5CURA

G158e/k44e/r57e/y49e bacillus subtilis lipase a with 20% [bmim][cl]
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDETGTNENNGPVLSEFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIELLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Esterase
total genus 70
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5curA00
1E8DA 2J3DA 4X95A 3BDVA 5CT8A 3QPAA 5AKYA 2XLCA 2ACEA 1UOPA 2HIHA 5HKBA 4PQEA 2QXTA 2WG2A 4FKBA 4NMWA 4BB0A 1P0QA 3WL8A 1PV1A 5AK4A 1CR6A 1IMJA 2QMQA 1GPNA 5A2GA 5AKLA 1YB7A 4AX4A 4ZXFA 4BC1A 5DYTA 4HZGA 3AFIA 5AI0A 4Y7DA 2PBLA 4H18A 4HAIA 2HA2A 1MX5A 1E66A 2WUGA 3LS2A 4FOLA 5DNUA 3O4GA 1XZAA 3O9MA 3WKEA 4F5ZA 4AMYA 1O6FA 2OCGA 2PSFA 4NVRA 2XUHA 4X3CA 1Y7IA 2WKWA 3OOSA 3KXPA 3HYSA 3D0KA 4ETWA 5JAHA 4F60A 4U2EA 2WQZA 1H22A 1IVYA 1Z68A 1TAHA 2GZSA 2VEOA 3PF9A 3KOOA 4HTAA 1UT6A 4X93A 5K3FB 1JJFA 3QZUA 5DTJA 3G0CA 2WLSA 1QIDA 1GZ7A 1DWQA 2R8BA 3I2KA 1VXOA 1EK2A 2ACKA 4XVCA 4AB1A 5FPPA 4L9AA 3VJKA 4W1PA 4MYSA 1E8MA 2G4LA 2V97A 4J0HA 2CZQA 2GBGA 3GUUA 2GYVA 2QT9A 4BAUA 4UHBA 2BUCA 5C81A 3HZOA 4KYVA 5ALYA 3SC2A 3HACA 4Y2YA 5JANA 2VSQA 5YASA 3QYJA 3G0IA 3I6ZA 3LIIA 3BF8A 5CBKA 1C7IA 3DKRA 3FBWA 4EA6A 5EHZA 3ESBA 3N0TA 3O4IA 4MXDA 4AO8A 1H2YA 1XLVA 1CUIA 4UFNA 1BCSA 4DM7A 4BAZA 1ZD2P 4WY5A 2AXEA 4EY4A 2Z3WA 3GA7A 5K3CA 4Y9SA 4LXIA 3KD2A 1U8EA 5AIBA 2QJRA 5AM2A 3H19A 3Q0TA 4KRXA 1TRHA 2PVSA 5HF6A 3ILSA 4K6KA 5CT9A 4U2BA 3V9AA 1ISPA 2WM2A 4CCWA 1FFCA 3IUNA 2VAVA 4Y2VA 1BRTA 2XMGA 5ALDA 1I6WA 1MTZA 2D0DA 3BF7A 2XQFA 2DSNA 1UFOA 3FOBA 4B9EA 2JGEA 4Y2JA 2WHPB 2WG0A 1XZBA 2XMDA 3AIOA 1DX4A 1QIIA 2XQJA 1AKNA 2AJLI 5ALIA 3QMVA 1VE7A 5BWBA 3VDXA 3W9UA 1J06A 2BGRA 4B7ZA 1QIFA 5A71A 2RAUA 3WZLA 3AZPA 2DQZA 1G5FA 2OAEA 2CUTA 4KAFA 2HADA 4G8DA 4DMKA 3C70A 2OGZA 1H23A 5DLPA 3DOIA 1LZKA 5AOAA 4RNCA 1F6WA 4B0OA 3K2IA 5AOBA 1W1IA 2O2IA 4ITVA 5HZGA 2AJ8A 1A8UA 3WJ2A 3C5WP 4I19A 5ALVA 4GBGA 5LZ7A 1WB4A 3WWOA 4KE9A 4UFPA 4ZV7A 4QDTA 1ZD3A 4ZGBA 4JYMA 5H3HA 5HCUA 3BL8A 2WU4A 3IIIA 2WIJA 3KSRA 2WJ6A 5K5EA 4AXBA 1YAHA 1L7RA 1TCAA 2XMQA 4B82A 5FUMA 3BE8A 4X92A 3GBSA 4A16A 4OB6A 1YS1X 1QTIA 2PU7A 3H17A 1CUEA 1ORVA 1AC5A 4N8SA 5T4EA 4HXGA 5ALUA 2Z8ZA 4MWSA 5AKGA 5DTIA 4IHAA 2RHWA 2V96A 5CXXA 1ZIYA 4PSCA 5D6OA 3WA7A 4KJXA 1O6GA 3H1AA 4CI9A 1ORWA 3D5EA 3HXKA 3QMWA 4PW0A 4KE7A 4OYYA 4OU5A 2JGFA 3ZPXA 4J0DA 3STVA 4G5XA 3G9XA 1JKMA 3FCYA 1XROA 4BCCA 1F0PA 4OYLA 3P2MA 3M81A 1XRRA 4QLAA 1OILA 4UHHA 3ZLVA 1DT3A 4FWBA 4XX1A 3PDCA 3SK0A 1T2NA 2JGKA 1YAJA 5CW2A 2H7XA 4X90A 4DNPA 4E15A 5CMLA 3W04A 3DCNA 3C8DA 1YA8A 2FJPA 1IUNA 3ED1A 1LBTA 5FV4A 2PX6A 3ANSA 3B5EA 5JALA 3L1JA 4M0MA 1R9NA 1VA4A 2WFLA 1BN7A 3QPCA 3DJYA 1NU8A 4LYDA 3NOXA 4L3WA 1AX9A 2Y1KA 4P93A 3TRDA 4QWMA 5AKZA 1W52X 1YCDA 2OXEA 4QDOA 2BUBA 3E3AA 1XZDA 4CFSA 3O0DA 1PJAA 4IH9A 1OCEA 4Z49A 3LP5A 4HRYA 4WDRA 3ICVA 1MU0A 4WDQA 2HM7A 3IBTA 2Y6VA 4QE3A 4JH0A 4OCZA 3FVRA 2HU7A 2O7VA 4JEIA 5T4FA 4BATA 3CN7A 5JASA 2ORYA 4KR0A 1VZ2A 1FFAA 1CFJA 3K9BA 2QS9A 1ZI9A 1DU4A 1A7UA 4P08A 3W9BA 1J1IA 4NS4A 5JZBA 1VXRA 1CVLA 5EFZA 4UBNA 3A2LA 4BP9A 1CV2A 5D3ZA 1XRNA 1FFDA 1QLWA 1QIEA 2VJBA 1K63A 1CPYA 3EF3A 4X91A 2DFPA 4UBLA 5LZ8A 5C7YA 1WOMA 3AIKA 2HFKA 4H7IA 1ZJ5A 5HF8A 1E5TA 2Q0XA 1N1MA 5AKXA 4DIUA 2Y2VA 5LZ5A 4N8DA 5T4BA 5LZ4A 2QR5A 3E4DA 5C8ZA 1EHYA 2YYSA 3LLCA 4BDTA 2QKYA 5AI8A 5JD5A 5LZ2A 2HA5A 4N5HX 3OTQA 2HRRA 1WHSA 1DWOA 4KAAA 1CQZA 2ZJ6A 1CUBA 2GBCA 1ZGCA 1QJ4A 4PV7A 3DD5A 5FP0A 3QVMA 4G4JA 5HK8A 3VJLA 2FX5A 3C6ZA 2WFLB 5IVHA 3WKDA 1ZIXA 1B41A 4FTWA 2H7CA 1XZJA 3I2IA 5AKEA 1QE3A 3DL7A 3V1MA 3CN9A 3FSGA 2GZRA 3R3WA 4FDMA 1BEEA 1XKTA 3K6KA 2DQYA 5HFAA 4J7AA 4JYPA 4AO6A 1HL7A 1LZLA 4UBJA 4QDZA 2W6CX 4W63A 1MPXA 1SFRA 1UWCA 3JYHA 5A62A 4O08A 1IZ7A 3DNMA 1CLEA 1BROA 4LHEA 3IDAA 4EY8A 5ALNA 5KWIA 3L1HA 4UPDA 3G8YA 1XZCA 1GGVA 4WFJA 3O4HA 1EB9A 1NU6A 1AURA 1TCCA 3M83A 3GROA 5JD4A 5EIAA 1M33A 1LNSA 3IA2A 4BZWA 4DNQA 1FSSA 3C6XA 4BCBA 3FAKA 3IUQA 1XLWA 3A6ZA 3VISA 2YH2A 2I3ZA 2C0QA 4M0EA 2VATA 2RONA 1XZLA 1UKAA 1EX9A 1U2EA 1WM1A 2EDCA 4J0KA 5EIHA 1W4LA 3WL7A 1Y37A 4P9NA 2JF0A 4Y2RA 3W05A 2G5PA 4M0FA 3CCCA 4C88A 1KU6A 1EINA 4Y2PA 1GT6A 1JFRA 3AINA 1UXOA 4GHWA 5AKKA 1EK1A 1VKHA 1LPMA 2C5FA 3D2CA 3OC0A 2GBFA 4G9GA 3MVEA 4X6YA 5JD6A 2HU5A 4Q1VA 4BRZA 4RGYA 4H0CA 3RM3A 2V9ZA 3HEAA 1XZHA 2XT0A 2J3QA 2DCMA 3UUEA 5DWDA 1KEZA 2XMRA 4ZI5A 4OSEA 1XRQA 4QWWA 3I6MA 5AH0A 2XQGA 5FDFA 3G0BA 4NZZA 2WJ4A 4QDXA 2Y2UA 3WYNA 4FFWA 1GKLA 5AP9A 2OAGA 2C58A 2H1IA 1N5MA 3ZWQA 1E89A 2ZYIA 4LXHA 3C8HA 3UUFA 4QNNA 4K5QA 1GXSA 2PSEA 1RP1A 1TIBA 1VLQA 1YSCA 3D4LA 3STWA 4GW3A 1WB6A 3WWPA 4EY5A 2PPLA 5KWJA 5CT5A 5E4TA 4Y2QA 3I2FA 1R3DA 1R88A 1EDDA 1JJBA 2HA6A 4Y2SA 1G42A 2LIPA 4AQDA 3D3NA 4G8CA 5HKAA 4F21A 4RE6A 1LLFA 5JYCA 2GYUA 3FYUB 4MJ3A 3I2JA 3LCRA 2ZSIA 3R40A 4UHEA 1GPKA 3I1YA 3HSSA 5HQ3A 2H7YA 4JUIA 4Y2TA 5EI5A 3DDUA 3WK5A 5LIPA 3NWOA 3G9UA 4G8BA 2AJBA 4GDMA 1ACLA 2C5GA 1ACJA 3I28A 5AKIA 3KDAA 4FLFA 4QA9A 1DWPA 1XZIA 1CIJA 4KAJA 2PSHA 5BV7A 4OB7A 3N2ZB 2R11A 2WUFA 3DL4A 4WFIA 1ZI8A 1LGYA 2P8SA 