5CURA

G158e/k44e/r57e/y49e bacillus subtilis lipase a with 20% [bmim][cl]
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
179
structure length
179
Chain Sequence
b'HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDETGTNENNGPVLSEFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIELLYSSQVNSLIKEGLNGGGQNTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 70
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5curA00
1RP1A 1E8NA 1UT6A 2XMSA 3H2JA 5ALKA 4Y2PA 5DNWA 1XRRA 3ZLVA 2DCMA 4AXBA 3L1JA 3G9ZA 4BC1A 1U8EA 4XWGA 2QTBA 2LIPA 1ACLA 3D2AA 3NUZA 4J0GA 3BJMA 1CQWA 3DCNA 3SC2A 3H2GA 2HA2A 5KWJA 3ZLUA 3ESBA 3K6KA 4DNPA 1JMKC 1OILA 2JGEA 3AZPA 2GBIA 2WM2A 3M81A 1K6EA 3LLCA 3EQ8A 1ISPA 2XUIA 5JARA 3C6BA 4CIAA 2HA7A 5CH3A 2BUBA 1EX9A 1AUOA 3R3WA 1MX9A 4K5QA 6YASA 1AC5A 1E66A 4YK7A 5D3ZA 4ZWNA 1CUWA 3L1IA 1DTEA 1G5FA 3WMRA 2C58A 3T52A 4NVRA 1QO7A 5AM5A 4DMFA 1CUIA 4HRYA 2JF0A 3QM1A 3T4UA 1W6RA 3R3VA 4QLOA 1DT5A 3FYUA 5AKIA 1MN6A 4ZGBA 2PU5A 1UKAA 3F8SA 2P8SA 5AI9A 1YASA 2XQGA 1THTA 2CEKA 5YASA 5EIHA 4QDTA 3ZI7A 4E11A 5AHXA 4MWSA 5DNUA 4UFPA 2XDWA 2HIHA 2GZRA 2V97A 5A7GA 5H3HA 4YX9A 4PNZA 1E3QA 5DLPA 3F96A 4B7ZA 4QDUA 3UMJA 5D7BA 4FTWA 4FWBA 4CCYA 5AI4A 4L9AA 4XVCA 2QOEA 3C43A 4FKBA 1AMNA 4FLFA 1Q0RA 1RWQA 2ZSIA 1MNAA 5HZGA 3DEAA 3DKKA 3PE6A 5J3JA 2AJBA 3M3DA 1DWOA 3STTA 3G0GA 3WZLA 4OSEA 5SYMA 2WHQA 2CKMA 5CRIA 3HRHA 3H1AA 1VE6A 2ZYSA 2WJ6A 4DLNA 3PICA 1XZKA 4MYSA 1BN6A 1R88A 3DL4A 4AQDA 2ROQA 4J0JA 3B12A 3U0VA 4H7HA 5ALFA 3H18A 3D2BA 2DSNA 1CRLA 5BWCA 1TAHA 2EDCA 1CUBA 4H7DA 5JD4A 4GHWA 5T4BA 4X00A 2CJPA 4KEAA 5HF9A 2BAGA 2XMCA 5A7HA 3QZUA 2GBCA 2HDWA 4E14A 5CXUA 3DOIA 5HF8A 3STXA 3H2HA 1TKRA 4ROTA 2WTNA 4KR0A 5AK3A 5E4TA 4X94A 4X97A 5HFAA 1XZMA 3G8YA 4PF1A 4UUQA 1CUUA 2CZQA 4BCCA 1EDBA 4BB0A 3I6ZA 2HL6A 4FBLA 4G4IA 4Y2RA 2JGJA 1UOPA 1TQHA 1DWQA 3I2FA 4OPMA 2D5LA 4ARBA 2HA3A 2WFMA 1FFEA 5T4HA 3W05A 3H2IA 2HA5A 4BE9A 2XUOA 5LIPA 2OGZA 5ALNA 3W9UA 1QIMA 1A8QA 3WZMA 1GQRA 2WFZA 4YPVA 4C01A 3G9TA 3LS2A 1LBSA 1QIHA 1GQSA 1XQXA 3GZJA 1ZI9A 2XUQA 5AKZA 1VZ3A 2HM7A 4BP8A 3ANTA 3AZQA 3IIIA 1SC9A 2XQFA 4UBJA 4S0XA 1YA8A 3ICVA 4PSCA 1L7QA 4W1RA 4Q3LA 4G8BA 3R0VA 5DYYA 2XUJA 4Y2UA 4U2DA 1JFRA 2ZJ7A 4Y9SA 4WJLA 2VAXA 5ESRA 1Q0ZA 3ILSA 5CBKA 5BV7A 2WJ4A 4MEBA 3D4LA 5AKGA 5I8PA 3F97A 4Y2TA 2B9VA 1WPRA 5K3BA 1XZHA 4OB6A 1H23A 4H7KA 1EDEA 3D59A 1HDEA 1DINA 4RNCA 5HCUA 3A6ZA 1M33A 1THGA 5AH0A 5FPPA 3W9BA 3BIXA 2VATA 3FYUB 4LHEA 2BCEA 3DQZA 4LKOA 4OB8A 3ANSA 5C8XA 5CURA 4NMWA 3A2NA 5CT5A 5I7UA 3NGMA 1XZLA 3A70A 2H1IA 5AKYA 1CUSA 4K6KA 1DX4A 4UBMA 4A5SA 4B85A 1HQDA 4KE8A 3AFIA 3OOSA 2G5PA 4B84A 3IUNA 4HXGA 5CTAA 2IITA 4CCYB 4G1FA 5AI8A 4Y2YA 3V9AA 1GZ7A 4BP9A 4BTLA 4KRXA 4UBLA 1CUXA 2WIFA 3G0DA 3LIIA 5AI6A 1EH5A 1IZ8A 1LNSA 2V98A 5JIBA 1ZIXA 2BFNA 3C70A 1S8OA 3VVMA 1C4XA 3EQ7A 5AOAA 4KE9A 1QOZA 5ALRA 4DMCA 2R11A 3M82A 1VA4A 3IBTA 1JU4A 4HS9A 4WFIA 3WWDA 4RE6A 4AZ0A 3AIKA 1VOTA 4H77A 2QUBA 4UHCA 4DYHA 2AJDA 5AM4A 5JD5A 4DSAA 4Q34A 2O2GA 3AZOA 1DQYA 3HYSA 4LIPD 5A2GA 3PUIA 3I28A 3RKSA 4WCVA 3TGLA 3N0TA 4HAIA 3G7NA 3MVEA 4B6GA 1ETHA 1GPNA 2OQVA 2PSJA 4XJVA 3H0CA 1XROA 1MX5A 5EHZA 4BE4A 1QE3A 5AO9A 3A2MA 2WUEA 1H2ZA 3TJMA 4FDMA 2OGTA 4M0MA 4AMYA 2YYSA 3QMVA 3PF8A 2FUKA 4G8CA 5FLKA 1LPAB 4DMHA 1R3DA 3WIOA 4B80A 5C8ZA 2QXTA 3I1YA 4GECA 4QNNA 2QVBA 2HRRA 1BRTA 4BVLA 1XQWA 5AKKA 1VJ5A 3R3XA 2ZJ6A 4GWLA 4OCZA 4AZ3A 4C89A 5ISMA 4P9NA 4G4GA 1K5PA 1LPMA 3IDAA 3JWEA 2O2IA 4F5ZA 3R40A 2JGLA 1XLUA 1IVYA 2ECFA 2QXUA 2X76A 3NOXA 4Q82A 1T2NA 3WKBA 2XMZA 3WWOA 1FFAA 1EDDA 1BN7A 3WLAA 4BATA 3F98A 4KYVA 4BCDA 1BEEA 3YASA 4H35A 2PSDA 5FPQA 4BDTA 1N5RA 1YR2A 1WHSA 4EY6A 1WOMA 1LBTA 1TIBA 4FHZA 3GA7A 3P2MA 4B83A 4H0CA 1Y37A 2C5FA 2OCLA 1XRPA 2Z3ZA 4QDXA 1XZAA 2Y2UA 4I3FA 3VJKA 3FLAA 3ZWQA 3WWPA 3HZOA 5LZ8A 3WL7A 4LYEA 5IVIA 3UUEA 1SOMA 3LCRA 2BKLA 1XZDA 4EY8A 2I78A 3G9XA 4HTAA 5EIAA 1IZ7A 4CI9A 3WI7A 2RI6A 4KAAA 1P0PA 3QYJA 2C0PA 4N8EA 3E0XA 3B3QA 4FOLA 5JZSA 3H19A 4UPDA 3AIOA 3VKFA 4QWWA 3BDVA 1EK1A 4F60A 3AINA 3QMMA 2JGFA 2V9ZA 1H2YA 5CXXA 5KWIA 5AKLA 3D3NA 4X91A 1KU6A 4UBNA 3KDAA 2HU5A 5T4EA 1QIFA 4JYPA 1H22A 4MWTA 1BROA 5DNVA 2XUPA 1N8SA 1XQYA 1E89A 2QR5A 1YSCA 4UBOA 3OTQA 2ZYIA 1DWPA 1K63A 4OYYA 1E8MA 5K3CA 3U1TA 4NS4A 2HU7A 3BL8A 2ES4A 4U2GA 3AUKA 5HKAA 3FVTA 3HLKA 1CUFA 5ALEA 1QONA 3F9CA 4X95A 1ZD3A 2QM0A 5JADA 2RHWA 3DD5A 4Q1VA 4GLBA 1MJ5A 1VZ2A 1K4YA 2BJHA 2B20A 1FSSA 2CBGA 4UHHA 4L72A 3KWJA 3FBWA 5FRDA 3OURA 3FWHA 3EQ9A 1A8UA 1QIKA 2CB9A 5ALLA 3STVA 3HABA 2DHEA 1W4LA 3D5EA 2VAVA 5HK8A 2WIJA 5LZ4A 2ONCA 3W06A 4HZGA 4OB7A 5ALIA 4AO7A 2PBLA 3WYNA 4DGQA 4FFWA 4ZREA 4F21A 5ALPA 2OXEA 2Y6UA 3UUFA 2QT9A 4L0CA 3G0BA 4BZZA 4HXEB 1ZICA 3EIOA 2VQ6A 4ZV9A 1W75A 1QTIA 1WCYA 1I6WA 4A23A 1MNQA 3MGAA 4C4XA 1ZJ4A 4X85A 4HVTA 1IUNA 1LPPA 4G5XA 1J06A 2O2HA 3CXUA 2WQZA 1EB8A 2AJ8A 1VKHA 2HADA 2OCIA 4IH9A 3S8YA 4CCWA 3FCYA 2VT7A 5JZBA 4IO0A 4IH1A 5CT9A 2XLCA 1BCSA 1U4NA 2Z8XA 3KOOA 4GI1A 4X6UA 4LXIA 3IUQA 4H7IA 5A7FA 3L1HA 4X3CA 1AZWA 3I2GA 1UKBA 5AK5A 1CUDA 