1LGYA

Lipase ii from rhizopus niveus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
265
structure length
265
Chain Sequence
KVVAATTAQIQEFTKYAGIAATAYCRSVVPGNKWDCVQCQKWVPDGKIITTFTSLLSDTNGYVLRSDKQKTIYLVFRGTNSFRSAITDIVFNFSDYKPVKGAKVHAGFLSSYEQVVNDYFPVVQEQLTAHPTYKVIVTGHSLGGAQALLAGMDLYQREPRLSPKNLSIFTVGGPRVGNPTFAYYVESTGIPFQRTVHKRDIVPHVPPQSFGFLHPGVESWIKSGTSNVQICTSEIETKDCSNSIVPFTSILDHLSYFDINEGSCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIACYLGLYCEROL LIPASE
publication title The crystal structure of lipase II from Rhizopus niveus at 2.2 A resolution.
pubmed rcsb
molecule tags Hydrolase (carboxylic ester)
total genus 86
structure length 265
sequence length 265
chains with identical sequence B, C
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1996-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lgyA00
4WY5A 5AK6A 4QWWA 3DEAA 4X94A 2PSHA 2VT7A 2PPLA 5EFZA 1USWA 4INZA 4UHEA 3SWWA 1FFCA 1G66A 4OSEA 3VDXA 2VQ6A 3E0XA 4Y2VA 3ICVA 3C6XA 2WG0A 5KWJA 3I2GA 2BUCA 1ZD4A 1ODSA 3PI6A 4EY8A 4DIUA 1P0PA 3FAKA 4L0CA 2WTNA 5I9IA 1EK2A 4G8DA 5ALEA 5SYNA 4CCYB 4H7KA 5AKHA 3WWEA 2XQFA 4G4JA 1NU6A 4KRYA 1Q84A 3I6YA 1MX1A 1MAAA 2PSFA 3TJMA 4BDSA 4ZXFA 2JF0A 1J06A 3O4JA 5J3JA 4GWLA 4NZZA 5CT6A 2BFNA 3UMJA 2BJHA 3M3DA 1XLWA 1XKLA 5AI6A 5FUMA 1VOTA 3STVA 2XLBA 3ESCA 5A7GA 2Y2VA 3G7NA 4N5IX 1YS2X 3MUNA 3A2NA 5HF5A 1KU6A 5ALTA 4FWBA 3B12A 3BE8A 2XMZA 1XZFA 1XLVA 2FX5A 3HABA 1JT2A 3RM3A 3G0BA 3GZJA 3NWOA 5IKXA 2WLSA 5HFNA 3R3WA 3VVLA 1TCBA 1LGYA 1K5PA 2XB6A 1XZDA 2XMCA 3L1JA 3IULA 1DQZA 2CKMA 4X90A 3UUEA 3DJYA 2XUDA 4V2IA 1AURA 5FDFA 1DX6A 5JAHA 3H19A 3KWFA 4LYDA 5HCUA 4LXHA 1UFOA 3EQ9A 4L3WA 5ALUA 5IH7A 4GLBA 1GXSA 1IZ7A 2CJPA 3BDIA 4Q34A 5AKXA 3TGLA 3QMVA 2QJRA 1U8EA 3RKSA 4WFIA 1H2ZA 3VJLA 2XUHA 3DCNA 4PO3X 3FOBA 2JGKA 1X2BA 3KDAA 4HTAA 1QIFA 1ZI9A 4OYYA 3FVTA 1LPOA 4MWTA 3DQZA 3HJUA 3Q0TA 5HF8A 1FSSA 2XUAA 1N5RA 1TQHA 4XIIA 4BTVA 4UBNA 3VJKA 1XZEA 5DYWA 3WJ2A 3FYUB 4HXGA 3PE6A 2XQJA 3A2MA 2V98A 3AIOA 4DTCA 3WI7A 3C6ZA 3G9UA 5CMLA 5LZ5A 3OG9A 4QLOA 3HEAA 4MYSA 1UK6A 5DWDA 3VVMA 3H18A 3G0GA 2JGMA 4FDMA 4IH9A 3WKBA 5JATA 3N2ZB 4K6GA 3R41A 5K3BA 2DSNA 3ED1A 4AX4A 5ALSA 1R50A 1QIMA 1CUBA 4DNOA 1H23A 3SC2A 3WWOA 4DMFA 1XZHA 4LXIA 4ETWA 3WL7A 4C87A 1E5TA 1O6FA 4W9RA 1XZLA 3GBSA 5CRIA 1XLUA 4QA9A 1Q0ZA 3W06A 1WB6A 4G1FA 1C7JA 2C0QA 3G9ZA 2WKWA 3BXPA 3RLIA 1EA5A 3W04A 4OU5A 1J1IA 2QVBA 3C87A 2BGRA 1NX9A 2HFJA 4FOLA 1EB8A 3R3VA 1MU0A 1BRTA 5ALGA 4X93A 4E46A 4Y2PA 1BN6A 1UZAA 2JGJA 2WU4A 2ZSHA 5ALKA 4WFJA 4PV7A 1DT3A 2AJ8A 2LIPA 3WKCA 3TEJA 3K6KA 4BBZA 2X76A 1YA8A 5A71A 3H2GA 4RNCA 4P08A 2QMQA 4O08A 5C8ZA 1IUNA 1MJ5A 2O7VA 3GFFA 4ZGBA 2QKYA 3WYNA 2VJBA 2B20A 2C7BA 3C5VA 4J3JA 1YR2A 2WJ3A 2XMSA 2GBFA 3AUKA 3STUA 2PM8A 2DHCA 3GELA 3QPAA 5C8XA 1R1DA 4KE8A 1CUWA 5ISMA 2H7CA 3DOIA 2RGUA 1XRNA 3R3ZA 3C8HA 5JAUA 3CCCA 3IDAA 4MYDA 3G8YA 4JNCA 3ANSA 1U65A 1J2EA 4B81A 3R40A 5D6OA 2YASA 4MXDA 2OGTA 4G4IA 4X3CA 1YB7A 2ZYRA 5CH5A 5KBYA 3HXKA 3TRDA 1G42A 3AIKA 3FBWA 3DOHA 4EY6A 5HQ3A 4Q05A 1QIDA 4X97A 3FSGA 4YASA 3WWCA 3D4LA 5CT9A 3PUIA 5LYYA 3O4IA 1AX9A 1AKNA 4BC0A 5LZ7A 1E8NA 5DLPA 4JUIA 3ZLTA 4UHBA 4G8CA 3CN7A 3MGAA 1QO7A 1VLQA 5AKIA 4BAZA 2YH2A 4IQ4A 5ESRA 1LNSA 1W6RA 2PBLA 4RE5A 1QTIA 3ZV7A 4B82A 2AJLI 1H2YA 3I2HA 1QIGA 1H2XA 3M83A 4AMYA 1XZJA 3BIWA 5DNWA 5CXXA 4X6UA 1LPBB 1MX5A 4U2DA 2Z3ZA 4N5HX 2QM0A 4BZZA 2WHRA 1BEZA 2WJ4A 1ORWA 2XT0A 4L9AA 1BU8A 1ZGBA 2GYUA 5K3EA 3D7RA 4UHHA 3HI4A 2QOEA 2RAUA 3R3YA 5JANA 2JGEA 3RARA 1OILA 2PVSA 1Q0RA 4G9GA 2QS9A 5AKGA 4J0CA 4OD0A 5C8VA 2AJDA 4XWGA 4CI9A 3DDUA 3WK6A 2WILA 3D5EA 5AM4A 1GKKA 4DM7A 1D07A 5CURA 1H2WA 1VXRA 1CUEA 1WM1A 1CUSA 5KREA 5BOVA 2WHPA 2WFMA 3FCXA 1DT5A 1HL7A 2G63A 3QZUA 1T4MA 4OB6A 3O0DA 3C43A 4M0EA 4HXFB 2GBCA 2HRRA 5HF9A 5T4EA 1QO9A 5F4ZA 1VA4A 3WK4A 4H7JA 1YAJA 4AXBA 2WFZA 3OM8A 1CUIA 1FFDA 3BL8A 4UFOA 1CUZA 2XUIA 4OUKX 3EQ8A 1L7AA 2PSDA 1UKCA 1ZI6A 4IHAA 1IUPA 4U2CA 4M0FA 1DU4A 1K63A 2OCKA 4PSDA 4AO6A 2HA7A 1XKTA 2GYVA 5ALHA 4DMHA 5T4FA 5HK8A 4B7ZA 3W2TA 4K6KA 3V1LA 3ZI7A 4BTLA 2FJ0A 5HKAA 1XZGA 1XRLA 1F0PA 4IO0A 3WZMA 2GBGA 4UBOA 1EI9A 4BP9A 4B0PA 3C8DA 2C5GA 2C58A 3STYA 5ALVA 3ESBA 2VT6A 2WUFA 2J4CA 2H7XA 4HRXA 2VTVA 2O2GA 2IX9A 2PUHA 3M82A 3NOXA 3R3UA 5HFAA 1U4NA 1GGVA 1CVLA 5DYTA 1W1IA 1Z68A 3IURA 4FNGA 1YA4A 4QE3A 4H7EA 4W1QA 4DGQA 4RE6A 5ALWA 4C4YA 3G0DA 1LPMA 3C45A 2DHDA 1CUFA 2O2HA 2B61A 5DNVA 4B9AA 2RHTA 4MJ3A 5IVHA 1VE7A 5AICA 4UBMA 3OPMA 4AB1A 2AJCA 1LBSA 5LIPA 1WHSA 4RGYA 3HRHA 4G5XA 4DMCA 3VISA 5ALDA 5AM3A 5E4TA 4CCWA 3H04A 1GPLA 1SCKA 2RI6A 4Y7DA 3QMMA 5AK4A 1VJ5A 4ARAA 5FV4A 1CEXA 2Z3WA 1DWQA 1I6WA 3PUHA 5C7YA 2AJBA 4CG2A 3LCRA 5YASA 1PFQA 4H77A 5DJ5A 2HHAA 3BF7A 4X85A 2X5XA 3AZOA 1R88A 3WL6A 3RK4A 1E8DA 1QTRA 4B9EA 3T52A 4ITVA 3STXA 4LHEA 3WA6A 3ZPXA 4BE4A 4WCVA 4CG1A 1GPNA 2BGNA 4BVJA 2HM7A 3BJMA 3H2JA 2ES4A 3WK8A 5FLKA 3G0CA 3R0VA 3F98A 1UKBA 2DFPA 1T2NA 1ZICA 1Y37A 2ORYA 2WIGA 2O2IA 1EK1A 3DLTA 3I2KA 1A7UA 1CR6A 4J0JA 4QNNA 1F8UA 1EVEA 3U1TA 5ALRA 1N5MA 4BC1A 1QIJA 4TPKA 2WQZA 1GT6A 3BIXA 1ZOIA 2I3ZA 2UZ0A 2PUJA 