2R2GA

Structure of eugenol synthase from ocimum basilicum complexed with emdf
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
310
structure length
310
Chain Sequence
GMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERQRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and reaction mechanism of basil eugenol synthase
pubmed doi rcsb
source organism Ocimum basilicum
molecule tags Plant protein
molecule keywords Eugenol synthase 1
total genus 111
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.1.1.318: Eugenol synthase.
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2r2gA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2r2gA02
1TT5A 4NNJA 4XA8A 3LU1A 5BSFA 5KJCA 5CG1A 4P38A 4MVJF 4RV9A 1NHGA 1YL5A 5B4UA 5JAMA 2JD1A 4G5HA 5G4KA 4NFHA 1C0IA 4ND3A 4PG8A 3O8QA 1I36A 4YACA 2CDCA 1ADCA 5DF1A 3UW3A 1PZFA 1A71A 1PWXA 3E1KA 3QVSA 1F8FA 1U2DA 8ADHA 1X15A 3E9QA 3WBFA 5BNIA 1PR3A 1XG5A 1GU7A 2VUSA 1Y8QB 5F1PA 1R6DA 5BQFA 3O03A 3DR3A 1Y1PA 2DLDA 5GZ6A 3TF5A 2BGKA 2JJYA 1HKUA 4WCDA 4WE3A 1I0ZA 3RJ5A 4R54A 4URFA 2CF5A 3I9OA 3PFFA 3AY3A 4QUKA 4Q39A 3GMSA 4MVJH 4XQCA 4F45A 1E3WA 1LDMA 4CQLA 2X5KO 1DIRA 4IJKA 4JLWA 2G1UA 1P31A 4JIGA 1AHHA 1S6YA 4IDDA 4XB1A 4IIUA 3RFXA 1QYCA 3TPCA 1R4NB 2D0IA 1A9ZA 5DBIA 1BDBA 1NR7A 3E03A 4NU5A 2V6MA 3LT4A 4IDEA 3WGZA 1UR5A 4J4TA 1B0AA 1B3RA 2V65A 2GNAA 1QLJA 1A7AA 2NTJA 2DQ4A 4R01A 1ZK4A 3AOGA 1MB4A 3I52A 1Y5MA 1YQXA 4AICA 2LDBA 1AXGA 4NBTA 1T2FA 4UEJA 2WTBA 4ZQGA 4CR7A 3I1JA 1QSGA 3NEPX 1U8FO 4HKTA 3OIFA 1UZNA 3STHA 3RC7A 1Q2XA 4EYEA 2WD8A 5A5FA 5IZCC 3ITDA 4HWKA 3VZRA 1ZK2A 1HSOA 2Y67A 3BMQB 3ENNA 1A7KA 2VNSA 2JCVA 3RJ9A 4DPMA 1R0KA 5JMPA 2O23A 4Y67A 5G0UA 1E77A 1LJ8A 2Q45A 2ZTMA 4L76A 5T5QA 5JCXA 5KNLA 4PRLA 3HE3A 5HRUA 2J3KA 1KEPA 3PJEA 2GUGA 1AXEA 3FCOA 1PZHA 3PFWO 5JO0A 3PYXA 2ZCVA 2QHXA 5C37A 4PLGA 5U1PA 2O4CA 1SEVA 2YV1A 3PYMA 2FN7A 4GLLA 5A5EA 3GG9A 1KERA 3GEMA 5F1KA 2B83A 5KKCA 1R16A 4ITUA 3O8QB 3DZKA 2R6JA 2FWMX 2O50A 3H65A 4FFOA 4K26A 3C7DB 4KQWA 3AM5A 4GL4A 3SEFA 1IULA 4LN1A 4YWJA 4GX5A 4OSPA 4J9UE 4JP3A 4IXTA 1B2LA 3GHYA 1OZAA 4PLWA 4UULA 8LDHA 4WLEA 2NU8A 5KVVA 4LRSB 1B16A 3GMDA 4YT4A 1I2ZA 5JAZA 4PLCA 3GVCA 1H2HA 1HT0A 2I65A 2PWZA 3RBVA 4CJXA 4ALIA 5ES3A 1RPNA 4II3A 4D3SA 4N54A 4MJLA 3PI7A 5THKA 3RUEA 3I3OA 1E3WB 3SXPA 4AL4A 4XR4A 4YJHB 3U49A 1RM4A 4DGSA 3E48A 1GYRA 1O0SA 2Y99A 3GA0A 1QR6A 2NU9A 1GR0A 1OC4A 3K31A 3KTDA 5F21A 5EINA 1FMCA 3Q9NA 4YAIA 2ZB7A 4W4TA 3WFJA 1BVRA 2VZ9A 1G0OA 1FF9A 4Y6PA 4JCOA 3TZCA 4CMIA 4DREA 1DAOA 4RDIA 3OSUA 4WCFC 2C5AA 1TT7A 2AQKA 1E1MA 3PEFA 4HFNA 5KCZA 1ENPA 3GHHA 4PG4A 2DTXA 1ZNQO 3D4OA 4W9NA 2EGGA 1WWKA 2Y68A 1O89A 1QV7A 1M6WA 3O4RA 1DO8A 4FN4A 1NM5A 3VVCA 1ISGA 4DVJA 5ICMA 4L4RA 4CQMB 4I9HA 1G1AA 4R69A 3I4FA 4NH4A 3GZNA 1MA0A 2JHGA 1P0CA 2B69A 2FSSA 1E3SA 3ZV6A 3AUSA 2WMDA 4RVSA 5CFZA 3TZQA 4B4UA 4XYGA 3WGOA 1P77A 1B15A 4OKIA 1XLTA 2G76A 5JO9A 3ABIA 1WP4A 4OXYA 3K30A 4R1TA 3ZW8A 2P68A 4ZRMA 3AU8A 4RZHA 4JBGA 3ZWNA 1LLCA 4KUHA 2WYWA 4IINA 1WZIA 4R9RA 3WIDA 3TFOA 5JY6A 1MX3A 3PZBA 3BZUA 5EESA 3VZPA 1Z82A 5EMHA 5C3MA 1EUZA 4AJLA 4D44A 5JXWA 3PRJA 4B8WA 2OBNA 3QIVA 4CM3A 2CVOA 3GNSA 2D3TA 2FPIA 5IXYA 2VRBA 4GMFA 4NK5A 4RCVA 4U7WA 2WEKA 4XQEA 3ZV5A 2UDPA 4NJMA 4N18A 4HXYA 3MJTA 1PS8A 1DIGA 1DHTA 2PH3A 5AXDA 5G0WA 2Y1EA 3LC7O 1O6ZA 4GH5A 2Q1SA 3V8BA 4ALJA 5BT9A 1PS0A 2NACA 5LDGA 4DXHA 1T2DA 4Q3AA 3AUAA 5L53A 4J2OA 2NU6A 2OXIA 5JBIA 2P5UA 2EHDA 3TL2A 2Y05A 4X54A 4RVHA 1UXKA 4U6SA 1JW9B 4A03A 4UVGA 1IB6A 4ZVVA 1HDOA 3AM3A 3Q3CA 4KMSA 2J5KA 4FC6A 3WNVA 4P8RA 5IZCA 3HG7A 1XWFA 4FDAA 2HUNA 1MFZA 2AE1A 4IJWA 3ZWMA 4ESOA 3I9LA 3OFSA 2Z1NA 2RIRA 3UCFA 1KVTA 4BNMA 3FN4A 3OJEA 1P9LA 2YHIB 4TZTA 3Q0EA 3VVBA 4CM4A 3D5TA 1I01A 1TEHA 5AVOA 3P2YA 4R3WA 4A26A 4E0BA 2V6FA 3P7MA 4D3FA 3IS3A 3L6EA 4MO2A 1ZXBA 1A9YA 1Z75A 1X13A 2EJWA 1XEAA 1U5CA 1Y9AA 2HMVA 4E5KA 3FWZA 1TT5B 1GAEO 2FOIA 4XEHA 5EERA 3WIEA 5TF4A 3WOHA 3ZNNA 2HRBA 3HB5X 1DIAA 1SAYA 1WXDA 2ZJ1A 4D42A 3L4SO 3GGGA 3JQBC 5IJZA 2RH8A 3GR6A 3JQAB 4CM4B 4CR6A 3DOOA 1V35A 1WLYA 3DMTC 2Y1GA 4E5YA 1U3VA 4D79A 3OHSX 1YL6A 2PK3A 1VI2A 4HV4A 1E1NA 1ISMA 4KP7A 3ROKA 2X0IA 3VC7A 1E3JA 1LLUA 3U4CA 1X14A 1LC0A 4J90A 4BMNA 1NASA 2DBRA 2NUAA 4JBIA 4PG6A 4B7UA 3S8MA 1HLDA 2F00A 3QW2A 4JN6B 1HWYA 2NVWA 3NT2A 3RC2A 2Y1OA 3RVDA 1SPXA 4BNZA 1EVIA 1SB9A 2YY7A 2X23A 4BKQA 1W0CA 1U7HA 1AUPA 4NJMB 5JLAA 2Z1MA 1PJCA 5G0SA 3PPIA 5I9LA 3E6AA 2I3GA 5TQVA 4R4JA 3ZW9A 4WPGA 1DEHA 2HU2A 2CDBA 2Z95A 3JV7A 3WWYA 4DC0A 3L6OO 2R00A 2IDZA 2YW9A 5DOVA 2F1KA 3P5SA 4UREA 3EVNA 3D3WB 1T26A 1ZSYA 1ENZA 1ADBA 2BMAA 5F5LA 2I67A 3SLGA 1UJMA 4B4WA 2DUUA 4WJZA 4KWHA 4OXKA 5TSDA 3RSHA 5HM8A 4GX2A 4H15A 1Y5RA 1PQUA 2BLLA 3N58A 1VLLA 3D4PA 3G49A 1IOLA 3QHAA 3IKVA 4FB5A 4BMSA 4IQGA 3KXDA 5FFFA 2DAPA 1J5PA 4MVJG 4OQZA 4JX8A 1CIVA 4DLLA 4QFCA 4RQUA 2PKQP 1PL8A 4DA9A 1P33A 3AWDA 4Z0HO 1PJSA 5CDGA 4U6QA 1V8BA 1K0UA 3H9UA 4GAEA 4E30A 1E7YA 4YT5A 1PZEA 4WECA 5FF9A 1C1DA 1BXZA 2RHRA 1NWHA 4FPXA 1ZKMA 1B8VA 3MJ4A 4OGWA 2GO1A 4WOJA 5ICSA 1E7WA 4D43A 3LLVA 2IYOA 5C7LO 