3CN9A 3QPCA 4DTCA 4I19A 1CUZA 2WKWA 3BXPA 3R3UA 1X70A 2WUGA 5A71A 4GBGA 4AN0A 5DTJA 3RM3A 2WJ3A 2XT0A 4X90A 2WUDA 1P0IA 1CV2A 1G42A 1ZD5A 4MEAA 1UFOA 1YCDA 1DQZA 3E3AA 3WA6A 2QRUA 3QMWA 3VISA 1ORVA 1R50A 1UKCA 4BRZA 2G5TA 2VEOA 2WFLB 4IH4A 2OAEA 1B6GA 4KAFA 5DTIA 3OC0A 3C45A 3FVRA 2J3DA 3QPAA 3D0KA 4KE7A 3B5EA 1G4HA 3O9VA 3PFBA 1TRHA 3ED1A 2O7RA 1OXMA 4B0OA 2K2QB 4UBIA 2Y6VA 4AMZA 1TCBA 2WIDA 3R3ZA 4EA6A 3IUJA 4QLAA 2V96A 3OM8A 4K6GA 4Y2QA 3W04A 4XIIA 1YAJA 3O95A 5LZ9A 3C8DA 4J0IA 1Q84A 4ARAA 4E46A 4TPKA 2PM8A 2OAGA 2W22A 5K5EA 2WHRA 5EHQA 3DDUA 4LYDA 2WIGA 3GBSA 3FCXA 1MO2A 2PVSA 1C7IA 4UBKA 3DLTA 5FOQA 3ESDA 3WKCA 2QMQA 5AM3A 1ZI8A 5ALUA 4BTVA 1H2XA 1EHYA 3MUNA 3AJAA 2VJBA 1UK8A 4WDQA 4MXDA 3PF9A 4IHAA 3ZPXA 4J03A 3WKAA 2ZVDA 4RE5A 4KRYA 3JYHA 2JEZA 2YXPX 4FBMA 2HFKA 3G02A 1T4MA 4FLEA 5JYCA 4Y2SA 2IX9A 3D7RA 4ITVA 1PJAA 4UHBA 1BE0A 5JD6A 1XZEA 5LZ7A 5FP0A 2YASA 2JEYA 1F8UA 1EK2A 4K6HA 4W9RA 4QA9A 1YB7A 4DNQA 2XMRA 3PI6A 2O7VA 2XUFA 3O4JA 2Z3WA 1VLQA 3H04A 4BCBA 4BVJA 4P08A 2DHCA 2HA6A 4AO6A 2IIVA 1YS2X 3WQHA 2DQYA 1ORWA 3GROA 5JZ9A 2VF2A 1OCEA 3JW8A 4QEKA 2XMGA 3FLEA 4PSUA 1XRMA 5HK9A 1ZJ5A 3AILA 4G4JA 4QZVA 3CCCA 1XFDA 1QIEA 2NW6A 5K3DA 1LZKA 2DQZA 1ODTC 2WG1A 3WYDA 3C8HA 3KXPA 5DJ5A 1MAAA 4B0PA 3DJYA 3BJRA 5AKJA 4U2EA 1W76A 5HKBA 4KAJA 1VXRA 4GDMA 4AN1A 2EDAA 3FSGD 4CFSA 5LYYA 4ZXFA 5EHXA 3WWCA 3BF7A 4PW0A 4KACA 4HRXA 1XKLA 1J07A 3KWFA 1VE7A 1GGVA 4FLMA 5C7YA 1DU4A 4CIBA 1XKTA 3WIBA 1G66A 3VJLA 1LPBB 2XUKA 1U65A 4AX4A 3HI4A 5T4FA 5IKXA 5LZ5A 1MAHA 4M0EA 4PO3X 2G4LA 2I03A 2ZJFA 1F6WA 4WY8A 2H7XA 2Q0XA 2C7BA 1GKKA 2PPLA 5E2IA 2ACKA 1IMJA 5AM2A 3V1NA 2H9YA 4X6XA 1JMYA 1CR6A 5EFZA 5E4YA 1WPXA 5AM0A 1SCQA 1LPNA 3ICWA 1TK3A 4A16A 4MYDA 5LKRA 3G9UA 5ALDA 4BZWA 1UWCA 1EVEA 3AIMA 1QO9A 4Y7DA 1QTRA 4RGYA 4ZV7A 1CLEA 4C4YA 2FJPA 3I2KA 2ZYHA 3WKDA 3C6XA 5CW2A 2RONA 3Q0TA 2XUGA 1O6FA 3ESAA 2RGUA 1LPOA 3G0IA 3FYTA 5IVHA 2PSEA 4X93A 3BE8A 3HACA 1CVLA 1GPLA 1X2EA 3STYA 2VJCA 3HJUA 4Q05A 4Z49A 4Y2XA 1HLGA 3EF3A 5D3KA 5LKAA 2WFLA 4JNCA 4DM7A 2JIDA 3C6YA 4KE6A 3V1LA 3MUOA 1UOQA 5AOCA 2PUHA 5HF5A 2XE4A 4W1SA 4EY7A 4O08A 4U2CA 4C6HA 3WK7A 1ZOIA 2W6CX 2UZ0A 2WHPA 1NU8A 1JJIA 4EBBA 2WG0A 5C8VA 3OPMA 5ALGA 4Q3KA 1WB4A 3HXKA 2BGRA 4ETWA 4DNFA 1QZ3A 3WK6A 2VSQA 5HQ3A 3FYUC 1ODCA 3WL6A 1AKNA 3PUHA 3WK8A 2DHDA 3DKRA 4J0KA 5CT4A 1Y7HA 3WK9A 4J0HA 2J3QA 4JUIA 4EY4A 4V2IA 2I3DA 3I6MA 4BVKA 4N8SA 5AKXA 5ALXA 2XB6A 3STWA 4AB1A 2YH2A 5JALA 5ALWA 1KU0A 1NX9A 4E15A 3I2IA 1RYYA 1AURA 4BC0A 5I9IA 3OG9A 1XZJA 4H7EA 4EZIA 3TRDA 3V1MA 5ALZA 5DYWA 3V1KA 4FNGA 2Y2VA 4QDZA 3K9BA 1XZFA 1D07A 1USWA 4P93A 5JAUA 3HC7A 3VXKA 1GXSA 1TCAA 4GXNA 4JH0A 5ALOA 1XRQA 4OD0A 2CUTA 1LGYA 2OPHA 3M83A 3R41A 3RARA 3C87A 5SYNA 1WB6A 1QFMA 2I3ZA 1VA5A 2JGMA 5JANA 1XLVA 3C6ZA 2H7YA 2C0QA 1JKMA 4BRSA 1N1MA 2AXEA 5HFNA 3GUUA 1CUVA 1SCIA 3CCBA 4EUSA 1O6GA 2C4HA 3CN7A 5CH5A 5ALMA 1MU0A 2XQJA 2ZYRA 4INZA 4G9EA 1QIIA 2WU4A 1XZIA 1XRLA 2B61A 1WM1A 2EEPA 2PSHA 1LLFA 3WKEA 2PL5A 4YASA 3WL5A 2ACEA 4H7JA 2PU7A 1A88A 5E4JA 1Y7IA 4PSDA 3KD2A 1EB9A 3X3HA 3LP5A 2ORYA 3VDXA 4BYMA 2GYWA 2QKYA 4XX1A 3F67A 5K3FA 2WLSA 5FXMA 2FX5A 2QJRA 4P92A 1UZAA 5EHNA 1GPKA 5IVDA 5JAPA 5FUMA 3H2KA 2WSLA 4OU4A 2VJDA 1FFCA 4OUKX 3DYVA 4U2FA 4GEGA 4MQMA 1JJFA 2J4FA 4MJ3A 1CUAA 3DOHA 1CIJA 4G8DA 4TVKA 3IURA 1HPLA 2Z8ZA 4BAUA 4LXHA 1IUOA 4C87A 2JBWA 1MX1A 1QLWA 1C7JA 2JGIA 2X5XA 1F0NA 5DYTA 1UXOA 2OCGA 4OYLA 5AKEA 1W52X 3H1BA 5CMLA 4EY5A 3C5VA 5ALHA 5BOVA 2XUDA 1K8QA 2DR0A 4WFKA 2XMBA 2Y1KA 5AP9A 5KBYA 1QGED 1LPSA 1CUHA 4NZZA 4QWMA 3SWWA 2Z5GA 5IH7A 1DT3A 2CMFA 4J0DA 4B9EA 2B4KA 3BDIA 3TEJA 1Q83A 3BIWA 4LXGA 2WU3A 3ZLTA 5JATA 1UOOA 2GBGA 1CUCA 2PUJA 3QPDA 2HHAA 3DYIA 1MT3A 5EIEA 1ZD4A 2G63A 4J3JA 5ALYA 1ZD2P 3O4IA 2GBFA 2RAUA 2FJ0A 1R9MA 4Y2JA 2BUAA 3W2TA 3IA2A 3WK5A 1H2WA 3I2HA 3V48A 2QJWA 2WHPB 5FDFA 5ALVA 3DL7A 3FOBA 5HQ3B 1E5TA 1HL7A 4M0FA 1CUGA 4UHDA 1MPXA 1CUEA 5F4ZA 3PFCA 4B82A 5JAOA 4H18A 5AK6A 4CG3A 3IVMA 1J2EA 5AJHA 2HFJA 3QH4A 2E3JA 4DIUA 4C88A 2J4CA 3HEAA 5CT8A 3NWOA 3BWXA 1CEXA 1WHTA 2OGSA 3RLIA 4C4ZA 1UK9A 2DFPA 4FMPA 4KJXA 2OLEA 1P0QA 4D9JA 4B81A 4WY5A 1SCKA 4X7BA 1ZI6A 1ZIYA 1CUJA 5EGNA 1BCRA 2WILA 5ALTA 1R9NA 4UHEA 4BAGA 5CT6A 1AGYA 5AIBA 2RHTA 2PX6A 1CFJA 7YASA 1XZBA 1FJ2A 5ALJA 4CG2A 3E4DA 3S2ZA 1CQZA 2QS9A 5K3AA 4QE3A 1Z68A 3GFFA 4BAZA 5AOBA 1QJ4A 3SK0A 3SX4A 3D2CA 5A6VA 1QIJA 4DSZA 4OU5A 4RPCA 3I1IA 4JEIA 3BF8A 5CH8A 1EINA 5ALQA 4N5IX 2ZSHA 1R1DA 3FSGA 1QFSA 4BBZA 4B9AA 5LZ2A 2HU8A 1CUYA 3WK4A 1YA4A 4N5HX 1GKLA 3WJ1A 4G9GA 1PFQA 3I2JA 4FFVA 3QBJA 1A8SA 4BDSA 2XMQA 1ZGCA 3E1GA 4DNOA 2OG1A 4J7AA 2PSFA 4F0JA 2XUHA 4UHFA 4N8DA 5FV4A 1HKHA 2OCKA 3WL8A 1EXWA 1DX6A 2HA4A 3FLBA 3WWEA 1F0PA 1NU6A 1MTZA 2XLBA 3I6YA 3KSRA 1SFRA 4L3WA 4X92A 1LZLA 5AM1A 2AJLI 2XQKA 1ZGBA 5LP1A 1QIGA 5K3FB 4DMKA 4PV7A 2GYVA 1UK7A 3R3YA 2OQIA 3GELA 3H17A 5AIAA 2VJAA 2H7CA 4WFJA 1JT2A 5JAHA 2AJCA 2HA0A 4Q3OA 5BWBA 4HXFB 4MQLA 1EVQA 1EA5A 4ZRDA 4GW3A 4IQ4A 5ALSA 3VVLA 1P0MA 1XRNA 2VT6A 1XZGA 4H7FA 3O4HA 3LIPA 3ZV7A 4FNMA 2C5GA 