5BWBA 4OB7A 1DWPA 3OURA 1UOQA 4BRZA 3O95A 1QFMA 4BCBA 3LP5A 4J7AA 2ACEA 5ALMA 5AKZA 3QVMA 3MUOA 2G5TA 4EBBA 4X91A 2HU7A 2H1IA 2XI4A 2XUJA 3WZLA 3HZOA 4DNFA 5HQ3B 1CUYA 1IMJA 4X00A 1GQSA 4KAAA 4WFKA 2V97A 2HIHA 2WM2A 2WSLA 1CLEA 3FSGD 3AZPA 2XUPA 1LBTA 2JBWA 3VXKA 4I19A 1JJBA 4EA6A 5JZ9A 1QONA 2WUGA 2XMBA 1TKRA 3KD2A 4TVKA 4U2GA 1LZLA 1XZCA 3IUMA 1WPRA 4Y2XA 5DTJA 2PSEA 1TRHA 3S2ZA 4J0HA 2RHWA 5A62A 1XZIA 2HU5A 5JZBA 4EUSA 1YB6A 4DYHA 2C4HA 2GZRA 1CUAA 1F0NA 5AI9A 3WK9A 2ACKA 4H7IA 3GA7A 1SCIA 4LYEA 2WU3A 5AM1A 3STTA 4X6YA 4KE7A 2CB9A 4FNMA 1UWCA 1W76A 1HKHA 4CIAA 4J0KA 1BCSA 2BKLA 4BYMA 2B4KA 2JGIA 3LLCA 2Y6VA 4J0GA 3D3NA 3HYSA 3DNMA 4KRXA 1JU3A 1QGED 4Q3OA 4NMWA 2OCLA 5AKLA 4ARBA 1GPKA 5DNUA 2Q0XA 4EB0A 5ALZA 4QZVA 1EB9A 2H7YA 3G9XA 3OTQA 2V96A 4AQDA 3LIIA 5K5EA 2OAGA 4KR0A 1UOPA 2W6CX 1P0MA 3E3AA 3D59A 1WHTA 2Y2UA 2WHPB 1F6WA 2WJ6A 4U2FA 1LZKA 5HK9A 3G9TA 3WWPA 3FWHA 3EF3A 2WIKA 3QM1A 4ZREA 4A23A 2GZSA 1CIJA 3LS2A 1R3DA 2E3JA 5I8PA 3WLAA 2I03A 5AJHA 1PV1A 2EDCA 1ETHA 1K4YA 2QJWA 2HA5A 5AIBA 1XZBA 1YAHA 1G4HA 5AI0A 3X3HA 1AGYA 1AZWA 1QJ4A 1MTZA 2VA9A 3HSSA 4J0DA 5JAPA 2RONA 3B5EA 3P2MA 4BP8A 5EI5A 4GDMA 3C5WP 5K3FA 4A16A 1EXWA 1NU8A 4QDOA 4E11A 1XQYA 4LIPD 3SX4A 5JYCA 5JALA 1RWQA 2ZJFA 2ZVDA 1Q83A 4XJVA 3SK0A 1SCQA 5D3KA 1R4ZA 5AM5A 1QIEA 1TIBA 1CUDA 1MN6A 4N8SA 3IVMA 1EH5A 5AM2A 1LPNA 4FBLA 1XRQA 3OOSA 4DNQA 1YCDA 2JGFA 1ACLA 4ZV9A 1VKHA 1FFBA 4QDZA 3D2BA 1CUHA 1X70A 3ZWQA 5E2IA 4LKOA 1CQZA 1J07A 3JYHA 4CG3A 1HPLA 3IUNA 5JZSA 1R9MA 1WPXA 2JEYA 1VE6A 4OCZA 1UOOA 4X6XA 3I6ZA 4PF1A 1EDDA 2XMRA 4F5ZA 3M81A 4PNZA 5FOQA 1U2EA 2WFLA 4ZI5A 2DHEA 1MPXA 2J3DA 3I28A 3OC0A 3AFIA 4HRYA 1ISPA 2OG1A 1EINA 3EIOA 1BE0A 5K3CA 1AC5A 4H7HA 1XRMA 6YASA 4EZIA 2NW6A 1CFJA 4Y2QA 3H2HA 4C6HA 1WB4A 1SC9A 4K5QA 3I1YA 2OQVA 4F21A 3AINA 1ZJ4A 1C4XA 2XDWA 5FP0A 2FUKA 4X92A 2BAGA 2HA4A 3QPDA 5AIAA 3WYDA 2VJCA 5D3ZA 3T4UA 4UBLA 3WJ1A 3A6ZA 2HRQA 4LXGA 1ODTC 2XUQA 2QR5A 4ZV7A 2QRUA 3DD5A 1EVQA 4N8EA 1FFAA 5HZGA 4JYMA 2XMDA 1ODCA 5ALOA 1DQYA 4UFNA 2XMQA 1MX9A 1HLGA 1WCYA 4H35A 4HZGA 4P93A 2QTBA 1AUOA 5ALXA 2OCIA 5FPQA 1UXOA 3G0IA 1P0QA 1FJ2A 1JU4A 2HADA 1E89A 4C01A 4MQLA 2WIJA 4OYLA 2CUTA 4L72A 4UUQA 1QFSA 2JGLA 4XX1A 1QIIA 2JIDA 1W4LA 4Y2SA 4I3FA 2AXEA 3FCYA 3S8YA 4JEIA 1HBJA 3STWA 4KYVA 1SOMA 5IVDA 4HVTA 2GYWA 5E4YA 3B3QA 3WQHA 1MNAA 1YSCA 2OCGA 1N8SA 4GW3A 1OCEA 4UHCA 1QIHA 2H9YA 2CBGA 4K2AA 3AIMA 5EHZA 4WJLA 2XQGA 3PF8A 1LPAB 1JI3A 4MWSA 5CH3A 1AQLA 4DMKA 1WOMA 3WA7A 2D0DA 2VSQA 2Z5GA 1DWOA 4QLAA 3ZLUA 5AI8A 4KE6A 3V9AA 4PSUA 5A7HA 2ROQA 3F96A 3H2IA 2WIFA 1XQVA 1YASA 3KSRA 3LIPA 2CEKA 5ALIA 3KXPA 1S8OA 3W05A 3F97A 5LKRA 5AKKA 2OGSA 4F0JA 2XLCA 4UHDA 2HA0A 1JMYA 1ORVA 4Y2UA 4I4CA 1QLWA 4UFPA 4BVLA 5EIEA 3I1IA 3AJAA 5EGNA 1B6GA 4GEGA 4FBMA 3WL5A 2QUAA 4HXEB 3IBTA 4OU4A 4PQEA 5FKJA 5K3DA 1TK3A 3CXUA 5FPPA 3IIIA 2DR0A 5CT4A 3CCBA 3WK5A 4RPCA 3DS8A 5BWCA 4KAJA 5EHQA 2PU7A 4AZ3A 4GXNA 4H18A 1IUOA 4EY4A 1XZAA 3PICA 5AK3A 5H3HA 2QXTA 1E8MA 3D2AA 3HLKA 2XUKA 2VJDA 3W9UA 4PSCA 1BROA 3QMWA 1QZ3A 1ZI8A 2FJPA 3QYJA 4B84A 1E66A 1W75A 2WTMA 4HAIA 5EHXA 5LZ2A 3H1BA 1BN7A 3BJRA 4W63A 4D9JA 4FHZA 4Y2YA 1XZMA 4FLMA 2Y6UA 3H17A 4IH4A 5CT8A 4BATA 4AN1A 2OGZA 3WIBA 2P8SA 1P0IA 1YS1X 4E14A 2XMGA 2HL6A 3A70A 1VZ2A 4BDTA 4C88A 4H0CA 5C81A 5K3FB 1ZJ5A 4BE9A 5EHNA 3ANTA 1A8SA 3G02A 3WIOA 5KWIA 1CUCA 4UBKA 1EX9A 4WY8A 2BUBA 1JJIA 5CXUA 1UT6A 4UBJA 2QT9A 4YK7A 3HC7A 3I6MA 5LZ4A 5IVIA 4DNPA 5ALNA 1MAHA 1N1MA 5AM0A 1DTEA 7YASA 2PU5A 3V1KA 4QDUA 2WG2A 5AHXA 5LLSA 1E3QA 4U2BA 5ALYA 4KAFA 1TCCA 4AO8A 1UK8A 1JKMA 4AMZA 2OPHA 2XQIA 2ECFA 2ZYSA 4S0XA 3DL7A 4GBGA 4KEAA 1B41A 4BAGA 2XUOA 5BV7A 4JH0A 2Z8ZA 3V1NA 4BRSA 2HA6A 2XQKA 5LKAA 3H0CA 3L1HA 3E4DA 4DSZA 2WFLB 2K2QB 2WHQA 3O9MA 1Y7HA 2EEPA 3FYTA 4FTWA 3DL4A 4W1SA 1ZIXA 4Y9SA 3PFCA 1XQXA 5LP1A 1CV2A 5ALLA 2WG1A 5JADA 1JJFA 4BZWA 3QITA 5T4HA 1MNQA 5HF6A 1XROA 3F67A 2QUBA 2Z8XA 1LPPA 1UKAA 4GHWA 1VA5A 1QOZA 5AI4A 4EY7A 3GUUA 1IVYA 3V1MA 4Y2JA 4Z49A 4BVKA 5K3AA 4B6GA 2OXEA 5EIHA 1ZIYA 2D5LA 3NUZA 1JFRA 3F9CA 4QWMA 1TCAA 4MEAA 1BEEA 5LZ8A 5E4JA 3O4HA 3MVEA 4AZ0A 4DLNA 4B80A 4N8DA 3IB3A 1ZD5A 3QPCA 1MT3A 2VF2A 4BB0A 2HFKA 3C6BA 2QZPA 4B0OA 4PW0A 4Y2TA 5FXMA 2WUEA 3Q8WA 5AKYA 3C6YA 5AK5A 2HA3A 3PFBA 1RYYA 4CCYA 2W22A 4ROTA 4GECA 4FKBA 4WDRA 4CIBA 4ZRDA 4FLEA 1CPYA 4X71A 1CQWA 2I78A 4Q82A 5ALQA 4P9NA 4UBIA 3ESAA 3QH4A 2EDAA 5SYMA 1CUXA 3JWEA 4G4GA 3DYVA 4Q3KA 3WWDA 5FRDA 4B83A 2VAXA 1H22A 3GROA 3FVRA 4OPMA 3JW8A 3BF8A 5LZ9A 3C70A 3WKEA 4W1PA 1WB5A 3FYUC 4G8BA 3IUJA 4FFVA 5JD5A 5IVKA 1SFRA 1BCRA 2ZJ6A 3H1AA 5AKEA 1LLFA 1OXMA 3V48A 1CRLA 1MO2A 2VEOA 1LPSA 4B85A 3BWXA 5ALFA 3VJMA 3E1GA 3PF9A 1W52X 1FFEA 1ZGCA 2ZYHA 1X2EA 2ZSIA 2RIPA 4K6HA 4X95A 2VATA 5JIBA 4A5SA 3WKDA 5DTIA 2G4LA 4NVRA 2B9VA 3IUQA 5D7BA 2GBIA 5CH8A 1AMNA 3A2LA 4AO7A 2G5PA 4IH1A 2V9ZA 2WIDA 1XRPA 3IA2A 5AH0A 5AOBA 3N0TA 1C7IA 3W9BA 2DCMA 1DINA 3AILA 3KWJA 1ACJA 3DKKA 1K6EA 5JD6A 1ZD3A 2X8BA 5A2GA 4P92A 2XUFA 1G5FA 2R8BA 3UUFA 4CFSA 4M0MA 4YX9A 4MEBA 3L1IA 4XVCA 1EDEA 1EDBA 3VKFA 2BCEA 3FLAA 3PDCA 2CZQA 5A7FA 3FYUA 2PX6A 