2G77B

Crystal structure of gyp1 tbc domain in complex with rab33 gtpase bound to gdp and alf3
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
173
structure length
173
Chain Sequence
b'RSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase-activating protein GYP1
publication title TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase activator/protein transport
total genus 52
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2g77B00
1S3SA 3B1YA 4MKFA 2QP4A 2VA8A 1ZD8A 4DB2A 4PSKA 4MH0R 3E70C 2IA5A 1XDBA 3KXKA 4EIWA 1XMIA 3PUYA 1Z63A 2ZJYA 1W2GA 4Z1MA 2CVFA 1XJCA 4H1VA 3NEYA 3RWMB 3K8YA 621PA 3Q72A 3VNUA 1TQ2A 1YU9A 2VP0A 2UZ3A 5IF9A 2ZSEA 2C9OA 1J7KA 3I5XA 5AUPB 1OH7A 4JT2A 5F98A 2ZANA 1XD9A 1E2DA 3O8BA 1DAFA 1ZUHA 2FWRA 4UNPA 3L8YA 2BCJQ 1WE2A 3RRNA 2QBYA 5EXXA 3AUYA 4DZZA 5AJWA 4E07A 2QTHA 4BFZA 4BRWA 5KDDA 1UKEA 2IYXA 2YV5A 4ESVA 3THYA 4LX0A 2NO6A 1BKDR 1KMHA 2C98A 2A78A 1YR9A 2XXAA 2JLSA 2KWIA 3B1ZA 3EZ2A 1Q44A 2ZQ5A 4I1SA 5CITA 2C9YA 1I4DD 4WXRA 4C7OA 1DPFA 2C03A 2ZSFA 4A15A 2CLDX 1E2PA 4V0ME 3PUZA 4B3XA 4TL9A 1JR6A 3EW9A 2XOKD 1GM5A 5E3HA 2P2LA 5G53C 5BQ5A 3TNFA 3VQTA 4F4JA 3U61B 2OFXA 4V0KA 4DSNA 3N2IA 4CEHA 4LHYA 1KAGA 4LYAA 4ZDWA 4P0TA 1NL3A 2XZLA 2KB0A 2QMHA 4HSEA 4A8JB 4HATA 3AVOA 3QQ5A 2QENA 5EXTA 3MSXA 2IYLD 4V03A 2GZAA 4MDFA 3AF0A 1ZC4A 1LY1A 2RGDA 4Q1DA 3UK6A 4URYR 1TF5A 1Z8FA 1K8RA 5LD2B 3MWJA 2DR3A 2YC4C 1E2FA 4XTRA 1SXJB 1YZTA 4MYCA 4IJMA 2NO1A 2BBWA 2FPLA 2FF7A 2JJ8A 4KSBA 2HF9A 1K5GA 1OKKD 2OCBA 4MKHA 5AJYA 1YQTA 4QHYA 1D9ZA 4TZ0A 1FQKA 2OAP1 3GLIB 3IQXA 2YOFA 4CDGA 2KSQA 4RD2A 3D31A 5AUQA 2GA8A 2NO9A 1XMVA 3KTAA 1N6IA 4PC1A 3I92A 4L16A 1XF9A 3I8XA 4F38A 4KBFA 1OH5A 3MWKA 1KY3A 2NZJA 4BLQA 1BO6A 1XCGB 4EPVA 1A4RA 4MA4A 2JJ1A 5DIFA 5FUYA 3UG6A 3I62A 1G7TA 3QF4A 4LHVA 3WY9A 1AM4D 4R71A 2EFDB 5KU1A 2I1VB 3NIBA 2IUUA 4PC7A 2JAQA 1QDEA 4B48A 4MGZR 1G18A 4RKEA 2J0UA 1IQPA 1XXHB 5JJKA 1E96A 4Q47A 1XD8A 2HJVA 1M6NA 3IIJA 3BC1A 1FX0A 3KKMA 4W5JA 2VYFA 4NZYA 1RE0A 4EQ6A 3LVRE 1NVWQ 1G5TA 2BJWA 2QAJA 3N5CA 4A36A 1VHLA 1NIJA 2HDNB 1UBEA 4QC2A 4EJSB 4LUCA 5CLQA 2IYZA 1C9KA 2GEUA 4G5RA 5E7JA 3HR7A 2JDID 3MLEA 3O8DA 1SXJC 3SQXA 2KE5A 4LJ6A 1U94A 3EIEA 4L9SA 1Q21A 1CF4A 1W0JD 1J2JA 3TR5A 3QPUA 3AVYA 2AKYA 1DAMA 4OJKA 2FU5C 3EIHA 1ZMXA 1ETUA 2GHIA 3LA6A 3K09A 5H68A 3T5DA 1FOEB 4Q1BA 5ELXA 4PAOA 1LFDB 1ZNXA 1YZLA 4LV6A 2A7QA 1HURA 3ZQJA 2JLUA 2IS6A 4UNQA 1UKZA 4A6XA 4BLSA 1FTNA 1X3SA 2CK3D 1RKBA 1U8AA 4M9QA 5HCIA 1X8LA 3SBDA 4IW3B 4U7DA 1T8UA 1U98A 3LX8A 5JHHB 2BMFA 4PX9A 2HLDD 4Y0VA 3OAAA 4EDHA 2Q9BA 4KFSA 4URWR 3E2IA 1T3HA 2G1KA 1OXXK 1VYUA 4P4SA 2D7CA 3RAPR 2JIZA 3FYHA 4AYTA 2XNSA 4M1MA 4LBVA 1ZAKA 1ZINA 2WBLC 4AD8A 3BB4A 1HT2E 1RRCA 1IN8A 2AK3A 5BN5A 3VR4A 3QPVA 1X8KA 4M1SA 3V4FA 2G6BA 1GITA 2PLFA 2GZDA 4JKIA 4EJSC 3S1AA 3QNUA 1P7CA 3U60B 1VYVA 4IDNA 2N1BA 4UJ5A 1GAJA 2HXYA 3SDZA 4MITA 1IXSB 1W1WA 3K53A 2VRWA 1E2GA 4YMUA 3THWB 4TL8A 1G21E 2QRZA 1EX7A 1Z83A 1A7JA 1UM8A 3AF2A 1Z5ZA 3CF6R 4MRNA 5UKDA 4EAQA 2NMVA 2F9MA 2X19A 4D0NA 2QQ0A 1P73A 3EWSA 4B3FX 3PEVA 1E2LA 1XEWX 2Q0HA 4DB4A 1A2KC 2OZEA 1GNPA 3VKGA 1G3RA 5CIWA 1YZKA 4CEJB 5DYIA 5AUOB 2BV3A 5CYOA 4CYMA 1XFAA 2RGGA 2VPPA 4YC7A 2FSGA 3WRYC 4AYWA 3LBNA 2GILA 1E9AA 2E9SA 2NGRA 4TL6A 4AI6A 2GCOA 3PEUA 1S2MA 3D3QA 3MUFA 1OFHA 3CRMA 3W90A 3BB1A 4LBWA 5JZVA 5K8UA 2IYTA 1CS4C 2QGNA 3SOPA 1D5CA 1MH1A 1U0JA 4KI0A 4M21A 5G3ZA 3SU8A 2A5FA 1G3IA 3HR8A 1MO3A 3KUCA 1ZM9A 4IDPA 1L4YA 2IW3A 1GFIA 3VR3A 1GUAA 3LO5A 3T1QA 4HLDA 3BERA 3DZDA 4D82A 3CF2A 2ZSAA 2AXNA 1GOTA 4C0AC 3I61A 1Q22A 2QI9C 4LJ5A 2F55A 1W36D 1JPJA 5L3RA 3TRFA 1OIWA 3U44A 5JSZA 3DM9B 1JAHA 5FPSA 2FPMA 3FFBA 4B6EA 5B2ZA 5D3MA 1HUQA 4II7A 1P75A 2VSFA 3AVQA 5B64A 1W48A 3V4RA 2GEVA 3T34A 5EXPA 3GLHA 2A5YB 1YR6A 2HUPA 2KJQA 1YVDA 1PUJA 2QROA 5FL7A 4JJZA 1GZSA 1ZM3A 1OYWA 1G1MA 1LS6A 2MSDB 1NBME 1MRNA 1QHHA 2GEDA 2CJWA 4KLNA 4Q4HA 3RS2A 4HZUB 5JJLA 2QQEA 3AM1A 1CRPA 2QT0A 1R0ZA 4MRSA 5CDFA 2YNMA 1KOFA 2ZR7A 1L8QA 1NLFA 4B73A 1VG9B 1L2TA 4M1TA 2QMUA 