5CURA

G158e/k44e/r57e/y49e bacillus subtilis lipase a with 20% [bmim][cl]
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
179
structure length
179
Chain Sequence
b'HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDETGTNENNGPVLSEFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIELLYSSQVNSLIKEGLNGGGQNTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase
molecule tags Hydrolase
source organism Bacillus subtilis
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
total genus 70
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5curA00
3HI4A 2WIDA 4QDTA 1A88A 1JU4A 5HF5A 1JU3A 2WLSA 3QPDA 3WJ1A 2WG2A 4H7FA 2WKWA 1EHYA 5AKIA 3IUQA 1XZCA 2WIGA 5AI4A 4G1FA 2W22A 5AKHA 3BDIA 4HRYA 3FVTA 1QFMA 3ZV7A 1U65A 3H2HA 2JGLA 3G9XA 5FPQA 5ALLA 1GGVA 3KSRA 1K4YA 1XZJA 1UK8A 1YR2A 4LYEA 3WK8A 1QO7A 3Q0TA 4B83A 1CUHA 5BWBA 1LPAB 5ALJA 3DYVA 3B12A 3FSGD 4Y2RA 2WU3A 2YASA 2VF2A 4D9JA 1AKNA 4BDTA 2X76A 4GBGA 4F5ZA 4UHCA 3STYA 3AIKA 4E15A 1SCKA 3WKAA 3W9BA 1ZIYA 3EIOA 3VJKA 4EBBA 2XMRA 1LPPA 5AKXA 2ZSHA 2AJLI 4EUSA 4RPCA 1HL7A 1A8QA 4QNNA 4BCDA 4DM7A 5JAPA 2XMSA 1QO9A 5FV4A 1TRHA 2D5LA 5A62A 2B4KA 1XRLA 2ZJ7A 5EIAA 3OURA 2DHCA 4H7DA 2OQVA 1XQYA 3FVRA 4PSUA 4B81A 5FUMA 3C43A 1YB7A 4AN1A 3H19A 1IZ7A 1CVLA 4CCYB 4AZ3A 4BE9A 1JMKC 1R1DA 1THGA 1W4LA 4KR0A 4Y2XA 1HDEA 1C4XA 2HA7A 4YX9A 4H35A 3PUHA 2HA4A 4S0XA 3E0XA 2WFZA 4Q82A 4W1SA 1GZ7A 1MX5A 2C58A 4FLFA 4B85A 3QMWA 2OCLA 4RE5A 2XUPA 2HL6A 4H7KA 3B3QA 1XROA 1YA8A 4C89A 2XMQA 1FFBA 1QIGA 1YSCA 5ALRA 2XE4A 4UFNA 1AUOA 4X94A 5LZ5A 3EQ9A 4G8BA 1UOPA 3H1AA 3ZLUA 4G8DA 1XZKA 1XZFA 4GXNA 1NU8A 5AKGA 2QKYA 2OQIA 2PU5A 2UZ0A 2XUOA 4HXEB 3VXKA 2OAGA 3H0CA 2BJHA 1UK6A 4KRXA 4YASA 2WUDA 1CUFA 2YH2A 4HVTA 5E4JA 4DMKA 1XZAA 5DLPA 2E3JA 3ZPXA 1CUVA 3FNBA 4J03A 1FFAA 2OCGA 4U2DA 3I6MA 1ZI9A 5LZ7A 4CCWA 4EHBA 3R3YA 3IUMA 4Y2PA 3O4IA 1WPXA 3JWEA 5K3AA 2WFMA 3ANTA 2DQYA 1MT3A 2XUJA 3IURA 4A23A 3X3HA 4N8DA 2XLCA 3ANSA 4W1QA 4UBNA 5F4ZA 1ZJ4A 2BGRA 3T52A 1Y7IA 4BAUA 5ALGA 4QE3A 5HF8A 1BCRA 4BCBA 5T4EA 2QT9A 1QGED 4UFPA 1AZWA 4Q05A 5CH8A 5ISMA 4W63A 4BRZA 3IUJA 3TJMA 5CT8A 3PFBA 4WFJA 2LIPA 4XX1A 4DMHA 2HA6A 1ODTC 4X85A 5AM0A 3Q8WA 4AMYA 3L1HA 4KYVA 5AK5A 1JI3A 3STXA 5ALYA 1DWPA 2I78A 1CEXA 2BAGA 5AI6A 5LZ8A 3YASA 4K2AA 4OU5A 2R8BA 4HAIA 5ESRA 3C6ZA 4PQEA 4W1RA 4PSDA 4BAGA 4FKBA 2XUFA 3N0TA 4HXGA 3I2GA 3TGLA 5CXXA 2ACKA 5AM2A 4JH0A 5YASA 1EX9A 1BN7A 4FFVA 1ZI6A 1EDBA 2H7CA 2O2HA 2PM8A 4E46A 1ETHA 3K2IA 1YCDA 2QJWA 3CCBA 3M82A 4UBOA 3BDVA 1CQZA 1CUAA 3VKFA 4JYPA 4X71A 3ICWA 5DWDA 3GFFA 2JIDA 1P0PA 1CPYA 1YS1X 4MQLA 3BIWA 1D07A 2OAEA 2AJ8A 1VE6A 3C6YA 4IH1A 4BDSA 3DEAA 2JEZA 1TQHA 3G9TA 1EB9A 4KE9A 1BN6A 5JAHA 2QOEA 3E1GA 2WFLB 5ALIA 1EK2A 5EI5A 3FBWA 4H7HA 1HLGA 1DWQA 1XZEA 5EGNA 2V9ZA 5DTIA 2HFJA 5AM5A 2WJ4A 2OGSA 2GBFA 3QBJA 4MXDA 4J7AA 1WB5A 3PDCA 2QRUA 1XRPA 4WY8A 3WWPA 4J0HA 1N5MA 3WK9A 1XRNA 2PBLA 2IIVA 4ZRDA 1BRTA 1E3QA 4YK7A 4GW3A 4Y7DA 4L9AA 3V48A 3HABA 1EI9A 4XJVA 5LKRA 3T4UA 1XKLA 3WKCA 4OYYA 4BP9A 3K6KA 4Y2UA 3VVMA 3FYUB 2H9YA 3ESCA 3S2ZA 3O0DA 4IQ4A 3DYIA 3PFCA 1H2YA 5JZBA 3R41A 3G8YA 1XLVA 5K3BA 1LPSA 2C7BA 4AO7A 2CBGA 3RARA 2ZYIA 1QLWA 1H23A 1AX9A 2ES4A 3ICVA 5J3JA 2RHWA 2VTVA 4EB0A 1EVEA 2ECFA 1ZGCA 5E4TA 3I1YA 4L72A 3HLKA 3DS8A 2QJRA 3EQ8A 1EDEA 4KE6A 4IHAA 5AK4A 5BV7A 4P08A 4AO8A 1IUNA 1X2BA 1I6WA 3BJRA 3A2NA 1R50A 3I2FA 3V1KA 2WJ3A 1CFJA 4X00A 1H2XA 2ORYA 2VEOA 4BC1A 4BVKA 1CUIA 2XQIA 5HCUA 3OC0A 2XUDA 5H3HA 4U2BA 1U2EA 3ESAA 2JEYA 1LPBB 5CT4A 4J0JA 4WDRA 3F9CA 3H17A 4X3CA 1QTIA 1XRRA 5DNUA 5JAUA 1JFRA 4RGYA 1GKLA 2G4LA 2B20A 3IIIA 1LGYA 4EA6A 3AZPA 4PSCA 1PV1A 4JUIA 4DSAA 3BF7A 5DNWA 3D59A 4FOLA 4Y2QA 2GYWA 3A70A 3FYUC 4BYMA 4F0JA 1UOQA 1YS2X 1LNSA 2CJPA 3STTA 3WK6A 4OB8A 1P0IA 1L7QA 2ACEA 1CQWA 3WIBA 2PUJA 3RM3A 7YASA 5FPPA 2PL5A 2WTMA 4BATA 2XMBA 2OXEA 1ZIXA 1QIFA 1P0QA 1F6WA 1N1MA 4FTWA 4A5SA 1VXRA 2CKMA 2Z8XA 1XRQA 2G63A 3RKSA 2PSEA 4UBMA 4B82A 4KACA 1LBSA 1LLFA 5T4FA 4JNCA 4N8SA 5ALDA 2K2QB 1G4HA 1EH5A 1ISPA 1MN6A 5HK8A 4BZWA 1W76A 2XQGA 1UFOA 2X5XA 3NWOA 4OB6A 3C8DA 4C4ZA 3WIOA 3O4JA 5ALTA 3STUA 4AB1A 4UBIA 5SYMA 4MYDA 5A7GA 4LXIA 1JMYA 5AKEA 3WJ2A 1CUJA 2ZSIA 5JALA 3UUFA 1KU6A 5ALKA 1LZLA 2HRQA 3OM8A 4DMFA 3LCRA 5JARA 2W6CX 5CT5A 3G0CA 3GUUA 5A7HA 3SWWA 2H7YA 4MQMA 3LIPA 1P0MA 1XZGA 3JW8A 4B9AA 2XDWA 2GZRA 5JASA 3WWCA 5JZ9A 1MJ5A 3DDUA 1N8SA 2YXPX 3WL5A 5LZ2A 5C8XA 3I6ZA 4BRSA 2J3DA 3HRHA 4L3WA 2EDAA 3F8SA 1ZGBA 4GWLA 2PSDA 2C5GA 2FJPA 1ZD4A 5K3DA 2WUEA 5HQ3B 2JGMA 4ARAA 4EY6A 1UK7A 2VT7A 3PE6A 4HZGA 3O9VA 5A7FA 2FJ0A 4DNOA 4K6HA 2WHQA 2ZYHA 2CZQA 3ILSA 3HXKA 4OD0A 2I03A 3G7NA 4PV7A 5K5EA 3WZLA 1ZD2P 3FAKA 5AKJA 3WK7A 5D3ZA 4LXGA 4JEIA 1E8DA 1LZKA 4OB7A 4DYHA 3SX4A 1J07A 1ODCA 3DLTA 3SK0A 4H0CA 3A2MA 1TCBA 3W05A 5FDFA 4TPKA 1XLWA 5ALVA 1XZHA 4FMPA 1FSSA 3V1LA 1Y37A 1NX9A 5DJ5A 4DIUA 1EB8A 5JANA 4N5IX 2WJ6A 5JADA 4A16A 2AJDA 4KEAA 2DQZA 3CCCA 2OGZA 1UKAA 4H77A 3IA2A 3WK4A 1GT6A 3IDAA 3I6YA 1G66A 1QOZA 5HFAA 1ZI8A 4QA9A 1CIJA 5FKJA 2XUQA 1WHTA 4J0KA 1K63A 3H18A 3IVMA 3R3ZA 1MO2A 2FX5A 