4BAUA 4H7DA 1HDEA 3D2CA 1M33A 5AP9A 4UHFA 4BCCA 5ALPA 4KACA 4TGLA 4FLFA 3WL8A 2IITA 2VAVA 2J4FA 1CUUA 2YXPX 4H7FA 3FNBA 3KOOA 1K8QA 3HACA 1CUJA 3ESDA 1XQWA 4E15A 2DQYA 3AZQA 4QDXA 1ZD2P 3R3XA 5AI5A 4QDTA 3FLBA 1CUVA 1JMKC 1THTA 2HU8A 5ALJA 4G9EA 4U2EA 3FLEA 1EHYA 2QXUA 5JARA 4BCDA 5AOCA 4JYPA 4HS9A 4YPVA 4NS4A 2HDWA 5HKBA 5CBKA 2XE4A 1VXOA 4J03A 1XFDA 1RP1A 5T4BA 1L7RA 3I2FA 3F8SA 4AN0A 2OQIA 4FMPA 1GZ7A 4WDQA 3O4GA 2DQZA 3ILSA 3BDVA 2R11A 2C5FA 2PKYX 3D0KA 1KU0A 5CW2A 1DX4A 1VZ3A 1XZKA 2J3QA 4C4ZA 4EY5A 3O9VA 2IIVA 3EBLA 4Y2RA 3ZLVA 2OLEA 1GKLA 2XUGA 3QBJA 5A6VA 4X7BA 5JD4A 4OB8A 1PJAA 1THGA 1HQDA 3U0VA 4F60A 2YYSA 5EIAA 5JAOA 3H2KA 1TAHA 2BUAA 2Y1KA 4FFWA 1CUGA 3NGMA 3WMRA 2JEZA 1XRRA 2O7RA 1R9NA 4MQMA 5AO9A 2ONCA 4W1RA 4QEKA 5AKJA 1O6GA 2CMFA 3WK7A 5AOAA 4C4XA 4GI1A 2I3DA 4ZWNA 4UPDA 1QIKA 3I2IA 1A8QA 3I2JA 1A8UA 4KE9A 3CN9A 1KEZA 1GQRA 4C89A 2HA2A 2ZYIA 1L7QA 1UK7A 1IZ8A 1A88A 5JASA 5I7UA 4Q1VA 5DYYA 4DSAA 2WUDA 1QE3A 3YASA 1BS9A 4Q3LA 1Y7IA 4KJXA 2PSJA 3WKAA 4EHBA 2PL5A 2ZJ7A 5CTAA 5CT5A 2VJAA 2OAEA 3K9BA 4J0IA 1UK9A 3DYIA 3K2IA 3EQ7A 3ICWA 3DKRA 2C0PA
chains in the Genus database with same CATH superfamily
1E96A 1E6CA 4FIDA 3C4QA 4YAUA 3V33A 1G7TA 2YJ3A 3E5RA 4RD3A 5JDIA 1TL7C 4JZYA 1K68A 4D9MA 1G8GA 5EFZA 1USWA 1MRZA 2B34A 3PC3A 4P3XA 1HEYA 5FL3A 1PQPA 2BM1A 3DLCA 4MHSA 2VQ6A 3CRQA 4JC4A 3W90A 2GTIA 3FZYA 3LGAA 5AUPB 4F4UA 3LHKA 3H9QA 4OO3A 1SMKA 2EL9A 2F6RA 4QULA 2WDZA 1L0BA 1ZO8A 3C6XA 3ELBA 2VKQA 3HDJA 5E7MA 2W70A 1G8FA 1ZNXA 3D1VA 3SR4A 2BUCA 1ODSA 3PX2A 1V1RB 2DTDA 2E4VA 5EHIA 3W9SA 3OF5A 2UVPA 5ICCA 2H4FA 3GVCA 4DIUA 4V0RA 3COJA 3FD8A 5EAIA 1TO2E 5FFFA 1RRGA 4H1UA 4DCVA 3R0XA 4TKUA 4PZCA 4CKZA 3GZ4A 1I14A 1H3NA 2ID7A 4ZAGA 5I9IA 2PH3A 5ICSA 5BY2A 4JI4B 2ZE7A 1EK2A 3NWEA 2VK2A 2QTMA 2RGWA 3GHHA 2AOTA 3DLBA 1UBCA 2BY4A 2PGAA 5ALEA 1BJRE 2NO0A 4WBNB 1E9AA 2VPZA 2X3FA 5IXYA 4RZIA 1OZFA 3OEED 4H7KA 4X45A 4J49A 1GL7A 5FL7A 1P0FA 1I7NA 2PMDA 1K89A 1Y9EA 3PNSA 2ZBFA 5KJFA 5CCEA 3H6HA 2O2XA 3FRHA 4TXMA 4QSHA 3SF8B 1KR2A 1P91A 5JI2E 3LBNA 1N1GA 2WZQA 3HYLA 1C50A 4ZXFA 2IY7A 4F12A 4BNDB 2FZVA 3NFYA 2R4QA 1SXJE 3JCZA 3L07A 4GWLA 4MK4A 2JD2A 2AOUA 4X61A 4CLOA 4NZZA 1E7MA 1PJBA 2YNMA 4I55B 4OQYA 3RSGA 1Z5GA 2ZCJA 3ZYZA 2EQAA 3OP1A 4B4OA 1E9BA 2VLBA 4B4WA 1XDUA 3HBMA 5L51A 5AI6A 2HJSA 2BFOA 4F2HA 1BDIA 1JHMA 3JVVA 4DYDA 2RH4A 1DCFA 1O6CA 2XLBA 3O92A 4HDNA 3STVA 2VTBA 2W42A 1COWA 5AJZA 4HRAA 1Q0QA 2FSVA 1AS0A 3REOA 2QVCA 3GRFA 3A1SA 1A69A 2IZ5A 3HUEA 5JG7A 1E2IA 7MHTA 1I3NA 1MHPA 1KU6A 1VHTA 2AVNA 4IXTA 3L8FA 3H5WA 3WO1A 4C3OB 1P31A 1K5HA 1GLNA 3AOEC 1NVXQ 3SPXA 3UIEA 1FPQA 1E3SA 3EFOB 4CF3A 4JDPA 1U81A 3AERB 4LWPA 1VYHA 4DLYA 2XMZA 4UNNA 4JLNA 1GRRA 1LI7A 2VJLA 3SNHA 1XLVA 4I66A 1Z17A 3NI2A 3RUHA 5I9TA 1DAFA 2X0KA 2FX5A 2YZ7A 3I01A 2Z5LA 2XBLA 3DMYA 1NLZA 4MQFA 3B52X 3A7EA 3P20A 3GZJA 2LTAA 5JQGA 1KFJB 2GSDA 3H5TA 2EFEB 1KP3A 1RACA 5IMBA 2WLSA 2DP4E 1M6YA 1KBQA 5HFNA 1PQWA 2DSTA 3N3AC 1WKCA 2PT9A 3ZLBA 1N2XA 3FGOA 3MAAC 4EA7A 1EFCA 3CJQA 1XBTA 2C84A 4RF4A 2Z98A 2BEUB 4PIMA 4E1BA 1MXHA 2XMCA 4KFRA 3G2KA 1OMOA 5IJ0B 1J2YA 2EQBA 3L1JA 4E4TA 3IBGA 5FLYA 3GT7A 1Z4IA 5A5FA 4WJZA 1GJRA 1AO3A 4X65B 3WQSB 1PFYA 2BCGY 4LNHA 3ERCA 3OZVA 3O1LA 2AR7A 2MJLA 3KWFA 3D8BA 3UJHA 4ZHSA 4DMRA 4LC0A 3RWMB 5JCJD 2MSCB 2OWDA 4FX5A 1KOJA 1UH5A 1RXEA 4DIOA 4L3WA 1KAEA 2Y93A 3BK7A 2A1UB 1L7DA 1Y6FA 3AJ8A 1O94D 4Q4LA 3RHFA 1SCUB 3A4VA 3GJ5A 1HYHA 4N47A 3RS8A 1QH1A 2PGJA 2GBLA 2P62A 5HRCA 4WTOA 2CJPA 4B3SB 1NW7A 4PX9A 4RK4A 3DPUA 3EHDA 4I9GA 1Z6AA 3CNNA 4GWGA 1L7NA 2MTBA 2WF8A 4ZOAA 1B0AA 4J7XA 3M89A 5HRUA 4QOGA 3L4BA 4ZOCA 3CO0S 3QEOA 4ZALA 3PFHA 1U8EA 1JL3A 4LDZA 2JLWA 1Z38A 1NW9B 1H2ZA 1KQPA 2AMYA 4WECA 3VJLA 3DFIA 4UTOA 1T1EA 4PO3X 2JFVA 5EJMA 1M1YE 3T61A 1C1XA 2ZG6A 5BORA 4MVYA 1KZHA 1I9CA 4E5NA 2JGKA 2WA2A 1DC8A 4PC1A 3SM9A 4O4LA 2MDTA 1NZDA 8MHTA 4CJXA 3VR5D 1C8VB 4CKWA 3R6LA 3GUHA 4GEKA 3VOBA 4F3RA 2HCRA 5CB4B 3DDOA 3JYPA 2HZBA 3Q0TA 5HF8A 3ST7A 3R0JA 3AI1A 3T5PA 2E85A 3WRXC 2ZYTX 1N5RA 4ZPJA 1DDIA 1P8AA 2EAUA 2CVQA 3QOYA 3Q40A 3VU9B 4XYMA 5CFZA 4BTVA 4ZVPA 3L8GA 2GN2A 1ZOSA 1R8QA 2YHIA 2RG7A 4G5QA 5DYWA 3WJ2A 4EUKA 3CPSA 3FYUB 2BZSA 4MV4A 1R6BX 3IDQA 4KSCA 2C78A 3N76A 3W7BA 1QLJA 1DO2A 2XQJA 3JQPA 1I32A 4GF5A 5C32A 3KT6A 4XD7A 4NMMA 2BL4A 4EI7A 5AQ1A 1OYVA 1BHSA 2QYTA 3EQ6A 5J4KA 3G9UA 3DAFA 1SXGA 3G82C 3OG9A 3HEAA 5FI1B 1NJ6A 1UFQA 5F35A 2UZ4A 2OHVA 1UK6A 3PC8A 3KQOA 3VDRA 1PO7A 1LW6E 2XVZA 5FWXA 4CIXA 3DDZX 2EJUA 4Z3KA 5B1YA 4YDQA 3WOHA 3G0GA 1JYEA 4RTNA 1UFVA 4GQBA 1T1RA 4JB0A 1ZCJA 3B3AA 3WMGA 3FHOA 3FRJA 4LWZA 4FDMA 5FH9A 4JEHA 2APJA 3FCOA 3OZSA 4UDYX 3UAYA 3W8RA 3TN7A 1NE7A 2QW8A 1Q12A 2PD6A 2IDZA 3DL2A 3WKBA 5JATA 3R41A 4HWOA 4QTTB 2AMJA 4TQ9A 4JSYA 5L45A 4K6FA 1XXLA 3ED1A 1Q6ZA 2A3NA 4G3XA 3F4LA 4MI6A 1C9YA 1J0EA 1R50A 1ZL0A 4O33A 4I3HA 4CT5A 1JVSA 3BTOA 1OJ7A 3BWDD 3JWHA 1HDRA 2B98A 3D7MA 3FPJA 3ZNPA 1H23A 1K9VF 4F9GA 3DFFA 3VKHA 1LW7A 1EGAA 1PJ3A 1ZBDA 3G2OA 1YUMA 1EUQA 1GD1O 3R0IA 4DMFA 2FSUA 1Z0SA 1XZHA 3BFJA 4LXIA 2OP1A 4RD4A 4ETWA 4MRVA 4JI2B 3HLYA 5EE3A 2EKZA 1E5TA 5BR8B 