2R2GA

Structure of eugenol synthase from ocimum basilicum complexed with emdf
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
310
structure length
310
Chain Sequence
GMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERQRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Eugenol synthase 1
publication title Structure and reaction mechanism of basil eugenol synthase
pubmed doi rcsb
source organism Ocimum basilicum
total genus 111
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.1.1.318: Eugenol synthase.
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2r2gA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2r2gA02
1E7YA 4N18A 1U1IA 4ZQBA 3FNEA 4IZHA 1A5ZA 1WLYA 4GMGA 1AXGA 2GDZA 4MP8A 2Q1SA 1NPTO 2OMEA 1Y5RA 2YV2A 4P38A 3GK3A 2P5UA 3UVEA 3L0DA 1HT0A 3IIEA 5CDGA 3TZKA 5KVVA 3I6QA 3CXRA 1P1JA 3PZRA 4CM5A 2B83A 3INRA 1HYHA 1OC4A 1B3RA 3TZCA 3M2TA 3ICCA 3CTMA 4HFRA 1FJHA 5I7VA 1ZVMA 3IP3A 3GR6A 2D0IA 1V6AA 3QA9A 5JDCC 1XQ1A 3CKYA 4IDAA 1B0AA 2GUGA 1GYRA 4E2YA 3RASA 1DEHA 1P1KA 4A26A 3X2EA 4I8XA 1A4UA 2E4AA 2FPPA 2NLOA 2NVUA 2Y1GA 2BH9A 1IL0A 3JYNA 3TDKA 3UW3A 5JS6A 1KEPA 2YQ4A 1ONPA 2X5JO 3BMQA 3KLMX 2J3HA 4R1SA 2CSUA 1VE9A 2WYUA 3EAGA 1CF2O 4R16A 2BGMA 4LISA 1HDXA 4EYEA 2EERA 4DBVO 3JSAA 4IDBA 2Y68A 4N5NA 1BDMA 1YDWA 2F1KA 4PRKA 1ZXLA 3U0BA 2DFVA 1GTMA 4E32A 4D7AA 2B4RO 2Y0EA 1DSSG 2AE2A 3FN4A 4IJWA 3N74A 3F3SA 3ZWOA 2VZ0A 1U8FO 3E5RA 5U9CA 1I10A 1Q1NA 2AHRA 1OBFO 4Q39A 4ROSA 2YQ5A 4IIVA 1H5QA 3CEAA 1JQBA 2IRWA 3SJUA 4B4VA 3L6OO 2J8ZA 4LCJA 1HLDA 5T57A 3GEMA 4CMCA 3S2FA 4W6ZA 4WNCA 3F1LA 3U4IA 1ISGA 1X15A 4FQ8A 4FR5A 1HE3A 4MO2A 3U3XA 1J0XO 3ZWPA 2EV9A 1U7TA 1P3DA 4WOKA 4IZIA 5TC4A 4FFNA 4CLOA 2D2IA 2TMGA 4LMRA 1QLJA 3NDRA 3W8EA 4EGFA 4TRRA 4OXNA 4E2ZA 4WKGA 4YAJA 3WGIA 2X58A 2FR0A 4JK3A 4PVCA 3BMNB 3NX4A 2PGJA 2YUTA 1YONA 3ZWWA 3KBOA 5EIOA 1GQ2A 4FW8A 4YJGA 3DBVO 3M1AA 5T5QA 3PGXA 3UFXA 4WLVA 1V0JA 4RPLA 2ZK7A 2CFCA 5I7EA 8LDHA 4XQCA 2Y67A 1FMCA 2NTNA 4NH4A 4DMLA 4XGNA 2R6JA 5CG2A 2DTXA 5DT9A 1XR3A 2I67A 3RQSA 2QW8A 4BNIA 4EJ6A 3PLNA 4MPDA 1KVRA 4PLYA 2PD3A 3O4RA 5C37A 5A02A 5IDWA 3P5SA 2YFHA 4WLFA 2PZJA 3DQPA 3UF0A 9LDBA 3ANNA 2PLAA 1S7CA 4QFCA 4J4BA 3QRWA 2B37A 4J9VA 4YEDA 5TJ9A 1HZZA 1R4NA 3GA0A 1V35A 4MDHA 1PZEA 5L4LA 2VOEA 2XAAA 1GCUA 2C82A 1Y8QA 1PQWA 2EIHA 4J0FA 3INGA 4D41A 3GZ4A 4YRBA 5L51A 1DFGA 2PD4A 2IDZA 1X1EA 2BELA 3JYOA 5JXWA 2Q4BA 1JN0A 1DC3A 3MJEA 2Z1NA 5ES3A 1ZW1A 2ZB3A 1XCBA 2PH5A 1DOHA 2I3AA 1MA0A 3JQBC 1KEVA 5TT0A 4AFNA 3DDNA 4CM8B 1GV0A 2Q45A 3U4DA 4CJXA 5JYDA 3PFFA 3LYLA 2AMFA 3H9EO 3KYBA 1LLDA 2C2XA 5I8ZA 1SZJG 3HFGA 4YDRA 3BTVA 3WBBA 1CERA 3LT0A 3G1TA 3MOIA 2Q2WA 2BFMA 3PIIA 4DBZA 3JQFC 2OP1A 3PRJA 3BTOA 1BSVA 2P91A 2ZYAA 3AI2A 3OICA 3GEGA 3HDHA 3RIHA 3E8XA 2C20A 1D8AA 3GNSA 2ZB4A 3ICPA 4FSHA 1L1FA 4RPGA 4AJ2A 1EUCA 3L6EA 3HNPA 4QSMA 5I9NA 1P1FA 3M2PA 2AE1A 2OGUA 4ID9A 4OKIA 3F9IA 1R0KA 5KKCA 1G0NA 4EUHA 1ISMA 1H2BA 4AJEA 2WE7A 1ISFA 1WW8A 1DRVA 4B8WA 2B36A 1YH3A 1OZAA 1LDNA 2Y0DA 3K31A 2PGDA 3U09A 4Z0HO 4GLLA 1SPXA 1HE4A 2W90A 4EBFA 2LDXA 3DHEA 3A28A 4IXTA 4MVJG 2VT2A 4BNKA 1NHWA 1NNUA 3KYCA 3HWRA 2P9EA 4PG6A 2CY0A 2VRCA 4BQRA 4E4YA 5I9LA 3RUAA 2ZTMA 1GEGA 1IE3A 2GF2A 3VPXA 4XYGA 1SMKA 2PKRA 4FIZA 4ALIA 1PWXA 2X6TA 2PR2A 5I9MA 2ZTVA 3AUTA 2DAPA 1UDCA 5HM8A 5JC8A 2O4UX 3ANMA 4WPGA 4R3NA 2NV6A 4TSKA 3OA2A 1G6KA 4TVBA 3GN2A 3LC7O 3DEYX 1Y9AA 3DR3A 4C7JA 3DFUA 2P4QA 1JDJA 4HADA 4O0LA 4Z6KA 4BUCA 1TXGA 3TWOA 4R1NA 2NVBA 5GY7A 1ZO8A 5KCZA 3RU7A 4TKLA 4OHUA 2X8LA 1XELA 1PR3A 3E03A 4HWKA 2O3QA 3RBXA 4W7IA 2E82A 1UAGA 1CDOA 5CAEA 1CWUA 3GVCA 4IQ0A 3V1TC 3ON5A 1FDVA 4BNGA 4MINA 1O9BA 4LW8A 1DAPA 2ILTA 1GDHA 1GZ4A 5C7OO 1EMDA 4KWIA 3L4SO 4FC6A 4J1NA 3K2EA 4AJNA 2X22A 5JMPA 1ZSNA 3Q9UA 1Y1PA 1P1RA 1LNQA 4WCFC 2Y0CA 1WDLA 3UCFA 3QQPA 2IEBA 3BHJA 2CMDA 3ONDA 1Y8RA 1SB8A 2XPCA 4NFHA 2FP4A 2J6IA 3INTA 5IDYA 3E5MA 4Q3CA 2PZKA 1PS0A 2HQ1A 4INAA 1B26A 3A9WA 3JQBA 4BNHA 1UXIA 1HTBA 3BXXA 1QYDA 5CDUA 5K6AC 2BFPA 2X23A 3W8DA 4CUZA 5TF4A 3UOGA 4UUMA 4UAGA 4CPDA 1SAYA 4FOOA 2JD0A 5J23A 3WQQA 1BXGB 3NT5A 2ZB7A 3NT2A 2H5LA 4J43A 1UZNA 1B14A 2I3GA 1E3JA 3C1OA 1B3BA 3ZV6A 4IDGA 1B8VA 2G76A 5G0WA 3ABIA 2I76A 3B1FA 3PJDA 1XGKA 3UUWA 4CMEC 3V2GA 3SLGA 1NWCA 2Q99A 2D5AA 1UXKA 3G1UA 8ADHA 3H6KA 4QO8A 5AXAA 3FWNA 3L77A 1ENPA 4JLWA 4PLZA 3ZHYA 1YRLA 3AJRA 2A35A 3ONEA 1UP4A 3P19A 3L07A 4BGEA 3QJ5A 1WMBA 5G0SA 2G0TA 1K0UA 1DXYA 1I32A 3EGOA 5TJHA 4DQUA 3DFZA 4PG5A 3FD8A 4B3HA 3LSYA 2YW9A 3ETGA 3HFSA 3T4EA 4PLFA 4CM6A 2GSDA 3BTSA 4X54A 1C0LA 5H82A 1U3TA 4KUEA 4D42A 1Z7EA 2GD1O 2BF7A 3PJFA 4C7KA 2HJSA 4O59O 5JCXA 4KTTE 4A7PA 1MC5A 2EGHA 3KEQA 4PZEA 5AXBA 4CQMA 1EK6A 1U7HA 3I3OA 1TVEA 3WMXA 3C7AA 3G49A 3JQ8A 4WLUA 4Z0TA 3AY6A 1M2WA 1O6ZA 3OHSX 5ILOA 1P1HA 2ZIZA 4ZA2A 3EHEA 1UJMA 1PZFA 4YJHA 2RH8A 2V6GA 1CQIA 3WWZA 3FHLA 4RPKA 5COQA 3ZWNA 4HV4A 2OHXA 2VCYA 5CPBA 1ISJA 4CM7A 3I83A 5L4SA 3GVXA 5IN5A 5L7WA 3QY9A 4L0QA 1T2EA 2Y1CA 5L53A 1U4OA 1Z45A 4P4NA 3H5RA 5TX7A 3PFWO 1JA9A 4FGSA 1X0XA 4E5PA 4XCVA 1DBVO 3B20A 2DUWA 1O95A 2PKQO 2P68A 