2R2GA

Structure of eugenol synthase from ocimum basilicum complexed with emdf
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
310
structure length
310
Chain Sequence
GMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERQRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eugenol synthase 1
publication title Structure and reaction mechanism of basil eugenol synthase
pubmed doi rcsb
source organism Ocimum basilicum
molecule tags Plant protein
total genus 111
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.1.1.318: Eugenol synthase.
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2r2gA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2r2gA02
1T4BA 4JJIA 1H6CA 2HUNA 5TIIA 2GZ1A 4AG3A 1V9LA 3GGOA 5BSGA 1FK8A 3IKVA 4RO0A 5C7OO 5GZ6A 3EUWA 1Q0LA 1I5RA 1LA2A 4W99A 2OBNA 5BSEA 1ADCA 2EGGA 4L73A 3WGZA 4BS9A 4A73A 4DREA 2E48A 2WTBA 4AJKA 1F12A 1WPQA 4UEKA 3PDUA 1NPYA 3AK4A 3GT0A 4R69A 1QV6A 4ONEA 3TOZA 3JQ6A 2CDAA 4M8SA 2OMEA 5AQ1A 3OECA 2O4CA 2VHVA 2JAHA 3WBBA 1YO6A 1VJ1A 1A9YA 5TX7A 4CV1A 2EKQA 3UW3A 3NYWA 4RVUA 1I01A 3NTOA 1X7DA 4E5YA 3E18A 3S2EA 1CF2O 1EQ2A 4WUVA 3JD0A 1LU9A 4HKTA 4KDFA 2PKRA 4CMEC 4XYEA 3ZV4A 2DTEA 3C1OA 3NT5A 3L6EA 2VQ3A 4Y6PA 1NQ5A 4W9NA 4DLAA 3TQHA 3A06A 3GEMA 3GMDA 3ONDA 2D0IA 3PQFA 4PG8A 2CVOA 1R4MA 5GZ3A 3I9JA 4R5HA 5JFOA 4BO8A 2GPTA 3WS7A 5JO9A 3EYWA 1YL5A 1QSGA 3FTPA 3DZKA 2B37A 1NXQA 3LC7O 4IJUA 4AJLA 2PZKA 5KTKA 1NAIA 1OOEA 4GH5A 5F1OA 1VM6A 5K6AA 4PVCA 2IYPA 1WAMA 3DZJA 2PR2A 3W4IA 4GX5A 5EN4A 5TGDA 2J6IA 3WX0A 2GASA 3KYCB 4KP7A 3U5TA 4YR9A 2SCUA 5A04A 1JAYA 4E5NA 5GZ1A 3P5SA 5JDIA 2FZWA 2QQ5A 3ZU2A 1DB3A 1SC6A 4MVJA 4U0KA 1YBVA 4DBZA 1PZGA 4TRMA 4DTIA 3AOGA 2V65A 5B12A 4RLHA 3IP3A 3HG7A 4FFRA 5T64A 3VZPA 2J3JA 5ICSA 1EDOA 4IDBA 1ISFA 2Q46A 5CPBA 1XDWA 1BXKA 2JKVA 3RC7A 2DBVO 1XELA 2B4QA 3P7MA 1HE4A 3D1LA 2VUTA 3QJ5A 4LGVA 3BMNB 3GVHA 3CZRA 4EUEA 1EFLA 1ZXLA 4ZQGA 1I3MA 2BF7A 4IJWA 4JP2A 1O94A 5ITVA 2ZB8A 1YB4A 2HK9A 4FPXA 3VH3A 3FD8A 3COSA 4BO6A 4E31A 2DBQA 5K0ZA 3CZMA 2IZ1A 1HZZA 1MP0A 1TA4A 3NJ4A 1DIBA 1LRKA 4BNFA 3CMMA 5KJ6A 1DIAA 5JCJD 3AW9A 1PJCA 2OO5A 1N8KA 1VL6A 5CDTA 2QW8A 1XU9A 3INRA 4MVJH 4CUKA 5CEFA 2O48X 1IYZA 1VJTA 1TT5B 3A9WA 3JQDA 2Y05A 5DCUA 4KOAA 4CV3A 1RJWA 3HJAA 1YDWA 4XJSA 2C2XA 1F14A 3HDQA 2FR1A 4HNHA 3PJGA 2JD2A 1LUAA 1UXKA 4RGBA 1M6HA 1PGPA 1EK6A 3IQDB 1YDEA 4FR5A 2JFFA 3DHNA 1HDRA 1LNQA 4FSHA 5TC4A 4EDFA 3QWIA 3ZNPA 3O9ZA 1PZFA 2NVBA 5JBIA 4XWYA 3G17A 2NQTA 3KYCA 3RROA 2IE0A 4JROA 3DOOA 3HB5X 2GN9A 4JQCA 5AXAA 3ZHXA 2HRBA 1QXSA 3I4FA 4OH1A 3WYCA 8LDHA 1LDNA 4ZA2A 2BH9A 2CMDA 1EVZA 2GCGA 3WIDA 1EEHA 1ADFA 3KXDA 2J3IA 3CTMA 3FWNA 5I8ZA 3UKOA 4CR7A 2AXQA 3TFOA 3CMCO 3JSAA 3BTOA 1GDHA 2VZ9A 3LU1A 2Q3EA 3H9UA 2CF5A 3BHMA 2Q45A 3RJ9A 5KWEA 1NQOA 4E6PA 1DFGA 2FN7A 4OSPA 3BMNA 4YWJA 3WG9A 4WCFC 2C54A 5TJHA 4F3YA 3HFGA 1WP4A 1TT7A 1XWFA 3DTYA 1VKOA 2JCYA 4TKLA 2HRZA 4JCOA 1E1KA 4I9UA 1PS0A 4R9SA 4EZBA 3O26A 1BVUA 4PLZA 3RUDA 3LSYA 3FRJA 5IN4A 1ML3A 2LDXA 3QWBA 1E1NA 3WSVA 4MVJE 2GRAA 1DRUA 1YL7A 4E0BA 1WMBA 3Q0EA 4ALLA 1ENPA 2HAEA 5FI5A 3CUKA 5A5EA 1T2EA 3ENKA 3F1KA 3PTZA 1TT5A 1O0SA 4II2A 4BMNA 3PI7A 3RSHA 3DHYA 1BDMA 1PL8A 5KJCA 5C3MA 4XYMA 1X1EA 4XGKA 1LTHR 4N54A 2J3KA 2VYVD 2VZ0A 4DPLA 1LX6A 3F9IA 3X2FA 1LSJA 1Y8RB 1M2WA 4JXKA 2H9IA 5FWNA 3JQ8B 4FFOA 3L9XA 4PLVA 2QRJA 3GN1A 3WTCA 1PTJA 3JQFA 4HP8A 4PLHA 1ZK2A 1ZMTA 3M6IA 3PQDA 3GFBA 1R0LA 3SC6A 4RJTA 4ILKA 2FPPA 3VZQA 4YJFB 3CH6A 4I5EA 5HBRA 4DC0A 2OHXA 1JN0A 3PYLA 2RHRA 3GZ4A 1RYDA 1HWYA 1N1EA 2B5WA 3MOGA 5IG2A 5JY6A 1GUYA 2Y1DA 4LRTB 3UCFA 4XB2A 4OXNA 4BNKA 1P0FA 1V8BA 4RF3A 3FCOA 3KLPX 4FC6A 5TLSA 4ZU3A 4I5DA 1K89A 2IZZA 4WPGA 2VTEA 3E1KA 1VE9A 1ZXBA 3GNTA 4J3FA 3FF4A 4Y98A 5F5NA 4RPJA 4ND4A 1TEHA 2Q4BA 1KOLA 4J7UA 3LK7A 1YJ8A 2OP1A 1UXIA 3HDYA 1RYEA 3WLEA 3WIEA 3S1LA 1P44A 3V2GA 3ANNA 4EJ0A 2GERA 4NBTA 4J4TA 3OICA 4E2ZA 3ZWPA 1W4ZA 5I9LA 2C0CA 1LLQA 3GNQA 3H5AA 1LDBA 3NEPX 3PPIA 1BVRA 4UUOA 2DFDA 5EJ2A 1QLHA 2V6GA 4BO7A 3HE3A 1B3BA 4I5FA 1LSOA 4BB5A 3OSUA 1HRDA 5G4LA 1HETA 2WSBA 2DLDA 2CUKA 5KJEA 3U3XA 2NWQA 1C0IA 2W8ZA 2HQ1A 1BW9B 4CMHA 5ENVA 5TRTA 5EMHA 1X0VA 3AY3A 3M1LA 4D0RA 3ZV6A 3WYBA 4I9NA 1Y8RA 4KWHA 4KZPA 1ZVMA 3JQ8A 3FI9A 1MX3A 4EUHA 4R41A 5F21A 4C7KA 6LDHA 1R0KA 2EJVA 4P4GA 5ENDA 3UICA 4OYRA 4CLRB 2VOEA 3ANLA 3S55A 4QFCA 3RIHA 2X58A 3GGGA 3PJDA 3GLQA 4GKVA 4BL5A 1JKFA 1T25A 1Y5RA 3FR8A 1SNYA 4J16A 3D64A 3HFSA 4ALKA 1NR7A 3QVXA 3JQGB 1NR1A 3S2FA 5JYDA 2YJZA 3F5QA 2Y66A 3AY7A 1NVGA 1I24A 3GDOA 4RF2A 4XCVA 3ZWAA 1A5ZA 4S3MA 4FFLA 3ZNNA 3ZWCA 1QORA 1O6ZA 3B1JA 4TRNA 2RIRA 3ZH2A 3V5NA 3A4VA 4BMVA 1ZMOA 3L77A 1A72A 1QYCA 4LVUA 3DMTC 2AEMA 2BFPA 1B16A 2O3SA 2PKQP 4WCDA 3FBGA 3KVOA 2AA3A 5A3VA 2X0IA 4OQYA 2QX7A 3Q9UA 4BNMA 3FSRA 2ZTUA 1BMDA 3MJCA 3MJTA 4HFMA 4XQCA 3TZCA 1GCUA 2BHLA 1R37A 4BIIA 3ICPA 4XDYA 3WLFA 3I6QA 2ZTMA 2ZATA 3WBFA 2E6UX 3BHJA 2EIHA 1VPDA 5TJ9A 3KEOA 4XYBA 3JYLA 4DLBA 2B0JA 1L7DA 5HS6A 1D1SA 3OBBA 1GYRA 1AUPA 2NACA 4XDZA 5CHEA 5IF3A 1DRVA 5DF1A 1BW9A 1P1FA 3OF2A 1DIGA 2GGSA 2PD3A 4Q3EA 3ZU4A 4HXYA 