1LGYA

Lipase ii from rhizopus niveus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
265
structure length
265
Chain Sequence
KVVAATTAQIQEFTKYAGIAATAYCRSVVPGNKWDCVQCQKWVPDGKIITTFTSLLSDTNGYVLRSDKQKTIYLVFRGTNSFRSAITDIVFNFSDYKPVKGAKVHAGFLSSYEQVVNDYFPVVQEQLTAHPTYKVIVTGHSLGGAQALLAGMDLYQREPRLSPKNLSIFTVGGPRVGNPTFAYYVESTGIPFQRTVHKRDIVPHVPPQSFGFLHPGVESWIKSGTSNVQICTSEIETKDCSNSIVPFTSILDHLSYFDINEGSCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIACYLGLYCEROL LIPASE
publication title The crystal structure of lipase II from Rhizopus niveus at 2.2 A resolution.
pubmed rcsb
molecule tags Hydrolase (carboxylic ester)
total genus 86
structure length 265
sequence length 265
chains with identical sequence B, C
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1996-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lgyA00
3GELA 1HBJA 4WFIA 3IURA 1WB4A 3BF7A 3C8DA 5ALDA 4ZGBA 3R0VA 1AQLA 2YH2A 3X3HA 3FLAA 4QZVA 4J0JA 4PW0A 3FCXA 2ZJ7A 2H7CA 2P8SA 1THTA 4DMHA 3OC0A 5C7YA 3GUUA 1JJIA 5E4YA 1CUAA 4X71A 4F0JA 1YAJA 3WYDA 3ANTA 2VJBA 4FBMA 5CXUA 4H35A 5DWDA 3WIOA 4Y2QA 5AM3A 2ORYA 5T4HA 4FNMA 2FJPA 3U1TA 4BVKA 3JW8A 4MEAA 3C6YA 3PDCA 1GQSA 3G0CA 3ZLVA 4BCDA 3RK4A 2B9VA 1ODSA 5JD5A 1CUEA 3C6BA 1QE3A 3F97A 2VATA 4BATA 3NGMA 4Y2TA 5KBYA 5CH8A 1NU8A 2EDCA 4L9AA 4BB0A 2GYVA 2IX9A 1O6FA 2WUDA 2CB9A 1Q84A 2XB6A 2PSFA 3VDXA 1YA8A 5D6OA 2WTMA 5AKIA 3I1YA 3D2AA 3WL8A 4EA6A 2D0DA 4F21A 4HS9A 1XRPA 1E89A 1U2EA 1CEXA 3M3DA 1SC9A 1CLEA 1JMKC 1YS1X 4YK7A 3W2TA 4QA9A 2HFKA 2OCLA 5H3HA 3DCNA 1C4XA 4B9AA 1MN6A 1CIJA 1XRMA 4DMCA 3FSGD 4DMKA 3SX4A 1BEZA 4FOLA 1ISPA 2C0PA 3DKRA 3F8SA 4P92A 1YS2X 4UBOA 5HF9A 4M0MA 3QZUA 4YPVA 4B85A 4LYDA 5ISMA 2VAXA 2JBWA 2VTVA 1CUFA 1A88A 1GPNA 2ACEA 3K2IA 4LXHA 1VZ3A 5AHXA 3T52A 4ARAA 3FOBA 2QOEA 4Y2PA 4J0GA 5HKBA 2EDAA 1E8DA 5DJ5A 3WK8A 1XZHA 4QDZA 3I28A 1XZJA 2OLEA 4EBBA 5EIEA 2WILA 1VKHA 2DCMA 1GZ7A 2VJCA 4H7IA 1CFJA 4PQEA 4ETWA 4FNGA 5YASA 1ZD5A 2WQZA 3Q0TA 2PX6A 1LGYA 3FNBA 1XFDA 3HXKA 3DD5A 3H2GA 3ZLUA 2H9YA 5CT5A 3E4DA 4HXFB 4WFJA 4BZWA 1GGVA 1U8EA 1QTRA 3DEAA 3A2LA 2Y2VA 1MNAA 1FFAA 4UBIA 1N1MA 3ZV7A 4KYVA 2QS9A 4I4CA 3UMJA 4M0EA 5AH0A 3DS8A 5F4ZA 3K9BA 3IUJA 3HRHA 1TAHA 3ZI7A 4KE8A 3RARA 5IH7A 3SWWA 4LHEA 5SYNA 2QKYA 4BYMA 3VXKA 1YB7A 4KAFA 2C58A 2WHPB 4J0IA 1Y7IA 1UK6A 1TCBA 4LYEA 3F98A 4MWTA 5K5EA 4PSCA 4UHDA 5DYTA 4KAJA 4BAGA 5AKJA 3R3WA 3ZPXA 3MGAA 4G4GA 5HZGA 1UOPA 1H22A 5D3KA 3WK9A 4N8DA 2NW6A 3CCBA 1P0IA 3GBSA 2YASA 3ZLTA 2B20A 3ESAA 4UFNA 1TIBA 1CUUA 2DHCA 4KRYA 3ESCA 1RP1A 4L0CA 4C01A 4YASA 1LPBB 1I6WA 5HCUA 1LPNA 3G7NA 4UHHA 4EZIA 1HKHA 3KOOA 2XMZA 2IIVA 5JD4A 4Y2JA 3CCCA 1LNSA 2ECFA 5HKAA 3STTA 1WB5A 1OCEA 4BAZA 4KR0A 3R3XA 2B61A 1JT2A 1VE7A 5CT9A 2QXUA 5IVIA 1K63A 3ILSA 1CUZA 4KRXA 4DYHA 4F60A 3IA2A 2XDWA 2JGEA 4CG2A 3V1LA 3ESBA 3V9AA 3IB3A 2CKMA 1WHTA 1CUXA 2EEPA 5LZ5A 1R9NA 4DGQA 5EHQA 2GYWA 4CCWA 4QLAA 1MT3A 1BN7A 1J2EA 3DYIA 5AIAA 2OAEA 1DX6A 1YB6A 3HZOA 1AKNA 1BE0A 3A2MA 1Q83A 3H0CA 3NOXA 4H7JA 4X92A 4INZA 4EY4A 1F0PA 5DLPA 5AK6A 4CG3A 3I6ZA 3W05A 3WWPA 3F67A 4Y7DA 3D4LA 1WPRA 3H19A 2PL5A 5LKAA 2BUAA 5AM0A 1LZKA 1QIDA 1QLWA 3C45A 3EF3A 1QIGA 5FLKA 4OCZA 2Y1KA 3FYUB 1XROA 4GDMA 4H77A 4B83A 3D0KA 1CRLA 5CMLA 1X2EA 3R3YA 2WM2A 1UWCA 1MNQA 5AM2A 1XLVA 5CURA 4W1QA 5ALMA 2VT6A 1XLWA 5ALIA 3G9TA 5HF6A 4X97A 5EHXA 1WM1A 1Z68A 5IVHA 2V97A 5JATA 1QIFA 2G4LA 4K6GA 3E1GA 4UHBA 2WG1A 4U2DA 4X7BA 3WQHA 1QIMA 3TJMA 3G0BA 4FMPA 5EHNA 5DNUA 7YASA 3H2HA 3KXPA 1MAHA 5HK8A 3ANSA 3IVMA 2RI6A 3I2JA 1OXMA 4B81A 1YA4A 2QJRA 2JGMA 1BEEA 4GECA 4Y2VA 4TGLA 4P9NA 1CUVA 2WIJA 1IZ7A 2Z8ZA 3H2IA 4DMFA 1ACJA 1QIKA 2Z3WA 1NU6A 5DYWA 1JJBA 1EK2A 2PU7A 1ORWA 5AK4A 1ZD3A 2XUJA 3W9BA 1SCKA 3B3QA 1ZI6A 5K3EA 3KWFA 3O4HA 4W63A 4N5IX 1QGED 3BXPA 4UHEA 2ACKA 3WWEA 1K5PA 5D7BA 3O4JA 4GXNA 4J0KA 2WFMA 1R88A 3O4GA 1UOOA 1XKLA 3S2ZA 2WJ6A 4Y2YA 4OU5A 3WLAA 1ZGBA 3AIMA 3LS2A 2VT7A 1GT6A 3WWDA 5DTIA 1J1IA 2XMCA 5FPQA 1WPXA 3PUIA 2VAVA 5BWBA 4QLOA 3KSRA 4Q82A 2VSQA 2XMSA 1X2BA 2XLCA 3EIOA 4AMYA 2HU7A 3FCYA 5AOBA 2VA9A 4B7ZA 4EY6A 5JAUA 2GYUA 3WA7A 4N8SA 1VJ5A 4E14A 2HU5A 4PSUA 1N8SA 2WHRA 2ZJ6A 5CTAA 1QFMA 2AJBA 2AXEA 3FYUA 3G0GA 3RM3A 2ROQA 1HLGA 2I3DA 2JIDA 3G0DA 1B41A 2PSJA 4RGYA 2O7RA 3DOIA 5LZ4A 1L7AA 5A7FA 3FYUC 3UUFA 2QZPA 4B6GA 5A7GA 2HU8A 1A8QA 2G5PA 3I2FA 3H17A 3QVMA 5DNVA 5CBKA 4DLNA 5HK9A 4A23A 4MQLA 2XI4A 4X95A 1W52X 2XMQA 3WL6A 3G02A 5ESRA 5AI0A 4W1PA 2ZYSA 2DSNA 2OCIA 2ZSHA 2YXPX 4BP8A 1DT5A 2HA4A 5EGNA 1H23A 3KWJA 3D59A 1J07A 4OYYA 2XT0A 3O9MA 3FYTA 3LLCA 1DU4A 3L1IA 5ALQA 1Q0RA 2LIPA 4WY8A 2DHDA 3GROA 1CV2A 1OILA 2O2GA 4QE3A 3G9ZA 2XMGA 4BE4A 1YSCA 5A7HA 4AX4A 5LZ2A 5FKJA 1AGYA 1AZWA 4WY5A 4Y2XA 4PO3X 3H2KA 2JF0A 4FFWA 2ZYHA 4B9EA 4PNZA 5C8XA 1R4ZA 4W9RA 1HDEA 3DKKA 4ZREA 5A6VA 2AJ8A 2Y6UA 3GA7A 4KAAA 4TVKA 2CUTA 1ZD2P 5ALSA 3HABA 2V98A 3V1KA 4B0OA 2HRQA 2FX5A 2WU4A 3MUNA 4AO6A 3ZWQA 2XUIA 3V1NA 3AUKA 4BP9A 4WDRA 3IUMA 4MEBA 2XMDA 4IHAA 5AOAA 5C8VA 5ALHA 3QMVA 1P0PA 1YAHA 1VLQA 1XZCA 3BJRA 4J0DA 1W1IA 2Z5GA 5SYMA 3DJYA 3ED1A 5D3ZA 2XUOA 1QONA 1SOMA 1XZIA 1IUOA 3FVTA 