5CURA

G158e/k44e/r57e/y49e bacillus subtilis lipase a with 20% [bmim][cl]
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDETGTNENNGPVLSEFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIELLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 70
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5curA00
5SYNA 3AINA 3T4UA 5FLKA 1A88A 2FJ0A 4GDMA 4X94A 4H35A 1XZFA 1QGED 5I9IA 3R3ZA 1QFMA 4Y2PA 4JYMA 2ROQA 3WWPA 1B6GA 4FTWA 4IH4A 4Q3OA 1ZD2P 2X5XA 1D07A 4MYSA 3VJKA 4MQMA 2VT7A 3QPDA 2DQYA 4UBMA 5FKJA 1R9MA 3DYIA 3CCBA 3IURA 4F5ZA 1W4LA 1VXRA 1EK1A 2PM8A 5HQ3B 1ODCA 4AQDA 5ALTA 4YK7A 2QT9A 4NVRA 3FYUB 4K5QA 3Q8WA 2RONA 5C8VA 3NGMA 1J1IA 3DJYA 5AM3A 1VA5A 3O9VA 4TPKA 1WCYA 5DNVA 3LIIA 3FVTA 1YAHA 5FXMA 5JD6A 3LLCA 3H04A 4X6YA 4BVLA 1UK7A 2HA6A 3WIBA 1JMYA 3G9ZA 3I2HA 1XZDA 3G0IA 4UPDA 4XIIA 3MGAA 1SCIA 2WUFA 3F8SA 1DWOA 2XUIA 5EI5A 3MVEA 1Y7IA 3DS8A 1YB7A 4OYLA 4Y2QA 1YA8A 5C8XA 4X91A 1CQWA 3G0DA 2WTMA 3BL8A 1W52X 2JGFA 4QLOA 2VJBA 1FSSA 4UFNA 4Y9SA 2HU8A 3ZWQA 3DOHA 1UZAA 4MEBA 2VSQA 3KSRA 3BJRA 1MPXA 3OTQA 4Q3KA 2DSNA 4G4GA 4PW0A 4QNNA 2Q0XA 1LLFA 2RAUA 4A5SA 1LGYA 4JEIA 5DYTA 4B83A 2FX5A 5BOVA 1HQDA 1WHTA 1TCCA 3NOXA 2C0PA 5LYYA 3GELA 4CIBA 3H1AA 5HF8A 3E4DA 1MX1A 2PL5A 3T52A 3VVLA 5JD4A 3I6YA 4J3JA 1BRTA 4B81A 4AB1A 4AMZA 4OB6A 4QLAA 5AOBA 2Y2VA 4G4JA 3FLEA 4HRXA 2CMFA 3WKBA 3PFCA 4NMWA 2BUAA 3STXA 1RYYA 3B3QA 1HL7A 4OB8A 1H2XA 4HZGA 3C45A 1JI3A 1SCKA 4G1FA 3RK4A 3RLIA 4X6XA 1MNAA 3RM3A 1FFEA 1R1DA 2HA4A 3FWHA 2WFLA 4GWLA 4A23A 3ZLTA 4UHFA 3U0VA 1H22A 4IQ4A 1IUPA 5D7BA 4CIAA 1EXWA 4OSEA 5J3JA 4BZZA 1L7QA 3HLKA 4J0HA 5FDFA 3ESDA 3AZOA 3I6MA 5CRIA 5IVDA 2CEKA 3W06A 1LPPA 4J0KA 1Q84A 2WFZA 4J7AA 4C4ZA 5CT6A 4RNCA 3A2MA 1RWQA 5AP9A 1A8SA 1C7IA 1EVEA 1XKLA 2JGLA 1R3DA 5JAOA 4FFVA 1XLVA 2VQ6A 3UMJA 3FCYA 4BE9A 4K6KA 1DU4A 1JT2A 4W1RA 5JANA 4DM7A 5DNWA 1CUUA 2IIVA 1Z68A 5E4YA 2WM2A 2JGEA 2XLCA 5K3CA 4INZA 3KOOA 5IH7A 4F0JA 1CV2A 4UFOA 4UUQA 1W76A 1FFDA 5T4FA 5HZGA 2XMDA 4AN0A 4KYVA 3O9MA 4GECA 2WUEA 3H19A 3W04A 3WL8A 4H77A 1XZLA 3WZMA 3K6KA 2Y6VA 4FBLA 1CUAA 2EDCA 4MEAA 3FYUC 5ALYA 4NZZA 4ZV9A 2QZPA 4H7IA 2AJBA 2VJDA 4W9RA 1XZCA 2E3JA 4AX4A 4OCZA 4KRXA 1XRPA 1DQZA 4WY8A 3H2GA 3R40A 3V1NA 1XRQA 1ZGBA 2ZYRA 1FJ2A 1GPNA 3G9XA 1AURA 3B12A 4X93A 3R0VA 5AHXA 1ZD4A 5CT5A 3I28A 2PSJA 2Z8XA 3RKSA 4GW3A 3ZLUA 1R4ZA 2OGSA 3STVA 1Q0ZA 1DINA 4FBMA 2WJ6A 2OAGA 5EHXA 1HBJA 1ODSA 2WIKA 2QOEA 2Y1KA 3DKRA 4Y2SA 1MJ5A 5A62A 1TIBA 1PV1A 2XDWA 1L7AA 2CJPA 3H2JA 3TJMA 1ORVA 2H7XA 4J0DA 4CI9A 2OGTA 3WA6A 5ALHA 2VAXA 4KE6A 4ZREA 1DTEA 4DNPA 3ZPXA 3VVMA 4BC1A 3D0KA 5AJHA 5LZ2A 2HL6A 1BN7A 4AXBA 2BAGA 5AM4A 3OOSA 5AOAA 3I6ZA 2XI4A 1TAHA 2JEZA 1C7JA 1X2EA 3WKEA 4H7DA 5EHQA 5E4TA 2H1IA 4KAJA 4PV7A 3G0BA 2X8BA 2HFKA 4G8DA 1TCBA 5HF6A 4DNOA 4OUKX 2XUHA 1THGA 3D4LA 4KR0A 1P0MA 1IUOA 2XQKA 5KWIA 3EBLA 1CUJA 4B80A 2HIHA 4PSDA 5BWBA 2WLSA 4DSZA 3R3WA 1MTZA 2WJ3A 4KEAA 3SX4A 2YH2A 2VATA 1UOPA 1K4YA 3VJLA 5YASA 4BBZA 1H2YA 5ALVA 1QE3A 1ETHA 5AKLA 2PVSA 3VJMA 2HA0A 3V1KA 3PF8A 4J03A 3X3HA 5DJ5A 1LPNA 1E8DA 1XZEA 4RGYA 1J06A 5AKZA 5AKJA 4QDZA 4LHEA 4AO7A 3O4IA 3BJMA 1FFCA 3ICWA 2H9YA 2AJ8A 1JFRA 3WYNA 1VJ5A 2WIJA 4BDTA 2HFJA 2HHAA 4QEKA 4LKOA 4J0CA 4PNZA 2G63A 5AKXA 3QVMA 4DNFA 5CMLA 1CUSA 5ALZA 2WHPA 3E0XA 2XQJA 4QDTA 3FOBA 1QIIA 2B4KA 4D9JA 1VE7A 3G9TA 4E46A 2DFPA 4FDMA 4BDSA 3H18A 1AKNA 2QRUA 1CUHA 2XMBA 4LXIA 1O6FA 4DSAA 2CKMA 5FPPA 2AJLI 3S2ZA 5KBYA 4KAFA 1F0NA 5A7HA 4X71A 5IVKA 4DTCA 5A6VA 1XLUA 1BCRA 3DL7A 4BE4A 2PKYX 3CN9A 4OB7A 2YASA 4MXDA 2W6CX 2RGUA 5AKYA 4DMKA 4QDOA 1QIHA 5CT8A 4UBIA 1ZI9A 1ACJA 2V96A 5DYYA 3IULA 5ALSA 1NU8A 1PJAA 3OURA 2GBGA 1N5MA 4WFJA 1YB6A 1K5PA 3RARA 5AIAA 1UKBA 5A7GA 5ALEA 1EDBA 4FLFA 4Y2RA 3EIOA 1F8UA 1EINA 1MU0A 3I2KA 4GHWA 4BAZA 3PFBA 5JASA 2ZYHA 4ZI5A 4EA6A 2HA3A 2ONCA 4C4XA 5DYWA 4ZXFA 2C0QA 5CT4A 4YPVA 3AUKA 3R3XA 1QO7A 3OM8A 3WK4A 3PDCA 2EDAA 1UK6A 4DGQA 4J0IA 3U1TA 5ALMA 3VDXA 2HU5A 1CLEA 4MJ3A 1NU6A 1LZKA 1U4NA 4ETWA 2AXEA 2B61A 2UZ0A 3FSGD 5AK5A 1ZD5A 5LKAA 4M0EA 1E5TA 2JF0A 1ZICA 4ZGBA 1IUNA 3LIPA 4B6GA 5ALWA 1W1IA 4L9AA 1OCEA 4AMYA 4BVKA 1AX9A 2HA2A 4FHZA 4UBLA 4FOLA 1WOMA 1EDEA 1XQVA 5HF5A 1THTA 3IIIA 2I03A 4WDQA 3VISA 3BF8A 4CCYB 4Q05A 4FMPA 3WIOA 1EA5A 3ZV7A 3ICVA 5HFNA 5K3BA 5T4HA 3FLBA 1P0PA 3JWEA 1LPMA 5LLSA 1VZ3A 1AC5A 2DCMA 4BCBA 4N5IX 4FWBA 4N8EA 2HDWA 1UFOA 4UHHA 3WYDA 2ZSHA 4EZIA 2AJDA 4OU5A 5FRDA 5ALLA 2X76A 5LIPA 1WPXA 5ALXA 5AI6A 1MO2A 4I3FA 1DWQA 1XZKA 3L1HA 1CUYA 5AK4A 3D2CA 1G4HA 3JW8A 2YYSA 1GKKA 3AZQA 1DX4A 5EGNA 3HC7A 4C6HA 3WI7A 4W1SA 4G8BA 1WM1A 1Q0RA 1XZHA 4BB0A 5HKAA 2G5PA 5C8ZA 2WIFA 3EQ9A 4M0FA 5IVIA 3ZI7A 5IKXA 1ZD3A 1GXSA 1TK3A 3FAKA 1EB8A 4UBNA 2WFMA 2XMQA 1BE0A 1LPAB 5AI8A 2RHWA 3QMWA 4BTLA 2XUFA 2XQFA 5C81A 2OCLA 2PBLA 4K6HA 2PU7A 2HU7A 4EB0A 1YR2A 3WL6A 5JAPA 1CPYA 5K3AA 4AN1A 3PF9A 3HABA 1MAHA 5K3DA 1X2BA 3E1GA 5FV4A 1CUEA 3ANTA 2I3DA 3FNBA 5CTAA 4DMHA 4ZRDA 5DWDA 5CH5A 5AOCA 1UOOA 1TKRA 4WCVA 3WK9A 1CUBA 1QIMA 1DX6A 5HKBA 1QTIA 5EHZA 4LIPD 1CUDA 1N1MA 