4ZI5A 5HKBA 3I1IA 1BU8A 2VAXA 4G4JA 3D2CA 4AZ0A 3FYTA 3WQHA 4K6GA 1ZJ5A 4QDUA 5DYTA 4AMZA 4J3JA 3E4DA 2RGUA 2WM2A 3C87A 3GA7A 1YAJA 1AGYA 3VJLA 1SCIA 2VSQA 2GZSA 3G9UA 3C45A 3FCYA 4DNQA 4LHEA 3ESBA 3OTQA 5A6VA 5ALXA 1VZ2A 4E11A 1XZLA 2V96A 1BEEA 2B9VA 1CV2A 5ALMA 1TCAA 4GI1A 1UZAA 4Q3KA 4X6UA 1XQXA 5SYNA 2WTNA 2HA3A 4KE7A 4N8EA 1CUGA 1CR6A 1UK9A 1Z68A 3BWXA 4HS9A 4ZGBA 2EDCA 5EHXA 3A6ZA 4G8CA 4Y9SA 3AINA 2C0PA 3W06A 1CUEA 1PJAA 5ALNA 5FXMA 2WIFA 5BOVA 2D0DA 1GXSA 5E4YA 1A8UA 3HC7A 5A71A 5ALHA 4WJLA 3HACA 2HFKA 4X91A 3ZI7A 4UPDA 4XVCA 1ODSA 5KWIA 5D3KA 1X2EA 3H04A 2XMCA 1XRMA 3EF3A 3G9ZA 5DYWA 2OGTA 1N5RA 4INZA 4WFIA 3VISA 2QUBA 3WA6A 1B41A 4C4XA 1TCCA 1RWQA 5I7UA 2HU5A 1QIIA 3FCXA 5FLKA 1XZMA 4H18A 4P92A 3BXPA 1CUYA 4WDQA 4Q34A 4MEAA 5EHZA 1YASA 4DTCA 1LPOA 3DOIA 1DX4A 4U2EA 4QDXA 5JAOA 3DL4A 5JZSA 4X93A 4WY5A 2VT6A 4IH9A 3G0BA 4KRYA 2QS9A 2XUAA 1MNAA 2ZYRA 2Y6UA 2Z5GA 1ZD3A 2Q0XA 4MWTA 3SC2A 5EHQA 2Z8ZA 4XWGA 2X8BA 3AUKA 1U4NA 2JGFA 4X6YA 2DFPA 3PF9A 4BCCA 5AI8A 1E5TA 1QIMA 1FFDA 3QYJA 1UOOA 1EDDA 3PF8A 4M0MA 1VA4A 4W9RA 4CG3A 1ACJA 4F60A 4AXBA 6YASA 4C01A 3WKDA 2IX9A 5IVHA 3AILA 2JGIA 4NZZA 4TVKA 4UHDA 4UBKA 3KDAA 4DNFA 1W6RA 3WWOA 1OXMA 2XQFA 4OCZA 2VAVA 3MVEA 2J4CA 1DU4A 4L0CA 5AKKA 3DJYA 2I3ZA 4OSEA 3D3NA 1AMNA 5CH5A 2DHEA 3GBSA 4DGQA 5C8VA 1R4ZA 5I9IA 3H2KA 2O7VA 4BBZA 3WL8A 4CI9A 2BUCA 4BTLA 1MNQA 3HZOA 1E8MA 3EQ7A 1DWOA 3VJMA 4TGLA 2BKLA 4LIPD 1JJBA 4U2CA 1YB6A 2O2IA 4PF1A 4FWBA 4G4IA 3FLBA 3OG9A 4UHFA 4LKOA 3ZLVA 1NU6A 4F21A 1EXWA 2HA5A 5ALQA 4RNCA 1BE0A 2WFLA 3DD5A 5HF6A 1ZD5A 5LYYA 4OU4A 1WOMA 3I2IA 5CRIA 3M3DA 2GBGA 1IUPA 3WL6A 2RONA 1VXOA 3V9AA 2HU7A 4LYDA 1Q0RA 1W1IA 5AK3A 5AKYA 3H2GA 3DOHA 4KJXA 1WCYA 3DQZA 2C4HA 1W75A 3F98A 4ZREA 2GBCA 5HKAA 4M0EA 1GKKA 1ZICA 2I3DA 2ZJFA 1PFQA 3R0VA 2BFNA 4EY7A 4BAZA 3KOOA 1Q84A 3O9MA 5CT6A 1S8OA 3R40A 4DNPA 2CEKA 3QZUA 5BWCA 1BCSA 3WK5A 4ARBA 3WKBA 3DL7A 4B80A 1MAHA 3WMRA 1G5FA 3UUEA 1QIDA 2WILA 3D4LA 1ORWA 2ZYSA 5JIBA 1DQYA 2QR5A 4ZXFA 4ZV7A 4UBLA 1EK1A 5K3FA 4B84A 1K6EA 2QMQA 4P9NA 2JF0A 3W2TA 3AIOA 5LIPA 2HADA 3DCNA 3IB3A 3C6BA 3KWJA 2PKYX 2ROQA 5AJHA 5HF9A 1XLUA 4FNMA 1AURA 3V1MA 4QEKA 5IH7A 4BC0A 5KBYA 3N2ZB 1F0NA 4X95A 3KWFA 2OPHA 5AI5A 1KU0A 4Q3OA 1G42A 4E14A 1K8QA 4C87A 3BL8A 3WKEA 1CUWA 4MEBA 3KXPA 2AXEA 3QVMA 2Y6VA 5LZ4A 4CG2A 1F0PA 3D2AA 2CMFA 3AZOA 2Y1KA 5AH0A 1VZ3A 4J0GA 3S8YA 1U8EA 3EBLA 2WUFA 1T4MA 2OCIA 3AIMA 3C70A 3G0DA 4OYLA 4QLAA 5JD4A 1GPLA 1WB6A 2R11A 3F67A 5LKAA 5AOBA 1FFEA 1DX6A 1R88A 1BS9A 2JGJA 3W04A 1QONA 1QIJA 5A2GA 2WHPB 3I2KA 4UUQA 1JJFA 1E66A 5EIEA 1MX1A 5AK6A 4UFOA 1QE3A 1VKHA 1QFSA 1RP1A 4CFSA 4LXHA 4B7ZA 4MWSA 4C4YA 4G5XA 2WU4A 1L7AA 2O7RA 2Y2VA 2RHTA 2WHPA 4X90A 1CUXA 3E3AA 3V1NA 4U2GA 2ZVDA 3C5VA 5CXUA 3QITA 2HRRA 2RIPA 5AI9A 4BTVA 1MPXA 4QWMA 2XMZA 1QTRA 4JYMA 4DSZA 2QZPA 4QWWA 3MGAA 2WQZA 4UHEA 4NMWA 3FLAA 4BVJA 3F97A 3R3VA 4OPMA 3RLIA 3WYDA 3D0KA 4IH4A 3C6XA 2WSLA 5AM1A 1LPMA 1BROA 1TIBA 4X97A 3W9UA 4B0OA 1CUSA 3ZLTA 4K5QA 3WWEA 1HKHA 1KEZA 3QPCA 4XIIA 4Q3LA 1TKRA 3R3WA 4G9EA 5CURA 2XB6A 4QDOA 5T4HA 2H1IA 5ALPA 4FFWA 3A2LA 2WUGA 3FLEA 5HK9A 5DTJA 1UKCA 4X6XA 2PU7A 3AZQA 3ZWQA 1R9MA 4Y2VA 1FFCA 5LLSA 4QZVA 4NS4A 4BP8A 3L1IA 2J3QA 2O2GA 2DHDA 4GECA 1IMJA 3KD2A 4GLBA 2VA9A 1AC5A 1ZOIA 3R3XA 5C8ZA 4UHHA 1WM1A 1YA4A 5AIBA 3VVLA 3FWHA 5AP9A 4V2IA 1XZDA 1IUOA 3BE8A 1UKBA 2VATA 1E8NA 1LBTA 4X92A 2PX6A 2ONCA 2QTBA 3G0GA 3U1TA 3M83A 1CUZA 4J0DA 2V98A 2HM7A 2Z3ZA 1GPKA 3BJMA 5JYCA 4FLEA 1DQZA 2QUAA 3VDXA 3QH4A 1JT2A 1QIKA 5CBKA 1C7IA 4KAJA 2GYVA 5DNVA 2DSNA 2XMGA 4HTAA 2WG1A 2PSHA 4CCYA 2DR0A 1SFRA 4EY8A 3JYHA 3CXUA 4KAAA 3G02A 1F8UA 1ACLA 3QPAA 2HA0A 3AFIA 3HYSA 3CN7A 1HQDA 3CN9A 5KREA 4GHWA 4EY5A 4MYSA 3L1JA 3LP5A 3I2JA 1UT6A 3K9BA 5IKXA 2AJCA 5ALEA 2HU8A 3QMMA 4X7BA 1IVYA 2AJBA 2XMDA 3IULA 2XUHA 5EIHA 5AOAA 3IUNA 4CIBA 3G0IA 3PUIA 3GZJA 1LPNA 1QIEA 1L7RA 5FOQA 2HA2A 4Z49A 2RAUA 4G9GA 5I8PA 3MUNA 4H7EA 1XFDA 5ALZA 1R3DA 5D7BA 5LZ9A 1A8SA 5JD5A 1SCQA 2VJDA 3FOBA 4FNGA 1H2ZA 2WIJA 5ALOA 1T2NA 2VJBA 1DTEA 4Y2TA 4CIAA 4CG1A 3OPMA 2BUAA 2NW6A 1CUUA 1O6FA 4BB0A 2QM0A 2DCMA 4U2FA 3ED1A 1Q0ZA 3O4HA 3LLCA 1XKTA 1GQRA 3TEJA 3QM1A 2G5PA 3P2MA 1TK3A 2XUKA 4YPVA 5AICA 4RE6A 1EINA 1VA5A 2PUHA 2Y2UA 2XLBA 3PICA 4H7IA 1J06A 1CUCA 4K6KA 5JD6A 5DYYA 4G4GA 1XZIA 1JKMA 5CMLA 3QMVA 4I4CA 1YAHA 2FUKA 2PVSA 2C0QA 4ETWA 2CUTA 5JATA 3WI7A 2B61A 4W1PA 3WZMA 3BIXA 4BE4A 1UWCA 3IBTA 1K5PA 4AQDA 3WL7A 2PSJA 1ORVA 5C7YA 5AM4A 1E89A 4HXFB 2JBWA 4BZZA 3B5EA 1CUBA 4KAFA 4C88A 3WYNA 2OG1A 3O4GA 4B9EA 1HBJA 4PNZA 1DINA 3O95A 2QVBA 4Q1VA 1VOTA 1GPNA 1AQLA 2C5FA 1OILA 5E2IA 1DT5A 4OUKX 3D5EA 1A7UA 2HDWA 2Z3WA 4N5HX 1W52X 3LS2A 3UMJA 3M81A 5AI0A 4ITVA 4ZWNA 3H2IA 3F96A 3C8HA 2H7XA 4HRXA 2PPLA 4H7JA 3H2JA 5EHNA 4FLMA 5FRDA 3WLAA 4GEGA 4UBJA 4J0IA 5ALSA 2WG0A 1EA5A 1OCEA 2XUGA 3HEAA 4AO6A 5EFZA 3DKKA 1TAHA 4J0CA 4PO3X 4Y2JA 2JGEA 1CUDA 1WB4A 5K3FB 4DMCA 1VLQA 3MUOA 4P93A 5AKZA 1SOMA 2XT0A 3BF8A 2XI4A 1XQVA 1WHSA 5CW2A 4MJ3A 4PW0A 1GQSA 5FP0A 3STVA 3C5WP 2BUBA 4KE8A 2BGNA 4IO0A 5HZGA 1QJ4A 