4B4WA 1M67A 4WASA 1EE2A 1X14A 2OGUA 3DBRB 1EUZA 1E7YA 2XAAA 3L4BC 3ZV5A 5DZSA 1Z7EA 1HDCA 2UV8A 2JHFA 5IDWA 2I3GA 2DAPA 4A26A 5COBA 4L9RA 2EV9A 5JPIA 4RPGA 5FYDA 1E3SA 2EF1A 4CLRA 4GI2A 4FD3A 3VVBA 3GVCA 4X54A 3PP8A 4O5OA 4DRYA 4LRSB 1BGVA 1ID1A 4GVXA 5L95A 1GZ3A 1ONOA 4MOWA 5C7IO 2QG4A 5FEUA 4O0LA 4XA8A 1H93A 1ZEJA 2X6TA 1IULA 3T4XA 2GZ2A 2EJWA 4UEOA 1K0UA 1LLUA 1NFQA 4O59O 1ZK1A 4E33A 4E2WA 4IM7A 2NTJA 1HZJA 1T2FA 4CMAA 4RVFA 4UAGA 1G6KA 1PU2A 1LBEA 3DR3A 3F4LA 4LK3A 1Y8QB 4CMKA 4MP6A 4IXTA 2FR8A 4E5MA 3MTGA 5KJFA 4OKNA 4BO0A 2VHYA 1O95A 4Z3KA 3VZSA 5IZCC 5JS6A 4L75A 1SMKA 3DC2A 5G0UA 1FDTA 2OFPA 4CLDA 3IUPA 3G49A 1T2DA 2D2IA 3BAZA 4WOKA 4IZIA 3TZ6A 5AYVA 4BVAA 3ONEA 4IUYA 3TL2A 5JNLA 2GR9A 4J6FA 3ASVA 3RU9A 3PZRA 4TROA 3OMLA 4JK3A 2W2LD 1DC6A 4GLLA 4JJGA 4CMJA 4GL4A 1VL0A 4NDNE 4Y67A 4DMMA 5CDUA 1NPDA 4FGWA 2J5KA 1P9LA 4IXWA 3NTRA 3DO5A 2OL4A 1T2CA 3KHUA 2YQ5A 5CDGA 3I9KA 4J1QA 3I9NA 4HNGA 3AM4A 4BNLA 1R0SA 3DBRA 1DDOA 1UJMA 2PH5A 4KUGA 1KS9A 4E2XA 1BXZA 3MZ0A 3GQVA 1ZK0A 2AQKA 5LDGA 3V1TC 1WLYA 3VTFA 4Q39A 4ZQFA 1F0YA 2OUIA 4W6ZA 3OEYA 4W7HA 4OAQA 3D3EA 1KVQA 1P77A 1XLTA 2V7PA 1PGNA 4J0EA 3BMQB 1NVMB 2DTXA 2VRCA 3E5RA 4YAIA 1A27A 3IP1A 2IYOA 2NU7A 3M2PA 5L7WA 2VWQA 3PWZA 3LLSA 4HWKA 1JA9A 1LXCA 4J49A 2FPIA 4OMUA 2C07A 2I66A 3PIDA 4IIVA 1E6UA 3WQSB 4A5OA 3P2OA 3KM0A 3G3EA 2X9VA 5IDYA 3SVTA 2WD8A 3NJ8A 4H7PA 1U3UA 1B8PA 3C7AA 4NR0A 1ULSA 1Y8QA 1WNTA 2VUUA 3QY9A 1MFPA 1HDZA 1MB4A 4UUNA 1EVYA 3E48A 4J9UE 1I32A 1PSDA 1B8UA 2X5OA 5K6AC 3H5RA 4BNHA 4BKQA 3IJRA 1BRMA 1UZLA 4YJHB 1XSEA 4UUMA 4RVSA 3VHRA 1PJ3A 4O1MA 3WICA 5JAIA 3A1NA 3LF1A 4N5NA 2NNLD 5BNFA 3ASUA 4JBHA 3U09A 3OFSA 4PLYA 5B1YA 5DNAA 4BMSA 1CEQA 1I36A 3KB6A 4GGOA 4BQPA 3B1KA 2GNAA 3AUAA 4PG5A 4OHUA 3UF0A 3VPXA 3WGOA 3S8MA 2OBYA 4XYLA 3R0IA 4YRBA 1ZJZA 3K96A 5KKAA 3KSDO 3ZWOA 5L53A 4MO2A 4BNIA 2D4AA 5LC1A 4JP3A 3RFVA 3KZVA 2G82A 1CJCA 1XA0A 3DONA 3KYDA 2ZQYA 4CR6A 4R3WA 1DBVO 5LDHA 3F46A 1IE3A 4XB1A 4CLEA 1EDZA 3DAPA 3QW2A 3ZU3A 4BOYA 1IL0A 4GBJA 4IINA 4QO7A 2O2SA 4BV9A 2VYNA 2FP4A 1F8FA 3BMQA 3NDRA 3IJPA 3UFXA 2HK8A 2JHGA 2VT2A 5J23A 1T1RA 4GX1A 4DYDA 4IDFA 4KTTE 3RC2A 1PGOA 1MC5A 3H9JA 3OQBA 1UAYA 2Q1WA 1L1FA 4PRKA 1Q7GA 2QIOA 1ZK3A 2P2SA 3D5TA 4PFJA 2BGKA 1ZSVA 3LT2A 3QP9A 3RUIA 2H63A 3BA1A 3GVPA 4YJHA 3HUDA 1GYQA 1I33A 3I4CA 1ZKMA 2X9NA 1H2BA 2CNBA 4UVDA 2RCYA 2GN6A 2UVDA 1MXHA 3ROKA 4Q3DA 4DC1A 3JQ7B 1OC4A 4WECA 4AJ2A 2ZJ0A 2PZLA 3DTTA 2YDYA 1DC3A 4B3HA 4XQEA 1Y9EA 4J4BA 2VTDA 5L40A 3IL2A 2AMFA 2JD0A 4BNWA 2H5LA 4J7CA 2EKLA 2FHSA 3EZLA 2A92A 3IC5A 3PXXA 5G2OA 5ICMA 3MTJA 3JQCA 1CQJA 2W4QA 1XQ6A 4M55A 1IPEA 4ND5A 3DEYX 4XGNA 1P1RA 4PG6A 3QE3A 1YH3A 3I1JA 4ZQBA 3HSKA 1A4IA 4NQZA 3OJLA 1JWAB 4D44A 3EAGA 3A14A 3B1FA 2IRWA 1HLDA 2CD9A 1E0DA 4QXMA 4XEHA 4BNZA 4R54A 5ITWA 2BD0A 3EY4A 3IIEA 4Q3AA 5CDYA 2P4QA 5BQFA 3E9QA 3MJVA 2UUOA 4WKGA 4ZICA 1ISHA 2E49A 2OORA 5IJZA 2RAFA 7MDHA 3OEWA 1W0CA 3FNFA 1DJQA 3TFQA 4IDAA 2QYTA 2O3QA 2P5YA 3RUHA 4TRJA 5THQA 3LYLA 3PWKA 3VKUA 1GQYA 4FJ0A 5L7TA 1R15A 2DC1A 2IXAA 1P33A 4CQMD 1JKIA 3L9WA 3OIGA 3WGHA 4WEQA 1MA0A 1ORRA 2AEFA 2B35A 5JCJA 4B3IA 3F3SA 3AUTA 4TRRA 2Q2WA 2JCVA 3MOIA 4UULA 5CG2A 3DAGA 1PZEA 2P9EA 2YHIB 2ZQZA 4MJLA 3KSZO 4INAA 4JGBA 3ETEA 3NX4A 3X2EA 2WWRA 4GPD1 4NU6A 5ER9A 3JQEA 1LC3A 1OMOA 1NPTO 2BGMA 2Y1GA 1GQQA 2WJPA 3EC7A 3H65A 1YXMA 2FWMX 3JQFC 3NAQA 3WDSA 1U3TA 2WYVA 5TQVA 4CV2A 1A7AA 1D1TA 1FMCA 3TZKA 4U5QA 4OJNA 2VT3A 2FR0A 3EMKA 3GFGA 3DBHB 3RVDA 3TDKA 4IDEA 1NAHA 3FNEA 3K8ZA 3JQ7A 2QYSA 5I9NA 3C7CB 4F45A 4JLWA 3U49A 1KIFA 2P9CA 4YT2A 3QLJA 4BQRA 2IODA 2VZ8A 5HM8A 4G2NA 4AICA 3ZNQA 3I3OA 3OJEA 3Q9NA 4EUFA 4TMFA 4Z0TA 1BTOA 1A4UA 4A27A 1UXGA 2X5KO 3GGPA 1HSZA 4YAEA 4OGWA 2AW5A 4Z0HO 3G1UA 3PYXA 4YT8A 1PGQA 1K6XA 1WVGA 2J5QA 1E7MA 2W98A 4ALMA 5KVQA 3QVWA 1J0XO 3TSCA 2DBRA 4PZDA 4ZN6A 3BIOA 2NADA 3UCEA 4XQGA 1QRRA 4LSMA 3MEQA 1PIWA 1CYDA 4DWVA 4K1LA 4NFHA 3W6ZA 1BDBA 4RV9A 4BNUA 2B4RO 1XHLA 1Z45A 4Q3NA 1X13A 4NK4A 4PLTA 3AU8A 2D5CA 3V1YA 5L4NA 4BO4A 5L9AA 3WOHA 1N1GA 1X7GA 4GWKA 4H16A 4PLPA 1KEUA 3TL3A 3ULKA 4R4JA 1N9GB 2WEKA 1SPXA 3IKTA 2YHIA 4BGEA 1PR9A 4FIZA 4CUZA 5C37A 4EW6A 1ZJYA 4EEXA 1ZO8A 5DBFA 4R51A 4RVDA 3H8VA 4M49A 3MWEB 4MKZA 4IPTA 4J2HA 2O3JA 2VWGA 4A7PA 3GEGA 4NHEA 1UDCA 1NYTA 3H5NA 3H9GA 4AL4A 4DUPA 3RCBA 4BO5A 3DBHA 4ITUA 2BI7A 3ZWVA 3WGGA 2E4AA 4IQ8A 1GAEO 3L6OO 2HMTA 4LVCA 3JYNA 4M1QA 2EEZA 2YFQA 2B4TO 1SO8A 4BGUA 4EI2A 5JAMA 4ZRNA 3VDQA 1IZ9A 2RH4A 1E6WA 2BMAA 3R3SA 4E32A 3I6IA 1N92A 2AHRA 1M76A 3I83A 1WXDA 1E5QA 2E37A 3IS3A 2YFHA 4N5MA 1F17A 4WNIA 1JW9B 1EVIA 3Q6IA 5K9ZA 1Y5MA 5L45A 1X15A 1NNUA 5G0TA 3QWFA 3GNSA 4NG5A 2EWMA 4UVHA 3CPSA 4L4RA 4AJJA 3SC4A 3RKRA 3CE6A 2CDBA 2XXJA 5IZ4A 1GPJA 1U2DA 2YV1A 4YB8A 1HYHA 3KYBA 4KDEA 5JY1A 2ILTA 5TT0A 5F5LA 1Z7BA 3QQPA 3S2IA 3OQ6A 3KV3O 5B4UA 3GHHA 1BSVA 1P31A 3AY6A 3ADPA 3FN4A 5A1TA 1L7EA 3BHIA 1QR6A 2P68A 1EE9A 3O03A 4D41A 4DL9A 1I3KA 1KBZA 2I9PA 4K26A 3WGYA 4QFDA 2C82A 5BT9A 4DA9A 3VOSA 2PV7A 3DBVO 1NHGA 1B2LA 2EERA 2UYYA 5A9SB 3H3FA 3WTBA 3QA9A 3PGXA 4G81A 1C0KA 1N9GA 