4RL6A 2E4AA 2YYYA 4P22A 1B26A 4UUNA 4XKJA 3W4JA 2P9EA 1B8PA 3NUGA 3ANMA 4FJ1A 1I30A 4J91A 4TROA 3A9WA 3KYDA 3HDHA 3GF4A 4BKUA 3RD5A 1I2CA 3GGPA 2C7GA 4NJOA 3SBOA 4CUJA 1PGPA 4CM9D 5A9SA 1JWBB 2PGDA 4AJNA 2D4AA 1XKQA 3TSCA 3H8VA 4C7JA 1Q7BA 3F5QA 4OKNA 1MC4A 1GCUA 3WX0A 4NIMA 2P91A 4GVXA 3JQCA 4YAKA 4YR9A 2GRAA 4DRYA 1BXGA 2JL1A 2BGLA 3F47A 2QW8A 2EV9A 2CZCA 1YOVB 3W6ZA 3U9LA 2VHVA 3M1AA 2YQ4A 4GWGA 1KY5A 4CL8A 3L9XA 4HADA 2ZJ0A 3SVTA 3JQGB 4CLRB 2XOXA 2OP1A 4YRBA 2WYVA 2O3UA 3QQPA 3M2TA 1CERA 2A35A 3JD0A 4MVJP 4K6FA 3GZ4A 1F8GA 5ILGA 2DBQA 1EUCA 3E9MA 3L4BA 5A3JA 3KYBA 4WLOA 2HKIA 4QEDA 1MV8A 5CEEA 3CEAA 1GV0A 2PD4A 1WMAA 2HO5A 2WDZA 3X2EA 2J3HA 4RVGA 3H9QA 1I5RA 3JQGA 3E18A 2DPHA 3HZZA 4CQMA 3GPIA 3MJEA 3DBRA 2X86A 5ENVA 1M76A 3DFUA 4GQAA 4INAA 5ITVA 4EJMA 3DMTA 3F9IA 5DBFA 5A1TA 1N92A 3GZNB 5JDIC 4TVOA 4DC1A 3AOEA 5T67A 1K3TA 3OEWA 2AG8A 2W2KA 4B4VA 3ST7A 1U1IA 1H5QA 3ZZNA 1AHIA 2IEBA 3FBGA 3GG2A 3OP4A 2OP0A 1DRVA 3HHPA 4B4OA 3AUUA 3V2HA 1QYDA 4HX5A 3JQFA 1UAYA 4RJTA 2PZLA 1RKXA 2GASA 2HRZA 4WNCA 2Q1TA 3EY4A 4EITA 1H0KA 1O94A 4ND1A 3ZNPA 1L1FA 1L7DA 5JYDA 4BMVA 3CZMA 3NT4A 1XDWA 1LUAA 3RQSA 4ZGWA 5T64A 1E6EA 4FFPA 5HBRA 3H5RA 3GUCA 2R00C 1XA0A 2GYYA 1HDCA 3H9GA 4XJTA 1OC2A 4CMEA 2DM6A 1QLHA 4NFSA 4A27A 1BSVA 1ZVMA 3MZ0A 1JKJA 4K1LA 5G0VA 1R66A 1TVEA 5I9NA 3K6JA 3LK7A 1X7GA 3KB6A 4EJ0A 3VH4A 1NQTA 4ZQFA 2NM0A 3C1AA 3VPHA 5K0ZA 3WR5A 2C2YA 4C4OA 2G17A 2CVQA 1QP8A 4KDFA 3PQDA 1F17A 3E5RA 4J4BA 4R16A 3VDQA 1ISIA 2V6BA 3F1LA 3DXFA 3A4VA 3NX4A 2WSBA 1GZ6A 1NVTA 2H1SA 1DAPA 3EZYA 4WGGA 3ZWAA 4EZBA 3FNFA 3NTQA 1U3WA 3DOCA 4LMPA 3ZNOA 3IDSA 3MJVA 3N74A 4BVAA 1H6BA 1BHSA 2IXBA 3HUDA 2IZ1A 1M6HA 1N5DA 3DEYX 3SC4A 3OEYA 1JKIA 3ASUA 4Z9FA 4GKBA 4J49A 2C82A 4L8VA 4Y6RA 2ZQZA 4E5MA 3INRA 4JJFA 2HDHA 2WD7B 1ISJA 2Y0EA 3UCXA 4D0RA 3PK0A 1IZ9A 1EE9A 4FOSA 1AE1A 5C5IA 4BNNA 5L7TA 4EUFA 2OUIA 3AI2A 1PJBA 4CLOA 3PWZA 1LEHA 3WGHA 2IRWA 1W73A 4NBRA 1T25A 4A0SA 4K6CA 2ZB3A 1GZ4A 2BRUA 2Q2QA 1ZK0A 1U28A 3QWAA 2DC1A 3P19A 1QRRA 1ZEMA 3QY9A 4UVHA 3RBZA 3GFBA 4P4LA 3DZJA 3CE6A 3WJAA 4O1MA 3V5NA 5GZ1A 4E2WA 1W4ZA 4GKVA 1JU9A 4DPLA 1BRMA 1RM0A 4ALKA 3TZHA 1I2BA 3QWIA 3JYPA 4RPKA 4YRDA 4QT0A 5EN4A 1VJ1A 2B4RO 4BNXA 3RUCA 5JAQA 4IPTA 4JJIA 3EYWA 3EHEA 3LT1A 4W99A 4FGWA 4BNHA 5DDIP 2RH4A 1DC4A 4TZKA 3ZHZA 3OIDA 1PJ2A 3WXBA 5KJEA 2A4KA 3FHLA 2UUOA 2OORA 2XAAA 1GPDG 1MXFA 4MIEA 1DC3A 3GFGA 1DXYA 1VSVA 3K9QO 1DHRA 1EBFA 3QRWA 1DIBA 6LDHA 4RF2A 1D4FA 4XX0A 2GN8A 1JN0A 3BIOA 4MVJM 1ADFA 1DFIA 2FSVA 1YB5A 2GF2A 3HADA 3IOYA 4J6FA 4JQCA 2W2LD 4E5NA 2PGLA 1Z7EA 4CM6A 4GX1A 2Q4BA 3ICPA 3BMCB 1Q0HA 5FEUA 5HS4A 3JQ8B 4LCEA 3SLKA 1PGNA 3K96A 4JGBA 3DBRB 3F5SA 1GV1A 3ZN2A 1ISHA 3AI1A 1PEDA 3AM4A 4CLHA 4A5OA 1FK8A 3WTCA 1SZJG 3FTPA 1QKIA 1M75A 3IJPA 3OF2A 4PLHA 3CSDA 3KSUA 3ZH2A 3RU9A 3AOEC 3DWFA 4BNFA 3TZKA 2GPTA 3MTGA 3DBVO 3LLSA 4KTVE 2OL4A 4I5DA 4TMFA 3HDQA 4I08A 1JAXA 3OJFA 5KWEA 3HJAA 4Z3DA 2VWHA 3OJLA 5KJ1A 2P5YA 1HE4A 4CV0A 1X1EA 1DLIA 3BXXA 1OBFO 4BKRA 2O3TA 1IL0A 2E6UX 2B37A 3QP9A 2GGSA 3JD1A 2B35A 1P1JA 3O9ZA 2D59A 4E31A 1JKFA 3W4IA 3WICA 1PGQA 3DTYA 1E0DA 3G0OA 3DBHA 1GFSA 1NQOA 3INGA 4IBOA 1X7DA 1TI7A 2EKQA 1LDBA 3ROMA 4PCVA 3RAJA 3NDJA 3RROA 3FF4A 1I33A 4EEZA 2CNBA 1R0SA 5B37A 4HFRA 5A03A 5TX7A 4I5EA 1BTOA 1ZJYA 1VE9A 4BO9A 5IF3A 4NBWA 4CV3A 2ILTA 1CRWG 5JMWA 1Y8RB 2IODA 1UXIA 2JFFA 4Y98A 3ETGA 1LLQA 1UP4A 1JQBA 4XQ9A 4ND4A 3WYCA 4IJVA 2P9CA 2X0NA 4OOFA 2WE8A 4NMHA 1YBMA 1TB4A 3R3JA 1PJQA 2G82A 2FP4A 2ZIZA 4IIVA 4HP8A 4OL9A 4N5MA 4WLNA 4EEXA 1A4IA 1P74A 1WW8A 2QQ5A 5DZSA 1HF3A 3CINA 4JNKA 4B7CA 3PDJA 4AJIA 5IFLA 1PSDA 3ZCXA 2HK9A 5H82A 2SCUA 4XRGA 3E9NA 4WLFA 1NPTO 3WDSA 2XPCA 4U8GA 3TOXA 2X1HA 4UVEA 4ZA2A 3U3XA 4RLHA 2OGUA 4OO3A 4E2YA 4QFDA 4WEOA 4NDNE 1P1RA 1UP7A 1PZGA 1ZK1A 3R0IA 4GI2A 4RVDA 3AW9A 2BH9A 1E3IA 4II2A 4S1VA 2OMEA 4BNIA 1HXHA 2P4HX 2Q46A 3DZGA 2CSUA 3H9EO 4A10A 1CETA 4XQGA 4RPJA 3JCZA 1G0NA 1XELA 3RWBA 4GPD1 3EW7A 1J49A 3PHLA 2C29D 4AJJA 4CMJA 3GRPA 1K6XA 1Q0LA 5IXSA 1WVGA 4IS2A 4ZRNA 3T7CA 3BTSA 1T2CA 3W6UA 3D64A 5CPFA 3BMOA 2V7PA 1YQGA 1LU9A 2C5EA 3PVZA 3HDYA 2O3SA 3TOZA 4D45A 3AY6A 1NTOA 1P3DA 3GRKA 3KBOA 3LF1A 1V3VA 3S2IA 4F6LA 3JYQA 5ITWA 4FW8A 5BSHA 5L45A 3DOJA 1HL3A 1KVUA 2AHRA 4CUZA 1R15A 2BFMA 3ZNQA 3O26A 4IGEA 4G81A 4AG3A 4PG7A 1NP3A 4L75A 4A7PA 3ONEA 5DCYA 2AE2A 2QRLA 3RUHA 4AJHA 3IP1A 2PZJA 1ZIDA 1GUFA 3PJGA 1RJWA 2NLOA 2NQ8A 4KDEA 3C1OA 3ZU2A 1GQ2A 1C0PA 1F14A 4O5OA 1YB1A 1J0XO 1E7MA 2DVMA 3H4VA 4CLRA 3Q1LA 1BW9A 1HE3A 3C7AA 5BNTA 4FBGA 3WGQA 3W8DA 1IY8A 1GD1O 3DZBA 2FR8A 4BO3A 5CHEA 3PGXA 1NXQA 3R1IA 1I3LA 2QRJA 2VHWA 3DAFA 3L4BC 1Z7BA 2H9IA 2HK7A 4YJFB 3KYCB 3TFQA 1KC3A 3I6IA 1Z74A 1GQQA 1UXGA 1RYEA 4KWIA 2P4QA 4WNIA 3HSKA 4MPDA 3QWHA 4HUJA 1YOVA 4IDBA 3RIHA 4AJ2A 1LQUA 1NFQA 1NR1A 4IMRA 5TS3A 2EIHA 4NHEA 5T6BA 1ULSA 1EQUA 1GUZA 2ZKLA 2AXQA 3AFNA 1B7GO 4J7UA 1ZSNA 2Y0CA 3GEGA 3H2ZA 3ZWVA 3B20A 1DJQA 4FFNA 3UN1A 2JHFA 1T4BA 5T8KC 1OMOA 1ZH8A 4MVJI 4CLOB 4ZU3A 3B1KA 4HNGA 5TIIA 1E6UA 1LRLA 4Y6SA 5B4TA 2GZ1A 3FTNA 3F4LA 4BNYA 2D1YA 4Q3BA 4D3DA 