3AY7A 4JJFA 4DTIA 4RLSA 4CM9D 2X0NA 4BKQA 2Q1TA 1LLUA 2FSSA 3BMOA 4O63O 3E9MA 4MVJH 3TF5A 4NJMB 3JQGB 3LK7A 3JYLA 4G5HA 2Q3EA 3WDSA 2W2KB 1H2HA 4MIEA 4CLRA 3PQFA 1RM3A 1FDWA 2UV8A 4E33A 1XU7A 3NV9A 4R1TA 4B4WA 4J9UE 2V6BA 3PVZA 2PNFA 4NFSA 4MVJP 4BNTA 1BHSA 1E5QA 2B5VA 2HK8A 5FWNA 4RF3A 3SEFA 1DIBA 2VYND 2WDZA 4IJVA 5BT9A 2Y1FA 5BSFA 3KSDO 1N5DA 3ITDA 1CEQA 1HF3A 4QXMA 4WCFA 1NM5A 1Z73A 1LDGA 1PJBA 3VH3A 5H83A 1DC5A 5BSHA 1KERA 2OORA 3JD1A 4CMJA 1DO8A 4NHEA 3S2EA 1EVZA 3GMSA 3I9LA 5KVSA 2W2LA 3BYZA 5HRUA 4L8VA 1MLDA 2YJZA 3DL2A 4Y98A 3HUDA 5K6AA 4BGVA 4CR7A 3WNVA 3IL2A 3CE6A 3DBRA 3WGGA 2NWQA 5TGDA 1PWZA 2ZATA 3OM9A 4F45A 4WNIA 1Q2XA 1GQQA 4MP3A 5DDIP 4OAQA 3WJAA 2HCTA 4CUKA 4EITA 4KDFA 4CV3A 2ZQYA 5EQFA 4D44A 2FZWA 3GGOA 4DL9A 4L73A 3QWIA 3WX0A 5A9SB 5JSFA 3LZ6A 1QSGA 5JFOA 2GYYA 4XRGA 1YVEI 2HU2A 4KOAA 4RCVA 1EE9A 1MV8A 3BHIA 3OQ1A 4OKNA 4CUJA 5HS4A 4GI2A 3VPSA 5L40A 2FHSA 1ZK0A 5CDTA 2WWRA 3K6JA 3OJ0A 1MP0A 3GZNA 1WDMA 3P7MA 3PEFA 3PJGA 4H15A 3ASUA 4CLEA 1UZLA 4KWHA 4JBIA 4S3MA 4JBGA 4ALLA 5A3VA 1J4AA 3D3WB 3I1JA 2PTGA 3C7CB 4DIBA 3RKRA 4DWVA 1HDOA 1NWHA 2BGKA 4FFLA 4N5LA 3A14A 5DOVA 2RCYA 2AA3A 2AXQA 1NX6A 3DOOA 4IPTA 3VKUA 5JDIC 2I66A 1LSSA 4J49A 4E3ZA 5JO0A 2FR8A 5JNLA 2GZ1A 4CQLB 5I8WA 4CQLA 4NI5A 4DGSA 4DIOA 4H16A 5B1YA 5C5IA 4AJ4A 4ZICA 1MXHA 3AI3A 3D64A 2ZKLA 4BNVA 2ZYGA 4IS2A 5CG1A 3UCEA 1A72A 4Z3DA 5GZ1A 1QP8A 4IJUA 4J7UA 6LDHA 5IZ4A 2CF6A 3DBHB 1ID1A 2PA3A 4ALJA 4FFPA 1F0YA 3JQDA 4ND4A 4CV1A 4XQ9A 4CMBA 5DOZA 1WZEA 3RVDA 2CVQA 3W1VA 4O6VA 4UREA 2EHDA 2AQ8A 4NBUA 1ZK4A 4H3VA 4R1UA 2NM0A 3WB9A 1A4IA 1SEPA 2I6TA 2PY6A 1B16A 3HHPA 5DCYA 2QG4A 1JU9A 4Q3DA 1BW9A 3S8MA 1JKJA 1LSJA 1M67A 3RUCA 4B7UA 3K9QO 3RUFA 2C59A 3GEDA 1N1EA 3CINA 3RBVA 3IKTA 4CM1A 2H6EA 4PG8A 3DZGA 3DMTA 4Y6PA 3MWEB 3R1IA 4B4OA 1YJQA 2Y1EA 2X9VA 1R4MA 3H9GA 4XZ3A 3S2GA 1UUFA 3JD0A 2YDXA 4B7XA 3TN7A 3VTZA 2GN9A 2RIRA 1VKNA 3F5QA 3Q2KA 4TRJA 1PJCA 1Q7GA 1T4DA 4BV8A 3EK2A 1A27A 5JE8A 3RC7A 1DDOA 1EUZA 2Z5LA 3AM5A 4BMNA 4D0SA 4URFA 3UXYA 4DPMA 3NGLA 1LEHA 1RPNA 4BNWA 3AFNA 3ZNNA 3EDMA 2GR9A 4TROA 4FPXA 1E77A 4OOFA 3PWZA 3RI3A 1IOLA 4E13A 5K0ZA 3TL2A 3FNGA 3KZVA 2W8ZA 3E18A 2VRBA 1I01A 4OQZA 4DPLA 2IYPA 1Y9EA 2O3UA 4R9SA 4BKOA 1PQPA 1KVTA 1VI2A 3GY0A 4FDAA 4E21A 2Z95A 2QX7A 3JQ6A 5KJCA 1C0PA 4YB8A 3BAZA 1Q7BA 2H63A 4E12A 4FJ0A 4RO0A 4TKMA 5FYDA 5TRTA 4PFJA 1A71A 4HFNA 4WECA 1DIGA 4AJ1A 4ND3A 1QV6A 5G4KB 4BGUA 1RWBA 1GY8A 1I33A 5DP1A 2D1YA 4IQGA 3AK4A 4R69A 3ZNQA 1P74A 1T4BA 3GH3A 3TRIA 3DONA 3AU8A 1HDYA 4EEZA 3IJRA 4EJMA 3GT0A 4JN6B 1Y81A 5B4VA 2CUKA 2LDBA 4P8RA 5EERA 4BIIA 3RUIA 4Z9FA 2P2SA 2CD9A 2UDPA 1ZK1A 2NNLD 2VN8A 1ARZA 4YCAA 1XDWA 4BO6A 1FDSA 1QYWA 3RC2A 1ZJZA 2R2GA 4M54A 3MOGA 3W6UA 5G0UA 4IGFA 3I9NA 1IY8A 1YBAA 1EBUA 2Z1MA 3G17A 5AXDA 1BGVA 5IF3A 3ETDA 3TFQA 4J7XA 4L4RA 3KEOA 4ZJUA 1EUDA 3VOSA 4U6QA 1W4ZA 2GZ2A 2VNAA 1VJ1A 3EC7A 1ENOA 5IG2A 1WZIA 3UAGA 2XF8A 2HAEA 3G3EA 4FC7A 4RDIA 3B1KA 1EDOA 4ZQEA 4B8ZA 3GLQA 2O7QA 4CMIB 2PK3A 3TPCA 5CPFA 1MXFA 4Q3BA 4RZHA 3ADOA 1ADGA 3D1LA 3RKUA 4JROA 1ZBQA 4GKBA 3KVOA 4MP6A 3ZHXA 1T1RA 3EY4A 4P4GA 3UN1A 2W4QA 1JLLA 3UH1A 4K6CA 1JAXA 2NTJA 4IM7A 1LSUA 2FR1A 3P2OA 3GGPA 4YT5A 1ZSVA 1E6WA 4J2HA 1GPDG 3L9WA 2DBVO 1C1XB 3D7LA 3LC2O 4F6CA 1ADCA 2D5CA 5JMWA 3Q6IA 4LCEA 4ALMA 1ZMTA 3WG9A 1LDBA 2H1SA 4NBWA 2J5RA 4F3YA 2I5PO 1UZMA 4Y8VA 1EBFA 1U3VA 5THKA 1YWGO 4TQGA 3N58A 4O1MA 4B7CA 1YBMA 3FNFA 4A27A 2WYVA 3JYQA 3I4CA 2OXIA 3HB5X 2HK9A 3EW7A 4PG7A 5IXYA 3E48A 3F4BA 3BMNA 4CM4B 1TEHA 4AJOA 1GUZA 4IDCA 1GAEO 4F6LA 3WBFA 4I1IA 1KS9A 2GN6A 4RZIA 2AEJA 4AG3A 4PLVA 4UULA 1KEUA 1H93A 2AG5A 4ZRMA 2QYTA 2PV7A 3KHUA 4D79A 3QLJA 3FPCA 1DPGA 1NFQA 2AEFA 4BKRA 1K3TA 3PYLA 3RD5A 3KM0A 2Q49A 4I9NA 3PPIA 2GN8A 3KSZO 4J91A 5T8KC 3F1KA 1PX0A 1E1LA 1UP6A 4IIUA 3ZV3A 2RHRA 5L45A 2R00C 1YO6A 5JCJD 1QR6A 5F1OA 1E3WB 2VWGA 5F21A 1U3UA 2VOJA 3AW9A 5FFFA 3ZWCA 1O5IA 2C7GA 2GZ3A 3N7UA 3PP8A 3V1UA 5B4UA 4BO0A 1HE2A 3LT2A 1YS4A 3SLKA 1E3LA 3HG7A 1KVQA 2AQIA 3SBOA 4WLEA 2DFDA 5KVQA 3GFBA 4BMSA 1D1SA 2B69A 1DC6A 2VTEA 5DULA 4OOEA 4ND2A 2C0CA 5DZSA 1Z75A 1EDZA 2BFOA 3RROA 1YQGA 2OFPA 4UVHA 4CM8A 1F12A 1JWAB 4D46A 4DLBA 3LVFO 1HSOA 3HJAA 5LCXA 2UAGA 1LDYA 2FSVA 2WTBA 4NNJA 5EQDA 4K1LA 3DZJA 1VL8A 4NBRA 1DLJA 3UGKA 2VWHA 4U8GA 5LC1A 1IZ0A 4CR8A 1DRWA 5JDCA 3R3JA 4Q3AA 4BQPA 3ASVA 4CMAA 1KIFA 4IQ8A 4BKPA 1H9BA 4M1QA 4GQAA 4MVJI 2Q2VA 4R41A 1ADFA 4BO2A 4NJOA 3F6YA 3GMDA 1KEWA 1ULSA 4XJSA 3I9JA 1E7MA 3NAQA 3T7CA 3LC1O 3ZU5A 2ZYDA 1MB4A 1GCOA 1TA4A 1N1GA 3NDJA 4BNUA 2QRJA 3BA1A 1AGNA 1P44A 3H2ZA 1FF9A 1PGNA 1T2FA 1U28A 3GPDG 2EP5A 5GZ6A 2VWQA 4FOSA 3F5SA 4XB1A 2HKIA 4PIVA 2HSDA 1QLHA 2UVDA 2OUIA 5TSDA 3WTBA 1I2BA 3H5AA 1SCUA 1QRRA 2HMVA 2DU8A 1TLTA 4RDHA 1RM4A 3PHGA 1ADBA 3O8QB 4NPCA 5G4LA 3L4BC 1ZCJA 2RH4A 3DTYA 4R54A 2P9GA 1OC2A 4QUKA 3QV1A 3D5TA 2QIOA 3DXFA 3C1AA 4I9HA 1K89A 1WXDA 2JJYA 1ONOA 1U9JA 4TMFA 4OH1A 1IULA 5A3JA 3A4VA 1SBYA 5COBA 3UICA 1YOVB 4NMHA 5F1KA 2X9GA 1UR5A 5FI3A 1NHGA 3PQDA 4XGKA 3WGHA 1DJQA 1GPJA 3H65A 3ROPA 4E5YA 3ZWMA 2DTDA 2VHXA 4KZPA 