2R2GA

Structure of eugenol synthase from ocimum basilicum complexed with emdf
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
310
structure length
310
Chain Sequence
GMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERQRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eugenol synthase 1
publication title Structure and reaction mechanism of basil eugenol synthase
pubmed doi rcsb
source organism Ocimum basilicum
molecule tags Plant protein
total genus 111
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.1.1.318: Eugenol synthase.
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2r2gA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2r2gA02
3JD3A 4IQ0A 1CRWG 1PSDA 1UZLA 3VAZA 3I4CA 2PZLA 2YHUA 3PJGA 1UH5A 2HLPA 3CINA 4WOJA 3WLEA 3C1AA 4I5FA 2C5AA 4R54A 1ISIA 2CVOA 5GZ3A 2GERA 2P4QA 2VTEA 3EZYA 3KYDA 4HXYA 4CLDA 4CQMB 4IZIA 3WXBA 1YONA 2CDBA 4KMSA 3LC7O 5G4LA 3RKUA 1DIGA 4BO5A 1E1LA 4RL6A 4HX5A 2E48A 2EG9A 4ID9A 3SJ7A 2GD1O 3PFFA 2CY0A 4IDBA 3VDQA 1HLDA 1HYHA 2ZTVA 4DIOA 1H6CA 1EFKA 2J3HA 3NJ4A 2OMEA 2WE8A 1UXGA 2Z1NA 5DF1A 5F21A 2CVQA 1C0IA 4IBOA 3U4CA 1OBFO 4A7PA 1HDCA 2VHYA 2HMTA 4OAQA 1TT5B 3AI1A 4N54A 3CH6A 3HDQA 1YL7A 2EV9A 1K6XA 3WYBA 1HZJA 1M75A 2SCUA 3B1JA 3KYCB 3JQFA 4OHUA 3K2EA 4URFA 3H8VA 4BOYA 4W4TA 1HDGO 2VUSA 4QO7A 3SLKA 4KQXA 3HFSA 4PLVA 1E7QA 4BMNA 4U6SA 5JDIA 1LDGA 2DFVA 2XXJA 4PVCA 1M66A 3DBLB 4FGSA 1UAGA 2ZB3A 4W82A 4CR8A 1EDOA 5JO0A 3U62A 4R1TA 2Y93A 3WFJA 3U4DA 4XRRA 1D8AA 5T67A 1V3VA 3BHIA 1N1GA 1ZSNA 4R41A 2X9GA 3ZV3A 3GVHA 1U3UA 5IDWA 2Q1WA 1PR9A 3RI3A 2RBEA 2YDYA 4DL9A 4GI2A 1EE2A 3AFNA 1HYEA 3MCVA 1XCBA 3GFGA 4HV4A 4UVGA 2VQ3A 1DJQA 5IDQA 5C37A 1B15A 1VLLA 2BD0A 5EINA 4YRBA 2OGUA 3AW9A 3H9JA 2VUUA 5L3ZA 4CM3A 4KP7A 3WGTA 3IDSA 1U4SA 4NFHA 4BO4A 1A7AA 1EUCA 1E7RA 1H2BA 1N1EA 3AOGA 4FSHA 2PZMA 5A06A 2DQ4A 2DU8A 4FC7A 1EK6A 2C59A 2X6TA 3H65A 4GVLA 4ZQGA 1ZFNA 1QRRA 5AXAA 3HN2A 3WOHA 3GMSA 4AJNA 2OL4A 3NT2A 2YV2A 3ETDA 3UCFA 3I6IA 2NACA 4D3SA 2OORA 3WICA 5DP2A 1P45A 4RQTA 3I6QA 4TWRA 1YBMA 3Q1LA 3RUFA 3IKVA 1ARZA 3ZWPA 2I66A 2A35A 1NWHA 3CMCO 5CPBA 5B12A 2DBZA 1C0LA 1BSVA 3QWIA 4MVJF 2BFPA 3FWNA 1PL8A 2ZB4A 1MG0A 1PQUA 4PLYA 1NHWA 3GQVA 4ZVVA 1Y5MA 2HRBA 4Z9YA 3K2BA 2D4AA 2Q2WA 1AXEA 3RFVA 4N5MA 3U4IA 5TT0A 3NV9A 4IQGA 2I67A 2ZJ0A 2WWRA 4BNJA 2H1SA 3D5QA 2YHIB 2EEZA 3K31A 4CMIA 4EBFA 4CMEC 1D1SA 4FFNA 5LCXA 4W9NC 4R01A 4HNGA 1U28A 5JE8A 3BMOA 4ALLA 2CZCA 1U4OA 3IS3A 3ZW9A 5G4KB 1IL0A 5JW6A 1T2FA 2ZIZA 4JNKA 1XA0A 1K6IA 1E7YA 3OMLA 3P5SA 3NTRA 1NASA 2P5YA 3JQAB 4FJ0A 2FOIA 2DBVO 2WM3A 1E3SA 1IUKA 2VWPA 1ZCJA 3OA2A 3OM9A 2PGJA 3ZV4A 5CPFA 3JCZA 4CMHA 3ENNA 1ISMA 1EZ4A 3GT0A 2HUNA 4YXFA 4YJHA 5IFLA 4MVJM 2W2KB 2WJPA 2YUTA 4NK4A 1B8UA 1OFGA 3DBHA 1K0UA 3QRWA 2JKVA 4J9UE 3JSAA 3LT1A 1SC6A 4PLZA 5IDYA 4BNTA 1WDKA 4MP8A 2HJRA 2AQIA 1D7OA 1HE2A 1IULA 2UUOA 3LLVA 1ZXBA 4BO0A 1NR7A 2NU7A 2JHFA 1B16A 1QYXA 1QMGA 4OKIA 4W7IA 3ZWBA 4F3YA 3BTVA 1JKJA 1NXQA 4F46A 2R00C 2BFOA 3OQ1A 2QG4A 3D64A 5KVSA 1WW8A 1UR5A 3WQRA 5BSFA 4I08A 4R1NA 1L7DA 1NX6A 3H9UA 5I9LA 1E0DA 1V6AA 3OP4A 1U3TA 4FGWA 4FCCA 4NBTA 4IDDA 4CM4B 2VN8A 2HJSA 5KKAA 4MJLA 4XIJA 1I2BA 3DBRB 3EMKA 4AL4A 1PU2A 3GVPA 3PQDA 4YAKA 3QHAA 2WSBA 3LQFA 4IMRA 1U7TA 2VNAA 3PQEA 1ISGA 3OIDA 4CMGA 5COAA 2OO5A 1PGPA 2Z95A 3BMCB 3DL2A 4ZD6A 3VTZA 2V65A 4XRGA 2J5QA 5GY7A 4TZTA 5A4DA 4A0SA 3E9QA 4J4BA 4CM8B 3VVCA 3VPHA 3MWEB 1BTOA 3HE3A 1E92A 1MUUA 1RYDA 4CM7A 4BKUA 1IPEA 5FYDA 1D1TA 4LCEA 2QZZA 1LU9A 5ES3A 3KM0A 5B4TA 1B8VA 1EFLA 4GSLA 3TZHA 4FIZA 3FCOA 1Q7BA 2FPGA 2VOJA 4RVDA 2C0CA 1LDBA 4DLAA 1GUFA 1P0CA 1T1SA 1TB4A 3QV1A 4M54A 5COQA 4Z3DA 3WGQA 5JAZA 4QFCA 4DYVA 3CZMA 2PK3A 4CJXA 2VUTA 1H0KA 4NH4A 1DC5A 5A3JA 5HTOA 2EWMA 4WLUA 4I1IA 1V0JA 2FSVA 1WMBA 1EVIA 4UEOA 4I5DA 1M6HA 2BH9A 4R1UA 4XCVA 4BO7A 1E6UA 5K6AA 3M2PA 3WIDA 2AE2A 1IYZA 5JAMA 2BKAA 3JQDA 3LK7A 5LC1A 5A04A 4JBGA 2EW8A 1I3KA 2NU6A 3BTUA 4NBWA 2WYWA 1R4MA 3RC7A 3FI9A 4KDFA 4TRMA 4L9RA 3QWAA 1PJSA 3S55A 4BGEA 3E03A 3GZNB 4WOKA 3E82A 1ZSYA 4G2NA 1QV7A 1PJCA 3UOGA 1ZJYA 4XWYA 2JCYA 3HDJA 1A5ZA 4LISA 4PLTA 4RLSA 4AJ2A 4E13A 4Q3EA 3CEAA 4RO0A 5JBIA 1WDMA 2O50A 4S1VA 2BGKA 2V6GA 5JSFA 1U5CA 2NU9A 3A9WA 4I5EA 4WK6A 3U49A 1KBZA 4QUKA 2Q1SA 5BNIA 4PG6A 1C1DA 4J7CA 1ZKMA 4ESOA 1A4UA 4RPHA 1P74A 4MINA 1Y7TA 5T8KC 1J49A 1QYDA 3GHYA 4B8ZA 2Y0DA 1SBYA 1XHLA 1M6WA 3H3JA 5JYDA 1HWYA 3DR3A 3JQ7A 2UDPA 9LDBA 2NV6A 4PLFA 1LX6A 2BF7A 2ET6A 3D7LA 2VRBA 1BXGB 4NIMA 3SEFA 3HB5X 2X58A 4PLCA 2PV7A 2IRWA 3HDYA 3NEPX 4YAEA 3VPXA 4FFMA 1Q0HA 3PEFA 3IOYA 4QO8A 1ZNQO 4BQPA 4WASA 2EXXA 4PZEA 2DVMA 3VPSA 2CNBA 4F6CA 3ONFA 3WBBA 4RPKA 4NFSA 3OSUA 4PLGA 2Y1DA 5ILGA 3JQ8A 3JQBA 5JFOA 5MDHA 3M1LA 1Q0LA 4PRKA 1XKQA 3TSCA 4J1NA 2H63A 3ZNPA 4XR4A 2FHSA 2WD7B 5IAAA 2VHZA 2C7VA 1IE3A 2ZB7A 3AFMA 4NG5A 4ONEA 3D3WA 2BRUA 3AM3A 5BT9A 3RC2A 1GV0A 3ONDA 2O2SA 4B8WA 1MX3A 1S6YA 2BLLA 4BL5A 2FWMX 5KJCA 2G5CA 5IXYA 1EMDA 1G6KA 4OGWA 4TZKA 4CUZA 3FNHA 3Q3CA 2VHWA 5CHEA 5KTKA 4CM5A 3GK3A 3ZHBA 4NDNE 4YAJA 1T2DA 3JQ9A 2PLAA 4UEJA 1EVYA 2X5OA 4J3FA 1L1FA 