3C87A 1K6EA 2I78A 1HL7A 1VOTA 1G5FA 3WKDA 2OCKA 5J3JA 5K3FB 5ALJA 5JANA 4GWLA 3I6YA 5HQ3B 1ZICA 1ODCA 3DQZA 2X8BA 1LPOA 2ZVDA 5ALEA 1SCQA 3EQ8A 2OGZA 4AO8A 1XQYA 3DOHA 4JYMA 4O08A 2X76A 5AI9A 1CUWA 4CIBA 1DINA 4UHFA 4OSEA 4BTLA 4OUKX 5FP0A 1C7IA 3FWHA 1FFEA 1XKTA 3HEAA 5HFNA 4CIAA 2BUCA 2OCGA 1QTIA 5ALNA 3IULA 5AKXA 3EQ7A 4BCCA 4F5ZA 2Z8XA 1BU8A 3U0VA 1O6GA 1EVQA 3BDIA 3D2CA 4A16A 3R3ZA 3N2ZB 2GBIA 2QVBA 2JEYA 2HM7A 1XZAA 1DTEA 1MJ5A 2HA3A 1MAAA 1YR2A 2J3QA 3JWEA 4ZXFA 1MU0A 4OB8A 4AN1A 3WK7A 1W6RA 2R8BA 5EIAA 2XUQA 2V96A 5AKLA 5T4BA 2XQKA 4OB6A 1CQWA 5AM1A 3SK0A 3V48A 4X6YA 4V2IA 4G5XA 3WI7A 4ZV7A 3STXA 3DDUA 1E5TA 4BRSA 4DNFA 2BGNA 5IVDA 3AZPA 1EA5A 1T2NA 4U2GA 4B0PA 5CH3A 2C7BA 1H2XA 3AIOA 1LBTA 4I3FA 5LLSA 1UKCA 1D07A 2BJHA 2GZRA 4RE6A 5K3CA 1R50A 1W76A 5ALRA 2IITA 2XUAA 2XUPA 5AP9A 1JMYA 1XRNA 1XRRA 5DNWA 1UK7A 2QJWA 1MX5A 5JZ9A 1GQRA 4GI1A 3QMWA 3QYJA 5JIBA 4DTCA 5FOQA 4I19A 3G9UA 5JD6A 4HRXA 5ALVA 4BTVA 4ARBA 5HFAA 3BIXA 2WTNA 5K3DA 3VVMA 3GFFA 1EVEA 2WKWA 5AI5A 2I3ZA 3IBTA 2RAUA 4JUIA 1ACLA 1XRQA 4YX9A 2HA7A 3PUHA 4S0XA 3O95A 4DSZA 3EQ9A 5ALPA 4GLBA 3LP5A 2WFLB 2XQIA 1E66A 4X91A 1DX4A 5K3FA 2WIFA 1XZBA 4NVRA 2WUEA 5CT8A 5BWCA 3R41A 4W1RA 1UKBA 3AZOA 1JKMA 4W1SA 3LIIA 4EHBA 3DL7A 1ZD4A 1MX9A 2UZ0A 1AC5A 4EUSA 2WUFA 5ALWA 4X3CA 2O2HA 4FHZA 3VJLA 4UFOA 3FLBA 2BKLA 2HA6A 2JGKA 3QPCA 3STVA 4EY5A 5KWIA 4ZWNA 4D9JA 1GPKA 3O4IA 4G8CA 4L72A 3A70A 3STYA 2C5FA 2PKYX 2RGUA 5LP1A 4QDUA 5EHZA 1R9MA 5BV7A 2X5XA 3P2MA 3HLKA 4HTAA 5I8PA 2R11A 3NUZA 1YASA 4QEKA 4FLFA 3AFIA 2E3JA 3WKBA 3W04A 4KACA 4DM7A 5JAPA 1PJAA 5E4JA 1GKLA 2HA0A 1MO2A 1Y37A 3W9UA 5KWJA 4MJ3A 3AINA 2WHPA 1BCRA 1R3DA 2RONA 4UPDA 1RWQA 5JAOA 2CEKA 2OXEA 4UHCA 1ZI9A 4G4IA 3CN7A 3PF9A 4IH1A 2HDWA 4K5QA 4WCVA 3PE6A 5CT6A 5FRDA 1QOZA 1N5RA 4JEIA 1FFCA 3AILA 2DFPA 1QIJA 2PSEA 4XVCA 4X90A 5C81A 5AIBA 5K3AA 5FXMA 4LIPD 1XZFA 5HF5A 3BIWA 1HPLA 6YASA 1UXOA 4H7KA 4JNCA 5JZBA 4UBKA 4ROTA 1XZKA 4CCYB 1EB8A 1T4MA 1P0QA 1ZJ5A 2HADA 3OURA 4P93A 1JU3A 4IO0A 2VJAA 3L1HA 3CN9A 3G0IA 4BBZA 1GXSA 1UK8A 3HYSA 3M81A 3JYHA 1DWPA 2OAGA 4GBGA 5AM5A 3PICA 1H2YA 3WL5A 4X6XA 2PBLA 5JYCA 3VISA 3TGLA 2WFLA 2WU3A 1EDEA 4X6UA 4L3WA 5LYYA 1EINA 3N0TA 3QM1A 3GZJA 4FWBA 5JAHA 3LIPA 3E3AA 2QUBA 3HACA 2CZQA 3C5VA 3BWXA 3I2GA 3WMRA 3SC2A 1Q0ZA 3R40A 4KE7A 4H7FA 2XMRA 1ODTC 1XZGA 2XUGA 4GEGA 3R3VA 1FFBA 3D7RA 4EY7A 3VJKA 4GW3A 2WUGA 1BROA 3G8YA 3OM8A 1UZAA 3C5WP 5JARA 5I9IA 4FBLA 2VQ6A 4QNNA 1UFOA 3PFBA 2J4FA 1P0MA 3QMMA 4GHWA 3T4UA 4C4XA 4K6HA 4BDTA 5E4TA 1TKRA 3F96A 2WG0A 3O0DA 4G9EA 1G66A 2JGLA 1THGA 5AI4A 1PFQA 5EI5A 2Y6VA 1S8OA 1J06A 3H1AA 5ALZA 4QDXA 5I7UA 2GBFA 5CW2A 1CPYA 4B84A 2D5LA 5AI6A 3BF8A 3BE8A 2DQZA 1KEZA 3FSGA 4K2AA 4Y2SA 1A8SA 5AICA 1ZIYA 1CUYA 2WJ3A 3KDAA 4ZV9A 4N5HX 2C4HA 5AO9A 3WKCA 3STWA 2QT9A 3WK4A 4BC0A 1GPLA 1ZGCA 2O2IA 1NX9A 3I2HA 3AJAA 1TCAA 4IH4A 4Y9SA 1WCYA 5AKZA 1A7UA 4J7AA 3C8HA 4X85A 3WKAA 1XQVA 4CCYA 1IMJA 1QIIA 2G5TA 1E8NA 2QTBA 3WJ2A 1QFSA 1IUPA 5LIPA 2HA5A 2WSLA 5AKYA 1QZ3A 2HFJA 4Y2RA 1XQXA 4AZ3A 2OGTA 1ZJ4A 4KJXA 4UBNA 4BAUA 1JI3A 1EXWA 2HL6A 5AK5A 2WIDA 2I03A 3WWCA 4C89A 4Q3KA 4FKBA 5C8ZA 2J4CA 4BRZA 2JGJA 3WKEA 4EB0A 1UT6A 2ZSIA 4TPKA 4HRYA 1F6WA 1YCDA 3MVEA 2QXTA 5EFZA 4X00A 4AMZA 2BUBA 4HAIA 4MQMA 4MYSA 1ORVA 1PV1A 5AK3A 5E2IA 5FDFA 5EIHA 4Y2UA 4IH9A 1XLUA 5AKKA 1BS9A 2YYSA 1ZI8A 1XZDA 2WG2A 2PUHA 1K8QA 1CUIA 4Q05A 3E0XA 1W4LA 2DHEA 4BVLA 1VE6A 1EB9A 3F9CA 4RNCA 3VVLA 3HSSA 4NZZA 2WIGA 4KE9A 2XQFA 4Q34A 4B82A 5FPPA 4FDMA 1SFRA 5A62A 4H7HA 2DR0A 3TRDA 1F8UA 2CJPA 4BVJA 1FFDA 1LPSA 1LZLA 5ALTA 1CUSA 3QITA 2AJCA 2QMQA 2WLSA 1CUDA 1G42A 2V9ZA 5A2GA 4U2CA 3R3UA 4IQ4A 5ALLA 4QWWA 1XZMA 2OGSA 1WHSA 2PVSA 3IIIA 1USWA 2W6CX 3L1JA 3H1BA 2WJ4A 4H7EA 1TCCA 4AB1A 3MUOA 2OQVA 2DQYA 4UBLA 1RYYA 2CMFA 3WIBA 3H18A 1QO9A 4G8BA 5T4FA 4G8DA 5ALFA 4JH0A 3C6ZA 3KD2A 4PF1A 4XIIA 1IVYA 3FBWA 3Q8WA 5LKRA 3HC7A 4A5SA 2HIHA 4MYDA 4OB7A 4C6HA 4AN0A 4E11A 4M0FA 4UBJA 4OD0A 3IDAA 4ITVA 3IUQA 4WDQA 2B4KA 1K4YA 5ALGA 2BGRA 3STUA 3UUEA 3OTQA 4HVTA 4LXGA 2J3DA 1BRTA 3K6KA 4MXDA 1XZEA 2C0QA 3D2BA 4BCBA 5T4EA 2H7YA 1L7RA 2BFNA 3FLEA 1IZ8A 5BOVA 5JASA 3H2JA 2HHAA 3QBJA 2G63A 2W22A 5JALA 1EX9A 3OOSA 5KREA 4UUQA 4HXGA 1U65A 4AQDA 2Q0XA 1ETHA 1Y7HA 1VA5A 3WA6A 2XUKA 3WK5A 4AZ0A 2XUFA 1EI9A 1UOQA 4U2FA 2CBGA 1IUNA 5AKGA 4J0CA 1GKKA 4H7DA 3PFCA 4Q3LA 4LKOA 4UFPA 1DQZA 1AUOA 2RHTA 2AJDA 2XQJA 2ES4A 3M82A 3NWOA 2XUDA 2XQGA 3C43A 2VEOA 2XE4A 3QH4A 1CR6A 1A8UA 5HQ3A 3WYNA 1FJ2A 4AO7A 1DWQA 5IKXA 4DNQA 4NS4A 1XQWA 3B5EA 2JGIA 5JZSA 5FV4A 4QDTA 2QRUA 1H2WA 2ZYRA 4MWSA 4XX1A 4FFVA 1LPMA 2JGFA 4PV7A 4LXIA 4OPMA 2OG1A 1VXOA 1C7JA 5CT4A 2JEZA 3QPDA 1WOMA 4RE5A 4E15A 5AM4A 2C5GA 2VF2A 3S8YA 3WWOA 1E8MA 3VJMA 2BAGA 1MTZA 5JADA 4U2EA 3ICWA 3C70A 5IVKA 5DTJA 5ALKA 2PPLA 4OU4A 5ALOA 1W75A 2ZYIA 1XRLA 4J0HA 2QUAA 4CI9A 3W06A 3I6MA 1JFRA 4HZGA 1ZIXA 2XMBA 2O7VA 3RLIA 4UBMA 3EBLA 4Z49A 2HRRA 3DLTA 3WZMA 2AJLI 4J03A 1N5MA 5CXXA 5K3BA 4FLMA 5A71A 4DNOA 2RHWA 1AMNA 3C6XA 4G4JA 4DIUA 2K2QB 3DYVA 1CUJA 3ICVA 3ESDA 3AZQA 4Q1VA 1G4HA 1DQYA 4H18A 2GBGA 3CXUA 1MX1A 3BL8A 