5CG2A 2FPGA 4N7RA 1PQWA 5L4NA 2AW5A 1YWGO 5TGDA 3K5PA 2ZK7A 1M2WA 4ZD6A 3V2UA 4YTEA 3ZU4A 2ZYGA 1EUDA 2Y93A 4IZIA 3KYDB 3FWNA 1YONA 4H3VA 3DHEA 3LC1O 2NNLD 4D41A 2BD0A 3D1LA 4WASA 4BS9A 5U4QA 5HS6A 2J3JA 4MP8A 1SNYA 5BNFA 4LW8A 1WNTA 1O8CA 2VWQA 2XF8A 1HSZA 1E5QA 1QYWA 3GN2A 4H16A 4RQTA 1ZEJA 5CDSA 3BYZA 4FD3A 2EF1A 2HMUA 2DBVO 3ZU3A 3JQEA 5A02A 1A27A 4R5MA 3Q11A 5JCJD 3JQ6A 2EG9A 3C24A 2UYYA 4BNUA 2X7HA 2PA3A 3BA1A 4FQ8A 4UEOA 3DZIA 1E92A 1I24A 2GSDA 1DDOA 3FR7A 3NTRA 3ZV4A 1U5AA 4DYDA 3QA9A 3JQBA 4J9VA 3CUKA 2CMDA 4EDFA 5DCUA 2GZ3A 2ZYAA 4M55A 5THQA 1ORRA 3WS7A 3N7UA 1H9BA 4DQVA 3IQDB 3F4BA 4BNKA 3KSZO 3FR8A 3K2EA 1GQYA 4CR8A 5F5NA 2VUUA 4J3FA 1BDMA 3QVXA 3I9KA 4IQ0A 5FWNA 1C1XB 3TN7A 4AJPA 4DBZA 3MJCA 1HZJA 4HBGA 3VTZA 3KV3O 5DP1A 3NYWA 5A05A 1ZUD1 3ORFA 3BMOB 2UVDA 4PLVA 2D5AA 1DRWA 1E7SA 4GMGA 3GDOA 5CEFA 3BHIA 4YAGA 4R3NA 4XYMA 2P9GA 2X22A 3C1TA 1YS4A 1IHYA 5L4LA 4TQGA 1U4OA 2VTEA 3MOIA 3DAPA 4XIYA 2P2SA 5GZ3A 3KHUA 5A9SB 3ZWYA 3INTA 1SOWA 2VYNA 1NNUA 1PTJA 4R68A 1I3NA 1LBEA 3GVPA 4PLPA 4E5PA 4B3IA 3WQRA 1AN9A 5LC1A 3VPSA 3D7LA 1N2SA 5IDWA 4C7KA 2RCYA 2BFAA 3AFMA 1PL7A 5MDHA 3LT0A 2PFGA 5TT1A 1I32A 4MIYA 2VHYA 1OOEA 1YDEA 3KOUA 3MOGA 4FC7A 4NG5A 4QSMA 4IUYA 4EUEA 5B12A 1WDKA 4BNTA 5BR7A 1H93A 1MG5A 2G5CA 4XR9A 1N7HA 1O95A 2NSDA 1NAIA 2GDZA 3UCEA 2RHCA 4BOYA 2JD0A 5JC1A 2PTGA 3RFVA 1PJTA 2WWRA 3GNQA 4IDAA 2YUTA 3RUDA 3A06A 3DQPA 5IDXA 2O2YA 4P4NA 3WWZA 3JQ9A 1EDZA 1LDNA 3L77A 3ULKA 2WJPA 4ZQBA 4CMIB 3PZRA 3ZWXA 1K5HA 4XGIA 1LDGA 4MP3A 4YA6A 4YVFA 2JFGA 2X9GA 2PH5A 1XGKA 3H5NA 5EL0A 2YV2A 2HMWA 2X0RA 3ZWPA 3VPGA 3DFZA 1LRJA 1Q0QA 3GEDA 4CMBA 3NJ8A 3UFXA 4CQMD 2VHZA 4NK4A 2QG4A 1B3BA 4PZDA 2EKPA 2NVUB 5IZ4A 3VH3A 1HDYA 1P1IA 1H94A 1XSEA 1DFHA 5DCWA 5HWSA 5I8ZA 3ON5A 2IE0A 3V1TC 2FY8A 3FRJA 3ETEA 5DN9A 4AJOA 1HTBA 2ZYDA 3G17A 4XB2A 1VC2A 3QVOA 3PP8A 1LX6A 1W6UA 4TWRA 4A73A 4IJUA 5A3VA 3DBHB 3UUWA 4PN3A 4Z9YA 4XYLA 1QYXA 1O9BA 1D1SA 4NBVA 4D46A 5GMOA 3OQ6A 3KEQA 3L6DA 4MIOA 4M86A 3AU9A 3GVXA 1GCOA 5KVQA 4PLTA 3VPFA 3GNTA 4Z0TA 4ZQEA 3CKYA 7ADHA 1NWCA 3I9JA 1H2BA 5KJFA 5KVSA 4FIZA 1ID1A 4ID9A 3NV9A 1V0JA 2DTEA 4FOOA 2VWPA 3GN1A 3TQHA 1EEHA 3FI9A 3OJOA 2YFHA 1NAHA 1R0LA 1RWBA 3MJSA 3LSYA 1YXMA 1HETA 1G6KA 2JD2A 3OICA 4CLEA 1Q7CA 3OH8A 3IAHA 1PU2A 2OBYA 1ZCJA 2I6TA 4GVLA 1A5ZA 3ANLA 1SBYA 5LDHA 1CYDA 1GYQA 3F46A 3JYLA 4I1IA 4NZ9A 1O5IA 3PYLA 4MKRA 3IIEA 4UUPA 4MVJE 3DBLA 2CD9A 2J3IA 3WFIA 4KZPA 5JDCA 4D0SA 1VJTA 5COBA 2AQIA 2QIOA 3AI3A 3S1LA 2ZTVA 4GSLA 2O3RA 1YE3A 1SCUA 2EP7A 1K2WA 2EXXA 3AK4A 4YJGA 3FPLA 1I8TA 2YHIA 4IMPA 3PDUA 1V3UA 3ADOA 5FI3A 3RCBA 4DIFA 1U2GA 3U62A 3UXYA 5EIOA 4DL9A 2ZTLA 2PZMA 1UZMA 1E5LA 4KUEA 4OYRA 2D8AA 1PJ4A 4I5FA 2JFHA 1KYQA 3VH1A 1SB8A 1UXHA 1UDCA 1TXGA 3KO8A 4M87A 5TJHA 3HB4X 4CM8A 4CMEC 2FR0A 2Q4EA 2HK8A 5KVCA 1Z73A 3GPDG 2Q99A 3BTVA 1ZJZA 4B8ZA 1IPEA 4YPOA 2IZZA 4J16A 2I76A 5L7YA 3U4IA 1MC5A 1EVJA 3EC7A 4I8XA 1EZ4A 4LCJA 4J7XA 4CQLB 2IZ0A 3AJRA 1QXSA 3FNHA 3EDMA 4E4YA 1WDLA 3KSDO 4J43A 4UUMA 4B7XA 4IGFA 1BW9B 4QXMA 4CM8B 1E3EA 4J1QA 2I66A 4HNHA 2VZ8A 3DDNA 2FR1A 1EBUA 3CTMA 3I83A 2X9VA 2B5VA 1DJNA 5C7IO 4LRTB 5I7FA 5L3ZA 3CMCO 3PIIA 4PRKA 1T24A 1LI4A 4OQYA 1BG6A 2V6GA 3D3EA 1ONPA 1IZ0A 5JCJA 3WGYA 1YDWA 3K92A 2VCYA 1VKOA 4RPLA 3WLFA 6ADHA 1S7CA 3Q9UA 3QV1A 2JAPA 3DB2A 3S2FA 5JSFA 1WPQA 4R51A 5EJ2A 1MXHA 1HDGO 2OFPA 5JNLA 3WSWA 1FDWA 1M66A 4FSHA 1EMDA 4PLFA 4E3ZA 2C54A 3R6DA 1C1XA 3H2SA 1EE2A 4MVJD 1CWUA 2VYND 2PKQO 4XGKA 5T8KA 2CDAA 2X0JA 4BNVA 3HNPA 1NQAO 3GY0A 1YQDA 1T1SA 2C07A 3TRIA 2BHLA 2I99A 4KTTE 3G3EA 4ZICA 3DL2A 3ZHYA 4KQXA 3EGOA 1X0VA 5L40A 1VM6A 2O7QA 4YYZA 3MWEB 1E7QA 5JC8A 1YJ8A 4DMMA 2JAHA 2YDYA 1I10A 3WJ7A 1KIFA 1V3TA 1XQ1A 3OA2A 2EW2A 2GERA 1C14A 1C0KA 3VZQA 4IM7A 2D5CA 1BGVA 3A28A 1OFGA 3O38A 3V2GA 1CEQA 2BGMA 3EZLA 1GUYA 3G1TA 4BGUA 1R12A 9LDBA 5G4LA 1Q1NA 3L07A 4LVCA 3RKUA 4NBUA 2GD1O 1Z45A 4EJ6A 4L0QA 2Y66A 4LMRA 2QX7A 3W8EA 5JYEA 4E12A 4CPDA 2WYUA 3DONA 1HLPA 4J0FA 2YJZA 3BMNB 1JVBA 5AXBA 1SO8A 3EK2A 3JQ7B 1P1HA 2ZB4A 4RO0A 3UOGA 4CMHA 2AQ8A 4M1QA 1N9GA 1EFKA 1VSUA 3VZSA 4XYEA 3QE3A 4R41A 1NFRA 4O59O 1U7TA 5T57A 4LISA 3RUFA 4CM9A 1ZW1A 4DQUA 2BI8A 4AJKA 4Z6KA 1XU7A 1R4MB 2Q3EA 3H5AA 1J4AA 2A94A 1PL6A 2E37A 3Q2IA 1YBVA 3PWSA 4RVUA 1KC1A 1PJ3A 1LSJA 5H81A 1MG0A 3PJFA 2AEJA 2GZ2A 1C0LA 3T4XA 3UKOA 4CL3A 3GDGA 2R2GA 3H7AA 4GLOA 2HMTA 3VHRA 4LSWA 3B1JA 2BF7A 3Q6IA 5K9ZA 3IP3A 4GGPA 4J2HA 4RVFA 2RBEA 1TLTA 1QG6A 1VJ0A 2YFQA 2AG5A 1V9LA 3WG9A 3IUSA 1ZMTA 4W7IA 4YJHA 2NWQA 1JVSA 3A14A 3JQFC 3OM9A 3FNGA 1X0XA 3HN7A 3M2PA 2DFDA 1UDAA 3D0OA 3WYBA 3JQDA 4DYVA 2X5JO 4TVBA 4BV9A 4IY1A 2PR2A 1BMDA 3PHJA 2QYTA 3DTTA 4FCCA 3K8ZA 4IDFA 3I5MA 4E13A 3WYEA 2DPGA 1NVMB 4DUPA 4O6VA 4OXNA 4YT2A 1HZZA 2C20A 4BO6A 1E1KA 1CF2O 1IYZA 5L7WA 2XXBA 1SOVA 4AJ1A 1FDUA 1KEUA 2Q50A 1QORA 1GY8A 3PQFA 5AOVA 5HTOA 4H7PA 2HSDA 4BV8A 4J7CA 4XIJA 5CDYA 1C3VA 1CQJA 1U4SA 4MINA 3WTBA 3OQBA 5G2OA 5A04A 1QYVA 5TJ9A 1KVRA 4EGFA 1HYGA 2Q2VA 2X58A 3NDRA 2FMUA 2NQTA 1NPDA 4M49A 3QWFA 1WZEA 2IXAA 2NADA 1LRKA 2I5PO 4TRMA 4DQXA 2Q1UA 4LVUA 