4F0JA 3QITA 5E2IA 4B81A 3R3UA 3WK8A 4QDUA 1LPPA 4X7BA 1MNQA 2X5XA 1F8UA 5AJHA 4DTCA 4BE4A 1RYYA 4MEBA 1QIKA 3DS8A 5AKJA 1SCQA 5FOQA 3VVMA 2VTVA 4AMZA 4K2AA 3M3DA 4QEKA 4FLEA 3ESAA 2OG1A 1K6EA 1JMKC 1QO7A 4INZA 2WIGA 4UBIA 3T4UA 5ALSA 4K6GA 3WIOA 3SX4A 2RHTA 3D59A 2PUJA 1BCRA 3AIMA 1CUXA 2K2QB 2CEKA 3M82A 4KEAA 4AZ3A 3SWWA 4U2FA 2O2HA 5ALKA 3A70A 1LPNA 5K3BA 4J03A 2EEPA 3EIOA 3PUHA 4A23A 3QM1A 3WMRA 4ZV9A 4I4CA 4UHCA 3F97A 3WQHA 4BCDA 1ZICA 4EY6A 5AI6A 3ESCA 2C4HA 5JAOA 1LPAB 1WCYA 4W1RA 5LLSA 2RI6A 5AOCA 1ZD5A 4H7FA 4UHFA 4FBMA 4Q34A 3HI4A 1H2XA 3GZJA 4X71A 5CT4A 2VAXA 5AIAA 2JIDA 3BXPA 4CIBA 1HKHA 3RKSA 1H2WA 2IX9A 2WIFA 2C7BA 1EH5A 4UBMA 5I8PA 4KE8A 4WJLA 4XWGA 2Z3ZA 5KREA 2OGTA 5IVIA 3DOHA 5I7UA 3NGMA 2B20A 1AMNA 4BVKA 4L72A 4N5IX 5HF9A 1YR2A 4GWLA 4TPKA 2HA7A 2XUGA 3HJUA 4E46A 4GXNA 2Z5GA 4CCYA 4H7HA 4FFVA 2AJCA 1CUZA 3G9TA 1K5PA 5CH8A 3PFCA 1XLUA 5K3EA 3LIPA 2B61A 4GECA 2HA0A 5LKAA 3WK4A 3JW8A 2QJWA 2YXPX 4LYEA 4CG3A 2WU3A 4C4XA 1WB5A 2G63A 4W1SA 1MN6A 1W76A 4FBLA 5SYNA 1T4MA 3HC7A 5EHXA 3G02A 2O7RA 3WLAA 2DHCA 2WHRA 5A6VA 3H2IA 5F4ZA 1HBJA 4LKOA 4BTLA 4DSAA 4B6GA 2QZPA 3I6YA 4H7KA 1QFMA 3MGAA 1VZ3A 4G1FA 3H2KA 4BAGA 3WKBA 1QOZA 4IH4A 4WFKA 3VXKA 3CXUA 2JEYA 2WJ3A 3TEJA 3L1IA 5JAPA 5FRDA 3STXA 1CUUA 4UHDA 5ALTA 5IKXA 3EQ8A 1R1DA 5ALPA 4BVLA 2JGMA 1CUJA 3FYUC 3TJMA 5K3FA 5CH5A 3H2GA 4DGQA 3MUNA 3EQ7A 1B6GA 1E8NA 2CB9A 1TCBA 4MQMA 4ARBA 4IO0A 1MT3A 2WILA 1LPOA 3F9CA 2WHQA 3D2AA 1E3QA 3H2JA 3ESDA 5ALJA 1VOTA 4I3FA 1R9MA 1UK8A 1XFDA 2HU8A 4Q05A 1JJIA 3FLBA 4UUQA 4CCYB 2BAGA 2OQVA 2OCKA 5JIBA 1QTRA 4DSZA 1DQYA 2IIVA 1K8QA 3H04A 5ESRA 1FFEA 2Z8XA 5HF5A 1EXWA 4OU4A 4X94A 1MX9A 2VF2A 4AN0A 1TQHA 2NW6A 5FLKA 1QIHA 5LZ9A 1CUCA 3C87A 1SCKA 1DT5A 4C4YA 4BDSA 4GLBA 4J0JA 4PSUA 2J4CA 3KWFA 4UFOA 1J07A 2XQKA 3PFBA 3R3YA 1CUVA 3H1BA 2B9VA 2H9YA 5A7HA 2WIDA 3FYTA 5AK3A 1LPBB 3CCBA 1R50A 2Y6UA 1WPRA 4H7DA 1A8SA 5ALRA 1UKCA 1N8SA 5ALZA 3F8SA 3H0CA 5CURA 1ZD4A 4RPCA 3S2ZA 1Q84A 4OUKX 4TGLA 2BFNA 1IUOA 3FWHA 2WUEA 3AJAA 5DNVA 3VJMA 3WWCA 5JZSA 1A88A 4BTVA 3BIWA 2WTMA 2J4FA 1CUWA 3S8YA 4ROTA 1TK3A 4DMHA 3ZLUA 3ZLTA 1P0IA 3I2GA 5ALHA 1VA5A 4A5SA 4FHZA 3WL5A 2VQ6A 5CTAA 1U4NA 2DHEA 2OCLA 3H2HA 2O2GA 3F98A 4AZ0A 4CG1A 3WK7A 1GQRA 1U65A 3R3ZA 5AM3A 4KACA 5EGNA 4IH1A 3WWEA 1YS2X 3D2BA 4W1QA 1MNAA 3WKAA 3C5VA 1HQDA 5AM5A 4BC0A 3U0VA 3FLEA 4OD0A 1W6RA 5J3JA 3E1GA 1CUFA 1QONA 1BS9A 1MX1A 5JATA 1EDEA 5A7FA 2XUAA 3RARA 1QIJA 3WI7A 3V1KA 2ZSHA 2ZJ7A 3C6BA 2XDWA 2WUDA 5ALXA 1JI3A 1PFQA 1CUYA 3EBLA 5ALGA 2CKMA 4C6HA 1NX9A 1G4HA 3QPDA 3WL6A 1Y7HA 1BE0A 3ANTA 5FPQA 2QVBA 4FNGA 1XKLA 4MYDA 3DYVA 1ODTC 3IVMA 1BU8A 1OXMA 4ZWNA 1YB6A 1YASA 1XZFA 5DJ5A 1SOMA 2XUJA 1AQLA 2G5TA 3C6YA 3WK6A 5E4YA 3IURA 5CRIA 1YA4A 4DNFA 4J0IA 5DYWA 5CH3A 1JMYA 4W9RA 2VT6A 4YK7A 4OB8A 3GFFA 2E3JA 2QUAA 5KBYA 3W06A 6YASA 3AILA 2EDAA 2QM0A 1G66A 2XI4A 3WIBA 1XQWA 2XUIA 1J2EA 2GYWA 4B83A 3BJRA 1BEZA 1L7QA 2ZVDA 4J0GA 4EZIA 3R0VA 4BZZA 3VVLA 3WK9A 1QGED 1A8QA 3STTA 1RWQA 2XLBA 3RLIA 1THGA 1XRLA 4MWTA 3R41A 5E4JA 4DNOA 3IUMA 5AK5A 2ROQA 4EB0A 7YASA 2WFMA 2WSLA 1SCIA 3EQ9A 1R4ZA 4X6UA 5AM0A 1LPSA 5ALEA 1VE6A 4HS9A 4DYHA 1THTA 3ZI7A 2I03A 3V48A 2HFJA 3DQZA 5EIEA 2XUKA 4Y2XA 1IZ8A 4BP8A 4XIIA 4Y2UA 3I2HA 4YPVA 1AUOA 4BRSA 2BKLA 1DINA 1D07A 2RIPA 3STYA 3A2NA 3WZMA 2BGNA 4HXEB 4H7JA 2XUFA 2HRQA 4WCVA 2PL5A 4B85A 1SC9A 3IUJA 4GI1A 2XMSA 4N8EA 2BJHA 1XZMA 1UZAA 2WFZA 3FVTA 5IH7A 5LKRA 3C43A 2WG1A 4WY8A 4EHBA 4EUSA 2ZJFA 3KWJA 4P92A 2JGJA 5HK9A 1KU0A 5JADA 1ZGBA 5T4HA 3E0XA 5D7BA 3WKCA 3JWEA 4ZRDA 4J0CA 3H18A 2QRUA 1XZKA 2HL6A 1ZOIA 3PE6A 3UMJA 5AM1A 4C89A 2B4KA 1C7JA 1HDEA 4Q3KA 1K4YA 4B9AA 1UK7A 4PSDA 1DTEA 2AJDA 1X2EA 4PF1A 5C8VA 1AZWA 2PSJA 1ODSA 1ZJ4A 4B84A 1BN6A 3PUIA 3FSGD 2OQIA 2UZ0A 1MAHA 4K6HA 1HPLA 1MAAA 1UOOA 2HA3A 5I9IA 4JNCA 1CQWA 5EHNA 2VJDA 5AHXA 1EDBA 3FNBA 2V98A 4EBBA 1S8OA 4PNZA 1QFSA 4PO3X 4IQ4A 1VJ5A 3V1LA 3X3HA 3OURA 3WWDA 2JBWA 1LBSA 3G7NA 2VJAA 3BJMA 4ARAA 5JAUA 2JGIA 2HHAA 4FMPA 5AI9A 4KRYA 2DHDA 1ZI6A 1XQXA 1Q83A 2DR0A 1H2ZA 2PKYX 2ES4A 2JEZA 2VA9A 4X6XA 3STUA 3W2TA 4YASA 3R3XA 3A2MA 2VT7A 3I1IA 2XUQA 2HA4A 5CXUA 3C45A 2PM8A 1EVEA 3B12A 3OM8A 2OGSA 1Q0RA 5ALLA 4XJVA 4BE9A 1P0PA 4LXGA 1XZGA 1XQVA 1F0NA 2WHPA 4C4ZA 4KE6A 3FLAA 1CEXA 2ONCA 1Q0ZA 5IVKA 1JT2A 3HABA 1FFBA 4MEAA 1JU3A 1XRMA 3BDIA 1QO9A 2YASA 5JARA 5AI5A 1EA5A 5A7GA 5K3DA 4H7EA 1GPLA 2BCEA 4X85A 3QMMA 4U2GA 5K3AA 5FXMA 1QIGA 1EVQA 3YASA 3DLTA 5AKHA 4CG2A 2ZYHA 1GKKA 5LP1A 2WTNA 5AI4A 4BYMA 5ALWA 5AM4A 2ZYSA 5BWCA 2CMFA 1WPXA 5HQ3B 4HVTA 2ECFA 3G0DA 1QZ3A 3TGLA 3HRHA 4DMFA 4X00A 2JGLA 3OG9A 4HRXA 2XB6A 2FUKA 4ZREA 2XMBA 4GEGA 5BOVA 4G4GA 2W22A 2VJCA 2X76A 4DLNA 1UK6A 5AK6A 1XRPA 2C0PA 4U2DA 4D9JA 1ETHA 4TVKA 4FNMA 5JZ9A 1XZEA 2RGUA 2QUBA 1DX6A 2CBGA 2PU5A 3U1TA 1XQYA 3HLKA 5AICA 3IB3A 1HLGA 1X70A 3AUKA 2GBIA 3WJ1A 2X8BA 4CIAA 3O95A 5ALQA 3AZOA 5CT6A 3Q8WA 2HDWA 5AO9A 2I78A 3WA6A 4Q3LA 3G9ZA 3GELA 1QIMA 4G4IA 3ICWA 3O9VA 1JU4A 2QOEA 2IITA 2OPHA 4U2CA 1IUPA 1WHTA 4AO7A 2XUOA 4C01A 1CUAA 1C4XA 2WIKA 3PF8A 3NUZA 4L0CA 2QXUA 4MQLA 3B3QA 4Q3OA 3RK4A 3QH4A 2XE4A 2I3DA 5DNWA 3OPMA 1ODCA 3G0GA 3FYUA 1EI9A 3MUOA 3D7RA 5LYYA 4G9EA 5D3KA 4BBZA 4H77A 1UKBA 4H35A 5DYYA 2ZYRA 3BWXA 5ALMA 1USWA 2XQIA 2XUDA 2OCIA 4AN1A 1N5RA 5SYMA 3AZQA 5C8XA 2XMZA 1MO2A 1CUSA 1GQSA 4EY7A 1CUHA 4E14A 1P0MA 3T52A 3VKFA 4C87A 3BIXA 1DQZA 4UBKA 4UBOA 1TKRA 3V1NA 4S0XA 1CUGA 1MJ5A 3DYIA 4HXFB 5ISMA 4YX9A 4DMCA 4V2IA 1L7AA 4X97A 3PI6A 5EHQA 3F67A 1UOQA 2FJ0A 1CUDA 1UK9A 1W75A 3QBJA 3DKKA 3WYDA 5FKJA 4QLOA 2CJPA 2PSDA 3FCXA 4OPMA 4RE5A 4BVJA 3PICA 4FLMA 1CRLA 1EB8A 2BUAA 2QTBA 1FJ2A 5ALOA 4B80A 2D5LA 3R3VA 5IVDA 1AGYA 4J3JA 3O4JA 2OLEA 3ZV7A 4Q82A 4E11A 4QZVA 4B0PA 3F96A 2XUPA 3DEAA 3IULA 5HFNA 2PUHA 4LIPD 5ALFA 1X2BA 2XMCA