5LZ7A 4X94A 1KU0A 4K6KA 3FAKA 4JYPA 1QO7A 1LPAB 1F0NA 3A2NA 2XLBA 5CH5A 4NMWA 3A6ZA 1EHYA 2FJ0A 4DSAA 1AURA 4FLEA 3FVRA 2PU5A 5LZ8A 4BC1A 4G1FA 2OPHA 5AOCA 5AKHA 1FSSA 4AXBA 1MPXA 4E46A 4WJLA 4HXEB 3IUNA 2QR5A 1DT3A 4CFSA 1JJFA 2GZSA 4PSDA 3M83A 4C87A 2HA2A 1EK1A 1L7QA 1M33A 3AIKA 4B80A 1XZLA 2WIKA 3OG9A 3HI4A 1TRHA 1VXRA 1LLFA 3RKSA 1VA4A 1VZ2A 1CVLA 5AJHA 5AI8A 1CUBA 1EDBA 3DL4A 1HQDA 2PUJA 3D5EA 5DYYA 1KU6A 2WFZA 4XWGA 1CUHA 2PSHA 1TQHA 3PI6A 2ONCA 2OQIA 3BDVA 5LZ9A 4C4ZA 1EDDA 4BZZA 3G9XA 4C88A 1LBSA 4FTWA 4BDSA 2PSDA 3BJMA 1R1DA 4N8EA 2H1IA 2VJDA 4Q3OA 1TK3A 4H0CA 1E3QA 3OPMA 2GBCA 3I1IA 1BCSA 1UK9A 4KEAA 1CUGA 1B6GA 5ALXA 5FUMA 3PF8A 1EH5A 4U2BA 5AKEA 4XJVA 1DWOA 1BN6A 1H2ZA 1LPPA 4EY8A 1UKAA 4X93A 3WL7A 3LCRA 2FUKA 3DNMA 4ZRDA 3WJ1A 3B12A 4P08A 5ALYA 1CUCA 3WK6A 4OYLA 2Y2UA 3D3NA 5ALUA 2PM8A 2Z3ZA 1AX9A 4C4YA 1U4NA 5CRIA 3I2IA 2H7XA 3TEJA 3YASA 1X70A 1WB6A 4WFKA 4QWMA 4J3JA 4BE9A 3V1MA 4DNPA 4KE6A 1QIEA 1CQZA 3QPAA 4CG1A 4ZI5A 3I2KA 1ZOIA 3HJUA 3O9VA 2QM0A 2ZJFA 4G9GA 1SCIA 1JU4A 5HF8A 2XUHA 3H04A 2WHQA 4QDOA 1QIHA 3WZLA 4RPCA 1QJ4A 2RIPA 2BCEA 3VKFA
chains in the Genus database with same CATH superfamily
1T13A 4OF4A 4WACA 4WFIA 4CETA 4R1NA 1EP1B 3FWNA 1PR0A 2C57A 2ID8A 3K16A 2JGAA 3C8DA 1U9IA 5CG1A 8ABPA 3W5CA 3VNUA 1SB8A 1A77A 2XECA 4HZUB 3FLAA 5ERXA 2M6LA 2ODPA 4PW0A 1LLQA 4ALKA 3GJ8A 4LOLA 2W93A 2ZJ7A 5IWCA 4ZYXA 3FHOA 4QYWA 3UQYS 2O7QA 3T38A 1JE0A 1Z3IX 2H17A 1IG0A 1OHHD 1HTWA 1SBYA 2A9RA 4F0JA 5EZQA 4ZMSA 4KXQA 3L5KA 1QKJA 2NYVA 4RM3A 5EXEA 5MN4A 3Q10A 3ANTA 1HNWB 4FBMA 1PGJA 1RAFA 1E61A 2FFAA 1TYZA 2HRZA 4H35A 4W7HA 4R2JA 5FQNA 4Y2QA 1M34A 2JEOA 1P62B 2ORYA 5T4HA 4JKOA 1ESNA 2X9VA 2JIPA 2NU7A 4Q48A 3UMMA 2FJPA 3U1TA 3VPFA 2I6SA 2HQ1A 3IVXA 4B47A 5LWQA 3FBTA 3HWX1 4BVKA 1F2DA 2Z9BA 4MEAA 1J2JA 1YRWA 3V34A 4JLWA 4KNYA 1ZK0A 3RHTA 4G0QA 2NV2B 4BCDA 2OHJA 1WUIS 4KDEA 2B5OA 1P6XA 1K8ZB 1SBNE 2COUA 2IEDA 3TW8A 4RLSA 2O8EB 4M38A 5JD5A 2OQ2A 3C6BA 1QE3A 4C0BA 4CLRA 1L4MA 3C4VA 2VATA 3NBFA 1YJCA 4ZODA 4BXOA 3NGMA 3ZGVA 1XYVA 2QN1A 5KBYA 1ABEA 5CH8A 3DDOA 3Q8LA 1L4HA 4M89A 1P4AA 4HVAA 4ZTUB 3BH6A 3GNLA 3PC6A 5AJWA 2FPIB 2CHVA 4NENB 2XXBA 3PC8C 2WVJA 5TX7A 3FDFA 4IIBA 3MRSA 3GGJA 1V8FA 3OBBA 3LZDA 2CB9A 1Q84A 3IHWA 4KPUA 4WRRA 1MOZA 1Z0SA 3CO5A 3H1FA 4HQNA 1CJKC 4YGYA 5E1MA 5DZSA 3R5TA 5HIMA 1NFRA 2I2FA 3LRXA 4NZYA 5DKFA 3VDXA 2CLLB 1R5JA 1E9AA 1T0UA 3O4RA 4JQSA 3SR3A 2ZRGA 3I1YA 5L95A 1KZYC 4DV6B 3MWDA 4F1JA 4RY0A 1CHNA 3DR5A 3QNUA 2B7BA 5KC9A 4IP0A 1U7XA 5C7OO 4RTQA 1DB3A 1XQ9A 1G6Q1 1KJJA 3HGTA 3SHOA 1O87A 1Z2PX 1PJTA 2OO5C 4BUZA 2OAP1 1ST3A 1CLEA 3KJFA 2WZDA 3O94A 3EB9A 3OZGA 3TDMA 4ZJPA 3E22B 3ND6A 3V2IA 3W2TA 2ZDGA 4CMIB 2JA2A 2EYQA 2HFKA 3UMFA 4L8FA 4P2GA 5FPSA 1H93A 3T9EA 4BX3A 1MP0A 1PGPA 1L8AA 3GLQA 1PU2A 4R83A 4U6QA 1S2DA 1C4XA 5KNCA 3DNPA 1MN6A 4YJGB 1XRMA 3I1FA 2PMCA 3LCUA 3OIFA 1ACMA 4BWVA 3HCFA 1ZUHA 3I6IA 3VO9A 2ZS9A 1CQJB 3A25A 3ZLBA 1XMSA 2QMHA 2IYZA 4NJEB 5I7VA 4AJ2A 3LCMA 3OH8A 2QQ5A 4MP8A 4WI1A 1Z5OA 4YGXB 5EWJB 2E5LB 4OMDA 4DEXA 2PO7A 1WCXA 5BVHA 1CZKA 4FOLA 4OAQA 1ZGAA 4Y1RA 1ISPA 2C0PA 5FOWA 3CT4A 3MGKA 2NZJA 4MW6A 1PO7A 3HDJA 3DE4X 4P92A 1GOTA 2X7HA 3C4QA 3VKVA 4EW6A 3HQ4O 1MQ9A 3FUWA 5DOVA 5TQ2A 4B6PA 4E1BA 4YPVA 4B85A 1C8KA 1FQWA 2G9NA 5JNUA 3GG9A 3M6IA 3GRYA 4L1KA 1H2BA 3CEHA 1R5NA 3OZFA 4LYDA 3URMA 3WVNA 1E3WB 1M75A 2JBWA 3CZPA 1VI2A 4Q9IA 4K2HA 2QBYA 1A88A 1H4SA 4AIIA 5FYDA 1GPNA 1RFLA 1WW3A 2ETVA 3NV7A 3LAWA 2OFOA 3LX6A 4LXHA 4IQGA 2W37A 1KMHA 2OG2A 4POOA 3F6BX 5AHXA 5A1JA 4F92B 1O57A 2R85A 3LPDA 3A1SA 1PI3A 4G5QA 3QOXA 1WXHA 3AR3A 4LG1A 1EZ4A 1HH4A 1L5NA 4Y2PA 2C2YA 4PRYA 4WBSA 5CM9C 3UV7A 1GY8A 5CGZA 4J0GA 1LI4A 4F5DA 5HKBA 3CF2A 1NSTA 1ZVQA 1IHUA 4HPXB 5DJ5A 3UPUA 2IUTA 4KLZA 3K5WA 4EHHA 5TJ9A 1UBUS 3QEOA 3JQDA 3BA6A 1KEVA 1MRZA 1RWWA 4QDZA 4D9GA 5CB4F 2NU6A 4X24A 2OLEA 3U80A 1YCFA 4QQNA 1IXRC 1L1EA 4R1OA 4BBJA 1SCUA 4ZAXA 2HMTA 3B36A 3GP8A 1KP3A 1NBIA 4RL4A 2B3TA 2DCMA 3LT0A 4H7IA 4G1VA 3QBTA 4KWEA 5CEFA 4I4TB 3NHFA 1SBHA 3LYAA 3UMRA 4B3BA 2O8BB 3JVUA 4JGGA 1VYTA 4F56A 1QUFA 4DUGA 4IR7A 3PHGA 1XCPA 2HIMA 4OHKA 1OFGA 4GUAA 4O29A 3RYFA 3IOYA 3WGLA 6LDHA 1R6BX 4KN5A 5FBZA 3A2KA 4BLRA 5JI3E 1PWEA 4MVJD 4DLLA 1PFGA 1KJ8A 2JJYA 3WV4A 3TECE 5F3WB 3Q0TA 4D6PA 2QW0X 1FIUA 4ZU1X 1IHPA 2LCIA 2YIJA 1E0KA 1YT5A 4JDUA 1LGYA 3FNBA 3ZNNA 8LDHA 4IFIA 1XFDA 3HXKA 2XVZA 4QSHA 4X8OA 4BBPA 1USVA 1FXWA 3H2GA 1JSZA 3HL0A 3GHHA 4MHOA 3JATB 3M1IA 4QASA 4E33A 3ANNA 4WZBA 3QY0A 5KVQA 3UJBA 3E4DA 2D5BA 5IMBA 3PV0A 5KOHB 4BZWA 2B25A 1U8EA 1VPLA 1Z0KA 2X4GA 1RBMA 1YQTA 3H4TA 4GXRA 2A86A 3NT5A 1JHRA 1KETA 1MNAA 4CJXA 3MCTA 4I8DA 4X1KB 5REQA 3B6ZA 1J9GA 3L8CA 1SCNE 1FEZA 2OE2A 2NGRA 2Z1DA 3GZ4A 3B6MA 2PCJA 5CXQA 2QS9A 3H75A 3J7TA 3PLNA 4TM7A 1GARA 4C4SA 3OKFA 3UMJA 4K0RA 3KXDA 3H4MA 1QZUA 5KJ1A 1KERA 1E1CB 2ZREA 3NRCA 2VYNA 2CEAA 1XA4A 2H2GA 3BD7A 4JI8B 4TLMB 4KQJA 3DVAA 3SI7A 2J09A 1JNXX 4GZ3A 1V5WA 3VJRA 2GFHA 1Z08A 4Q3NA 1N32B 1ZIPA 2CHGA 5IS2A 5IH7A 4FDLA 2QG4A 2IYWA 1YB7A 1GSAA 2P65A 2A7QA 2QDKA 3ZU2A 1TGVA 3EOAI 1G4UR 4AN1A 2WHPB 2FWRA 2ODWA 4O4HA 2ZATA 