2R2GA

Structure of eugenol synthase from ocimum basilicum complexed with emdf
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
310
structure length
310
Chain Sequence
b'GMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERQRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eugenol synthase 1
publication title Structure and reaction mechanism of basil eugenol synthase
pubmed doi rcsb
source organism Ocimum basilicum
molecule tags Plant protein
total genus 111
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.1.1.318: Eugenol synthase.
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2r2gA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2r2gA02
2GGSA 1YRLA 1I0ZA 1DJQA 2UUPA 5EESA 3MTGA 3DZFA 4NPCA 1A72A 1KVTA 2G1UA 2GZ1A 5AXBA 4RPLA 1ID1A 3DBLB 2Q2WA 5DNAA 4DRYA 1VSUA 1J4AA 3PI7A 3EAGA 4HFRA 4CMCA 2C2XA 2VHXA 3IC5A 3IJRA 3PJDA 1T2AA 5G0SA 4PLGA 5IAAA 1PEDA 1HLDA 1YONA 2NVBA 4NU6A 4CV2A 1IHYA 1UR5A 1ENPA 2OMEA 3CEAA 1SEPA 1NPYA 3DBVO 1N2SA 2IZ1A 3KB6A 4QX6A 2I99A 3UCEA 3H7AA 3W4IA 4DQUA 1I33A 3F4LA 4BQRA 2Y1CA 1NFRA 1O9BA 3GG2A 3L4BC 1DBVO 1TT5A 2EERA 2FHSA 4JIGA 4XWYA 3PLRA 3V2GA 5I8ZA 1UP4A 1XELA 1BVUA 1X7DA 2J5RA 5IFLA 5JMWA 1A27A 4J2HA 1XDWA 3D3WB 4JN6B 4ALMA 2AXQA 2Q1UA 1B0AA 4U6SA 1P45A 3JCZA 4PLPA 1WXDA 3LT1A 3WBFA 4B4VA 4IINA 2X9NA 2GZ2A 4OSPA 4G65A 4CLEA 1H93A 5BSHA 3DWFA 4WJZA 2Q45A 1EDOA 3CUKA 1ZO8A 4GX0A 4GKBA 3RU9A 4C7JA 2PH3A 3ZN2A 1HE5A 4Q3DA 1LJ8A 4W82A 5CPBA 3IP3A 4XYMA 5C7LO 1CEQA 3A14A 3NTRA 1T1RA 3NX4A 4XQCA 3UKOA 3W8DA 4Q3NA 1ZBQA 1KOLA 4IDFA 4TRMA 5G4KA 2YZ7A 1S6YA 4R68A 4C4OA 3HWRA 4OSOA 3MWDB 4AJIA 3IIEA 2JAPA 1PX0A 3IKTA 2DBRA 3HE3A 3HSKA 2GASA 1JA9A 2HQ1A 3HJAA 1SBYA 3DEYX 5L3ZA 2Q4EA 3I9OA 4IY1A 3NDIA 3GVPA 3F5QA 5DF1A 4CQMD 3IDSA 1XIVA 1P44A 5TC4A 1B2LA 3VPHA 3VZPA 4CV0A 3R0IA 3GMSA 1HL3A 3HADA 1LLUA 1BXZA 4GQAA 2W2KA 1IL0A 1GPDG 1TLTA 1CJCA 3ETGA 2PR2A 2X9GA 4NFSA 3OJ0A 4R1SA 3K8ZA 4XRRA 3I5MA 1NHWA 2YV3A 3DBRB 3PTZA 3UXYA 3ZNQA 3QVTA 1K6XA 3GLQA 2YQ4A 4MVJH 1PZHA 3FN4A 3WXBA 4BNLA 4ZVVA 3Q6IA 2A4KA 2QW8A 3CXRA 3AW9A 4FS3A 3ANNA 3NJ8A 1GCUA 1HZZA 4TKLA 4YCAA 5BNIA 4UVGA 4Q9NA 1IPFA 4UEJA 1DIGA 1BW9A 3BAZA 4ND5A 4YB8A 3WYEA 1EQUA 2PNFA 2EKLA 3MJCA 3T4XA 2AEJA 4ALJA 1ZIDA 4NK4A 2TMGA 1QR6A 4D3FA 5TRTA 2VTEA 2NSDA 4EITA 5KNLA 3UCFA 5T64A 1LLCA 1E3SA 4UUOA 1R37A 4BNGA 2NTNA 1MA0A 4PLWA 4PLHA 1E3JA 1XLTA 4BNUA 4A27A 5DP1A 2DFVA 4ZQFA 4DWVA 3RUCA 1ISHA 3RFVA 1BGVA 3LC1O 3AU8A 1ZMTA 2CF6A 5G0TA 1PIWA 1YBVA 1LI4A 1PGQA 5IDYA 3RKUA 4R3WA 5A4DA 3S1LA 1DC6A 2X0JA 3FTNA 3TJRA 2Y66A 4RVDA 2C29D 3HN2A 1KEVA 4WLOA 2C7GA 4QFDA 3DMYA 2V6MA 3C8MA 1PQUA 3SBOA 3I83A 3OHSX 2CY0A 4UVIA 2Y68A 3OH8A 4AJLA 5L95A 3PGJA 1WDLA 2A35A 3AWDA 2VHVA 3SJUA 3U49A 4B3IA 3GDGA 3MJTA 1AGNA 4LCJA 2ILTA 3DTTA 4OL9A 2B69A 4G81A 3KLPX 2AQ8A 5K6AA 4FFOA 4AFNA 4WLUA 1B8UA 4PFJA 5MDHA 4CJXA 1WMAA 1C1XB 4IDAA 4O59O 5T5QA 3ICPA 4K1LA 1LXCA 1A71A 1K6JA 3KXDA 1PWXA 4QTZA 4KDFA 1GYPA 3KSZO 3NDJA 1X1TA 1NP3A 3WJ7A 1PJ2A 1SC6A 4PIVA 3JQ9A 1XA0A 4WOKA 2NUAA 5G0WA 1P1JA 1YL6A 4BKUA 1HSOA 3HFGA 8ADHA 3D7LA 2X23A 2VNAA 3JQAA 5IXYA 3C7DB 3TPCA 2R00C 1B15A 4AJ2A 1LDYA 1ZVMA 5IZCA 2E49A 3B20A 1JVSA 1K5HA 2NTJA 4OGWA 4BOYA 2C5EA 5EPOA 3ST7A 3OBBA 1PZFA 3PXXA 2C7VA 2Q2QA 2NM0A 3VC7A 1YKFA 4CR7A 1A7AA 4CM7A 1D3AA 5L45A 3ITDA 2B4RO 4LW8A 1AHIA 3MJVA 4LRTB 1JWBB 2R6JA 4R9SA 3D5TA 1IUKA 1WDKA 4FCCA 1NWCA 3F6YA 2GNAA 3QV1A 1LEHA 3M6IA 2PD3A 1I32A 2GRAA 3IUPA 3PHGA 1A4UA 5LC1A 4MP6A 1E1LA 3DAGA 3E18A 3BMCB 5L7TA 3DBLA 3K31A 1R16A 2HU2A 4E33A 4NI5A 2RHCA 1DDOA 5F1PA 1EFKA 1E1MA 1DLJA 4MKZA 4BNIA 1F0YA 2A92A 3CINA 4YRBA 4FPXA 5JAMA 1QRRA 5CEJA 2RAFA 4QECA 1QLJA 4BGVA 1YB5A 3WJAA 1R12A 3BZUA 1I3KA 1RJWA 4RORA 1DIBA 4IMPA 1M76A 4OM8A 3RUFA 4FIZA 1O95A 4BO0A 3GN1A 4DPMA 4JX8A 4FOSA 4NNJA 1CQJA 3NV9A 4XZ3A 3EK2A 3B1KA 4FJ2A 1CRWG 4PLYA 4XB2A 1KEWA 4DXHA 4GSKA 1GQQA 7ADHA 3D3WA 5JFOA 3WS7A 1P1FA 2O3RA 5L4NA 1E5LA 1R15A 3KEQA 4P8RA 3ASUA 1O8CA 2V6FA 4YYZA 4HNGA 1MC5A 2X5JO 2H1SA 1E7SA 5FF9A 4LSWA 4MP3A 4TROA 2ZYAA 1L7DA 3B6ZA 2NVUB 1PR3A 1PGOA 2BELA 2GLXA 1Z73A 2DUUA 3BMOB 3PVZA 4ND4A 3GRPA 3TL3A 2AA3A 3NTQA 4BNXA 4XGIA 5A04A 5CDYA 4DLAA 2YYYA 3DDNA 1ZXLA 4P38A 4WUVA 3ZWWA 3K2BA 3OECA 1WDMA 2QYTA 4R4JA 3S8MA 2H9IA 4GL4A 1G0OA 1VLLA 4E2XA 3C1AA 4BO5A 2X1HA 3N74A 4PGFA 2YFHA 4XCVA 1V9LA 3E5RA 2OZPA 4XQGA 3D1LA 1HDYA 4IUYA 3UN1A 3I4FA 3ZWOA 4HKTA 2IZZA 4JGBA 2P91A 3AFMA 2ZYGA 2FRDA 3M1AA 4BNKA 2Q1TA 1ISIA 1PJ3A 2NVWA 5GZ3A 1B8VA 1ORRA 5EJ2A 3SJ7A 2DM6A 4GAEA 1KERA 1X15A 1YXMA 3NT5A 4PLTA 1LDNA 2XAAA 4R1UA 2H5LA 1UDAA 2XF8A 4TSKA 3ZH2A 3NRCA 4Z0PA 4RGBA 2FR0A 4J0FA 4NH4A 2X0NA 1OZAA 4TVOA 3B1JA 1I30A 4EZBA 4J1QA 4W4TA 5JXWA 5IZ4A 2PGJA 3ZV5A 3H9GA 5TT0A 3RQSA 3VH4A 4CV1A 1YE3A 3CZRA 1PS0A 4L75A 1NAIA 2VT2A 4DMMA 4CM4A 4LVUA 4AJ1A 5JE8A 3EUWA 4P4NA 4UAGA 3PWKA 4Z9XA 4BHTA 1YH3A 5F5LA 4CM8B 2DFDA 5F5NA 3N58A 1K3TA 2VWQA 4QT0A 2FOIA 3ENKA 1PJ4A 4CLOB 3ONDA 3FNEA 1R6DA 1Y9AA 1YB4A 5IJZA 1LSOA 2QRJA 3IS3A 4BL5A 1YB1A 1MLDA 3S2IA 3JV7A 4OQYA 2XXJA 2ZB3A 3E9MA 3LT2A 3PFWO 