3SC6A 1VL0A 4CMAA 4UAGA 1ZEJA 3E48A 1ADFA 3G17A 2C2XA 4L0QA 5EJ2A 4PZCA 4RDIA 1DIHA 2FR1A 2IXBA 4OKNA 4NQZA 3ZZNA 3K9QO 1HXHA 3U5TA 1D4FA 1JU9A 2A94A 3PHHA 3DXFA 3A14A 3CTMA 3IKTA 3U9LA 1GZ4A 1QP8A 1VM6A 4WCFB 3F1LA 3GAFA 2DBQA 3Q9UA 4CMKA 3GPIA 3RUEA 5HRUA 5I9MA 5KOIA 2O7QA 3DTTA 2G17A 4MVJG 4NJOA 2G76A 3BMQB 3RU9A 4CUJA 1EUZA 1QXSA 4B3JA 1OI7A 2GYYA 4IJUA 2C2YA 4FN4A 3MJ4A 4TSKA 1PS8A 3CKYA 2FR8A 3ZHYA 4XJSA 1SOWA 3TFQA 2B35A 2ZK7A 4YDRA 4XD2A 3I9OA 2JFFA 4N5NA 3R3JA 4IS2A 3JQGA 3RFTA 2X0NA 1HL3A 3L07A 2I99A 3HFGA 1V8BA 2BELA 4PLHA 4E5YA 2BGLA 3FNFA 3JYNA 4HY3A 1GV1A 1HDRA 2WDZA 4ROSA 1IZ0A 3ASUA 4B3HA 5KVCA 4WNIA 2PY6A 1A71A 4QTZA 2GCGA 5KIAA 1H5QA 2NTNA 3ASVA 2QQ5A 1HTBA 2Y1GA 4OIMA 4LN1A 4BS9A 4NJMA 4L4SA 2NUAA 1CIVA 3V1TC 4LGVA 4PCVA 5T57A 5L7WA 1U8XX 4P38A 1OAAA 1LDEA 2H9IA 2LDBA 3VH4A 3TDKA 1G0OA 4EW6A 2HK8A 1GUYA 3KV3O 1IHYA 3E6AA 3NAQA 4YT5A 4R3NA 3WIEA 2PZJA 5CEEA 2J3KA 1WXDA 3QVXA 1CETA 5G0SA 1MB4A 3S1LA 3V2GA 1P1IA 5T6BA 3DZKA 1VSVA 4A03A 5C5IA 3SC4A 2DBRA 2PKQP 2X5JO 3PVZA 4BO9A 4E32A 1E5LA 3JYPA 2J5KA 1PGQA 3AK4A 1Y6JA 4E5PA 4AFNA 5DN9A 4YT8A 3GG9A 4WLFA 2I3AA 4JJGA 3WSWA 2B36A 1M2WA 3OJEA 3PGXA 1PS0A 3QSGA 4BUCA 4BO8A 1GR0A 4CLOA 2EKPA 4I9NA 1NP3A 1XDWA 3QA9A 3KRTA 1LQUA 3PWKA 1MG5A 1K5HA 6ADHA 2NNLD 1MLDA 1DHTA 2X1HA 3PDJA 2EF1A 5DP1A 3L6OO 4ND5A 1RKXA 2C07A 1GQYA 4GSKA 1GUZA 3KZVA 3L4BA 3LVFO 4KUEA 3KBOA 3DHEA 3SBOA 1CEQA 1QSGA 3KLPX 4J2OA 4HNHA 3ZWXA 1MXHA 1V3UA 1EUDA 2PA3A 4DPLA 4MIOA 3RU7A 3O4RA 1YJQA 1E6EA 1LLCA 4YQZA 5I7VA 7MDHA 4KUHA 3E18A 1AHHA 1U2GA 3K73O 5JDCA 1E1KA 1EQ2A 2X5KO 4TKLA 4CM9A 4DMMA 5G0TA 3NDRA 5JC8A 4DMLA 4RQUA 1FDVA 4J49A 1ZMTA 3SXPA 1VI2A 5MGBA 5JCXA 4JLWA 4KUGA 1E3WA 2X9NA 4WCFC 1WWKA 3WJ7A 3DC2A 3GDFA 1PJLA 4R1SA 4EITA 1G1AA 4O1MA 3E9NA 4GMGA 3V2HA 2NADA 4E2WA 3OJFA 1O8CA 2BFMA 4K1LA 1R4NA 3C8MA 4HKTA 4GQAA 2CDAA 3RUAA 3EK2A 3AY7A 1BW9A 3DAGA 3INTA 2OUIA 4TRJA 1LSUA 1YGYA 5F1OA 3UKOA 2RHRA 4RPGA 2ZJ1A 1YL6A 4R5MA 4IUYA 4IQ8A 2CSUA 1ZVMA 4BKQA 4GX5A 1UZMA 1TVEA 1ZUD1 1W0CA 4MOWA 2JAPA 4Q3BA 4WGGA 3UHAA 1ULSA 4BV8A 1JVBA 4ZJUA 1BDMA 3WWYA 4PVDA 1GY8A 1KVUA 3OH8A 1GAEO 5TX7A 3GMDA 1H9AA 4ALKA 4FW8A 4GBJA 4RGBA 4YYZA 1GZ6A 2JCVA 3LLSA 2HMVA 4UULA 3KOUA 4YWJA 3DEYX 1O0SA 2D5AA 4P4LA 4RJTA 1HDYA 3ZWCA 2Q50A 2BI7A 4WLOA 3GGPA 4MIEA 5IDXA 4D79A 1NYTA 3RD5A 3FR8A 5L45A 3U4HA 5JY6A 1YWGO 3PYXA 3FTPA 1K6JA 4B3IA 1O94A 1PGJA 3I3OA 3MZ0A 1PJ4A 1EDZA 2AQ8A 3DFZA 3LYLA 1LSSA 1O9BA 3GEDA 1L7EA 2OBYA 4E12A 4E5NA 2RH8A 3WWZA 4GGOA 4IPTA 5L4LA 1DBVO 4Q3DA 5A03A 1N7HA 1P1RA 2X22A 5KVVA 4XB2A 4P4NA 4E0BA 2P9GA 3BYZA 3KB6A 1ADBA 2GZ3A 4RF2A 4G5HA 3K92A 1ZH8A 5A05A 3H7AA 2PNFA 2IYPA 3M2TA 4DPKA 4Y6SA 2EERA 3ON5A 1FJHA 1LSJA 3G0OA 4BNGA 1XG5A 5B1YA 3RJ5A 1OMOA 1RPNA 4KTVE 1H94A 4CMIB 4R9RA 2UYYA 3DO5A 3LC1O 4A73A 4Z0HO 2V6FA 5C3MA 4R5HA 3BMOB 1N9GA 3AY3A 3WGIA 4GX1A 1P3DA 2Y1CA 4IJWA 3PHJA 5BSHA 3N7UA 4FBGA 1BVRA 3KEOA 1SMKA 1GQ2A 4FD3A 4J2HA 3ZCXA 3QWFA 3D1LA 2NU8A 5TRTA 5ER6A 5I8WA 1OOEA 5ICSA 3U0BA 2FZWA 4EI2A 5ILOA 5DULA 5CEFA 4EUFA 4GWKA 2JFGA 4YJHB 3JQFC 1QLJA 4KZPA 4E5MA 3UN1A 3HSKA 3P2YA 3FSRA 4KQWA 5JCJA 3AWDA 1Y8QA 4D3DA 2FPPA 1DFGA 4AJIA 3IL2A 1BDBA 4XR9A 1HKUA 3NGXA 4PG8A 3RSHA 2AEMA 5JDIC 1N8KA 4XQCA 2YV3A 1DHRA 3ZWWA 1Y8RA 2IE0A 3PHGA 4II3A 4XX0A 3IJPA 5K9ZA 4LRSB 1YS4A 2BFAA 1NAIA 2G82A 3CE6A 1EBUA 3WGOA 1KVQA 2X4GA 5EESA 2FY8A 3B1KA 1VC2A 4CL8A 3LSYA 4BHTA 5LDGA 1O89A 4I8XA 3QLJA 1LLDA 2IZZA 3IP1A 3OBBA 2HU2A 4J6FA 3LU1A 3VHRA 1I2ZA 2P2SA 2V6BA 4Q39A 1NPYA 3RROA 3GLQA 3KXDA 2Q2VA 5EN4A 4J43A 3PPIA 3WB9A 3GHHA 3W4IA 3KUXA 1JKIA 2PKQO 2B4QA 2O3SA 3I83A 4IINA 1MXFA 4L4XA 4ZQBA 5CDYA 5JPIA 3BA1A 4KWIA 3DAFA 4B4WA 4G81A 1QKIA 4J7UA 4E30A 1QV6A 2YFQA 4WLNA 1ONNA 1W8DA 5AYVA 1GPDG 4X54A 1WZEA 3UW3A 3QVSA 2FSSA 4IJVA 3TOXA 2NVBA 2WD8A 4OQYA 3EY4A 4GX2A 1C1XA 4QECA 4CV1A 5TT1A 2GUGA 2O3QA 4XEHA 2XPCA 3ZWOA 2FR0A 1KEVA 1RM0A 3F47A 1Z45A 4CM9D 3GEGA 3VPFA 3IP3A 1HDZA 1LEHA 3PTZA 2YW9A 3MJTA 2W8ZA 1WVGA 3B6ZA 3HHPA 2RH4A 5LDHA 4RZIA 2PR2A 1QR6A 3W8EA 4K28A 2ZTLA 4WUVA 5GZ1A 1ENPA 2EHDA 1AXGA 3GC6A 1UXKA 5FI5A 5U4QA 3H5RA 3Q2KA 4FJ1A 2OXIA 4NK5A 3NT5A 3OIGA 3ZN2A 1PL7A 3IUPA 4ND4A 3ZU4A 1ZK1A 5KKCA 1HE3A 3OHSX 3GNQA 4LSMA 1GD1O 1AN9A 2GZ2A 5G0VA 2O3TA 2DC1A 4XA8A 1YJ8A 1Y9AA 3KYCA 3ZW8A 4GKBA 2O4UX 5BNTA 3I9MA 3I9KA 4ZHSA 1PEDA 4GPD1 5FWNA 2B83A 2NVUA 4AG3A 2Q4BA 1R66A 4ND1A 1R4MB 3T4XA 4XZ3A 4QFDA 4WJZA 3NRCA 4XDYA 2B5VA 2JHGA 2UV8A 1V9LA 2H5LA 4CL3A 1DXYA 5EMHA 2ZKLA 1E7MA 4IS3A 3Q9NA 3TZ6A 1YDWA 2E49A 1EEHA 3V1YA 3AUAA 4CR7A 4XDZA 4MPDA 4GMFA 3V1UA 3VVBA 4U7WA 5L7TA 4GWGA 1NQAO 2DUWA 4O0LA 1CQIA 2RCYA 3I9JA 2CDCA 1B26A 1HRDA 4FR5A 4R16A 5IN5A 3JQ6A 1N7GA 3ICCA 4Y67A 1C1DB 1YQGA 4U6QA 3GEMA 4H7PA 2JCXA 3BXXA 3EGOA 5A02A 3S2EA 3VC7A 3EAGA 4EDFA 1VJ0A 2GO1A 4R9SA 1J5PA 3D4NA 5CFZA 4DBZA 3S2GA 4OYRA 4CMBA 5F1PA 3CPSA 3ADOA 4Y6RA 3JQ7B 2Q45A 4P8RA 1Z82A 4U8GA 5IZCA 2CUKA 5C7LO 2AQKA 3VPGA 1DRWA 1FK8A 1LXCA 3F3SA 4M55A 5CDUA 3H4VA 4AJLA 1KY4A 1T25A 3COSA 3H2ZA 3KSZO 3KO8A 1U2DA 3NJ8A 1K2WA 4ITUA 2RIRA 4OQZA 4S3MA 3HG7A 