1LGYA

Lipase ii from rhizopus niveus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
265
structure length
265
Chain Sequence
KVVAATTAQIQEFTKYAGIAATAYCRSVVPGNKWDCVQCQKWVPDGKIITTFTSLLSDTNGYVLRSDKQKTIYLVFRGTNSFRSAITDIVFNFSDYKPVKGAKVHAGFLSSYEQVVNDYFPVVQEQLTAHPTYKVIVTGHSLGGAQALLAGMDLYQREPRLSPKNLSIFTVGGPRVGNPTFAYYVESTGIPFQRTVHKRDIVPHVPPQSFGFLHPGVESWIKSGTSNVQICTSEIETKDCSNSIVPFTSILDHLSYFDINEGSCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of lipase II from Rhizopus niveus at 2.2 A resolution.
pubmed rcsb
molecule tags Hydrolase (carboxylic ester)
molecule keywords TRIACYLGLYCEROL LIPASE
total genus 86
structure length 265
sequence length 265
chains with identical sequence B, C
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1996-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lgyA00
4QDOA 5LZ2A 5AM5A 2WIDA 4MWSA 4UHBA 4NVRA 4C4YA 2VT7A 2XMQA 4BRZA 2VF2A 4HTAA 1K5PA 4C88A 4OU5A 1CV2A 1EX9A 3C6YA 2WKWA 3QVMA 4DNFA 3IUNA 3FLAA 2XQJA 2C58A 5AK6A 1WM1A 1DX6A 1AGYA 4HS9A 2XQKA 2PSHA 3V48A 1R3DA 1QGED 2ZJ6A 3IBTA 1XQYA 4GXNA 1MPXA 1ZOIA 2Z3WA 4H7DA 1PJAA 2ES4A 4KAAA 5ALEA 3AZOA 1MN6A 1H2ZA 5K3BA 1TKRA 4DIUA 3E0XA 3BL8A 1DQYA 1BS9A 1LPSA 2JF0A 4LHEA 5LP1A 2VJDA 2AXEA 1GKKA 1CUXA 1R4ZA 3N2ZB 3MUNA 3D5EA 3G9TA 1JMYA 5AI6A 5E4YA 4W1QA 5AI4A 5KREA 4FLEA 5AICA 3BJRA 1SCIA 1QIMA 2HIHA 1YS2X 2PKYX 2PSEA 3BWXA 4V2IA 3STUA 2QMQA 2XQIA 4PSUA 3V1MA 1CUAA 2VAXA 3H2IA 1QO9A 4MEBA 2I03A 3F8SA 2VJAA 3CCBA 5D3KA 3ZV7A 1LPOA 5DNUA 4B0OA 5A7GA 2AJLI 5EI5A 3HJUA 1IVYA 2ACEA 4J0KA 3IULA 1C7IA 3PICA 4DMCA 4H18A 4DNQA 1LBTA 2G4LA 2EEPA 3M3DA 1IUPA 2YYSA 4Y2PA 1E5TA 3A2NA 5ALIA 2QJWA 2V96A 1XRRA 3STVA 3FBWA 4UPDA 4E15A 4G5XA 3HLKA 1XZAA 3O9MA 4G1FA 1XZFA 3FYTA 5AM3A 1WHTA 2WHPB 1LNSA 4UHCA 1E8NA 1TCBA 1X70A 3OURA 1G4HA 2WFLA 2Y2VA 1ZD2P 4X3CA 3ZWQA 3MVEA 4GHWA 2GBFA 1ODTC 2G63A 4UBJA 1XZJA 2CB9A 4B82A 1W76A 3K9BA 3BDVA 4K6HA 2I3ZA 1IZ8A 3HABA 3DYVA 3DKRA 1CVLA 5FPPA 5EGNA 3F96A 2PPLA 2GYUA 4B9AA 1XKTA 4GLBA 2Y1KA 4J0CA 2BJHA 2OXEA 3BJMA 4I19A 2JGKA 2PVSA 5A7FA 1R9MA 5HCUA 3WKCA 2CJPA 2H9YA 2BAGA 4HRXA 3HACA 3S2ZA 1CUGA 5LYYA 1JJBA 1W6RA 3IURA 5CT9A 4GI1A 2VJCA 5HF8A 4KEAA 2JGFA 2WUGA 4Q3LA 2RAUA 2QUAA 5DTIA 3VJLA 5LIPA 2WM2A 1XZKA 2XMSA 1EI9A 4OSEA 4IH4A 3WA6A 5A62A 5JADA 4LXGA 4AXBA 2H1IA 5JATA 1IZ7A 4FHZA 3YASA 4Y9SA 2QT9A 1T4MA 4KAFA 2XUGA 1EDEA 1Y7HA 2HU8A 4JYPA 2JGMA 5AM0A 2XUQA 5AKJA 2WUFA 2Z5GA 5ALJA 3M83A 2OCKA 3S8YA 3ED1A 5AKGA 4NZZA 4FBMA 1WPRA 2R11A 2XUHA 4LYDA 1KU6A 4ZGBA 3DOHA 3PUIA 2PM8A 5I7UA 1WB6A 2WQZA 5CH3A 3TRDA 3GA7A 2WG0A 4B6GA 1XQVA 4HZGA 3OPMA 2AJ8A 1VZ3A 3I2GA 3G0BA 3O4IA 4PNZA 3FYUC 4QZVA 4ZXFA 5K3FA 4CIBA 4X00A 3KOOA 1A8SA 2OAEA 3W04A 5AHXA 3FWHA 3DS8A 3QPCA 4QLAA 1PFQA 1K4YA 3ICVA 3C87A 1VA4A 1EH5A 4BTLA 4C01A 1WHSA 4EB0A 3KWFA 1AX9A 3A2MA 4AX4A 4QWWA 3A70A 1GT6A 2DSNA 1BROA 2GBIA 4U2FA 4EZIA 2Z8XA 4L72A 2OGZA 1E3QA 2HADA 3EF3A 5FV4A 4KAJA 4I4CA 4B7ZA 5ALXA 4YK7A 2WFZA 3HZOA 4BCDA 4JH0A 2BCEA 1Q84A 3H18A 5SYNA 1JI3A 3BDIA 4UFNA 1DU4A 3WJ1A 1CUVA 4WDQA 1LZKA 1JJFA 3K6KA 2O2HA 4F5ZA 2C5FA 1UXOA 1EXWA 2PU5A 4BRSA 5CT4A 1FJ2A 2J4FA 4FBLA 4DGQA 2VSQA 2BGRA 3WWPA 2Y2UA 1ODCA 2XT0A 3IUJA 3PDCA 5LZ9A 5IVIA 3W2TA 4AN1A 3O9VA 2XLCA 3V1NA 3UMJA 3I2JA 1XRMA 5FPQA 4ARAA 4W9RA 2E3JA 3H2GA 5JAOA 3AIOA 3BE8A 4W63A 3HRHA 3ANSA 4B81A 4FNGA 2O7RA 3T4UA 5I9IA 5AOBA 2G5PA 3JW8A 3QPAA 3ESBA 5E2IA 3L1JA 3IUMA 4L3WA 3U0VA 4Y2VA 3SC2A 4H35A 2WG1A 4X95A 5DLPA 1EDDA 1XKLA 4WFIA 1FFCA 1W52X 1FFDA 1DINA 4AMYA 1S8OA 3IUQA 5ALMA 1QJ4A 3I2KA 1HBJA 4GWLA 1W75A 4KRXA 1UK7A 3C6ZA 5JAHA 1YB6A 1YS1X 5HF5A 2VTVA 4UHFA 4B80A 4W1SA 3WIOA 4HXEB 3GZJA 2QXUA 3KD2A 2OCLA 5EHQA 4CCYB 3O4HA 4G8CA 3FNBA 4U2CA 3IVMA 6YASA 3WWOA 3WK6A 1CUHA 2XDWA 3H17A 5DYYA 3GROA 4CG3A 1TK3A 1MAAA 2VT6A 5ALRA 3NGMA 4HXGA 2O2GA 4ZREA 1X2BA 1DQZA 4M0FA 2ZJ7A 5K3DA 2HU7A 2WHRA 3R3ZA 1CUIA 1E66A 3AZQA 5JASA 1FSSA 2CZQA 3P2MA 2GBGA 4LIPD 1XFDA 4W1RA 1QIDA 3LP5A 4EBBA 1XROA 1P0IA 4RGYA 1J07A 1ZD3A 2RHTA 2OLEA 1LLFA 1IUOA 4S0XA 1DTEA 4YX9A 5HK9A 5JANA 2HA2A 3AZPA 4MWTA 2C7BA 3CN7A 4QWMA 5A6VA 1XQXA 5BOVA 3LCRA 2PSJA 1YA8A 3HSSA 1AMNA 3I2FA 4QEKA 5FOQA 1QIFA 2VEOA 2QM0A 1VXOA 4PSCA 3DNMA 3VXKA 4C4XA 4YPVA 2XI4A 2Y6VA 3AIKA 2VATA 4GEGA 3HYSA 1EB9A 5A71A 5DNVA 3JWEA 2AJCA 2XUPA 2HU5A 3WWCA 1J1IA 1D07A 1ZD4A 2OGSA 1W4LA 4H7FA 1QZ3A 5AKXA 2WFLB 1Y37A 4Q1VA 2YXPX 4IH9A 2QKYA 5LZ5A 5T4BA 3TGLA 3BF8A 1ZJ4A 2CEKA 5K3AA 4F0JA 5E4TA 4Y2UA 2V97A 2QRUA 3LIIA 4HAIA 1ZI8A 1CUWA 5AIAA 4DNOA 5LZ8A 5AKKA 1DT3A 1ZIXA 5IVDA 4X71A 5ALPA 4Y2QA 5C7YA 1CUYA 2XUOA 5ALWA 3NOXA 1CUJA 2QZPA 5DYWA 1OXMA 4GBGA 1XRQA 4H7JA 5ALLA 1ZI9A 1QTIA 5DTJA 4UHEA 4OU4A 1VOTA 4QNNA 4BP8A 3ZI7A 4G8BA 1JKMA 1TAHA 3D3NA 1XLWA 5HKAA 5AI8A 1UOQA 1EHYA 2H7CA 5YASA 2HFJA 4X90A 1VJ5A 1UKCA 5EHNA 1J2EA 3MUOA 4H7EA 4M0EA 2XMZA 5AKIA 5HQ3A 4DM7A 4QE3A 2EDAA 2ACKA 3EBLA 2OCIA 4DYHA 2X8BA 4J0IA 3W9BA 2OPHA 4CCYA 1P0QA 5CT6A 2QOEA 4BCBA 4J0JA 2WJ4A 4FFVA 4E11A 1EB8A 5AKZA 3GUUA 2JIDA 4RNCA 1RP1A 3G8YA 1OILA 2J3QA 4UFOA 2XUDA 4J3JA 3WQHA 4OB8A 1QO7A 4EUSA 1DWOA 4X7BA 2XQGA 5FRDA 