chains in the Genus database with same CATH superfamily
1AQUA 1NBAA 2RCNA 2YN0A 5D5HA 2J3DA 1E69A 2GMWA 2VWQA 3NHUA 4R01A 1V71A 4X95A 3RB8A 3FR8A 1T24A 2X9NA 2V7PA 1YMQA 1T36A 3VBEA 3G9QA 4OP2A 2E9SA 1ADYA 4AS1A 1T8RA 5D85A 2PUCA 3WQRA 2W2TA 1QH8A 1N2CE 1UOPA 3OKFA 4HX9A 3SQLA 3HPQA 3JQ6A 5HKBA 3PEYA 3S5JA 3PQ5A 2GK6A 3CRW1 4L5AA 3E7XA 1N6HA 3KQSA 5MGBA 5BN4A 3IP7A 1NUHA 4NMWA 3DTVB 3NKVA 4WN9B 4BB0A 1P0QA 4FWIB 3WL8A 5ILOA 1EESA 1A5ZA 1KR5A 1QDLB 1G2PA 4MPPA 1PV1A 4XZ3A 3T5BA 3VR2A 3B1VA 3ZX4A 2RMKA 5E1MA 4DXHA 1CR6A 1Q7RA 1X7DA 4P7JA 5LD2B 3TL6A 4RVHA 5B64A 4Z4EA 1WXQA 4HUQB 3EGOA 2A78A 2G7ZA 5LXTA 3JZDA 3UMVA 4FDVA 3TLZA 3R8FA 4K8OA 4C30A 2XRFA 4WE3A 3AFIA 5AI0A 3V8RA 3R0XA 1DV1A 1ZW6A 1QO0A 2I99A 2JFXA 4KV7A 4BNVA 4H18A 2A9RA 4HAIA 3IMGA 2PZJA 1ZGZA 1EVIA 3QXHA 1PJCA 1MX5A 1WMBA 1JHXA 1LS6A 1Z15A 3D02A 2Z30A 3LS2A 4YV1A 1GNSA 1F7UA 2C9OA 1AK1A 1EFHA 4ESEA 4XOUA 1WR8A 1NQTA 1DC3A 2XYGA 2GPJA 3WFZA 5IBPA 4KITB 4AMYA 3GAFA 3SIWA 3GAMA 2EG5A 1Y81A 1FW6A 3H9JA 1MXHA 3NT2A 4ZKEA 1T5TA 1JBKA 2OZEA 2Q99A 4FZJA 2PIDA 3OFJA 1N2EA 1HT3A 1QQAA 1VBKA 4OY3A 1L8QA 1FA9A 2C78A 4LWZA 3F6RA 1VSTA 4JBNA 1ADCA 1EIZA 2ZUWA 3BZWA 3OM1A 4QFCA 3HYSA 4RMHA 1WV0A 3LQKA 1SAYA 1GAEO 3QLVC 3RYFA 3O82A 2OXCA 3D6UA 4MWGA 1UXJA 1H22A 1D4ZA 4KQWA 4QRDA 3SQWA 2H17A 3D0QA 5DSZA 4WZBE 2C7OA 4MLCA 4HTAA 3WMFA 4F1JA 1RJEA 3NJ8A 1XVIA 2ONYA 3G0CA 3TIGA 2FPPA 4NI5A 1LXCA 3GXOA 2NO4A 1K9SA 1DKPA 2R8BA 3EHDA 3I2KA 3KNZA 3E3NA 2GN4A 3IODA 3P97A 4TKVB 3T7AA 1U2SA 3KALA 1E2BA 2NZ2A 4N5DA 5BNFA 1BE6A 1EE1A 5FPPA 3U3MA 1T0JB 4L9AA 5IYZF 3K6SA 5J4YA 1IWOA 2FN9A 4MULA 1E8MA 1XTQA 1K5DA 3C3BA 1N2SA 3QVWA 4ZIRA 2O4CA 4LK2A 3IC5A 4EAQA 3BT7A 2C9YA 1JTVA 2CZQA 2GBGA 4KX5A 2P5SA 4OHPA 4JI6B 3T9FA 5IAAA 1H2BA 2FI1A 2GYVA 1QHNA 2O4UX 3DQPA 2VS1A 4IDGA 5JI3E 2QBYA 4V0MA 1DKMA 2BUCA 5D3MB 5JJCA 1KTVA 5JSUA 1GVNB 3MJCA 4DQDA 1XJ0A 3NVMB 3HZOA 2K7FA 4N0DA 4OTZA 1Z28A 2C3PA 5IU6A 3HACA 1Y48E 4Y2YA 3F1LA 2A2ZA 2AG1A 3E18A 3ODGA 3AFGA 3P8ZA 4PZLA 6LDHA 3IAS6 3TRHA 3ZNOA 2IQIA 4ALKA 1SQFA 4N1AA 4RF2A 1H8ED 4AG5A 2B0JA 4N03A 3SHQA 3ZNQA 3ZDQA 3OWXA 5D8DA 1NFRA 4OREX 2VZ9A 1C7IA 1NVWQ 4QJ4A 1XA4A 2IX3A 1XE3A 1YZTA 1W59A 4Y9DA 1DEAA 4RFVA 5GIOE 2WTEA 1R4MA 5C37A 1BFDA 2RH8A 1N2CB 2ODWA 2AG5A 2VSYA 3CPJB 3V7NA 4OAPA 3IB6A 3UXMA 3W8NA 5KQRA 1TQDA 1Y98A 4OIFA 1ZPDA 4J90A 3U3JA 1KO5A 4YRFA 1X7XB 1DC7A 3PHIA 4W4TA 2A1TR 3CR8A 3FMPB 1FDOA 1CIPA 1O5TA 2C97A 3COVA 3M5DA 1JWBB 1SKYB 4HDRB 4DM7A 3D54D 5K2MA 4RK1A 4FIZA 5KNBD 5KINB 1CYDA 2AXEA 1L5LA 4EY4A 2FFBA 4L8VA 2IY7A 3L3BA 1O9BA 1IATA 4QTTB 4RJJA 1JWAB 2YV5A 4BBAA 1X1DA 1IEQA 4J91A 4KTTE 5DHTA 2UYGA 1I3NA 2BEKA 3E5NA 3CSDA 1UBNA 1NJ1A 2QJRA 5AIBA 5IRCD 2FFAA 3TNLA 3Q0TA 4MS1A 3T6KA 2WK1A 3NYIA 3K15A 2G9RA 1JR4A 3UOWA 1KQGA 4RTLA 1N0WA 2PX2A 3HO6A 3S2IA 2J45A 3G13A 4K6KA 4WOJA 2VK8A 1LBHA 4B35A 4KR7A 1JG3A 1NHGA 5BN3B 1Z88A 2FFHA 4FSDA 3FWYA 3WLNA 4HAVA 4PZYA 3BTSA 4JBYA 1FXSA 2PVCA 3QV2A 3KB8A 2P11A 1SG9A 4RTSA 4DV5B 5TV2A 3M33A 4OP3A 1KIMA 2AOTB 1KGSA 3ICCA 2D0DA 3LBIA 1U8TA 4TXHA 4U00A 1Y9JA 4L7VA 1FQWA 1I5RA 2XQFA 4U0JA 4Z4IA 1DX9A 3ZGZA 3BK2A 5EGSA 2P41A 1JQBA 2RGXA 3GUYA 4WKBA 4EUFA 2E4YA 1IVSA 1IN8A 2H06A 1J8MF 4Q15A 4ZAFA 3TCKA 3FOBA 4LF8B 3EMKA 1ZM4A 3FR7A 1NOJA 1S8AA 4PCVA 10MHA 1Y1LA 1H1DA 5AOVA 4NHEA 5DYIA 3GVCA 3K94A 4Z9XA 2WG0A 3RQSA 5LQJA 1G21A 3M6XA 1X7YA 5FIUA 2AJLI 1PFWA 1U0BB 1TTPB 5MN4A 5FLYA 4IYRA 1ULSA 2QUIA 3EPRA 2NO7A 1U9ZA 1C81A 1COWD 1VLJA 3U5ZB 4GPTA 5TQVA 2HHHB 1ZSYA 4UXIA 3EARA 4I1RA 3RS7A 4BEBA 2AHOA 2Q4DA 4IHJF 1J06A 2PMBA 3GUZA 4P83A 2QIOA 4UEKA 1PJTA 4Z86A 3U2QA 4EVIA 5I9TA 5A71A 1OB5A 2CFTA 3AZPA 4ZEWA 2PRSA 1G5FA 1HOXA 2OAEA 1W5TA 1JTFA 1KDPA 5LQDA 4YR9A 4PXSA 4G8DA 5LQMA 5JECA 1MAUA 1U7DA 5M5BA 3A05A 2OGZA 1T0IA 2HJSA 1Z6AA 4Q4JB 2C20A 2L69A 2YMPA 4PYOA 4AIIA 1VGVA 4UMEA 5LB2A 1LZKA 2VH2A 3GB9A 1V4NA 2ONKA 1IQRA 3EDRA 5DLDA 2HX1A 1PLLA 4JJEA 1JHQA 1F6WA 1YQXA 2X23A 3FPHA 4B0OA 4BJ6A 4IF6A 5AOBA 2O0JA 1NP7A 4HQFA 3FOAA 2JGNA 1E58A 4AKTA 1A5TA 1PU2A 1D7AA 4ZOQI 1WCXA 3PPYA 4PNPA 4TVOA 2IP4A 1V0JA 1A2OA 2EERA 2OFWA 4UNRA 5JAMA 5EERA 2GNOA 5EJ6A 2G3YA 5D3MA 1Y0BA 5DX0A 1KO1A 1KYYA 4B6OA 1B6RA 1WUJS 4PRKA 2GAOA 5FOSA 4C4SA 3OTIA 2QQGA 4HNRA 2Y0DA 4K6CA 4KH0A 2PUTA 4PTYA 3CONA 4RF4A 2CFCA 4H08A 3TQTA 