4DZZA 2R6HA 3CRMA 4JB3A 4EHNA 2DGDA 2ZRFA 2NIPA 4NU8X 4HUQB 2GAJA 4L95C 3ONDA 4DZRA 5JXWA 3TX6A 4JUAA 5FTJA 3LBFA 3ZI4A 4MWTA 4RMHA 1IY8A 2TMDA 4WA8A 3A1CA 4UHDA 4RVHA 5E9JA 3ICQB 1SUSA 2AE2A 1KZ9A 4LQ4A 3U3ZA 3NM6B 5AKJA 1M10A 3KXLA 1BYIA 3G1TA 4I1PA 2YIVX 4RVFA 4US0R 5DDIP 2GK7A 4MUBA 1WMBA 1FP1D 3QF7A 4RHUA 2RCYA 2NSLA 3PRHA 3A9VA 4MRMB 1PD0A 1XB2A 2XWBF 2FF5A 3LECA 4MV3A 4TKVA 3OCJA 3A3NA 1Q1EA 1V5EA 4YPOA 1X1AA 3P20A 4TZKA 4RQAA 1T6YA 9ATCA 1RJFA 2TMYA 2EJTA 1QNFA 2Z5VA 3ZIAA 4YT4A 3B6IA 4KR7A 1GFWA 2W2XA 3DAHA 1ORHA 2AN1A 3U3JA 1LC3A 4B48A 4FCTA 5EJMA 5IN5A 3WISA 2RGNA 1DGQA 4D4GA 4IAOA 4EG1A 4BLPA 1K6XA 4ZK6A 4TVBA 4C01A 2V3WA 1HE3A 1QANA 2XOXA 3R7NA 1RJEA 4YB8A 4YASA 3WADA 3ZW8A 1JDNA 4C0WA 1WRBA 2GAFA 1I6WA 2P3SA 3E70C 2C7RA 5E9AA 1LPNA 3L7YA 2ZQYA 3LXUX 4OBBA 3G7NA 1NBWB 2CMGA 1NQOA 2ZCVA 4G5GA 2W0SA 4L16A 3RANA 1C1HA 3E9CA 4UHHA 2AG5A 2WMDA 3NATA 3WLLA 5I9BA 4EZIA 3IPYA 5AUPB 4BMOB 4YY3B 1O03A 5LCXA 2ZE5A 3FRJA 3BD8A 4TXJA 1EAMA 1W581 1YUMA 3EHDA 3EZGA 1I5OA 2FW6A 4WE3A 1KDTA 5JD4A 1IC6A 3ZEAA 5B6PA 3B1VA 2IP2A 1Y0BA 3CUUA 4Q7MB 3WQRA 2OKGA 4IHQA 1FYXA 3KT8A 1IFXA 1WB5A 1IG3A 2ZIFA 2WDPA 1DIAA 1QHHB 3IVAA 4RGBA 1I51A 4KR0A 4Q3AA 1TAGA 5C31A 4LQLA 3W77A 4Z3OA 2B61A 1L5RA 4KFCA 1Z33A 4LJSA 4P0QB 1RZRD 3FFTA 4JBLA 4MI3A 4YAIA 3BAZA 1YUNA 2KSQA 3DBLB 3LY8A 4MJLA 1KJZA 4MPTA 4UATA 2OA0A 1G8HA 2BHLA 3KS9A 1ZK1A 1AV6A 1U8XX 4JROA 2Q3MA 4LCJA 1CBUA 1K63A 3ILSA 2IPAB 2RG7A 1OA0A 2ZUWA 3OTIA 3DTVB 3ETGA 1ZPDA 1ISJA 1PT8A 4KSYA 3QA9A 4AYWA 1QG0A 2HEIA 4NLLA 1DEAA 1NF9A 4F60A 2Q2VA 1Y6GA 4ZEMA 1G21A 2W8BB 4HAWA 3X2SA 4NPCA 5FUXA 4CG2A 2FCRA 2QX6A 3IB3A 3AVQA 4B4OA 4C22A 4D82A 4ALLA 5LQKA 1NOIA 2AOTB 2VDVE 3EZYA 1DIHA 4Z4GA 4K46A 1L3BA 3B1WA 4NBLA 1EAYA 1AMUA 3ROXA 3M0EA 2VYFA 1E2KA 3FKSA 2YXLA 3A6KA 3LC1O 3NRJA 4PNHA 4DREA 3D4OA 3MUEA 5IHPA 1TUBB 4QLAA 1XCGB 5J58A 3PX7A 1J2EA 4LC0A 3W8RA 4NE9A 3SMQA 4HUJA 4NRDA 4ZTZB 4JITA 4CLEA 3HCOA 1EWKA 3DDCA 2EXXA 3LBAA 3V1YA 3SS8A 1AKNA 3A2MA 4AG5A 3ZG6A 4LOHA 1QGAA 3H0CA 4QX6A 1IM8A 4PGHA 5E6UA 3BQ9A 4X92A 3Q9UA 3GC6A 2P9ZA 1TEVA 2VSXA 3U40A 4EY4A 1H4QA 1Z22A 3VHQA 4DEVA 2DUMA 1NLMA 1XMQB 4Y7DA 3IKMB 1B74A 4PYMA 3I83A 3TE7A 4HG2A 5A02A 1IE3A 3E8XA 1CU1A 5LKAA 1VL0A 4C30A 3KKEA 3DOJA 4UVGA 5EKSA 2NU8A 3LLVA 5GINE 5ES4B 4R1SA 1SXJD 2RKOA 1E9SA 1D1SA 1Q0UA 2NAFA 4QUEA 3OETA 1QLWA 4EJFA 3EC7A 3ICPA 2IZ5A 4ND1A 1D09A 2HUNA 4MMYB 3DAFA 3IR7A 4QUJA 4F5EA 1VIMA 1SCAA 4BGEA 2OSBA 1F14A 1DJOA 1FTWA 3FLMA 3K9HA 4LY6A 4KWTA 4LSZA 3RUIA 2QTHA 4D92A 4KFUA 4J1TA 3U4MA 5FT9A 3O8QA 3BCRA 1XROA 1M7BA 2P2YA 2XCTB 4PGAA 5TE9A 4JJ6A 4ECAA 3BSWA 4OQDA 1E6CA 3N2GA 5JPIA 2XY4A 1CRLA 2I99A 2Q28A 4MCAA 1QYCA 1KJYA 1H1TA 4PIPA 5DGIA 3QU7A 3L92A 2BW0A 1N2XA 1JEDA 3TRFA 1V2HE 2I3GA 1XLVA 1EUCB 3QXJA 4LJKA 5CURA 3NPAA 4I50A 4OQLA 2VT6A 1CNFA 5ALMA 3ZZ0A 1FMTA 3B5JA 4Q3BA 4Q6BA 16PKA 4MV0A 3SVLA 5HF6A 3EZNA 2PLNA 1I30A 1Z68A 3PXAA 5EHXA 2HBQA 5IVHA 3FSEA 1RQPA 1LSOA 5JATA 5D3MB 4JEMA 3QJYA 3NANA 2RIRA 1RS0A 2G4LA 1SEPA 4UHBA 1DAOA 4RD3A 3NONA 1RXSA 4HGRA 1M0EA 1YVDA 3HUDA 1X8LA 1SHZA 1ZVJA 4JUDX 4U2DA 2CSXA 3COSA 3DEYX 1V8OA 4OX9Y 2NZUG 1MA3A 2XEDA 3O8CA 3RVSA 1Y9DA 1L3IA 2D0OB 2Q5LA 3G0BA 4FMPA 4XUGB 3OE1A 4OKSA 5F2OA 4KQGA 2VJPA 4JX8A 1FW8A 6REQB 3FCUB 2V0CA 1SIUA 3ANLA 1BDIA 3CCFA 1J4AA 3PGLA 5AJZA 5HK8A 1D7AA 2RI6A 3I2JA 3EXHA 2VUSA 1AK1A 1ADJA 1U81A 1HNNA 2PAFA 2WT4A 2AW5A 3AM4A 2BFDB 5ENVA 2JBHA 1VLZA 1BEEA 2G83A 4RO0A 4GECA 2BGTA 3EAGA 3NOQA 4PYLA 3SF0A 1ZU5A 1JF8A 2OZLA 4TGLA 4P9NA 4FFBA 2ID9A 4G0PA 4M49A 3IQHX 4HDQB 2JHPA 3ZWOA 4KFTA 4EGFA 4WT7A 5BP7A 1W44A 3CR3C 3D8TA 3LT1A 3OAAD 4DMFA 5A4AA 1BOFA 1L5SA 2Z3WA 4HH3C 4LYHA 5DYWA 1PQWA 3W2GA 1K5HA 3PJFA 4CPDA 3CVOA 1S89A 1BZYA 4UMDA 5AK4A 3VZDA 4EAAA 1U1IA 4EYSA 2WM9B 4MIYA 4JJKA 3MWYW 1M1YA 2P69A 3GPIA 5CR9A 1D9ZA 2V74B 3FA2A 2CD9A 1SCKA 1F2UB 3RBAA 3T3DA 1WEKA 3WIEA 4TZ0A 3IPXA 5AFSA 1ZI6A 2C97A 3GGDA 3KWFA 1ZC3A 2MINA 3NDRA 6NULA 1QP4A 4K8RB 4PSVA 3DBHA 2CDCA 1Q3TA 1NBMD 3F2IA 3W9SA 1NVMB 1VPDA 5EQFA 3WBBA 4OHYA 3ZV4A 5IZCA 2Q3HA 3VTFA 2W2PA 3MC1A 3WWEA 3I34X 3MJCA 4PPQA 3TL6A 3PA6A 3ZE6A 5DM70 4MW1A 4AUKA 3KSZO 5L40A 3HXMA 1HFJA 1Q0TA 4LF6B 2HQOA 1QZZA 1C0KA 5E2AA 3PXCX 2J6CA 2WFMA 1R88A 4CHGA 1XKLA 3BWBA 1YDFA 3I72A 4HH1A 5AUQA 3VAAA 5ARBA 1NV8A 2PZBA 3BE6A 1SMKA 1O7JA 1UFRA 1YB5A 3ES9A 1XQ6A 3QVJA 4RKWA 4Y2YA 3IEIA 5G0UA 3WLAA 3WSTA 1ZGBA 4M99A 3AIMA 4LRTB 3ZIUA 1U0RA 4WCDA 1YA6A 4K9QA 1EJBA 5DNAA 3Q3EA 2HXGA 4R01A 3LUPA 1K92A 1NC1A 1I6KA 4LBVA 4C06A 4I8IA 2Z6VA 4MWOA 4LVOA 5F2EA 1SVWA 2DH6A 1DPFA 2VJKA 2Y99A 3UANA 3WWDA 3GRZA 2ZJ2A 3BIFA 1IWOA 3K15A 4P1ZA 1J1IA 4R9NA 2XH8A 4O0MA 3J81A 2ZZKA 7REQB 4YMLA 1G0OA 2GPWA 2AC2A 3HSKA 5DH9A 1TMYA 1YOVB 4FGZA 3MMXA 4C6SA 5JLJA 3BOSA 2WP0A 3KV1A 5G41A 3VR3A 4ZJYA 1Z56C 1GT91 3UATA 3EEQA 1RE1A 3LC2O 4NEQA 1DKRA 1JZTA 1KMNA 1UPAA 2FMFA 1OFTA 4RXUA 4UKDA 3BK1A 1WXIA 1BHSA 1Z62A 1XX6A 4PYOA 4NCAA 3H1EA 1CFZA 4OI4A 4JBXA 3U7IA 5LYJB 1GITA 4FGUA 1CY2A 4DRZA 4NEGA 2VT2A 3AEXA 4ZYYA 1GV0A 1UF9A 2H1FA 2BEUB 5LB4A 2HCTA 3AWIA 3V7NA 5EZ5A 3WB9A 1VSQA 1Y7LA 4PZPA 