3MJCA 3R6DA 5DBFA 4EUHA 1CJCA 4UVIA 5CDSA 4YQYA 2C7GA 4P4GA 2VNSA 2XOXA 1A4IA 3O26A 3VZRA 3VKUA 3KSUA 2CMDA 1JDJA 5TJHA 4MVJA 1NHGA 3ITKA 3ZV6A 2R2GA 1DAPA 3D4PA 4YRAA 1WNTA 3EYWA 1E3LA 4BNUA 1IOLA 2JJYA 4E6PA 1KVSA 1ENYA 2FPIA 3WTBA 5I7FA 5I9NA 3PLRA 3AJRA 1ENOA 4Q3CA 3VH2A 4HFJA 3G3EA 5TNXA 3OECA 3SVTA 1O6ZA 4FB5A 1TXGA 4FFPA 4NBVA 1X7GA 5JCJD 4PGFA 3D3WB 3AUUA 2Q46A 1X13A 2FMUA 2PWZA 4HBGA 4J9VA 4QEDA 4OOEA 4DQXA 4QT0A 1P9LA 4JP3A 4BNKA 1Z7BA 4AJPA 3RQSA 2QHXA 4Z9XA 3PRJA 1HEUA 4XYBA 4PG7A 3HB4X 1UP6A 2GASA 1YXMA 4AJEA 1LLQA 3FBTA 5IN4A 4TVOA 1KC1A 2HAEA 4IXWA 1BWSA 3AU9A 4YJGA 5IZ4A 3OJOA 1DFHA 5G4KA 3BHMA 3PHLA 5THQA 2FN7A 3U09A 1LDYA 1T24A 2C20A 1SO8A 3KETA 3PIDA 3RFXA 3S2IA 1RYEA 3DMTA 1ZXLA 4O6VA 2D59A 3PYMA 4HUJA 4EJ0A 4BMVA 1B3RA 5ER9A 4DBVO 1CWUA 4OM8A 1ZEMA 3C1OA 1R15A 3F46A 5K6AC 1KVRA 2E82A 1YRLA 1LJ8A 4OL9A 1P77A 4BV9A 3FTNA 2A92A 4ZQEA 2Q1TA 3ONEA 4CLEA 4M1QA 4AICA 1F12A 3ETGA 3HJAA 2GN9A 3ZU2A 1ZIDA 2QW8A 3ZU5A 1HDOA 2RHCA 4J90A 3Q6IA 1PGOA 3STHA 1VKOA 3O03A 2CFCA 3AUSA 4CUKA 2POQX 4NBRA 3WS7A 1PIWA 1WZIA 3C7CB 3HDHA 2ILTA 2B4TO 3OA0A 1XU7A 2B5WA 2G0TA 2V6MA 3GF4A 3JQGB 3WX0A 2GNAA 1I5RA 5AXDA 3VZQA 1WPQA 4D41A 1QLHA 3GN1A 1JTVA 4N5LA 1HSZA 4BNHA 3ICPA 4NBUA 4KOAA 3GVCA 1LLUA 4K26A 2AHRA 5ITVA 1LNQA 3RVDA 3VH3A 4JJFA 3L9WA 3PYLA 3W1VA 4CM4A 1IY8A 1LRKA 4J7XA 3GVIA 1GYQA 1KETA 4BQRA 4NJMB 1VJ1A 2OP1A 1DC6A 5A9RA 4R4JA 2Q1UA 1TEHA 3DZBA 3NYWA 4DC0A 1YE3A 3UVEA 1SNYA 1PWXA 2TMGA 3BMNA 3MJVA 8LDHA 2GSDA 5AXCA 1C14A 1GPJA 3OJ0A 2P9CA 4B7UA 3WMXA 4WNCA 1VL8A 2DAPA 4N18A 3RBVA 2GR9A 3NX4A 1W4ZA 4CM8A 1JAYA 5G2OA 5TIIA 1H9BA 4EUEA 3OETA 1LDNA 3MJEA 3RASA 4DPMA 1A27A 3JD1A 4Y8VA 1ID1A 5DT9A 1NQTA 2VYNA 3JQEA 3JQBC 2F1KA 1F8GA 1KOLA 2ZTMA 2GN8A 4GAEA 3JQCA 1BXZA 1VL6A 3E5RA 4D0RA 4KDEA 1XQ1A 2OHXA 4BVAA 2YY7A 3FNEA 4FFOA 3ABIA 4CLOB 2DM6A 4PZDA 4FFRA 3K6JA 1QG6A 1I2CA 3IUSA 3QY9A 2QRLA 1GQQA 3FWZA 3F6YA 3DQPA 4BMSA 4PG5A 5L4SA 3P2OA 3DMYA 1AHIA 2YQ4A 3GN2A 1UDBA 5HA5A 3ZWYA 1CDOA 1X1EA 2HMSA 5TJ9A 4IDAA 1SB8A 4YT4A 2Y05A 3LF2A 4J1QA 1YOVA 1WAMA 4ZRNA 1SOVA 4TKMA 3JQ9C 3JTMA 2P5UA 4AJ1A 4IGEA 4ZICA 2NTJA 3W6UA 5TGDA 2HCTA 4RPLA 3TZKA 3WNQA 1X0VA 5L40A 2C5EA 3Q2IA 4HWKA 4QSMA 3MWDB 4A10A 2F00A 5KJ6A 4Z3KA 2D5CA 2Y68A 1QYVA 2FRDA 3QVWA 4OMUA 4TQGA 4D44A 1ISHA 1CF2O 2YFHA 3ST7A 1E3WB 2J3IA 5T64A 2EIHA 4H15A 5DCUA 3NUGA 4B4VA 1ZK4A 4YRDA 4D42A 1XIVA 3FPCA 1UDCA 4G65A 1JVSA 4YACA 4MVJD 1HE5A 3WYEA 3WMWA 3Q11A 3SLGA 4BNMA 2Q4EA 4M86A 4MVJH 1UXIA 5JAQA 1R4NB 2C29D 4E5KA 3PP8A 1GEGA 3ULKA 3ZI0A 3ZNOA 1B14A 1BW9B 2DLDA 2Y1EA 4YTEA 1ORRA 3RC9A 5DDIP 4M49A 4CLHA 1T4DA 4O5OA 3ZWVA 4RF5A 3GAZA 3PHIA 2EKLA 4BIIA 1T2CA 3JV7A 1ONPA 3WSVA 2GF2A 2EP5A 1XSEA 2HSDA 1A7KA 1R37A 3IQDB 4RLHA 2JL1A 2DTXA 3AI2A 4DUPA 2AQHA 5CEJA 1EQUA 1NWCA 1UAYA 4J0FA 4W6ZA 1GCOA 4IGFA 2OOSA 3IC5A 1KC3A 4XJTA 5A9SA 1MFZA 2VRCA 3PLNA 5BNFA 1DLIA 4UUMA 4DLLA 1I0ZA 4UREA 1YDEA 1YB4A 1A9ZA 4IXTA 4GH5A 4TRNA 4ZN6A 3I23A 3SJUA 1EVZA 4BKOA 5CG2A 4Q9NA 5L9AA 4E31A 1PJBA 2PKRA 3KYDB 1U5AA 5A5EA 4WLVA 1DPGA 4JGBA 1LC0A 3GVXA 3LF1A 2YDXA 3FNGA 5EPOA 4FOSA 4M87A 1NPTO 2V7PA 1NVMB 3ZHXA 3ZDFA 4JXKA 1ULUA 1WMAA 4RVFA 5TSDA 3VZSA 4CV3A 2DT5A 4XYMA 3NDIA 3ROPA 3C3XA 4XQGA 4J1TA 1U8FO 2ZB8A 4IDEA 3D0OA 3RWBA 1LC3A 3TL3A 2O4CA 3MOGA 1Z75A 4WEQA 5JNLA 3EW7A 1NVGA 4L76A 5AOVA 1EBFA 1ZK2A 1MA0A 3BTOA 2DPHA 3DOCA 4JQCA 1EK5A 1ZJZA 4RVSA 1QYCA 3KYBA 3TPCA 3HN7A 3H9GA 5DCYA 3A1NA 1UXJA 3ROMA 4EEXA 1XEAA 3GNTA 4CV0A 5KVQA 1A9YA 5TF4A 2PD3A 3EC7A 1ISJA 3UH1A 2Z1MA 4FOOA 3NTQA 3PI7A 4JCOA 1E3JA 1DDOA 3L4BC 4XKJA 4RF3A 5A1TA 3ZNNA 1TI7A 2NQ8A 1NTOA 1T26A 2DUUA 3PDUA 2I3GA 1UP4A 1NBOA 3TL2A 2B4RO 4C4OA 1VRWA 1SAYA 5J23A 1YVEI 3QVOA 4BNLA 4BB6A 1Y8QB 3PXXA 1JKFA 3O8QA 2QIOA 3QP9A 1J0XO 4J1SA 1LBEA 3ZV5A 3GY0A 4J16A 5TS3A 5JDCC 3L77A 2EGHA 4J4TA 1ML3A 2ZCUA 3L9XA 4OH1A 2Y1OA 4RV9A 2Q99A 4MIYA 3WFIA 4FC6A 4NHEA 2HRZA 2PD4A 1I33A 2OZPA 2XAAA 4FQ8A 3RCBA 4YJDA 3WLFA 1ZSVA 2VYND 1B3BA 3B70A 3LT0A 1BXKA 5JYEA 1R12A 1YBVA 3UCXA 2PTGA 2LDXA 5JO9A 4AJHA 3FN4A 1Y1PA 1AE1A 3AOEA 3T4EA 4XQEA 2OFPA 3DAPA 2EJWA 3E1KA 1I3NA 2GN6A 4QQRA 1BRMA 4FJ2A 3UF0A 4ZQFA 2O48X 3VOSA 3RAJA 2D3TA 1WLYA 3WBFA 1KERA 4W99A 1LDMA 3EVTA 1Q2XA 3P19A 3UAGA 3IMFA 3GA0A 5I8ZA 1YQXA 5HS4A 4MKRA 3LT4A 4WEOA 4EGFA 1LI4A 1TA4A 4L75A 1T1RA 4JP2A 4XIYA 4YAGA 2QRJA 3PWZA 4FPXA 2QRKA 4XYLA 1GZ3A 2J6IA 4AJJA 2EKQA 2H6EA 1B2LA 3QW2A 1M76A 2VTDA 3VZPA 4CLRA 5DCWA 5U9CA 3TOZA 5EQFA 4C7JA 1VSUA 1C1XB 1DIRA 2PD6A 4FS3A 4I9UA 2QYTA 4LRTB 1OZAA 5AXBA 4B7XA 1HDXA 1NFRA 3ZWAA 3ZH2A 5CDTA 1BGVA 1SEVA 3C24A 3BIOA 1U3WA 5L51A 2DPGA 1FDWA 1JWAB 4WCDA 1ENZA 4E21A 2AE1A 1SCUA 3E9MA 1LRLA 4DQUA 3F5QA 1DFIA 3K96A 3OEYA 4JIGA 1DLJA 2JFHA 1E3IA 1T2AA 1P44A 4RVGA 1DRUA 1EE9A 1I24A 2C54A 1PTJA 2Y99A 2HO5A 4Z9FA 1E5QA 2VT2A 2J8ZA 1VKNA 1S7CA 3BZUA 1PZGA 5IF3A 1YQDA 1X14A 1IPFA 2J5RA 4YR9A 1SPXA 1PR3A 1JA9A 4RCVA 2UAGA 1MC4A 3ANLA 1MV8A 1B7GO 4GGPA 4A5OA 1QORA 4QXMA 5C7IO 3DZIA 3PK0A 5CDGA 3W6ZA 1ZK0A 1ZW1A 2NVUB 2FZEA 3F4LA 3DBHB 1U7HA 5ICMA 4J4HA 4OXYA 2VRCD 2I5PO 