 3TI7A 4UBNA 2ZREA 1JZTA 2JEOA 3EODA 4HNAA 1YL6A 5FXMA 2A33A 2IYXA 2IXEA 1FNCA 1YI0A 2AW3A 3T34A 1TF7A 3TSCA 1AQYA 3GC6A 3OUZA 4FONA 4NFSA 2AKAB 4RFSB 5DCYA 4UZSA 3DKRA 2FFJA 3DR5A 3H18A 1ICIA 1IN5A 1R6AA 1UODA 3IIJA 3P9YA 3PGKA 4GRAA 4Q7EA 3NHRA 4RZUA 1OIVA 3V2IA 4E2ZA 1A9XA 3SR0A 2C0PA 1M8GA 4K9SA 2I8LA 2QQEA 5DM2A 3QEOA 2PQMA 4C6TB 1DZIA 2HMAA 1NN3A 2ROQA 1Y8QA 2NPFA 4XAQA 4GECA 4LXUA 5L3ZA 1NONA 1DIBA 4DJAA 2Y1CA 2Y27A 2J0SA 3KV1A 4M99A 3JZIA 2L17A 1CY8A 1MD9A 2Y4OA 1UM9B 2CBZA 2IIPA 3THYA 1FFBA 2OBXA 3OZIA 5DTRA 1E94E 2ZWAA 4OB7A 1KRWA 2OV4A 1DQRA 2HFKA 2JIZA 2ZROA 3G0BA 1TW3A 3L3BA 4MGEA 5CYOA 5AJVB 1PQPA 3WHPA 2NW6A 4C4YA 4Z1MD 3PI6A 3ND8A 1OU4A 3I2IA 3UMJA 3QTLA 4QBHA 4WX2B 1ZJYA 4N12A 4B6EA 1QQ6A 1PLJA 3AYZB 2UYHA 1K7CA 1V95A 2Q2VA 2W6CX 4B3TB 1INLA 4KQGA 2Z8XA 4HDSA 4NF2A 2Q3BA 5DCLA 1OTXA 4DT1B 1AGYA 2WD9A 3PUZA 4XDYA 3AVYA 4YBRA 1W4AA 3KJIA 3OZCA 4ARUA 2DHDA 1U04A 1J0AA 2A67A 3U7QA 3VPHA 1Y8RA 1YE8A 3KQTA 3USES 3GQBA 1YJQA 1JKJA 1U28A 4JUAA 4CR6A 3AIIA 3QYJA 2YFQA 5CLLA 2FQYA 3Q9LA 1CPYA 1Q1AA 4GRIA 4RLQA 2R68A 3S7TA 4AP6A 5GOZA 1GAEO 3O8QB 1QM5A 3D2BA 1FTNA 5FNVF 3GO4A 4IS3A 1VA4A 3C5CA 1RCUA 3I5UA 4L8LA 1V1JA 4WLFA 4K3UA 4K9DA 4DEVA 1S3SA 5HF9A 5LIPA 1E60A 2WM9B 2GD2A 1RLTA 4PRZA 3T5GA 2O8FB 3AWIA 4UNQA 1U8EA 1LBQA 2PYZA 2VF5X 1Z36A 1ZITA 1I2MA 2RHJA 4JQYA 4M46A 4LVCA 1AQIA 3T5PA 3TEMA 1U7HA 1N4DA 2JIOA 2PZ8A 3L7KA 4JAVC 4JUFA 5AKHA 4LXGA 1JJIA 3A31A 3RK0A 2K7FA 4KHPB 9ABPA 1CUBA 4IEFB 2GCOA 3DOJA 3RVKA 4PSKA 4GDMA 1MO4A 3G02A 5LU8A 4FI3C 2I4MA 4A2CA 2O5RA 4B84A 2XUKA 3HK2A 2HSDA 3M6WA 4K5QA 1H8HD 4CG1A 5MN4A 3V97A 1CHNA 4RKYA 1CETA 4H60A 4W5NA 4H1WA 1ZA2A 4Y2YA 