3TLAA 5LN1A 3IMKA 4UAJA 2B2CA 2PX2A 2A84A 4X1KA 1MB4A 2D1FA 3AI2A 5IDXA 3CLUD 2FX3A 2P4SA 4EUFA 2NXEA 3HH8A 1UP6A 4GNKA 4YRAA 2HDOA 1WV1A 1Q77A 5MFPA 1Q0ZA 2P9BA 2Y67A 2BF4A 3K9GA 2FRDA 2PJZA 3HADA 2PKCA 3IFSA 2I3GA 4K1LA 4LRXA 3W06A 4DCOA 1C7JA 3K70D 1K2VN 4BIMA 2ZB3A 1X0XA 1YIDA 1JQJC 1D0VA 4MWOA 2PXHA 4MUEA 1QVVA 6Q21A 2HJHA 2L42A 2WKWA 2ZJ2A 1N2OA 1S7GA 2FH5B 2XNDA 2JLBA 1N8TA 4O1MA 5A04A 1JDTA 4C7OA 2J0VA 2NUTB 4NZYA 2SNIE 1TVEA 1ULUA 2QRVA 2R2GA 2ZVJA 3AW8A 4XVRA 3BH0A 4YRBA 4M60A 1XAIA 1BYIA 4JD5A 4OF4A 2BGRA 2VXYA 1L4YA 4G09A 2C8VA 4LQ4A 4X6LA 5IKOA 3TKAA 2HT6A 3BILA 5IW8A 1J2TA 1R74A 2NT4A 3L41A 3TOZA 3WLEA 3QE2A 1XCPA 3EEBA 3PNPA 3QELB 1ORIA 1ACMA 4FOLA 4D4GA 1I3OA 5TT1A 3RKUA 5ALGA 4DPMA 4B43A 1G6Q1 2XWJI 4E46A 5KNBD 4PWYA 1BN6A 1SUWA 1UZAA 4YRNA 4IG4A 5B7QA 1KDZA 3TSWA 2ZUEA 2B8NA 4HAXA 4LMBA 4Q93A 2Z1DA 1HLFA 5JRDS 2DZDA 4JIGA 4BBZA 1VCHA 7MDHA 1ZUIA 1J20A 2X76A 4RTMA 2FP4A 2RDMA 1Y1KE 3HVRA 4HCJA 1YA8A 1UC8A 5JAQA 4AWBA 3PC4A 2OT3B 4CM6A 2BDEA 1SHJA 2W2KB 5A71A 4CTNA 5K03A 3QNUA 4V0SA 3H2GA 1RAGA 2HR1A 5CLQA 2G76A 2NO5A 3T7RA 3D0OA 2Q5EA 4TVSA 2WF7A 1AK1A 2HLDD 5CM9C 3DE6X 3TRKA 4RPHA 2CV1A 4GC5A 3GFFA 3K05A 4CL3A 4IHJB 4MPRA 1WD5A 1XWWA 2ALJA 1HL3A 1NXPA 1ZA1A 2ZJBA 2ZUWA 1SKBA 3FB1A 4OH1A 1ADGA 3ZI0A 4K3UA 1S2NA 1W35A 1K4MA 3BFKA 2VDLB 4PTLA 3I0ZA 4Q4DA 1QTNA 4ENPA 1NONA 2A5YB 3EWNA 2GBFA 4N82A 4AYWA 4N0PA 1GFSA 1KYQA 3FIJA 3CA8A 3T3MB 3MINB 1U2QA 1K97A 4HLNA 4RTPA 1LDYA 4L8LA 4UUNA 4DQLA 4MJLA 4RMGA 3LMKA 2VDWA 1N1DA 3TZEA 3UUFA 2Q3JA 3TL3A 2P9YA 4QREA 4ZMBA 1R1DA 2BP7A 2GK7A 1SG6A 2D54A 4LSMA 4WLFA 4DEVA 2ZANA 4MW6A 3C97A 3SHTA 2CXSA 2V4MA 5U9CA 1Y6GA 1VHLA 4UASA 3UMFA 3WVNA 1UIMA 3FG9A 2NPIA 2XGGA 4BFCA 5I9LA 5K6TA 4RYLA 4XM2A 1TA9A 2QU8A 3GVHA 2AFVA 1RLTA 1YZGA 2IKQA 2EWVA 3CCCA 1GU1A 1BXGA 3NIGB 4J6FA 1AXEA 1Y3HA 4G5FA 4JNCA 3ZZ0A 3ANSA 1J2EA 2Z56A 2QLMA 5UKDA 1LV8A 3D4PA 4I5DA 1OTXA 4P8RA 2CV0A 3VMMA 3DMNA 4LE1A 2B78A 3BJZA 4FD2A 1K8RA 4G4IA 4ENUA 5BNWA 4X3CA 2ZYRA 3BFPA 3FHLA 1P33A 4R84A 3QWHA 1X1SA 4IDAA 1SOUA 3BD7A 4L0DA 1G42A 1PZFA 4M21A 3EJ6A 2DY0A 4MUYA 3JASB 2BSQA 1QF9A 3PFIA 4OHOA 1JVNA 1Z0IA 1WX1A 3K1AB 1JQ5A 2GT1A 1I2MA 4HGYA 4OOEA 4WW0A 1KDRA 3DOHA 3HU5A 4EY6A 2WJGA 5DCWA 2XT9A 4X97A 2GM4A 2J7KA 1M7BA 3HG7A 5IN4A 3DBRA 3AY0A 4RELA 2ATEA 3N53A 2IXEA 1SBHA 2FPIB 3MOIA 5JMPA 4ALKA 2E5WA 3BRCA 3O2JA 3PUIA 2G3YA 3LX4A 5LSAA 3L6OO 5CX1B 2GD1O 3RI3A 3OA2A 3OI7A 1IIRA 1GTSA 4JUIA 1MT0A 3KOUA 4F2DA 1ZK3A 3SJZA 1KYWA 2W6IA 4KIUA 5GMOA 3CN7A 1O6ZA 1VLQA 2H6EA 1L4LA 2RG1A 3DXZA 4R0MA 3E84A 3TOXA 2QNIA 4KXXA 3T3NA 1YE8A 1RE0A 4LCEA 4CDRA 2CN1A 3KYBA 1LNSA 1W6RA 2RB4A 2IP2A 3RIXA 3ZE9A 4CF4A 1NUQA 2UAGA 4QGHA 1D4ZA 1RQ2A 2NYUA 1SU7A 1SG9A 2O3JA 2XUZA 2QZ4A 4DMGA 1RHUA 3OZUA 5JNTA 2IUTA 3W3AH 4IGFA 1ADYA 2F3QA 2ISCA 2WWWA 3DZKA 2BSXA 2IYPA 4KX3A 3ZV7A 4R5MA 4EJ2A 4JODA 4WBNF 2AJLI 3I2HA 3NKLA 3URMA 3UXHA 2JANA 4FP9A 1QIGA 1H2XA 1KEPA 1ZSNA 3U9LA 5JEEA 4AMYA 2PGDA 2WSBA 1XJWA 1FFSA 3AV0B 3P45A 5F33A 1GITA 1QVZA 4GLFA 5F2OA 5G2OA 4LFBB 2QTVB 2ZIXB 2AFIE 4MPJA 1I9GA 1BHJA 1Y63A 5I47A 1FJGB 3U6BA 4U5QA 1LVUA 3DTVA 3HI6A 4GSLA 1VGQA 3H65A 2QAGB 5CJJA 3IALA 2Z3ZA 1XCMA 4COOA 1E3MA 1H2EA 1YZLA 1U6JA 2W6ZA 1NNUA 3O4FA 3O8QA 2BZ0A 4I55F 4M86A 5SZHB 2WHRA 2NZXA 5U4QA 4B8YA 3IVGA 1C0EA 2BEVA 3PHJA 1ORWA 4ZIRB 1XTTA 2XT0A 1YUBA 4NAUA 1D2GA 2P5SA 3UTDA 1G20B 2VHVA 3ABRB 4ZQFA 2GK6A 5K3EA 4DA0A 4DV0B 1FLDA 1TJNA 4LC9A 4LMAA 2OENG 1T43A 1ZONA 4RVSA 3OOHA 4LQDA 3CUVA 3HI4A 3RSHA 3UZUA 4YV0A 2O5VA 3DC2A 4OHVA 4JEUA 1N5KA 2ZXFA 3IRUA 3QI7A 4NBWA 2WM8A 4P7FA 3RARA 5JH7A 3WBBA 2PVSA 2ZT8A 2P9QA 4DLPA 2O07A 1AJEA 3MJSA 1OTYA 4MRRA 4HNRA 3DMFA 4IZ6A 3ZDFA 2YXBA 3CLSD 2BGIA 4AY3A 3IH5A 3AL0C 2ZETA 3WGKA 4ISBA 4R8VA 3P0FA 2AJDA 4X20B 4LCJA 4XWGA 4AF6A 2IS6A 2O54A 2GEBA 4P3OA 3A11A 3WK6A 5DBFA 2HC9A 4HWGA 4WESB 1E63A 1TEVA 4WPGA 2DBVO 3DUWA 2UUOA 1OIVA 4N65A 4Y2GA 2J9ZB 2GD6A 2A9RA 4GR4A 4MROA 3UFXB 1U0OC 2AWOA 4DRZA 1KEEA 2WRZA 4DM7A 4MRAA 4UHJA 1M5RA 4XUEA 3KV1A 1D07A 1AA9A 1SNYA 3V2GA 1X77A 4DIKA 4YLGA 5K0SA 1KS9A 2DPMA 3SHVA 1S9HA 1UJCA 1FDRA 4IGKA 3WGNA 3WSWA 2CNLA 4QBHA 3CVYA 1KAHA 1I4DD 3ORQA 4BASA 2BRUA 2YMQA 1TZMA 2CXPA 3QKTA 1Z5UA 4QGBA 4R31A 3TTTA 4PZUA 5BOVA 1IN7A 3H5LA 4WN3A 4Z9XA 4M6WA 4NI5A 1F2TA 1U3VA 1DT5A 2EV9A 4YREA 3T3HA 5I4IA 1BJTA 3SDZA 2NO7A 3ENKA 4IGIA 1T4MA 4OB6A 1R5JA 3EBPA 2YW9A 2FZKA 4M0EA 1ABFA 3BHJA 3HGQA 5K8VA 2HRRA 1UP4A 5HF9A 3PGXA 1WXGA 1LKZA 1NVFA 2B6NA 3GEBA 3MWEA 2VSXA 4TN5A 2VDRB 1QHYA 3JQ7B 3MFYA 1CY7A 2P7IA 4M1OA 1GXSB 5CT8A 1M67A 2E0IA 2FG7C 4CMCA 1M2OA 1U2DC 4MV1A 3LYHA 4PM4A 5LUAA 3NVAA 3ZWCA 3KQWA 1CUIA 3GN2A 4HAUA 4DLKA 1ZY2A 4E3ZA 1SVOA 4YMTA 2YJZA 2EHJA 5BYBA 1ONPA 1PS8A 1QVRA 1KAOA 3TJRA 4JQYA 4ZN6A 3FCAA 3OJXA 1IN4A 1ZL2A 2GN1A 2GN0A 2OAP1 1J8VA 1RHMA 4M0FA 4K9RA 1K63A 1LFDB 5B7PA 1FDVA 4P4SA 3THYA 4F5YA 4CMJA 4O02B 3QG1A 5K4AA 4MW4A 2BH9A 2VHUA 2YUTA 3BG5A 3DGFC 2MINB 1EIWA 3L1VA 2G5GX 3KKEA 1OV6A 3KLMX 1LCIA 2ZRJA 3VZQA 3MQ2A 4TV9A 1R37A 1L1QA 3ZE0B 1PJSA 3KRTA 3NAGA 3PNQA 2VAPA 4JS0A 4OQ4A 5CB4F 5I7OA 1YGYA 4K6KA 3OFVA 