5HFNA 1BEZA 3ESDA 3DNMA 2P8SA 2GYUA 1FJ2A 2VJAA 4I19A 5ALWA 5AOCA 5ALUA 2ZJ6A 3NGMA 2JGKA 2WIKA 5CT9A 1MX9A 1O6GA 4FBMA 4EZIA 4QLOA 4I3FA 1DT3A 2VJCA 1Q83A 1THTA 4FHZA 5AHXA 1XQWA 3WA7A 1SC9A 2GBIA 5IVIA 4ROTA 2EEPA 1B6GA 3FYUA 2WHRA 2VQ6A 3R3UA 2G5TA 1H22A 3RK4A 2BCEA 1JJIA 3HJUA 4DLNA 1MU0A 4QDZA 1CRLA 3I2HA 4WFKA 1R9NA 2CB9A 4B6GA 5IVKA 1C7JA 2YYSA 2RI6A 5CTAA 1H2WA 3FSGA 2OLEA 2QXUA 5C81A 1EVQA 1RYYA 3OOSA 4AN0A 1MAAA 3H1BA 1HPLA 1QZ3A 3STWA 1WPRA 2V97A 5LP1A 4C6HA 4EY4A 1VE7A 4FBLA 3TRDA 4BVLA 5ALFA 4Y2SA 5CH3A 5KWJA 4FDMA 1Y7HA 2HIHA 3NOXA 1IZ8A 1M33A 2XUIA 5AM3A 1J2EA 5AKLA 4Y2YA 4B0PA 4AX4A 1CLEA 2PSFA 4M0FA 3NUZA 5HQ3A 1J1IA 1MTZA 3LIIA 2OCKA 1VJ5A 5AO9A 3U0VA 5T4BA 2XQKA 4O08A 4UHBA 3AJAA 1UXOA 3D2BA 5D6OA 2HHAA 4WCVA 3I28A 3PI6A 3DKRA 3HSSA 5AIAA 1QIHA 4NVRA 2QXTA 1X70A 2IITA 2XQJA 5IVDA 3GROA 3WWDA 5K3EA 2J4FA 3GELA 1USWA 3D7RA 5K3CA 1XZBA 4ZV9A 4GDMA
chains in the Genus database with same CATH superfamily
1BO6A 3A25A 4MVJI 3AWIA 3C7CB 3RU3A 2MSKA 2ZUVA 2R6GA 3BMOB 3E18A 3MINA 3R6LA 1A88A 5L6MB 1USIA 5HF5A 4WOPA 3H8VA 2V6IA 4FWTA 4DLXA 2EKBA 2QSYA 4D2IA 4DQDA 2J87A 3QVOA 4OHFA 2H59A 3RSLA 1DAIA 3S2SA 1GZSA 4ND6A 4PBSA 4H7FA 3SFZA 4FFPA 2WKWA 1EHYA 4MPPA 1GXSB 1HH4A 2EEZA 3LT0A 3FPCA 2NACA 4GZ3A 4XM1A 4LCBA 3CVYA 1B23P 5FI5A 3UB4A 1N3LA 1SJ9A 5DIZA 3FROA 1IBLB 1GDTA 4G1FA 2JD0A 4IDOA 4RS3A 4TKZA 2GEJA 3KSBC 2VSFA 2W22A 5AKHA 2NN3C 1RR6A 4B35A 3ANXA 1E7MA 2X9LA 3AR3A 5DNAA 4B6EA 2WB2A 3S68A 4QJBA 4N6NA 4WZ6A 5DT9A 3LPAA 3HHEA 5KX5B 4EPRA 2OZPA 5BMVB 1KWGA 2EIXA 3L6OO 1GM5A 2QTVA 3PYXA 1UDAA 3FMVA 4RY2A 2C98A 3S6JA 3AKZA 1E0KA 4HNSA 4DSOA 3B3GA 4DAEA 1XCPA 3VYVA 3LY7A 1GCUA 2PZEA 3QE0A 3TIGA 2QGFA 1SKUA 1Y4UA 5GONF 1FW8A 5F35A 1VB5A 4O8ZA 3SNHA 3E3MA 4EVQA 2XYQA 4RA9B 5EEHA 3W3AA 4BO2A 1XNJA 2GN0A 1TA9A 3THSA 1HLFA 1G4AE 3NX4A 1R27A 3ZDCA 1UK8A 1YR2A 4L76A 1HK7A 4UVIA 1JHUA 5CDYA 3Q0TA 3DM9B 3GZ4A 1C0KA 1VBKA 4JQZA 3OMXA 1RWWA 3G59A 3WFJA 2C7PA 2XHZA 1LPAB 2Z1MA 5KYUA 3NB0A 3JASA 2BVNA 5ALJA 1EWYA 1EQ2A 3DYVA 4M7RA 1P17A 4N47A 3DH0A 3MRXA 2P9YA 4TMTA 2HF2A 4ZAWA 3DLBA 2BZSA 4RZHA 4Y2RA 5AW6A 2IDJA 3C8UA 1U9YA 5C51B 4D9JA 4KKXB 2X76A 4R9UC 2HCFA 4F5ZA 4UHCA 4HYYA 3U5ZB 3AIKA 5I9BA 4CQMD 4WV3A 4ZCTA 3HDGA 1CJBA 2D2XA 3LL7A 4RJLA 1IPHA 1TLLA 1Y6ZA 1YL5A 4NJEA 1PNTA 4E15A 3UH0A 4JT8A 2GN9A 1J8MF 1SB8A 1KOJA 1XZNA 1SMKA 1AUVA 2I3AA 2WA1A 3ASYA 1JSZA 3EIOA 3OZBA 5DCWA 4YJGA 4EBFA 4EYGA 4HTFA 4LG1A 3REFA 5JTUA 1PEYA 2VP5A 2X7JA 4KQJA 2QSUA 5EIBD 3SLKA 1GZDA 4F38A 1GG2A 4XOIA 3Q3HA 1ORRA 1OW3B 4J76A 4RWEA 5CW1A 2FPXA 4B74A 1M8JA 5F1OA 4AP6A 3EWIA 1YMQA 1A8QA 4A91A 1X7ZA 1GUDA 3OZAA 3FMOB 3V1YA 2A35A 2XMSA 5LQSA 3EVTA 1K8XB 1QO9A 4LZPA 2R3SA 5E2AA 1HDCA 2GAIA 3KPJA 2QJFA 4R9SA 1MVNA 1TRHA 5EXDA 5EFOA 3EF1A 3I23A 5J63A 1LDEA 3PL1A 3U49A 4EW3A 1YR9A 4S1TA 3UJHA 4KGVA 4JI3B 2P78A 4GE0A 3IE0A 5F9FA 3O31A 3B60A 1PFGA 4HPXB 4L0DA 5D3QA 2YTZA 2ZE7A 1HFKA 4V0MA 4ZYLA 3T3MB 3FVRA 4B81A 1W19A 2QU8A 5J43A 2XYRA 2JAWA 2P2YA 3HU3A 3A10A 4KX3A 2WC1A 2VUUA 1OE0A 4BX3A 5FFFA 2VPIA 2WTBA 3DCJA 3C14C 4AN1A 3H19A 1IBCA 2MR6A 4EYSA 1M74A 4L5JA 5E6RB 1YQGA 3OX1A 4KQKA 1O95C 3P0HA 5BT9A 1X14A 5ADHA 1R9GA 4CF5A 2ZU0C 1U0HC 1JMKC 1R1DA 4EUNA 2Y0PA 2RHRA 3Q0EA 3LE8A 3OPNA 1V9LA 3HYCA 3QELB 1Y3BE 4FYKA 2HA7A 3OIDA 4AK9A 4C05A 3SJBA 1D2EA 4H35A 4GKKB 4ES6A 2HA4A 3ZDZB 3FB1A 3QBVA 4S0XA 2W6IA 4G1MB 4RSGA 2CXHA 5HSGA 3KB8A 3VNBA 5H5JA 4QXOA 3FA2A 2O05A 3BERA 2FPSA 2E2WA 3SZUA 4PZ0A 5DTQA 4CHGA 1GZ7A 1MX5A 3GXBA 3LDUA 3N7AA 3NYIA 1Y63A 3K70D 4MPJA 2XSZA 2GCNA 4F6LA 2W71A 1O5IA 1C5KA 3TZEA 2DR2A 1YA6A 2O6HA 1A7JA 3L18A 2ZRKA 1XELA 4QU0A 5CFQA 2QXYA 2RGEA 3KSUA 3WRVA 1MC5A 2VTEA 5EYPB 3MWFA 4C89A 5BVHB 5KOYA 1JEJA 1VLJA 2AYXA 5DK4A 4FX5A 3RGWS 4F93B 5FNVA 1TO6A 2WQ7A 1JWBB 1PE0A 2GF0A 1RWNA 3ANLA 2TMYA 4X94A 5LZ5A 4ENSA 3VNVA 1OMOA 4RD1A 2VJMA 2YL2A 3I53A 2ZI6A 3U4QB 3E2PA 3GJZA 5AKGA 1U3CA 1YQQA 3JASB 1FPMA 4Q4HA 1C9JA 1RSZA 4E70A 1LQTA 2PU5A 2XUOA 1K89A 1PKXA 1PJTA 1STOA 3CF4A 3GFGA 3OZSA 4FI3F 4HXEB 3CINA 4F12A 1E3WA 1SHKA 1A9XA 2DFNA 2FE1A 1UK6A 1J0CA 2LUOA 3LI2A 4KUEA 2FG7C 4KRXA 5DK6A 1CRQA 4YASA 3FDJA 3EIXA 4KOEC 2NU6B 1RZ3A 1UEJA 1BSVA 1MW9X 2XWPA 3HN6A 4NNOA 1FBNA 4EGAA 5LJLA 5KQMA 3OTWA 1D3AA 2BE9A 3PQ3A 3FF1A 4L5CA 2E3JA 5CDFE 3B1JA 1CUVA 3ORFA 5F1PA 2O3QA 4J03A 1JH9A 4L8LA 2VP3A 3G2OA 2OCGA 2OGWA 2R6DA 3DHNA 3I6MA 3MT9A 2RCNA 1ZGHA 4QGAA 4U2DA 1ZI9A 3R7WA 1BH6A 1Y1QA 2ONJA 3CEMA 2IXEA 3RRYA 4CCWA 1Z22A 1DAOA 3R3YA 5DEOA 4NECA 3CMCO 4DLSA 3DLCA 3CX3A 5DLDA 2V65A 3WZ2A 4YCMA 1U6KA 3KM0A 4NV1A 4RTJA 4FHFA 4MROA 4R1QA 3OQBA 4LBZA 3T61A 3HB4X 4WERA 1IHUA 2HT6A 4CV2A 3DAYA 3PC3A 3RTCA 1E2QA 3HXLA 3ZI0A 1KOLA 1O5OA 4A23A 4FFOA 2IS4A 5FQNA 4KPUA 4YLEA 3MYYA 1N1GA 3MF4A 1KAEA 1Q0TA 4NR0A 1JEOA 1ZJ4A 2OV3A 5F4ZA 2BGRA 1M9NA 3T52A 3BC1A 2PRSA 3K9CA 2RGWA 2HWKA 2J6HA 4WW0A 3UO8B 1YZ3A 4HB3A 5LP6C 2X9QA 3EMDA 3EH2A 2EL7A 4M0CA 4XYGA 2VAMA 3T4EA 2DBZA 2VK4A 4E2ZA 5KNLA 8ATCA 1DEAA 1F5SA 3TDKA 4B3RB 3H5IA 5JAIA 3F90A 1BCRA 4AY4A 1KI8A 2WINI 4EELA 2BYTA 2QT9A 1U3VA 