3D4PA 1BG6A 3SJ7A 1LDEA 2Y1CA 1Q0QA 3NKLA 3LT4A 3C8MA 3L6DA 2C59A 1KC1A 3KEQA 1PJSA 1H9BA 4LMPA 1HYEA 2R00C 1NM5A 4DBVO 4RPHA 3WSWA 1I30A 4TVOA 4D45A 4DPKA 3QVOA 3PZBA 1QYXA 4IDGA 4YQYA 1DAOA 1ONNA 4J90A 4WK6A 2X23A 4BO2A 3UXYA 4S1VA 4LSWA 4RQTA 4A0SA 4XGIA 1XIVA 1H5QA 2DTDA 2X1HA 4GSLA 2VN8A 3DL2A 4CV0A 4ZJUA 1M75A 3TZQA 4J1NA 1HE2A 1JDJA 1NBOA 2VCYA 3GC6A 1HT0A 1RM3A 3UVEA 2ZTLA 2V6BA 3DOJA 3JYQA 3P19A 1R12A 1VLLA 2TMDA 1PJTA 4JJFA 5I7EA 4K6CA 1MC4A 4XRGA 2Y1OA 1I0ZA 1I2CA 5JLAA 3D3WB 3WNVA 1R6DA 1KY4A 4FJ1A 5DCWA 2AEJA 3JD1A 1V0JA 2AQHA 3MWDB 3OHSX 5G0VA 5KJ1A 3PLRA 5IFLA 4RL6A 3VH1A 2WMDA 4NFYA 3TZHA 4LW8A 2Z1MA 2HMSA 4DYVA 3FHLA 1VRWA 4BNGA 5A9SA 4KQWA 4IY1A 5FFFA 1SBYA 5AXDA 2CSUA 3K2EA 1X7HA 3NGXA 1V6AA 3ADOA 4MIEA 5DP1A 4J2OA 4YJFA 5JW6A 1C1XB 4L4XA 1QLJA 1OZAA 4EGFA 2PLAA 1E1LA 4IBOA 1OBFO 4PZEA 2GSDA 4Q3CA 5DOZA 3WGQA 2HMUA 4AJPA 3KTDA 1U1IA 1KC3A 3OJOA 2DUUA 2WDZA 1XQ1A 1YS4A 3EDMA 3CSDA 1GPDG 1HDXA 1HDYA 3ZW9A 5B4TA 4QX6A 1VKNA 3GAZA 4HBGA 2EP7A 5A4DA 1FJHA 9LDTA 2O3TA 1C0LA 1X0XA 3E8XA 3AM5A 1TLTA 3C1TA 4Z9FA 1LDYA 3BMOB 3NRCA 4B8ZA 4M87A 4PLWA 5IN5A 4GGPA 1YWGO 3I9OA 1HLPA 2NU9A 5CFZA 3U4IA 1HKUA 4Q9NA 4U6QA 3UN1A 1XU7A 3ROPA 4OXYA 4YJDA 1HEUA 4O6VA 3TNLA 1A71A 2YV2A 3NUGA 1DLIA 3TRIA 1GEEA 2WYWA 5DULA 4L4SA 1P1JA 1ISMA 2X5JO 3B20A 3FWZA 5AXBA 5L4LA 5A9RA 3TWOA 2VOJA 3WJ7A 1OFGA 1XYGA 2BELA 2EW2A 5JCXA 4IS3A 4P8RA 4XIJA 1Y7TA 1E6EA 1UZNA 4PLGA 3JTMA 1U8XX 1LSSA 2Q2QA 3ZCXA 1I2ZA 3BTVA 3D3WA 3RFXA 4RVHA 4DQVA 3AI1A 1A7KA 2EW8A 4WLVA 1PS8A 3LT0A 4J4HA 1YQGA 4R68A 1NP3A 1U4SA 4E12A 3ROQA 1PZHA 3W8EA 2DFVA 4DVJA 1U5CA 4J9VA 1LRLA 1JQBA 5FF9A 1KVSA 5HA5A 4FFMA 1X1TA 3Q2IA 4TVBA 5A03A 2J5RA 3O8QB 3JQGA 5JSFA 2DPHA 1C1XA 3WQQA 3OA2A 1GU7A 4RF4A 1H9AA 1R4NB 1B0AA 2C2YA 3U0BA 2PGLA 4AFNA 1AHIA 1WDKA 1D3AA 3LC1O 4J7XA 4NJMB 5CPFA 3ITDA 4FQ8A 2YHUA 1ZUD1 5JDCC 1EBFA 4MKXA 4BNJA 4DLLA 1U9JA 2NU8A 3VTZA 1G1AA 4PLFA 3PHJA 4XRRA 3RUCA 3JQ9A 2HSDA 2Y99A 1ZIDA 3DQPA 3ZWWA 3GDFA 1DFIA 1CIVA 4MVJM 5ER6A 3RFTA 2G5CA 2Y1EA 1B26A 3I9MA 4K6FA 3GVIA 3M1AA 2YDXA 4YCAA 2ZYGA 1LQUA 4B7CA 3JD4A 3PGJA 4I5GA 4BO3A 2JAPA 3DZHA 4WLEA 1EUDA 1PEDA 1EFKA 3GRPA 1ADBA 2X0RA 3JD3A 1NHWA 3WGTA 3CXRA 3STHA 3GF4A 1RM5A 5LCXA 3TOXA 4CM9D 3KRTA 1YB5A 2C7VA 3ZNOA 2BFMA 2JL1A 2F00A 2Z1NA 2YQ4A 4PLCA 5EESA 2NTVA 3T7CA 3PK0A 2ZCUA 3RQSA 1LQTA 4G5HA 1GTMA 4ROSA 1DHTA 2C5EA 3T7EA 3AOEA 4JN6B 1LDMA 2ZTVA 1PGJA 1DEHA 4UREA 5IXYA 3GUCA 1PJ2A 2I5PO 5ADHA 3JQBA 3EVTA 3F47A 1Z6ZA 3AI3A 4Y6RA 2EP5A 2HU2A 4DPMA 5KVVA 1E3EA 3E5MA 1PQUA 1ULUA 1WDLA 4MIOA 3H2ZA 2AG5A 4LN1A 2DVMA 3ABIA 1Q1NA 4R1UA 4URFA 3IAHA 4YAKA 4E13A 3WFIA 1IZ0A 3RJ5A 4B7UA 3HWRA 5TSDA 4AJ1A 2ZIZA 3O8QA 3KBOA 4NH4A 1TVEA 1RM0A 4XR9A 4YDRA 4BNXA 1MG0A 2YZ7A 3DHEA 2BLLA 2DUWA 4U0JA 4CM7A 1VSUA 3VPGA 4W9NC 2O2YA 2XXBA 1MGOA 2C29D 1WDMA 4NJMA 1E77A 5CAEA 4DIBA 4QT0A 5EQDA 1ISJA 4YJGB 1LEHA 1UR5A 3WYEA 4DXHA 4FFPA 1NWCA 3AJRA 3Q11A 4QTZA 4RZHA 3DMTA 3CEAA 3VAZA 1WW8A 3H9QA 1LI4A 2LDBA 4JX8A 3WB9A 1VJ0A 1U3WA 2GDZA 4IGEA 3ZDFA 1TXGA 1IHXA 1GCOA 3GR6A 4FCCA 2BKAA 2VHXA 3RAJA 4E5PA 1PL6A 4Y6SA 1CETA 1P1HA 4RF5A 2I65A 1ENOA 3EVNA 3CKYA 3RBXA 1C0PA 2I76A 1YBAA 4BB6A 5JDIC 1I10A 4L8VA 3W4KA 5HTOA 4Y9DA 4BGVA 1MLDA 2VUSA 3SLKA 4CQMB 1HSOA 4EJMA 2PTGA 4RPLA 3OH8A 4P4LA 4BKOA 2EKPA 2EHDA 1B7GO 4JNKA 2P91A 1DPGA 3OIFA 4MDHA 5A02A 2CFCA 5IAAA 1NFRA 4TQGA 3N74A 3JV7A 4ESOA 3PWSA 2G17A 1ISGA 1KEVA 4ALIA 4YQZA 2PFGA 4AJ4A 1F06A 1EQUA 3SX2A 1I3NA 3DDNA 5T8KA 3VH2A 4GWGA 5EIOA 3GUYA 1AXGA 1AXEA 5JMWA 4IQGA 4GLOA 3W6UA 4FFNA 3AWDA 4QQRA 4KMSA 4Z3DA 3WWZA 1T4DA 2CF6A 1I2BA 1GZ4A 4GSKA 3HADA 3DBLB 3F1LA 3ZWXA 2Q2VA 4PN3A 4J43A 1ZZEA 4E5KA 4D42A 3ZWNA 3QIVA 3LDHA 5T5QA 1SB8A 5A9TA 1NWHA 3AFNA 1ZK4A 3BZUA 4I8XA 4WEOA 5DBGA 2YV3A 1N2SA 2DBZA 3KUXA 1GYPA 3GEDA 3ZHZA 4A2CA 4CMCA 1CERA 5JC1A 4YJGA 1E5LA 9LDBA 5L3ZA 3SJUA 1V3TA 2X22A 1KYQA 1S6YA 4HY3A 4ZQEA 5TT1A 4F6LA 2Z95A 4A03A 5U1PA 1HDOA 4YTEA 2R2GA 4OKIA 5L51A 5EINA 2RH8A 4JIGA 2ZB7A 4AJEA 1PS9A 2H1SA 5T67A 1GUZA 3HDHA 3ANMA 3LT1A 2I3AA 4FN4A 4GAEA 1W6UA 4OOEA 3LLVA 1VI2A 2FMUA 4YA6A 2B69A 4IMPA 4YPOA 2VHZA 4ALNA 3AI2A 8ADHA 4WOJA 4TKMA 1J4AA 5G0SA 1IB6A 4CQMA 1MG5A 1NASA 2A4KA 1NQAO 5JMPA 4BGIA 3HZZA 3DXFA 1JKJA 3LQFA 2OXIA 3AU9A 4P22A 3K73O 2V6FA 3I5MA 3SXPA 1ZEMA 4OM8A 1DC4A 3IOYA 3QSGA 2CDCA 1VL8A 4LMRA 4BKPA 1J6UA 3BTUA 4IQ0A 1D8AA 4HFRA 2FSSA 5AVOA 1U7TA 3H2SA 2FZEA 4ZQHA 4UVEA 4CM4B 4AJIA 5C5IA 1O8CA 2VYND 4NJOA 1UZMA 4MIYA 2B83A 1UAGA 1WWKA 2CVZA 3V8BA 5I9MA 1W8DA 4IGFA 5CP8A 3DBLA 1YONA 4GX0A 3F6YA 3JD2A 2OZPA 1ZFNA 1XKQA 3FTNA 4ID9A 3FR7A 2P9GA 3I52A 5AOVA 1AN9A 1P1KA 1EUCA 1PWXA 3JQAD 2D1YA 5H82A 5ILGA 1ZBQA 4NPCA 4E4YA 1RWBA 1QKIA 1SEPA 4QSMA 2IEDA 4OO3A 5T57A 3T4EA 4CL8A 4BHTA 2D59A 3H6KA 3OM9A 4I9HA 4II3A 4OXKA 4MPDA 3FPLA 2O3UA 3HNPA 1P74A 4QUKA 3K31A 3HB4X 2C7GA 1N7GA 2ZKLA 3GAFA 1GR0A 4XJTA 4EEZA 4RDIA 3PYMA 1M6WA 4IDCA 4JBGA 4R1SA 4U8GA 5JXWA 5BSHA 1FXSA 2A35A 4OL9A 1PJQA 4R16A 4GX2A 2VWPA 1Y6JA 3BYZA 4AJNA 4CL3A 3WMXA 1PL7A 3ZWBA 5BR7A 1XGKA 1Q7BA 5GY7A 4P38A 5DBIA 