1H6BA 2C82A 4YJFA 4B4UA 5GMOA 4J91A 4JBHA 4D46A 1PZFA 4MVJE 5AQ1A 2GGSA 2NTVA 5HS6A 1R0SA 1FDUA 3ZWNA 3D5TA 3KLMX 4YA6A 1X15A 3I9NA 2JD2A 4MP3A 3ZU3A 1OC2A 1P31A 3DOJA 4NI5A 4U0JA 4ALJA 4YVFA 3WR5A 2BMAA 2P91A 1N5DA 3INGA 2VWHA 1O5IA 1UXHA 3EZLA 3MTGA 4PN3A 3DFUA 4CQLA 5FI3A 1KS9A 2IEDA 4PIVA 1JAXA 4W7HA 4I5GA 4XGIA 5IJZA 1HF3A 4BNFA 3HADA 2O7SA 1JN0A 5DOVA 2AEFA 2NWQA 1JWBB 2DKNA 2NLOA 1XELA 3EDMA 3ZWMA 5JXWA 5ITWA 5KJ1A 2VT3A 2B37A 3Q0EA 3E8XA 2P4HX 3AM4A 1Z6ZA 3OF2A 1FXSA 3OIFA 3CXRA 4IM7A 4IIVA 3F5SA 3RUDA 1HLPA 3WDSA 2E4AA 4L4RA 1WDLA 4N7RA 3TNLA 1DIAA 2Q3EA 3JD0A 3O9ZA 1NFQA 2Y67A 2EGGA 2NM0A 3U3XA 4OO3A 1Z7EA 4PLPA 2ZYDA 4Y6PA 4DXHA 1W73A 1K3TA 3UUWA 4RORA 3RJ9A 5HBRA 1NVTA 1TLTA 1SEPA 5EERA 4CQMA 1E77A 4D7AA 4OJNA 4BO1A 5A3VA 3LZ6A 1U9JA 4CMEA 1GU7A 4CV2A 1MGOA 3PGJA 4LMRA 4W9NA 4BNVA 1DJNA 3WYCA 1V3TA 1H93A 1AUPA 2D8AA 4A27A 3AI3A 4BGVA 2VWGA 3CIFA 4AVYA 2D0IA 1NQ5A 3DONA 2UVDA 3ENKA 1TT5A 5HM8A 2AEJA 2HMWA 1ONOA 3ZHZA 3MTJA 3GH3A 3DZJA 5KWEA 5JAIA 4M89A 2WEKA 1P33A 4MKXA 3DOOA 4ZGWA 1PL6A 1PZEA 4Z0PA 5JS6A 3LDHA 1IZ9A 2Y66A 4NFYA 4D43A 4E3ZA 5C7OO 4I9HA 3B20A 4MVJI 3H3FA 3JYQA 3I4FA 1NAHA 1KEPA 3RIHA 4IDCA 5ENVA 4WLEA 3AM5A 4YJGB 5F3RA 4DWVA 5L95A 3VTFA 3V2UA 4AJ4A 1XQ6A 2ZTUA 4BNZA 3QIVA 1GFSA 3QWBA 4YT2A 2O2YA 3DBLA 5HWSA 1NNUA 2IZ0A 4XB1A 2DTDA 1PJ3A 4TRRA 4O59O 4YCAA 2O3UA 3GGOA 1W6UA 1DRVA 2HK9A 4J0EA 2OBNA 1H2HA 3OQBA 5FFFA 4HFMA 3TRIA 1Q0QA 5KNLA 1G0NA 1Q7CA 4H16A 1ISFA 1TT7A 1GDHA 2AG5A 4FFLA 1ZZEA 2BHLA 5F1KA 2R00A 4MP6A 1J6UA 4UEKA 3DZFA 2NQTA 1DC3A 3NKLA 5IXSA 5JC1A 1KYQA 3IIEA 2HK7A 4EZBA 4HP8A 3GRPA 1E1MA 3AUTA 4Q3NA 4BB5A 2WE7A 1LA2A 3OICA 4PFJA 4UVEA 3A4VA 2GN4A 1HSOA 1EVJA 3H2SA 5F5LA 4CPDA 1OC4A 4A26A 1O95A 1M67A 3P7MA 4YB8A 3CSDA 5TQVA 2JD1A 3W8DA 1H6DA 4UVHA 2JAHA 4IJKA 3OEWA 1Z74A 1HZZA 1PQWA 4TROA 3F4BA 3CUKA 4QX6A 1LTHR 4E4YA 3ZNQA 3H9QA 3DDNA 5H83A 4CMJA 3CZRA 4LCJA 3EVNA 3HNPA 3C85A 2A4KA 4NNJA 2PH5A 3HZZA 3JQ8B 5IZCC 2HMUA 4R68A 3BMNB 2PH3A 2ZYGA 2CF6A 1YH3A 2W98A 3HWRA 3V8BA 4Q3AA 4WPGA 1XLTA 2YV1A 2X0JA 1FF9A 1T4BA 1FMCA 1ADCA 1Y9EA 3ETEA 3GUCA 4YEDA 4ALIA 4CM1A 4WKGA 1ZMOA 1PS9A 4LVUA 4ZQHA 3R3SA 1Y81A 1C0KA 3GNSA 1P1KA 1UDAA 1Y5RA 1YL5A 1XWFA 2GZ1A 3NDJA 3PQFA 5DNAA 1B8PA 2YZ7A 2VZ0A 4BKRA 3JD2A 5K0ZA 4O63O 3F9IA 4DA9A 3KSDO 2I76A 4PLWA 3T7EA 3B1FA 2YHIA 1E1NA 2P68A 1YO6A 2JD0A 4NU5A 3OFSA 4K6CA 3NT4A 3CMMA 4IIUA 2ZCVA 3QE3A 1C0PA 4BO3A 1F0YA 5A9TA 2Q49A 1J4AA 4OSPA 1XU9A 4LMPA 4INAA 3DZGA 1JLLA 3ANMA 4DRYA 3PJEA 4EJ6A 4EJMA 4DREA 1MC5A 5KCZA 1ZK3A 4BNWA 1R0KA 1UP7A 3G1TA 1GTMA 3KVOA 2X7HA 2PGDA 2XXBA 3JQAA 3K8ZA 3RBZA 3LT2A 4D45A 4EYEA 2VCYA 3HQ4O 4MVJP 1HYGA 4RPJA 4XGNA 2W2KA 3H9EO 3GZ4A 2VZ8A 1HETA 1I8TA 2O3RA 3INRA 4RDHA 2I65A 3GFBA 1PZHA 5ADHA 1YOVB 5FEUA 1I36A 3DTYA 3RUIA 3VKVA 1NFFA 2ZQZA 1E3EA 1LSOA 1DAOA 4B7CA 5AVOA 4UUPA 3DMTC 4MKZA 5T8KA 5TLSA 1F06A 1YBAA 2WMDA 4R69A 1MP0A 5DBGA 4E2YA 1PJTA 3ADPA 4HFRA 4NMHA 4R3WA 3I9LA 3DHNA 1C3VA 3DZHA 1YB5A 3KHUA 1PX0A 3PIIA 4E2XA 1I10A 1RWBA 5THKA 4K9DA 3ROQA 4CQMD 4II2A 2B69A 3MJSA 5GZ6A 1X7HA 3N58A 1UZNA 4GL4A 4IMPA 5COBA 1KEUA 1SZJG 2B0JA 2YJZA 4ZRMA 2VYVA 3GR6A 3BHJA 4IDGA 2QZ9A 3GOHA 3D4OA 3JD4A 3SX2A 1MFPA 3TN7A 2VWQA 1KEWA 1R6DA 2IXAA 3FPLA 1X0XA 2Q2QA 3W4JA 5JMWA 2BGMA 1RM3A 3EHEA 3AY6A 3BTSA 3QJ5A 3DBRA 2WYVA 4E2ZA 3DWFA 1PGNA 1ZBQA 4BGIA 1DO8A 4CODB 1BHSA 4DYDA 1VJTA 4MDHA 4BO6A 3FF4A 2AG8A 4LK3A 4TMFA 2Y0CA 1CQJA 3ROKA 3OJLA 3F1KA 3D3EA 4XYGA 1WP4A 1ZO8A 2AW5A 1KY5A 1RM4A 2GPTA 3BMCA 2VHVA 3K30A 2EW2A 3QQPA 5DOZA 2TMDA 3BAZA 4JN6B 2I6TA 4LSWA 5A9SB 3ANNA 2W2LA 4JBIA 5DZSA 4BGUA 1DIBA 3IAHA 4DC1A 1NR1A 4R51A 3S2FA 1HE4A 4CMCA 2CF5A 3W8FA 3KEQA 2W90A 1PJQA 2G1UA 3GRKA 3PFWO 4CM6A 2EJVA 3TQHA 2A9FA 2D2IA 3G79A 4GLOA 2YYYA 2I9PA 3W4KA 1K89A 1PJ2A 4TVBA 3T7CA 3JYOA 3UFXA 3PWSA 4CR6A 3QVTA 4DIBA 1R0LA 4GKVA 3RC1A 4YBZA 1N92A 1UUFA 4BNNA 3X2EA 4U0KA 3X2FA 2GRAA 3H5AA 3KTDA 4AJOA 9LDTA 2PFGA 4NZ9A 4B79A 1LQTA 3DBVO 1I3LA 4BO2A 1BMDA 4Z6KA 2NSDA 3G1UA 1ADGA 5TC4A 1F14A 4YPOA 1CERA 5BSGA 4ND2A 2RAFA 4M8SA 2X8LA 3E5MA 3GPDG 4FDAA 2DFDA 1Q1NA 3TZQA 1T2EA 3GZNA 4ALMA 1E6WA 4LVCA 2X0IA 1I32A 1IHXA 4EEZA 1BG6A 2AMFA 2X86A 3K5PA 3L4SO 4JROA 3WG9A 1D3AA 4DGSA 4UUNA 3TZCA 1QYWA 1DSSG 3H5NA 1GYRA 5BR7A 1NM5A 4GX0A 3I5MA 3WTCA 4DIFA 4HADA 1DEHA 3EUWA 1GEEA 3R1IA 4BNXA 3NGLA 1NQOA 4NPCA 5B4UA 5EIOA 3LC2O 4UVDA 2BI8A 4ILKA 3H6KA 3OQ6A 3L0DA 1P1JA 3UCEA 3O8QB 3FHLA 1DC4A 2D1YA 5L4NA 4PG4A 5EL0A 2Y1FA 4HFNA 1HT0A 1KVTA 3RUCA 1P1HA 3RUHA 3R0IA 5T5QA 4DLBA 1YKFA 5B37A 2X0RA 4RF4A 1N2SA 4ND3A 5ENDA 5I7EA 5IG2A 3M1AA 1BXGA 4U5QA 4MO2A 4RVUA 1GL3A 4NR0A 3UICA 2P9EA 4L8VA 1UJMA 2HQ1A 4E33A 3GG2A 1U3VA 4XGKA 2E37A 3QWHA 4PRLA 5EQDA 4BNIA 1A72A 4JK3A 1X1TA 2ZQYA 2X9VA 3WGHA 4IY1A 4OOFA 4XYEA 3C7AA 4DQVA 2DTEA 4IZHA 5KJFA 1RM5A 2HKIA 1SB9A 1I3MA 5BQFA 4UUOA 4ZU3A 3O38A 4D3FA 2IYOA 4OXNA 1AGNA 3JQAD 3RKRA 4RZHA 2XF8A 1XR3A 2O3JA 3UGKA 5CG1A 1XGKA 2CVZA 1NPDA 2WYUA 5G0WA 1GADO 2WD7A 2X23A 5L7YA 5JLAA 2E6UX 3FR7A 4DTIA 6LDHA 2O23A 1F8FA 1R16A 4BKPA 3A06A 4CLRB 3GDOA 4A2CA 2YQ5A 