4UFNA 2XI4A 3PDCA 4W1QA 1JI3A 4W1PA 4K2AA 1XQVA 5AK4A 2R8BA 2VA9A 2D0DA 2PKYX 4TGLA 1W1IA 1HBJA 3QITA 4AO8A 4Y2VA 1E8DA 3DNMA 2GZSA 3C5WP 1BS9A 3QVMA 3N2ZB 5A62A 5EI5A 4ZI5A 2VTVA 5AI0A 5LLSA 2WG2A 2BGNA 3FAKA 3STUA 1U2EA 2WTMA 4EB0A 1XZCA 4X71A 1YS1X 3IB3A 3IULA 4U2BA 5FKJA 1TCCA 3WA7A 1AQLA 3K2IA 1WB5A 1L7AA 1FFBA 5DWDA 1X2BA 3A2LA 5KREA 1YAHA 1QIDA 1GT6A 4W63A 4UFOA 1A7UA 1IUPA 2XMDA 3FNBA 1XLWA 1BEZA 4I4CA 1BU8A 1JJBA 1ODSA 1B41A 1VXOA 1UK6A 2QUAA 3ESCA 4CG1A 4J0CA 5HF6A 5AKHA 2XUAA 1ACJA 5K3EA 2GYUA 2RIPA 4PQEA 1JU3A 2WUFA 5AI5A 4WDRA 1L7RA 3IUMA 2WIKA 1EI9A 4JYMA 3DS8A 3O9MA 3WJ2A 1FFDA 4EHBA 2HRQA 2BUCA 1AX9A 4QDOA 3Q8WA 3G0CA 1R4ZA 1YB6A 2X8BA 5C81A 3RK4A 5IVKA 4X6YA 1CPYA 2QZPA 2JGKA 5AICA 1KEZA 3O4GA 3EBLA 3VJMA 1N5MA 5D6OA 1J1IA 3O0DA 2XQIA 3HSSA 1PV1A 5JASA
chains in the Genus database with same CATH superfamily
1E6CA 1HDGO 4M89A 3H2BA 4EGCB 4Y2PA 3D5QA 4V3BA 5D3QA 4NCBA 1CTQA 1Z7YA 1RYEA 1XJ5A 3CZAA 4MR8B 4RC9A 1AF4A 2O8CB 2FFAA 1UADA 2DCMA 4J6EA 4R1OA 2VDPB 1CRZA 4IG9A 1ACMA 1RVDA 2FCRA 1IBCA 2OM6A 2A3RA 3G9ZA 4MB2A 4KSBA 3RLFA 4BC1A 2O23A 2RARA 3GOHA 3K09C 4J4BA 4PYQA 3D2AA 3NUZA 4Z0TA 1B0ZA 1IVNA 1JXAA 2O8VA 1NNI1 1I36A 2VJNA 3FHJA 3HFRA 5DYNA 5TRTA 4LDZA 4F85A 5KKNB 4DF3A 4LY6A 1XYYA 2RSLA 3IP7A 4ZVOA 1E61A 2O0LA 5IJAA 3KCQA 5KEIA 2EJWA 3NHAA 2J3EA 2D1RA 4DYVA 3DZKA 2NV0A 5IJ9B 1SN7A 4MGYR 1R3UA 2YMLA 2I6TA 3IBCA 2YVAA 1YONA 3AZPA 2I1LA 3HB7A 3M6VA 4E51A 1BXGA 2EERA 3GJ8A 3L5OA 4D96A 3ZV4A 3TCNA 1QMPA 4I1PA 1JDUA 4LSZA 1AGPA 2LD4A 3F0TA 3T6KA 3DZFA 16PKA 1OW3B 3AI3A 3O8QB 2X2PA 4QVGA 5CDFE 2IY8A 3K32A 4M99A 4DA8A 3PXCX 4FGLA 4NCXA 2J9FB 5JEDA 3VC2A 3O3NB 2UYCA 5K4AA 2HA7A 1WKCA 2VRCA 4U9IS 4AD8A 2BUBA 4EEZA 2I62A 2Q4EA 2CLFB 5K4GA 5DSXA 4G41A 5C1IA 4XWWA 2PLNA 4RVHA 2F43B 2AFHB 4DLAA 2DBQA 4EJMA 3VO1A 2J8ZA 5JR3A 1I24A 4ZWNA 1EVLA 1EIWA 4QHSA 1WCV1 3L1IA 3RSQA 2PRKA 3JTMA 1DTEA 2O6HA 4LRUA 1JEEA 1ZSVA 2YIVX 4F4JA 4KV9A 1XN1A 2EFDB 1B0AA 1ZUNA 2JH3A 4JFAA 4D79A 5AJTA 2VJYA 4KRFA 4DSTA 4ISCA 2PHZA 4NVRA 3B1KA 1QO7A 4TWZA 2ZDQA 1JEYB 2P7IA 4POOA 4AW9A 3GLFA 2B5VA 1U8YA 1GM5A 3SR4A 2YW9A 4PGHA 1LQ2A 2O2ZA 2QI9C 2QJFA 1A7AA 4NQRA 3T1HB 2IU0A 1WS6A 4YJ2B 1XD8A 3GJ3A 5K6AC 3QIVA 3L8MA 4AF8A 4RPHA 1W36B 2IOQA 4Z8YA 2YWXA 3A1NA 4MQ4A 2ZFUA 1UC9A 3A1VA 1DT5A 4IIDA 4QLOA 5D00A 5FA8A 4HRAA 5ENZA 3TH5A 2BT4A 2PANA 2V6IA 4D3DA 4OGFA 5DH9A 2QTZA 2QN7A 3ENZA 3QBEA 5AKIA 1TOAA 3KWMA 2OK8A 4LC1A 5JEEA 3K5WA 1E5LA 5ER9A 5B58C 1UKAA 4MJLA 2FZLA 3F8SA 3EXAA 3E2MA 4LEIA 4DZRA 1JJAA 3J7AC 1NVEA 2CFSA 3FPAA 4DCVA 1OWPA 4G5QA 2JA2A 3QKIA 1M34E 2HWUA 3PNBA 3KAQA 1XF1A 2CDNA 4ZKEA 4Q5IA 4ZYTA 4S04A 1IBLB 2CEKA 3IVAA 2PXCA 4XQEA 1DNPA 2NO1A 5DCUA 3HBAA 1G60A 1NG9A 3MK31 3W8EA 4Q18A 4ZMRA 5BY2A 4XYMA 4MWSA 3PYMA 2SCUA 1JH8A 1ZWLA 3BBLA 2XDWA 2V97A 3FHLA 3K0FA 5A7GA 5IXYA 4H3SA 1KK0A 3TQHA 1GAXA 1E3QA 4O02B 5B1HA 5DLPA 3LYUA 1YULA 3QNUA 1RZUA 5IYZB 3F96A 2AHOA 2SHKA 3TLYA 3P9YA 1KI6A 2AVNA 4O2AF 5DI3B 3RWOA 3T9FA 1RCFA 2CXQA 5DBFA 4CCAA 3N2KB 3H3FA 4TYWA 1EGHA 5FOSA 1WO8A 1KVQA 4CKBB 1GCAA 1VHWA 1VYVA 4L9AA 4BVFA 5KYXB 1HMYA 2C9ZA 4RW0A 1QGUA 2QR3A 5BN1A 5JPDA 3HKCA 1G3RA 1MNAA 1P9WA 3IMEA 1E0JA 3CSSA 4N5MA 3BN3A 4I8XA 4D6YA 4JQYA 4EFNA 4EO4A 5INTA 3DKKA 1WKVA 4TXMA 1FJHA 1PVDA 4RGQA 1EP3B 2O0MA 1F9EA 3QEOA 2BGJA 2AJBA 3AF5A 3I9FA 4UW9A 5A6SB 4X7PA 3RJMA 3M3DA 4U7DA 4KI0A 2HQOA 3LWZA 3B1XA 3G0GA 3BGWA 3FZQA 3TLJA 2WYWA 3CY6A 3KQQA 3SYTA 3HVJA 1UBMS 4DIKA 2XDQA 3THSA 1CS0A 3TXAA 1H42A 4UVGA 3ASVA 2WHQA 3LXMA 3T5DA 1KQ3A 4ETNA 2X41A 1XXLA 4PXAA 1X7WA 1MJNA 3ROFA 5CRIA 2QL7A 1Z88A 2P1RA 3HRHA 4YMIA 2NUTB 4ZT7A 3WVNA 1BVYF 1J39A 4PZ0A 4D92A 2BFPA 4J6FA 1ZONA 2QW1A 1CWUA 1AQYA 2X6TA 4YP9A 1E4OA 2Z04A 3I4CA 1KR2A 4KAXA 1AGNA 2OT3B 2VP6A 4DREA 1MHPA 1XCPA 2MSDB 2Q1UA 2BMJA 3A6FA 4R8RA 4UQOA 1G21E 4MNTA 1BN6A 4ZVRA 4S3MA 5HM8A 1G9TA 1QQ5A 3FM9A 2PR2A 1GZHB 2CUZA 1OC4A 3GDOA 3GLIE 4HAXA 3R3JA 3K9QO 2ZITA 4H7HA 5ALFA 4M46A 3D2BA 5LOVA 4PHFA 3TX6A 4IJQA 1XEWX 2FWAA 3DEKA 1TAHA 4RXUA 4JJEA 4NNPA 3OQHA 2CXSA 1QKKA 4MITA 4TVBA 4Y0VA 1ODLA 1BH2A 5DNDA 4LY0A 2G0TA 2EZ9A 3UICA 5DP1A 2CJPA 3TLEA 1H3EA 4KNWA 4ZO4A 5HF9A 4YUAA 2WRZA 4OQLA 3QZUA 4XWTA 4MRNA 1QTQA 1KHTA 1PJCA 4BLQA 3EYWA 3QTBA 5KQMA 2HDWA 1KOLA 3MWEB 3E05A 5CXUA 1NRJB 2JCGA 2ZBPA 4EDFA 5E2BA 1CQJA 4ZHQB 4MICA 4DQKA 3KIPA 2B21A 1TKRA 2W2LA 2X9QA 3K5IA 2ZB3A 2ZJAA 4ROTA 5BV2P 1GY8A 3TNFA 1RRPA 3FX2A 1Z22A 2PZGA 1K7XB 3E35A 2CC2A 2D8AA 1NY5A 3B3GA 3P0FA 4RANA 3AVUA 4UUBA 2XTNA 3MMPA 4S1NA 2D1YA 4F6CA 4GSKA 2VYQA 4TQ9A 3VNVA 3K53A 4PF1A 4IVQA 5D5HA 3RHTA 4NYJR 3TD6A 1E3IA 3HB4X 4FI3C 5JXHA 1XOIA 2BM9A 2HJHA 1V5IA 4UVHA 2CZQA 4LBWA 3LHKA 5CXQA 3NDRA 4HLQB 1JNYA 5HYVA 2QLTA 4XJTA 3IMCA 5GZ3A 2WF8A 2OD2A 3AMVA 5HUHA 3JAMA 4BJ6A 2QTCA 5FBHA 4XTRA 4V39A 4ZIRA 5BUZA 3RC8A 3COZA 4YCBA 1NF3A 2UZ4A 3FR8A 1G3UA 5J5VA 4G4IA 1JIQA 1SCNE 2PFGA 3A4YA 1VQ1A 2W93A 5JISA 1TQHA 1YKGA 2JIZD 1FK8A 3UIEA 5FOWA 1DWQA 3I2FA 4OPMA 4AJEA 4D56A 4CHTA 3EISA 1DXOA 3Q72A 4ZGGA 2V4ZA 4GR9A 3AHJA 1L9XA 2BFEB 2HA5A 3N1UA 