5CURA

G158e/k44e/r57e/y49e bacillus subtilis lipase a with 20% [bmim][cl]
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDETGTNENNGPVLSEFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIELLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 70
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5curA00
2G5PA 1A8QA 2WUEA 3M81A 1VZ2A 4W1RA 1XRLA 3WWDA 7YASA 2QJWA 4I19A 2FX5A 3C87A 1F0PA 3QM1A 3V1NA 1YS2X 3V1MA 4C4YA 1GPKA 2VF2A 3BJRA 4MEAA 5JAOA 3L1HA 4N5IX 3WK6A 1A7UA 4M0EA 3F8SA 1CUGA 5CTAA 3DD5A 1XLVA 3F98A 4EBBA 5JD4A 3KDAA 2C5FA 1XZCA 3OPMA 2XMSA 4QWWA 1GGVA 1DQZA 1UOQA 4J0KA 4KACA 5KREA 4DMCA 2J3DA 5AO9A 4K6GA 2X76A 4V2IA 2JGIA 4PNZA 5C7YA 3PUHA 4ARAA 3D2CA 5E4JA 3DOIA 3TEJA 1QO7A 2Y6UA 4TGLA 3M82A 5DNUA 2I03A 1Q83A 1KU6A 3EF3A 1QIKA 4MWTA 3WKEA 4EZIA 2PBLA 5ALWA 3VJKA 1XZKA 4U2EA 5C8XA 4X00A 1U65A 2JGFA 4BCBA 2XUQA 3V9AA 4DM7A 1X2EA 5AM2A 4AXBA 2BFNA 1ACJA 5CMLA 4XWGA 1CUHA 3HLKA 2Z3WA 3BF8A 2OQIA 3Q0TA 4BZZA 2DHCA 2OCLA 5DNWA 1Y37A 1XLUA 1U4NA 1XZAA 5ALJA 2DFPA 4X94A 5JALA 2OGTA 4MQLA 1AZWA 4Y9SA 1XZIA 5AI0A 5K3CA 2ZJ6A 4OU4A 1EXWA 4W1QA 4H7JA 4BBZA 1XZJA 1LPNA 2HA4A 4HS9A 1G5FA 5ALHA 2HA0A 3A2LA 5AKYA 4F21A 5ISMA 3F67A 3LS2A 5FLKA 4DIUA 2Y1KA 4ETWA 2JGJA 4G8CA 3H04A 2W6CX 2GYVA 4C01A 4KRYA 2WLSA 1ZJ4A 1XQVA 1E66A 1WHSA 4EY5A 5ALGA 4G9GA 3C5WP 3I2KA 1P0MA 2WG2A 1GQSA 4X6UA 3UMJA 1W75A 4IH4A 4INZA 2RAUA 1N5RA 5T4EA 5CURA 5LZ7A 1JJIA 4DNPA 4G4JA 2G4LA 2OCGA 5AM4A 1DWOA 5CH8A 3HXKA 1UWCA 4AZ0A 2D0DA 5C8ZA 1GXSA 1WB4A 4E11A 4ZI5A 4UBLA 2VAVA 2BUCA 3QMWA 2C5GA 2HL6A 5EFZA 5BWBA 4DTCA 2XUFA 5AI8A 2YYSA 1N1MA 1XLWA 2XUHA 2WIGA 1CUYA 1AX9A 5JARA 1WHTA 4KE8A 3N2ZB 4WJLA 4ARBA 3OURA 2J3QA 4N5HX 1QIGA 4DYHA 3SWWA 2R8BA 4UBNA 2HFJA 1P0IA 2WM2A 4QLAA 3CN7A 4O08A 3WK8A 4BRZA 5K3EA 5BOVA 4QZVA 4BAUA 2JEZA 2XUOA 1G42A 3O9VA 4H18A 5D7BA 4GECA 1GKLA 3I2HA 5AKGA 2DQYA 4BB0A 2QT9A 4I3FA 2CKMA 3E0XA 4H77A 4EY7A 3GROA 2BUBA 3IUNA 1VXRA 1NU6A 3HYSA 1MX5A 5FV4A 3ICVA 1LPSA 3BXPA 4WY5A 1CEXA 4X6XA 1O6FA 3EIOA 3AIOA 4MQMA 4BVKA 4HXFB 3F9CA 1TCAA 5CT9A 2XMGA 3WI7A 2OGZA 5AKIA 4B6GA 4FMPA 1TK3A 3W2TA 4KE6A 4FDMA 4P08A 2CJPA 1C4XA 1LLFA 4H35A 4PSDA 2IIVA 1QIDA 3STTA 2H1IA 2O2IA 1DTEA 1QFMA 4FWBA 3C5VA 2XUDA 2RI6A 2XQKA 3C45A 4DNQA 3WQHA 4X97A 1UKBA 4WFJA 1MN6A 3AIKA 5DJ5A 1T4MA 3WYNA 4EHBA 5AHXA 3PI6A 3VDXA 1THTA 3R0VA 6YASA 3WL7A 2C0QA 4PQEA 2GBIA 4HAIA 1LBTA 1UK9A 1ZI9A 2WKWA 4BVJA 2GBFA 3FBWA 4WCVA 4J3JA 3D3NA 3C70A 2CB9A 1P0QA 3O95A 4HRXA 5K3BA 2XMCA 4AQDA 1T2NA 2PSJA 1EDEA 1R3DA 5AKXA 4OYLA 1CFJA 1UXOA 1EI9A 1ZI6A 3AZQA 1AQLA 2WJ6A 4MYDA 3VISA 5FOQA 1MT3A 1ZJ5A 2VT6A 3BDVA 3P2MA 4RE5A 3HSSA 1OCEA 1BCSA 2GBGA 2PU5A 4A23A 1BCRA 2QVBA 4J0IA 2JF0A 1MAAA 1VA5A 1EK2A 1BN6A 3PFCA 3FCYA 3ANTA 1K63A 1IZ7A 4WDRA 5D3KA 2G63A 2VTVA 3DYIA 5AI6A 3JWEA 5HCUA 5AM1A 3WK5A 5KWIA 1L7QA 5CW2A 4BC1A 3H19A 1BN7A 2DSNA 5ALUA 5JAPA 2B4KA 3OTQA 3H2HA 4B7ZA 1HDEA 5BV7A 1R9NA 4JH0A 4FFWA 1JJFA 4B9AA 4X3CA 4EY8A 4TVKA 1YASA 4ITVA 3U1TA 1ODTC 5EIEA 1WM1A 2C58A 3STUA 2VJAA 4Y2JA 3I2IA 2H9YA 3WA7A 1XQXA 5CT5A 3SX4A 5CT8A 4G9EA 2ZVDA 3FLBA 2WTMA 3M3DA 1IUOA 1UK7A 2HU7A 4H7IA 3L1JA 1GPLA 2HU8A 4KJXA 4FLFA 3CN9A 3UUEA 4BP9A 4W1PA 5YASA 3U0VA 2XLBA 1A88A 1W52X 1TCBA 4KYVA 2JGKA 3EQ9A 5LIPA 5ALXA 3FNBA 3QYJA 2ZYRA 4QDZA 1SCKA 4KRXA 3O9MA 3I28A 1CPYA 4B80A 2WJ4A 4EUSA 3BL8A 1CR6A 2O2GA 2XUIA 4AX4A 1Y7IA 1Y7HA 3HRHA 3FWHA 3K2IA 2C4HA 2QTBA 3WK7A 2Z3ZA 3G9TA 2Y6VA 2RGUA 2HA2A 4H7DA 1IMJA 3AZPA 1CLEA 1M33A 3KOOA 2WUDA 1UZAA 4JYMA 1E5TA 2WFZA 3S2ZA 3YASA 4Q1VA 3FLAA 1BU8A 1YB6A 2Z8XA 1ZD4A 1QIEA 2D5LA 2JEYA 1ZGBA 4H0CA 2ZSIA 4DLNA 3STXA 3FAKA 1WOMA 4LIPD 1ACLA 4EA6A 4X91A 1UFOA 2RONA 3R40A 2DR0A 5AM0A 1CUFA 1CIJA 1H2ZA 4NZZA 4ROTA 4BCDA 4J0CA 3MVEA 1SFRA 3TRDA 1DQYA 1DU4A 1ZIXA 2WU4A 4QA9A 3BIXA 2OG1A 4IHAA 3WK9A 3D5EA 3EQ7A 4Z49A 4FNMA 4OB7A 4RPCA 4B83A 2QUAA 1VXOA 3W04A 4EY4A 3TGLA 2ACEA 2X5XA 4E15A 1JU4A 1CRLA 1JKMA 3H2JA 2RHWA 1ORVA 2XMDA 2HIHA 4OUKX 5T4FA 1N5MA 1TQHA 2QJRA 2ZYHA 2XDWA 2YH2A 4J03A 1OILA 5HZGA 2PKYX 2EDCA 4C4XA 4IO0A 2VJBA 4LXGA 4YX9A 4TPKA 4W1SA 1IVYA 4DGQA 4I4CA 3HC7A 5ALKA 4UHDA 2BGRA 4PSUA 4Y2PA 4FOLA 2YASA 3E4DA 1KEZA 1U2EA 4ZWNA 2VSQA 4HTAA 4Y2QA 3WYDA 1XZDA 3KD2A 3G02A 4CIAA 5EI5A 5JASA 5ALVA 3DCNA 2BGNA 1USWA 2PSEA 4IH9A 1MU0A 3NGMA 1MAHA 2AJCA 5IVDA 1QLWA 5A7GA 5I9IA 2XUJA 4OU5A 1EVEA 4B81A 1DT3A 4CCWA 4X92A 1FSSA 1RP1A 1ZD5A 5JATA 1CUIA 1R4ZA 3B5EA 4OPMA 4P9NA 4GBGA 1BRTA 4LXIA 3PFBA 1VOTA 4LYEA 3WIBA 2QR5A 3I2JA 4EB0A 3AILA 4UHEA 1QE3A 3NWOA 2XT0A 2WUFA 2BJHA 3ESCA 2ZJFA 5HF6A 4YK7A 2V9ZA 3M83A 4F0JA 1UK8A 1QIMA 4B9EA 1ISPA 5JADA 5AKEA 3AUKA 5AOBA 4K2AA 2QXTA 2OAGA 5AK3A 5LYYA 1LPAB 1UT6A 5AJHA 4JUIA 5K3AA 2QMQA 3G9XA 1CV2A 3IULA 4GW3A 3IUJA 1VJ5A 4BVLA 2E3JA 4AMYA 4HVTA 3IVMA 2V96A 3W05A 4BAZA 2LIPA 1TKRA 4PW0A 4U2GA 4J0GA 4MWSA 2WG1A 5AKJA 4FFVA 3IBTA 3ZLTA 2WJ3A 3IUMA 2VT7A 1QOZA 4MEBA 2Y2VA 3HEAA 4AO8A 3DYVA 4X7BA 4BE4A 4RGYA 3FVRA 1LPBB 5ALIA 1CVLA 3BIWA 4BTVA 5LZ5A 4GEGA 4A5SA 1JI3A 3LIIA 4UBKA 4AO6A 4X90A 