1WAMA 2BFOA 2VWGA 4L73A 2VOEA 1BXGB 3OA0A 1H6DA 2FHSA 4MP6A 4Y8VA 3U4HA 3LF2A 4ONEA 3B1FA 3SX2A 4RF4A 1M67A 5I9MA 4UEKA 2VHXA 1BWSA 4GWKA 4TKLA 3PGJA 3ROQA 1FJHA 1LSUA 3DZFA 2PGJA 5I7SA 3HDJA 4QQRA 5A06A 4BNLA 3T4EA 1NYTA 4WOKA 2VTDA 2Z5LA 2GN4A 3WBBA 1OI7A 4BO0A 4L9RA 5F1OA 4ALLA 1GPJA 4B79A 4B3JA 3H3FA 5FYDA 4BNGA 5IAAA 3S2GA 5KJ6A 3GLQA 3KLMX 3K73O 1YGYA 5KTKA 3EAGA 4R9SA 1K6IA 5DT9A 4OIMA 5TC4A 4PLZA 1YBAA 3GVHA 4XD2A 1Y9EA 2Y1DA 2O4UX 3NGXA 2AEMA 1GADO 4Q3CA 3AY7A 5K6AA 5EQDA 3LZ6A 4TSKA 1PGJA 4TKMA 3D4NA 4BO1A 4J4HA 4Z3KA 1ONNA 5FI5A 1P1FA 2GCGA 3WMWA 4BUCA 3I9MA 3JTMA 2CY0A 2J5RA 3GOHA 4FFRA 3OBBA 1IE3A 1T2AA 4LGVA 3LT2A 5L51A 5J23A 4YB8A 4BNJA 3B70A 3MTJA 4UAGA 1RM5A 1R4NA 4IDGA 5CEJA 4EW6A 2A92A 2W8ZA 3OIGA 5EQFA 4JP2A 3IMFA 3FSRA 3KVOA 2QRKA 2D2IA 5GY7A 5G4KB 4AJEA 4U0JA 4BO8A 3F3SA 3ITKA 1B8UA 5JY1A 1QV6A 4HY3A 1T1RA 4Q3EA 5AXCA 2G0TA 1XHLA 3WQQA 3WGGA 3VKUA 2YHUA 4RDHA 1DSSG 5TNXA 3C3XA 3UVEA 4JXKA 3OMLA 3BMQA 4E2ZA 4CMAA 2VT3A 3S55A 2HLPA 3QVTA 3CZRA 1VRWA 1Q7GA 4BO4A 3GDFA 3PQEA 5DNAA 1U3UA 4W6ZA 4BIIA 1F0YA 4YT8A 4NI5A 4PZCA 4R1NA 4F3YA 4R1UA 5CP8A 4BB6A 4U5QA 2VRCD 1PQPA 2BKAA 3JSAA 1L7EA 1VL8A 3GGOA 3VH2A 4YJGB 3WGIA 1LQTA 4RPHA 1X1TA 3DAGA 3RASA 4CV2A 4WCFB 3I4CA 4N5LA 1WDMA 1OAAA 3F1KA 4G65A 3GAZA 4ALNA 3ADPA 3D5QA 1KY4A 2VNAA 2Y1CA 1KEVA 3M6IA 5I8WA 3HQ4O 2PV7A 3U5TA 2HAEA 3JD2A 4YCAA 4FGSA 3LDHA 5I7VA 4BB5A 4FR5A 4CODB 5G0TA 3GH3A 5CPBA 3ZDFA 3WMXA 2J6IA 3MWDB 1KBZA 1LA2A 2C2XA 3VDRA 5TRTA 2VZ0A 3KETA 4OH1A 4NU6A 3I6QA 4W9NC 1QMGA 3OJ0A 3H6KA 3TL3A 3LYLA 2C7VA 1Y6JA 4RPGA 1PX0A 1Y8QA 1NFFA 1Y7TA 1I3MA 2DFVA 4JBHA 4NQZA 1ZSVA 1GDHA 2UUPA 1ZXLA 1HRDA 1LDEA 2Y0DA 2UV8A 3GC6A 4O63O 1VL0A 4IS3A 1P1KA 4O0LA 5I7EA 2B36A 5BSEA 5JW6A 3VAZA 4YJDA 2GN6A 7MDHA 2TMGA 3ZV3A 4MOWA 1PR9A 1T4DA 5KOIA 1PWZA 1VKNA 5CAEA 3UGKA 5KIAA 2GR9A 2HJSA 2NVBA 1ML3A 3DMYA 3QLJA 2Q2WA 4BQPA 1H9AA 2POQX 1FDSA 1CDOA 4NPCA 1B14A 4JROA 3VKVA 1MUUA 2EEZA 3RKRA 4XDZA 1HYEA 4Q3NA 1UXJA 3MEQA 4TRNA 4BKPA 5ENDA 3QWBA 1A72A 3BMCA 3FBTA 3NAQA 5AXAA 1MP0A 1XCBA 4ZQHA 3C85A 1EK5A 2ET6A 4CUKA 3TJRA 5ER6A 4EBFA 2JCYA 3P2OA 3PJDA 2W4QA 1KVSA 2X4GA 3GQVA 3PIDA 3S2EA 4OHUA 4BQRA 3UH1A 5K6AC 3OQ1A 4AVYA 1D7OA 4YXFA 2QZZA 2ZQYA 5H83A 5C7OO 3FPCA 2WM3A 4IQ8A 1NHWA 3B6ZA 4MDHA 1DFGA 4A2CA 4BHTA 4OM8A 4QX6A 4XRRA 1U8XX 4JK3A 2B4TO 1ONOA 2I3AA 5CDUA 3UHAA 3RI3A 4GGOA 1EFLA 3NT5A 4XGNA 2OO5A 4DIBA 1N7GA 4WUVA 3NKLA 4ZHSA 4ILKA 5JFOA 3JQ7A 1EVYA 1ULUA 3C7CB 3OECA 3RC9A 5JPIA 1JAYA 4JJGA 4NR0A 5KKAA 1TA4A 3RUIA 4BKOA 4YDRA 3LVFO 3ZGYA 4GBJA 3FD8A 4Q9NA 1I3KA 1HDRA 3SJ7A 4U0KA 1MLDA 4PIVA 1JA9A 4XDYA 2E82A 5MGBA 4CV1A 3QJ5A 1XYGA 5A9RA 3LQFA 1T2EA 1R37A 2H5LA 2PNFA 3PWKA 3T7EA 1UUFA 2CFCA 3QVWA 4TRRA 4CMCA 1PJLA 1SMKA 2I9PA 2PY6A 1D1TA 2B0JA 1IHXA 3CIFA 3E8XA 3E82A 3GK3A 4RZIA 2J5QA 3WNQA 4DIOA 1DLJA 1IPFA 3BAZA 4QECA 1DC6A 2EGHA 3D3WA 4FFLA 1XU9A 1HYHA 3NTOA 4OOEA 2X9NA 3DHNA 5IN5A 1EVZA 2X6TA 1VL6A 2EERA 4CMGA 4LK3A 2RAFA 1NX6A 4E33A 2QZ9A 2E48A 1KOLA 2EW8A 2VOJA 2AQHA 3H3JA 4PVCA 2DTDA 1R4MA 1SEPA 1NQ5A 4QTZA 4YBZA 3COSA 2EJVA 1LTHR 3IJRA 4G2NA 2UAGA 4UUOA 4MKZA 4J0EA 3IUPA 1RM3A 1YVEI 1K6JA 1ZBQA 2AMFA 1YH3A 2C59A 4YJFA 3GT0A 4EI2A 1XR3A 2FRDA 3CPSA 3ENKA 4KOAA 4DLBA 4YRAA 1GL3A 1UAGA 3CMMA 4DPKA 1H6CA 3ZU5A 3WSVA 1C1DB 3G79A 4PFJA 2YZ7A 1YKFA 1EQ2A 2VN8A 4WKGA 1YJQA 3CXRA 2C0CA 5AYVA 1PGOA 4K9DA 1E7RA 5EPOA 1LNQA 3PLRA 5B4VA 2DU8A 4WEQA 3KEOA 3BTUA 4DMLA 1ZK3A 3GUYA 4S3MA 1D8AA 3KZVA 3ZHBA 4WLVA 3V1UA 2WE7A 4J1NA 1F12A 3TWOA 3RBXA 1CJCA 3DHYA 5L95A 4K28A 3L0DA 5A9TA 3ONFA 1NPYA 2NV6A 2JCXA 1HEUA 1PS9A 4OMUA 3UAGA 4YEDA 1ZMOA 4IDCA 4Z9XA 3GVIA 1U3TA 4OSOA 2VRCA 5DOZA 1LXCA 5TLSA 2CUKA 4RORA 5JDCC 1N9GB 4PGFA 4AFNA 3M1LA 1LC3A 3BHMA 2ZB8A 4R5HA 2Y1FA 3U4DA 4ALMA 3EUWA 3U09A 4RF3A 4BNWA 3ASVA 4QO8A 4L4XA 3W4KA 4ROSA 4I9NA 1HE2A 2W2LA 1DOHA 1KEWA 2ZTUA 2NTVA 2LDXA 2FZEA 1DIHA 3JD3A 2BI7A 3JYNA 2W98A 2DKNA 2EWMA 2OHXA 5L9AA 1LLDA 1IUKA 1KS9A 3PTZA 3PHIA 3ZHXA 4RGBA 1ZFNA 4HFMA 2NVUA 4MVJA 4ZJUA 1GYPA 5F3RA 4CLDA 3AUTA 4I9UA 2O48X 3WGTA 1YL7A 1GEGA 3ONDA 2HCTA 4E21A 4WLUA 2HQ1A 3H9JA 3K2BA 1CQIA 2GLXA 3F6YA 3KM0A 4NFYA 1GZ3A 2FPPA 4BL5A 3TDKA 5B1YA 3HFGA 1NBOA 1YO6A 4BO2A 1EK6A 5HA5A 1J6UA 2IYPA 3U0BA 1KVQA 3W8FA 2CVZA 4DBVO 5ADHA 1N1EA 3EVTA 4FFMA 4GX0A 4AJ4A 3L9WA 1LSSA 2EP5A 3ZWBA 5JAIA 3EMKA 3JQ8A 4BO5A 2GN9A 3PHHA 4DWVA 3ANNA 4IXWA 4XJSA 1XQ6A 2Q49A 4PLYA 4Y9DA 2AEFA 1UH5A 2WD7A 4YAEA 2PD3A 4EUHA 5LCXA 1DPGA 1MGOA 3JQ9C 1AGNA 1ARZA 1JLLA 1GEEA 1YB4A 4CLXA 3E5MA 3HN2A 4UVDA 1Y81A 4B3HA 4BGIA 4LSMA 4R1SA 1LDYA 4XWYA 3TZ6A 4BGVA 5JDIA 2ZCUA 4M54A 2VT2A 5JS6A 4YQYA 1ISFA 4FJ2A 3VOSA 1N8KA 3RU7A 3GAFA 2YDXA 1JTVA 2DUWA 4WK6A 4UVIA 3BHJA 5CDTA 4Z0PA 1FXSA 1FDVA 3BMNA 1P44A 3CH6A 3I23A 3NRCA 4W82A 1XIVA 5DULA 1JDJA 4E32A 2BFPA 1UP6A 2YQ5A 3WB9A 2E49A 3HWRA 5L4SA 3FNEA 3WQSB 3ETDA 3X2FA 4ZN6A 4XZ3A 2NU7A 1Y8RA 2X5OA 2W2KB 3HFSA 3ICCA 1UZLA 3NGLA 4P4GA 2PZKA 2PLAA 4CMKA 2CF6A 3NJ4A 1MFPA 5ILOA 4YAJA 3PXXA 3SJUA 2HMSA 1BXKA 5U9CA 5IN4A 4MKXA 4PG5A 4FS3A 2NTNA 1ADGA 3RFTA 4HFJA 