2VZ9A 1GYPA 7ADHA 1F17A 1IB6A 5KJEA 4CLXA 3MOIA 4RVHA 5CAEA 5DBIA 3MEQA 4WE3A 3WGGA 2AXQA 4B4OA 2J3JA 5H82A 3L6DA 5B4VA 1I01A 4JX8A 4OSOA 3JYLA 1GCUA 3IJRA 1B0AA 1DB3A 1JQBA 2PGLA 2Z5LA 3PJFA 5F5NA 3WQQA 1N9GB 4BNYA 3WNVA 3ZGYA 1VE9A 1PWZA 3GUYA 2HDHA 3PZRA 1E7WA 2VYVD 1P0FA 1VPDA 2OP0A 3ORFA 2IODA 1KIFA 4P22A 4WCFA 2ZYAA 1H6AA 4KTTE 4F6LA 2QYSA 2ZATA 2FP4A 2UUPA 3G49A 1FDTA 2GDZA 4WECA 4Y98A 3BMQA 2VHXA 1V35A 1U1IA 1FDSA 1Q7GA 4H3VA 4K6FA 2IDZA 4LW8A 5BSEA 3AU8A 3V5NA 5L53A 1E7SA 3N74A 3C7DB 5FF9A 4ALNA 2EP7A 3PZBA 4GLLA 3C1TA 2WTBA 2GLXA 2W2LD 4YJFB 3FD8A 4AJKA 2CD9A 2IZ1A 3GDGA 3TJRA 1Y8RB 5CP8A 3L6EA 3WGZA 2PZKA 4D0SA 4IDFA 3TFOA 3A28A 3I52A 3FBGA 2R6JA 4GVXA 2VOEA 1LRJA 3VDRA 1I30A 1RJWA 3TWOA 3WJAA 3DB2A 2IEBA 4CQLB 4C7KA 3UXYA 1XYGA 4L74A 4KWHA 5A5FA 1YB1A 2W4QA 3RBXA 1LUAA 3VH1A 3NTOA 1X7DA 4DVJA 1BVUA 5H81A 4YAIA 3WGYA 3FRJA 3DHYA 1PQPA 2AA3A 3I1JA 4Y9DA 3S8MA 3WQSB 2QX7A 2Y0EA 4F45A 4JJIA 5JY1A 4NU6A 4L73A 1Z73A 1DOHA 4Z0TA 1JW9B 3GGGA 3M6IA 4ZA2A 2NVWA 1P1FA 3HUDA 3PJDA 4OXKA 5G0UA 3AOEC 5I7SA 8ADHA 1CYDA 5JMPA 3ITDA 4XQ9A 5U1PA 3TF5A
chains in the Genus database with same CATH superfamily
3JD3A 1CRWG 1UZLA 4ZYTA 1H1TA 2AFIE 1TUIA 2WSYB 2YHUA 3TI9A 3G23A 2HLPA 1WVMA 2JAUA 2QVLA 4HMQA 3CINA 3WLEA 1NNSA 2HCRA 3UJHA 1ZA2A 1L5VA 1EYZA 3BJZA 1FB5A 2PX8A 3QKIA 3R9IA 3NDPA 3K9GA 1R5BA 5CYGA 4EGAA 2PG3A 3A25A 2O2XA 1U65A 1C29B 1YQQA 4D0LB 3K9BA 2OLJA 3FPGA 3WXBA 1PE0A 2XUPA 3WL8A 4M0CA 5CYOA 4KMSA 3RKUA 3LC7O 4MR9B 3E70C 5G4LA 4BO5A 3AJEA 1CY8A 4YQEA 5KQSA 4ID9A 1L5QA 5GM1A 1XWIA 3VI3B 3PFFA 4IDBA 3QW4B 2ZRNA 1J7JA 2X8BA 1H4TA 2ZTVA 3ENQA 3NJ4A 2OMEA 2A4MA 2WE8A 5F21A 2ID9A 4AG5A 5CDHA 3JSXA 3QI2A 4R1MA 1R6TA 1WU8A 3FSEA 1OBFO 2OR3A 3LHIA 3U4CA 1B73A 1GA4A 2HK6A 5IC5A 3D8TA 2IVFA 2BFCA 1VLHA 2PL9A 4XE5A 5FPTA 5JZVA 4KRYA 2C3MA 5MN6A 4P7JA 4TLDA 5GV7A 1WCIB 1AKMA 1L5RA 2EV9A 1LPAB 3D2CA 4OLHA 1Q44A 5A0VA 3WYBA 2WQ7A 2SCUA 3OZWA 4OHUA 5KMGB 4R1OA 1M1UA 2VUSA 1MO4A 4OU4A 4YWHA 1LGYA 2YXNA 1AZLA 3D31A 3H2GA 2Q7XA 4DJJA 3FLMA 1ZRNA 2JEOA 3QFTA 2RH5A 1PTJC 1U5BA 4JUBA 1ORDA 3R0ZA 4A8JA 5LVAA 5CA1A 5JDIA 4ZOLB 5DWDA 5KTSA 1W46A 2WIBA 3DBLB 1FTSA 1UAGA 1VCOA 2ZB3A 2C94A 3R23A 4IFBA 2C77A 4ZVTA 5CVJA 2Q5FA 1ZIYA 4HVTA 1TFUA 2Y93A 1EFVB 1T8TA 3LTEA 1NQXA 4XRRA 4YASA 5LQRA 5PGMA 2QAJA 4FYJA 5T67A 4EAQA 3NWJA 1DBIA 3F6EX 3QTBA 4O4IB 1EGMB 2XCTB 1G5IA 4KLNA 4EAAA 1F2TB 4NZYA 2X9GA 1IATA 2XI4A 1ZLYA 2GAAA 1F6WA 2OV8A 5IDWA 1C7QA 1PR9A 2PRKA 3ZDRA 5LFAA 3N59A 2X3YA 4ZYLA 3DXXA 3HYSA 1R9NA 3SEAA 4W8OA 3PDWA 1K7EB 2WFZA 4XIGS 5GONA 1SHZA 4LC9A 2I3ZA 2OKGA 4G36A 4F4HA 3MJFA 2VQ3A 1FNSA 2OGWA 4UNSA 5JXIA 1Z4JA 5EINA 2JRLA 4G0XA 5KPDA 2JGKA 5K03A 4NE2A 3WGTA 5CVCA 1IN6A 1VPVA 5FPKA 1FSGA 1UKVY 3AXTA 2FPWA 3D6TB 4FDMA 4TV9A 1M1YB 4NFHA 3NBKA 4CEJB 1M2GA 2V4UA 3CF4G 1TEXA 2W8BA 1EUCA 1E7RA 2GYVA 3AOGA 4H0CA 5JHHB 3BE8A 2PZMA 2DQ4A 3EQ9A 2IOQA 2PUGA 4FYXA 3VO1A 1JWLA 3K8QA 7AT1A 1AG9A 2GF0A 3BEDA 3ET5A 3H05A 3A4TA 5AXAA 1T9DA 3RYHA 4ESVA 3VPDA 3KAJA 2BL4A 4N01A 3ILYA 5C18A 1T0JB 1T10A 3GUHA 3STWA 1RPJA 3ENVA 2YV2A 2WZBA 4U2BA 1LB1B 2ODTX 1Q95A 1IAVA 3MQ4A 2ZFUA 1ZGZA 3QVKA 3UV6A 1NQUA 4D3SA 3X3HA 4R0NA 5CYFA 5AVXA 1DWUA 3I6QA 1T8RA 3TX2A 3VJRA 3L7MA 4Q7EA 1RDFA 4L08A 1XKXA 3RUFA 4EF5A 1SQSA 1NL3A 5F51A 2G77B 3ZBTA 1J07A 1S2MA 2I66A 1QZXA 3NEJA 1EZZA 2GZAA 2QLTA 3OCUA 2IGBA 2FPIB 2WIJA 3O92A 4N03A 1GZ7A 2M9MA 5EJIA 4XGQA 1C0LA 2PWAA 3KWFA 4V1CI 1U2QA 2H1HA 4LHXA 2OHVA 2BFPA 3PFCA 4MVJF 3WVNA 1PQUA 4NV1A 4NMLA 3ABZA 3GQVA 4JC0A 3HJRA 4HATA 2JZNA 4HWTA 5BURA 1B42A 2D4AA 3PUKA 1VCIA 2Q2WA 3DP9A 4R71A 3RFVA 5TT0A 3U4IA 4DDMA 1JQEA 1ZQ9A 2JIQA 4XWKA 1Z06A 2ZRFA 2F1HA 4I1RA 4OD0A 1QZ3A 2FB9A 2ZJ0A 3GV0A 3HA5A 5T41A 2Q7DA 1FFYA 4S2UA 2AVDA 3EOBI 1ZH2A 5EXPA 3L1JA 3GOQA 4CMIA 3DE2X 3GDHA 5JNVA 5D6NA 2YVAA 1QNFA 2BHRA 5CURA 4HNGA 4MGYR 1EHIA 1P62B 4ALLA 1T6NA 2CZCA 4JD5A 4DANA 2VP6A 4BLRA 3CU5A 2WTEA 4ZAGA 1EK1A 1IL0A 1JYEA 4J0CA 5CXXA 2ZIZA 3Q7PA 2ZCJA 1CR2A 3WMGA 1H5NA 4UZEA 3E8SA 2QZJA 3ZVKA 2BZ1A 2RGNC 3AXSA 3NONA 2VWPA 5IMBA 1UANA 3DE1X 4FI3C 1YHZA 3TTSA 1RBQA 1U4NA 4H6WA 4LJ8A 1EZ4A 3FUWA 3GT0A 2HUNA 1YR9A 2ZU6A 1DRJA 2W2KB 2WJPA 3W5HA 5IASA 1B8UA 5J1TB 5GIPE 1KH2A 3MINB 1HQDA 3OQNA 3LQ2A 3QY0A 2C2MA 3KX2A 3LWZA 5DEOA 3BDIA 2VPQA 2FX3A 2JKVA 2ZJ6A 4G5YA 4JHLA 4EA8A 1EWYA 1QBGA 2VSFA 3HBLA 3KUDA 4ZIRB 3R5FA 5EGNA 4NY1A 3CLVA 4E94A 3VNUA 5EOVA 1F60A 2ZUWA 3KB8A 3BJRA 4U4AA 1HE2A 1IULA 1RAAA 2UUOA 4BX8A 5BN5A 4NCKA 2X8JA 1N4AA 4RBNA 3NMUF 1EK2A 1K08A 2WJ3A 1QO9A 4W7IA 4YMWA 3U3MA 4D4GA 3U2QA 4G9EA 3BTVA 4QPNA 1GPH1 3H4IA 3PNVA 2CCJA 2PZAA 3CRQA 4G56A 2P9BA 4I55B 4X8OA 4XPIB 4F46A 5CFMA 2HJVA 2QG4A 1O94D 1UOOA 3I8XA 2HFJA 1Z18A 3I3SR 3LLUA 3WQRA 2Y0PA 4Q3LA 4XX1A 1ORWA 2GEKA 1T6ZA 2O0MA 3IAEA 1J70A 4HSGA 4MI9A 4O29A 1GTL1 1TZCA 3EGDA 4RA9B 3H9UA 4EHKA 3TUZC 1UKEA 3DF7A 4NXMB 3HPRA 3OCVA 1E0DA 4IF6A 1U3TA 3GJ5A 1IXSB 1D9XA 1H05A 1JPVA 4NBTA 2VQFB 2Q6TA 4DLNA 2O2ZA 3ECAA 4RD3A 1I7NA 3VTKA 1RMQA 1T9KA 4QZVA 4F3TA 3TRJA 4F5YA 4MQUA 1RT9A 4XIJA 3UJ3X 4AL4A 3EMKA 5A4IS 4KRFA 