3W9UA 1CUUA 3LIPA 4PSCA 4KAAA 1SCQA 4Y2TA 3H1AA 5A62A 3CXUA 1YCDA 4G5XA 4Y2UA 1E89A 3A70A 5F4ZA 5HQ3A 1BROA 5CH5A 4WDQA 3O4HA 1O6GA 1QO9A 2PVSA 4YASA 5KWJA 3FYUA 1JFRA 4G4IA 5HF5A 2HDWA 5AH0A 1EHYA 1RWQA 4UFOA 1LPOA 2WIKA 3D59A 3LLCA 4U2DA 4UFNA 4GWLA 2C7BA 3H1BA 5CH3A 4ZRDA 3DL4A 3WWEA 2XQJA 2WQZA 1Q0ZA 1QIHA 2G5TA 1UKCA 2GYUA 5CXXA 3EBLA 2QXUA 3I6YA 3I2FA 5K3FA 5DYWA 1L7AA 1EVQA 2VJDA 1QFSA 4W9RA 4Y7DA 1XZFA 3KWJA 3LCRA 1JU3A 3G7NA 5DTJA 3G9UA 5ALQA 4C4ZA 3IB3A 4BC0A 3KWFA 3STVA 1XRRA 5JD5A 5HK8A 1Q84A 5BWCA 1QTIA 1F8UA 1FFAA 2HRQA 2ROQA 3G0IA 4F60A 4L72A 3VXKA 2OGSA 3FSGD 4FHZA 4QEKA 1GQRA 3WA6A 1U8EA 1E8NA 4UHFA 4P92A 1LNSA 5JZSA 3VJLA 4BYMA 1CUXA 2XUGA 1DWQA 3JYHA 3DOHA 4RNCA 5ALDA 4KAFA 4B84A 1TCCA 2OXEA 2ZYSA 4UPDA 2ORYA 5CT4A 4KEAA 5ALNA 2DQZA 3DL7A 1QIIA 2GYWA 3DNMA 2AJ8A 2WIFA 3WKDA 4OCZA 1UKAA 3FOBA 2IX9A 3WWPA 2QS9A 3PDCA 2ZJ7A 2BCEA 4GDMA 1XFDA 2AJLI 1EB8A 2WHRA 4FBLA 4DMFA 4PF1A 3OG9A 3RKSA 4BATA 2GBCA 5JAUA 5JANA 5AM3A 1MPXA 4BP8A 1MX1A 1QZ3A 5FUMA 3ESDA 3AFIA 1ZOIA 3C8HA 4Q3LA 1IUNA 2BKLA 4H7HA 4JEIA 2CBGA 3C6XA 2WHPA 3CCBA 5SYMA 5JAHA 2HA6A 3VJMA 2PU7A 3C6ZA 1ZICA 4D9JA 3G0BA 5LZ4A 4IQ4A 4OB8A 1QIJA 5AM5A 1QTRA 1ODSA 1OXMA 1XZGA 3H2GA 4UBJA 4NMWA 5AKZA 5EHQA 1G66A 3DEAA 4YPVA 1HBJA 1AC5A 2WFMA 4N8DA 4B85A 2RHTA 3V1KA 1R1DA 1FFBA 5DNVA 3S8YA 1LPPA 2Z8ZA 4S0XA 4CIBA 2RIPA 3FCXA 4M0FA 5JYCA 2Y2UA 2XUPA 2BUAA 3QPAA 3T4UA 4CG2A 1GZ7A 4LYDA 1CUAA 2P8SA 3PF8A 4ZXFA 1MO2A 4QNNA 1GPNA 3WJ2A 3MUOA 3I1YA 3DS8A 1ZD3A 3PICA 3O0DA 2CEKA 3R3WA 3V48A 2QKYA 4Q05A 3AINA 4OSEA 1XRPA 4JYPA 3O4GA 2DCMA 4Y2SA 1P0PA 1H22A 3IUQA 1YSCA 2CUTA 2HA5A 2XB6A 4QDTA 1XKLA 3VVLA 5HFNA 4XX1A 1QGED 4DMKA 3I1IA 4GLBA 1AKNA 1WB5A 2NW6A 3G8YA 3R3XA 5D6OA 2DHDA 3I6ZA 5A2GA 2WIJA 3ILSA 4LHEA 3R3ZA 4MYSA 2W22A 4HXGA 4QDUA 5HKBA 3DKRA 4QLOA 4X6YA 3KXPA 3WMRA 1WB6A 2I78A 2O2HA 4HZGA 4UHCA 2HA7A 1JT2A 1R9MA 3GUUA 4K5QA 3WWCA 4CG1A 2VAXA 1HQDA 2XQFA 1EDBA 2I3ZA 2ZYIA 1SCIA 4J7AA 4J0HA 5HF8A 5AICA 1XRQA 1XQWA 5IKXA 2XQGA 2JIDA 4L9AA 3D4LA 4CCYA 3GA7A 1IUPA 4BRSA 1CUSA 3C6YA 1HLGA 1ZGCA 3GELA 3KSRA 1VKHA 4XIIA 3WLAA 4AZ3A 5E2IA 4OD0A 4WFKA 3T52A 1PJAA 3TJMA 1W6RA 3I2GA 3RLIA 2XI4A 1E8MA 2K2QB 5IVHA 5A7HA 3ESAA 4QWMA 3HZOA 1C7JA 2VEOA 1XRMA 4P93A 3B12A 5ALMA 3ZI7A 1CUEA 3C6BA 4L0CA 2EDAA 1WCYA 1LZLA 2WFLA 4KE7A 3WZMA 4UBMA 5LZ2A 3SC2A 3I6MA 1XZMA 4G8BA 4CG3A 2ECFA 1VZ3A 1B41A 1K4YA 4HXEB 3G0GA 3BDIA 2OCIA 3ICWA 4KAJA 4Q34A 1VE6A 5ALTA 5LZ9A 1LPMA 2VA9A 3WWOA 4A16A 4B0PA 4DNOA 4C87A 3SK0A 1J06A 3D7RA 5CT6A 5HFAA 4UFPA 5EGNA 2C0PA 2JGEA 3QMVA 3FLEA 3FYUC 3HI4A 3DLTA 2GZSA 1L7RA 1JMKC 3STWA 1FFDA 5HQ3B 1J1IA 1CUWA 1DX4A 4Q3OA 4GI1A 5FDFA 4GXNA 3MUNA 1R88A 3FYUB 4OB6A 3EQ8A 3H18A 4C88A 1XROA 5AOAA 4U2CA 5DLPA 5AK4A 3VVMA 2O7VA 3BWXA 1SOMA 5AK6A 1PV1A 5K3DA 3A6ZA 3ZWQA 4AB1A 3FSGA 5FPPA 5DYYA 4BDSA 3QH4A 1MTZA 4U2BA 5A71A 1FJ2A 2WTNA 3IDAA 5AKKA 1X70A 2AJDA 2J4FA 1AUOA 5K3FB 4DSAA 3GBSA 5ALYA 2PUJA 4U2FA 1EA5A 1EX9A 3WJ1A 5AIBA 3FVTA 1EINA 4N8SA 4PO3X 2UZ0A 1E8DA 1BS9A 4UBIA 3PF9A 4DMHA 3DKKA 2H7XA 1TRHA 2ZSHA 4UHBA 1EH5A 4NS4A 3G0CA 1YAJA 4BAGA 3DDUA 3JW8A 5C8VA 1CUJA 4Y2VA 1YR2A 2OQVA 5ALEA 4WY8A 4J0DA 1MJ5A 2PSDA 1H2WA 1BEEA 1UK6A 2ACKA 2HADA 3D2BA 4AN0A 2V97A 2I3DA 3WKBA 1BE0A 1EB9A 2WU3A 3R3UA 3WL8A 1WPRA 3RM3A 3R41A 5AKHA 4M0MA 5T4HA 1W76A 3D0KA 5JD6A 5AP9A 4X95A 5CBKA 4NVRA 1HPLA 3QMMA 3L1IA 5EHXA 1A8SA 2QRUA 2VJCA 2PX6A 5I7UA 3R3VA 2Q0XA 2PUHA 2B61A 5ESRA 5ALOA 4X71A 1H23A 2FUKA 4G8DA 4DSZA 3BF7A 3E3AA 1CUZA 2OLEA 3ZV7A 2HM7A 2QOEA 1K8QA 5IVKA 3B3QA 3WK4A 4H7FA 5CXUA 5D3ZA 2ES4A 1K6EA 4UBOA 2PM8A 1GKKA 3R3YA 2WHPB 5E4YA 3WL6A 2YXPX 1XQYA 4ZV7A 2X8BA 3QZUA 2HFKA 5T4BA 3ZLUA 5LP1A 1Q0RA 2PSHA 1K5PA 2CMFA 1YS1X 1PFQA 1J07A 3DQZA 1DINA 4PV7A 1BEZA 5KBYA 4AMZA 2HRRA 1XKTA 1LBSA 4F5ZA 1SC9A 2B9VA 4HRYA 1Z68A 3PUIA 3F97A 3ESBA 3HABA 5DYTA 5A6VA 1A8UA 5SYNA 2XMQA 4MXDA 5FP0A 4G4GA 4BDTA 3H2IA 2ONCA 3OOSA 4LKOA 5EIHA 1MNAA 1YAHA 3NOXA 3QBJA 1E3QA 3OC0A 5ALSA 5ALPA 2R11A 5HK9A 3OM8A 3W06A 1CQWA 1G4HA 3NUZA 4G1FA 4E46A 3ZPXA 1QJ4A 3MGAA 2DHEA 2JGLA 3UUFA 4N8EA 1DT5A 1QIFA 4FKBA 5ALRA 5ALZA 2PPLA 1R50A 3QPCA 3FYTA 1EDDA 4W63A 3WKCA 4B82A 3WL5A 2EEPA 5AI5A 4ZGBA 2WSLA 2O7RA 3STYA 1X2BA 4FLMA 4H7EA 3CCCA 4FBMA 1CUCA 1CUVA 3IA2A 3ZLVA 2WHQA 4FLEA 4L3WA 2H7YA 1EK1A 3K6KA 5HKAA 1IZ8A 1D07A 2WILA 1RYYA 3K9BA 1QONA 1S8OA 5FXMA 2CZQA 2VQ6A 5A7FA 3RARA 3C43A 1W1IA 2QZPA 3ANSA 4J0JA 4CCYB 4KE9A 5AKLA 2XUAA 1AMNA 1TIBA 5JZ9A 5ALLA 1ORWA 4K6KA 5AOCA 4X93A 4AO7A 3QITA 2JGMA 5I8PA 2FJPA 4BE9A 1H2YA 3BE8A 5ALFA 5AIAA 1CUBA 2V98A 1LGYA 2XMZA 3H2KA 4ZV9A 5AI4A 1DX6A 4XVCA 1YA8A 4BTLA 1MX9A 1NU8A 1HKHA 1NX9A 4C6HA 2WFLB 4BZWA 3E1GA 5E4TA 3ED1A 1C7IA 4ZREA 2XUKA 3G9ZA 4UHHA 3QVMA 3LP5A 5EIAA 1I6WA 4K6HA 5JIBA 2BAGA 1XZBA 2HHAA 3IIIA 3Q8WA 5LKRA 4Q3KA 1MNQA 2XQIA 4MJ3A 2XMBA 5H3HA 1ETHA 2XLCA 4Y2YA 1XRNA 1UOOA 2QUBA 3DJYA 5JZBA 2WG0A 3O4JA 5LZ8A 2GZRA 1F0NA 1YB7A 3F96A 1TAHA 2XE4A 3QPDA 1ZD2P 4AN1A 2OPHA 4B0OA 1DWPA 5AK5A 1B6GA 4C89A 3GFFA 5AI9A 2PSFA 1ODCA 1ZI8A 1JMYA 5LLSA 2OAEA 5CRIA 1XZHA 3H0CA 2VATA 2WIDA 4FNGA 3W9BA 2OCKA 4EY6A 5LKAA 4X85A 3RK4A 1WPXA 4Y2RA 4LXHA 1FFCA 1VE7A 1W4LA 1VA4A 3V1LA 3A2MA 5K5EA 2B20A 2WUGA 1AGYA 1XZEA 3O4IA 2AJBA 1F6WA 4QDXA 4JNCA 5FKJA 2IITA 3PE6A 4KR0A 4OYYA 4QE3A 4WFIA 3AJAA 3D2AA 4BCCA 2JBWA 1H2XA 3A2NA 3AIMA 1CUDA 4IH1A 3IURA 4UUQA 1GT6A 5IH7A 2AXEA 4GHWA 2J4CA 3WZLA 1ZIYA 3N0TA 3H17A 1J2EA 4Y2XA 3VKFA 3X3HA 5C81A 1XZLA 5HF9A 5DTIA 2HU5A 1N8SA 3GZJA 4RE6A 1JJBA 5EHNA 3G0DA 2PL5A 5EHZA 4H7KA 1THGA 3HACA 1CQZA 4QDOA 5FPQA 2XMRA 4DNFA 5IVIA 1AURA 2Z5GA 4CFSA 5J3JA 4E14A 1FFEA 3BJMA 1HL7A 1KU0A 3WIOA 4FTWA 2QM0A 1VLQA 2HA3A 3WKAA 4Q82A 1YA4A 5FRDA 3AZOA 4CI9A 2FJ0A 3C8DA 4XJVA 3HJUA 5DWDA 1UOPA 1LZKA 2H7CA