3GLFA 4JZKA 1YZNA 3BIFA 1TL7C 1G3MA 2F6RA 4YMTA 2QAGB 3TSWA 1A2BA 5FTMA 2HCJB 1IN5A 4URUR 2PX3A 4ZIRB 1Z29A 2ZRJA 1P62B 1E94E 3X2SA 4HAYA 3P20A 5CLLA 4BQSA 1E1QD 2R6GA 2ZSBA 1XCMA 5DYGA 1O87A 2PT7A 1PZNA 1TUEA 1G7RA 4PPGA 4DBLC 3TSZA 3U3OA 4AG6A 2NPFA 3UMSA 4QM6A 3OEEA 5FUVA 2AHOA 3DEFA 2DPXA 3PUXA 1N3BA 2PT5A 3MMPA 4TT3A 2CNWA 4M53A 1FTSA 2O0HA 3ZYCA 2GCPA 5TVKA 3QSYA 4Q4JA 3UWKA 4HUTA 3RVBA 5E7MA 5JRJA 1JR3E 2ZUDA 1PUIA 3OIUA 3SYNA 4OQNA 2JEOA 3W5IA 3OIYA 2O8EA 2OCYC 2GJAA 4FMCF 2WWGA 1Q3HA 4AIIA 4XWAA 1AS3A 5J40A 3SHFA 1M7GA 2IBMA 3ASYA 4DSTA 2EFGA 4BRUA 4RFVA 3Q5EA 5DO9A 1VYTA 1R8SA 1BMFA 5KPJA 1OFIA 2YINC 2UZIR 4G01B 3GCGA 4LC0A 3VX3A 1Z0DA 1M74A 1X1RA 2PZEA 1AZTA 5FL3A 3TK1A 1LW7A 4N0DA 2QBYB 4B71A 1VCIA 1XP8A 2ZI4A 2FSFA 4FIDA 3R9IA 4IDOA 4FWTA 3A1WA 1Q1QA 2WJIA 5TY0A 2OXRA 5DI9A 1G8GA 2PH1A 3GEIA 4IDQA 3ZVRA 221PA 2EYQA 2W83A 1FP6A 2RCNA 5L3VA 1D2EA 4M1OA 4A82A 4PC2A 4BGDA 4ZKEA 1FL9A 2O52A 3LXXA 5DN6A 1RRPA 3BOSA 2Q9AA 1NMZA 4IDHA 4TTRA 1F2TA 3OFNA 3T5GA 3MJHA 3ZIAA 1UPTA 4C7OB 1BS1A 2YC2C 3LLMA 4HLUC 4C30A 4TYYA 2PMDA 2D74A 1NRJB 5FOTA 1SQ5A 4RZ3A 2PEZA 1TAGA 1TQDA 3B2EA 3I3SR 2QMOA 4EUNA 2HYIC 2B8WA 2CMKA 421PA 1JAIA 1GKYA 1WMSA 4AWXA 4DWJA 3CKLA 5J4KA 4B75A 3L0IB 4A9AA 4JLKA 4Q4LA 1F2UA 3IEVA 3ND8A 2EYUA 2GDJA 2J9RA 4RFSA 4Q00A 2C78A 2J7PA 1XMSA 4UXIA 2IEZA 3FKSD 3LX5A 5JS8A 1N5KA 3IPYA 2W6JD 5GJVC 3WRXC 3HYRA 5KSZA 4YMVA 3R8CA 4TQUS 1J8YF 3LRPA 3OESA 5FOXA 5LB2A 4WOPA 1T5LA 1VIYA 4C0KA 3Q8XB 4A0HA 1E0AA 3AB3A 5AUNB 1LNZA 1E1RD 4NU0A 5B58C 2RMKA 2CHGA 3OEHA 1HQCA 4JLAA 1XTKA 3HYTA 4JSTA 2J0SA 4Y0AA 1G6OA 1KY2A 1OXTA 2FGKA 3A1TA 4EFMA 4Z1MD 2ONKA 3KTAB 4TYQA 1MABB 1TU4A 2ZE7A 4DLZA 4DDVA 4F92B 4C2TA 4V0OA 4WAUA 2FE4A 3I8SA 1CR2A 2BKUA 3QXCA 2JA1A 4JSYA 2G3YA 2RGXA 4POAA 3V00A 1AS2A 1I4LD 1DG3A 3F8TA 3QF4B 4JVNA 4LPKA 3GLGE 821PA 2AD5A 3NHAA 2AL7A 5IT5A 2FEMA 2WZQA 4N3NA 2J0UB 2PL3A 4FCVA 4L15A 1VG1A 4Q9KA 4V0NA 3QIAA 4IKEA 3CW2A 4JVSB 4UKDA 1J70A 1FX0B 2V6JA 4OQXA 1KHTA 1KKMA 3NH6A 3KQKA 2NOAA 5JMTA 3LQRA 4EQ6B 3TH5A 5M04A 3I1FA 1CJTC 2J1LA 3JZAA 4PR0A 2WICA 2XGJA 2XSZA 3B78A 1XU4A 1G3QA 1N6LA 3B1VA 2DY1A 1U2RA 2ORVA 2VHUA 1IXRC 1UDXA 1WQ1R 4FXPA 4ZDKA 2RGNC 1NY5A 2C04A 3EC2A 1FW6A 1TPZA 2JLQA 1KI2A 1M7BA 2WM9B 3RRZA 2QTVB 3G82C 3U4QA 4M9XA 2XNDA 1ZUIA 4RD0A 1CR4A 2A2ZA 5AJZA 2UVQA 3W5JA 5L3QB 3ICQB 1TX4B 3C8UA 4NYJQ 3ADDA 3N2EA 1JQJC 4V0MA 3TUIC 4EPWA 1NN5A 1IJEA 2OILA 3DOFA 2CCKA 5BN3A 3CNLA 2HJGA 2OUKA 1Z6XA 1VECA 3L43A 1AGRA 3F0TA 1Q1ZA 2O8CA 1ZD1A 5JRZA 3PUWA 4Q02A 1Z0JA 2X1VA 4PFSA 4YLGA 1WXQA 5J4HA 4JVMA 4P4SB 4QGHA 1T0JB 5EJEA 3SJCA 3AVVA 2JJ2D 3Q85A 4B44A 2J0QA 5J4VA 3T12A 1IY2A 1X1SA 4EFNA 2C8VA 4BEJA 3LY5A 1AKEA 2EU8A 2AK2A 5JS7A 4HI0E 5FTJA 3ND9A 1MKYA 2AKAB 1T5IA 2F1JA 4DSUA 4B43A 1SHKA 1GIAA 2VP2A 4OHXA 4F91B 3ZVLA 2GXSA 5H1YA 2VSOA 2JJ1D 1KO7A 4LV5B 3SEAA 4D26A 1KJWA 1G7SA 3IGFA 2OCPA 4K8OA 3AGPA 4QM7A 3PG5A 1F6BA 2ZJAA 2J5XA 1HH4A 3A4NA 1IONA 1OXUA 2P3SA 3MCAA 4EKDA 2F1IA 3EXAA 3GJ0A 1GVNB 3L0OA 4GPTA 3QJYA 4C4PA 3K09C 2XTMA 5K8TA 1G5RA 2H8KA 4DJTA 3ZLJA 4GL2A 2C77A 1PJRA 3AF4A 3GD7A 3QENA 1JPNA 3VFDA 4DLYA 3BXZA 3AKCA 1UBGA 1N25A 2CHVA 1JB1A 4A0RA 3T61A 1UJ2A 4Q1FA 1MO6A 4LYJA 2IT1A 5KSPA 2OO7A 2A5JA 1EFCA 3EG5A 4GMXA 4AKIA 1EWRA 3A37A 2GCOB 1YKSA 3GJ5A 5FFMA 3A4MA 5KHOC 1YR7A 1Z0KA 2ANCA 4HLCA 5KNBA 1AIPA 3SJZA 3NXSA 2V1XA 4FCWA 2FV8A 1JALA 5JEDA 2E87A 2ZS8A 4UJ3A 3NG1A 4FW9A 4KFUA 2GXUA 3B8HA 3LD9A 4JJKA 4LSGA 4TLBA 2XX3A 5DNYB 3ZD6A 5KDOA 1CIPA 2ZYVX 3HPQA 3LLUA 1GRQA 2FSIA 1S0UA 2WKPA 3NWJA 4GZLA 4JLPA 4QRHA 2O0KA 4XD7A 4GP7A 2K5UA 1G17A 4PHTA 3FFAA 4YQFA 1QRAA 2FA9A 5DH9A 3U44B 3NDPA 3OAAD 1OIXA 2ZEJA 1N6KA 4GOKA 1JEEA 1D2MA 4BFYA 1NVXQ 4CT4B 2JIZD 3WP0A 2X8AA 4QOSA 2VTKA 4W9MC 1VMAA 5D3MB 1OLOA 1TU3A 3AKEA 3SYLA 4TMZA 3GLHB 2B7CA 1S3GA 4LJ9A 2CCGA 1Z0AA 2WSMA 4MGIR 4US1R 4BZQA 2OESA 4DLRA 4DRZA 4LWZA 4KYIB 1QHHB 4Q4AB 2CJWB 3FHCB 2WJYA 2GZHA 4QFMA 3R7WA 1P2UA 4BE7B 521PA 2O5VA 4DUGA 4HAZA 1S9HA 3TGPA 1XBTA 1R2QA 1ZW6A 2IYQA 2V55B 4NYIR 