1LGYA

Lipase ii from rhizopus niveus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
265
structure length
265
Chain Sequence
KVVAATTAQIQEFTKYAGIAATAYCRSVVPGNKWDCVQCQKWVPDGKIITTFTSLLSDTNGYVLRSDKQKTIYLVFRGTNSFRSAITDIVFNFSDYKPVKGAKVHAGFLSSYEQVVNDYFPVVQEQLTAHPTYKVIVTGHSLGGAQALLAGMDLYQREPRLSPKNLSIFTVGGPRVGNPTFAYYVESTGIPFQRTVHKRDIVPHVPPQSFGFLHPGVESWIKSGTSNVQICTSEIETKDCSNSIVPFTSILDHLSYFDINEGSCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (carboxylic ester)
molecule keywords TRIACYLGLYCEROL LIPASE
publication title The crystal structure of lipase II from Rhizopus niveus at 2.2 A resolution.
pubmed rcsb
total genus 86
structure length 265
sequence length 265
chains with identical sequence B, C
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1996-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lgyA00
3ICVA 1CEXA 1K4YA 1YSCA 1G4HA 1Y7IA 3KD2A 3V1KA 1ZGCA 4DTCA 1ZI8A 1WM1A 4B81A 3L1IA 2AJCA 5LIPA 2QKYA 1VA5A 4Y2TA 3DYVA 4MEBA 1R9NA 1BRTA 3H2IA 3LIPA 1TCAA 2VAXA 4IH9A 4X6XA 4AQDA 2WU3A 4RE6A 3QH4A 5IVIA 3HXKA 3WIBA 3NOXA 3WWPA 2OGZA 3I2JA 2R11A 1GPKA 3BE8A 1WB4A 4H7JA 3YASA 3IBTA 1Z68A 3WKEA 1R4ZA 4ZV7A 5K3FA 1M33A 4X3CA 4BCCA 5I8PA 1UKCA 2JBWA 4FBLA 1R9MA 3OOSA 3HLKA 1T4MA 2H9YA 2WFZA 4L72A 4UUQA 5CT8A 4TGLA 1QIIA 1MAHA 3DEAA 1W52X 4K2AA 5CMLA 3PF8A 3AFIA 1AQLA 1YS2X 4B9AA 1CLEA 5AM2A 4EZIA 3PE6A 5IVDA 4M0FA 1SCKA 1ODCA 3WKCA 3H1BA 4MYDA 1SCQA 4X97A 2H1IA 4PSCA 1JU3A 3I2FA 2RONA 4OSEA 2AJDA 2WTNA 4DLNA 4J3JA 5EI5A 3FYUC 1YR2A 4H77A 2GYWA 3BDIA 5BWCA 4MJ3A 2G4LA 3WK8A 3BDVA 1CUUA 4MYSA 1C7JA 2JGFA 4FWBA 4C01A 5C81A 4OYLA 1DQZA 3M82A 2JF0A 4LHEA 1CUSA 5AM0A 2Y2UA 2GYUA 1VZ3A 1R88A 1VZ2A 4Y2XA 1P0QA 1L7AA 3R0VA 4Q3LA 3O4HA 4X94A 1C7IA 1QTRA 4DIUA 2WLSA 2G63A 3C5WP 5ALQA 4EY7A 1KU6A 3PUIA 4EHBA 5HF5A 2QXTA 4HRYA 1WHSA 4A5SA 5CURA 1XRQA 2ZJFA 2V9ZA 5DNUA 3PF9A 5CRIA 4FNMA 1H23A 5ALPA 2VQ6A 4UBOA 1DT5A 3A6ZA 2AJBA 2Z5GA 1BEEA 2BUBA 4HZGA 4KE7A 1MPXA 1Q0RA 3WL5A 3FSGD 3IA2A 2DR0A 4Q3OA 4ARBA 3B5EA 1DX4A 1WCYA 1CUAA 2JGLA 4XJVA 1TQHA 4Q3KA 1QIEA 5JALA 5KWJA 2ZJ7A 1B6GA 1CUBA 2O7VA 3WWOA 4UFPA 2Z8ZA 3IVMA 5CXXA 5AM4A 2BUAA 4OUKX 5IVHA 2PU5A 1LNSA 1A88A 2XUPA 2XMBA 3V48A 1ZIYA 1W75A 1EVQA 3FLAA 2WHRA 1MAAA 2DQZA 1EDDA 3G7NA 2J3DA 4JH0A 2WM2A 4IQ4A 3GROA 5FOQA 5K5EA 3OG9A 4ZRDA 4D9JA 5A7GA 3WK4A 5DJ5A 1VOTA 5DWDA 1XKTA 3G0CA 4XWGA 3M3DA 2B4KA 5AH0A 4B84A 4X95A 3FSGA 4FBMA 4W1PA 3STWA 3ZWQA 1H2YA 3SK0A 4B0OA 2ROQA 5EIEA 1AX9A 5JAOA 5FKJA 3E1GA 4DM7A 5CTAA 3C45A 4X6YA 4B83A 1VJ5A 2XUOA 5AM3A 4BAGA 4BRZA 5KBYA 5A7FA 2GZRA 4NS4A 1DTEA 1XFDA 1ZICA 2ACEA 1ZJ5A 2H7YA 5JZ9A 5DLPA 1F8UA 1Y37A 1R1DA 5ALOA 3WL8A 5EHXA 5AKZA 5HFAA 4YPVA 3E0XA 3MUOA 3O9VA 1EDEA 2HU5A 5CT5A 3FCYA 5JD4A 3EQ9A 4X93A 1F0NA 4C4YA 1YASA 4OB7A 4K5QA 5AM5A 2C58A 3V1LA 3BWXA 3KDAA 1JMYA 3IIIA 4QDOA 5HCUA 4BRSA 3ESCA 5HK9A 1QGED 1YAJA 4WDRA 3K6KA 1TRHA 3IUQA 3SWWA 4CG2A 2BKLA 4CIBA 4LXGA 2WIDA 1QLWA 2ORYA 3FCXA 4DMHA 3M83A 4J7AA 1LLFA 4EA6A 3DDUA 1TIBA 2HRQA 4G1FA 5ALIA 1H2ZA 2BUCA 3UUFA 3QMMA 5K3BA 1UK8A 1CUDA 2O2IA 4BDTA 3B3QA 4KAFA 2QUAA 3I6YA 5JZBA 4AZ3A 3CCBA 4QLOA 1HLGA 4WY5A 4QDTA 1GZ7A 4C6HA 3I1YA 1TCBA 5AK4A 1VE6A 3IDAA 4AO8A 2WIFA 4H7IA 1RYYA 1TKRA 3HYSA 1BU8A 1BROA 3WA7A 1AKNA 3OTQA 1GT6A 1CUVA 4H7HA 5I9IA 1XQWA 3H17A 4DNOA 2OG1A 3LP5A 3DYIA 5ALTA 3ZLVA 2WUDA 1EA5A 3K9BA 4UBMA 4ARAA 2OLEA 1XQYA 2DFPA 4U2DA 1MO2A 3G0BA 4I4CA 1XRPA 1QTIA 2QUBA 3PDCA 4AO7A 3OPMA 4WFJA 2ZVDA 4FHZA 2WJ6A 3OM8A 1AURA 5JZSA 5ISMA 2PSFA 1ACLA 3N0TA 4PQEA 3H19A 2XQIA 5EFZA 4GI1A 4BE4A 3DL4A 3CXUA 1O6GA 1SOMA 4DSZA 4CI9A 1QONA 4OB8A 5H3HA 1DINA 3VKFA 2ONCA 1P0PA 4KAJA 2JEYA 4DYHA 3HRHA 5IVKA 2OCIA 5SYMA 2HHAA 4GHWA 2OPHA 1EK2A 1Q84A 5DYWA 4EBBA 5T4FA 1ZD2P 1UOOA 3IURA 2IX9A 4EUSA 4JNCA 3I2KA 2DSNA 1IZ7A 3JYHA 4E15A 1H2XA 4ITVA 5ALFA 4G4IA 4OU5A 2QJWA 2ZYIA 1RP1A 4C89A 1CUIA 3SX4A 3FVTA 1OCEA 2JIDA 3W9UA 4Q34A 2XUHA 1AMNA 4Y2YA 2DHCA 4LXHA 2WTMA 1N5MA 5C8VA 1ZOIA 4QDXA 4G4JA 4HRXA 5EHQA 1TCCA 2I3ZA 4W1QA 3B12A 1WPRA 2J3QA 5ALUA 1A7UA 1XZJA 4TPKA 5DNWA 3DKRA 2VF2A 2C7BA 5AJHA 5A7HA 1GXSA 3HJUA 1LPMA 4BE9A 3QYJA 1HL7A 1EVEA 1IZ8A 1LPOA 3D59A 4W9RA 1CUGA 1IUNA 2HIHA 5CH3A 4BYMA 5I7UA 2WHQA 4PW0A 2YASA 5CH5A 3K2IA 4UBKA 1FFAA 5JAUA 1IMJA 4J0JA 2WFLB 4BZZA 2WFLA 3NGMA 4EY4A 2JEZA 1DX6A 3Q0TA 4G8BA 3C87A 3ILSA 2O2GA 4UBJA 1LPBB 5FPPA 3A2NA 3WMRA 2ECFA 4HXGA 1MX9A 5HF8A 4E11A 4PO3X 1XZEA 3F9CA 1K5PA 3IUMA 4UPDA 3VISA 3C70A 1J07A 3ZI7A 1W1IA 1FFBA 3BIWA 2WIGA 4FLMA 5AKJA 4ETWA 1QO9A 4BCBA 5AKXA 3C6XA 3HI4A 1CUJA 2BCEA 2QRUA 1W76A 5ESRA 2XUGA 4ZGBA 3AJAA 3BXPA 4X91A 1CR6A 5LKAA 2XB6A 4UHBA 1XZGA 2XQFA 2Y6UA 4H7DA 5HKAA 1EK1A 2HA7A 3DCNA 2WUEA 3WZLA 5FLKA 5K3FB 1P0MA 1XZBA 5AK5A 4N5HX 1QIHA 2QM0A 1GQSA 3LS2A 5DYYA 3LCRA 4CCYA 2XDWA 1QZ3A 1FJ2A 2HU7A 2FJPA 3AZOA 3O4JA 2EDAA 4HVTA 4Z49A 2LIPA 1R50A 1JU4A 2W6CX 5AKGA 5C7YA 1J2EA 3ZLTA 2OAEA 5C8ZA 1CUZA 4B7ZA 2DQYA 1E66A 1UWCA 2QZPA 3C6ZA 3WL7A 3DOHA 4BDSA 2Z3ZA 1EB9A 1XLWA 4KEAA 4X6UA 3JW8A 5K3DA 3CN9A 2R8BA 5AI5A 5AO9A 2XMQA 3D5EA 1ORWA 1ACJA 3D0KA 5DTJA 5EIAA 5A62A 3FOBA 2YH2A 5ALEA 