chains in the Genus database with same CATH superfamily
2G5PA 1ZMOA 4PTYA 3IO5A 4KDFA 3LYUA 5K0CA 1U02A 2JCGA 3A7EA 3O83A 4KUHA 4Z4EA 5HJ5A 2Y9MB 3LFUA 1PBTA 4W1RA 3U40A 4IJWA 2WWIA 7YASA 1DKOA 4OHBA 5FL7D 3RVKA 2W2TA 2D5CA 3MMSA 3L6RA 4WLEA 3RYFA 2GXAA 2FX5A 4B6PA 1F0PA 4BASA 1ADBA 2R96A 3NOQA 1GPKA 2VF2A 4W8GA 5FTNA 5BSTA 1F7VA 4RVHA 1IDN1 5JWHA 3BJRA 1VPWA 3K5PA 1PJRA 1KARA 3OFKA 4N5IX 4YTEA 4I9HA 1TPYA 2FG5A 2J5KA 4NU0A 2QMUA 2G5GX 4HOYA 1FTQA 4RO0A 3L41A 4UATA 1Y5NA 3MC1A 2I8LA 4HP8A 2GZAA 4UDXX 1TMOA 1CP2A 3AG5A 1XLVA 2DPMA 3DD5A 4ZT4A 4YDQA 3GT3A 1P2TA 4BX8A 5E3HA 2XVZA 5JY1A 1SULA 3RUEA 7REQA 1AKQA 1XZCA 4HB4A 4W8OA 2RJ3A 3ZHUA 1XTTA 1V5FA 1TD9A 2VUSA 2ZDQA 4RA6B 2J45A 2H4HA 2W2MA 4OHPA 4V0QA 3X1WA 4UZSA 3ZXIA 1N2EA 1EFPA 1C9MA 1SCBA 4N9WA 2WMNB 1I6MA 1MDFA 4KACA 4OGKA 2PKCA 5B2ZA 2YFKA 3P9PA 1EHCA 3MWYW 5KJEA 4Q9LA 4ZXPA 2J3DA 2P2CA 2JFVA 3QELA 1D1SA 1GQ2A 1KI9A 4PXAA 4ZCTA 3O75A 2X76A 2BFBA 1YMQA 4GOJA 3P7MA 2I7CA 3PUHA 1E18A 1YR3A 1OI7A 3OLYA 2PXHA 1RPTA 3PR3A 4QVGA 5DNAA 4D9MA 4IO1A 4DXDA 5C9ZA 1QO7A 5IBRA 1GVHA 4C3VA 4TGLA 3M82A 2ETXA 2I03A 3QA9A 2IP1A 3W4JA 5JPCA 3HM9A 1ZIOA 3FDZA 1Q83A 3K2QA 1BA3A 1SZDA 2P6MA 3MIZA 1JSLA 2IA5A 3LE8A 1KU6A 4N3NA 1Q77A 1D0VA 4KXMA 1HYHA 3PKIA 2ZBPA 1B3BA 1X7YB 5F52A 5JS1A 3DEKA 4GKVA 1CE8B 1ZXBA 221PA 4I8IA 4ZJZA 1XZKA 2ATVA 3QEOA 4H16A 1U1EA 1I01A 3D5TA 4K9KA 4B3IA 3LCCA 4HSGA 1U65A 2Y1CA 2BTQA 4RXMA 3KWMA 5F78A 4O4IA 4KRGA 4Y18A 2PQ0A 4UXHA 1Z26A 4D96A 4CDNA 4F3RA 3CFYA 3WWYA 4HV4A 4NBNA 4ZMBA 3KEOA 4BMVA 3EDOA 2D54A 1HG1A 1UODA 2OAQ1 3WLKX 4DM7A 4JLWA 2HMUA 3OWXA 5LQDA 1S9HA 2R4QA 5GOTA 3DOEA 1NRIA 4FR5A 1NIJA 4LNHA 4R0VA 3EIWA 4AG5A 4AXBA 4O4LF 4DCMA 2BFNA 1YXMA 5MHTA 2OLKA 3W1WA 3DE3X 4XXHA 1WUTA 4WNAB 1VDZA 3FIUA 4DMMA 1TM4E 5ECYA 3S28A 2BELA 3EEOA 4JXXA 1U1IA 1IY9A 1YZHA 3KPVA 3ZE8A 2IYOA 4Z4QA 1T1GA 1MRZA 1U3DA 2JFFA 1OX4A 3D6AA 4XWGA 4JJ7A 3QFHA 3T7IA 4IJUA 1RHUA 3UN1A 1CUHA 4YIHA 3I8SA 1YZUA 3HLKA 3LWDA 1X8KA 4P5PA 1OB2A 5JLJA 3DBLA 1KZYC 2PMWB 2I4MA 1YOBA 5AVOA 1KOLA 1TEZA 1T6XA 1E6CA 2O2CA 4M2LA 3ZBTA 1QOPB 5E1OA 3Q9NA 4ML3A 1E3JA 3IODA 3MMXA 3Q72A 3HUEA 3NAQA 1VKRA 3GFBA 3PJRA 1PFUA 2IEGA 2DQ4A 1L3IA 5LOVA 1QQ6A 1CW2B 4RX1A 1U4NA 4MJ7A 1KJ9A 3CEAA 1I4OA 1MBZA 3CT6A 3JY6A 2X1VA 3QBEA 3JARB 4FU0A 4IIJA 3RAJA 2I4IA 3VR3D 4YT4A 2DFPA 3AVWA 3P9KA 5F76A 2UZAA 5JALA 5COAA 1NBAA 3ZCTA 4D56A 1XMJA 1CT9A 2X4DA 3FPEA 3KPUA 1DDOA 1XZIA 2ZJYA 1HI9A 3GRFA 2OGUA 4UUOA 1NR7A 4OU4A 3UAWA 3W2IA 2ZB4A 4ZYZA 3MYRA 1OBCA 1LEHA 1O58A 2FPOA 2NUPB 4F6RA 2YX1A 1ZK3A 2HC9A 4FYKA 3UUGA 1LPNA 2C4WA 4QM7A 3N74A 4MQFB 5HZKA 3THOA 5MN4A 2W11A 4KWHA 4B6OA 3BH7A 1ORIA 1XRJA 1D6MA 4A0SA 4XR9A 1FIUA 3FSEA 2C8KA 2XOXA 3A04A 4O4LA 5C53B 3P9YA 3CRW1 4XGNA 5AKYA 3OEYA 2VYFA 2YZGA 1LWNA 3VSEA 3F71A 1YWGO 4KSYA 1WETA 4C3ZA 5FLKA 1BIFA 1YT5A 4OHMA 2JJ8A 4N49A 4GH5A 4C0WA 5LD2B 1P4SA 4GLLA 2ZT5A 4N12A 2X6QA 4PCAA 5CBPA 2Y1KA 4ETWA 4RTQA 1U3VA 2ZCJA 3IOMA 4JLOA 4D4JA 4E33A 1X80B 1HFKA 3ZXSA 4H31A 2OFOA 3ETHA 3SJCA 4FW9A 1T2CA 2H2IA 2ZEJA 1ZW1A 1NQWA 4DV5B 1V8PA 3OU2A 1PP4A 5REQA 3LX8A 3D8RA 2VHZA 4I5GA 3UWKA 4EB6B 4DDWA 1ZJ4A 2O06A 4XDZA 2O59A 2KSQA 2VCHA 3T1OA 2HLNA 1WHSA 3LC0A 1M34A 1S3FA 1Z6XA 2P2LA 4EY5A 4ZEMA 5ALGA 2VHTA 3JZDA 3WHIA 5IT0A 2PHZA 3PC6A 2P6NA 3I2KA 5DP2A 4FMCB 2GOYA 5BQ3A 2WG2A 3EXHA 4MKGA 4BLVA 1GQSA 2PIDA 2Q5HA 1XP8A 1JFLA 3IE1A 4X6UA 1WP4A 2MMGA 2VHXA 3K0EA 1N6HA 1Z5PA 3E05A 5FO0A 1N5RA 4MYHA 5TQ2A 4JCCA 4WXRA 1AQJA 2QT0A 4OLHA 3MELA 2HXYA 5CURA 2PXCA 2CXNA 1JJIA 1UMDB 4G5SA 5K4AA 1COWA 1IM2A 1DFHA 1MJHA 1V1MB 1E2EA 3LDUA 3LVRE 4HDMA 4JBGA 3LFHA 4LN1A 4JLDA 4LK2A 4QSMA 1U5BB 3VHLB 4N6OA 1V11B 1OGIA 2BKXA 2B6NA 2I4TA 3ZWAA 1PR0A 1DWOA 2OMEA 1Y8QA 3ELYA 4CMEA 2QY9A 1U4SA 1GPDG 1NVXQ 2JJ2D 2TMGA 3DDHA 3KKQA 3NHRA 3KR9A 4AXXA 5A4IS 3CVXA 4MR9B 4OQDA 2XT9A 1IFXA 2B8WA 2QPOA 2VJNA 4RMGA 4DG8A 2WPDD 2VDKB 2O8DB 1TD1A 2ZUWA 4UBLA 4XYGA 4E7PA 3BHMA 4RULA 1M2JA 2Q4DA 4QEDA 3QMWA 2C5GA 5E8JA 5ICFA 3L9XA 3OZ7A 4JI5B 1BG6A 2OKCA 4FILA 4BE7B 2P30A 1CY0A 1LLDA 4Z4IA 4ZYXA 2ZUSA 4CLOA 3SXPA 1T9CA 3KTDA 1DTWA 1NUTA 3I1FA 3GH1A 4DTCA 1JIVA 2WU8A 4WOJA 5HCIA 5JT1A 2A0YA 4XLZA 3QVKA 1A3CA 1PNRA 5BT8A 4YFYA 4YN3A 2BKAA 2NO1A 2X40A 1A9SA 5FA5A 2GN0A 2YTZA 4YO7A 3TZLA 2XUHA 1QC5A 1CUYA 2P8JA 2YICA 1C3JA 4CPDA 