3THXA 3GLFB 2ODWA 4TL7A 3WBJA 2CBZA 2WPDD 3OIWA 4LC1A 4PXAA 5A4JA 2VF8A 4OYHA 5KOYA 1A1VA 1D6JA 1WP9A 4FI3C 4TQ9A 3NEJA 2MSEB 1WA5A 2ODBA 4PTLA 4PZLA 4X8HA 5BWMA 3VKHA 1DBSA 4F4IA 3KXIA 3W3AA 1FMLA 4YONB 1R0WA 5FPYA 2QPOA 1GILA 2MMGA 3R9XA 5FBWB 3RRMA 4CIDA 5BN4A 4LY6A 4GOXA 3IDQA 4JL6A 2ZREA 1KI9A 4OK6A 1OXVA 3A1VA 3QOFA 5L3SA 1SKYB 3ADKA 4O2RA 1SGWA 3M0EA 3UIEA 1KI6A 1P61B 1JBKA 2BOVA 1KDTA 2O8EB 4PO8A 3P4YA 5FUWA 3LH5A 4B3BA 2GXQA 4CEIA 4EPXA 3GFTA 5HZKA 4IOLA 3SJBA 1XZPA 2RGNA 1PV4A 2XB4A 2WKRA 5K8IA 4TTPA 1G4AE 4KODA 5DGXA 3SI7A 3CIOA 3RC8A 2ZR9A 5EQTA 1TQ4A 1IY1A 1Y63A 1CJUC 3CX6A 5HKKD 4A1FA 4ON9A 3EZ7A 2FZLA 1N6NA 3MJRA 5JCPA 3HU2A 3BH0A 2UKDA 4OI2A 4Q7LA 4WVFA 4I1VA 1U9IA 5BXQC 3FHTA 1QVRA 3VR5A 4QG7A 4C2UA 3T15A 1VTKA 2ZITA 3H0KA 1JNYA 3VTKA 1PLLA 4MGKR 4U02A 1X8JA 4WZBE 1C4OA 2ZTSA 2IS2A 1EFTA 4W5HA 1Z6GA 2WAYA 3QG5A 5CK5A 1IJFA 3B82A 5KTYA 1TUIA 4PHHA 3I72A 4KV9A 3WYFA 4BUJA 1F2TB 3CRW1 3KJHA 1JI0A 2OV2A 3MRSA 2CVHA 2GRJA 3TUJC 1FFHA 1RPZA 1IN7A 1NBMA 5DLQC 3A36A 1KK0A 2ZYUX 3LFUA 4KYUA 4HDCA 1MO5A 1FUUA 2NO7A 4BZXA 1Z6TA 2ORIA 1NF3A 1T4GA 4JBYA 4OI1A 4KXFB 5FR1A 2Z4RA 5FBQB 3EPKA 4H1UA 5HCNA 3SE0A 2R9VA 4C0JA 2VSXA 3IQWA 4B3GA 1RC8A 1FNMA 3U6KA 1Z0IA 1M1YE 1NN1A 3K9GA 4AK9A 3ZH9B 3TIFA 1Z07A 3M4YA 5EZ6B 5DISB 1RYHA 1DAKA 2ZAMA 3CWZA 1ZUNB 4RFSB 1NJFA 3RWOA 1ZCAA 1CKEA 4OI4A 4ESHA 1U8YA 3O47A 3PITA 3GPLA 4TT3D 2CNWD 4PHGA 4URVR 4G5QA 3EIQA 3I4LA 2C96A 1JEDA 2BJVA 4TLEA 3DMNA 2QL6A 2Y8EA 2RGAA 5BW8A 4C0QC 5J4YA 1P72A 4UXHA 3EA5A 4M9ZA 1KMQA 1P2TA 3V9PA 4L8GA 5KNDA 1GRNA 5FBLB 4BLTA 1KDRA 2VBCA 1II8A 4OK5A 2DFNA 2WSSA 3UXMA 1NKTA 1NLYA 4QKQA 3DZ8A 3IIKA 3F5FA 1E6CA 2NG1A 1W7AA 2OG2A 3U7FB 1E2NA 2QSYA 1SXJD 4H9GA 5CB6A 3AKYA 1UBFA 2YOHA 1QVAA 3LAWA 3PCRB 5CYPA 1JR3A 4MRPA 3ETLA 4B2IA 2P6NA 5IHPA 4N0EA 3SHWA 2ATVA 2YVUA 3A1SA 4MUAA 3RS0A 5EE0A 3QBVA 3KJEA 1WBDA 2ASEA 1EFRD 1ZC3A 4DIDA 2PMKA 1II9A 4O0MA 4D4JA 2F43A 2ZIAA 1RRGA 2QE7A 1GWNA 1RFLA 2Z83A 4FMDB 1Q12A 1Z28A 4M1WA 3RABA 2XJ4A 2P65A 3W6OA 4LJAA 1DO2A 3FGNA 2I4IA 1ZM7A 3QEJA 3K0AA 4IEIA 4ZDJA 3BB3A 3QKUA 5EE3A 2OSBA 2YYZA 5HPYB 1RIFA 5DN6D 5DE3A 5FPHA 3R9WA 3ZVNA 1YZUA 4HB0A 4A0GA 2DWPA 2O8DA 4RCYA 2FJUA 3QPWA 1VKJA 4TZ6A 3SS8A 2GBLA 3OFND 4JMPA 5IK2D 3ZIAD 4KJZA 2G0TA 5FPTA 3SR0A 2V4ZA 3WNDA 4Q21A 5C1BA 2IF2A 4ACBA 3ONWA 1YRBA 4FINA 1CXZA 1R5NA 4OQFA 1I4TD 1H8HA 2A30A 1HV8A 1F60A 4RZ2A 2DFKB 4BEBA 3W8RA 2QA5A 2IYUA 1Q57A 2R6CA 2G9NA 3TE6A 2ZETA 2PZGA 2Q21A 3CM0A 3WNBA 1W44A 5C4MA 1MR3F 4YDSA 3EZFA 3K9LA 6Q21A 1E3MA 1JJVA 3W6NA 3KQNA 2TMKA 4O3MA 3K9HA 3KB2A 3SFVA 3DM5A 2ERYA 1ZBDA 2O8CB 2ZYTX 2MSCB 2V7QD 2HT1A 2DCUA 1KGDA 5C4GB 2QP9X 5JLJA 2J45A 2F7SA 3PXGA 1NKSA 1EK0A 2DWOA 3OEHD 4F4CA 5TXGA 4Z51A 4JBXA 1IXZA 1F48A 1FP7A 1OHHD 2XOKA 2YWHA 3SFZA 3ZQ6A 1HE8B 3M6AA 3U3RA 4BZPA 1E9DA 1IBRA 2B8TA 5JI2E 3P1JA 4LJ4A 1ZM2A 1P9NA 3P27A 3ADBA 4YXWD 4KFRA 4XJXA 4PANA 1XPRA 2G1JA 2YWGA 3Q9LA 3BK7A 2XITA 2JATA 2AFHE 4P4UA 2A3RA 1Z22A 4Z8XA 1W5TA 2DFTA 2DWQA 1LF5A 2IEYA 2ZYWX 4PC3A 3CBQA 3WP1B 5AK0A 5E95A 2Q6TA 4FWIB 4PQRA 2WWYA 4HDQB 1G291 2C9CA 2CEAA 5B30A 1DOAA 1IM2A 1R0XA 4CZ2A 2WWFA 1YHNA 3B13B 3K0CA 4O2LA 1W49A 2ZUCA 2VP4A 4KITB 3C7KA 2OBMA 4JLNA 4XVUA 3GLGA 1E2MA 2XSZD 1N6HA 3PENA 2NZ8A 1KSJA 4I99A 1P2SA 3W9YA 5LDDC 3CPHA 1QHSA 2J46A 3KXLA 4LBYA 1G8PA 1CR1A 2A5DA 2QG6A 1XPOA 2YHSA 1XX6A 2NQ2C 3IO3A 2ZRMA 2A5GA 2EQBA 4TYWA 2BKEA 1OYYA 3Q7PA 2PJZA 3KKNA 1KIMA 4PQFA 2OBLA 1T91A 1GNRA 1AZSC 1TNDA 1P6XA 1WDTA 4A6PA 1QZXA 1EGAA 2ZSDA 4ZO4A 3VMFA 1E79A 3FMOB 4UNNA 1FNNA 4MRRA 5CJ2A 3EWAA 2FX3A 1NP6A 2BDTA 3HU1A 1XZQA 4B74A 4BFSA 2FMXA 3Q3JB 2ZI3A 4D4KA 4S35A 3KQHA 3CRQA 1Q1BA 3H4MA 4NMMA 3W3ZB 4KCGA 4BFTA 2P5SA 1CR0A 3PVSA 1NVVR 4WBSA 4GRAA 5C2JB 4G1UC 4OQLA 4OQMA 4ZV4A 2JDIA 2ZJOA 4JLOA 3KKQA 4LOAA 5GADl 4Q1CA 2NTYC 5CIQA 3U3MA 4B3DA 4S2EA 5L8VA 3KJGA 2WVJA 1BOFA 4PZZA 1ZM4A 2AXPA 1Q1EA 1NSTA 3R7WB 1P9RA 4XSHA 2VH5R 4NYMR 1HY3A 1TQ6A 4KBGA 4BFWA 2ZXUA 1XEWY 3LBHA 3QXXA 3QXJA 3JVUA 3R20A 3IKJA 1N0UA 2DHRA 3LW8A 3WBKA 2JLZA 