2P4HX 4YT5A 3RC9A 3BTSA 2BFAA 2EGHA 5ES3A 3ZW8A 3DFZA 1H6BA 1DO8A 1YL6A 5C7LO 2JFGA 3ZU5A 4CLXA 5FI3A 3G79A 2YUTA 4ND1A 1IUKA 3RI3A 4CM6A 4IJVA 1KEWA 2HO5A 1EBUA 4OOFA 5F1PA 4B8WA 3PRJA 4MVJG 2O4UX 2X0JA 4D43A 4CPDA 5JAQA 2D3TA 3ZWYA 4D3SA 3QVTA 5KIAA 1DLJA 4CM4A 3UGKA 1UDAA 1XG5A 3EHEA 1PJLA 3KOUA 1K6JA 3ST7A 3VPFA 1QP8A 3K6JA 1A9ZA 3L4SO 4TZTA 4L74A 5IDQA 5EERA 4CUJA 1H6DA 1YRLA 3U9LA 1SB9A 3W4JA 2FPGA 4YEDA 2GYYA 1C3VA 2HJSA 2Y0EA 5U9CA 2G76A 3G0OA 2FRDA 2WYUA 4MVJD 3OJ0A 5DDIP 1CWUA 4CM3A 3Q2KA 3GOHA 4UVGA 4FDAA 2DM6A 7ADHA 6ADHA 2BFOA 3DOCA 4I08A 4J1TA 1WMAA 3PFFA 1DRWA 4CLHA 2O23A 3F4BA 4MVJI 5A06A 2QHXA 3JYOA 4CLOB 1VC2A 2NQ8A 4PRLA 3ZN2A 3PDJA 1CQIA 1PR3A 1SEVA 2QZZA 2VYVA 5DP2A 3NGLA 2IXBA 2VHWA 5AXCA 3U4HA 4E30A 4HUJA 3AUSA 3HHPA 4NMHA 1YE3A 4CR8A 1J5PA 1JTVA 1V3UA 1Z74A 1FF9A 3HDJA 1R16A 3TF5A 5DT9A 4XKJA 4Z9XA 3BMCB 3ZI0A 4YRDA 4CQLB 1KEPA 1KVRA 1SZJG 1UXJA 3B70A 3F5SA 3OP4A 4R1NA 4WGGA 1ZSYA 3LVFO 4U7WA 2HMVA 5KVCA 1C1DB 1B14A 4D46A 1WZEA 1Q7CA 4W82A 4P4NA 4GKBA 4CMEA 5COQA 1YJQA 3GMSA 4KTVE 2HJRA 5THKA 5COAA 1Q2XA 3E6AA 4LCEA 4HX5A 1XEAA 4J0FA 3UOGA 1U28A 4YXFA 2GN8A 4IIUA 4IMRA 4PGFA 3Q1LA 1O5IA 3QRWA 5TS3A 3RBVA 2GN4A 3IMFA 4BNYA 4MINA 3DZBA 2O50A 2JD1A 3MJSA 2GD1O 4B4VA 3MCVA 1G0NA 4BNNA 1U5AA 1JWBB 1IHYA 4LISA 1GZ6A 2QRLA 1GQ2A 3DZFA 2YW9A 5I8WA 3SLGA 4PG7A 1PQPA 4YACA 4N7RA 5BSFA 3BXXA 4MVJF 4D3DA 4N18A 2J3HA 3GPDG 1UXHA 4ZRMA 4YYZA 2Q49A 4ZVVA 2ZB4A 1ZCJA 3ZHYA 1P3DA 1PQWA 2JFHA 1EMDA 4XIYA 1UDBA 3A28A 2CY0A 2ZYAA 2I99A 3WGIA 3RUFA 1DAPA 5JO0A 3MJEA 3K9QO 3TPCA 3U4DA 1AHHA 4B79A 1OI7A 1DFHA 3PHIA 3ITKA 2G0TA 4FS3A 3K5PA 1SOVA 1C14A 2X86A 3P2YA 3KLMX 4IJKA 1P0CA 1AE1A 2NUAA 1B8VA 2H6EA 2HKIA 3D7LA 3GN2A 3U4CA 1QMGA 5KNLA 3GZNB 2C20A 2HCTA 4GQAA 4YRAA 1Y9AA 2AQIA 3DAFA 4CLOA 4K28A 4WJZA 3WFJA 1RM4A 3MJ4A 1QYDA 3C24A 2PH3A 3O38A 3V1UA 4B4OA 4EYEA 4XX0A 5DN9A 4O63O 3OQ1A 4WCFB 4FC7A 4CJXA 3DZIA 4JBIA 1ARZA 3ZV3A 4TSKA 2WE7A 1QYVA 3W8FA 4NBRA 5IDXA 1GEGA 2ET6A 3BMCA 1HYGA 2NLOA 2Q4EA 4CQLA 1UH5A 3ONFA 2Q1TA 5TF4A 1Z73A 2JCXA 4DIFA 4WNCA 4DIOA 3ZWMA 3D4NA 1C1DA 2E82A 3G1TA 2W2KB 1DOHA 3FBTA 4PVDA 1HE3A 3NV9A 3W8DA 4Z9YA 3C7DB 5I7SA 3QVSA 2R6JA 4NFSA 3N7UA 1O89A 1SCUA 2XOXA 3C3XA 1ENZA 1T26A 3JQ9C 2YY7A 1K5HA 1DIRA 1ZSNA 2BI8A 1Y1PA 3Q3CA 1SOWA 3DMYA 1FDVA 3PVZA 4OQZA 4RPKA 4AVYA 4J1SA 4EJ6A 2BGLA 1R66A 2GF2A 5H81A 2VRBA 3EW7A 2G1UA 3GHYA 1Y81A 1NFFA 3L07A 4U6SA 1IOLA 2D8AA 2O7SA 3KO8A 2B5VA 2PGDA 4BV8A 3RASA 5I7VA 5L4SA 2GLXA 3GDGA 4D3FA 2DKNA 4XZ3A 4K9DA 1ADGA 3DZGA 5CDSA 5TNXA 1DJNA 1KVUA 3EK2A 4QECA 3AOEC 4Z0PA 3W1VA 3CINA 1CDOA 5T6BA 3L0DA 4HFNA 4L76A 1U8FO 5H83A 4TWRA 2X0NA 3JQBC 3D4OA 2PNFA 4A10A 2NTNA 3GZNA 3N58A 1K3TA 2PD6A 3OIDA 1GUFA 1PJ4A 1QYWA 4KWIA 3LZ6A 3VH4A 3PJEA 4H3VA 1U3VA 4E2YA 1ZH8A 2J8ZA 4WCFA 2XPCA 1LC0A 4NI5A 4MVJP 3WR5A 3E82A 2CZCA 4CMBA 3VPHA 1GV1A 2ZK7A 4NK5A 1IY8A 4RDHA 5IXSA 3RWBA 3ORFA 1GY8A 2HLPA 4IDDA 1LRJA 4ALJA 1YQXA 1Z75A 4BO9A 5CG1A 5L7YA 3K2BA 2W2KA 2X9GA 3SEFA 4KUHA 2D5AA 1E7QA 2Q50A 3RUEA 1E3WB 1MUUA 3GRKA 3ZGYA 1T1SA 4OIMA 1D7OA 1HDGO 1RPNA 1E7WA 2PK3A 4J91A 4CMGA 3OA0A 1UUFA 3LC2O 4YBZA 1LSUA 1GADO 1MV8A 4CM1A 4H15A 2DQ4A 3HN7A 1N7HA 1RKXA 2Y1FA 1HTBA 1FDWA 5CEEA 1PJBA 2NVUB 2PD4A 4NBUA 2YYYA 5DOVA 4WLFA 4YAJA 4F46A 4R5MA 1U7HA 2RBEA 2A94A 2AE1A 3O4RA 3K92A 5CEJA 4GMGA 3E03A 2HDHA 2Z5LA 1S7CA 3EGOA 4RCVA 4ND3A 3PIIA 3SBOA 3GK3A 3R6DA 3IDSA 5EQFA 2UDPA 2ZYDA 2NVWA 1IPFA 4BUCA 2GUGA 2Y67A 3K30A 2C5AA 1YVEI 1UP4A 2FY8A 1EK5A 5A3JA 5EL0A 3QHAA 4CM9A 4EBFA 2W2LA 3FPCA 3KSUA 4DGSA 3M2TA 5JAZA 1H94A 3WNQA 5KKCA 1XCBA 5T8KC 1UP7A 3ENNA 3E9MA 4IZHA 2X7HA 3FNHA 5U4QA 2R00A 4YVFA 4WLNA 3ON5A 1Z82A 2O7QA 4HADA 2PWZA 3FNGA 2PGJA 5HWSA 1ZNQO 5ILOA 2UUPA 4KUEA 2IEBA 5JE8A 4R9RA 1I8TA 2AE2A 4NU5A 4ND2A 2DT5A 3AFMA 4CM5A 3DFUA 3BMOA 3QV1A 2P5UA 3NT2A 4D7AA 1BXGB 4XR4A 1JU9A 3PHGA 2OOSA 1N5DA 3D5QA 3ETGA 3CIFA 2OP0A 3TJRA 1O9BA 3B6ZA 1HE5A 3VDRA 3LF2A 2HMWA 3WWYA 4UUPA 1LJ8A 3I23A 4BNTA 2B36A 1CRWG 3I9LA 1YGYA 1E3WA 2Y68A 3GG9A 4WE3A 4XYGA 2AG8A 2AQ8A 3D0OA 2X4GA 1T24A 2RHCA 2Y93A 1ONPA 4YT4A 1NVTA 1J49A 2NSDA 3PLNA 1LLDA 1BHSA 4DMLA 2WM3A 1P1IA 5HRUA 3RU7A 1E1MA 3INGA 1TI7A 4W4TA 4AJHA 4AJOA 3HQ4O 1YB1A 4KQXA 3E9NA 2NVUA 1GL3A 1KERA 4GMFA 4CM8B 3DB2A 2QZ9A 5G0WA 4Y8VA 4IS2A 4D79A 2Y0CA 1V35A 3UUWA 3R1IA 1B15A 3RBZA 4ZHSA 3NT4A 4FW8A 4ZD6A 1UP6A 2VWHA 4QEDA 1DIHA 1Q0HA 1GFSA 3U62A 1KY5A 1HL3A 1W73A 2VNSA 4C7JA 3PJFA 1YOVB 3V2HA 1I3LA 3RC1A 5DCYA 2Q1UA 3EZYA 2HK7A 1T2AA 2O3RA 1YQDA 2NM0A 2CVQA 4BNVA 4Q3BA 4PZCA 4PG4A 3GH3A 5I7FA 4CODB 1KETA 1U4OA 3PQEA 3UHAA 1ISIA 3JCZA 4DQUA 4RQUA 1SAYA 1LLCA 3RUAA 5BNTA 4RORA 1V3VA 1R4NA 1P45A 3R3JA 4MP8A 4WLOA 3KYDB 3ICCA 5A05A 2GO1A 2ZJ1A 4CMIB 3OETA 1ZW1A 4M89A 1QV7A 2QRKA 1HXHA 4C4OA 3RD5A 1PX0A 4XQ9A 3OJFA 3UAGA 4DQXA 5BNIA 4BKRA 3NTQA 2FSVA 1JAXA 4L0QA 5KCZA 1G0OA 4R1TA 1MFZA 4NNJA 3HN2A 2IDZA 2XF8A 4RZIA 3RKUA 1NX6A 5G4KB 1H0KA 3UCXA 2Q99A 2V6MA 1BXGA 3PFWO 4FJ2A 1M66A 2WD7B 1BWSA 3GA0A 4QO8A 3GVXA 2PY6A 2IZ0A 1JVSA 3INTA 3PHLA 3ETDA 2BRUA 4UEJA 5HS4A 4WLUA 3JQAB 