2V7PA 2OBNA 1NFQA 3MZ0A 3JQDA 4NZ9A 2HMSA 4GKVA 4J7UA 1YGYA 4EBFA 1TI7A 2J8ZA 1TVEA 1AXGA 3HUDA 4G2NA 5KKAA 1B26A 2JJYA 4XDZA 1MP0A 3PZRA 3L6OO 4DLLA 1E3WB 3GRKA 3GNSA 2HSDA 5L7YA 3HB4X 4K28A 3OIDA 3PHIA 1PJQA 1GR0A 5IDWA 4S3MA 3ZWBA 1H6BA 1MC4A 1GQ2A 3K73O 4RPHA 3PYMA 4MO2A 4PG5A 2BI8A 3G49A 4D44A 3AM3A 4LGVA 2JHFA 1GPJA 1VL6A 3VVBA 5A3VA 1JDJA 5H81A 1B14A 4BNFA 4AJJA 2PK3A 3EDMA 4DIFA 1D8AA 4LMRA 4DC1A 4ZD6A 2VRCA 4MVJG 5TNXA 2O48X 3INTA 1ZXBA 4IM7A 5L9AA 4DYVA 2VYVD 3TZQA 3ANLA 1P31A 1X7GA 3K5PA 4FGWA 3P2YA 4YQZA 5DULA 1KC1A 2B5WA 5HBRA 1VKOA 1Q7BA 3LQFA 3WOHA 3U9LA 1ENOA 2JHGA 1DPGA 5H83A 4D3SA 1T2CA 1C14A 4HNHA 2PWZA 1C3VA 3ETDA 2G0TA 4TRJA 2O4UX 4JLWA 2O3UA 4CMIB 2Z95A 4Q3CA 2NTVA 2IDZA 5ER6A 5T6BA 1H6DA 1RYDA 2PV7A 2CNBA 5CEFA 5EERA 1X0XA 1HWYA 5K6AC 2DPGA 1QORA 4NG5A 5KVVA 2BD0A 2YDYA 3QHAA 4YXFA 5A1TA 4WK6A 2ZTLA 1JAXA 2LDBA 1DFGA 7MDHA 2ZCUA 4UUMA 3DFUA 2J3JA 3Q0EA 1FDUA 1FDSA 1MX3A 1ZJZA 3JQFC 5JDCA 3G3EA 2HRZA 2Y99A 3E9NA 3BHIA 4KUGA 4JJGA 2HMUA 3L0DA 2UAGA 1Z45A 4YTEA 3JQ9C 1EZ4A 3BMCA 1LSJA 5CP8A 1NVTA 2H6EA 2ZJ1A 4XQ9A 2YUTA 1FF9A 1I2CA 4J49A 5I9NA 1HKUA 4WCFA 3A1NA 4WASA 4RVUA 4FGSA 2HMWA 2CDBA 4PG6A 4ZN6A 2D1YA 3HZZA 2FN7A 1D1TA 4XB1A 3GGGA 2IEBA 3RVDA 3WGGA 3AOGA 4ID9A 4ND3A 6ADHA 1H2HA 1GZ4A 4R41A 3RBZA 1EBFA 2SCUA 1P1KA 1U3TA 2YHIB 3GT0A 3STHA 3P19A 4E21A 1OOEA 3H65A 4QFCA 3RC2A 4XGNA 4ZGWA 1X7HA 2O23A 4I08A 5EL0A 4E0BA 1NBOA 4UVDA 4ZA2A 4J9UE 3FWZA 3OMLA 1U3WA 2B4QA 1KY5A 1UZMA 3Q2KA 4GMGA 1H2BA 2JD1A 5JYEA 1X1EA 2C5AA 3A4VA 1M6HA 2UYYA 1R0KA 2O7QA 4X54A 4R5MA 4ZRMA 1ONOA 3HQ4O 4NBVA 1VM6A 2H63A 3DZHA 4UREA 4BO1A 2WDZA 4DVJA 4GX1A 2POQX 4CLRB 5B1YA 2W2LA 1DC4A 1QYVA 5H82A 1Z7BA 4TKMA 4RDIA 1YO6A 2NVUA 4N5NA 1DHTA 1Z82A 5GZ6A 4EJMA 3JD3A 2YW9A 3LDHA 1LX6A 4Q3EA 3ORFA 4K9DA 5A5EA 1XQ6A 5CDGA 3DMTA 1ZKMA 1BTOA 2VQ3A 5JY6A 1T2EA 2FPPA 3VPFA 1ARZA 4A26A 3GMDA 2VOEA 3DAPA 3I6IA 4HXYA 3AI3A 4BO4A 3OJFA 1T1SA 2CFCA 3DAFA 3RUEA 1BXKA 2DU8A 2NV6A 2GERA 3LF1A 4JK3A 3JD4A 1GZ6A 2RCYA 3FHLA 1ADFA 4PLVA 5IDQA 2NWQA 3T7CA 3H2ZA 2HJSA 5KOIA 3DHYA 3SXPA 4EUEA 4ZJUA 3ADOA 2OL4A 4EW6A 4NBWA 4M87A 4OMUA 3JTMA 2UUOA 1V0JA 4RPKA 5FFFA 4BO3A 4WLNA 2GO1A 3EZLA 3JQBC 4BB5A 2GPTA 1MXFA 2ZQZA 2EJWA 3FWNA 3U0BA 4JXKA 3RKRA 1VSVA 3WTCA 1FDVA 1VJ0A 3ENNA 2EG9A 3KLMX 3GUCA 3JYOA 1GY8A 4GGPA 4GGOA 4GWGA 1PSDA 4I5EA 5CPFA 4BO6A 4YRDA 1A4IA 3JQ8B 5HTOA 3WQQA 4BIIA 3DBHB 1MB4A 4WEOA 3WGTA 3CH6A 2O2YA 3K96A 4PZDA 2EP7A 4P22A 4A7PA 3L9WA 1LQTA 5ICSA 4L4RA 1SNYA 2VNSA 5A05A 3SVTA 3S2FA 4PZEA 3NDRA 4KDEA 5CFZA 1B16A 1U3UA 5JO9A 3MJ4A 3RCBA 4OOFA 3DQPA 2GSDA 1GV0A 1F17A 2I6TA 4WPGA 3OP4A 2C54A 3UICA 4IJKA 3ZDFA 1ZNQO 1QYXA 5KJEA 3PWSA 4Q39A 3ROPA 5I7VA 3FR7A 4ALKA 2EWMA 4CM8A 4P4LA 2LDXA 1PJBA 1JWAB 1KY4A 4CODB 5I7EA 1KVUA 2BGKA 3R6DA 4IZIA 4I5GA 5ENDA 4HFNA 4CLOA 2IYPA 4BO7A 1B3BA 3LZ6A 3PQFA 3ZCXA 1LC3A 1IZ9A 1T25A 3H5RA 1E5QA 1EUZA 4PLZA 1X0VA 4FW8A 1I3MA 4FFNA 3H6KA 3AUUA 2Y0CA 1NPTO 1HXHA 1N8KA 1N92A 1LRKA 4XIYA 3UOGA 4BV8A 1GUYA 3FNFA 5KKCA 2QG4A 5CDUA 2X5KO 1E3WA 4LMPA 5BT9A 4YAKA 1LBEA 2X9VA 1VL8A 1R66A 1XQ1A 1K89A 1MG5A 2D5CA 4N5LA 2BF7A 4BNYA 2G5CA 3D4OA 3UFXA 3GUYA 2VUTA 3LC2O 2P9EA 2CF5A 3AI2A 4LVCA 4AVYA 1M67A 4Z9YA 3ZNPA 2D5AA 1VI2A 3EW7A 4AJNA 5C5IA 3RROA 3VZRA 1K6IA 3GEGA 4GLLA 3BIOA 1KS9A 4BMSA 4BVAA 3DZJA 2HJRA 4YVFA 4BO2A 1E92A 4L4SA 4ILKA 4J1NA 3JQCA 3UGKA 4BNTA 3ZW9A 3KEOA 2AMFA 4WE3A 4E3ZA 3P7MA 5ADHA 5I8WA 2O3JA 1LLDA 3HDQA 1AN9A 2CSUA 1K0UA 2X86A 3HDJA 1LLQA 1ULSA 2Q46A 4MVJE 1PWZA 1UUFA 1EUDA 3UCXA 3F3SA 2NQTA 3U3XA 4MPDA 3OSUA 1AE1A 3NT2A 2Y1FA 4RF5A 4WCDA 1Q2XA 4FN4A 1DRUA 5KVSA 4BKPA 2OO5A 3TL2A 5TGDA 3OIGA 1HDCA 3BHJA 1JN0A 4O5OA 1SAYA 4CMIA 4B3HA 3EVNA 3GVIA 1LDBA 1P0FA 4RDHA 1HE2A 2CDCA 4PRLA 4QO7A 4CM9D 1JVBA 1BVRA 3WG9A 1SZJG 4F6CA 4CM4B 4FJ0A 3PJFA 4GLOA 3ZHZA 3IKVA 3KSUA 4TMFA 1W73A 2HK8A 3KYDA 4HWKA 4K26A 2GDZA 3I9KA 3KV3O 4BMNA 3PDUA 5IG2A 5EINA 2BKAA 3F5SA 3BA1A 1PS9A 5JDIA 2PKQO 3K92A 3OQ1A 4R3NA 1UAYA 3CE6A 3JD2A 4IMRA 2WTBA 3CSDA 3MJSA 1HETA 4CL8A 3FPLA 1LRJA 3KVOA 3EY4A 1ADBA 4JBIA 4NJMA 4S1VA 3A28A 1IOLA 3LF2A 4J1TA 1LSUA 2P68A 3GZ4A 4W7IA 4D46A 1ZUD1 4M54A 1OI7A 1W6UA 4M8SA 4PRKA 3BTOA 4AICA 1ISGA 1JKFA 1I2ZA 1VL0A 2PZMA 2O4CA 3GQVA 1C0KA 4JP3A 4OIMA 2J3KA 3KO8A 4DBZA 2YHIA 3E48A 4ZQBA 3OICA 2DC1A 2DTEA 4WLFA 1E3LA 4CMEA 5L4SA 1O89A 1EE9A 2AQHA 5FWNA 2OORA 4FFPA 2VYNA 9LDTA 4GWKA 1U28A 5B12A 4D41A 5B4VA 2F00A 2X5OA 3V5NA 2BMAA 2HO5A 2EEZA 1EK5A 3GAFA 2DVMA 4GSLA 3PGXA 3C7AA 1ADGA 2C82A 4N18A 5JDCC 4ZHSA 3RBXA 5DOVA 1UAGA 1B8PA 1H94A 5IF3A 4NIMA 2JCYA 1PGJA 3DZIA 3WGIA 5JCJA 4CLRA 4BNZA 1SOVA 5A06A 2FR1A 3DZKA 1E1KA 5JBIA 1ISMA 5AQ1A 1FK8A 5JAQA 3AUSA 2O50A 3O03A 5IN4A 1V3VA 4AL4A 1LQUA 5TSDA 1LUAA 3E82A 4II2A 4BNWA 4E2ZA 4YAGA 2E6UX 2YFQA 4CMKA 3C85A 2UVDA 3NKLA 5IDXA 3X2EA 4HADA 3PK0A 2ZTUA 1C0IA 2JCVA 1E7WA 5KJCA 1HF3A 5TT1A 2JD2A 1EE2A 1UH5A 2PD6A 4YDRA 1ZZEA 3I6QA 1NR7A 5JO0A 3Q9UA 2ZYDA 3UW3A 5K9ZA 2Q49A 3L6EA 4OH1A 1E6WA 4D3DA 4DPLA 4DQVA 5A03A 3ZW8A 3ROMA 3WYCA 3K30A 3L9XA 1Q7GA 4NBUA 4R1TA 1MV8A 3W4KA 1F8GA 