1F06A 1LBIA 3JATB 1M2OB 4BVGA 4OQFA 2OB1A 2Q21A 2AR7A 3W2EA 5D86A 3N2ZB 2FEPA 4IBOA 1UQTA 1EVYA 2WRZA 2AOWA 4NCXA 1PR2A 5FI0B 4EVSA 1KEKA 1W1WA 3ZY2A 5G1OA 3IOYA 1XZQA 3SSOA 2A1IA 1SEPA 2BVNA 2D2EA 4IOKA 4C05A 3FOZA 5TGDA 1H4SA 2AB0A 1ZQ1A 1QGAA 1QIGA 3UJCA 3PEWA 5E6RB 3FOEC 3PUYA 2IW1A 2PWBA 2BHLA 4JT8A 1E1MA 2X3YA 3PP8A 2I6XA 3PFKA 1UP7A 1QB8A 3R20A 3WNCA 1RLJA 3WVNA 2HFJA 2CCJA 2F55A 1TTQB 3B2EA 2QLFA 1UBUS 4X1KA 1FUUA 5JDIC 1JQKA 1S9DA 5H4GA 3KOMA 2VP3A 4KKXB 5FFFA 2F1KA 5CLIA 4FYPA 3P2IA 4MA5A 1M8KA 2I8AA 4BN5A 4OHRA 5DYGA 3WK8A 4BRZA 5IK2D 5K3EA 2DVMA 2J87A 4R5MA 5BOVA 1OJ7A 3JQRA 1ODKA 4KU4A 1ESZA 4K6MA 4D9KA 1AM4D 4HB0A 4QZVA 1AF4A 4BAUA 4YV2A 2JEZA 1XN4A 4AIIA 1DJQA 1Z4PX 2D2IA 2VDMB 3PQ2A 1G42A 2OE2A 3CX8A 3O9VA 2G28A 3Q3GE 4M99A 5EHGA 5EL0A 6NULA 2FG6C 3ASVA 4JP1A 5FI5A 2O0LA 1K86A 4I2NA 2GEDA 4S2EA 5AKGA 4BB0A 1UJBA 4MVJD 2XQVA 4ZVUA 2FEWB 4I3FA 2CKMA 5DCUA 1E64A 3OJFA 1TM5E 4D82A 5IF9A 2M98A 1OWPA 1QFXA 1WTCA 1DAKA 1ODJA 3CUWA 3GROA 1KDYA 4GM1A 4R41A 2F4NA 1U8ZA 3PQ6A 4QO7A 3IUNA 4RABA 4OYHA 1VXRA 1XMXA 1J0XO 2O8DA 2CK3A 1HE8B 1ZQ9A 4WQMA 5KX5B 5C1OA 6Q21A 3TMKA 3F3MA 5L51A 2P40A 1LPSA 3BXPA 4I4LA 4FMCF 4WY5A 5GOZA 4LZJA 3Q9UA 1P1CA 4MAAA 4RV4A 4X6XA 3ROKA 4BBPA 4S1WA 2O8BB 2AVNA 1SKUA 3AIOA 2XE6A 1EYZA 3MK31 2FZLA 1EA7A 1QGYA 4US0R 2VQDA 1E5DA 1GZUA 3BE6A 3GWGA 4QRHA 4RDHA 1G1MA 1M1ZA 2F17A 4PQGA 2GBLC 3NHLA 4CM9D 1N77A 1FXWF 3FOFC 3DDWA 1U99A 1SHJA 2GSDA 1E2GA 1H4TA 1D3AA 2DJ5A 1TIKA 4V1CB 3IL2A 2QEQA 2DBQA 2ERXA 3CKMA 3F49S 2XYGA 1Y5LA 4L4RA 3W2TA 3R7LA 3TD2A 3AHFA 2HF8A 4KN9S 5I7VA 2A3RA 3KXLA 4ND8A 4YUVA 2WZDA 1YZLA 3C7DB 4OHFA 1SCDA 2GF9A 4MQUA 5HSGA 1PGNA 1QUFA 2YNMC 3EDMA 3ISTA 4UNQA 2PS0A 3DZFA 4CHGA 1HT2E 2NV2B 1RABA 2RI6A 2XQKA 3IQEA 4DNQA 1ZNZA 3JD0A 4H2DA 1WZEA 3C5EA 3UK6A 3WQHA 2CC2A 2NZJA 3TYXA 4MH0R 4MZXA 1JHQA 2HO5A 1E3MA 4ZV4A 2DMRA 3T3GA 1RC8A 3ZX4A 5HZMA 1CQIB 5J2TB 3WGKA 3Q6NA 1AK2A 2FQXA 3B7PA 2QD3A 4JSTA 3OP4A 2R68A 5C7OO 4A0FA 2WJHA 3LXUX 4FFDA 2WHEA 3I58A 5FOTA 2WP0A 3OF3A 5KQPA 4ZO4A 3AONB 2QROA 4EB3A 5A0TA 3VDXA 1NYTA 3NU1A 1THTA 3VR4H 4CLRA 3BIJA 1VRCA 1UANA 4K28A 1KGDA 1KI6B 1OWOA 3CISA 3AY6A 2YWCA 1LF0A 3OCJA 3V2IA 2FQYA 4C1NA 3KR2A 1UBKS 4Q00A 4YJ3F 5FV7A 3ER9A 1H1DA 3UAYA 1L4HA 1O54A 1QKKA 1B2RA 1N6LA 2PGIA 3J80A 1KJQA 2I1VB 3ELBA 4J3FA 1O8CA 2W48A 1O6CA 4RPJA 4E70A 4EHLA 5B6PA 2ANCA 1W0CA 2GBFA 2HIMA 2C2ZA 5ES3A 4P4UA 4ZEVA 4J3JA 1TFUA 4O63O 1L7DA 1ECPA 4J3NA 1B0PA 4INAA 4B4WA 5JI3E 1GO2A 5CHEA 2WAMA 1GFSA 3EK2A 4KWEA 1QHYA 1NMZA 1T2NA 2N47A 1KTVA 1EVJA 2C00A 3MWDB 4I5EA 3C6MA 2ARKA 4QOIA 3AB3A 4RENA 2F1JA 4L2IA 4ZEOA 3AM3A 3TCKA 1J2JA 2AK2A 2QZZA 4QU5A 2HCFA 2PSJA 3ZTWA 5B55A 3OX3A 1KYXA 1XK7A 3QPUA 3X2SA 5J3JA 1XYVA 1CFJA 3GJ6A 1R74A 3VU0A 4M9ZA 4L78A 1WBJB 4XSVA 1EI9A 3DZ8A 4MUHA 4Y6SA 5CDGA 4V0ME 4MWDA 3CZRA 3Q9SA 2JD2A 1KEEA 1CF2O 4OJNA 4R2JA 4C4SA 1W47A 2X8LA 5TJHA 1JR4A 3UK0A 5KNLA 3HWRA 3JVEA 4PPFA 4UW9A 1ZJ5A 4NE7A 5BP7A 3BDVA 1FFXB 3A1DA 3P2MA 3FZGA 1QMPA 4RE5A 5BR7A 3HWWA 3MSCA 4C5CA 3H87A 1BTOA 3H86A 3HSKA 4IV0A 3RTAA 5KX5F 3BTOA 1SBYA 1UEXC 2PCLA 3A9VA 4LOHA 1OCEA 1Z4LA 4M8IA 4QOEA 3T6KA 2DPGA 3WGZA 2CT8A 5E1MA 1U3FA 1NHGA 2GBGA 1GCUA 3GMDA 4J0IA 3QIVA 3FAZA 3NIBA 5JCOA 1B7GO 3CSUA 1T2EA 1MAAA 1MO5A 2GFQA 3BA6A 4U3JA 3VTAA 3K1ZA 3BBLA 4YJ3A 1EIWA 3JVUA 1ZGHA 3OKPA 1ST3A 3I04M 1X9GA 3D4NA 4KR7A 3AR8A 1LD3A 3CWCA 1XVAA 4GLOA 4D41A 3COWA 1JKJB 3KJHA 1EE1A 1UJNA 2NXWA 3IEVA 4WDRA 4MGHA 5KINB 1I94B 4XR4A 4LV5B 1NOJA 1MXFA 2VTVA 4G56A 3CY6A 1WLYA 4LW8A 3IAFA 3K71B 3IKVA 4RHEA 3VR0A 2NXJA 3SIWA 3WK5A 2HWWA 2QGFA 2Z83A 5EZ5A 4NPHA 3JPYA 2HQSA 5D51S 2ACVA 2Z9CA 2CHFA 1L7XA 1VPTA 1OXSC 2DSNA 2QRJA 2R7MA 2WJGA 3E9EA 3H19A 4RYLA 2B4KA 1QF9A 2OKGA 3DWIA 4F2DA 1H0SA 1UXKA 1G3MA 3LDHA 1CRZA 3BWEA 1FFYA 2CB0A 1LX6A 3N7UA 3O38A 1NZFA 1HDEA 4AMBA 4DWWA 2AXNA 1SIUA 4JH0A 5BV7A 4PYLA 2TMDA 4DQKA 4TYNA 3OJ0A 1K7SN 3NTLA 4X3CA 1RRPA 4HB2A 3QUCA 2UYOA 1GPMA 4JJGA 3GFSA 4GC9A 2GEBA 4YREA 2VDJA 3H1EA 1JSZA 1U1GA 1V3VA 3Q7EA 4KJZA 2YJGA 4UMDA 3W3AA 4Q9HA 4XUEA 2VYVD 3STUA 5J63A 3OY7A 2IUYA 4ZYTA 1X92A 3HE3A 1TEVA 4PBTA 5KC9A 5AW1A 4MWEA 4Y2JA 3I2IA 1LSOA 1NATA 2H9YA 4IJVA 5CT5A 2XX3A 3WA7A 1U0EA 1NN3A 1YQUA 3DE1X 5A3QA 3E9CA 1AN0A 3DTTA 4HH4A 4L95C 3FLBA 4PZPA 1PFWA 1Z2AA 2VRNA 3M3DA 3U44B 2H29A 4H7IA 2NU6A 1BAPA 3EOZA 3GRUA 4GZ5A 4IDDA 1ZY2A 4K88A 2OOKA 3L1JA 5KAPA 3WQSB 5JJ5A 1OH6A 4FFPA 2HU8A 4ANFA 1EPUA 4IOJA 4DG5A 2QZ9A 3PXBA 3IDFA 4KJXA 1QRTA 4B2IA 4PZCA 2MT9A 4CMGA 3IKJA 1PD0A 3CLVA 3GJZA 1ONPA 3AR5A 4RU1A 3U31A 4F1KA 3RHTA 5FPKA 2NU9A 1A88A 4PANA 4R98A 1ZKMA 1JAIA 5CVDA 1KHHA 2I7TA 2YJ3A 1YBMA 3C3XA 1H93A 4ODIA 2Q7OE 3CEJA 4C20A 1QK5A 3FNBA 1Z13A 3N8DA 2L19A 2X0KA 3JQGA 4BFZA 4E1VA 2WYUA 2ZYRA 3FETA 1IJKA 4J43A 4QDZA 3ZDFA 3L4JA 1Q15A 3CGGA 5FR2A 1PJ4A 2XNDD 1R0ZA 2HUPA 4KRXA 4MV5A 3TL6A 1DJMA 2NQ2C 1AUQA 4G0ZA 1N8KA 1CPYA 1VBNA 4NH0A 1ZISA 4B80A 5E6UA 3SNHA 3C3KA 2O2GA 2XUIA 3FVVA 4N6GA 2GCEA 2VAWA 3BXGA 1P7WA 1Y3FE 2JCBA 1NW4A 3QEJA 2FWPA 4H17A 5B3LA 2FWBA 