3AM3A 2VNAA 3NDJA 5A5FA 5KVSA 1B3RA 1E7RA 1VSVA 4PIVA 5F3RA 3VKVA 3NDIA 4D0SA 1GV0A 4FGSA 4W7IA 4B4UA 4B7XA 3WQRA 1FDSA 1AGNA 4MP3A 4FB5A 1YKFA 3PHHA 1U2GA 2A9FA 3QWAA 4EITA 3S2GA 2I6TA 4NIMA 1EZ4A 1H6AA 2Q1SA 1PWZA 4I1IA 3ZHBA 2I67A 3JYPA 3VPSA 4CM8A 3GG2A 3VC7A 1OC2A 1H2HA 5GMOA 3PEFA 3H9EO 4NBWA 2Y0DA 1WZIA 3IUSA 3KETA 1ENYA 3WXBA 4LCJA 4MKRA 4FOSA 3L4BA 2JJYA 2WE8A 1XR3A 1K6IA 2EXXA 4ZGWA 1YBMA 2PZMA 1QG6A 3C1AA 1NQTA 1DC5A 1YOVA 2VRCD 4YAGA 1OAAA 3H3JA 2GZ3A 4FBGA 2FOIA 3UH1A 2PA3A 5JC8A 1HF3A 4F6CA 3QWHA 1E3IA 3AUUA 5B4VA 4GVLA 5B37A 2X8LA 1MXFA 1E3JA 3WJAA 1TB4A 2DU8A 4HFJA 4XD2A 4G65A 4CMIA 4HV4A 1JVBA 2POQX 2ZCVA 4E3ZA 4BO1A 3V2UA 3H4VA 1K2WA 4M86A 4NBVA 2F1KA 2PKQO 1DHRA 1JLLA 1R4MB 2UAGA 4PCVA 5F1KA 5JDCA 1NTOA 1KVTA 2ZB3A 4N5LA 1DSSG 4FOOA 4RVGA 1E7SA 4Z6KA 3VZRA 3GY0A 4R3NA 2PZJA 5G4KA 5MGBA 4M54A 3GPIA 4B3JA 4OSOA 2WD7A 1GD1O 1LDGA 3C85A 5EPOA 5JYEA 2NV6A 4NZ9A 1EVJA 4R01A 4RLSA 2DPGA 4BKUA 1E3LA 2W90A 5IZCA 2TMGA 1FDUA 3DWFA 3H7AA 4E21A 5MDHA 3ZZNA 2EG9A 3VVCA 3TN7A 1F8GA 3WMWA 5KOIA 3JQAA 1DXYA 2NU6A 1D4FA 1E92A 3ROMA 4UVIA 4TZKA
chains in the Genus database with same CATH superfamily
2BF4A 3MUFA 4CKZA 4DHWA 1JAHA 3TYXA 3IURA 1RDFA 1RLUA 3TTWA 5LU8A 4BAGA 3PC3A 1PDWA 1T0UA 1JG7A 1U7OA 2EFCB 3ILHA 1T8UA 2HA0A 4G0ZA 5TIIA 3S99A 4F3NA 4XD7A 1FRVA 1FK8A 4YUZA 1W88B 1JS1X 1L7PA 2FZKA 1CC1S 2Q29A 3FB4A 4P7JA 4UBKA 4PYRA 4RO0A 4QRDA 2ZUCA 3K8QA 4ARVA 1N1MA 4Y2TA 5CLJA 2UUAB 1I5RA 5BSEA 4UD6A 4MCHA 1DJOA 5H9WA 2WTBA 1WPQA 1SG6A 1T36B 3OE7D 3SBEA 3ZK8A 1KQOA 1MNAA 3BGOS 4WXRA 5DPMA 1QV6A 5JD4A 3TOZA 1QIIA 3R5XA 4Y6LA 3HJGA 1WHSB 1XRMA 5C32A 2KPOA 3L1VA 1BKYA 2OMEA 5GGYA 4EH1A 5A4JA 3KJQA 1F8YA 1VRCA 2JAHA 2N3ZA 3WBBA 1A9YA 1OI2A 2WINI 4FCWA 5EZ6B 1DNPA 2EKQA 4B6SA 1HQKA 2EBWA 4DXDA 4D57A 1XTBA 1P80A 1FUYB 1ZA1A 1X7DA 1QF9A 3KPJA 3E18A 4NNPA 1FSSA 1CF2O 1ZUIA 4YC7A 1GT6A 3JD0A 4IIEA 2QS9A 1LU9A 2FPOA 2OHVA 3EGVA 2ZAIA 3OJCA 2IV3A 5BN5A 4L78A 2X0DA 2DTEA 2HWYA 3EEFA 3IXLA 4AF8A 5HOQA 5AM0A 4Y6PA 4ASUA 4PZZA 1J7JA 3DNPA 1JEJA 3TQHA 3A06A 4G8JA 5CRIA 1PWEA 3UJDA 4JEHA 1XTKA 3ESQA 2ZUTA 2D0IA 4MJ3A 1ECLA 2V7UA 4Y1RB 4Y30A 1Z83A 1GL9B 4J6EA 1G4UR 4R5HA 4DV2B 2GPTA 1YZKA 3NANA 3OOYA 1J8FA 4CHTA 3SI7A 3D0QA 1YUBA 3V33A 2W2OA 1FNBA 3F9RA 2OZVA 2D00A 1XZHA 1NXQA 4ZVTA 4C04A 2PZKA 3DMHA 5ECWA 4AQ7A 1KDPA 1KK0A 1QX4A 3H11B 4QPCA 3CZ4A 1P4SA 1VM6A 2C03A 1WBJB 3AFGA 1NVXQ 2EL9A 3DZJA 4RK7A 2PR2A 2O6HA 3WL7A 2K2WA 1ZI8A 5BQ5A 3BGIA 3X43A 3QVKA 5I7AA 3KOZA 2JGJA 3I0ZA 1LLFA 1JYFA 3KYCB 4TL6A 2SCUA 1JAYA 4E5NA 2OPHA 4DLXA 2EAUA 4Q1BA 3FETA 3VOAA 5K7SA 1G5FA 5JDIA 4RTQA 3E4CA 4LFCB 3H16A 2Y27A 4LZPA 3TSOA 1Z8NA 2FJPA 3TB6A 1N3YA 2D13A 4TRMA 3T7AA 1UM9A 4EJ2A 2CXNA 2AGVA 3DOFA 4CI9A 3QVVA 5B1SA 1JF8A 1PNQA 1P0PA 2GVDC 1RZRA 3NATA 3QFTA 4DJ5X 5F52A 5CPBA 1XDWA 2JKVA 1P39A 1S9HA 4OJYA 3RC7A 1D0VA 2RGNA 3RO7A 1RMTA 2J9ZB 1XELA 3QPCA 3KKKA 1USUA 1U0LA 3DP9A 2B4QA 1QIMA 1XDBA 3F74A 1HE4A 3P7MA 1MPTA 3SAJA 4DR5B 2X3YA 3PL5A 2QSZA 3QJ5A 1R88A 3BMNB 4N7MA 3OT4A 4H60A 3GP8A 1TAUA 1I3MA 4ZI2A 2FEPA 3I28A 5TPWB 1GAWA 1ZUWA 4JP2A 5AJXA 4RABA 1O94A 4BMYA 4MXDA 3V46A 1YB4A 2PKXA 5CNJA 3RTGA 4R81A 5J2TA 3AZQA 5ALUA 3L06A 5EJ8A 1FRQA 3RSFA 4H1UA 2A2ZA 5JV5A 4E31A 5AHRA 1BKSB 4G5FA 4LBWA 1ABFA 2GPNA 2IZ1A 4HLQB 3DVSX 2AZXA 1TA4A 1TUBA 3PQCA 3UZUA 1GKYA 1RYFA 3CMMA 4PGHA 1YA6A 5AW7A 2YN2A 3ZZ1A 3KKQA 4C6TA 1RQRA 1RBMA 3IIIA 4JR0A 3QTTA 3B9PA 4M0FA 1A1VA 3E27A 1VL6A 3BMXA 4P93A 2OD2A 3PE3A 5KYUB 4CUKA 2KI5A 1BH2A 5IBRA 4Z9BA 3TXYA 2O48X 1KI1A 2C88A 2WF7A 3A9WA 2HU5A 3FUCA 3RVLA 4I1VA 4R71A 1SZCA 3HJAA 3G02A 1DMRA 3N28A 1F14A 3R44A 1U90A 5AM5A 4RNDB 3PJGA 2JD2A 1N6PA 1LUAA 1W52X 1OLXA 2CN1A 2RK6A 2VDJA 1YFJA 4TM8A 5EWJB 4E46A 4KO4S 4QBGB 4XTRA 1M6HA 2XYPA 5BO5A 4S0XA 3IQDB 4ARUA 1TCAA 3SEAA 1J1ZA 1BE0A 3ZKWA 3SZOA 2WSMA 3QWIA 4NCXA 4TTVA 3REQA 4CNQA 4DCJA 3O9ZA 5JBIA 4QYXA 3G17A 2NQTA 3RROA 5LR6A 4O4LA 4YLGA 2XBLA 4D3ZA 2WYOA 3TMKA 1AKNA 2ZIVB 1E9BA 1KEEA 3NHZA 3IT2A 4BJ5A 2HRBA 3I4FA 4OH1A 3WYCA 1EA7A 1KO4A 3GLRA 4FTWA 2MR6A 1ADFA 3IP6A 3CTMA 2PGXA 2PNJA 1UWKA 3RYTC 4B8YA 4WT7A 4PINA 1HNWB 3JSAA 2ZZMA 1QK5A 3DAHA 1JDVA 1VP3A 4OVKA 1F6BA 3BHMA 3NXSA 5B5SA 3RJ9A 2WPDA 4LWQA 3JWGA 5CYPA 1CRZA 2XUJA 2QM7A 4E6PA 2FN7A 1BWPA 5JQGF 1J42A 2C54A 4F3YA 4F4CA 2GFIA 2XDQA 3D5EA 1TT7A 1CZUA 4QOSA 5E9WA 4EPVA 5JZSA 5KNCH 3EPJA 4IDUB 2A0FA 1VKOA 4DLWA 3IDAA 1JEYA 5LXTB 1W0KD 3U13A 1K88A 1X7XA 1MQ9A 1YC2A 1PR0A 1E1KA 1CXZA 3JY6A 4LSZA 5DI3B 3M5WA 2W8BA 4PLZA 2A1UB 3SHQA 2HW8A 4Q4AA 4Q1CA 2IPXA 3GROA 3X3HA 1WZ2A 3ZW8A 3E9DA 1AKMA 1R0CA 3WSVA 1PT8A 1TRKA 4LY6A 2OAP1 2VDPB 1VJGA 2L19A 4D80A 2QTNA 4MV0A 2HA5A 2HXYA 5HEKA 5IKMA 2VS1A 3CUKA 4BZPA 5E1DA 4Q6WA 4C78A 1FTSA 1T2EA 3F1KA 3O1JC 3PTZA 4L0MA 4XJVA 4AUEA 4II2A 5JXGA 3VA7A 4IL5A 4FWTA 5IVKA 1C5KA 1NURA 3CCBA 3JATA 3RSHA 3ZZTA 1NW6A 1OROA 1XDUA 3DCIA 1OR8A 3IERA 1BDMA 1DARA 1FXUA 3CLTD 1M5TA 3OFND 4NZZA 5CFQA 3R7BA 4N54A 3UTDA 4ZCPA 4UC0A 3VNSA 4I4TF 4KWTA 4XAQA 5JH7B 1P7ZA 1SOMA 3ABRB 4PFSA 1VSBA 1NQUA 2VYVD 4DPLA 1LX6A 3PXCX 4LQ4A 1M2WA 