5ALKA 4S0XA 3RLIA 3T52A 4PSUA 1WB5A 1JI3A 1XRNA 5JIBA 3X3HA 2BGRA 1G42A 4AO6A 4J0CA 2K2QB 3H2GA 4LYDA 5CW2A 1XZFA 5HF6A 1K6EA 2JGJA 3I2HA 4CCWA 3W9BA 5LZ5A 2XUQA 1LGYA 5BWBA 3EBLA 2HA2A 3R3UA 4H7FA 4P9NA 3STTA 3ZV7A 4JUIA 2OCLA 3C43A 1E89A 1MNQA 5AOAA 1ZGBA 2O2HA 3Q8WA 1CIJA 4A23A 3DQZA 5AK3A 4GLBA 2WUGA 1NU8A 5AI4A 1Y7HA 4MWSA 3QITA 1YAHA 4BC1A 4NMWA 1WOMA 3HC7A 1HQDA 5AIAA 4GW3A 4H35A 2WU4A 5ALNA 1IUPA 5K3EA 5SYNA 5EHNA 2HADA 5J3JA 1C4XA 3F67A 1HKHA 3FNBA 3OURA 4FTWA 1EDBA 3R41A 1BN6A 2WJ3A 1CUWA 4YK7A 4F0JA 4EY5A 4Y2RA 4QWMA 2QXUA 2V98A 3ZPXA 5HK8A 1MNAA 2FUKA 4ZREA 2QVBA 4HXEB 3TRDA 2Y6VA 4OB6A 1YCDA 4BAZA 2QTBA 4BBZA 1MTZA 3F98A 4WY8A 2GBFA 1QFSA 1CUFA 3QMWA 3R3ZA 1LPAB 2WIKA 1GKLA 1G5FA 4B6GA 1T2NA 2RI6A 1K63A 1ODSA 3C8HA 2IITA 1XROA 1LPSA 1CV2A 1XZKA 2XUFA 3ESAA 4PNZA 2WFMA 3CN7A 4P08A 1ZJ4A 1FFEA 5CBKA 1R3DA 1CUHA 4H7EA 3R3WA 1DQYA 1EHYA 5ALSA 3DS8A 1F0PA 4E14A 1CFJA 1JMKC 4H0CA 4J03A 1XZLA 3W04A 5FRDA 3O4GA 2PSJA 2CB9A 5EIHA 1A8UA 3DJYA 1H2WA 3ZLUA 2XMZA 5AICA 4HS9A 4QDUA 1EI9A 2PSHA 5HF9A 2RGUA 1CQWA 3AILA 1VE7A 3FYUA 5ALXA 4WDQA 1Q0ZA 1U4NA 4DNPA 5JD6A 1LZKA 1SFRA 1U65A 1VLQA 3VXKA 4BC0A 3I28A 3WZMA 4BTVA 2OGTA 2Y1KA 1XQVA 1XZAA 3AZQA 5AKKA 5ALHA 5JASA 2J4CA 5AHXA 1QE3A 2XQGA 4ROTA 1HDEA 1JJBA 3G0DA 5JAPA 3P2MA 2YYSA 1LPNA 2WQZA 1AZWA 1THGA 1JJIA 2Z3WA 2PSEA 1O6FA 5D3ZA 3SC2A 4H18A 3H0CA 5CT4A 4AB1A 1XLUA 4HAIA 4X71A 3WI7A 5A6VA 4XIIA 4AN1A 1UOQA 4UFNA 2CKMA 4A16A 2JGKA 2C5GA 2C0QA 4K6GA 1XRLA 5AI0A 5DNVA 4OCZA 2NW6A 5BOVA 3UUEA 1LBSA 4RGYA 2VT6A 2WG0A 3STVA 1OXMA 3H2HA 5LP1A 3O0DA 4NVRA 4IH4A 3WLAA 5AK6A 4KR0A 2QJRA 2E3JA 3H2JA 1BE0A 4KRXA 4B0PA 1ZD4A 2DHDA 1QIFA 1SCIA 4UBIA 4KE6A 5LLSA 3G0GA 4B82A 1MJ5A 4Y2UA 4G8DA 1IUOA 5C8XA 3WYNA 3F8SA 4DSAA 2CEKA 3AUKA 2ZYSA 3T4UA 3WKDA 4X92A 5FDFA 3EQ7A 4C87A 3G9UA 4AX4A 3I2IA 1OILA 4BP9A 3KWFA 4N5IX 2Z8XA 3C5VA 4UFOA 4RPCA 4L0CA 4G4GA 4Y2JA 1SC9A 3H1AA 2ZSHA 4NZZA 2OAGA 4BCDA 3GELA 2PUHA 3DOIA 4HTAA 3MUNA 2HA6A 3ANTA 4BTLA 1N1MA 1UKAA 1JFRA 1YB6A 4OYYA 2VT7A 2PBLA 4U2CA 3G9TA 4J0HA 3RK4A 4QE3A 3W05A 3WIOA 1YA4A 1X70A 3BJRA 1L7QA 4KE8A 5LZ2A 4CG1A 4Q82A 4CIAA 4J0KA 2VJCA 1ZIXA 1BN7A 4X00A 2AJ8A 4L9AA 2AXEA 5T4HA 3LLCA 2JGMA 1GQRA 3D2CA 2Y2VA 3VJLA 1CUEA 5AKLA 1WPXA 4LIPD 3G9ZA 2GYVA 5YASA 2OXEA 5T4EA 2IIVA 3BIXA 2XMDA 3N2ZB 1DT3A 3RKSA 1E3QA 4G9GA 5EGNA 4BAUA 2VEOA 1D07A 3HACA 4FMPA 3LIIA 4WCVA 5A2GA 2PSDA 5KWIA 3DD5A 3G8YA 4U2BA 1QFMA 3PFCA 5AOBA 2QR5A 4E46A 2CJPA 2PM8A 1PV1A 4EB0A 4MQMA 1ODTC 1E5TA 1U2EA 2WIJA 2OGSA 5D6OA 4GWLA 4W63A 4N8EA 4UHDA 5AI6A 2V97A 4XX1A 3DL7A 3WJ2A 2OQVA 1DWOA 3S2ZA 1PJAA 2AJLI 3BF8A 3QM1A 2C5FA 5ALDA 5BV7A 2PVSA 2JGIA 3ESBA 1BCSA 3UMJA 3WYDA 3QMVA 5CXUA 4FKBA 4DMKA 3GFFA 4QEKA 4KE9A 1QIMA 2OCGA 3O95A 1YS1X 2GZSA 4K6KA 2CZQA 3VVLA 4UBNA 4QZVA 1TK3A 4IO0A 1HPLA 4QDZA 5E4TA 3EIOA 3G02A 2PU7A 1CUXA 1BS9A 3FLEA 1J06A 1HBJA 2VAVA 1TAHA 5LZ8A 5E4YA 1P0IA 2I3DA 5AP9A 1GPLA 4KJXA 1VXRA 5AKHA 2ZJ6A 3E3AA 2XMGA 3F97A 2HA4A 3R3XA 1X2BA 4JYPA 3IB3A 2ZSIA 2HFJA 3L1HA 2VTVA 5LZ7A 3QBJA 4H7KA 3KSRA 1NX9A 4U2GA 1QIDA 3I6ZA 1K8QA 4G9EA 2VJAA 3FBWA 6YASA 1FSSA 4CCYB 2YXPX 3MGAA 3OC0A 3WWDA 2XQJA 4GBGA 2QS9A 3WWCA 3A2LA 4J0GA 2OCKA 5HZGA 4Y2SA 3HEAA 5JANA 1UK6A 3NWOA 4N8DA 1AGYA 4MEAA 1U8EA 4DGQA 5ALYA 5AOCA 5FP0A 5AKEA 1A8SA 1ORVA 4FLFA 2HFKA 4Y9SA 1VKHA 4GXNA 3PICA 1UXOA 3I1IA 5F4ZA 4F60A 3FVRA 2XMRA 1CQZA 1WHTA 4FNGA 1JKMA 2D5LA 3WK5A 2B20A 3VJMA 3W06A 2BGNA 5LYYA 2VSQA 1QIJA 3HZOA 1ZI6A 3WK6A 5E2IA 3RARA 4WJLA 2HRRA 4PF1A 4J0IA 4X90A 3D7RA 4Y2VA 3KOOA 3DLTA 4AMYA 3GZJA 3PUHA 3V9AA 2QT9A 1DU4A 1N5RA 3O9MA 4KAAA 4DNFA 3D2AA 5CT9A 2P8SA 3D2BA 1GGVA 1NU6A 3WK9A 3C6BA 2GBCA 4M0EA 1E8NA 3DKKA 3D4LA 1UFOA 4FOLA 1MX5A 1XRMA 4Q05A 4O08A 3RM3A 2XUAA 2WHPB 2WHPA 1H22A 4HXFB 2HA3A 2BFNA 4OD0A 4QLAA 4G8CA 3ANSA 1QIGA 3ED1A 5AIBA 3D3NA 1QO7A 1Q83A 5ALJA 1N8SA 1GKKA 2ES4A 4AMZA 4Y2PA 2W22A 2CUTA 4EY6A 4C4ZA 4P92A 4OPMA 5HKBA 3VJKA 2PKYX 2G5TA 4ZI5A 1MU0A 1ZI9A 3IUNA 2DHEA 3MVEA 4FFWA 1THTA 3AINA 2HU8A 4AN0A 2WILA 4YASA 3WL6A 3QPAA 1A8QA 3IUJA 3H04A 1UK7A 3G0IA 1UZAA 4Q1VA 4MWTA 3STXA 2VJBA 3WJ1A 2XUDA 4KRYA 4ZXFA 1XZMA 3A2MA 5A71A 2GBGA 4F21A 1CUYA 4G5XA 3WWEA 4IH1A 4XVCA 4CG3A 5KREA 2WG2A 3GBSA 4MXDA 4PSDA 5JD5A 3A70A 4BB0A 2PPLA 1EB8A 1XZHA 4AZ0A 3GUUA 4X85A 2XUJA 4UHHA 3W2TA 1RWQA 4UBLA 4QA9A 4W1RA 4LKOA 3FWHA 3BL8A 4J0DA 3FYUB 3HABA 3V1NA 5JADA 4EY8A 4C88A 3M81A 1ETHA 1X2EA 2PX6A 2V96A 4INZA 1J1IA 4FFVA 3IULA 1BCRA 2B61A 1XQXA 2JGEA 1B41A 4UHEA 1USWA 1G66A 3FYTA 2WJ4A 4LYEA 1EXWA 2XMSA 3DNMA 3V1MA 1UKBA 4GDMA 1EX9A 1UT6A 4M0MA 2C0PA 2Q0XA 2RHTA 5FUMA 2FJ0A 2XE4A 5ALVA 3O4IA 4QNNA 5K3AA 3GA7A 1XZIA 2O7RA 4DNQA 1XKLA 4Y7DA 2OQIA 2H7CA 3I6MA 2EEPA 1ZD3A 3PFBA 1AUOA 2UZ0A 1IVYA 5CH8A 3R40A 4BZWA 2XI4A 4W1SA 4N8SA 1PFQA 2BJHA 4YX9A 1FFCA 1W6RA 1AC5A 4BATA 1UOPA 1EH5A 5K3CA 4WFIA 3WKBA 3WK7A 1XRRA 4FDMA 3TJMA 2J4FA 1LPPA 2HDWA 1BEZA 3EQ8A 3QVMA 4K6HA 2PL5A 2G5PA 1CUCA 1VA4A 4GECA 3QZUA 4GEGA 4UHFA 5FV4A 2VJDA 5AI9A 1MX1A 1YA8A 4U2EA 1KEZA 4JEIA 3KWJA 1I6WA 4X7BA 2RAUA 2X76A 3BF7A 1EINA 5AKYA 3R3YA 4BVLA 2QMQA 5E4JA 