5AQ1A 4N5NA 4IZHA 3MCVA 2ZATA 1ENYA 2VQ3A 2DBZA 1HDXA 2YV3A 3Q2KA 5BSGA 3WLEA 4RLSA 1HDZA 3C8MA 2HJRA 4QO7A 3RC1A 4BGEA 3ZWCA 1V6AA 4BO7A 4M8SA 4CM1A 2W90A 3TNLA 1H6AA 1DRUA 1P0FA 1JWAB 4TRJA 1UDBA 4XCVA 2PD6A 5DBGA 5JE8A 4D7AA 2B4QA 3VTFA 3A1NA 2X8LA 4OAQA 3PLNA 4W7HA 3UF0A 2TMDA 4I5GA 3IL2A 3JQAA 4J1SA 4PZEA 3ZWOA 4L74A 4FJ0A 1N1GA 2B5WA 2EKLA 3BTOA 4DTIA 1E3LA 1ZZEA 3IKTA 4YQZA 1HE5A 3W1VA 3DO5A 3PHGA 3SC6A 5A4DA 5COAA 1P45A 4DLAA 1LSOA 3I9NA 3KUXA 2JKVA 4F6CA 2IEDA 1DC5A 2OZPA 4KUGA 5TT0A 4PVDA 4J1TA 3R3SA 4F46A 1PIWA 2VUTA 1DBVO 1E6WA 1F06A 2O3QA 1KETA 1FDTA 3UICA 2H63A 1EDOA 1W8DA 4RF5A 3RUAA 3QSGA 5IDYA 3IC5A 4M89A 3KYCA 5ER9A 4L4SA 1K89A 1X7HA 5DP2A 4CM5A 3G1UA 1NVGA 5IG2A 3OETA 1GTMA 3KRTA 2VYVD 1WMBA 3V1YA 3ZWWA 1RYDA 1U9JA 5IDQA 3JYOA 1SC6A 2FZWA 3DBLB 3KLPX 1DB3A 2BELA 4ND2A 3JQAD 2O7SA 9LDTA 4E2XA 2O3JA 4Q3DA 2J8ZA 2VYVA 3DC2A 1BVUA 4CM7A 4E6PA 3DZHA 1A4UA 3NDIA 3JD4A 1E1LA 2XXJA 2H6EA 2QYSA 4WCFA 5COQA 2A9FA 3VPXA 3LC2O 1ZO8A 2DT5A 4ND5A 1YRLA 2O2SA 2OOSA 2PKRA 1VPDA 4GSKA 3ROPA 4OJNA 2Q1WA 3ZI0A 1Z6ZA 4XYBA 1ENOA 2AA3A 1D3AA
chains in the Genus database with same CATH superfamily
4NNJA 3LU1A 5BSFA 4W8OA 4P38A 5EHXA 3AVOA 3PT5A 3NYRA 1Z16A 1T36A 1EK1A 3TJMA 1Y1SA 1Z68A 4KCGA 2ZWAA 2PKYX 4RHUA 1NRIA 3MTDA 2WWWA 1NVWQ 5ESRA 1XZ8A 4NFHA 5KHLB 2AZXA 1HUQA 1QFJA 4XWWA 3O8QA 4JNGA 3C8UA 3KKZA 2PZ8A 3AG5A 4EUKA 1QTNA 2VZEA 1BD3A 1ADCA 2LP4Y 5DF1A 1PZFA 3UW3A 4DUGA 3MT7A 5HW0A 3VR5A 1KAOA 3R44A 1Y48E 1JE0A 3E1KA 3QVSA 3KU1A 2I2DA 4MA5A 5A3QA 1ULHA 1X15A 1A8PA 4RCZA 3P2EA 1KKUA 4E5DA 2VUSA 1Y8QB 3NHAA 5BQFA 1Y3FE 1T5OA 4HDMA 1L5GB 4RD3A 3TIFA 1KFJB 4WCDA 1HKUA 2BSXA 4WE3A 3RJ5A 1XWIA 3ZW7A 1R0BA 4BJ6A 5T4BA 1V4VA 1G21E 4R1QA 3TTXA 3FZNA 3GMSA 4XDGA 4HZIA 3U61B 4F45A 3N5CA 1LDMA 2FWNA 1BWRA 1EFVB 3CKLA 2QTWB 1DIRA 1LF0A 1NJGA 2YIMA 4IJKA 4JIGA 4IDDA 1F2UA 4F12A 1I4EB 1Y9DA 3TVYA 2NSHA 4Q7EA 4WSOA 3MTQA 3WOVA 1BDBA 1A04A 4DT1B 2V6MA 1AN0A 3GH1A 3HRKA 4O1IA 4IDEA 3COPA 3WGZA 2HF8A 4J4TA 1A97A 1RBMA 1SK9A 1EH5A 4R01A 3NVDA 1TKCA 1E9DA 2F4NA 3AXSA 4PIPA 1GNLA 1Z28A 1YQXA 2ZUCA 3GLSA 3VR0A 3ZHRA 4YUZA 3FLMA 1K92A 4NBTA 4UEJA 4KRFA 1M10A 4ZQGA 4CR7A 3WL5A 1RVV1 3NEPX 5C52B 2ARKA 3CVUA 2WR8A 3P0JA 3DCNA 4F7WA 5LMUB 5FBHA 3U1VA 4HWKA 2H4WA 5SZKB 2VTKA 4D5GA 1ZK2A 1HSOA 3BMQB 4BX9A 3ENNA 4ZZ0A 5LOVA 4LF7B 2AI1A 1A7KA 4Z0NA 2JCVA 4DPMA 1R0KA 1A77A 5HE8A 2Q4DA 3MYRA 3W8RA 4W63A 4CDMA 4AMYA 1BU5A 1HTWA 5JCXA 3INNA 4NPHA 5HRUA 4UZFA 4PRLA 4UU7A 5IWCA 1OF1A 4HB0A 2OSVA 2H4HA 3LHKA 1Y6RA 1IB0A 1WBDA 3L4KA 3HR7A 3FCOA 4DGQA 2JBAA 2QLMA 3W5BA 3JVUA 2O2EA 3NWOA 4PLGA 3E2IA 3O82A 3PYMA 2IBSA 4PYNA 3OLYA 3NHRA 5E8RA 4GIBA 1KTVA 3V6MA 5KKCA 2QTTA 4ITUA 5AVYA 3P9KA 1Z56C 3OE1A 3GLIB 3TW8A 2AMLA 4KQWA 3I2HA 1G2IA 4GL4A 1QZZA 2DQKA 1YKGA 5KSPA 1IULA 1Q6ZA 2FLKA 4D4IA 4LN1A 3AJ8A 5CA1F 4P3YA 5DXFA 4IXTA 5D86A 4O4LB 5KX5F 1GZ5A 2I4MA 4AB1A 1NN3A 2KI5A 3GHYA 4PLWA 4TV8A 3U7QA 2AOUB 5JALA 4WLEA 3ZKWB 5B1EA 5CFQA 2F8TA 1O87A 2FX3A 4TYQA 5AVJA 3VI3B 2BT4A 5KVVA 1I2ZA 2A9KA 2V96A 3LPAA 4NOMA 3RBVA 4ETMA 2PWZA 5HZMA 3O4GA 1RPNA 4II3A 5KNBA 2B8WA 4FWIB 4ZV7A 1RP1A 2ZSHA 1SA0A 1VLVA 4Y2GA 3T5BA 4F4JA 1UPXA 4OK3A 5LUAA 1GRCA 1YR9A 4MTCA 5T41A 3SXPA 1ULBA 1UBTS 2FCAA 2PYZA 3V97A 1JG3A 2ERXA 1Z7WA 2WV7A 4TT8A 4QBIA 1JHYA 3CSSA 1FEZA 5BMVF 1S3FA 2EFYA 1T5DX 1XZCA 2QTNA 2XWPA 1O0SA 2K7ZA 2Y99A 1L7OA 1T3HA 3CNLA 4KX3A 1OC4A 3T4UA 2BLNA 5K99A 1PSWA 4YRLA 3JS5A 3Q9NA 3AIKA 4X94A 4DJDC 4ZYLA 1SVKA 3R6WA 1TU0A 3IIIA 2FG6C 4ZOLA 2C5BA 2VZ9A 3OIVA 3TM4A 4CMIA 4XI9A 4QT4A 4DREA 4Q1BA 3A1CA 2ZIEA 3THSA 2ZUEA 1YR7A 1JEYB 3AFIA 2C5AA 4BQIA 2AQKA 3ZJYA 4HFNA 1TOAA 5E9JA 3GHHA 3D4OA 4XZ3A 3SX2A 3TSAA 2Y68A 3O4RA 1M6WA 3DDOA 3EGIA 3VVCA 3HRIA 2XD9A 1H22A 4UU8A 3KZCA 3O4IA 4L4RA 4Y0VA 4I9HA 3KR0A 1G1AA 5ICMA 2J0UA 3R24A 2V98A 4HDQB 2QX9A 3L01A 1XTKA 3KQPA 1Z4IA 4OUDB 1XJ5A 3SHOA 1RAGA 1PG5A 5MN6A 4C5CA 2PMFA 4N12A 3PXAA 3R76A 2IGTA 4LYAA 2FSSA 3LOQA 4G0ZA 4WWHA 2HJHA 4Y2QA 5BMVB 4H9GA 4ARBA 3COZA 4INOA 5JO9A 1XLTA 5TMDA 1PT6A 4B31A 4RQBA 1ZY2A 4DA7A 1DKRA 3I61A 1WP4A 4LYJA 3AF0A 3K30A 5DGHA 5DM0A 4ZV4A 3B38A 1AKWA 3ESCA 2IH2A 1L4FA 2DPYA 2YMLA 5LA6A 2C4VA 1KJ9A 1KI6A 4WXRA 1EUDB 4LXYA 2WYWA 4IINA 1WZIA 1I1OA 3TFOA 4TTQA 3C5WP 4D9MA 3H99A 1HT2E 4V1CI 1XKXA 1PNVA 3EXG2 2GJSA 1WA5A 1SR8A 3MGGA 5EMHA 4DA4A 1EUZA 2A88A 5JXWA 4UDOA 4RJLA 4JVOA 3V8NA 1JHVA 2JIMA 1M7BA 4B8WA 3G2OA 4A0QA 1ZVVA 4UCXA 1QVAA 4WERA 5J4LA 3ISTA 3IA2A 4RCVA 3IODA 1S89A 4H1TA 3ZV5A 3TEMA 4P5DA 1QP4A 4N18A 3O1JC 3OPQA 3MJTA 3ESRA 4E11A 1PS8A 1DHTA 2A9JA 4IEFB 5G0WA 1J8FA 4NENB 3K8OE 4AUNA 3REFA 4DXHA 3HBJA 1H8HD 4G2TA 1T2DA 2XA1A 4KN9S 2WVAA 2FNAA 3AUAA 4H3KB 4HYQA 5CHYA 3WP0A 1QIDA 4I3HA 3FAKA 3B2NA 4ARUA 4ZVOA 3GAAA 2CGEA 2GTHA 2EHDA 2HXSA 2DOKA 3GCZA 4FFDA 3SSMA 3M70A 4X54A 3KEGA 1UXKA 4RVHA 3T7TA 3UGQA 1IJEA 2PVPA 1PI3A 4TS3A 4ZVVA 3Q3CA 3CNOA 2D7CA 1REQB 4FC6A 4KMSA 4RA6B 2CCKA 1DVRA 2GPYA 3L7LA 1HNNA 1N2BA 4P8RA 3EQ9A 3V8RA 4FDAA 4M99A 1MT0A 2HUNA 4PAQA 1MFZA 2AE1A 2P2LA 1V1RB 3ZWMA 4JP1A 1C9NA 4FGKA 4UHBA 3EIOA 3VNBA 