2DR0A 1JU4A 1TRHA 4UUQA 4FLFA 2LIPA 4GDMA 4OUKX 4XIIA 1F0PA 5A2GA 4W1PA 4HVTA 3SK0A 5LKAA 3R3WA 2PSDA 4BVLA 1QIGA 3DCNA 4BC0A 2WSLA 3DEAA 1R50A 4UFPA 4BC1A 5JAPA 3C6BA 3QM1A 2QUBA 2ZYSA 4H77A 3C5VA 4CG1A 1SOMA 1AURA 2VAVA 1JJIA 3DQZA 3RARA 1WB5A 1SC9A 3WYDA 5AKLA 4G4GA 3QZUA 4PQEA 1RWQA 4U2DA 3GELA 4CI9A 4QA9A 4C6HA 1GPNA 3SWWA 2W22A 3R3XA 2FUKA 2CKMA 2VJBA 2JEYA 2B61A 3FVRA 1CLEA 2BGNA 4G4JA 5AKEA 4DMFA 5ALHA 4X91A 5FXMA 5KWIA 3I6ZA 5CURA 2DHEA 3EQ7A 3NUZA 2QVBA 2OG1A 4Y2YA 1QIKA 4NMWA 5JIBA 4OYYA 5K5EA 2WLSA 3D2BA 3ESDA 3G9ZA 3WK5A 4O08A 3R3VA 4KYVA 3Q0TA 5ALSA 4KE7A 1QIEA 1PV1A 5AK3A 4G4IA 1XZCA 4D9JA 5HQ3B 1RYYA 4M0MA 5HKBA 2X5XA 2DHDA 2RIPA 3VISA 4WY8A 4X6YA 1YAJA 3VJMA 4DSAA 1H2WA 3R3YA 1WB4A 1WPXA 2ZVDA 1GKLA 5FDFA 1A7UA 5IVKA 1HKHA 1A88A 4FDMA 1QONA 3WK8A 3O4GA 4N8SA 4XX1A 4BE4A 2C0QA 3F67A 4NS4A 3QITA 2ECFA 5T4FA 4DNPA 3OOSA 1MT3A 3WYNA 1L7QA 4ZI5A 3QMWA 1J06A 4AZ0A 3STYA 3JYHA 2C4HA 4FKBA 1AZWA 1UOOA 4BDTA 4WDRA 5HF9A 3VJKA 1NU8A 3D4LA 4RE5A 5HZGA 4G9GA 2UZ0A 3D2CA 4X85A 3HXKA 1UWCA 3FLBA 3L1HA 3U1TA 5AIBA 4FTWA 1CUEA 3OM8A 4JNCA 5HF6A 1H2YA 4HRYA 2QR5A 4OYLA 5IKXA 5EFZA 3WK7A 3KXPA 5CRIA 4KACA 2AJDA 4Q3OA 3FCXA 4BATA 3NWOA 5DYTA 3WKAA 3H1BA 3MGAA 2OQVA 4WFKA 4QDUA 1GPKA 1M33A 2QTBA 2DHCA 2WUEA 3PFCA 1N5MA 2WU3A 4AO7A 4TVKA 4BDSA 2JGEA 1CQZA 5D7BA 3QMMA 1LPPA 3WL5A 2GYWA 3G9UA 1CUDA 4AQDA 1Q0ZA 2QXTA 5SYMA 4MYSA 4AO8A 2PL5A 3PE6A 1LBSA 1C7JA 1ZJ5A 4I3FA 5T4HA 3ICWA 3DLTA 4EY5A 1SCKA 4H7KA 1AKNA 5CXUA 1CQWA 1UKAA 4BBZA 4RPCA 4X6XA 2WTMA 4CG2A 1AUOA 3FAKA 1QOZA 4X6UA 3B3QA 2O2IA 3O0DA 1XZHA 3WMRA 2WHPA 1MX9A 4UBIA 1CFJA 4ETWA 5EIEA 5HFAA 1QFSA 4FOLA 4U2EA 4F60A 3VDXA 1THGA 4E14A 4Y2XA 3C45A 4OPMA 4K6KA 2RI6A 1CUZA 4H7HA 4JEIA 5AO9A 5IH7A 1XZLA 5ALYA 1B41A 1L7AA 4BTVA 4BVJA 3KDAA 2WJ6A 4A5SA 3ZLVA 4AO6A 4FMPA 2HA0A 1CEXA 1BCSA 4EY6A 2O7VA 4UHDA 1H23A 5ALUA 1E8DA 1CUUA 1MU0A 1Y7IA 1VKHA 5A7HA 1GGVA 3C70A 4BE9A 3WL7A 1YAHA 4EY7A 3DYIA 4N5IX 4EY8A 3VVLA 5JALA 4OD0A 5EIAA 2JGJA 1MX1A 4Z49A 1XZGA 1HQDA 3IA2A 1MX5A 1U8EA 2OAGA 1CUSA 2BUAA 3C43A 5HFNA 1B6GA 5ALKA 4ZV9A 2WG2A 3GFFA 2ZYRA 2Z8ZA 1Q0RA 2WIKA 4J0DA 4Y2SA 4FWBA 3FSGD 1TQHA 1FFAA 3KWJA 5H3HA 2NW6A 1QTRA 2AJBA 1G66A 5JZBA 3WIBA 5DNWA 4BCCA 3A2LA 2HFKA 4B83A 5LLSA 4UBKA 1NX9A 1DWPA 3DOIA 4J7AA 4YASA 3FSGA 5JD5A 4PSDA 4N5HX 2X76A 5ALFA 5FP0A 2P8SA 5AI5A 1DT5A 2FX5A 4FFWA 1XZMA 2ONCA 3PF9A 1GPLA 3FCYA 1LZLA 1R9NA 3ANTA 4Q3KA 3F97A 3QPDA 4BAZA 1KU0A 5ALZA 5CBKA 4AN0A 3PF8A 5AJHA 1WCYA 1T2NA 3V9AA 4L0CA 1QLWA 1UZAA 5JD4A 1KEZA 1R88A 5J3JA 3WWEA 1U4NA 4C87A 2I3DA 1ETHA 2H7XA 4K2AA 1FFEA 2WFMA 5T4EA 2XMGA 4KRYA 5DWDA 2IITA 2QS9A 3QYJA 5AK5A 5AI0A 3RK4A 3CCCA 3PI6A 3W9UA 4OB7A 1VE7A 1F8UA 2C5GA 1CUBA 4Q34A 3AJAA 5BV7A 2WUDA 5AI9A 2WU4A 4MEAA 2QJRA 3SX4A 4MYDA 5EHXA 5CH5A 2HDWA 2ZYHA 2PU7A 4GECA 2FJPA 3WA7A 2GBCA 4BAGA 5D3ZA 1ZI6A 3F9CA 3V1KA 2B4KA 4L9AA 4DSZA 2FJ0A 1XRNA 5C81A 3WL6A 1GXSA 1P0PA 3WKEA 5IVHA 3WZLA 1DX4A 3PFBA 2XB6A 3IB3A 1NU6A 3RKSA 1QIJA 2W6CX 3ZLTA 3VVMA 2ORYA 3I28A 4ZRDA 1VA5A 3C8DA 1UFOA 5ALDA 2HA5A 1TIBA 1G42A 1YASA 3IDAA 4WY5A 3UUEA 4IO0A 1YB7A 4B0PA 3VKFA 1E89A 3WZMA 1ZGBA 3H19A 4BVKA 4LXIA 1C4XA 4P92A 5F4ZA 2HL6A 1GZ7A 2WIGA 1ZD5A 4UBNA 4BZWA 3WKBA 2XUFA 1K6EA 4X94A 1ZGCA 4IHAA 5KWJA 2HA3A 1FFBA 1GQSA 5C8VA 3H1AA 1UKBA 1BE0A 1LPNA 3WL8A 2B20A 1BEZA 4QDTA 1HL7A 4E46A 5AOCA 1CRLA 3WI7A 4DMKA 2GYVA 5EHZA 1GQRA 1CUFA 3KSRA 1W1IA 1SCQA 3E4DA 2XUAA 1USWA 1EINA 4BP9A 5JARA 4U2BA 1VE6A 3R0VA 1K63A 1IUNA 4PV7A 3A6ZA 2GZRA 2OCGA 4TPKA 4Y2TA 1JU3A 4B84A 3LLCA 3CN9A 1YSCA 4MXDA 1CR6A 3L1IA 2PBLA 1O6FA 1F6WA 1R1DA 5ALNA 1P0MA 3STXA 4UBMA 2PUJA 1EK2A 4TGLA 4OB6A 3ZLUA 1ORVA 1Q83A 2HA6A 2OQIA 1QE3A 4MJ3A 3HI4A 3D7RA 1XRPA 2HA7A 3CXUA 5K3FB 4XVCA 3BF7A 3H2HA 2Z3ZA 5AK4A 3AIMA 3G0CA 1XZEA 4EA6A 2VQ6A 3DD5A 4AZ3A 1CIJA 3W05A 4EHBA 3I1YA 5CT5A 2BUBA 1H2XA 1SFRA 2BUCA 4CIAA 4X97A 2GZSA 2ZYIA 1HPLA 3ESCA 3EQ9A 4J0HA 2ZSIA 5I8PA 2Q0XA 3LS2A 1VZ2A 4Y7DA 5E4JA 5AM4A 3I1IA 1MAHA 3M82A 2HRQA 2DFPA 3BXPA 5FLKA 5JZ9A 1BCRA 3AINA 1THTA 4MQLA 5CT8A 3FYUB 4XWGA 4N8DA 2J3DA 1BEEA 3FLEA 1YA4A 3G02A 1G5FA 5DJ5A 2K2QB 1XRLA 5CW2A 4ZV7A 3FOBA 4WFJA 2XUKA 3WK9A 4Q05A 1QIHA 3OG9A 3WJ2A 3M81A 1ACLA 2HA4A 3G0IA 1BN6A 4DMHA 1N1MA 3E1GA 3LIPA 4BZZA 2PX6A 1E8MA 1U65A 1XZBA 3H2KA 1LPMA 3O95A 3STWA 2XUJA 4XJVA 4A16A 1O6GA 3O4JA 1MNAA 2WHQA 3W06A 2JGIA 1YCDA 2JBWA 5BWCA 4U2GA 5JZSA 5D6OA 4WCVA 5CH8A 5LZ4A 1BN7A 2RONA 4HXFB 5K3EA 2JGLA 4MQMA 1H22A 2DQYA 1F0NA 2WTNA 3R40A 1IMJA 5ALQA 4EY4A 1VXRA 2EDCA 2IX9A 3H0CA 1MO2A 4UHHA 3WKDA 2HRRA 2J4CA 2BKLA 3RM3A 1MTZA 4K6GA 3H2JA 7YASA 1WOMA 3EIOA 3C6XA 4JYMA 1MJ5A 2CUTA 1TCCA 2C0PA 3R41A 2JEZA 1OCEA 5ALGA 1XZIA 4C89A 1N8SA 3C8HA 4KE9A 3TJMA 5C8ZA 4GW3A 5KBYA 3WWDA 1ZIYA 5HK8A 1XQWA 3R3UA 1XLUA 5AKHA 4QLOA 5C8XA 1U2EA 2XE4A 4KE6A 4ROTA 3OTQA 5AM2A 2G5TA 4AB1A 4CFSA 3DKKA 3BIWA 3I2HA 4LKOA 2ZSHA 5AKYA 1UOPA 4J0GA 4PW0A 3DDUA 1DWQA 4JUIA 5FKJA 5CXXA 1LPBB 5ALOA 2XLBA 1AC5A 4B9EA 1ISPA 2HHAA 4IQ4A 3HC7A 3QMVA 1L7RA 1HLGA 3D2AA 4QDXA 2Y6UA 4BYMA 1CUCA 4LYEA 5AP9A 4X93A 2ROQA 3G7NA 1QIIA 2XMCA 2H7YA 