2EKQA 4TRRA 5THQA 4KWIA 1RM4A 1FXSA 3ZWMA 5T8KA 5CDTA 5JYDA 3AOEC 4I8XA 1Y1PA 2EP5A 2I65A 1O94A 2DBQA 2ZJ0A 2AQKA 2DLDA 4YBZA 4DLBA 2Z1NA 4YT5A 5EN4A 4DREA 4BNJA 3I3OA 3KM0A 4WCFB 3K6JA 2IYOA 3KZVA 4WNIA 3GEDA 3AY3A 2JAHA 4WLVA 3RJ5A 3JQEA 5K0ZA 2DBVO 3JQ8A 4WNCA 4OXNA 1W0CA 3IP1A 4RCVA 1X13A 4NBRA 3DBHA 1DFHA 2BGLA 4GBJA 3IUSA 4U0JA 1DAOA 5ITWA 4E2YA 2D0IA 2BFMA 4XRGA 4Z3KA 1QMGA 2GUGA 4RF2A 2FZEA 2NU9A 4RPGA 1YVEI 4UVEA 4XR4A 3L4SO 1GU7A 3V1UA 1WMBA 1MFZA 2GN9A 4FC7A 5B4UA 3ZHBA 1ZK1A 3QA9A 4MINA 2AEMA 4ONEA 2UV8A 2Q50A 3CMCO 3GY0A 5BR7A 1BG6A 3ASVA 4MIYA 3JYQA 3VZSA 4BUCA 2WM3A 4Q3AA 2GD1O 3FBTA 4Q3BA 1KETA 1GUZA 1U7HA 1QXSA 1SEVA 4MJLA 4XR9A 5JMPA 3OETA 5LCXA 4IDGA 4RLHA 2X58A 4LISA 1Q0QA 4CPDA 1V3TA 4GMFA 3WMWA 2PY6A 3GGPA 3OEYA 5FI3A 3TSCA 4JQCA 5A3JA 1JKIA 2CMDA 4RZIA 3JQAD 1PL8A 2IZ0A 3D5QA 3IAHA 1T24A 2HKIA 4II3A 2WEKA 4Z3DA 2P9CA 3JD0A 2Z1MA 4NU5A 3QWAA 4BGEA 3IOYA 3PHLA 1XKQA 4HV4A 1HTBA 2J3IA 2Y93A 1HE4A 2D2IA 1BSVA 2XPCA 3LVFO 1LSSA 5COBA 3ZV3A 3RFXA 1R0LA 1DLIA 2B0JA 4ZQHA 3TZHA 3OJOA 1BMDA 3RC9A 1Y8RB 4R54A 1OFGA 3MEQA 5COQA 4D42A 2YV1A 3PYXA 4YJHB 4M49A 2X0IA 1NQOA 4FFRA 3ZNOA 2YQ5A 3AJRA 1YBMA 1P74A 1YS4A 1H6AA 1ZH8A 4OQZA 3E6AA 1R4NB 3OEWA 2X22A 3TFQA 2I67A 4B8WA 4CQMB 1WVGA 4F46A 2G76A 1XSEA 3QWHA 1C0LA 1Y9EA 4JBHA 2AE1A 4CM1A 3SLKA 1Z7EA 2PKRA 2DKNA 3I4CA 2IRWA 4YT8A 3VH1A 4RLSA 1OAAA 3GNTA 4RQUA 1EEHA 2B83A 3PWZA 3V1YA 4AJHA 3UHAA 4YEDA 4Z0TA 1Y5MA 2NQ8A 3O38A 1N7GA 2VWGA 1TEHA 3AI1A 3GOHA 3E9QA 4EJ0A 3GR6A 1PZGA 3S55A 4QQRA 1CWUA 5B4TA 1J6UA 2FSSA 1KIFA 4BKOA 4J43A 3H8VA 2FZWA 4FDAA 2PKQP 2VUUA 1PJTA 1GZ3A 1KYQA 3TFOA 3D64A 4MKRA 1OC2A 4O6VA 1T26A 1U4SA 3GDFA 3U4IA 1ZSVA 3UUWA 4E6PA 4FB5A 4PN3A 1KBZA 1BDMA 3WB9A 1PJLA 1UXKA 1DAPA 1DEHA 3UAGA 4YJDA 2HK9A 1D1SA 3AUTA 5I9MA 4YAJA 4WOJA 2FMUA 4WECA 4GVLA 1NXQA 5EQDA 3Q1LA 2OOSA 1XG5A 3E03A 2J5QA 3F47A 4BMVA 1XHLA 1IHXA 3TRIA 5DBFA 2EKPA 4F45A 3TWOA 1LRLA 3OA2A 1U8XX 4YJGB 3RD5A 3VPGA 2X7HA 4RPJA 1ZFNA 4ZU3A 4L4XA 3I23A 4JJFA 5G4LA 4FBGA 1IZ0A 2AG8A 3FNHA 3JYPA 3MTJA 3UF0A 1ZJYA 1ZMOA 1QKIA 4K6CA 3ZWVA 1QYWA 1LA2A 5DBGA 4HP8A 1EMDA 1EQ2A 3I9MA 1NNUA 3IQDB 1UZLA 1T4BA 2BI7A 3ZHYA 3KUXA 1HSZA 1UDCA 4I9HA 1IY8A 4NFYA 2HMVA 2WD8A 5JDIC 4L76A 3H5AA 1Y8QB 4I9NA 4EUFA 5C7OO 2ZB7A 5DP2A 1UXJA 1QP8A 2DBZA 1I8TA 4DGSA 3VDRA 1VC2A 3JQGB 3ITKA 1HE3A 4UUPA 2EF1A 3GGOA 1CETA 3V2UA 3GZNA 5TJ9A 3W1VA 2YDXA 1JTVA 3JQ7B 2QZ9A 4XYEA 5TS3A 4CLHA 3QSGA 1GTMA 1JKJA 1LDGA 1MUUA 4CUKA 3RJ9A 1M66A 3RFTA 4B79A 1GUFA 1EVIA 1RM5A 3PLNA 4CMEC 9LDBA 4J1SA 2WWRA 4D79A 4CMGA 4M1QA 2HLPA 3WQRA 2Q2VA 5DT9A 3A9WA 1E0DA 3PQEA 3KYDB 2Y1DA 4OKNA 3NYWA 1BDBA 1MXHA 2IODA 4KOAA 2Y1GA 1JU9A 4TQGA 3D4NA 3ZU3A 4A03A 3VTZA 3V8BA 4EEZA 1UP6A 3FCOA 1F12A 1IULA 3R1IA 4OAQA 4XQEA 1GAEO 3TF5A 4BO9A 4AJKA 3GFBA 5KVQA 5A9TA 3DC2A 3WDSA 1GQYA 4M89A 1FJHA 1VJTA 4NJMB 4B7UA 1CQIA 1U3VA 4FFMA 5DCWA 1K2WA 3Q2IA 5AXAA 3DB2A 3PP8A 4EDFA 3ZI0A 1MG0A 4AG3A 4J6FA 5IZCC 2AQIA 3G17A 4L73A 4CLXA 4CR8A 2VCYA 1HDRA 2P4QA 2BLLA 1N7HA 2WMDA 3OQBA 4Y6PA 3GDOA 5ER9A 3HHPA 4CMHA 5TQVA 4RF4A 4EJ6A 4LCEA 1QYCA 2Y0EA 1P77A 3DO5A 3GN2A 4GX2A 4MIOA 1VRWA 2EJVA 2BRUA 3AUAA 3RSHA 1O5IA 3FRJA 1MFPA 1DC5A 1WAMA 5G2OA 1J49A 1GCOA 4IIVA 3W4JA 1B7GO 1RKXA 2QYSA 2JFGA 3QVXA 5GY7A 1PJCA 4CMAA 5F3RA 2NU6A 5JSFA 2EW8A 1JLLA 1WZIA 5T8KC 4BNHA 2Q3EA 4IDCA 4W6ZA 1I3NA 4WGGA 2RHRA 4RVGA 1EK6A 1R4MB 3LK7A 3DOJA 1NQAO 4XA8A 4BKQA 3AU9A 3WX0A 3GA0A 3NTOA 2OGUA 4NFHA 4AJ4A 2IEDA 1PJSA 4D43A 1CYDA 2CZCA 2GN4A 4JJIA 3WBBA 1U2GA 4KZPA 2BFOA 3H4VA 1TT7A 3KTDA 1KEPA 4NQZA 4E13A 5I7FA 5T67A 3S2EA 5C3MA 2O2SA 4MKXA 3OF2A 3ULKA 3PIIA 2NLOA 4CQLB 1YQGA 3LLVA 2HCTA 3RI3A 1EFLA 2QIOA 4W99A 3HG7A 3H9QA 1LDEA 3HDYA 4A5OA 2BH9A 5JC1A 1KVQA 5I9LA 4NR0A 3U4HA 1WWKA 4ND1A 1N5DA 2EHDA 1ULUA 1Y8RA 5KJ6A 4ITUA 1YL5A 4CMBA 1OC4A 1T2DA 3BMNB 4YJHA 4ZQEA 3RAJA 4ESOA 5JS6A 2PA3A 3QLJA 4IDDA 5ILOA 5KCZA 4YACA 3RUDA 4AJOA 4NK5A 1P9LA 1JW9B 2NNLD 1E77A 2W4QA 1HT0A 3DZBA 3H3FA 3QWFA 4OYRA 4XIJA 4GPD1 1PQPA 1R4NA 2A94A 4W9NA 4YWJA 1WW8A 4CQMA 2FP4A 1FMCA 3DOOA 4CL3A 2V65A 2P4HX 1YOVB 3S2GA 4IQ8A 1NR1A 2Q4BA 4Z9FA 4YJFB 3DOCA 5ILGA 1ONPA 1BXGB 1U8FO 3Q9NA 3QP9A 4KUEA 1SO8A 1QV7A 3GPIA 1XR3A 2B36A 4I5FA 5L4LA 5JPIA 5F21A 2Y67A 3WGOA 5CG2A 3GVXA 5DOZA 5AVOA 5THKA 1IB6A 4H15A 1N1EA 1SB8A 3ZWCA 5JW6A 1GDHA 3H2SA 2OHXA 4Z6KA 1QG6A 1EVZA 1NVMB 2GCGA 3KBOA 4MVJM 5HS4A 4QSMA 1P1HA 2WYUA 1ZK3A 3WGYA 5CEEA 1UZNA 1A7KA 1N1GA 3Q3CA 3ZWAA 4CM3A 1ONNA 2RBEA 1DSSG 1UXHA 4BB6A 4DQXA 5CG1A 1KVSA 2E37A 2AE2A 3D3EA 3PYLA 1RYEA 1WP4A 3DFZA 2DAPA 4AJEA 5ENVA 3CIFA 1E1NA 3LSYA 1NVGA 2Y0DA 1L7EA 2VTDA 2PGDA 4IQGA 3HN7A 5JY1A 3D4PA 3ZU5A 2X8LA 3DZGA 4CM9A 1LTHR 3F1LA 4XKJA 4ZICA 2ZB8A 4PLFA 4YPOA 3NAQA 3VAZA 3VPXA 2W2LD 5EQFA 2Y05A 1GEEA 1ZW1A 3EHEA 4IPTA 3G79A 4E31A 4R9RA 1CERA 3I9JA 3WNQA 2C2YA 3C24A 3H9UA 4LN1A 3HFSA 2O7SA 3HNPA 1E6UA 1HZJA 2WSBA 1IYZA 2I66A 4YJGA 1DB3A 3O9ZA 1DIHA 4MVJP 1W4ZA 3MOGA 3RASA 1G0NA 2PTGA 4FQ8A 4RVFA 4B4UA 5T57A 1EDZA 1GYQA 1XWFA 1P33A 4MVJD 3SC4A 3TOZA 1ISJA 3O8QB 3RC1A 4KWHA 3SX2A 1HDZA 