4JVSB 1SPXA 4DLNA 1U1FA 4OGLA 2GPBA 3AOGA 4NE9A 3IGFA 4Q24A 2GCIA 1V6SA 3LXMA 1OYYA 1SCUB 2H5JA 1JU9A 2VXBA 1UBLS 1WVMA 1ADFA 3JZMA 4LG1A 5ALPA 4AJKA 1CDOA 1L7QA 4C1BA 1JDNA 3BH0A 3WGZA 3HA3A 2CMFA 1J8FA 2A1UB 5H0IA 4DZRA 2OOKA 3KYCB 4HEJA 4LRWA 5DOVA 3WIEA 5D7BA 1DRKA 2BGTA 3ZZMA 4EW2A 1NP7A 1PFKA 2Z09A 2IELA 1WAMA 1J7KA 1O1YA 1CF9A 3IOBA 3KHUA 4LJ7A 3GEBA 4L9RA 2AD5A 3TXYA 2EJBA 1K68A 4BKUA 1J9EA 3UMCA 1A27A 4M87A 1N32B 4O4LF 4O4HB 3F73A 3FZNA 1MIOB 1F5NA 1FEZA 4R69A 3HBFA 1I2BA 3HQ4O 5TJ9A 1CUZA 1RYYA 1VGVA 3NHYA 1YTUA 1ZNXA 4XWWA 1YULA 3QUBA 1S2GA 1RAAA 1FP4A 3JATB 3KK0A 3W2HA 2M6RA 8ABPA 2VT3A 4NZZA 4RKFA 4NPCA 1SPBS 4QPNA 3HN6A 4JL5A 2P68A 2DE0X 1A9PA 4CCYA 1J39A 1AXEA 4B3DA 2OEPA 2GCEA 1PJRA 2B1JA 5AKGA 5L3SA 3QKUA 1X8LA 2JC3A 2ZXFA 1YTLA 4EHNA 2J3IA 3WO0A 8OHMA 4WLEA 1RYHA 3I73A 5TT1A 3S28A 3U48A 5AXBA 4V0QA 5DYTA 3AGPA 1DPGA 1Z6ZA 3H5RA 5DSTA 1X7WA 4IGKA 2DCMA 3HKCA 2RBKA 2BGIA 4O2BA 3N9IA 1KY4A 1NDQA 1BFDA 2XUGA 3QSYA 1MDBA 1DBRA 4HQ6A 3A26A 4O2LA 3I9KA 3MJEA 2A57A 5E7QA 5JATA 2F7SA 1V3TA 2AI1A 1AHHA 1RWWA 4QELA 5GGYA 3UQYS 5FADA 4B73A 4CRWB 3VR2A 1CJVC 4TKUB 4AAYA 1TRHA 4NPHA 1GPUA 2NTVA 3N74A 1QO0D 1XTZA 2ZR7A 3C3CA 3N0VA 3ONNA 4BV8A 4BFLA 5A5GA 3GYGA 1Z29A 3MWYW 2JBAA 4HB4A 4OXRA 5DGCA 4CR8A 4IX9A 1XQ1A 1YRAA 3HMQA 3NDIA 4GEKA 3Q41A 4JIGA 3LH5A 3V80A 4LBYA 5JSZA 2O19A 1AQJA 2EKQA 1W59A 1T4CA 3DMHA 1KR5A 3DKKA 4ND8B 1JBKA 4PG5A 3RVRA 1NQTA 1A9ZA 3IUSA 4CWAA 2M9MA 1EFVB 1KBOA 1E7WA 2BSQA 3IEMA 1OA1A 3W78A 3DVLA 4UZEA 4LYYA 1N2ZA 3N2YA 3PJEA 3R3WA 4QAJA 1OZFA 1YRHA 2PBZA 4B4KA 1U3VA 5DN6D 2WY2D 3UBMA 1L7EA 4UD2A 4N7JA 5FBLB 5J43A 3A36A 3WIBA 1UBSB 2WJPA 5DNUA 1WNTA 2QUKA 