4UEOA 4MIOA 4CLHA 1QMGA 5CEEA 3I9KA 3NT4A 1VM6A 3EVTA 3PHLA 3MTGA 3RC1A 4RPHA 5ILGA 1F8GA 3OJEA 1YGYA 4ZU3A 3ST7A 3EVNA 3JCZA 2VYNA 3GHYA 3STHA 5C3MA 4W9NC 3IKVA 4XYEA 1MUUA 1ULUA 3V2HA 4H7PA 2JAPA 1VJTA 3GVIA 2JKVA 2PD6A 1C1DB 4BNFA 1BWSA 1BVRA 4YQZA 1RM5A 3U62A 1I30A 1HSZA 1T24A 3DBLB 3GOHA 2EW2A 2FPGA 2VHVA 1E92A 4PGFA 2YYYA 1MG0A 3T7EA 2IZZA 3DHNA 2G1UA 5T8KA 2HK7A 1QORA 3EYWA 3AI1A 1GADO 1LQTA 4GLOA 1GYPA 4MVJE 3VAZA 2ZJ1A 2IODA 1E5LA 2SCUA 3D5QA 1JKFA 4XYMA 3CUKA 4DIFA 3F47A 3O9ZA 4FB5A 5F5NA 3ZWXA 4AJIA 2WYWA 5F1PA 4XRRA 3H9JA 4IS3A 3WGTA 2X4GA 3FCOA 1O8CA 4FFOA 1N9GB 3PQEA 1Y6JA 1U2GA 1I3MA 1U3WA 1CRWG 2QZ9A 4NBTA 4D45A 3VPHA 3HN7A 2OBYA 3OQBA 3VZPA 2CDAA 4FS3A 4N54A 3CPSA 4WUVA 4HBGA 1E7QA 5U4QA 3RBZA 1X1TA 3X2FA 5KJFA 4IMRA 2C7VA 2O48X 1BXGA 4RVSA 1QYCA 3KOUA 4K28A 2ZCUA 1OI7A 3ZH2A 1ZIDA 4OYRA 3U9LA 4KUHA 4OO3A 3NKLA 3QVXA 2Q2QA 3JQFA 3NRCA 4R5MA 1ZXBA 3ZDFA 1VL6A 4R01A 1F8FA 2DBQA 3KUXA 5BQFA 1XEAA 5CP8A 3JYPA 4NG5A 1NXQA 5KKAA 3WYBA 4GGPA 3CSDA 1UH5A 4FBGA 5MGBA 4GH5A 3KYDB 1PJSA 4U0JA 4GKVA 4UVGA 1V3UA 2W98A 3U5TA 3GC6A 3OP4A 1BDBA 2NVWA 3S55A 3OIDA 4UVIA 4MIYA 3FR8A 1P33A 3IS3A 4M86A 1JTVA 2JCVA 4FGWA 3RWBA 1VLLA 3FRJA 1P1IA 4CODB 4YACA 2WJPA 2QYSA 1LQUA 4ZQHA 4PZDA 3JQ7B 4CV2A 3PDUA 4GWGA 4OGWA 4YT8A 4E2WA 3O26A 1G1AA 3L4BA 2VHZA 5DF1A 5JPIA 3PHIA 3MCVA 2V6FA 4JCOA 3MTJA 4GSLA 5GZ3A 4YWJA 2WSBA 4ZQGA 3AY3A 3Q3CA 4HY3A 5TNXA 1R37A 1EEHA 4YJDA 4KQXA 4EUFA 2VT3A 4Q3NA 4GAEA 1RYEA 4GX0A 1F17A 3DZBA 4DC1A 2DUUA 3QP9A 4J6FA 1N7HA 2VHYA 4R4JA 1H0KA 4S1VA 1X7HA 1N8KA 1AHHA 4ZD6A 4OJNA 4OSPA 4NK4A 2YV1A 5AYVA 2BFAA 4LSMA 4Y6SA 2X1HA 1K6JA 1YE3A 3DZHA 2I65A 4J7CA 2HLPA 3ONFA 5I7FA 3OJLA 4RV9A 4W9NA 3C7DB 3D4OA 1EQ2A 2J3IA 5BNIA 1DAOA 1H6DA 1ZNQO 1C3VA 2FPIA 3GG2A 3VZRA 3W6ZA 4K9DA 4CV0A 1OMOA 2E48A 3QVSA 4WE3A 4II3A 4JIGA 5KOIA 3QWBA 4AVYA 5ICSA 4IJKA 4QO7A 2UUPA 1UAYA 3GRKA 3JQGA 4NJMA 4BO7A 2XXJA 4YAKA 2WMDA 2W2KA 1KC3A 1KY4A 2J5QA 2BGLA 4R5HA 4EW6A 1NVMB 5CDSA 3WOHA 1A7KA 3JQ9C 1K5HA 3FF4A 2YV3A 5T64A 2WD7B 1E3EA 1EFLA 3AU9A 1J6UA 1GD1O 1U5AA 1PGJA 2H9IA 3DTTA 3M6IA 4HKTA 4XIYA 2VRCD 3E1KA 1RM0A 2O3TA 4DYDA 3LQFA 4JXKA 2IZ1A 2Q4EA 1HXHA 1I24A 1DFHA 2G5CA 3QVTA 3NGXA 4XA8A 3ZZNA 2OO5A 4FJ2A 4WASA 1BVUA 4XKJA 1RYDA 3TOZA 2Y05A 3TOXA 2IXBA 1DIHA 5CHEA 2B4TO 1HL3A 4OSOA 4N5MA 1ZUD1 1Z74A 3GG9A 4NK5A 3IUSA 3ZI0A 5I7SA 2VZ9A 4BO4A 2X0JA 2DBRA 3IDSA 3M1LA 2WD8A 1X0VA 1IZ9A 4D3SA 3CZMA 2GRAA 5IN4A 1QYVA 4YAEA 3HSKA 3IOYA 3ZV5A 3GN1A 3GDFA 4RPJA 1LLQA 3LU1A 3WS7A 4BVAA 4NFYA 3VC7A 4CMEA 1W73A 4CLXA 4NR0A 2EJWA 3ZWAA 5JYEA 2O23A 4ITUA 3WGYA 2CNBA 2JD1A 3W4IA 1LA2A 2JFGA 5JY6A 2HRZA 2I9PA 5A9SA 2JHGA 5HTOA 3GF4A 3LDHA 5EN4A 3AWDA 4NQZA 1PZHA 1IPFA 5KJ1A 1YQDA 1ORRA 3ENKA 4BO5A 1R6DA 2J3KA 1BTOA 3H7AA 1EQUA 4DQVA 4LVUA 1I5RA 1HWYA 1GL3A 4J1TA 5C7IO 3JQCA 2YHIB 4HX5A 2NSDA 1NYTA 2RAFA 2FWMX 3OQ6A 4CMHA 3D3WA 1FDUA 2PKQP 1K6IA 1H6AA 1S6YA 3TNLA 3WSVA 4DYVA 2C5EA 4HUJA 1PU2A 4UVEA 1N92A 3MZ0A 4Z9XA 3IMFA 3DWFA 3O38A 1AN9A 1LDEA 3RUHA 4FD3A 3I6IA 3WFJA 4YYZA 3JQAB 3TZHA 1X14A 4OM8A 1PSDA 3VH2A 4J2OA 1NQ5A 4IINA 2C29D 4OMUA 1LSOA 4DLAA 5JAQA 4GX5A 5DCUA 7ADHA 5ICMA 4KDEA 1Q7CA 2PZMA 5JAMA 2IE0A 1M76A 2EW8A 2NU6A 3H5NA 3HADA 1R16A 1ZK3A 2EEZA 3DB2A 3DBHA 5ITWA 4YJFB 3IQDB 3Q9NA 4BNLA 4BOYA 1I2CA 5TLSA 4O5OA 2CZCA 3HZZA 4YRAA 2VYVD 2X5KO 1U5CA 2VTDA 2C07A 3JQEA 2JAHA 1JAYA 3FBTA 2YFQA 3UKOA 4A10A 1I36A 1CETA 3WQSB 4OXYA 4EJ0A 1LRKA 1DJNA 1EVJA 1KETA 1P0CA 5K9ZA 2B35A 3KO8A 4PLCA 3ZWBA 3CH6A 1HDCA 1B8PA 2DPHA 3HE3A 4JGBA 4YT2A 1WP4A 1LI4A 1Z82A 4UUOA 4BL5A 2JCXA 3VKVA 3EMKA 3ITKA 3DZFA 3JQ9A 2NU7A 4R51A 3H3FA 4IDDA 5U1PA 5KTKA 5TS3A 3AOEC 2ZQZA 4XYBA 2Q46A 3OEYA 3TSCA 5EL0A 4JP3A 1KYQA 2GERA 3VH4A 1ZK2A 3PXXA 4NDNE 3K73O 5T6BA 4DC0A 1VL0A 4L9RA 4ZVVA 1GZ6A 2JHFA 4PCVA 1U4SA 3QW2A 1EZ4A 4RVGA 1NPYA 5A04A 4LN1A 5ENDA 4I08A 1DHRA 1I3KA 2QHXA 1UXHA 2BD0A 4I9UA 3TZ6A 5KNLA 2UUOA 4YR9A 3GAFA 4D0RA 3F46A 3GVHA 3R6DA 4QQRA 5B12A 5KVCA 4BB5A 4J0EA 2RHCA 1V3VA 2DBZA 3RJ5A 4RF5A 3E82A 1C14A 2HMSA 3GRPA 1UP7A 1WNTA 2PGLA 4ILKA 1TT7A 1MG5A 2Q50A 3OEWA 1YJ8A 5IJZA 1SOVA 2PFGA 4MVJD 5HWSA 3E6AA 5ITVA 3RFTA 2NACA 3ZU3A 4TZTA 3BMCB 3BMCA 4L76A 2NU9A 2J3JA 1O94A 3ZGYA 3PK0A 1YBVA 2GLXA 3ROKA 1H6BA 1ZSYA 1LTHR 5CDYA 5G2OA 5JO9A 4Y9DA 5G4KA 1RKXA 2UYYA 5TT1A 3C24A 2YZ7A 1PEDA 5KIAA 2BHLA 4DPKA 4PLTA 3SVTA 3WSWA 3NTRA 1NQTA 3GNQA 1KOLA 1XKQA 4G65A 4XX0A 3H3JA 4XR9A 5TQVA 1ZJYA 1P77A 4PLWA 3MJCA 1AXEA 2JCYA 1I3LA 3CMMA 1L7DA 1NR7A 1VC2A 1YB4A 3GAZA 2W2LD 4P22A 4YVFA 3SXPA 2CDBA 4R68A 5JAIA 5BSEA 5JDIA 4CMKA 1EE2A 2G82A 3VZSA 3C1TA 1XLTA 2F00A 4E2XA 3ZU4A 1PL7A 4K6FA 4XJTA 3DHYA 3MJ4A 5L95A 3PYMA 3QVOA 3ULKA 5THQA 1XSEA 2QQ5A 1ZKMA 5JY1A 4CMIA 1C0IA 1NTOA 5A05A 1F14A 3FBGA 5A5FA 1I2ZA 5BR7A 2GPTA 1MFZA 3VDQA 1XU9A 4L4XA 2NVUB 4XDZA 1P31A 1JVSA 3BMQB 3ROQA 3HB4X 1BMDA 3T4XA 5C7LO 1D1TA 1IUKA 1WMAA 3BHMA 3PWSA 4ZHSA 2EG9A 4L4SA 3FSRA 3JQAD 4RJTA 3KXDA 3QVWA 1FDTA 4DRYA 4ALNA 5ER9A 3RFXA 1C1XA 3OIFA 4RQUA 4IDEA 4M8SA 4OQYA 2X0RA 1D7OA 1MFPA 1IHXA 2VQ3A 3DAFA 1GUYA 1RJWA 