1PU2A 3DTVA 5A7FA 1QZZA 4P80A 3GVPA 2C9BA 4YAKA 3LQFA 1XMSA 1FYEA 2FX5A 5C31A 3LXUX 5ADWA 3REOA 2SNIE 2DQYA 2JC3A 3CR7A 5COAA 5AHXA 4AXXA 2QMQA 4BMCA 2R65A 1R9JA 1RP1A 2OO5A 2QPLA 2YWBA 2Z95A 4LV8B 1F48A 4ZD6A 3NFYA 4XRGA 3X1ZA 4IXMA 1HZZC 4G0ZA 3UK1A 2ZVDA 4DUGA 4TZTA 3IE0A 4N3AA 2X41A 3E9QA 3RJTA 3VVCA 4QWWA 4N47A 2OQIA 3CJTA 4BBZA 2EX0A 1RYDA 3GZJA 4K0RA 2HI0A 1FP4B 1QTIA 5LZ9A 1FVOA 2QM7A 3I2FA 1P4GA 5FYDA 1SCQA 2UVPA 2IH2A 1D1TA 5KSYA 4P7BA 3O75A 2I91A 2Z43A 7MHTA 2HEIA 4OK5A 3LX5A 5B4TA 3QVJA 4B3FX 1LPMA 2QNRA 5K0SA 3CUSA 1LDBA 1SUWA 3TEJA 5GVRA 1W5AA 4S1OA 4ND8A 4M54A 2A30A 1QBKC 4H18A 3D0QA 1UMDB 3ZPXA 1RWNA 4QFCA 2ANBA 1LBHA 2PK3A 1D07A 2AG1A 1NXWA 1E79A 1NSYA 1K3FA 2H07A 2OE2A 1H0KA 3JYHA 1DC5A 4NH4A 1S89A 3SC2A 1I6KA 2EWMA 2ZS9A 5A3JA 5HTOA 4LXXA 1II8B 5F9HA 1ZRMA 1FY2A 1M7HA 2PJZA 1WBDA 1V6SA 2XEXA 3E58A 2XKJE 2O0HA 4C7XA 1ICEA 3T1VA 5ALLA 1T5IA 2V1XA 3IBTA 4M21A 1M6HA 2BH9A 4GI7A 4BO7A 1E6UA 1FL9A 3HY6A 2XCQA 3OZFA 4AF8A 4ETWA 4BGDA 3EPHA 3G1WA 3QUQA 2F8LA 1E5XA 4N1AA 3HEMA 1FQKA 3X1DA 5A04A 2ZZNA 1G8KA 2NU6A 3A3KA 3TR6A 4NBWA 3RVPA 1R4MA 3CPJB 2R85A 1YACA 1FMFA 3S55A 1PJSA 4B5LA 4MR8B 3G8AA 1NN1A 2ATIA 3GEHA 1V8PA 2VJQA 3E82A 1U7PA 1ZSYA 2P6UA 4G2NA 1JFTA 1OYOA 4Y9TA 4KWCA 1SBQA 4HMPA 1L1RA 2Z2ZA 4XWYA 2FMTA 2PRJA 5L3RA 4RLSA 1U02A 3TR5A 1Y9DA 4XQ0A 3RIGA 1GQFA 1G20E 1CP2A 3AF3A 2JVJA 1SD1A 2O50A 3OU2A 2OYRA 3GPCA 3ASYA 5J2UA 1P7WA 1C1YA 4JZYA 3C3JA 2I6XA 3WIUA 1U5CA 5CIYA 3A9WA 4W5HA 1U94A 2ZJ4A 4ILEA 3SE0A 1YC2A 3FW1A 3U49A 1KBZA 4QUKA 3H18A 4Y9RA 4PG6A 3GAMA 1A4UA 3DE6X 4IIJA 4AT1A 3REQB 2EBWA 1P74A 2GARA 2YVLA 1UDRA 3AL2A 5FL7A 2WFAA 3JARB 4HWGA 1DCFA 1WMSA 1DMRA 1EKXA 5CDFE 4YI5A 1QVRA 5TEWA 3EF1A 5KTNA 4R2XA 1KDOA 1PT6A 2WU8A 1M6WA 3LW7A 3PQ6A 4XWGA 1QZUA 5HQJA 1HWYA 3LKZA 1XRPA 3UAXA 4GPIB 1BU5A 2NV6A 3KQMA 3OZRA 4PLFA 3MUEA 5CB6A 1KYXA 3D7LA 5ESRA 5KYYB 4NIMA 3RG2A 3SEFA 1UPXA 3HB5X 2X58A 1TA9A 4PLCA 2CLKB 2GXUA 1JNYA 2QSZA 3NEPX 4Q16A 2I8LA 3B3GA 1N5IA 1ZM3A 3H1EA 3Q6NA 4NSNA 4FFVA 3RYIA 1JEYB 3IOYA 1G2PA 3VR5A 2R5NA 3BK1A 4H3KB 5L6LB 1JH9A 1BJTA 4QPZA 4WASA 4P33A 1RZUA 4Q15A 2DVMA 2VO1A 3RABA 3VPSA 1TGYA 4PRYA 5FPPA 2BTOA 3AJ8A 2WOJA 4EPVA 3A1SA 1I1OA 2Q8QA 3BSSA 5JFOA 4UBNA 3T5BA 4DBLE 1NE7A 1Q0LA 4PRKA 1XKQA 1HPLA 3O91A 4H4EA 2J7PA 3TSCA 1SQ5A 3GJQA 2QRUA 2VJMA 3DG9A 4J1NA 1JIUA 1P1CA 4IGKA 3VKGA 5CMLA 4AROA 4Q4DA 4K05A 3FNQA 1GQRA 1XOIA 2ZLBA 3GJTA 5DYTA 5IAAA 1EFUA 3W2GA 1ZKDA 2W58A 1L3BA 2A5LA 3AFMA 2ES4A 1C4KA 1BXRA 2DHDA 3MWYW 4NG5A 4XUCA 4W5OA 1WBBA 3D1JA 4Q18A 3C6YA 5BT9A 5HZKA 1GV0A 1KMCA 4X41A 4OHYA 2O2SA 4P9NA 1CNFA 3FVWA 3L0YA 3AEQB 3ZHVA 1QU3A 3ENWA 3T3EA 5A9RA 2FWMX 2PTHA 5DB4A 2Y1LA 2IYZA 1EMDA 4OGWA 1OYVA 1O58A 1PJZA 1EFHA 3IAUA 3QPWA 4TL8A 4J1JA 3CR3C 1DDIA 3Q3CA 4IG9A 2VHWA 1NVAA 3N0XA 3TUIC 2QVCA 1KEEA 4CM5A 3P9YA 4ECAA 2IXTA 1FW8A 3GK3A 3ZHBA 5K3BA 4YAJA 5HDBB 3JQ9A 5AW0A 4IDUB 1DUVG 5IUNC 1PT8A 2CFOA 3M5WA 3QELB 4BMXA 1PP4A 1WL8A 4XUDA 3STVA 2WT8A 1L1FA 3IO3A 4I8IA 5BPHA 4HHEA 1VL0A 2G0NA 2Y76A 1ADFA 4Q4CA 7GPBA 3PF9A 1BE8A 1MEOA 2YJ3A 5EJ2A 3U7HB 4QYXA 1UODA 1WX1A 2HHAA 1BDJA 3DA8A 1F0PA 4JKIA 4ARCA 3F96A 1Z0IA 1M8FA 4INJA 3CVOA 5B58C 1X9IA 2V45A 2A94A 1D4OA 4PX3A 2IV3A 3WRYA 4XAQA 3KELA 3U9LA 3M33A 3PITA 1HC7A 4WCFB 3GAFA 4P4SB 5AOCA 5K0LA 1ECCA 2VJNA 4UNRA 3B78A 3W5BA 3RUEA 2GESA 3FGOA 2PS3A 3C6KA 1JX6A 5FTWA 2O7QA 3DTVD 2B78A 3DTTA 3OAAA 3PICA 4JLPA 3JRWA 4NJOA 3UGTA 3K9FC 5AJHA 3QOXA 2I2AA 4RK1A 2CFTA 1EWKA 4J29A 2QTZA 3RIMA 2ZIGA 4B3JA 5AVSA 2GYYA 2BZ0A 1MRSA 2AWOA 4LXHA 1YIAA 1S8FA 4YJ3B 3MJ4A 3P9XA 2WAMA 3B6KA 5BUQA 1QQ7A 2JGAA 4J8PA 4B6SA 2FLWA 2CV0A 4XJSA 1H4VB 3I5UA 4DUGD 5CJPA 1BMFD 2B35A 2ZK7A 4YDRA 3LUGA 4XD2A 4XWTA 5BSTA 2BFBA 4N5NA 3R3JA 3UTDA 1BS2A 3T5PA 4HMOA 2X0NA 4ZMRA 1L5SA 2VJYA 2R96A 4IDPA 2ZE8A 4N6OA 4AYXA 3ZDQA 2G80A 1NM5C 4UBMA 4PLHA 4A6XA 4EYOA 2BGLA 4HY3A 2AN3A 2B4AA 1SPBS 3JYNA 3EXHA 3EWNA 4HGYA 2PX5A 1D2MA 4MUMA 1AUVA 1IZ0A 2DKOA 4B3HA 2Z2IA 3LWDA 1R00A 4WNIA 5KVCA 2G9RA 2PY6A 3B6IA 3LPAA 3EXG2 4G85A 2YCLA 5J4VA 5B30A 1H5QA 2IDJA 2JFPA 1RD4A 5EJ9A 3U7RA 1XTQA 3DMNA 4GKAA 4LN1A 4O4LB 2RHLA 3FUXA 4MRVA 1XVIA 2DHQA 2JFZA 5EIAA 5SV2A 2NUAA 3OQVA 1ZOPA 4C05A 1HGXA 2M1XA 1QGUB 4DQKA 1XZNA 3I9V1 1SR8A 3M82A 1K75A 3B53X 1OAAA 3WFZA 1HYBA 2H08A 2LDBA 1GUDA 2HHHB 4DM4A 4EOGA 3RK0A 3TDKA 2IELA 4EW6A 3IAM6 1GUYA 5KYTA 1VRCA 3WIEA 3H2YA 4D99A 1PQYA 2ONCA 4JOCA 1XZDA 2JB9A 1SKQA 3FCCA 3I8OA 3SK0A 1FFXB 4B43A 3EEOA 4WKCA 5MF6A 4XUGB 3FCAA 4AYTA 2FKNA 3BWCA 3OCWA 2EEPA 5AHOA 1MB4A 1NV9A 4FEGA 4D0GA 4YPVA 3DZKA 1VSVA 3SC4A 3T9BA 1G4HA 2P5TB 3MRXA 4U39A 5ELLA 1P4JA 4LDJA 2JLQA 4JBWA 5DSZA 1Z4OA 2J5KA 1C0EA 1PGQA 2ON6A 3AHCA 1H22A 3DZ8A 1Y6JA 2PWYA 8MHTA 1RQ7A 1QG4A 4KRXA 3ORYA 5BXYA 3ETHA 4JU8A 2I3AA 3WSWA 1KAGA 1XMQB 3L8DA 3OJEA 2KS6A 3BSWA 4BUCA 4L0DA 5JSZA 1GR0A 3C4JA 1O97C 3FJOA 5F52A 2ZTHA 4AP6A 3LKVA 4OX9B 1CUEA 3HCDA 2NP7A 1QANA 1RXYA 1WULS 1CY7A 3LFUA 1ODLA 3S2SA 3PHCA 3PXBA 2YY5A 4D1YA 1VB5A 1NXPA 3ZH9B 1PL0A 5K3AA 2GNPA 5FL7D 2IF0A 2ISCA 2OUKA 5DP1A 3K6KA 3L6OO 2NZVG 1EQAA 