3TM4A 2HU7A 1KARA 3G3EA 3V55A 1C3VA 4EHKA 2NO9A 4CKWA 4RKYA 4ZEXA 2J46A 4BGIA 4DKJA 2VA9A 2GTPA 4EHIA 3D43A 3M4YA 4I6JA 3A9SA 2DHRA 1KDOA 5JC8A 4DTIA 4HQOA 2FN4A 1VJ5A 3IIMA 5EPOA 3UJHA 1N8SA 3EJWA 4NU5A 4CF6A 3PDIB 9GPBA 4ETIA 4F6CA 3P9IA 5CTAA 5DGXA 3CLHA 2VJNA 2PKEA 3PPIA 4LE0A 1PSWA 1QFMA 3QOWA 2AJBA 4H60A 4BNGA 3TLJA 1TD1A 1N6HA 3REQB 5EVJA 3FYUA 2JK0A 1IATA 1OLUA 2EFCB 1J8YF 1RAHA 2Z43A 3G0GA 5TF0A 3U39A 4A82A 5J4YA 3L4BC 3V8PA 1KS9A 1NRJB 1UJ6A 2ROQA 3OM0A 3BGIA 2F62A 4JASB 4JJ4A 3MRVA 3LC0A 5FTLA 1WVGA 4IFBA 4XEHA 4OSOA 2PG3A 1IBMB 4YRGA 1EMDA 2C94A 3LX5A 4WECA 1JIQA 4LDRA 4WZZA 1PW7A 3DMHA 3TL3A 1UH5A 3WY9A 2ORED 2GCNA 4DQLA 5DEOA 2D8AA 3OICA 1Y63A 3DOIA 3CR7A 1PLKA 1WCWA 3EQZA 1IXSB 5A7FA 5IHXA 4EG7A 4S1PA 2QPAA 2C1ZA 4LOKA 1QX4A 4EUEA 3JQ9C 1DUSA 3T6KA 3AF3A 1ESZA 1ZEMA 2B8JA 2QZPA 3DAGA 3A26A 4XGQA 3QA3E 1RKBA 4NARA 5NULA 4ENWA 3E35A 5A7GA 2HU8A 3THRA 4EGAA 3JQBC 3N76A 4K9PA 4L4RA 3RC2A 4QC2A 2I9KA 1M6YA 1W34A 1YC5A 5TC4A 2CVFA 2GXAA 1OXUA 3GCZA 5HK9A 4C3VA 2ZIZA 5AR1A 1WLYA 1B76A 1JPVA 1RM4A 1VFPA 2XI4A 1R74A 3HY6A 4PTZA 4X95A 1I01A 1WW2A 3DAYA 3WL6A 2J6HA 2Y0DA 2C61A 2G3YA 2NACA 4P5DA 4QGBA 1NVBA 2GCIA 4CEIA 2R2AA 4Y0AA 1RABA 3WLEA 1K7YA 2OCDA 3KP1A 3W34A 2Q45A 3AB7A 4RTNA 1W0KA 3GEBA 5EPEA 4RMIA 4MI1A 4IINA 4EITA 5EJ9A 4D26A 4EJMA 5BSWA 1EBFA 2VF4X 3OBIA 4Q66C 5L7TA 1DT5A 2WYVA 2HA4A 3CUTA 2Y0CA 2H65A 4HYTA 3NIFB 2BP7B 4X44A 5DBEX 1A1VA 1H23A 4AZSA 1TO2E 1H69A 2F1KA 4LWZA 4QGAA 3QNMA 1HYQA 4R2XA 4E12A 4HDRB 4XFDA 4Y6OA 1V5IA 1FFWA 3ILHA 2IEIA 2QMZA 3QXCA 4RY8A 1E4YA 2OXCA 2GETA 2H0RA 4ZYUA 2XT0A 5SZHB 1DKLA 2CK3A 3EG9B 1KK3A 1WZCA 3FYTA 5B57C 1QV6A 2P9CA 3EYAA 2IF2A 4QOIA 1MAUA 1DU4A 3L1IA 4B3HA 4P5EA 2BVNA 1QHGA 4YALA 4HAXA 3DCJA 4YUXA 2Q1SA 2ZZMA 5DK4A 2HK7A 2DHDA 3ASUA 3GROA 4MRRA 3NW9A 1JG4A 1TIKA 4IXNA 2O2GA 4OX9B 4OQMA 4C0LA 5I8WA 1H1DA 4Q3DA 3F0TA 3WZ2A 4PVDA 3A9WA 4EECA 4OM7A 3UHPA 1C7FA 1W88A 1Y7TA 2NUTB 2X58A 2ZIAA 1MIHA 4II7A 3X1XA 3MTAA 1DXQA 4NV3A 5K4HA 3W3AD 1W1WA 2D1RA 1AGYA 4UAUA 4Y2XA 1S2NA 4MINA 5BSGA 2ZYHA 3PXBA 1YR7A 1OFVA 1UKVY 2YC2C 5JCJD 4URFA 1BHO1 2BMAA 4H31A 1R4ZA 3GA0A 1ZXXA 3DKKA 3U13A 2SKDA 4KO3S 3H2BA 1EWQA 4IY1A 1N8KA 4UZEA 4KVZA 3KQLA 1MJNA 2L2QA 2W4MA 5A6VA 1NR7A 5B64A 3AOGA 4IJUA 1MUUA 1P17A 1Q11A 4KAAA 4TVKA 2HSEA 5IASA 1Y80A 3VC1A 4FMDB 2WTUA 3KNZA 1GN8A 5AW4A 5ALSA 1C0IA 5ED4A 1JIXA 3RT7A 4RTJA 1H42A 4R05A 4TYWA 2V98A 1JECA 2FMIA 4WXRA 2HRQA 1PDWA 3MUNA 2C5SA 4K9DA 5F4BA 4Z0HO 2O19A 3X2EA 1K1EA 1LWNA 4HR7A 3V1NA 3S1SA 4RVOA 4Z9AA 3BH0A 3I6BA 1S7CA 3OZXA 1I24A 4TTSA 4UNNA 3FBGA 2RGGA 3AP1A 3I9V6 2VHXA 3KQKA 4A8TA 2FW9A 4IHAA 5DI3B 3L8FA 1ZM4A 2AR9A 4RJ2A 4ZGWA 4JLPA 5DHSA 2RBGA 3I5AA 4V1CB 1L4BA 1P0PA 1YAHA 2GNOA 1G3UA 4L5YA 4KTTE 1NF3A 4LK2A 4WVFA 5T5QA 1I4DD 4GP9A 5HNKA 1KSHA 1AUXA 2OL4A 2Z5GA 3ORRA 1AHHA 4PX9A 1ATIA 2JASA 5FLXA 4A6PA 3ED1A 1T2CA 5D3ZA 1E2LA 5JQGB 4NJMA 5ICGA 2FEMA 2Q5EA 1NE2A 4K40A 1IUOA 3FZYA 3TQCA 5FOTA 3K1TA 3DEKA 2YOHA 2GI4A 4D9IA 4GZLA 5J4HA 1K6EA 1M66A 4XVQA 2I78A 1JEQA 2JAHA 1WAMA 2VHCA 2KMLA 2BY4A 5DHPA 2V4MA 2PS0A 3WLQA 2CXNA 2VLBA 1S8NA 5J3JA 3S2YA 3C41J 3HNOA 2E5FA 2J59A 3LCJA 1E94E 4GWLA 2FQQA 3MTDA 1N5JA 3E03A 2K7FA 2J3JA 4ITRC 4DDMA 1NN1A 5K8JB 2X8BA 1FLNA 4DCCA 3QUQA 4OXNA 5ALEA 4CM9A 3HKEA 2C5EA 1DQNA 3ELYA 3OPYI 1SCQA 1G6HA 1U1FA 2D5IA 2OGZA 2V7GA 2Z57A 3N8GA 4RC9A 1NJSA 2E4VA 3CPSA 5G4KB 4B31A 1WP9A 1RKUA 4BX2A 4JYMA 2YMMA 3OZVA 3PHLA 5EE5B 5AI9A 1XKXA 3ADBA 2AG1A 2PGLA 2VPQA 4LYYA 1JKJB 1Y9ZA 2A9FA 1N5OX 3HFRA 4UHFA 3G5TA 3WBJA 3G5UA 4OSEA 4RJJA 2AL7A 3KYCA 4A6DA 3T5AA 1KSFX 2FSHA 3IQIX 3O8RA 1KTIA 3INNA 4FBGA 4HLDA 4HVCA 1UJ2A 1A2QA 1U11A 2VDQB 3CRNA 4WOBA 2ECPA 5JBIA 3DP7A 3HEAA 4DN6A 2BUCA 4TTTS 1K8RA 1Z45A 2FCAA 3S70A 3TG8A 3L02A 4MVJG 1IXYA 4Z4IA 1AUQA 2VTDA 4PICA 1I7QB 4E1AA 5L6LB 1V16B 1O94A 2RGXA 4YI5A 4J76A 4OHVA 4I1YA 1THZA 3H9QA 4AIRA 4F5ZA 5FORA 3GK3A 3OX2A 1KVUA 1XD2A 2D5CA 2D13A 1K0UA 4JHXA 4QBTA 4X1IA 1SQ6A 3U0VA 1BXKA 5KNCD 2DPLA 1U02A 4V24A 4ZC1A 3LKVA 1AZLA 1C7RA 1V1MA 2H08A 2Q62A 3CZ5A 3D2CA 3R3ZA 2AZXA 1BX3A 2PUVA 1R4NB 1XN1A 2GBIA 2QVBA 5LC1A 4C7BA 1WXGA 2QTVA 1H5QA 3KKNA 3TD6A 4IV0A 1MJ5A 2EGGA 5EERA 1E4EB 2GM9A 5BQXA 2EP8A 1Z35A 3UKJA 3NC0C 5A4FS 1V9LA 1YCGA 5B2EA 1IH8A 2DUNA 1XDDA 1MAAA 4OQFA 1TU4A 4WOPA 4WNAA 2OV1A 3ONEA 1NVXQ 4C0KA 3IMFA 3K2EA 4IQ0A 4HOYA 3I3SR 4QXPA 3U5ZB 4GGMX 1W6RA 3QEKA 2OHXA 3A9UA 3JAKB 4WK0B 1K6IA 5B1EA 2FXVA 2VQ3A 4B6QA 5BR1A 4TUYB 5GTDA 4ERNA 3ZU6A 4X5OA 1Y3AA 1E6WA 2D0PB 4ZCSA 2XQKA 3DDHA 2LDXA 2KHZA 4R9RA 1XDZA 4CM8B 1GG5A 3QSGA 2L69A 1QGYA 1R9GA 2DTEA 4L6AA 4MR8B 5AM1A 3SK0A 4Z7NB 2GZMA 4Y0NA 2F1IA 4C07A 5CBPB 1QV7A 3BILA 3OF3A 4HGYA 4R1LA 2OV8A 2R7LA 4G5XA 1YACA 2CLCX 4EG0A 5IJ0B 3ZC3A 4ZV7A 3WAJA 1D6JA 4GLJA 2G28A 4O4LA 1O5OA 4EG6A 4FUTA 2FX3A 3LU1A 5HUHA 3WR5A 1N7IA 1RR6A 1L7PA 4KFRA 5ESDA 4RIIA 1X13A 2QROA 3D7KA 3OHSX 2CBXA 1RJDA 1SGWA 2BGNA 1T3ZA 4RSRA 5F76A 3RU2A 3ETHA 3UHFA 4DKXA 4HQRA 1UBKS 2Y1OA 1E7WA 4M7OA 4H4EA 3VH4A 3OKCA 2GBLA 1B0ZA 5HMMA 3NVAA 1GFZA 1R8SA 5EIBC 1CEQA 3MERA 2IHUA 5LQRA 1MQAA 4EVSA 1ZA1A 3OHMA 