3FFTA 3T38A 5CVTA 5JS8A 4BLUA 4KGVA 3QVSA 1I0IA 3IQHX 2IHBA 4BNXA 2E4YA 3KXDA 3RW9A 1T0IA 4B32A 1SIWA 5CFPA 4CN8A 1LQUA 3JVUA 2XWPA 2XCTB 1XZGA 2E6KA 3OOYA 1F0PA 3E23A 3VOAA 1J1ZA 1XWFA 4UEOA 4UUBA 1FRZA 1RZUA 3B2NA 5FA5A 3Q8LA 2WHYA 1A77A 3G6KA 1LTKA 3SS9X 1BWSA 4B1FA 1IOWA 2QIOA 3WZMA 221PA 1EFTA 3G3EA 1MAVA 1N1EA 4BP9A 2P3OA 3RLFA 4IFIA 3T1QA 4OKIA 4E13A 3R4VA 2YCLA 3EQ2A 1ZVKA 1WXEA 3DTTA 3ESBA 2OLJA 3ZXUB 1AV6A 2IHYA 5FFMA 1J09A 1DQPA 1VPTA 3R3JA 4QICA 2J4CA 3GLIA 4XPIB 3QXJA 3H0KA 4CVNA 3HUTA 4Q1EA 1YNOA 4G0XA 5LP6C 5DSZA 2A33A 3R1IA 5HPYB 3THWA 3HE3A 4OAOA 4UU7A 3CB2A 4R51A 3EK2A 2QL5A 1RXIA 4JIMA 4BGUA 4DEYA 3MT8A 4LV6A 1VKOA 5C2JB 1THZA 5AFSA 1N9GA 4D41A 3NOXA 5HFAA 1L6IA 1M6VB 3TG8A 5DYTA 3D3EA 4LOKA 4O3MA 3KTFA 1I13A 1OWMA 3P19A 1S2MA 4HYQA 1ISSA 3AHIA 3ZJ4A 4FI3C 1QUEA 3SC2B 1VSVA 1WMSA 3K1TA 2A5JA 2C2OA 1V3VA 2LRHA 4DV6B 3FOZA 3PX7A 2LDXA 3LV8A 3ROQA 1FDOA 4GM1A 2XOXA 1O3YA 1QX3A 2DAPA 1C4OA 3V2IA 4G86A 5TT0A 1U0LA 1MAUA 3GLKA 3QVTA 3L6EA 5FBVB 5IASA 2B99A 2G4CA 1HNNA 2R1TB 3SQXA 2AXQA 2B61A 5DNVA 4EB8A 4DIBA 4B9AA 3H2ZA 1DUSA 4ID9A 1PJTA 5IVHA 3HDTA 3KR0A 2VK8A 4KQEA 4AB1A 2P6RA 2HQSA 4XWAA 1H94A 3ZGZA 4ZCIA 1PEKE 3QEKA 3TQFA 1PN3A 1JR3D 1T15A 2AUNA 2EBHX 1OLXA 3E27A 3EDYA 3JZIA 3TKLA 5IK2D 1IOZA 3M6VA 4UAGA 3Q9SA 4YT5A 5AM3A 2DR2A 1L4UA 3G7SA 4CIWA 3PIDA 2IZZA 1SCKA 2X14A 1Q5PA 4N5NA 4UXJA 1K4KA 1WE2A 3QMMA 2G17A 4KXMA 3TBFA 2DQ4A 3F7MA 4H6PA 1H2AS 4AZTA 1CEXA 4WA7A 4DR6B 5AXAA 3CZ9A 4F92B 1YMVA 4R1QA 1FX1A 3AONB 4CG2A 2PO5A 4D9NA 3LCRA 4PC7A 3MT7A 5YASA 2OBLA 3T9EA 3F5DA 3VV2A 4D74A 1T0PA 4H77A 2ZPTX 1J56A 3UBTA 3BF7A 4X85A 5EQTA 1QU2A 4AK9A 2VTDA 4B3BA 2Q1TA 3JYNA 4KH0A 4F93B 1R88A 1JQBA 3WL6A 3RF6A 2CC2A 1SPXA 3U7QA 1E8DA 3RAGA 1T6BY 4ITVA 2VP4A 4AN4A 4QT4A 3SYLA 3FWNA 1Z0KA 4WCVA 1SG0A 1R4NA 1GPNA 3SR0A 4FHFA 1J5PA 2GAFA 3KFVA 2BEWB 4FFRA 4OBXA 3GDOA 4Q21A 4ZAYA 3WOVA 4D79A 3VA7A 1XVUA 1OXVA 1NYQA 3H2JA 4EMSA 4QTUB 5FLKA 1FYVA 1I3MA 1TEXA 1VBMA 5ADHA 2P41A 4IHJF 3LQKA 3MCZA 3GR6A 4FYJA 4NBRA 1T8UA 1NT4A 5KYTA 1G5TA 2DJ5A 2GBPA 3L3BA 4JT4A 5EXTA 4F45A 3BULA 4FGSA 4WKPA 2OBNA 2WYVA 3O03A 4MIOA 5EKXA 4DZRA 3UH0A 4BX8A 5GPBA 4M1KA 2N42A 1U2PA 4BLSA 2PA3A 2WIGA 1M8PA 4LZPA 4MB6A 4MPPA 4QAQA 5IT4A 5A05A 3GY0A 3I2KA 5KJCA 4FMDB 2BMAA 2I3AA 4PN7A 3C6KA 3A1EA 3B1WA 2VJMB 3E1KA 3FSJX 1D6SA 4LXQA 1F8UA 1QHFA 2I7CA 4QNNA 5A6SB 3WBJA 2OY0A 3GK3A 4HB4A 1GZDA 1N5MA 3ESXA 4O29A 3NT4A 4Z9BA 4PPFA 1WXDA 3P9QA 1J8MF 3JQDA 4TL9A 1MO4A 3GL9A 1M0EA 5HBRA 3MXOA 2WQZA 1XEWX 1O8BA 1HG1A 4M8KA 2I1WA 1DIRA 3R5KA 3ZHYA 3OCUA 1CJCA 2GS9A 2XGMA 3LDHA 4A0RA 5TPWA 1NM5C 2PLNA 3RS4A 2ZAOA 3UB2A 4PG4A 4XIFA 3TOSA 5EJ9A 3GT0A 1VSQA 3VI3B 3KWLA 4MUKA 1C7FA 1SY7A 1WZEA 4KQFA 4OB7A 3WHLA 4C2BA 1ZMBA 1VJTA 2V4ZA 3P0JA 3TWOA 5ED4A 3EFEA 3OQJA 4NZNA 3TQRA 3M6XA 4BRZA 1NVEA 2FZ5A 2F8LA 2D4HA 4B35A 4J7AA 5BN4A 1WCXA 3M1LA 4GZLA 5B4UA 2Q3MA 1EFRD 3PGKA 3T9FA 3QUBA 3QVMA 2MSWA 1KSGA 3I53A 4A2QA 2FWAA 2KLHA 3GA5A 4NYIQ 3LPNA 4NZOA 4TMKA 1E0SA 1B2LA 2HU7A 1REQA 2H1IA 1SN7A 1O89A 5K8CA 3DYBA 2VZ9A 3V8VA 3L5KA 2YIDA 3AM1A 4R68A 3FWKA 4UJ3A 2X2OA 3JARB 2Y0CA 5AVOA 5HQ3B 4HJXA 4DDKA 1IMJA 3W6PA 4X00A 1PSWA 3ROMA 2XYRA 3UMYA 1MUUA 3CR3C 3W1VA 1KI1A 4LDQA 3TB4A 5HUQA 4I6EA 4JJ4A 2D7JA 4DCJA 4M9ZA 3T5BA 1CLEA 3FSGD 1S2LA 3GZNB 4L4YA 4HLQB 3DULA 3OZEA 1Z13A 1SXIA 3NONA 3GWZA 1WZ2A 1CEQA 4HYEA 4LRQA 2IZOA 2FPPA 4JAVC 3BWCA 3AFHA 4I19A 1M6NA 1N6KA 1QONA 1WDWB 2X8LA 1TKRA 5CYPA 3RWOA 1BA3A 5BW6B 4ZKEA 3PJGA 3IUMA 3RASA 1SVIA 2GHIA 2ERCA 4Y2XA 2PSEA 1Q2XA 4OM7A 5A3VA 3VPDA 1PR6A 3VVCA 5KNLA 2F8TA 1BGWA 1GVHA 1YOVB 4B2LA 1UL1X 2ORED 4M9RA 3SJUA 3QYFA 2RHWA 2C3PA 1YI0A 3GLQA 4YMVA 1QK3A 2QUHA 2HU5A 3A31A 3KKLA 3OCZA 3F6BX 3BGVA 4HATA 4Y18A 3V8NA 3O73A 1YB6A 3VTFA 1RM0A 5J4YA 3AIIA 2ZIAA 4DDHA 3ROKA 4P7KA 4TTSA 2YFKA 3DVQX 2IV7A 1JP7A 1Q3HA 2ACKA 3VYRB 5E1DA 3EUFA 4J4HA 2XXAA 1F6DA 4ZXPA 2OZKA 2QRLA 3RC7A 1KHHA 5IS2A 4DV7B 3RC9A 4ZC1A 1E6KA 1V37A 2OR3A 3B2EA 2IBTA 3U7HB 2RCNA 4P5DA 4AJOA 1U7HA 5TMEA 1JALA 4CT4B 1X8XA 4X6YA 1P4JA 2J7PD 3F6CA 1J99A 5FBLB 3IELA 1GZSA 3GJ8A 5DM70 2UXCB 1D2RA 5SY4A 2CB9A 3EZNA 3WV5A 5DHPA 4DXDA 5L4LA 1IXRC 3NZEA 1FW8A 2JI7A 3MLAA 3HA3A 4IWYA 3CW2A 1YS6A 3KTAA 2C61A 3PJRA 1UWCA 1W76A 1WOYA 4G4SP 4M99A 1BCSA 2QPLA 3FJ1A 3PWSA 4R2XA 5FJIA 1A72A 3UOGA 4BKPA 4JKYA 4R2JA 5MN4A 3JSAA 3LLCA 3JR7A 2Y6VA 3VPSA 4PLFA 2GPAA 1E2GA 3DNMA 2IJGX 4UW9A 2NU8B 1U6IA 2RI0A 1XO1A 1WXHA 3O0TA 4PQRA 3UCEA 1T1JA 4Q9NA 3HDQA 3LUJA 1NKVA 3UB3A 3GFVA 3UYKA 3VTKA 4F2WA 2Q5IA 4HFNA 1QHHB 1IN8A 3NHBA 3NHUA 4X8HA 4Q3OA 2C2GA 3LY7A 4DC9A 3H6GA 4NMWA 1ENZA 5AKLA 3OY2A 2NSHA 4KR9A 4ARBA 2RI1A 2Q0XA 3BMQB 4HH1A 2A5DA 3LVFO 2GN8A 4QZVA 2F1HA 1X6VA 3TNDA 3LUKA 3VZBA 2ZSDA 4QJ3A 2JH8A 2XSZD 3NKVA 1MVLA 1P6UA 4NLLA 3BL5A 1Q95A 3GLVA 4RS4A 3ZKWA 5KTKA 5LXTB 1FCJA 1XMOB 1GUZA 1WXXA 2H5IA 4XI9A 1NXOA 2YRFA 1U3WA 4AQDA 3LIIA 3J7AC 5K5EA 4GOLD 3M0EA 3C14C 1JIIA 4ADSG 4ESVA 3PDHA 1B0PA 1J8FA 4QELA 3EW7A 2WC1A 2GR9A 4UEWA 3AM4A 2W6CX 1L5HA 1P0MA 1UM8A 4D99A 4JVSB 4LDRA 1ZCAA 1O4WA 3E3AA 5AVJA 4K9SA 3CLTD 3BXEA 4EZEA 1UMDA 