1NAHA 4URFA 2WE8A 4XJTA 4BNVA 4YRAA 1SPXA 1QLHA 2CUKA 5ES3A 5LDHA 1M2WA 3WLFA 2EGGA 1U4OA 3WLEA 3OJLA 1D7OA 1PGNA 2X4GA 3MOIA 4PG4A 3RUAA 5JAZA 2G17A 3FD8A 1Y8QA 3LT4A 1AHHA 3QJ5A 3VOSA 3T4EA 3RWBA 4EUHA 5F1OA 2B35A 3GEMA 3K2EA 5MGBA 2I76A 2JCXA 3JQ6A 2WE7A 1PQWA 1NYTA 2TMDA 4J7XA 4CR6A 3RC7A 3FF4A 1Z6ZA 2R2GA 4BS9A 2IXBA 1Q7CA 1Y81A 4PLCA 5DN9A 3WYBA 2Q1WA 3JQGA 2Q99A 4J16A 2ZTMA 4UEOA 4BNMA 1I5RA 2AEFA 3NEPX 4OXYA 4CMJA 1DOHA 2YHUA 1LNQA 3ZWNA 3CKYA 3SLGA 1E3IA 3DHNA 2GR9A 1CIVA 1NX6A 3JQ7A 1VJ1A 2VZ9A 4IGFA 3NT4A 3EGOA 1DFIA 4TVBA 4H7PA 3WICA 1P1IA 3CMMA 1JQBA 3RUIA 3GVHA 1F14A 4J90A 4J2OA 4MP8A 1T4DA 1I36A 3FBGA 4JP2A 3OA0A 4NDNE 3QE3A 4IXWA 3L6DA 1DIAA 3L07A 3BXXA 1JAYA 3QIVA 3LT0A 4IBOA 3GG9A 4HY3A 3AM4A 1XGKA 2ZIZA 3F9IA 3INRA 4LK3A 2G82A 3AY6A 2EXXA 3KRTA 4N5MA 4E5YA 2W90A 5JCXA 5U4QA 5BSFA 3CZMA 4R01A 3BYZA 4DTIA 3X2FA 1ENZA 1C1DA 1E3EA 1ZCJA 4WKGA 2JKVA 3H3JA 4B8ZA 4JROA 1E7RA 2V6GA 3I1JA 4N54A 4H16A 3DXFA 2RH8A 3MJEA 4U7WA 3QVSA 1V8BA 2CVQA 3G1UA 1HRDA 1I3LA 1J5PA 1GL3A 4E5MA 3ZNNA 2GZ3A 5A5FA 4KQXA 1ISFA 1YDEA 1UXGA 3BTUA 3OIFA 1Y6JA 2HAEA 4Y6SA 2QRKA 4DBVO 1WNTA 2ZATA 1BRMA 1U1IA 2VT3A 1A9YA 3GF4A 4J4BA 4LSMA 2F1KA 4DPKA 2NACA 1LDMA 1DC3A 3FSRA 5AOVA 3EC7A 1Y5RA 3F46A 5AYVA 5ICMA 3TOXA 5F1KA 3ZV6A 2IE0A 1KC3A 5J23A 1Z75A 3WTBA 5HWSA 4J91A 4NHEA 4U6QA 4KQWA 5U9CA 4B7XA 3U4CA 4B3JA 2OUIA 4J9VA 4XYBA 2PFGA 1DRWA 1J0XO 2VHYA 4DA9A 3NUGA 1R4MA 3M2TA 1QV6A 4J7CA 3DONA 4BNNA 4IDEA 2Y1EA 3SC6A 4B4OA 3KYBA 4ZRNA 1HLPA 2ZCVA 4IDBA 2PD4A 2WD7A 4WCFC 3BTSA 1UP7A 2X0RA 2I3GA 5JNLA 3LYLA 1FDTA 3PIDA 1XU7A 4L9RA 1C0PA 3VVCA 4MIEA 3A06A 3AM5A 3PFFA 3GZNB 3JQFA 1YWGO 2AW5A 1U2DA 3OFSA 3VDQA 2DTXA 1XCBA 2BHLA 3W8EA 4TZKA 1U7TA 2EGHA 4U5QA 4CQLA 1D4FA 4O0LA 4QXMA 1H6CA 1G1AA 1N9GB 4J4TA 2YJZA 3NGLA 1YBAA 4RVHA 2DUWA 5COAA 4ALIA 5FI5A 4I1IA 3ZZNA 4WEQA 5L7WA 2HMTA 2VWHA 3WIEA 3VHRA 1NTOA 1L1FA 3BMNA 3FPCA 2Y1OA 3WGHA 3VH3A 1PL6A 4XYLA 3VZQA 1EBUA 3WR5A 4A0SA 2GN6A 4UULA 1R0SA 4Y6RA 3GHYA 4IXTA 4XJSA 2OXIA 1A5ZA 2YV2A 5BQFA 4GH5A 3BMQB 3U4DA 1RM0A 3O26A 2NADA 1YOVA 2W8ZA 3C7CB 4UUNA 5KVCA 3R3JA 2JFHA 4YJFA 5TLSA 1BXGA 3DHEA 3DMTC 1H9BA 3KYCA 2BGMA 3TDKA 1EUCA 3T7EA 4XX0A 3ROKA 1EVYA 2CVZA 2VOJA 3PEFA 2PGLA 3ZV4A 4G5HA 4FC6A 4FFLA 3WGZA 2X6TA 4LRSB 5EIOA 4OOEA 2WYVA 3NJ4A 3PDJA 5TJHA 2PZKA 3W6ZA 1ENYA 1U5AA 3WIDA 2P2SA 1TXGA 4O1MA 1Y7TA 4W7HA 4E5NA 5I7SA 1E7YA 1ZK2A 3JYNA 1PU2A 3H9JA 2VYND 4IS3A 1W8DA 5JLAA 4IGEA 3OQ6A 4MVJF 3FI9A 3C1OA 2VZ8A 3VKUA 4KMSA 3FR8A 4GX5A 1GD1O 4L74A 1HDXA 3ETEA 1Q0HA 3QQPA 4Y98A 1YL7A 3TQHA 1NHGA 3UH1A 4IJUA 1NASA 3HDHA 4DMLA 4INAA 4YAEA 2VHWA 4TWRA 4W9NC 4L0QA 4CUJA 1TA4A 3K9QO 2PZLA 5B37A 1F06A 3KHUA 5TX7A 3WNVA 4E5PA 1B3RA 5JCJD 4PVCA 5LDGA 4R5HA 5AXDA 1Q1NA 4ROSA 3TZCA 3C3XA 4RVSA 4K6FA 1ZEJA 3NGXA 3QWIA 5L51A 2CD9A 1NQTA 2P9GA 1ZK4A 2BFAA 4B4WA 2J5KA 2E48A 5G0VA 1X14A 3D0OA 4CLDA 1EVJA 4HBGA 3U5TA 3JQBA 1NQ5A 3KETA 2B5VA 2GN8A 1NPDA 2B4TO 4YT2A 2AG5A 1XYGA 5KTKA 1WPQA 1E6EA 3CTMA 1ADCA 4BKRA 2O3SA 3IL2A 3BHMA 1YQXA 1QSGA 3PPIA 1WZEA 3JD1A 2PH5A 3O8QA 1UXIA 1AUPA 2D8AA 3C1TA 1U9JA 4KP7A 1NM5A 5KJFA 4Y9DA 1OBFO 4E32A 2D4AA 2P5YA 4PZCA 3ZHXA 2EW2A 5DCUA 2ZB4A 2NU7A 2V6BA 3L77A 3B1FA 4MVJI 1P0CA 4B7CA 1SOWA 1CDOA 2I9PA 4JCOA 3ZU4A 4FOOA 2CDAA 3WWZA 4JBGA 5BNFA 4ND2A 4BQPA 1HDGO 1I24A 3L4BA 3FNGA 5A9SB 1Z74A 2ET6A 4J0EA 6LDHA 5KJ1A 4XGKA 3QVWA 1HYHA 1PZEA 2VZ0A 4E2WA 1UJMA 3ONEA 5C37A 1I01A 1KEUA 3ADPA 3WQSB 4OHUA 5HA5A 3VKVA 5FYDA 2OFPA 4ALNA 2ZK7A 3M2PA 3P2OA 3ON5A 2FWMX 4YT4A 3V2HA 1GYRA 2VYVA 3OM9A 4RQTA 3TZ6A 3DBRA 1AXEA 2NU8A 1TB4A 3QW2A 4OJNA 3G0OA 4L8VA 4Y8VA 2C20A 4GVXA 3O4RA 3H5NA 2PZJA 4TRNA 5GMOA 5BSEA 3ZWPA 4BGIA 2VUSA 4ZQGA 3BTVA 4AJPA 1V6AA 1MGOA 3RIHA 2VN8A 2GF2A 4IQ0A 2D59A 1M75A 3H9EO 4UVHA 1IPEA 4C7KA 4R1NA 4TZTA 3WWYA 2RIRA 2J3HA 2O3TA 3F4BA 4QO8A 1YJQA 2E82A 4MDHA 5CAEA 4RL6A 1TT5B 2B37A 4KUHA 4Z0HO 2J6IA 1PR9A 1SB9A 2DPHA 3AK4A 2JFFA 5HM8A 4QEDA 4IJVA 2ZQYA 3I9LA 1Q0LA 1HYEA 3KOUA 1ZSYA 4Y67A 4PG8A 3ZU2A 1XEAA 1VE9A 4FJ1A 4OO3A 2RH4A 4BGUA 4F3YA 3EYWA 5HS6A 1FDWA 1NWHA 1QYDA 2QHXA 3JSAA 3RBVA 3W8FA 2FSVA 1WLYA 1DO8A 3ZGYA 3PHJA 3ZWXA 3GNQA 4GI2A 1H5QA 3VH2A 3EZYA 1PGPA 1SCUA 4R51A 4BO8A 4XYGA 3UVEA 3ABIA 3E8XA 5G4KB 1DHRA 5JC8A 1DXYA 1YQDA 4EI2A 3IJPA 3GVCA 3KSDO 2JL1A 1U5CA 5IXSA 4I9UA 2QX7A 3B70A 5AXCA 2EV9A 2QRLA 3CPSA 3RUHA 1O0SA 3HB5X 5L53A 1G6KA 3EMKA 1YDWA 1V3UA 1C1XA 4WLEA 1IE3A 4R69A 1BWSA 5JAIA 4A73A 3AFNA 4CM5A 2W2KB 1GADO 1ZEMA 3E5MA 4MOWA 4HX5A 1CF2O 1P3DA 3ONFA 5A9RA 4CM6A 1HDOA 2I5PO 4A2CA 2O3QA 3MCVA 3PJEA 4FD3A 5TIIA 2D3TA 5CHEA 2A9FA 5FEUA 1N9GA 3PQDA 1KVRA 4HFJA 2E4AA 2HRBA 3P5SA 5L40A 4RO0A 4F6LA 1P1RA 2C07A 1VKNA 1UDBA 3INGA 2I3AA 5DCYA 2HUNA 1BW9B 4IZHA 4FR5A 3I9NA 2OBYA 2WYWA 3ANMA 4U0KA 1DIRA 1I10A 2UDPA 4D45A 2OP1A 3PZBA 3TNLA 2FR8A 3I52A 1S7CA 1XU9A 4PG7A 3TZKA 4HFMA 1H0KA 4RZHA 3W6UA 2VWPA 5GZ1A 2QQ5A 2W98A 1OMOA 5DBIA 1ZK0A 5BNTA 1GEGA 1RWBA 1V35A 1C1DB 3MWEB 4R16A 2ZTVA 3V1TC 2VHZA 3BMQA 3JYLA 4IIUA 4D7AA 2OP0A 3QWBA 3PJGA 2WJPA 5U1PA 4DL9A 4J3FA 3AY7A 2PLAA 4XDYA 3Q11A 