1MN6A 3HSSA 1YB7A 1WB6A 2B9VA 1ZD5A 4KACA 3E4DA 1CRLA 5ALMA 5HFNA 2X5XA 4DMCA 4Y2QA 3BJMA 4L3WA 2D0DA 1ISPA 2DCMA 2X8BA 4AXBA 2HA0A 3AZPA 5FXMA 3C6YA 4WFKA 2XLBA 2HM7A 1MT3A 7YASA 3ESDA 4BP8A 3STUA 4QWWA 1JJFA 2VA9A 3H2KA 4FLEA 2XUIA 1KU0A 2H7XA 3F96A 1CVLA 2ZYHA 1XZCA 4I3FA 3U0VA 3STYA 3CCCA 1QOZA 5ALWA 5LZ4A 1L7RA 4I19A 5D3KA 4RE5A 2CBGA 3QPDA 5HQ3B 2VATA 5HQ3A 5AI8A 3FAKA 5DTIA 2WKWA 5JARA 2CMFA 1GPNA 3FLBA 3I2GA 5ALLA 2XT0A 3PI6A 3NUZA 1DWPA 3C8DA 2GBIA 4MQLA 1JT2A 4ZWNA 3TEJA 5T4BA 4BVKA 4DMFA 4OU4A 3U1TA 3KXPA 5LKRA 5IH7A 3S8YA 2WSLA 2RIPA 5AKIA 4UHCA 5JYCA 2XLCA 5EHZA 4IHAA 4U2FA 2BAGA 4P93A 3WQHA 2PUJA 1XZDA 1CPYA 1E8MA 4TVKA 5ALZA 2ZYRA 5ALRA 5FPQA 3AIOA 3WKAA 2XMCA 2QOEA 2XUKA 3AIKA 1W4LA 4B85A 2I78A 5CT6A 5LZ9A 4KYVA 4V2IA 4RNCA 1E8DA 5IKXA 3L1JA 3AIMA 3QPCA 4F5ZA 5JAHA 2ACKA 3ICWA 5ALGA 1QIKA 5JATA 3H18A 4PV7A 3R3VA 1LBTA 2C4HA 1QJ4A 4ZV9A 4BVJA 5AM1A 3WA6A 2EDCA 2I03A 4B9EA 2WG1A 3VVMA 3VDXA 2HL6A 2XQKA 1S8OA 1FFDA 4JYMA 1F6WA 1LZLA 3EF3A 1DWQA 5DYTA 3TGLA 5D7BA 3JWEA 2FX5A 3G9XA 2WUFA 4CFSA 1VXOA 4C4XA 4B80A 1XLVA 4LXIA 1UK9A 2RHWA 2HA5A
chains in the Genus database with same CATH superfamily
3I09A 3OE5A 2ZG6A 3ZDYB 2BFEB 1CEXA 5B3JA 4BOYA 5LLTA 1T9GS 2H2DA 3FG9A 3WMXA 3AM4A 3JCZA 1YSCA 2O8NA 2ASVA 3TZQA 3JATA 4RENA 2VHCA 2WLTA 3I58A 4ZT3A 3LK7A 3KD2A 3V1KA 4DAOA 4DTCA 3ZYZA 5CEEA 4TQAA 1BXGA 5G0UA 2GYYA 4EMUA 2O57A 3L1IA 1PIWA 4TVSA 4EFDA 5B6JA 2AJCA 3KEMA 3U4MA 1RRPA 1PVOA 5LIPA 3GOHA 2HBYA 1BDHA 3DSRA 1QRUA 5BSVA 1HDIA 2IE0A 1EFKA 4MV3A 5TEVA 1RWMA 4MEBA 3WAGA 3VU1A 2N9UA 3CW9A 4F5WA 1Y4ZA 3BS4A 4IJVA 4ENPA 1PJ8A 3TEFA 4DV4B 2XB8A 3OQOA 4BB6A 3W3AA 1CS4C 1R5OA 3NT4A 3WGTA 4IH9A 3BMQA 3LC2O 1NOJA 2BY4A 1Q5PA 4IGEA 4AQDA 2NYAA 4P31A 2VNSA 2ACVA 4HBZA 4LRYA 2DGDA 3VQTA 4ZCTA 4ARSA 2ZDQA 3QX3A 1SU8A 1G3MA 2YYAA 3WWPA 4O0MA 2JBAB 8ATCA 2ZRNA 2E82A 1SPBS 2OGZA 4TWBA 3HZRA 5CNKA 1GPKA 1WUTA 3IAXA 4AY4A 1LFAA 4M8KA 5AW1A 5IMSA 3X1KA 1XTZA 4ZHQA 1HYHA 2V4ZA 5IDYA 1P3DA 1J39A 3W7BA 4H7JA 3UKDA 1E1MA 3HBFA 1MZPA 4Q3AA 2MYPA 3PPIA 1E2PA 3ZD8A 1U2GC 3QVTA 1ML3A 1R4ZA 5F5LA 4OI1A 2WWXA 1M33A 1AK2A 2R6AA 2ZS8A 3BCUA 3GMTA 3NCTA 4X3CA 3PHHA 1N9GB 3O4VA 4ZOEA 5DKFA 5TS3A 5I8PA 4KVGA 1H9CA 2VH1A 2WNIA 2UUPA 5CFNA 3RC8A 3G17A 4X44A 3VTZA 1NY6A 1I6MA 2JAXA 3LRTA 2QN3A 4FCWA 4D9KA 5B58C 3GJSA 2W6MA 4BRWA 2Y71A 3HLKA 1R6BX 5D01A 7ADHA 1NQOA 4F5EA 4ARIA 1Z7BA 1LI7A 1KAEA 4L72A 2P5SA 3RCBA 4CL3A 1BFUA 1PFYA 4P2GA 5CT8A 1EBUA 3L0CA 1AGRA 1N6NA 1OKKA 1AN0A 1TK2A 2PKQP 2EV9A 2VDLB 2JDID 1XEAA 3MYRA 5C4GB 4JOSA 5BV8A 3LTNC 3L1KA 2CL7X 4PPYA 1W52X 5KTMA 2AW3A 4AMBA 1O6BA 4CMBA 3PF8A 2QVCA 4WINA 2CLFB 3N87A 4TVOA 1LB1B 2IA5A 1UM9B 2N3ZA 2ZOSA 1OZHA 2AX3A 1X8XA 1GIAA 5KU1A 2FXIA 1U90A 2EFHB 5CPFA 1LEHA 2DF8A 3FSJX 4MUJA 1G17A 4K0KB 2Z1MA 1XMVA 3RFVA 3DV0A 3MGBA 4BV3A 3ADKA 4R2XA 1P4SA 1PR2A 3DFZA 4XEHA 4A0HA 4J4BA 2BEUA 1P2VA 4GWGA 1PJCA 2GF9A 4RM2A 2F55A 4EZIA 3PE6A 1RMYA 1QZUA 2Y0EA 1PZHA 4M1MA 5IVDA 1NDUA 1Z25A 2ZJAA 4J8PA 2Y9PB 2OBMA 4X97A 3VH4A 2PKCA 1IZ0A 4I8XA 3FXAA 1HFKA 2GNOA 4IMRA 1Q3KA 2F1JA 5F21A 3F73A 2GPYA 1P44A 3T7AA 1DJQA 4EUEA 4XFJA 2VDMB 1V8PA 1JU3A 1XVIA 2HMWA 1E1YA 3L7KA 1FMJA 3KSBC 3I61A 3JQGA 3OZRA 4C6TB 2O5RA 1OIWA 3HY4A 1OXTA 1SOWA 4HN4B 4LC0A 2WTNA 2IGBA 4PLTA 3NHPA 1MOSA 3HL4A 5C8DA 3BDIA 4NCJA 2IGTA 1ZS9A 4XTRA 2X7HA 1S8NA 1N6KA 1E64A 3CUTA 4OG2A 1L1QA 4KB5A 4ZOAA 2R44A 2W2VA 3IPRA 1GAEO 2GNPA 5BWCA 4MK4A 2XPCA 3VO2A 1GA1A 5FJIA 2J85A 4GNRA 4MUIA 1YTUA 5FT9A 3FX2A 2QJTA 3P2YA 4HPWA 1CUUA 2AC7A 5L40A 1CJSA 3OLVA 3PITA 4AJJA 1CE8B 3F4LA 4C20A 4CKWA 4L3OA 1PG0A 1J24A 1WQ3A 2JGFA 4IG4A 2FW9A 4IZIA 4TL8A 3ETJA 3GD7A 5CLFA 2F6RA 4DXHA 1ISSA 3DH0A 2R6FA 2J32A 2X9LA 3FAZA 2YIJA 4GX1A 5KNCH 4LHEA 4Q4AA 1GOTA 2JAHA 3BKXA 5L6LB 5I7VA 1JXMA 4Q37A 4B4VA 1MH9A 2R4UA 4DHWA 4ESEA 2GYUA 1VZ3A 3QG5A 3D6HA 2ZULA 4MV8A 5EJ9A 2DYKA 2FP3A 4MRVA 5DEIA 1Z38A 4U9IS 1JECA 1P0QA 2PX8A 1NFRA 2JDIA 3K96A 4IDHA 1GN9A 1OJLA 4IJMA 4Z7OB 3PA6A 4K0RA 5LDGA 1OH8A 3IX7A 4RUKA 1N0HA 5T64A 1OE0A 3FTDA 2HWWA 3H8SA 3O4HA 1N6HA 1G8AA 2JLXA 4F86A 1N78A 3FZGA 1FF9A 2ETXA 2WLSA 3ASYA 2L42A 3HYRA 1QLHA 5HX7A 4EY7A 1VPDA 2P69A 1G9TA 1B43A 1ZRMA 3ZGYA 4ZIRA 2IZ6A 3A7EA 3OM0A 3ADDA 2I1WA 4UOEA 1BMQA 5LMZA 4IIJA 5K51A 5HRCA 5FORA 3DAYA 2W98A 3CEHA 2GM3A 4B4UA 4GOND 5C1DA 3T3PB 4UJ5A 5BPHA 5CK5A 5BUQA 5CPBA 2ZTMA 5DXJA 1P18A 2W90A 4QYIB 4PSKA 2AVDA 3PF9A 4AG5A 2ANCA 1ZXXA 1H23A 5DT9A 2REXB 3UJAA 5CFRA 3FRIA 2VQ6A 5EMKA 1S8AA 1GZVA 3AY0A 1K27A 2R4QA 2FUG1 2A9JA 4LGYA 1D5WA 2AJBA 2X4GA 3MD9A 3TSYA 3DA8A 1ZH8A 1HSOA 1JWAB 3F1KA 1Q0RA 3I8SA 4KMSA 1K2WA 4DPMA 1Y1LA 1CY6A 4MV0A 3FSGD 3H8JA 3IA2A 4XYMA 4ZQEA 4R2LA 4HFMA 3RJZA 1YL6A 3TIIA 2PH3A 1TPZA 3AC0A 3B5EA 3UK2A 1DX4A 3OP4A 3LUGA 3IE2A 4JLSA 1WCYA 2XVZA 1P8JA 2DBQA 3P94A 4K9RA 4DLLA 5CVJA 4ZZ3A 4IX1A 1DQPA 1GR0A 4REMA 4HT3B 3EJWA 5HNKA 3TAHA 1P60A 3FDIA 3HFJA 3VR2D 3AJRA 2HCFA 2MDTA 1F2TA 3CR3C 4PM4A 1J49A 1UPXA 3QU2A 1B6GA 1ISRA 3HCNA 3NIWA 1YXMA 4UFPA 1DHRA 1RMTA 2QTAA 5B3KA 3VNSA 4BNLA 3JQ6A 3INRA 7GPBA 1PLJA 2NTYC 1I2DA 4J94A 2PHZA 4GMFA 5K8JB 