3ANSA 2Z5GA 1JJBA 1CQZA 1IZ8A 3DNMA 4KAAA 5I7UA 3LP5A 3WK8A 5LZ9A 4B9AA 1QO9A 4EHBA 5EIHA 3IDAA 1JJIA 5AKIA 3BDVA 1LPSA 1HLGA 1QTRA 2WIDA 1CEXA 2VAVA 3R3YA 4EUSA 2Z8ZA 2XMRA 3HACA 3OC0A 3WZLA 1S8OA 1U2EA 5D3KA 3IBTA 4H7JA 2WG2A 3QPCA 3O0DA 4BRSA 5KREA 1CUGA 3H0CA 1TCAA 4DLNA 1OILA 1VOTA 1ZIYA 5JARA 1H2ZA 2XMCA 5EIAA 4FNMA 3PUHA 4FKBA 3W9UA 1ZOIA 3I1YA 3IUJA 5LP1A 3STWA 7YASA 2OAEA 2PX6A 4UHEA 4LYDA 3QMVA 5T4EA 2PSHA 3I2IA 3LS2A 1MN6A 2AJCA 3IA2A 3CCCA 4BRZA 1F6WA 4Q1VA 3WWOA 1ORWA 4QA9A 3WKDA 2ZYIA 1U8EA 1EVQA 4QE3A 5K3EA 1LPOA 4J0JA 4G9GA 2C58A 4GBGA 2VJCA 3O4JA 5LZ8A 5DLPA 1QZ3A 3HYSA 3DKKA 2VEOA 2D0DA 3DEAA 3IUMA 2BGNA 2QXTA 5CH8A 2I3ZA 4E15A 1T4MA 3GROA 5D6OA 4X95A 4KE8A 3O4HA 4V2IA 4Q34A 3O95A 4AZ0A 2C5FA 5FOQA 2ORYA 2JGMA 1G5FA 3I1IA 3CN7A 4BAUA 4W63A 1KU0A 1WHSA 4GXNA 1M33A 2VA9A 2WFLB 2QR5A 2XT0A 2PUJA 3A2NA 4F60A 4Y2UA 3AIMA 4X90A 3UUEA 4XVCA 5HK8A 4PSCA 1BS9A 2OCIA 2O7VA 5AI5A 5AM1A 1EI9A 1XZGA 1JKMA 5K3FA 1I6WA 3WLAA 4EY8A 1YSCA 3TGLA 1FFAA 4FFWA 5BWCA 2DHEA 1WPRA 3GZJA 1WB6A 2XUQA 1X70A 3FLAA 4CG2A 3A70A 2QS9A 3F9CA 1EX9A 4P93A 4EBBA 1BEZA 1VLQA 3W05A 2RI6A 4HXGA 1LZLA 3C8HA 3WWDA 1SFRA 3BDIA 3C87A 5A7FA 3QITA 2IX9A 3AFIA 4H7HA 1GPLA 1N8SA 3HSSA 1T2NA 2XE4A 3PUIA 4H7FA 2PU5A 5JZ9A 2FUKA 2GYUA 4OD0A 2O7RA 1U65A 1QIDA 3A2LA 4QWMA 4LXGA 2WSLA 3PE6A 2WILA 3WKAA 3IUNA 2HA5A 4ZWNA 5AM5A 4AO6A 3V9AA 1G42A 1RP1A 1H23A 1BCSA 3I2FA 1CUCA 4C88A 1HKHA 1UK9A 1CRLA 2BGRA 3G8YA 3GBSA 1E66A 4FNGA 1DWPA 3B5EA 1FFBA 5FPQA 3ED1A 4B85A 1GQRA 4XJVA 2V97A 1MNQA 3QMMA 3STTA 3KWJA 4X85A 3L1JA 5FUMA 1Y7HA 1PFQA 2XUDA 2WG1A 2ZJ6A 3D7RA 4PF1A 5A71A 1B41A 1ZIXA 3N0TA 4K2AA 1QLWA 4OPMA 1QIEA 4HS9A 3M82A 1L7RA 4EY5A 3BWXA 2DQZA 1C4XA 2XB6A 5JAUA 3WWEA 3QPAA 4AO8A 1XRLA 1O6GA 4QWWA 4W1PA 2H7YA 3MUOA 2V98A 5C7YA 3DCNA 3QBJA 1W75A 1XKTA 1YA4A 3WJ2A 1CVLA 3R41A 3STYA 1QIKA 4U2EA 2I78A 4TGLA 3WK7A 4ROTA 2VF2A 2B9VA 3PICA 2OGZA 2JBWA 2XUJA 1CUIA 3WA7A 2XUAA 4G4IA 2G4LA 5HQ3A 1YS1X 5A2GA 1J2EA 3KXPA 5HK9A 3FYUA 3VKFA 4UHDA 3I2JA 4JH0A 4DMCA 3DDUA 3EQ8A 5DNUA 3F97A 4Y7DA 4YX9A 1CR6A 3ESAA 4E11A 4BTVA 1VA4A 4X92A 3OPMA 1AMNA 2GBIA 4IH9A 2GBCA 4QDXA 1LBTA 1NX9A 2OQVA 3UUFA 2C7BA 2O2GA 2Y2UA 2DHDA 4KJXA 3IB3A 5T4BA 3C70A 4CCWA 2WHPB 4J0GA 3DLTA 3C6XA 4YASA 4PSUA 1XRMA 3Q0TA 2XMGA 4FLEA 3WL5A 3WJ1A 5E4JA 1LPBB 3AIKA 4I4CA 3FYTA 4O08A 3M3DA 5CT9A 4MYDA 4AZ3A 4DNQA 5AI0A 2H7CA 1J07A 5CURA 2J3QA 2ECFA 2QUBA 2XMSA 5ALOA 1XZIA 1UKAA 3KD2A 4RE6A 4BATA 2ZSIA 3C43A 3O4GA 5ALQA 2GYWA 1IVYA 4X6UA 5JADA 2WU3A 4RPCA 4G9EA 1LBSA 2RHTA 4DMFA 3R3VA 3H17A 4I19A 3WL7A 1QJ4A 2P8SA 4PQEA 3WWCA 5ALGA 4H18A 1UWCA 5AKHA 3BF7A 1ZI8A 4ZV7A 2WHQA 4IH1A 1XRNA 3GUUA 2CUTA 4JUIA 3JYHA 5AM0A 3W2TA 4BYMA 2XLBA 2JEYA 2CBGA 1BN6A 1E8NA 1GZ7A 3C5WP 5ISMA 4Y2VA 3FBWA 3ESCA 3WMRA 5I8PA 2Y6UA 2BKLA 1Q83A 4G8CA 4FLMA 3QYJA 1CFJA 1CUVA 4OYYA 3FVRA 1XZMA 4BP8A 3PI6A 5AI9A 2C5GA 1ISPA 2J3DA 4C01A 1KU6A 3ILSA 2CZQA 4CG1A 5H3HA 1MX5A 4LXHA 4Y2YA 1YASA 4ARAA 5HF9A 2J4CA 1N5RA 1GQSA 5AK6A 4UFPA 1XROA 2VTVA 4JNCA 4Z49A 4C4YA 1AZWA 4ARBA 2O2IA 2XMZA 3D5EA 4C89A 4H7KA 3G02A 3KDAA 4HAIA 2WJ4A 1H2WA 3QZUA 1MX9A 1A8UA 4EY7A 1USWA 2K2QB 2Z3WA 2QVBA 1XZBA 4OU4A 2VJAA 4NS4A 2JGIA 1JJFA 2XQIA 5FP0A 3K2IA 2PSDA 1EHYA 4M0MA 2QJRA 2BUCA 5SYMA 1E3QA 5HFAA 1XQXA 3H2KA 4P08A 1JU4A 2V9ZA 2D5LA 3TRDA 1K6EA 1SC9A 3HZOA 4P92A 3BE8A 2BFNA 2WUDA 3AIOA 4S0XA 2RIPA 5ALKA 3F98A 4BCDA 1QIJA 4U2DA 3G0GA 2G5TA 3AJAA 3QH4A 3AZPA 3BIWA 4C87A 3IUQA 5LZ4A 1YAJA 1R50A 5IVHA 1DT5A 3R3UA 2QXUA 4WY5A 2J4FA 5JZBA 5JATA 3CXUA 4KACA 1EH5A 2OLEA 3FSGA 5KWJA 4TVKA 1EK2A 4UBKA 1UK8A 2JGJA 1UXOA 5HCUA 3D3NA 5AI4A 4B0PA 4IO0A 1ODTC 2ZYSA 1ZJ4A 2XUPA 5CBKA 4G5XA 2WIGA 1WB5A 1BEEA 3SC2A 2OCGA 4QDUA 5AO9A 4L0CA 1Y37A 1GKLA 4P9NA 5LZ5A 3WK5A 3EF3A 4X7BA 1R9NA 3F67A 3L1IA 3SWWA 2OQIA 2GYVA 3LCRA 3NUZA 2Z3ZA 5JZSA 3V1MA 4GI1A 3GFFA 1CUXA 1AQLA 3D2BA 2XUKA 2XUGA 4HXFB 1E8MA 2JIDA 2R8BA 3BXPA 5ALPA 4MWSA 4UHCA 3E3AA 4QZVA 1XRRA 2B20A 2EEPA 2HRRA 1ZI6A 5AKKA 4CFSA 1TRHA 4W1QA 1BU8A 1KEZA 4A16A 3H1BA 2W22A 5JD5A 1EB9A 1XFDA 3DD5A 2O2HA 3A6ZA 5EFZA 1VE6A 5DTIA 2GBFA 2ES4A 3MUNA 5AH0A 1OXMA 1XZAA 5ALUA 5AIBA 3DOIA 2QJWA 3ESBA 3S8YA 1QFSA 1AUOA 4E14A 5JAHA 3TEJA 4UBOA 4U2BA 3K9BA 1XQYA 1ZJ5A 3FCXA 2CB9A 4Y2TA 1GT6A 2HA7A 3DQZA 4PO3X 1ACLA 5CXXA 2QMQA 5ALJA 5AM2A 4Y2XA 5JYCA 3N2ZB 5AKEA 3YASA 4N8SA 3DL4A 2NW6A 3IVMA 6YASA 1VKHA 2ZVDA 5D3ZA 5ALDA 3NWOA 2WHRA 4X3CA 4UHBA 1G66A 1VXOA 4U2GA 2OG1A 2FJPA 4HVTA 1VZ2A 4GEGA 1IZ7A 5E2IA 2HM7A 1P0IA 2DR0A 1YCDA 1SCQA 4X97A 3I2GA 2OCKA 2ZJFA 5CW2A 3HRHA 3KWFA 3V48A 4H0CA 1W6RA 5JIBA 4BVJA 1UT6A 5LZ7A 4CG3A 1HDEA 4HTAA 4BAGA 3WQHA 1UKCA 3HXKA 2GZRA 3C6ZA 4KRYA 5K5EA 1QIGA 4HXEB 2WTNA 4RE5A 3EQ7A 4GLBA 4UBJA 3D59A 4IHAA 2VT6A 3F96A 1IMJA 1GGVA 4B0OA 4B7ZA 1F0PA 2GZSA 2XUOA 3SK0A 2ACKA 2WQZA 5K3FB 4EY4A 3G9UA 2HRQA 5ALNA 2QUAA 1HPLA 1BROA 1DQYA 5ALFA 4BZWA 5EHNA 3GA7A 3C8DA 1XZJA 4ITVA 2PUHA 3C5VA 1UOQA 3D2AA 2IITA 4Q82A 4BP9A 4U2CA 3H2IA 5BV7A 2WUGA 1QIFA 5CH3A 1ZGCA 4EY6A 3HJUA 1P0QA 4H7EA 3H2HA 4L72A 4N8DA 1DT3A 1JU3A 4KE7A 4Q3LA 1E89A 1XLWA 3C6BA 4LYEA 1CUFA 4F21A 1MAAA 4HRYA 3VXKA 5ALRA 3M83A 2QM0A 5JALA 4L3WA 4U2FA 5F4ZA 1LNSA 1CUWA 2BJHA 2LIPA 2JGKA 2PPLA 5CXUA 4Y2JA 3BIXA 4MQLA 3WKCA 3HEAA 2OPHA 2ACEA 5ESRA 2YXPX 5EIEA 1SOMA 3QM1A 3P2MA 2WG0A 4KE9A 4B82A 4DYHA 3G0CA 2HADA 1A7UA 5DTJA 3HI4A 1QOZA 4DIUA 4JYPA 2QTBA 4WDRA 2XQGA 4WFIA 2DHCA 1GPKA 4BC0A 3C6YA 4BCCA 4XWGA 3M81A 3V1LA 4CCYA 1A8QA 1MT3A 4X00A 2QKYA 2R11A 1JMKC 2PSEA 1EDDA 3STUA 4B9EA 1K63A 2WU4A 3OG9A 1CIJA 2OXEA 2WKWA 1CUZA 4N5HX 3W9BA 2PSFA 1YS2X 1TQHA 1WB4A 5AK3A 1XQWA 5LKRA 5AKGA 4XX1A 5ALIA 5AICA 3ZLVA 4WFKA 3G7NA 1AGYA 4MWTA 2ZJ7A 4WJLA 4B84A 3DYVA 1QONA 2BUBA 3AILA 3WK6A 4K6GA 1K8QA 1R88A 2C4HA 2BCEA