2YFYA 4YBZA 2Q41A 3UG7A 5J1SB 1HFWA 4Q05A 1CE8B 1E0SA 5ISMA 2ILTA 3HFJA 2QPAA 8LDHA 4W63A 2JG3A 1SVLA 4LBVA 3ETLA 4BRZA 3TJMA 2Z57A 3RF7A 4ZI7A 1YACA 4DA7A 2J3EA 1Y1TA 5CT8A 2DPGA 2Q2QA 3PFBA 1WZUA 4K6OA 1J90A 2H3HA 4WFJA 2YQ4A 2D59A 1ORIA 1IY9A 3CWZA 3N9IA 4I5EA 4JMPA 1M5RA 1CS4C 4M1YA 1VL8A 5ICEA 1PGQA 1J8FA 2HA6A 1I9GA 4DV6B 1RBYA 1Y33E 2FB9A 4KYIB 3WAJA 3HVIA 4XYEA 2CMDA 4Q9AA 4O2BB 5DHPA 1Q1AA 2EF0A 4HP8A 3HKCA 1CJUC 3LYLA 3UANA 5HOEA 5LP6B 1HWYA 1KP9A 3KDPA 5ALYA 3GP3A 2O8DA 1T4BA 1XNGA 3I8OA 4P4TA 3GEBA 3OZUA 5LZ8A 1PJSA 3S2EA 3ZCSA 1J5EB 2QBYB 2B37A 3IR7A 4A4DA 4JDUA 2CUZA 1KRXA 1HO3A 2R8BA 2YWJA 5IJ9A 1ZGAA 3RRMA 3RV4A 3O7WA 4HDKB 1YGPA 4E4RA 1B8PA 2GERA 2JFOA 3MJDA 5J5VA 1Z0DA 3MG9A 1B0UA 1M73E 1RQLA 4I4TF 3QPWA 3C6ZA 1TMYA 4KDFA 3PWKA 2YKGA 2PR7A 1MUUA 4BAGA 5GGXA 2I4TA 3TK1A 4BVFA 4FKBA 5B2EA 2EZTA 4HUJA 5HGJA 3OIWA 4Z7QB 3FOEC 2H5EA 1Z7BA 2OP1A 5AW9A 1UXKA 2VF4X 1NKVA 3OLYA 1EFDN 1ML4A 2OCYC 3TGLA 2Z09A 5CXXA 5JQGA 3GLSA 1SBHA 4ZEOA 2P6MA 2JIQA 4JXKA 4AU1A 3DEZA 2DLNA 2HRBA 4NBLA 1KGDA 5TLSA 1AMUA 1HDGO 2H7CA 2V3VA 4FDAA 2ACVA 2A0WA 2O2HA 1HYQA 1WR8A 2ZWOA 2NVUB 5KB3A 3K2IA 2HLDD 5C1DA 2F17A 5J59A 1DXQA 2QTMA 2XF8A 3LXUX 3PRYA 4RK1A 2QJWA 4F3YA 1W85A 4Z4QA 1FFGA 1FX0A 2IHUA 3L4JA 2WSSD 4OQYA 3BDVA 3C8ZA 4RF2A 1CUAA 3BL5A 3F9IA 4DIBA 3EUFA 1A27A 1Z45A 1YOBA 2IEZA 2WU8A 2ZPAA 4BJ1A 4A5OA 4MYCA 1SCBA 5GGYA 4V38A 3NTVA 3PFGA 4IAOA 1NAIA 3FGZA 5JTTA 2AEMA 5EESA 1CPYA 1T8TA 2RHCA 1BOFA 1YS1X 3IIMA 4KW7A 2ZI7A 2NX2A 1TEVA 5F2EA 3KJGA 5KX5A 3JQBA 1AKVA 1MABA 3DHWC 3EDMA 3BIWA 3DMPA 3M6XA 3QP9A 1D07A 3D3EA 5F21A 4KAXA 2AJ8A 4NYJR 1VE6A 5LYJF 5H8WA 4MS1A 1N4AA 3DEAA 5TQ0A 3Q9UA 2JEZA 1TJ3A 2GMWA 3G9TA 2PMCA 4YUZA 3U31A 1UJ5A 4NCJA 3K8ZA 4FEGA 5JAHA 3QF4B 2AI3A 4FYVA 4QOIA 4D46A 1A95A 1BTOA 4W6QA 4L5IA 3ZDQA 1FCJA 1O9GA 3BM5A 1K75A 1FLNA 3RC3A 1H9CA 1EP9A 3DZ8A 2X8JA 4HTFB 4YC7A 1IPEA 3TLGB 3FBWA 2OAQ1 4CEIA 1HLGA 2WPDA 2EZ8A 3V7YA 5LC1A 3L2OB 1GO2A 4UTRA 2I2WA 4DQLA 1KAGA 1WSDA 4AZVA 2X9NA 2V9ZA 5AM5A 4LN1A 3S7TA 2I76A 3A14A 4IINA 1DAGA 2E0IA 5IN5A 2GBFA 2F8LA 1VBMA 4MUGA 4QHYA 1PK7A 1R5BA 2BDEA 2W2NA 1WB5A 4NU8X 4OQFA 4TM8A 4X3OA 5ULLA 1UPUA 2QRQA 1DXHA 2F1RA 2WVGA 3EPLA 4B3SB 1ECPA 2AG1A 5JZOA 1G7RA 1NMXA 4WBXC 1U0OC 3C5CA 3TWOA 4Q9KA 3SEAA 4EGFA 5JWHA 1YS6A 3MWDB 3WK9A 4G25A 4U0KA 1XRNA 3RUCA 2PBLA 5REQB 2WVJA 4ZRDA 1E3QA 1W1WA 3EVEA 2ZYWX 1NUPA 4YK7A 3RSSA 4HDQB 4D4HA 3DAHA 4NYMR 4R8SA 1IB6A 1WXIA 2O0MA 2IXBA 2ZR7A 2RHLA 3U3DA 4W5QA 3VZSA 1BX3A 4MVJA 2HJSA 2WD8A 4J16A 2AC4A 1U7TA 4LZOA 2NWQA 2XQVA 3KB2A 3KKQA 4XVRA 1XKLA 1D9XA 1Y82A 5CVJA 4BFZA 5BR1A 4IKOA 4H3HB 1KC3A 4ONEA 4FKMA 1RHMA 3VVMA 5D7NA 1LVHA 3FZNA 5ITZA 1GSOA 5A3VA 1TJ5A 2X15A 3AF6A 1MHPA 1TMKA 1ZY2A 1O9HA 3EPPA 1E63A 4W99A 4N49A 5AJXA 3L9WA 3PD0A 1JG2A 1KP2A 2DUUA 1KDOA 1E4OA 4GX0A 4AI6A 3S2ZA 3Q9SA 3RVLA 1J9EA 3I0NA 3O0DA 4YT5A 5D5QA 2B30A 1OOEA 3KT3A 1D1PA 4IQ4A 4XYMA 3HK2A 2Q6LA 1C30A 1YS9A 4ITUA 2GXUA 3GH1A 3H7IA 4YXFA 1AK2A 4DV1B 2NO7A 3IT1A 3RG2A 4TS1A 1TAQA 4FUQA 4A0HA 1X1BA 3DDSA 4F3TA 5EKSA 3ZJ4A 1XLVA 2MIIA 1OKKA 1J56A 1XXHB 3KVNA 4WX2B 2FSVA 2H1SA 3CLHA 5K3BA 1LPSA 2X6TA 5ARDA 4AO7A 1NVEA 3ET4A 2ZT5A 4KN5A 3JAMA 3KZXA 1EESA 3L84A 4R98A 4TV8F 1CD5A 1E58A 1W85B 3BRQA 4BGUA 4AMBA 2L18A 4GXTA 2F4VB 2ZBFA 4LFAB 2A0XA 3IIKA 4H16A 5CIQA 2GASA 1WP4A 1Y6RA 2P7IA 1PX0A 1OX4A 4K6MA 4NWIA 4MITA 5D8DA 4AIRA 1EVEA 5KNCD 4PSAA 3TAXA 1NFRA 4GSKA 4JUAA 4YRZA 2BFOA 5KQGA 1E59A 3VO2A 3HV2A 3DS8A 1JN0A 1N57A 2FQXA 3IUBA 4MTCA 3VR2D 5K51A 5K0CA 3ZE7A 5AYVA 1MRNA 3LDHA 2G9RA 3ORRA 5TE9A 1SG0A 1L5HB 3G2IA 421PA 3Q5EA 2XOEA 2OHVA 4B3DA 1C50A 2FSUA 1F2VA 2LRHA 4C5BA 5KTYA 4AJ1A 5CA0F 3N2GA 4RFSB 1QB7A 2FHPA 3KEOA 1T2VA 2YFHA 2ZRCA 1IUNA 3H05A 4Q6BA 1X2BA 1I6WA 2NU6A 1LB1B 5TMEA 3WHPA 3I2FA 3QJYA 1E2EA 4GE3A 4CLDA 1N6HA 1MR3F 2H1HA 3UVEA 4IUYA 3ZTYA 3MCUA 2FDRA 5LQMA 1QM5A 2JHPA 1WA5A 4OKIA 1H2XA 1U1CA 2ORYA 2ZE8A 4BWYA 4QATA 3KT8A 3LFUA 3MRTA 4ZC1A 2FUCA 4BVKA 3GLGB 1H6CA 1IRXA 4MAMA 3X43A 1LX7A 2HOQA 4I55B 3NV7A 3ELUA 2XUDA 3TZKA 2ORVA 4U2BA 3ZVNA 4I81A 3MTQA 1NF2A 4M60A 1RAIA 1OUMA 2ZCUA 1Q1ZA 2RHDA 5FCDA 3I92A 2HQBA 1GSHA 3JWPA 3UWDA 4YCSA 2G67A 1BHQ1 4FS8A 5T6MA 3RJ5A 1LPBB 5EPOA 5DMXA 3E7WA 1W36C 2MWMA 5F5XA 3H17A 3BA1A 1EAMA 3O1LA 4OTZA 4CN9A 3OX3A 4W9NC 2FETA 2CHGA 4KUGA 5JNRA 3U44B 1X7WA 3QPBA 2KB0A 3O73A 3OFSA 1K6JA 2H4HA 1KI3A 1XRRA 3H0KA 4KBYA 4XYBA 1FU4A 4JLUA 4L4XA 5D3MB 5EERA 4CBVA 4UEQA 4WBNF 5I7WA 5H16A 1BA2A 2G4LA 2O7SA 1O89A 4NHOA 3GMDA 3LAWA 5T41A 4OJKA 5TT0A 2B20A 3FWYA 4RZXA 3ZS8A 4EGQA 1F2DA 3JQAB 3X1DA 3O1JC 4Q1FA 1JA0A 2R25B 3FF4A 4PLVA 4PSCA 2YXBA 1TO2E 1KF0A 4JUIA 4RF4A 4MS3B 4QYMA 3T1HB 3OQNA 4HNAA 5CLHA 2HV8A 2X8LA 3BDAA 3GPBA 4QIHA 3BF7A 4EO7A 3UW1A 1QDEA 2EJCA 4FOLA 1EGAA 2ZR8A 4MKRA 4RPJA 3SHQA 2FN8A 4EYOA 3A7EA 1M2VB 1Z0SA 1KQGA 3UV7A 3PHIA 3FYUC 4F0JA 1YB5A 2I2DA 2HQSA 3QVXA 4YRBA 1LNSA 1TZ2A 1UDWA 3WK6A 4L2IB 4OB8A 3EUWA 3ZGOA 4Y6RA 3M6LA 1L4GA 1PT5A 4TMZA 3WO0A 2H54A 5DGTA 4ZHQF 1SOVA 2PJZA 1C9EA 4V0SA 2PFGA 1DMSA 3U4IA 1NQOA 5IBCA 1JIJA 3KG2A 