1M2GA 1Z2DA 1N9GB 3LPCA 4P8RA 1UPXA 5A1JA 2BEKA 1VLZA 3NR2A 4GP7A 1RM0A 4K2HA 4YRTA 5IABA 3IQEA 3CZ9A 3BHJA 1NF2A 3NHJA 1O9BA 4U39A 3I6QA 4IQGA 5IN5A 3F3KA 4P4UA 4PTYA 4F21A 3A4LA 2Z98A 1HUQA 4BLPA 3BTVA 3I01M 3FNFA 3RU7A 1OHHA 1CRQA 3C98A 4DSOA 3BMXA 2XYQA 2YJTD 1KPHA 4RFVA 4ZPJA 2ZE5A 3LS2A 4NBTA 1RWNA 5JSKA 2EOAA 4DKXA 2CHFA 1QIHA 4MRMA 1GQSA 4G36A 4O4HB 4HD8A 3GZJA 5K1ZA 2Q3DA 1UZMA 5A0FA 1GSOA 1TC1A 2Q07A 3NTXA 1XAGA 1ZN2A 4DCCA 3OIFA 2G76A 2QG9A 2VAPA 4DHWA 5K8IA 4F46A 1JHRA 5A5DA 3Q8MA 2LE0A 4Q3EA 2OBLA 2PS0A 1WXHA 2VF7A 1JR3A 3GN2A 4G1BA 5H02A 3WIUA 2Z0MA 4UARA 2E5FA 4BP8A 5DYGA 5MF6A 4QEZA 3DG9A 2WF5A 1ZD8A 2WM9B 3B82A 4JWKA 5FEUA 1FFXA 2J07A 4I55F 5KYTA 1SC9A 2PJZA 1L5YA 3ZS8A 2C99A 4Z1MD 1Y4SA 2F17A 3K7EA 1C7QA 5C1PA 2W2VA 3NAGA 4KK4A 4ENUA 3IQFA 2P5TB 4RD6A 2JI8A 3GO4A 3G85A 2HRBA 3EGDB 2DM6A 4ZVPA 5CNKA 1DP4A 3UFXB 1Q5PA 2OEPA 2AD5A 3G1WA 3PI7A 4YQZA 3QFSA 4GC5A 5U4XA 3PTZA 1CZHA 2I8CA 5ANRB 4G5RA 5E6UA 1ZFNA 1SCUB 2FF7A 2ZROA 2IYPA 1U31A 2EX0A 1WD5A 4W1RA 4A91A 1JEQB 1C3OA 1YU9A 2G9RA 3B89A 3F6CA 4LYFA 5KC8A 4XIYA 1BW9B 1E58A 2BHSA 2HR1A 3QLVA 1YMUA 3SR0A 2GCOA 4H3VA 4I99A 3V4ZA 4EYQA 2AE1A 1JFRA 2O8CA 4ZVKA 4LVNA 2CCKA 4QD3A 3ND7A 1UBRS 4EO7A 5DKFA 2VAXA 4PRZA 3L0DA 4IDHA 4XLLA 2CL0X 4J9VA 5BV7A 2FEXA 1XA4A 1ZA2A 3JWJA 3GJ5A 1KNXA 1RBYA 1ESZA 3E9QA 3JQ8B 1NBEA 5KVQA 5JXGA 1H5UA 1MB2A 1U0FA 4MUIA 3VKVA 3RWMB 3UK0A 5BN5B 3ROTA 1Y1QA 2PO5A 5TVGA 3SLKA 1V9CA 5IJ9A 2WVHA 3MB8A 3IR6A 2A1TS 3L3BA 1Z5UA 2P4HX 3GUHA 3IMKA 5DCLA 1NSTA 1Y1KE 2YKGA 1G2QA 2HWYA 3A6LA 4B3RB 1WU7A 4J43A 3SNKA 1XZHA 4HRVA 1P17A 3CZRA 5MN4A 4PLWA 1Z6GA 1J6UA 5G0SA 1DEAA 1XDGA 3EVTA 3EODA 1L4KA 2J9FA 4G5YA 3M2TA 1TQ4A 2VHVA 4H7KA 2QSZA 2LBPA 3DWEX 1EDEA 4N0MA 1Y4DE 4JP8A 1C2YA 4MQFB 3H6KA 5F7JA 2HPAA 1EXDA 2VNSA 1FVXA 1BTOA 1E32A 1SEVA 5EJMA 3BZWA 2AFHA 3A6ZA 2QIOA 1WSBA 5AH0A 2VPWA 4HP8A 4OHMA 5FPPA 3RRJA 5L3ZA 1ECPA 4G0OA 4E6PA 3V1YA 3KZNA 1Y3HA 1UPFA 4BEBA 1R8JA 1K86A 2EVWX 3KKZA 4GBJA 4IWNA 4O5AA 4XQ9A 3WGLA 1DCKA 2GCGA 1QYVA 4JQCA 3RVRA 2IYLD 3DQZA 4LKOA 1KFBB 5C8XA 4NMWA 2VP2A 5FTKA 1SIOA 3A2NA 3WAJA 1YBVA 2A9RA 1QOPB 2QTNA 3AEUA 2PX4A 4CFYA 3RIMA 1QV7A 2FHPA 3RUPA 4DR3B 1C80A 5LNK1 5ELMA 1TJNA 1DC8A 1R9GA 2QMHA 4RZXA 4EUEA 3JQGB 4PHCA 3HDQA 1CUSA 4K6KA 1E2MA 4S2UA 2YMPA 2GWRA 3RTAA 2ZRQA 3HNRA 4L8VA 2EJVA 5ITZB 1PJRA 3C5CA 4B3TB 1U2QA 2OESA 4B4UA 3HCNA 2PXHA 1G5RA 1KJWA 4ZK6A 4LF8B 2CVZA 3Q6MA 2G5PA 1P5FA 2GHRA 5KSOA 1ISJA 1WR8A 2E89A 1CU1A 2QRNA 2NT4A 4QEDA 3HB0A 2OE2A 1WVGA 3ZE8A 5BNZA 2IITA 4B32A 4BQPA 5I4BA 3BULA 3GRCA 3T5TA 4H6XA 4I8IA 3ZHZA 5C8DA 4I6EA 1GNPA 4RELA 4ND2A 5C4MA 3LL4A 4QUAA 4DY4A 5BVGA 3AJRA 2MSLA 3KVVA 4E70A 5T67A 5EQDA 4TV9A 2WJZB 1I2MA 4BTLA 4M0PA 3B85A 4BYGA 1USVA 1PX2A 1FTQA 3T5MA 3SM3A 2A4MA 3LLUA 4MAFA 5REQB 2IS1A 2ZB7A 4IFEA 4MW6A 3OPYI 2GM9A 3AUFA 1SKQA 4A0QA 3O3CA 3LIIA 1EH5A 1LNSA 4JMLA 1R64A 2RGDA 3CPSA 1B0PA 2BFNA 4RZHA 3WJAA 1V1MB 1N6RA 3OA2A 2AXPA 4OJNA 2OCYC 4AMUA 1GTSA 3EQ7A 1EWRA 4BNFA 5LC1A 1D2AA 1L3IA 1QOZA 1T9HA 5IS2A 1QMGA 2GF0A 1N0WA 4RSGA 1F12A 4IW3B 2CL6X 1LBIA 2I2FA 2ZTHA 1QFJA 3JD1A 4MV0A 1IJKA 4IOKA 4DCOA 5CDUA 3L6CA 1ABBA 1KAQA 1MPTA 3IEIA 3PXEA 5D51S 3IESA 5JCJA 2O5VA 3UT5B 2C5AA 2YS6A 5AJUA 4WFIA 2XBUA 3LPLA 3NATA 4FCVA 4LVOA 4XJSA 2UUPA 1RRFA 3WLMA 2JRCA 1UJ2A 4HCJA 5AW5A 2BF7A 4EWLA 1HK7A 4RFSA 1WQ3A 3MQFA 1RU3A 4XGRA 4B45A 4EHAA 2HMAA 2Q50A 4YMLA 2BEWB 4HQ6A 4OQMA 1EE1A 4CBVA 4Q01A 1JMVA 2VJLA 4YQYA 5LMNB 3I6IA 4G1EB 1JKFA 2QD1A 3Q7PA 4X0EA 3X44A 1JF8A 1USGA 3EUFA 4LRXA 4O0MA 3QVVA 3PXGA 2A1TR 3TQSA 4LJLA 2ZIWB 2QNRA 2FN9A 2WJHA 3EVNA 1RRCA 2FLKA 2IH4A 4PTZA 4UU8A 5AM4A 1GKYA 5JJIA 4OUDB 2E5LB 3L4JA 1W36D 2SBTA 3CVOA 4BKUA 3IJ5A 4KQFA 3OQOA 1KK3A 2JI4A 2EKQA 5CG1A 3HYSA 4IQ8A 1VPDA 3Q0EA 4LIPD 1S96A 3C3XA 1V5EA 1DS6A 5IN4A 3PUIA 2QAJA 3DEHA 1FXSA 1LVUA 5JSUA 1S2IA 1V41E 2PH7A 4JVSB 2HIAA 3N0TA 4MWEA 1VCHA 1RXIA 3WGMA 2C96A 4L4SA 1KAEA 4LDQA 3MTIA 4C0LA 2DFTA 2H4YA 4BKOA 1N8KA 5ECWA 4LNHA 4B6GA 3AESB 5BYBA 3U44B 2OQVA 1VLLA 2YS7A 3LMKA 1XROA 1OLXB 1ONBA 2QN8A 4NV1A 3DNFA 1MX5A 4FYWA 3G59A 2E37A 3KTFA 2EKPA 1NP3A 1NL3A 5AO9A 3A2MA 2IZOA 2VYVD 2WUEA 3UJCA 4DS3A 1H2ZA 3ZK7A 1C8VB 4MA0A 4LI0A 2M6LA 1AOXA 3MAJA 4REMA 4JENA 4JQOA 1YKFA 4R41A 1DUVG 1GFIA 2FSSA 3EC7A 3MWEA 5FI0B 1IY8A 3RYTC 2FUKA 3RG8A 5J58A 5E9QA 4B3JA 2J9GA 3G8AA 4OV6B 2JBAA 3R3HA 1C1DA 1JHPA 1NC1A 4GU5A 4E1VA 3KNZA 1KYQA 3I1YA 4PAWA 5DGDA 1F4LA 3HP1A 1UZLA 1VB3A 3ZE7A 1J8VA 2WVAA 3C74A 3WFJA 5J23A 1MDFA 1CZKA 2HRRA 3BGIA 2BEUA 5I9MA 4BO4A 3VZCA 4JITA 3V8QA 4O0LA 4HMOA 4KMSA 1QHYA 4N40A 1Y7TA 1XVLA 3NWBA 4FN5A 3WIVA 2ZJ8A 4RTKA 2V5UA 1PTJA 1Y1TA 1L4MA 1Z7BA 3CUVA 4QXRA 3VX4A 1R7RA 2IYFA 1I7DA 4AZ3A 1QS0B 4RULA 1EUZA 1GZDA 3CF4G 1T0JB 1A95A 4J0EA 4P9NA 1U8TA 4DILA 1TFUA 1K5PA 1ONOA 2HPZA 2YN4A 4WD3A 5DNEA 1AS0A 2B69A 2ZYDA 3IDAA 4K0RA 3RTEA 1PD1A 4F11A 5HP4A 2JGLA 1UMCA 4IVPA 4P86A 2H06A 3PENA 1OB2A 2QIPA 3RVSA 3UHFA 1X74A 2ZATA 4IS2A 3CIOA 4EB8A 3JD3A 3KKQA 4NAVA 2ZRKA 1SC6A 2JJYA 3LNTA 5BW8A 1TLFA 3WKBA 4DYDA 