chains in the Genus database with same CATH superfamily
4JUAA 3G7SA 3AINA 1EGAA 2UYYA 2CVPA 3RIHA 3W4IA 4LFBB 4XSGA 3MQ4A 2AN5A 4JJAA 4P5EA 3UATA 4B3BA 3WGIA 1O1YA 1M2KA 2FJ0A 5MN6A 5BN3B 2OAQ1 4IDEA 4H9GA 2DBYA 4IOJA 1XZFA 2CE2X 1JJ7A 1JR6A 3K2QA 3OCXA 1KI6A 1YOVB 2Q4BA 3BXZA 4NK5A 2J5KA 4N3CA 1KQNA 4B2PA 5EJIA 3R3ZA 4IXDA 1RWBA 4JYMA 2PO5A 1CY8A 1T1IA 1Z2DA 2QAIA 2BF7A 1LLDA 4HCJA 5TVGA 1XHFA 3UAVA 2ROQA 1CJVC 1W59A 2H4FA 4MKIA 3G2OA 4FHEA 4WBSA 5CXSA 3DC2A 3WLNA 5BWLA 5C8YB 3A6JA 3O8RA 2X5XA 5J4HA 4XYMA 2ZZNA 2RBEA 3BFXA 2GN4A 2AWOA 3VJKA 3HKEA 2VDRB 2VT7A 2BEUB 5EWMB 4RKQA 5KVCA 3LUPA 2RAFA 2MINA 2I4IA 3E6AA 2XDYA 3VRHA 5F9FA 4P4GA 3PQFA 3PX2A 1OH7A 1G8HA 1WXDA 1K8ZB 3QKTA 4LTDA 3CH5A 3FUVA 3N2LA 4CL3A 2DECA 2X58A 2YJ5A 3CCBA 2FMXA 1XRSB 4F4DA 3FWZA 4M1SA 4TX1A 1LX7A 1W4LA 1VXRA 2XOXA 3UAWA 1PYOA 1V43A 1SCNE 2PM8A 1Z0SA 4I9UA 3VDQA 1ODCA 3AYZB 1V8BA 3JQEA 1GCAA 3OZDA 4R1MA 1YHYA 1P3JA 2W8BB 2XV1A 3F7MA 4OOEA 4WKCA 2QT9A 3SIXA 4DRXA 2AJTA 2ZAOA 3V7YA 4IP0A 4PLHA 3EZNA 1LF0A 3FYUB 2WR8A 2YNMC 1LBEA 1Z2PX 2AFRA 1C81A 4IJQA 3ZGOA 2RONA 1M2WA 2FZVA 2ILVA 3IE0A 3TZQA 1U4SA 3NGMA 4RO0A 4ESOA 3D43A 1HOTA 2DT8A 3AMVA 4YTEA 4N0EA 4YEDA 4DG8A 1X0VA 1P5RA 3S4YA 5AM3A 4DILA 1I7QB 2CXNA 3VR3D 3AETB 2FB9A 4TPKA 5B3JA 4I6GA 4DQKA 3T06B 2Z4RA 4DMMA 2OQRA 2WOOA 3NWEA 1N75A 2AI3A 5GADl 2P30A 4I1YA 4MPDA 5DHPA 2ZI3A 3MBIA 1E64A 3OQJA 3QVGB 3UH0A 4AUNA 4F3RA 4P5DA 2X1LA 3LLCA 4DLPA 5I4CA 3VHLB 3II6X 3PC7A 3L8DA 3TJRA 1QV6A 2O4UX 1UDRA 2IIPA 2OBYA 4RDHA 2HSGA 5E7QA 4BVLA 1L5VA 1UK7A 1GPWB 2QQFA 1AKYA 1GQ2A 3KP1A 3LNTA 5DEOA 3WIBA 5DMXA 2WWGA 3K7EA 1Q1ZA 2BHRA 5IXYA 3AKCA 3I2HA 3IIKA 4F6CA 3G0IA 3IAFA 1A9XB 4UPDA 2XWJI 2J9FB 2H0RA 3QKIA 4Q9HA 4EBBA 3LOQA 4J4HA 4RS4A 5IZCC 1DVRA 3I9NA 5CTJA 1OQAA 4UULA 4EAQA 1E92A 2YWEA 2ID8A 4FYYA 6CHYA 3MERA 5LXTA 5EI5A 1KYIA 1AF7A 2AH5A 2JGAA 3IQZA 1I4OA 4D6YA 4XX0B 1P33A 3KSAC 4ZCSA 1VKRA 2XCLA 1CY2A 4ZTZB 3AIIA 4FEYA 4LHXA 2Q1SA 4X91A 1ZJJA 5C1DA 3W77A 2GN2A 1NNUA 2ZTVA 2JAXA 3LDGA 4X6LA 1FSSA 3RTAA 1Q95A 3PTAA 4Y9SA 2HU8A 4EYSA 1D04A 3ZWQA 3T15A 3R7SA 1UZAA 2PIDA 3IAUA 2VSQA 5KTYA 4EMUA 3H1GA 4HN9A 4U9HS 1E6EA 4POAA 4UAJA 2B6NA 4JLVA 1VBNA 4YRLA 3I8OA 4Z0TA 3J81A 2IDKA 2ZRDA 2AFIB 1O94D 3ACDA 3OTQA 1V47A 5TGZA 3RDPA 3WO0A 2B36A 1TCVA 4G4GA 4QNNA 1RJDA 1FP6A 1WSWA 3M6WA 3MT0A 4FYXA 5KOHA 1HR0B 2I1LA 3JQ8B 2G8LA 2RAUA 2F1JA 3REFA 4M46A 1LTHR 1LGYA 3ANLA 5DYTA 3TEMA 1YQDA 3GMTA 4YLEA 4B8WA 5ICMA 5K0TA 1N9GB 4HF7A 2G1JA 3FCCA 2DCUA 2VYND 1WHTA 3ON5A 4TMXA 3ZCXA 2W48A 4RA6A 2QROA 4Q18A 4FHCA 1NQUA 3PR1A 4MKHA 3SHOA 3PDHA 1YDWA 3TZHA 2EKPA 5HF8A 4UXHA 1V1RA 2BMEA 3DAFA 3EG5A 2PL5A 1R8YA 1U9IC 3JD4A 5EXXA 1W0KD 4JMPA 3ICCA 3EZFA 1M6VB 3I6YA 2BFPA 2E5FA 4FMDB 5DIZA 2IV2X 1BRTA 1EFRA 3CWZA 1FSPA 2CDNA 1BE1A 4MVJA 3O5AA 3NNNA 1VYTA 4HMOA 1T8SA 1YKFA 5BQXA 3PNSA 4G4JA 3Q2KA 4MS3B 4OQLA 3T0GA 4DPMA 1SKBA 2XMPA 4YCDA 3UMCA 3UOGA 4BVHA 2JLZA 2F8TA 1GCIA 2WQ6A 3C48A 1EXNA 4K8OA 4PIPA 3RUDA 1P1KA 1C4KA 4JZKA 1VPLA 4YWHA 2PZEA 1EEHA 1M0EA 4INOA 2ISQA 4PQYA 4R31A 3DUFA 4X9XA 4EUNA 4QHTA 121PA 1IB0A 3FGOA 4X65B 1NE7A 3B3QA 5LSAA 5K0CA 1HL7A 1ZGAA 1H2XA 3Q5GA 4OB8A 4Q9IA 4DMLA 3CX7A 1EX7A 3EEFA 2Y92A 4DIFA 1HNXB 2R00C 3DV9A 3RK4A 1LSJA 1GITA 1YRWA 2XD4A 1TZBA 2H1WA 2YS7A 4K3UA 4PXSA 4X1IB 1N36B 3ICPA 2IODA 1XXHB 3K0AA 3MNFA 3RLIA 1B23P 1BOFA 2DUMA 2ZSJA 4FPXA 1MNAA 1TVKA 1V3UA 2QHXA 1Y8AA 2FPIA 2VHZA 4X6XA 2IY9A 3ZQKA 4LQ4A 4IGIA 1KEKA 4IM7A 3QA3E 4P54A 4F3NA 1CS4C 1L7OA 3ROZA 4IZIA 3EVDA 5DMHA 1ZAKA 3CRW1 4C6SA 1UUFA 4FCTA 1XAHA 3L84A 4A23A 3OFND 3ZLTA 5U4XA 1UR5A 3M3PA 1MXFA 3U0VA 1S01A 3FNGA 3PWTA 5FEUA 3OX1A 4FW9A 4A6EA 4BHTA 2YR0A 5C1PA 1N0VC 4TV8F 2GVDC 2XVXA 3OA2A 5DM60 4QSMA 1SUWA 4J6EA 4J07A 3L8EA 4BZZA 4YDQA 3PCXA 2HLNA 1BFUA 5G41A 1GAQA 3ESDA 2IUFA 1IJKA 3LCJA 4IIEA 1HYBA 1ML4A 1T1JA 4NBRA 4QRDA 2C3OA 4P4SB 4YFVA 1QCYA 4CTOA 4IUBS 4AY5A 2QTAA 2ZTSA 1E3MA 3I37X 1H6AA 3MCVA 5DGIA 1LVHA 4K86A 1X39A 2F1HA 1Q3HA 5GTDA 3GEHA 1NR1A 5CAEB 4XUDA 3DC7A 2GK6A 2AOWA 4WCFA 5BRAA 4NDAA 4ABYA 1N2IA 3FFXA 2W8ZA 1POXA 3HCPA 1SC3A 3RS0A 4C4ZA 4JL5A 4RNCA 1LX6A 3A2MA 3K1YA 3EQ6A 5CA0B 1RWQA 5AP9A 1BEUB 3ND7A 1EVEA 1IHOA 3V00A 1C4OA 2OOSA 3DVQX 5ETJA 3U7FB 3HLYA 3K5PA 5GGXA 3H3XA 4IJ6A 2P0YA 5CYFA 3T7SA 4LJ4A 4ER6A 1QQTA 4HL6A 1UC4B 