4UEKA 2P9ZA 2AZ4A 1WHTA 2AB0A 2Y2UA 3KXIA 3ZNOA 3MTQA 4GE0A 2C9MA 3LQFA 4QD3A 4LOLA 2PGOA 1JIJA 1W1UA 2W83A 1SH7A 1F6WA 2JAUA 3GFQA 1Y4SA 3HB0A 3AETB 4GUDA 4U2FA 2DUUA 1ZKMA 3G9TA 3W6UA 2ZUSA 3JQ9A 3O9ZA 2B6HA 4JMPA 4H17A 4M8LA 4MARA 4KPYA 4PBTA 3UM9A 4JJEA 4A23A 3IP8A 1G5RA 4RD6A 2E3JA 3TPFA 3CUEF 1X87A 4WNAB 3T1VA 3Q3EA 5ICGA 3P7MA 1HFJA 3TXAA 2R79A 1OOEA 4FQ8A 1O8CA 1IQPA 1AHHA 1Z3CA 1HYBA 1VLZA 3QQ5A 5IXSA 3FPLA 5DVZA 1JA9A 1L6RA 5KYUA 2FVYA 1NDUA 5LQCA 1GSHA 2QTCA 3U62A 3PQ5A 4DB4A 1MO3A 1ZESA 2FSHA 1LRJA 1RE1A 2G09A 3CVOA 621PA 3TL6A 4H59A 2WSMA 1ZC3A 3ZGLA 4KIGA 2UU9B 4OJTA 1DC7A 3V5NA 5KTPA 1LA2A 2ZR9A 4FNAA 2F48A 3LGSA 1ZUD1 1B16A 1D2HA 4A16A 4DN6A 2ZUVA 1CC1S 2ZB2A 3A9CA 4N9WA 4E11A 1U28A 3FI9A 4Y9DA 5AMXA 3DXFA 1YK1A 5KKAA 3EEQA 4CKYA 2G1UA 3V7FA 4YCCA 4GLJA 1TRKA 2WMOB 4B2IA 3PR3A 3A04A 1RWQA 2ZVDA 1WZUA 4RDIA 1FP2A 3D3JA 1CJTC 3N7AA 2WW8A 4NE9A 1DBIA 2YWDA 5D3KA 3WYFA 3W8DA 1CVRA 3BHNA 3JWIA 3VPAA 1ONBA 3ADKA 3K4PA 4EHIA 3H2BA 4IVNA 4WXPA 1PW7A 4FCVA 2GKOA 4FR2A 4YJ2B 3OKPA 4N8SA 3R7NA 4EGAA 3MBKA 3R7AA 1VG8A 1T8WA 3Q9NA 3EZYA 1E9VA 2O3QA 3OZTA 3CH7A 3IJRA 5ESWA 3F1LA 1YQTA 3AKZA 1U1GA 2B7BA 1BVRA 2TMGA 3NC1C 1XRQA 3AHDA 2Z9CA 5TQ0B 2JGFA 3NOOA 1ACLA 2I7VA 1M0TA 1TO6A 3JVEA 4JHLA 4Q3CA 1D1SA 3UA3A 1GNSA 3EF0A 4QDZA 5LNK6 1QPZA 4JI8B 1EVJA 2A0YA 2V5AA 1QQ7A 3C5EA 4MS4A 1C3EA 3CSUA 1N0VC 4N40A 3RVOA 4ALLA 1EDZA 5JCJA 1Z6YA 3O4RA 2OCDA 4BEJA 9ABPA 4AL4A 4LKOA 4YRPA 5B12A 4TZ0A 4OJQA 3NHLA 4CHGA 2EFCB 4A8JC 2QL7A 1GA4A 1O94A 3GJRA 4QUGA 4WEQA 3IUNA 3H13A 4MQEA 1CDDA 1P2FA 3HDVA 4FFSA 1WPXA 4JVMA 5JZSA 5KTSA 2DUWA 4KXQA 3ZWDA 1GPWB 1DKQA 2W0MA 4YRFA 3X1ZA 5EN4A 2F1RA 5C8YB 4AJJA 3NKFA 2BMDA 1PS9A 5EE0A 4Z0HO 3IPRA 3GNQA 1GGFA 2WTEA 5CVCA 4C0JA 1EDDA 3ZY5A 3ZWAA 5JECA 4M98A 3DE5X 2K6GA 3MJCA 3PQ8A 4HWTA 4UVGA 5FWYB 1VI2A 1TT5B 3ZS9A 1MB9A 4JHXA 3DEJA 3T34A 1ZGHA 2GILA 1SHUX 3BFVA 3A05A 2GPNA 1Q7RA 1TB4A 3QSYA 4HEA1 3H4TA 3SX2A 2BKXA 3OOJA 2Q1XA 3QY9A 2J9XB 1AKYA 2V5UA 2V7UA 1U02A 3AFIA 3DOEA 1NG1A 1W8DA 4HRYA 3ZLJA 1FY2A 1W581 5L7YA 5E2BA 5CYOA 4DM4A 3IAEA 1RBZA 5IBCA 2C54A 3K09A 4ND3A 1KEWA 1WCWA 2ZRHA 4U9IS 2FEXA 3MTIA 1PNOA 1G3IA 3EH2A 4AW9A 1DJNA 1F1BA 3BT7A 3HBJA 1QQAA 3NXKA 3UCXA 4Y8VA 6YASA 3IHWA 3IT3A 2NW6A 4LJRA 3PHLA 3IESA 2DLNA 2D0PB 2O48X 2QP3A 4BNLA 2CCGA 4CL0A 1A9YA 3VGPA 2IX3A 1R8XA 4R3UC 4WINA 4OP2A 5JVDA 1V4VA 1VGVA 3D6HA 4HDKA 3IP6A 3QV1A 4I9UA 1I80A 4TUYA 5HQJA 4MITA 1YHNA 2O7SA 3KKPA 4I2NA 4F21A 1NVKA 2GXQA 3SSOA 4R9UC 1ZJ4A 4ZCLA 1RRCA 1BKSB 4INPA 1NVBA 4PLHA 3EMKA 3ZW9A 1JNXX 3Q85A 1PX0A 3ML1A 2IV3A 4FGLA 3QPDA 4MDYA 1V5WA 4L4SA 4TXLA 5T8KA 2O5RA 3A6DA 3T4UA 3IE2A 4HB3A 1J23A 1G21E 1KSFX 3A6ZA 2HRQA 4LRUA 5IC6A 3ZWNA 5A3RA 4DY4A 2BE7A 3RSFA 1JDJA 2Z8YA 2B36A 2QD2A 1ODTC 2XUQA 2QR5A 3M34A 4TSFD 4B17A 3HBAA 3DD5A 2QTHA 2XKAA 2C2WA 3V42A 1KQNA 3F5QA 1L8OA 4OHFA 1U0EA 2VXCA 4N8EA 4FYIA 3UK2A 1IWBB 3UAXA 1V26A 2B7LA 5CA1B 1IU9A 4BRWA 1RWVA 2VG8A 3ENNA 5K0BA 5HZGA 2GD2A 3HB1A 5IT0A 3AVWA 2J3IA 1Q3TA 1IZZA 1RT9A 3WYBA 3FZGA 4DUYB 1O5OA 2ZRNA 1W59A 3RT9A 4WZ6A 3AOGA 2XMDA 1P9OA 1BG6A 1TUGA 1XXHA 3HO1A 2DC1A 4NMHA 4EITA 3R5XA 4RJ2A 3WLOA 3V8RA 5ALOA 2YWXA 4UFNA 1VRCA 4B31A 4TXJA 2VHWA 3WICA 1HLGA 2CW5A 5D85A 4HF7A 3UGQA 4CEHA 3DT9A 3ROPA 1ZH8A 1ZINA 1HGXA 3L1KA 4HZGA 3GLHB 2MYPA 5C34B 3KQTA 1QRAA 2G77B 3AUFA 2AKAB 4P84A 1AUOA 5F3WB 2D06A 4BQRA 5IBRA 4Z1MA 2O3SA 3HR8A 2QIPA 1XTKA 4FMDF 3KQLA 3G0HA 3L9WA 2M6RA 2ZPUA 1DAKA 5HHTA 1XEFA 3MJFA 3A4MA 4Q1CA 2ORIA 2ZUUA 1AY0A 4MS3B 2Y1EA 4X8MA 3SIPA 3AEQB 2HWXA 1SUIA 2XXBA 2JIMA 1RAIA 3BS4A 1Z0ZA 2OBXA 4HLCA 2JGNA 2GHRA 3I73A 1N6HA 1CJBA 1CRWG 4I0WB 1N25A 1H0SA 4XB1A 3FUXA 4YMLA 4ETIA 2DHRA 2WIJA 2HREA 2MSLA 1TECE 3NVDA 3MJRA 2Q2OA 4EJMA 1TF5A 2JGLA 3OH8A 2C04A 4LGCA 3CPEA 3PPIA 1K0UA 1DEOA 1E3DA 1E3JA 3N2KB 1EEHA 5FUVA 3UWSA 3BIFA 4LY0A 2YIJA 5KNBA 3MS2A 1KQGA 2AXEA 1XNQB 5KHAA 3DMDA 1NY5A 1L7EA 3FCYA 4JEIA 2ODTX 4OGWA 2O2EA 1A4XA 3DSRA 3RS7A 1EJBA 2W7TA 2NUAA 1ISMA 3JS5A 3A14A 5C9ZA 1SBZA 4IF6A 4ER7A 3NIWA 5EMHA 4IX9A 2E89A 4HVTA 2CJFA 3OFND 1CNMA 1DTWA 2Y9MB 3W5UA 4Q0MA 3WLQA 2QTLA 5TJHA 4D02A 3BD8A 3KAQA 3ELDA 1ZJ6A 2HLDA 4JI0B 2GEKA 3TLKA 1O03A 2OCGA 1KF0A 2I2AA 4M36A 5JPIA 3P2IA 4AULA 1OCEA 1OX5A 3HHPA 2NV0A 3KSUA 4UHCA 5EQDA 3M3HA 3QTTA 3QX8A 5EY5B 2J0UA 4JJAA 2OHGA 1VKJA 4EDHA 5B4VA 1TFUA 1YQQA 2AV6A 3RYHB 1YRWA 3N2GA 4BVFA 5EHZA 3N6RA 1QBGA 3SXPA 3LD9A 1SO8A 3EW9A 4KKVA 2HBYA 5D01A 4DADA 4QPCA 1LWNA 3QEAZ 1SZPA 4YDSA 3CG0A 3DBLA 3RTDA 3EXHA 1ZXXA 2HJGA 1OX4A 2JIQA 2OV2A 5I48A 1QZTA 4GVPA 4QUJA 2FE4A 1PCXA 2J32A 3L7MA 3NANA 1O87A 4XR9A 4F4JA 4LBZA 1OFUA 1P2BA 1QKIA 2ZRKA 4ECEA 2H1FA 4MV5A 3QENA 1GUDA 2VPYA 3I30X 3K1YA 3F96A 2IYFA 3H2IA 3QFHA 5GGXA 2NNWB 1U4OA 4N54A 2WFAA 5B3JC 3C2QA 1ADFA 2VHJA 3PEUA 3MM4A 1U1EA 3HVKA 4DRXA 4DV3B 5KJ6A 2ICAA 2IP4A 4LTMA 1Q20A 4CLRA 4Q9LA 2OCYC 4XWKA 4B48A 3EIFA 1N36B 1Q16A 2IGTA 4EFLA 3RR2A 2WU8A 3F97A 4ND1A 1FYDA 1DHTA 2G9QA 4EQ6A 3CTMA 4LJSA 3OUUA 4EEZA 2Q3DA 3M2TA 1Y8RB 2E4WA 1JT9A 4I4CA 4PNHA 3A7DA 3IP1A 3KYCA 3S55A 2ZTMA 4BVLA 4F8EA 5JY1A 3I1IA 3AJAA 1IDOA 