5E3IA 4GC5A 3CPEA 2HADA 3FN4A 3NG1A 3OJEA 1GOTA 2YHIB 4HATA 1WPGA 4HAVA 5E4JA 1RYFA 3D5TA 1TEHA 5AVOA 5CX4A 4TL8A 2DH5A 4LOIA 5G02A 3UJCA 4PHCA 2QP9X 4A26A 1GDTA 4EHLA 1U2TA 3BRWD 4YMWA 2ZWMA 3IS3A 4MO2A 4L0DA 1II0A 2EJWA 3IJ5A 1XEAA 1U5CA 1SD1A 3NIFB 4AYWA 4TSRA 5EVJA 3B89A 3O4FA 1TT5B 3A37A 5BUZA 5EERA 1K97A 3BREA 3OP1A 4XE5A 5AIAA 1DIAA 1XUOA 4FFWA 5DHFA 3NRBA 4DLTA 3GGGA 3I1FA 3JQBC 4CR6A 5IJZA 3GR6A 4Z49A 1XEFA 5AUPB 3DOOA 6YASA 1WSAA 4P0QB 1V35A 3O3NB 1COZA 1TMOA 1SUAA 2Y1GA 4G07A 2IUUA 4P33A 1U3VA 5KMGA 4MV4A 3BK1A 2I4NA 4DCMA 3ILSA 4Y1RB 1VI2A 2HF9A 2E2WA 4UAVA 4ZEWA 1E1NA 1QGAA 1O6GA 2NZUG 2UZ0A 5TMEA 3AB3A 5KDOA 4YT8A 3AINA 1E3JA 1X94A 1EJ0A 1HX7A 1X14A 1EVEA 4BYGA 1ILWA 5EVCA 2IS4A 2DBRA 3ZDAA 2GM5A 5AIBA 1HOTA 2NUAA 1O54A 3S8MA 4KIJA 4JN6B 3ZY4A 621PA 4K87A 3CW8X 3RVDA 1TF2A 4BQQA 3X43A 2YY7A 2X23A 2IP4A 2R87A 3WLQA 3HJGA 1CG6A 4NJMB 2Z1MA 2P67A 2R8EA 5TVGA 1L4HA 1TQ4A 3G7SA 1G8YA 4Q9IA 2JIPA 5EWJA 1F5SA 5DGCA 5G0SA 1BKYA 3E6AA 4DANA 5J2TA 4WPGA 3HL0A 5BN4A 2AJDA 4I6EA 2RH9B 4MNTA 4MS1A 2ID4A 5T4HA 1H66A 4FHFA 2I1QA 1V9CA 5EE5B 5B30A 1AMUA 4DC0A 2O06A 4W8HA 2JI8A 3L6OO 3R6GA 2YW9A 2O2XA 5DOVA 2OAGA 4ZREA 2QW0X 1DTWA 3AERB 3JZAA 3LM8A 1WF3A 1T26A 4KEAA 4LXTA 1MDBA 1J5EB 3A4LA 2BV3A 4MR7A 3THXB 1XNHA 3MMPA 5HJ5A 4GSYA 3UT0A 4A6EA 1KI2A 2NO5A 2R1TA 2V6IA 4NSNA 1VYHA 4B4WA 2MYPA 3Q12A 1UM9A 2HRCA 4UFNA 3IEVA 2XI4A 3I2GA 4CI0B 3AV3A 5HM8A 1J2TA 2AFIB 4X6LA 1PQUA 2BLLA 3N58A 5AI8A 2Q5JA 4GZ6A 2FV8A 3G49A 4V0ME 2OSBA 3G5TA 1IOLA 1T4MA 3KHTA 4FB5A 4BFYA 1E1DA 1POWA 1QGOA 4LC1A 5FFFA 4MVJG 5LB2A 2RHGB 4OQZA 1CZKA 4JX8A 1CIVA 2QT0A 2VA8A 1N3IA 2YCBA 4N5HX 4DLLA 1YSCA 3QU2A 4QFCA 3SYTA 4HG2A 1PL8A 1M8KA 1X7YB 5FLKA 5JU6A 1TVCA 4D26A 4RKWA 1O96A 3G1WA 4Z0HO 4MDFA 1ZJ4A 1WSBA 1BEUB 3LWDA 4U6QA 4ZAWA 2X0DA 4DSUA 3O8CA 2G9RA 5E9QA 3WWPA 2I9KA 2FEOA 3CUTA 1FSFA 1PZEA 2PYIA 4INPA 5HJEA 1WXWA 2JKZA 2BGTA 1UK9A 1NWHA 4FPXA 4D57A 1RAAA 1ZKMA 2D0OB 3MJ4A 4JLDA 3TLEA 4YMUA 3NHZA 2ZGVA 4I8IA 5IAKA 3VU8A 4D43A 5C7LO 4RL6A 5JSHA 4TVSA 4R7TA 2E4AA 2FPLA 4D3FA 1B26A 5HDBB 3ANMA 5EY5B 3V48A 4BWFB 1YOBA 3A9WA 3QXGA 2YRWA 3HDHA 4P7KA 3ZE9A 1NKVA 1A9QA 1E79A 5TQ0B 1QU2A 3GF4A 1BEEA 3P9RA 2R4TA 4PYKA 3DOHA 3GGPA 1TK9A 4NJOA 4O4HB 2FJPA 1L5HA 3RAPR 3T5DA 1H2EA 1NMXA 1PGPA 4LTDA 2XNDD 4GG1A 4DY6A 1CEEA 3IILA 2OWDA 5EKSA 2YXNA 3IEMA 5D5PA 1XEWX 1KRWA 2EFCB 1YNSA 4ED9A 1KQFA 4LEIA 2QENA 4NAUA 5A5GA 1ZHOA 3TAXA 4HR7A 3AKZA 1WJGA 2XJ9A 2J7KA 2E7ZA 1XMPA 2ACEA 3HCDA 3MBIA 4NIMA 4OKNA 3VSCA 1US8B 3OKPA 4HDRA 2WSIA 1H9CA 3EZGA 2GRAA 4EA9A 3SBEA 1II8A 2RHMA 4YRPA 5JZ9A 2ZXUA 3AR9A 4O4JA 1CUXA 2INGX 2QW8A 2HGSA 2CZCA 2I6GA 3CZAA 1FXWA 3E15A 3HYNA 3IEKA 2N1MA 3M1AA 4OLFA 5T4FA 1N4AA 1VHTA 3WA6A 3EMVA 4GWGA 3Q87B 4QOIA 4ZOLB 4CKEB 4CL8A 3SVTA 3QKSA 1KK3A 2PWAA 5E4TA 1YJ5A 1JR3A 2Y76A 5A7GA 2Q28A 4P7JA 1FFAA 3KX2A 1QHIA 3TM5A 4AY5A 2YOHA 1LY1A 2QP3A 1CERA 4MVJP 1K0FA 1FUKA 3JD0A 2Q6VA 4R8MA 5DTEA 1TKAA 3OHMA 1E2UA 2DBQA 3GLVA 2NVOA 4MV9A 1XD2A 4PF1A 1NVKA 3RHSA 1G66A 1GL7A 3E9MA 4TXMA 4I1SA 3VFDA 1LV7A 4QKQA 4MCAA 3H9CA 1ZN2A 4WLOA 4H6VA 4C4XA 4ZMRA 2ZROA 3UJAA 3P0IA 2QTVB 1WMAA 3ETHA 3M4YA 2AMYA 3GLKA 2J3HA 3LOPA 4N39A 5EUCA 5EMJA 1E61A 4RESA 4YAFA 4LFCB 3V55A 3QU9A 3IQXA 5B36A 2JLZA 1QVWA 5P21A 2XVYA 2AV6A 2GZMA 1KE2A 5J4VA 4I8DA 1R6VA 2JIBA 3D9QX 3DBRA 3DEAA 5ENVA 4B8YA 1RP7A 1BA3A 2HUPA 1MABB 4B3BA 1V5FA 5ITVA 1HNXB 2DEUA 1NOJA 5JDIC 4DC1A 2VIIA 1P4AA 3PFKA 4HX2A 2YICA 2AFVA 2AG8A 2ZVDA 3ST7A 1N4DA 2H2FA 3EQ8A 2BVNA 1NUUA 3FBGA 8OHMA 1VYVA 1V96A 2IUFA 4Z99A 2PMKA 4RVOA 5E1DA 1WCIA 4ZT3A 4BMCA 1BQ4A 2AOUA 1Y5NA 3FCUB 4B4OA 2AKYA 2G9QA 1BZYA 3AB7A 3V2HA 4DFDA 3M0EA 5TQJA 3UWSA 3G8CA 2PZLA 2EJTA 4MEJA 2MIIA 4LNHA 2GASA 3A26A 1PT8A 2RSLA 3QF4A 4MARA 1H0KA 2ZE5A 4ND1A 2WHPB 3OQOA 3ZNPA 4MWGA 4S1NA 4H77A 4BMVA 2F8MA 4GMKA 4C0QC 2E9SA 4QJ4A 1YUMA 1N3BA 4ILEA 1AK2A 4L2IA 1MTZA 4MQFB 3NHYA 4FFPA 4PBSA 2JGNA 3KVVA 4PPGA 3ZQ6A 1OR8A 4KXMA 1HM5A 2XUIA 3C6ZA 4GPBA 3H9GA 3CFYA 4H1WA 4XJTA 2DM6A 1QLHA 1DDGA 2ZSBA 3IMKA 1ZVMA 2IP1A 4B48A 1L5WA 4K1LA 5G0VA 4ZVLA 4IJ5A 4ZEXA 3EFBA 5B6PA 1KSGA 5KQSA 2AJCA 4EJ0A 3MRTA 1NC1A 4UCWA 3NORA 2JLRA 3QVVA 2WD9A 5ARBA 3DYIA 1KSFX 2Q9BA 1XZNA 3N6RA 1Z12A 1VJRA 3C1AA 3VPHA 2XB2A 1KHHA 2ZEJA 2G17A 2CVQA 4LHXA 4EZEA 3VR3D 2I87A 5EIAA 4J4BA 4E07A 2OFWA 5EJAA 3K1AB 1NQUA 2XUAA 3H83A 3IO3A 4D4LA 3RO7A 2GPSA 1BMTA 3A4VA 1PR0A 1BC5A 1GZ6A 3NX4A 1AO0A 3REGA 1M2EA 2HBRA 1L1EA 4EZBA 5KWVA 2PU5A 1GNQA 3IDSA 2XZPA 3QGMA 3N59A 1BHSA 1ZA2A 2R0QC 2G3YA 4C07A 4Q7LA 4ER6A 1FS5A 2OEPA 3FUVA 1ID8A 4JODA 1JKIA 2YS7A 1OB2A 3NETA 1EDEA 3BF7A 3WAKA 3R5FA 4J49A 4CFYA 4BU0A 1Z5PA 2P0YA 2PUHA 3CURA 3LXRA 1A95A 2ZQZA 4E5MA 4JJFA 2HDHA 4M88A 2Y0EA 5C1DA 3RAFC 1IZ9A 1EE9A 2BZ0A 5C5IA 4X3OA 3CUYA 5L7TA 3AIMA 5JARA 2B7LA 2GTPA 3WGHA 1T25A 4MRMB 5LIRA 2OCPA 1C2TA 4K6CA 1GZ4A 3RRZA 2R85A 2PAFA 4QPDA 5EE0A 1WCYA 3DVSX 3H4MA 1QG0A 3P19A 3QY9A 2OPBA 2FN4A 1U8UA 5EHQA 2H2IA 1K5GA 1YR6A 5EYPA 2O5CA 2GPNA 5HM6A 1W4ZA 2ZT7A 3EDYA 2HEGA 3CLHA 2IIVA 3O75A 4RZQA 3WK6A 2CFTA 1BRMA 1SXJB 