4L75A 4IGEA 4L74A 3LT4A 4NIMA 1VJ0A 4PZCA 3TZQA 3AOGA 1X7DA 3PTZA 2VUUA 3RU9A 3W4JA 2EGGA 2QRLA 2FMUA 3AOEA 3BTUA 4GMFA 1E3SA 2P5YA 4IUYA 3FTPA 2DLDA 2HJRA 2XOXA 1I0ZA 4CM4A 4HNHA 1JKIA 3C85A 5IDQA 4GGOA 2ZTLA 1JVBA 5AOVA 3ZNOA 1EK5A 5JLAA 2QZZA 3QE3A 3JD3A 3I52A 1QYXA 4G81A 3OA0A 2TMDA 3PI7A 4LVCA 4WLNA 2ZJ0A 4Q9NA 1ONNA 3VZQA 2I99A 1LLCA 3DAPA 4LK3A 4RF2A 3OMLA 4UEJA 2AEMA 4CLOB 5B37A 4Z9YA 1EFKA 3KLPX 3A1NA 3GFGA 1HETA 3WYEA 2DTEA 2OZPA 4R3WA 3U4HA 3ZN2A 1B8UA 1PGOA 1VKOA 3QWHA 4A5OA 5EPOA 1Z7BA 5A03A 2AW5A 1R0LA 4JQCA 4PLPA 4AJHA 3OJOA 4YJGB 3H4VA 1N7GA 4KP7A 5A06A 1E3WA 5MDHA 3L9XA 3KETA 2EWMA 1ENZA 1TB4A 4MJLA 4BB6A 5TIIA 4F46A 3OF2A 4QTZA 2HUNA 3PYXA 1JW9B 1H94A 1E7WA 2GN4A 4TZKA 1C0KA 4E5NA 5KJ6A 1DC4A 4ZRNA 4DREA 3FPLA 4LRTB 1BXZA 3GHHA 5T67A 4M89A 2EF1A 1PJLA 3UCXA 4QEDA 2B5WA 3IC5A 4J4HA 5L7TA 3BZUA 5COAA 1O89A 1YL7A 1IYZA 4Z3KA 4UVDA 1SOWA 4DLLA 2C2YA 2DKNA 3D0OA 3CMCO 2IXAA 1NVGA 1LU9A 4EZBA 1XYGA 4GVLA 3VH1A 2V65A 1HEUA 1GZ3A 1R4NB 2A94A 4U6SA 4B3IA 4ONEA 5GMOA 1GQYA 1Y8QB 3V8BA 3K2BA 3EZYA 4WK6A 2ET6A 5A4DA 4JJIA 2O50A 1PL8A 1DB3A 3RJ9A 3S1LA 2IYOA 1E3IA 4IDFA 2CVZA 2YDYA 1H9AA 4AJKA 3ZHBA 4PG4A 3BIOA 4IY1A 4Q3EA 5DN9A 5A9TA 2O3SA 4D3DA 3ORFA 3NEPX 4ND1A 4WGGA 2J5KA 4GX2A 1GEEA 1DLIA 4EUEA 5JBIA 4ND5A 1NASA 5JW6A 2O3JA 3GUCA 3O8QA 1E1MA 3NTOA 3NYWA 1GFSA 3GDGA 1BG6A 3PJEA 4ZQFA 2B0JA 1LJ8A 3NJ8A 3AM4A 3C8MA 1UDBA 4KUGA 3OIGA 4LMPA 4KTVE 4TRNA 4Y6RA 4BO8A 3A06A 3EUWA 2NTVA 1WAMA 1VSUA 2AQHA 1LX6A 2EXXA 4J3FA 4XDYA 3WXBA 4CM9A 1YKFA 3HDYA 4MVJM 1H6CA 2O2YA 1PJTA 2EP7A 1YOVA 1YQXA 2HRBA 4HFJA 3LF2A 1V9LA 1ZEJA 3VVBA 2HMUA 2ZTUA 4DUPA 3AUAA 1T25A 4YAGA 4BS9A 5LDHA 3RSHA 1E7SA 3DAGA 3VPFA 3ZHZA 1DIAA 4KMSA 4YBZA 1N2SA 3JV7A 5IAAA 2DVMA 1ZMOA 3ZCXA 1P0FA 5AQ1A 3TFOA 3MJTA 3KYCB 4KQWA 2D8AA 2VUTA 1A9YA 3AM3A 3PZBA 1T2AA 3ZWVA 2D59A 3GQVA 1WVGA 1D4FA 1SB9A 5IZCC 3B70A 4M49A 3U4CA 3HDJA 3OETA 4CR6A 2E49A 1KBZA 4GL4A 1ZEMA 1C1DA 3FNHA 4TVOA 3NTQA 4BO1A 4PRLA 4DQXA 3PHJA 2CDCA 1PJ3A 1UXGA 3U49A 1HLPA 4DXHA 1MX3A 4DA9A 2FOIA 1ISIA 3DBLA 4QFDA 3VDRA 4RORA 4XGIA 2V7PA 2WEKA 5F5LA 5DBFA 1Y5MA 4JJGA 3KB6A 4QECA 4P4LA 1W6UA 2Y93A 1A9ZA 3ZW9A 1SC6A 2DPGA 4YAIA 1PJ4A 2CVOA 1BXKA 4U7WA 3MWDB 3RFVA 1EVIA 1PGPA 2R00A 4U0KA 3ROMA 3QIVA 4OL9A 4K26A 2CF5A 3EZLA 3RCBA 3ZV4A 9LDTA 4HNGA 2FY8A 3QWAA 4ALKA 1ML3A 1CJCA 5JAZA 1YB1A 1HDZA 1KVSA 3I5MA 4JX8A 4NU6A 1IHYA 1PS9A 5ADHA 1NPDA 5CEJA 3HN2A 3VTFA 1FK8A 1NVTA 4XQEA 4E0BA 1N9GA 4LRSB 1AHIA 3ENNA 4YT4A 3W8FA 1HYGA 4CM3A 3H9UA 1J5PA 5HS6A 2GNAA 1DHTA 1D3AA 3GDOA 1XA0A 3NJ4A 4WCDA 5L4NA 1MC4A 1V8BA 2RBEA 4WLOA 3WIDA 5B4TA 4GPD1 2Q1UA 3OJFA 4MVJF 3WTCA 2Y66A 2Y99A 2C54A 4FCCA 1XIVA 3G79A 3WYCA 1G0OA 5DBGA 1LC0A 1Y8RB 4J4TA 4FJ1A 2X0IA 1U2DA 3I9MA 4XQGA 3CZRA 1MGOA 2DM6A 1UXJA 5DP2A 4CL8A 4WEOA 3K92A 4ZN6A 2NQTA 4JBHA 1ENYA 1CIVA 4RL6A 3Q0EA 1HDRA 2Y1DA 4GVXA 3I9OA 3FR7A 4IMPA 4RVFA 1B7GO 1K6XA 3WNQA 1SO8A 5ENVA 1GUFA 3Q2IA 5KJEA 3KYDA 3DOJA 4J16A 1E0DA 4EEXA 3H2SA 3C3XA 1LDMA 1NAHA 4MKZA 4J1SA 4M55A 1LXCA 1PGQA 5L9AA 1U8XX 3ZW8A 3LLVA 1LUAA 3WGZA 1R15A 2D4AA 5L7YA 4GBJA 1HYEA 4GSKA 1NR1A 1PL6A 1YL6A 4I5GA 1M6WA 1SNYA 4A73A 4E5MA 1X7GA 3KSUA 2B4QA 3NDIA 3OH8A 3R3SA 1NFFA 3B6ZA 1XG5A 3JQ7A 1JWBB 2C5AA 1YL5A 4YPOA 5AVOA 5FI5A 1HDGO 2HMTA 2VYVA 3D4PA 3IUPA 4DMMA 1KY5A 3COSA 3QHAA 3OFSA 7MDHA 2POQX 5A5EA 4EDFA 3OECA 1W8DA 5IXSA 4RVUA 2O7SA 3R0IA 2Q1WA 1AUPA 3GUYA 6ADHA 1VSVA 4Y67A 4AL4A 4BNNA 2DC1A 1K2WA 1V3TA 4LGVA 2GO1A 1E1NA 3PIDA 4U5QA 3ETEA 2EKQA 2QRKA 4W82A 1HKUA 4CQMB 3K96A 4N7RA 3NUGA 3JQ8B 3RUEA 3TJRA 3WR5A 2P9CA 5BSGA 3DZIA 4AJLA 3OSUA 1NFRA 5IZCA 3PWKA 3ANLA 4NU5A 2A4KA 3WGOA 4IBOA 4W4TA 4YJHB 1PS8A 4OIMA 4FN4A 2NUAA 1I3NA 1M75A 4XWYA 1DRUA 3ZWYA 2BLLA 4BNJA 1FXSA 2HMWA 4BO9A 1PJQA 2VWPA 3IP1A 3UHAA 4RVDA 5FF9A 1Z6ZA 1LRJA 4I5EA 1QXSA 5DNAA 1VRWA 2WD7A 1VPDA 3QWFA 2A92A 5LDGA 2PWZA 1DIRA 4QT0A 1M6HA 2JD2A 3BMOB 1E6EA 4HP8A 5G0VA 4WOJA 1Q0QA 4MVJA 1HE5A 2Y1OA 3F4LA 2OL4A 3HQ4O 2PZLA 3LT1A 3RC9A 4CLRB 4FFRA 1XHLA 2NQ8A 3V5NA 3DZKA 2HDHA 1W0CA 1YB5A 4BKUA 3DMTC 2GGSA 4BNYA 5EESA 1PR9A 3FWZA 3O03A 4WEQA 1O0SA 2YY7A 4YRDA 4I5DA 4XEHA 3SC4A 4WCFB 4A0SA 1PJ2A 1E1KA 4W7HA 4XIJA 5L3ZA 1P45A 1ZFNA 4PLHA 5BNFA 2BKAA 5EINA 1NQOA 1T26A 2VHWA 1E7RA 1YDEA 1ZH8A 3WMWA 2IEDA 2X9NA 3GPIA 2ZB8A 1R12A 4J1QA 1M66A 1I8TA 1NP3A 2OOSA 4BO3A 4M87A 2PH3A 1IB6A 3DOCA 1PQUA 1EVYA 2VUSA 1PIWA 3DBRB 3I4FA 2BMAA 2JL1A 1NAIA 3GVPA 3MJVA 3OBBA 1PZGA 3LF1A 2ZCVA 3TQHA 5HBRA 1ZZEA 2FRDA 3KTDA 1GYQA 3G0OA 4BV9A 1XWFA 1T2CA 2NADA 5H81A 5G0TA 1YXMA 3AFMA 2YHIA 4NZ9A 1AE1A 1F06A 5IDXA 1OOEA 1OFGA 3VVCA 2OBNA 4RGBA 2X7HA 3E9QA 4YXFA 1TT5B 4J90A 1TT5A 4UUPA 2X5OA 1XQ6A 2G17A 1OAAA 1B2LA 1GV1A 4BNXA 4TWRA 4XB2A 4IXWA 2FN7A 4TRMA 2AQKA 4BMVA 3H8VA 3GZNB 2BI8A 2HO5A 2AG8A 3AUUA 3DC2A 3JQAA 1HZJA 3K30A 3JTMA 1ISHA 4RVHA 4UUNA 4XR4A 3HDQA 4E30A 4RLHA 2EJVA 1KC1A 3FI9A 3GNTA 4RF4A 3WQRA 2JFFA 4AICA 5JC1A 2XXBA 2IZ0A 3WWYA 1WDKA 3LLSA 3MJSA 1CYDA 3WFIA 4PVDA 4YJFA 1T2DA 4C4OA 3ADPA 1NQAO 2EKPA 5BNTA 3V2UA 3I23A 1WWKA 1PTJA 4CMGA 1LRLA 2OP0A 2O3RA 