2HRDA 4YO8A 2O59A 1TI7A 1DAKA 1F38A 2P30A 2EC5A 3QP9A 4NECA 4ZO6A 4UFPA 4AY5A 1M75A 3DFZA 4C2UA 1QH1A 4QDTA 4ZVNA 1A71A 5BW6B 2H2WA 4I1VA 2PRKA 2Q1WA 4ZGBA 3KKOA 3P9ZA 4HGYA 5EEGA 5H3HA 1HRKA 4DR5B 4IDAA 2HJWA 3BFKA 2WU4A 1WULS 2BFWA 3F8TA 4MAAA 1C80A 4LMPA 5EHIA 1J6UA 1PG0A 1XZQA 1YVRA 3BIOA 3KSRA 3CX3A 3NW9A 3QQ5A 3KUXA 4R68A 5DN6A 1Q7GA 3Q41A 4ZAZA 5F9HA 1DEKA 4H60A 3PDIA 3OX2A 3CF6R 3JU3A 1YAHA 5TVKA 1O3YA 2FFQA 3U48A 3PJRA 2ZJ8A 3Q3GE 4X92A 5TE9A 1TKAA 2J33A 4EZEA 4E1VA 3LTNC 4NK4A 3KOWA 5HKOA 4JVMA 4YXFA 3CJRA 3WGGA 2F8SA 4US0R 1QTIA 1PIWA 2D7JA 4FCCA 1E94E 4JJIA 4ZI2A 3JWPA 1EGQA 1UR5A 5T4EA 4AZWA 3C1OA 2AOUB 4REQB 5TRTA 4DIUA 4V1CA 4HXGA 1V8BA 3PGMA 3BOSA 3EVZA 5ALUA 5GOZA 3J81k 1Z25A 2FHSA 4JT9A 1XXLA 3PFIA 1W48A 4XFJA 3R7SA 4UE2A 4MWSA 2FF7A 4PVCA 2QTHA 5DTIA 3TZBA 3OQOA 3E23A 2P9BA 2X3FA 2V96A 4K6FA 4YN3A 3WTCA 1GO2A 1ZD1A 1P9NA 4RZSA 1D1SA 3K8YA 5CNKA 1NBMA 3HXKA 5HBGA 5FUBA 1M5RA 3IL2A 2B9EA 4BO8A 1E1YA 3NVDA 4MLDA 4O4HF 1RJGA 3M7IA 3D4BA 2JGFA 2AMLA 2Z4RA 5FWYB 1UXIA 3BK7A 3ONNA 4MJLA 3AF0A 3T4PA 3B7WA 1JYEA 3N0RA 1UH5A 1ID8A 1AZLA 1PL6A 1G98A 1X7XA 5ERGB 3VKGA 2JFOA 5BUCA 1R4NB 1GV0A 3STVA 4G5XA 2NU9A 3G9XA 5TARA 3RASA 3KJQA 3S8EA 2VDWB 4OF4A 5BSEA 3TX2A 5G0TA 3WYAA 5JCJD 5CU7A 1OGJA 1UP6A 4OYLA 2Y0BA 1NI5A 4YVFA 3PHJA 3MJVA 4O2AB 2IYEA 3VPHA 1GNVA 1Q7CA 1S9HA 4GT1A 3ZOZA 4QLAA 1E2FA 1P1CA 3MTIA 1TM2A 2E6KA 2YQ5A 3GD5A 2H4FA 4QT0A 3DBRB 5F3RA 1VRVA 3LQRA 5JWOA 2ZSAA 3Q7PA 5E2BA 3PWSA 2C7PA 4HNUA 4FHCA 1Q77A 3A11A 3ZLVA 5EA2A 1E6KA 3BAFA 3CV3A 1CULC 3H9QA 1XHEA 1OYWA 4Q4LA 4XX1A 4AURA 1KAOA 5AW3A 1R0ZA 2DUNA 4RZQA 3DE2X 1YAJA 3W7VA 4GPAA 1OBFO 3OTOB 3SHVA 5C1PA 1U7HA 1YRQA 1WHTB 1E2EA 3OT4A 3P9IA 4O02B 3GZNA 3AOEC 4G67A 3HU2A 3EZFA 3ZHXA 1MOPA 1Q6ZA 1ULHA 1VDZA 2QAGA 3ECAA 5UKDA 4HUQA 4OOEA 4FR2A 2JFPA 2XX3A 1RM3A 4E15A 1FQOA 3LECA 3NCHA 1MXFA 3TQCA 4FMCF 1SKYE 3C8DA 3D3WB 1IUNA 4A2WA 5EJGA 5K0ZA 1NVBA 3LH5A 3T7CA 3TXAA 2V5AA 2O1XA 1U2DC 3MW8A 1F1JA 3V6LA 3I2YX 4M0MA 3ANXA 3CC8A 4HSGA 4PANA 1NMEA 2NAFA 1KEKA 4KFCA 5CA0A 1X15A 2A92A 2AOUA 4REQA 2J3HA 4PYKA 4B74A 4E6EA 2EHDA 3O2NA 2HU2A 3QPCA 1NRWA 1WU8A 4YV0A 3HB7A 4HQRA 1Z6TA 5KHLB 4NL4H 1CDEA 3EHEA 1DE0A 3IPXA 2Q29A 4HDRA 4MKHA 3TRDA 1O5OA 3A6FA 3IE0A 1UBOS 4G3XA 4QWMA 3HKEA 4RHEA 5AKZA 1ZNWA 3ZDEA 3AF2A 1ADGA 4EL5A 3G6WA 3FX2A 1BWPA 1NOKA 3VDRA 2VWPA 2O7QA 2LRHA 1QF7A 2GKSA 4QDOA 3GFVA 1PX0A 3RAFC 1NBHA 2C2WA 1U9IA 4UNPA 3DBRA 4YRDA 1XZDA 3OECA 1T9ZA 4RVGA 2ZI4A 4B32A 3BDAA 3AO0B 4IIBA 4MW7A 2ZVJA 3CWZA 1PF7E 4HQOA 2W2XA 3PA6A 1FC0A 2Q5QA 4IH9A 5DLQC 3IV6A 4Y1FA 2HJVA 3HBJA 4HRVA 4ZK2A 2KHZA 3Q11A 2C5AA 1H65A 1NQAO 1LS1A 1E6CA 2DWUA 2EFEB 3ICVA 3NTQA 4RL6A 4WJZA 1G7CA 1NSTA 1ZX1A 2IEYA 2YVLA 2Q5HA 3OD5A 3QLJA 4MB0A 4RIFA 5IN4A 3B6EA 3RS0A 4LC9A 4JH0A 1Y3DE 4OCZA 4UARA 2PMWB 2BEVA 4CW7A 3TWOA 5LNK1 1UZNA 2HU7A 2RD2A 2ZI9A 4TV9B 2ODTX 1M83A 4HGPA 2H9AA 3OOWA 5CG2A 1HL3A 3HB1A 1LI7A 2RH4A 2P7HA 5EVCA 3KR0A 4BNWA 1W88A 1J9GA 2HK8A 4P4LA 4BATA 3AVXA 1QRAA 1BMFD 1QGUA 2EJUA 4YQYA 3TLMA 1CZNA 2ORYA 4AROA 1M0WA 3EZXA 3JR7A 3KE9A 2JFVA 1U9CA 3MOIA 2VUIB 1NATA 3NCTA 1UJ4A 4IJQA 4HGOA 1QO0D 2XOEA 3JS5A 3WB0A 2JDID 7REQA 5DV9A 1BDBA 6GPBA 3TW8A 4IICA 1J8QA 4P7GA 3U19A 1K0UA 1FFXA 4I4TF 1ZI9A 3ET4A 3QE2A 4MW6A 4DT1A 3INGA 1M6WA 3BEDA 5TXGA 3L4BA 2NUAB 1QS0A 1O87A 1RDFA 2HJ9A 4FJ1A 4HP8A 3W9BA 5B12A 1J1IA 1SVWA 3NHPA 3ZDRA 5CK5A 3FF1A 1TFRA 1MOQA 5KYXA 1MP0A 3QWBA 8GPBA 4HLQB 4Q18A 3S1LA 3WDKA 1OWLA 3DR5A 5JZBA 4O3FA 5D1HA 1CV2A 1ZQ9A 3FUCA 3BWCA 1AKTA 2RBKA 4UZEA 1FFDA 1QLWA 1O0SA 1DXYA 3GUVA 3PTLA 4ARCA 4FK8A 5H80A 1PEAA 2PR7A 2M2IA 1K63A 4ME6A 3AMVA 3KXKA 3N2EA 2GVDC 2R6FA 4G0OA 4OM7A 3HJGA 3W34A 3U4IA 1OLOA 2FR1A 5SYAA 1OWMA 3HR8A 4RELA 1HZZA 1Z6GA 1S1MA 4QUBA 1KHTA 3KTAA 3LRXA 1WOMA 3R3HA 3UHOA 4JL8A 5FUYA 5FT9A 5HIIA 1M1YA 1H8EA 3C3AA 3SSMA 3WLRA 5KPDA 5MFPA 1O8BA 1BW9A 1PBNA 4EJSA 5CEJA 5CEFA 1IEXA 5C8DA 5HF8A 1E5TA 5B7GA 2A3RA 1N1MA 3MWLA 3Q10A 4K28A 4NCIA 1HYGA 1XTJA 4WK4B 4BNDA 4RZ3A 2NPIA 5BW8A 1N32B 3R5TA 4EK9A 1NR7A 3K0KA 4DJ5X 1AKEA 4KO8A 1SUEA 2E4XA 3H0KA 4FB5A 3QOYA 4L5CA 4ZANA 5T8KC 5IH3A 1JPUA 4TYPA 5A1TA 2VJQA 1GKYA 2QR5A 2AIRA 1ZD8A 5K8IA 2C0CA 2YYSA 4LOLA 4X64B 4P32A 3DMDA 3H97A 1WHSB 5GV7A 3H83A 4BDTA 3L46A 2IHNA 3BSFA 3FAZA 4XVHA 1G20E 5AI8A 4L4ZA 1YZQA 1NVVR 5A4MS 1E7QA 4XLZA 1SXQA 4N5HX 1ESDA 1C7FA 1OVMA 3L1UA 4N0QA 3NBQA 4I2VA 1C9EA 2UXDB 3EG9B 2L82A 2VP0A 3GGPA 4WLFA 5CR9A 1GYPA 2C2KA 1XCPA 2PHZA 3KLPX 1BDJA 2VNSA 3HSKA 3MRTA 4QTXA 2BI8A 1ZGCA 2ZJOA 3G2MA 1JP7A 4IQFA 4P7FA 4JSTA 3ML1A 4GBJA 4N3CA 4QD3A 4C6TB 1UZUA 2G0NA 2ZTMA 4ZEVA 3DD5A 1ZM7A 1ZWKA 3PJEA 3X1MA 3ZDYB 3MILA 1UC4B 1QR6A 3MERA 2GZMA 4MMZB 1KDOA 2J3EA 1RVV1 4EB6B 4FNOA 2GZDA 2WBLC 2WFLB 1XTZA 3VV2A 1NP6A 1V6CA 4YAWA 4B4UA 4EKDA 5B7PA 1GA1A 4YHHB 1FVHA 1N0UA 4E4YA 3LUAA 1BVRA 4E31A 2HYIC 3FYSA 2WOOA 4PSKA 2EW8A 3TAUA 1Z2AA 1FFWA 1O0CA 5K0LA 1XCMA 3DT8A 1L7NA 3OMXA 4AXXA 3IQHX 4MW1A 3V1MA 1FMLA 1L7OA 3CN9A 2EF0A 5K3OA 4ZOBA 5JMTA 2XAUA 1G17A 3KHUA 4ZOLA 3PZBA 3T7RA 