1WSDA 4ALKA 4F8JA 3TZEA 4ZCMA 4UNSA 2AOTB 4L02A 2DLCX 3QWIA 4YRDA 4JKYA 5EN4A 4QJIA 2VUHB 3B9PA 3RUCA 2WILA 1RHMA 2PX0A 4DDTA 5JAQA 4IPTA 4BNHA 2ZREA 4EHAA 4PZ0A 1DC4A 2VVTA 3UMGA 1G20E 4R1PA 3RTEA 1S8OA 1DS6A 2RGYA 4UHDA 2MWMA 4YJKA 5KJEA 2GZSA 1UKAA 1KU0A 1WCXA 1M5UA 4HAOA 3WRXA 5BSVA 1YA8A 3I6BA 4WBNB 3SOZA 1DC3A 3FDZB 3K9BA 4BU1A 3K9QO 1R74A 2MTBA 4NXMB 2F4VB 2XMQA 4XX0A 4KJXA 3D8BA 3LLCA 4FWTA 2LBPA 3BIOA 4K9LA 1DFIA 2GF2A 4J6FA 3ZNOA 1G8SA 3ADKA 5CM2Z 4CKYA 4EVQA 4JI4B 1OWPA 4OVKA 4OU4A 4BRUA 1K06A 2HZ7A 2PGLA 2AN9A 1Z7EA 2HU8A 2QT9A 1XQXA 2ROQA 3EOZA 1RJEA 3IDQA 3ICPA 3G6WA 4G5RA 1Q0HA 4KSCA 3PXGA 4RHEA 3DV0B 3LXMA 1ZH6A 1N2XA 1A9XB 1TYBE 3K96A 4JSYA 4DXDA 4RHXA 3F5SA 3H6HA 3MINA 1N2CE 5C32A 1KMIY 2CEAA 1ISHA 2JFUA 4G5OA 4V3CA 3AI1A 4QOSA 1GRNA 3NB0A 1C7RA 2Z09A 5B64A 4CLHA 3P20A 3WGLA 3I5AA 1U7WA 3RIXA 5LQKA 3F5FA 1E9SA 1IOVA 1SK8A 2JH9A 4LBWA 5AQEA 3CSDA 3KSUA 1R0YA 3ZIUA 1IG0A 4GPEA 1YIOA 2DPXA 2GPTA 3WYGA 1S9DA 2B8NA 2FW6A 2P6OA 4KTVE 4N3CA 5G3YA 5A5DA 5K5EA 5AJXA 2BSQA 4I08A 1JAXA 1CQIB 2WTXA 1T0JB 3UA4A 5KWEA 5FCDA 2VWHA 3OJLA 3BDIA 2GWRA 1DTEA 4NWIA 4WN9B 3ROGA 4A16A 3RPEA 3BXXA 1OBFO 4FXOA 4CNQA 2C2GA 3DT8A 2HPAA 3I0ZA 3UGTA 4TWJA 3QP9A 1KI7A 3AW8A 4ARVA 2AFRA 2CUTA 1WUHS 2B35A 3OPYA 2D59A 3TTVA 2Z5FA 4KC0A 4CL2A 1JKFA 1GPMA 3F6CA 3ESXA 1K5PA 4RIEA 1E6LA 1N6IA 1WY7A 1E0DA 3IQFA 4HGQA 3DBHA 3AEYA 3HB7A 3QEBZ 4N65A 3P2MA 3RROA 1E2IA 2IY9A 1QCYA 3OIUA 3OQJA 1QDLB 5EXEA 2HY7A 4N0DA 4OFZA 2R84A 1GGEA 5TX7A 1IVYA 1BTOA 3F0TA 3S27A 5LR6A 1GRVA 1VE9A 2C9CA 1B4DA 3A04A 3V7FA 3VSEA 4QREA 1G59A 5ICGA 5AICA 4YN3A 1X74A 3AR8A 4HDRB 4KXXA 4ZI7B 2ZIXA 2O8FA 1UJ4A 4L5AA 1USUA 2H8KA 3STWA 2CCJA 1UOEA 1Y3CE 4KU4A 1P3JA 4WIAA 5DWQA 3QUSA 4JD5A 4DKJA 3R0QA 1D4AA 1QG2A 3I04M 4O8CA 3QX8A 1YRBA 4TPKA 3LDUA 5IHPA 1YA4A 3MJHA 3R3JA 4DMGA 1AUQA 2BI4A 2E55A 5PGMA 3AGQA 2R9VA 3MD0A 1JDBC 3IR7A 4X20A 1XZKA 1SWVA 2ZIZA 4N6GA 1FY2A 2QM7A 2FSFA 4MUJA 4N5MA 4WLNA 3TPFA 4L78A 3CRNA 2XUDA 4DR4B 4LX8A 5DZSA 4QOEA 1PYOA 4B7CA 3TRFA 4EA7A 3ZIAD 3VJRA 4QXOA 1SY7A 2OQIA 3PBKA 3OO0A 1ENOA 5H82A 3KQKA 1TJYA 5F4BA 3KELA 3MUNA 1NU8A 1GCIA 2XPCA 3KPYA 4RNCA 1MO5A 4U8GA 1PVDA 3COVA 4OJYA 4ZA2A 3SKXA 1VMKA 2L17A 3C16C 4E2YA 2NO4A 1X7ZA 2VQFB 1YQEA 2Q21A 1P1RA 1T8YA 5FLEX 1ZK1A 1GU0A 3R0IA 4RVDA 5JZOA 3BXFA 1NVVQ 4ZI2A 1I0LA 2WB4A 4TYPA 3TB4A 4FT4A 2A0FA 2OMEA 4RBNA 2CSUA 1KJIA 5B6IA 1ZW6A 1Z0FA 3H9EO 4G0YA 4XQGA 3ROXA 4RPJA 1G0NA 1XELA 3TINA 4YYEA 3RWBA 1W29A 1LBTA 4NZPA 1D2RA 1JH8A 4L95C 1Q0LA 4DARA 4GMXA 4MRPA 4WQMA 4CE6A 1FOEB 4IS2A 1YIAA 1C30A 4PHHA 3T7CA 2CHGA 5T6MA 4JA2A 1T2CA 3S40A 1O0BA 1DBRA 3D64A 2HDNB 4IV0A 4IHQA 4MS3A 3D6FA 3SQNA 2KM1A 1LU9A 2QL7A 3DYBA 3MCUA 3HDYA 4K6GA 2A6PA 3GEIA 1ZRMA 5DHPA 3MCWA 5A4FS 3LF1A 4D92A 1GN9A 4FI3C 2EQ5A 4WKNA 5AVZA 1BQ3A 4PX9A 2A1UB 4PCAA 3JYQA 5LP6C 3S2IA 5ITWA 1LK0A 4L0MA 2PO5A 3HRHA 2HOQA 3QVGB 4NCHA 2QX8A 1ND6A 3A7EA 5EG5A 1WD7A 2E3JA 1YFLA 4EY4A 3U7EB 3PLAE 4BFLA 3FFXA 1NP3A 2QJRA 2GHRA 2FKNA 2R86A 4I14A 4YCCA 2I6FA 1ST2A 1W5AA 3ONEA 2A5LA 4DJAA 3SR4A 4Q12A 1CK4A 1GUFA 1RJWA 3BS4A 3HCNA 4KDEA 1GQ2A 1XWWA 2UVQA 1F14A 4MUMA 3SK0A 4C7VA 4S1TA 5IUJC 3D31A 4JVNA 3UAWA 2DVMA 2Z5VA 4IFEA 1BW9A 2AFHB 4QU8A 2Q6KA 5HQ3B 2ZRQA 2XAUA 4K9PA 5JZVA 4OH7A 4P36A 3DZBA 4DN6A 4BN0A 3OZUA 4BO3A 3PGXA 3G2QA 5HOQA 3KSMA 2IL1A 3DFKA 2WB2A 2O0JA 4AN4A 2QRJA 3GRRA 1O5OA 2H9IA 2Q3DA 2XY4A 5IK2A 5AP9A 1FQWA 1PNOA 5FFNA 4O2AF 1QJ4A 3TFQA 5G3ZA 1KC3A 3I6IA 1Z74A 4GLFA 4Y9RA 5KAMA 1GQQA 2X7JA 3P9IA 3CNEA 1QHNA 3NFYA 4KWIA 2VJLA 4MWTA 3C8DA 3Q0TA 2AX3A 2PZGA 1HEYA 2BFEB 3P5BA 4WNIA 5HKBA 2JEOA 1V11A 2VK1A 4IZOA 2CMHA 4RVNA 2A59A 1PUXA 1YOVA 1XXHB 4IDBA 1PNQA 3M6MD 4BLOA 4IMRA 1SG6A 4C4TA 4EG4A 1OFTA 4NHEA 1Z6PA 2YJGA 1ULSA 5IKPA 1EQUA 2QTZA 2IYYA 1B8NA 3A0UA 2ZKLA 3AFNA 2E4XA 3MXTA 3Q9LA 5IEBA 4MICA 3ZWVA 3AI7A 3W9SA 2QLFA 1XO1A 3T1HB 3Q8LA 1Y0BA 5P8WA 4GI1A 1QB8A 1Q6YA 1VLQA 1OUMA 3QOYA 1WHTB 2JHFA 4B71A 5T8KC 5B6JA 3NDBB 4XFDA 821PA 5DM70 1E1YA 3ELDA 4H0CA 1TCVA 2CWDA 4GXNA 5E9AA 1NRWA 4HNGA 2OR3A 3HKDA 2ORED 4CU2A 1LRLA 1ZNYA 5B4TA 4BP1A 3GZJA 3LP8A 3F4LA 5AUQA 4BNYA 4GLJA 4ECEA 3SZUA 5L4NA 3F8SA 3PNLA 5EWMA 3QMPA 1U2ZA 2AW5A 1YWGO 3NWBA 3OT1A 2C0PA 1VKZA 2B1RA 4ZD6A 4UBMA 2UZ3A 3VNSA 4TT3D 3ZU4A 2ZYGA 5GONB 4DR6B 4IZIA 2Y93A 4RKRA 2R7AA 4DV6B 2PGOA 1GAJA 3FWNA 3LC1O 3OCJA 2W6JD 2I4TA 1N1MA 1YR2A 221PA 5ALIA 2W43A 2V7TA 4WCVA 1E9BA 2XIJA 1EEXB 3HKDB 3HNRA 2ADFA 2Z6AA 4R98A 1WNTA 1YZTA 2NXEA 3HB1A 4FEGA 2E89A 1SVLA 2XF8A 3D0QA 3OWHA 1HSZA 1E5QA 4MJ7A 4H16A 3BYZA 4P1ZA 3SBXA 3SX0A 3TUZC 1UCFA 1VE3A 4QFBA 5A02A 4AKEA 1CZLA 1IG3A 2PQ2A 4R5MA 3TECE 4H27A 1RSZA 2ZYRA 3C24A 1U8CB 5BOVA 4EHKA 4FUQA 3E9YA 1K4KA 2VNKA 4NHOA 3UPDA 4IIHA 5IMSA 2X7HA 3NOOA 4KKVA 1Z8HA 4HGRA 3BA1A 4FQ8A 4UEOA 1OYOA 3EXFB 3DZIA 4WKPA 3C6MA 4P5PA 2I62A 2GSDA 1DDOA 3PDWA 5A6SA 1U5AA 2ANBA 4BBPA 1DTSA 1OPXA 3VR6D 4J9VA 3RS8A 1JJVA 4AZSA 4AUMA 2EBHX 3P0FA 3FROA 2VYFA 4A1FA 3C3WA 3IBTA 5HK8A 2POCA 2ZJAA 1W76A 3HY4A 3O4HA 2QORA 3PGKA 5D85A 5C8YA 3UXMA 4L9AA 1C3OA 4CR8A 2VUUA 2HLHA 1BDMA 