2H9IA 5DASA 5FOVA 3R6TA 3JQ8B 5AW9A 1VGVA 2JDIA 1JMVA 5DNCA 3SEQA 1G19A 1T5LA 1VXOA 4PLHA 1ZK2A 2P3SA 5HFJA 2XUOA 4OHZA 4G0NA 4I2VA 4FFSA 1KJQA 5AVQA 4L9SA 1R0LA 4UCXA 4FR0A 2BFFB 4DG5A 1VJRA 2ZT8A 4ILKA 5ADUS 1E69A 3VR5A 5BV1A 4ZI7F 3VZQA 4I19A 3FYUA 1AF4A 3CH6A 3TR5A 1DOZA 3P9NA 4I5EA 5HBRA 4ZCRA 5H9VA 2OHXA 5AH0A 4ZAYA 4ARZB 3BKXA 4L4UA 2EIXA 1VG0B 4FXPA 4QJ5A 1ZY2A 2II6A 4BNDA 4ECEA 2O8FA 1RYDA 2WG0A 1B73A 4UUBA 4AMUA 1SC3A 2I2BA 3LUKA 2IV2X 2IHTA 5KTPA 1IONA 2AN1A 3BJEA 3HP7A 3KZCA 2A78A 4OXNA 4BNKA 4ER6A 2FCAA 3QMVA 1QG0A 2W71A 1P0FA 1GN8A 1MR3F 1SD5A 1V8BA 4NE9A 2N0SA 2YICA 1J90A 4FC6A 4L08A 1TGYA 2H0QA 3WHLA 4ZU3A 4WPGA 1TO2E 2VTEA 1YR3A 3ET5A 4H7FA 4M0EA 3GNTA 3X1JA 3FF4A 1T5DX 3PC6A 3QEMB 1TADA 1TEHA 2H17A 2YXDA 3HO8A 1KFBB 1G291 2C97A 3LK7A 3UHFA 1PHRA 2WU4A 4I1PA 3FTFA 5HE9A 1UXIA 3HDYA 1RYEA 1SHKA 5LP6B 2GFQA 4TTRA 3S1LA 3L7JA 2FZVA 4BWFB 2Y0PA 4MEBA 1O77A 4LZZA 3BEOA 3VAYA 4CIXA 4DMUB 4EHNA 2HYDA 1U9IC 4J0QA 5AICA 3BE5A 3C3CA 2I2AA 5CVJA 3ZWPA 5KCMA 2BGGA 2ZJ7A 1W4ZA 5FWYA 1WOYA 1UOOA 3HPQA 2JBAA 2B3DA 3LPCA 3NEPX 2H5JA 4WZAB 3SR4A 3CU5A 4A92A 2QM8A 3VPCA 4PICA 4HZUA 2DFDA 3SQDA 1TAQA 2R5WA 1N9KA 4YJ3A 3RSSA 1X2EA 4I5FA 5BXYA 1YD7A 3B13B 3DPIA 4YV1A 4IH4A 4J03A 4MGEA 3V7YA 1HETA 2WQ6A 2ES4A 1SVWA 3ETCA 3U3XA 3V7NA 1LJUA 1C0IA 1CQZA 2AK2A 4CMHA 1BW9B 2X19A 4F04A 2H59A 5ENVA 3B36A 4MV5A 5F77A 3MINB 1XQVA 2XWJI 3M1LA 1II8A 1U3GA 4D0RA 4YCSA 4ZCLA 2H11A 1IWPB 3TTVA 3BK1A 2VSFA 3I8XA 1RJ9A 3SDZA 1FB5A 1GM5A 1EG7A 3UAWA 4CIAA 4PX9A 4EUHA 4LOIA 6LDHA 4JQZA 4ZV7A 2EJVA 2PVPA 4X1KB 2NW6A 1OVGA 2PKYX 5AKYA 1YC5A 5E38A 4GKVA 3GGGA 4CEIA 1CUBA 2WSSD 4Q3OA 3FR8A 4IOMA 2QN6A 4ALKA 2QR5A 1NW4A 5AUOB 3QVXA 5DTMA 5F78A 2UXDB 2YJZA 3SCZA 2Y66A 2O8CB 1AUXA 1X2BA 4RK0A 1UBJS 4DDHA 3O7WA 1ECCA 4FFLA 2A0YA 2J6CA 2VK1A 4GKKB 1QORA 3B1JA 5D1NA 4TRNA 2M1XA 1KJWA 1G21E 1H69A 2PLRA 3BGSA 3IVCA 2WFLA 3NIWA 3I32A 4OQDA 4P3YA 4BMVA 2PZBA 3DFKA 1VCHA 2PX6A 2G09A 2PH7A 1A72A 2QQ0A 2VJCA 3N87A 1QYCA 1QWOA 4NAVA 2EZ9A 2ZJBA 2BFPA 4QXRA 2O3SA 2GZSA 4RY9A 3RM3A 3KVOA 5A3VA 5BUQA 4AO6A 3KQMA 5KOHA 4G0UA 2QX7A 3Q9UA 3FDZB 5CT9A 2FGJA 5K01A 1EJBA 1OFUA 4LMAA 2RHDA 3DQZA 4HSEA 5EKSA 5AKZA 1L4MA 5LN1A 1VJ5A 1UPAA 1Y5LA 2P78A 2JHPA 2WKSA 3ICVA 1AN0A 2IP2A 2BRUC 3TZCA 2P5SA 3C6BA 2LCIA 3ICPA 1XTSA 2HCRA 3PUZA 4LNUA 1YRAA 4MWDA 2XMSA 3QLUA 4CKCB 4KB5A 4EB3A 2ZTMA 2WWXA 2GFHA 2GCEA 1EI9A 1HOXA 4KNWA 3DHVA 3UV6A 3WBFA 3D2BA 1IUPA 2EIHA 2QX8A 3I0MA 3Q41A 1VPDA 3QX7A 4W8GA 5CYGA 3CO5A 3KEOA 1HTWA 2ZFUA 4P2BA 2J3QA 3S6JA 3TR0A 4C1BA 4IJQA 4CCSA 3JYLA 3EVCA 4RTPA 3P45A 4HAUA 1PV2A 1EWKA 1AUPA 1ZN8A 1U3DA 1OGYA 3AP2A 2JLZA 3NC4A 3ISTA 5DK4A 1M2EA 3UWSA 6REQA 4XDZA 1E8MA 2AF3C 5AJYA 5E6UA 1P1FA 2GGSA 2PD3A 3ZU4A 4HXYA 3R6GA 1M67A 1Z34A 1AK1A 1ZMBA 2DHEA 3G9TA 4QLBA 2QMQA 5KQRA 2ZCJA 2IOYA 3H04A 2XAUA 3IQZA 2GKSA 1AA6A 4OMCA 4P7KA 3ZV5A 5FLEX 1Z7EA 1HDCA 1KMCA 1QANA 1Q83A 2JHFA 3A6ZA 2DAPA 5IDWA 1N6OA 1V95A 3QE4A 2GDJA 2JLVA 2EV9A 3BGWA 3K6RA 3GGJA 3HXTA 4RPGA 2GSWA 5KREA 4QFMA 4CLRA 5ELLA 3GJ5A 4QUEA 3IOMA 5BYAA 4TLDA 4JQOA 1RHKA 4CTOA 3GVCA 1ML4A 3MOSA 4O5OA 2FFAA 1ID1A 3CRVA 4OQPA 3I64A 3ZD8A 1ONOA 2VXYA 3PDIB 1ZEJA 4UNNA 3EC2A 2XEXA 4W8OA 3R8FA 2AYZA 1K0UA 4ER5A 2FPIB 1ECGA 3AEZA 4D0LB 4CFYA 2H06A 1PFVA 1XZFA 2IXDA 3ZZMA 1A50B 1TFRA 3ZEAA 2O8BA 1EAYA 2P77A 3TTXA 3NVAA 3EXHB 4NBLA 1C8BA 2YNMC 3T5CA 3Q7TA 3NGMA 2UYCA 1PU2A 2JLRA 4UU0A 1CY8A 3T7DA 2PXCA 3GFSA 5FBRB 2AR7A 2C5SA 2WU0A 4NMMA 1IVSA 3OOSA 3T3DA 5KJFA 3OZSA 2NZXA 3AEUA 4EG4A 3BQMB 2XUHA 2ECPA 4OKNA 1XYVA 2VHYA 1O95A 4BO0A 3ESBA 2NOAA 4KL8S 1ZRHA 1UBFA 2HT1A 4QGBA 4EMTA 4KLCA 4KRXA 3HR7A 4L75A 1USIA 4LJ5A 4KFSA 3O21A 1X7ZB 1PF7E 5CLGA 3BJZA 4P4SB 3KPUA 3A1CA 1FPQA 1T2DA 4IZIA 5GONA 1NJ1A 2AFIE 2D2XA 3LGSA 5CM9C 4XGQA 3VI3B 1TK2A 3OE5A 4MYRA 3R7AA 3BWXA 4D8UA 3CF6R 1TQDA 4J6FA 5G02A 3PZRA 5CDFA 5BRAA 5I01A 4BPBA 3P0RA 1JMYA 3EBLA 3EG9A 1NLYA 4GLLA 4JJGA 5CFLA 3PA8A 5K0BA 4JYCA 4Y67A 3BWYA 4BUJA 2P27A 5IT0A 2O57A 1S7GA 3DO5A 3MTDA 1R3DA 3B6EA 3KHUA 1OBHA 1XVIA 1Q11A 2V5AA 4OLFA 1VL1A 3V32A 2NP7A 1V1MA 3I9NA 1KYXA 3LUDA 2O6LA 2Z9DA 3AM4A 3HN6A 1R0SA 7ABPA 1GAXA 2ZAMA 4G5OA 1PFKA 4TLAA 1JH9A 1LW7A 2HO4A 5EEGA 1AM4D 3NJRA 4E2XA 3I6ZA 3MZ0A 1N2GA 3MQ4A 2CCJA 4G4GA 1ZK0A 2MYNA 2Q9BA 4INJA 2CVHA 4PHHA 5LDGA 1I4OA 1JZQA 2PXHA 2Z9CA 4ZQFA 5JLJA 2IU4A 1GZ7A 3K20A 5DHTA 3SSAA 3D81A 1A1SA 3RWOA 1D04A 1N6LA 1N75A 3TVDA 3DLHA 2NXNA 1GGMA 1RXIA 5LDDC 3QNMA 4QAQA 2CD7A 1KI2A 1KVQA 1UIMA 4Q5IA 2JAUA 1GNRA 3SQNA 4J0EA 5A6VA 3BMQB 1EFRD 1NVMB 2ZITA 4X1YB 3UFXB 2OHFA 2VRCA 3RUPA 2COEA 3UT5A 5LD2C 3IP1A 2B3TA 1JJVA 2IYOA 3FCSB 2C1EA 2VWQA 4HWKA 5L7WA 1GWNA 3VYVA 2AEEA 1LXCA 4EQZA 1Y63A 3ZHQA 1AKUA 3QOFA 5J4HA 3G8AA 3PIDA 4IIVA 1E6UA 5EAIA 3WQSB 2JAXA 1WABA 3BN3A 3REFA 2AXEA 3KM0A 4NAHA 4BMXA 1UBMS 3BJRA 1OQAA 2VXBA 5IDYA 3M0EA 1E2IA 5PNTA 1MF7A 5K3CA 1WEKA 1QGOA 1ULSA 2XUKA 3AG6A 3HP1A 4B47A 2VUUA 3E5NA 1MFPA 1QB8A 4WNAB 2HWUA 4HRVA 4UUNA 5JD6A 5KNDA 2W6JA 2EFYA 2V3VA 3W34A 1I32A 4OBWA 1CTQA 4QA9A 5A5VA 3GQBA 4EENA 3H5RA 2DLNA 4BNHA 2RGRA 