2HRRA 4QJIA 1G6KA 4YQEA 1I6KA 2I1QA 2R8EA 4BGUA 2P4EA 3AFNA 5I45A 4G0QA 4A16A 2B35A 1ZH8A 2ZIVB 4IV0A 3LZ6A 2VPZA 5BN3B 2B8NA 3GRZA 2VWQA 2XOEA 2D3TA 3L05A 5JQGF 2W6QA 4PR3A 2PX8A 2B4YA 2R97A 4D3YA 1ESZA 1XN4A 4S1NA 2QT0A 3ZHQA 1S1MA 3EJ6A 5FJJA 1JAXA 1OLSB 1LKZA 1SMKA 4B4DA 1RI4A 2HXYA 1XTJA 2WJHA 2GKOA 3QELB 4HEA1 1TQHA 4IQ0A 4M7WA 1RR6A 1B7GO 1M2HA 2ZSHA 3ANYB 2AVDA 1N1DA 1WS6A 3RC3A 1PYOA 4F5YA 4UTVA 3CZMA 1ORRA 3GAFA 3L7BA 5B2ZA 3UMVA 4B3HA 4EDFA 4RMNA 5D3KA 4CKWA 5FF9A 3NBKA 5CH5A 1UKCA 4PO1A 1T2NA 3KKNA 5B7NA 5C8ZA 3WK5A 3KYIB 5B64A 1NX6A 2ZP1A 4C5AA 4DSAA 1NQOA 3WRYC 3NBFA 4EZEA 3FH0A 1JG4A 2W6NA 4ZKDA 3JQ7A 3OE5A 3R8FA 4HXFB 5DHPA 1AMUA 3II6X 5DEOA 1YGPA 5BR7A 3AY0A 3ILXA 1HQDA 1M2JA 3HLYA 2I6FA 3NYRA 4NAUA 2Q2OA 3RRYA 5HBRA 1SZJG 3U56A 3B3GA 1HEYA 2VK2A 2ZRIA 3ECSA 2C5SA 3ENQA 1ACJA 3FPFA 4BQPA 1EFLA 4M1OA 3L8MA 2ZJ3A 3FCYA 3FCEA 1C9MA 2FA9A 2GAFA 4NIMA 4QRHA 4BO9A 2J0VA 4UBOA 4RK4A 3RSOA 4BLWA 1VB3A 4C04A 5CDTA 1XO1A 2QRLA 2GXQA 2FMKA 2ZSKA 4ZOLB 5E3IA 5E9AA 4ZIRB 3PRYA 3QU4A 3Q87B 2YIMA 1GZ4A 1CD5A 1UBHS 2AZDA 3CCCA 4KUGA 5HTOA 1IWOA 4FOOA 4XSHA 4LFBB 4C01A 4U7TB 2CLSA 1KRHA 4HFNA 4QXAA 4I4CA 1A69A 2Q9BA 1FL9A 3O91A 3ROKA 5I4BA 1YMQA 1UQRA 1R18A 3R7NA 4X92A 5K0NA 1Z0ZA 1RM0A 3G17A 1P2BA 1XHLA 5U9CA 3F3SA 3I28A 2GLXA 4HVCA 3UHPA 3I76A 4QGSA 2VA8A 5CJPA 4KVFA 1ZM9A 3DTVD 4PWZA 4URZR 1KDVA 1BEEA 3VGJA 1ZRMA 1KDPA 3V6MA 2GNOA 3TSYA 3EZLA 5BSKA 1ATIA 1PN3A 1MNAA 3UMMA 1W88B 3KZ1E 2QSZA 1MAHA 3M1LA 1CZOA 1DFHA 2HK7A 2Q5OA 2ZB7A 3ZI0A 4H27A 1L4HA 2GN6A 2HHCA 3OIGA 1KZHA 5M3BA 1ZNWA 1FXWA 1MJFA 1Y7HA 1Y7PA 2HIAA 4AY2A 2WP0A 4DBZA 1L7AA 1ECLA 1XAIA 2P9BA 1IBCA 1L5MA 3S6JA 