4ITVA 4INZA 1EVQA 3ESAA 2XMRA 2VA9A 3DL4A 4RE6A 5AH0A 3B12A 4ARBA 5FUMA 4DLNA 3Q8WA 3GBSA 1JT2A 1QFMA 3RLIA 3BIXA 4LXHA 1ACJA 3OC0A 1UK8A 1EVEA 4BAUA 3B5EA 1EA5A 2R8BA 3FVTA 5LZ7A 3I6YA 1ZICA 4BB0A 2DCMA 2XMBA 1AQLA 3AILA 4PO3X 5EIHA 4AMZA 2B9VA 4X92A 5BWBA 1ODSA 3HEAA 5AOAA 1K8QA 1EDBA 3X3HA 2D0DA 4A23A 4G9EA 4Q82A 1YR2A 4CCWA 1BU8A 2I78A 5ALTA 5LKRA 1BRTA 4IH1A 2DQZA 5ISMA 3D0KA 2XMDA 1LGYA 3T52A 3AFIA 5AM1A 3IIIA 2IIVA 1EK1A 4Y2JA 2WILA 2PUHA 4P93A 4F21A 3I2IA 5K3CA 4KR0A 5ESRA 1LPAB 1A8QA 4DTCA 1UK6A 2WIJA 3DL7A 4KJXA 2WIFA 1MNQA 2RGUA 4N8EA 4P9NA 3TEJA 3I6MA 2V9ZA 3UUFA 3QBJA 3PUHA 5JYCA 2YASA 4G8DA 4FNMA 3E3AA 3F98A 2BFNA 3H04A 1N5RA 4PF1A 3FYUA 2XQFA 5CTAA 2PSFA 1CPYA 3ILSA 4FLMA 2WJ3A 5JD6A 2OGTA 1JFRA 2XUIA 1TCAA 3G0GA 4K5QA 4UBOA 4B85A 3G9XA 3AUKA 2V98A 3EQ8A 3DJYA 4WJLA 3G0DA 2ZJFA 4OCZA 3V1LA 4H7IA 4QDZA 2CBGA 4KE8A 3D59A 1ORWA 4J03A 1UT6A 1X2EA 1HDEA 1XZDA 2HM7A 3C5WP 3K2IA 4ZWNA 4C4ZA 5CMLA 3WLAA 1XLVA 4P08A 1UK9A 4Y2RA 1VLQA 2D5LA 4UBLA 2YH2A 1JMKC 2CMFA 1I6WA 3ZPXA 3WK4A 1A8UA 3STTA 2RHWA 1Z68A 3QH4A 4H0CA 3N0TA 5JAUA 5ALVA
chains in the Genus database with same CATH superfamily
1NUSA 4MKHA 4QDOA 3JQCA 3TLXA 1Z62A 5LZ2A 2BFAA 2WIDA 1TZBA 3I72A 3P9XA 3PFNA 1N2IA 3Q0EA 4MWSA 4UHBA 2HN9A 3H8WA 1XLTC 2TMYA 1QGOA 4I8DA 4G0MA 4HTAA 2QM8A 4MINA 1RXCA 3S2UA 4C88A 3IT3A 2CF6A 4S12A 5CA1A 4Q4DA 5BN4A 5LXTA 3TLZA 4JLDA 3A4IA 2P0AA 2BJVA 3FNEA 4UAUA 3S4YA 5CGQB 5CCEA 5KHOC 1GLVA 5CDSA 3BMOB 2X0EA 2J0UA 5K2OA 1XFAA 2XQJA 2P4UA 4LDNA 4X84A 2C58A 1Q19A 1KJIA 3K0SA 2LE0A 4UNPA 4CYMA 1WM1A 2R0QC 1AGYA 4YMWA 1I94B 4GGMX 1R3DA 2FSIA 3EIFA 2ZJ6A 3NCHA 4MRRA 3FOWA 4GMKA 2C2KA 3ENKA 1UZLA 3WIDA 1OBVA 1E2IA 2PXHA 1KE2A 4CLDA 1O5OA 3QWAA 1KDOA 3WYFA 1A8IA 1G98A 3IJRA 3EPKA 5LM3A 1YZFA 2PYDA 1LX6A 2C9MA 2SECE 3BMQA 4Q9AA 2ES4A 4GOND 4BWVA 4WINA 3IQDB 2VJNA 1BXRA 3L0BA 5ALEA 3AZOA 3E8SA 1SHKA 3DT8A 3GFPA 5TARA 1ZA1A 1O94D 1TKRA 3FJOA 3Q3JB 3RU3A 4B7UA 5K0TA 4D25A 3TZCA 4WADA 1O8CA 3MUEA 3BL8A 3KKLA 3HRIA 3V34A 4NPAA 2RHCA 4R31A 3U17A 2JF0A 1LPSA 1HXHA 2G4CA 2VP9A 1HX7A 1M2HA 3U61B 5AMXA 4DF3A 2ZPUA 1ZISA 2PE5A 2VJDA 4YCCA 3TKLA 4IFTA 1QVZA 4I4TF 1QH8B 5F9HA 3ORHA 2LWIA 1RABA 1OROA 1QZXA 4HPWA 4JZKA 1NJ6A 2C4VA 3LC7O 4RSMA 3RHSA 2Z4SA 3KKPA 1JMYA 1NVGA 3DW1X 2QTWB 2CLHB 3RB8A 1KRWA 3LQYA 3TR0A 1Y8QA 4WK2B 1J21A 5AI6A 4ZD6A 4LTNA 5JXIA 1R4NB 1Z7GA 5K3SA 4D92A 4BASA 5AI4A 3TG2A 4DB4A 4AY6A 4CLRA 4V1CI 1UPBA 4P3NA 1I4OA 4EJMA 3JYQA 1WBDA 4ZT4A 3TUJC 1QIMA 4F3TA 1RI1A 3E1SA 1L5ZA 5K0LA 1YR3A 3K8ZA 1YS2X 3TJRA 2AVNA 3TLGA 3L4KA 4WJKB 1XO1A 1LJUA 1YDMA 4JENA 4L5IA 1HDYA 2XQIA 4D8XA 4HNHA 1W93A 1GSAA 3LECA 1WV1A 1ISRA 3A58B 3IC5A 4L3OA 4DANA 2VAXA 5EZYF 3V80A 2I03A 1JE1A 2VJAA 1D04A 2ZRIA 1ECCA 2ZRDA 3QOYA 4WZAE 1GYQA 2CC2A 2XOKA 1CDOA 1RBMA 1SD5A 5D3KA 1CWUA 2OOSA 3HZRA 1PL7A 4AX8A 5DMXA 4GDFA 3QVJA 5H4HA 1ZVJA 2A0YA 4KPYA 5I5EA 1NV8A 1ZOLA 3KB1A 4PAGA 1S4QA 2QP3A 2ZUUA 1TW3A 1U7WA 4B0OA 4PWYA 2I5PO 2BTEA 2EFCB 5A7GA 4ME6A 1YE3A 4C1NA 3LLSA 5EI5A 4PZ9A 1Z17A 1WXQA 2ZSDA 3R7DA 4BUCA 3C6QA 1E9CA 2WQ6A 3SHFA 1GEEA 1KAGA 3EULA 1EZ4A 4RQAA 5LMUB 4JCOA 3HA2A 4B6OA 1JXQA 3B52X 2FWRA 1WE2A 2J48A 3QW4B 4GPIB 2NVBA 1C7IA 1FXWF 1I5RA 1Z4IA 2QIPA 2VXBA 5FUXA 6NULA 2XZDA 3LPNA 5FYDA 4DMCA 5T41A 2V4ZA 4G3XA 3T94A 3KQWA 4TZ6A 1H1LB 1T2FA 3FH0A 4AM8A 3W6NA 2EEPA 2JH9A 3WIEA 3FOZA 1B7GO 3IVXA 3VO8A 1IUPA 3L06A 4G0XA 4Y2PA 3GGGA 1VRVA 2Q6LA 3HVJA 1ZD1A 4UM9D 3S6JA 1N2SA 1C30A 1CTQA 3BZBA 3MT0A 4K40A 2QJWA 4NZPA 3RTAA 5B7PA 3HWWA 4YUXA 5E3JA 2WYVA 2P77A 5ICFA 4ZEXA 3RYIB 4CI0B 3MWDA 5DN6D 5JC8A 1N6OA 1PR4A 2PZLA 4HAWA 4WZAB 5C3UA 1KTIA 3PB3A 4PXYA 4FJ0A 4L74A 4UPVA 1KEWA 2PR7A 4GXQA 1IONA 3I4LA 2PBRA 4QOJA 3O9MA 4NJMA 2WJHA 2JJ1A 4DUPA 2PZKA 3VYSB 4LECA 3IT0A 3FCAA 4MGIR 5PGMA 4EVRA 1NNLA 2R7LA 2DHRA 3GJTA 3DZJA 2TRSB 4OXIA 4RC9A 4HDSA 2DRIA 3P9YA 2FTKE 2QR3A 3LQKA 4F6CA 1Y3CE 3A7DA 5MN6A 2NO4A 4IV5A 4PBTA 1FDRA 1E2FA 3L8YA 1RHRA 3E58A 4UHCA 5AYVA 3SIXA 4UZFA 4UJ5A 1TCBA 3ASYA 3IDQA 1M9NA 4AQYB 3ED5A 4Y9UA 3TRFA 2I2CA 3DBHB 1Q15A 3C3WA 3OURA 1NG1A 2F8LA 2QU8A 4I1UA 4QUHA 1VLHA 2GN8A 3UOGA 2AN4A 4ZK2A 2XXAA 2Q4EA 2X5KO 1K5DA 2HWUA 5DEOA 3U3ZA 3U3OA 4N5DA 2P1RA 2CY0A 3DM9B 4RTQA 5G41A 4HDRA 4JNKA 3SPXA 3PHHA 3RFUA 3GVCA 5B30A 1RBQA 1ULUA 4ZARA 3KL2A 2WLTA 5G0SA 3ABQB 1W76A 1AHPA 5DM70 4MW9A 3HABA 1ETUA 1NXTA 3CZRA 4ER6A 4RMIA 3RVRA 2Q4RA 3WNVA 1KJQA 3TL2A 1L5MA 3HB0A 3NV9A 1UBNA 4WNAB 4WRRA 5GOTA 4H17A 4YV7A 2GM4A 1J24A 1DAIA 1JDJA 4QBIA 2DUUA 2PEYA 2YKGA 3FFXA 4G56A 4IJMA 3SQNA 1TYAE 3Q8MA 1KSGA 3F6RA 1TIPA 2JDID 4JMPA 1SU4A 4NMXB 1NC1A 2EQBA 3B6EA 1P2VA 1XKTA 3GARA 4UTXA 4GLBA 3UT6A 4LCBA 4XWYA 3GNLA 1DOAA 5E3HA 4KQMA 4J0CA 3N0VA 3IBSA 4W6ZA 5EUBA 2X7XA 1FP7A 3AESB 5A02A 5KDLA 4ZU1X 1A27A 2BGJA 3EOBI 5HG0A 2ZI5A 1PFYA 2OCAA 4CKYA 1U9IC 2PRKA 1NF2A 3DOCA 4DHWA 2AW5A 1ZS9A 2YBEA 1C1DA 3KV3O 2E55A 4MTCA 1GPYA 1X19A 4LKRA 3IV7A 3G3EA 2FUCA 3N3BC 2CJPA 4BNDA 4WW0A 2NZJA 3GPLA 4C21A 4KXYA 2JA2A 4YGXB 1OQAA 1N8NA 1R12A 2Y1LA 4XTCS 5EUCA 4BEBA 1X9IA 3HACA 3IVAA 4NNOA 1CUGA 2YWBA 2Y1EA 2QYTA 2C5HA 2HAEA 