3K72B 2F1HA 3AEYA 5DRTA 2R25B 3E22B 2W43A 3IJRA 1PI3A 1BRMA 5KOJA 1D6JA 4LDNA 1XSEA 4KLRA 1GR1A 4RVSA 3VHRA 1GZUA 2QL7A 4WADA 4NARA 3WICA 4HNAB 4EELA 2O0MA 3BFXA 3ASUA 5BWLA 2ZSHA 3U09A 3OFSA 3W5IA 2QN2A 2FMXA 2Q5QA 3AHDA 3FOCA 2EF0A 2BEWA 2CXTA 3RRNA 5FTLA 2CKMA 1K7FB 1P5JA 3O2JA 3MB5A 2W6ID 5DLYA 2RBGA 3ZGLA 3BCHA 4TWZA 3B1KA 2GNAA 3AUAA 1YJXA 4PG5A 3SHVA 1OB5A 4OHUA 2G1AA 1COWA 4EPRA 4FEEA 4UTRA 4OD0A 2MIIA 3VPXA 3WGOA 3JYHA 3V9PA 3QEKA 3TAHA 1LBHA 3I5XA 1YJBA 3IQHX 1CQJB 1ZNZA 5KKAA 3KSDO 4HPWA 4YCDA 4YRCA 1VCIA 3TEFA 5HGJA 3S2UA 3W90A 4BLUA 1P62B 3KE8A 2D4AA 1CDEA 1Q12A 3F98A 4WBNB 5LC1A 2HFJA 1RQ2A 5C31A 3WGMA 4OJQA 1CJCA 3SXUB 2PS3A 3WL3A 2DBYA 4I55B 1XL1A 1PLJA 4D4GA 1RWXA 2AVDA 2JIDA 3DAPA 1E9AA 2HPHA 4OIFA 5KVAA 1DRKA 2PVCA 3T7KA 4AZ0B 2QRQA 4BOYA 3W7VA 4GBJA 4L8FA 3A04A 4MRPA 1KFEB 4W5HA 2ZWMA 1QBGA 4BV9A 1VECA 5A0TA 4WFKA 4AMVA 3N2EA 5AESA 1A8SA 3TLAA 1O54A 4G4IA 4Q6BA 2VT2A 1T1RA 4OSEA 3PGA1 1C81A 3A9SA 3I05A 4FFBA 3KWMA 1QVAA 3B5IA 4KLNA 4QVKA 2GD0A 2IH4A 1B00A 1Y8CA 1OSNA 2BFBA 4ZMRA 3PT5A 1GNPA 3V48A 4LEIA 1B76A 3RC2A 3EB9A 4LYAA 1H22A 1E1QD 1WSBA 2G9VA 1UAYA 3OQBA 4PPYA 3T5TA 3NH6A 4IEFB 3BQNB 2AH5A 3NBFA 1Z8HA 3BB1A 2OKCA 5FI0B 3RSOA 4EGSA 3X1WA 1PW5A 1M6VA 1BE1A 1PYOA 1Q7GA 2FG5A 1NOKA 5EC8A 1MV5A 5C4GB 4IIBA 3PE6A 4NNOA 1MORA 4R7GA 1GLVA 4R83A 3O73A 1LPOA 1N2BA 4ZTUB 5E2IA 2FU5C 2GS9A 2QIPA 3WL5A 3TVTA 4KFCA 4CEJB 3RUIA 1M6EX 1QH8B 1LJLA 2HLDA 3HGTA 1X8XA 2H63A 5E7MA 3OTGA 1V5GA 1E0JA 1Z5GA 2XOKD 3OT1A 4YJHA 1FP2A 3N8NA 3L7LA 1I33A 1HNZB 3D3QA 5K8UA 3EASA 4PX5A 5I9IA 3I2GA 4KQ2A 3JALB 2C2OA 3JZAA 2GN6A 2R8EA 1MXHA 1F2UB 4DC1A 1XK7A 3C3KA 2VJQA 3KEFA 5T3YA 3EISA 4BVEA 3SHTA 3M34A 1YK1A 1E6CA 1RRGA 2HJGA 1DC3A 2MHCA 2YDYA 4DSUA 4O1HA 5CVEA 3WYDA 2I78A 4ZVMA 3WWCA 2VTDA 2WWWA 2H5LA 4NMXB 1KMQA 1Q1GA 4UBJA 2FHSA 5FOUA 3R5JA 4DV7B 3JQCA 4MULA 5EPUA 1XQ6A 2A33A 3D7RA 2YWJA 2YYAA 2MYPA 3CSUA 3D7SA 3I9V6 5JS2A 1D7AA 1ONSA 1M2VB 5E2BA 2R8BA 3KHKA 5IH7A 1KXJA 1OYWA 1OXUA 3AETB 1D2RA 4RETA 3I1JA 2Z3ZA 2ILVA 4ZQBA 1UBRS 1YHZA 1SD1A 4DLNA 3OJLA 3VSEA 5K03A 3EAGA 2IRWA 1HLDA 5ITWA 1E0DA 2NV2B 4XEHA 1UJCA 4R54A 2ZJ4A 1Z6AA 2GEFA 3I5UA 2Q41A 1SKYB 5DSTA 3I2KA 1DWQA 3G5TA 3KQYA 4ZRDA 1BMTA 3E9QA 5BQFA 3MJVA 1AV7A 1BWQA 2E49A 3EC1A 2CJXA 3NPAA 4ZYWA 2UXBB 3LUPA 4CBVA 2JKZA 2LWIA 1ECFA 1HFEL 2G5PA 4G0PA 4KK4A 4R1QA 4E15A 1W0CA 4ENQA 3ZDCA 2O5RA 1OASA 2A3NA 2OGZA 1H3NA 2O3QA 2P5YA 2QYTA 1TEXA 3VKUA 3DDCA 4RFLA 5L7TA 1NSTA 3BCRA 1A9QA 4ACAA 2HBZA 5J1SB 4LJSA 1JKIA 5G1NA 3WHKA 3EPKA 1O6BA 4WEQA 1OJ7A 1MA0A 2B35A 3MMNA 3RV3A 1CUIA 3ZVLA 2H29A 2J7KA 4B0PA 1IWOA 2ZAOA 3F3SA 4Q66C 2RD2A 4U2GA 2Q2WA 3FZQA 3IUBA 4GZLA 5CX1B 3VR6D 2JCVA 2R6GA 1DUIA 3DAGA 5HKBA 1F3OA 3BD6A 4QVGA 3CRW1 4MJLA 3BSYA 2CHEA 4INAA 3IMEA 2I1LA 3DGFC 3OCCA 2I71A 3X2EA 9ABPA 4M7OA 4HPJB 5LA6F 4Y2RA 1T91A 2JFNA 1OIXA 1LC3A 1VMKA 1M8FA 4DCGA 4KOEC 5E4YA 4XVUA 1GQQA 3EC7A 1DEXA 3LUFA 4FK8A 4QRHA 4FMCF 3B3GA 4MR8B 3RR2A 3HXOA 3WDSA 1U3TA 5TQVA 1D1TA 3DVRX 2BMJA 3H4TA 4IZ6A 4Q02A 4TLMB 1HFJA 2PUWA 2VT3A 2FR0A 3EMKA 4KKXB 2CSXA 1M8KA 2JJMA 3SS9X 4MB2A 1DBRA 3C3DA 1G4HA 1PG0A 1PT6A 3A4IA 4ZZ3A 1BWRA 2Q3HA 2I4MA 2D54A 3LP6A 2QI9F 1JPJA 4S1WA 1E1YA 3U31A 3U49A 4K9RA 3W6OA 1ZOSA 2E85A 3PG5A 4EOGA 2QE6A 2Z08A 3GEBA 3O3NB 4MR7B 3AONB 1CZHA 4KXNA 1XAJA 1UKZA 4YUVA 3ZNQA 4A82A 1PT5A 5F9MA 1HMPA 1T2NA 3HMKA 3Q9NA 1K3UB 4TMFA 1I5OA 1C80A 1M6YA 2ISQA 3HKBB 1XA3A 3D4LA 4A27A 1EWVA 1SBHA 3H13A 1AC5A 1UXGA 2BMFA 5CW2A 1JBQA 1U7WA 2WV9A 5MF6A 4OGWA 3AQ4A 3R5KA 1W581 4OY3A 4Z0HO 5TS2A 5I4KA 1XZLA 4Q9LA 1KNXA 1FSZA 3M3PA 1WVGA 1K6XA 1GGKA 2FDRA 5C81A 2X1LA 5AJWA 4ALMA 3O95A 1FBTA 5AI0A 2Y6VA 3TSCA 1C30A 3CIOA 3QF4B 1CQPA 1I4LD 1XXLA 2DQSA 3G0IA 1PSWA 1W2HA 5JVDB 3CHYA 4MICA 3FKSD 3TLCA 3GJXC 1M7BA 1Q57A 4QDJA 4RGQA 4TTJA 2H00A 3UAOA 1BAPA 4K1LA 4FHDA 4F2WA 1U7XA 2ZM6B 4R2XA 2XH8A 2AR0A 2ICAA 5AUPB 4HTFB 1IU9A 3V7FA 2YJ5A 1Z45A 2VDMB 4DRXA 1X13A 1QH9A 3OM0A 3VO9A 2I87A 5CCEA 3V1YA 2D5CA 5L4NA 4AY6A 2MSLA 4BO4A 4FCTA 3WOHA 2JLXA 4H16A 4PLPA 3KFLA 4B3FX 4I50F 3USCS 4R4JA 3J80A 1N9GB 2WEKA 1SPXA 1RIIA 1ZIYA 5FJJA 2JLWA 3T1QA 4BGEA 3R0ZA 4FIZA 4R8MA 5LIRA 4HF7A 3V3KA 3ISJA 1OZFA 2B6HA 4MR9B 2XGMA 4P7FA 4DJTA 4C88A 1ZL2A 1M2HA 4RVDA 4DUYB 4X6LA 4EPYA 2NXCA 1V5FA 1MNQA 1LBSA 2PH1A 1JRLA 1GL7A 2OHIA 3NFYA 4O4JF 4I9GA 4AKHA 4FONA 2XNHA 5F2KA 4LJKA 2WHRA 5IBQA 3HV2A 2QRHA 5IUKC 4AWXA 4XX0B 1J2RA 2M6RA 4ITUA 4P3XA 2XBMA 1V11B 4NS1A 5CBPA 3RTAA 1MEEA 4KPEC 2QM3A 2B4TO 1ODTC 2H65A 4ZRNA 5FD8A 3BA6A 1Q44A 2Q6VA 1O3YA 4MYDA 4Y9UA 3HXQA 2PGAA 2YVUA 4NF2A 1ZIXA 3WBKA 4QEZA 2GZMA 3N76A 2WAAA 3GJZA 3IS3A 1TM1E 4N5MA 1BX1A 1QCZA 3LDUA 1EVIA 3RT7A 3VJRA 1X15A 5G0TA 1Y6QA 1SOUA 2OWEA 1ODFA 1OXSC 3ED5A 3SC4A 4LQCA 3WA7A 2CDBA 2A14A 2XXJA 2P4UA 3TW8A 4PONA 1H2RS 2X41A 2YV1A 4YB8A 1P91A 3U48A 1GPLA 2L82A 3RU2A 1NVDA 1YFKA 3UAXA 4Q48A 4GR4A 2ILTA 3O5AA 3VR2D 1BX0A 3S2IA 2WT4A 3KV3O 4G1EB 4KFRA 4UATA 3BRQA 1I5EA 1A9OA 1M6NA 4PC3A 4OXIA 3SHWA 3NDBB 2PX8A 2Z8YA 1OXBB 1TGVA 3ZE7A 4IDXA 4C06A 1UPXA 3OO0A 4ZCIA 3PEYA 3SDSA 3O03A 