3AIOA 3KKZA 2F1RA 4P7FA 4CE6A 1KQ3A 3CZRA 3UXEA 2GZ2A 5IF3A 4CM4A 3CY6A 3L7KA 2E7ZA 3ZHCA 4U7PB 1Y8QA 2QN9A 3F5SA 4CBVA 4TV9B 4BPBA 3KLMX 3P71T 5E7MA 4D9NA 1YFLA 3FVQA 1ZH8A 4FYXA 4HLCA 1R50A 1YR3A 1ZEJA 4EA8A 5BR7A 1NIJA 2FRXA 2V8BA 3N2NA 4D8VA 3QTLA 4RY9A 4BX9A 2E1RA 3KEOA 2AQKA 2J6BA 1MRSA 3DV0A 2IV3A 1ENYA 4BRWA 5I48A 3BN3A 1SVKA 1V8BA 2C4NA 2G5GX 1FK8A 3ZDEA 4D9BA 4K28A 4P32A 2OR3A 3JYOA 3KB6A 3PQ5A 4WOJA 1Z5ZA 1XRRA 1FNCA 4JQYA 4L6IA 5DNWA 2ZRNA 2X0RA 1OWPA 2F3RA 3NBYC 5BYBA 3RJ5A 1O0SA 3V5NA 4M7WA 2BM1A 1V1RA 3ACBA 3GD5A 3IIKA 4BQIA 2CCGA 3TOCA 2C9BA 3PQ4A 4GI1A 1E2GA 3SBXA 4AECA 4L8GA 3H1TA 7MDHA 3QYJA 3U7QB 1DEHA 2OFFA 1V95A 4URYR 1Z6YA 5FOQA 3GBVA 1SOAA 5K8TA 1QK4A 2NWQA 2QRQA 3C3CA 1CDOA 1KRHA 2WSIA 3C7TA 3OFSA 4K6OA 3GRRA 4P22A 5JISA 4R1TA 4C4AA 3DZCA 3L6RA 2D1YA 1KY3A 3N0XA 1EHCA 3KUUA 2WTNA 3F7NA 3ROFA 3IFSA 2EERA 1LSJA 1P72A 2CCJA 4AC9A 2I3ZA 2RAUA 3H6KA 4JKYA 3RSLA 3VR6H 3K9FC 3OWXA 1L5OA 1PJ2A 1RHRA 3WLOA 4Q7EA 5JXHA 3SYNA 3COJA 3LOUA 2YWXA 1FP7A 3QKTA 1UOEA 3S2FA 3AH8A 4C0SA 1GLVA 1U7DA 4HQLA 4DSZA 5A0VA 2CKDA 1R64A 4Q9JA 1V6CA 4GD3Q 4JJAA 4EKDA 3KC2A 4DSUA 1OU4A 4EJSB 1VPTA 4TLDA 2YN2A 1XIVA 4F2HA 1IHYA 2XQIA 1N6RA 3OPXA 5KS2A 2H2HA 4CV3A 3B38A 3S5JA 4HN2A 3QVGB 4M22A 1ZD1A 1G2PA 2MYNA 3H11B 3WRXA 4WKPA 5CDYA 2BMVA 1M2OA 2VCYA 4KGZA 2O23A 5CT8A 4NZNA 4DIEA 3CS3A 1X7XA 1OAAA 2Q21A 2PKXA 3IEXA 4UTNA 1O6BA 2F3TA 3AZOA 4G5SA 4HTFB 1FZTA 1NPDA 2G7MC 1EEHA 1JHYA 3TCKA 4JODA 3ET4A 5TS2A 3BB1A 5FI0B 1KE2A 4W1SA 4EK9A 3GAFA 3BWDD 1JG2A 3UK7A 2O59A 2I4IA 3DL7A 3EXG2 3MOIA 3EGEA 1JJ7A 4HD8A 3SC3A 2J87A 2WUFA 4D3SA 1DI0A 2DEUA 4F3CA 4X3CA 3NVKI 4QM6A 1XF9A 2PJDA 4ZRNA 3CEJA 5FUQA 4L74A 1TO6A 4S3MA 1L4UA 3MWGA 4UFOA 2BKLA 1D2MA 1YNOA 3HYTA 3DW1X 2FEKA 3ZIAD 3K2BA 3G2PA 4TWAA 2VQEB 1TYDE 1XL0A 3ZH9B 4JVNA 4EBFA 4D9JA 3O4IA 1HE4A 4YPFA 5LXTB 4PX5A 4YYEA 3A70A 4H1UA 2B83A 2HWKA 2OCBA 4B6EA 1Y42X 4U7WA 3DNFA 3NUGA 1TAQA 3F5DA 2J5XA 3PHJA 5IN4A 2QU8A 1ZISA 2INGX 1VQ1A 4BFWA 4Q15A 1A82A 5JSZB 3Q6MA 2EBFX 5IDWA 3S7TA 3D8UA 5IT5A 3HLKA 4D0SA 1CYEA 1KBOA 4BNFA 2XA9A 5I8PA 1VKNA 5IKPA 3BFXA 5U4QA 4G6ZA 3MCWA 3K94A 2XRFA 2ZWPA 4DA8A 4BV8A 5SYAA 1BFDA 1RE0A 5F78A 5ED0A 2QVGA 1V4NA 4DWWA 4XGKA 2JJQA 5EUQB 1S7GA 2PRKA 2CXRA 3LQRA 3T7DA 2VO1A 2H1OA 2WNHA 4AY5A 2Q3FA 1XF1A 5E4JA 1RJ9A 1EFPB 1NXSA 1GKLA 3SIXA 1ZW1A 3TSWA 1Y37A 4LZPA 1BRMA 3CMCO 3L7MA 5BXQC 1DAKA 1WTCA 1NLUA 3L6UA 1NNEA 2YL2A 1M6HA 1QWSA 3TGPA 2WHPA 2A35A 1KEEA 1SZCA 4H6WA 3OMWA 1T8WA 3GA5A 2O8VA 3AHEA 5JAOA 2JKVA 1NJ1A 3F6SA 1T0JB 3DPIA 1XDBA 3CLRD 4Q03A 4XCXA 5EEHA 4F6RA 1UM8A 2AEMA 3DH0A 1A72A 1ZCJA 2EQAA 1FRNA 1EIWA 3GH1A 4ODIA 1NP7A 3DKIA 4UHCA 4OHZA 3MMZA 1OZHA 2RDMA 4RVSA 1E0JA 2VLIA 3CN7A 3PF9A 4IH1A 4EEZA 1JILA 2A3RA 4ZZ1A 2HDWA 5BR8B 2CL0X 2QUJA 1WKVA 2IXTA 2DKNA 5JRJA 5DHAA 1HKUA 3CZAA 3PE6A 2QSUA 1K97A 1P4SA 4LXTA 3GY0A 5E7QA 4BMPB 2YV2A 4ZT6A 2CHQA 1IXZA 1CR2A 2WF7A 3B2NA 3CMMA 3BQMB 1QOZA 3EH1A 1FFCA 3BCHA 4P83A 5CVUA 3P2EA 2DFPA 1H1LB 4R7TA 4Y3UA 4OHFA 1PTJA 1UMKA 4XZ3A 2K7ZA 1YB1A 4DHEA 3G9QA 3QVSA 3DDZX 4P3KA 3GDHA 5K3AA 5FXMA 4LIPD 4DR5B 5FOUA 5K8IA 1XZFA 1QHYA 1GA6A 3IJ5A 4CEHB 5DHUA 3D8SA 1RSZA 2PQ0A 1Z37A 2X8LA 3MQ2A 4TYMA 1UXOA 3IAS6 4B9EA 4H7KA 4ZKDA 1CYDA 4TKLA 3BTSA 5F7XA 2AD5A 2BYTA 2QTZA 1ZH4A 2DXIA 1KJQA 1TYBE 2Y0EA 1QORA 4AP6A 4NZMA 2GDZA 3RADC 3HA2A 3EVTA 3NKLA 4Q9LA 1L9XA 4CCYB 3MQFA 3UV3A 2PH5A 3UV6A 1EFVA 4UM9B 4D3XA 3MILA 4HYYA 4UUPA 2BLNA 2JCYA 3QE3A 4Z8XA 3HJHA 3JWJA 1M1NB 4HX9A 3HBMA 1F2TB 3VH2A 1Z2CA 3WXBA 2HADA 2XNCA 4M1WA 4E5PA 5GONF 2G88A 1UPUA 3KX2A 4V0NA 1J22A 1DOZA 3H8WA 4AAYA 3EZFA 4P93A 1KFCB 1RRFA 4G36A 4C21A 4GPZA 2OFWA 4KO1S 3L4EA 3P0EA 5EXDA 2C92A 2VNSA 1W5AA 4LCBA 4F2PA 2YNMA 4CLOB 1DAIA 4DOMA 2E55A 5DE3A 2O06A 4ZQBA 1OGIA 1GXSA 4XASA 1BSVA 4DLUA 1V43A 5G1PA 4UEKA 2JI6A 3PXXA 2GKOA 1Q7EA 1XEWY 1YZTA 2OAGA 4GBGA 3N2IA 1DTWB 4JL6A 2G1KA 4PIMA 1AF7A 1XRJA 3HEMA 4X6XA 3BHNA 3N1UA 2P2ZA 3ZHVA 1ZWKA 1QC5B 2BR5A 4URWR 5AVQA 1KO7A 4UD6A 1RIIA 2QR3A 4COKA 2WU3A 3FD8A 4MHSA 1EDEA 3E3NA 1YTLA 4L6CA 1S1MA 1AB6A 2VXYA 4EPRA 1N2BA 5LYYA 1LNZA 3AVOA 1GNLA 2NSHA 2XHEA 4TRMA 3PPVA 3TOSA 3FZNA 4UEOA 3U4QB 4NE7A 3M49A 2BFPA 1N92A 1JLRA 1NQTA 2FLWA 3H9JA 2IGBA 4ED9A 4D4LA 1CJVC 4BNKA 4EKGA 1JDPA 1B93A 1NJ5A 2HC9A 5JVDB 4D8WA 4UOZA 2UUOA 2C2XA 1UEJA 3LUJA 4EJSC 3AERA 1JIIA 1L4GA 3SY8A 3GLGB 2ZT5A 2CNNA 3OZAA 3TI7A 3ZD7A 2HDOA 3JV7A 4JCOA 1XTRA 2X0NA 2XKAA 4TS9A 4X3PA 1ABFA 1BXGB 5K51A 4CKBA 2WWXA 3QW4B 3RS2A 4BEBA 4DJTA 2XB8A 4GT1A 2R68A 3R40A 4EKNB 2VSFA 5ECGC 3IXQA 3L4BA 2CXSA 3FPBA 5DP1A 2PZ8A 4M88A 2XQVA 2UVDA 4H7FA 2GJ8A 2XMRA 4OYRA 4W4TA 1CIVA 2YY7A 1GPMA 4G07A 2YTZA 2ZVQX 3O90A 5TT1A 3K9GA 3OESA 5C53B 4QIHA 4JP2A 5KQLA 2VRBA 4GW3A 4I6GA 3OJCA 2H11A 4MQUA 3AK4A 2BM0A 3IPAA 4HSGA 2QV7A 1XTJA 1UWVA 1IOZA 3G5MA 3P27A 4DBVO 5KINB 1HM5A 1OFUX 2WUGA 5TMDA 1GVHA 1ZC4A 2BM8A 4U6NA 1CDZA 1BROA 1UKEA 4YO8A 5FWXA 2QMUA 3B3JA 4RHEA 5CVEA 5ES3A 4B3JA 3OM8A 4FGSA 2YFYA 4WH0A 2GZAA 4KQFA 2J0QA 5JFTA 2EX4A 2LD4A 5K0JA 3NHLA 1PS9A 3WX0A 5E1OA 1PW5A 1OROA 2RB5A 1UWKA 2WICA 3NAZA 3R4CA 2PUEA 