2JC3A 1J56A 1G0NA 1NBIA 2UVDA 3K6KA 5HFAA 3ZH9B 4C4AA 4D79A 2VCHA 3C2QA 4NE7A 2CL5A 2Z2ZA 3HKCB 1HL7A 1N1GA 2WM9B 3QTBA 3ILHA 5CNIA 4D8YA 5ULLA 3P2IA 3TEFA 2OM2A 2KLHA 3TMAA 1C9JA 4ROSA 4RD4A 4RH3A 4JZKA 2CXPA 2PD3A 2ZWVA 5J2UB 2W6CX 2OB2A 5AQ1A 4PZ0A 5JPCA 1L2TA 1MPXA 3MTJA 1VE5A 1BIFA 4WEQA 3VHXB 4BUZA 1K7YA 5KJ6A 2ASVA 2CMHA 1U3TA 1JHOA 3DNMA 3F71A 3ZKWB 5FWXB 3K6SB 4R2MA 4WTOA 4EUKA 1BROA 2BKVA 4OQDA 4EY8A 4UVGA 2VKQA 1I4LD 1LWOA 2QX7A 3BQ9A 4E5VA 4TKVA 2FF5A 1E2HA 1VBMA 3H1EA 1XPOA 3O4HA 1NU6A 4UM7A 4JYBA 1EFKA 2ZTVA 3FF4A 1HE5A 4JD5A 3AVTA 1OXKB 3IO5A 1H2RS 5KQPA 3CVYA 1A9ZA 1L5HA 4J2TA 3ZV3A 3L0BA 5H16A 5FYDA 4MUAA 5IDVA 3V8VA 1PRYA 1BOOA 3MMSA 1A9XB 1E99A 5JD4A 1X1BA 4RETA 1QF6A 2B35A 1U8YA 4G36A 2R6JA 3NFRA 3MTGA 2QN3A 3PGXA 4EG0A 1CG6A 1ORTA 2I65A 1A2BA 4JLMA 4KVGA 1QM5A 5HTKA 1K8YB 4AP9A 1D6SA 2DRIA 4RNDB 2PGNA 1FSSA 3C6XA 1YB2A 1AVTA 4RAQA 2O20A 1DAHA 4J0FA 1VP3A 4M55A 3PDJA 1KC1A 4TS9A 4U6SA 4AZSA 4LJRA 2X2FA 2F8MA 4I5EA 5IAGA 2FEKA 4UULA 5HUJA 1HT0A 2VATA 4DIBA 4I4NA 2E4WA 2QQEA 4IP0A 1RS0A 1W6UA 5ECGC 1JBQA 4ARSA 5F5XA 4MCIA 2IPMA 3ZUPA 5LP6A 4R1NA 5EIHA 4X1IB 4CIXA 4K6MA 1WKCA 3H3XA 2VWGA 3WL7A 2IZZA 3D6VA 3IAS1 3K0HA 5BYBA 3H05A 4L95C 1SPXA 1YDGA 2YX1A 3Q5DA 4G2NA 3H11B 1KI3A 5EQFA 2A3NA 4Z9AA 3RRZA 4EMBA 3OLYA 1D2GA 3LGXA 3W2FA 4A0RA 2P91A 4KH1A 2P6RA 1ZK0A 1YJAA 2V4ZA 3AINA 3TPFA 4CMBA 1RADA 4MVJH 1BFKA 1JE0A 1EFTA 2ZE5A 5H1YA 4RYDA 2G6BA 4CQLA 1WF3A 4G89A 3SR3A 4GHWA 1GTRA 1Y9DA 1VYHA 4OXKA 4PRYA 5EMHA 2VBIA 5ILQA 2O8FB 4JGGA 2HUPA 3S2UA 4NRDA 1KJZA 3S1AA 3H5OA 1K2VN 1GU1A 3OETA 5B4UA 3K2QA 2E5FA 3CYFA 4QO7A 1QX4A 4MAMA 4X6YA 3U3RA 1G5RA 4BRZA 3LUGA 1XDSA 4A15A 2NU7A 2BGGA 1YZLA 1SKAA 2A94A 4RGYA 4D3FA 3C3EA 4KXNA 1RWMA 2ZRCA 2W93A 4U7TB 1YFJA 2PAAA 3DWEX 1LDMA 2VHXA 5G40A 3PQ6A 4EFKA 1II0A 5BSUA 3MWEA 4EFNA 3AWDA 2SBTA 3V8MA 3IIJA 2PLFA 4PSAA 4XEUA 2W70A 2YZKA 5DBFA 3V4FA 1FTWA 5DWDA 2ENWA 1KRHA 4DNXA 1K89A 2Q3FA 4MA5A 3PXUA 1CY4A 2XMRA 3EFEA 3DLHA 1RXWA 1NJ6A 1PR3A 4WUTA 3OC6A 2J41A 3M4YA 1EDZA 4ZQIA 1K9VF 1PJLA 5FBZA 3U9LA 4LOHA 3MD9A 4BMZA 3WGTA 4DR2B 3G0BA 3NV9A 4QODA 3OZRA 1QG2A 4FFBA 4MKGA 2Y2UA 4ZAVA 4GEKA 4O6VA 3DA8A 2KI5A 3NWBA 5AP9A 2EBFX 2WQ6A 1LSUA 2GN6A 1ZGHA 1VC2A 4G1VA 1XGKA 3ESYA 3MJTA 4KWIA 1K4KA 4JIGA 4BEVA 2ZYIA 5BN5A 4CKZA 4HHEA 5L3SA 3R2JA 2GM3A 2J87A 4JJZA 2WR8A 1JVSA 3R5JA 4HEQA 2WPDD 1H0HA 4K5QA 4M9RA 4MRNA 4ZZ2A 1RP1A 2J5KA 4B5KA 3T3PB 4BFLA 1TIBA 4P4SA 5AUQA 1WB6A 1H5UA 1GKUB 4WBNF 3C3DA 3RUAA 1Y5MA 3WWPA 4EY5A 3LLSA 1CC1S 2GO7A 5KWJA 5DW0A 3QU5A 1BE8A 3I5UA 4HSEA 2JKVA 3Q87B 2C42A 1G2IA 2UUCB 1FEZA 5A3JA 3H0EA 3T3IA 5BV8A 4PYNA 2XADA 3KSDO 3I2FA 1R3DA 1F3OA 2ZIVB 2CFRA 3LL7A 1UWVA 4QNMA 2CCGA 2O0LA 4WOKA 1E9CA 1A7AA 1EDDA 4FFLA 4EJSC 2QZSA 3DT9A 1NV8A 1DL5A 4HDMB 2VHTA 4R41A 2BOVA 4KXXA 2Q0QA 4AQDA 1EZ4A 3D3NA 5H9WA 1UJ6A 1FUYB 1H5NA 4BKMA 2XODA 3IOMA 2Z5LA 5KAMA 4AMUA 4DG5A 4N0MA 1E9VA 4OXQA 4F21A 4RE6A 4KLCA 1YDEA 3H9UA 1MDFA 3GQBB 4H3SA 4YFVA 2Z8YM 4UAJA 2IYWA 3OBBA 3WHPA 4YQEA 4FCVA 2EGUA 4WJKB 5JO9A 5BQOA 4LW8A 1RQPA 3CVJA 4XB2A 2BGIA 1O54A 5EPEA 1ZAYA 1I32A 3JCZA 4RSMA 3S8MA 1SBQA 2WYHA 2IYQA 3T9BA 4TOIA 1N0HA 4Z6KA 1FFHA 4QUJA 3OF5A 4O2BA 3AVYA 2FE1A 5AUNB 4JUIA 4D1YA 2R7NA 5EI5A 3DZFA 3DDUA 3OFNA 4LTMA 1FYWA 5LIPA 2BBSA 3O21A 5A3SA 1QPZA 5IWAB 3HBLA 1PAUA 3G9UA 4G8BA 4JBXA 1PDVA 3KPUA 1DP4A 1VE9A 3NHKA 4JBGA 2YVAA 1ACLA 2E4UA 3JD3A 4M46A 2DGDA 3O3CA 4MDEA 2QZZA 4KWHA 4FLFA 3D31A 3IPYA 4GLFA 4NNPA 4QA9A 4MUHA 1UAAA 5HXAA 4DGSA 2D3TA 3DFMA 5K8CA 1UBGA 1SVMA 2W2VA 3VU8A 1SG0A 1RQ2A 2W2LA 4CM9A 2V3CC 5TQJA 3CF2A 3VR5D 4CMJA 4X63A 1RZRA 2ZJ5A 5GZ3A 4WSOA 5LQKA 3E3LA 4N5NA 2YBDA 4XJXA 3KBOA 2PJDA 5TSDA 1M2JA 2FMKA 3CLUC 4DMLA 3CZ9A 1K7XB 1KI6B 1OROA 4TLAA 3MCUA 5I7FA 4MWZA 3B70A 4NDAA 4PE5B 2I9PA 5E2IA 3LQ2A 4DWVA 3T1YB 3DZDA 4IV8A 2IUUA 3WGJA 5I47A 2FVXA 3L92A 4QDUA 4UASA 2QYSA 4BFZA 3CJTA 3OJLA 1LPPA 5BRAA 1Y4ZA 1PJ3A 1E5QA 2X15A 4D4LA 4NAUA 5F78A 1G20A 2XHZA 2BHLA 3Q9LA 4MP8A 4NEGA 3K31A 3M3HA 1OXXK 3OLQA 5HPYB 2PWZA 2YNMC 2FK7A 4IDBA 1ZZGA 2FEMA 4KZKA 4DV1B 4EHJA 2PPVA 3SZRA 1U0LA 4M60A 2IEZA 1U90A 2ID7A 5M3BA 3AKEA 1RYYA 1CD5A 2JAXA 2ODBA 3BMOB 1Q2UA 5LSAA 1QIKA 3X1WA 2F4NA 4JQCA 5FPTA 1KEUA 4D9IA 1SC6A 3NEJA 3SHOA 1AK9A 1UPFA 3DS8A 4M98A 3LHIA 3X44A 5KOJA 4URWR 4YUVA 3ZBQA 1ADJA 3Q85A 1H4SA 2ZI6A 2IYAA 2QTLA 4YREA 3VVMA 1N2IA 3PRHA 5L8VA 3GLUA 1R0RE 3KT0A 3KP1A 1B2RA 4AMZA 1VRCA 3MJ4A 1ZISA 4KWCA 5LPNA 3HB5X 3LOQA 5ER6A 3WGYA 3OM0A 4EBFA 1D2AA 3VR1A 4HAWA 1GA4A 4HG2A 5I45A 3GA5A 4TXMA 4RDHA 2QM8A 4RWZA 3B13B 1MEJA 4FLEA 3TLXA 2D2FA 3B78A 4H6VA 1A9XA 5HYVA 4EVSA 5ICFA 2GPSA 4MW0A 5LLTA 2I6SA 2EATA 3OA0A 4BASA 1PSZA 1JMKC 1V39A 1U0TA 5GAJA 4YRMA 2BFFB 221PA 1R0WA 4XWYA 3W3AH 4EJ0A 4PFJA 5IBCA 3KAKA 1PT8A 2PKQP 4EATA 3QKWA 5KSWB 2ZVQX 5FTNA 3NFYA 4DMUB 2PBRA 4E30A 3GP3A 2JS7A 5JQWA 3L9XA 3RRNA 5ALSA 2GS9A 3T61A 4C0BA 3BAZA 3FHLA 2IEIA 2V5VA 1OZGA 5FFMA 2RHTA 4JZYA 4D3YA 4RHUA 4UDOA 4DOMA 1BCRA 4FOSA 5EZQA 2A9KA 1CRPA 1JEAA 1ZHFA 1QG6A 3I4CA 3B8EA 2I4LA 