5J4LA 4DEYA 2WAXA 1E9EA 2B21A 2OE2A 4MRVA 5TV2A 3THXB 2CXXA 2AD1A 4XIGS 2FFAA 3BBPA 3C14C 2IYSA 1P9WA 3TVDA 3T35A 3DKPA 2ZE6A 3THYB 1MT0A 1US8A 2EWWA 2ZRKA 4PO1A 4LRWA 3VNVA 1CEEA 1KMHB 2HLDA 3U3KA 1HA3A 2FFHA 3QXHA 3L8ZA 3U7EB 3CZPA 1KZ7B 5HE9A 1T3LA 3CONA 3GEEA 2RAPA 4GFDA 3C41J 3VU9A 2XXAB 2IYYA 5HZHA 4MGYR 1FZQA 1ZRHA 4UXJA 1DVRA 1OIVA 3TW4A 2XB2A 5DHFA 2BWJA 5FI1B 4JVLA 2WWIA 3AF1A 4TLDA 3RNLA 4GP6A 3IO5A 3D8BA 4TWZA 3LVQE 4BECA 2RGEA 4CEHB 2IYVA 4PO9A 3RC3A 2HCBA 3GJ8A 5L3SB 4DCSA 3LBIA 1W4CA 4LJYA 2ODEA 3VHXA 3X1ZA 4DCVA 4C0HA 4FCTA 1KI6B 4OHYA 5AWFC 5FR2A 1H8EA 4QNMA 3BORA 4D4LA 5KO2A 1W0KD 4XD7D 2ZU0C 4CEIB 5H8WA 1X86B 2ZS9A 4DLTA 3CZQA 3GFPA 4LV8B 1XTSA 2OM2A 2QTFA 2QU8A 5JFGA 2WJJA 2WJGA 4XWKA 3QXSA 3RS7A 2CCJA 2L0XA 1E9RA 2WMNB 3H84A 1GDDA 4XH9B 2GWHA 2KBFA 1KYIA 3L0PA 5J47A 1AQYA 1K6MA 1YRAA 1ZIOA 1SVSA 4JLBA 2XZOA 2QMEA 1X6VA 4GZMA 3C15C 2P67A 2QM7A 4NCKA 3P32A 3GJ3A 1KZGB 4NE2A 3IHWA 1NN0A 4LHZA 4OK3A 4DEXA 1G5PA 2DB3A 2ZI9A 4I1UA 4QXAA 3CO5A 1KI1A 2FNAA 3TVTA 1KK2A 4D81A 1XPUA 2C5LA 3H1TA 4URXR 2ECKA 3IHLA 4KU4A 1XTRA 1EX6A 4IFEA 4QBFA 5CJPA 5ANRB 4QGFA 4LDJA 3AGQA 3HU3A 1B0UA 3ZJYA 2O8BA 2ZE5A 4IRUB 5FTLA 1L7VC 1DEKA 3H2YA 1D8TA 2IXEA 4P3YA 3G0HA 1TF2A 3CLVA 3ZZTA 3G5UA 2JASA 4RCZA 2FN4A 4JT4A 3CRVA 2JGNA 2NO0A 4WW0A 4G3XA 3U7HB 3QI2A 5LB4A 1MRSA 1E2JA 4NONA 2D2FA 4M1YA 3F3YA 3ADCA 4PZYA 1ESMA 3KFXA 5F2EA 2HXSA 4RSGA 3PJRA 3REGA 1KSHA 1R6BX 1R0YA 2CLCX 4IVRA 1Z3IX 2CL7X 4BFXA 2QZ4A 1U9IC 4NTZA 4O25A 1II8B 2I3BA 4TMWA 4DHEA 4KHZA 3MG9A 4K46A 3BRWD 5H70A 2G83A 3K70B 4RJLA 1Y3AA 1RYFA 1E98A 1Z08A 1A5TA 4LBZA 2GXAA 1G8FA 4PAQA 3FHOA 5SZKB 1EXMA 2CL6X 2FSHA 4JYBA 3PEWA 2RGBA 1JXOA 4AKEA 4IOJA 2Q9CA 2D3WA 5EE5B 1E0KA 1N5LA 4HB4A 2GVDC 3FMFA 4UQOA 2F43B 2ORWA 1XTIA 1KNXA 4GT1A 2IUTA 4WZAE 3VR1A 3UKDA 4KAXA 2RHMA 1R5BA 4L9WA 2I1QA 1SXJE 3K0AB 1DAIA 4NDZA 1Z06A 1GNQA 3S1AB 4OL0A 4A4DA 5EP3A 3KZ1E 3FE2A 4U5XA 3CNOA 4DCNA 1CULC 2EW1A 2W0SA 5JI3E 2O8DB 3CPEA 1R5OA 1LTQA 3GLIE 1R10A 3A1UA 3NC0C 4WA7A 1CRQA 1DS6A 1Q0UA 1RW4A 3B7GA 1NG1A 1U0HC 1QF9A 1U90A 2ZRDA 2XTZA 3SJAA 2W2XA 1LF0A 3L2OB 5TB5A 4Q01A 2P5TB 1XEFA 1AA9A 1XD2A 3AP1A 1UEIA 2WIAA 3W8NA 1M34E 1PLKA 3EZ6A 3U7GA 1J8MF 2YZ2A 4PHFA 2R44A 4R9UC 3WNCA 5CM8B 2VP6A 5FTKA 4LJ7A 5HR5A 4GNKA 3RYTC 3K70C 3TR0A 4Q9JA 5J5CA 5TARA 5JWRA 1EFUA 1XXHE 3NBYC 3IPXA 4IXMA 3B5JA 4FMCB 3UANA 2GJSA 5AJXA 2H92A 4JS0A 4PAMA 4B33A 3QY0A 5EUQB 3U2QA 4JLVA 2PEYA 2OAQ1 2ZJ8A 4A2QA 5KUTA 3QEOA 2Z5FA 4QJ5A 3A6PC 2EWVA 5AJVB 2REOA 2ZRLA 1LV7A 4Q19A 2WSSD 1Z2CA 3DL0A 2OCAA 1R4AA 3I5YA 1KNQA 5EZ5A 4C0BA 3TLXA 2BIFA 3A58B 4WXPA 2Q3MA 3KQLA 5AR1A 1EG7A 5CM9C 4M1KA 1T0HB 5CK4A 4Q1AA 1JR3D 5JSZB 1XTJA 2GBLC 2H18A 4B76A 1G20E 1Q3TA 3Q5DA 4J0QA 1O3YA 4OJQA 1XJQA 2SHKA 4JLDA 4RKFA 4IOMA 4JLMA 3ICEA 1E9CA 2ZU6A 3HPRA 4B2PA 3CRRA 1U81A 1HT1E 1T8TA 3L82B 3FKSA 1DELA 2WWXA 3E1SA 3RS5A 1VCMA 3P26A 3K1JA 5E7IA 2J87A 3SBEA 2XZPA 4NYIQ 4QGAA 4Q4HB 2IYWA 3EZ9A 1DE0A 2BVNA 3AP3A 3FTQA 4HUQA 3QE0A 2ZAOA 3N70A 4B3CA 3R8FA 2DFLA 721PA 1LB1B 3VHLB 1KO1A 3MD0A 3IBGA 1SVOA 1N5IA 3GLGB 3LW7A 2CE2X 1V5WA 3LQQA 4URZR 1I2DA 3EPLA 4JL5A 5A0FA 2R6FA 2W0MA 5B57C 2BMDA 2ZRBA 5KYKA 3UWOA 4NH0A 2HT6A 2C95A 2CHQA 3QKTA 3EASA 5FBVB 1DTSA 2PCLA 4RD3A 4DLXA 1E9FA 2JLYA 2JCSA 4M22A 1H8HD 3AH8A 4MYHA 1ZNYA 1GRRA 2PX0A 1RJ9A 5JJIA 4G0NA 2ZI7A 4LGMA 2H5EA 3EA0A 2R6DA 4M8NE 4ZI3A 2Q3HA 4UNRA 5SZIA 3OE7A 3BFXA 4KVGA 1TEXA 1YZQA 3QVUA 2BC9A 4LPSA 3WMEA 2JLXA 1OB5A 3WYGA 1E4VA 3ZGXA 5EE9A 4ASUA 4ERNA 3C5HA 3OF5A 2FG5A 1G64A 4Q48A 1G16A 5BYJA 3AEZA 4Q4JB 4I81A 4NHOA 1E4YA 1KSFX 2GTPA 1G3UA 1S1MA 5GVSA 5KPDA 1II0A 1XEXA 4R2HA 3J81k 3SQWA 121PA 2GF0A 4BLPA 4OI0A 2J59A 4Q7JB 1G6HA 3DMDA 2ZRFA 4P33A 1F5NA 4DDUA 2QNRA 3GFOA 3IIMA 3K0CC 4GOJA 1ZU5A 3TQFA 2VO1A 4TSFA 5FOWA 2AN9A 2GK7A 2D2EA 3AV0B 2IXGA 4Q1EA 2O0JA 1U8ZA 1KKLA 2REBA 3PEYA 3BH6A 2QRNA 4JBWA 2QT1A 1E2EA 2XJ9A 4A2WA 4A0FA 3AF3A 4X8LA 3TKLA 3GJ6A 4IEEA 1OXSC 4G5GA 3QKSA 2Z43A 2H1LA 3FWYA 5FL7D 1PLJA 2WMOB 3BAFA 4DLUA 2IWHA 1KO5A 