4WZAE 4BY9E 1Q1NA 4Q4JA 3PXXA 4YMUA 2QR3A 4M88A 5FWYA 1W35A 5F12A 3ZHXA 2LKCA 5C8YF 1N75A 3UJ3X 3K71B 4XYEA 2L17A 3GJRA 3SY8A 4QVKA 1EVQA 1G8JA 5AQ1A 4IJUA 3LSYA 4QG7A 2R5WA 4IICA 4EUFA 3K9FC 3I62A 2O0KA 5LPNA 1HDZA 2WWTA 2OAP1 1JEJA 2J6CA 4PZ9A 3OIUA 1GNTA 4WGFA 4ZZ0A 4WK0B 1WXXA 1O5TA 3Q7PA 4P5PA 1YJ8A 2J3DA 5ESRA 1UJNA 5GPBA 4ACAA 1UMDA 4R84A 4XRRA 3ZCXA 5LNK1 1U0NA 4JH0A 1HNXB 3RSQA 3VOSA 3COYA 4HH1A 1OGIA 1IZYA 4GRIA 5DGXA 1KJJA 3L40A 2I4LA 2JCBA 2ODWA 3K9GA 3CZ4A 3OZAA 5E1BA 5A05A 5K5EA 3OG9A 4ZRDA 1ZHFA 4ZO6A 1D7OA 1R64A 2AB0A 3KLPX 3PQ4A 3WK4A 1HNWB 2NU7B 3OUTA 3LUPA 2F7SA 1VOTA 1Z2CA 2WYHA 3DM9B 4IUDS 3GQBB 4ND5A 4F1KA 3L0ZA 5J58A 1XKTA 2EJTA 1PV4A 1O94D 3LY9A 4Q4LA 3DFKA 3TI7A 2B4KA 2ERYA 4WZAA 4ADSG 4ZK6A 2HWUA 4B84A 4JOCA 4UXIA 3FSGA 5D87A 4WX2B 1N1GA 3KOXA 1W5EA 1LWOA 2ZUVA 2RH4A 4YROA 3HZZA 1A0OA 5CAEB 2PL3A 5K1ZA 3SK0A 4B0OA 2ROQA 4ZQIA 3E53A 1AX9A 1GZDA 2FP4A 2YWDA 5FKJA 3MTJA 4M87A 4NONA 2PRYA 1EFPA 1SXJE 5AJTA 3D31A 1EKXA 3NTXA 3OVMA 1ENOA 3C45A 2E4UA 5TLSA 3LPNA 1QFYA 4B83A 4ENSA 1PFGA 4G56A 3HDHA 1C9MA 4M0UA 1JMVA 2XUOA 3TIFA 3G0HA 3VR2A 1PJBA 5HDBB 3BQ9A 2XKKA 4CMGA 1R0XA 3OFND 1Y34E 3RWMB 2GZRA 1JIJA 5TRTA 4NS4A 1DTEA 2Y8EA 3VC1A 4K8OA 4BMSA 2SKCA 4Z4HA 4RABA 3M33A 4IDQA 1CJCA 1W73A 2VSNA 2ACEA 4GM4A 4DQ0A 4AD8A 4XR9A 1ZW1A 1PEDA 3L6OO 3OUZA 3R6GA 1Y37A 5GOTA 1IN4A 5CX4A 1V1RA 5F1KA 5TGDA 1DRUA 2QMUA 2Z1NA 3FB1A 3HEBA 4ZEXA 3T38A 1EFDN 3GLHE 3RVJA 3S55A 3E1SA 2PE5A 1N25A 1YO6A 2GVDC 3O3MB 5DCLA 1FFHA 2Z9DA 4LJ7A 3SNKA 3T6KA 4DPLA 3QUBA 3E70C 3H86A 3CLUC 1KI7A 1OAOA 1MGPA 2W6ZA 4OFWA 5CT5A 3QKRB 5AXBA 5JY6A 3HVKA 2B30A 2WYVA 2Z2IA 3A25A 3K35A 1ZCJA 2PA3A 4ZHQF 4CEIB 3GPBA 1VMDA 1ENPA 1HNNA 1SXJA 1X3LA 2EFDB 4QD3A 2QBYA 4BGIA 4JXZA 1KDOA 1RXSA 2UZ1B 3AEKB 3EIXA 4P32A 1XVTA 2BHRA 4PONA 3VC7A 3BB1A 3O74A 3WLSA 1J2RA 5LN1A 1PBTA 5TGZA 1ZJ6A 2W2PA 1XA3A 3UWOA 3A6KA 1G8MA 3F6EX 1CZHA 2LRHA 2IIPA 4LCEA 1GA6A 3G2IA 3GJ3A 4GP9A 1JMYA 3CTMA 1PWZA 1WCXA 4QDOA 4WW0A 4I1UA 4J7UA 5FBRB 3A3YA 1C9JA 4KK4A 1CKEA 3KEQA 4Q1AA 5EJGA 3V8VA 1Y3FE 2QA5A 3H75A 4BRSA 1X7GA 4KPEC 3SZOA 2IPOA 4R68A 1ZX1A 1CHNA 2DLNA 3ZE8A 1YAJA 3UCFA 4ZVQA 3HDVA 4IIUA 3MM4A 4CLRB 3IUQA 4TROA 4MJ7A 1D2NA 1R37A 2HF8A 1IIRA 3GLHA 3RYFB 3SKXA 4CG2A 5ILOA 1LK7A 1JR2A 1U02A 2BKLA 3E82A 3EVAA 3H6HA 4HEA6 1LLUA 4JEUA 1JPNA 4LXGA 5EJFA 5H70A 3UATA 5BVGB 3U19A 3S2YA 3BK1A 2PJUA 2ORYA 4J3NA 4L5CA 2GS9A 1CK4A 3ZZ0A 3CZ5A 4BO4A 2OESA 3KOWA 1Z74A 1GUBA 1U0EA 1KVUA 1OLXB 3L8MA 4FZJA 4HMPA 1Q2UA 2NXJA 1U9IA 4YJ2B 3RT7A 1QRRA 4MLPA 1LLFA 2PAFA 4LW8A 2HRQA 3IJ5A 4Z6KA 5ALIA 1H2ZA 4YMTA 3UUFA 3D0QA 2Q5QA 3U0BA 1BAPA 1SKUA 2BN4A 2AKYA 1ECLA 3RRBA 1F2UB 1GDDA 1GDTA 4EQ6A 2VP3A 1MRNA 4BDTA 3OCZA 3ZEIA 2QUAA 4MI1A 3RYCA 3EIHA 5I7HA 3OOJA 2XYPA 5JZBA 1LVUA 2OOKA 2DUJA 3I05A 2Z04A 1OROA 3RRMA 4AZ3A 1LF0A 3T99A 5G3ZA 2FVXA 4QLOA 1P33A 1AQIA 1I7DA 3PNQA 4WY5A 1NRXA 1WLSA 3ZK9A 3K4PA 4C6HA 5IT4A 3PEUA 4QTTB 1Q6YA 1MO3A 5FNVA 4HWKA 3IR7A 2QTCA 4BVFA 1D0VA 1ECCA 1VE6A 4TL6A 3WIEA 3OJ0A 4GZLA 5IBQA 3N6XA 4H7IA 2CDCA 1QBGA 2OHOA 4UTPA 3LUCA 2AYYA 5FYDA 4ID3A 2DFDA 2BTEA 3H5OA 5BOSB 1Z7WA 1RFLA 1GPAA 2PXXA 3A10A 2IV3A 2JFVA 2CYBA 4RZHA 2G09A 2UYOA 1NQ5A 3OA2A 3SS9X 1AKNA 1XEXA 2J7KA 4TMZA 4NBNA 4W5JA 4II2A 4HAYA 2I80A 1YDWA 1FP2A 4U0JA 3O8NA 2O20A 1YB2A 5EWMB 3A3OA 1GRQA 2X9QA 1ZD8A 3LP5A 4BFWA 4ER0A 3UXHA 2WUDA 3CBGA 2G8LA 1YHYA 4MWGA 5C5IA 3JWPA 3K9BA 1VYTA 1F4VA 3NH6A 4RXMA 4C08A 4PYRA 4KO2S 1RLTA 3L0SA 1PGQA 1OV4A 3R0QA 1DELA 1ND6A 1N0VC 1SIOA 2I1LA 1OZFA 3CSSA 3L8GA 2FPUA 1YIOA 3NKVA 3ZOKA 2H8GA 5AVWA 5FOSA 1N32B 1B74A 4PQRA 2EKBA 4CF4A 3SVTA 1DC8A 2WWRA 1O5OA 1ZP6A 2R1TA 3WQBA 4AW9A 5KOHB 3U6KA 1KE2A 3TDMA 3KAPA 4KW7A 4A3SA 3T5GA 3IVRA 1QTIA 4NDAA 4CM8B 4PYOA 3RTCA 1PK7A 2X22A 4K88A 4NOJA 3PDCA 5D84A 5FHQA 1M83A 2QQ5A 2V7UA 1DAOA 4B33A 1TZBA 3PBKA 2EP5A 3PCRB 4XFDA 1EE2A 4IIJF 1GFIA 4AM8A 5B3LA 4Z4QA 1JFVA 1T26A 1QZXA 5K09A 2R2AA 2ZVPX 1CVRA 4JHLA 4PWYA 5CLQA 5I4KA 3HUUA 3I04A 3OM8A 2BRUC 2JL1A 2OHVA 3A3PA 3SVZA 4W5NA 2GO1A 2GPAA 5E1OA 1AURA 2QORA 4BNUA 5E6SB 5ICGA 2VJOA 3O75A 4C78A 1L7MA 1JQ3A 1TQ2A 4C0QC 4E70A 3MIZA 1I33A 3JQEA 2HREA 5BSKA 5E6RB 3VKHA 3H19A 5UKDA 4MI3A 4UARA 1DO8A 5L4SA 3DL4A 4MWBA 3P0EA 3F6BX 3BZUA 2CLDX 1XR3A 1O6GA 2ZRLA 4BEVA 4PGHA 2HW8A 3DAGA 4K9NA 1L6RA 5IASA 4TL9A 3ZWNA 1QONA 2ASEA 3LXXA 2GMWA 4F6LA 1YRHA 2FN4A 4X20B 1TOAA 4Q4HA 5FBKA 2B8EA 3DW3X 4RMNA 5JLJA 3HNRA 4FYYA 4KAJA 4K9OA 4NJEB 1RDFA 1V11B 1XZPA 4D42A 2Q5EA 2IF0A 1U3VA 4PSVA 1NX6A 2FHSA 4FBGA 5IVKA 5BW6B 4LQDA 3IXQA 5FA5A 1D4OA 3TGPA 3QIAA 4X66B 3V4RA 2EARA 4M49A 1HE4A 3FMGA 1JR6A 3KZXA 1QKIA 1MEJA 1Q84A 1R5NA 1G2QA 2VSYA 1W94A 3IBGA 2J9RA 4EGJA 1B26A 5CA0B 1GL3A 1FP4A 2CJFA 1TK9A 4C43A 4LMBA 1ZD2P 4RDIA 3JARB 2WOJA 1L5YA 4WAUA 3VR4H 2GAIA 5JPDA 3AHIA 5FBVB 1C8VB 3O6VA 1B15A 5H0IA 4LZAA 4DM4A 3W5BA 4DLYA 2LCIA 4HVLA 3RVLA 1PQWA 4F6RB 3TLJA 2FZVA 1XJQA 5E0OA 2AF4C 2DKNA 4NBVA 5E7JA 2DWPA 2B6NA 4M7OA 2Z5LA 1D4FA 4R2MA 4WE3A 1N8NA 1YJAA 3I52A 4JQCA 5ALFA 1XWWA 4G1BA 4J1QA 4ALJA 3PEWA 2VTKA 4GVLA 2EFCB 4F5YA 2OYSA 3ORYA 4CCSA 4GYYA 