2OCYC 2Y0PA 1USIA 4EG6A 4RELA 4GR9A 1CP3A 3N75A 4XIJA 3F6EX 3K2IA 4LRWA 3EFHA 5E9JA 4CL2A 4JY7A 4WLFA 5BNFA 3D02A 3CNOA 1E1RA 4MVCA 2F9MA 5AXDA 2OV2A 3L84A 2CXUA 5CXQA 5K99A 3HK2A 1PO7A 1MJNA 4HWOA 3LT0A 5BNTA 1YBVA 4ZOEA 1AY0A 3G9TA 1AO3A 5AVUA 1LUAA 2RGUA 3UBMA 4B6FA 1R4AA 2P2GA 2XTJA 2CE2X 1SXJD 3JQFC 4H7DA 2Y99A 4RVNA 4KFTA 3WGYA 4KQWA 3HA3A 1DOAA 1QNFA 3AZPA 4HDCA 2DERA 1MZVA 2WAOA 3FPLA 1AF7A 4MLCA 4AKSA 4C14A 1ZCJA 2QTNA 8ADHA 4JYMA 3VV3A 2XAAA 2WFZA 5EQFA 1IQUA 3G85A 3FZNA 3INNA 2RFLA 3RFCA 1WLSA 1GLGA 4JR1A 4D0NA 4EG7A 2QQ5A 4B4UA 1GKIA 2Z2JA 3GBVA 4PONA 4OQMA 4S05A 2LR0A 2QTAA 4EA7A 1PR4A 2GSWA 3QNWA 4X7MA 1FBNA 4ZT3A 1E4EA 2D5LA 2HSJA 4F5DA 1YACA 5H9WA 4GOMD 1ZGBA 5LUBA 4H0CA 2GEVA 3V7WA 2ZTVA 1ELOA 1A04A 3L05A 3QGMA 1Q0QA 2PRJA 1FQJA 4KLNA 4X5OA 4ZVKA 4IP0A 1Y9JA 4ZRMA 3SE7A 3KLBA 2PYZA 2J5XA 2VT2A 3STXA 4ASUA 1N34B 1RHRA 3FAKA 5LP6F 4CIXA 3CJRA 2OOSA 2RGBA 5FWYB 4CBVA 1ST2A 2VDWB 1YB2A 4URYR 4X91A 5GZ1A 4JP5A 4YAOA 3CH6A 1WZNA 3DNFA 3I8OA 3PS9A 1P60A 2XTMA 4UCQA 1Y98A 1LC3A 2IYEA 1F5NA 2LDBA 2FEOA 4OP1A 4XB2A 5DGDA 3RK0A 1X1BA 2VNIA 3PHIA 5A2QA 4EUFA 2FGJA 1VPVA 4IDNA 4KX5A 4M76B 2IX3A 2ABWA 3PRYA 1RYDA 1MAUA 3TKLA 5G2OA 3AR4A 2RC5A 1P2BA 2VAMA 2V65A 1ISRA 4CG0A 4KBFA 3I3SR 4GVXA 4C08A 2VCYA 1YZKA 3Q6MA 4HNHA 3OEED 1D2EA 2HHHB 4OHZA 3U7RA 1DQYA 1DU4A 1SRRA 4QTTB 1C8VB 1WSWA 4Q02A 4JI6B 4BVHA 4EG5A 2FEXA 4H60A 3IMKA 3ZNOA 2O5EA 2Y0EA 2YXEA 3GVXA 2X7JA 5JXIA 3BILA 4QA9A 3B8HA 2Q2WA 1N2CA 1QBGA 3BX1A 1NC3A 2AX3A 1RP7A 5I01A 2WJWA 1P5JA 4JC4A 3D3JA 1JEYB 2IK8A 3TGWA 1IEWA 1VXOA 3MMNA 4LPKA 3EEBA 2FV8A 1E3EA 3W04A 4NG5A 4EY4A 2C03A 2X5XA 4M0CA 1XMSA 3W90A 2A9KA 4Y2HA 3DEJA 3ZZUA 5KOHB 4RTRA 1O0CA 4O29A 5K05A 1JKMA 3UTDA 3DLBA 4X1IB 3KZKA 4IXDA 2XOKA 3PQ8A 2ONKA 5DEOA 2A1TR 2I6QA 3A6PC 2XMDA 2HIHA 3LRTA 4JBLA 2OHFA 1JG1A 1T3SA 4US1R 3UA3A 4C4AA 1RZVA 1K7EB 2SCUA 3I0NA 3GLUA 4OX9B 1TX4B 1ZH6A 2AC4A 2H1VA 4EFLA 1U3GA 4HWRA 6ABPA 2V6BA 4TLDA 4EF5A 1N5MA 4HF7A 3GY0A 3U7FB 3IAXA 1JECA 2IU6A 4R9VA 5LP6A 3RFFA 1CHDA 5FB3A 1J21A 1X77A 5IAEA 5A04A 3IJ5A 3QKSB 3U7JA 2FQWA 2H00A 2WU1A 3P26A 5D6NA 1RQNA 2DEUA 1N2JA 3A9CA 2VZ9A 2CNKA 3ETNA 4YX9A 1BDJA 2W00A 4O0LA 4AM8A 1HDZA 4BFLA 4FGSA 4RPLA 1H3EA 1X7WB 3GUHA 5DXJA 2UU9B 2RD2A 3ICQB 3LL4A 3MTEA 5LJIA 3NO4A 4XDGA 4ILEA 4UHDA 4PSUA 3MWEB 4LSWA 3NMUF 1N2ZA 3A37A 1MFPA 1RMTA 4IIFA 4X3PA 5CDFA 4B74A 3L7YA 3RHFA 1X1TA 2BGKA 1TO2E 3G2QA 3NOOA 3WYDA 1Y7PA 1ZIPA 3H16A 3IAS1 4HDRA 2HTFA 3KD2A 1BWSA 5CLLA 5H1YA 5CFMA 1XR3A 3GIDA 1U0RA 1I6LA 1Y1PA 4O8CA 1YCHA 4KN8A 4QNRA 2FETA 4MV1A 3S81A 4XJTA 2V7PA 4JJ4A 4CQLA 2VQEB 4ZCLA 4NYJQ 3A3OA 4OU5A 5C8DA 2V7VA 3ULKA 3ZWNA 2BFDA 2YBDA 2ZJOA 1PV2A 1NMQA 1ZL2A 4JWKA 4RXUA 5BN5B 2WC1A 3BHIA 4ZAWA 1R4ZA 5FHRA 3U4QB 3B5EA 3PD1A 1XNGA 3WQBA 4EUHA 4MVJH 3FYSA 4EHAA 2EFHB 2RAVA 2R8PA 1POXA 4PG4A 1Z2PX 1GUAA 5TEVA 3WC4A 3DEZA 4TV8B 4R9SA 1XP5A 3B3JA 1EE9A 2ZRBA 2C4VA 5CA0F 4KWTA 1ICIA 1KZ7B 1ZBDA 4OF4A 3JQ7B 4Y1RA 4EQZA 4YRNA 4D8UA 4UHEA 4R3UC 1IVNA 1H0KA 4OHOA 4DV3B 1Q57A 1QE3A 1GRQA 1NYLA 3IQDB 1KTIA 4JXZA 3ILYA 1NLYA 2VYND 8MHTA 3AR6A 2WUFA 3ADPA 1H85A 1EG2A 3A9SA 4RV9A 4UU1A 5JH7F 4ON9A 3Q3JB 5BOSA 5EIBD 3L01A 2J31A 4GU5A 3VC1A 2R2AA 1KAOA 2IHYA 3OQIA 4FOOA 1KMHA 4ZALA 3Q8XB 3VUEA 5D7NA 3ZCXA 4TT3A 5FIUA 1DQPA 2G6BA 2V9ZA 3B1KA 4QJBA 1HDGO 1Z0AA 4BQPA 3EDYA 2JA1A 3PYMA 2A88A 3CHYA 3AUKA 3SBXA 3K2EA 3VZSA 2IZ0A 5C52B 1NBHA 4K2AA 5EJFA 2QXTA 4PZ9A 3M5WA 5LYYA 3PGKA 4ND7A 2PO7A 2SKEA 3X1XA 2R1TA 4JUIA 5JHHB 2JFBA 5JW6A 1W5BA 5CXSA 5DMXA 5K3AA 3VHXB 1HEUA 1G9XA 3G9XA 2ORED 1X3SA 3KUCA 4GW3A 5FPHA 1NONA 4AX8A 1T0HB 4IMPA 5EKUA 4ARCA 1LSJA 3GD7A 4HVTA 2JBAB 3IVMA 3WLMA 4G26A 5K4HA 4YRCA 1G5QA 3ZY6A 3RBAA 4EYOA 5G0WA 4RGQA 3ENVA 1SCUB 3KWLA 1L7OA 4H0NA 2XTZA 3ZHBA 2W6JD 1CQJB 4EHJA 4RKFA 4FZJA 4U2GA 4DLVA 2DECA 4JENA 2EKLA 2LKCA 3KEFA 4MWSA 1L8XA 5AKJA 3CUVA 5CA0A 3VKVA 1MB2A 2G72A 2XTAA 1BKSB 3IBTA 3QG1A 2M1ZA 3QUSA 3ZLTA 5EJ8A 5FLXA 3CUEF 1T6ZA 4UASA 2BONA 2FWRA 4LUCA 4DWOA 2IYRA 4UXJA 1PT5A 2JIQA 4HN4B 1YR8A 3S6JA 1NJSA 3HEAA 5JH7A 5LM3A 1G2IA 3UFXB 1KQOA 5LCXA 3GRAA 1L5NA 4WV3A 1IJBA 4WE3A 1TQ2A 3TVDA 4BE4A 2HZ7A 1GPAA 4ED9A 1E96A 3LU1A 2BPOA 1KBZA 1TF7A 3BYZA 1WS6A 4KIJA 4A5SA 4DRYA 1JI3A 4AO6A 3IP7A 5JJCA 3VOAA 5I8WA 5K6AA 4X90A 4LXXA 2EJTA 1T6YA 2HRCA 3AF0A 1NMSA 1CRQA 5DI9A 1Y1LA 3LJKA 4TQUS 1E6WA 1MH1A 2H1FA 3ZV6A 4TLAA 2D7DA 4HAWA 2LXNA 2ZOSA 1BHO1 2VPQA 1CDEA 2DWQA 3LYHA 4HVAA 4E5UA 4Y2TA 4PSKA 5DTEA 3TOVA 4WWHA 1R0LA 2OV8A 2J3EA 2MSKA 3EXEA 2B25A 5HA5A 3IVCA 1YCDA 2V0NA 4QATA 4F4CA 2Z2XA 4D3FA 2Z8YA 1TTTA 1IN7A 2EQAA 4HTFA 3ISJA 3EOAI 4H27A 3A70A 3FTQA 4NESA 5TDHA 5HQ3A 1DGQA 5G0UA 3Q4GA 3S5JA 1J7KA 3H2SA 1ONBA 4RCYA 2ZBUA 3KAPA 3KJIA 2RK6A 6LDHA 2IPNA 1UMBA 3KD3A 2RAPA 3FYUA 1Q7RA 3OX2A 4G4IA 4JUBA 4TV8F 1P9LA 3PHHA 3HXMA 3W8DA 5KREA 1GAXA 2NZUG 2OK8A 2Q4EA 1W4CA 3FPFA 2I62A 1IJEA 1VG9B 2G08A 3EMVA 5DI3A 2JK0A 3R5SA 1LC0A 2DWOA 4ZCIA 1L4LA 1BCSB 4BECA 3LX6A 3W8NA 5E6SA 2QW1A 1C0EA 3QLVA 3GARA 2FF7A 2YXBA 1TQ4A 3F8WA 5B1YA 4GMFA 