4B35A 3IBYA 2ZE8A 1D9XA 1US8B 5G41A 1SVKA 2D62A 1N6PA 3CX7A 1E9SA 2O8FA 2N46A 3ZVMA 3QKRA 1CU1A 3AVTA 4HAVA 4ZCLA 4CRWB 4EFLA 2MMCA 3VU9B 2JJ2A 3MFYA 1UKYA 2FFBA 5G3YA 3GEHA 3OZXA 4F93B 3FB4A 2P6RA 3KJIA 3QVVA 4BWYA 4AY2A 3MWLA 1E2QA 3K0FA 4OBEA 1DG1G 2IUSA 4M2LA 1MABA 1UDWA 4PPFA 4ACAA 1CJMA 4HAXA 4Q9IA 4QL3A 5KDLA 2W00A 4ZPXA 2OT3B 4US2R 3CNNA 2WOOA 4JYCA 3X1DA 4Q18A 4DT1A 2GVZC 3B1XA 4IVPA 4R2IA 1IHUA 2R2AA 5HTKA 1E79D 1F2UB 1V43A 5IRCD 2W2TA 3FDIA 1KTVA 3LWNA 3OEED 1OH6A 4C0SA 2R65A 3SZRA 4QJ3A 2EFEB 2VL7A 2X2EA 1Z6AA 4BLOA 4TTQA 4V02A 2FPKA 4A8JC 2BMEA 4AC9A 4RD1A 4FD2A 3IILA 1E0JA 3M1IA 1E2HA 4C9BA 3SN6A 5LD2C 2IXFA 2R62A 4MQBA 4DVGA 4E03A 1TMKA 2QSZA 2V54A 3ZS8A 4NBSA 2IC5A 2P6UA 3B9PA 3CB4A 4RZXA 4AG5A 1BMFD 2ZVPX 2GCNA 3AUXA 2Z6VA 5L3QA 3H86A 5JWHA 3IUYA 4C3ZA 2BBTA 1COWA 2DBYA 2IF0A 2OXCA 2ZI6A 1N2CE 5FOSA 4D4MA 1KI7A 1SZPA 1OB2A 3PUVA 2N42A 4OHZA 1CBUA 1SVIA 3HWSA 3W34A 1Z2AA 2B7BA 5FH9A 2O8BB 3DVLA 3T1VA 1M2OB 2RHDA 3JVVA 3PQCA 3VAAA 5KSOA 1VCNA 4A92A 1DAEA 4U00A 4X8OA 2PBRA 4DLVA 5SZJA 1W36B 2W6IA 1YE8A 4GI7A 2HYDA 5DSZA 1T3SA 2H17A 3TMKA 4EPTA 1ODFA 3FOZA 4HEJA 1G19A 1W2HA 2ZRCA 4CF7A 2V3CC 1M7HA 3T06B 2ZVQX 3DO6A 1W4RA 4OKSA 4L5BA 1ZU4A 1MOZA 1QHNA 2QEQA 2VHCA 4DKXA 3P4XA 1AS0A 4XVQA 3ECCA 4L4UA 3HP1A 2ZUBA 3BFKA 2D4HA 2B6HA 3VR6A 5JWOA 2REXB 4Q03A 1LS1A 3PFIA 5HE8A 3A4LA 3K0SA 3NBFA 4QHTA 3U4QB 2CLSA 4R7ZA 5SZHB 3DKVA 2ATXA 5EXSA 2WOJA 4ZCMA 5E4FA 2PJRA 2J7KA 5JCZA 2J7PD 2BEJA 1H8ED 2VP9A 4AKHA 1ZVQA 2WPDA 3RSOA 3AVUA 4UNSA 3B6EA 1T6NA 2VEDA 3Q7QA 1BYIA 3LNCA 1I2MA 4LHWA 1J90A 4QNRA 3TJZA 5DI3A 1NNEA 4TMVA 3B60A 3LXRA 5FBRB 4A2PA 4IHQA 4NP6A 5JHGB 2KBEA 1E2IA 3FKQA 4LHXA 4ARZA 1IAQA 3KFVA 3PR1A 2IK8A 4HB3A 1KI8A 3OHMA 2ZJ5A 4XWOA 3NTUA 4GSYA 3O8RA 2A9KA 3UG7A 1OFTA 1W36C 2OBNA 2WIBA 4BPBA 1NY6A 3EC1A 1ZP6A 2V1UA 1SKQA 1ZJ6A 2B92A 2Z4SA 4YMWA 3CWQA 2F1RA 1HYQA 1N6OA 2QORA 3BE4A 4TMKA 1CLUA 1FQJA 2ZRHA 3U3JA 1ZCBA 3W6PA 1GKIA 3NVAA 2EFCB 1OF1A 2JLVA 3TUZC 2ZJZA 3AVXA 1DARA 5GVRA 1E32A 3WXMA 1AQUA 2EFHB 3CF0A 2X2FA 4LK2A 3BD9A 1HE1C 4NCHA 4RZUA 4ITRC 1PVOA 4ILEA 1QG4A 2F3TA 3CR7A 5EP1A 5F9HA 1CJVC 2GKSA 4B34A 4Z54A 5EP2A 4Q7KA 1XD2B 3AQ4A 1G41A 1OKKA 2VHTA 1N6RA 5F9FA 1XMJA 2H16A 4G5SA 5HKKA 2ZRIA 3AP2A 2BM0A 1W46A 1E9BA 2J0VA 1P5ZB 3BJIC 4Q7MB 1KJZA 1MO4A 2YWFA 3NKVA 4Q9LA 1UBCA 4GBMA 3FPAA 1GL7A 2QGZA 1QHIA 2PZFA 1Z0FA 3RRYA 4D0LB 4Q4AA 4B6FA 3OIVA 3D7MA 4RY2A 2XNDD 4TLAA 2QPAA 1U99A 4N1AA 3VKWA 1VPLA 4DCTA 2LCFA 3NBZC 4LYHA 3NBXX 2H57A 4BASA 4W5WA 2BCGY 3QUSA 4MYTA 4B32A 1VG8A 1E99A 1IN6A 2FFQA 2F1HA 1P2VA 3RLFA 1OPXA 4LJ8A 4JKYA 2W58A 1NVVQ 4DC9A 1ESNA 2D7DA 4E22A 1SVWA 1AN0A 1QHYA 1ZD9A 2FOLA 2LWIA 2R6AA 1XJ0A 3DOEA 3TAHA 4E5UA 3RSLA 1D2NA 1XNJA 2ZRGA 1SVLA 4DIEA 3KB1A 4OHVA 1GSIA 2ZJ2A 2YJTD 5FUXA 1NIPA 2CDNA 3HJNA 3QG1A 2WWHA 4NYMQ 2VHQA 3REFA 1FMJA 3ZZUA 2JLWA 4LYFA 4HYYA 1CP2A 1JJ7A 1W0JA 4NCJA 3KQUA 4PQYA 1SVMA 3B1WA 2V9PA 4Q66C 2AWOA 4US0R 5KNCA 4HUQB 1HEIA 3GQBA 1ZNWA 2OEPA 3BWDD 4LI0A 3FMPB 4A8JA 4TYNA 1QHGA 3EAQA 4TMTA 2VQSA 2VHJA 3FMIA 3T1OA 4PPQA 4XOIA 3RS4A 1ZYUA 2CK3A 5TDHA 4XTCS 4AURA 4ZCIA 1XB2A 4ZKDA 1EESA 1QHXA 4PSAA 3RANA 2AWNA 1SXJA 4BFUA 1LVGA 3GJ7A 3GP8A 2OFWA 4HAUA 1B23P 4KSCA 2ZS7A 3EPHA 4FMBB 5G40A 1KK3A 3KL4A 3X1YA 1OT3A 2GK6A 2QAGC 4WZ6A 3GLIA 1RJ9B 2E1RA 3NH9A 1N0VC 3AVPA 1EFRA 1KI3A 4D25A 3UMFA 2JLRA 1S9DA 2G77B 1S4QA 1G8YA 1P60A 2ZRNA 1OV4A 4FN5A 5FOVA 2V8OA 2WTUA 4DDTA 3AKDA 4CT5A 1KJYA 1CJKC 1DAGA 1ONBA 3ZS9A 3WMGA 5JEEA 4X8MA 4NPHA 3VX4A 3B9QA 1UF9A 4B47A 3C4JA 2BEKA 3DPUA 1U0LA 1OFUX 2RH5A 1XEXB 1WB9A 3VR2A 4TLCA 5IK2A 1WF3A 1XXHA 4DLWA 4KO8A 2OFOA 3EARA 4OHWA 4WIAA 3RHFA 1KK1A 3BFVA 3ZD7A 5GJCA 1R8QA 1AGPA 2GF9A 2V6IA 2GJ9A 3HDTA 4AKGA 4MUBA 2RGCA 4EJSA 2CL0X 1JECA 3L0SA 1VHTA 2QP3A 4I4LA 1G9XA 1L4UA 4V0LA 4XSGA 3X1XA 4EPRA 3U6BA 1R7RA 1WBBA 1YR8A 1E0SA 2W2VA 3A8TA 2Q3FA 1KAOA 1NMXA 1RRFA 3BGWA 3IEUA 4PPNA 2NPIA 2G0NA 2GAAA 2GJKA 2CE7A 3QKSB 2BBOA 2XAUA 2OLKA 4JIMA 4F7WA 4ZI2A 2HF8A 2WHXA 3BS4A 3TBKA 4DDWA 2NIPA 2VLIA 