1SC3A 1U7WA 2BFCB 4MUBA 1E61A 1D09A 4RIHA 4KAAA 1KDZA 3I8SA 1CEQA 4JBYA 3HJUA 1MXHA 3FNRA 3RF7A 1RJ9A 3CF4A 1V3UA 5GJWC 2SCUB 9ABPA 3E9DA 4KMMA 3K0CA 2OV6A 3WZMA 4MPPA 4YRFA 2IPAB 1XN1A 4JUFA 4JI6B 3NCHA 4KUHA 4RY0A 1IN4A 3I05A 4QNMA 4UDXX 3TLCA 1BCSA 2RONA 4KC0A 3CYFA 3EBPA 2R79A 2TRSB 1EQ2A 1U5BB 4CM9A 5AW4A 3R9XA 1ULZA 3NDRA 1T3ZA 2GYUA 3KV1A 5G0TA 3VR5D 1FDVA 3H2KA 4A8JB 5CA1B 5FUQA 4RTKA 3VR5H 4KRGA 5F1YA 1A7JA 3O8DA 3GRZA 5F2KA 4JLWA 2DWCA 5G1OA 2X9NA 1WUKS 2QTHA 3AR2A 4K40A 2BGWA 1WWKA 1XMVA 2ZXFA 4ZKDA 4IJ6A 1GDDA 1II9A 2O06A 4R1SA 3B52X 3W79A 4EITA 2YYAA 2COUA 2FQWA 4RXMA 4O1MA 2FPSA 3I42A 5A4JA 2J7PD 3D8RA 5B57C 2YWXA 4LMAA 5CXSA 4X1IA 1J5XA 3PCRB 3UK2A 5LR6A 4CEJA 2CDAA 2I3DA 2UZ1A 5IKXA 1LSUA 2CXUA 2WWXA 3CBQA 3C98A 2FEWB 3ISVA 4PNHA 1XRMA 3RF6A 4Y30A 2ZJ1A 5GONB 4TTPA 1S02A 3M3DA 1KK0A 4RMHA 2BSQA 4FMDB 1ZUD1 3QQ5A 1W0CA 1YDMA 3QU7A 4IQ4A 3W77A 2IEYA 2JAPA 2CJYA 1M5RA 2IH4A 1Z7WA 2JHPA 1ULSA 5HMMA 5CGZA 5C8VA 2WDPA 3W2TA 3EXFA 3IIJA 3B9BA 5JNUA 1BC5A 4M22A 4OHFA 4LWQA 4TV9B 1BROA 1CZNA 2GO7A 1KVUA 2I22A 2W8BB 3OH8A 1EUCB 1CUHA 4UATA 1GAEO 1L5WA 2GTIA 3GYBA 4FNMA 1M5UA 3T9AA 1Z35A 1DPFA 4NATA 4KU4A 4ALKA 4GBJA 4RGBA 4YYZA 2CXPA 3LLSA 2HMVA 4UULA 3KOUA 2KLHA 1AMUA 1YT5A 1POXA 4KVGA 1IC6A 1WXXA 1NMYA 1VMKA 1OFVA 2BI7A 1JG2A 3BL5A 4KPGA 4OJTA 4YRGA 4ZVKA 5EXSA 4ZI5A 3W5SA 4ZCRA 3KQLA 1NYTA 3X1XA 3FR8A 4J0DA 2P7IA 2YS6A 3NH6A 3U4HA 5JY6A 5L45A 4UU0A 2OAQ1 1SOUA 4TMZA 5JD5A 1PGJA 3IIIA 1DCMA 1DCKA 3MZ0A 4PQEA 5IRCD 2AQ8A 1SUAA 1RBYA 1COWA 2H2IA 3JVUA 4OI4A 1G8MA 2J0UA 4WINA 3DVLA 4EG0A 4B09A 4E5NA 3OAAD 3WWZA 2WMYA 4FWTA 1UKZA 1ZL2A 3TIIA 2VR1A 4YC7A 1JFRA 2IYTA 4IPTA 1DBVO 4Q3DA 3HVIA 4BQNA 1ZQ1A 2BEUA 5KVVA 2NZ2A 4OQNA 3W6NA 4FBLA 3DFIA 4FSXA 1UF9A 4MS4A 1AJEA 1CUWA 1ADBA 1LZLA 2GZ3A 3CJQA 2ZU0C 3LGSA 3OZEA 2JGEA 2NZ8A 3MB8A 3K92A 4F9FA 5A05A 4MW4A 3E9RA 1C9EA 2IYPA 4JGGA 3VYUB 1I94B 3TSAA 2ZUFA 2A7XA 3ON5A 5FAXA 1FJHA 1DX4A 2HCBA 3G0OA 5HF9A 5B1YA 4ZXPA 3E3LA 5EIBD 1HTWA 1RPNA 2JZOA 2LP4Y 4CMIB 3DPSA 1OASA 3FSGA 4K9MA 4A73A 4Q82A 1U6IA 1MJ5A 2HHCA 2Y9MB 4YJ2F 3F6PA 4X9XA 2COKA 5AK4A 1Z25A 4G1UC 3WGIA 4GX1A 4L5BA 3DL0A 3G2MA 4IJWA 2CLDX 3N7UA 4UEWA 4DIDA 4FHFA 4WNAA 4Y2GA 2NU8A 1CRPA 2PQ0A 2Z1DA 3QXHA 1EVLA 1VMAA 4PQRA 3ZYCA 3HBNA 4DRXA 5JSHA 4PXYA 5ER6A 5LD2C 5ICSA 4O8ZA 4PPGA 3QFRA 2JJ1A 4MYHA 5D5QA 2X0EA 4GWKA 2JFGA 2VSYA 1YVPA 1RI4A 2J9ZB 3PGA1 3TXAA 4E5MA 1ZMBA 4Q48A 3AVXA 2PFSA 4KXUA 3PA6A 5F77A 1DZ3A 3WSTA 3AWDA 1ZN2A 3LE8A 4IYRA 3O2QB 4XGRA 3LIIA 3GELA 2Y77A 4XR9A 3M1YA 1FLAA 3RIYA 2YKGA 2AEMA 3K35A 3LUFA 1E5TA 4JS0A 5BYJA 1DHRA 4KYVA 1Y8RA 4IRXA 4II3A 4UU8A 2J32A 4XX0A 3ZWWA 4TKZA 3IJPA 4FS8A 1ZOOA 2CL5A 2PVCA 2BFAA 2G82A 3PU6A 3SHVA 2XBLA 4W8GA 5BN5B 2X8JB 4X8MA 4EB8A 4FGLA 2HCJB 3LK6A 4EW1A 2WTAA 1NW7A 1BFKA 2EVWX 3DQZA 4KO3S 4COKA 3EPLA 3LSYA 3AUXA 3H3XA 3E27A 3LY8A 3NHJA 3O0TA 3QOYA 2HU2A 1NI4A 3HACA 4MQFA 4CI9A 3EB9A 4V0SA 1KS2A 2YNMA 5DNVA 1TD9A 1NPYA 4DSTA 1JQKA 3R0QA 3EGDB 4OLFA 3RROA 2VJDA 3GD7A 2ZRHA 4V1CB 2AOTA 2L82A 4X1YA 1XMJA 2Q5OA 2Q4TA 3PPIA 4RJLA 4B3XA 3KUXA 1BCRA 1Q22A 2Y1WA 1MXFA 4ZQBA 1YJ5A 1MRNA 4BX2A 3GGDA 4IX1A 4B7AA 3VR2D 1QKIA 4J7UA 3PUHA 5IM5A 2YFQA 2Q6OA 1JDBB 3WRXA 5KOHA 1ONNA 5A4AA 1NRWA 3U3DA 1W8DA 4EKDA 2A0UA 2LKDA 4P54A 4HBZA 3UW3A 4GE0A 3K0BA 4C4PA 4MQ5A 2WD8A 4OQYA 1JZQA 3CF6R 4E08A 2CL7X 4CV1A 1Z8HA 2A59A 4IV5A 1NC1A 5EP4A 2W7TA 3UB2A 3OMWA 1ODCA 2JRCA 2RB5A 5AH0A 3ANYB 4JVMA 4RKWA 4HAYA 3CPHA 2YRWA 1U0BB 4G4SO 3IPLA 2O2HA 4CM9D 1CXZA 2Y3IA 4C08A 1C41A 3V6LA 2YW9A 3QBJA 4IAOA 1QFSA 5TE9A 3TNDA 3B6ZA 2PUBA 1Q7RA 1AV7A 3GUUA 3R5JA 4F56A 3KCQA 2OHGA 2GBFA 4BJ5A 3I01A 2XNJA 3KKLA 4ND8B 5AVVA 4UMDA 3K9WA 1AXGA 1PV2A 3NVAA 2QD3A 4FIDA 4ZV4A 3H5RA 3BL8A 4BPRA 2MSEB 3KS9A 2A8YA 4NK5A 2OXIA 3N5KA 3SC2B 4Q93A 2VJBA 3MJRA 3N7TA 1XALA 4ND4A 5BQXA 4BQQA 2OYSA 2YRFA 3E3NA 2ADMA 3OD1A 2JI4A 4JI7B 1AS0A 1JKXA 1W25A 3GNQA 4LSMA 2D1FA 1GD1O 5GGYA 3THSA 3U4GA 3JVEA 4X8HA 3GRYA 5J47A 2GZ2A 1ISPA 3HTXA 4AN1A 3JASA 2H5EA 3OPNA 4GECA 4KITB 4A1OA 3I9MA 5AVRA 1SC1A 1H5UA 3GCZA 3O4GA 4AB1A 1OX4A 3NWEA 4GKJB 1R4MB 3T4XA 1MB0A 3SJCA 4IIYA 2X77A 1V16A 2YX1A 4HYTA 1VHQA 1YFZA 3U7FB 3K2QA 2JHGA 2JGFA 4EY5A 3KL4A 4CLRA 3L6CA 3SXJA 4EHHA 1DXYA 5EMHA 1E7MA 1CUIA 1PNRA 3L7YA 3SX4A 4DMHA 3TZ6A 1VGQA 1YAHA 4EP1A 2E49A 4IP0A 1D6SA 3AUAA 4NCIA 3IQEA 3OCXA 3JWIA 4JITA 2H57A 3NZEA 5DBOA 2Z4SA 3VNSA 4GPZA 1CY6A 4XDZA 3WV4A 1OXKB 3VYVA 2PJRA 1QGZA 4MPDA 4FYIA 3WP0A 4BRWA 1NQAO 2DUWA 3OLVA 3TM4A 1O2DA 2ZIVB 4NCXA 4RTQA 2J6HA 2F43A 3I9JA 2CDCA 2R1ZA 4NESA 5DI9A 4US2R 1HRDA 4FR5A 4R16A 3KXIA 5JQGA 4FUQA 2OB2A 3L0BA 1XVUA 4Y67A 3GW8A 4C3UA 4U6QA 1COWD 2J0SA 4G0WA 2XUOA 5A02A 2E6KA 3S2EA 2OCBA 4ZK2A 1YR1A 3ZUPA 5K6TA 3EVDA 2QN8A 3DM9B 5DLDA 3D4NA 2QVXX 4HX2A 1N2BA 1XWWA 4E15A 3S2GA 2BE9A 4FCTA 4HK4A 3FY4A 1KR2A 3L01A 1MO3A 5DE3A 1I1NA 1NZDA 5F1PA 4X6LA 1RCTE 4CMBA 1LV8A 3Q8WA 4A2QA 2OESA 3UMRA 1IRXA 4BBPA 4MS3A 3WLHA 4RSGA 1JEDA 2CWWA 1GPAA 1N1DA 1LXCA 3DFFA 1QHEA 2GFHA 4MAAA 4B4DA 5G3YA 5CDUA 3H4VA 2FW8A 3Q88A 4AJLA 2PKXA 1S9DA 4KE6A 