4YP0A 1Z13A 1JG7A 4TZ0A 1U8UA 1Y89A 2ERXA 1EDDA 3T9EA 5CVDA 4PQRA 3TIVA 4E09A 1E9SA 1NGSA 4N5DA 5ARDA 1Z82A 2AWOA 4HFNA 4BMCA 3EZ9A 2J30A 1Y4ZA 2W0SA 4HZUA 4LZAA 2W48A 1YRWA 1GUDA 3C3BA 3IX7A 3TRFA 3LE8A 1C5KA 2FFJA 1V6AA 3LYHA 1G0OA 4H35A 2PSDA 4LDPA 3RTDA 4F2WA 3JWIA 2O8DA 3RADC 4FB5A 1FFHA 2QW8A 3ZHBA 1IQRA 1SHKA 4JSYA 5H80A 4Z5XA 1WHSA 1U2DC 1WOMA 3FPFA 4DQXA 4ZODA 3ROQA 2KS6A 4II7A 4HGQA 2ZRLA 3LQRA 1YVPA 1VHDA 3GGDA 3P2MA 1Z2PX 2PGDA 3Q7SA 1HWYA 2BWJA 3TZKA 4OM7A 2NNLD 4B83A 5HDBB 3OQPA 4OI2A 1P60A 3UH0A 2OC9A 4XDZA 2Z3ZA 2B7LA 3TZHA 1LUAA 4QDXA 4Y98A 1E60A 4FQ7A 1OWNA 4X7RA 4YV1A 4LRSB 4PG7A 3L2OB 4FHGA 2XADA 2ZI3A 4W6QA 3NHFA 4P31A 4Q7JB 2R96A 1RAHA 3L46A 4ZALA 3WWPA 3ZQ4A 4FINA 3AHCA 4QOGA 3K6SB 5DHAA 3OD1A 3GI1A 1YGPA 3RH0A 4CUJA 2ANCA 2UVPB 2A9KA 3H5WA 4HWTA 3VHXB 2HSEA 2A6PA 2BKLA 5CVVA 3HU2A 3FFBA 2NSHA 3BYZA 5I4KA 3IVGA 4UUMA 1CD5A 3W4JA 1QRSA 4ER3A 1MB9A 3UFXA 3UOAB 1ZLYA 4WASA 5LM3A 3LHDA 2C0PA 3R1IA 4Q7EA 2HNAA 3B3QA 1US8A 3CBQA 4FOLA 3AXTA 1HE8B 3H19A 5JZSA 1Z07A 3DFIA 3VKFA 1JTFA 5T41A 1U4SA 1JEQA 1G8AA 4RJIA 4WY2A 1X7ZB 4BX8A 3N6VA 2EBWA 4F60A 2I2DA 5FX2A 3AINA 3QMMA 4FP9A 3DTVA 4IAOA 3TZLA 2JGFA 2VP5A 1OU4A 2CVQA 2H5EA 3CZ4A 4DR4B 4DLVA 1VFPA 1H2YA 3L7JA 3ZXXA 4EHNA 4M9XA 4YVFA 2R8PA 1I1QB 4ZCQA 1AS2A 2EKLA 2NZXA 4M55A 3JXEA 1JA9A 5CLLA 4ITUA 5C4IA 3RUHA 5A04A 4GPZA 3PLAE 4KZPA 2H85A 4ZQGA 3W6PA 4UQLA 1M2JA 3OC6A 4X7MA 3TG8A 2HU5A 3PITA 4GUAA 3THXA 3BZUA 5T4EA 4D97A 1MA3A 1W19A 3P0IA 4KPGA 1FA9A 1KRWA 2TYSB 1QJCA 3KB6A 3IV6A 2OZVA 4GPTA 4QRHA 2Q6TA 3CR7A 3LWDA 3OE7D 1ORHA 1KTIA 3B6EA 2Q0QA 4DJEC 4K6OA 5F9HA 4FFDA 5DNVA 1TAQA 1R4NA 1ZR2A 2OORA 1ADFA 4WGGA 5BNIA 4PFKA 3D0RA 4GVXA 4YMGA 1DV2A 2HDOA 4KL8S 5CFOA 5EIEA 4OHXA 1OTXA 2P4QA 5IT4A 2FG7C 3IBGA 5DM4A 3RJZA 3OTQA 4EJSA 4ZDIA 1G2OA 4KNVA 4WCDA 5GJVC 3WLNA 3H1GA 1YJBA 3NOOA 2B9EA 3O5AA 2QTVB 2H17A 1DWPA 4LS3A 3KEOA 5GIPE 1FRFS 1DIAA 4X8MA 5A03A 1V7QA 2G9QA 1MGOA 2NG1A 4I66A 4KXFB 1OLOA 3H1TA 2VDVE 5B1EA 5K01A 1GTJ1 3EEQA 3M4NA 1P2UA 4OGWA 1O89A 2E18A 3OZAA 1OIXA 4PRYA 1SULA 3AFHA 3PFKA 4PBTA 1B26A 2WP0A 3LBHA 1CJTC 3HLKA 1A72A 4ZVVA 2HO5A 1SQFA 2NNWB 3G49A 2CZGA 1CUFA 1T9DA 4IDEA 3SSNA 1GYRA 3F9CA 4NTZA 1N5DA 1Z12A 4RIIA 5ALEA 1PBTA 2I34A 3FSRA 3O73A 1AXEA 1R15A 4MTCA 4Y6OA 2JCYA 5JADA 1AXGA 5C8YF 4QIHA 3EGEA 2NUPB 1UKZA 3QWBA 1VZ2A 3DDCA 3OFSA 1ONSA 4NPHA 4YBRA 5JNVA 2GKGA 3AW9A 2HF9A 3VPXA 1I30A 4Z4IA 3MINA 4AZTA 7MHTA 4NJMB 1W2HA 5IZCA 3KWJA 4CCSA 2NAFA 3IQIX 3FSJX 1PEDA 1T2DA 2YNMC 2X9LA 3EQ9A 1A8UA 3L41A 3STVA 3FGOA 4MI1A 3M4ZA 1D2RA 3I0MA 1SVKA 2I4IA 2IXTA 2FK8A 3FTNA 2BMWA 5ITZA 3ZZ1A 3ZCQA 2W2KA 4RYLA 5BPHA 1ZVMA 3W06A 4GL2A 1P3Y1 2DFDA 2GFQA 4RDCA 2RAFA 421PA 3WYNA 1N0HA 2M1ZA 1V47A 1KSHA 1SXQA 2XCLA 3IJPA 4KQ2A 1DG9A 2FFHA 2A0KA 5KSZA 3KWLA 4L0CA 1VHQA 1GZVA 4BZZA 4DDVA 5KWSA 2R4TA 1E3LA 4GKVA 5EXTA 2VUSA 2CGEA 2VQ6A 1GAEO 4ZV9A 3E6AA 4B71A 3L7MA 1MAVA 1QTIA 3BD8A 3DD1A 3DDSA 5C9ZA 1I6WA 3O0TA 3V4OA 1YS6A 5BMVA 1XCBA 3EVEA 4AZ0B 3F2VA 4C4XA 3JQAA 1ML4A 1JB1A 3FG9A 3PSAA 2IK8A 4DIFA 3HYLA 1ZJ4A 3NV7A 3LSTA 2J5XA 2E1PA 2P4UA 2Z09A 3NAMA 2V7BA 3T8YA 2Q3BA 4TL9A 3LKDA 3FPJA 4MV9A 4KDFA 3U4AA 1LPPA 5K03A 5K0BA 4G5XA 3D8BA 1RI4A 3DBHA 2H52A 2ZIFA 1Y8AA 2QP4A 2NSDA 4AZWA 4XWKA 2GX6A 3JQBC 4FW9A 5F7XA 4E4YA 1L4YA 3PVCA 1IOWA 2ASVA 3KXIA 5KYWB 4OA8A 1YI1A 3ND5A 4NV3A 3FNGA 1T15A 2AK3A 1P5RA 1EB8A 2GZAA 2A5LA 2H1LA 1UXKA 3Q3GE 2WBLC 2OCIA 4XSGA 3RKUA 4IH9A 3BTUA 2AEJA 2P9FA 2IZZA 3HR8A 3TJZA 1PLKA 2VT7A 1SXGA 4FCWA 4GYWA 6PFKA 3K9FC 2B37A 5FR2A 1VSQA 4GOND 1E5VA 3AONB 4JP3A 3K0SA 1BQ4A 2D5BA 1C9YA 2XLCA 5CT9A 5DX8A 1IY9A 5KNCH 4AKGA 4KOEC 5AFSA 1B4DA 1VP9A 2P5YA 2G7MC 3C4JA 3TSAA 1DARA 1KDZA 4X6UA 3NPAA 3VDRA 4LXIA 4N9QA 1Y6GA 5MHTA 4ER6A 4RD2A 3UCEA 3OD5A 3W5DA 4UE2A 2A9VA 4Q24A 1NE2A 1CUDA 3IRUA 1YNOA 4HGOA 1BA2A 4CWAA 1FVOA 1S89A 4F56A 1Y1PA 3QPCA 4HTFA 2XGSA 2FEAA 2Z9BA 3OM0A 2QVXX 4LWOA 2H9AA 2QB5A 3SYNA 3E84A 2X4DA 3GRAA 4JU8A 4B43A 1GA4A 5G3ZA 5GZ6A 2WOOA 9GPBA 2UZ1B 3MAAC 3A6GA 4INOA 2GT1A 4Q1BA 3TD2A 2HSZA 4JJFA 5I7WA 2VHJA 3BXPA 4A36A 1UCFA 3KVOA 2YVUA 3NCHA 4PGGA 1ZU5A 2Y0EA 3NTLA 4A10A 2XVAA 2TECE 4N0EA 4RQTA 3MJTA 5EE9A 3NEPX 4W9NA 4N3AA 4LQLA 3S29A 2YJ4A 3VHXA 1MXHA 1O3YA 4IO1A 2IXBA 3A4VA 5ICSA 5ABPA 2XT0A 1H2EA 3OQ6A 4X90A 1KYTA 1VCNA 2ABWA 2XWSA 3U5ZB 4B3XA 4OQ4A 2WUDA 1EUDA 1P0IA 2FZWA 3TSYA 2NUAB 4LXTA 3V8PA 5TGTA 4G63A 3ZY4A 1K0FA 3K31A 5CM8B 5EWJB 4MEAA 1W4AA 5KVVA 2Z6QA 3KLBA 1T1SA 1ZX1A 1CFZA 3TL2A 3DUFA 3H99A 2GXAA 4ZZ1A 3RYHB 4G0UA 3RGGA 1MP0A 3DM5A 1EWKA 3MGCA 4CKXA 3TIGA 4KU4A 3LT5A 1AUQA 4WNCA 5B53A 1X1SA 1FP1D 4IDCA 3A7DA 3LVQE 2AX3A 3MCWA 3PKJA 4XYEA 3UOWA 2NQ8A 4DLLA 3I8XA 2G9NA 3VISA 3GH1A 1FVHA 5AK0A 1S3FA 4IFBA 5K2OA 3WGOA 1U1GA 1Z74A 2QT0A 3LKVA 1V9SA 1NW6A 1VJGA 2R9VA 5DXJA 2J3HA 1EFLA 2MWMA 3F3SA 4BNHA 1Z37A 2VO1A 5EIBC 5EZ5A 2P65A 3RIXA 4DEXA 4F3CA 2WFLB 2AZ4A 2V6BA 3KD3A 2HCJB 1V3TA 2DZDA 3IBFA 4A7PA 1I4TD 3DCYA 2BV3A 3HDGA 1YK1A 5DTIA 2PS1A 2PMCA 5L7TA 4I1VA 1MB0A 4OQDA 1QWOA 5FLYA 4COKA 3QPAA 1E79D 3D0KA 