1N2EA 4TRJA 3GN1A 2XAUA 1GPAA 3DNPA 1H93A 3OU2A 1NAHA 1P6QA 4GEGA 4Q3NA 4YJDA 4DA7A 4ZHQA 4ND8A 4C04A 1D9ZA 3PITA 4WZAA 2AD1A 4HXEB 2W2TA 3L8YA 2LR0A 4RYDA 5EMJA 3REQB 3ZXXA 3VO9A 3BDAA 1G2IA 4RD0A 8ABPA 1Z5ZA 2H2IA 1KI6B 1ZSYA 3KE9A 3LCCA 3CXUA 3FA2A 3OPVA 4MP8A 4TS9A 3OY7A 4Q3DA 5FPSA 2ONJA 2VEDA 2ZI6A 3M3PA 3QWBA 3R9XB 3S99A 1TT7A 2J9YB 2I6GA 1GLGA 3DCYA 3KJZA 3KKNA 4KPFC 3IIIA 3U19A 1USUA 4O63O 2VBIA 2IPMA 2R6GA 2EFDB 3CCBA 1HOXA 1HDYA 1SRRA 1U2DA 2EGHA 2E7ZA 3CVUA 4EO4A 3DZHA 2R86A 1VLLA 3HZRA 3IBFA 4OXYA 5EHQA 2I34A 4GPIB 3CRRA 5BWCA 5JMTA 1X3SA 2NXJA 3U4QA 3SOPA 3BBLA 3LU1A 3BSSA 3OX1A 4AZ3A 1SELA 3L0OA 3WLTA 2P9HA 3I45A 4G81A 2RJOA 2FKNA 2QTAA 3K8YA 4NU6A 4AG3A 4YCDA 2PIAA 5MGBA 1NBIA 3UPTA 4KKXB 2G9ZA 3CG4A 3P9CA 5LXTF 1O58A 2G9UA 1P4GA 3SI7A 5EJ7A 4Z9AA 2DKFA 7REQA 2J9RA 2VP0A 3DVLA 2BKEA 4AAYA 1KIAA 2JL1A 4BY9E 3KZXA 2FZWA 4QRHA 2G8NA 3FDZB 3CRMA 1C3JA 1U5BB 3I72A 1HE8B 4PZYA 5EQFA 2ZK7A 3FZEA 4R1OA 2GPYA 2PX5A 4JI3B 3ZZMA 2OBFA 5FNVB 1NJ8A 2PUVA 5CEFA 1DKRA 1RPAA 2VJDA 1P2VA 1VTKA 1QGUA 1U2ZA 2FWIA 4CM8B 5CLFA 1V5FA 1BROA 4MUBA 5AWFC 3PZRA 1LVHA 3G7UA 3PQFA 4UNIA 1U9ZA 3QYJA 5G1OA 5HKKD 5J4HA 1EM8A 4NBTA 3PR1A 3H5AA 4TYNA 4HAIA 2WP8J 4Q7KA 3E9NA 3DEZA 3O3CA 3GCZA 4WNCA 5JFGA 2ZRQA 4ZDJA 2BT4A 3JVIA 1NN1A 2G1JA 2ZJ8A 3A4LA 3W34A 1D6NA 1KZ1A 4Z8YA 4NFHA 2G88A 4W63A 4P80A 3L01A 3GQBA 2GN9A 1NTOA 1NMYA 5FA6A 4DDTA 5FO0A 4WOPA 1NRIA 4OGLA 5IRCD 4NMLA 3FZNA 3T3IA 2G25A 2H29A 2EZ4A 2IF2A 1NNSA 4AN1A 3IMEA 4LGYA 2I87A 2P8SA 4XD2A 2CK3D 4CKEA 1QK4A 1PFVA 2AZXA 3I1JA 4P3KA 1RWMA 1R00A 2FPKA 3C6MA 4YPOA 4ZANA 3CPHA 1YS1X 2Q1YA 3UA4A 4E14A 2HL6A 2HSZA 5IZCC 1AXRA 4H3KB 3TFWA 4RMHA 3QFCA 5JJCA 4H0CA 2I4RA 2O0JA 5BN5A 4S2UA 1QK5A 3WLPA 4DC0A 1E3TA 4DA4A 1M34E 1NUTA 3FPKA 2VCHA 1KWGA 2LGJA 1ZJ5A 4Y0AA 4BE9A 1ZH2A 2IODA 1MFZA 1ENPA 2VDJA 3ANTA 5DI3B 1IBMB 1A8SA 2VUTA 4DILA 4B47A 1RTKA 3GGDA 6REQB 1OXTA 5L4NA 1JH8A 1WSAA 1PTJC 2XB8A 3GU3A 3ICCA 2IH5A 1UPCA 4AIIA 1CUCA 1LI5A 1L3BA 3DM9B 3QJGA 4AECA 1Y6JA 3ZQ6A 4TKVA 5GQSA 2O2YA 4I1UA 4XIYA 3WGLA 1T3HA 5HKLA 3RFFA 4AYTA 2B2NA 4N7JA 3QE0A 1BDMA 1Z7WA 1PWYE 2JIPA 5AVSA 5LQRA 2JFOA 4G0OA 2C5AA 4GH5A 2M6LA 4UBJA 1HEUA 3HCRA 3CX3A 4GKVA 5FI5A 1TTPB 4Y6SA 4MHOA 2O14A 5LZ4A 4YJ2F 3QJYA 2CVFA 3CKYA 3LDUA 4DNPA 1V8FA 3T6KA 3GDFA 5E3JA 3EDOA 4JVLA 3W77A 4TS1A 1UR5A 3U7FB 2CT8A 2FPWA 3D2LA 3N7UA 2H8KA 1A4IA 2IPOA 3HM2A 1XAJA 3WNVA 4DSOA 3OLWA 4RZSA 3T12A 4DEXA 3TLYA 5BRJA 1RXSA 1N5DA 1RYMA 5LLSA 5AHXA 1O97D 4U2BA 3SY8A 4ZVLA 4BB9A 4TKZA 4C7XA 3F5FA 4KAFA 2Q4EA 1SHTX 1UK8A 4KAXA 4BKRA 4LOAA 1N9ZA 5DF1A 3T95A 2IU4A 3H9BA 5CVJA 1LU9A 4O4HF 3U1VA 5CB0A 3EPLA 2POQX 2XQIA 3PFNA 2ZYSA 4QGGA 4S0XA 3RVKA 3U1BA 1V6SA 3DL7A 1JXMA 2JGDA 1G59A 4KEAA 1QF7A 5IYZA 1JWLA 2CFCA 4KHZA 1QCZA 2XUOA 4MCJA 1X7YB 1M1NA 5HMLA 1U98A 3RSLA 2F8MA 2E82A 1JAHA 1F14A 3T7SA 1JVBA 2VF5X 5J2TA 4OX9Y 1Y8ZA 1Y5MA 2PH1A 1N77A 1HI9A 2X2EA 4XGQA 5JVDF 4QFBA 4BRSA 1A0OA 4GMHA 1JXAA 2IPLA 1QG2A 3FX2A 4OQEA 2XQKA 4EPXA 1L7MA 3W7AA 1S3IA 4BO3A 3IAM1 2YQ5A 3C41J 3E4DA 3L1HA 4XX0A 1SXJD 2Q41A 2CXHA 2O23A 4G89A 3RUFA 4ZAWA 4A6DA 1FNSA 1Y7PA 4AJ2A 5JLJA 1AA6A 2WAXA 1V39A 1RRMA 4UNSA 4V3BA 3ABIA 3UGJA 3NDRA 4HAZA 5H83A 2J9GA 3VM6A 1E99A 3W5SA 2HJVA 8GPBA 2QJTA 1RAEA 3OQ6A 4KMSA 5EPUA 3OBIA 1CV2A 1JNYA 3D6NB 2BGTA 3CRVA 5ALLA 1GAEO 1I2CA 1IG3A 5DRTA 4AS3A 1JJFA 3M6WA 4M3NA 3HKBA 2X0IA 4IIJF 4OXQA 4BZWA 1MNQA 3MCUA 4TMFA 5G53C 1U5CA 1Z4OA 4MS1B 3IOEA 4L5AA 4Q4HA 1MOSA 2QUBA 2Z8XA 3CJRA 2YFHA 4Q6BA 5THQA 1NQUA 3AHJA 4JI1B 1VA5A 1QOZA 4LOHA 4C0XA 1HM5A 1RQPA 2O2ZA 3C3CA 4BNYA 2JGAA 2WAAA 2NIPA 1H1LB 3H97A 1A9TA 4MGHA 2DQSA 3O74A 3RQIA 2L17A 1TQDA 4I99A 1F2UB 2RK3A 4B6GA 4R7ZA 1QDEA 2CNWA 5EIHA 4Z7QB 1GTRA 2Z5FA 1Y7LA 4RK5A 4YRMA 1TQ6A 1G4AE 2G06A 2Z95A 3H5RA 3QGMA 4CMGA 4CKXA 4UQOA 1QF6A 4YUAA 1MIHA 4OHKA 1GUBA 1NI5A 3DZCA 1TCAA 1PT8A 3I8OA 4EX6A 1CZKA 2EFYA 3RRNA 3O2SB 1DKUA 2GLTA 4I6GA 3ZCSA 2QW1A 3NMUF 4HAOA 5KTOA 5E4JA 3JRWA 1N2CB 3O4HA 5BVGA 4AZ0A 4DLNA 1H4VB 1WZNA 4B80A 3W5DA 4N8DA 2HPVA 1M75A 3C1UA 3SE0A 3IB3A 3M7IA 4UHKA 3DO8A 2VH1A 3GLFA 2P3SA 1CHNA 2ST1A 2JLYA 4H4EA 3T7AA 1MT3A 4P54A 2FGKA 1QCDA 2VBGA 1N78A 3FNHA 1NBMA 5CA1F 3LF2A 4BO9A 4IUCS 2O8FA 4C0WA 1CW2B 1I4LD 5JJLA 5DASA 3BMOB 3ECCA 4DM3A 4F1KA 4MVJE 5I9NA 2N46A 5K05A 2M6KA 2V6MA 1XA3A 1IQ0A 1JDZA 3DG9A 4BFTA 4DMUB 4W9NC 3ZZTA 5KX5B 4D45A 2YV3A 3CEJA 4G0VA 4HQLA 3NT2A 1BE6A 4X1IA 3BFXA 3OZWA 3TAHA 4CM7A 5AW7A 1JEQA 1Z0AA 4WQMA 3ZIAD 1I6KA 4KGDA 1FUEA 2HWYA 2ZRMA 1W19A 3HCDA 4JLPA 1OXSC 1Z4LA 4XCVA 1H0RA 3A3KA 1L3IA 4PLCA 4G56A 1BMFD 1MMFB 4BMNA 5KQLA 3KPJA 2C8LA 3E03A 3G13A 4O2LA 4PZ0A 4RAOA 2GPBA 2RKBA 5IK2A 3ZHRA 4PYKA 4PNEA 4CCYA 1CR4A 1GRCA 1GPUA 3B78A 5DHAA 4D6YA 1HTTA 3SEZA 1FVFA 4LI3X 4GECA 5JBQA 2H54A 4WDRA 2VTEA 3ZH9B 1SB9A 2FF5A 4LKRA 4DQKA 3PUYA 4FLEA 1CPYA 4QQNA 3EGOA 4KB5A 1JLHA 2V7WA 3O2QB 3OOEA 4HNHA 1TFRA 3F49S 3B1XA 4BMXA 4PHTA 3A27A 2ADFA 4TLDA 3OMLA 4P9NA 1A4UA 4Y1FA 2BI8A 4RNDB 5ERGB 4L2IA 3ZWPA 3HWWA 5KB3A 1D9XA 2PJDA 4XWOA 5F51A 1CUXA 4F96A 4LOIA 2FPSA 5DP1A 2XVXA 1ZQ1A 2NADA 4D0RA 1RBYA 3E8SA 4HC4A 