2F8MA 3IURA 3H1FA 4AUEA 5DIFA 2AR7A 3UWOA 5DGIA 1C5KA 1SGWA 1AUQA 1PJ2A 2XEDA 3OPNA 4GI1A 4CV0A 5ETJA 4JP3A 4QNMA 5HF8A 1P9WA 3PXEA 1YZUA 3ILVA 1NLFA 1FLVA 2P6RA 5GVSA 2PH7A 1AXRA 1FX0B 4OXNA 2PZFA 2RAUA 1WMAA 4LHZA 4W7IA 2I4IA 1W36C 4R9NA 3KAQA 5F5XA 2FFQA 2ZDQA 2CVQA 3EJWA 3PTAA 1OMOA 4CIDA 4ZV4A 4IMIB 5IAKA 3AEUA 3BWYA 4ISBA 3ORFA 4DJ5X 1PK8A 1T43A 5JADA 4OX9B 5LUAA 3CZ4A 2YW9A 4QYWA 1G291 5SY6A 3K9HA 3F90A 5I9TA 4EFMA 2RDMA 1IZ7A 1YI1A 2AYXA 2CXHA 4NATA 4ZDIA 1BCRB 3GCWA 3GMTA 3TZ6A 1YR7A 1G5HA 2YYAA 1BKDR 3B3AA 3ORSA 5CX1A 5JD3A 5BVHA 3ADBA 4O2RA 1GG8A 3EVDA 4Y9SA 4MGYR 3GQBA 4E1VA 3AUTA 3LYAA 3WLTA 2C95A 3PNOA 2LCQA 5BUCA 2JGMA 2OGWA 3E53A 5JR3A 1C9DB 4GBJA 3A1CA 1P5JA 4XDHA 4ALJA 1Z2CA 1HDIA 4Q02A 4J0QA 4LDZA 2Z5GA 2GFIA 1ZNYA 1MFPA 4BQQA 1L7BA 4G5YA 5DWVA 1F06A 4C0XA 2Q2VA 4ND8B 1OFUX 3VVCA 2PFSA 2R11A 3MILA 3ORYA 3ADCA 3D6HA 4LYDA 1M2OA 1YC2A 3N76A 2I87A 1M2NA 2IV2X 3G88A 4KO1S 3G5UA 2I3BA 4AY3A 1FSZA 5DGTA 5HTOA 1FTSA 1OX4B 2PLNA 1PVVA 2G9UA 4JSRA 1SQSA 5A9SB 1E9RA 1XJ5A 1BFDA 3DQQA 2C2HA 5DNYB 1IOWA 1Z06A 4LYHA 4HAZA 4UREA 3ESRA 3INRA 1YZQA 3WWZA 2VPXA 3LQ4A 2VQEB 5J2TB 2GA8A 2IEGA 3DBRB 1D4OA 1TT5A 2GSWA 3OPMA 2AJ8A 3TNDA 2AOTB 3ZWMA 4US2R 1AY0A 3WGHA 5KMGA 3QFCA 2PXAA 4Z3DA 1COWD 1QV9A 2L0XA 3I2GA 1I4EB 5DTEA 1VYVA 2YY7A 3ZVRA 1E4YA 1H69A 1RJFA 2QBYB 3R7WA 3NALA 3ZG6A 4QZVA 1L4MA 5K3FA 1WTAA 1J8QA 2W00A 3ECCA 1SXJB 1R5JA 1YO6A 4H3KB 4X00A 1P9LA 5LBTA 3L7YA 2ZAGA 1T5SA 1RMTA 3OKPA 3VKGA 3LVQE 1UMCB 2EJVA 5AW2A 1GGJA 2E4WA 2Q3FA 3B6MA 1LVUA 3DS8A 1X1EA 1PFQA 1K4YA 2F17A 3GWGA 1U3FA 3ICVA 2FMUA 2I33A 2RH8A 2O3RA 2EAUA 4RZSA 4BTLA 1NDUA 4DLSA 2KQUA 4PPNA 2QL9A 3CUVA 2Q2WA 4C01A 1PYDA 3EEIA 4QIHA 2Z6QA 4EB0A 4CKWB 3CF0A 3TX2A 3SJCA 3MJVA 4UHJA 1ZIDA 4R01A 4DDKA 4ZI3A 2DSNA 3KUDA 2DT8A 1O9BA 1YB1A 2C2GA 4KVAA 5JOQA 4N9WA 1HT0A 2GO1A 1S3IA 3KYDB 4GNKA 1CW2B 2PKXA 2Z8XA 3D4IA 4IGKA 3I42A 3ZCQA 2OGZA 4G9BA 1TLFA 3ZOZA 3AEKA 3TLAA 1S0UA 2EGUA 4C05A 2G6BA 5LDGA 4DIMA 3H1TA 4KW7A 4LG1A 1NBIA 5K45A 4I4CA 5LQRA 3AL0C 1L1FA 3ZGOA 1F2UB 2QTGA 1E2HA 4OLFA 1R10A 4GLFA 4I81A 4XQ0A 5J40A 5DXJA 5B1HA 1R4MA 2HBRA 2IZ1A 2WFZA 2AQIA 4YK7A 4BCDA 3K6RA 1Q84A 4DA9A 3ZD7A 1JDVA 4IXNA 3F6PA 3MCVA 2OP0A 5SYNA 4P7GA 1SVWA 3LQFA 4YRQA 2EYUA 4MYRA 4WMLA 3FW1A 5G1OA 2DR2A 4ZQGA 3N2KB 1EGVB 1XMJA 3V00A 3ZR4B 2RJOA 1CUVA 1CBUA 4XPIA 3RJZA 1A69A 3K6KA 1V1MB 2O2HA 4F5ZA 1HZZC 5CCDA 1I3LA 2WJYA 2XWJI 3ZTTA 4GLLA 4BRSA 4FD2A 4Q66C 4Y9RA 4RK4A 3VM6A 4J7XA 3VO2A 3HNPA 1L1QA 2X7HA 2OYCA 1T91A 3DONA 3KR9A 3LLMA 3CR8A 4HLNA 9MHTA 4GL2A 2Y2UA 3N05A 3UFXA 5G40A 3IUJA 2JJQA 5EMLA 3OFSA 5TE9A 3OOYA 3REGA 3T5DA 3UK1A 3V7UA 4CKBA 2HDHA 2Z2ZA 3RC7A 1BX0A 3PENA 3W2TA 3O9VA 1T5OA 2XLCA 4MAAA 3ZE6A 1Q57A 4QEDA 1RI4A 4XB2A 4TL7A 3A28A 1RIIA 2IPLA 3I2JA 3UMJA 3MLAA 3TN7A 1X38A 5FPQA 1W36D 3T35A 2HSDA 5HDBB 1BVRA 1V26A 1GNTA 4W9RA 4ARAA 3H2GA 2XCTB 4KBGA 1EFVB 3KSDO 2ODTX 3RS5A 4YV0A 2KHZA 1G8HA 3KB6A 1K7SN 2Y1OA 3KQMA 2CXRA 1DRKA 3Q1LA 4J1TC 5TLSA 2VJPA 3HRHA 4BNYA 3GLFB 2WM3A 3KWMA 2XUZA 1FDSA 3IBYA 3KM0A 3W78A 4AYTA 4CR8A 2CEAA 2JLSA 2QV7A 3OSUA 4FNGA 3ETCA 3T7EA 2D1RA 4FP9A 3QNMA 1I24A 3K0CC 4YJGA 1Z4KA 4LQ4A 4OGWA 4KODA 3AC0A 4K28A 4NX2A 3ROXA 3DD1A 4DUGA 2G5PA 3JW8A 1OH6A 2VDLB 1B74A 3FPBA 3QPAA 4PGAA 1HRKA 5BXQC 2YQ4A 5T57A 3VR1A 4DC9A 4YJGB 5JT1A 4NNPA 3Q2IA 2FN7A 3HSKA 3GPIA 4FVTA 4L51A 4P3XA 1H8HA 1HE5A 5A1JA 3NH6A 5JXGA 4ARSA 1TXGA 3VOBA 4F1KA 1T1IA 1XCBA 5C8DA 2ZI4A 4Y2VA 1P1BA 3BM5A 3BUSA 3CO5A 3N2KA 4HN4B 3EBOA 4M0LA 3SC2A 1P62B 2BKXA 1BDBA 2X8LA 4ASUD 3TZQA 5ABPA 4YAUA 1IXYA 4G84A 1H5NA 3AI3A 3L01A 3H1GA 3NM5A 4BGDA 5CDTA 1RYFA 3QJ5A 2YL2A 4UVHA 4FDAA 5DLPA 1UBJS 1N4DA 3GVXA 3MT7A 2K7ZA 3OQIB 4ZT2A 3QENA 4I5EA 2PA3A 3SD7A 1WF3A 4F93B 3B8EA 2FZCA 4RS3A 4PLVA 2PKQO 4S0ZA 4TMYA 4XUCA 1OXVA 1PJQA 4WXRA 4AMYA 5FWXB 1ZK2A 3WNBA 1QU3A 1HBJA 3UJ9A 4JR0A 1DG1G 2H5JA 2NXCA 1W75A 1W94A 4KRXA 1UK7A 4IRUB 1G8PA 4UDNA 1X8XA 1YS1X 1U8CB 1Z4QA 1TMOA 3L6RA 3PC8C 2X6RA 3IAUA 4KQHA 1HYBA 1OX4A 2V58A 1QGZA 4FGKA 4Q4AB 4UAVA 4W1SA 5H16A 3WIOA 3WR5A 4B80A 1O4WA 3MTIA 4EW2A 4M7WA 4IW3B 3W6OA 4HYYA 4MPPA 5ITZB 2C5SA 3P96A 5FQNA 2OCLA 2GM9A 5EHQA 4L15A 1FXSA 3O4HA 1BJRE 4KNVA 4BQSA 4M1ZA 4OBBA 1WMSA 1ZM7A 3NJ4A 1NY6A 2E6UX 2VF7A 1K7FB 4M88A 3TBHA 1AN0A 3OIWA 2V7XA 1Y4DE 4EB6A 3GLHB 1XMSA 1XU9A 4IJ6A 3IVMA 4DLRA 3B20A 5DU2A 6YASA 2MU1A 2VT3A 5IABA 2PK3A 3CCFA 3LUPA 4ND3A 1LD3A 5FUVA 2OHGA 3C3AA 4LFCB 2G8NA 1IQ0A 5HWSA 3E8XA 1C9YA 3W8RA 1W85A 5FA8A 2R7AA 5ERYA 2C7OA 2G71A 3H17A 4D9EA 1EWKA 5IK2A 3WAJA 1VPLA 4WOCA 1JPVA 2BL4A 4XJXA 1PWZA 1IY8A 3K0AB 4QDJA 3PRKE 4FBGA 3TQTA 1PR6A 1S02A 1UBLS 1PT9A 4RQTA 4CEIA 3ENWA 4U5QA 1CHNA 1X2BA 1W4RA 2I65A 2NO5A 4WKCA 1DQZA 4M0FA 1OYYA 2ZJ7A 4U2KA 5I47A 3QE2A 1LLUA 5G0WA 1K6JA 3DKPA 3W5UA 4JL8A 3PX7A 1U7XA 2Y0BA 1C7ZA 2VHEA 2D59A 2OHJA 4MRMB 2WVGA 2LV8A 3FKQA 4RZXA 5T3YA 3NM4A 3GIWA 4NYJQ 5FBVB 1QYWA 3KVYA 2A9OA 2I76A 3ZTWA 1M34B 1T9BA 1GL6A 3H5LA 1YE8A 2YWDA 4NESA 2H3HA 1E66A 3P2MA 1UQTA 3T06B 2YRFA 3QELB 2GBGA 4J7UA 3VUEA 4ZYLA 5I6DA 2QU7A 4RPHA 3AWIA 3S55A 2JASA 1DSSG 1IN4A 1L5HB 