1S1CA 1GG2A 3U5ZB 4DUGD 1ZIPA 2C2HA 2O8FB 2V7QA 1Z6YA 1NVUQ 2GJ8A 3QKRB 2GAOA 3RDPA 1W47A 3TAUA 4EPYA 2ZM5A 3LV8A 1QG2A 1HQYE 1T9HA 2ANBA 3BH7A 4QGGA 2WKQA 1OHHA 1UADA 2QY9A 5LBIA 3GLHE 1IN4A 3SNHA 2IHBA 1OH8A 2WWWA 3K0FB 2AX4A 2IHYA 1BYUA 4KFTA 1W4BA 2DYKA 1KI4A 4NCIA 4HDOB 4K81B 4P32A 4YDHB 4YXWA 2EVWX 2ONJA 4IFBA 4TMXA 4YMSA 1AK2A 5KSYA 4DSOA 2C99A 4W7SA 1N0WA 5CDFE 4DXAA 4DT1B 2F9LA 4D6PA 3UPUA 3CX8A 1E69A 1JQLB 3NHBA 1W5SA 1OSNA 4R98A 1M8PA 4P4TA 2ZJBA 5EP4A 2XEXA 2YWEA 3GLFE 1C1YA 2VF7A 2QM8A 3OE7D 5CB8A 2RKOA 2PLRA 1XWIA 2WV9A 4NL4H 1OW3B 1AKYA 1JXMA 3PIRA 1P4SA 5EE1A 4ASUD 2FGJA 4TQAA 5TMPA 1UAAA 4C0LA 1NG9A 3WYAA 5P21A 3K0EA 2VP5A 5BYKA 2VIIA 3ZZ0A 3K9NA 3I32A 3SYKA 3WMFA 4D2IA 4PSVA 3THWA 2IS4A 1GL6A 3C16C 3QF7A 2IL1A 4IOKA 4HAWA 5FTNA 1S8FA 3KX2A 3UMRA 5C18A 4D80A 3AVWA 3C5CA 2QPTA 5A5GA 1NSFA 1P3JA 1RVDA 3QBTA 2ZRPA 4MYUA 2FH5B 4GDFA 3JZMA 1EWQA 3TW8B 1YJ5A 4HLQB 2H7VA 1H65A 4TSFD 4KLZA 4DCUA 4CEJA 1OJLA 5FPKA 1GL9B 1RZ3A 2GETA 4LCBA 1E1QA 3TSOA 2BM1A 1GTVA 1SKYE 3E5HA 1ANKA 1S96A 2ZPTX 3GMTA 2QN6A 3ZDQA 4M0LA 4TN1A 1BIFA 2YOGA 3I73A 1UEJA 2J41A 1HTWA 3TQCA 5DHAA 4G5OA 3D6TB 1NI3A 1VCOA 2LKCA 3WHKA 2ZROA 1YZGA 5GJWC 4NYJR 2G88A 3EX7C 1F3OA 2Z0MA 1DAHA 4CW7A 3UATA 4MKIA 1K5DA 2P0EA 1FPMA 4LZZA 1WCV1 8OHMA 1XTQA 4I1OA 1DO0A 3WHLA 4B2LA 4HZIA 2BBSA 2QUZA 2IYRA 3RS3A 1XRJA 1GP2A 1SHZA 5D3QA 3ASZA 5JECA 2ZI5A 1NJGA 2FEOA 1TADA 3KDSE 5JBQA 5EUMA 1DADA 1G7CA 2GNOA 3MGCA 3CUEF 4IVQA 4NKRA 1NBMD 1OE0A 2IX3A 3O8CA 4MDEA 1J99A 1ELOA 1NN3A 1VIAA 2GESA 1XCPA 4GMDA 4JLJA 2AFIE 1TEVA 1KDOA 4QHSA 5C46F 3MAAC 4ZDIA 4M4SA 1KO8A 2X77A 2ERXA 3SC3A 2J3EA 2OHFA 4ABYA 2R8RA 5IDVA 2IS1A 1A82A 2YKGA 1VDZA 3FVQA 3KUDA 3LDAA 4JL8A 4IXNA 1NLZA 4HZUA 1UKVY 4QBIA 3T1TA 1SULA 2WJVA 2FZ4A 5DI3B 4BLRA 3CPJB 1WRBA 5F3WB 1TTTA 1IY0A 2FDCA 5GJBA 4KVAA 1Z47A 4ARZB 2HV8A 2XTNA 4BFVA 3KKPA 4RD4A 2HEIA 4FMDF 3KKOA 4M9SA 1UFQA 2QAGA 4DLSA 3EPJA 3DDCA 3PV0A 3K70D 4ZIRA 1TF7A 4QBHA 1W4AA 3MWYW 3THOA 4CGZA 2PCJA 1IOZA 1N5JA 1BH2A 4RD6A 2ODNA 3B85A 2LKDA 2ZRAA 3NC1C 1VG0B 1G8HA 1AJEA 3GJ4A 4TYPA 4E09A 1QBKC 1G4UR 2F3RA 2BMJA 4CVNA 2OLJA 2ZR0A 1COWD 4HB2A 4MKGA 1KSGA 3CR8A 4QJ4A 5LPNA 2D06A 4AYXA 4Q9HA 2RB4A 2WJHA 5FOUA 5FI0B 4D0GA 2QE7D 1Q20A 1ZNZA 2W6JA 4QBGB 1W0KA 3CH4B 1KO4A 3GJXC 5K8LA 1MV5A 2IWRA 4HLUA 1EFHA 3CH5A 2W6ID 4Q5IA 4PC6A 2AR7A 1CTQA 2KI5A 1E2KA 4P31A 1GKUB 3DHWC 4Z8YA 1KDPA 3NDBB 1E1RA 4RVCA 1FUKA 4XVRA 4NCNA 2BHRA 1NMYA 3X1WA
chains in the Genus database with same CATH superfamily
1S3SA 1MJGM 1CIVA 4ZWNA 3WOHA 3G59A 3PYLA 1ZD8A 4MUIA 1SBYA 4DB2A 4MH0R 1JBEA 2JVIA 4RY9A 2IPXA 2HPHA 3E70C 3FUXA 2IA5A 1Z63A 1XMIA 3PUYA 3L8HA 4C01A 3P9SA 1W2GA 3UMCA 4FX5A 1T25A 1XJCA 3SICE 3RWMB 3WRXA 4E4YA 621PA 3JQ9C 3R40A 2DAPA 4A8PA 2UZ3A 1MB4A 3NASA 1Q0SA 4BO6A 2P4UA 3NBAA 5CVTA 2IZZA 1XD9A 2NSDA 1DAFA 1U3WA 2VJAA 3JV7A 2PMWB 2BCJQ 3RRNA 1NQVA 3BWMA 4F9FA 2DPGA 1FUIA 2C31A 3F5QA 4RE5A 3IMCA 1YR3A 1EE2A 1XQ6A 2GS9A 3GJSA 3H5OA 4FYVA 3U4MA 2YX1A 2QTHA 5GOZA 5J9FA 4GMFA 3UH0A 3WTBA 4BFZA 1PT6A 4AQDA 3C7CB 4YUYA 2NO6A 1KDZA 1M5TA 1BKDR 1MORA 3AIOA 3JVDA 4JA2A 1UAGA 3VYTB 3OY7A 2Y1CA 2B1RA 1IY8A 4IS3A 3RVQA 2VDWB 2GI4A 2PV7A 3FX2A 4IJVA 1JSLA 3G8AA 2JHGA 5KMGA 2XXAA 1T5TA 2JLSA 4XR9A 1JDZA 3HJRA 1X7HA 1Q44A 2ZQ5A 4IUYA 1Q7CA 1ZMRA 3K5WA 1RBQA 1MQAA 2ZSFA 2DT8A 3UJNA 4A15A 1U7DA 1O8CA 3NNSA 3QWBA 1CVRA 3EW9A 2VDNB 1GM5A 2P9QA 3OSZA 3PVZA 4ARAA 5E3HA 2DSNA 1FDSA 2BGNA 2P2LA 5BQ5A 1M1UA 4MUYA 4F4JA 3GARA 1WS6A 1M83A 3HADA 3N2IA 1W9HA 2W48A 4CEHA 5JFTA 3FOWA 1JZSA 4LHYA 3VZBA 4LYAA 3AERB 3C3KA 3ZEIA 2AUTA 1C3XA 3R5FA 3R3JA 3V9AA 4EKGA 3GQBB 2KB0A 1DZ3A 4WFKA 2HTFA 5F1OA 1O4VA 4RK5A 3O8LA 3QQ5A 4HY3A 1Y8RA 5FLXA 4E21A 3A6FA 1JR2A 5EXTA 2IYLD 1C29B 2GZAA 1G5FA 3EQ7A 2H7YA 3R7DA 3UK6A 2RGDA 3MJDA 4Q1DA 4QOJA 1Z8FA 1VB5A 5LD2B 2DR3A 2QE6A 2Q46A 3NTQA 4IGAA 3U56A 1PG5A 1YZTA 2NO1A 1YQUA 2BBWA 4ZAZA 3NHKA 1AY0A 1QHFA 3PQEA 1RLIA 1P81A 5E2IA 4N5HX 2IEDA 4MKHA 4PCUA 4CTMA 4I7EA 1D9ZA 3U49A 1KBQA 1UC8A 1HDXA 4BNWA 