1P29A 3NHRA 1NAIA 2N42A 5HMLA 3WLPA 4C9BA 1AD2A 1FQJA 4Q3EA 5FV7A 2PLWA 1DIOB 2HT6A 4GMKA 5JYBA 2Q1WA 2WSIA 3WLLA 4J4TA 2VL7A 1B0UA 1A7KA 1UIRA 1HTWA 1B3BA 2FK8A 1O6ZA 5DO9A 5EZYA 4DR1B 1XHEA 4YRBA 4BZXA 3AW8A 4G4JA 2A1UB 5CDTA 3NHLA 2I8AA 1SVLA 4B1FA 2I3ZA 5J47A 1TMKA 4KH0A 1HFWA 4G23A 1PDOA 1V5EA 2VRCD 3LBAA 3B1VA 1TLFA 4LNAA 3H7AA 1PQUA 3Q3GE 3EX7C 4CN8A 1XZJA 3JAWB 2YWCA 2I6SA 4XE5A 1QB7A 3EPRA 4JJ7A 2NUPB 4KN5A 2O06A 3THRA 1T4CB 5IC5A 4BE9A 3QYJA 3BWBA 1EVEA 3FPHA 3MILA 3V2GA 2ZSAA 3L05A 5DOZA 3B20A 1XUOA 1LPOA 2X13A 4W9RA 1KL7A 4BQRA 1UBNA 1W6UA 1XB2A 5CH3A 1L7DA 2MSEB 4DJFC 4YJ3A 3SVLA 1O87A 2OB2A 3D8SA 4IINA 4OK3A 5EOVA 5GZ3A 2F62A 3P96A 3K2IA 1C7FA 3NDJA 1FFAA 2AHRA 1NVAA 4W5HA 2ZREA 1QFZA 1LDYA 4J0JA 1M1YE 3PJEA 2NX2A 4O2AF 2XQVA 3C3BA 5CG2A 2CYAA 2FSIA 3NAZA 3HKEA 4Z7QB 4PNHA 3O2NA 3U7QA 4MP8A 3NGMA 5GJCA 3PJRA 2WTEA 1H2BA 4B79A 3GH3A 1KI4A 1FUIA 1YOVA 2YBEA 3AETB 3BUSA 3LCJA 2QAGB 2QYHA 3QW4B 3Q0TA 4G8BA 2O2GA 4OP3A 4E7PA 1WOYA 2R1VA 3M2PA 4LF8B 3ID6C 4NPHA 1E79D 1VSQA 3HQ4O 5HF8A 2GWHA 1RI2A 1LDMA 1X80B 1OIVA 5KYTA 5B1EA 1RZ3A 1N9ZA 1PK9A 1VHLA 3IUMA 4FUQA 4R7ZA 4UPDA 3VISA 4Q3NA 1CY1A 1FQWA 1KFJB 1LVHA 4KO3S 4H3SA 4A4DA 2G70A 1NN5A 2D1RA 2QTRA 4UREA 3RSGA 1T2EA 4FOSA 1ZVKA 2H51A 3LQQA 1YNOA 1DEKA 1RKXA 1ZLXA 2E4YA 2PQ0A 4ZC1A 1A7JA 1HE3A 1FFBA 3C3CA 4OJQA 1J1UA 3F5FA 2UVQA 3LGSA 2FPRA 2VOJA 3EFBA 2ZB2A 3EFOB 3BFVA 1ARZA 4CM9A 4BCBA 5KZMB 3FMOB 3ZQUA 1E7YA 3UJCA 3A11A 3M1AA 2CXXA 1M1YA 4MR9A 3ZX4A 4O2RA 2EF1A 2D74A 4HXYA 3EIFA 1E9FA 4MVJG 2VRCA 2V3WA 1U5AA 4DGSA 5EWLB 1OLOA 4I99A 1L4BA 1W8IA 1H8EA 2HQSA 3RS3A 3FBGA 4X91A 1BJTA 4CKCA 3D6TB 3BH0A 3CZ9A 2JFHA 3F6YA 1UWLA 1W85B 4RCZA 4QXAA 1KO8A 3VHXA 4DHEA 5DT2A 1E9VA 4YONB 1KJ8A 2BH9A 5LSAA 2XR1A 3QGMA 2P2CA 1FB5A 1WMAA 1FTQA 1YJQA 2BSAA 3L1VA 3Q1LA 4D5EA 5IWCA 1XZGA 4MITA 3AP2A 1KY3A 5ESWA 4H7DA 3F78A 1RPNA 2RK3A 1XCMA 4FGWA 4QUEA 1Z6GA 1EK1A 5F77A 2OVBA 3A3NA 3AFGA 5KYGA 3C5EA 4I1IA 2I8LA 1PJRA 3LCMA 4TV8B 2CD9A 3ZHQA 1KRXA 3FZEA 1V5GA 4QNMA 1JP7A 3WZLA 2JFUA 3QUCA 1NPDA 2AXNA 4KXQA 5TNXA 4DLKA 9LDTA 1MEEA 1XIVA 1XZBA 1VHQA 1RJFA 1L8OA 1SURA 1Q15A 3EDYA 3IOCA 1QIHA 2PT9A 3I1JA 4G67A 4JASB 4NRDA 5G41A 3RU7A 3V42A 3UBTA 1M7GA 4YWJA 4C4PA 4TLDA 2Y1GA 4MCAA 2WNHA 1Q7RA 1VCMA 1P5ZB 1SOVA 1V8ZA 1JHRA 3R5HA 2VSOA 3UB2A 3CCFA 2A35A 2BBOA 1FJ2A 4B3MB 2FJPA 2EWVA 5DH9A 3FF4A 3LVRE 2GD6A 2LIPA 1JU4A 3I4LA 3QXCA 4NFSA 2YRFA 1E79A 3B89A 5HVNA 5AKGA 5C7YA 3Q85A 1J2EA 5F78A 2F17A 4YT8A 2FR8C 4BN0A 2PWYA 4B7ZA 2DQYA 3AG5A 4JA0A 1N2BA 5KHAA 4CFYA 1IB0A 2W8BA 4C14A 4E30A 4S1TA 4M1KA 4FFRA 2RI1A 3LKZA 3A4YA 4BDSA 5GAJA 3GHHA 1RJ9B 1T2UA 1V4VA 4MTCA 3EZLA 3TL6A 4HJXA 4CV2A 3S1LA 4G4SP 1IZ9A 5K3DA 2BKUA 1E3WB 1YDEA 3B3FA 3VZBA 4ARVA 1GTRA 4QU9A 5KINB 2QI9F 4O8CA 3CS3A 1H9BA 1K9VF 1Q21A 2ENWA 1ULZA 2QD4A 2C8JA 2QQEA 1SKAA 1AIPA 3D0KA 3CZQA 1H65A 2WWVD 2GKGA 3I92A 1C3EA 1QAQA 3BGVA 1E58A 2X0IA 1B93A 2K5UA 2PT5A 1TF2A 2YH2A 3IDZA 3UMBA 2I7DA 5ALKA 3TBFA 3EBPA 1Z62A 4P7GA 3ONVA 2FV8A 2XNJA 3M6LA 1WB5A 2Q6TA 5EN4A 1JI3A 3P27A 1XJ5A 3BJIC 3C85A 3CSUA 3KCNA 3R6WA 3UNXA 2XYHA 1XN1A 4Q6BA 2A59A 1LUAA 3RUEA 1WLYA 1XRNA 1NJ8A 2SKEA 4EQZA 2QENA 5DNYB 3HCEA 1E2MA 2OHFA 3KB2A 3KXKA 4X7PA 4GYKA 4FZRA 5HJ7A 3UJNA 2WWWA 1AUPA 2K2QB 4Q7QA 1G9SA 1C1HA 1L1EA 4LYDA 3NUQA 1DG1G 2OPBA 2OOSA 1H0KA 3AR6A 3TW0A 2WWHA 4ME6A 5BN3A 4W9NC 2Q3CA 2ZRHA 3K1AA 2HCJB 4JSRA 1HE8B 1K6EA 4V0NA 5TT1A 3I2HA 1JFSA 3EE6A 1XTSA 3OT1B 1RM5A 1RW4A 1RXEA 4NV0A 3W9BA 4C30A 4ZMRA 1DUSA 3DBHB 3KV1A 5C9ZA 1AZSC 3FUWA 3KSUA 1V16A 2G82A 5IXJA 4Q12A 3EBLA 2QX6A 3R3UA 1HTTA 3JR7A 4P9NA 4RVGA 3STTA 1CJVC 1UMCB 3ZV7A 2CLEB 3LV8A 2H92A 1MNQA 4W6ZA 1NIJA 2GDZA 3FR8A 4JENA 3U31A 1LI4A 4ZKDA 2OD9A 1O8BA 1M1XB 3R6TA 1YQXA 5KNDH 1OB2A 2BSQA 1ZD9A 2O2HA 1JAYA 4OXYA 2NVWA 4RD4A 4QNRA 2GF0A 5EP3A 3UUGA 3PXBA 2PGLA 2G9VA 2EFJA 4O4JA 2PWZA 1WQ4A 3DQZA 3Q3EA 1NMZA 2ODEA 4BLPA 4DLVA 3PU6A 3WFIA 2QTWB 5BXYA 1SC3A 2YFKA 2RHCA 3PQCA 2CLIB 2Q45A 4H4EA 2HEIA 2FE1A 3GGPA 2CV1A 4O02B 4AWAA 2ZRPA 1JG6A 4UD2A 2I4NA 4R83A 3OZIA 2PJRA 4UU7A 3KPJA 3WIDA 1HQDA 4CTOA 1Y33E 1IEXA 4O5OA 4WUVA 5GGXA 3VVCA 1MKYA 4YLEA 1X87A 3FI0A 3OT4A 4KRFA 1T5HX 2VSXA 3CJTA 4QRDA 3V55A 4EPYA 5K3EA 2YHAA 3ISTA 2X8JB 5J3JA 1S2GA 5BMVF 3LA6A 2HJVA 3R9IA 4DL9A 2QSUA 4DXAA 5ED4A 2F1KA 4WY8A 4D9BA 3R0XA 4I81A 5FTKA 3EG9B 4BE7B 3BGDA 4YALA 2TMYA 1YIAA 3T1QA 5BMOA 1LX7A 1YCHA 2IXTA 2LD4A 1HDGO 2B5VA 3FYSA 3W6NA 2VF4X 2XHZA 1G16A 2G5GX 5LP6B 4Z2AA 4E2ZA 2ZIWB 1ABEA 4E88A 1CRQA 1JALA 2R7NA 1P17A 4REQB 1YMUA 3L0IB 3OD5A 5I7FA 4EY5A 2N1MA 4UEKA 4A92A 3S40A 3VU9A 4MVCA 3IDFA 2VUIB 3K31A 3CPHA 1SUSA 3R9XB 1EM8A 1I7PA 3E9EA 1WXGA 2ZLBA 1UBLS 2QXUA 4MWEA 4N0EA 3TZLA 4BO5A 1PR6A 3W2GA 1PR0A 1NP6A 3ZCQA 1XD9A 1UP6A 1E9AA 1IXRC 1WNFA 1Q7BA 3DXFA 4PS0A 5K03A 3U1BA 2BFMA 3KT6A 2ADOA 1IY9A 2P9ZA 4LBWA 1YCDA 2BFDA 4OB6A 4BAZA 1OUMA 3JZMA 1RRMA 1MTZA 1PUJA 4QJ5A 3LRXA 4YRZA 4JL6A 4DG8A 1JQLB 1C8KA 1HE5A 2BGUA 2PYZA 4P86A 1FBNA 4YIHA 1FXSA 2LCFA 4GGOA 2WIKA 4RSGA 2X86A 2Q3EA 2W0SA 3LO5A 3WRYC 2C77A 4JUCA 1GKLA 1PEKE 3BOSA 1G5QA 4MEJA 5FHRA 1VQ1A 1AS0A 