1PJSA 2CDBA 1QH1A 4FYXA 2XV1A 5F3RA 5A4JA 2DETA 4M2LA 4EBBA 1ADFA 5SV2A 2IXDA 3GRZA 1FSGA 3OTOB 1OH8A 1F7VA 3FHLA 4LOHA 2NU7B 4BNJA 1ZH0A 1DTEA 1WQ4A 2O3SA 2R8EA 1JEYB 1O54A 1XTQA 2EQ5A 4MWEA 5CPFA 4FEYA 3T7DA 4C6TA 2DQKA 3LW8A 5JANA 4OGKA 4N12A 3W2IA 4JU9A 3CN7A 3ZE0B 5FL3A 1I2BA 4IDNA 3UXMA 3EIEA 3GJYA 1Z4JA 2OFXA 3K2QA 5EJAA 5TXGA 5BOVA 2ACWA 2OHIA 3GCDA 3TO5A 1PLKA 3KALA 1M67A 1M73E 1YA8A 4RCYA 4KH0A 1X7WA 5IC4A 3OQMA 5FOSA 1IM2A 1OLOA 1M2GA 3I2FA 4XOIA 2WHYA 3WLLA 2GN6A 2ZIWB 3HU5A 4ZIRB 3I6QA 1DBIA 2LTAA 4QEKA 4ARVA 2ZBRA 1KETA 4RMHA 5FOQA 1HDZA 4UKDA 1QIFA 3UK7A 4KGDA 3GF4A 3V32A 3H1PA 2C7VA 4IWYA 5EP4A 4PPQA 4MW1A 1TZJA 1O1YA 1K1EA 3RVDA 1VI2A 1RHUA 4BOYA 2IH5A 3A4VA 2JCVA 1USUA 3VPXA 4PSCA 4CM9A 3K31A 5BNWA 5KOHB 3RJ9A 1TZKA 5A05A 3R8CA 3PQ5A 3T5BA 2XXJA 3ZJYA 2ODEA 1FS4A 4R84A 2XI4A 2Y6VA 3TOSA 2WVJA 5DLDA 5U9CA 1VSUA 4F86A 1OZ0A 3L40A 3CH5A 1DAHA 4WHMA 4QREA 2RKBA 4XWKA 3P7MA 2ILTA 5B3JC 3KEQA 4MQ4A 2D7CA 5AJZA 4OMCA 3TTYA 1EM8A 3ZDZB 3NEPX 2AJCA 2XUPA 1I2DA 2HU5A 3WWCA 5KVAA 1J1IA 1CS0B 2IFTA 4Y6SA 2OGSA 1Y1PA 1XDUA 4I1PA 1K9VF 1W29A 1Q1EA 1DC4A 3TMAA 4PEVA 1ZJWA 4KWEA 2RHLA 1XCJA 2QKYA 5LZ5A 1NXSA 4IQ8A 1AD2A 1ABFA 2HREA 4ICIA 4MDHA 1RQPA 1U6JA 3T5TA 1L5YA 1UKVY 3PPVA 5A0FA 4CTOA 1YCHA 3EHDA 3K09A 2WF9A 2PGOA 4HQ6A 5EQJB 5K3AA 3KPUA 2AFIA 2BFPA 3ELBA 4KVFA 4Q6WA 1SVMA 3CZAA 2YJTD 1QC5B 4Y2UA 3H83A 5KYUB 1U9ZA 2EXXA 3KLMX 3NYWA 4GX1A 1FSPA 1YDWA 3LIIA 3PEUA 5JYBA 2P65A 2QE7D 4KSBA 3EXHA 2QTLA 3M6VA 1QCZA 4QUJA 4RUKA 4D56A 2C3YA 3ICCA 1CJBA 3U81A 4DNOA 1X3SA 4B5KA 2EF0A 4IVPA 5LZ8A 4IDGA 5JV5A 1QP7A 1A98A 1RHMA 1ZIXA 1ADBA 2P90A 2ZOSA 5LQDA 3C97A 1ESCA 5J59A 1U11A 1PIWA 1CUYA 2CXTA 1V35A 2IA5A 2WOJA 3ENQA 4R0MA 1V48A 3THXA 5CLHA 3VZPA 2PGDA 4ECAA 1SCAA 3LCUA 2QZPA 3MWGA 1E2EA 1OXMA 3H7AA 4Q3EA 3GFOA 1QH9A 4UUOA 2GBLA 2ZYWX 3N07A 3ZDDA 1Q17A 4CEHA 4TMFA 1GAWA 4B47A 3HS3A 1HC7A 2X2FA 1L4YA 4ABTA 1QTIA 2PVCA 4ENSA 1TOAA 1I0IA 1NVXQ 1ZSVA 4NR0A 2RGEA 4QFDA 3RW9A 1IB0A 2CMHA 1ILWA 4OU4A 3VZCA 4JXJA 2VP5A 2Z08A 5IDQA 3SC6A 1IBRA 2FWNA 2QVXX 3A6JA 3DEZA 4BP8A 1YACA 3UTDA 3OCJA 2LP4Y 4PC2A 1Q21A 4DQXA 3HJBA 3UMVA 4UNRA 1E5VA 3AF0A 1HA3A 1TAHA 3NT2A 4Z1MA 3MTEA 4P0PB 3B1VA 1GM5A 2WHXA 3A1NA 3K9QO 5AI8A 3TTVA 1UOQA 2HQRA 3K9NA 1F5NA 2IYYA 3TGWA 3BVPA 1N7JA 1ONPA 1EHYA 1EFLA 1H0HA 2H8GA 3NHRA 5G1PA 5BQXA 4YWJA 1RRGA 2CW5A 2I4MA 3TK1A 2X1HA 1JZSA 3SS7X 1OH7A 1ENZA 3KVVA 2ZE6A 4KOEC 1XTIA 5I7HA 5JROA 3CO0S 3HJTA 3NYQA 3UWDA 1JV2B 2I2DA 4R3NA 2HRDA 3HR7A 4UZSA 4ZOAA 4C7OA 1PI3A 4UNIA 1IJFA 3BB4A 5KJ6A 1RZVA 4NI5A 3DZIA 2NNLD 4RWZA 4YFVA 2GKSA 1P1IA 1IY2A 1HYGA 2FWIA 1E5QA 4P5EA 2XVXA 1VE9A 4CIWA 4M0EA 4TTTS 4B4UA 4Z5XA 1ZL2A 1KYXA 1Q14A 4P31A 2GAJA 5CHEA 5HQ3A 5C7IO 4AY2A 2BEVA 1GGKA 1Z6ZA 2PKWA 4OQEA 1N3YA 2GPNA 2R4QA 3EBLA 4ZFNA 3B70A 2G72A 4B6EA 5JAQA 4KFTA 4ZI7B 1L7OA 1T8TA 1Q1QA 5DP2A 4GRDA 2F48A 4L9WA 4PSVA 3MSCA 2C42A 3SP1A 2XJ9A 4URZR 3W9BA 1I32A 3OHMA 4I7EA 2HO4A 3VQTA 4DPKA 2JLYA 4MUEA 4WOBA 4DCUA 1DOHA 2JRLA 2QIOA 1WBJB 3CH7A 4XRGA 1FNNA 1G2QA 2VAWA 5JBIA 2BGTA 3QLUA 4FEGA 2ZWPA 5BNTA 1U5CA 4NU6A 5EQFA 4MGZR 4RPIA 2F59A 5JJ5A 3BH7A 2WJ4A 4Z0TA 4ZAFA 1EB8A 5AKZA 4RNCA 4DV5B 3G8YA 2YY6A 2HUNA 3D6JA 5LU8A 2Y68A 2G6TA 3EVCA 2BHRA 1E1RA 2RGNC 4N0MA 3TBFA 2G67A 3SJBA 3VGPA 5KU7A 3HCCA 3NUGA 4IX1A 4QODA 5KCMA 5D84A 6PFKA 1Y1LA 4HWGA 4AJKA 1JYFA 1EUYA 3ZDAA 1HGXA 1JSCA 3SDBA 1CRPA 4N76A 4OI1A 3MLBA 2IWHA 1V7ZA 4KIFA 2CYAA 4R05A 1UZMA 1EFTA 1X7ZB 1Y63A 3QFHA 4Q3NA 5FRDA 4CL0A 4RTLA 3NWEA 2C7PA 4Q39A 1BZYA 1UJNA 1D5CA 3G2OA 3EPLA 1WW3A 1JU4A 3Q6NA 1WDWB 5LXTF 3LGSA 2A1IA 4UUQA 1NVAA 2I7VA 1G5PA 4AKTA 1KZGB 3ME5A 4WD3A 5A0TA 4KIWA 4YJ2B 2OY0A 1QR2A 1R4NA 3OLCX 2JBHA 3ADDA 2NVUA 3CUUA 4ALNA 2F43B 4F85A 3SK0A 2H1SA 1U5AA 5TRTA 3ZVLA 2H4HA 3ZY3A 2Y1GA 1ZHHA 1G8JA 2QG6A 4GKAA 4MS3A 5LA6B 4CKEA 1CP2A 2Q3MA 3R3WA 4WXHA 3NWBA 1O0CA 1DQSA 4YDHB 1EWVA 1KIAA 2QRMA 3CNLA 1BGVA 1LQ2A 2NVUB 1N3BA 3DCNA 2J7PA 3HKBB 5LUBA 4BC0A 5ECYA 4BO0A 1IVSA 4L4YA 1I5EA 5E9AA 4UFPA 2QTMA 3MGGA 3TAUA 1GXSB 5JC1A 3PT9A 3OE1A 2Q4TA 4Z8XA 1P9RA 2WYUA 3PKIA 1EKXA 1SOMA 1EFVA 3I8OA 2D1FA 1RC8A 5C81A 5PNTA 2VAVA 4AWBA 1RAFA 3LOQA 1JJIA 2V0NA 1V6SA 3RARA 2JIBA 3O38A 1SC9A 4DS3A 3WYDA 5M5BA 5DMHA 4M1TA 2PZBA 2BRUA 1Z83A 2IHJA 2QVZX 1RXVA 4LX0A 4KGVA 4E08A 1RCFA 1BWRA 2C4TA 3SOZA 2DXIA 3DUFB 1XDDA 1Q1GA 3RD5A 3ZHSA 1O0SA 3GJRA 4C6HA 2I4RA 1W8IA 3S27A 1QHGA 3G1WA 4I9UA 3RS8A 1OC4A 1CJMA 2W22A 3ONFA 3R3XA 3L0DA 4O4HA 4Y0VA 1DC7A 2H1VA 3E2MA 4J3FA 4QYXA 4JI1B 1TEHA 5JS7A 1JG6A 1UP4A 2G9QA 4P7BA 4TQGA 1R5NA 5AVTA 1OXSC 2B61A 4W9NC 1XYVA 4LBWA 1PLJA 3FVRA 4U7FA 1VC2A 5GPBA 1C3OB 5BSKA 3BXFA 1PK7A 3MCWA 1QX3A 1WHSB 2ZBEA 3ETJA 3OWHA 4WUVA 3NBQA 4L57A 1MV5A 5AK0A 5ALHA 1FW6A 5K99A 3CU5A 4WGGA 2BFBB 2QN1A 1QAQA 3I6ZA 5CURA 2DHEA 5FTLA 3NUZA 3U4DA 1D1SA 1PJTA 2QVBA 2OG1A 3H6GA 3AKDA 3M6WA 4B46A 2KX7A 3ORQA 3A3OA 4ZVLA 1OXXK 1NL3A 4EGCB 2PH3A 1WUHS 1G0NA 4D02A 3P27A 3ROZA 4OYYA 3OZRA 3OLXA 2J3KA 5JUWA 2WLSA 3E9MA 4DY4A 1WHTB 4FCTA 4NCHA 1JEOA 4FYKA 2QRPA 1I1NA 2IEYA 5LSAA 1ZGHA 3R3VA 1E79D 3E5MA 1QHEA 1V37A 2R44A 