1CUXA 4B3GA 3M82A 4F93B 3EQZA 4KEAA 5CLHA 4B44A 2RAPA 2QUHA 4U2FA 2O2HA 2DP4E 2RHHA 3A70A 1O94A 2Q4BA 5FOUA 4HB0A 3UO8B 4BRWA 1GL3A 3U09A 3EIOA 1NDHA 4BLRA 5F2OA 1HKUA 3R44A 2DT8A 4WESA 4ZAWA 3Q88A 3HN7A 3VPBA 3WMRA 5EKTA 1HSZA 4ZV9A 1GEEA 3D4OA 1GPBA 1Q1AA 1EX1A 1NJFA 2COUA 1GVHA 1WXEA 4E07A 3IQDB 4RK6A 3SN6A 3P9PA 3AVVA 3FETA 1X80B 4LWQA 2VXCA 3T06B 3ZK7A 1PK9A 5AI6A 1GGFA 1WXXA 2PMKA 3BHMA 4MPJA 5DGTA 4QKQA 3X2FA 4PTLA 4FEYA 2SKCA 3P2YA 3V4ZA 3PE3A 2IWHA 2WJWA 4WVFA 5DP2A 5IM4F 2RI6A 5CA1A 2Z9CA 2ZW9A 2HBQA 4B71A 2FKNA 4H7FA 1W2WB 3BZUA 4KO4S 4OAQA 1RXUA 4N39A 4X7RA 1VPLA 4RESA 5DBHX 1HDYA 5CT4A 1DAEA 1Z07A 1KAQA 1W0CA 2RI0A 2VAXA 3EZ2A 4P22A 4LZAA 1R37A 4GWKA 3GPCA 2RB5A 2V7UA 2LCIA 1W47A 5EJ2A 3FSEA 1SBTA 4L0DA 1SXGA 4M3NA 4F97A 5EMNA 2OV4A 3JYLA 1HE4A 2IX9A 2C7BA 3OQPA 4TN1A 1ILEA 2G4CA 1J20A 3F1KA 4LF9B 3LYHA 4WJLA 4AD8A 4XWGA 2O8DB 3RVKA 4ZYWA 1E2NA 2CMKA 1K7FB 2DHRA 4TZ6A 3F6BX 3A4MA 3S3TA 3GIDA 4GKKB 3CZRA 2A67A 3OE5A 3U44B 3OKAA 4PZPA 3SOPA 3BXOA 4ZC8A 1NBME 5IVIA 1YOVA 2EJCA 1NN1A 2LXNA 3HGQA 4I50A 3FLMA 1KOLA 4D9HA 1LX7A 2CB0A 1T2CA 2TMYA 3HBMA 4GM0A 1WEKA 5CLIA 4DKJA 5KTPA 4GI3A 4AK9A 1QRDA 3HKCA 1SZCA 1IIBA 1PSWA 3BFPA 3N8HA 1VSUA 4A2PA 1YR2A 4GWLA 3WMWA 3COPA 3IERA 4TM7A 1FS5A 1HLFA 5EPUA 4YDQA 5CA0F 3PPIA 1PQ4A 2KW5A 3EG9A 3T3DA 5DX8A 1V6AA 1XCBA 3PIIA 4OFBA 4GYWA 5HWSA 1EFDN 4H7HA 3JPYA 4F46A 4RA6B 5CDFA 1WCIA 5AHOA 3G9TA 1K5PA 2JLBA 2P4HX 3PA8A 2C82A 2VF4X 1E2PA 1PHRA 1M73E 2EL7A 3K5PA 5DT2A 2X8JB 5LMNB 2DYKA 4IVPA 2YIMA 1YKSA 4KOAA 3DCJA 5AJYA 1LDNA 5H82A 3PXEA 3RAEC 3WK4A 2WJZB 4NFLA 2O5CA 2Q0SA 1W5SA 4O29A 2YXPX 5HE8A 1FS4A 4PHCA 3HKBA 1DAFA 3DMGA 1BWQA 2J9ZB 3Q4GA 4WH0A 3U3XA 1UT8A 2HSEA 3LBNA 1WB5A 1RKVA 3ZE0B 4IYJA 1CNFA 3L7CA 4FBLA 3Q9UA 3Q8KA 1L8AA 1DRJA 3W2EA 1DIGA 3G5LA 1A8IA 3R9XB 3I8SA 4KN9S 1HYQA 1IXKA 1I1NA 3G02A 3HC7A 4JMLA 1U1CA 4MPDA 4FYJA 4IJKA 4NBWA 1C0PA 2DHCA 2XAAA 4ZALA 4E4TA 3H9GA 4BKRA 3WGIA 1KMHA 1DIAA 2HXYA 1KNQA 1E1QA 1T9GR 4GQBA 3W5CA 4B6QA 1S4QA 4B6GA 1VG8A 1E4EA 1RCTE 4H7KA 1YRYE 2QRHA 3OEHD 3OMLA 3PV0A 4V0QA 2H2HA 3DLBA 1QK4A 5EN4A 1PT9A 3RS8A 5TB5A 5C5CA 1CNEA 2IDMA 4EI8A 4HZUB 4EO4A 1Y4SA 2UUOA 2Z5VA 4XW2A 5KDDA 1Z5PA 3ESRA 3EXIB 3PL5A 3LFTA 5KYGA 4ES6A 2J85A 2WJ3A 2ZWAA 3U17A 2XT6A 4EB8A 3KL4A 2ZRPA 3TEJA 3TZ6A 3PQCA 3AY7A 2CD9A 1L9XA 1UEJA 5C3UA 3VTZA 3L1IA 3RSCA 2J5QA 1OFVA 3A26A 4KK4A 3C3KA 2LZ0A 2AX3A 2R5WA 4A8PA 1SZPA 4BU1A 3LI2A 4ONEA 1CUUA 3FPLA 4OX9Y 3Q2IA 5IKXA 3I52A 4YAOA 1UC5B 3D9QX 3KUUA 4HR7A 5L51A 4OXYA 3EZGA 2YWRA 3A9TA 2FWPA 4XSVA 3QFRA 2BBOA 3K20A 3IILA 3QVKA 3FYCA 1GXSB 1IE3A 2CNOA 1WW8A 3P1JA 4WMLA 2H5EA 4EG6A 3MUNA 1EK6A 3KO8A 3STUA 3MTAA 3KQUA 4R84A 2Q2NA 1Y1RA 2JHCA 3HJCA 5TS2A 4EKEA 4YAUA 4UUBA 3KK0A 4ARBA 2RH5A 1XAIA 2QTAA 4FGKA 2ZKIA 1MT3A 4ZD6A 1Z6PA 2WILA 2P0AA 4RTKA 1FLNA 3WLFA 2GFIA 1I2AA 1LVHA 4QELA 2IYNA 5F5LA 1IM5A 3H2JA 4QFBA 3UT0A 3AL3A 3ESDA 5EMMA 2RK3A 4D56A 5JEEA 1ICEA 1LBEA 3RSFA 2COKA 4WINA 4O2AF 1HSOA 3IXLA 3OAAD 4V0ME 3S7ZA 3V97A 5BOSA 4TTRA 2XE8A 3A1NA 3QQPA 4JJGA 2BGLA 3TS1A 5B7QA 1UAYA 3FLBA 2Y0EA 4UUQA 4QAJA 4GGMX 3AEZA 1M3SA 4FFDA 4XAQA 2A5YB 2W00A 3BMQB 3D0RA 1S6YA 2IF0A 2OQVA 4DSZA 7REQB 4HQNA 1EEXB 1IG0A 2DTDA 2EYQA 2HDNB 4YCAA 3SJ7A 5A5DA 1EXWA 3K70B 3FVWA 1KYTA 3A4NA 4G0MA 1P0FA 4MA0A 1BDMA 4JT2A 2ZR8A 5DXAA 2BKEA 5LMCA 2QAGB 2ZJYA 3JAWB 4K05A 2GUGA 3QEMB 1KDRA 3BBPA 1XRJA 3CFYA 4WCFB 2NW6A 1NBOA 4WCFA 4ZT6A 5JLJA 1RHMA 8MHTA 4YO7A 3C87A 1C1HA 2B4RO 1FPMA 3OKCA 5CDGA 1VHJA 4TTQA 2RHLA 2VJMB 5I51A 3G8CA 4Z3OA 2QZ4A 4J0JA 5CVJA 2A6PA 2D1SA 2RK4A 4NESA 5GVSA 1EX7A 1Z16A 4ALMA 2ZUEA 4D57A 3ZU6A 4IMJB 4JXXA 1RD4A 2GTIA 2PUWA 1VIAA 4F7DA 2PKEA 2H51A 4ZJUA 1ZAKA 3FBGA 4UFOA 3TFOA 1RMYA 3UPDA 1J07A 1E3WA 3R3YA 1KEVA 4TZTA 4RM2A 4IDOA 3D4PA 2Q3MA 4J43A 2B9VA 2G07A 4R7ZA 4MB6A 1SHJA 2I6UA 3SC3A 3AESA 4ENPA 3F4KA 4OFWA 4KKXB 3TIFA 3FM9A 5IUJC 5IEBA 4JC4A 1P9WA 4DR4B 1C1YA 1BX3A 1LPBB 2Y1DA 3OZIA 4MV1A 5F4BA 5FL7D 1DBVO 3W5IA 1JYFA 5E0OA 5FBQB 2PS1A 3L7NA 2OHGA 2AEEA 2ZJBA 4GLLA 4CGZA 1CY1A 2YC2C 1S89A 2P4EA 1A8SA 2Z2IA 5LD2C 3L07A 1XXHB 2C4KA 1I80A 2GEBA 1KH1A 3QKSA 1OB2A 1X7WA 4P34A 5COQA 3L49A 3T0GA 5TMBA 5KDLA 1QP0A 1ZD4A 3RRJA 1NN0A 1U0OC 1EG2A 5HDBB 1FMJA 3S2ZA 5BNWA 3BRWD 1OH7A 2MHCA 1FRNA 4CODB 2KYRA 1VG1A 1P72A 1KQOA 2NUTB 2Y0CA 2ZBGA 3LBFA 5SY6A 2BFNA 2VA8A 1JW9B 1QC5A 1F51E 3MMZA 3FWPA 4AY4A 1T9GS 3UMMA 1STOA 2ZETA 2HI0A 4WV3A 5TT1A 1WMAA 2XHEA 1T9AA 4X9XA 4ZCSA 3OFKA 1ZC4A 1FUKA 3ZD7A 2A5FA 4TWJA 1PWEA 1QTNA 4DN6A 5JDCC 1JKJA 2CE2X 4GICA 4O4HA 1RXEA 3FNRA 3FYDA 3DAHA 1L8OA 3PQEA 4LXQA 3SYKA 4C29A 2YJGA 4TSFA 3EXIA 3ABRB 4WKCA 5EMLA 4F1KA 3DDCA 4ROTA 2P65A 1TK3A 4JI7B 4ZFNA 3NPMA 3P26A 9ATCA 1C8KA 4BVAA 1RYNA 3K16A 1JHVA 2V7EA 1Q57A 4WA8A 3I2GA 4ESVA 1VA5A 2C9DA 4A5SA 3GCDA 4AG3A 4EKNB 4TWRA 1M2FA 2JIMA 3LGSA 4XYMA 1IL0A 2FETA 3WL5A 4COOA 3OIVA 4NZMA 5EE1A 1OR8A 3TMKA 2C7GA 2OLKA 2XF2A 4RUKA 1CZRA 1FYXA 4HMOA 2DHEA 4GKAA 1KS2A 1VG0B 4QGSA 5AW0A 1QJCA 1R0KA 2O2GA 3F98A 3LWNA 4GGPA 2JVIA 4AZ0A 3C3JA 3OE7A 