3FTPA 1DJNA 2C0CA 4DIBA 4KTTE 3M1LA 4NBTA 5TF4A 5KWEA 8LDHA 2YY7A 1LC0A 3WFJA 4H3VA 3WFIA 5ITVA 3GPDG 3SEFA 3GHHA 1ZSNA 2AHRA 1PL7A 2JD0A 3LU1A 4RV9A 3WSVA 4P4GA 5EMHA 2VRBA 4RF3A 1PTJA 2R00A 4EYEA 3LLSA 3PRJA 4E12A 4N7RA 4FSHA 4CUZA 1A9ZA 5A02A 5KIAA 3ZWYA 4ALLA 3WGQA 4M55A 2P5UA 3G1TA 4EEXA 3E1KA 3DL2A 1PS8A 3OJEA 3DTYA 4CV3A 4E30A 1DRVA 2QZZA 4D0RA 4DIOA 4D0SA 3QVOA 3EVTA 2IXAA 3GAZA 2WD7B 1BHSA 3GK3A 2VRCD 4IS2A 4O63O 2CVOA 2FPIA 4M86A 4OKIA 2XOXA 3ROQA 1LU9A 3GFGA 2Z5LA 3LC7O 4YAIA 4I5DA 4DC0A 1H9AA 4KTVE 2FY8A 1NFFA 3RU7A 5BSGA 2DQ4A 4IJWA 3U62A 4YA6A 3AOEA 4A10A 1F8FA 2BFPA 2GYYA 1RM3A 4J4HA 5CDSA 1HEUA 1SMKA 4PCVA 1GFSA 2FPGA 2Q1SA 5C7IO 1E7MA 4YQYA 1T2FA 3JQAB 4YR9A 1ML3A 4NMHA 3TN7A 4U8GA 1VPDA 4XD2A 4DYDA 2HDHA 3F1KA 3GH3A 3BMOA 1GV1A 1RPNA 2EIHA 2HK7A 3WMXA 3IMFA 1I2BA 3DR3A 3QRWA 5IN5A 2XXBA 5HRUA 3GC6A 3U09A 4XEHA 1E7QA 2DTDA 4MVJA 4QUKA 3VTFA 4E5KA 4PVDA 4BV9A 1YJ8A 3WSWA 5DZSA 2C59A 4RJTA 4EGFA 3PHHA 5A9SA 3R3SA 4NJOA 4JNKA 1M6WA 3N7UA 4OXKA 3ICCA 4UEKA 5G0UA 3VPSA 2ZKLA 5DDIP 2DT5A 1O6ZA 1HYGA 3QY9A 4DUPA 3KYCB 4HUJA 3COSA 4E4YA
chains in the Genus database with same CATH superfamily
3H4IA 4NARA 3H97A 1R6TA 1E64A 1NONA 2FZGA 2C9YA 3O82A 4DWOA 2O0KA 4RPLA 2FJUA 1ACLA 3DBLB 5CM8B 1T0IA 4TMZA 3WL7A 3PCXA 4H2DA 2IL1A 3MT7A 1E2BA 2XI4A 2GEJA 3IJRA 3PJDA 4OKSA 1T2AA 1ZGGA 4TM8A 4DLXA 4MYHA 3D81A 5DXFA 3TECE 5CDHA 4V0KA 3N5KA 1PEDA 1YONA 2ACEA 1WOYA 1WV0A 4LYJA 1ZISA 3M9LA 2DQSA 4G26A 2CHUA 3VBCA 3HEBA 4BTLA 3FOAA 3CEAA 1SEPA 2PQ0A 5JD6A 2B6NA 3FCAA 3IA7A 4RTPA 2W6JA 5LBUA 1FS4A 4BLTA 1D0VA 5A0TA 4A8TA 1J2UA 1H8ED 3IB6A 1JR3A 2OECA 3DC7A 1WP9A 4U7JA 1CQJB 3ONVA 2VRWA 3SYKA 1I33A 1BMQA 4CL2A 2I6SA 4BQRA 2Y1CA 3MIZA 3U3ZA 1KFJB 1N8TA 3BFPA 4JIGA 3AESB 1KI9A 3PLRA 5K2OA 1XELA 1Z0UA 1UEXC 2HWKA 3GOQA 1CZRA 3NMUF 4ZAYA 1I51A 1XDWA 2RH5A 2CK3D 2JA2A 3T9EA 2C3UA 1P45A 1SHZA 4AO7A 4LRXA 3O1JC 3K0HA 4HVTA 1X42A 4C3OB 2H2IA 3B6MA 5KREA 5KTOA 1RZRD 1BMTA 2B61A 1SUAA 3FZNA 2CMHA 3RHTA 3ZHQA 5K3OA 3OT1B 3R9IA 2PCJA 2QE6A 4W63A 4DZTA 2AUTA 1WKVA 3CUKA 1QQTA 4NICA 1HDIA 4URZR 2ROQA 4GKBA 5A6SA 2PSDA 3RU9A 1AS2A 2PH3A 5FBKA 8AT1A 1DTSA 4JSTA 1GZUA 3RFUA 5DTJA 1MO2A 2G5PA 3DMPA 4GPIB 4V39A 5AI5A 4BMZA 5C7LO 1COZA 2XCUA 3HU3A 1JYSA 3NTRA 4C0BA 4XQCA 2WJZB 2DUNA 4P80A 1A7UA 2C4HA 2I4RA 4X7MA 3TZBA 4EQ6A 2BCGY 1J0EA 1CUCA 4D6PA 4TTQA 3L04A 1S6YA 1KTIA 4C4OA 3DWGA 3GUHA 3BDIA 3IP8A 1GL7A 1JX6A 3ILVA 2BJHA 3SHVA 4BCDA 1P29A 2DBRA 1DBQA 1UPUA 1W59A 1P1CA 3HSKA 4AUEA 5LZ2A 1SBYA 5L3ZA 3CR8A 2Q4EA 2V4MA 3I9OA 3PB3A 1E1RD 4UOEA 1VHDA 3WGNA 3MT8A 1XIVA 2DHCA 4NAHA 2C4MA 2XQKA 1FS5A 3BGSA 3HJUA 4IMIB 3BK7A 2WFAA 2C9ZA 3GMSA 1KJYA 2G9QA 2FMXA 2IU6A 3HADA 5HJ5A 5EMKA 4MEBA 1IL0A 1F2UB 2GJSA 1A69A 1PWEA 4TLBA 5FCDA 3ETGA 1IM2A 1ZHHA 2PR2A 3Q7IA 3R20A 3FLEA 4ZYUA 3UWMA 5M34A 2X9GA 4NFSA 1NJ6A 4H6PA 4AYTA 4MAAA 1FRQA 3I5MA 2YV3A 1JT2A 1Z2EA 3E3OA 2VJPA 4ZAVA 5JVDB 3DKPA 3QVTA 2NU8B 1QH0A 4MVJH 3VDNB 5ESRA 2PL1A 3VI3B 2VP5A 1CR6A 3HLTA 1MAUA 3DCYA 4YMGA 1WMSA 5KPJA 1KO8A 2A4KA 2QW8A 3QELB 3QG5A 1P0MA 1U2RA 1NKSA 3NJ8A 1YK0A 4N0MA 1KJIA 1S3SA 4UVGA 4YCAA 3DW1X 3EODA 3TLKA 1UOOA 2IPMA 1DIGA 4UEJA 3LKBA 5EGSA 2BFDA 5CIYA 2XUHA 2ERCA 3DMFA 4J0KA 3CLSC 3WYEA 3TRFA 4EI7A 3UOAB 2P6UA 3PRYA 4XD7A 2C7BA 2F3TA 2QUIA 3EBPA 2RGBA 4BVJA 3JAKA 4IEIA 2AEJA 2NSYA 4E5VA 1PR1A 4RKEA 2FMKA 2J85A 3FPKA 4UQLA 4D3FA 4EITA 2NSDA 3FCUB 1WNFA 3LP6A 3KSMA 2CCJA 3KAKA 3PNLA 4RHYA 5T64A 1LPSA 1TM2A 3LLUA 2DMRA 5I3CA 3F5MA 5LIPA 2ZWIA 3A1UA 4BNGA 1SVUA 1MA0A 2J6BA 2NTNA 2C84A 4C20A 1E3JA 4YJKA 4GOXA 2QB5A 3T7JA 1W1WA 4F2GA 2DFVA 3F7MA 5J58A 1TU0A 5SV2A 4CF6A 1ZMTA 2QD1A 4C0KA 5G0TA 1PIWA 2W9XA 3CB4A 1J56A 3EUEA 1FQJA 5F23A 1X19A 2QP3A 3PDIA 1XXHB 2IPXA 4HDAA 4ODIA 2NQ2C 3S1LA 3WOVA 5KYWB 4RVDA 4ARZB 3WAKA 2P3OA 5ALFA 3WB0A 3HS3A 3REQB 3QIAA 4NZYA 2C7GA 4BVBA 2X0KA 3JVVA 4OHVA 2DWQA 2FG7C 2VH2A 2A57A 4WNAB 4KIGA 3FYDA 1ZHOA 2J0UB 2CY0A 3W2GA 4DLTA 2Y68A 3OH8A 2C2MA 2F8SA 1QU2A 2I6FA 4X92A 3U6KA 2XKBA 4FGUA 1NRWA 1WDLA 4NV3A 4WDQA 4B3IA 3P94A 3MHTA 4FDVA 1V25A 3AB7A 3H6HA 2MIIA 5G02A 3HCRA 1PL0A 4LCJA 1CNMA 2ILTA 3LGAA 2BGTA 4OHYA 4QLAA 1SC1A 4RSMA 3ZHRA 1PYGA 2AC4A 4G81A 5FBQB 3IVGA 5I5GA 3SBXA 2ZSAA 2WU3A 4WLUA 5MDHA 4PFJA 3ZYZA 3E22B 4CJXA 3HR8A 4AUNA 4ZYLA 1SIBE 2WKQA 4O59O 3KXDA 1T43A 1K6JA 2RI0A 3T0IA 3LQ2A 4QTZA 3A9CA 3KVRA 4QQNA 3UW1A 1AS3A 4DR1B 3KSZO 4JQYA 2JI7A 3NDJA 4B71A 2Z6QA 3RU2A 5BORA 4O8CA 4OLHA 4N01A 5HDBB 2ZSUA 3WLIA 4O4LF 3EGEA 5KI6A 1SC6A 1ORWA 1WA5A 3EZXA 4PIVA 1G6HA 5A5DA 4WOKA 1WXXA 3FYSA 4OAOA 3M6UA 3OFND 3Q7SA 4S0XA 3HFGA 5KO2A 5MHTA 2ONKA 3JQAA 1XMVA 2BR4A 1UBOS 3GW8A 4Y0VA 3T3MB 1PTJC 3QU9A 4HTFA 4W9MC 4BX3A 3B20A 2FPXA 1BDJA 2LVBA 3QFHA 4AYXA 1IXSB 3R5SA 5EPOA 3S28A 3C70A 3OBBA 3OIVA 3SFZA 3ZTYA 3PXXA 2C7VA 3LPNA 1WBDA 2QBYB 3EIQA 1KMHA 1OBOA 1TMYA 1A7AA 2QUZA 5JR3A 4FBLA 5CA0F 2B4RO 2CDRA 1C9JA 1AVTA 3ZGLA 3MJVA 2CUNA 2BWJA 4PSKA 4BFUA 3QUSA 4OQDA 3OIWA 3K71B 2XNKA 2DUJA 3GIDA 1WDKA 1L5YA 2GPYA 4LXIA 1XEWY 4URVR 1ORVA 1QWSA 4J07A 3AHJA 5LYJA 3RVKA 3U3OA 2FF7A 2NTYC 