2HEGA 3E18A 3EE6A 2BHNA 2GJSA 1R3DA 2KE5A 3CZMA 4JXKA 4PONA 1V7CA 5D86A 4FFVA 3OEHA 1NFRA 3AFHA 1RPZA 2GF0A 3OOHA 3DULA 4K6KA 1JHPA 1DG1G 4JEUA 4LYHA 1NUPA 1JT2A 1QDUA 2QSZA 2AR9A 4HHEA 5JANA 4H31A 4BNFA 5FWXB 1CUUA 2OVBA 3DTVA 2VJQA 1V1MB 3GPBA 3I1FA 5MGNA 4EG3A 2WM2A 3Q6IA 1N7HA 5KZMB 3L7BA 2W2LA 2N0SA 3I04A 2XLCA 5GJBA 2O3TA 3KOOA 4U0JA 3KR0A 4Q4HA 2XVAA 4B3TB 4CEIB 3ZDXB 4DBLE 1PWEA 1KKUA 3AX6A 3SU8A 3ZE7A 1C7FA 3SXJA 3CTPA 4DLVA 4Q12A 4ZALA 4AJPA 4BO0A 4UFOA 3LHDA 4MLCA 4UXJA 4UUQA 1W76A 4I8IA 1Y6FA 4CKWB 2LR0A 3P0JA 5T4FA 3RV3A 4LXUA 5EJ9A 2MMGA 2OHJA 4AN0A 1DDOA 2RARA 2Y05A 4KU4A 1GLNA 1QC5B 4OFWA 4RD3A 2WUEA 3EIUA 3OFKA 3VPCA 1W2GA 3NTRA 3VNQA 4TKVB 1RXYA 2SNIE 2LTAA 2O59A 4UC0A 5F73A 4PNEA 3OMXA 3GZNA 4NU0A 3T5BA 1ZVJA 1Z29A 4RPJA 5EJEA 5KYGA 2W71A 1SBHA 4CJXA 4MEAA 2R7LA 2DY0A 4NZZA 1GRQA 2QY9A 2GT1A 1ZWLA 2CCJA 1UMBB 2AJBA 4XA8A 2VJDA 4W9RA 5CK4A 3S0JA 3U7EB 2ACVA 5TEVA 4ZFNA 1Q1QA 3B6MA 1PBTA 1XRPA 3RAGA 4D1YA 3ANYB 4DCJA 2VCEA 2IGBA 1VSVA 3SAJA 3W3AD 1UJ2A 4WY8A 3SDZA 2EGGA 4QRIA 2W6JA 3I9JA 4P6VF 3G5TA 3VNSA 5I4KA 1BNCA 2SBTA 3UEOA 1V39A 5CP8A 5CPFA 1LA2A 4NAVA 1ZGBA 1L4KA 3KXDA 4KH0A 3FGZA 4RFSA 3O91A 4BGVA 2I4LA 3H4VA 1AURA 3SVTA 1G2OA 3HVKA 4GXTA 3U4QA 1O5OA 1D9ZA 2PJDA 4YPFA 1CX9B 5G40A 3RJ5A 4X93A 3OEYA 4HJXA 4YCMA 1PR4A 4DV0B 4BB6A 3THYB 2WW8A 3U7QA 1B8VA 2PMKA 1LI5A 1QS0A 2ZXEA 3I28A 4JBWA 3G17A 1F2UA 2Z8XA 1KZ1A 1QRRA 3ISJA 2C96A 1E77A 1LS1A 1TEHA 3MAJA 3ZR4B 2QTVB 2W2MA 5J4YA 1G0OA 5KYXB 2R8XA 4R9NA 5CB4F 1ABEA 1E3LA 1TYCA 1KC3A 1Y6RA 3AOEC 4FHFA 4HYEA 4JQYA 4NH4A 5FUBA 1E7QA 2C98A 4H3KB 4KO3S 3KQHA 2GCGA 4WVFA 1DINA 3FHCB 3JVIA 4MJLA 1BQ4A 5GMOA 5HKKA 2BY4A 3SQNA 4CQMA 5G3YA 2AQ8A 3SYLA 2AGVA 1U0FA 2UXBB 1RFLA 3ZTYA 2CWWA 5TS2A 4OQDA 4J7CA 2HNAA 1MJ5A 4CE6A 2E4AA 4IINA 2W4QA 4HK4A 4ITUA 1PV1A 1PSWA 1L7AA 1E2GA 2DKNA 3PA6A 4QOHA 4AJKA 2P78A 1ORVA 2IEGA 4XCVA 2OGTA 2KLHA 2L19A 3LCCA 5CX4A 3RS4A 4KE6A 4TSFD 1DTEA 3AR6A 5K2MA 3C6QA 3VZRA 1WETA 3LVRE 1H1TA 2VWQA 1OZAA 2R6GA 2B78A 5T6BA 1VGQA 3OZCA 1H4QA 4Q4JA 4B8ZA 2BKVA 2XWSA 3D0KA 1GL7A 1OBCA 2J5BA 2P0EA 2ZIUB 4Z1MA 4OI1A 3V33A 4EM6A 3NUGA 2ZRAA 3TCXB 4RTQA 2GJAA 1D4ZA 1Y5LA 1DQSA 1U2RA 3ELUA 3EZXA 1BVHA 4BNDA 1QNFA 1BFKA 3JD2A 4DLXA 1HDIA 2HBYA 3OZEA 1JR3A 4I9GA 4JC5A 5ECDA 1YVRA 2W2VA 3OOSA 5AW1A 5LQDA 2FWIA 2GWHA 3I6ZA 1CP3A 3BEOA 3WFIA 2JBAB 4AKGA 4LOIA 1RRGA 3ICQB 1F8YA 2QE7A 3TAHA 3GLFA 2YRWA 2OC4A 4O4HA 1C7JA 1NBIA 3NT5A 1HLDA 5DBEX 3WKEA 2W6MA 4N12A 4Q3CA 1H2AS 4MV0A 5DCWA 2ADFA 5E4TA 1A4IA 4JJKA 5EHQA 5GV7A 3ZHOA 3ZWMA 3DJFA 3MMZA 1SUFA 4XDYA 3TI9A 2R65A 3G0BA 4HDMA 4YRTA 4YIKA 4J76A 5LU9A 1AIPA 1U3DA 1ZXXA 3BH7A 4B87A 4CR6A 5GWXA 5K8LA 2J1LA 2DUWA 4OVKA 1V0JA 2GPBA 4YJHA 2VNIA 4RJ2A 4A36A 1THGA 1W5AA 2LXNA 2JH3A 3D4LA 4QYIA 3T1VA 2CY0A 1U0NA 1TT5A 1N7IA 4E32A 1AZSC 1IUOA 4MIOA 5KWIA 1GZ4A 1E9CA 2CFOA 4M37A 2I4NA 3PNVA 2CCGA 5EXTA 1PTJA 1X9HA 1Q6YA 4RPHA 4L5YA 4TS3A 5B4VA 4NFYA 3WNQA 4LGCA 2JFWA 4OH1A 1V8OA 2W6PA 2HIAA 5SYAA 1I7DA 2VATA 1RWXA 1H5UA 5CVVA 5H1YA 1JW9B 1XC7A 4BB9A 2I6XA 3EG9B 2IS1A 1J7JA 1Z5ZA 4CVNA 2QTHA 3CLTD 1XCJA 1P7CA 3W5IA 1YK0A 2NN3C 4H6VA 3DBLA 3JQ7B 3JYOA 4WV3A 3SXPA 2AZMA 4OP3A 5EIFA 4CKEA 2XCIA 3CF0A 5DX1A 3WLLA 3BIOA 4EO4A 2C9BA 1ZCFA 3GJXC 4X1YB 1YQWA 3B36A 2A5YB 4S1WA 1R0RE 4FYVA 3ZVNA 3DZBA 1DG9A 1RI4A 1QCZA 5DJ5A 1LPNA 4GMHA 3WRXA 4LC0A 1NDUA 1PLJA 2ZSEA 5CNIA 2OO5A 5AQ1A 2H52A 1H42A 4URVR 4DY6A 1KJ9A 2V45A 4ALNA 3SICE 1ENZA 3K09C 4I1RA 1H5QA 2IEZA 4BNYA 4P0TA 3QU7A 5U9CA 3MGCA 4IFBA 3K2EA 4FGWA 4CV3A 2Q8NA 1BO6A 2IYEA 4CV1A 4CLOA 5IXJA 2RE8A 2R96A 3DWIA 3X1ZA 3INTA 3O4IA 1M7HA 1P2VA 3ZH9B 5I48A 2NUAB 1U9JA 1YA6A 5TPWB 1K27A 1W49A 5EE5B 3B70A 3BJEA 3VR5H 4BV3A 3IT1A 2HSJA 3IAHA 1RXWA 4RELA 2HFJA 4XFDA 2NVUA 1NUSA 1M10A 2ZAIA 3R2JA 2LBPA 1NT2A 3L6CA 4PU0A 3T0IA 3T3MB 4PNZA 1Y1RA 4E4TA 5AKXA 3QVMA 4PX3A 3KQPA 1W93A 5CMLA 1KFKB 3LX8A 1YRBA 2F48A 1OD6A 3DE6X 3QK7A 2RK4A 1BMDA 2C59A 3ZE0B 3X44A 1QMGA 3E0XA 3G6KA 1PR9A 3UAXA 4QDTA 4DUYB 2EW1A 2QVZX 4LYFA 1D0VA 1YL5A 3AUFA 2NUBA 1KFCB 3KJEA 2VRWA 4YAJA 2R1UA 4GFDA 3BD6A 4GLOA 2C5AA 2MYPA 4PC1A 5B37A 3S5JA 3LGAA 4RLSA 4LF8B 4X61A 3C4QA 4FDMA 4BDSA 2PX0A 1L7BA 2BMDA 4XASA 3W79A 3ZW8A 5JQGA 4X41A 3H18A 5U1PA 1AKNA 2QRUA 4F4CA 3L07A 1S8FA 1X7WA 1WY5A 2XMBA 1FUUA 3AJDA 3NT2A 4U00A 1O6FA 2BGIA 3SHWA 5DNCA 2JLYA 1UMCB 1E1YA 5EYPA 2AJLI 3BIJA 1SCAA 1E5DA 5K01A 1JQAA 4RBNA 2ZUWA 3E4CA 3N5CA 1AG9A 1FRNA 1Y42X 3BCSA 4R2LA 5AHRA 1T5BA 1HT1E 2JAUA 1VMIA 1F0NA 1Z6AA 2VTDA 2XNJA 3BRWA 4R0VA 5A1JA 2GQ0A 1KJ8A 2JDIA 3FBGA 4HY3A 5KNBA 3SZ3A 1DDIA 5KTNA 2BMFA 4EZEA 4DCTA 1VHTA 3LP8A 4MHSA 4WY2A 3ILHA 4CKXA 1KO8A 4DTCA 5PNTA 5T6MA 3QWBA 2QUIA 1CHNA 4X0EA 3TB4A 4S3MA 1XLUA 2JGRA 4B3IA 4GQAA 4Q1BA 4TRRA 4QPPA 1X15A 1BDIA 4G1VA 1W4ZA 3IVXA 4E30A 1R5JA 3AESA 3CN9A 3H5RA 4X44A 4BASA 3AKZA 2J67A 4UMEA 1MOZA 3S3TA 3DSRA 1WDTA 2QYTA 2V6MA 4PG8A 2FDCA 3ANMA 4M49A 4OB7A 3G8AA 2RGUA 5D85A 1AKVA 3K71B 1GTL1 1S4MA 4QFDA 1QIHA 3UXEA 4OIFA 3KTAB 3DV0A 3GPIA 4YHBA 2ODAA 1V5IA 3VC2A 