4WK2B 3AJRA 3IB6A 4HV4A 3DKVA 4FC6A 3WWDA 1JZTA 5FRDA 2XCIA 1UJNA 1H22A 5DT2A 5FPKA 2PVCA 2XVAA 4URUR 3KE8A 5LZ9A 4JDUA 3KP1A 4YWJA 1GZ5A 1V9SA 2Q6KA 4QLBA 3QYAA 2PR2A 4YQEA 4W1PA 1N8KA 1GTVA 5DMHA 2RGBA 4ECAA 5KYWB 3FYUC 3D9QX 3SDBA 1D2EA 4AKIA 3KQSA 4RZXA 1X1RA 3VOTA 5IWCA 1YOBA 1E2LA 4FFVA 5IVKA 1YBVA 3H05A 3R09A 3W7VA 4YXFA 3TQCA 1S0UA 4LZLA 4K9NA 4LJ9A 2WUWE 2WY2D 2ZAGA 1IWPB 3QVWA 1BCRA 2LNDA 2ODNA 1N6RA 4P1ZA 3M8KA 3VU1A 4CHTA 5AKEA 1YL7A 1LLFA 3IV7A 3I9FA 2OC9A 4L4UA 1WRBA 3V48A 4QECA 2GZDA 2F59A 4BMYA 4IMJB 4IOKA 4LJAA 1US8A 3ZKAA 3KKOA 2H1RA 4LJ4A 4KGZA 5I4CA 3M1IA 2HEGA 3SZMA 1JKIA 1NXSA 4V1CA 1AUPA 3E1GA 4K28A 1IPFA 2IOFA 3GEPA 1FFEA 5J5AA 4B34A 1YK0A 3DQPA 2WLTA 2IZ0A 2E5FA 4HGRA 3V4OA 4D9BA 3IJEB 3D1LA 1BS2A 2IHVA 2ZYHA 3IKVA 5JWOA 2ZUDA 1OLSB 1KI3A 5HJEA 2Z2IA 2RIPA 2YZNA 4IYJA 3JD0A 4AJHA 2AMVA 5JIBA 3NDBB 3AEUB 1FFYA 4KK4A 4A5SA 1RDFA 3SXJA 3UEOA 3ZI4A 4RETA 1JZSA 4NVRA 4LRYA 5TXGA 2BFEA 1BSVA 2OMEA 2OZLB 3QVOA 4MWEA 1IN6A 4YGXB 5TE9A 2CDCA 2ID4A 5EKDA 4E4YA 4EHAA 5FX2A 1WETA 2XB9A 2H4WA 5ITZA 2G5PA 3OEWA 4RU1A 2JS7A 2C5SA 3LWBA 2E6UX 1ZGZA 1XRPA 2GFIA 4G37A 5AH0A 3CNHA 3N0TA 1PR4A 2OMKA 2VHZA 1C7IA 2C2YA 3JU3A 1NR5A 1E9DA 3ECSA 4X8LA 1J0AA 4C2TA 5DTQA 2Q1UA 3W9BA 2DCMA 4IGEA 3AILA 1H0KA 4TTRA 2ZEJA 1X9GA 1Q1NA 1EFRA 3IPAA 4D9CA 4ENSA 6NULA 2J48A 2AG1A 5JNSA 3ER9A 3DKKA 2ATCA 3AY3A 3RRYA 4EHFA 1O96B 1K6EA 1ZW1A 3PRKE 2AFHB 4JC0A 4TT3D 2C96A 2UYCA 1NYTA 4JLSA 3HCAA 3ND8A 4Q4CA 1W9HA 4GI3A 4LY6A 5EIBC 1N5LA 2Q2QA 1R6VA 1V35A 2W6JD 3HVJA 4LE0A 4US0R 5A2GA 2RGEA 4H15A 1CT9A 3QF4B 4GM0A 1VQ1A 1T9KA 1UANA 4X1YA 4NECA 4MWBA 2FEMA 2NLOA 3CWCA 1TM3E 4JOSA 1N6NA 1AKRA 1WF6A 4PZDA 5LYJA 3SBEA 3AGQA 2HNAA 1Y9JA 1CQJA 1U0HC 2ISSD 3B1FA 1FP6A 3DEIA 4HPJB 4MEBA 3Q9UA 1U1CA 2AC2A 1TU3A 3BMCA 1RM5A 2FUEA 3EAGA 1P2TA 2EQ5A 2BTOA 4AU1A 1EDEA 3OEHD 3TNJA 4Y6OA 4WN9A 3UICA 4BV3A 5G0VA 1HFEL 3EJWA 1PQUA 4R83A 2XD4A 2VHYA 3OIDA 2OQ2A 5BSRA 5KC8A 1NTRA 3PNVA 1WTAA 3T94A 4CEJA 2CZQA 4YV7A 1FUKA 2QRNA 2RSLA 1Z18A 2AZTA 4K8OA 2PX6A 2ZI7A 3UB4A 2J08A 4RUKA 3P5SA 1CG6A 1QAQA 1HDEA 1M5UA 4JVOA 3WGIA 1RI2A 3ZHUA 5ERYA 1M33A 2CUZA 4HGQA 5AP9A 4UHFA 4HVCA 3AUSA 1F4VA 3DKPA 4RGQA 1O9GA 2R5NA 1CZOA 3E70C 4EW6A 1I4OA 5E6SA 1MPTA 4L8VA 3UXEA 4BLOA 4KDFA 1NHWA 4Q9HA 5LA6B 3WGYA 5TQ2B 2EZUA 1Y3DE 4Q02A 1MO5A 3MB8A 1H42A 4EF6A 1MP0A 3K0AB 1D1TA 3OFKA 2NSYA 3T0GA 2MSKA 4L6IA 4KW7A 3ED5A 2HLNA 1LS6A 5I01A 4YB8A 3B6IA 1E5XA 1TZCA 3GMTA 5FNVF 2WJZB 1DKMA 3T5TA 2H2AA 4E15A 2ZT7A 1NJ2A 1BC5A 1OH5A 3SSAA 3EGXB 4IQ8A 1I51A 5LLTA 4LJ8A 2O2DA 3Q5DA 4HTFA 3WC4A 4JR2A 3W5HA 1Q11A 1B7GO 3R3XA 5JQWA 5JBNA 4QDTA 4GOMD 5CA0A 3ZWOA 4R8SA 1XK7A 2J7PA 3HY6A 4ZZ2A 1HE2A 1JILA 4L9WA 4MLZA 3UT0A 1NVWQ 4QGFA 1VRWA 1YCHA 1P77A 3QWFA 4P5PA 4ZVSA 2ZJ5A 3QXGA 2IU0A 3PGJA 3AC0A 4G9EA 4AWAA 5CDYA 1FX0A 5TARA 4MDEA 3A6GA 1F8FA 1EHYA 4EPVA 4NPAA 5B3KA 2WP0A 1PJZA 4PXAA 2JAQA 5C52B 4BU0A 2NU6A 3H8VA 1YFZA 4KUEA 4NS4A 1EQUA 1TZKA 4YPVA 1ZAYA 3PWKA 1EGQA 1FBNA 1B26A 3QU4A 1XQ6A 1QZXA 1VXOA 1OWNA 4L73A 3OMXA 3RYFB 2ZREA 3WGTA 4J03A 3LUGA 3KETA 1CSEE 3NR2A 1IUKA 3LOQA 2XDQB 4KOAA 1P1RA 1XMSA 1CS4C 3HU1A 3R7DA 4HT3B 5BUQA 1CQIB 2REQA 2JBHA 3X2EA 1F5SA 5IWAB 2XWBF 2Y9PB 4FMPA 1B6TA 3GJTA 4TRRA 1D09A 3AF2A 4L85A 2A78A 3JALA 4M8IA 4WDQA 1BWPA 5C4GB 2NUPB 1N3IA 2AQIA 2O4UX 1KDYA 4XWWA 4HBGA 3KT8A 3BDVA 3HY3A 5CDGA 3KYDA 4Y6LA 2C5FA 1ID1A 4CGYA 3TEFA 1JLKA 1TYAE 2UZ1A 4ERXA 3NDPA 1YRYE 2FN7A 5F52A 1DX4A 2NTNA 5GADl 4GOND 3RREA 3TSAA 4B7XA 3AFNA 4ZCQA 1E0JA 1PR5A 4UDNA 1GADO 2OORA 4BLQA 2BMVA 3WGHA 3CEHA 3ZIUA 4UMVA 3E3NA 3KZOA 4N0EA 1TUBB 5FTJA 1UFKA 4OM8A 4C4ZA 5KYYA 1R8YA 2K7ZA 4WZBB 3EBLA 5GJVC 3SC4A 4QM6A 1W4BA 2RD2A 1KZ7B 2JAXA 2WT9A 1YQUA 2E4XA 2DPHA 2H1LA 4JGGA 5JE8A 3TW4A 1IC6A 4FSHA 3ZJUA 2BISA 2OLEA 4U1RA 1WW8A 1JHUA 3BMNA 1JLLA 1NN5A 1FTYA 3OZ7A 4FU0A 4J4TA 6CHYA 2UXBB 5KOJB 1TQ4A 2CYCA 1NR1A 5JD4A 2ASEA 2HSEA 3JQ8B 5CM2Z 1THGA 3MWFA 2X4IA 3H86A 3SYMA 2GAAA 1SPBS 2PNFA 2Z2JA 3DPIA 1FTGA 4C0BA 1SRQA 1ZCBA 5BSKA 3TSCA 3U0VA 1MABB 3EVEA 2JLXA 5E7IA 3KOMA 4L4RA 2AD5A 4Q4JB 4XQ0A 4HQ0A 3KDSE 1RKXA 4A4DA 4U3JA 4MRMB 3S6JA 3R7FA 4PLVA 5JAOA 1G5PA 3NBMA 4IAOA 3WMXA 2ZLBA 1GRQA 4ZD6A 5KQMA 3DUFA 2BFBB 2EOAA 5H68A 1U7ZA 4ISCA 3TFQA 1JW9B 4CEIB 3CBQA 3OLZA 4GP9A 1UBUS 4DREA 4LXUA 2G72A 2FZLA 4LF9B 1X9IA 1IM8A 5AKJA 1O6GA 2CMFA 1EWQA 1HSOA 1OHHA 4BWYA 5AOAA 4CMEC 5CBPB 1I3CA 2FMXA 2GCEA 2WJYA 4O4IA 4YFYA 4A2CA 1ENOA 3BD6A 3VAYA 3PZBA 4RBNA 2ZI4A 4H1HA 4ZWNA 3PDUA 3GF4A 2X13A 3UC5A 2OK8A 1LBHA 3VMFA 1HYQA 3VR4A 2K87A 3CV3A 2FWJA 3VH2A 1OYWA 3VZPA 4EG8A 3HVIA 1CU1A 3IPLA 1BW9B 2FOXA 3MBOA 2G71A 2IBSA 1L7VC 3EGEA 5G4KB 5C7OO 2YWRA 4JBNA 3CN9A 1S8FA 3OQBA 4L6CA 1Y6RA 1A27A 2QSUA 1BFKA 4I2VA 2WMDA 2Q5QA 4UXHA 5DWVA 1V95A 3QFSA 4J8PA 4GG1A 5G0TA 1W4AA 4ZYUA 4WXYB 4EHKA 5K8IA 2B82A 2JCGA 1FU8A 4GO1A 4LWOA 5A2QA 5I7UA 5JASA 5KJEA 4Q66C 4R1PA 4NDZA 3DAYA 3LCVB 4JN6B 1G55A 3GP5A 1PRYA 3FWPA 4DSAA 5EJ5A 1JKJB 4FT4A 4MCAA 1QC5A 1QE3A 3U26A 4BLPA 1N33B 3OQPA 4LSGA 1ZYUA 1M2WA 4G1UC 1XEAA 4PSVA 3K5IA 3PP8A 3EG9B 3MWDB 3ZQUA 1UXIA 4Y3UA 4CUKA