1Z35A 1USKA 5FAXA 5TV2A 1FVXA 1GTL1 6CHYA 1IN1A 4TVKA 3HGTA 3Q10A 1JMKC 3A58B 1HZJA 5JWRA 3A4MA 3W7AA 4JJ6A 3AHDA 2EFHB 5IC6A 5A05A 5BSKA 1SCKA 2WTMA 4M22A 5LPNA 4G9BA 3BA6A 4AMUA 3BMOB 2QMEA 4H6XA 1IZZA 1L9KA 1ODKA 3KJEA 4PLVA 3TMAA 1DRWA 2CNDA 2WZBA 2AN5A 1JWLA 1ZWKA 3GDOA 4JHLA 3MAAC 3BHIA 4R3NA 2JEYA 1YS4A 2G80A 5TR9A 3CVVA 4D4JA 3QYFA 3MRXA 1XCPA 1RPAA 1YF3A 4IKEA 2J4FA 3MS2A 2EFGA 4XIYA 1YTLA 3VO1A 3EX7C 1NBWB 2ZRAA 4I9FA 1ZR2A 2BY4A 4AY6A 2VYNA 1EAYA 1SZDA 1HG1A 1I3NA 2L42A 3HO6A 4PLPA 4K3UA 1U9ZA 4R68A 1PK7A 4E5PA 4B3IA 5ICCA 4X6YA 4NICA 3OFKA 3KC2A 5B7QA 1D0IA 2DUNA 3RKSA 3R40A 5IDWA 4DR3B 5BYKA 1VMIA 2X1LA 4UXJA 1ADJA 3LT0A 3QPAA 1OX6A 2JGAA 2OHVA 4QYIA 3LKBA 3I58A 1I32A 4HXFB 1T35A 3UC5A 4I6JA 3ZYZA 1CHNA 2PUTA 4M0KA 4YRRA 2JHCA 4NV3A 1BH6A 1EFTA 1MH1A 1WDKA 2QQEA 1ML4A 1JHAA 3I3SR 3FGOA 5BR7A 5FUMA 4BOYA 1O95A 5EJEA 1SA0B 2NSDA 2OYSA 5JC1A 3MRSA 1N77A 4NBKA 3PPVA 3ZDRA 2PTGA 3KPVA 5JIBA 1PJTA 5HIKA 1T5LA 3V8VA 5FPPA 1XZFA 3GNQA 1R1DA 4EW2A 3OPVA 3A1SA 1UPUA 3NBKA 2VRWA 1TK3A 2XHEA 3PFIA 3TB6A 4QGSA 4FBMA 2J5XA 3O3CA 4MQBA 3SEAA 4BFWA 1GKUB 3ABRB 5IAOA 1B00A 1W87A 4EEKA 1F1JA 2D1RA 3L77A 4YCBA 2G4VA 4P3OA 3UZUA 1W49A 2XSZA 4ZQBA 3THRA 3THOA 4ARAA 3IOMA 3OTOB 1MIOB 1DTWB 4AP9A 4YVFA 1E2JA 1ZDMA 4ZZ1A 2FHPA 2X9GA 4OFWA 4XSGA 5JD5A 3EPKA 1T5SA 1I2MA 2PH5A 3DVRX 4KPEC 1NV8A 3HB9A 2Y2UA 4N48A 3DFZA 2PAAA 3CZQA 1Q0QA 4JLSA 3GEDA 4B44A 4CMBA 4LY3A 4CQMD 2OXTA 3FIJA 2NVUB 1YZUA 5DVZA 5IZ4A 2OLEA 3I42A 2XZLA 1IIBA 1P81A 1WM1A 2BEUB 2DHCA 4YP7A 1HDYA 1H94A 2IF0A 2KLHA 5FTNA 4EL5A 2FPGB 1F4PA 3VR1A 3I30X 2JBHA 4P93A 5HWSA 4AP6A 2C4UA 2FY8A 3RSLA 1IK6A 3Q3JB 1TEXA 3KOWA 4IDQA 5DN9A 3WYFA 1J22A 4DLZA 4JCCA 1TDJA 4EPYA 4Z86A 1VC2A 3L79A 4D3ZA 5JTUA 2FZGA 3QVOA 1W6UA 1IJFA 1CJUC 3EEBA 3AESA 1DQNA 3LFTA 3LWNA 3OQIB 4FOPA 4PXSA 3EQ7A 4PTYA 2OA0A 1VYUA 2HR1A 3FYUC 1OKKD 4GD3Q 4FKBA 3DUWA 3IEXA 1FTSA 1NBAA 2NZVG 1JBKA 5DYGA 1CY8A 4KK3A 2ZRLA 4UQPA 3K6KA 3KEQA 4MIOA 3AZPA 4F06A 3PKIA 3R7BA 3RK1A 5E1MA 3N87A 1AQJA 3H6GA 2YC4C 3KL4A 1THGA 1MORA 4PLTA 2FXVA 3VYTB 5KAPA 5E1BA 4BX8A 2VHEA 3CKYA 3LPMA 7ADHA 1NWCA 5I4CA 2VDRB 4EF6A 1Q3TA 1JBEA 2QVBA 3BEOA 3EOAI 1Z4PX 4FOOA 2G7ZA 1EGVB 3TQHA 4NBNA 1XAJA 2IEAA 2MHCA 3FI9A 3UK1A 4ZDIA 3W5SA 1X1AA 3M1IA 4BX0A 2SICE 5KSOA 5HPYB 1R0LA 2BBWA 3LBYA 3MJSA 3DW3X 2JEZA 3ZJ5A 2J6BA 1BFDA 3FYUB 3TAHA 3B12A 4CLEA 2Q29A 3EIUA 3T61A 4KQMA 3KKKA 2VLBA 3KT0A 5M7EA 4ESVA 3IAHA 2GTIA 2WKPA 3N0VA 3MTBA 3NC4A 3PITA 4ZYZA 3NWJA 1CYDA 2GHIA 5L6MB 3JYLA 3HJCA 5DGIA 2ZJBA 1D1QA 2VC2B 1Z2DA 3EA0A 3MT9A 4NZ9A 4XUDA 2I4OA 5EPEA 1QRAA 3NM5A 5JXHA 3IIEA 4UEQA 4DV3B 4K9QA 4ZK6A 2ZRCA 4PSDA 3F5DA 3DKVA 2CLSA 5F23A 1JYFA 1YU6A 4G09A 1MB9A 1S4QA 2V7XA 1QGZA 3B8EA 4BLSA 1VJTA 1N25A 5ITZB 1FE8A 3CO0S 5C0OE 4MB6A 2QZ4A 4U7DA 3SZRA 1NJ6A 4GSLA 1SCUA 2IH5A 1K2WA 4Y18A 3LVBA 3HV0A 4YJGA 1NW3A 1ACMA 2LE0A 2FW1A 2VXOA 2WAYA 3D7NA 4U2FA 3FHJA 5THXA 4DNFA 4H08A 1U2GA 3FHCB 3IQGX 4JEUA 5ISMA 1KYWA 1XTUA 2IK8A 4NCJA 1IN7A 4XIIA 4NC9A 3D3NA 3IERA 3SG0A 1KYQA 1EQAA 3V32A 1SCAA 3ZXUB 1UXHA 1XN4A 3LGSA 1UPTA 1BCRB 5HYVA 3KO8A 4M87A 4IYJA 3VJLA 3QVMA 3VPBA 4IGKA 2FR0A 1KQOA 4EPXA 2YY6A 3W90A 3HA7A 3LG2A 3TNFA 4M6WB 2Q99A 3EQZA 1ZJZA 4N8DA 3E81A 2Q2OA 4YUXA 1DQZA 4NTZA 3SF8A 1G3UA 3AEKB 4P35A 1CTQA 4G86A 1O97D 2Q3HA 2RI1A 3ZV7A 1MC5A 1ZUNB 4LCJA 3V4RA 2BEWA 2IF2A 5B58T 3AJRA 2PHZA 4MS4B 4FX2A 1QXSA 2R751 4LBVA 5IULC 1MRZA 4J43A 2G1AA 1OLUA 3CLSC 4UD2A 5FBLB 4EFKA 2RHDA 3BH0A 4QUGA 4B7XA 2BEVA 2Z04A 3UJ9A 4Q0MA 1U6IA 3KJFA 4J1QA 4JYAB 2ZS7A 2VZ8A 1VE5A 3DDNA 1IM5A 2FR1A 2PRJA 1EBUA 3BWMA 3IUNA 5LLSA 1MDFA 1DJNA 3DUFA 3PUYA 2XCQA 4E6EA 5K8UA 3CMCO 2DCUA 3TRDA 2HDWA 3LKVA 3K0CA 2V3VA 1BS9A 1GL6A 1ONPA 2YVQA 3L02A 4ZOQI 3WYAA 6ABPA 1FQOA 3R7DA 2IDJA 3L18A 2ACKA 3K92A 1PEKE 1WTCA 2ZBEA 1B6SA 4C0AC 4DCVA 2FQ1A 1CIPA 4R7ZA 3Q9UA 1A5AB 4J0JA 1E2FA 3W3AA 3DCYA 2WG1A 3ZX5A 4JVLA 1AV7A 2QTBA 2R6HA 4UZEA 5IAJA 3Q4GA 1SQFA 3JWJA 4KWCA 3MHTA 1YKSA 4P58A 3ADDA 2EFEB 5GVSA 4E3ZA 4UNIA 4QAJA 3V7YA 1M66A 5K6RA 1CKEA 1EMDA 1Y5IA 3OCYA 1UT6A 3KSBC 2QN1A 3LBHA 3I2YX 4MVJD 5J43A 2XLCA 1CWUA 2VYND 5CH8A 2C4TA 5T8KA 4B32A 1XDBA 3KKOA 3OURA 1L7NA 3KJGA 1T1SA 4QLAA 4FVTA 2BHLA 3TRIA 1B6TA 4ZICA 3BIFA 1FSPA 5E6SA 4FMPA 4KQXA 1D04A 1F2VA 3EGOA 5KMGB 4YMGA 4R9NA 4BMXA 5L40A 1E7QA 3Q7SA 3L5OA 4X7RA 1TZKA 2P40A 3BJIC 1AV6A 2D5LA 5ALSA 3PGLA 1JHOA 2OV2A 2W2NA 3ZHVA 1CP3A 2WMYA 1YDGA 3T7RA 3WBJA 2E5LB 2OMKA 1U8ZA 3RFCA 3VZQA 1I6MA 2QR3A 3NBUA 1LI7A 2OC9A 2WF6A 3ZD8A 1KIAA 1W2WB 3SS9X 1TYCA 3EZLA 1D5WA 1FVFA 3DT9A 2PR7A 5FPQA 4QZVA 1X7WA 4KQ6A 3HC7A 2YFYA 2B99A 1Q1NA 1EWKA 1T5TA 3L07A 3Q6MA 4NBUA 5B57C 5B7PA 1JG2A 2GYVA 4L0QA 2Y66A 4EAQA 4L50A 4FR0A 5G41A 1LVUA 4Q16A 2G5GX 4J0FA 4BWGA 3BMNB 4G23A 3WDMA 1SO8A 3JQ7B 3MGCA 5B55A 4OLBA 4Y0NA 1C7ZA 4A0GA 3ED5A 3UOGA 1B74A 3VO2A 4DV2B 2YV4A 1M6VB 3HDGA 3B3JA 2FWAA 4XASA 1E3QA 2HMYB 1JKXA 4GPZA 3VZSA 4X3PA 3L7IA 2ZE8A 3R3WA 1YVRA 3ND9A 4XSVA 3RC8A 4R41A 4CCAA 2P9FA 1IEVA 5EIFA 4P4TA 1XLWA 4EI9A 1R88A 3RUFA 5ILQA 2FPKA 3MLBA 5IUKC 1N3YA 2ZJFA 2ODNA