4BO9A 5KNLA 4G5RA 3TIFA 1OX6A 2YWGA 2VP0A 2O1EA 3E48A 2BIFA 1HOTA 3W5VA 1KI6A 1ONOA 1G5RA 2GEDA 2XYRA 4G41A 4KUGA 2XT9A 3ENZA 1EUCA 3QMMA 3P9KA 4AZVA 4GHWA 4ER6A 4HH0A 3UPTA 1A5SB 1NRIA 3AKZA 4UM5A 4YJFB 1TKRA 4B5KA 3O0DA 4RKRA 1RI1A 1U5BB 2NXCA 1NTRA 2NQTA 4II3A 1O77A 2JGLA 2XZPA 4L85A 3FMVA 2W2TA 4QU8A 4L4SA 3I9LA 4JK3A 1XHEA 2EJVA 4YHBA 2F00A 3OO1A 3WGZA 3IKTA 1RXYA 1Z83A 5LQCA 3E7DA 1SR8A 2OP0A 2PSSA 4M0UA 4ARVA 4D9MA 3PDHA 1J06A 4NTZA 2C3PA 2APJA 3H1AA 3NAGA 5THXA 5C35A 5L4LA 3KETA 5LMUB 5JD3A 2O8CB 2QE6A 3VYSB 2RCNA 3EFOB 3VOBA 2WD9A 2G77B 2POCA 1OD6A 3GWZA 3KZOA 3NHKA 4YEDA 5CW2A 4BNTA 4ENVA 2PUDA 4ITUA 1PUXA 2V4UA 1RHUA 4EI2A 1N75A 4Q9AA 3DL2A 3VR3D 1D8AA 4JOQA 3DWEX 3RVDA 2YQZA 3EHEA 4K2AA 5TPWB 1A8SA 3FAZA 2ZBDA 3MSXA 4MR9A 4QYMA 4TV8A 3S2SA 3AVYA 1X8JA 1YD7A 1RQ2A 3PNYA 4ZN6A 1JT9A 4XYLA 2WJ3A 3NYQA 1TMGE 2WIBA 3GJXC 4JGBA 2ATEA 3PD1A 1CY0A 4FP9A 5TDHA 2C4HA 4B17A 3ZNOA 1O6CA 3OM9A 2EGHA 2JJ1A 4W5WA 1R5OA 1T8PA 3WKCA 3TNYA 2H4JA 3IQXA 3MBKA 3NRBA 5B4VA 4I81A 2H63A 7ABPA 1V4VA 4YJ2F 4LHZA 3IEVA 1A5BB 3JQGA 1BE6A 1QHNA 3CE6A 4BC0A 3MS2A 3UM9A 4DV4B 3MPOA 3ABRB 1GPLA 1YDEA 2BMWA 2FP4A 4NPAA 3K6SA 1ZGCA 3I8XA 2BI4A 1DARA 3V7UA 2ESRA 4JJ8A 1MDBA 1NX9A 1VG0B 4CIYA 1T36B 4BNYA 4P8RA 2B1IA 2ETXA 3PYMA 3Q3GE 2I1VB 3AETB 3JZFA 1PWYE 3KCQA 1T5HX 3R5HA 2DH5A 4MA4A 2ANBA 3G6WA 5K0BA 2CL5A 2WA1A 1RI3A 1TCAA 2SKEA 5DT2A 2Y0PA 3C3EA 3PNSA 2PN1A 3QXGA 4Q4JB 3BXGA 4Y9SA 1N6IA 2ZT7A 3I4FA 3UW3A 1ILEA 3DXXA 1G8PA 3O3MB 2WUVA 5HTOA 1BHJA 4J7AA 2C3OA 5AVUA 1OAOA 1PJSA 5IM5A 3H2YA 6ADHA 4IX1A 3C8HA 2Z95A 4MRAA 2ZSUA 4X85A 4BWYA 1QIIA 1RMQA 4PE5B 1M1ZA 1S2GA 2G5TA 3IA7A 4ZI3A 1AS3A 1QFSA 5IKEA 2FW8A 4IIUA 1IUPA 2DPHA 1E6EA 3VHRA 3RGWS 3VZRA 1PR4A 1T8TA 4NHOA 1F5SA 4AULA 3FN4A 3QF4A 5CDUA 3HB1A 2NZXA 1UPTA 1R8XA 1C7ZA 4P33A 2HH9A 4HLQB 2HFJA 4JC4A 5K0TA 1G59A 2PXXA 1SPBS 5KQMA 1SC4A 4I5DA 2PZFA 1G16A 5FULA 2XNDD 4ANFA 2HMWA 1ZJ4A 2IXAA 4DY4A 1V5GA 1CRZA 1K3FA 1K5DA 1ZYUA 2OBNA 1TEZA 5BQPA 1WU7A 4K1XA 1EXWA 4C89A 2WIDA 3WG9A 5KYWB 4MEJA 1WD7A 2R5WA 5J59A 4DLVA 3U56A 1P3DA 2SCUB 5C8ZA 4HYEA 4KYTA 4MRSA 2J4CA 1LDEA 3LKDA 3RJTA 3TBFA 1JIVA 2P3OA 4HEQA 2WAAA 1PR1A 4JLJA 4LV6A 3O6VA 5F1YA 1TO1E 3TYXA 4NOMA 1EXDA 2VNAA 3I73A 2QRKA 2CL7X 4R6WA 4QJ3A 4RMGA 3FUXA 3IODA 1UT6A 2N46A 1FNDA 5CW1A 1YZFA 1PVDA 2ZSIA 3DFFA 4GR4A 4MQ4A 1E77A 4J90A 3SXPA 3TK1A 2DUJA 5KSOA 3IAEA 4R40A 5C1OA 4GPBA 1MCZA 1ZNXA 3QVVA 2FW7A 1G6KA 4IIFA 4GI2A 4RD6A 4LVCA 1W0KD 2QPLA 1ATZA 5JNTA 4AMZA 3N2KB 3OIUA 4EFDA 4MIOA 2KI5A 4GRIA 1ZDMA 1KKMA 1MC1A 1A1SA 2ZJ1A 4MQMA 4CKEB 1E1YA 4MA5A 5A3SA 4ZFNA 3ZQUA 1GRQA 4CTJA 2ODNA 3AEUB 2B37A 1NOKA 2I34A 3Q5DA 5E2IA 2RI0A 2O0MA 3KQWA 4WN3A 3FYHA 3EN0A 3Q85A 3ZCRA 4FCCA 1QKKA 4E5MA 4DJ5X 2PUTA 5AJYA 5CPFA 4B1FA 2ISSD 4A6EA 3R77A 5CDFE 2VUUA 4H3SA 2FSUA 4XM1A 5AKKA 1O97D 2VUIB 1OQAA 2ZG6A 3A7EA 4JBWA 5CJJA 2Q7DA 1ZI8A 2RGYA 4XVUA 2WG2A 2JCSA 4PBTA 1K8QA 1U9CA 4WXYB 2QUHA 2CXQA 3NFRA 3ZQJA 1LBQA 4Q05A 4BVLA 1ZUIA 4YCCA 4DL9A 5LVAA 1QDUA 1XCBA 4HNVA 2XIQA 1VGVA 4O3FA 4CDRA 3TCXB 4AF8A 3D5TA 3VVLA 4WERA 4OI0A 2XA2A 4FT2A 1J23A 2XCOA 4R16A 3SNKA 2FFHA 5JMTA 2WIGA 1A7AA 4NF2A 1JHPA 2HWWA 3FWYA 3PNOA 3LL7A 4Q34A 2FEPA 4JENA 2KPOA 5BN4B 2I8CA 2FWIA 3OPYB 4M36A 3U7JA 4I9GA 3G2HA 2G6TA 2RHCA 2ZJBA 4UAGA 5F1PA 4EZBA 5A62A 2LVBA 3BRCA 2H4YA 1JG3A 4FDVA 2BFCB 1T5LA 1LFDB 4QQRA 4NPHA 1RWNA 3D7LA 4PRLA 5IEJA 2G09A 2VK1A 3LK7A 4GMFA 4M8IA 5BORA 1XPRA 4BVJA 2RH9B 3W4IA 1XU9A 2BR4A 2HMVA 1SBQA 4C1BA 2O2CA 3HE3A 4FYPA 3QITA 3OPQA 3W8DA 2AJCA 1DQPA 1MABA 2ZPUA 1KR2A 1V0JA 1UDAA 2WLSA 1E1KA 2QD5A 4K1LA 3HU1A 4R2IA 1G42A 3WRVA 4DY6A 1GVNB 5CLJA 2VTBB 1G8KA 4RWEA 1VHWA 3ST7A 3BKWA 3HUEA 4U3JB 4QWWA 4YJ3F 4CMCA 5LU9A 1C9YA 4FDTA 4NY1A 4CR8A 4E03A 2AMFA 2C96A 4L8WB 5JWHA 5KO2A 3L1JA 4B8ZA 5CB4B 4XR4A 2D4AA 4Q24A 5CHEA 5I4KA 3I61A 3PKZA 4CZ2A 1JAHA 1XV5A 4UBLA 3RC7A 1YRQA 2CMFA 4KHPB 1MO4A 5AHWA 3NMUF 3H18A 1KYYA 1QO9A 3D3KA 1S3IA 4MCJA 4R2WA 4UOQA 1C0LA 4CTMA 5LFAA 1T3HA 4MSUA 2ZBRA 5LDDC 3R3JA 3KZCA 2JBAB 5IJ9A 3CNNA 4EF4A 2Y1XA 1ZJJA 3CONA 3RYCA 2NO4A 3ZQ4A 4DIOA 2GILA 1SCBA 4MKXA 2D6FA 1X80A 1EM6A 5KKCA 4XIFA 2QZ4A 2OFXA 2X4IA 2QRZA 4U00A 3PUXA 4YS6A 5E2BA 4EJ2A 1UBTS 2H2WA 3FUTA 4EB3A 3FOWA 4FXPA 4E07A 4M0LA 4G89A 1Y8AA 1AF4A 4H9GA 2C8VA 1OI4A 3SDZA 4ZJUA 1DHTA 1E96A 2QM8A 1DOHA 1AE1A 1YI1A 4QBGB 1NX6A 2IU4A 4CEJA 3SCZA 2BFBB 2UYQA 4IVRA 2E37A 4LBZA 4JLVA 3TLAA 3ZDYB 1C0EA 4PY2A 3HDYA 3FJYA 2J08A 4PX3A 4E11A 3JYNA 4NECA 3L0OA 2TMGA 3B2EA 5IG2A 1MX3A 2EW2A 1TYEB 4OD0A 2G9QA 1NUSA 1QDEA 1X38A 4Y67A 3IUQA 4IBOA 1OKKD 1TX4B 3NLLA 4M0KA 4CM1A 4IFEA 3I9KA 4AUEA 5KTNA 4CM9D 1BH2A 1B00A 3V4SA 3EZLA 1NDHA 4EM6A 4FHGA 3N9IA 1G7CA 3WLKX 4YUYA 4B73A 1U0LA 4LXGA 2J3DA 3P0RA 2YXDA 3EVBA 1BRTA 3K6KA 8ADHA 4ZI2A 4J2TA 4U9HS 4XEUA 2O3UA 1WA5A 3IOBA 4O4IF 4G0XA 2H7YA 3AI1A 4QJIA 2BFNA 3ADDA 1A5ZA 1E62A 2Z6QA 1I2ZA 2YVKA 1T1JA 2LBPA 2X9LA 3PC4A 3ER8A 2HZBA 3H2JA 3CNOA 3C2QA 1UXGA 1OIXA 2YW2A 2CJWB 2W22A 1M83A 5JDCA 3LZ6A 2QD4A 3IAUA 5CCXA 2OC4A 3JVEA 1NZJA 5E3IA 2GCOB 4JB0A 3CKKA 4ZEOA 3BDAA 4QKQA 3M3HA 4EGJA 2GPYA 3CQ9A 