2WIKA 3D59A 1Z29A 3LLCA 4U2DA 5KSYA 2NMVA 1M67A 3UBTA 4B3RB 4ID9A 3G2PA 4GWLA 3IS3A 1T43A 4ZRDA 2P78A 1FYFA 3H11B 2VJMA 4E6EA 1SXQA 4R68A 4S1OA 4YRPA 5EJ4A 3CM0A 1EJBA 3AT1A 1X1CA 3L0IB 2PD3A 2WQZA 1MUUA 1OU4A 1OWLA 4G5GA 3V1YA 3C4VA 4AS3A 2PUWA 2OD2A 1JG6A 1KVTA 3ND7A 3IMGA 3FKSD 4LZWA 4EHDA 2G5TA 2R8OA 5L6MB 4UNSA 3FRJA 4WA8A 3CNQS 1QGOA 4IMRA 1JTEA 3AJ9A 1Y6JA 1IHPA 3EG9A 3I2FA 4G5OA 1WA5A 2ADOA 4HNGA 4DR6B 1GA1A 1JALA 1T25A 4PG6A 3AY3A 3BC1A 5FUBA 3C6KA 3D1VA 3DM5A 5KMGA 3B1WA 2IQ5A 3HO1A 4W5QA 2X5KO 4FS8A 1T36B 2NZ8A 2ZZKA 4B5LA 2ZKIA 3OQMA 3MYYA 1VHTA 1XZFA 2VNJA 5GQSA 5EFOA 1ATIA 3MPOA 1EM6A 2R8ZA 3KWJA 3UJHA 5IAAA 5TMDA 4OHYA 1MRSA 2E1RA 1NBME 1KBQA 2AZDA 2MWMA 3FWYA 1N57A 2XJ9A 3T1TA 2AFHA 2JRCA 3B5IA 2VQSA 5EXSA 2ET6A 4ADSG 3W9YA 1AH2A 3QVOA 1SHUX 3X44A 1UCFA 1PNQA 2ZVPX 4M7PA 2I99A 1ISFA 4OXNA 5HM6A 4LYHA 4G01B 2CSUA 1DEKA 2QBYB 1JV2B 4ZO9A 4DBLC 5HK8A 3DVAB 1I2AA 3F5SA 2N3ZA 4GG1A 4J0QA 4XZ3A 3WAGA 4KPEC 3WLFA 4FE3A 1NVVR 2P5YA 1DUSA 2I5PO 2FOXA 2ROQA 1YJ8A 2PCJA 5ADWA 2I22A 3BMNB 1XVIA 3PLAE 2FZ4A 2WAAA 2QJFA 3W5HA 1UP6A 3FPCA 1DC8A 1LI4A 3VXKA 4AJJA 3FSGD 2AR0A 4KQCA 1WUIS 1XVUA 3CVUA 1TW2A 3PD0A 3PX7A 4Q7MB 3O7WA 1KI4A 1GQRA 2DBVO 3N39C 3KHSA 1Y80A 3V2UA 1SIWA 1GL6A 1FRFS 2ZJ2A 4C6RA 4EZEA 5CVEA 5TIIA 4EFNA 5DH9A 1SQGA 3FTCA 2WVHA 3O31A 4MNTA 2QNBA 1E3TA 1UKZA 3HDQA 2HBRA 3LOUA 3LVBA 4A6DA 4R8MA 3UFBA 3AUTA 3EAQA 4QU9A 4CR6A 4FEYA 4OIMA 1PUXA 4DDTA 4WK2B 1E2KA 4KAFA 4B84A 2FSIA 4N0EA 3M9XA 1CVRA 5DW0A 5CLJA 4OP2A 3SLGA 5I9NA 4R16A 3SLRA 4F2HA 2Z5LA 5KPJA 2Y67A 3AUUA 2EFYA 4MPRA 2HZBA 2EVWX 4C21A 4FYYA 3L93A 1F2VA 1RRCA 2YJ6A 1H65A 5K1ZA 3EA4A 1M6WA 2XRFA 3E9DA 2DWPA 1ZJJA 5F21A 3DNMA 1I1NA 1ORTA 5FWNA 3WKDA 1GRCA 3DAHA 3TINA 1PU2A 3FOBA 9ATCA 2N9UA 3NV9A 1TZ2A 3UFXA 5DNYB 1OTXA 4MV3A 5H9VA 4UAUA 4NABA 3PDCA 3VYTB 4C9BA 5LQCA 3WLSA 1Z0DA 2WHRA 3TI9A 1F5SA 2BDUA 4M9QA 1STOA 2JGRA 1MEJA 4I2VA 4L7QA 3THYB 3RBZA 1HDOA 2O8NA 2C9MA 1IB0A 1GNVA 3OG9A 2VI5A 4UZEA 5CP8A 1N2SA 4UNIA 1SU8A 3O8RA 2F7SA 3THYA 3A6FA 2LGJA 1MX1A 7ADHA 3MINB 3AFIA 3C8HA 2C59A 3ESDA 1ECBA 1IUNA 2EZ9A 5JOQA 4UE3S 3C3WA 1PR3A 4JEIA 1HYGA 3SXUB 3VU8A 4DXAA 3U19A 2PA0A 3ONNA 2TS1A 4X66B 1BGXT 3HO8A 1KJNA 4G5RA 3UIEA 2FKAA 3D7MA 2OXFA 5LZ4A 2A59A 2Q8NA 3HYNA 4UM7A 4NMWA 1XZGA 3S2YA 3H2GA 3RNLA 3OX4A 4TKVA 5B64A 1OYOA 1TTHA 3JWHA 3WIUA 2UYCA 3KT0A 4DJ5X 1I0IA 1YFZA 1F2UB 1G66A 4TTVA 3B1FA 5T57A 3HCAA 3WL3A 4PIPA 3HBFA 1QTNA 2B7BA 4DSUA 2FW7A 1VBKA 1THZA 3B60A 3NBYC 1SG0A 4NK4A 1EX1A 4DDKA 2DLCX 1HTTA 1IE3A 5DGIA 2D1TA 5DNVA 3E3NA 3BSSA 2JGDA 2J0EA 3C6QA 4DMGA 4XDYA 2XZLA 3DW3X 3TLBA 1LPPA 3F6PA 3E7XA 4RVDA 1C0KA 3AEKA 4S0XA 2RIPA 4A0RA 5JYCA 3SX2A 2Y2UA 2FR8C 4UOQA 3T06B 3QPAA 1F4VA 3IBFA 4XUDA 2ZBQA 4CNQA 5JNLA 1ZC3A 2JHPA 1Y6QA 4LYDA 1CUAA 1U8CB 1XKQA 2VSFA 3TW8B 4O2AB 1X1EA 4ZXFA 5FL3A 4L73A 2ZAMA 1HDCA 3UAOA 1GPNA 2DFVA 3PGXA 3K35A 3UGJA 3MUOA 2V3VA 2WP8J 2C7GA 1ZJWA 3DS8A 3AL0C 2G80A 2ZDGA 4YCBA 3EISA 2WABA 3WRWA 4GMGA 4BJ1A 4BY9E 1PDVA 2G0NA 1Z7GA 1I51A 5KCZA 5DZSA 1CNMA 4OSEA 5DLQC 3N76A 3MTDA 3OLWA 4CMJA 4N41A 4G0MA 1NUHA 2ZSBA 1DG3A 3N05A 3NUGA 2JLUA 3SX0A 2OL4A 1YO6A 4AKHA 4R6WA 2ZGVA 1YZTA 4YUXA 2AS0A 4DY4A 4PZUA 4HVLA 5K0FA 4GKAA 4REMA 4O5OA 1P0PA 3PC4A 4MB0A 2WSYB 3SYTA 3UK1A 4AL4A 2YW2A 4I50B 4HNUA 1H8HD 1U6KA 3DGFC 4K3VA 4LY9A 1QANA 4QDTA 1L3CA 1Z5VA 4N3AA 4RGVA 2Q62A 4KMMA 3NBKA 1QGED 2QLBA 4F72A 1ZESA 4GLBA 1BQEA 5CB4A 2NW6A 1C1YA 3V8NA 5KHLB 1L7PA 5IKPA 3RNOA 3R3XA 5EQJB 3WQRA 2HMWA 1KI3A 2FP4B 1X13A 2QP4A 4KO3S 4PC3A 5A2GA 2WIJA 1U0OC 2XGGA 1KJIA 1U9JA 3M5DA 3JYPA 4LHEA 5KEIA 1U2GC 3E7PA 2J9FA 1EUQA 5IC5A 2WUWE 4URXR 4HXGA 1KQFA 3M2PA 5MF6A 1YQTA 3FTPA 4YT5A 1K6XA 5CAEB 4KOEC 2F8TA 3ZZTA 2Q07A 1ONOA 2J6HA 3EUAA 1BU5A 3PXXA 5JG7A 5LMCA 1G8HA 1PTJC 3H6GA 1L4NA 5F5NA 1QE0A 1KK2A 2OXIA 4CV1A 5DT2A 4UHCA 1QCDA 1NY6A 4KQHA 3OESA 3PG5A 4UCFA 3KKNA 2HMSA 4MCAA 4A2PA 4UJ3A 3WWCA 2VAXA 2GRAA 2QX9A 2XQFA 5TQ0A 1EDBA 1KE1A 4G0NA 4JJIA 3N6XA 4GAEA 1O57A 1R0CA 3FB1A 5EXPA 1J09A 5AICA 2HJSA 5HF8A 1U9YA 4A0HA 1XEAA 2NQ8A 4HAVA 5DHPA 5KJ6A 1LK7A 1ENPA 2XQGA 1BXZA 2JIDA 4DDHA 1S96A 5JNWA 3RIYA 3DL2A 1K7YA 3C3JA 2NU8A 4ESHA 5ARBA 4BXOA 2ID8A 3D4LA 4IY1A 4CCYA 2J67A 3EY4A 3HYCA 5AVTA 4WZBB 4DHWA 1ADFA 3LKDA 7ABPA 2Q5OA 1ARZA 5T3UA 5FFMA 2B21A 3VSDA 4JUAA 2ODTX 2B2NA 2RKOA 1G6Q1 1MORA 1O4VA 2V7EA 1ZGCA 1T2DA 2NUAA 2W90A 1NV9A 4PIVA 4ZI7B 4J2OA 3MCAA 3B6JA 2JJ2A 4Q5IA 3RYHA 3CX7A 3OTOB 3WLAA 1NRJB 4ECEA 3CZ5A 3S5UA 4D42A 5HJEA 2ZM5A 4IXTA 1G63A 4LJRA 3ETDA 3SHTA 4K8RB 1QX4A 1UZMA 4TRMA 2B1QA 4LOKA 4FKMA 1G6OA 3QUAA 3ZW7A 1B2LA 5B5SA 4AG6A 1EVIA 2CHQA 4R2HA 2A5YB 4MRRA 1KS9A 2FSHA 4ZOBA 3VDRA 4EYGA 3TH5A 4POOA 2ZSKA 3A58B 1T4DA 4RC9A 3OZWA 4FJ1A 3LPNA 3PPWA 4MQEB 4FHGA 4OK3A 3EY9A 2WM3A 4MVJF 3TM4A 4BUZA 1AD2A 3CLTC 2C04A 5CB0A 3MIIA 1ISIA 1DMRA 1NDUA 2DR3A 3E7WA 2XKJE 3TKYA 4K05A 1JJAA 2JLCA 2OV4A 3C6BA 1CY2A 1SOVA 4UCWA 4ZVRA 2OHHA 1WCYA 3KZMA 1LZLA 4D7AA 3F6SA 4ZIRB 5HUHA 1B74A 3BFXA 4B71A 3WZMA 3SZGA 1N8TA 4LS3A 4UBMA 5LWQA 