1V71A 2QL6A 3K8OE 1ACJA 3T1QA 1ILEA 1VFNA 3QWHA 4QULA 2V96A 4EW2A 1DC4A 2JVKA 4LHZA 3IULA 1U7TA 4DF3A 3DZIA 3GBPA 3WYGA 2O0LA 4BO9A 1R16A 1PK9A 4BX0A 4D0SA 3IPXA 1W46A 4FR2A 1CQXA 2Y27A 2ZRIA 1OREA 4WFJA 1NVKA 2CNKA 2LCIA 3PPWA 3S27A 4LSZA 3IMGA 5B5SA 2DFDA 3CNOA 1K5PA 3PS9A 3RARA 2IH4A 5AIAA 5A02A 4C3UA 4CN8A 3AK4A 1JQLB 4G01B 4IICA 4OJNA 1P5HA 3ER8A 3OCWA 1E9BA 4DB4A 2ZIEA 5JS1A 5CJPA 4WASA 1LJ8A 1MO5A 1N34B 3WJ7A 3ZY2A 2IS6A 1WEKA 4Y0VA 4OKNA 3TKYA 4EYEA 5BMVA 3QQPA 1XCGB 5K99A 4N54A 2ATXA 1KC1A 4GHWA 3PFBA 4BAZA 5H9WA 4LF4B 4ZICA 1GR0A 4RVFA 4E3ZA 1DL5A 5LP6C 4YRAA 3W78A 2ZYHA 2CJYA 4X84A 1NXVA 1Z4OA 2G6BA 3PHIA 3QKSB 2ONCA 3L6RA 3IPAA 3DBRB 5DH9A 3K5HA 4TKLA 3REQA 1TIKA 1YVUA 4ENWA 5DYWA 2C07A 4L9SA 5CT4A 4YAIA 2H4HA 4P82A 4W99A 4DGQA 1QAOA 2WM9B 5BUSA 3NU1A 4E09A 3ETGA 4V3CA 1BMTA 3VDXA 1CLEA 3O82A 4S24A 4IRUB 4L8YA 3UQZA 2A0XA 1HE8B 3C7DB 3PFKA 3WGZA 5LOVF 2Y93A 4M0DA 2WNSA 5J2TB 5A0FA 2GOYA 4QPDA 2IYUA 3KL2A 2AXEA 3PTLA 1G3QA 4HQOA 2ODWA 1ESCA 2JB9A 2B61A 2BF4A 3PPXA 4TZTA 2K2WA 5J40A 3S2IA 2BBOA 3WGTA 4B34A 5LKAA 4TTTS 4KSCA 3VYSB 2GPNA 5JXHA 4W5RA 1O87A 2OY0A 3GVHA 5G1OA 4DABA 2EIXA 4B3MB 2J6IA 3FMPB 1IY1A 5HIJA 4QQ8A 2DH5A 2MWMA 2YC2C 3E9YA 3L6DA 3M0EA 4HWPA 3PGA1 4BNMA 2XA9A 1I13A 2Z2JA 3OQ1A 4F91B 3JQFC 2POQX 3JRNA 3LIPA 3N8KA 4EPXA 1SBYA 4ZOLA 1L5SA 4ZEVA 4L9AA 3A7EA 4H6WA 4PWZA 2XNDD 2FLWA 5TMBA 4LZLA 4ZMSA 1NURA 2QTCA 3SVZA 5KYUA 4DADA 3OZUA 4D4MA 3BK1A 3PEEA 4HH4A 4BXOB 1YB4A 1EDEA 1DUIA 2VDKB 2UVQA 3M6LA 3T7TA 2Z6QA 4WDQA 3KYJB 4I1PA 3PZRA 1V37A 5CVUA 5IANA 1ZEMA 5JZMA 4FEAA 1B8OA 4EB6B 1DMSA 1EA5A 5JEEA 4C4OA 2PZ8A 3COPA 5HFNA 3EIEA 5K3BA 4BWFB 4YUZA 4DV5B 1S1MA 3ZQ6A 1LPMA 1KGDA 2C4WA 3OE1A 4YT5A 5LLSA 1IBCA 1VZ3A 3AERB 5H80A 3SHFA 4P86A 1EUYA 4ZODA 4WLOA 2YJTD 5HG0A 1E4EB 4BCBA 3D3QA 2I9KA 3NHLA 1UFOA 5I7SA 3W5CA 3WYDA 8ABPA 1XDGA 1ZM7A 1QZZA 1B93A 2CDAA 3BFJA 1OU0A 3Q0EA 1N2EA 5F3RA 3ZZNA 5FRDA 2AG8A 5E8JA 3TKLA 3PFHA 4MUHA 4FCCA 3O4VA 3P96A 3SXUA 5LIPA 1WPXA 5LQCA 3QI7A 2RD2A 1EM6A 2GDZA 2KBFA 1VJRA 1MCZA 1V16B 5JSQA 2XD9A 5DGCA 2X5OA 1DWQA 1GR1A 5TEWA 3FVVA 5DHTA 3TIVA 5M04A 1JKFA 3HBNA 4FJ1A 1CUYA 4A91A 4Q9DA 2R1ZA 1G21E 3DE4X 4P2BA 1RJWA 2H59A 1YKSA 5LR6A 5BT8A 3AI1A 4GOKA 3GLVA 4ZC1A 3JW8A 4AF8A 1WNFA 2OBFA 4I9HA 1NMQA 3ER9A 4UTXA 4DPLA 1UZUA 1WZNA 3GB9A 4IRXA 5C8DA 1DX4A 4QDJA 3HBJA 5FNVB 2FPPB 2G72A 4Z9YA 5F5NA 4L51A 5EGNA 4O4LA 2C94A 4WNYA 1N8TA 2PMDA 3WI7A 5J1TB 3LLVA 4O4IF 4EHKA 2W6ID 1KNXA 1IXYA 2WB2A 2ENUA 3QFSA 4JOCA 1SU8A 4KN8A 4LWQA 2YXNA 4XEUA 2AMJA 3PUYA 3JQ9C 4C9BA 1WM1A 3O2NA 3PNLA 2VH1A 3OSUA 4LI3X 4TN5A 3U44A 2OWDA 4C0AC 5FNVA 4L3OA 2ODBA 2VT2A 5BVHB 3SEAA 1W8DA 1ZIOA 5I9MA 4MSUA 1PZFA 4I8XA 5C8ZA 3B78A 4RVCA 4G5OA 3CO5A 3ZXUB 4XAQA 4ZZ3A 1J5PA 4JC4A 4GBED 2QX7A 3A05A 4KDRA 4M54A 5TQ0B 3ZI7A 5HS4A 2IP1A 1QYXA 4ECAA 5IKXA 4O8ZA 4TXHA 1DAPA 1I4WA 2ZE8A 2PUAA 2WFMA 4E13A 3ZCUA 2FW7A 2QI9F 3HYCA 1IJFA 5DNAA 1LPAB 1OXBB 1X7YA 3LF1A 4F9FA 5IM4A 4AY2A 4PINA 2FSIA 2PKRA 4W7HA 3QUAA 5K4HA 3NI2A 4ZVMA 3EGDB 2NO7A 4IMPA 1P1CA 5THXA 4BTLA 1PSZA 2CNNA 4TV9B 1P8JA 3FGPA 2BELA 1J8YF 3H5NA 1NN3A 3HKBB 4QOJA 4LOHA 4JIMA 1DEXA 2PU7A 1N1GA 1WSBA 2C8KA 2WIBA 3BKXA 4KMMA 2JIBA 2GN1A 3OI7A 2CLMB 1ISIA 1XVIA 4HQLA 3F6YA 4QYWA 1KDPA 5K3AA 3C5CA 3S68A 4MARA 5DBOA 4GG1A 5EZYB 4FNOA 3MZ0A 1CS0A 3QMPA 4S35A 4MYRA 4B3CA 2EFDB 2O1EA 4MW9A 4DR4B 4A0GA 3RG2A 4NBVA 1SVMA 3S29A 4GPTA 4HVCA 2VXYA 2VJYA 5EP2A 3RCBA 3GPDG 3U9SA 1CUEA 4NONA 1G8KA 1VCHA 3ANTA 1C1XA 3L0BA 3VZQA 3ORQA 4IDPA 5HIIA 1SB8A 4ENPA 2NPOA 1SCJA 5EXSA 2V9CA 2OAP1 5EXPA 4TWRA 5DWDA 1AB6A 5CH5A 4TLEA 2HT6A 2XBUA 3NHUA 4U6NA 1UOEA 1VYHA 3PXBA 4HUJA 1O0CA 1CR1A 5HM6A 4X7RA 1N57A 3IP3A 3CUKA 1TTPB 5HKBA 1SEPA 2D1QA 3AM1A 3ZGVA 1Z38A 3ANXA 3VO1A 3RRYA 4NZPA 2IYOA 1ODIA 4ZZ2A 4YJFA 3GIWA 2G88A 2MYTA 3RBZA 4JKIA 2VG8A 4DPKA 4NDNE 3K9NA 4DWOA 2WAYA 2WWFA 3IDAA 3WAJA 1QZXA 2CVFA 4DR1B 2LW7A 1ZMRA 5JRDS 1DV2A 3OJWA 2PUWA 3LY9A 1T26A 4ZZ0A 1JHQA 2I91A 4XGRA 2PZAA 2PR7A 2QP9X 1ID1A 2VAVA 1ZD1A 2AFHE 4GUDA 3SOZA 1HH4A 4EUSA 3THSA 2QDXA 5FFNA 3OC0A 4NQRA 1N9KA 1S8OA 3AU8A 2H1HA 2OHFA 3OJXA 3P2EA 4MIYA 2GWRA 2XWBF 1N2SA 4MMZB 5J63A 3GV0A 3Q0IA 1YDGA 4BMYA 1CKEA 3P4YA 3WLKX 2GBPA 3QWIA 4BRSA 4QUBA 3WB9A 4ZI7A 2Z0MA 4RTLA 3QX8A 1CUGA 4PLVA 2PBFA 1TCAA 4E5DA 4MK4A 4N7JA 1IAVA 3HJGA 1JDBB 1OILA 1D6SA 1ZIYA 3C1UA 3F5DA 3KUDA 2C82A 4LVCA 4MULA 2VFAA 4GP9A 2ZBQA 3GRVA 4PZ9A 1KJZA 3OY7A 3KU1A 3KAKA 4EPYA 4UNRA 1WCWA 2ZBEA 3QG1A 4M8KA 4C0BA 4RZIA 2ZDGA 1B3BA 2YW9A 4D46A 4FKBA 2J6HA 2B3DA 1OXUA 1O03A 3AWIA 4RUKA 1LTQA 1Q21A 3I1YA 2ODNA 4POOA 1VG9B 1RWOA 4WZZA 3K94A 2BFEA 3H4MA 5DSTA 2Q5FA 1GGFA 2NZYA 2TSYB 3STWA 1S2LA 1WW3A 4GX2A 2ZLBA 1MIOB 3HN2A 5BXQC 4AF7A 3QMVA 1OW3B 3U17A 5EMLA 5T4EA 2C3YA 3DAPA 3MCZA 3NYWA 5JPDA 3LS2A 1I2BA 4GMDA 3NHKA 4IWYA 3FNEA 3LNCA 3FNFA 4RMGA 3SM9A 3AVWA 3P2JA 1AY0A 1AKEA 4H7PA 4HUQA 4L28A 5EE0A 2Y1LA 3RS3A 5IKEA 4L73A 3NJ4A 1MH1A 1PJ3A 4H6XA 4NLLA 4ARSA 3JWGA 5KWSA 2CGEA 2R9VA 1SQSA 3VH1A 2A0FA 2ZB4A 1C9NA 2OO7A 3KQUA 2GTPA 