2O9JA 2XAUA 4AKEA 4YRIA 1O87A 3GC6A 2ZRBA 4WA8A 3B8EA 4HWOA 5D5PA 3UPUA 2QLTA 1KSGA 4JLWA 5FPPA 2DX7A 2I2CA 4IFEA 5DSTA 2FZVA 4KXNA 4UM8B 5HGXA 1IIBA 1L5MA 1M76A 3VFDA 1VPVA 3TQOA 3P5BA 3QBTA 2UV8A 4BATA 3ROKA 3AFHA 4QNMA 3GP8A 4GKBA 3THYB 3ONWA 2C54A 4ISCA 3RS8A 4PNHA 3IVAA 1SQGA 1U2DA 1FNMA 5E3JA 1NV8A 1VP3A 2E48A 2J5XA 4TXNA 3WWYA 4ZT7A 2E4ZA 2Q27A 1QCZA 1QYXA 4X7RA 3L6UA 5A04A 5KYYA 3K2EA 1AUXA 5ALDA 4LRXA 1A7KA 2CK3A 4IWYA 1HURA 3M3HA 3K32A 1G4HA 1EH5A 5PNTA 4F11A 2FMFA 4BZWA 4NY1A 1U2GA 4E2XA 3ZY4A 4RZIA 1WXQA 2PHZA 3S1LA 5CCEA 5CB6A 2QJOA 1I32A 4DANA 1CF4A 3ZV5A 1M66A 2H4FA 2X41A 2J08A 3GFVA 2X2FA 3QEOA 2ALJA 2XNSA 5GIOE 1Q7EA 4IJQA 3E70C 4OB6A 1L5GB 1CRWG 2VFAA 3U19A 1QH8B 3MS4A 2AR0A 3EC7A 4WUTA 3WIOA 3O4JA 1Y89A 5G40A 4Q7KA 2FJUA 5G41A 2NVUA 3H7AA 1GTMA 4Q3AA 5KU7A 4P4SB 5A7GA 3LQ1A 5AKEA 3ROQA 1N5LA 1E2JA 3CUUA 1I4OA 1U7UA 4U3JA 4ZQEA 2XH8A 5HUJA 5IEJA 3O1IC 5DKFA 4EW2A 1ZZEA 2H0QA 4P7KA 1E7RA 2I7CA 3R7WB 3EHDA 1Z0AA 1KK0A 2D2VA 1G5HA 1TM1E 3GQBA 3IEUA 1DOAA 1Q21A 1OBHA 4Q4AA 4BN0A 3LCRA 3I04M 5GINE 3G0CA 5A7HA 2WR8A 4DG5A 3T94A 4HB4A 2GA8A 4LNHA 1M6VB 4GICA 2ESRA 5B64A 1P29A 3GAAA 1W7AA 2ZR0A 4OA5A 2WWGA 3TTYA 5D5HA 3PT9A 4P7JA 3HCEA 1RYNA 5I5GA 5JVDB 4XDZA 1Z4IA 1MG0A 2C5EA 1G41A 5B3JA 1XZGA 3WL3A 3V2IA 5KU1A 3V9PA 1JPJA 2Q3CA 3D64A 2QG6A 3OWHA 4FEYA 4ZP1A 4LDNA 5WRFA 2B3DA 1ABFA 1XCOA 5CG2A 3C6QA 5JASA 3WWCA 2F1IA 3MMPA 3OZVA 4KDCA 4FFRA 4JP5A 4M8NE 4I9NA 5JZ9A 1MGOA 3AI1A 3B7GA 1W4AA 2SICE 4MKZA 3DV0A 3EVGA 3RRZA 3PJDA 4U63A 1PYDA 1G8GA 3A6DA 3FZEA 3QENA 4CT5A 3IE2A 4H2DA 2VSNA 1Y5MA 2X8JB 2FRDC 4E09A 3AB8A 4J29A 5K4GA 3NG1A 4AWXA 2GCOA 1NPYA 3IQFA 5C5IA 2O5EA 1X80B 3LCVB 1T1RA 3OX2A 1LK5A 4GLFA 3GFOA 3RFVA 1JV2B 4NEGA 3H5TA 2A9JA 4JLNA 1L4NA 4D82A 3FW1A 3GT3A 2P27A 1U5BB 5D51S 1NDQA 3JCZA 1V2GA 3TCNA 1PNRA 2O8FB 3FWPA 1VL6A 2AGVA 1GL7A 1ZD4A 3M2TA 5AVVA 4ENPA 3RJ9A 3L7MA 3ZDDA 1U6JA 2BELA 1K8YB 1CYEA 3E3LA 3WLPA 4GOXA 3WRWA 2QX9A 4YDRA 5I3CA 1SHLA 4RD6A 4ARAA 4BFTA 1A8HA 1LH0A 4EGCB 3VAZA 1KI1A 2ZFUA 5A5EA 5B7QA 1JDBB 1U9JA 3MIIA 2PIAA 4HZGA 2DQSA 2VDPB 1JAIA 3HPQA 5A7FA 1Z4KA 3HKCB 3KVVA 5C8YF 1RWMA 2VOJA 2C2WA 3TD2A 5LQKA 3HTXA 4IDNA 3S27A 1KH1A 1ZRNA 5FA8A 3ZDFA 2ZYHA 4FI3C 2VPXA 2XNDD 2HMWA 2CZQA 2FLWA 4NZ9A 2Q5QA 4NXNB 4JA2A 3H1FA 4F4IA 2HMSA 2A94A 2Q9BA 3R75A 3VO1A 2AEEA 2REQB 5U9CA 3U1BA 3N8NA 5ERXA 3G7NA 3FKQA 4PV7A 4D0NA 5K5EA 5KC9A 3WDLA 2R7NA 2RK4A 4XUGB 2OSBA 2OZLA 1BCSB 1FQJA 1B6RA 1Z0FA 4H1HA 1AN9A 3IR6A 2OWDA 4XPZA 1EUZA 1RC0A 1J23A 4QPPA 5EKUA 2K7FA 2AVDA 1V1RB 2OR3A 4IZ6A 1MENA 2PBZA 1PUIA 1A4IA 1ULZA 5E3HA 3CKYA 4TWJA 1IY1A 1VJRA 4HDCA 4ILEA 2I6FA 1CDOA 3ETEA 4K87A 3RYCA 5LL6P 4O4HF 1ODCA 2FSSA 1XDZA 4JEHA 3A2MA 1T1SA 1TCBA 3F71A 1L3IA 3SSAA 1SBIA 4TPKA 4HI0E 1CJKC 1XJCA 2FPPB 5T3UA 2PX4A 1T4CA 1H2RS 2CBXA 5KCZA 1P5JA 3QG1A 4FMPA 1NSTA 5B5SA 1M1YA 3TCKA 2E4XA 1Y37A 3TOXA 3CVXA 4H3VA 5DJ5A 4U3JB 3DWFA 5P21A 3IEKA 4JENA 3W1VA 2VNHA 5JANA 1HR0B 3CVJA 1TNDA 1FX0B 3HV0A 3G2PA 3I01M 5DN9A 2A0FA 1OX4B 5BQ3A 2QTLA 4M99A 1GCOA 4HNQA 4A16A 4UPEA 2Q62A 4MEJA 3KQNA 1VL2A 4G9BA 3A4YA 2P9HA 2AJDA 2DB3A 2P9FA 3MJRA 5A9RA 3SS7X 3R9XA 5FOWA 1YMVA 5C32A 4KH0A 1KARA 3UT0A 3ZU2A 3OQJA 2ZJ1A 3L93A 4EW1A 1WDKA 4RF3A 5IKPA 5FUXA 3VZCA 3IA2A 5TQJA 5BOSA 4KQ2A 3ROTA 2BGTA 2WMOB 1R3UA 3FMPB 1YQWA 1DPGA 4HBGA 3FOAA 4R8VA 2VUIB 3K1TA 2VYQA 2JFVA 1N2GA 2WM9B 4I50A 4YAEA 2CFIA 3W5JA 2O3SA 1B6TA 3ZIAA 1R37A 4F2HA 1G66A 1QOZA 2SECE 4LV5B 3K6SA 5CLJA 2JHFA 1R5OA 3RKRA 2B69A 4D6YA 4CPDA 2IW3A 3VOAA 1EBBA 1T8YA 1U3TA 2H7VA 2GPWA 3F2IA 3UENA 1MJGM 3UAGA 4EMTA 2B2NA 2XUQA 3FH0A 1C3VA 3A1SA 4L7QA 4I55A 5FHQA 3TOZA 1Y1LA 3IB6A 4J0KA 5CP8A 1K63A 3H18A 1XEFA 2QP9X 1OU0A 3PEFA 3SHVA 3V4VB 3U0BA 3L1UA 1CZOA 5C53B 3HDQA 4QXAA 2FX5A 4ESOA 4UEKA 3I1IA 1J1ZA 4GOND 1JBKA 2G0AA 2IA5A 1E94E 1TI7A 3NR2A 4K6GA 1ZJ5A 3M7IA 4R1OA 2IYLD 2XA1A 4J3JA 1M1NB 1ILWA 3WDKA 4ARIA 1OD6A 4JB2A 2HIAA 3LA8A 3NBKA 3PI7A 3C87A 1S2NA 1FFXA 2YNMC 3DLHA 3TJRA 1AGYA 2XIJA 1HXHA 4OJTA 1OWPA 2DWUA 3ADDA 1K7YA 4UDYX 4MQBA 5EMJA 1Q1QA 3JWIA 3KZVA 4ZO9A 5CFZA 1F7VA 1DIOB 1KIMA 1ZL0A 4CLEA 4DNQA 1RLOA 1OZ0A 4LHEA 5LNK6 2X8WA 1E6MA 1HGXA 1ZKMA 3EB9A 5B6IA 4M8IA 3OX4A 1PJRA 4V2UA 4ZRNA 1QANA 1JG4A 1PQWA 3OJCA 3RPEA 1G3IA 2B9VA 4OQEA 3GEGA 4WBNB 1C9NA 2NZYA 2A86A 5ALMA 5EHGA 3FIUA 2JD1A 4PHHA 3BH0A 3W7BA 3QWFA 1AY0A 2KI5A 2OHFA 3UWOA 3S40A 3C3MA 3TTVA 4KE7A 3JAKB 1DRWA 5E9AA 3NHLA 3E35A 5TPWA 2ZZNA 1ECGA 4R2MA 4JLVA 3BGIA 1Z68A 1UK9A 1C30B 3JALA 3BWXA 5DM0A 1DRVA 1G0OA 2RI1A 4ZGBA 4KHPB 2R47A 1Z6AA 1VHWA 2JFQA 3A6ZA 3BSYA 4ALNA 1ITZA 4HY3A 4Y9SA 4MRSA 2X1LA 3VDQA 3WMFA 4EL5A 3AINA 1VLVA 4JJ7A 4G24A 4PWZA 1WNTA 2WJGA 2PL1A 4KQIA 3ZTTA 4U7PB 3DE1X 4FILA 5GOTA 3M49A 1XD2B 1PJAA 4DIOA 2VPWA 5EJ9A 4NK4A 2ZU6A 4PS0A 4RQTA 4QEZA 1RHRA 3FTCA 5ALNA 1SU7A 4G0NA 4YIHA 1Y4SA 2VDVE 1UAYA 1ZJYA 1W1UA 4G41A 3G9QA 4MAFA 2WIFA 3P32A 2O0JA 3VR5D 1WP9A 5BOVA 3ROPA 4E5PA 4BVEA 5HRAA 1GXSA 3QV1A 3OIUA 1Q44A 3HC7A 5BUCA 2PKCA 3PVZA 1PV4A 4AS2A 3ER8A 4G3XA 3U7IA 3ZDRA 3NVMB 4CIYA 3HACA 1BKSB 5EZ6B 