3SC6A 3L6DA 2BRUA 4BNMA 1KVUA 4UEKA 2O4CA 4ZGWA 1J49A 3D3EA 3RAJA 3B1JA 4HFMA 3WLEA 4G2NA 3WICA 1Q0HA 2FZEA 5FEUA 4BHTA 5F3RA 2X86A 4BNZA 1DFIA 1GR0A 3PHHA 1X13A 3K8ZA 2EKLA 4CLDA 1LBEA 2WE8A 2E6UX 4PLGA 3WIEA 5IFLA 5HA5A 3PGJA 4EI2A 5A1TA 3ZNPA 5AXCA 1P9LA 2YHUA 2P4HX 1BRMA 1QV7A 4CQMD 2BI7A 5DBIA 1WPQA 4YA6A 5KWEA 4I5FA 2V6MA 4R9RA 2VZ8A 4II2A 3WJ7A 4Z0PA 4B3JA 4ESOA 4WJZA 5JCJA 4B4UA 3VHRA 1L7EA 3P2YA 3PDJA 4YQYA 3GGGA 2A9FA 3MEQA 4YTEA 3ZU2A 1SEVA 3KRTA 1BW9B 5ER6A 1R66A 4QX6A 2VNSA 3IJPA 4E6PA 3K5PA 4PN3A 3DO5A 1T1SA 3IAHA 1QG6A 4LSWA 1Q0LA 5EMHA 4E5KA 1Y7TA 4RQTA 1QKIA 4JP2A 4GWKA 4MKXA 2NU8A 5CEFA 3V1YA 1R4MB 4D43A 2E37A 4XYLA 2GASA 1E6UA 1NBOA 4AJPA 4MKRA 4A03A 3WLFA 4GX1A 1GU7A 3E9NA 4HXYA 4XD2A 1LC3A 3JD2A 3RUDA 3VPGA 1R0SA 3JD4A 4W99A 4A2CA 3H9QA 2DT5A 3PLRA 4JNKA 4NBVA 3S2IA 4BGIA 2WM3A 3KV3O 4OXKA 1CQJA 3SJ7A 3DMYA 2JFHA 4DVJA 2DQ4A 3D4NA 3Q11A 4MOWA 3TL3A 5A9RA 4D3FA 5DCWA 1UDAA 2GCGA 3FTNA 3W4KA 4AJJA 3WGQA 3QSGA 3Q1LA 4CL3A 5CFZA 1IPEA 3SX2A 4E31A 1B15A 1A7AA 2D3TA 1HRDA 5EJ2A 1TI7A 3AUSA 4FFMA 4B79A 3CIFA 2O2SA
chains in the Genus database with same CATH superfamily
5KOJA 2EZTA 5FWDA 2EZ8A 3SNHA 2YN2A 1L8AA 1U1IA 2VPYA 1CUEA 3FNEA 4ZQBA 1A5ZA 2HHAA 2DWUA 4K8OA 1BO6A 2XIQA 3EA0A 3MD9A 4MP8A 4PS1A 3SF8A 1JI3A 1HH4A 2OAQ1 1NPTO 2XMDA 1Y5RA 2YV2A 3PUYA 4IH9A 3IRUA 4NOJA 5ALDA 3IBGA 3L0DA 4MIKA 5CDGA 1TAHA 5F7ZA 4JI3B 2ZAIA 1QOQB 3CXRA 2WILA 3GJSA 3KB2A 4DQLA 2JCBA 4CM5A 5JRJA 2CV1A 3ZZ0A 3M81A 5K3EA 3L0YA 4ER7A 4QBTA 2O8EB 1J5XA 3IUJA 3LAWA 3M2TA 1RBYA 2E9SA 4G86A 5WRFA 1W29A 2R8EA 4GEGA 3GR6A 4RJ2A 1AV7A 1D2RA 3VR4D 1DEAA 1V6AA 1R0RE 2B7BA 3H99A 1XQ1A 2QYHA 2JK0A 3BQMB 3CKYA 3PX3A 3SICE 1YRWA 4JEUA 1GYRA 3F73A 4WIAA 2WG1A 3RASA 2EX1A 5HTKA 1E2PA 2HJWA 4OHPA 1IBCA 1NRXA 1O03A 2E4AA 3E7FA 4QXOA 4JL5A 4L4UA 4R98A 2Y1GA 5KQMA 3JYNA 5LBTA 3TDKA 3AJEA 3PD1A 1TRHA 1KEPA 2QR2A 1NIJA 1T5DX 2HZ7A 4IUBS 3KQNA 4L9WA 5F52A 4EHIA 2I2DA 4IUDS 4PCAA 4JOCA 1JPVA 2CSUA 1VE9A 2WYUA 3SQDA 3HNRA 5KYVA 1N2CE 1W2GA 3D2CA 2BGMA 3TQFA 521PA 1AK2A 2QSYA 3NVAA 4D98A 4BBZA 5JAOA 5M29A 4ZZ0A 4IDBA 4ZV7A 3C6BA 1YR6A 2H51A 2Y68A 3IYLW 5A5DA 2FMTA 2E3JA 4XVCA 3ZDBA 3QXSA 1OB2A 3PFKA 2NUTB 3DE4X 3A6GA 1GTMA 1ESMA 4JOSA 2B4RO 4LYEA 1G9TA 1NE2A 2Y77A 3N74A 3CW2A 5EKUA 1IIBA 2A9RA 4M3NA 2YW2A 5I4BA 3L3BA 1U8FO 2O7NA 3E5RA 1Q1NA 2LR0A 5FR1A 3PR3A 3FJOA 4TV8A 8GPBA 2NO0A 4C7MA 5JPCA 1ZESA 5HF8A 1RBMA 1P2SA 4QDOA 4XWTA 2B8WA 2BGIA 4Z4IA 3DV2A 3CEAA 2XWPA 1U0JA 4JT4A 4U2BA 2R84A 4F7DA 1TCCA 2R4TA 4KRFA 1OF1A 4X64B 1II8B 2P77A 2WSMA 3BDVA 3EFBA 1PNTA 2WZCA 4X3CA 2WIBA 4LXUA 4ZT2A 4I8IA 2IXGA 3SYRA 2G7ZA 5A2QA 5JZSA 3TIVA 1FY2A 1X15A 4MO2A 4C2BA 1HE3A 4JI7B 2JI9A 3CNEA 1UBMS 1WSBA 3C16C 1P6QA 3D6HA 1RQRA 4BAGA 1VTKA 2EV9A 3ZZ1A 3T7TA 3WWDA 4E4TA 1M33A 2ZIWB 5EZ6B 5TC4A 1XMVA 4IJMA 4FFNA 4G0NA 4EG1A 3M7IA 4DUZB 1SVLA 1Z47A 2PUTA 1OYYA 3KU4A 1CJSA 4FTWA 1YZTA 5LYJF 4TRRA 2OV3A 1Y4UA 5CFOA 1RAAA 2W2VA 1TU4A 4XD7A 5F76A 3WGIA 1MVNA 1RDFA 1E6LA 2FR0A 3B2EA 4JK3A 1HE8B 2Q3JA 4X95A 3BMNB 4A6PA 1JWLA 3UWOA 4POOA 2VDNB 3ZKWB 2PRJA 1Y6ZA 1YONA 2VI5A 3JZIA 4I6GA 4NDAA 4QRIA 621PA 2XW6A 1GQ2A 1VBNA 5DCLA 3CVVA 3CC8A 2IX3A 3DQZA 1B0ZA 1KSHA 3DBVO 3TZLA 2XXAA 3EUFA 5K99A 3UFXA 2DHQA 1XAIA 2G6TA 3OUUA 1UPUA 3MT9A 2DWQA 4BX9A 1K8QA 4IOLA 3H6HA 1C9EA 2V9ZA 3EGCA 2NTNA 2QKYA 2XNDA 1WMSA 4IEFB 1Q3HA 1TM3E 1KI6B 4XGNA 3W6PA 3WYDA 3ZZTA 2DTXA 5M04A 1NSTA 1AB6A 3FZEA 5DT9A 4GP7A 4BNIA 4RMIA 2QTRA 1JF8A 1K97A 4YQFA 2BZ1A 2DHCA 1M1YB 3SFZA 4HQNA 5IDWA 1QCDA 4IJ5A 1D5WA 4FOPA 2YFHA 2VH1A 1ECJA 3IJEB 3KTFA 3AF3A 3DQPA 4DV0B 4MHTA 4X7BA 2PLAA 3QRWA 2CFOA 4YEDA 5TJ9A 1V35A 1BA3A 1J25A 1L4BA 1M0EA 5CYPA 1II0A 1HK7A 3E53A 3QUAA 2Z6UA 3U80A 1GCUA 1HDIA 1XB2A 2C82A 4K7JA 1E9EA 2QG6A 4YRBA 2YVLA 5TPZD 2PD4A 3QX9A 5JXWA 2F17A 2Q4BA 1ACLA 2H29A 3BKXA 4HBZA 1ZW1A 2NZXA 3RS2A 3WGNA 1WSDA 3I73A 4PBTA 2I3AA 2WW8A 3BOSA 3PDCA 2W6CX 3C0KA 2HWYA 3CE9A 3DDNA 3BB4A 5FO1A 4Q7QA 2R6AA 2IS2A 3DAOA 2AOTA 2ZI6A 4IJQA 3STXA 3O7WA 3LYLA 3DAHA 2X0FA 5IC5A 3KUCA 3M34A 4D9MA 1I7PA 3W5SA 5LP6B 1HM5A 1JR2A 3DYBA 4KPGA 4LOAA 2QVXX 3DEZA 4QJ4A 4JQYA 5I8ZA 1SZJG 4M7PA 5LQKA 2JLUA 3G1TA 4MWTA 4OPMA 4UFPA 2E89A 2Q2WA 1O94D 3NI2A 4DBZA 3N2ZB 3JQFC 2OP1A 1OLSA 4ARVA 2B99A 2QRNA 2RDMA 3BUSA 4NH0A 1JQJC 3AEUB 2IYSA 1JLSA 3DPSA 5DIZA 1AGRA 1EGVB 5U4XA 3RQIA 5KMGB 3HKDB 5IEBA 2C4WA 5CGQB 4EPXA 1NKSA 5KWIA 2ZB4A 3ICPA 4FSHA 3WKAA 3TXYA 1FFCA 1JFFA 3FNIA 3DS8A 1AU9A 1MU0A 3FMVA 5ICGA 3L6EA 3SCZA 5K0GA 5J1TB 1JQAA 2AE1A 3E3OA 1I0IA 1H3NA 5EP4A 3IUBA 3NHJA 4KO8A 1KRHA 4MQ6A 1ISMA 4MX8A 1H2BA 3S7TA 3UO8B 4P3OA 5BN3B 4LZOA 1ZAYA 4LMBA 3TI7A 4IIJB 4L85A 4CXMA 1TKAA 1KTVA 1W5TA 4AYXA 3DYIA 5BSWA 4ZYYA 3HP7A 4K2AA 1YH3A 1FVOA 3M5DA 5K3FA 2KYRA 3C43A 1SIWA 3DHEA 1TC2A 2I4OA 4HH4A 2PGAA 4IXTA 3KZ1E 2ISQA 1Z2NX 4MVJG 2VT2A 4XTRA 4ANFA 2FMKA 4BNKA 3KYCA 2EWWA 4NEGA 5HG0A 3GL9A 3NWEA 3EWNA 2P9EA 2VRCA 1U2PA 4B81A 1DQSA 1P2BA 1ZZGA 3PT9A 3LSTA 1JBKA 4MUJA 5CLHA 3RUAA 3BJZA 4MW0A 1KAQA 1J70A 1HQKA 1P2DA 2H4ZA 3GA5A 3M3PA 3P4XA 3Q5EA 3VPXA 4JEIA 