2VSXA 3PCTA 2O2SA 3GZ4A 4TKZA 2O1SA 4OHYA 4OMDA 2OK8A 5DKFA 4D9IA 4GVPA 1VBKA 4FN5A 3UT0A 3AR8A 3FW1A 4NYMR 1EVZA 5DCUA 4CG3A 4R1LA 4PHFA 2WJ6A 1MBZA 3QMVA 1L5HB 1JPVA 5JNUA 2NVUB 3H4MA 1QGDA 2CVFA 1PR2A 2Y05A 3O7WA 4EB6B 2NUAA 3SYKA 1A97A 1K7EB 1JEJA 2FRDC 4GO1A 5EEGA 3W90A 3Q85A 5CD9A 1PVVA 4HS4A 3TLCA 1DL5A 2BCJQ 2G0TA 2QX9A 3LHKA 2XKJE 4FLEA 1RCFA 5IKMA 1RFLA 1JSRA 1E6KA 1EK5A 1L9KA 1IY2A 4M0KA 2HA3A 2VC2B 5AVRA 2B4TO 1X7HA 4TMXA 4IUYA 1VPLA 1NJSA 2AJTA 1EI9A 1FLAA 1KEEB 2E18A 2Z2YA 2F9FA 3PGVA 4X00A 3V8MA 2H1VA 3EXIB 3R6TA 2RHDA 2YVLA 5H9VA 4MYTA 3ROMA 3RAPR 4MWEA 1J0EA 3GP5A 4BDTA 1F9EA 1HDCA 1OBHA 1PT6A 2HTEA 3BMCB 3EOAI 4KMSA 4RESA 2IZ1A 2XRYA 3AKCA 5JHGB 1TJ4A 1UUFA 3ZW8A 2D4HA 4DIEA 3CQ9A 5EKUA 3R7WB 3TQTA 3PNKA 1DO0A 4G4IA 4GICA 3KHTA 1UJ5A 4ALNA 2NUPB 2CL6X 2IEAA 5EI5A 2OM6A 4TRNA 2NVOA 3HL0A 1UDBA 4IRMA 4DHWA 3A0UA 1ZGAA 3FHCB 4QFBA 2ORWA 3UUFA 3V5NA 1K7FB 1M2NA 3RVBA 2P2DA 4FU0A 4RLHA 4AQYB 3KOUA 1J2JA 2W8BB 4OJKA 3K1AB 4ON9A 1BXGA 4J6EA 4JUIA 5AOVA 4BNHA 3W5CA 3KPJA 4QJBA 4MS4A 1IBKB 1RXEA 1AUVA 2BPOA 4DA4A 1UP6A 1NIJA 1N8KA 2Q4OA 4M54A 3SC6A 3WGQA 4DMGA 2D2IA 1GN8A 1Q2XA 1XQYA 2J3JA 3M9XA 4G5YA 4PGGA 2XUFA 2WPNA 3EMKA 4RE6A 5ULLA 4BNKA 3LP5A 4TRRA 4S2EA 4B4UA 1J21A 5AK5A 1QMGA 2RGDA 3NEJA 1VRWA 3P0HA 3T0FA 1LNQA 2H2WA 3GCDA 3PVSA 4J76A 4LDNA 4XCQA 1LRJA 1FFEA 2NZYA 4MO9A 5F7ZA 5K1ZA 3VO1A 3W5JA 2E21A 4ACBA 3E3NA 4URFA 1YRWA 4JP1A 4D3FA 6LDHA 1TEZA 1TVKA 3OCYA 4A8HA 4KXLA 1K92A 2D5BA 1M2VA 2GDJA 4LZNA 4N6NA 3I64A 2I78A 1EVLA 4DLRA 2XCUA 2FPMA 3RFCA 5BQ3A 3N3AC 3ANLA 2ZWOA 1BCRB 1LZKA 1K97A 4I8XA 4QC2A 2FK8A 1NZDA 1VPWA 1U8AA 1BKSB 4HPJB 1FP1D 2GFIA 1FYXA 4BO5A 1WF3A 