2ZB8A 1NVGA 1L6RA 1O6CA 1M2VA 1MA0A 2D5CA 2O48X 3R7LA 5HUQA 1F6DA 1G4HA 1OZFA 4W82A 1Z5ZA 4ED9A 1Z26A 3O9VA 4LUCA 4FGUA 1ZR4A 4O3MA 4KQ6A 3WADA 1TRHA 4CGZA 2C59A 5DU2A 4UD2A 4AS3A 3GRUA 1GCGA 1WBDA 3N7UA 3IR5A 2YFKA 1JIUA 1W5SA 1CC1S 1DGQA 4RA9B 4H4EA 2AD1A 3H9BA 1RKXA 4PLVA 4AMZA 2WIDA 3R3ZA 5BR8B 1XTZA 3IUJA 4YLYA 2PQMA 4FFMA 3KUUA 1ZITA 4QLAA 4ZZ0A 3HSKA 2V96A 3G0OA 4Y1EA 5JZOA 1L1EA 4XIIA 2DXIA 1YAJA 2MR5A 2PT6A 3BGDA 1J9EA 3GAMA 4DL9A 1YS4A 1THZA 3O95A 4MAMA 3REGA 2BH2A 1XYVA 4GM0A 3WLPA 2C2OA 5FTJA 1D7OA 3CKMA 1QVAA 1SNYA 5KTRA 1P7ZA 1AZTA 1JKJA 1MBZA 2I3AA 2WWFA 5E6SB 4WFQA 1KIFA 1OFVA 2QD2A 4PHGA 1OI3A 5K5EA 2WHRA 4TMZA 3HZHA 3U16A 3DDUA 3L0BA 3IV7A 2JKVA 3G2OA 3GBSA 1U7HA 3ND9A 4AJHA 2J4DA 4AS1A 2F1KA 2AW3A 3WP0A 1WTCA 3EAQA 2OOKA 1NW7A 3FTQA 3GJTA 3ZCPA 2IUFA 2PVSA 1C7IA 3DMTC 4ZOAA 2JATA 3DB1A 5EZYA 5TEWA 2HAEA 1L8XA 5FNZA 4ZQFA 4GP9A 1HQYE 3ESDA 2X4IA 3NVKI 3C3AA 1AIPA 3DOEA 1PX0A 3SVLA 2ZBDA 1T1JA 1XA0A 2R6GA 1J2RA 2PD6A 3EMDA 4D74A 5AM3A 1IONA 3WRXC 3CHYA 1F0KA 3GK3A 1ORIA 3QBVA 4P33A 1XTSA 1N34B 4R54A 4NCAA 1VIVA 2ZQZA 4GZ6A 5JBIA 4M0KA 3ZOKA 1QHHA 3PF9A 3N70A 1FPMA 3LNCA 1N5KA 1SR8A 4C6SA 2HPHA 4I1YA 1KKUA 1ISGA 1X7ZA 1JQ3A 2FWIA 3E9NA 4J03A 3SEQA 1VFNA 1FSPA 3U3MA 2ZVDA 4YT8A 3V7WA 1R8SA 3AGPA 1OJ7A 3GVHA 4GKBA 4KVAA 3S1LA 1DJMA 4YRGA 1CJMA 2JEZA 1VMDA 4FBMA 1LJLA 2F3RA 3WB2A 5LQDA 2I7DA 4HDRB 3GLGE 2HFKA 2CVOA 2BELA 3UMSA 5HWSA 1T4MA 1CDZA 3WL4A 4AUKA 3WDMA 2ZANA 4M0LA 5LDGA 3PQ7A 4A6XA 1SD5A 1EHCA 1OZGA 1NVFA 3FBGA 3PIRA 3T41A 2ZWPA 1V5FA 4N6GA 2G83A 3CEAA 3IUSA 1YK0A 3PNVA 3V8BA 3PE4A 4DQVA 5IUJC 4TMWA 2PUCA 5J63A 2YJGA 3EHEA 3TGWA 2C9MA 4A0RA 1TVCA 4UHBA 4KYIB 1BE0A 3EEYA 5M5BA 3TINA 1XZEA 3LWBA 4OBBA 5CVEA 1NOKA 5H3CA 4KQ1A 3ZG6A 1G18A 3EC2A 4G97A 2KE5A 5FP0A 2ODPA 1H2BA 3X1XA 3OZIA 4S1PA 4A0FA 3DBRB 4E5UA 4LJKA 2CBZA 4K6HA 2QTVA 3HO6A 2M6SA 3IP6A 4OO3A 4W9RA 4BBPA 1YIDA 4F3YA 5JCXA 2O8FA 4QA9A 1YB7A 4DNQA 2AQIA 4PANA 2XMRA 4BQEA 2R00C 4Y8VA 2X3UA 3PCXA 4BCBA 4BVJA 2ZU0C 4AF7A 1MJGA 5F7ZA 3TXXA 1QC5A 3D4OA 2NN3C 5AD1A 4I36A 1TAGA 5EIBD 1YS2X 1C0EA 3BC1A 4CLEA 1SAYA 3K96A 3SF8B 2VQSA 3FMIA 2RGNA 4XRGA 1PJ8A 4R1TA 1A9OA 1DDOA 2YN2A 4TLEA 4G3XA 3EFBA 2VWQA 2ZLBA 4W6ZA 2HGZA 5NLLA 3B53X 3R9XA 1KK1A 2QRLA 1D1SA 1OCEA 3BJZA 4FZVA 3JW8A 5I01A 1QVZA 2PZ8A 4PSUA 1I33A 1ZMXA 1GOTA 2B36A 5HK9A 4IJ6A 4CT5A 1I5EA 5EE1A 3KUCA 4TWBA 3IAS1 1KS2A 4G4JA 1Z4MA 5ECYA 5G0UA 3PWZA 4NBRA 1RHJA 1WZ2A 2JI9A 1J0BA 1M9NA 3I9LA 4ZEXA 2C2WA 1ZGGA 2Q9AA 4L6IA 5FWNA 4IDFA 3ZCXA 2WG1A 1NATA 4BFVA 2VL7A 1D4ZA 2IXEA 4LJ7A 4WJZA 2XA2A 3KXPA 4TTIA 5DJ5A 3VH2A 5HMMA 3WYDA 5DOZA 4GS5A 2OSVA 4CQNA 2I2CA 2HQBA 2PKQO 2AG1A 1W76A 4KBFA 3DW1X 2ZREA 1FFGA 1M34B 2B3TA 1YB1A 2Y9MB 1EBUA 4X20A 4CMKA 3LKBA 5DRTA 4KAJA 1VXRA 3RNOA 2OZLB 5H0IA 1A9RA 4GDMA 4UM8B 1CHNA 5G0VA 4AQ7A 4CLRB 2QRKA 1ILWA 1PVVA 2EDAA 3JQ9A 3VAAA 3ZEIA 4YCSA 3K0KA 3G7UA 5DM1A 4N3CA 4EH1A 5LYYA 4WESA 1M2OA 3T3GA 1K66A 5EMMA 1F60A 5FTWA 5BXQC 2ZWAA 3K2QA 3P2KA 3ZIDA 4DDMA 3N87A 3V1TC 5K0EA 1CR4A 1HDRA 2QQ5A 3EIUA 4JQZA 4QUIA 1A82A 5KTSA 2ENWA 2RHRA 1CY7A 3NUQA 4CDNA 1K5GA 3K6JA 4GZ3A 3EEIA 1DELA 4U6SA 1KJQA 5JNRA 2O06A 3MLEA 1IHDA 3JRWA 3T4PA 4CL2A 5CCBA 2GHTA 3EBPA 4UOQA 1DU4A 4IKPA 3ZV6A 2P9YA 3HY6A 1HM5A 4BVBA 1LWOA 2XDAA 3BE5A 1WZUA 1RE1A 3QY0A 4HBZA 3DOCA 3UA4A 4AY2A 1U0HC 3K73O 3U7EB 3BWYA 4HDQB 2WF7A 2YOHA 3VC3A 1TRKA 1PQUA 3BGSA 2BTEA 1LFAA 2HMYB 4IV5A 4ZRNA 3VMMA 3LQQA 3DKIA 1JDTA 3NZEA 3FSEA 2B1RA 3PDJA 3EMKA 3ZZUA 3A3YA 4AX4A 1K4MA 1MQ8B 2ONKA 2MU1A 2GPBA 1VJ1A 2W0MA 1MAHA 2ZSUA 3LHFA 4FEEA 4ALIA 1PYOA 4M0EA 5IBRA 3SS9X 1O7JA 4JLUA 2R6CA 4PO3X 2IZ6A 4NX2A 4MKIA 3GRRA 5DO9A 1F6WA 1KDRA 3GQVA 3NNDA 4RXTA 2PL3A 4HVAA 3SFZA 2ZAMA 4NK4A 4RKEA 4UJ5A 3CR8A 3UK2A 4N3NA 2HNKA 4BFYA 1II0A 3ZDRA 4AF6A 4TLLB 1WMSA 2Q1TA 3L6EA 2XCIA 3G5MA 1Y98A 3IR7A 3RUEA 4QUKA 2ZW9A 3KT8A 2ZDGA 4FT2A 4YJKA 1S4QA 3W3ZB 5AM2A 2YXLA 4OXRA 1A9ZA 3EDMA 4HWSA 3PYLA 1G21B 1RPTA 4G24A 1CR6A 4NU0A 1RCUA 4R8KA 1T29A 3TVDA 4FX5A 5L45A 4W5RA 1Z63A 1M8JA 3FCSB 5CHEA 5KHAA 5G1NA 3RNLA 3RVPA 3ZW8A 4BU0A 4DVGA 3GLIB 2PKRA 1IB6A 4BFZA 3PC3A 3THYA 2UZ1A 3NXSA 1FSZA 3DBLB 5LKRA 1NXOA 3G9UA 3B2QA 4FYMA 3LL7A 1OZHA 4BZWA 1FUIA 1WPGA 2HMWA 2Q6KA 4LOAA 1UWCA 1BWPA 1EVEA 3BREA 2VWPA 2J1LA 5ICFA 2EX1A 2PA0A 5FPYA 3EOAI 1YZHA 4HDMA 1QO9A 5CBPB 4Y6PA 1KEEB 5HQTA 2IU6A 2H6EA 1V8FA 2BKUA 2GVNA 4C4OA 3A4IA 1R4MB 1BXRB 2QN2A 5E2AA 3MGKA 5AUOB 4QUGA 2P4SA 1A9YA 4N4AA 2C1EA 4ALJA 4BVHA 2WWWA 3REOA 1B43A 3O8RA 2QN1A 3VTKA 4LJAA 3LPNA 3HMKA 3WKDA 1NRWA 1SUDA 5CK4A 1HYBA 3Q0TA 3UV6A 1QG6A 1CDEA 1Y63A 5THXA 2RGUA 3ME5A 3R9KA 4CN8A 2WJYA 1Z5OA 4M36A 2CKDA 5HPYB 5J4KA 1TF5A 1PSDA 1T5TA 2AZMA 1C4OA 2Q3LA 1RHMA 2C97A 3E5NA 3JV7A 4LBVA 4QUDA 3OTOB 4NICA 1SGWA 2NPIA 4WN9A 1X2EA 2J5BA 2CMKA 3HJUA 3GAFA 3QKUA 4ENWA 3HWRA 3EF3A 2XNDA 5CLGA 4U5QA 2A0XA 2WFLA 5ULLA 4NBUA 3JQPA 2ADOA 1X6VA 3N59A 1Z0UA 1W5BA 4BFCA 2JIDA 1GA1A 5UKDA 2HSWA 2D1FA 3U49A 1XU9A 4R84A 3BJEA 1AA9A 4IOLA 4ENRA 1N2IA 4FHCA 4BO8A 1SUWA 3GEDA 4OBEA 4RABA 3RASA 4OHPA 