1COZA 4HLNA 2PFSA 3PVZA 4PYOA 4I5FA 3WKDA 5ADVA 1U8EA 3DOOA 2YKGA 2V7UA 4ND3A 1LPOA 5EZ5A 3L49A 4LY3A 3WBFA 2VJCA 1QHGA 2HIGA 1VQ1A 4RZUA 2XVMA 3LQQA 3OIWA 4ARUA 2IHUA 4M55A 4YCSA 5LZ8A 3WP1B 3AEUB 1ZISA 2BN4A 3IMFA 5BV1A 1QKIA 3PQ5A 4HDRA 1JFTA 3JWHA 3FPEA 1O3YA 4MR9B 2ENWA 4HC4A 2QZJA 1EUCB 1RHUA 4GVPA 2F8SA 2FW8A 2Z5VA 3VR3A 1SUSA 3MJVA 2P11A 2GASA 3DEAA 5DX0A 1H5NA 3VZSA 4BNUA 5AD1A 3IUMA 1MR3F 1JG2A 1KRXA 3PWSA 4R1QA 3BD9A 1WPGA 1RPJA 4N7MA 4S1NA 3KPYA 1I7NA 1KYZA 1NLYA 1Y3CE 4FZ5A 5CH8A 1MABB 1K86A 2P9CA 1XV5A 3PHCA 3DW1X 5KPJA 3BWVA 4FFSA 1V48A 3KPWA 5D6OA 4HNQA 4L8WB 5DX8A 1FDIA 3UO8B 1UIMA 1ZLYA 4Q34A 3X0DA 3HB1A 2AB0A 1FFWA 3B82A 1UJBA 4I9NA 4O4JA 1SH7A 3NBZC 3OOWA 1JVBA 1XP8A 2PWYA 5I7RA 2C7PA 5B3AA 1ZHHA 3CN7A 4DLZA 4PO9A 1SXHA 3D1JA 4EI2A 5ALTA 4Z8XA 2BC9A 4TM8A 4MJ7A 4YUYA 4ENUA 4P7JA 1WHSA 2BLNA 4FGKA 5ICSA 1VJDA 3T5CA 1DLJA 4BV2A 1N32B 2F2TA 3HKDB 1PX0A 4XQGA 3FFTA 2HMYB 5EPOA 1N33B 4KVFA 1PW7A 3AR2A 2HCJB 2YQZA 1GFIA 4MS1B 1AV6A 1JRLA 1LFAA 2BISA 1TMYA 2R1VA 5FPKA 1ZUWA 1H2HA 3T1HB 1F5NA 3A26A 3AJRA 2Q5HA 4ZYUA 3H5OA 3GOQA 4TLAA 5JOQA 3U7HB 3UUEA 5GOZA 2M6LA 3ZU5A 3O8DA 3B3FA 4IGAA 1TJ5A 3LQ4A 4H1VA 3TTWA 3VDNB 4B48A 1FW8A 4PSCA 2ANBA 1QGDA 4KMOA 1OWMA 3ZV3A 3C4JA 1FYWA 5C0OE 4ZCMA 5JMTA 1BG6A 1COWD 3JYQA 2J9YB 1EI9A 3Q9LA 4DIEA 4QQKA 4Z4GA 1XZGA 1VYUA 3CEJA 3L93A 1JKMA 1P1BA 3NTLA 5KKCA 3MIIA 4QJBA 3O4RA 2H07A 4HDKA 4TTSA 2AMFA 2V5AA 1OXTA 4DXAA 3A6PC 5B1HA 4F1JA 3LCMA 1JEQA 3TGLA 4AY6A 2VNJA 1OT3A 5KHAA 2NO5A 3T7RA 4BV8A 4R69A 1EFTA 2EX4A 3ABRB 4D8VA 1MAVA 1E61A 3GRFA 4AUMA 2OV4A 3L8CA 1WPRA 4CDRA 3RROA 5ECGC 4FFRA 3QF4B 2C57A 2K87A 2JLCA 3HUDA 4LNHA 4Y1RB 5MDHA 2FQQA 2WYVA 1UDBA 2ZBRA 1MW9X 3S8EA 4Q00A 2V3CC 5IC5A 1QH8A 4R1NA 2BW0A 3FLAA 2QLMA 2CXPA 1OIVA 4CG2A 4HD8A 4C07A 4LJLA 1V35A 2JARA 2QS9A 3F9CA 1CETA 3PQEA 4BEBA 4P93A 2FR1A 1FS4A 4GBJA 4L4SA 1JL3A 4KKXB 4P31A 5TT1A 3VMFA 2WTBA 4BLVA 1NPYA 1BKDR 1OIWA 2YJ6A 3NBFA 4Q21A 4IG4A 1GPMA 5AESA 3HM9A 2RI6A 4MV5A 2C97A 2NZVG 3LUKA 5LIRA 2JZNA 1LZLA 5SZIA 3C8HA 4YAFA 1IQRA 3LY5A 3ZCSA 4BZPA 2AMYA 2HI0A 3C87A 5A7FA 4TMVA 2Y8EA 4CZ2A 4V24A 1TM3E 3R8FA 1RCTE 3EX7C 2PT6A 3QITA 4QREA 4JR2A 5B2ZA 2CNBA 1US8A 3TR5A 2O8FA 1JH9A 1XVTA 3E15A 3U16A 1YR3A 1SQ0A 1PFKA 3EDQA 4Y0AA 4QBHA 4G2TA 4B6QA 4DCUA 5CVEA 1XAJA 1IVNA 3DGFC 1P4RA 4RKEA 2X9QA 3ROFA 5ESWA 3TVTA 2FUKA 2Z43A 3ZHYA 1Q15A 3GJ5A 2G6TA 1GPUA 2OK8A 3B6IA 3BCRA 4PZDA 2W6NA 2P9YA 4P7FA 5FHQA 1TOAA 2BKUA 2CYBA 3L8ZA 1K8YB 3HJBA 3GLUA 4IJWA 3G5UA 3WMWA 2AQKA 3OFNA 4X60A 4JR1A 4RIEA 1IATA 1U65A 3PYMA 3RUAA 2FMTA 2AV6A 4E4YA 1SHJA 1IHUA 1V41E 5ELLA 2VSFA 3DBIA 1MG5A 3HY4A 3PE6A 3S44A 4OK3A 1DIAA 5B3JC 4LGVA 4ZOBA 3U56A 1P29A 1CB7A 2PGOA 2XZTA 4GPIB 4XPIB 1M2OA 3IUNA 2M98A 2WC1A 4JD5A 3FMOB 4OHCA 3CVJA 2BZ1A 1RJEA 3CHYA 4H3SA 1BYIA 2NYAA 1OWPA 2BFFA 4P3XA 3ZJYA 3V9AA 2R1TB 5T3YA 1G42A 5IRCD 2MU1A 2A5LA 6GPBA 4PG4A 5IYZF 3C24A 1I3CA 2H65A 1JTEA 4C88A 4ZGWA 2JJYA 1UCFA 2ZFUA 3H1FA 4HZUB 1JR4A 1PT7A 4HN4B 2ZYDA 2O8CB 4E07A 4GMKA 1C1HA 3G8YA 3MJEA 4DOMA 1TKCA 1E66A 3P9IA 1BE6A 1W7AA 1Y1LA 4FNGA 2W37A 4L8VA 1FFBA 1VE3A 4D42A 4EW1A 3GLHE 3N2IA 2HMWA 4M8LA 4RH1A 5FPQA 3ED1A 1F1JA 4CKCA 3QOXA 4MUBA 3ZKWA 3ZGNA 1A8IA 1HE4A 4DLBA 1GQRA 4PC2A 1Z4KA 1CZRA 3KE8A 3PRHA 4KQHA 4DARA 3QMMA 3STTA 1JHVA 1H8ED 1RADA 3CUYA 5F1KA 1L1RA 4ARIA 4UAUA 3LSYA 1RXVA 3GP5A 2NYUA 2PJZA 2OEPA 4O33A 3M9WA 1YR1A 5JLJA 1V4VA 1XNGA 2G17A 4UOEA 3KXLA 1HWYA 1Y7HA 4JCOA 3UBTA 1E6WA 1YF3A 1VJGA 3QJ5A 4I81A 2H9IA 3E82A 3UCFA 4PGHA 1JHUA 1NHWA 1ZH8A 3D7RA 3N0RA 3MT9A 1XN4A 3OC6A 4PF1A 5FI3A 4ADSG 4F9EA 2FEMA 3R23A 1JS1X 5F4BA 1B41A 2RJNA 3RHZA 1FFGA 1ZUHA 4K81B 3U4IA 4PY2A 3SE7A 2OBMA 2FPOA 1WV1A 2AK2A 2JASA 3KT0A 4FXOA 4JENA 3ZHXA 4WZBE 4D02A 3O75A 1UP4A 3BTUA 4UJ3A 4N5MA 3C7CB 1S0UA 1VJ0A 4N0DA 5HQJA 1UMDA 3N0TA 3PWKA 1QLWA 4OQZA 3TMAA 1QIEA 2RGCA 1IK4A 3H6HA 3JASB 3WLMA 1ST2A 4HGYA 3PXEA 1L4EA 1N3LA 1ZU4A 2PD6A 1J39A 2WWYA 1YQUA 2YXDA 2BBTA 2JJ1D 2YFHA 1WJGA 2ZBVA 3ND6A 5KYTA 2QTGA 3V4SA 2PBZA 1CC1S 1T8WA 2PSSA 1A9RA 4EMSA 1M7GA 4K1LA 3TLMA 4B6OA 1YXMA 1L9KA 4X20B 3ZGZA 3LZDA 3GH1A 1RRMA 1MLDA 1C4XA 3FPKA 1YNOA 4NC9A 4AJ2A 2COKA 3ZWBA 4ENVA 3QKRA 3U5TA 3EQZA 5AVZA 3D1VA 1ZU5A 3ZBTA 3K8YA 5KVSA 5J1SB 2BFCB 3KJGA 3W3AA 1PJQA 3T3HA 3H9GA 2Z2IA 4JC8A 3W7BA 2FZ4A 3H5VA 1XRLA 2E4VA 4QXMA 3CS3A 3V80A 2ZJOA 1Z4JA 2NT4A 5CJJA 1A72A 4E6PA 1Q7GA 4D57A 2QLNA 5JFTA 3PHLA 1Z2AA 1ESNA 3MUOA 2V98A 3KVRA 1NR5A 3DCNA 4JSRA 3A4YA 1YOVA 5K8VA 1TU0A 3RB8A 2P91A 3KQSA 4LV6A 1C3LA 1I4LD 1ES9A 4N4AA 4GRDA 5EP4A 5G0SA 3S2SA 4DGSA 5C1BA 3C4VA 1ZN8A 2Q0QA 2WZDA 3VI4B 1E2EA 3ZTWA 4OYRA 2WA1A 5BO5A 4X64B 4D98A 4EVRA 4M1WA 2YWXA 1IN7A 3CNHA 5C8YA 3DP7A 1QIKA 1A76A 1PR0A 3IPLA 1QYRA 3L05A 4OBWA 1UBLS 2BEUA 3AEYA 3BWDD 5EWMA 4EKDA 4TGLA 3NKLA 4FVTA 4ROTA 2ZE7A 3TLEA 5JJ5A 1Y89A 1LLUA 3LDAA 2EIHA 5E6UB 2BH2A 4HAVA 2K4MA 4IMRA 4PPQA 1QO0A 2WD9A 2QW0X 1GTMA 3IX7A 4CF7A 3ETJA 1LRJA 3ETNA 1CF9A 1L7PA 1U2GA 3R76A 3OUUA 2RAPA 4G4IA 4D97A 5LPNA 1DJLA 4HEHA 5DRYA 2CF6A 