4ZMBA 1OAKA 2HF8A 2P69A 4PXAA 1IVYA 1P5ZB 3V4LA 2OA0A 3V80A 5KSOA 2VHJA 3KKMA 1MW8X 1RKUA 2DFPA 3AFOA 3DVQX 4IDUB 1EP3B 2FQXA 5LC1A 2GN2A 5HQJA 1ZGCA 1J9EA 3BMCB 5L7TA 1CR1A 2FPLA 1OI3A 3CVWA 1DDOA 1EFKA 4KE6A 2X40A 1WF3A 2WC1A 1DLJA 3IDAA 1OKKD 4A8JA 2A92A 2XDAA 1C3LA 1T15A 3K0FA 4DCSA 4FPXA 4WFJA 4BWVA 4EG6A 3WA7A 4I2VA 2IV3A 1U9IC 5CEJA 4BY9E 5J59A 1I3KA 1OYYA 4I1UA 5FKJA 1C9KA 3C48A 4OYYA 2I2CA 2PS9A 2O2HA 5FO0A 1OVGA 5DWDA 1DUSA 2FPOA 4TT3D 4BX9A 2X8JB 4N40A 4PNHA 2FWAA 3E7XA 2OFFA 5CB8A 4W1QA 1T4CA 4LZLA 4OHPA 5IUKC 4CXMA 4L5AA 1YC2A 1GWNA 3G9ZA 4MEJA 4P7FA 1GR1A 2P9QA 3OE1A 4KO3S 2W11A 4XB2A 5IU6A 3UGQA 1DP4A 2ZPUA 3CE9A 3FVTA 3IPRA 3GJQA 1WUJS 1EJBA 5L4NA 3GLGB 1LTKA 4PONA 4QBHA 1S02A 3VU9B 3QYJA 3FCCA 3GBVA 2X5JO 3SZGA 3SFVA 4LG1A 4U3JB 4ME6A 2AFVA 1E7SA 2H2FA 1JL3A 1ZBDA 3PNSA 3M4NA 5IJWA 1J5XA 3GJZA 1PR3A 1UPTA 4A2WA 3ZHUA 5CBPA 3NHRA 2GLXA 2Z4SA 4O2AA 4EVSA 4RXUA 1XDSA 3A4MA 4I3HA 1CW2B 1Z73A 4DUGA 2DUUA 1NR5A 4MGIR 4CF3A 2ZETA 1GPWB 3EF0A 1H5NA 1COWD 1RAGA 2R48A 1RXIA 3NTQA 3M70A 5JJ5A 4Q05A 3LH5A 1DKLA 4KIUA 4Q15A 4PBSA 2ZAYA 2YYYA 3DDNA 3FGZA 4QYTA 5F12A 3ZWWA 2JIOA 2QYTA 4U2EA 1OTXA 2ES4A 5A4AA 3VM6A 4GL4A 2XCLA 4OJMX 4JUBA 1VLLA 4QRIA 5H80A 2ODQA 2HLDD 3C1AA 3ELDA 3MD0A 4BRSA 1HPLA 4V02A 3ANTA 1CUIA 1G3QA 2OZLB 4JZYA 4LTNA 2E4YA 1P2UA 3NXSA 4E2FA 4XQGA 3IEPA 4EAAA 1WR8A 3I4FA 1UDWA 3ZWOA 3FYUB 5DX0A 4BX8A 1E2FA 4V3CA 1XMJA 2ZYGA 1XZDA 3G8BA 4R40A 2Q1TA 3H2YA 3OTOB 1WSWA 2QVBA 2ORYA 5HYVA 1J20A 1I5OA 4KWEA 1JHPA 4GAEA 3S81A 3ISTA 1PT7A 3G8DA 2BZ0A 1SCQA 3FDFA 4HWGA 3DEIA 3G0DA 4UKDA 3LX4A 3HJGA 1XJ5A 1I9CA 3OZ7A 4WKCA 1IB0A 2ZI5A 4TTJA 4B3XA 3IP6A 3NRCA 3Q12A 2FX5A 1JJFA 2NMVA 3KEMA 5FIUA 2FR0A 3KJIA 3RUPA 2G9RA 4L5BA 4CKXA 4CW7A 3RVBA 3O8LA 1CBUA 4IIGA 4P0TA 4QD3A 4BVGA 3B1JA 3DUFB 4X85A 2CNOA 3K35A 3PF9A 4DYHA 1CQXA 1N5LA 1QV9A 4N12A 2C7OA 1XVUA 1PDVA 4QOGA 3T9CA 4DUYB 2Y92A 3K09C 1E4EA 1Y82A 3TAHA 1M6VB 4UU1A 3W3ZB 4F91B 1E18A 2G72A 1B6RA 3RRZA 1K4KA 2JBAB 2VT2A 3CKLA 5IJXA 4WI1A 2CLOB 5JYBA 3DD1A 3ZKWB 4UAGA 3GJSA 3KQWA 4QHTA 4CM8B 4LXUA 5HK9A 5ALJA 3N58A 1YD7A 1KE2A 4HWTA 4YAFA 4ZHQA 5HR5A 2AJLI 4MB2A 4N5IX 5J2UB 4YRZA 1UT8A 3PFHA 1VYHA 2YYSA 4EVQA 2EFGA 3FLBA 3R24A 1I1QB 1R6DA 4NFLA 1LSOA 5AM4A 2HJ9A 3L05A 4WD3A 1DG1G 4MW6A 1GXSA 1MLDA 3UV3A 4BL5A 4C14A 3EB9A 3NHUA 2G09A 3BERA 2QLLA 4DCOA 1NURA 2CLDX 3KKZA 3OTIA 4M1WA 4JAVC 1WXHA 3E9MA 3PFWO 3NHJA 2HLNA 1ZD1A 3DH0A 4GKAA 1J8QA 1NFQA 4AAYA 2RGDA 1QVZA 2HMSA 2C3MA 5FBWB 1NC1A 1HZZC 4EBFA 4EVRA 3WWPA 2IWRA 1AXGA 3DTVA 5KKAA 2JJYA 3SC3A 2OCBA 1T0BA 3IAUA 5CB0A 3RVNA 3BRQA 3UMRA 1QX3A 3GRKA 2HBQA 1N0WA 2HSDA 3I8SA 3DDHA 1W19A 3LNCA 3HB4X 1QIFA 3MSXA 3I2KA 3WHLA 4AXBA 4MA0A 1Y80A 2P27A 1MC4A 1WV1A 4WVLA 1YNOA 1GTRA 2R60A 4MV6A 2CHGA 4D44A 3MYRA 4FMBB 2VJLA 1Z6QA 2JHFA 3IQZA 5A7FA 1GPJA 3R5XA 3RYTC 4BTVA 5DTIA 1Y37A 5H81A 1Q1BA 2QX4A 1ZJ5A 2DULA 1VJCA 5BSVA 1B14A 4AJJA 4R1LA 3ZDBA 4IV5A 3NEJA 5F7OA 5KTMA 4R98A 3MG9A 3AR4A 4Z51A 3HB0A 2LCIA 4LNUA 1HI9A 1LPNA 2G28A 3INTA 4HWOA 5FB3A 4ZJYA 3IAAA 4DYVA 1CUBA 4MGZR 1MB0A 4JVMA 2NZXA 3K1TA 5GIPE 3ANLA 3K5PA 5DULA 4YQZA 1KI3A 2B5WA 4TMWA 4KQ9A 1V6CA 3LTEA 5HBRA 5CMLA 2PCLA 3H42B 4QA9A 3AF5A 1AQIA 1ENOA 3WOHA 4ND6A 2R79A 2JVJA 2X0FA 1MENA 2D5IA 1BWQA 2A1UB 5H83A 4D3SA 3BWYA 2MOKA 4NDZA 3ETDA 1IBCA 4OBBA 4S24A 5LP6C 3RARA 3T3PB 2IOYA 3OE7A 4JLWA 1V5GA 3B6EA 2XJ4A 4QGBA 2CL7X 4UCFA 3HKCA 3HP1A 1QZZA 1UK7A 5HMMA 4QPNA 4CG2A 1KJQA 2A2ZA 3PR3A 4UJ5A 5CEFA 5K6AC 4D2IA 1W5SA 2GCNA 4NG5A 4Y1GA 5KBYA 1Z38A 2P75A 2YDYA 1NVBA 2Q4DA 2JAWA 2XQIA 3LO5A 2VA8A 2ZTLA 5EIAA 4YXFA 3DFMA 3FOBA 3OAAA 4GEKA 2HY7A 5T3YA 3GLSA 1C30B 1E69A 1SR8A 3N8DA 2CBGA 3STYA 1GNSA 1KKLA 1Q6ZA 1CU1A 1TCCA 1Z3IX 2PMWB 5ECGC 3EXAA 4E6EA 5JDCA 1HG1A 2IHUA 3I8OA 2ZT7A 1XZCA 2HRZA 1J0CA 1TZ2A 2KYRA 2YWBA 3I64A 4XQ0A 1HYQA 3BHIA 3VRHA 2HMUA 4K6OA 4K5QA 4PO3X 1XTQA 4E1BA 4RYDA 3UFBA 4DJTA 3CX3A 4BMPB 2UAGA 1VE6A 1SVIA 1Z45A 3LUKA 4LDRA 5FWAA 2QTCA 3Q8KA 4ZI7B 2PZGA 5EP3A 1ODLA 1X92A 3LIIA 2XMGA 4I9GA 2I8LA 1X7ZB 5FPQA 1XI2A 3L2OB 4NYIR 4WASA 2I1VB 1GGEA 4KN9S 4FGSA 1KMNA 3EG9A 2XB6A 4ADSG 2HMWA 2PRZA 2AOTB 5SYNA 4QL3A 4YHBA 4R0VA 3DNFA 1S9HA 2EHJA 4ZN6A 4RAOA 5DKFA 3GGGA 4U9IS 4F3RA 2P4UA 3WGGA 3AOGA 2RHWA 3BWXA 1T2VA 4EB6A 6ADHA 3RIGA 1FBTA 3MMSA 5KMGB 3RBZA 2XZOA 4EW3A 3G0CA 3LCRA 1U3TA 3GT0A 2I4OA 3STHA 4KMRA 4DCVA 1N77A 3JQRA 3H65A 2BTEA 4MPPA 2XQJA 1SQGA 3FWHA 1X2EA 4ZVTA 4ZGWA 2F67A 4W5NA 2WU4A 2X3UA 4JBXA 2O23A 4GMKA 1BGXT 5TVGA 4E0BA 2PJDA 2YNMC 3BL5A 4J9UE 1V6SA 1XXHE 3OMLA 5CFQA 2IA5A 4XIFA 4XEUA 3KT8A 3EWNA 3GA5A 3BJEA 5GGYA 2JEYA 3N2IA 4K05A 2ASEA 3TD9A 2BE9A 3HNOA 4O2BB 1P5JA 3ACBA 3CFYA 4INJA 1RP1A 1X9IA 5AT1A 3ZJ4A 4UHFA 3OZUA 4B6QA 1KFCB 2JHPA 4FB4A 3E9DA 1VB5A 2ECKA 4TUYB 1DOZA 2I62A 2XMSA 1G2OA 2A67A 2XCTB 3S7ZA 2J45A 5LMCA 1OXVA 3OZSA 5H82A 3FA2A 1ULTA 3OKCA 2J3DA 5JXIA 2ERYA 1N5MA 2ZXEA 3PUZA 3PSHA 4N5NA 5FNVA 4Q3EA 5CXSA 1MOSA 1KZYC 1T4MA 2QV0A 4WA8A 3O9MA 1K66A 3QJYA 3V7FA 1AMOA 1RFGE 5BT8A 2XRYA 5JCOC 1L7OA 2WTMA 1Y1LA 4OM7A 1W7AA 2VQ3A 3CWZA 4RH0A 2UVPB 