4DLSA 5BSVA 3KYJB 1G1AA 2J59A 3ZVLA 4XYLA 5AM3A 1N57A 4XYEA 3LQFA 4W1QA 4KMRA 4PCAA 1VPTA 4QJ3A 4RQAA 1E18A 1EWYA 2YL2A 3IT2A 4RCZA 3WKAA 1JSXA 3C5VA 2ZKLA 3PHGA 2JKYA 3R4CA 4KN5A 3BD8A 1KMNA 5GM2A 4EYEA 3GLGB 2KPOA 2GFHA 1GTL1 2XYRA 4R8MA 2GPTA 4UAGA 5IT4A 2J4DA 3CZ4A 3I1JA 2AYYA 2O07A 3OF3A 5BSHA 5L3QB 1FJHA 3UXEA 3L6EA 3WWYA 1XIVA 4UTZA 1XP8A 2C9CA 4OD0A 1W6RA 4IIJB 2ACWA 1AS3A 4JQOA 4TMKA 4GNRA 5K99A 1CUFA 5J3JA 2JHFA 3V4RA 3IKVA 2JAOA 1IZZA 1JJVA 2X9LA 4I14A 4EUHA 3OQNA 4C2TA 4RKQA 1CEYA 4PZCA 4O5OA 2JEOA 4LBZA 1QPBA 1EDEA 2AI1A 5JSYA 4FDTA 4V1CB 4IFBA 2W6PA 2LKDA 2Z2XA 3RARA 3ZG6A 4ALJA 2GCNA 3IFSA 3ITKA 4J3FA 5F52A 3V32A 3WI7A 4BVFA 4PYJA 3FPSA 3ZEAA 1FUIA 4F2HA 2GZ3A 2BJVA 4U9HS 1Z4NA 3H3FA 1TYZA 2ZJ7A 2D5IA 2WJPA 4B34A 4EITA 5K0NA 3E7PA 2LPMA 2WUDA 4HMPA 3JSAA 4DCGA 4M83A 1L8LA 4BNUA 3ZXYA 1E1KA 2VI5A 1GPH1 1B0UA 4M6WB 4YJ3F 3DFKA 5AXBA 3NVKI 4RSHA 2CKMA 5ALGA 3TINA 1LA2A 4S1PA 4RZ2A 1L5ZA 5T64A 1D0SA 1NX9A 1PI3A 1VBNA 2XNDA 3MSCA 1G4HA 3OZEA 4U5XA 2D1FA 1MO5A 5F76A 1HF3A 1NNEA 1Y7HA 3PXAA 5FPQA 3IBGA 2AN3A 2C5EA 5SZKB 4CR8A 6Q21A 3MQ2A 4P31A 4HNGA 2N47A 1GA6A 3W8EA 3C74A 1UP7A 1WDLA 3N2GA 2ZBUA 4GXQA 3ONEA 1GG2A 4RKYA 4UMFA 4LRWA 4KDRA 3R5SA 4CNBA 1KYVA 1ODTC 1P5JA 1KI8A 1S02A 1BU8A 1OXMA 4XSHA 3WLLA 3DM5A 4P3XA 1YB6A 1YASA 1NLMA 1YXMA 4L3OA 3TTXA 5HOEA 5ITZB 1KP3A 1M6VA 1AQLA 2OO3A 2XUJA 3WRXA 2P9TA 5E9AA 2WF7A 3EXFB 3I9JA 3LXMA 3W4KA 1XXHE 2JFQA 3HGTA 3QVOA 3IURA 4J16C 2O3UA 3QKRB 1YA4A 1YOBA 5DN6D 2BKAA 4Q3CA 3AL0C 1PDOA 4J7XA 2X4LA 1TA9A 1PZFA 2V3VA 1AXGA 5JTUA 2YRFA 1SA0B 2GPWA 5GZ1A 1V5IA 4IDNA 3OZVA 3R0JA 5IK2D 1Y6GA 1P1KA 1K5HA 3LPCA 1ISGA 2X6TA 3BBLA 3SVZA 1NRIA 3ETJA 1C3JA 2QN2A 4IIUA 3LRPA 1A1SA 4TLBA 2VT6A 3PXGA 4YK7A 2FRDC 4DSTA 1SCUB 3VC7A 2Q4TA 2X0NA 3S2SA 4OLJA 5CYGA 1T0PA 3GFFA 3RT7A 2FLKA 3FGOA 4JSYA 3EEQA 1I6LA 4RQTA 3E9MA 4R9SA 5AVSA 3CRVA 2XE7A 5DRYA 5KBYA 3W06A 2XECA 3AEKA 3QUQA 4WBNA 3A1UA 3AUYA 2KMLA 3GYBA 4JB2A 5EXEA 3R7LA 4GMXA 4XH9B 4A1OA 4ARZB 3HYCA 5ENZA 1V11B 5E8JA 1E5DA 1DZ3A 4H1VA 3ZWYA 2QORA 4CYMA 3UEOA 4B6SA 3H8WA 3MEQA 4HNQA 1TMOA 2I6QA 1EZ1A 5J40A 5JSHA 1SUPA 2FV8A 3ZYZA 4DQLA 1GDTA 2O0KA 1J2EA 2Z08A 5D3QA 1PJBA 3IV7A 4Y2HA 1BW9B 4ZIRB 4DC0A 4JJ4A 4UVEA 1Y6FA 3MOSA 4B45A 4OFZA 2GD0A 4Q4HB 2UYQA 1PT7A 2IA5A 3A3KA 3MZ0A 4EWLA 1L4HA 1ZP6A 3RTGA 4J0GA 3VJRA 4EZIA 4BZZA 3L41A 4RENA 3LNCA 5HX7A 1GLVA 5FA6A 2OT3B 2IXAA 1ZCAA 2GF9A 2IOHA 1OXBB 3P2EA 5EL0A 2O23A 3STTA 3WGZA 1C9YA 2F59A 3KAQA 4B76A 4XR4A 3OQMA 3O3OB 4YDRA 2JZNA 5L53A 3RC8A 3T41A 1OLSB 4CETA 4L4RA 5TNXA 2FP4A 1ICIA 3R41A 3WZ2A 1XZNA 5K0TA 3FH0A 4C7OB 3L84A 2HZ7A 4FEAA 3SDZA 3TOXA 1N9KA 4H59A 2W6JA 3USZA 5ADVA 1EJ6A 1EFUA 2ROQA 1EEHA 7YASA 2WMOB 5AVZA 1SH7A 4M9UA 4IV5A 2V7QA 2QRJA 1SCIA 1RJWA 3EQ9A 5E0KB 3K1AA 2JCXA 5DWQA 4X6UA 1GT91 4N7BA 5DH9A 1LPSA 2NXNA 2ECOA 2OCDA 1FFXB 3A0UA 3SHWA 3AY6A 3ZE9A 1VHWA 1FPQA 3HHPA 1YCFA 4I2NA 1RRFA 1THTA 3T99A 3ESZA 3K53A 4MRMA 1JQAA 4AT1A 3QEAZ 1PUXA 2O0MA 3EEFA 1ATZA 1AS2A 1I9CA 1RE0A 2Q3DA 2XUKA 3N58A 3NQ41 5CVUA 4CMIB 3UBTA 4WHMA 2H65A 5DK4A 3DMRA 1LY1A 2OAP1 1REQB 3MJEA 4MVJE 4IOLA 3ASUA 1IZ8A 1P73A 1I4OA 4KXWA 1I7SB 4P54A 2H00A 2GNPA 3LBYA 2G8LA 4LN1A 1HFJA 1RAIA 3BSWA 5EIXA 1TZMA 3CVUA 2XD4A 4X45A 3TFWA 1ZUD1 4R2HA 4HF7A 3RYCA 5KOHB 2PS3A 3DE6X 4K8RB 4BLQA 4BRSA 1ZS9A 1FXWA 2ZTSA 4R2LA 4BN5A 3T15A 5KYTA 3GW8A 3WAJA 3LHDA 1YONA 3MGKA 2X9QA 3KEFA 4I9NA 1JIXA 2BKLA 2ANCA 5TQ2B 1D07A 2B7BA 3G17A 4ZMBA 1JXQA 1SUSA 4EYGA 1H3EA 2YV2A 2P69A 4HXEB 4H7JA 3I34X 1YKFA 2XCQA 2PL5A 4WCVA 3IUJA 4B85A 3P32A 4GI1A 4CF6A 4YCMA 3L5OA 4ABTA 2NXJA 1ZQ1A 1KORA 1XZMA 3NDRA 3OWHA 1UZAA 4L50A 3PFFA 1TZBA 5BW4A 3FVTA 4RANA 3KX2A 4X1OA 1OJLA 4G0QA 1U02A 3RYHB 3C43A 4EO9A 2Z9DA 3C16C 4BQPA 2GF0A 3MCAA 3L6UA 1XV5A 2QJFA 3PJGA 4XCQA 3CX6A 2DT5A 4QU9A 3ZXUB 4ZO7A 1LSJA 1YDWA 4S12A 2ATEA 2UYOA 3E9CA 3GCGA 4FIDA 3C3YA 3GY0A 3L7MA 2YR0A 1QZXA 3R7WA 1L4GA 1TUEA 4Y0NA 3QVLA 3EVGA 5D7BA 3WKCA 3JWEA 1OIVA 4J0CA 5JBIA 4Y6RA 1ZOIA 2MYTA 4BFVA 3DVSX 3N7UA 3ZWNA 1V37A 2P2SA 2Y1WA 2A4MA 4Q1BA 4RABA 1MRNA 5GWXA 3UAGA 1QNFA 4DV6B 1Q12A 1Y1SA 2QP4A 1PS8A 3RFTA 5EJAA 2B4KA 1C7JA 4EARA 3UM9A 3P71T 1HDEA 2NU6B 3DDZX 1YK0A 5BN4B 1YT5A 3DW1X 3NM6B 4Q3KA 4XTCS 3T34A 1K4YA 3I6QA 1UP4A 3VDMA 3ELDA 4B9AA 3IAEA 4I5DA 3A32A 2ZCUA 2FPXA 1TVEA 5G0WA 4JJAA 4IHQA 1U63A 1JV2B 2AJDA 3R09A 4OMUA 4JVOA 5DNDA 4LHWA 1GHTA 5JLAA 4JOBA 1NE7A 2QVYX 3RVDA 3W1EA 1EJBA 5TDHA 4A0SA 1UL1X 3MF4A 2PSJA 3KB2A 1ODSA 1YR6A 3UATA 1AGPA 4A8HA 1BN6A 2XVXA 4FHEA 2J30A 3FSGD 4BWVA 1BVYF 2VSXA 2ZJ2A 3KCQA 1Z38A 4OJNA 2WDPA 3FCOA 2FRDA 2UZ0A 1QUFA 2QF7A 4KVAA 4KUGA 2RGRA 3HO1A 1SD5A 2PZAA 1UOOA 1Y8QA 2HA3A 3F73A 1CBUA 3KKKA 1PR0A 3TO5A 1VIVA 1NW7A 2HPHA 3RABA 3RQIA 5EHNA 3NOOA 5EUMA 2VJDA 1HDGO 3FROA 2YIDA 1EDBA 4ER6A 4BJ3A 5I6DA 2V98A 5JS1A 1SVOA 2I29A 3K0AA 1T4GA 3PGA1 1POWA 4TUYA 1EP3B 1S8OA 4MJ7A 1KYWA 3UFXB 2W4IA 3HLTA 2QD5A 4DANA 5HNKA 3WP1B 4HBZA 4ZAXA 5KOHA 2Z5FA 4OQZA 3D8UA 4MYHA 3V1LA 1V45E 3LSTA 2QIPA 4J2HA 1U0GA 1Z5GA 2G36A 2QSUA 1XL1A 