2V5UA 2COUA 5BMVA 4G89A 3COZA 1HSOA 3GAAA 2XSZA 3TRFA 4OBBA 1QV6A 1QK3A 2XDYA 4EIWA 3I52A 3N28A 3I6MA 4ZEWA 1SN7A 1XZMA 3R6GA 4MW9A 5BSMA 3E48A 2OHGA 5T64A 2JLAA 2ECFA 1XTRA 1VZ3A 3NI2A 4FR2A 3ND6A 2P5UA 4RK5A 3UJPA 3F7OA 4ME6A 1ZN9A 1GITA 3COJA 4HXEB 4DOMA 1QE5A 3LCMA 1WF3A 1GPH1 3BDIA 1NJGA 2R6ZA 4IJMA 1Z6QA 3ICWA 4KAJA 3R5XA 2Z09A 1VE6A 3DBOB 5BSWA 1GAJA 3EZNA 3IXQA 2VA9A 3QWHA 2IYZA 3CLRC 1QR6A 1WXEA 3MBKA 1DV2A 3LUHA 3A27A 1RLTA 4IUDS 2XEXA 4ZJUA 4OUDA 4ZTZB 3KTAB 1NBOA 3QE2A 5EGNA 5IK2A 3SVTA 3VZPA 3QOWA 4XE5A 2C0PA 1WMSA 2OFPA 1KKMA 3S40A 2ZULA 1I3LA 1G17A 1TUBA 2FKNA 2HSZA 5HFJA 5TMBA 4IKEA 2GCNA 4D46A 3RC8A 3QMVA 3HHEA 1NFRA 1TYEB 4RZUA 4DR3B 2H0AA 4CHTA 3DLTA 2GD2A 5B4UA 2DPLA 3DMTA 1L7RA 3O21A 1JMKC 4JEUA 1KE2A 4F3YA 2Z98A 2ZPTX 3LHFA 2P2ZA 5BRAA 3U48A 4F85A 4MVJA 3IDQA 1XAGA 1MJFA 1Q5PA 5IFLA 3NOVA 2ZRDA 5HKKD 1JG4A 5IM4A 2PZAA 2X8WA 4GI1A 3KYCB 5E0KB 1OC2A 2H5JA 2HI0A 1EXDA 2DTXA 5FAKA 1V1RB 2EGGA 3L7DA 3NALA 4YCAA 2YVUA 3VC7A 1VJRA 2DUNA 4ZK2A 3OQNA 3BSWA 3H18A 1MLDA 2GVDC 1QHIA 2I1LA 3PSHA 5KTNA 3V4FA 2GPSA 2ZRMA 1FMTA 4IS3A 2D3TA 4E32A 1PR9A 1E2QA 4FDUA 4H7PA 3J7TA 1NW8A 3SZMA 4I9FA 3L7CA 1VTKA 1OT5A 2DKNA 2JARA 1CK4A 1XA3A 1FA9A 3VVMA 2VYQA 1O9BA 2UZIR 3BK2A 3C41J 4BQRA 1DAIA 1G9SA 2REXB 3LCVB 3UKJA 3RANA 1US8B 3X2FA 3LF2A 2C9OA 1SOMA 1XVVA 2DTEA 3KV1A 4JT9A 3FW1A 1LY1A 2BMAA 3RG2A 1E9EA 4DIFA 1SO8A 4KPFC 3EODA 3PDUA 3A6ZA 1RKXA 5D2CA 2CJWA 4NAVA 3ZWQA 4E3WA 2VJLA 1E6UA 3SQOA 3K4PA 1XPRA 4CQMD 3BKXA 5FPPA 2Y0DA 4GICA 4H6WA 1RQ2A 3QH4A 5KYYB 2CHEA 3QKIA 4FZ3A 5EUBA 2RGWA 4PAQA 2WTNA 5A71A 5CFNA 3N59A 1X70A 3BULA 1O0BA 1WXHA 2CFCA 2O19A 1KOJA 2GT1A 4LWPA 1SVIA 3FR8A 3L7OA 3H5LA 2QYHA 3K9FC 4E5MA 1LVUA 2WD8A 1Z4JA 4O5AA 4KVZA 4CI0B 5UKDA 1Z3CA 2GZDA 2H63A 4WZ6A 5AIBA 4LF5B 1L8LA 1RXEA 3CTPA 2JZOA 1BDHA 5CEFA 1I4WA 4KTTE 3V5NA 1MB3A 4M9CA 2Q9BA 3ADCA 3T7SA 4BNGA 1J42A 1RRGA 3PF9A 2WJVA 3IJPA 1E5XA 4PYJA 5JSUA 1N4DA 2Z2IA 3AL2A 1WDWB 2AMVA 2PQMA 1XDDA 3AR2A 5CPFA 5DXFA 5FI1B 5KCMA 2W2VA 4IQ0A 1LNZA 2Q7DA 1FP6A 2NVUA 5AJXA 4UHBA 4BNDB 2IYAA 4M21A 4TTTS 3OMWA 4QYIA 3G0CA 4D0LB 2F43A 3RRZA 3SVZA 4Q3CA 2HW8A 2WNIA 4H6XA 2BEWB 3OUUA 2WJAA 1V8OA 3QVVA 4WKOA 3MBIA 2QG9A 1SXJB 1VG8A 4FE4A 2TRSB 3G8CA 4WY8A 1IOLA 1XQ6A 5EXDA 4J0DA 3VGJA 1ORHA 1CZOA 3VYVA 2ZU0C 4OEHA 1BEEA 2C1XA 1DHTA 1F6DA 2ACKA 3EA0A 2NAPA 1SXJE 4MS1A 1L2TA 1V4VA 4Y2GA 1J25A 3RAEC 4KK3A 2WZBA 3I6QA 2PR7A 1TJYA 3I5MA 4TTQA 4DIDA 3ZHYA 3C24A 1IM8A 3B1JA 3W6PA 2RH8A 3IPLA 1Q0UA 1VFPA 4UTRA 3A4MA 1ZN2A 1GPBA 3OZIA 3R3UA 3CX6A 2EZUA 3RFXA 2EZ4A 3S70A 3WL8A 4QM6A 3ROPA 1CR0A 3BREA 3HNPA 1CEQA 2B99A 4YMLA 2PUBA 4C7OA 3IDZA 2KLHA 3RQIA 2CVZA 2HHJA 1Z2EA 1GYPA 4BO5A 2LKDA 2VNSA 1W581 3HCRA 1I7LA 3MW8A 1Q1ZA 1BDBA 5JD6A 4L8LA 1D09A 2GZ3A 4RNCA 4NVRA 4W9MC 3JAWB 4JOSA 3RVQA 2MSEB 4PZZA 1D1TA 4CM4A 2ORIA 4MARA 2J48A 3QMMA 4ND1A 3NBQA 4ILKA 4L28A 2XF8A 5CU7A 5AXCA 5IASA 4LDJA 1GDDA 4FQ5A 5J23A 4K6CA 4MR7B 5DM2A 1EFDN 3ZIAD 4JXKA 1EXNA 1U6JA 3ZQ6A 1Y4ZA 1U0FA 4DNXA 2GS9A 2PUHA 5L7WA 1QF7A 2GEJA 4D4IA 5DVZA 3NTRA 5AHOA 2B61A 2O6HA 1M5UA 4LCEA 2ZUTA 4TKUB 1A50B 1ULBA 5T7BA 4G41A 1NNI1 1L4KA 3ZWMA 5ALOA 4X71A 5KS2A 1OLUB 1XBTA 3T7RA 3BCUA 4OMCA 3QX7A 4HNAA 4G8DA 4DSZA 1JEOA 1FXUA 2EKPA 1NMYA 3BF7A 3E3AA 4I1YA 3ZVKA 3SQXA 2OLEA 4RTKA 1PWHA 1GZHB 5IUNC 1HE5A 3K9HA 2M6RA 5EEGA 4OI0A 4GBJA 1C9JA 4GFDA 1CTQA 3VVBA 2DF8A 3G6KA 5IVKA 5SY4A 3NYRA 4RQUA 1J2UA 2HSGA 2Y68A 3A14A 3GNQA 4YRLA 3WK4A 5CXUA 5LJLA 3GUVA 3P96A 3DV2A 1QX3A 3S4YA 3RUIA 2C3MA 1FU8A 3AF4A 2I9PA 3I04A 4O1HA 5B3JA 3WLLA 2JJ1D 5CR9A 4BV8A 4UBOA 3V3TA 4PO9A 3EGOA 5G41A 5CVJA 2WHPB 4KYTA 2FPIA 3HXOA 1ECJA 1S3IA 1W35A 3WL6A 2CV2A 1SKYB 3MM4A 2J0SA 2YXPX 3ABRB 4BX2A 1EFVA 5E8RA 2RJOA 4B6JA 1CJMA 1FP4B 5A05A 2X8BA 3QZUA 1SKYE 4ENRA 3K09C 2MYNA 1SUCA 3E9RA 3GNSA 5LP1A 3ND5A 2JLRA 2RH4A 3QG5A 1P4GA 4IWXA 2N46A 2X8AA 3PLRA 1KNXA 2V6GA 4IKOA 4I8DA 3C85A 1PFQA 1KSJA 3DQZA 4N1AA 5ICGA 3CO5A 3OPQA 3I30X 1NV8A 4Z7JA 4AMZA 1W4RA 2NQTA 4PGAA 3DFKA 4RJLA 3DV0A 4HY3A 3IESA 3GPLA 2IP2A 3SYLA 3ASYA 1LBSA 1PQUA 1EX6A 4F5ZA 1OPRA 5CHYA 4MV6A 1PL6A 2B9VA 3QKUA 4HRYA 4D81A 1V16A 4F6CA 4YJHB 4ITUA 3BXXA 3PUJA 4AY3A 3BDAA 1BWQA 1RPAA 2NACA 2Q3JA 4R83A 4C4OA 5JFGA 5I6DA 3VI4B 3NUQA 4PWZA 2YMPA 2H9IA 4JN6B 2PTGA 4XWOA 4W5RA 3M6LA 2XMQA 4PAMA 5EQDA 5BSKA 4MXDA 3IP6A 5E4FA 3FHOA 3IQWA 4G0QA 4G4GA 1WRBA 4DA0A 1T29A 2VK2A 3MTGA 1UZLA 2ZUBA 1Z6YA 2BYTA 2O3TA 4JI0B 3GLFB 1T3HA 1UZNA 3T9DA 1Y7LA 4XCVA 5SV2A 5H8WA 1T26A 1MNAA 3GLIA 5L3SB 2J3JA 4DUYB 2XYPA 3K8OE 4EG4A 2R48A 4ZOQI 4ZC1A 3PVSA 3SC3A 3UXEA 4LA4A 3SHWA 3ITDA 2R4UA 4LV8B 3SZRA 1VIDA 5B37A 3K0KA 3UMMA 5ALPA 2R6FA 3GDOA 5CNMA 3BQNB 3E23A 1YD7A 3OM8A 2QUJA 5C0OE 3IILA 3GV0A 4O6VA 2QG6A 3DTVD 4EZBA 3AGQA 1ZJ6A 5CEEA 2E4AA 2O8CB 4FZVA 2R1ZA 1EGMB 1G4HA 2L2QA 4BLWA 3EXFA 1KEWA 3GR6A 1VL0A 4XQ9A 3ODGA 1Z4MA 2ZB8A 5AUQA 4A4DA 4B32A 3OPNA 4BNJA 4E46A 3O8OA 2XY4A 4KOAA 3QNMA 3Q15C 3FI0A 4M3NA 2Q2OA 1QJ4A 4TWAA 3MGAA 1JZSA 2JGLA 2YWEA 4XTCS 3IO3A 2ZQYA 3UUFA 4Z2AA 5JXWA 4KR2A 