2ISQA 1CQJB 1T0BA 3JATB 4KLNA 4X91A 4F8YA 1RT9A 1WW2A 1CEQA 3CRZA 2XB4A 3P0IA 5BVGA 1N6NA 1GJRA 4FU0A 2ADMA 4O25A 3HCAA 5FBKA 2M1XA 1G7SA 4BMCA 3NXSA 3U39A 5L7TA 3B1XA 2JK1A 2OP0A 2VYFA 5JSYA 2CLFB 4U9IS 2HQRA 1IHDA 3LUDA 2A4MA 2VF8A 3I1JA 4L74A 4KXVA 1XRMA 2Y66A 2FPIB 4MS4B 2B3TA 4F9TA 5DYWA 4QJ5A 3O47A 4ZVUA 1XNRB 5M3BA 1XTTA 2BFEB 3ND7A 4TLLB 4WZBE 2BZ1A 2PH5A 3H2ZA 3AHCA 3GQBB 3KE9A 4NEQA 1XPOA 1VL5A 2QG4A 2W9XA 3D2LA 1BX0A 5JH7B 4JHXA 4WFIA 4UEJA 5EIOA 3G49A 2QTCA 3BWVA 3GFTA 1E9EA 4PVDA 4Z9BA 2O3TA 3OZIA 3BRCA 1O96A 3CYFA 4YRPA 3WA6A 2CZCA 1B41A 2VP0A 4HO1X 2MINB 4C4XA 5K01A 5KOJB 1O4WA 3AERA 4URVR 1J8VA 3LKBA 1YZVA 5HUHA 2CVHA 3SR4A 3KAQA 3B78A 3V5NA 2LPMA 4ZAGA 3C41J 5H4HA 3VYSB 4H18A 4H7PA 3OH8A 1YOVA 5K4HA 4L22A 3GW8A 5CDFA 5LLTA 3IDQA 4P4SA 5K0TA 3LC1O 1JVSA 3EOZA 1DC8A 2CLCX 5FAXA 2F4NA 1PR3A 4YWJA 2YDXA 3RK1A 3S2YA 5HX7A 2FW8A 4Q1BA 1O5TA 3LV8A 1JAYA 2W4QA 1V7QA 3IMFA 5EMHA 4ZOLF 5C80A 1TO1E 3LDFA 5JAOA 2RC6A 3T9AA 4TTQA 1FRFS 3WRYC 1D5CA 3LT4A 3ESRA 3CVVA 1J9ZA 1BXZA 2H6EA 3TQTA 2Y27A 5B3AA 3B9PA 3R9WA 1ULAA 1KSFX 1IL0A 1YV9A 1SK8A 2H65A 2QS9A 4KRYA 3VOTA 2NVOA 1CRPA 3BHJA 2CNNA 4FGZA 5DRTA 4R41A 3VPHA 2YHIA 1RKXA 2YCBA 3DZBA 1HZZA 2JHCA 3VPGA 3ICQB 3I5MA 1XPRA 4OYRA 5A5VA 4C43A 3BICA 1OI7A 1RYFA 2QJTA 2Z5GA 3GD5A 4G5SA 4KWTA 4TKLA 4UHKA 2PPVA 2IEIA 2W6JD 4CIXA 2VP4A 5EHQA 4FGUA 1TZMA 2PN1A 2OK8A 2CLDX 1BW9B 3CS3A 1NV9A 1FMCA 2X8BA 5FUQA 1E32A 1M2NA 4JVLA 2R62A 3DBLB 2DFPA 3MMNA 5FPSA 3V1UA 3DXXA 3KK0A 4AG6A 4BCCA 1L6RA 2WAMA 3L0SA 4F5WA 5ES4B 1YK1A 3CC8A 3W3AD 3AEUB 4OI0A 1FS4A 2XVXA 3N8IA 2LZ0A 5DDIP 1E2KA 3EWAA 3HVUA 2ZYGA 2D00A 3RF6A 3OIGA 4RPKA 4C30A 1HNNA 2MOKA 4I1SA 3K72B 4CM8A 2IUFA 2VNJA 2BTQA 2E5FA 3GARA 3UOAB 2GCOB 3PR1A 3QVTA 4AJ4A 1ACJA 1A9RA 4R3WA 4AXBA 1SUEA 4F60A 4ABTA 2CT8A 1M8KA 2DGDA 4K1XA 1V39A 1D2CA 3HXTA 3K96A 1M7GA 3K0AA 4B75A 4YRGA 5CPBA 2OZLB 1K08A 4NZZA 4PHFA 1BOOA 4A8JA 1GTZA 3AI2A 2QRKA 1QFZA 2HK9A 4HDNA 4O4HB 2OV4A 2O8BA 3HVRA 1PJ3A 1HG1A 2GZMA 2FU5C 3L8MA 3HRKA 4R40A 1F2TA 2BEKA 1LBHA 4YEDA 1W6RA 2DFDA 4LY6A 1RAHA 1XALA 1N2OA 1SHTX 4OMCA 4OCZA 1TEXA 3H16A 2ADOA 4K8RB 4QELA 4YMWA 5IAAA 3VQTA 1JPVA 5JSUA 4PRLA 4WKNA 5KQSA 3PX7A 1DKUA 1JH8A 1QJCA 2O7QA 5CBPB 1C3XA 3B2QA 3U7RA 3OESA 2PGNA 4KFRA 5AKKA 7GPBA 1TM2A 3D3NA 1AMNA 3Q8KA 5AW4A 2RAPA 2I66A 5AO9A 1U9CA 1R4ZA 2X0NA 3MINB 5TB5A 4CLXA 4MGZR 4HMOA 3ONNA 1XK6A 2IU3A 3ISTA 3I9JA 4BV8A 4NJMA 4BV2A 5JXHA 4N6OA 1QQAA 1VG8A 3II6X 1VL1A 1DEOA 4UAVA 3NWEA 3ZWPA 2VUHB 3S3TA 2HREA 2QRMA 3DUFB 3LVQE 4JVSB 4JL5A 1L7VC 4ZA2A 2COKA 3OD1A 4BTLA 1YDGA 2SCUB 3HZOA 4XCQA 1T1EA 3SKXA 4DWOA 4LWPA 2P1ZA 4QUKA 4RMGA 5GJVC 3GZNA 3VJMA 2ZSAA 3G2KA 1ZN2A 2P6RA 2TECE 4C7KA 3AERB 4JGIA 4LIPD 1JJBA 2X40A 1YB6A 3HRIA 3GLFA 5K0JA 4JI8B 2HLDA 2B1RA 4ZCQA 2X0FA 1DLJA 3NWJA 5BP7A 2IXGA 3FLBA 1T4CB 3K53A 2GUGA 4I50B 4WKBA 1X9GA 4RHCA 1P6UA 2O2CA 3CB4A 1RHKA 3JZDA 3T1YB 3NPMA 2PMFA 1H0RA 1BNCA 4DS3A 2Z08A 4GPAA 4F21A 3QQ5A 1TJYA 4K9SA 2V7BA 3KAJA 1DFGA 2ZSDA 4FGWA 4OF4A 5TMDA 4BQFA 4N7JA 2YS6A 5ALQA 1Z13A 1SD2A 1YUNA 2G1KA 3IKJA 3SXUB 1IEQA 1UQRA 2OO5A 1R6TA 1T43A 1BVUA 3PWSA 2NUAB 1ZD5A 3WLMA 5LDHA 5LYYA 1NY6A 2BEVB 5FNZA 3CVUA 2DETA 1DQNA 3LQ4A 1H3NA 5CRIA 3CR3C 4BO3A 1X80A 5COAA 4GX2A 4OYHA 1WZ2A 2FQQA 3KJXA 2RONA 1FNCA 3P8ZA 4MKXA 4R4JA 1E96A 4MWBA 3VU3A 1QLHA 1JMVA 2Y1DA 3HLYA 5TS3A 1JG6A 3USES 4KVGA 1Q0RA 4XSHA 4LXYA 1JDUA 3EULA 4EF4A 2L69A 4N40A 5EJ2A 4B4VA 3TB6A 1LQUA 3VZPA 1MB9A 2QX7A 3MN1A 4RKEA 4LOAA 1H8HD 4DR3B 3DOHA 1F0KA 1J2RA 2H1VA 2EBFX 3EFBA 3KFXA 1AN0A 3DQZA 1U1EA 5ITVA 1OAOA 5AVJA 3ZG6A 1VPEA 5CAEB 3TJZA 3MT8A 3PSHA 3D8HA 3OPYI 4YLYA 4MW1A 3PHGA 3BWBA 4MIKA 2WJZB 3JQGA 5HKAA 4DA4A 3BRSA 1ZICA 2ZJFA 3P26A 4EY7A 4P4LA 1HYGA 5DP2A 3VOSA 4BAZA 1DUSA 4BP3A 1FW6A 4QU8A 3FPAA 3GCZA 5J9FA 4Q0MA 1L5SA 3RD5A 4YMVA 2ODWA 4INJA 1S8OA 2ZSJA 3CEJA 3IIJA 3R40A 2CEKA 4DQKA 1X7ZB 4IJ5A 1BCSA 1YHZA 3UKDA 1Z5PA 4D57A 6GPBA 3FPJA 3KUKA 2ZT8A 4JAVC 5CGQB 3WLJA 2V0GA 4PR0A 3D3WB 1GZUA 3DL7A 2D4AA 3L0YA 1MAHA 1WHSB 1GPMA 1SQ0A 3RSFA 3SJCA 2IYPA 3JARB 5LMNB 2LTAA 4NEHB 1LY1A 2JC3A 3D4LA 1PTJC 1ORWA 3I4CA 4UVEA 5CDHA 2AKEA 1ZD8A 1AKUA 4LWOA 4LA4A 3BD7A 3SPXA 2TMGA 3TPFA 2W58A 3UK1A 1KKMA 1GR0A 2C3PA 2Z30A 2GJ8A 5IUJC 5J58A 2QMQA 5IT5A 4BJ5A 4GR9A 3BPSA 5HCIA 1PTKA 1IBSA 2J33A 3O7MA 4HX2A 4NJMB 3ZU4A 2HYIC 5D2CA 4IIUA 1ZM4A 3OO1A 3WNBA 1QTQA 3NW9A 1ZU4A 1B14A 1U98A 4L07A 3WP1B 1M6HA 2VBIA 3IALA 3URMA 4YMTA 3KWJA 2JIZD 3D6AA 4G0YA 1AQJA 2JH9A 2GBLC 4N03A 2A8YA 2VHJA 3JAKA 1KOGA 2X8AA 1DJPA 4FZ3A 1KKUA 4H6XA 4XSGA 5CFPA 3Q11A 2CEAA 1E1QD 4P5EA 4ZT3A 3GCDA 2PXHA 3QEMA 1WDWB 4FNOA 7AT1A 5HF9A 4WN9B 5BW8A 1OR8A 4OXIA 5JD3A 3H97A 1Q15A 5LSAA 2P6PA 4QEKA 4UXIA 4A6EA 1GUFA 4GAEA 3VPBA 2VIIA 3R0JA 5EJFA 4J1NA 5LXTB 1XD2A 1DTWB 2ZBPA 3CUTA 5KJ6A 4NXMB 4X95A 2A0KA 2C2MA 1GDDA 5FJJA 3SFVA 3LUFA 1VMIA 1VJDA 1PVVA 1ZMTA 1WW8A 1OJLA 3LBAA 5F7ZA 1KU0A 2F3UA 1G42A 3FDZB 3ENWA 1SBCA 3L43A 4BEWA 4RAOA 2QHXA 4C87A 2G77B 3BL8A 2IYYA 3ID6C 2XDYA 3H9UA 4GOOD 5F3RA 3WKEA 1XA3A 1FFWA 1ATZA 4M1SA 3K9LA 1KJZA 