1T2VA 2GN4A 1Z15A 3GQVA 5TF0A 2W8ZA 1TKBA 2JCXA 2GO7A 3ZKWB 4CDGA 3PTAA 2I4MA 3M34A 4LRSB 4OQDA 1NX6A 5AUQA 1Q7TA 2NO9A 1HDRA 3ZCQA 1JEJA 2WDZA 4EMUA 2J5BA 3L7LA 1NQAO 1A9OA 4WASA 3ZE2B 5DMXA 4Q3KA 1RS0A 2VWQA 3QUCA 2SKDA 1OX4B 1PQYA 5COQA 4MA4A 3UG6A 5DIFA 1M34B 3WK6A 3WYNA 3ZW7A 4YCMA 2H0RA 2YVQA 5HGXA 2C8LA 3DZBA 2EX1A 4PM4A 1E3WA 4A03A 1ZJZA 2I1VB 3FAZA 2F17A 3NIBA 3NEPX 3GPCA 2JAQA 3IESA 2BFFA 2XNJA 1D0SA 1IQPA 1BZYA 1QP8A 3LHKA 3RSQA 5JJKA 4J94A 1E96A 1TPYA 3BHNA 3B6MA 2HJVA 1C50A 2NT4A 2I2BA 2P78A 3KKMA 4W5JA 1UK8A 2VYFA 3RIXA 4B6GA 2ZCUA 4C22A 1EXDA 3IAS6 5J1TB 3LVRE 4LN1A 4XWYA 3TLGB 3ZZMA 4DZTA 1VHLA 2HSDA 1VE9A 4N8DA 1N3YA 5EPEA 3DV0A 2IGTA 2P9JA 1HL3A 4LUCA 3ROXA 2XBLA 3B38A 4F4UA 1AV6A 5CLQA 1ABFA 3PXEA 3KTFA 3ND6A 4FYJA 4PGMA 4UBNA 4OGKA 3MLEA 2BW0A 2JJMA 3KSUA 1P29A 3RPEA 4C3OB 1P33A 2BGJA 3SQXA 3OOEA 3HJAA 4N48A 4V0QA 4L9SA 5DW3A 1J2JA 3QPUA 2RE8A 1ZJWA 3P2IA 3GIDA 1K5PA 1G5QA 3DYBA 3GRKA 4IIYA 1Z4QA 1ETUA 3LA6A 3BFJA 4JV5B 2JI9A 4BNGA 3HB0A 1LZLA 1G20B 1FOEB 1TK9A 1VSUA 4TXJA 3T5DA 4AUNA 1IXYA 4Q1BA 4W1QA 3D5TA 1LFDB 3PPWA 1FLVA 1LBTA 1GKLA 1HURA 3ZQJA 2O3JA 2GEBA 5AQ1A 4PRYA 4KRXA 1FTNA 1X3SA 2CK3D 4M9QA 1U8AA 1VPDA 3OWOA 2QAIA 4Y0NA 1T8UA 3F2VA 3IR7A 4M89A 4MOWA 1N1MA 4XARA 1L5RA 1WOYA 2YRFA 3R44A 1O0CA 4IHJB 5B3AA 1Y89A 5A3VA 2BMFA 4PX9A 2HLDD 1X9HA 1KAHA 5T8KA 1BDIA 2GGSA 3OAAA 1Y3CE 1Z2DA 2V58A 4GF5A 4KFSA 3PUIA 1DIAA 3PZRA 2G1KA 4URWR 1OXKB 1CZLA 1VYUA 4IIVA 4ZOCA 4L72A 3QFSA 3VPBA 1QDLB 1YHYA 1NUUA 3S2FA 4LBVA 5JIBA 5C0OE 2WBLC 2WKWA 3BB4A 4K5QA 5HF9A 4KGVA 1FDIA 1OGIA 1MH9A 2WMYA 4TL7A 3X44A 4B84A 4F5ZA 5THKA 5BN5A 4GBED 4YRIA 3QPVA 1X8KA 4UHCA 1ZX1A 4UEQA 1M73E 3V4FA 5B3JC 1X1AA 2G6BA 2PLFA 5BNWA 2GZDA 3AYXB 4JKIA 2PKRA 4WESA 3SXUB 1ZW1A 2HA3A 4PZCA 3ZHQA 4CLHA 3U60B 3N7TA 3PLAE 1CQJA 1GAJA 2HXYA 6AT1A 4MITA 2I8AA 1IXSB 4WOJA 4EEKA 5A02A 1ARZA 1E2GA 1CQPA 2VNHA 3PR2B 4TL8A 3T7RA 4EAQA 1PX0A 3FW1A 1IATA 2HFJA 1V45E 3GGPA 2X19A 4DUZB 3RG8A 2NP6A 3UK0A 1E2LA 1CNEA 1XEWX 2UYGA 3QX9A 5BSVA 1KYTA 4O2AB 1A27A 2RAUA 2ZB7A 3K1YA 3PKZA 1ZXXA 1YZKA 5CIWA 1QCYA 2PGLA 5A3SA 4FZVA 1S5PA 5ARDA 5C8YA 3F8WA 5M5BA 1V1JA 4DHWA 4YUAA 1XFAA 1YJAA 2Q2VA 3G1TA 3WRYC 4B4WA 2GILA 4UUMA 2QD1A 3BZUA 3HJBA 3KFLA 5DM2A 4TL6A 1LDEA 1IRIA 4GOOD 4I08A 2GCOA 3WL5A 5K8CA 4N76A 1KRWA 2OC9A 4YJHB 4ECAA 3REQB 1K3UB 4PLGA 1JBQA 1ZNQO 2EBFX 3UJDA 5JZVA 4PZUA 4H18A 1JEOA 2Q1YA 4KTVE 5BNIA 1KEKA 1CDDA 2O50A 3D4IA 1OU4A 1Z7EA 3FLAA 3K5HA 3ONEA 4LSZA 1U0JA 3OJCA 5EKSA 3NYIA 2A5FA 2O9JA 1EVQA 4YCLA 5B3KA 3L05A 4UE6A 3U4AA 2IW3A 4CKZA 1R27A 2VATA 4E1BA 1JG2A 3UCFA 4HLDA 1A2OA 1V41E 3DZDA 2CVQA 5DBHX 2LBPA 2Y6UA 3CF2A 3UBMA 2A0YA 2FF5A 1HC7A 4F71A 1GOTA 3LBYA 2HPZA 3BZWA 2AF4C 4F2PA 3NOXA 2F55A 2GM3A 1KOGA 1JPJA 2O07A 2VJKA 1OIWA 5IG2A 3LY9A 4G65A 4KHPB 1CCWA 5JNWA 1LPMA 4LYGA 1XA4A 2ZUEA 5HMLA 2O7VA 2QD2A 5E4JA 1LGYA 3FFBA 4W82A 1BDHA 3V4RA 1HUQA 3W9UA 1P75A 2VSFA 3AVQA 2OD9A 1PBTA 3TFOA 3D3WA 4MVJP 4NIMA 1NBOA 3RVDA 3GHHA 3I8OA 1JQ5A 2A5YB 4FHFA 2QROA 2KJQA 1YVDA 1PUJA 1LKZA 3LUCA 4KN9S 1GZSA 4KNWA 4LOIA 1G1MA 1B4DA 1XLTC 1OLUA 3L8EA 4R5HA 4Q4HA 1VMIA 1QHHA 3Q2IA 2CJWA 4R31A 4S24A 3RS2A 1G8MA 1MHPA 5FJIA 4EB6A 5FF9A 5FAKA 1GFZA 1RAIA 3IOYA 2ZR7A 4BX2A 5KJCA 1NLFA 1XMQB 1PZFA 3OZ7A 4WOKA 1JU3A 4ZYZA 1MB2A 1SCDA 3QKIA 3AETA 3FN4A 1R0CA 1TL7C 1E5QA 1G3MA 3BXXA 4GECA 1V35A 1HMYA 2QAGB 4BV9A 1MA3A 2QRPA 1D7AA 3VAZA 3WV5A 4GDMA 1HDOA 1G8SA 2NSJA 4HADA 4URUR 2DP4E 3LM8A 3P0HA 5F2OA 2Q7XA 4HKTA 2I6XA 1P62B 5LC1A 1E94E 1EK5A 4YECA 3AHDA 2B5VA 2XGSA 1DTWA 3X2SA 1BE1A 4LDZA 4MZXA 2WT9A 5F9MA 5BQPA 1DDIA 3W7VA 2HBQA 3KJXA 2KLBA 3OKFA 4JWTA 3D4LA 3L07A 5JVDA 3KAQA 1OUMA 3OPMA 4Q3BA 1V8ZA 5J5AA 2VZLA 1JAXA 2OQ2A 1PF7E 5K4GA 1U2TA 4QOEA 3UMSA 4FNAA 2VHEA 3QEKA 2AJDA 4IRMA 4Y6RA 3EMVA 1N3BA 3CJQA 2EX4A 3GGGA 2O0HA 1U0RA 3VOAA 2LVBA 5TVKA 4ZCSA 4ZP1A 4Q4JA 3PGJA 1PR3A 4LSMA 5GM1A 1TU0A 4HUTA 3HHPA 1UWVA 3PA6A 3DCIA 2OK8A 2ZUDA 3B52X 1PUIA 3ETGA 2TRSB 1N2CB 4J6FA 4MIOA 3K71B 4MUMA 4QU9A 2O8EA 3EVCA 2OCYC 