2P9ZA 3GRRA 4J0FA 1N4AA 3VJMA 4L5YA 3UWSA 2WKPA 4GBJA 4FPXA 1E3TA 5PGMA 3IELA 2IHKA 4LHXA 4YR7A 1HNNA 1NN0A 2OD9A 3NH9A 1D9XA 4ZVVA 4LRXA 4AROA 2GVDC 1PGNA 3OM8A 4PZ0A 4XM2A 4JUCA 4CG2A 2A59A 2DPXA 1KEWA 4OIFA 2VJDA 3ZN2A 2JEZA 2HK8A 1KA9H 2YW2A 1WUKS 3MRTA 2I7XA 2AXNA 3KT0A 1PUJA 2ZGVA 3BPSA 2G9QA 4QTZA 4QO7A 4P3YA 1EUDB 2MDTA 2PNJA 2TMDA 4TYWA 3IH5A 4U7GA 5JZVA 5CVVA 2GI4A 2IZZA 2FCRA 2VAWA 5MFZA 4PV7A 3FY4A 3KKQA 3ANNA 3EUWA 3EQ9A 3OZRA 5IJWA 1JYEA 2ZJ1A 3MG9A 4RF4A 3FSRA 4RACA 1ISIA 2G77B 2H07A 4JP3A 1HT3A 2JFWA 2PKRA 1L5OA 2Y6VA 1X70A 4UDXX 5GJVC 4UFPA 5JR3A 5KTNA 1I5RA 4MVJA 1G55A 3IQWA 5DH9A 2H5EA 2HA2A 1QVZA 3V2HA 5A6SA 1GNLA 3CPSA 1SHZA 4Z4IA 3CF2A 1MRNA 1QOPB 3QVVA 3PHJA 4O8CA 5DLEA 2VUUA 3DEZA 3QE2A 5KYTA 4RXMA 2QV7A 1M6VB 4AMUA 2H2AA 5ICCA 3V34A 4KPGA 5TS2A 3BDVA 1ZL0A 2C7GA 5TGZA 2XEXA 1HDIA 4LMBA 4YT2A 5DI3B 3C6MA 1M34B 2ZULA 4U9IS 3FMVA 4CI0B 3ZVKA 3ASYA 1DP4A 1WNFA 2B0JA 3HDHA 4FXOA 3U16A 1PG2A 4EB0A 2F2TA 3V7FA 4P5DA 4UUOA 4KPFC 2ALJA 2H85A 4QQ8A 3RKRA 5J4YA 1IN6A 4DYVA 2Q0HA 2B1QA 3CVJA 4G1MB 3AIMA 1Z5WA 1R4ZA 2A35A 2RKOA 5T4BA 4P3XA 4FOPA 1IIRA 1EJ2A 1Q0RA 2OZPA 2ZYDA 2G25A 3I0ZA 4K26A 3I4LA 2ZCVA 5BT9A 4A6XA 7MHTA 1M1XB 1W85B 2PUGA 2XPCA 2ZIXA 4BO1A 5EMLA 3ADKA 1ISMA 3OX3A 3K5PA 2QYHA 1OWMA 2AFIB 5AW2A 3JU3A 2J3KA 3ZIDA 3CUVA 2FSUA 5HOEA 4Q7MB 2QP9X 2ZYRA 2EKPA 2QVZX 2DT5A 3RVPA 2OAGA 2X40A 4YJ3B 1B43A 4RM3A 1DADA 1J42A 1GPMA 2Q4EA 2LXNA 1NJ5A 3TO5A 4BKMA 1KU6A 3G85A 4NJMB 4Z54A 4J1SA 1P72A 3X1KA 3ZLBA 4JLVA 3DG9A 3AKZA 2C5AA 5KTSA 1C3OA 2A14A 2FWNA 4BVGA 2QTLA 5FTLA 1KFCB 4M0LA 4DQKA 2EFYA 4KHZA 3N05A 1D4OA 4TGLA 3NIFB 1FPMA 1U1DA 3IERA 2EQAA 3Q2OA 5DLPA 