3HDYA 1I3LA 2IHYA 3U3KA 1O54A 3DNPA 2PUHA 2DRIA 1MJFA 3NYWA 5JFOA 4YRFA 3QEAZ 1MO3A 1SMKA 1A71A 1WCIA 5DT2A 4ZZIA 4W1SA 4IGKA 1UBUS 4UVIA 3CNEA 4H1VA 4OH1A 1GQQA 4O08A 3DB2A 5DN6A 4U2CA 1Z33A 2JI6A 2C78A 3VR5D 1OGIA 1UEXC 3Q7EA 4YDRA 3S27A 2NZYA 3WWZA 3K5PA 2VHQA 3V1UA 2W6CX 3FYSA 3BT7A 3PCTA 5JNWA 4M8KA 1NU8A 4XYLA 1TADA 1IEWA 1OI7A 2NV2B 2X86A 5HIMA 3O74A 5TMBA 2YHAA 5U4QA 4BS9A 4IMPA 5H5JA 1UDRA 5GJWC 4C0AC 4LYHA 2Z5LA 4HH0A 3K9NA 4QFMA 2AI2A 3M4XA 4GZMA 4QBIA 3RAPR 3UV7A 1M3SA 3HXKA 3KQHA 4C29A 1QZ3A 2X9NA 4FBGA 4DJTA 2CLKB 4LW8A 4RYDA 2REQB 3BQNB 4JLSA 4N7BA 4J7XA 4OTZA 1J5PA 2OB1A 2QPOA 4Q9JA 3JVDA 2OQ2A 1AKNA 1JN0A 1MORA 3J7TA 4TYNA 1NW5A 1JEJA 5C31A 4KREA 2EX4A 1PK9A 3OE1A 4OAQA 2JZNA 4REQB 5MDHA 1FE8A 5AVUA 4NOLA 1O5IA 3N07A 4DA9A 4YMHA 5HG0A 5C5IA 2AYZA 3PGXA 4XXHA 4EF6A 1A7KA 3P9QA 5L3QA 3MD9A 4Q39A 1E2EA 2J3QA 5EINA 3BRWA 2OKCA 3QU9A 3KQSA 1NVAA 3HKBB 1E63A 2I3DA 2AC4A 3I37X 3I6MA 4DPLA 5B6IA 4N8SA 1HKUA 2WB2A 3C7TA 2F9LA 2VDOB 2ZWIA 3BHNA 3CEHA 2HDHA 2J5QA 3ZWDA 2O7NA 2YHIA 4WL0A 4WUVA 2R1TA 5ALXA 1IU9A 4G0VA 1COZA 1G63A 2AI3A 4M8IA 3KQVA 3D3EA 2OV1A 3N6RA 3SC4A 3L77A 3JVUA 5LU9A 4D9CA 4YH1A 1BHSA 4G09A 4ANFA 2TMGA 4D4JA 1PI3A 1CQPA 2Q2QA 4XAQA 3ZWWA 1QO0A 2QMZA 1VSUA 4ZVTA 5EUQB 3I2IA 1OTYA 1JI0A 2YJ5A 4F8JA 1YE8A 5CXSA 3UMBA 4MS3B 5I9IA 3BMOA 3MYRA 4E7OA 1XZJA 1G7RA 4KX3A 5D1HA 1P4HA 2BZ0A 5DE3A 3UB4A 1N3YA 2C2YA 3KL4A 2VWGA 4L76A 3TI7A 3A4MA 3TRDA 4OQFA 1XEXB 3V1MA 5DASA 3KQLA 5ALZA 3KLMX 3FGNA 3QENA 2C84A 2FWBA 3AKCA 4QYXA 2GGSA 4WXRA 2PKCA 5JFTA 3UNXA 4EFLA 2IHJA 2VJMB 4LZWA 5LL6P 4H3KB 2VTEA 5TNXA 1SUBA 4HFRA 4M1MA 2H9IA 4QHYA 1D07A 4IJKA 5CCXA 1BQEA 4P93A 1XCJA 1YQEA 3IYLW 5F2NA 3SHWA 3ZYCA 1GXSA 3EIQA 3O7MA 4J8PA 4UVEA 4BFWA 1KH2A 4I08A 4DV6B 4GVPA 4JH0A 4J1TC 4NONA 3A1TA 3G17A 4FYYA 4YRBA 2O20A 3A26A 1HSZA 1S3IA 4ZPXA 3HV0A 3ZXYA 5JW6A 4R2IA 4RWZA 4D42A 1B6TA 1R16A 3QE9Y 4KPEC 1WNFA 3G7SA 3R41A 3RARA 1D7AA 1DIGA 1WB6A 4G23A 2XA1A 5SYNA 1K6IA 1QFMA 4GNRA 4CM3A 4NRDA 5JDIC 1RC0A 4LMAA 3P0HA 1VA5A 5IUNC 3IXMA 1WF6A 4O4IA 4DAEA 4R8LA 3K3PA 1R5NA 4A0HA 3UMYA 3T38A 1E9EA 3UH1A 1M6EX 1Z0IA 2O5EA 1YZUA 3CKKA 1DB3A 3TK1A 3N39C 2GF2A 5JO9A 1D8AA 5EP1A 3GD5A 1JQLB 1DL5A 3G2KA 2WWTA 1VTKA 3P9XA 1M1NA 2C5SA 3LCUA 3QEMA 1SCIA 2VCEA 4IUDS 4P7GA 1E0DA 4YP1A 3VKUA 4BB5A 4MV1A 5IDQA 1HDYA 1S8FA 3PEEA 1U8FO 4O3FA 1NE7A 3DXFA 1I8TA 1EP2B 2QD4A 2ZYRA 1MABB 3PQDA 4HDNA 4M3NA 2AYYA 1QIIA 1T3HA 2WU4A 3TW4A 5EJ5A 1EZ1A 4DGSA 2B61A 1RQXA 3PR3A 2XB2A 3L1KA 3EF1A 3OZWA 1W34A 1YRYE 3L04A 3CX4A 1YL6A 2XKJE 4DA6A 1ENZA 2QTWB 4XUGB 5F35A 1P29A 4JOSA 3ZZ0A 4AFNA 2RJNA 5A3SA 2V7EA 1P81A 4BE7B 1P1RA 2GERA 5CDTA 1H0SA 2XV1A 1YJ8A 2GZDA 1RDFA 3AP2A 4IEIA 4KUEA 2NGRA 5EMLA 3W5IA 2PDAA 2EFJA 1OKKD 3CW9A 3EVZA 4JXKA 1R9JA 1RACA 4JUDX 4YCCA 4J0FA 2LV8A 3E7FA 1UPTA 3JYQA 1RFLA 4FXPA 2BONA 3L84A 1XVIA 1JAHA 4P54A 1P91A 2V55B 4EIWA 3JQ7B 4TYQA 3ZUPA 3MSXA 5HUJA 2WQ7A 1HYQA 1TT5A 1Y9DA 1Q15A 4HWOA 4D41A 2WABA 2ORYA 4UTPA 1SD2A 4EF5A 4PAOA 1H66A 4MVJA 3UVEA 3DVRX 1X7XB 5DNAA 3RBAA 2GYWA 2PLWA 3SR3A 1R0KA 5FI3A 4ZARA 1BGXT 2FVYA 4DDUA 1HORA 2FWJA 2FW0A 1VDZA 4FIDA 4KQMA 4OFBA 3QVKA 3ZHTA 5I5EA 4KQHA 2WLSA 3A06A 1T8SA 5DW0A 3KYDA 2OL4A 2QJRA 5B2EA 4IJUA 2OZPA 4P92A 2ATVA 1Q1BA 1UZAA 3ESXA 1I1NA 5IVDA 3PUXA 4L22A 3WIEA 4RDIA 1X7YA 3TAHA 3AF1A 1JIXA 1YHZA 2GLUA 3PFWO 1YQ9A 4KH0A 4JHLA 3EUAA 4HFMA 2GNPA 4FHFA 2XF2A 3ZH2A 1JZSA 3DFKA 1FFCA 1KFKB 3EASA 1SC4A 1TZJA 3DYVA 3LI2A 3LY7A 4NFSA 5DIZA 1TO2E 5KDDA 1DC5A 4U2FA 2C8JA 1GZ4A 1CG6A 3T9DA 1SZJG 4A26A 3JVEA 5LA6B 1MRNA 4H0FA 2VHEA 3ZHCA 4DQ0A 2BRUA 4AJIA 4PC1A 3OCZA 1EFUA 4M8SA 3FOZA 4MRSA 3IURA 1HPLA 2Z8ZA 4BKQA 5FEMA 2J3MA 3DLPX 2X23A 4C87A 2JBWA 2R7KA 1FP6A 1P62B 2Z2IA 3P2YA 4MR7A 5FT9A 2CLLB 5ICGA 4F5EA 4F5DA 1Q20A 4ZRMA 1C7JA 1C1XA 1CZNA 1NVDA 3BWDD 4IP0A 5GINE 1D1TA 1LU9A 1X1TA 1HNWB 4MLPA 2R8OA 5TPWA 2A84A 3ZXSA 1G8JA 2FW7A 2OCGA 1C4KA 4M7RA 2WTEA 4WZAE 5AKEA 2CHQA 2R6DA 4EHHA 3W77A 4NYMQ 4GG1A 1O5TA 5F2KA 3HL0A 4OSPA 1OGJA 1BMQA 1QH8B 5B1DA 3EVFA 4EY5A 3TAXA 1BMFA 4KXLA 1SY7A 3VPBA 3ZCRA 5ALHA 2EBHX 4ALNA 1Y8ZA 5L3SB 2GQ0A 2AFIA 1F5SA 1CEYA 1RXCA 1XDWA 3SJUA 1ODIA 1FS6A 1K8QA 1RMQA 3KRTA 2FPWA 3AERB 3Q9UA 4WFKA 2BFFB 5CLQA 2ZRNA 3V2HA 2Y1KA 3U0BA 4B2YA 1Z4QA 3CE6A 5KBYA 4F5WA 1F9AA 1L4FA 1QGED 1U2ZA 5CBPA 1KEEA 3U1BA 3KYCB 4QWMA 2FVXA 5CYGA 5EVJA 2Z5GA 4IEFB 4PHTA 1AM4D 2HSGA 2OCPA 4IIBA 1CNFA 1OREA 3ZC3A 2PAAA 3QLVC 1LX7A 2ZS9A 4ZICA 2VKTA 4LE0A 4J0DA 5CA1B 1IM2A 4OI1A 1U1FA 2JDID 1MZPA 5IK2D 4Q6BA 2WTXA 1M6HA 2XSZD 2BHTA 1F8XA 1EWTA 1W59A 3BDIA 4U8GA 5EKXA 4GBMA 5K8CA 1PZXA 1T91A 4LXGA 5HJ5A 3A6DA 3OKAA 5IAGA 4YRCA 4QT4A 5FL7D 2CCJA 5KX5A 4JVNA 4JJZA 5CB0A 1ZEJA 2VNJA 1T26A 3KVRA 8ADHA 1BD4A 1JFLA 1HZZC 1L4EA 2CD9A 3CRZA 2HJRA 2NXCA 3D7MA 3Q9LA 1NRXA 3VOTA 4PC7A 1WW2A 4YRKA 2J7PA 1QZXA 1VG0B 3IO3A 4I50A 1I1HA 1NASA 2C57A 2G63A 3N8DA 4XDHA 1TIPA 4NE9A 3B2EA 1BFDA 3N9IA 4QU5A 2NU7B 4J3JA 2AC2A 5ALYA 4K87A 1DCFA 2GBFA 2OUKA 2HBYA 4LQCA 4MVCA 4Z4GA 1E9AA 1HE5A 1KK2A 1RQNA 4R9UC 4WPGA 2GBLC 