1ZK4A 4BLTA 1O94D 3ZGNA 5ECDA 2Q0XA 3FHCB 1YIAA 3H42B 5FBKA 5KQGA 3PNVA 1VCIA 1PX0A 1VJGA 2JFUA 1ENOA 3DW3X 1GHTA 2P6NA 3Q1LA 4KOEC 1YK1A 4BIMA 1U7PA 4Q9DA 4AZ0A 1FYWA 2RBKA 3SAJA 2R3SA 3VUEA 5BWOA 1Y5IA 3AXTA 4P3PA 3JD3A 3JR3A 1N0IA 2HHLA 3RRZA 1N3IA 1EYZA 3GL9A 3GLGE 1DG1G 3F9RA 4HXYA 1SELA 4KVGA 4L4XA 4U2FA 4DF3A 1JA1A 2CBGA 1L4LA 1IUNA 3IBFA 4BYGA 3RS9A 1I1NA 2XTJA 4WCFC 1GU0A 1M6VA 1TADA 1TDJA 3BJIC 1CTQA 2X6QA 4HN4B 1R2QA 4UCQA 1YS4A 1OBFO 3HHEA 3N75A 2Q4OA 1IIBA 3OJFA 3P96A 2JVKA 1W2HA 1M0TA 4OXKA 2O2EA 4H27A 4JU9A 3R9IA 3RIGA 3RWMB 3H6HA 4BB6A 5HFJA 3IJPA 2G82A 2WQ6A 1YIDA 3I8OA 4ISBA 3DVLA 1SUCA 3N8HA 5BW4A 3C3JA 4LZAA 5FUYA 3LUGA 3M6MD 2ES4A 1M6EX 1VE5A 4OMUA 1AS0A 3MN1A 2P68A 1FDRA 5C2JB 2CLMB 5BSKA 3HKDA 1D4ZA 1BWRA 1S3FA 4QL3A 2D00A 1X0VA 2OBMA 3I8SA 4TMKA 2DWOA 3GCWA 3OLVA 4H6PA 3S28A 1CZNA 1RLTA 4QRIA 3T9AA 1RW4A 1CR6A 1A8UA 1T0IA 2DWPA 3BMQA 3H5IA 5F5LA 2PUAA 4EEXA 3GT0A 4M6WA 2V6JA 2EFHB 4ZDKA 4DNQA 1NL3A 1YZUA 3G82C 3KVVA 3R4VA 4MIKA 1HQYE 1MEEA 2QX7A 4J7XA 1XQWA 1XTIA 4DR4B 1HNXB 2IPOA 1FXUA 1NNI1 1WSAA 2PANA 2GN0A 3E7WA 4LQDA 4MW0A 2ZYRA 2HQRA 3HYRA 5EIOA 1KDRA 3U49A 1VP9A 1ULSA 4B2PA 4FVTA 4FFVA 1JP7A 2VKQA 3R7FA 2YDYA 5EXXA 1JXAA 3PGXA 3U3RA 3K9WA 3QX8A 4PBSA 2IEZA 4MQ6A 1I2DA 2DBQA 2QGFA 1ZLYA 5ELMA 3WE7A 3D2LA 3DLIA 2D1QA 3QI7A 4K9NA 3ICCA 3RVLA 2H1LA 2J3KA 4E15A 3UBTA 4ZXPA 1U8ZA 1M6NA 1G38A 4ML3A 4DDVA 3S8YA 1KXJA 3M89A 4KN6A 1E8MA 3GFRA 4ZANA 4K81B 4N47A 1A9XB 3GJ0A 4PZZA 2BAGA 2FR8C 2P9BA 5BNZA 4BB5A 4BHTA 2X2OA 3HCBA 4QQFA 5MN6A 3VKHA 4NZ9A 2H5EA 4DCSA 4BKQA 2VWHA 4RA9B 4DCPA 1NVUQ 1QRDA 1VPVA 3B52X 3LP8A 4D4HA 4BGUA 3IDZA 5ALKA 5L3RA 1G63A 2J9FA 3CVXA 4S24A 5A03A 4RZHA 1XRLA 2FPOA 2PMKA 3W8NA 1PG5A 1OWOA 3BB3A 2R7MA 4D02A 2CDRA 3D3QA 4CI9A 2YIMA 4F8JA 3I6MA 5B7QA 2XD4A 3RJ9A 4QUIA 1WVIA 2AXNA 2I7XA 2GHTA 4JEUA 2FOLA 1NATA 3HBLA 1YZ3A 3EEIA 2O7VA 3AR2A 3CYFA 5DU2A 4UBMA 1I3OA 1L0BA 1VJTA 1YC2A 3WZMA 3QLVA 1IWBB 4RK6A 2CLIB 2H1VA 3D6HA 5CXXA 2C3YA 3EMDA 2E21A 2E4XA 1YWGO 3L0IB 5K3BA 4OLAA 3O4FA 2IX3A 1P1CA 1VMDA 1F17A 2RHWA 4IF4A 2JJ8A 1AMNA 2XAUA 4XDZA 3MYRA 3SBEA 3SVTA 1RACA 1KMIY 4TUYA 1FSPA 4L3VA 2HF9A 2Q3JA 2PNJA 3CWCA 3R9XB 1CUJA 3AVXA 3PPXA 4HDSA 4Q1VA 4LDZA 1GL7A 5DIFA 4H18A 2GBGA 2PWAA 4RH0A 3RAJA 2B6NA 4R84A 5HKKD 2VP3A 2EEZA 5K01A 5D2CA 3DGEC 1PLLA 4P4NA 2B94A 3OQMA 2P2LA 1AUPA 3HXLA 4R2LA 2AOWA 3CRVA 2FPXA 4FR2A 4S1TA 5H4GA 1MA0A 2EZTA 3Q72A 1X1RA 4ZVNA 2ZTMA 3ZQ6A 3KUDA 1C4OA 1QO7A 2I1LA 1BMFA 3PJEA 4NULA 1C1XA 3I9V1 2KQUA 1WX1A 2QXYA 4IKEA 1N2HA 3BGSA 1LPAB 3DHNA 1P1FA 3HWSA 4I14A 4RACA 2CXXA 3WRYC 3A2NA 3LXXA 3GEDA 3P1JA 4UQLA 4ZHQF 4GXTA 3RLFA 3RRMA 4CG0A 1FFYA 4BUJA 1C4WA 4RTLA 2FJ0A 3EK2A 3EQ2A 4PFSA 5H1YA 4X45A 3SIPA 3I12A 4BKMA 3KD3A 4DSAA 4FLEA 4JUCA 4UTRA 2AUNA 4OJKA 2PU5A 1YKSA 3BREA 3DO8A 4JVSB 4RPKA 5LZ8A 2FUEA 3PEEA 4RDCA 4PYRA 3ZHUA 4E5YA 2CZGA 2EHJA 4G1FA 4Q9KA 2OPHA 3ZDAA 1Z2DA 1FSSA 4CQLA 5G40A 3M8KA 4P7KA 4RABA 5DLQC 1FDVA 2A4MA 4QECA 1Z2AA 2CLOB 2Q5FA 4RV9A 3QEMB 4C04A 5K0ZA 3WFIA 3QRWA 5IKMA 3PEVA 3V4VB 3ZJUA 4FGJA 1TL7C 1YDGA 2H54A 2QR5A 3GJ4A 4XOUA 1Y6JA 4ZTBA 1T6BY 1DT3A 2P75A 3EOBI 4PSDA 3E05A 4YXWA 3IT3A 3Q6NA 2HA2A 3TAXA 4YCNA 1DBQA 1NZDA 3VQTA 2O8FB 3LVRE 1L7QA 1NXVA 1QAOA 2HCRA 1LTKA 1QM5A 3BTOA 5HDBB 1I80A 2W43A 3TUIC 5BRAA 3ER9A 4I5GA 1M33A 3QHPA 1Q12A 1U3WA 1XZLA 1AUVA 1Y1TA 2FK8A 2KE5A 2WYWA 4PLGA 4ZOEA 4YLYA 3HLYA 1KOGA 4DLYA 1VXRA 1LLFA 4LX0A 4NV1A 5EZYA 1VA4A 2WRZA 4N76A 3EUAA 2F9FA 1EESA 4LYGA 3WGTA 2W2MA 1M2VA 2ZR7A 5EUCA 2ZOSA 1I2CA 4LYAA 2IY8A 4L02A 3SZRA 2I3BA 1R66A 1TK9A 1U1CA 2PLWA 2ONZA 3EDMA 5AW5A 5CM2Z 5BWNA 1EDBA 5AJXA 2NV0A 4M1KA 1T10A 3Q8MA 5C5IA 1G7SA 3VR5A 2PMWB 5DYYA 1OI2A 1H6DA 3TR0A 2AI3A 1EFRA 2EVWX 2WFZA 2Z83A 4LDJA 4LTNA 3KR9A 4LXUA 4XWGA 3ZJ4A 1OR8A 2FNAA 3OZWA 2XWSA 1X7HA 1IN7A 1D6SA 4WIAA 5LZ9A 3BDVA 1O5IA 1R6AA 1HWYA 4M76B 5HUQA 2QLLA 1OH8A 1GIAA 4WA7A 4G65A 4AJEA 1UJCA 4ER0A 4RF2A 5SZKB 5TQ0A 4BZZA 4AI6A 4L3OA 1VDMA 3C3WA 1GNRA 2HLDA 2IPLA 2QM3A 3BMNA 2Z2KA 3MJHA 3UJ9A 3DZBA 5K45A 4YP7A 3F1LA 1KVRA 5B12A 3NTQA 5C1DA 1G5QA 3D0OA 1E1QD 1AGNA 1TK3A 3UKOA 1A0OA 1RC0A 3LO5A 3OMLA 3I1IA 1VE1A 2JFOA 3OPMA 1JQ5A 1NHGA 2R8XA 3GNSA 4KEAA 3TCNA 4LXYA 5HX7A 4LZJA 4EY3A 5ALXA 3IPLA 3PI7A 4GKAA 1RM0A 5D3QA 3HFJA 4ENRA 2VBIA 1EH5A 2A9PA 3TSZA 4B3FX 2G9VA 3MCAA 3NEJA 4OQEA 4UVDA 4XJVA 1ECCA 2I7TA 1OLSA 1GV1A 2Z1NA 1CZLA 1YDWA 2B92A 4UCFA 2GM4A 2XW6A 1VI5A 3WL7A 3TTVA 2IYEA 2NYUA 2I87A 4LPKA 3MXTA 5EJ4A 4JJFA 3Q7PA 1P4RA 1Z0DA 5AW8A 4YCDA 1SOWA 2DQSA 4UU7A 2FSVC 5C18A 3NDPA 4P2BA 2Z4RA 4G1CA 4Z7JA 1E1RD 4HKTA 4JVMA 3MRTA 2I4OA 1ZOSA 4AY6A 3NT2A 3GMTA 2P3QA 2PJUA 1EUQA 4YWJA 3DVRX 1MMFB 5DN9A 5ALYA 1M76A 2Y2UA 4WJKB 1ULUA 3UB2A 4ZVOA 2J9GA 1P9NA 4Y6RA 2C2BA 4BQFA 3CBQA 3JASA 1DBWA 4JXXA 3IE2A 1TTHA 5ADVA 2XYQA 5KCMA 4YRAA 2D0IA 4KYIB 3KXIA 4OHPA 4RJIA 3MTIA 1L5GB 4C4YA 3UAGA 3GLIE 3WB0A 2C7QA 5J5VA 5JS2A 1Y6FA 1VPWA 1ZNQO 5EKUA 1ZZGA 3A28A 2IDMA 4PS1A 2PUBA 1C9KA 1KMQA 3WB2A 1CRQA 4J3JA 3V1MA 1P1BA 3QYPA 3C5CA 5DNEA 2BISA 1CQZA 1MAVA 3IUPA 4ZVKA 2IEAA 4CG1A 4L2IB 1NXWA 1H4VB 1LVUA