4C05A 3A1CA 4TM8A 1U2GA 1T3TA 3QVGB 1YC5A 3U4QA 1T2NA 4IRMA 5ERYA 1K63A 1GTG1 2J46A 4D9FA 4PZDA 5DM2A 2J31A 2OG2A 4GKJB 5ICCA 4QREA 2R86A 3NHMA 1KEVA 4O0LA 1WCWA 2C98A 2PKXA 4DMMA 4MHTA 5CLJA 4HH4A 1RKVA 2F1HA 2P1RA 4PZPA 5IYZF 1UXIA 4DTIA 4PNZA 2WFMA 4PR3A 3TR5A 4YJ3F 3NHZA 1E20A 4HGZA 1I1HA 1J0AA 1EK0A 4XM1A 2V65A 3ZQJA 2XA1A 2AS0A 2IYFA 1LDEA 3O3NB 1DXQA 1SR8A 5JSYA 5EJEA 2IT1A 3B6KA 3EH1A 3FETA 3MLEA 5CHEA 3RASA 4JP8A 4B3HA 4YYZA 2BE9A 3EPPA 4W8OA 4XVRA 1DQYA 5ALSA 2AE2A 3MA0A 5REQB 3NHFA 1SBTA 4IF6A 4P35A 3RHTA 4H0CA 3RSOA 5KOJA 1AKQA 4J03A 1GCGA 1KPHA 3GEIA 4Y2GA 3X2FA 1U3TA 3NH9A 2A1TR 2R1UA 2GEDA 2JFGA 1G5HA 2WYOA 1YGPA 1NQVA 3NWBA 5HS6A 2GCOB 3LRPA 2JJYA 3L46A 3M5DA 4RKYA 1L1FA 4A6DA 2HPAA 1VG0B 1PI3A 1TUGA 1KO5A 2VBCA 3QY9A 4JBNA 3L0DA 3PXGA 3AV3A 4KFUA 3TNJA 3V1UA 3JRWA 4C2BA 3DPIA 3TNFA 4HS9A 1M7HA 5DXAA 3W8NA 1EUZA 5CCBA 3PL5A 3WGOA 1G8KA 4O8ZA 4OHWA 3H1PA 1QGZA 3ME5A 5SZHB 3GZ4A 3MXTA 3K1JA 2PDAA 5K4AA 3MGCA 2FWMX 3EAFA 1MV5A 1W0KA 4PXYA 1MQ8B 4XLZA 3RYIA 3G7SA 3WB0A 3F9IA 2BI8A 2YFHA 5JTTA 2ID9A 3AFNA 3E7DA 5CEFA 1VG1A 1NVGA 1DJNA 4E5SA 5JXJA 2BGGA 1I4DD 4TLCA 5G4LA 2PQMA 1DJOA 3Q9SA 2WWYA 5TQ2A 3Q7RA 4PC2A 2WJJA 3ZK7A 1VLQA 1E77A 1ZUNA 1DBVO 2QRVB 2LKDA 3QFFA 5TQ0B 4B6OA 5A4FS 2O8BB 3UK1A 4AG3A 2GHRA 1EQAA 1N2CB 4YAEA 4JC4A 5LA6B 3NEPX 2KHZA 2IVZA 1DBWA 2BM8A 2Y1KA 1XQVA 2G0NA 2GI4A 3W2HA 4RGQA 2BEWA 4BQNA 2B82A 3BHMA 3NBXX 1PSZA 4H4CA 4A7PA 3QVSA 5EE0A 3M9WA 3KYCB 3KVOA 1Z75A 3HN7A 2A6PA 4TWIA 1NW6A 2EGHA 1DE0A 3EW7A 4GR5A 3PXDA 1OH7A 3OBBA 3CNLA 2XQGA 3ISJA 4N18A 4MQ5A 4PXAA 4DKXA 4O2BA 1M6VA 2QVGA 4FE4A 3FW1A 4CUKA 1Z5UA 3P4YA 1UXGA 2IK8A 3K0AB 3H7IA 4RIFA 1TJ5A 1KAMA 1KS9A 3FPLA 1THGA 3JALA 1JJIA 1PHPA 4RTJA 2Z3WA 3D8TA 1DOZA 4NZOA 3CVWA 3B13B 1HFJA 4D6YA 4A8JC 3FPSA 3T3HA 1T1IA 1O6FA 3FYHA 3PWKA 4PNPA 3DL2A 4WBSA 2H8KA 4LNUB 4MWZA 3H0CA 2Q3MA 2IYLD 2RHOA 4Q18A 4AB1A 3R77A 1D2GA 4X71A 3DMDA 2Q1SA 5AUQA 5K8LA 1O0CA 4IWNA 3WI7A 4LGCA 1C5KA 5DGDA 2HI0A 5A6VA 5FQNA 4EBFA 5KSOA 1UOQA 2J48A 3U13A 2CKMA 3THYB 1RMQA 1YVEI 3AEUA 4A16A 1OXBB 1Y3IA 2O4UX 1ZMBA 1NJ1A 3A1FA 2C0QA 4LYAA 2HXYA 4P7FA 4L5BA 2CLOB 1XRLA 2YXDA 4GVPA 1XMIA 4MV9A 1KE1A 1XCGB 1I4WA 1W48A 2ZYAA 2NW6A 2BD0A 4M1YA 1M76A 4PLFA 5KS2A 2NO7A 3TUZC 3UUEA 5E6UB 1M8GA 1RXUA 1SQ6A 3FKSD 4OBWA 2VT6A 4DA6A 3QP9A 1KAQA 3QELA 3DMPA 3HDTA 3ZQ6A 1WZEA 3EEYA 1K5DA 1QOPB 4TT3D 1YK0A 1NTRA 3DTYA 2ZI5A 1OWNA 1OXMA 2XITA 4C7BA 3H2HA 2R7KA 2VKQA 3NIGB 3MAJA 2ZCVA 4N40A 2HJWA 3C97A 1IB6A 3E5HA 3O0DA 1IQRA 2X9GA 3HPQA 4XAQA 3K92A 3V8MA 4ABTA 1NF8A 1AQUA 1P2DA 1WUJS 1V9SA 1Z22A 4KR0A 3A4TA 5A3QA 3NNDA 1YVRA 2CHUA 4H9GA 1T8UA 4KRXA 4ANFA 3M3PA 5HCIA 1GLNA 1U1FA 3ZXIA 4YN3A 2PZAA 4B0PA 3VV2A 4ZCIA 1ML4A 2HMTA 5H59A 5IAJA 3KETA 1HR0B 1AKRA 1MJ5A 4UDNA 3TIGA 4G8DA 2FN3A 3KKMA 4K9KA 2GSDA 4IEEA 4TQUS 4CJXA 2FSUA 5BSMA 3NETA 3R24A 3NI2A 2BM1A 2HBQA 4IYJA 3P26A 2PQ2A 3WYNA 3DEZA 4QEZA 3KKLA 1T0PA 3E03A 4L8GA 4GPIB 1OWOA 2QU8A 3D6AA 3LDFA 5M7EA 1KORA 4OHFA 3SXUB 3T4UA 3WKDA 4R51A 4BNKA 4JLUA 1D0IA 4MSUA 4OXIA 1NGSA 2UV8A 1BWPA 4MIEA 2DERA 4UZEA 5JT1A 5CU7A 3QF4A 5FI0B 4CMJA 1SZPA 4GLJA 3EQ7A 4C87A 1MR3F 3DLIA 1F5NA 1RNLA 4LI0A 4PFSA 4X7MA 4ZI7A 4RZIA 4ESHA 2AXPA 4FFBB 4BP9A 1UBTS 3Q5GA 2P35A 5KTKA 3I5MA 2Z8XA 4NOKA 4CU5A 1DIRA 1HX7A 3CPEA 2H4JA 4JROA 3K4QA 4RPCA 4OHVA 10MHA 4O4JF 4J43A 3GVXA 1VKNA 2CMGA 2OAGA 2IU0A 3U9TA 3ANLA 3KJEA 4QXQA 3KU4A 1LTHR 3DOIA 4FQ7A 4HTAA 5EERA 1UJMA 2QLBA 3BQMB 2JZCA 4OFXA 1C7RA 4P22A 4YJKA 1KDRA 3F49S 5DE3A 4X8HA 3W6PA 1N1MA 4ARZB 1X7ZB 4MYHA 1A72A 2DBZA 1DLJA 1KY4A 1JEYB 4OYYA 1I9CA 1YDFA 5DRTA 1KJNA 4RXUA 4OYRA 3H5RA 4DCCA 4URVR 4AU1A 4DVGA 1JDZA 4QHTA 2OCYC 3AEYA 2IEZA 2C2KA 4RCYA 4TT3A 3SEFA 1H42A 1DP4A 2JJ2A 2JH9A 3CEJA 4IOMA 1X70A 2FZCA 1W0CA 3RHFA 4AXXA 2Q1XA 1EJ2A 3OCYA 4CG1A 5FTLA 2DTEA 1Y6RA 5AW2A 1IY1A 4J0KA 2VP5A 2MTBA 2V7TA 1T5BA 3BL5A 5J63A 4GYJA 3A1EA 3LDUA 1J8FA 2GD0A 4OBEA 3L7CA 2IYQA 2BMJA 1YNSA 4NARA 4YP7A 3TTYA 1D8AA 1DSSG 1EGAA 1IOVA 2EJUA 1A4IA 1GQRA 2WAYA 3D2CA 1IXKA 1MJHA 1WVMA 3GCGA 4J2HA 1D2EA 1M2KA 1CUEA 2JD0A 3H9JA 1ESZA 3OF3A 1Q1AA 4XARA 3U49A 5AKLA 1WPXA 4OOEA 2YZKA 4AJLA 1NMSA 1V3UA 3QQPA 3G89A 2H5IA 4K46A 1NG9A 3AVQA 5YASA 2OXEA 3SJCA 4J0EA 1U2PA 1XRSB 1CRPA 3A1VA 3O8OB 3OIGA 3DE6X 2BDUA 2KLHA 4TQGA 3GNTA 1T91A 5TXGA 1OAAA 1V5FA 2O07A 4P3KA 1DT3A 5EKXA 4GOOD 2OZKA 4ZQCB 1TYCA 2QN2A 4HNQA 4EJ0A 4ZYXA 4Z4CA 1RLJA 2IP4A 5BWNA 5FWXB 4W5TA 1YDGA 2EX0A 3A6HA 3HJRA 3EY4A 1FE8A 3BHIA 3TQRA 4BAUA 4E4YA 1L8AA 4FMPA 2FLWA 3SQOA 1R00A 4NNJA 1DMRA 1NXQA 2C2YA 3ECCA 1B0AA 3P20A 2NYRA 5ERGB 1KI6B 4K9LA 2DEUA 1DDGA 1C29B 5B1DA 1CQJA 3FGNA 3IMGA 4P33A 5EL0A 1OREA 5JFOA 1WXQA 3T5CA 1QFMA 1WY7A 2XKAA 3NFYA 1KDZA 3ILHA 4CKBB 3PFCA 3WX0A 4S04A 1WQ1R 2LIVA 1QK4A 5IARA 5AW4A 3GLFE 2Y1DA 3AF1A 4JP1A 3ITNA 4M0KA 1TQ4A 4WA8A 5JTUA 2D6FA 1O95C 3GJTA 3ZGNA 2JLWA 3AOEC 4AJ2A 4XQEA 3RVPA 4M6WA 1Z2DA 3WWYA 4JDUA 1PV1A 2QJOA 3D0RA 3BXGA 1SOAA 2JFPA 4CQLB 1P7ZA 1VLLA 3E1KA 2WIJA 3MT8A 3Q8KA 2QZZA 4PYNA 3NRCA 4GC9A 4OUDA 2XZPA 5EKUA 4E3WA 2ZB4A 1UMBB 3GA5A 2DY1A 2ZJ1A 1SELA 3BXOA 2YDYA 