3ZJ4A 4BLTA 1M6VA 4EKEA 4XYGA 1CKEA 2H2HA 4M1KA 4ALIA 5AWFC 1K66A 3QF4B 1J97A 1RRVA 1ZGJA 5I9MA 4BQIA 1GDDA 2CHGA 3OFJA 3AUTA 5ITZA 1UDCA 3OE1A 5JC8A 4E03A 1UOQA 1Z16A 1Q95A 3PXUA 2NV6A 3NAMA 4HN4B 3OA2A 3PA6A 2XBLA 1RQGA 4TVBA 5LB4A 3VU9B 3S8EA 1F3OA 4WKBA 3DEYX 5KQLA 5LU8A 4ZRDA 3Q6NA 1MOSA 1JDJA 1L7OA 2P4QA 4EF6A 3UM9A 3LK6A 3EVAA 5FHRA 4BUCA 1E9AA 4Q1EA 4Q3OA 5IF9A 3TOVA 1TXGA 2A5YB 2ETXA 3CGWA 2YNMD 3AHCA 4LHYA 4R1NA 2BGRA 3TWOA 3GPLA 5GY7A 1ZO8A 1IUPA 5KCZA 4TLCA 4BWFB 4CFZA 1NOJA 2OV8A 4C08A 2V7XA 2D7JA 4MUYA 3JALB 3B48A 3MXTA 3RRBA 2QPTA 4W1QA 1FTNA 3TECE 1PFVA 3V1TC 5E7JA 1M2JA 1VJCA 2QLNA 2WUGA 4G23A 4DR1B 4LW8A 4TUYA 4YRKA 1NXTA 2QMZA 4NCXA 3QEAZ 1C8VB 1E6KA 4AO8A 4A2WA 1F6BA 1KJWA 2C8VA 1NATA 3K2QA 5FULA 1RI4A 3P0FA 3IEKA 2SCUB 4HWGA 4IIDA 3STTA 3KQKA 3BEOA 4FC6A 2O57A 3ZYZA 2R6CA 4O2BB 2DBYA 4OUDA 5JMPA 1ZGCA 2AC2A 3K9HA 1WBJB 1XQWA 1QH1B 1Y1PA 4WUTA 5EIBC 5B36A 1TU0A 1KR5A 2Y0CA 3N86A 1WCV1 5HOEA 1E3QA 1T1GA 3MTAA 1T9BA 3ONDA 4WL0A 3P9PA 4MKHA 2QJTA 3IQEA 2XPCA 4YRPA 1PUXA 1RQ7A 2FQWA 2J6IA 3DL0A 3INTA 4FI3C 5D00A 5IDYA 5AW9A 4Q3CA 5IH7A 1SCNE 4MVWA 1B43A 3LNTA 3AGQA 5IJXA 2QRGA 1B26A 3JQBA 3QBTA 4KN8A 4AS2A 4BNHA 1PVDA 1UXIA 5BUCA 5LIRA 4C0XA 2WKSA 2ZJ4A 3W8DA 4CUZA 3S68A 5TF4A 2A9KA 4UUMA 4TKVA 1WXWA 3TSOA 2JD0A 2ZB7A 2H5LA 2SNIE 2BFCB 3AILA 4X20A 4YUYA 3N8NA 1B14A 2FP3A 2RGEA 3ZOZA 3LL7A 4IDGA 1EFHA 3A26A 3ABIA 5DI3A 5LBUA 5LMZA 4K88A 2I76A 3PJDA 1USUA 3H2KA 3OZRA 3UUWA 2XQFA 1P9WA 4L8LA 2PMCA 1NWCA 2P0YA 2AI2A 3HVJA 3O84A 3FMPB 3G1UA 2H9YA 2WNSA 4RJKA 1AMNA 2H1LA 5GVRA 4QO8A 3OLYA 5FOQA 1N7JA 4JLWA 4PLZA 1B8NA 5EFOA 4ZAFA 3ZHYA 3SSNA 2PX8A 4GYJA 1V6SA 3V1NA 3ONEA 5K0SA 1T36A 2UKDA 2AN3A 3AXTA 3FI0A 5CW1A 4TM7A 3AFGA 1WMBA 3TDMA 2G0TA 3F8SA 3FOCA 1I32A 1SHTX 2WB4A 3D2BA 3EGOA 5TJHA 4DQUA 4CKXA 1P4AA 2C9OA 1EEXB 1N2HA 4KJZA 4EHKA 3HFSA 4QUAA 3T4EA 2GA9A 4CM6A 5TMPA 2GSDA 2IYLD 1Z3CA 4LJKA 4ZO6A 1TQ8A 4F5DA 3G23A 2QQGA 4KUEA 3VO9A 3QSYA 2WPDD 1E9VA 4B34A 2VQEB 1XXHA 3N2GB 1NVWQ 3NIWA 2G1KA 5FNVF 1MC5A 1X8LA 1HLFA 3LRXA 2Y3IA 4V0ME 1VMKA 2CLFB 2R1ZA 3KEQA 4WACA 1NMQA 1WRBA 5DLEA 5AXBA 3NTUA 4HLCA 1IJKA 1O1YA 2BKLA 3I2HA 2FPLA 1V8DA 4MQMA 4GW3A 1EK6A 3K8QA 1TVEA 1W5AA 1POXA 3B3QA 4NBLA 3WMXA 5LJLA 3L7LA 4P81A 4BQFA 1S1MA 1ZC3A 3MRTA 4IO1A 3V9AA 4R84A 1S8OA 5GOZA 1FTGA 3ROZA 2OLJA 5L8VA 3LNCA 1P1HA 4ZA2A 3WP1B 3ZIDA 4YJHA 4FGZA 3ZVNA 1SHJA 3FHLA 4KBFA 1ZIOA 4RPKA 2V3CC 4HV4A 4A8JB 1UBCA 2XUAA 1KU0A 1HMPA 1SWVA 5CPBA 1OH7A 2WHRA 1RJ9B 3I83A 3TAHA 3GVXA 2VJKA 5IN5A 3AHJA 3I8SA 1PUIA 2A30A 2XTJA 1TK3A 4FB4A 3K71B 3INNA 3ZXUB 1EM6A 1HBJA 3I34X 4P4NA 5FUXA 5AJWA 1N2IA 3AW8A 1N0HA 3PX2A 2AFIB 4E5PA 2GD6A 2R48A 5ISMA 4OHFA 3KKKA 2YMMA 1KK0A 3QUSA 4JJFA 4W1RA 1IQUA 1T91A 4BP3A 3OQMA 4CM9D 2FPIB 1BA2A 5BORA 2Q1TA 2OY0A 1LLUA 2FSSA 5DWVA 5CFPA 4BB0A 4O63O 4OHCA 2HCRA 1L5FA 3E9MA 4KFTA 3DZ8A 3R6GA 1KQ3A 4JB2A 1RMYA 2Z2YA 5FIUA 3ZOKA 2QTHA 5K5EA 1D6MA 1YOBA 3QI2A 4NV0A 3R7SA 4A0HA 3L04A 2V7EA 2HA7A 1RM3A 3TOCA 1JQLB 2FFAA 2UV8A 2XLCA 2A3RA 2YV4A 4LMAA 2QMUA 4B4WA 2KLBA 1JXOA 2V6BA 5DLQC 1JIKA 2PNFA 4MVJP 5BW8A 1BHSA 1NUSA 2B5VA 3IRVA 4FFDA 3UPDA 1U11A 2I4LA 4MH0R 4DCPA 5IANA 4HD8A 2WDZA 2VYND 1RJFA 2OAGA 2WWWA 1H4TA 4IJVA 1WCIB 2Y1FA 4JELA 4WINA 3KSDO 4EOGA 3QKSA 1ABFA 1L7AA 5BN1A 5HMMA 1RWVA 4K0RA 1S2DA 5CXQA 4U2CA 2W5UA 5EJIA 1KKUA 3BXHA 3SJCA 4MRNA 1SULA 3RYCB 3C6KA 5EE5B 3S5JA 2H9AA 3IQGX 1DC5A 1GA4A 1GSAA 1FTYA 3MUOA 4DLSA 1V11A 3LUAA 3ZQ6A 1PJ8A 3S6JA 5BSHA 2OORA 2Y8EA 3BWMA 1VXRA 3S2EA 3F7OA 3TLMA 4XUEA 3GMSA 2A33A 2GM9A 4ER3A 2A5GA 1G2IA 1A2BA 1NVFA 2H48A 3KPYA 3BYZA 1QG0A 4JP5A 4NZYA 5IKEA 4L8VA 2OFFA 4WT7A 5K6AA 3MELA 1FS6A 3MRXA 4ETIA 3KZKA 4CR7A 3CE6A 2P78A 4WRRA 2NWQA 1PWZA 4E7PA 2P90A 1DWQA 4UDOA 3OM9A 2ZEJA 1A97A 2BT4A 2WJ4A 3UIEA 3L7MA 4GU5A 5E1OA 3WJAA 4J29A 4FNAA 1UM8A 4KI0A 1WF3A 1JAZA 4TQAA 4CV3A 4KC0A 3TLZA 2ZQYA 3FMIA 1XALA 1FUEA 1YZFA 2FZWA 3T61A 1XEWX 3GGOA 2Q7DA 4DL9A 2FLWA 2XB8A 4OATA 3U7GA 1M8JA 4ZEOA 3ZE7A 3TLXA 3KQMA 5AICA 3MLEA 3USCS 3LZ6A 3MNFA 1QSGA 4BAUA 4F85A 1VRCA 1ZVKA 1J7KA 3QEMA 4GZ3A 2R79A 4XRGA 1LBTA 1YVEI 2HU2A 3VR3D 4PBRA 5EJGA 1MV8A 3BHIA 4CUJA 4EELA 2XYQA 2CFIA 1XEXB 3LCCA 1SOUA 2OFWA 3ORQA 2VTBA 1IN8A 5L40A 1HI9A 1ZK0A 5CDTA 2X0KA 4DRXB 4HDMA 4JI1B 3ZHQA 3RYHB 4B7ZA 4BJ1A 4IG4A 1FX1A 1WDMA 3MAJA 2NP7A 1J00A 1SC4A 1TYEB 2XRYA 3VVMA 1UZLA 4ZK2A 5F2KA 5B6IA 4IQFA 3NHYA 4ALLA 1JXMA 2G5PA 1C7JA 5DYYA 2A1UB 1J4AA 3D3WB 1UBGA 2PTGA 3ZBQA 3KS9A 4NYJR 4HH0A 2ZW9A 4DWVA 1HDOA 4LYFA 3R2JA 1VLMA 2O0KA 2NYUA 1PBTA 3DOOA 1X9IA 3VKUA 2FLKA 1RWWA 1LSSA 4J49A 4K9KA 2JFZA 2CNDA 3D0QA 3IOBA 1XLTC 4O2AA 4E3ZA 4WZZA 5GV7A 4DNFA 4NCJA 1GT91 1KJQA 2BC9A 3MG9A 4NI5A 3IV9A 1WCXA 1FXWA 4H16A 2J4FA 1ZI8A 4AJ4A 1E1CB 4DIOA 5C5IA 3BM5A 5GJVC 2FG6C 2QUHA 2UVPB 5FKJA 3GJ6A 3HVHA 3GT3A 3B78A 2ZKLA 4IYRA 1M8KA 4IWXA 3UYKA 3LLUA 2ODNA 3KHSA 2NV2B 3H86A 5E9JA 5CB6A 5JS7A 4OQQA 5B3KA 2XOKD 4QDZA 3E1GA 4IH4A 1ID1A 1K5GA 2F43A 2PWAA 1N0IA 2GHRA 2N46A 3G82C 3G68A 1J9GA 2HF2A 4HAOA 4EA6A 1N8TA 5FTJA 4XQ9A 2JHAA 3F7MA 1WZEA 2GXUA 