4EMBA 4H9GA 1ZD5A 2FOXA 3GMDA 4CL0A 3R9WA 2JGKA 1GTL1 3NEAA 4G56A 4OUDB 3I6IA 4GHWA 4NAVA 4G5GA 5CX1A 4ZT2A 4DW8A 4F5ZA 2QXUA 4UEQA 3ZJTA 4QQ8A 4M37A 2CFCA 5AVKA 4UTPA 5KWIA 1JQ5A 2NV6A 1FFXB 1M1XB 3PT5A 5ALQA 4X71A 4RKWA 3LGSA 2QTHA 1Y6GA 1ZN2A 2G9UA 1JLHA 4HDKB 1JI3A 1PDOA 3VSEA 1UPFA 4P7GA 3W2HA 5KOIA 1TADA 5DBOA 4WESB 1T3HA 5LYJB 1PWYE 1JI0A 4EUEA 1ZINA 2HNKA 2OD9A 3ADOA 3DE0X 5C3UA 3HVRA 5J4YA 2NNWB 2OL4A 4NBWA 2G8LA 3UMCA 4OMUA 3JTMA 4IGIA 2IVFA 2UUOA 3QKSB 4IKEA 4PANA 4RPKA 3SDZA 3MJHA 3IMCA 1TU3A 1FQWA 3PNYA 4WK0B 4Y30A 1WSBA 3VR5A 3G7SA 2LKDA 3H2BA 5CYPA 1NLUA 4BB5A 5AWFC 1D5WA 1ZGBA 3FWNA 4JXKA 3KR0A 1WPRA 5E3HA 2VHUA 1Z4JA 2J9GA 3DE1X 4P4SB 1JRLA 2AZDA 3GCGA 4WN9A 5EYPB 4ZVRA 3KLMX 1FC0A 1RMQA 2HDNB 4GGPA 1Z7YA 4WTOA 1RPJA 1AKRA 4YRDA 3JQ8B 1OWMA 4XM1A 4IX9A 3QKTA 4UNRA 1R6BX 4DMFA 4A7PA 2IH4A 4OF4A 4PZDA 1G21B 3JASA 1LQTA 4F93B 3KPYA 5ICSA 2CKDA 2XOKD 4PQEA 5A05A 4JI7B 3HA7A 2W2NA 3VR6A 5CFZA 5SYMA 2A14A 5D5PA 5DM0A 5B1SA 3SVZA 3IULA 4OOFA 2V55B 3CF6R 4Q03A 5BN5B 5K2MA 3RJTA 3E5HA 4DEYA 2XOEA 1NN1A 3AT1A 1OHHA 4AUMA 1L8XA 1SVWA 4X1IA 3SBDA 3E1SA 3ZDFA 4MVYA 3QXSA 2YUIA 5AW9A 3RT1A 4B48A 1ECJA 1GCIA 4Q39A 3ROPA 1BCRA 3L8YA 3WWCA 5HRAA 5I7VA 5JH7A 1VIDA 2HHHB 2Q6KA 2EWMA 4HJXA 4X90A 2UUCB 1L7BA 2DUMA 1Q0ZA 4V0QA 5DTQA 2O59A 1RAIA 4GLBA 1KY4A 3KVVA 4PYRA 5AIAA 3R6DA 3E2IA 5AHWA 4HFNA 5ENDA 3WLTA 2PXCA 2FFHA 1LKZA 4NC9A 3T52A 1LC3A 5CLQA 3PNKA 3ZHVA 4C1NA 1T25A 3K2IA 2ID7A 4MPJA 3KU4A 4NE9A 4PLZA 3B7GA 5EWMB 3R7WA 5KWJA 1K9SA 4KYVA 4HDOB 1NPTO 1HXHA 1ZI9A 4RCZA 2YWXA 3STVA 1SXJC 3KYIB 4JC0A 1U5BA 1X1AA 2X8AA 3FYHA 4BV8A 4F85A 2QG4A 3T5CA 1TZBA 3SHTA 4GMXA 4X00A 3TKLA 1IJFA 3WV5A 1ZGZA 4RY0A 5CDUA 4TL8A 4YAKA 1LBEA 1ACJA 3Q3IA 4YUZA 2X9VA 2IDMA 3EUAA 1R66A 3ME5A 4BB0A 3GLGE 1QHHB 1XQ1A 2CNNA 2HA4A 2PAAA 1FMFA 2EATA 4BNYA 1N6NA 1LBSA 4KIJA 1ZDMA 4L4YA 5KQSA 4AVYA 2CF5A 3W5SA 2Q9CA 2PLNA 4Z9YA 2D5AA 4RHXA 3EW7A 2ZIXB 5C5IA 2QLMA 1K6IA 3GEGA 4L8GA 2LWIA 2VZEA 3WBJA 2GXAA 3BIOA 4EY3A 4AKEA 4D92A 3MCAA 3EEOA 4L4SA 1U3GA 4J1NA 3T5MA 5HXAA 3JQCA 3UGKA 2IY7A 3IV9A 3MMNA 3FVRA 1VJDA 3VQTA 1G18A 4WE3A 2DPLA 4E3ZA 1RWPA 2A9JA 2OFOA 5ADHA 1WB4A 3X1ZA 3S68A 3TE6A 3Q9SA 1YHNA 2FZ5A 2QL6A 4Q3LA 5CFOA 4KW7A 3I0MA 4XJVA 5DNEA 2C8KA 1M0WA 1UUFA 1EUDA 1G8JA 4JOSA 3N2NA 1PT5A 4BZXA 4IHKA 1TKCA 4RJIA 1FUYB 4BE4A 2H3HA 4NZPA 2HQRA 4WCDA 5KC9A 1YA8A 1VZ3A 1DRUA 2WA1A 2PL9A 3D1VA 4ZU6X 5JTUA 3THWA 3PC8C 4XSHA 3F9RA 4GRDA 3AB8A 4G8BA 3BRWA 5IJ0B 1R5NA 3OEHD 2D4HA 3BHJA 1YRYE 1JN0A 2O1XA 1G3IA 1X1QA 3AXSA 1C8KA 2P7HA 2C4VA 4PC6A 2HW8A 1GA6A 3TTUA 3C0KA 5JNSA 2PAFA 3VR5H 4E1AA 3RLIA 5EI5A 5JPCA 1QNFA 4PRLA 3EQ9A 1JVBA 4ZEOA 4IH9A 1UPCA 2O06A 2OAQ1 5DASA 4K0RA 4TV8A 2ZRHA 4XIGS 3OWOA 3THOA 4HDRA 1EFVB 3R5JA 3KYDA 3U2QA 3I39X 2IP1A 5FTKA 3I9KA 1JYFA 2Q21A 1MC8A 4X45A 3G0GA 4LEIA 2JCBA 3F5SA 5DBEX 1PS9A 2ZRPA 1GCAA 2PKQO 1UAYA 5FV7A 3L18A 1W0JD 4D5EA 4OP2A 1GKYA 2IKSA 3AZOA 3JD2A 3Q3GE 4U7TB 1E20A 1IWOA 4CU2A 1NDHA 1YR2A 3WK9A 4XW2A 1HETA 1RPTA 1J0BA 3BREA 5K6TA 3KVOA 3BGWA 1VHQA 3VR6H 1T9ZA 1NU6A 2DQZA 1QMPA 2F1RA 1IOLA 3LF2A 4J1TA 5EEHA 2P68A 2BT4A 3F6EX 4AMZA 5AW4A 2PGNA 1CY0A 1TF7A 2BEUA 4HK4A 2H4XA 4M54A 5ECYA 2IV2X 4HOYA 4EY4A 1S89A 3BTOA 4LJ7A 3BAFA 4DV4B 1JKFA 3WLMA 1I2ZA 2HJWA 2PZMA 1CRLA 4LC9A 5KOJA 3HP7A 1YFJA 2YHIA 4FHCA 1Q1AA 2EFCB 4HATA 2J59A 3KCNA 2HSJA 3L79A 4IHJF 4GZ6A 3HV2A 5KHAA 4OMCA 3L0SA 4CMEA 2R8ZA 4Y7CA 5IC6A 3LUCA 3WZLA 4EA8A 1TYCA 2OORA 1MTZA 1S4MA 1YQTA 4FFPA 4GWKA 1U28A 4MUXA 4P7KA 4D41A 3VKGA 4ND8A 4X63A 2F00A 4Q4CA 1N6KA 3D7RA 4NX2A 2BMAA 2HO5A 1L8OA 4QUBA 4UBMA 4C6TB 3FOCA 1W2WB 3ML1A 4KXFB 2DVMA 4GSLA 4YCLA 5AI0A 2JJMA 2IELA 2WWFA 3FWPA 4NCAA 3GEEA 1YIDA 1YRHA 3VPAA 3ND8A 5C5EA 5FX2A 3C4JA 3L4JA 4LJ4A 1GZ7A 3WGIA 1D4ZA 1PGJA 2CXTA 3AR7A 3K8OE 1SQFA 1P6XA 4ZZ1A 5A3QA 4KR0A 4BNZA 1G59A 1F6BA 4F72A 1V8FA 4LYDA 1US8A 2QAGC 2VBFA 3DZKA 3O3OB 1XZ8A 1YS2X 4D26A 1KPGA 2MSEB 4M0DA 4JXZA 3IPLA 5JAQA 2NUPA 3AUSA 5D3MB 5IN4A 4FOLA 1QE0A 3M9XA 2GAFA 2GHIA 1C7QA 3ESRA 4DCMA 1LUAA 2H1VA 3E82A 4BNWA 2QVYX 2RH9B 4YAGA 2E6UX 2WBLC 2YFQA 3W8NA 4F4FA 1OX6A 3C85A 1QS0A 3X2EA 4N8EA 3UXHA 1EFPB 4DIDA 1CVLA 4HNRA 4U9HS 3HVHA 4RY9A 1JU4A 5JAPA 5KJCA 5JMOA 1PLKA 1IOVA 1DEOA 5DHUA 1XNGA 2GK4A 3DE6X 2HRQA 3CUVA 5IAGA 4EG0A 1TECE 1R0WA 1CUDA 4P33A 2ZVQX 3L6EA 1MJGM 5HIJA 3UMBA 4DQVA 2ECOA 4IICA 4LXHA 3ROMA 1O54A 3D4BA 3C87A 3PNPA 4N4AA 2BTQB 3N3AC 4IOMA 3T7AA 4NBUA 5G1PA 1MV8A 2HU7A 3KJEA 3L1KA 3W4KA 2XDYA 5THQA 1G8GA 2L19A 4D8VA 5K0EA 4KWIA 3DLHA 1PKEA 4DARA 3VVMA 5B7NA 5CDTA 5JSHA 3FM9A 3AOEC 4TV9F 3HJTA 4YMSA 1ULZA 2DBQA 4C3UA 4R2LA 1RABA 2QMYA 3OUUA 4YBZA 2YBDA 3FMVA 3KS9A 2HBRA 3MMPA 3CURA 3P2IA 4KXUA 4DREA 5F4ZA 1FFAA 5BN3B 1CQIB 4ED9A 3I3OA 3KM0A 3QNWA 3O8RA 3K6JA 5ITZB 3OLCX 4AKSA 1IXZA 2IYOA 4PTLA 4UXIA 5AQEA 5LQUA 5CVTA 1IN7A 1M5TA 1OXBB 4BVFA 4D9GA 3RJ5A 1C7IA 3JQEA 5AMXA 2IEAA 4CIVA 3L1IA 2D62A 4QICA 2H1RA 2VDVE 1D0SA 1W0CA 4NBRA 3RSSA 3LCMA 1VMAA 1TFRA 2OLKA 2SCUB 4R7GA 5BSRA 2Q8QA 3CONA 4BECA 3IBCA 2AD5A 3A4LA 5HOEA 2EC5A 1IXYA 3OPMA 3NIWA 3RABA 