1A96A 2HF2A 3W77A 2PCLA 1LDGA 1GKYA 1OFHA 1SBIA 4UHDA 5AI6A 2OZLA 2V6MA 2V97A 4UULA 4XX1A 1RE0A 2D54A 1L5RA 1RCUA 3D6MA 2F4VB 1YWGO 1WSWA 2IPAB 3KTOA 3M49A 2OXRA 4PC3A 2C3UA 3AR9A 3QEBZ 3EFHA 3V3KA 3Q15C 4DR5B 1PJAA 1UQUA 2BBSA 1UPCA 3QBVA 4YCLA 2C5FA 3FNIA 4GGMX 5ALDA 5EJMA 2QR2A 1WDTA 3Q0IA 4BKUA 4EHJA 1GSAA 3GLFA 1TVMA 2PVSA 2JGIA 1KZ7B 2I3BA 3ZG6A 5P8WA 4DRZA 3I5AA 3UVEA 2WOOA 3SIRA 1F51E 2WSBA 3ZHZA 2FSHA 4B6JA 1K06A 4G0OA 2IY7A 3WYDA 1ZGJA 3QUQA 4KO8A 3SD7A 2G83A 4MMXB 3CUUA 1N33B 1Y8CA 2FPXA 3GFFA 4NJMA 4OV6B 5SZIA 3CR7A 4RTMA 3EDCA 1Z0JA 2R6JA 1KQGA 1CEQA 1FYEA 3D7SA 4L75A 2GHIA 1FLNA 1KYXA 4B3TB 1KYTA 4DAEA 4ZALA 2VQFB 3C39A 3GEDA 2JFNA 2BKAA 4A15A 5JJKA 3LI2A 3OTOB 3ROFA 4I14A 4DC1A 4HDRA 2Y1WA 1I8TA 4G2TA 3EYAA 2O7NA 3OKAA 3VC2A 3BWCA 2DPXA 4BFSA 5MHTA 5C5DA 3T15A 4MYUA 4CT4B 1OBHA 4H6PA 1QV7A 3BH7A 1K4KA 3FUTA 1DGQA 5BNZA 2AOTA 2EG5A 4QZVA 3JWGA 1TK3A 1Z18A 2VJNA 3LL4A 1XLTC 4IMIB 4Q7EA 5TV2A 3R76A 4C21A 3OWHA 5IKMA 2J67A 1M72A 5JWHA 1CW2B 2W2KB 3D7MA 3EGXA 2I87A 3BM5A 2HB6A 4JA2A 4F85A 5B12A 3FYCA 4X1IB 2WJYA 2YJZA 3ZHSA 1UJBA 1JHAA 2Q0SA 1V26A 2PU7A 3B38A 3M1LA 3OE1A 2HTFA 1E7QA 1I9GA 3B48A 3HCWA 1DIHA 4HV4A 3M89A 1XD2B 3TW6A 3KSAC 1EFUA 3DLCA 4O2BF 5B2EA 4V1CI 3UB4A 1VIAA 2VAPA 3H5NA 4RZSA 4XW2A 1RLIA 2FKNA 4B4KA 1UPBA 1UANA 4GWKA 1VXRA 1I3NA 3FTQA 4X62B 4C6SA 4DQDA 3F97A 1KYWA 4DMUB 3ZDBA 4JYPA 3OPYB 2ZSIA 1P7CA 1FDOA 4LBVA 2L69A 3HP1A 4XYBA 2VTVA 5KYUA 1MG5A 4H31A 2QTMA 3QBJA 4Q7JB 3UMGA 4OP2A 1YB4A 4DJJA 2BRUA 4Q3CA 1EQUA 1H0RA 2OV4A 3CZMA 4TWZA 1K66A 2YHIB 3IBYA 4XOIA 1GCAA 1NNI1 2VJAA 2J7PD 2VPYA 3G5MA 4CQMA 2QE7D 1KOFA 1QFJA 1TQ8A 2YMPA 2ZSJA 3MTQA 4HTFB 4CQNA 2JW5A 2Q5OA 3ABRB 3QOFA 3E3NA 1YZQA 3OEWA 3GB9A 2WV9A 4Y6LA 1XHFA 4DNXA 3NTVA 1JWBB 1XVAA 5DLEA 3TKYA 5CYOA 4LZNA 4QOFA 3S44A 1O96B 2GEUA 4REOA 1O08A 2JFOA 2D8MA 1FDSA 3BULA 4G01B 3ZVKA 2QQ0A 2PBFA 3K72B 5A5DA 1IXYA 1E9EA 3ZJYA 3ZWKA 3VKVA 2O3QA 2F3SA 2H9AA 1VPEA 4LXQA 3WRVA 2B5OA 4P4GA 4X60A 2X9VA 1XVLA 4YJ2F 1C9EA 4IIVA 2J6BA 1X39A 3BWDD 3OQIB 4UNRA 4N6GA 4PGMA 4JI0B 2ZK7A 3FTCA 3WLKX 3ONEA 2OZEA 4U0KA 2WU8A 4CLHA 1P2SA 2Z9CA 2IU3A 2BKEA 3ZU2A 4DGQA 5ALYA 2AOUB 4F92B 5IK2A 1J09A 4R8KA 3USCS 5JZVA 5ICSA 3ZKWA 3EZ2A 4ZEVA 4NULA 4QOSA 3AUJB 4KI7A 1BE6A 3GLGB 1Z36A 3K9CA 4I4TA 2PWPA 4JLNA 1E92A 1V71A 4RNDB 2W00A 3VMMA 3X1DA 1HH4A 5IP5A 3ML1A 1JYSA 3C1UA 5KO2A 4BU0A 1G63A 5ETJA 4R5MA 5KNLA 3QI2A 2P5YA 4RMHA 1L3IA 5CD9A 5F4ZA 1TVKB 2V7QA 1NONA 1PT6A 2FGKA 4ZO7A 1UPAA 4GX0A 2Q1YA 1DIBA 3VSEA 4KC0A 1JU9A 5ITZA 1PWYE 4D96A 2GRUA 1CQZA 3QU7A 5H83A 4YV1A 1S4MA 3TFOA 1QPZA 1F1JA 2HRZA 1B6RA 1WHTA 1L4HA 1X0XA 4RAOA 4S1WA 4Z5XA 3I39X 5C80A 1FYWA 1T0BA 4MPRA 3RDPA 5HWSA 5TMBA 1BXRA 1KVTA 1NVFA 3BXZA 3P5SA 4BVEA 4INPA 3AI1A 1IBLB 2WZBA 4FNGA 1JKMA 4WXEA 2IY8A 1T2VA 3REQB 2PUWA 1WTCA 3Q5DA 4MW0A 2ZU6A 3WGYA 1W19A 2AEEA 3DQQA 2QL7A 5J2UB 3W06A 1PSDA 2VSQA 3GXBA 1JZTA 1H2EA 1RBQA 3G6KA 2BT4A 3H5IA 3GG9A 4NYMQ 2B6HA 4V0LA 3VPXA 1QS0B 5JQGB 4C6RA 1SHTX 3RARA 3ZCUA 4WJLA 3TDKA 5JCJD 1PFVA 3TQCA 1JA1A 4BMCA 5F5XA 5CFQA 1PBNA 2J7PA 2REQA 3UGQA 4MARA 4MUGA 5DNEA 4G4SO 3FDXA 3LP6A 1KKLA 3PUHA 4B7AA 5BRAA 2XYRA 4D80A 4IJ6A 4HO1X 1UODA 1T9HA 2AFHB 1PYOA 5E3JA 3DTVA 2Q4OA 3G59A 4YWHA 3HXQA 3ABQB 2PGIA 2IZ7A 5ECYA 5JAIA 5DGIA 3EXHB 2P8SA 1TX4B 1N2HA 1V6CA 3D2BA 2FH5B 4U00A 1NU6A 3CEAA 3CNNA 4YNBA 3RIMA 4AZSA 5DGTA 5C32A 2DPMA 3C3KA 1K2VN 1V6AA 3WK9A 5L53A 5JVDB 1SU6A 1ZINA 2ZJYA 3P1JA 2JI6A 2RGEA 3C6BA 1SU7A 3VNRA 2ZRBA 3M1YA 3QWAA 3DTTA 1GAQA 3D4LA 4NYJR 4OQPA 4ZVOA 1HO3A 5TY0A 1RAGA 2R0QC 1YONA 3B1FA 4WCFC 4TV9B 1PGNA 1U3GA 1SKYE 4QQNA 1ZAKA 4GL4A 1FDVA 4PYKA 5JSZA 3EZGA 2FZLA 4KOAA 1CVIA 1UEJA 4JT9A 4Q05A 3K6JA 3PNPA 3GH1A 2QRHA 2ZUSA 2XUAA 3PPXA 1QPBA 4O4LB 4BNTA 1NJ5A 4QGBA 2P8JA 5CM9C 2HA3A 2BFNA 4HWTA 3I3SR 1N1DA 3E81A 4OD0A 2HLDD 4ZVKA 4V3CA 1C2TA 3B6EA 2KS6A 3W3ZB 4BQEA 1RZRD 1JEOA 2YWRA 5C2JB 2Q4DA 2GLXA 1W44A 4BN5A 5FEMA 5BWLA 5LWHA 2FEMA 3HY6A 1QO7A 3S2EA 2HRDA 5DHFA 2AG8A 4D8YA 5D6NA 1FLDA 4JELA 2GR9A 3DEYX 5ALJA 1KDYA 2QL5A 3QXHA 2QW8A 5GIOE 4Q9NA 2AH5A 5ESXA 1ENZA 3D43A 4E12A 3DZGA 5G4KA 2XXBA 4HUTA 4KKVA 4LCBA 5ERXA 1X9HA 3TWOA 4GLOA 2HEGA 1Q7TA 4ZGWA 2D1QA 2K6GA 1V8DA 4FEAA 3LBHA 3V4PB 3B8HA 1IOWA 1BX1A 1ZM4A 4AZWA 1U8ZA 1L1RA 1Y42X 3WO0A 3AHCA 5HKBA 1GAXA 1T0UA 1C7QA 4NPCA 4DVJA 3EVCA 2CFOA 4NEQA 4TTJA 4YACA 4AK9A 5BSWA 1OVMA 2C1EA 2G7ZA 2SECE 3BRCA 3MVEA 3NDRA 5ARCA 2PZEA 4FFWA 4RLFA 3QQ5A 3HWX1 4L9RA 3OLCX 5JBNA 4TSFD 4TTSA 1T0IA 2HU8A 4WVLA 4V0MA 1E2QA 1EA7A 1E0DA 2ONYA 2XB9A 3OPXA 3C1OA 3L8CA 4PLZA 5SY4A 4YASA 3CT4A 5FOXA 1E6LA 3EOAI 3UG7A 4M9ZA 1VHDA 1Q17A 3CC8A 1CNFA 2OQ2A 3H04A 3L06A 4TS1A 1N5JA 2CHQA 4WCDA 1T8PA 2C42A 3PR3A 1U0JA 4XXHA 4OI0A 4NMXB 2F8TA 1A9OA 1X7YA 2FAXA 3PHLA 2DWQA 3NM6B 4MWTA 3I8XA 1R0KA 2XTJA 3NGLA 2IYTA 4P80A 5JLAA 1KMCA 2O0MA 4DYDA 2IZ1A 3WMFA 3QKTA 2VJBA 3UTCA 4QLBA 5IUNC 3OZGA 1KBQA 1UPUA 3LBFA 1ZVMA 2HHJA 1XZMA 2PT7A 1YULA 3AP3A 4HDSB 1RI4A 4PCUA 5DMXA 5G3YA 1DAKA 3RS7A 1UM8A 3RTGA 4F21A 4S1NA 2NMVA 1CUYA 2R62A 3NNSA 4CV3A 2FR8A 4AJNA 1JF8A 1O9HA 1R6UA 2VXYA 4IH1A 