2PV7A 3C8HA 2OA0A 4HNVA 5M04A 2ZJZA 2ZTVA 3RS0A 2C7OA 4P08A 2O3TA 2O57A 3DDOA 1ZH6A 1MC4A 2Z6VA 4KIJA 3BIOA 3KT8A 3QFHA 5I7FA 3U39A 3TSOA 1JIXA 2CHGA 1L5WA 1ZS9A 4G8CA 4RJIA 5AXDA 1FPQA 2Z4SA 4GW3A 2BZ1A 3LCRA 3EX7C 2PLWA 4HL6A 1TQ6A 3EOBI 1SOAA 4BZWA 2XXAA 3MNFA 1AUPA 3FNEA 4N5NA 3PQ4A 4M38A 4BVLA 3KLBA 2GJSA 3LY8A 2C58A 4FCVA 1MB0A 4O29A 1RC1A 1REQA 4E1VA 1BX1A 4BLSA 5L7TA 1UXIA 4GE0A 3RJMA 3U1TA 1ILEA 1ZNQO 3VTAA 4D4HA 1WCWA 2YN0A 4OMUA 2GNPA 2GSWA 1K4MA 5DK6A 2J9ZB 3EN0A 1F7UA 5TB5A 5KJ1A 4RXTA 1AKVA 4GUAA 2C59A 1KS9A 2VBFA 5CEEA 2I4RA 1OI3A 4I0WB 3BCUA 1PCXA 4K9PA 4Q39A 3BK7A 1JR4A 3L1IA 4KRFA 2YNMA 5LZ8A 3ZE9A 1KJ9A 1AM4D 3WK7A 4C4ZA 4RHYA 2BR5A 1U9YA 2HPVA 1W7AA 2HUNA 1E9EA 2IY9A 1T8SA 3QWBA 4DDWA 4YWJA 2PDAA 1QZ3A 3L84A 4IBOA 2IYYA 4DR1B 3U09A 2RHTA 4PTLA 4A3SA 3CURA 3RC9A 4YACA 5KSZA 1P2DA 2FW8A 4ZCRA 3GDHA 5KOYA 4OK3A 2W0SA 4D9EA 4EZBA 2N42A 3WDLA 1RMTA 4QGGA 3QVGB 1MB3A 1OAOA 1T9KA 2BF4A 1NT2A 2FPUA 2GZ2A 3D4NA 3IUJA 3KS9A 4JZKA 2VWPA 4MUKA 3U6BA 2UZAA 1F7VA 4TYQA 4HDAA 1MVNA 2WB2A 5ALKA 1UFOA 2WIGA 2QX4A 2IU3A 2YCLA 4OQ4A 1RSZA 1E2FA 1U80A 4QICA 2Q5IA 1KYTA 2YL2A 1U7WA 2F9LA 1M75A 2VHVA 2Z9DA 1GG2A 1L7DA 1ML3A 1OWPA 2G9ZA 4LBWA 4LTMA 4Y7DA 5E6RB 4J0KA 4J2HA 2ZI6A 5LA6F 3RS8A 1C3VA 3O1IC 2HSJA 1B0ZA 2LDXA 1CY7A 3ET4A 3MQFA 4W5HA 2DH6A 5K6RA 3DKVA 4W6QA 1UXKA 2FKNA 4UEJA 1JEQA 3NAQA 3KJQA 3TKAA 4MRNA 5GM1A 3AM3A 2BM8A 2F3TA 1FBNA 2J9FA 3H4VA 1NP6A 1QIMA 3D8NA 3PYLA 5FTNA 2QLJA 3NT4A 1WSDA 1IUKA 2DFLA 4I50B 5EKXA 1U28C 3D2AA 1SU8A 4IZOA 3HU1A 5FR2A 5SY4A 3T3PB 3ZQUA 3PJFA 5AVVA 3T4EA 1SC3A 1T0HB 5SZIA 1U4SA 3B2QA 4X20B 5EJ9A 1SUFA 4I8IA 1C50A 2RGYA 3CRZA 3H8SA 4KK4A 