1PDVA 4J1QA 5M3BA 2P2DA 1NLUA 1J2EA 1QHIA 3UK1A 1LH0A 1P44A 2UUOA 4PZ0A 3QY9A 1WG8A 3L7OA 3EUAA 5FPSA 5HK9A 2FPRA 2H2IA 3AVPA 3FYUA 3GDOA 1DRKA 5CVTA 3VKFA 1R18A 1KQOA 3U6KA 1PF7E 1PJRA 1AZLA 2IXEA 2IW3A 3M1IA 1DTSA 3DDUA 3OHPA 4MRRA 2VR1A 4TSFA 1EBBA 3G79A 4DMCA 3PV0A 4TL7A 2B83A 4QYXA 5E6RA 1WR8A 3V7FA 3DFUA 3VI3B 5BR4A 1CR6A 3LXUX 4E11A 1WU8A 4BTVA 4QJ3A 1UPBA 3RJMA 1M66A 5C4GB 4HNUA 3TIGA 1FA9A 4RQAA 5K0ZA 3AETA 3EH2A 1TJNA 1QV9A 2XIJA 2NP6A 1ZO8A 2IOQA 2F3RA 2X0KA 4AZSA 1T25A 2GBCA 4IZOA 4QDXA 2WM3A 5AJXA 5KC8A 2G9QA 3QVGA 3NH6A 3D81A 2OQVA 4B4VA 1KBOA 5COBA 3UUFA 2O2GA 3PHGA 1YZNA 2Y2UA 1G21B 2ZRPA 4HDCA 3DLIA 2P4SA 3JRWA 2FEPA 1EJ2A 4FWTA 3VR4H 2A0UA 3P2OA 1RTKA 2Q2QA 3GMDA 5TNXA 1WD7A 3AVTA 1Q0HA 3NASA 3W8RA 4YBZA 5EIOA 2C8VA 2R62A 1RPAA 3AFGA 5CFMA 3ADCA 2B98A 1UDXA 2RBKA 1CR0A 1Y5MA 5DM0A 2WV7A 1QX3A 3GL9A 4PCUA 1PJSA 1GVNB 1MENA 4XUGB 1JLLB 1OLUB 2JHAA 2PKCA 2R6DA 3ABZA 1L5MA 3L9XA 4IDAA 4LI0A 5E4JA 4LY9A 1O0SA 4XUCA 2MSEB 2RGAA 1G2QA 3OPXA 4EHFA 4Q1DA 5H9VA 3VSAA 4KUHA 4PQGA 5FOUA 2ZXUA 3UK2A 4XX0A 3MTIA 2E87A 1ZK0A 2CLKB 2PUVA 2QI9C 4RTRA 5AI0A 3IAM6 1JDJA 2C03A 2XODA 4HWOA 1QAMA 2HKIA 2XMSA 3ASZA 1I6LA 4ND1A 5ALOA 1JPVA 2YWHA 2ZUCA 4AM8A 1XZIA 3M9XA 2NVWA 2P6OA 3LUHA 1F0KA 4KR9A 1G41A 3NEAA 5FUWA 4BATA 4OG2A 1SPBS 2PN1A 2CVZA 3C43A 1DKOA 4UREA 4QXQA 1THMA 2R8YA 5K8TA 1IVYA 1HG0A 1OY1A 3A1CA 1P7VA 5FI5A 3N8IA 1PG0A 4G65A 4G9EA 4COKA 2AFIA 3QFTA 3QVTA 1E0KA 2PFKA 4HATA 3EUFA 1ZRMA 1G5IA 4BKOA 4C4RA 2CLCX 3CW9A 3GMIA 1WLYA 2BJWA 3CISA 2JLBA 3NS7A 2AMVA 4Q1FA 5FWNA 3JQ8A 1X1SA 4NTZA 3SMVA 3QVSA 2AW5A 5JS2A 3PEWA 3EMVA 4DR3B 4YAEA 2PJRA 1ADGA 2CFIA 3BSSA 4L95C 1Q1GA 5AXCA 3KQYA 4JBGA 4DSUA 4B35A 1EK6A 2A9VA 2OHGA 3DP9A 4CW7A 4OXNA 2V4UA 4V2UA 1NP3A 3LHIA 5KU1A 2WSSD 4H27A 5TR9A 4ZYXA 3LOUA 2P9ZA 2IYYA 3TMYA 3OKFA 2JAHA 1P2BA 1SXGA 2FPGB 4WN3A 3W7VA 5BW4A 4GR5A 3R5TA 1I51A 4IH1A 4RYLA 2Q9BA 4Z2YA 2C7QA 2IUSA 4AQYB 2WF8A 1T1SA 5SZHB 5GPBA 3P8ZA 2IWRA 1PJCA 1M6EX 1UMKA 4JUIA 3JYHA 4M7RA 4A6DA 5AM0A 3W2TA 4GE0A 1UPCA 2I6UA 4MS3A 4OQQA 3BXOA 2NQ2C 2JEYA 1NWCA 4YR7A 4QARA 1E8NA 2GETA 2KB0A 5ISMA 3NFYA 5AJWA 3STHA 4B7AA 4NPAA 2VHUA 4CLHA 1DEKA 3NBXX 1WX1A 3C0KA 4RF2A 3SZLA 5I8PA 3SYRA 2YFKA 3EODA 2HHLA 3PD1A 1VKZA 2XXJA 4XTCS 4EQ6B 1EGQA 3MWJA 4M0PA 1T4DA 2B2NA 2C9DA 3RYIB 1Z6YA 3WB1A 4Y0NA 2AS0A 5DNUA 2P2SA 4TTVA 1IOZA 4IPTA 1FB5A 1IRXA 1N1EA 1QLJA 2NTEA 4IQ8A 2QNBA 4Q7MB 2DOKA 4DEYA 4X1IA 3QYJA 1CFJA 1XXHA 5JYEA 1TGVA 2AFHB 4MRMB 3N0WA 3C3CA 3DF7A 1V7ZA 3ZYCA 1EVYA 1L2TA 1T9GS 1W73A 1W4CA 4AKEA 3HVRA 1UL1X 2GNOA 3GH3A 1I6MA 4Y6LA 4YJKA 4CMCA 1GEEA 1U5BB 1EE1A 4TM7A 4UVHA 4XLTA 1U3FA 1YR6A 1XUOA 1X7HA 3GNLA 1P4JA 1PG5A 4JP5A 4FOPA 3X1YA 6LDHA 1KU6A 4BECA 2CZQA 2CLHB 1WZCA 3PQCA 2ZUVA 2VDQB 4D92A 1QYDA 3H8VA 1Y3DE 2H17A 3CBQA 4PYMA 4RD0A 5H3HA 1MX5A 1W8IA 5J5AA 5JH7F 3NIGB 5FFFA 2ZS9A 4HBZA 1RKXA 1YASA 4M1EA 3TFOA 1H8HD 1U5CA 3G23A 2GI4A 3NDPA 1VI6A 3MCUA 4YRNA 2RH4A 4Z9BA 3SSAA 4R71A 1LC3A 2JIQA 5AK6A 1ZITA 5J2UB 4IIJF 4P4SA 2O50A 2VTVA 5GVRA 2IU3A 2GM5A 4BNLA 3CX4A 3GZTB 3IVCA 2VC2B 1CULC 4ZAYA 1AZWA 1EP9A 1VLZA 4QXOA 5IDYA 2YNMD 3GGDA 4GEKA 4EI7A 3WGGA 2FPUA 1YKGA 2GD0A 3TLYA 5J5CA 3UANA 4C89A 2EP8A 3NCHA 1R0YA 1Z2CA 3SM3A 5DHAA 2EAUA 4D9FA 1OB5A 2B8TA 3KDAA 1JPNA 2D1TA 2X7XA 3HVJA 3N6XA 3OIFA 1O7JA 1VRCA 2KI5A 3QZUA 5CA0A 1VJCA 3V1TC 1L4NA 3LYAA 2YJNA 4QODA 2JCSA 4R83A 5H83A 2C9MA 2L2QA 4M9UA 4ND8B 3ICEA 4M7OA 5DM1A 5CFRA 5DI9A 2QZ4A 2Z3WA 3NHMA 2CYCA 4R68A 1NQTA 2H5IA 2R79A 2QVBA 3NAGA 4PYRA 4RENA 4UASA 4Z99A 3O31A 3DEFA 3DKIA 3NH9A 3SE0A 4PAMA 1WTCA 3JTMA 4OU4A 2DTEA 1NVEA 2VJAA 1IZZA 8ADHA 1JJFA 2H63A 3C85A 2M1XA 1BMFD 4G0MA 2CLLB 5IMSA 1C9KA 3NRBA 4NPHA 1V1MA 2PSDA 1EHYA 1U8UA 2G82A 3NHWA 1O2DA 1PEKE 1EDZA 4ISBA 4H6PA 3LLMA 5SYMA 4OQMA 1X1DA 1KGSA 1M3SA 4LWZA 1E3QA 3BRCA 5EE9A 5H8WA 2CYAA 1YRAA 3DMFA 3ZHZA 4CEIA 1JAHA 1ZESA 5FO0A 1NSFA 2AQIA 4PRZA 2JJ2D 2I4RA 1YDEA 3H2KA 4P08A 1NI4B 5C9ZA 1C0LA 1M5UA 4W4TA 2VF5X 1JU4A 1D2GA 4AKHA 4UKDA 4LJ5A 3AKEA 4RJJA 4CKWA 4C0QC 3OUTA 1E3WB 1SC9A 4P92A 3DM9B 1QC5A 1P1RA 1Z0IA 3UNXA 5FD8A 5DULA 4L0MA 3ZK7A 1CZUA 2WUDA 4TKVA 3WRXC 3F98A 4CT4B 3C41J 4RTPA 1WUYA 2OO5C 1LI4A 1M1ZA 4M1ZA 4UTRA 4HDQB 3PDJA 4IR7A 3I5UA 2G5TA 2C4UA 5BPFA 5DVZA 3GLRA 5CCXA 3K9FC 3RQSA 5C3MA 3FCOA 1Z7EA 4PCVA 3QH4A 3SK0A 1UMBA 2BZSA 3BIWA 3SF8B 1K2VN 3VO9A 1KIAA 2PVPA 3DW3X 1C29B 4LW8A 3R3UA 2YVKA 2QIPA 3CZAA 4JB0A 3ZZUA 2QXUA 1KJYA 3CB4A 4IO1A 2J4FA 1XKQA 5JZBA 3CXUA 3A6LA 1ENPA 2FPXA 1T4CB 5KWJA 1JJAA 1E6KA 2NO9A 3BORA 1RWWA 3L40A 3OEED 4W7SA 2F1KA 2XB8A 1L5RA 4OHKA 4YI3A 4F72A 3C1TA 4ZYTA 4ZU3A 1TK2A 1UAAA 5B3LA 4CKBB 3KLOA 4UBKA 2C95A 1UK8A 2EFCB 2JGJA 2PZGA 2Y71A 2ZVQX 5P8WA 4QL3A 3LBFA 5A4IS 1VBMA 1E1CA 2QL5A 2HAEA 2Y9PB 3LYHA 3Q3JB 2EFJA 4JBIA 4B0PA 4CUJA 1R8QA 1ZJ4A 4UTPA 3HG7A 2QYHA 2P6UA 4L76A 3HSYA 1HOXA 1IM2A 2QTVA 2XNDA 3HP4A 4NZNA 3IKJA 4PAOA 3R7LA 1BX0A 2GEVA 1WB5A 2N42A 2WIGA 4K9DA 4ZCTA 3HXMA 2FRDA 3DH0A 1L3IA 1ZIDA 2J6CA 2YV1A 3QNMA 1BWSA 1VP3A 2A88A 3OOJA 1AV7A 