3CY6A 3IIMA 3H2ZA 3KSZO 1YR3A 3AR7A 4Z8XA 1C9YA 3KO8A 3PA8A 1ZA1A 1DWQA 3HR7A 3FSGD 3DE5X 3RYIB 2Q1XA 1USIA 3NJ8A 1E9FA 3N3BC 3ESBA 3TG8A 3F78A 1I1QB 1PFUA 3Q3EA 1T6BY 5L6MB 3P9QA 1PKXA 4BP1A 5CDSA 1RJFA 1GFZA 5FKJA 3WWDA 1VE7A 1XXHA 1NRXA 2ACVA 1CCWA 2EL9A 1ZMRA 2VNSA 3O26A 4KLRA 3ZS8A 4GPTA 3U6KA 2BTQA 1JDJA 4K46A 4UJ3A 5AKYA 5LXTF 5GTDA 3ZV6A 1IBKB 3ITKA 1NVEA 2R2GA 3TNYA 1H9CA 4NRDA 2VJMB 1E3LA 4ZU6X 2JJ1D 1WKVA 2XA9A 3OKAA 2YN4A 3WTBA 5I7FA 3QEBZ 3AJRA 3WGUA 1FW6A 3IDAA 3G59A 5TNXA 2I9KA 4PQYA 2Q9AA 3KVRA 5BSWA 1BXRB 4NBVA 1KZ9A 4PGFA 3AUUA 1CEYA 5D8DA 4WK4B 2WRZA 3CNHA 4REQB 2PWZA 2IOFK 2FMFA 3ZXXA 4WFKA 4CQNA 4DQXA 2YYSA 3QBVA 3L0ZA 4QT0A 2QE7A 2G4CA 2RB4A 4BNKA 4Z9XA 4EBBA 3PRJA 2O8FA 1HEUA 2I6GA 4NS4A 1TMYA 5EPUA 5ALGA 3B5EA 1PLLA 2IUEA 1KEEB 3WIBA 4AJEA 4N5IX 5IN4A 1USWA 3ZE6A 2QIPA 1KYZA 1RAEA 3FLBA 3L6UA 3AU9A 4EATA 1CJMA 2CLIB 2LPMA 1DKNA 1E2NA 3BHMA 2C04A 4OA8A 4DMKA 5MN4A 3LGXA 3ZDAA 3UK6A 4OH7A 3PIDA 3RFXA 2OK8A 1RYEA 3S2IA 2JGNA 1AB5A 1RE0A 2RGEA 4O6VA 4QYSA 4KLCA 2ZYWX 3VYRB 3WYDA 2BGTA 2RI6A 4BMVA 2FSVC 2C5LA 5ER9A 1CY4A 4DBVO 1SQ6A 3RS8A 1UL1X 4OM8A 3T7SA 2FFHA 1DTEA 1OU0A 3A11A 1BWPA 1W19A 1R15A 3C1OA 2FSPA 4HAUA 3RH0A 3SHOA 5BV8A 3PC6A 3F46A 4DV1B 2E82A 4ZVSA 1WA5A 2GHTA 2QYHA 2R66A 3FTNA 2A92A 4EGSA 3GJRA 5DYGA 4S05A 2A1UA 4MYUA 2VNHA 4RHYA 3V48A 1I51A 4M1QA 1OGYA 2ID4A 3KTFA 1ESZA 1JAZA 3QU2A 4JODA 3ZU2A 1P4SA 4B35A 4KI7A 2QW8A 3ZU5A 2ZSDA 5I3CA 1M1XB 2JANA 4NAUA 4AMBA 1JEAA 3FFXA 4KPEC 1UBEA 1TTHA 2PT9A 3DOEA 3FTFA 2CFCA 1AM4D 4OL0A 3CKMA 2HU8A 2Z6UA 1O5OA 1WZIA 3RHZA 2V74B 1X3SA 2ILTA 2MSDB 2RHMA 4UHFA 3GF4A 4K87A 3SPXA 1LVUA 4E5UA 1U0JA 2AI2A 2I6UA 5AXDA 1E96A 1GLNA 1T5HX 1YB6A 2RHDA 1OZGA 3A6GA 3OCYA 5NULA 1JTVA 4UPDA 3K1JA 4CKEA 3EXHB 3SMVA 4AMYA 1TRHA 4FONA 1YS6A 4NICA 1IU9A 4HS4A 1CPYA 3NANA 5I5EA 3PEEA 4HVAA 3T7IA 1LY1A 2EQAA 1PW7A 1NSTA 1Q7EA 1Z0ZA 2OT3B 3DVAA 3JWEA 3L9WA 5TS2A 3RSCA 3W1VA 5LMUB 2LIPA 1TECE 3KCNA 2XNDD 4MV9A 5AI9A 3GVIA 1D5CA 2WQZA 3AKYA 5C34B 2ZAMA 3BXFA 2NUAB 3VC2A 3Q7EA 3NYWA 4EY3A 1FFSA 3UMMA 1ODSA 1MH1A 2C3OA 1PWXA 3ELUA 3MJVA 2G83A 2ZUBA 4LSZA 4YQFA 3ME5A 2MSKA 2GCEA 1A8PA 1C14A 1XAHA 2O57A 1ZUIA 5DTJA 5TB5A 2F8MA 1JXQA 1M7BA 4G8BA 4DV3B 4KW7A 2P9CA 3FZEA 3NBYC 3D6HA 4N18A 5DHQA 2NTEA 4CM8A 5LUAA 5TIIA 2C4HA 3N8HA 1CQWA 4KV7A 4LOLA 1UCFA 3TDMA 1YF3A 2J6CA 2QP9X 3AESA 1WCWA 4DPMA 2NO0A 3G82C 2YH2A 3SQLA 1Z5NA 5DGXA 3SFVA 1QFYA 1NQTA 2VYNA 3JQEA 3HYCA 1GLGA 1SD2A 4PHHA 3N2EA 3QVGA 4TM7A 4D81A 1ND5A 3GFTA 3DVSX 1M0TA 2H7YA 2XTAA 1OAOA 5FR2A 3KKEA 3THXA 1C8BA 4D0RA 3L5OA 4KDEA 1XQ1A 4QHYA 5CFNA 5JCOC 3NHRA 3OZDA 4BVAA 4YLYA 1UM9A 2I4NA 3D6UA 1YR8A 4FFRA 2Q07A 3OBIA 3HS3A 1OW3B 1I9CA 4M9UA 4UZSA 1Z0FA 1BO6A 2WIGA 4V24A 4Y0VA 1IY9A 1I2CA 1SCKA 2H1RA 2GPBA 5AWFC 1DBSA 1HEYA 2QRLA 1GQQA 3FWZA 5AW2A 1DKMA 3ESDA 2TMKA 3F6YA 3FAKA 1AKTA 4GPAA 1X6VA 3P2OA 5AM0A 4CN8A 3WK9A 3ZD6A 4D92A 1PT5A 5BVHB 3IHWA 3ZWYA 1JAHA 3BRQA 1RAGA 2H2FA 4HH0A 1DBWA 4X00A 4NH0A 3U13A 2HMSA 4GR5A 4IDAA 2D0DA 5TJ9A 2L17A 3EXIA 4C5CA 4EI8A 1YOVA 1WAMA 3ZXUB 1SOVA 3CUUA 1RJ9B 4IMIB 1R0RE 1SUSA 3F71A 4IGEA 4RPIA 3ZJYA 3HYLA 3ZR4B 4AJ1A 1YKSA 4S35A 5HZHA 2W6QA 4K9LA 1WP9A 4RPLA 4S24A 3TZKA 3V8MA 1J21A 3GB9A 1CFJA 1BVYF 1BCSB 4FDTA 4HWOA 2IEAA 4A10A 4XI9A 5BYKA 3RYFA 1DTSA 2NW6A 2D5CA 4KBGA 4XTRA 3GJSA 4DYHA 3LCRA 3M34A 2BCJQ 2FW6A 2GZRA 3K53A 2CYCA 3QVWA 2BMEA 4TQGA 3VU9A 1KQFA 1CF2O 4NV3A 3VOBA 3ST7A 3R7SA 1Z8FA 4UNQA 1QGED 4X3PA 3UXHA 2ZAOA 5FBHA 4DDKA 3KLNA 3UUGA 1RVDA 3GLFE 1ZK4A 1R6XA 3U4AA 1AKUA 3ZJ5A 4C0LA 4X64B 4ZAYA 4YACA 2BMWA 3Q3IA 4LHSA 3HLTA 1V8DA 1DADA 2RSLA 4C6TA 1O0CA 3TMKA 4X1IB 2C29D 2DETA 1Z16A 2VJLA 3ZI0A 4KMOA 1IPHA 1U0TA 2NSYA 1F6DA 1SRQA 2UZ1B 2Y1EA 4CGYA 2WV9A 3RC9A 1L0BA 1T5DX 1W96A 1T4DA 1H1LA 1S2NA 2O6LA 4IUBS 3PHIA 4BIIA 4NMWA 2QNBA 4XFJA 4ZYUA 1SKYB 4MWDA 1VKRA 3NQ41 4YGXB 2X8AA 3BMXA 5BR4A 1BZYA 2HSDA 2IBTA 1A7KA 1NJGA 3A04A 1TYZA 4ITVA 1E99A 2QE7D 4WK0B 4JYMA 2IQ5A 1UAYA 4J0FA 3VYSB 3EXFB 1IN7A 2MMGA 3IC5A 3H6GA 1OX5A 3KAQA 3S0JA 3X1JA 3RS0A 5A9SA 3G8CA 5BNFA 1DLIA 5FNVF 3TIGA 1I0ZA 1XHFA 3F2VA 4JT4A 4DIEA 2G1PA 3D8BA 1USUA 2UKDA 1A9ZA 4GH5A 1ZUWA 2KQUA 5TPWA 1ZW6A 2DGDA 3OP1A 2D4HA 1AS2A 4A0RA 1NW8A 3G7SA 2IZOA 3I23A 1H2FA 2WSIA 3SQWA 2IXFA 2PMWB 2GA9A 4K86A 4Q9NA 4AWAA 5CG2A 4JL6A 5L9AA 2N42A 2DLNA 1NXTA 3UK0A 3TGPA 2OZLA 3P0RA 5J5CA 3KYDB 1U5AA 1XL1A 2P1DA 3T1YB 3GVXA 3LF1A 4HQLA 3KPWA 5BNWA 2B99A 2J0UB 1RXWA 5EPOA 5B5SA 4FOSA 4BV3A 1NPTO 2HRQA 4ZODA 1ABFA 1NVMB 2ZIFA 1ULUA 2DB3A 1CJUC 1Z5VA 2RJ3A 1XNHA 2VDKB 2DT5A 2BEUB 4XYMA 4MS4B 2PO7A 4YUVA 2YWRA 1KZ1A 1AKNA 5DN6A 1U8FO 3RWBA 2H48A 5DW3A 3DZDA 1O0BA 2V7WA 5AOVA 2C96A 2Q62A 2XIQA 1ZK2A 4F71A 1ZVVA 3H8JA 3QUSA 4QREA 2JARA 2OGTA 4G4IA 3AHGA 1KO7A 1G5QA 2A5GA 1MEEA 3NIBA 1N9ZA 4MX8A 4E07A 4QEKA 1AZWA 1QYCA 1J2JA 1V71A 4KGZA 3TPCA 3BUSA 3R3HA 4A6EA 1PVVA 3ZX4A 3UUEA 1C4OA 1V95A 3ITNA 5DCYA 3BXOA 5CLJA 4V2UA 2PV0A 3DWIA 5DSXA 3T4PA 4V0KA 2UXCB 2CHFA 1GJRA 4CV0A 2G63A 1VXOA 4AK9A 2Q27A 2QTWB 1ISJA 3EG9A 4AULA 2Z1MA 4FOOA 4WNAB 1VE1A 4XJXA 2P3SA