4S2EA 2P0EA 4ZXPA 3I6MA 5CNIA 4B33A 4NCBA 4R7ZA 5BT9A 1JHDA 2DFNA 1Z0IA 4EA8A 3I3SR 1OX5A 5D5QA 5J4KA 1ZINA 2A0UA 2WVJA 2XBUA 3H3FA 3P2JA 4Q1DA 1E98A 2HRDA 3U3DA 3WTBA 1I14A 1O97D 4A6DA 3D4PA 4JYMA 1FU8A 1LDEA 2ZDGA 3C7TA 3IDOA 4CT5A 5BWNA 2GXSA 1R9MA 3DZDA 3L6DA 3U39A 4CI0B 4ZDKA 4CKYA 1NVVR 4ZT6A 1PJSA 1QTNA 4H3SA 3R9IA 3KQLA 2PGOA 4FX5A 4LMPA 1WW2A 4O4HA 3D1JA 4MYUA 1V8FA 1YV9A 4QRIA 3AVXA 2Y92A 1IBRA 1Z13A 2FSHA 4YMLA 4XLZA 3WSWA 1I30A 4WOCA 2C3MA 2FK7A 3QPUA 3WLAA 5ALLA 3QVOA 1TU4A 4DPKA 4HH0A 4QNMA 3W5DA 4FIDA 1RWKA 2RI0A 4WKBA 5C1IA 4DZZA 2XWQA 4TUYF 3I8OA 4UM7A 3NNSA 4FNOA 2VQDA 5KYVA 1FUUA 1KDVA 2Z30A 3C6ZA 3HBJA 4C0WA 1LPMA 3CLRC 4M0PA 3UXYA 2NU9B 1ZBDA 4JB0A 5GVRA 1X92A 4LHZA 4AX8A 1R8XA 2ZREA 2F8MA 3OE4A 4Y7CA 2DTDA 2X1HA 1YS2X 2PN1A 3ECAA 1C7FA 2B7LA 2W6CX 1Z68A 4HG2A 1YMUA 4KH1A 4JUCA 2D0PB 4JJKA 3GC6A 3RT1A 1RM3A 5FWYB 4YRMA 3EVFA 2QTHA 2PCLA 3UVEA 4XWKA 3SF8A 3DOJA 2FR8C 5CLFA 3VHXA 3LQ4A 1P9RA 1W5AA 4M9QA 4AYWA 3T1YB 3G2QA 4UASA 4FT2A 1Z5WA 3U80A 2IHYA 4AIIA 3C74A 4G3XA 5I7WA 2YJ6A 2ZYHA 4UNSA 2C77A 2Z6AA 3NXKA 1NKSA 4MUYA 1GTSA 1CDDA 2FOXA 2N1MA 1B6SA 1F51E 3OIYA 2XDWA 3D3WB 3M9WA 2P3LA 4AU1A 2MTBA 4HDNB 1ACJA 5LOVA 4LXIA 1DKRA 5FIUA 5BSRA 2VAWA 3OHSX 4KXFB 4ENPA 3PLRA 4RL6A 3QFSA 3IVAA 3DTVA 3FVVA 1FY2A 1X9IA 3CXUA 2WIAA 2VP5A 2CLMB 2WR8A 4QPZA 2B20A 3A9CA 2W00A 5FA5A 3UHOA 5A9SA 2YASA 2C8JA 4OI0A 2H2IA 1N2CE 1XDSA 2ARKA 5AXDA 4PPQA 3HLKA 1Z12A 1Q1BA 1O96A 4PQEA 1XXHB 3S0JA 1ZC4A 1X7HA 2FX2A 3X1KA 1V6AA 1ZWLA 3TZEA 2R86A 4J2OA 2C57A 5JW6A 4EGFA 1QLJA 3KZXA 2GTHA 1E4OA 4IBOA 3V7UA 5KU1A 1SUAA 3MRTA 2HMUA 2QORA 1BU8A 2YR0A 4LV8B 4B44A 4BX9A 2C7PA 3HUFA 2JFOA 2WDZA 1KZHA 1XQ1A 3FSJX 1CJUC 4L3VA 4CHGA 4LFBB 4UXJA 3Q9LA 2YXLA 1W4AA 5D87A 5B4TA 3U5ZB 2QN8A 4QX6A 5EJGA 5GWXA 1AQYA 3IBYA 1XLTC 1X0XA 3E8XA 1MIOB 1SQ0A 3Q6NA 1TLTA 1G5QA 3C1TA 4M6WA 4KAJA 3NRCA 1EP3B 4JKOA 3LHIA 3H1EA 5F73A 3TQRA 5CFZA 3I9OA 1HI9A 1DBWA 2WWIA 1YI1A 2Q3DA 4Q9NA 4G8BA 2XKAA 3GLHB 4U6QA 1RAEA 2WWVD 1MVOA 1SHJA 2EJUA 3AVQA 3CZAA 1FNDA 3SFZA 5CCBA 1DQNA 2VP9A 4Q0MA 5I8PA 1YCDA 1HEUA 3AHEA 1XLVA 3KQNA 4DKJA 3REGA 1MAWA 2YV2A 3NUGA 2JFZA 1N1DA 2X77A 2WYWA 4AZ3A 2ZT6A 2GXAA 1MPXA 1P1JA 2CMFA 4NZMA 4G5YA 1TYBE 3FWZA 1S4QA 3MXTA 2I1QA 4HPXB 5TF0A 1GZ5A 5L4LA 2H2AA 2IIBA 3U60B 2JJ2D 2A0WA 1F0KA 3Q5EA 2QZJA 4AY3A 1J2YA 2BELA 1G60A 4TQUS 3GWGA 4PGAA 2REBA 2H9YA 4JC5A 4AO8A 4X8HA 3KTOA 4EZIA 1Y7TA 3LPLA 1QU3A 2HREA 5HDQA 4OA8A 1PJAA 3VR4A 4MW2A 1U8XX 2PU7A 2EL7A 2ENUA 3QU5A 3AXTA 1I2ZA 1BQ3A 4YP7A 5CD1A 4LDQA 2XRFA 4RVHA 5LNK6 3LDFA 2JI7A 3AI1A 4FP9A 2FZ4A 1A2OA 3OMWA 4N01A 1OZ0A 1YQGA 4BASA 4NV0A 2HU8A 2FUCA 4R68A 5HF6A 1AIPA 1U4SA 3S28A 3ROQA 5KTYA 5FBWB 4DV6B 4GS5A 4R8KA 5JSKA 5ES4B 4WXPA 4HWOA 2WJVA 4ZGBA 5K3DA 1U5CA 3OU7A 2BWJA 2Y6UA 4H1TA 4EVQA 4F4FA 2EQBA 3A70A 1JSLA 3DH0A 1KP9A 1ZR2A 4XCQA 4ZJYA 3FLMA 1NJSA 3V00A 5EQTA 3UUEA 2Q5IA 4Z7QB 4DIKA 3DE3X 3WL6A 1NQWA 2RHGB 1RACA 2DPHA 1JG6A 3DT8A 3RYHA 2Z2XA 3VMFA 3RYIB 4RF4A 4CKEB 1FTNA 1ZCBA 4LRQA 2DFLA 1G2OA 4MRRA 3T5DA 3WWEA 4E11A 5CM8B 5DW3A 3DKRA 2AOXA 3TW6A 1AHIA 3N2NA 4I1SA 1DZ3A 1R9NA 2NTYC 3ITDA 4HNSA 3V4SA 5MN5A 2JGFA 2CLLB 1XDZA 4IRXA 1HORA 3GJ7A 4P9NA 1U9JA 1JHZA 2Q5LA 4LSGA 2NU8A 3IDZA 3K09A 3VTZA 1R74A 2GN1A 1G1AA 1Y3AA 3TDMA 3PHJA 4EPXA 2V97A 1ZCFA 3SOZA 3A7EA 3COZA 4EB6A 1H8EA 2IY8A 4LE2A 2JIOA 4LOAA 4OGKA 4O2AF 4ZI3A 4MVJM 3RFTA 4US2R 2G5CA 5KBYA 3EXIA 1PN3A 1TKBA 4IFIA 3GVIA 1YDMA 3AI7A 4O2RA 4RA6A 1JLSA 4F21A 1GFIA 3VU1A 3G7SA 1E0AA 4RK6A 3T3EA 2OLEA 1D4AA 4WLEA 1ZH0A 2H18A 2XUFA 3OLXA 1XK6A 4Q19A 1EFKA 2P4SA 2F4VB 4QC2A 3A2NA 5J5AA 2X0RA 3JD3A 2GAAA 3ZIUA 4E1AA 1DC7A 1RCTE 1Y3HA 2JJQA 5LCXA 3STHA 3ZHCA 3TOXA 1KQGA 4UMEA 2RB4A 4E3WA 1A5AB 3ZNOA 3AJ8A 3UOWA 4TL9A 3MUEA 2Z1NA 4F1JA 2YQ4A 1XMPA 2NTVA 4G8CA 3T7CA 1DWOA 2XWBF 4KRFA 1TPYA 1N2ZA 3FZNA 2ZCUA 1DAEA 5CFOA 1LQTA 1GTMA 3JZIA 3QLEA 4HLUA 3T7EA 4HGOA 4JN6B 2ZTVA 5CT4A 1P3JA 3N05A 4UREA 5IXYA 2NO7A 3BZWA 3GUCA 3QUCA 3D7MA 5ADHA 1WF3A 3JQBA 2XXAB 1CT9A 3F47A 1XEXB 2IHVA 4WH0A 2EP5A 2OR3A 3TJMA 2R1VA 3LI2A 1WDLA 4I1OA 2DHDA 4LN1A 1TMGE 1J09A 1Z28A 2DVMA 4DCUA 5EWLB 5H3CA 1EWYA 3I2JA 3SJBA 2ODTX 3HWWA 3BXPA 1VOTA 3B1WA 3D31A 4GR5A 4ISCA 4URFA 4CTKA 3UO8B 3WFIA 4B7UA 4J7AA 3S2YA 3WZMA 1Z2NX 2H52A 4C4XA 2P65A 3S5JA 3SHFA 1RM0A 1J2UA 4YDRA 2I7DA 1XQXA 4BNXA 1X94A 5EE5B 3CISA 2DUWA 2W0MA 3OLZA 4CM7A 1T2UA 4ZYVA 1VLZA 4G24A 1OFUX 2FW8A 4GZMA 2G77B 1M1YA 5C1OA 4NJMA 1L4YA 1WDMA 1E77A 4EZEA 1EM8B 1VP9A 1SELA 4EA7A 1WIWA 1LEHA 1Y0BA 1Y3FE 4A8PA 4FFPA 2IYSA 1NWCA 4RZHA 4QTZA 3N2ZB 4KIUA 1GCIA 1VPVA 1Y82A 3CEAA 3VAZA 2B8TA 1KJIA 4YRNA 4JNGA 2BHTA 1VJ0A 4YRTA 3WB9A 1H2YA 4IGEA 2YIVX 1DO0A 5IKOA 5AW0A 1IMOA 1IHXA 2VDWB 4LXXA 4OHOA 5FX2A 2CVFA 1QG2A 4HEA6 1AS3A 2RGWA 1DXOA 1K7XB 3HB7A 4PC6A 2OBMA 3KPWA 3U37A 2QBYB 4Z8XA 1NUHA 4KGZA 2V7XA 4OQFA 1V41E 2CW5A 3FX2A 2PRSA 4YO8A 1WJGA 5EPEA 2XF2A 1RRCA 4R0VA 2FG6C 2I76A 5AR1A 5L8VA 5JXIA 3IXQA 1GNLA 2QAJA 5JDIC 2EZUA 1I10A 4J3NA 1UPTA 3SWWA 3QX3A 3KTAB 3EFHA 3W4KA 1KSJA 4BGVA 2F3RA 2X2FA 3DO8A 3FFTA 3TLXA 3HSSA