2W9XA 3GJZA 5AO9A 2Z4SA 1Z47A 4QXAA 3CT6A 2A94A 3MB8A 2FN3A 4XXHA 2ZUUA 3ZU4A 4URWR 4G1UC 3BXGA 3EF3A 5FBWB 3R9WA 1FQJA 5LYJA 2ZIGA 4X7BA 5D7NA 1MB3A 2ISCA 3D8TA 5G4LA 1VL0A 3JSXA 1H9CA 1OFUX 5I7AA 2WJPA 3U19A 1WMBA 2PNFA 1P18A 1Z08A 4GGOA 2WUWE 2DLCX 3BPSA 2DUUA 3MOSA 4LJAA 4PYNA 4JJZA 3RPEA 3G1WA 2Z3ZA 1CIPA 1YDFA 3TLJA 4C5CA 3N2YA 1PNOA 2XKKA 4CMGA 5DPMA 5E7MA 2TMYA 1J6UA 3UUGA 2DFLA 1FUEA 2R7NA 3DV2A 4G1CA 4HADA 1MBZA 5IMBA 5FUQA 2YN0A 3EXFB 4EG0A 1GKYA 4HXFB 2IYPA 3SP1A 4BWVA 5JAIA 4D4LA 1YRQA 5SY6A 2JLXA 3BXPA 1RYHA 4U3JB 3EDYA 3QRWA 5BYBA 2PRKA 3D4OA 2JBAA 1ZGGA 3E3AA 1XDDA 4IJVA 2B20A 4C6RA 5AKKA 3AF4A 1NY5A 3IT2A 4INPA 3W2EA 3KUKA 1QRTA 3D64A 3EA4A 3UFXB 4IIFA 5B30A 1TRHA 4W1QA 1KI9A 3AR9A 2A35A 1KEZA 1MJFA 1K88A 1XEWX 2CLOB 3KALA 2RI1A 4YNBA 2JLUA 5GP1A 1MA3A 2WJIA 3H1BA 4Q0MA 1AN9A 3MQFA 4A16A 5JD5A 2J0QA 4KO8A 3WYFA 1EB9A 1QP4A 4UU7A 2I6QA 1XFDA 1W36B 2O2HA 2PV0A 2W6IA 3HVHA 5K0JA 2FSPA 3PL1A 1WPQA 2B9EA 3BWEA 3EVTA 5BYJA 3BWCA 3H8JA 1T5IA 1I9GA 3WXMA 4PN7A 5G1NA 3HJNA 2IZOA 3FMFA 3EZ6A 3DE5X 1BHSA 3W5UA 5AH0A 3CF6R 3RVSA 2NACA 3IOMA 1MX3A 3ZHUA 2JLWA 1NRWA 3DZFA 1DBIA 5AIBA 4FILA 3S8YA 3E9EA 1SEVA 1AUOA 1GZSA 1EZ1A 2HSZA 1FU7A 2MHCA 1NXXA 1M1XB 3CB2A 3KT3A 3TNYA 1ZQ1A 1I7SB 4IQGA 1OT5A 3EG9A 1M2HA 1T9DA 5JAHA 2DULA 3TEJA 4UBOA 2X0DA 4HEA6 2OYSA 1D4AA 2IK8A 4KQ9A 4L0QA 1CQIB 3IBSA 4QTUB 3WB2A 1A77A 1SOVA 1TCUA 2XRYA 3F5SA 3JQ7A 3OFSA 4DM4A 3AVYA 1G18A 3FOCA 4B6JA 1HDCA 1V8DA 3HEBA 3HXPA 1HORA 4N82A 4UUMA 1GT6A 2FETA 3W0LB 4EO9A 2CJFA 2Q0HA 1RXIA 1AS3A 2V3WA 1NDQA 2OCDA 5AW5A 5D1HA 4AAYA 2OGWA 4FNAA 3I9V6 4CF5A 4Z4QA 4H0FA 1RYDA 2BE7A 5BUQA 3WL4A 4NOKA 1VL5A 5C31A 1FYFA 3TLXA 3TKAA 1QCCA 1LDYA 3QLTA 1E0AA 1LSOA 3GPCA 1IJEA 1NV9A 3Q7TA 4MW4A 3YASA 4B32A 2D0PB 1JDUA 3DDOA 1YO6A 2CB0A 1UPAA 1D1PA 3NXSA 5LP6B 3PD7A 4RVOA 1A5TA 2Z4TA 1TADA 3MTEA 3K15A 4RIFA 4DEVA 1QVWA 3HO1A 2PNJA 2NUAA 2NM0A 5IFLA 4X3CA 1IIBA 1E60A 3K73O 1O97C 3HZHA 3IAM1 2V5VA 3ZK8A 5K1ZA 4MA5A 2O9JA 2GARA 3MWDB 1P0IA 2D5IA 4MLZA 4C4AA 1JG1A 3AWDA 3K31A 1TO6A 4K87A 3KSMA 2PT9A 1TUBB 2QUJA 1V6AA 4QUJA 3ZHSA 4KQFA 5BSEA 2UXCB 4ROSA 1DXQA 1Y4SA 2Q5CA 5AW6A 2GEUA 1AHNA 2GNPA 1PU2A 2EWMA 4QU9A 5KKNB 2YY7A 5GIPE 3SJ7A 3GAAA 5CW2A 3HRHA 3KWFA 4E7OA 2QGZA 3ONEA 3G2NA 4P1ZA 3ZNQA 2Y0PA 4FUTA 4I4TB 4RSHA 5FOWA 4L8FA 3ZQ4A 4A2CA 1HT3A 4DCSA 4DLKA 3JV7A 5HZKA 3ZJ4A 4BVJA 2ZAMA 4IVPA 3KHKA 2ZTMA 3N2NA 5EIWA 1I14A 5GAJA 5LZ7A 3VDMA 3PENA 1YMUA 4KN9S 3RS8A 3OJOA 1U98A 3DOEA 3TCNA 1PR6A 3OHSX 2HHHB 2YHBA 1UMCA 1KO4A 2DTXA 5JHHB 2HMVA 1UKCA 3FPJA 2EKLA 4RW0A 4BL5A 3UBMA 2R47A 4EKYA 2H2WA 2N1BA 4ESVA 4GOJA 5KDOA 1FXWF 1ELOA 4PZYA 2JHGA 2PGAA 3C6ZA 2D13A 3KWMA 2BFBB 3AB7A 3FLMA 3I3OA 3NJRA 4G5SA 5K5EA 4PFQA 4HNHA 3M7IA 5IZ4A 3W5AA 1L6RA 2QTLA 2VDNB 5J58A 3WR5A 1E1LA 2A2ZA 2HW8A 3MPUA 4NIMA 3V5NA 1N2GA 4GLBA 2G04A 3FNIA 3LPDA 1KKMA 2OA0A 5F2OA 3VSCA 4Q19A 1L5OA 3D59A 4HFNA 2VT6A 3L82B 5J9FA 5G02A 1U4OA 3PQDA 3BT7A 1Q0QA 3JQ6A 5DB4A 5T67A 3TPCA 1IMJA 4Z51A 4F1KA 1K75A 2QN2A 2ZREA 4LOLA 2IZ5A 2NO0A 4TWAA 3D3WB 1QK5A 4I1SA 3P0RA 1KP9A 4HSEA 1LW7A 3EFEA 4B7ZA 1KAQA 4G0WA 4G8JA 3RFXA 6ABPA 3AR5A 4PIMA 4KRFA 2X7JA 3VZDA 1RI5A 3I61A 2SHKA 2LKDA 5JV5A 3AONB 1HPLA 1DQYA 4TSRA 4WXRA 4HYQA 5ALFA 4Z7NB 1NYLA 3WHLA 1U7DA 4C14A 1PE0A 3UXMA 3PQ8A 2ORED 3EF1A 2RGYA 1XZJA 4Q39A 1I1OA 2P4QA 4BLUA 4EG4A 4E21A 1HI9A 3KQKA 4RSRA 1HRKA 2VPQA 4DG9A 3FR8A 3ROPA 5KIAA 1TYZA 3PFNA 4QTYA 4C2AA 3VAAA 4RKWA 1LXCA 2Q3CA 1AO3A 1HEYA 3X1WA 1DC8A 3HU3A 3H2IA 4D0NA 3QJGA 3FWKA 4ZDIA 2WUGA 2PRZA 4GUAA 2C3PA 4LMPA 3SEZA 3VNBA 2IOFK 2G36A 3DHYA 4AF6A 4V0LA 1F1BA 2H5JA 1P0QA 3ONNA 4ND5A 2XT6A 3N75A 1RKVA 3MA0A 1MT0A 4H7EA 1D2AA 4RYDA 4TYWA 4J43A 1EJ6A 1K6JA 2I33A 1YBHA 2KYRA 4N8DA 2FWAA 4R8LA 1E89A 3PNMA 1XLWA 3G5MA 1MB2A 2BEWB 2E4ZA 4NL4H 3W8FA 4EITA 1Z0DA 2C2XA 4HRYA 3VR0A 1E7MA 3WYEA 4PYIA 5ALRA 2XHZA 2YBEA 3E7FA 3LF2A 3RC3A 4L3WA 3I4FA 1Y9ZA 2D1YA 3BXEA 3QEJA 3QKSA 1SURA 5CGZA 5ESDA 3N3AC 1ADCA 4R54A 1ESEA 4JUCA 4A0RA 5F9HA 3DBRA 2OV6A 1W2HA 2LIPA 3ERCA 2O2ZA 2P9EA 3G2HA 5LQJA 2QL9A 4KSBA 4OQYA 1KYQA 4HH1A 1B73A 3UAOA 4TZ0A 2I34A 2X2EA 3NHAA 4RPIA 1HFWA 2NAFA 1AQYA 3NHZA 2GEFA 4FK8A 3LE8A 3DONA 3DVSX 3EGCA 4YUWA 1E59A 3OHMA 4NAUA 4YCJA 2CF5A 5A03A 2YXPX 4IDCA 3GFBA 4ER3A 5BW8A 4H3VA 1B43A 1VIAA 2WTEA 2VZ9A 5J2TA 4EG8A 1S3FA 1TM4E 3SDSA 1ZNXA 1Y3IA 2CNOA 3JQBA 2GZ1A 5HP4A 3FOEC 5WRFA 2X2FA 3IP7A 1U81A 2MMCA 4KK4A 2WG0A 4KFSA 3ME5A 5K09A 3B7GA 4HMQA 3CZ4A 3K1TA 3EGIA 4W5HA 4TMZA 2FZWA 4V39A 5AXDA 5A9RA 3UAZA 3RJZA 1WCV1 1USVA 2NAPA 2FAXA 5F5LA 4RH0A 4EKIA 3R09A 2JI7A 3AHDA 3PUZA 4MS4B 2YWBA 3T3DA 3TR6A 1COWA 4ZZIA 4DIUA 3FMVA 3P32A 4JYPA 3P94A 1HFJA 1GPAA 1U3VA 2QPTA 3RK1A 4BIMA 1O5IA 2WVHA 1L9XA 2XQGA 4M9RA 4WFIA 4YCBA 4LV8B 2ZI6A 2R6AA 3QBTA 4BQNA 2F7SA 3VYUB 2HXYA 3VR6A 3DTNA 2EL9A 4BXOA 1NNLA 2FGJA 5FOXA 5LXTF 3JATB 5JE8A 4XWGA 1BOOA 3M81A 5ELMA 2VP3A 3SLGA 1D2MA 4KQEA 1JHOA 3JALB 5T8KC 5BWMA 2WD7A 4DWWA 4R2WA 1Z74A 3VBCA 2RHGB 3OX3A 4B43A 3CFYA 2HX1A 3USES 3VC1A 4EB6A 1XNQB 2ZRJA