2WMOB 2P2CA 2PMWB 5EFOA 4IF6A 5DO9A 1PV1A 1NKSA 1JEAA 1IHYA 1LI5A 1ND5A 2FX2A 5C5CA 1DEKA 3HU2A 2RGYA 4RKFA 1U9JA 1SHZA 1RYYA 4S24A 1KI8A 3QXXA 3ZXUB 4L8FA 4MUYA 5HKBA 3WOVA 3BHNA 1VBMA 2DHDA 5ES3A 2AOVA 2CNLA 1R0LA 2XNDD 1YAJA 3VJMA 1V4VA 1Z35A 1H2WA 1UDXA 3R3YA 4YJ2F 5CR9A 5BV0A 5C80A 3FOFC 1NVDA 3OFKA 1PN3A 2A84A 3OTIA 1FX1A 2C88A 1YI0A 2N47A 4YMSA 3D6TB 1XYYA 4FFDA 3FNRA 2CWWA 4FCWA 2ZZNA 1HKHA 2CXOA 3A9TA 4CLEA 3WK8A 2A59A 3KE9A 3VU1A 4BIMA 4DNXA 2PS1A 2C0QA 3R5TA 4XD7A 3V46A 3D4OA 3ROMA 3DTTA 4YLEA 1G3IA 2PUEA 1VBFA 3T7IA 2V6IA 1M7GA 2FX3A 4RD0A 4FB4A 5J2TA 1DJMA 2QI9F 3HZZA 4OKSA 4EF4A 4KMSA 3OOJA 4AUKA 3IAAA 5JJCA 4MVJF 4BV2A 5ECDA 1DAFA 1W0JD 1AUXA 2HC9A 3JALB 3N28A 4JJEA 3TNFA 3JQ6A 1GAQA 1KHHA 3CUKA 1NFFA 3FHCB 3PC6A 5CM8B 3RNLA 1NTOA 3VZSA 5BMVA 5M29A 2EJBA 1XE3A 3IAS6 1Z16A 9LDBA 4FKBA 4R9SA 4EG4A 1L9KA 1MJGM 2XODA 3D81A 5LJIA 3IKTA 2IEZA 2WZCA 2VPQA 3JQEA 1SZDA 4KO2S 1LXCA 3IP9A 2OZEA 2FFJA 4B4DA 1PBNA 4AJ9A 3ZQUA 5K0EA 3HKEB 4E2FA 3QKIA 1SNYA 1SKAA 3V2GA 3ZJ4A 3IP6A 2BBOA 3O1LA 4WDRA 4BDTA 4V1CA 2R6R1 1XEAA 3N8KA 3UWSA 5J4KA 1W4CA 2HHCA 3JQFA 5IN5A 3VJKA 3VSDA 3CM0A 2PCJA 1NU8A 2NV0A 3FPEA 3IRUA 2QZSA 2HK6A 4DBZA 3KLOA 4DQUA 5HZGA 1VFNA 4CXMA 2G04A 4JCCA 3AR2A 4X85A 2YOFA 3UPTA 2SCUA 5HMMA 5AT1A 1F2TA 2WOOA 1UDWA 5DH9A 2XZOA 1UWCA 2RARA 1XTKA 3QA3E 2QD2A 3GJXC 3JASA 2AKYA 5ILQA 1MB9A 3KOUA 3L1HA 4CW7A 3E0QA 3F1LA 2NTNA 3R9KA 2OHXA 1WULS 1OBOA 1CUEA 2PD3A 2Q50A 3EG9A 2QVYX 3ZCXA 4JNCA 4DQLA 4HUTA 4XR4A 5F7XA 2QMEA 2QR5A 5EJGA 5HA5A 3WGJA 5IYZB 2QI9C 3A9VA 5IKXA 1EUQA 4BBPA 4C76A 2L69A 4OMUA 5B6JA 1F1JA 4P4SB 1WO8A 3MELA 3A6EA 5CRIA 1L5KA 2QTNA 1AZTA 1M2VB 4RDCA 1FX0A 3UMRA 2AJDA 3K9LA 3THXB 4Q3OA 4JWTA 1T9ZA 3SFTA 4BATA 4XLZA 2Q8QA 5DYTA 2HNBA 4ZCLA 1VE5A 3UZUA 2QN6A 4QRIA 4L4SA 5EE9A 2OT3B 2PLWA 3G49A 3HN6A 3JQRA 3NASA 4MUKA 2G06A 5B2FA 2Z2XA 3EQ6A 4ZO4A 2H2HA 2ECQA 4AD8A 4C29A 4DYVA 4QATA 2ZI7A 1JPNA 1JVSA 4HCJA 2OBFA 2DHCA 1QRRA 3CGGA 1SXHA 4TSFD 1JALA 1YQXA 821PA 2JI9A 3CLRD 3GT0A 5FNVB 2EJWA 4AI6A 3UATA 2DT5A 2IOFK 1C0IA 4JODA 4Q3BA 1CF4A 5I9LA 5FTWA 4MVWA 3L3BA 1MRSA 4V39A 1NOKA 1VL6A 1N5MA 5ESXA 4BL5A 2O8BB 1IN5A 1L6IA 2MR5A 1L4BA 1FNBA 3A32A 1L9XA 3K16A 1U0FA 1ULAA 1VSTA 1U1IA 1BG6A 1Z6QA 4LJ6A 4N7RA 3KOXA 1RQXA 3EVEA 4ZVNA 1LPPA 4MULA 1JQ5A 3RVKA 3GDOA 2JATA 4B2YA 1MOQA 2QTZA 4ZAYA 4FGLA 2I3AA 3IQEA 2R7MA 4FK8A 4NCXA 3GEBA 2GAAA 2NT3A 2NP7A 1A8HA 1F4VA 2D74A 4QXAA 2ECPA 1DHTA 1IOZA 2O4CA 3OBBA 1C3LA 1CNFA 4FX2A 4TKLA 1QBKC 3RU9A 2I8CA 1HZZA 1RP7A 3PBKA 3QF4A 2AE2A 2R68A 2HWYA 3G17A 4BJ5A 2FUEA 2C31A 3I9JA 4AQDA 1Q0ZA 4LRYA 3TJZA 1GO2A 5DCYA 5SYMA 1RFLA 1W0CA 4NG5A 4X8OA 1E2GA 5REQA 3I9FA 2IZ6A 1HY3A 3KTDA 3R0QA 2W8BA 1SHJA 2AX4A 4FXOA 2JJ1D 4MYCA 2FSPA 3PE6A 4TM8A 5E7IA 4HDNA 1QS0B 1Y6FA 1R9GA 2GCEA 4EKDA 3CZPA 1U0LA 4DVJA 2SKDA 2IXGA 2G88A 3ICWA 4AJLA 4ZIRA 3SAJA 1OWLA 1X1AA 5B7NA 3P0RA 3OIDA 3W5HA 1JLRA 2P4HX 1RQRA 4M22A 3ZY6A 3EFHA 5EPUA 2REBA 2AWOA 5BPHA 5CXUA 5E9QA 1P7CA 1CQWA 2A57A 1NNI1 2FMKA 4BWYA 3UJAA 2REOA 3EEQA 3G2MA 1U90A 3MYRA 4MWCA 3V3KA 1Q12A 3GNSA 3OEEA 4RPCA 4NH4A 4QJ4A 2YR0A 1E63A 4XLLA 1J22A 5JPDA 2EHJA 2I6TA 4G09A 2MYNA 3NTVA 4HRAA 3WMRA 3SU8A 4DG8A 1F8FA 5F52A 4FC6A 4O3FA 3GW8A 1H9CA 5COBA 5TT0A 3ZEIA 1JHQA 5F64A 3DFMA 1KQGA 2P0EA 4WOKA 2IHBA 3SXJA 3SLKA 3RYHA 3KKOA 4AECA 3I5MA 1NIPA 3HDQA 4CKCB 1QG0A 4L8YA 4DR3B 1JR3D 1ST2A 3ANMA 1U8TA 5E7QA 5CP8A 3C45A 4QX6A 1Z2AA 5DI3A 5F3DA 3X1MA 4B5LA 1V2HE 2PKRA 1CUZA 3O0TA 4H7HA 4O4LA 4UAJA 4WA7A 2YMPA 2IOQA 5A4DA 2QTVA 4JYCA 4EVIA 5JJIA 1B41A 1L7AA 4BTVA 5CAEA 3NHBA 3JZDA 5KTKA 1IM5A 3MBOA 1Q5PA 1Y6ZA 3VNQA 1IK4A 2H6EA 3AWDA 2OE2A 3IHKA 3SHWA 2GEVA 1RNLA 3NKVA 3WRVA 5K01A 5D7NA 5GQSA 3V2HA 3DE2X 5FBKA 1TT5B 1XRSB 1GUFA 1DTWB 4FMPA 5LP6B 4W8OA 3H6HA 1CEXA 4K1XA 5IBPA 1A1SA 4KO4S 3AJEA 2JAUA 2YN2A 1T8YA 4ITRC 3DZDA 4UHDA 4WV3A 3WGGA 2X15A 3PCRB 5ALUA 1JUDA 1K9SA 3LL7A 1MU0A 1W4BA 2WZQA 1Y7IA 1L5OA 2PX2A 3HJNA 4HYQA 3IOEA 4B17A 2C7QA 2HIAA 2ODPA 1YZGA 3K1ZA 5G0VA 1J5XA 1K6MA 2JI8A 4TWJA 2GCIA 1AKRA 2KI5A 1W0JA 3C70A 3QUQA 5EZYB 3WL7A 3I3OA 1Z5ZA 5HUHA 2IK8A 4EY7A 2QEQA 3OX3A 2I7XA 4V02A 3UCFA 4UQLA 1R15A 3AR6A 3DYIA 5SZKB 2Q6VA 2YV3A 5M34A 3VPHA 1Q0TA 4EYGA 1HORA 4FGWA 4EY8A 3VVLA 3O7WA 2YQ5A 1MP0A 1QGUA 5DBGA 2F9MA 3ZGNA 1XAJA 2VTBA 1QM5A 1M0EA 5FA5A 2ZSFA 2QD3A 4NICA 3AFGA 4DV1B 2GEJA 1J0CA 2XTNA 4WLOA 1O58A 2GEUA 3TRIA 3IA2A 2GR9A 4KDCA 1A7KA 1VECA 2YN0A 3B48A 3GI1A 3SZ3A 1MD9A 1RD4A 2V6FA 4M89A 5HNKA 2POQX 3C43A 3L8DA 2XIQA 1C2YA 4M6WB 2WG2A 5G4KB 2AS0A 1MIHA 1FSFA 3QLUC 5FBLB 5FX2A 4QASA 2R00C 1XKXA 1NMYA 3EIWA 1L5NA 4RTOA 4GZLA 1E2JA 3BN3A 4A1FA 5GZ6A 3COPA 1KMNA 4YJ3B 4HUQB 1G60A 1GVNB 3MWLA 4KQFA 2OAQ1 5JNSA 4NXNB 2ET6A 1H66A 4H4CA 3IFSA 5KPDA 2OGUA 3G2JA 5F3WB 1TQHA 4HNSA 8ATCA 3GRVA 1X6VA 3LQ1A 1DBPA 3L93A 2NW6A 3HCBA 3ZDQA 3BXZA 2JGRA 4I2VA 4QSMA 3TTXA 1YK0A 4E09A 2IPAB 2JKZA 2VQDA 4EG0A 3R6DA 5IT9A 3ER6A 4TWIA 2ZJ0A 4EO9A 3WIBA 2G08A 5LN1A 1P91A 1PFUA 4TMZA 1UEJA 3HA5A 3FFAA 3R3HA 3FCEA 4RLHA 3IEMA 4P80A 4BCCA 5CG1A 3KZNA 5E6SB 4KQCA 4PYIA 2HU2A 5EXEA 3WMXA 5B2EA 