1ULUA 3BKWA 4CG3A 1BOOA 3HLTA 3H42B 4N48A 3F71A 2CXOA 1OI7A 2C03A 1NLMA 3PFKA 4Q1DA 1NWCA 4HAVA 5LJIA 2CVFA 2WG2A 3GBSA 3K20A 5DRYA 2EFGA 3CH7A 3CKLA 4G5GA 4FNAA 5HE8A 2XWPA 1RP7A 2A4KA 1FFXB 1T43A 2PPLA 2RHBA 4ND1A 5ELMA 4RGBA 4AZ0B 5IAKA 4HEQA 1XZHA 4P5EA 2O3SA 4LUCA 2IYWA 2XUJA 2V0CA 4G07A 4PFQA 4TMYA 1DKOA 3OKCA 3K53A 4DSTA 4F04A 1BVYF 1GARA 1GDHA 2DRIA 3JQAD 3TUIC 3I64A 4OMUA 5DWVA 2EQAA 2ZJ3A 2WA1A 1DXYA 1QHHB 2UYGA 3BL8A 3WGMA 5EXTA 5I5EA 2WWGA 1HMYA 3NW9A 4NATA 3VYWA 5MN4A 1H2RS 3O7WA 5C7LO 4CEHA 2CJWB 3D8BA 3NIFB 4P3XA 5JXGA 1UFVA 2IYOA 1TGYA 3L7AA 4K86A 1ND5A 2G36A 4ND6A 1TEXA 2FMUA 3H0KA 1YE5A 4R8MA 5AK0A 5DCUA 3V5NA 2A1TS 2J6IA 3WB9A 4ZMBA 4C88A 2NXNA 1RVDA 1X86B 1E9SA 3GZNA 3I01M 3B6JA 4W9NA 5FTMA 5JROA 4L9SA 2VR1A 4A1FA 1M74A 5KNDA 3JQQA 2BGMA 2QRGA 3DD1A 3TMKA 3EHDA 4XIFA 2XADA 1Z6XA 1J4AA 2JGEA 4M98A 3H5AA 5LYJA 1Z4IA 2ZBDA 1LA2A 1U2SA 5F2KA 6ADHA 1H1DA 3AUUA 2D1YA 3ST7A 3I12A 3GGCA 4ILKA 1THZA 3A9VA 2V54A 3BJZA 3TBHA 1KC3A 2YQ5A 1SHJA 3R44A 3FYTA 4L85A 4U7TB 4LYEA 4GX5A 1EXWA 5JI3E 1Q7CA 2DC1A 2VF5X 1QQ7A 2R47A 3TIVA 3TSOA 9LDBA 2XMSA 3V1MA 3F7TA 3FPKA 2A5LA 3QHAA 4L1KA 3GIDA 4GDMA 3A1SA 3NHUA 2XYVA 4NOMA 1UT6A 4RVNA 5B1YA 1TQ6A 2QTHA 3H4VA 3ONFA 4J9UE 2CMHA 4IFIA 1EWQA 1YI0A 3GDGA 3COPA 5DX1A 4O4HA 4B3XA 2FJ0A 4MAAA 1C0PA 1WABA 4J2TA 1Z8DA 4FMCF 5B6IA 3DUFA 3HXLA 4K6OA 2OKCA 5K3AA 4QRIA 2XRZA 2FPLA 2RGYA 3ZWXA 2OORC 4I50A 3HP4A 2ZVJA 1FDTA 4TV8F 4OHCA 4D41A 4RZXA 4DNQA 2RSLA 2W58A 2YUIA 2OQIA 4ZT6A 1R6XA 2P5TB 5TF4A 1G7CA 1U8XX 1XZNA 4UDOA 1QNLA 4XFKA 1EPUA 1LLQA 1NQUA 2IOHA 2IYPA 1PZEA 3DKVA 2DX7A 1Y4UA 4ZYTA 2FZ5A 1K88A 1CJUC 4FGZA 2D00A 3DGEC 1YUNA 2XIJA 2UZ0A 1PUIA 1UKZA 4FYWA 2R25B 3C3MA 1HM5A 3DZFA 3TQSA 3ZH9B 1MDFA 5DVZA 1NVKA 2M9MA 4M4SA 4RJTA 7MDHA 1GD1O 4I4TF 2JAOA 4RIHA 1VIMA 1YL7A 3PFFA 4MQEA 5CIQA 3LXMA 4BIIA 3S5JA 1UFQA 4RZUA 3VU0A 4YR7A 1PK8A 3FTPA 1P2GA 2QIOA 4FC6A 5F9MA 4BXOB 2R9VA 2HLHA 3MJTA 2WPDA 4BFLA 2ILVA 4HYEA 4JHXA 3QLVC 1EH5A 1JKJB 5EQDA 1X38A 1SWVA 1PR9A 1Z8NA 3PHGA 5KCZA 4RPKA 2JLZA 1UZMA 2FG6C 5HRUA 3PIDA 1NUAA 2UAGA 5FULA 2ZI3A 4GMDA 5BSGA 1SQ0A 1KYIA 3NWEA 4H0NA 5AR1A 5IJAA 3EQ8A 5KC8A 1H6CA 2GZDA 2ZUDA 1MB9A 4HLQB 1GQYA 5DNCA 1UBCA 2PL5A 1QB8A 5L7TA 2HK8A 1Z5GA 2JFXA 1CUCA 2R3SA 4I9HA 3QZUA 1V95A 4C76A 5KQSA 3D6JA 1F7UA 1ZXBA 3A3KA 1XQ6A 5ULLA 2QRJA 3TLBA 1XA0A 3GRFA 4QELA 3DDHA 2XIQA 4EY3A 5DMHA 4YRPA 3WRYA 3W8RA 3N8KA 1UCFA 2OUKA 4E7OA 3RUPA 1YA8A 4U2EA 2NU8B 3NBFA 3KWJA 4IOJA 3DZDA 4NECA 1I6WA 1DCMA 1UFRA 4WLVA 4RTLA 4KIGA 3WV4A 2QAGC 1MJGM 3JZIA 1EINA 4M83A 1GGEA 1UADA 3NTOA 5JDIC 4HD8A 3W4KA 3WE7A 4HAOA 4NEHB 1FRZA 4OL9A 2C5SA 5HJ2A 1XU9A 4BVLA 4EHDA 1CYEA 2XUZA 2NNLD 3M9LA 4LK3A 4R9SA 1T6NA 4URWR 5DLYA 2HZBA 5E4JA 4B09A 1Y8RB 2QAJA 5FUYA 4B6FA 1SWWA 1PL7A 3TJZA 2CD7A 2GVZC 2VBIA 2X5XA 1YR1A 2YQ4A 5LMCA 3L7IA 3BJMA 4ND2A 3Q9UA 4ITUA 5L3VA 4JY7A 4YT2A 2P9EA 1FS4A 4YC7A 4BN4A 3P0JA 1N2GA 2MR6A 3GQVA 3O03A 4GXTA 3TQQA 4CLDA 3JTEA 2NACA 4K3UA 5JHHB 2DCMA 2FPSA 1TYBE 3L4BC 3IL2A 3EAQA 4BEWA 1E2JA 4BV2A 3GCXA 3DMFA 4YXFA 2CKDA 4C22A 2HM7A 4FDTA 5HQJA 1JQDA 4ZCMA 3ZY2A 5HGXA 3FIJA 1R8JA 2CUKA 3OOHA 4BP8A 3EOZA 5ARBA 3E9ZA 2IYXA 4JODA 4BGEA 2J5RA 2PAAA 2VA9A 2YZ7A 3DWIA 3G79A 3KR9A 4HQKA 2XUIA 1KU0A 2IELA 4LWPA 4RA9B 4ZVTA 3SHTA 2WTUA 3D1VA 3LUFA 1XX6A 2NSYA 5ECGC 4YPOA 5A3RA 1ZH6A 4FQ8A 3QYPA 1Q19A 2IEYA 2V5AA 2PH7A 4IMJB 4EGCB 1XZCA 4I3FA 4L08A 3STYA 4ASUA 3CCCA 2ZJ4A 4KDRA 3TSZA 5T7BA 5LZ4A 3MWKA 3R6DA 5BR7A 3WIUA 1A5SB 2YUTA 1FW8A 4R8RA 5D3KA 3NHBA 3TKLA 2O0JA 3I8OA 3CURA 2NU9B 2EU8A 3GJ8A 3UJHA 2CBGA 2I7TA 1JJVA 1V2HE 3AESB 3R8XA 5HQ3A 1SGWA 1V1MB 2CCKA 5IT9A 1N0UA 3VR1A 2YHBA 2GEJA 4B40A 5C7OO 5JMWA 5BUSA 1KPGA 1O7JA 4R6WA 2CT8A 1U9JA 1DJPA 3HRKA 3N8DA 4LS3A 1JH9A 2J4DA 1NF2A 2DWUA 2VPTA 5T3YA 5DXFA 3TGWA 3ZWVA 1WKVA 1ZHOA 4HQ0A 5DGHA 1U8AA 3O5AA 4NAHA 3NM4A 4AF7A 2D3WA 2C3MA 2BI4A 3JD2A 4KWHA 4WN3A 2JLVA 2GBIA 4IV5A 5ANRB 1ISFA 4LZLA 3WXBA 3DO5A 3BT7A 4DJDC 2ZXEA 1PR4A 2ECKA 2LNDA 4KTTE 3L04A 1VJGA 3M5WA 4ESOA 2RGGA 4DMFA 2ZQ5A 4HLDA 1RWWA 2NZWA 3V46A 4N7BA 1ZONA 1DC4A 3FMVA 5IAEA 3KXPA 4ROSA 1WMBA 3LVQE 4HAZA 4OATA 2JLAA 1RADA 4U39A 5KX5A 1BA3A 3S0JA 2WYUA 1EUCB 2RIPA 4IPTA 2YW2A 4AF8A 1HZJA 2I5PO 4IIYA 4FB4A 3PQ2A 1GV0A 1DG9A 1NR5A 1P0FA 2A57A 4U2FA 1K3FA 2BAGA 2C9CA 3R7WB 2XA9A 1Z3IX 2PX5A 2TMGA 1MFPA 4O6VA 2PUJA 1QH9A 4ZK2A 1CPYA 2GCIA 3RTBA 3GEPA 5A6SB 1PNVA 1FVHA 1YB5A 5EKDA 4Z0TA 2E4WA 4FINA 1I1QB 5ALZA 4KIJA 4LJ6A 1GSOA 4QQFA 4R41A 3QEMB 2RK6A 4KN8A 5FPQA 1NQAO 3AIOA 3MSXA 2DKFA 5I7WA 4M9UA 3R74A 3AIKA 4JBGA 2KM1A 4WT7A 1QYVA 2I91A 3ZJTA 3ERCA 2FNAA 1L5MA 5CNMA 1Y9EA 4CU2A 5F1OA 1JDBC 4O4IA 4NXMB 4HN2A 4JZYA 3PD0A 1M2VB 3MRXA 4V2IA 2NT4A 1PQYA 2BFFA 2RGNC 3HYLA 3W9SA 1N2SA 5DN9A 5EJIA 1ZM3A 3RH0A 5LQDA 4F5ZA 1BCSB 2PMDA 3IBCA 3UTDA 4MIOA 2AD1A 3NTLA 2C3YA 1US8A 3C3XA 5ALGA 4ND8B 1QIKA 3VHLB 4C7KA 1UXHA 3H18A 3ZWBA 1D4AA 1V43A 3WSWA 1H5QA 4BFTA 1G8SA 3Q2OA 1QCZA 2ZYUX 1LBTA 1AGPA 4XIGS 3K94A 1B76A 2HQ1A 3KB6A 3NHYA 3PC6A 4KZPA 4TYPA 1J0XO 4J0QA 4JI2B 1U4OA 4DILA 4YLGA 1TM3E 4NBKA 3AKZA 5G0SA 2IUTA 1CIVA