4D02A 2QD2A 1JJ7A 3ELBA 4P80A 4XIJA 1U2PA 3K5HA 3VZBA 2OBLA 2NZWA 1T9HA 1A2QA 1C4OA 2QGZA 5A3VA 3HBLA 1BEZA 1KJJA 1E77A 5EZQA 2G6TA 4FMDF 5KKNB 1O6BA 3B1XA 2BM0A 2V6GA 3JWGA 4XVQA 3UHFA 3PFGA 4XASA 4R1MA 4KR6A 2JIPA 3AM1A 2JIBA 1IZZA 1KMHB 3KIPA 3EDCA 3ROXA 3JRNA 3TPCA 3P71T 3M1IA 2W42A 3NM6B 1R6BX 1NJFA 1TQ2A 2FOIA 3TMKA 1AS3A 1IM2A 2YZ2A 2ZPAA 4QYTA 4B35A 4XCVA 1QO9A 4MARA 4CDNA 3G5MA 4F1JA 5CDSA 3ZBTA 3E7DA 3TBKA 4CT5A 3AHGA 5LZ7A 3QHAA 2Z56A 3DH0A 3KKLA 5JMWA 4R4JA 1JLHA 3U4QB 5EVJA 4PTYA 4C0SA 4ZRDA 1SBNE 4FGZA 3HBNA 1UPUA 1Y4ZA 3EXHB 4HX2A 2ZS7A 3FUTA 3PUXA 2IW1A 2CUKA 1VKJA 4X7MA 4L78A 3W9SA 1XCOA 4KQIA 2OCPA 4UBMA 3L4JA 4MHTA 1MX5A 1QV6A 2AR9A 2VTEA 3B2NA 2VKTA 3PE6A 3X2FA 1TZMA 2R6DA 3TOZA 2BRUA 1Z5PA 3C85A 3Q0IA 4K9RA 1ZXXA 4DF3A 2YFYA 3UANA 3MT7A 1UK9A 4JNCA 3ENWA 4RGYA 1YNOA 1EK2A 3BTSA 2H17A 1KO5A 1UPAA 1UAAA 3MERA 2VRCA 2R6FA 3L0OA 1Y1QA 4Q15A 1N92A 2BOVA 3HEAA 3ZW7A 1I0ZA 2CXHA 4YRRA 4L4SA 3RTAA 2ST1A 5TNXA 2RBGA 1JHYA 2HRZA 1E96A 4IEIA 2YR0A 4TTPA 5T4FA 3V8EA 2FP4B 4HRXA 4N7RA 4COOA 3A8TA 1QX3A 3A6GA 2BDUA 1UBUS 2ZWMA 3I2GA 2XGMA 3OG9A 3QJ5A 4Q1BA 3WLSA 3PB3A 5DOZA 1RFGE 1YAHA 2BM9A 1YCFA 4JVMA 2W6JD 4ZHQA 5BSEA 1A1SA 4KK3A 1EFUA 5JCOA 1VLLA 3JX9A 3OOYA 4DC1A 2J0UA 4G6ZA 3F0TA 3PZRA 2XBMA 4JOCA 1QP8A 5FR1A 5WRFA 1I6MA 2VUTA 3ZHCA 4MQFB 5JEDA 2DETA 4ZT3A 4HGNA 1KQGA 1CV2A 2P79A 2C03A 4RVCA 4WHMA 1CJTC 1XZNA 4P4LA 3KQKA 1JHRA 4Q4CA 1B8PA 1ID1A 1YCDA 2EJUA 1FNMA 1VECA 2NIPA 4MVJM 1EQAA 3SXJA 2PL9A 4AO6A 1Z4QA 2DWQA 2NO0A 3C7KA 1EUQA 1T9DA 1LX6A 4BQQA 3UUEA 4RX1A 5FUXA 1GNQA 4KPUA 1BOFA 3RTDA 1G0NA 3BORA 2Q5EA 1LLQA 4F9TA 1IG0A 1VDZA 5AW4A 1ZIYA 4QXMA 2C8JA 5AI9A 1U3FA