1E98A 2FUCA 1DT5A 2W8ZA 5IXYA 4FKBA 2ZTHA 3HHPA 1K5HA 5GY7A 3TAUA 3HCBA 2H5EA 5AD1A 4IGFA 3CKLA 1B8PA 2BKEA 2XDQB 4B47A 5BVHA 1I24A 2AMJA 1N5IA 3QPCA 4NNJA 3EC7A 4D26A 4MUBA 5ARCA 4EK9A 4QYWA 3HJAA 4UVGA 3IV6A 2WK1A 1J8YF 4CL0A 4FX2A 3DF9A 2HQ1A 3WKCA 5GVSA 1NE2A 2AG5A 2KHZA 2Q4TA 4WLVA 4YUAA 2VJYA 4B82A 4QTZA 4AT1A 2JC3A 2LVBA 2EEPA 1N7GA 3GCDA 1HK7A 1VHDA 3B53X 3K0AB 5AI5A 3VO2A 4A03A 1KH3A 1L8OA 1Y8AA 1YHZA 1NSFA 4ZGBA 4H15A 4YRJA 3LBIA 3WGIA 4OLJA 3IAUA 1G8AA 5K4GA 3PKZA 1TU0A 3TOZA 2XCSB 1V39A 3GAMA 3NB0A 4V0LA 2WI8A 2Z6AA 5KYGA 1SG6A 2ZANA 3CCCA 3RUFA 1XMVA 1AKEA 3TSAA 3WV4A 5D1HA 3GN1A 1CUCA 3EUEA 1IXRC 3RBXA 2NU7A 3RVJA 4IQGA 5GJBA 3BXFA 5K01A 1GSOA 1R0BA 2VVTA 5DTMA 1U2TA 3OMXA 3KYBA 4FI3C 2H7YA 3ZEAA 3T35A 2Q6IA 3W34A 5HDQA 4BVEA 4P80A 1IZ8A 1D07A 1FSFA 3MRXA 3E6AA 1M0WA 3K9BA 3DE0X 1Y9EA 5FXMA 1SELA 3CMMA 4R05A 4TMXA 4RAOA 3RARA 4IFBA 1KA9H 4XGKA 1OVGA 1WKVA 2RHHA 5DM60 3C43A 2IZ7A 4CR8A 2B1IA 3LHSA 1W1IA 3A9TA 4EVIA 1FYEA 2A3NA 2ZFUA 4IQ8A 4G63A 4J0JA 4XFKA 3AKZA 3DVRX 3HRIA 1QJCA 3Q7TA 2EP5A 2XYQA 1ABEA 3ZCVA 2L0XA 3R76A 3C0KA 1TIBA 3DDOA 1K8XB 4YC7A 2JAQA 3IAS6 4NENB 4LJKA 3ZWBA 4BFTA 4Z51A 4PYKA 5K0ZA 2EP8A 1CB7A 2J5BA 3OEEA 1JW9B 1ORWA 4XUGB 3FPGA 5HPYB 5JSZB 2X23A 3DZCA 5AOCA 2P9CA 2HSDA 5FJJA 1F20A 3MUFA 3VR5D 1JBKA 4U7FA 1IOWA 2JGMA 1CJCA 4AZ3B 3P9QA 1JR3D 3GWZA 4PPQA 5G1NA 3WNQA 4BE9A 2C96A 3T7DA 3QEAZ 3K16A 1QLHA 4GI3A 4J6EA 5AUNB 2WKSA 2R6DA 5FTJA 4KFUA 2J7PD 3OTWA 1RJGA 3PIRA 4HFJA 5H7XA 1VL2A 4XFJA 4IL5A 2V98A 4NE9A 2JD0A 3ES9A 2I6GA 4L74A 3ANLA 1RFGE 3H2KA 4PYRA 1YA8A 1Z15A 4G8JA 2R84A 5IJ0B 3EC1A 3TD6A 3CVYA 2GD6A 5HIMA 5IXJA 1NU8A 3C1UA 4FWTA 2RKBA 2A9PA 3ZWYA 3TECE 1GG2A 2PAAA 1R66A 3H2YA 4UU7A 3TTUA 4C6HA 2WFLB 4UNRA 2GUGA 3T3EA 3DAPA 2YFHA 4JX8A 5IHPA 3W5DA 4P34A 4DT1B 1PDWA 4TTAA 2YJZA 7MDHA 3CF4G 2QLNA 1D8TA 2R5NA 3LGSA 3M3HA 4M88A 1FMCA 1HTWA 2H0RA 4Q19A 4RJIA 1LDNA 2YJ4A 4V38A 5DIFA 3SC2B 3TK1A 4IGIA 4YI3A 1D7AA 4ZREA 1ADJA 3DUWA 2VZ8A 4X0EA 5LMNB 2YMQA 1KS2A 2PRZA 4BO7A 1J0EA 4BUJA 1OY1A 3NBMA 4UHHA 3NHZA 3SD7A 3RRBA 4EATA 2IHVA 2DG2A 3LLMA 5CIWA 1IRIA 3QUQA 4OJTA 1IN4A 3ONEA 4GVPA 2BAGA 3W8EA 2Q2VA 4FUTA 3FCUB 4B7CA 4R8VA 2HTEA 4J6FA 2HHAA 4MKFA 4O4JB 5JBQA 1DQRA 2YUIA 2Q0SA 1PLKA 3LBHA 3LPDA 3SJ7A 1UBLS 4I4TB 1RYZA 3A0RB 3H9QA 3RJZA 2G0AA 1ATZA 2QE7D 1I30A 1NDQA 1H2EA 5CVVA 1U4OA 2Y8EA 5IXSA 3VH2A 1C81A 1LTHR 2WNSA 3AKDA 3DXFA 1GLVA 1CNEA 4EW3A 2BR3A 2QVZX 5TMEA 2MOKA 2WG0A 4YH1A 3WS7A 2ADMA 2D2FA 4JQYA 3O4JA 1FP2A 3FZYA 4PTZA 1X1SA 3OZAA 3ZH2A 4PGMA 3RO7A 4DA4A 2AV6A 1EP1B 3KJFA 4ZT5A 2OD7A 1A27A 3F96A 3WGTA 1N2CE 1QRUA 2FW6A 1T1JA 1VMDA 2C54A 5L4NA 5FTWA 1KOGA 2QTRA 2AOTA 1MHPA 4OAOA 4D8TA 5JMTA 3HKBB 2Y4OA 1NXTA 2PS1A 1H2HA 3MD9A 4MWBA 3RYIB 4C3UA 2A5JA 4C89A 1AN9A 3RYCB 1T34A 2W4QA 3JYLA 2AFRA 4ER3A 1OJLA 3GFFA 1YDEA 3OWOA 4D79A 5IPFA 2KPOA 1CWUA 4OGFA 2X7XA 4DAEA 1DOZA 3OOYA 3A31A 2PSFA 4JKIA 4S35A 2VLBA 3ELWA 3U3ZA 3WNDA 1ODCA 5GM2A 3ZTYA 4E2YA 3H13A 4EO4A 4XJSA 2VYNA 1OU0A 2G67A 1L1QA 1OI4A 2Q1YA 3C2QA 5LLSA 3LPAA 2E5LB 1DDIA 3DA8A 3NQ41 3MXTA 1V3UA 3NFRA 1H1LA 4NTZA 4DCUA 4Q4JA 5FUVA 1PRYA 1U2SA 3DMPA 3QNUA 1TOAA 4HPJB 1EWYA 2PWZA 2LW7A 1H8ED 5DCYA 3EXAA 4CKCB 1YL5A 2YHSA 5GM1A 4PRYA 3A36A 3ZJVA 2TMKA 2FSVC 3LBNA 1E92A 2QN1A 3MGGA 4G37A 1ENZA 1P3JA 1D6NA 2B35A 4LBWA 4LGCA 4N7BA 3TDNA 4FX5A 3CW2A 1M5RA 3MQ2A 1YK1A 5JDIA 4BNMA 4EPTA 1LSSA 2LZ0A 2OCKA 2J9GA 4Z3DA 3V7UA 4E30A 5CD1A 1N2BA 2ECQA 3L18A 1Y82A 3WFIA 3THXA 1V0JA 2DT5A 4X85A 3RK4A 3AVQA 4CL3A 4ZTUB 4LXHA 5K8VA 4KI7A 1NJ2A 3OE7D 1CFZA 1LV7A 2BEKA 2X3FA 2VDRB 5IJAA 4Q9KA 1SBNE 2M2IA 4KWCA 5E1DA 1KYZA 3UNXA 2UUPA 1LFAA 3HDHA 4EPYA 2NSHA 1W4LA 2AF4C 2GM3A 1F8XA 3TNJA 1U8TA 3SS7X 4YWJA 1WCXA 1B73A 1J0CA 1QM5A 3BBPA 1AGYA 1XZEA 3G2OA 4C30A 5HRAA 2PZJA 1A2QA 3DE5X 5ADVA 3SKXA 2LDXA 3RRFA 3PWZA 1WCWA 2CLOB 4WBNB 1Y8CA 5AUPB 3HBNA 2R3SA 4QXOA 3SYMA 2K2WA 4U9IS 5E3JA 3MUEA 2QHXA 4GKBA 2HDHA 2IITA 2ZIWB 2YIMA 3FUVA 3PE6A 5DOVA 2C84A 2RHDA 4OYYA 5FOUA 2WFAA 3QFSA 4ZVMA 3WR5A 1CEEA 2BR5A 2ZIUB 1NJ5A 1M2FA 3WGNA 1HORA 5IAJA 3VX4A 1WF6A 4WFIA 2AOUA 2PVCA 4YRMA 1L5QA 1SCJA 2GERA 1MDBA 3NANA 1W88A 1H2XA 2OR3A 4WY2A 4FN4A 1J22A 4YP7A 2AZMA 1FJGB 2VPIA 3U7EB 3FNGA 4A1OA 4JSRA 1JDPA 3FFWA 5E7QA 4UUQA 1GT6A 3HR4A 3X1MA 2H85A 1NSYA 2JCXA 2AXEA 2FR1A 3VOTA 3CLUD 1EWQA 5TGZA 1N3YA 4EOGA 3PGA1 5L40A 3KKMA 4NC9A 3HXLA 1ZIYA 4OMDA 2CL7X 1JG3A 1HA3A 3W8RA 4P32A 1CD5A 2H4FA 3MHTA 1J2EA 1FFWA 1HDRA 2A94A 4FZRA 2CUKA 4U02A 3QV2A 3VKFA 3KM0A 5C81A 2GVNA 1XZLA 1DBRA 1AS0A 3W2FA 2OFXA 4G36A 5DTIA 2IEBA 2FAXA 3NDJA 1V3TA 3KR0A 2HU5A 3GZJA 4DSTA 4EL5A 5IW8A 1U7HA 4L15A 4URFA 3H5NA 5TPWB 4YR7A 4OLBA 1MMFB 1ZH2A 2YNMA 4BX9A 3JS5A 4B6QA 2PL5A 1W36D 4H7KA 1THGA 3HACA 2GM4A 4QQFA 1JILA 2ILTA 2V5VA 4NF2A 3ND8A 3KAQA 4W5JA 5IVIA 4EW1A 4F3CA 3NP9A 1J49A 4WESB 2Q5JA 3IVGA 3W2GA 2MCFA 2HDOA 4CMHA 1HL7A 1KU0A 2ZR9A 3BTSA 4FTWA 4WIAA 4GVLA 4DVJA 4WT7A 1QPBA 2HA3A 2JRLA 1NT4A 3EVFA 4P3KA 1HNNA 4CTOA 1A96A 1OBVA 1FYWA 3ROZA 4F91B 2ZT6A 3NP7A 5FRDA 3T4