3DT6A 2DRIA 2G9ZA 3IBTA 5DK4A 4NP6A 4RH3A 3RVDA 4B71A 5H4GA 1XTRA 4EG7A 1TM4E 3BAFA 2VDWA 2XKKA 1GP2A 4LRWA 1Z13A 4C43A 5IM4F 4KNYA 2RBKA 2YYSA 3GLHA 3GQBB 3H11B 2JLQA 4OI2A 4RV5A 1ZVVA 1AZTA 2P5TB 4ER5A 4B17A 4ZJPA 1A4IA 1ADYA 4BQEA 5DN6D 1SVUA 1YJAA 1JU9A 4HGOA 4RJLA 1LSJA 1YZQA 2W4MA 1GNLA 4M1EA 2GZRA 3CCBA 1P6UA 1FP1D 1TJNA 2OHGA 3GEDA 2W6PA 4LOHA 5D2CA 4ZMSA 3IODA 5ESDA 4CU2A 1K9SA 1NVDA 1Q7TA 4G36A 4MK4A 1J1UA 1J24A 4PG8A 4N3AA 1QOZA 1NYQA 3DMTA 2BHRA 5CITA 2FUEA 4KPUB 5E3HA 1EFVA 2ERYA 2QAIA 2JEYA 1BD4A 1UMCA 3A9CA 3N5KA 4JJ6A 3VR6H 4UM8B 3ZCTA 4XZ3A 1RKUA 4GI5A 3MWYW 3JRXA 4Q7MB 4XIGS 2CCGA 1HORA 2LP4Y 1UM9B 2YDXA 4B7XA 4Q6WA 1ZD8A 4BWVA 5K4GA 2O05A 1QNLA 2VDVE 1Q7GA 5AK4A 2OOKA 4RGVA 3ZYCA 3ZDCA 1XC7A 2OE2A 4BLOA 1TQ2A 3L1HA 3EK2A 1A27A 3MB8A 3RC7A 2FEMA 2WUVA 5JH7B 1KAOA 2BFEA 2Z5LA 2BKXA 5H3HA 1GRCA 1UBNA 1Z5NA 4IIGA 1EXWA 4URFA 5H3CA 4C0HA 1BCSB 2VNIA 3NGLA 2P2GA 4DPMA 3AFNA 2GRJA 2WMOB 4ZOLA 4CCSA 2BZSA 4TX1A 1J39A 1V5GA 3QKWA 4BC1A 5K0TA 1E77A 4OOFA 1ZOIA 4O4IF 2J09A 3FYUB 5SYAA 4H7EA 4DHWA 3S0JA 3V1LA 2VRBA 4TZ0A 3EXFA 3NHWA 3WLRA 4C0SA 2IYPA 1MW8X 4JS0A 1Y9EA 5I9IA 3T34A 2ZRFA 3U7RA 4ZCLA 3HA3A 5C8ZA 3DH0A 4FDAA 2QN3A 4YB8A 1G8YA 4OJTA 4YJ3B 4FJ0A 1J06A 4ND7A 4RO0A 4TKMA 4RM3A 1QF6A 4KPYA 1YQTA 1BKSB 3PUJA 4M4SA 4AJ1A 2AIRA 2IKQA 4MS1B 3WK9A 5AHOA 5H80A 5G4KB 3QFFA 1GY8A 1ZN9A 4YONB 4IQGA 5IBCA 1UPXA 3A9RA 3AK4A 3N0VA 4B4KA 1HEIA 1P74A 3TK1A 4AXBA 4EEZA 5HQTA 3IJRA 4DWOA 3ANXA 3Q7PA 3QU9A 2VXCA 2AJTA 1XAHA 2WUFA 1B6RA 3TW6A 3DD5A 1Q0RA 1Z06A 3MFYA 4RCYA 4NCIA 2CUKA 2LDBA 3ZY4A 4DMFA 4DWWA 2R11A 1U2QA 2BEKA 4PQYA 3RSCA 1OFUX 3C6YA 5IRCD 4U8HA 2O8EA 2GFQA 2Y9MB 4AAYA 1KQFA 3ROXA 1ZK1A 2NNLD 4YCAA 1GUDA 3E7XA 5J9FA 3DKKA 1XEFA 2PMBA 2R1VB 5AKHA 3MOGA 4EG8A 5G0UA 3VR1A 3NBKA 3I9NA 5LMCA 3NVMB 1YBAA 1EBUA 1G8SA 1M8FA 1F2UB 3GPBA 5AXDA 4F92B 4DUGD 7ABPA 4XOUA 1X7YB 1UT8A 3AINA 1QTQA 4Y1RB 2B82A 4HVCA 3D6MA 1UC4B 1K27A 1W4ZA 2B3TA 3SEAA 5FWXA 4LWPA 1WZIA 2OESA 3PQ4A 3G3EA 1U28C 4RDIA 3B1KA 1TUBB 1EDOA 3WRVA 3I01A 4BZPA 2ORIA 1NJ1A 2F3UA 2O54A 3AG5A 5CPFA 3T9CA 1GGEA 1DT3A 1Q44A 5ED0A 3F6CA 5CLGA 4ZCPA 3M4NA 4XVQA 2PYDA 2J0QA 1SXIA 5IABA 2R6HA 4JROA 1ZBQA 3BE4A 2GLTA 3KVRA 2NUTA 3TINA 1T3SA 3OD1A 4TLAA 4QBGB 1LS1A 4NVRA 2HRRA 5BWMA 3ZQJA 4W5QA 5ALJA 5JVDA 1SVOA 4TZ6A 4Q9IA 3UH1A 2WPNA 2FWAA 2QVCA 2NTJA 3IOCA 4GPTA 1IRIA 3P2OA 1XCLA 1XKLA 4I1OA 1IHPA 3NZEA 4MWGA 1AA9A 1U31A 2VK4A 3RAEC 4QYSA 1O57A 4LXYA 4EKNB 5EZYF 1ZSVA 4J2HA 1GPDG 1II8A 3L9WA 2DBVO 1IZZA 4HAYA 4P08A 1C1XB 3LC2O 5EJ7A 5EJ9A 2Q0SA 5CFLA 5JMWA 4JLKA 4OL0A 3Q6IA 4LCEA 3LKZA 4EFMA 1AQUA 4EI8A 1ZMTA 1W96A 4NBWA 4QUEA 5BV8A 2VJOA 2J5RA 3SKYA 4F3YA 3QZUA 5G53C 1Q5PA 5SY6A 5E7MA 3S70A 1FMLA 2CEKA 3SX4A 3WLHA 3ICQB 3FYDA 1YBMA 3L0IB 4QG7A 4A27A 2WYVA 3JYQA 3FFAA 3I4CA 3KV1A 4Z5XA 1F1JA 1UBUS 2XUKA 3BWVA 1V26A 1JBEA 4UCFA 1RKQA 4IXMA 4JLDA 3BMNA 4M0MA 3LP6A 4CM4B 1TEHA 1LS6A 2FHPA 3C5CA 3LPAA 4U2GA 3ZKWA 1KRWA 2ZIVB 3N8DA 4OB6A 4OQFA 1T2UA 3EEOA 1YD7A 2J0UB 3L46A 2QN9A 1SCDA 3WBFA 4I1IA 1BD3A 1E5VA 1KS9A 4X71A 2GN6A 4RZIA 3QOFA 5TARA 1E2DA 2Z3ZA 3R7LA 3HABA 4AG3A 3B2QA 1H93A 1LQ2A 2HSZA 4KIJA 4RTPA 1YJCA 1FDRA 3DVQX 3SR3A 1EE1A 4ND8B 3Q87B 2PS0A 2PV7A 4D79A 1Y33E 2WR8A 2Z4RA 1RRGA 3QLJA 3HMKA 3FPCA 1DPGA 2DCUA 2I6XA 4G5OA 4EL5A 5EAIA 3LL4A 2W58A 4EKDA 1JH8A 1K3TA 3IBCA 1KI6A 2I55A 4MA5A 1GOTA 2ZUVA 2Q49A 2WYOA 2YOHA 3UHJA 3QV2A 4J91A 1E1LA 4HGNA 1M1YA 1GHTA 3K09A 4H0NA 4R2LA 1IEWA 2QYOA 5D8DA 4BJ5A 5FTLA 2HLNA 3AC0A 3UMCA 2IY9A 2R00C 1QR6A 4FGLA 1OFTA 1AY0A 5F1OA 2N47A 2IYZA 3URMA 3UMFA 2IHTA 3ZL9A 2CKDA 3IOMA 2YIVX 2VOJA 3TVTA 3ZWCA 1O5IA 3FMFA 3N7UA 3GJ4A 4MUNA 4BO0A 3ISTA 2E4YA 5BNZA 4HYYA 3HG7A 3EAFA 2A67A 2JJ2D 2WT9A 2ARKA 4I99A 5SYNA 2BM9A 3SBOA 2Z8YA 4LTMA 1YULA 1DC6A 2YZ2A 1KOFA 1PLLA 2WU0A 3BRSA 3LUHA 3RFFA 1EDZA 2R65A 5J2UF 3VKFA 1U0SY 4Q4CA 2OFPA 3CO0S 3KOXA 3GJTA 2K7ZA 2IZ7A 3GARA 4DLBA 3BRWA 3CEPB 3LVFO 3FCXA 5JAPA 4RD4A 3OBIA 2UAGA 3NASA 4TT3D 1EDEA 4R1OA 1MABB 1G9SA 3JASB 5HUJA 2P6UA 1BRTA 5EQDA 4ZVOA 2P27A 3DZJA 1Z29A 4FNOA 1Y98A 3VDNB 1DLJA 3R3HA 3H6GA 2YWXA 4JZYA 5LC1A 1DRWA 4L0CA 3OHPA 1W44A 5A3SA 1QKKA 4AQDA 1QIKA 3AEUA 3STWA 3ELUA 3O2QB 2IUUA 2WFAA 1NDUA 2JBHA 1M8PA 1P3JA 1T5BA 2GBPA 3ASVA 4JWTA 2FZ5A 4M1QA 4MVJI 1QGAA 4R41A 4WBXC 3HKDA 4BKPA 5KMGA 1E1RD 4C87A 5DFAA 2GYWA 1B23P 3GMDA 1G20B 3I9JA 1E7MA 4D57A 1RQNA 1RC8A 4EG6A 4ENWA 1GPMA 3NDJA 1SWWA 3BJEA 2QRJA 3J7TA 3E7WA 4KXWA 1P44A 3ONNA 2WU3A 1R27A 1YU9A 2VWQA 1N36B 5LQSA 5FB3A 3STVA 3F5SA 5AVTA 1WXEA 1KO5A 2ES4A 2DPXA 5A7HA 1CQXA 1G98A 1N6OA 2HSDA 1Q17A 5TSDA 3TEMA 3T1TA 2IUFA 1E99A 2XE6A 3DULA 4BVBA 1N75A 4KGZA 4KX5A 4A3SA 4IIJA 1AM4D 1R5BA 1TLTA 1RM4A 2FDXA 3C2QA 3DXXA 3PHGA 4F96A 2C3OA 1CUFA 3DUWA 3O8QB 4CI0B 3KQTA 2AFRA 2M32A 1PF7E 5G4LA 1CJVC 1NW4A 2RH4A 3AO0B 4R54A 3RB8A 4BVFA 3WDKA 3MMSA 4PPFA 1R6AA 2E5WA 3OU6A 4FHDA 1IN5A 2DFKB 2Q3DA 4MMZB 2ZKIA 2V0GA 2AEEA 4GOKA 4FLEA 4UM9B 2ZZMA 3M5PA 3W6OA 3ORSA 3WB0A 4OH1A 5LQMA 3ID6C 1IULA 4WBNF 3J81A 1RLOA 3LCRA 2OSVA 5FI3A 3GJ5A 3OKPA 1FMFA 2IH5A 