3ASZA 5IARA 1KZHA 4D41A 4HGQA 3AY3A 3TKAA 3BUSA 1F2TA 5HW0A 1LBSA 3RFXA 3FHTA 1JZSA 2OHJA 2RBEA 1W36B 2HWKA 1NULA 1BC5A 2RHBA 5FORA 3K05A 1F60A 1AA9A 3HVJA 2BH2A 2I76A 2OV3A 2JIZD 1YD7A 3PCTA 4DDTA 5JAUA 1MDBA 1TTHA 1KEEA 2Z43A 5BSTA 1IXZA 2WWVD 2JGIA 1YBAA 2AQIA 4IRXA 4K2HA 2HHAA 1Z4JA 2WAXA 2AW3A 2ZDQA 4FMPA 1NXVA 3QE4A 4KRYA 3S68A 4NBLA 2GD1O 3T3EA 2PH3A 4XTRA 3WRXC 4YALA 2IY9A 4Y98A 4W5RA 3OQBA 1HYHA 3WYBA 2JEZA 4HFNA 4GNKA 4TSKA 4EJFA 2UZIR 2J8ZA 4X6XA 4OHRA 3W2TA 3VZQA 4B4WA 1VCHA 1MGPA 5BWMA 5JI2E 1J00A 2VT7A 2ZUBA 4PINA 3EFOB 2BGJA 1R18A 3RC7A 1SQ0A 1BHJA 2XUQA 3CRQA 4ZVKA 3TDMA 3U4DA 2I3AA 5KJ1A 3DGEC 1LSOA 2BTOA 4OHMA 5CYOA 3QX3A 3VKWA 1JPNA 4QYWA 3UY4A 4FYMA 4KFRA 2ZXUA 2C2OA 2FMHA 1CJMA 1U6JA 4I8IA 4LXGA 1OLUA 1V5FA 4GR9A 1F0NA 2HCBA 1VPWA 4WNIA 4JNKA 5EE0A 3ZDZB 3L6RA 1D2HA 3LT0A 3QJGA 2M6LA 4JCOA 3DEHA 2JK0A 4ZDKA 3W5DA 1TYEB 2GR9A 1CRWG 1Q0ZA 2IU4A 3VH2A 4YP0A 4U7WA 4FZ3A 2V8OA 1KMMA 4KREA 4I4LA 5LXTB 3KV3O 4CG1A 3CZ5A 2WSSD 3BFXA 4UAVA 3BMCB 5IKPA 3EIQA 1P81A 2OXRA 2VP6A 3OE7D 4C08A 4X44A 1XRMA 1N2JA 1UCFA 2YASA 3NB0A 5DT9A 3O1HB 1TO6A 3OZWA 1NW4A 3ETCA 1MJNA 1TJ5A 3G2QA 2DULA 3HN2A 2FH5B 4GX1A 1Y1PA 4LJKA 1ZSNA 1ORIA 1SKUA 3LXRA 4AKSA 2BTEA 3B20A 1XDDA 5A7GA 2YFKA 3HZZA 4S04A 1T6BY 1ZVQA 1GPLA 4U02A 2BCEA 1KJJA 3AVWA 4RKFA 2GLXA 2D54A 4X85A 4ZCPA 4BPBA 1GLNA 4IY1A 4KLRA 4R1MA 1MF7A 2OCBA 1NQOA 3JXEA 4NBKA 4B3DA 2B99A 2R47A 5FXMA 3ZU5A 5A9RA 1PL7A 3R9XA 3FDJA 1Z2OX 1MW8X 1KYIA 1EVQA 1JSRA 2QT1A 3YASA 3ONDA 2SCUB 1LEHA 1MABA 1I0IA 4EF5A 4NICA 1Q7TA 3A04A 3PDUA 1ZESA 2IE8A 2XBMA 1FRVA 4I50B 2OHOA 2VJNA 1M6VB 4FVTA 5ALWA 5AM4A 2WKQA 1NVFA 3HYTA 4XDGA 4DZRA 1PNOA 1XNGA 2CMFA 1WPXA 2CK3D 2H0AA 3LDHA 4LJ6A 1T4CA 3GF4A 4A1FA 4MW9A 3OIWA 3RAGA 5COAA 4TLCA 4LZLA 4XDHA 3ER8A 4C0AC 3X1ZA 2CDCA 3ETHA 5BQPA 2GJ9A 3JZAA 1Q2XA 3PT5A 1M0EA 2DERA 2CN1A 5K9ZA 2IYRA 3HVRA 2CSXA 3TGLA 3IE2A 1DO0A 1YL5A 1I51A 2XJ9A 3DP7A 3OEED 2I7CA 4H6XA 2CCKA 4IIVA 2FRXA 4PY2A 4DMFA 2PKXA 1E0JA 1EM6A 2ZIGA 2JGLA 3RYIA 4KQCA 3SC2B 3OG9A 4Q6WA 4WESB 3W1WA 4RZIA 2QLFA 4HRXA 5LM3A 1H6DA 2A9FA 2GH1A 1FYEA 2HD4A 1ESZA 3RHFA 2FUKA 1F2UA 1K98A 2XMBA 2X0KA 1DI0A 3J7TA 3WR5A 1DOZA 5J2TB 2Q5LA 1Z6ZA 4CBVA 5IYZA 3DMPA 4GE0A 2X76A 1KVUA 3LT1A 1P3Y1 4CE6A 4GF5A 2A1UA 4UNQA 2HT6A 2NO5A 2WVAA 3O2QB 2ETXA 2NTYC 4ODIA 3ZCVA 2HY7A 1A4XA 4W7HA 3WY9A 5FFNA 3BGVA 3OO1A 1CT9A 5HILA 2Q5CA 4L76A 1F20A 2F3QA 3CNBA 2R2GA 4MCAA 4FNMA 4TWAA 2IELA 4UCFA 1XZEA 3IYLW 2B30A 3C7TA 5IJZA 4WECA 1E2QA 1C3OB 3OFSA 3UF0A 1P2FA 2XOXA 2CWDA 4NH0A 4UCQA 3W90A 2XXAA 5G02A 1H3FA 2C2BA 4QRHA 1LK7A 2ZBRA 3OOYA 4UTPA 1RJ9A 3M9WA 1WIWA 2H16A 5G2OA 3T94A 4F9FA 2HLHA 2I22A 1X70A 3U9SA 5TJ9A 5CHYA 3MYYA 4LI3X 3M3PA 1P18A 5E3JA 1DIHA 4F4UA 1ZW1A 3JX9A 4HLCA 4R8VA 4FFNA 1AQNA 1USKA 2TRSB 3ORQA 3MMPA 4FT2A 3GEMA 4XARA 2FN8A 5AO9A 1VHLA 4UHJA 2JASA 3O8OA 2I54A 4WIAA 5IAKA 3ZY5A 1ZYUA 2QNBA 4L1KA 5M29A 3EK2A 1O4VA 3G9ZA 5TF0A 3ZVKA 4DA6A 3WLSA 4BPRA 4TTTS 3FNQA 4O4JB 3IUBA 2WSSA 2CHUA 3LX8A 4Q1FA 4F85A 3GJ0A 1T26A 1AV7A 2NQ8A 1FL9A 1QIMA 3C8MA 1GSIA 3IKTA 2WYWA 2YMQA 1I4WA 3BH0A 4F3KA 1VRWA 2XCTB 1H4TA 2JVKA 3K73O 1MZVA 2YMLA 4F2DA 1ORDA 3MHTA 2BM8A 2VUHB 1TCUA 2IITA 2JRCA 3HLYA 5IYZB 4JYAB 4CTOA 3FW1A 1GCGA 2H08A 3RBAA 2B94A 2XCIA 2ZSFA 3FBTA 3RR2A 1ZR4A 1ZR2A 4A36A 4LY0A 1KK1A 3QHPA 4O4HB 5J2TF 5JCPA 4LJAA 1JR3A 2XUOA 3HRKA 4N6NA 2PY6A 3TLGA 5JS8A 3QELA 2ANBA 1KIFA 1HE1C 2QL9A 4QOGA 1I94B 3UMFA 2DPXA 3ME5A 1TDJA 3E9ZA 3PF8A 3LVFO 4FHDA 1RWPA 1JHYA 1IQPA 3KXDA 5EVJA 4IWNA 2EF1A 1D2RA 2A1TS 3ETEA 4KQHA 3L7KA 3TNDA 4RDCA 3QLUC 5B3JC 4U63A 3BPSA 4B3XA 3ABZA 2IHJA 4K9RA 4Q21A 1DOAA 4II7A 1P7PA 1SKBA 2YCLA 3RNLA 3ZHZA 4ATNA 1SHLA 4ENWA 5KYWA 2CJFA 2I3DA 2OHXA 2OO7A 3BMOA 4EG4A 1T5IA 4M9XA 1O0BA 1O77A 4MRVA 4RZUA 1RAGA 3HFSA 5DW3A 5EYPA 1ODCA 3G0GA 3KB6A 5K45A 3ROKA 3ACBA 4D99A 5LBIA 2KSQA 5G1NA 1HI9A 1SEVA 4QOIA 3PPXA 1L5RA 1E62A 2Q41A 4LX8A 4MUMA 3Q8LA 3L06A 1B0ZA 3HJTA 3MUOA 2NYUA 5DB4A 2FCAA 5D3KA 1NSYA 3LD9A 4PS1A 3A6GA 1SXPA 1JKFA 3VR5H 3VSCA 3DLCA 5FLEX 1M2HA 2X0RA 3WE7A 1NMQA 5DYYA 1TMGE 2M6KA 3BWXA 1JBEA 4Q47A 3L7AA 3UT6A 1SG6A 3PKZA 4OGKA 4LV5B 4QVKA 3T9EA 3PFHA 1TUBA 1USWA 2Q1UA 1E9DA 1MB0A 3L6DA 4HDSB 2D1QA 2P3QA 4WFQA 3D1VA 3I3SR 1NJ8A 1OA0A 3CUTA 3G2LA 1KWKA 2OCIA 4AN1A 3KLMX 4I1OA 1N5RA 2WYUA 3CNNA 4JGBA 3T1NA 3F6EX 2XMZA 2Y0PA 3DOOA 4H4EA 5AVUA 4O2BB 1I4TD 4BLSA 1NVGA 2XCUA 4GAEA 5JH7F 1CUSA 2UV8A 1VSVA 2G17A 1JX6A 3AGQA 5JNSA 2G04A 1FNBA 2F1OA 3GO4A 3QF4A 1MJGM 1D2NA 1FUEA 2FU5C 1VPDA 2V7TA 3CLRC 3FTQA 2OC4A 5H81A 1DKUA 1P0MA 2CBZA 2HTFA 4GMGA 4OQFA 3V7FA 4C0XA 3FFTA 5JOQA 5BN1A 3UXYA 2ZS9A 2GB4A 3FB4A 1WOYA 2WD9A 1MJ5A 1I3MA 1RT9A 4DLPA 3PVCA 2ON6A 3OJ0A 4K7JA 3HCCA 1XALA 4WXPA 3JASA 4DA7A 1MOZA 3MSXA 2NTNA 2YJ4A 4MRAA 2VDOB 3CCFA 1RLIA 3HB9A 1AB5A 2PRJA 1J5XA 1RCFA 1AN9A 3V1TC 2PCLA 5EHQA 1IRXA 4D96A 3TQOA 4D7AA 1AZTA 4Z4CA 1DC6A 5SV2A 5JZSA 3MPOA 5L7TA 3DEJA 3NJRA 3QBJA 3KHSA 1KVRA 2EX0A 4MAFA 1JQJC 3V80A 1XELA 2FZWA 4AYTA 3EWAA 1ZDMA 3NUGA 4NJMA 1P2TA 3IP8A 2CJPA <