1CUWA 1SBNE 4WK2B 3RJMA 4RTOA 1E3TA 4G0WA 2V4UA 3Q6MA 4LTNA 4PX2A 4RCVA 2ZS8A 2IH5A 4RWZA 1NA5A 1YB1A 2HJRA 1F60A 3A31A 2YJ3A 3KQLA 1BDIA 1X9IA 2CSXA 2YOFA 4MR7A 3LUAA 1R4NB 4L51A 4ME6A 2Y1WA 2CHFA 4O8CA 5AH0A 2UYCA 3OY2A 4FYXA 1ZX1A 1DX9A 2FG5A 4NU5A 4CMCA 2R9VA 3EBLA 4HKTA 5EXSA 2X4GA 3WQBA 4Q3EA 1T4MA 3ZZTA 3GRYA 3OUTA 3GT0A 1SHJA 4H4DA 4GYJA 4PC3A 2W6ID 4YR9A 4F4CA 2NSDA 4QLAA 5IK2D 2DHQA 3HCFA 2DY1A 1NJ6A 5CA1F 3BWCA 4LJ8A 3WNVA 1VHDA 4BLQA 1HE5A 1W2GA 2WSMA 3KFVA 5DLEA 3HBJA 1XTPA 4RLQA 1PLKA 2H07A 4POOA 4BBJA 4EGSA 3JQ8A 5K20A 1SC4A 4JROA 2X58A 4E03A 5CGZA 4BPBA 1QPGA 3CH6A 1GPLA 1NBEA 1JKFA 3VR6H 3U61B 1NMYA 3CLUD 1F17A 4LC0A 1DX6A 1YDFA 3RANA 3PQ5A 1KI2A 3WS7A 3VMFA 3DQPA 4BNWA 2X1VA 1T13A 3I58A 1E5DA 4UM9D 3TL3A 5K45A 4ZPJA 3MB8A 1Z18A 3STHA 4I4NA 3DMTA 1LTKA 1UEXC 2BEJA 3UAOA 4PC6A 1T9BA 2PL9A 2QW0X 4TTRA 1FU7A 2XGSA 2PZAA 3WGVA 2D0OB 3UTDA 1QBGA 1QE3A 2G25A 1RQPA 2PV7A 3HB9A 2GYYA 3SKYA 3SX0A 2H9AA 3ZVKA 1YK0A 4X20A 4HH3C 1K86A 3JALB 1NP7A 2O14A 2VT3A 3WMEA 2CUKA 3RLFA 1PHRA 3UGKA 5L51A 4G5XA 5GY7A 3VPCA 3WP0A 1XUOA 3OIYA 4GI3A 2WNIA 2WU4A 1SXPA 5JS1A 4G5HA 4EKIA 1R9JA 1M1XB 2FHSA 1H65A 2IU4A 3V1NA 1JSXA 1EGQA 3BUSA 3U9SA 1PVOA 1JLRA 1PJ2A 1P4JA 4FOTA 2Z1DA 3DFFA 1YJ8A 4IHJB 1X1RA 2PRYA 2Q99A 1RPAA 3CPJB 4C4RA 1V1MA 4P6VF 3O75A 3NDRA 1WJGA 4Q3NA 4QFMA 5AI9A 3WNCA 4BTVA 4YAOA 2Q3MA 1KY5A 1XYVA 9GPBA 1D6JA 1QTRA 2K6GA 1IULA 5LQRA 1DDIA 2OCXA 2QZPA 3CH4B 2X9GA 3FKSD 4FW9A 2HAEA 3SHFA 5LDDC 1A97A 2MYTA 1FRZA 1SR8A 4QOEA 3V2GA 4AKGA 1D0IA 3DMTC 4IXDA 1CYDA 3OZDA 2GPYA 3UXEA 4HK4A 1QB8A 3JX9A 5T3YA 3KSAC 2ZRQA 2ATEA 3G7SA 4BVJA 1YRLA 4OM8A 2UU9B 1MV8A 3EXFA 3R3VA 5EQJB 2YV2A 3W7AA 1JEQB 1WMEA 3D0KA 3ORSA 4IH4A 4TL8A 4MGYR 1ZPDA 4YDQA 1L7BA 2QE7A 4M8LA 4PNPA 1D8TA 3EDQA 1Z8NA 2C07A 2I8CA 3BB1A 2WSLA 3KJIA 1C7RA 1ENOA 5AM1A 3HUDA 4O4LA 1J21A 2PGLA 4JU8A 1JQAA 3PXDA 4GYKA 4URWR 2R8XA 3OUUA 1BROA 3TRKA 2V3CC 3R4VA 3N53A 4X97A 2MMCA 5I7AA 2P62A 2XSZD 3SQNA 1ML3A 3UMGA 9ATCA 3L0PA 1HEYA 2F67A 3DMGA 4KO3S 2G04A 2YWRA 4BS9A 1HKHA 4MUXA 2QQ0A 3EE6A 3EEYA 4GSYA 2QZ9A 2GN2A 4M9UA 4B46A 4Q3LA 1TKRA 1EFVA 4FMDF 2Z9DA 4LGCA 4TLAA 4HAOA 5KZMB 2XB6A 2OHOA 3AU9A 5B1IA 3NHUA 3IJEB 3ZI4A 3VDMA 3LHSA 1FE8A 3IP7A 3FSJX 5KOJA 1PQUA 2H1IA 4H27A 3GEMA 1EYZA 3A2LA 3AY3A 1ULTA 3L9XA 1K3FA 2WUGA 2CL0X 1O8BA 4MV5A 4O1HA 5HK9A 1QFJA 1Q19A 4OHMA 4A9AA 3TI9A 1RM3A 3OKCA 2VPPA 1ZITA 5FQOA 1G20B 4REQB 2GWHA 5EP4A 4EEXA 1AUQA 1CP3A 3WRYA 3RS7A 2QVYX 3AZQA 1HE2A 3QLVC 1K6IA 3T6KA 3ZWQA 2OBNA 4QJIA 2AFHA 3E84A 3AQ4A 5LLSA 3B1KA 3R5SA 4DN6A 1S89A 1MEEA 1U28A 4RPLA 4CQNA 3DV9A 1PZXA 2E85A 2JDIA 4FFMA 4NLLA 3OZWA 3LC0A 1KFJB 2XZPA 1XC7A 2J3QA 3REGA 4F56A 1U8TA 1K7CA 2VP2A 1WG8A 2OVBA 4GLBA 3FI9A 3KU4A 2JLWA 1ZCJA 4JT9A 3IKLA 3R3XA 3NRJA 3E15A 1PT9A 3TZBA 1X8XA 3ICOA 3K0CA 4I2NA 4MCAA 2ZIAA 1QAOA 3OJLA 4MKFA 3WSWA 4C0KA 4P1ZA 4QOHA 1MJHA 1HLDA 2LKDA 2VH2A 4MRNA 2P0EA 4Z9YA 4RLFA 5IYZF 2LDBA 3AVQA 1ZC3A 1H66A 2FEMA 2FOXA 4HPJB 2GBLA 4J8PA 5HIJA 2DJIA 2PMEA 4HR7A 2QGNA 3U6KA 2O8CA 4PPGA 3GV0A 4V2IA 4FOPA 4CU2A 3IIEA 2PO7A 4R8RA 3HGTA 5CLFA 3AKCA 1B4DA 2QL7A 3HY6A 2NTEA 4DRXB 2FAXA 3GLTA 2X0EA 2P6UA 1E0DA 3OPYB 3RIMA 1N3YA 4FZVA 4YRLA 1E8NA 4PXAA 3THYA 2R6AA 2GEBA 3QYPA 3UZUA 1W48A 2B6HA 4RSRA 1ZIPA 4F5DA 2E9SA 4MA4A 3LQQA 2W83A 2WNHA 4X92A 5KDDA 4HAXA 4XLZA 4W7SA 1S0UA 1KQPA 4M2LA 3BOSA 1KXJA 4RD3A 3ZHZA 5KQRA 3U1TA 4D99A 4X41A 5C7IO 3PXXA 2GJ9A 4O6VA 4J0DA 1GPDG 2V98A 2C2YA 3KWLA 5FYDA 1YVPA 1PX2A 3X1XA 3N28A 2OV8A 3U4CA 3VU9A 3K05A 3L5KA 2CMGA 4QSHA 3VNSA 1I94B 3BJMA 4DOMA 2AMFA 2RGXA 3UHAA 4I1YA 4HWTA 3T0IA 2BP7A 3D54D 4FLEA 3ETHA 5F4BA 4M89A 2QUAA 3T7CA 4JNKA 1KMMA 3VDXA 1ZR4A 4AL4A 3C4JA 2G71A 5TR9A 3GDHA 2BT4A 2PKQP 3PWTA 1H3FA 4AG5A 1RM0A 2WF6A 1QH8A 5B7PA 1F8GA 3HNRA 2VJQA 3TMKA 3LKDA 1K2VN 2FMIA 2PZGA 4P3OA 4RMNA 1UQTA 3W1WA 4E32A 5I7SA 1O97D 5FOTA 2HK8A 4LHXA 1AT1A 4OGFA 2IZ1A 1Q74A 3L6EA 2EW8A 3A9UA 2PYZA 5IAJA 5JMPA 2XMGA 4P58A 4K03A 2AHOA 3A0UA 2DF8A 3UYKA 4XTRA 3ZZMA 5LP6F 1KZ6A 2PZBA 4TMKA 3ASVA 2PCJA 3N0RA 4XJXA 4LYHA 2UUCB 1IRIA 2UUOA 2PZFA 2NNWB 4URFA 5JO0A 2EFJA 3IAS6 4J1TA 4GOLD 1UXHA 4N4AA 3AVVA 4KFUA 2X1HA 4EJMA 4JGBA 2HA0A 3GVXA 1KK2A 1GPAA 2OHXA 4KXXA 2YJ5A 4B3HA 3MS7A 3CFYA 3DJFA 3U4AA 3SF8A 4F71A 3UWPA 2AFIE 1FJGB 3ZCTA 4R0MA 4G0OA 5BQPA 4YAGA 1SOUA 4UQOA 3AR4A 1HQDA 4LF9B 1OI4A 1F3OA 5KREA 2GO7A 4GHWA 4Q9IA 4MV6A 3L1JA 2Z6VA 2C4UA 2VRBA 1QV6A 2W48A 2ZATA 2VNKA 4LOKA 4LZZA 1WY7A 4S35A 2JGDB 3QTLA 4CM4B 1UT6A 2PX8A 2WYVA 4ZZ3A 3K9BA 2FFQA 5ALEA 2H8KA 2RBKA 3L8CA 3N2KB 1A2KC 2HU8A 3BFVA 4GYYA 2GRAA 4U7JA 4X7BA 4ZEWA 4WEOA 2QF7A 4MYTA 1J0DA 2VRCD 2XUHA 1OBOA 1XF1A 5AOAA 1W87A 2EBUA 2X5OA 2JBAA 3S2FA 4CIBA 4HDSA 4PLWA 4IDBA 2P90A 3ZU6A 3H1GA 3PUIA 4AG3A 4Q1DA 2HSZA 3A3KA 2VXCA 2ZYDA 4HXYA 1L7RA 2SHKA 3TM4A 4CTMA 3I8SA 5FOQA 1J25A 2UZ1B 3OKPA 1DTWA 2EVWX 2PLAA 3GN2A 4QO7A 2RAUA 4O02B 4AYTA 2O48X 4X8HA 3UCEA 4HRVA 3KQTA 2VJMB 3IHTA 3FDZA 1H2BA 3MTBA 3TTWA 1XFDA 1JYFA 2DBYA 1GPH1 3DOOA 1T36B 3HCDA 3TSCA 1N0IA 3R7SA 1BYIA 4DILA 3RASA 5ER9A 2VPZA 