4BZZA 1TK9A 3EG5A 2BFMA 1E79A 2XVYA 3CPJB 1QMGA 1UMKA 2GUGA 3FZGA 1UZAA 2A0UA 4MV4A 3DE5X 4RF2A 5AKEA 2Z8YM 4PHCA 3G5AA 1GU7A 2UYQA 1B6SA 4OUKX 3P9CA 5DI3B 2QM8A 5CA0B 2QVGA 3MJFA 4AQYB 2ANCA 4KZKA 2WB4A 2AEMA 1DAKA 3LWBA 3SY8A 3K6RA 5EE0A 3N8HA 1BG6A 5FLKA 3MTBA 4MIYA 3ROTA 4X62B 4BWYA 2AK3A 1VJGA 1Y63A 1Z5PA 2X2EA 3EOAI 4B46A 4U7DA 1XZJA 3OP1A 4TWBA 3SIWA 1EJ6A 4KXNA 4J0JA 4X65B 1L7PA 1GUZA 1U7HA 4LZOA 3RANA 2O5CA 4MJLA 4XR9A 4ETIA 2EQBA 2VHEA 3BF7A 3NBKA 2J33A 3HJBA 3P0HA 4IZOA 3MAAC 1V3TA 4GMFA 1W1UA 1HEYA 1VCNA 2PY6A 3INNA 5FI3A 5A3JA 3MNFA 1JKIA 3UHPA 3AJ9A 4OBWA 3B3GA 3U37A 1NN3A 1HYBA 1DTWA 5KDDA 3K70D 4PC7A 3C3JA 3IAHA 3ZK7A 2VEDA 5AM5A 3EGWA 2P9CA 3JD0A 4JVSB 2QZPA 2V5VA 2Z1MA 2VP4A 4UJ3A 5DLPA 1IZZA 1E2QA 2V7GA 2Z5GA 1H65A 3QWAA 4QPCA 1FE8A 2PUDA 3K9CA 2HGZA 3TXAA 1XKQA 2IIBA 5EHNA 3BFJA 1H9CA 1HTBA 1NW9B 3F0TA 4EMSA 1BHQ1 2BP7B 4OH7A 1KYTA 3RS9A 5COBA 4RTLA 3PFNA 3ZV3A 2I2WA 2I55A 1R0LA 2B30A 2W6OA 3PHBE 3RFXA 2ACKA 4KOEC 2QT9A 4PSDA 1Y8RB 4I19A 4JNCA 4NENB 1Y98A 5K3FA 2RK4A 3GGDA 3BCUA 3O8BA 1JG7A 1EFTA 1M0TA 2YQ5A 3AJRA 4FFRA 1KQNA 5CJ2A 4DY6A 1HTTA 5ADWA 4F3CA 1H6AA 1PG2A 1KS2A 2X14A 3OEWA 1R4NB 4XTCS 4B8WA 1VMEA 3MVEA 4M0CA 1L5KA 5ICFA 4E4TA 4IIBA 2VK8A 4PYNA 1F3LA 4NL4H 2NO1A 4LV6A 3VZBA 1T5IA 1C0LA 1XZQA 2FMHA 1P4HA 2AE1A 1A5TA 1EK1A 1Z0IA 1Z7EA 2PKRA 1VECA 4DDVA 4GR4A 3NHYA 2ZR7A 4ZOEA 1OLUB 3A2MA 3BIJA 3LCCA 3RAEC 2ID8A 2H9YA 1OAAA 2FJ0A 1YQUA 1LI7A 3GNTA 3I2IA 4KYTA 2VP2A 2IOFK 3RYFA 3NW9A 2QRGA 3UK1A 1EGMB 2NQ8A 2YY6A 1IU9A 2YZ2A 4OXIA 1W5EA 4BATA 2XQFA 3SM9A 1P19A 4HGRA 4RACA 2ZYHA 1N7GA 3B1WA 5C9ZA 1NF2A 3AI1A 4QEZA 4ESHA 3E9QA 4EJ0A 1PZGA 3OEEA 4W5WA 6NULA 4QQRA 1QF9A 3BHNA 3H0KA 4Z99A 4NV0A 4J43A 3H8VA 4B6OA 2AI1A 3QNMA 1YRAA 1DCKA 1PJTA 5JD4A 2H4JA 1T26A 1YIAA 1ZSVA 4E6PA 4K87A 4PN3A 1KBZA 5BNIA 5FTJA 4Z1MA 1BYIA 1EAMA 2G9ZA 3C41J 5ALTA 1QIHA 3AY0A 1UXKA 3TSAA 1DAPA 1G21E 3MWGA 2VJNA 5C2JB 4TS1A 1M1NB 2HK9A 3GV0A 2H8KA 3AUTA 5I9MA 2BEVA 3J81k 4Z7OB 3V1KA 4KPGA 1FTWA 4HYEA 4I5IA 3E05A 1MW9X 4AT1A 1NMSA 2NPFA 1KZ6A 3J80A 5DBFA 2EKPA 4X6UA 1BN6A 3EIEA 4EG8A 3M6LA 5I9BA 1LV8A 3AERB 1UZUA 1RPZA 2QMHA 3L4EA 3I2FA 1C7EA 4YJGB 4MARA 4LZAA 5IF9A 2JVKA 1RLUA 4L4XA 3MF4A 3FNHA 1CP2A 5EJ4A 1Y1SA 3BH7A 4WFQA 3ROGA 1U9CA 3UFXB 2PRJA 4EKYA 1AD2A 4H7DA 1XEFA 2E5WA 4MV8A 1WB9A 2A5YB 2D1FA 4F8EA 3T1QA 2BI7A 2CL0X 3EASA 2GZMA 4W5TA 3KUXA 4RMGA 4GMDA 2QU8A 1FLNA 3NVDA 2MHCA 2UZ1A 2BFEB 1JBKA 3CLUC 2QT0A 2AMYA 3PEYA 4NFYA 4OHWA 2FLKA 3OMWA 4PU0A 3R8FA 3I5YA 3PJRA 3O91A 2AFHB 4UW9A 1N0IA 2OKCA 4L76A 3KSAC 4R0NA 5EWLA 4TXNA 2ZQ5A 1SG0A 4YK7A 2ZIUB 2NGRA 2P0YA 3T94A 4DG9A 2WZQA 5C7OO 3MAJA 1NN5A 4OHOA 2NYRA 4COKA 2OXFA 5CR9A 2I6XA 1G17A 1BH2A 3LIPA 3ED1A 3UAZA 3DGFC 2EWWA 1AF4A 3ITKA 4P7JA 2HZBA 3MUFA 4HDNB 1C4OA 4PINA 4QDOA 3G2NA 3OT5A 4ZREA 5IEJA 1NXOA 1T8WA 1XXLA 2ZRJA 4MV1A 4OLFA 1EFRA 3WYFA 1K3FA 1RIIA 2HH9A 4IFTA 4YJ3F 5K3BA 2Z4RA 1JTVA 1L4YA 1UMBB 2ZAIA 4ZVNA 2P30A 2UXDB 3A37A 1SBQA 1MAHA 3OTWA 4WX2B 2ZUBA 2WJAA 1LDGA 2J9FA 4A6EA 4BGDA 1RLIA 2HHAA 1ZUNA 2K5UA 1OV6A 1QGOA 1BOFA 1GUFA 3B6IA 4RA9B 3SEAA 3V33A 4GPEA 1AA9A 3KJHA 4RULA 1RKVA 4G0XA 2VI5A 1FYWA 4G0PA 3RTAA 5I7HA 1JZQA 3W5DA 1W87A 3TX2A 3WWEA 4I1SA 2X1LA 4MMZB 2C5GA 3P4XA 1F8YA 1F2TB 2Y1DA 2ZRCA 2C9CA 3DE7X 4OHRA 5FOTA 4KOAA 3ZU3A 1LBQA 3P2JA 4CDMA 2ZDQA 4QGAA 4EEZA 1UP6A 3FCOA 2VL7A 1Q17A 4RE6A 4Z2AA 1Q7RA 2G25A 3MJRA 1FP4A 3QBTA 3CRMA 4V1CA 1I4EB 4WY5A 3CV3A 2AK2A 4FYWA 4RVOA 3V7WA 5B5SA 1V5FA 3F98A 1UBJS 1KHHA 2YXLA 1J00A 4QXOA 521PA 2BBTA 4NBLA 3T3DA 1ODIA 3W5IA 5DCWA 3B2QA 4HPXB 5DN6A 4BDTA 3MWJA 4XM0A 4BVKA 4RTNA 3WXMA 4H4EA 5G0UA 4QYWA 2JFZA 1N7JA 5E3JA 1O97D 2Z98A 4J6FA 4EYEA 4J6EA 2AQIA 5KZMB 4CR8A 1XCLA 5EZYF 1LTQA 1DG9A 1HDRA 3T34A 2BLLA 1N7HA 3EEIA 4FSDA 4YRLA 2WMDA 4NTZA 3H16A 3GDOA 5JSZB 2GBCA 3LPCA 4YQEA 4WBNB 4LDPA 3D6NB 3N70A 1NUSA 1VL1A 4ZCSA 1QH1B 2SKEA 4AMVA 3MB8A 5F2KA 6Q21A 4Q4HA 2RFLA 4TS4A 4MIOA 4PAOA 2PX0A 4X3OA 3ZZ1A 4DLZA 2BRUA 1MHPA 2NZ8A 1O5IA 4B5LA 4WKBA 1MFPA 3L6RA 4RK5A 5DTMA 1A77A 1DC5A 1WAMA 4ZKDA 4WIAA 1J49A 4F8JA 3W4JA 4DEXA 2JFNA 2QYSA 1JSZA 1Y34E 3QVXA 4OXRA 5GY7A 3HFJA 4DRXB 5SZKB 4OB8A 4CMAA 2C7PA 5F3RA 3ZXSA 4N8SA 1H8EA 1OFUA 2LRHA 2NU6A 3O94A 3ECSA 1J09A 3Q3EA 4OXXA 4C4SA 4BNHA 1CDZA 1SHUX 4IDCA 4TMVA 2HM7A 3C5CA 1HNWB 3U61B 1LJUA 1R4MB 2XH8A 3QOXA 4NS1A 4LXGA 3HR7A 4DLUA 1G1MA 4GOMD 2XODA 3EXEA 2VT6A 4XA8A 1P6UA 3LOPA 3AU9A 1DXOA 3A1DA 4FR0A 3T9DA 3H9BA 3MINA 2OGUA 4D43A 2NSJA 2IEDA 3NOVA 4AJ4A 4TMKA 2CK3A 5EJ8A 2GN4A 2YVKA 2RGUA 2X2OA 2WMNB 4GUDA 4JJIA 2WJ4A 2GUWA 1U2GA 3WBBA 5JD3A 3KTDA 2VQSA 1RZRA 1C50A 1EUQA 3FDZA 4IIYA 1D2EA 3H11B 1GGKA 3KLBA 4BNDA 4MKXA 1W9HA 5CD1A 2QV7A 4D8UA 3BFXA 1J2YA 3ULKA 1TE2A 1NNI1 3RVLA 2Q9AA 3DF9A 4JUIA 2H2GA 1RWNA 5J5VA 5BPFA 1TU4A 1T1IA 1AX9A 5K1ZA 2W2OA 4MQMA 4BCBA 3WA6A 4M46A 4M9SA 2BH9A 3H86A 4DNOA 4LS3A 3B13B 3VUEA 1FYFA 1GSAA 1ZD4A 3Q85A 2ZVDA 3T5BA 3HA2A 2F8MA 2CMKA 3WIOA 1M5RA 1N25A 2IYEA 4CMBA 4ESOA 4YJHA 1HFKA 1I3OA 1KBOA 2NYAA 4FFBB 4QGFA 1SUIA 5C32A 3KJNA 1JAIA 2PT9A 3UHJA 1P9LA 4KLZA