4RH0A 3PQDA 1U0RA 3DFIA 4RY0A 5EHNA 5KAMA 4JYCA 3OLZA 4MNTA 3AHDA 1Z22A 2IKSA 5DLPA 4E5YA 2BN4A 1G19A 2C8JA 4BGPA 4Z2AA 5C8YB 3I9KA 3O21A 3EF1A 4MLDA 2IV2X 4DCMA 5DW0A 1TYDE 2I4IA 3OZFA 3MTGA 5EIEA 4EENA 2CNKA 3A10A 5CFQA 3VU9A 5EXTA 2FOLA 3V1MA 2EJCA 2D6FA 4JUIA 3BD7A 3TQCA 3C3MA 3E61A 1XWWA 4WFKA 2JH9A 3CVYA 5C3MA 3KSRA 2G4CA 1JT2A 3IKVA 1HNZB 1O6BA 3RV4A 4FD2A 3PVCA 2ZAOA 3VDXA 2JAPA 3FNBA 3L6BA 3GFFA 1H66A 4ABTA 3IE2A 4QELA 3BERA 1TMGE 4XASA 1FSZA 1R64A 2ZB2A 4BNFA 4ZT6A 4EEKA 5LXTB 2DFLA 1RAFA 1DQYA 3EVBA 3G0BA 4M1ZA 3U62A 5BRAA 4HDAA 1I30A 1XZEA 3EF0A 1SQFA 3KZMA 4NXNB 1ZM7A 3PPWA 5F2OA 2VHVA 3C48A 3JALA 2ZDQA 4R6WA 2A8YA 3CCCA 1FVXA 1QOPB 2B0CA 4BEWA 2YYYA 4EI7A 4REQB 1S2IA 1W30A 2OAEA 3MUEA 4H77A 2DQZA 1GG5A 3DHNA 4OVKA 4W9RA 5T8KA 3WZMA 1RQXA 1GADO 4G8CA 2P6OA 1JA1A 3R3WA 5AK0A 2SCUA 2H4FA 3HJGA 1BS1A 5J40A 2FPWA 1IY9A 1OXVA 4O2BA 4BEBA 2Y1KA 1KDYA 4MWCA 1TPYA 1QH1A 3NBUA 1UFRA 3DP7A 3BSWA 3I58A 3H9JA 3QITA 2RG7A 4I6EA 2X4GA 1K0FA 3EQ9A 5HM6A 4EQZA 4LTNA 4UW9A 1UBKS 1Y6JA 2CE2X 2IW3A 3A4LA 2QVBA 3DWGA 1W36D 4RZ3A 3UT6A 1VE7A 3I6MA 4BBPA 4D45A 1A95A 3COWA 3GEHA 1MHTA 2JF0A 3OQBA 4TXNA 2LCQA 3SC2B 4N54A 3CPSA 5U4QA 4E11A 1SXJB 1TVCA 2WI8A 1X1TA 3PTLA 4C1NA 1KI3A 3UY4A 3KLOA 5EHXA 3OEEA 1FYXA 5E0KB 2EKBA 1DU4A 3CF6R 1KR2A 4ASUA 3OF5A 2BFCA 2QM7A 2LKCA 1XTZA 4CG1A 2CYAA 3E27A 3RF7A 2R66A 3P9NA 3RGGA 3T0IA 4JB8A 4PZZA 4OO3A 5CVDA 3TNFA 4B3GA 1PVOA 4BHHB 3ILVA 3UG7A 1K3FA 1OLUB 5IH3A 4WN3A 2R2AA 1QS0B 3E4CA 1XEAA 2NYVA 4RXTA 4NG5A 2P6PA 1ATIA 2XTMA 3UA4A 1FRVA 3EBPA 3FKSA 4GGPA 4K3UA 3WYBA 1UH5A 2XDWA 3VI3B 4BE9A 5KREA 5EHQA 3R5JA 3HYRA 5ICCA 2YYAA 1Y0BA 4YREA 5KYXA 4RK7A 4DADA 5CVTA 2I03A 1XU4A 3HRKA 1QCZA 2HU5A 2HMYB 3U39A 3OZXA 4J1TC 2GYVA 3WWPA 2PJZA 5IULC 1ICIA 1Z08A 1G18A 3G2PA 5E4FA 5EQJB 4D26A 1U80A 1O08A 4JYPA 4FGWA 4HR7A 5HJ2A 3RTDA 3K20A 3FRJA 4Z9BA 5FBLB 1P1IA 3EVZA 4UARA 4CODB 4US2R 4MB0A 1DJLA 4YACA 2H1VA 2MSDB 4BJ3A 2Y1XA 4E88A 1PWEA 3U81A 4PZDA 1EGHA 1PT8A 3X1ZA 1N3IA 1Z6PA 1IK6A 1G1AA 1E9CA 1FYDA 1Y42X 2BFBB 2C88A 1IMJA 3CNOA 3L4BA 3N2GA 3QLTA 2WKWA 5DF1A 4XWKA 5IWCA 4WKCA 3I8XA 4MQEB 2JIOA 1CJKC 1XMXA 2BKEA 3NHBA 4G5YA 1A82A 4RE6A 1JR3A 3D1VA 1T9HA 3QPDA 5GZ3A 4DSZA 4B09A 2WSBA 3GROA 4ZQGA 1S8FA 2F9FA 4MRMB 3IIMA 3SKXA 2PX4A 4YJDA 3PNKA 5G41A 1T3HA 5AHWA 2QG9A 4EUFA 4Q3NA 3V6LA 1RYEA 2HFJA 4XUDA 4RTSA 2WTUA 3W06A 4J6FA 2VHYA 1EXMA 4R4JA 4S1VA 1PUJA 4PIMA 4HJRA 4JSTA 3NP9A 1XKTA 1NNLA 4A8JA 3ILYA 1XZQA 4GIBA 2WU4A 3HXMA 4IICA 1MH9A 1RJ9A 3DZCA 4OJQA 4TTIA 4QGHA 3T4UA 2RE8A 1A2QA 1YDFA 2YV1A 3A32A 1JEAA 3IPCA 2BFAA 2BM1A 5LZ2A 3MCAA 4DOMA 1ZH4A 2X1HA 5HKOA 1NMXA 3DZHA 3AJDA 5LQUA 2ZJ6A 2YYZA 5CDFA 2NZ2A 4LGMA 5IX8A 2AFIA 3X43A 3ONFA 2FYTA 2ZSBA 4W9NA 2JVIA 1TE2A 3EZGA 1L7QA 3D4OA 4J76A 5BNIA 5K05A 2YY5A 1O6GA 5JSHA 1C3VA 1WUHS 2FPIA 4EPTA 2XUPA 1IUOA 2G28A 2ZQ5A 2FGKA 3A7DA 4EP1A 1MX1A 4II3A 2WJ6A 3MGAA 4JIGA 4OKSA 1MQ8B 3HTXA 5ICSA 2QRQA 1E2JA 1GKLA 2UUPA 1A50B 2ZWMA 3R40A 2IPXA 1R9NA 2WMDA 4OHMA 4I3HA 1KY4A 1ZOOA 2BGLA 2XQKA 4EW6A 1Y8CA 3NEAA 4UQPA 3FF4A 5AI5A 5T64A 2EQ5A 3A37A 1QTNA 2GN2A 3BL6A 1U5AA 2C3PA 2H9IA 4I1YA 4XIYA 4BTVA 4DG8A 3E1KA 4UAJA 1QZ3A 1RM0A 3ZQ4A 1ZBDA 1RACA 1WCIA 3BMXA 2C5GA 1H65A 1DV1A 3DEJA 3ELBA 4MLPA 1G16A 1HXHA 4NEQA 4P9NA 1DFHA 4F04A 3A6ZA 4XA8A 4OHXA 5BPHA 2FW0A 5DM70 3S2SA 4MA0A 1H23A 3RYCA 3M83A 2OG1A 3VXKA 2J5BA 2JGAA 3OQVA 1T5HX 3TOXA 5CHEA 3COVA 2GQ0A 1UL1X 4JODA 1S9DA 4CTKA 2ZROA 3E9CA 3VTAA 1ZGZA 1Y1QA 3ZI0A 1Z74A 1YGPA 4Q7LA 5I7SA 3M1IA 4GRIA 2YCBA 3VC2A 4WJKB 4PX3A 1RR6A 4E51A 5D3KA 2QUKA 2C9BA 3HCOA 4TN5A 2BMDA 1L5ZA 1SH7A 4JJ8A 3HCBA 2BTEA 2IYUA 3CZMA 3OO1A 2C9MA 3F3MA 1QYVA 1QGOA 1ZJ6A 2PX2A 5F78A 4AY6A 2FSPA 2UYGA 4GZ6A 2GPBA 3TXAA 4LBZA 1ND6A 4BCBA 4L3OA 3GDFA 3H87A 3HXOA 4GM1A 1WXIA 1QTRA 3GCZA 2O06A 4G0WA 2WLSA 3ETCA 1KXZA 5BR1A 2RB4A 3R5FA 4NFYA 3VC7A 1W73A 3PGVA 1E8MA 4CMEA 4CNQA 3IXLA 2C42A 4YR7A 4C5BA 5JYEA 2CNBA 5DX8A 2JFGA 3H0CA 3AVPA 5DYIA 4L02A 3SEZA 3T1QA 1V95A 3NU1A 2JLSA 4FSDA 2D0PB 5HTOA 3ZHUA 3GF4A 3HHEA 4V0LA 3AWDA 2OB2A 2PQ6A 1C7IA 3ZDEA 5KJ1A 2QQFA 1ORRA 1EX9A 3ENKA 1R6DA 2WT8A 3LBAA 3AR8A 1XEXA 3H7AA 4DQVA 4LVUA 1L5QA 3FE2A 4DRXA 2UZ0A 1UMDA 3C41J 1HYQA 4INOA 1CJUC 3EUEA 4M46A 4LFBB 4UPEA 3CQ9A 5ALVA 1TM1E 2NSDA 1T5LA 3LDGA 2FWMX 2OQVA 3OQ6A 1ANKA 2A1UA 3D3WA 4X63A 2PKQP 1Z6AA 3WP0A 4ARAA 3ZY2A 3MB5A 3OD5A 5CGZA 2XCQA 3K1JA 1Y5NA 3UV6A 1O4WA 1DKNA 1XTQA 2XGOA 4Z9XA 2C1XA 5ARBA 2ID8A 3SG0A 1M10A 3QE4A 3TYXA 3IMFA 3CR8A 2KBFA 3ZUGA 3EH1A 4DHEA 1T9CA 1GZ5A 1XFDA 2E85A 3GA7A 4OUKX 1Q16A 2OQRA 1LDEA 5DNDA 4FD3A 4MSUA 3NBZC 3VUFA 1PSDA 1UJ4A 1EWTA 3CTPA 4D9KA 1NQ5A 2I87A 3AF2A 4IINA 1TDJA 1E1CA 2OECA 5FRDA 3RVQA 3AVXA 2JGNA 5K3DA 1LSOA 2UVPA 3G9QA 3H5LA 3M49A 3PX7A 4GX5A 1IONA 3JZDA 4WN9B 4NV3A 5I7AA 2J67A 3F6PA 5DCUA 5J1SB 1R0BA 1Q7CA 1GGNA 5CFRA 2X8BA 1CRZA 2IE0A 3FDZB 3H5NA 4F7WA 3KKNA 1G5TA 4CL0A 5TLSA 4BOYA 2B34A 2CLCX 3KJFA 3STUA 1BYUA 2CZCA 2FEAA 3HZZA 2C2OA 3GEPA 2VYVD 4DJJA 1RHMA 1PR0A 1E2EA 3QYAA 2C07A 1EQAA 3JQEA 1HQDA 2I1QA 4DJDC 5JJCA 4RK0A 3U40A 4BFXA