1NNLA 3WK5A 4MGHA 4R9SA 4FSHA 5JDCA 1H2WA 3I2HA 1L8QA 3KB1A 2QJWA 2WHPB 3R5SA 3D6HA 3E27A 3UGJA 1JV2B 3IB6A 2AG8A 3ER6A 3LHSA 5LPNA 5BR7A 1QGDA 2XRZA 4BN5A 2XCRB 4X54A 1LBEA 2MSKA 1W44A 4NLLA 3OOHA 4IY1A 5JCOA 2II6A 2IVFA 4Y6SA 1Z5VA 2F1OA 2P4EA 4MQBA 2W2TA 5HQ3B 1AMOA 2XTAA 1F4PA 4N76A 1O6BA 5FOVA 4IJWA 3RAGA 1X39A 2ZE7A 2HBRA 1K89A 1Q22A 2Z8YA 3RW9A 4S1TA 1HL7A 2E5WA 3NIFB 4M0FA 5GJCA 4HGPA 4DPKA 1M5RA 1WDWB 1MPXA 4IS3A 3IJRA 1HNXB 1CUEA 5F4ZA 2Q28A 4PN7A 1VKZA 1GG2A 4IF4A 3QHPA 5FOTA 2XOKA 5CAEB 2X5OA 4B4KA 1WUKS 3ILXA 5TQ2A 3WHPA 5DZSA 4EEXA 3PNOA 5B3AA 1Z06A 1OMOA 4HUJA 4NAHA 3PWTA 3RS0A 2W37A 2E3JA 4EPYA 1TNDA 1MJGM 1SBIA 3HEAA 5TMPA 1UXHA 1Z3IX 4NENB 4NP6A 3UCXA 4CM8A 1BE1A 2B99A 4L5JA 1NMSA 2AQ8A 2P6NA 1I4LD 3C3JA 1K5HA 2VF8A 2DCUA 4S0ZA 1YDFA 3NDBB 4NYIQ 3ELDA 2BMVA 4U6NA 2RFLA 1EIZA 2MSEB 4OJQA 4RSRA 4C3UA 4KJXA 2LR0A 5CLHA 1V9LA 3D6AA 1QYXA 1OJLA 3K8QA 4B81A 2OFWA 1CVIA 1U0EA 1ZL0A 2DULA 5CUQA 5E9AA 4EYOA 4UHJA 2IV7A 2Y66A 3LBFA 3IQDB 1ZI6A 4ZI7A 2JHFA 4JC4A 3C7CB 1GT91 2DVMA 3PZRA 4UHEA 1D0IA 4I0WB 1P1HA 2IELA 4BNUA 3QVGA 3RK0A 2DAPA 2ZVQX 5LMZA 3K0EA 4U3JB 4BV8A 4BVGA 3HYRA 5KAPA 3CVVA 1E0AA 3MS4A 5AIBA 1ETUA 5B2FA 5H59A 4BQFA 3UAXA 4YA6A 5IU6A 3GAAA 3MBOA 1GPDG 4LQDA 1XZBA 4KIJA 4QTYA 1KI2A 2IXAA 4URFA 3SXUA 3LK7A 1QSGA 4QLBA 1E2UA 4PZPA 2ZJ5A 1NBOA 3ZK8A 1YGYA 5KTOA 3R5HA 2ZGVA 4C7OB 5LR6A 5JZMA 4TTVA 4UEWA 1I3OA 3K16A 4WIAA 1JPUA 3CLHA 4D0SA 2JJMA 3ZU5A 4INPA 4R8VA 4AWBA 2WZBA 3GUCA 4Q4DA 3L02A 5AOBA 4BAZA 3LX4A 4R31A 3RC9A 3SX4A 4RSMA 3ZHSA 4E2WA 2XZOA 2I7XA 2GHIA 1GTL1 4MJXA 1BYIA 5BNWA 3RBXA 4RPCA 3AOEC 7ABPA 1KZGB 3BVPA 4NJEB 4XOUA 3TZBA 5HRUA 1L5VA 4MB6A 4YJGB 3VU9A 1N2OA 3I58A 4PZYA 2P3OA 4G26A 1T8WA 1SO8A 4JL8A 2CSUA 1E2NA 4N5IX 1FNMA 1Z5NA 1R1DA 2ZSHA 3PC6A 4WLVA 2J7KA 3ETJA 3VSEA 4WBXC 5G4KA 1E2KA 3LVFO 4B8YA 5LSAA 1QPZA 3QKWA 4UEQA 2Z58A 3SQWA 4LWQA 3CKLA 2OV8A 4LRQA 1YJ5A 3FWPA 4MVJP 4BBZA 5LZ2A 3UBTA 5LFAA 2G07A 3QHAA 3D6MA 3JS5A 5DVZA 1S7CA 1FP7A 1FTYA 4Q1EA 5DTEA 1D03A 2IPMA 3IHTA 4MI9A 3RT7A 1CUYA 4GMDA 3N5CA 4MAAA 3GDFA 3EE6A 5C7OO 2ZS7A 3ZIUA 3WDLA 3CW8X 1GKLA 3WJ1A 4HR7A 4RK5A 3ONWA 1ND6A 1U3CA 2ZAOA 4G1CA 1Q3TA 3E22B 3ZDQA 2UVQA 3WQQA 3BSFA 3A6PC 4BDSA 2XMQA 5K0JA 1CQIB 1YBHA 3ZCTA 4YRAA 5CB4B 4R2MA 1NPTO 4X6LA 4FCCA 4FI3F 1ISIA 4A2WA 2ZIVB 4HH4A 2NQTA 4J7AA 4ZQBA 3CVJA 4CQLB 5KOYA 5HDQA 4GGPA 1GR1A 2AOVA 4UTZA 3W3AD 1L5SA 2O3QA 5H9VA 3REQB 4DCPA 3AT1A 5L53A 1HKHA 3CPHA 2AZDA 3DPSA 1YZ3A 1YV9A 2OZEA 3E7PA 4LRTB 4ODIA 4WCFB 4AY5A 1MTZA 1MABA 1W48A 3I53A 5JTUA 5EWLA 2JLVA 1SFRA 2YV4A 1ONPA 4S1OA 4MV5A 4TUYF 3TBHA 3I34X 5EJ4A 4QYIB 2JFYA 2V9CA 3OCYA 5CX4A 1E1DA 2GRAA 1R6TA 3CWZA 3U40A 5FBVB 4GM4A 4YB8A 5E1MA 4E12A 3KM0A 4EQ6A 5AM1A 3BRSA 3QW4B 4ENSA 1P6UA 4EL5A 2GB4A 3FNRA 3GX1A 1T4CB 5IJZA 3M33A 3R5KA 1QIGA 4Y7CA 2VK2A 4DMKA 3I1FA 3N2YA 1D9ZA 4PV7A 1RWWA 1UK7A 1YFZA 3BIJA 3OPNA 3P5SA 2VBGA 3R7DA 4HB2A 4JL6A 4C2TA 3P8ZA 1W4RA 5BW5A 2HK6A 4AZSA 2IYNA 1N2XA 4B75A 4UOEA 2PMWB 1C2TA 1JG3A 2HHLA 1NLYA 4JLJA 1LS6A 4RLSA 4M54A 1KVTA 2Y67A 2HA0A 1W6UA 5BWBA 1C1HA 1U1IA 2G6TA 2CW5A 3C16C 1XDBA 3MLBA 2DBZA 2CUNA 2O3RA 4ZVQA 2JKYA 4LOJA 4TYMA 1EVQA 1BDBA 1V71A 2GOYA 4M6WB 2QJTA 1O8CA 3H2SA 4GW3A 4PGFA 1K2WA 4GI5A 4CI0B 1GGFA 5BYKA 1I3KA 2X4GA 2XXBA 3QJ5A 3D3QA 1XZGA 1GSHA 1Y9JA 1E7RA 4TZKA 3VDMA 3D8RA 3D1JA 1UMBB 4FNMA 4XQCA 4Q4AB 1PWHA 4Q9IA 4YJHB 3QUBA 1P8AA 3KAKA 1D5WA 2VJOA 4OK5A 3IBYA 4QRIA 1S0UA 5HBRA 3TW0A 4AP9A 4S35A 5CFMA 1ZK1A 5KYNA 5CD1A 3Q6IA 4Y9UA 1LDBA 4LHWA 1X80B 2FSVC 2OHFA 4U9HS 4JP2A 3MRXA 1B2RA 2I55A 3HA5A 2I4TA 4MUAA 5FA5A 1OX6A 4DC0A 2R8BA 5I45A 2VA9A 3OPXA 2PUWA 1O57A 2Y0PA 1P7WA 3NHWA 5A1TA 1U8XX 2CFOA 2H1OA 2ZYAA 2DT8A 3HFJA 1HBJA 2GAAA 2QMOA 3B36A 4E3WA 4LHSA 4Y2VA 5FNVB 2HMVA 4EVRA 5F5NA 3A9SA 1U0SY 1YH3A 3ADOA 4GQIA 2Y1FA 2XWQA 1I7PA 1JFSA 3GCZA 5EI5A 1E1QD 1UANA 2FEKA 2OUIA 4ZI5A 3TCXB 1YDHA 3HUDA 4CQJA 1EKXA 4CR6A 3QOWA 1SELA 3RSFA 3DOJA 5AI0A 3DXZA 3VO9A 2I8AA 4EDHA 4PGAA 2WG2A 3A3PA 3MRVA 4DDKA 1TUBA 2DKOA 3W9YA 5HM6A 1U2EA 3EPHA 4CM4A 2WTMA 3LG2A 1DLIA 2V6MA 1U9IA 4YCJA 4A2CA 4V0MA 2IHZA 2P1ZA 4EB0A 5JNUA 1JG4A 4N0QA 3ROPA 1XZCA 1PT6A 1NR7A 3KKLA 4GZ5A 4X71A 4L8YA 3L7BA 1E6UA 2OP0A 1CDDA 4GXRA 2OZKA 3TE7A 1NVWQ 1V96A 2UYQA 3IULA 4U2BA 3W5UA 4R9NA 3BQ9A 4C9BA 2JJ1A 3UUGA 1RYHA 2QORA 4ZAWA 1N8NA 3O94A 1CY6A 1X7GA 3KLNA 2JEOA 3LP6A 3QNWA 3QKRB 1RSZA 4D9FA 4O4LB 2FSIA 1P2BA 3OJOA 5TMDA 2A9OA 2O8EA 1FFBA 2RGYA 4S05A 5TJHA 1X2BA 3VHRA 4D99A 1DO2A 2P3SA 2OFPA 3DE4X 3CUUA 4QG3A 3A2LA 4YCAA 2ECPA 2V54A 3OJ0A 4MUNA 4Z3KA 4ZOQI 4DE5A 2JC3A 4RVGA 5DTQA 4BWGA 4IUBS 2ZYVX 5ETJA 2NPFA 2B5WA 1UKVY 2ZSFA 2I9PA 4DBLE 1JWAB 1M2KA 3QY9A 1PKEA 3TOVA 1MMFB 1NXXA 3BMNA 3K0AA 1R74A 4URHA 2DMRA 1EXMA 1SBNE 1W85B 1A7UA 4K6MA 3RANA 2QX9A 4RMGA 2JBHA 2D00A 4FJ1A 4ZGWA 3UT0A 6Q21A 3FGZA 3DLCA 3QKSA 1ODSA 3AH8A 3CLUC 4FMCB 2J0VA 4K9KA 4NK5A 1ZVJA 2O05A 3ESCA 3B52X 4CG1A 2XNCA 3FPGA 4ETIA 4YO7A 1JQAA 2XUAA 4WE3A 3LX6A 4TTQA 3KTAB 1ACJA 1CT9A 1FS4A 3RS7A 3IIKA 3NIGB 1PT5A 3NQ41 1JU3A 1OFGA 5F5LA