1E3SA 4EIWA 1A9XB 3HKBB 3REQA 4CEJB 4TN5A 3FKJA 3P20A 5JSQA 8MHTA 1WBJB 3L6DA 1SUWA 4WKCA 1NXPA 1R16A 2R8EA 4P3NA 3AHDA 2ZSBA 5BV1A 3WE7A 3OPMA 2NW6A 4US1R 4GU5A 1WXXA 2VJPA 1G1AA 4QDJA 3DFMA 3HDYA 5AVXA 2IYOA 4J3FA 1THMA 2HF8A 2QM0A 3IBSA 4LS3A 3RBXA 4BB0A 1J9GA 1YZKA 2F3PA 2QTZA 3MERA 2RHBA 4HDAA 5KYKA 1FP7A 1NFQA 2WT4A 3O4HA 4TTSA 4C7JA 4OV6B 3LLCA 4PZDA 2IV2X 1E5XA 3PYMA 2JJ1A 1I1NA 2ICAA 3TEJA 1T8UA 3GN1A 3PPVA 4HLQB 3WX0A 4TKVA 1OXTA 2Q1UA 2H2IA 3ICCA 4LJ9A 2YV3A 4YPVA 4MVJE 4I3GA 2B98A 4DGSA 2R8PA 5AW7A 3SKVA 4MB6A 1R5JA 2PUHA 3RBZA 4DDMA 1RADA 4DJJA 4N41A 3KJEA 2CLSA 4UUOA 3GOQA 4X84A 4OJNA 4JV5B 1V3QE 2ZYTX 4OJMX 4CKBA 3NTUA 1L9XA 1OWMA 4HQ6A 3T7TA 1XTSA 4GMHA 3M9XA 1ADCA 2IL1A 2C04A 2V5AA 3AR6A 5IDQA 5CMLA 4UU8A 2XTJA 4X1YB 1UQUA 3QMVA 5D1NA 1YAHA 5LU8A 3QTTA 2DFVA 2DPYA 3DAGA 4HEA6 3RFCA 3SZ3A 4Y1GA 5T57A 3TLKA 2R6R1 4JQOA 3H9EO 3BULA 3ZJVA 1LW7A 4JC5A 1QUFA 2X5JO 1D1SA 1RTKA 1KE2A 3ODGA 3C6KA 4JUCA 3ZEAA 3R9XB 5KJEA 3LOUA 1L4FA 4LMRA 3FDFA 1QGOA 5LA6A 2IWHA 3R8XA 1T0IA 2X3UA 4E3ZA 1RYMA 1Q11A 2GEUA 1GGNA 2OAP1 1Y1RA 4ZU3A 4D9NA 4BQIA 4EP1A 2FWIA 4LDZA 4E30A 5KX5F 2IU0A 2BTOA 5LQDA 2CUNA 3WYAA 1KZ1A 2QLBA 3QKRA 5CIWA 2YN2A 3IUPA 2CLOB 3VR4D 3A6KA 1OGIA 1XK7A 2Q2WA 2CVZA 2HKIA 2O1EA 1ESDA 2CFTA 1OTYA 1A9OA 1UIMA 4FZJA 4YNBA 3SIPA 3Q7SA 3VO8A 3MLAA 4LGMA 3W2GA 4PGFA 3IEVA 3MUEA 1C2TA 1KVQA 4TTIA 2AC7A 1KDVA 3HR8A 1H1LB 4M1EA 4HLDA 1B8NA 4A1OA 4JXJA 4ZEMA 1B2RA 3UIEA 3DZJA 3NBYC 5L53A 1URPA 3EJWA 2FV8A 2AUMA 1SKQA 3DL2A 2KYRA 3MGCA 3VPFA 4QPNA 2PO5A 2XCTB 3O4GA 3KR2A 3EZXA 3LBIA 2RKBA 1HBJA 3CH7A 3KDSE 3FNFA 1MIOA 1N9GB 2QX8A 4LC1A 2BBWA 2C0CA 4X6LA 1TKAA 2JIBA 3TF5A 1MDFA 3MELA 2F8TA 4Y6PA 2P67A 4QT0A 4Q1VA 1O94D 3ZQKA 4AC9A 4Q9LA 4X1KB 5DBEX 4URUR 1JA9A 3O9ZA 4MOWA 1W5FA 4RMHA 1PUXA 1JJVA 4HWPA 2V3WA 1S6YA 1DS6A 1ID1A 4DJEC 3RHTA 1G3RA 3LYAA 4XD7A 3GP5A 3D5EA 4OUKX 4C6RA 4EJSB 5KTPA 2WWVD 3TVTA 1BVHA 4FT4A 3LP8A 3RU2A 1R8XA 3LS2A 4YJFB 4LBYA 1SXJB 1UDBA 4X44A 2SKEA 2WVAA 3M81A 2WU0A 3C3BA 4P5DA 4XM0A 3ADKA 3UMJA 1ZAYA 1K27A 3BCUA 5FOXA 4DR6B 2Q6KA 3F96A 2WUVA 1KS2A 2GM5A 3C8HA 2H7XA 3UJAA 1QHHA 2HLHA 1N1EA 1QK3A 2QD5A 4UVGA 3OVMA 3X1KA 1CF2O 2J32A 4B87A 4H7JA 5TS2A 3V4PB 1JIKA 2OV1A 3HXMA 3B53X 5FRDA 2R7AA 5D84A 1YFJA 3EVFA 4MV0A 1M1NA 3L40A 4LFBB 5C1OA 3CRW1 2XB9A 1F51E 3EIQA 4UBJA 4YR7A 1G8FA 5DNDA 2JKVA 4YI5A 4GXQA 2PUGA 4YCAA 1JDSA 1Z0JA 1H93A 5DM70 1G5TA 3DKKA 4ZT2A 2QIOA 4MULA 5LBIA 2Q4EA 1XQ9A 1DADA 3ZUGA 5K0EA 2JGEA 3ESQA 3OECA 4JEMA 3SP1A 4CMIB 1TMOA 1I8TA 3IOYA 1KZYC 5HILA 2WWRA 4I3HA 1YNSA 4OREX 4QODA 1JPNA 4WXHA 4C08A 2BHNA 2J07A 1Z0ZA 3HCOA 2YVUA 2WWFA 2QZJA 2NPFA 5AKZA 2XNCA 1O95A 2BGMA 1U7ZA 2BHLA 1NZFA 1WZIA 3BF8A 4PLCA 5BXQC 4TWAA 1NE7A 1RBMA 4J7UA 4RKQA 4DABA 3CNLA 4MS1B 3WADA 1YT5A 4IHJA 3TNJA 1SOAA 1SXHA 1XQVA 3HDVA 4II7A 1E2DA 1PJLA 1WE2A 2IGTA 2HSEA 3ET5A 3P9NA 5TF0A 5AVUA 1G8AA 3PA8A 3SQOA 2DQ4A 1W47A 1UZMA 2I2AA 2PVPA 1US8A 2RFLA 4ZVMA 3RUHA 2V58A 1N7HA 4JR0A 3UT5A 3W4KA 5M34A 221PA 1XTVA 5KSPA 3KZKA 1QJ4A 2J0QA 2P68A 2YWGA 4LJYA 1KAMA 1T29A 3M1YA 4Q3CA 9LDBA 2JI8A 1IY0A 3VR5H 2P8SA 3NYRA 1M8FA 2QMZA 3Q7EA 2Y9MB 4IUDS 4BLPA 1XP8A 3A1EA 1U2DC 1NPTO 2JIZA 3BILA 3OMLA 4F72A 1M2WA 5ALWA 4TXLA 2WV9A 2HTEA 2ZIVB 3GYBA 3D8SA 4LYYA 1V5FA 4ZYXA 5JQWA 2H4JA 4Z8XA 2JGKA 3IUEA 2FW6A 4TXJA 4B3JA 2PAFA 3U40A 4L5YA 3VC3A 1OB2A 1QF6A 3PC4A 1V6AA 5B3JC 2G6BA 1MX9A 4QASA 4QQKA 4QLOA 2ZOSA 3V97A 4M1MA 4I3FA 3SD7A 2IUSA 1RQNA 4IIEA 1TYBE 3TBFA 4KHZA 5H68A 5EJAA 1I6LA 4BX2A 3NT4A 4FHZA 4G1VA 1EFKA 5A4KA 1OLUB 2KMLA 4HYQA 3WGNA 3HB1A 4NATA 5CFLA 1MA3A 4GRDA 1TA0A 2E5WA 2Q8QA 4KR3A 3IC5A 2XXBA 3I64A 4OQZA 3GD7A 4EEKA 1KI4A 3PRKE 4HEJA 3VGJA 4XGRA 2EKLA 4CWAA 4YJ3F 2FPUA 5EUQB 4NBRA 1JDZA 1JIXA 1LWNA 1QGUA 2WHRA 2VQ6A 4MSUA 4Z86A 4BNMA 4IQFA 1SXIA 5CVTA 1ULUA 2ZTHA 2C3YA 3H6HA 3L8EA 4BO8A 1P3Y1 2J9FB 4KI0A 2BCEA 2FFHA 3PGMA 1JJIA 1PNQA 2VAWA 1JR3E 4OFZA 5F12A 3AXTA 3WB0A 4AKTA 4BX8A 4DLZA 1VSTA 3CX8A 5IFLA 4TV9F 2YVAA 4EYKA 1NXOA 4YUAA 2XR1A 4DLNA 1X7XB 2P77A 1T9AA 2VSYA 4HDOB 4QDZA 4DREA 6ABPA 1RZRD 1N3IA 4RZ3A 4R3NA 4YRCA 4QU9A 4A8PA 1R9NA 1E6KA 2Y1LA 3AEKA 3LQKA 3OY7A 2YYSA 4G5RA 4B6GA 4G84A 4JLJA 4Z54A 1FBTA 1BDHA 3ADCA 3ANYB 3FSRA 1YJCA 4P4NA 3QVGB 3BXEA 4YT2A 1WZCA 5DHUA 2OPBA 2QRLA 2C3UA 3L1VA 4UU0A 4ZHQA 3FGPA 3QFTA 1OT3A 2QTFA 2EG5A 1FTGA 3EZNA 2DLCX 3WGHA 3M5CA 4RU1A 5JEDA 1UAGA 1WPRA 4YA6A 4I08A 3UOGA 1MA0A 2EGGA 5AW5A 4YT8A 3GPLA 3H9JA 4G8JA 5DWQA 2XHEA 3RC1A 4EY4A 1OZGA 2C5SA 2E4AA 1BU5A 1FQOA 2C77A 4XZ3A 4FYHA 5DYIA 5TNXA 5AW8A 5C8DA 4C5AA 2WM8A 4TL7A 3H11A 3PGKA 5A9SA 4QBKA 5KWJA 2VK8A 1Y7HA 4FDMA 4BVHA 2VQDA 2IYUA 4PE5B 4JCOA 3UA3A 5TMPA 2ZYVX 1IZ8A 1TKCA 3NHSA 1JR4A 3B36A 5DHTA 4KQHA 2ZTMA 1H5UA 1QRAA 2NVBA 3WHLA 5BNTA 1ZS9A 3G2QA 1KZ7B 2J0SA 4KREA 2GSDA 4LI3X 4RABA 1E1CA 4CV0A 4BLVA 4KNYA 1S7CA 3NORA 1P4SA 3OE5A 4KO8A 1PQ4A 2PQ2A 3R0ZA 4WXMA 3GDWA 4OMDA 1CLEA 2PSFA 4BKPA 3WLLA 3NUZA 5HQ3A 4QYTA 3SDSA 4BVGA 4YCLA 3OLQA 2YOGA 3VU8A 2GJAA 1L8QA 1SA0A 1WY5A 1GRQA 3EZ7A 1INLA 2XQKA 1HT3A 3HG7A 1OAKA 1JAXA 4LJ5A