2CFCA 3ESYA 1DWPA 1M8KA 2GPYA 3E9QA 1P9NA 5THQA 3G5MA 5JWOA 5IN4A 1Y6RA 2Y9PB 3O8BA 2C9ZA 4ERXA 1FRZA 1YDGA 3NDRA 2GPSA 2IP2A 4KN8A 3UY4A 5KSWB 4MVJD 4CMAA 1DIAA 5H1YA 3CBQA 5DBIA 3Q6IA 5IUKC 2FEMA 1PGOA 5EZQA 3O5AA 4B73A 4OAPA 1CB7A 4OKNA 3GPDG 3JVEA 2O8NA 5EWLB 1DT5A 5GJVC 3AO0B 4TTRA 3WMWA 4CEJA 1T0BA 1FS6A 4TUYB 2PL9A 4YMUA 3DF7A 4URWR 1NW7A 1SWWA 1HT1E 3BE5A 4C7VA 4FFWA 3RHTA 1C3XA 3M8KA 5BNFA 1XZMA 4D74A 3DDOA 3WHPA 5LBIA 2FQWA 1TGYA 4EKYA 3WYAA 3P2IA 3ONVA 1W5AA 1N9GB 4HQ0A 2AK3A 2W70A 5CB4F 2RGGA 5EA2A 1OXUA 4CM3A 1XVVA 1S3GA 2J0UB 4GLJA 5G53C 3CKYA 4RHEA 3L8GA 5EKXA 5C8YB 3TFOA 1QRDA 2VAPA 1CEQA 1D2MA 4DDVA 1Y1SA 2C2OA 1XRJA 4Z1MD 4PRYA 3EG5A 2WJZB 3KR2A 4BAZA 3FFBA 1XWIA 4II2A 4CLOA 3FSJX 3PF8A 5DI3B 3UGQA 5AW3A 4Q9LA 3TDKA 2OXIA 4PS1A 5CYPA 1FU4A 5IJ0B 1PD0A 4GXTA 4O2AA 4OHVA 5C5EA 3TW8A 1BD4A 5JMWA 1KZ9A 3SZUA 4QBTA 3T5GA 3R8XA 3WWEA 1RKVA 2X2OA 3V8NA 2YMMA 4HDRB 1NTRA 1O4VA 2I1QA 3OT1B 1JW9B 2B1RA 2BFDB 1ZXXA 2DY1A 4DT1B 1B0UA 3KZMA 5BSWA 5K0GA 1UBFA 1GRVA 3EXEB 1Z56C 5I7AA 1KMQA 1GAEO 4NCNA 2NPFA 1AZLA 2PUFA 3VAZA 4RV5A 3QWIA 4ALMA 4K0KB 4N5LA 1Z74A 2GJ8A 1KO5A 4NBRA 1I7NA 3QYJA 4QNRA 3VSBA 3KPJA 4HQFA 2BCJQ 1JFSA 3ZE2B 1QE0A 4HYTA 4FGUA 2VHYA 3PDIA 1KY2A 3E3MA 4NZOA 2D7DA 1UZUA 4ZEOA 1JPJA 4LN1A 3LWZA 1VB5A 2COUA 1E2UA 2A4MA 4IMPA 3VR6A 1SQGA 1Q16A 3CE9A 1QSGA 3CCCA 3RK4A 3RVBA 4KLNA 3W9UA 1QMGA 4Z4FA 1CLUA 2QAGB 4BLSA 5ELXA 3PRJA 3N2GA 2QMYA 3TINA 1A9TA 3T3HA 1R8YA 3G2QA 1U0TA 5FB3A 3CVUA 4NY1A 5FUBA 3R24A 4Q34A 1YMVA 5BV7A 1ZVQA 1NWHA 2HZBA 1HI9A 4MCIA 1IM8A 4Q9JA 4KXFB 2BHLA 4XVUA 4L0QA 4MEAA 4MYDA 3NZEA 4EJSC 2HDWA 4HVCA 4G5OA 3NAQA 1W46A 4AIRA 4K9KA 3H86A 4U02A 4ZCPA 2FJPA 4X44A 4FEAA 1KK3A 1E1RD 3K30A 4OQMA 2ID4A 4PM4A 4C0SA 4FW9A 4GO1A 1J25A 1MG5A 3L1KA 3NHWA 1YR6A 1G8YA 2YTZA 1SURA 3F9CA 4GBED 3MW8A 4LJ5A 5JSUA 1P2SA 4L9AA 1U0EA 1Z75A 2DUMA 3C1AA 5KQLA 3QK7A 3KTOA 2EW2A 3OETA 3OZCA 5DWQA 3TW8B 1ZUD1 1B00A 3QHQA 2GWHA 1EFUA 1Z0JA 3WKEA 5CB8A 3HJHA 3K0FA 3CXRA 2YWRA 3N8GA 3QKTA 3PFBA 2ZJOA 5EKSA 1OI4A 1BAPA 4EKIA 3RKSA 1QIJA 2Q21A 4HPJB 1ZMXA 3FDZB 4IIJB 1RLTA 5KDDA 1T9HA 2QD1A 5CDFA 1NJ8A 3BULA 4NWIA 4JLUA 1IJKA 1ABEA 5IAAA 3HGMA 4BX0A 5B57C 1H2HA 4Q12A 1VA5A 4AF6A 1GOTA 2H51A 3FVQA 3MIZA 4L5AA 5B4UA 4D4KA 2WKSA 5HZMA 2AEMA 1IZYA 1RQLA 1TIBA 2OWEA 1J0XO 2I91A 2I9PA 2V65A 3TVTA 3ZU5A 4QLBA 1I3NA 1SQFA 4RELA 3FTQA 4A15A 1RJEA 2FB9A 4CM4A 3O1JC 4XGIA 3TW0A 4ETMA 3IDAA 1G19A 4WY5A 4IO0A 3TLGB 4E51A 2VP0A 4P0QB 3BSFA 1ZHFA 2ZUEA 3ESQA 4YRBA 3GDFA 1FFGA 1X9HA 3DLIA 3FI9A 1P72A 3K73O 4F2DA 4ZHQA 2IXEA 3G23A 2ZPAA 4DEVA 3QSYA 3DJFA 4Q9KA 3TLYA 3L04A 3IBGA 3DNPA 1Z34A 1ZGBA 1G0OA 3HBJA 4XIFA 3WZMA 4AKSA 4C6TB 2B1IA 1DOZA 2Q1XA 5ERGB 3SC3A 4PHTA 4DUGD 5I4BA 1U9YA 2X6QA 3UXHA 5CDGA 1QCCA 3AMVA 2HL6A 3GJ7A 2WIGA 2V8OA 4NG4A 4B48A 1L7PA 3HU1A 5JLJA 1ZD5A 1Z0FA 4KQIA 4UBNA 3TQRA 3EAQA 3M3PA 6CHYA 2A0KA 5IFLA 1G8AA 4LXYA 3GFBA 4HADA 4G65A 1KWGA 3R7FA 1ZRNA 3CA8A 3LL4A 2HA3A 3CEHA 3IJEB 2OB2A 1FFBA 3HYNA 4MAMA 5C8VA 1VTKA 3QVSA 4RW0A 1E4OA 4G07A 4TT3D 1YQWA 1L7MA 1N25A 4XSGA 5J43A 5KOHA 2B20A 2FR8C 1WETA 2AMVA 3EYAA 2FFRA 5B3AA 3QJGA 1P8AA 5DBFA 1PL0A 3GDWA 2G28A 1SUAA 5U4QA 3DMDA 3K0KA 5FBHA 1W8DA 3AR8A 4MHOA 4DXHA 5AOCA 3INNA 4D8YA 2DAPA 5AW6A 4ZI7A 2YWEA 4R8KA 1Q74A 5F98A 3Q5EA 3SBXA 2FCRA 3DC7A 4KSCA 5KZMB 1NVVQ 1JQJC 3FMIA 4OUDB 4FMCF 4O0LA 2ZCUA 1PF7E 4CDGA 3JYPA 1CRQA 5A9TA 1USWA 2GZMA 4JKYA 1JKFA 1G3QA 2POCA 3N2YA 3DLBA 1ML3A 2OVBA 1KNQA 4U2BA 1XMQB 2EARA 4JJKA 4AROA 1QFZA 3PNYA 1IUNA 5ED4A 4LVUA 4MS1A 3A3KA 1BSVA 1GKUB 2QG4A 2D00A 3R5HA 3EGOA 3LG2A 2O1EA 4LUCA 4BLVA 1BWQA 4MXDA 3B6JA 4YFYA 3KTFA 4QPJC 4HDSB 1E64A 2VC2B 2Q9UA 4F5EA 2QX4A 1Z4NA 3KEGA 1JHDA 1J39A 5FT9A 3STXA 4RFLA 3JD1A 2PUJA 2FLVA 3LU1A 3WLHA 3RK0A 4BGIA 3KQPA 1U3VA 4FX5A 4RZ2A 4HNGA 4OB6A 3DKIA 3DTVB 4XCQA 2D4AA 2YXLA 3AHDA 4NQRA 3AR3A 3RSHA 3H4IA 1BO6A 1Z15A 1BJTA 2GO7A 1R8QA 2R9VA 1L7XA 1YUNA 2W2TA 3EDYA 4QVIA 3U4MA 3HI4A 3I5XA 2FW8A 1G7RA 3FETA 4EEZA 1DV2A 2O14A 2GLTA 5K3FB 5JZMA 3AIMA 1XF1A 2PMCA 4E5SA 1OC2A 1U7ZA 2J41A 4EA6A 2VQ6A 2B4TO 3PHLA 1XTJA 4L5CA 3AHHA 4S04A 3QU2A 3DD5A 2AOTA 3SIWA 3WTBA 2CNKA 1QX4A 2R8PA 3MMZA 3HUUA 1M7BA 5TQJA 1KYIA 4C3UA 1I1QB 4DIEA 1P75A 3B3GA 1QU2A 2EP7A 2ZIVB 3G8CA 3T9FA 3THOA 3WC4A 1OIVA 3IUBA 4YUVA 1FLNA 1YV9A 3C1OA 1SFRA 2BUCA 2RB5A 3R7SA 4X97A 4EATA 1NN1A 3VOAA 2PT5A 3GZNB 1NJSA 2HJGA 3NX4A 2IHZA 1ZMBA 2GB4A 2R6HA 4R5MA 4GVXA 2E5WA 1Q1ZA 1XELA 2VQ3A 5EIOA 2KS6A 2NSJA 3DGFC 4CKCA 4P33A 5LR6A 1IEQA 1NVMB 5FOXA 1AKWA 4FDLA 4GZ3A 5E4JA 5AM4A 4TN1A 1K0FA 1LRLA 1M6VA 5BQ5A 1Z36A 3M82A 3LTNC 4AK9A 2CNBA 3BXPA 3GJ4A 5JZ9A 3B1KA 4QM7A 4YONB 2EKLA 3QFFA 1V0JA 3LY8A 4HGYA 4IVNA 5COQA 4MQLA 1EUDA 2QMZA 2Z30A 2G83A 2H2GA 3FYUB 3HNRA 2ZSAA 3LO8A 3LQ2A 4MZDA 3JYOA 4W5HA 1N0WA 3F2VA 1ZONA 3ILYA 3G85A 5IYZA 3DLAA 4LF6B 1YA4A 5KWVA 1EXDA 4GOKA 5J23A 4NDAA 4F45A 4W5RA 4OQ4A 5ICGA 3PV0A 3UV6A 3S81A 3FTEA 1TM1E 2HSEA 3B36A 3B85A 4EQ6B 3K32A 3LUHA 3ELWA 1GADO 1TCVA 5F73A 3JQ7A 3N1UA 1OV6A 3DBIA 4PANA 4HEQA 5EP2A 4URHA 5KJEA 4QGHA 4EH1A 4AKEA 1P74A 1U0NA 2PHZA 5ES4B 2E87A 2R8OA 1K08A 3MD9A 1CF2O 2C9DA 1BN6A 4IKEA 3Q3CA 4BLPA 4DMHA 3EZ6A 5A4MS 4QC2A 1E9DA 4J8PA 3K6SA 3KUCA 4FE3A 2HXGA 4G67A 2E7ZA 3L7CA 4OAQA 3RS3A 1LI7A 1E8MA 3L7AA 3Q8KA 1G9TA 1E3SA 3VR5A 1XTPA 3D6VA 3GDGA 3WLNA 3ZD8A 2IUFA 2V3CC 3KB8A 5THXA 3V4PB 3QVVA 4LC0A 3NTOA 3DZFA 3STWA 3OEWA 4GKKB 2I6SA 5FBQB 5CA0F 2O3JA 3I9NA 3P26A 1L6RA 2Q5CA 1O6GA 5BMVB 1MNAA 1NN5A 1C7QA 5B6PA 1KEEA 1WJGA 3A1FA 3RC2A 9ATCA 1M5TA 2ZU6A 1P6XA 3RV3A 4TSKA 4WZ6A 5GONF 3K70B 2JBWA 3DVSX 3K3PA 5ERXA 2BGKA 5BWCA 4S05A 5D6OA 2P67A 1JEQB 4CPDA 1FP4A 2VDPB 3ANNA 3NHJA 3OZUA 4HMOA 2VR1A 3K9WA 3NVKI 1YRHA 4QPZA 1Q6YA 2AOUA 2YCLA 4AC9A 2BFCB 4ZAGA 1USKA 4GZMA 1H2FA 3VR4A 3F5DA 4DG5A 1IH8A 3W2GA 5JFTA 1C1DB 1U2PA 5HSGA 4BFUA 5KNDD 1T9AA 3GGJA 2HBYA 3KNZA 3KVNA 4FFRA 3R40A 2DWPA 1IMJA 3WV4A 2IUYA 2OBBA 2O3UA 2ZJBA 1E94E 3AUJB 2J9ZB 1SZJG 2IX9A 4JVMA 2V45A 2DECA 2Q99A 3H0CA 4LDJA 4WN9A 1EIZA 3K9CA 3SBDA 3WJAA 3KTAA 1R6BX 2B8JA 3D5QA 4XWWA 4NOMA 2BHNA 3ECSA 1C81A 3D8TA 2I8LA 2FJUA 2HRRA 3C3YA 1VCOA 3CTPA 1WMBA 4LHVA 5L3QB 4RLFA 3G2LA 1MTZA 3OOWA 4ZQIA 4YACA 3JZAA 3L07A 1T35A 1QNFA 2FV8A 3CUTA 4K6GA 2PX8A 1UP6A 3G0OA 3H2JA 1WOMA 4U9IS 3EIOA 2YW2A 3IVGA 4D9NA 3FDZA 4XB1A 3QEMB 4INAA 1NE7A 3TW6A 3WP1B 4EPVA 4RDHA 2CUTA 5BSUA 4U8GA 2B8WA 5B7GA 1QYCA 1Y7PA 4N5NA 2GK3A 2CLDX 1IN8A 5IP5A 4JOBA 4LC1A 1GGMA 3PE4A 4MCHA 4OHRA 3AI2A 4C89A 4ZDJA 1D03A 1N8SA 2CBXA 3EEOA 2BM8A 3FIJA 2XDAA 4KX5A 4YIHA 3P0EA 4LNUB 4TL6A 2PGXA 4GW3A 1X86B 2GZAA 3ZGXA 3GFGA 1TZMA 1CR4A 4M1SA 4ZANA 3WWDA 1NT2A 1HTWA 3A10A 3A6GA 4DL9A 5AKHA 1E1DA 5EEGA 3SLRA 5L7TA 5AQ1A 4C2TA 2ENWA 2HUPA 2AMFA 3UANA 1L8AA 5H5JA 1QFXA 2AFRA 4D9MA 5ITSA 1U2EA 1E7SA 3THWB 1N6NA 1SKYE 4HB4A 4ROTA 3TR6A 2O5RA 4NDNE 2KYRA 2B7CA 2X1LA 4XUGB 4AB1A 4PRLA 4JDUA 3BIWA 4L6IA 3A3PA 1H9AA 1PRYA 3B9BA 3LP6A 5JCZA 3O9ZA 2E2WA 2WSMA 3FRJA 4J0GA 2WD9A 4IGEA 4LZAA 3WGOA 4K2HA 4F2HA 1XHEA 4RTKA 1XWFA 3WRYA 5I5GA 5KTSA 1KDTA 1R18A 5DHRA 2PLAA 5EE5B 1ZK3A 1CZOA 3NBAA 3WIVA 5JZVA 1FNSA 4KZKA 2BDEA 3QMVA 4O5AA 1WUTA 1RI5A 5CFQA 3CUEF 2WSBA 3D2AA 5K8UA 1O9HA 2B4QA 4RACA 1QUFA 4MS4A 1JI0A 1S89A 5CGZA 2P3LA 3M6FA 1H4QA 3NOOA 4X1OA 4HP8A 5D00A 2ROQA 5TJ9A 2EIXA 1YQTA 1HE1C 1QIIA 1UF9A 2QJFA 3AT1A 1D6MA 4INZA 5EE1A 2EV9A 1RAGA 4GC5A 4AMBA 4DT1A 4BX3A 4MI1A 4Z9YA 2XD4A 4HI0E 4RJ2A 1E3DA 2YWXA 2QBYA 1Z5GA 5AH0A 4JT2A 4ARBA 1RXYA 1RM4A 4DLNA 1Q2UA 4BNZA 2GRUA 4BFVA 1NXOA 2FHPA 2VLBA 1G9XA 4YRZA 4AUNA 2ZTUA 1YA6A 3AM1A 3E3OA 3SHQA 3AV3A 1OFGA 3BIXA 1T0HB 1PGQA 2EBFX 2UYOA 4YUAA 4XFJA 3QXHA 4FSHA 4LXHA 2EGGA 4Z51A 1P3JA 2PUBA 3OC0A 3QXCA 2V1XA 1FZTA 4KWCA 5HJEA 1WEKA 3H5RA 3ITNA 1V2GA 4QRDA 2AEEA 2WWFA 1FF9A 3CRNA 4KXQA 1EA5A 3BCHA 4WL0A 4FNAA 4YHBA 1L4UA 2XZTA 4RIGA 2B5WA 1IBSA 1GGHA 4RY2A 1X3LA 4U1RA 4WE3A 3F3YA 4AZSA 1YL5A 2HLHA 3H5OA 2WB4A 3AJDA 4A91A 4F5DA 1KVUA 1IPHA 3WXBA 4F8JA 3UQYS 2HXYA 2CLIB 5L40A 3WNQA 4WK4B 1GNVA 1I36A 4IFEA 3IPLA 1P6QA 2YJGA 2OM6A 4FHCA 4AMZA 1CIVA 4DDTA 5A06A 2CNDA 2AYZA 4Q19A 2B9VA 3AH8A 1SUIA 4JQCA 4Z3KA 2K7FA 1YJBA 3I61A 1EE2A 3V1TC 3RFCA 1ZQ9A 1UBSB 4GYYA 4QXOA 1AHHA 2Z5FA 3TE6A 4I8IA 1GUYA 4PG6A 5EL0A 3HEAA 4URVR 1Z7WA 1K8QA 3NXSA 1IUKA 3DEIA 3X3HA 2D0DA 4A23A 1I3OA 1P4AA 3GPBA 3MJFA 2FWBA 4RK5A 4G9EA 5IZCC 3SF0A 3TNYA 1YR2A 1BU8A 5IHPA 2GOYA 4CQLA 4IXTA 3WE7A 2NAPA 1OI2A 5LKRA 2X5NA 1IHXA 2QTTA 2ZS9A 5HX7A 3HCAA 4LBZA 2WF8A 5JCJD 2R7NA 2VJMA 1XZPA 2P3SA 1NNSA 3CMCO 5CJJA 3T52A 1WQ1R 2PLRA 1DAGA 3IIIA 2BHTA 3K9GA 4CIXA 1HTTA 5K3DA 1EK1A 5JNUA 4PGFA 3GLHE 4TTIA 2XIJA 4UU0A 4RYLA 3WAKA 3TVDA 3MQ2A 3QQPA 3MMSA 3MWJA 1JHOA 1W96A 1I5OA 2MT9A 2Q3DA 4RJLA 2BZ1A 2OXFA 1LPAB 1SKQA 4F71A 5HKKA 1E3TA 3GLKA 4F4HA 4BP1A 4U6QA 4DTCA 1M2EA 1JKXA 2L82A 4RIHA 5AOVA 1YE5A 2SNIE 1QGUB 1SXQA 4N8EA 3KQKA 2RAVA 4KKXB 5DOZA 4MMYB 3TLCA 3UIEA 1GDTA 4RFVA 1Y34E 2YXEA 2ZB8A 3GY0A 3WYEA 3I4FA 4YCDA 3RPEA 4MDEA 1US8A 2GNOA 4G1BA 5IF3A 2AQHA 1DXYA 4EFKA 4X8HA 3UUFA 4COOA 4OQDA 2X8WA 3QBJA 5E1OA 3LGAA 2OG2A 2QG9A 5KYWB 4RPJA 1ZVVA 4C20A 2BWJA 1NDHA 1U2RA 3E3AA 3GJ0A 2JVKA 3CF6R 4R6WA 4NOLA 2J0EA 4BV8A 2A33A 2BFNA 3DMGA 3WFIA 3TRHA 1JQKA 2GDZA 2Q45A 4ZT6A 4D9IA 2C07A 1HG1A 3BMNA 1BDHA 3A0RB 3FYUA 1TC2A 1GRQA 2FMFA 2QP4A 3WNDA 1RKBA 4IJQA 1TA4A 4UD2A 2PSFA 3IOCA 3T15A 3W3AH 4O6VA 2HTFA 2X4DA 3ILSA 4WUTA 2WJ3A 1GGNA 2YINC 2AUTA 2ZUTA 1Z33A 5EVJA 5JAZA 1GKIA 4DCVA 2VUSA 3C3CA 1JFRA 1GRCA 1Z08A 2YC2C 1TCAA 4O4JF 3DBLA 4D5GA 5KQRA 1MX3A 4ROSA 4JI6B 1N6LA 2C3UA 5DGXA 5KPJA 1RXEA 1BXKA 5KTYA 4QQFA 1OW3B 3DAHA 3UNXA 4B85A 1ESEA 3KT0A 5FPYA 3G9XA 3B1XA 3DWFA 3MM4A 2MSEB 1J5EB 4X0EA 2XBMA 4WFQA 2ZJFA 1MORA 1IXSB 4H7IA 2C99A 3LNTA 2GK6A 3D59A 3SEFA 5AXCA 3LSTA 4F3YA 2WYWA 3GCZA 1HFKA 2VDJA 1FFXB 2B2CA 1GTMA 1LJ8A 2DFLA 2HWXA 3A1DA 3JD4A 4GG1A 1NLZA 3ZK7A 5LP6A 1XZDA 4XZ3A 4RD4A 3AEZA 2RKWA 1D5WA 1QUEA 3C5WP 3K2IA 4XGRA 4ZWNA 4XM1A 3DE1X 3TD9A 2IC5A 5EJ6A 3TXYA 2BF7A 3NHZA 5AVWA 3BS4A 4JBGA 3IUPA 1N36B 3SYRA 1DUIA 1G4AE 4ZQCB 2B34A 3G79A 1EU1A 5CA0A 5IHXA 3ZXIA 4MS1B 5DT2A 2QGNA 4I6EA 1VLQA 1F3LA 3Q98A 4DYDA 1GUDA 2H11A 1IAQA 1Q3KA 4AIIA 2C2ZA 2C83A 1NZJA 1W25A 1N2BA 2DLNA 3HEBA 4R1OA 2MSNA