4FFSA 3G1WA 1J1ZA 4ZAVA 4H1WA 3ESDA 3RBXA 5BSUA 4RVDA 1ENYA 4AIIA 2BCEA 1I3KA 3G5TA 4W4TA 7MHTA 1SK8A 3D3EA 4WECA 1E64A 4AVYA 1ACLA 2PPLA 5C8DA 1U4OA 4RLHA 2EFGA 2HB6A 5K0ZA 1SNYA 4KH1A 3C3WA 5DNVA 1LA2A 4FI3F 4MQUA 2CD7A 2R97A 3A1FA 4M8SA 1ORHA 2O2IA 1O9HA 4FGUA 5H9VA 3LGAA 4HQKA 3DLBA 4ALLA 1TMGE 1Z0DA 5FL3A 4KACA 2W70A 1O95A 4N0DA 1KARA 4YJ2B 1JA1A 1VL5A 2PUWA 1AKVA 4FIDA 4RNCA 4Y9SA 3R9IA 4CM4A 3GEGA 2ATCA 5L4SA 4JXZA 1GZ5A 3FXAA 4WY5A 2XE8A 3HYNA 3SK0A 4JGBA 4LQLA 1G8GA 3GEIA 4TUYF 5CFPA 1AK9A 1FP6A 4NH4A 5L3VA 1C3VA 5FPQA 5GM2A 4ZKEA 1RAHA 3LXXA 4Q37A 3B2NA 3CTMA 1RXVA 2YUTA 3A6EA 3NOOA 4E32A 1ORDA 2P9YA 1A9YA 2PXHA 4RM2A 5DGIA 3UA3A 3T5GA 3ZCVA 4NX2A 4RFLA 2WAOA 5DF1A 3ZIAA 3FB1A 4JR1A 5IN4A 1QZTA 4GPD1 4HX5A 4C30A 2FUG1 2D74A 2LZ0A 4I5FA 2HF7A 2E2WA 1WOMA 3TIIA 4BDTA 1DINA 1X42A 4WFJA 2P8SA 1AURA 1TXGA 3IAHA 3O38A 3PHHA 4D3YA 1J49A 1GYRA 5D7BA 5B3JA 2B8WA 4RE6A 1VP9A 2FHSA 4RDIA 5J4KA 3QI7A 5DSZA 3L0IB 1GUBA 3QYAA 2FI1A 1K4YA 1RM3A 1T8SA 1ZL2A 4JLKA 1AXGA 1WUHS 3QHAA 4JCCA 3D4NA 1F2UA 5F7ZA 3ND8A 1R18A 1OA1A 2EYUA 1HE2A 2J9RA 3HFGA 2BL4A 4JEUA 2C78A 2J7PA 1XMSA 5DLDA 4NK4A 4V1CA 2RGUA 1KWGA 3A1EA 2W6JD 3KWFA 1KQNA 4TSKA 4EKYA 5ITSA 3MRXA 3EXHA 4YMVA 5KSZA 3PJEA 3RARA 4EJ6A 1N9GB 4O4HF 4DJAA 1J8YF 3N74A 4KQ2A 2BZ0A 1M5RA 1HE5A 5LB2A 4WOPA 1FSPA 2XB9A 3NHSA 3Q8XB 2GH1A 3HI4A 4ZO9A 1EP2B 3W4IA 1U5CA 2CLLB 3F6EX 4GOLD 3H6KA 3KOYA 4HNSA 1NA5A 5B58C 5ERYA 1JT9A 2OC4A 2Q8PA 4AMBA 2CHGA 5J2TB 1SIBE 1DX4A 3C3CA 3KK0A 2O19A 1PZMA 3WBKA 1RYNA 1G6OA 1KY2A 1RWPA 4FYPA 2PMCA 3FYDA 4NNPA 3F47A 3ZBTA 2QVYX 1VIVA 3TQTA 2ZE7A 1VMEA 5ALTA 3PF9A 4DDVA 2AGVA 4F92B 4CN9A 4C2TA 1FFXA 3AY7A 2FE4A 3MTAA 1ACJA 3I8SA 3FYUC 1CR2A 2BKUA 5K7SA 3QXCA 3PQ2A 3HN6A 5AJHA 4JQCA 4JSYA 3VNBA 1RXIA 1KZ9A 1NW5A 1QM5A 2H4HA 1EUDB 3CS3A 3UKJA 4AMYA 4POAA 4MEBA 1UP7A 5CXSA 1WXEA 1AS2A 1AUOA 1DG3A 1HORA 1XE3A 2CXTA 3EGXA 3F8TA 2GM4A 1DQSA 2AD5A 2LIPA 3ZV6A 3ZLVA 1M2OA 2AL7A 4AMVA 2FEMA 4QJIA 3FCYA 1JMKC 2EXXA 1A4XA 2R5FA 3PX2A 2JNWA 4L15A 3T4UA 2AZDA 4Q9KA 1WCIA 3QIAA 1IZZA 3FRJA 2ONCA 4UKDA 4BQIA 3I39X 4XUDA 3VGPA 5KTSA 2EOAA 1J70A 2ECFA 2FX2A 4OM8A 4DADA 1E7RA 1PVVA 1KKMA 1XTTA 1JF8A 2NOAA 5C7LO 3KQKA 1BQ3A 4EYEA 2IXBA 1RPJA 4QQRA 1X7DA 3JZAA 3NKFA 2XGJA 1WY7A 1TCAA 3OWHA 1G3QA 1UWCA 4NS1A 1BWQA 1IBCA 2DY1A 3WYBA 4ML3A 5I9IA 4CNBA 4GXQA 1EFKA 4H3VA 1UDXA 4FXPA 4FT4A 1JQ3A 4ZDKA 4KPEC 3HY4A 3UYLA 1AKWA 2RGNC 4CKXA 3KPVA 1Z82A 3GBPA 3S81A 4E88A 5DYTA 3WYEA 4Q7QA 1EYZA 3GYBA 1J0EA 4F6RA 2XR1A 2QTVB 3IQGX 4NZ9A 3U4QA 4Q3OA 3ZU3A 2A2ZA 5AJZA 3VYVA 1JHOA 3U4IA 1P9OA 4M54A 3TCXB 3LZ6A 4IZIA 3ICQB 3C8UA 4NYJQ 4XM2A 3CEMA 3N2EA 4E94A 4CL2A 5DBEX 2JIMA 3E22A 4EPWA 2IYOA 8AT1A 1IJEA 2OILA 1RKQA 4L5YA 3QK7A 1QYDA 2CUTA 4R8SA 4YP5A 4AG3A 3JD4A 1SA0B 3HVRA 1TYEB 4LCJA 1JFRA 4RMGA 4JLUA 1VECA 4UATA 4H0CA 4C87A 1Q1ZA 4QEKA 4ZVPA 4RLFA 4EG7A 2O8CA 1ZD1A 4GPIB 3VNSA 3CXRA 3AR6A 3PUWA 3DWEX 2O1WA 2RONA 3M9LA 2X1VA 4FBMA 4F11A 5J4HA 1YS6A 5C1DA 4TKLA 5J2UB 4ARIA 4B4DA 1C9YA 1K89A 3AVVA 3Q85A 1XKQA 2Q6IA 2Q4TA 3U7JA 5J4VA 5ALRA 4ALMA 2QVLA 1UMDB 3AHJA 2XDAA 4EFNA 2C8VA 3JW8A 5A3JA 1NATA 1AKEA 3ONDA 2PVPA 4KXYA 5JS7A 3DFZA 1OYOA 4ENSA 1RQPA 4MS4A 1QK4A 4QWMA 5HWSA 4WY8A 5IXYA 4IXDA 3AHCA 1O0BA 1WZEA 2WSBA 3ROKA 4OHXA 3W7AA 1GZHB 1H6AA 4OJNA 2GXSA 3OHPA 5IC4A 4LV5B 1L3BA 4D26A 1VE6A 3T7AA 3OFVA 1XAGA 1KJWA 1ZZEA 3B3AA 1GUYA 4B1FA 1NJ1A 3KJFA 4GGMX 4K8OA 4PLPA 4F9EA 4J29A 1YJCA 4HQNA 5A04A 1TO2E 2JKVA 3PG5A 1VBFA 2GD1O 3JS5A 5DKFA 5AW5A 2DJ5A 3CLRD 2J5XA 2YXEA 3QEMB 9ATCA 1PGQA 2OBXA 4D0SA 2K2WA 3G8BA 1PTKA 2YN2A 3GVCA 1Y8ZA 3EXAA 3GJ0A 1GVNB 2E3JA 4GPTA 4PYNA 4UHBA 3SCZA 1YKGA 4JN6B 3K09C 5K8TA 1G5RA 3WNVA 4GUAA 3BL8A 4EATA 1PJRA 3GD7A 3IMKA 3QENA 4MHTA 4MW6A 3TTSA 4EHNA 3VFDA 4OM7A 1KQ3A 2GPWA 3SS7X 5CH8A 1T0PA 1N2SA 3T61A 3BKXA 1Z5WA 2OO7A 2QNIA 1QO7A 3BXGA 4F4HA 1EWRA 3A37A 4PLVA 4AZTA 3ETEA 2OORC 1APBA 2MSKA 4LK3A 1Z0KA 1Z73A 5JD3A 5SICE 1FU8A 2WUVA 5JQWA 1EKXA 3SJZA 3STWA 1C9MA 2Q5EA 5IT4A 3I37X 4GIBA 3NXSA 1HYBA 1HK7A 1Q0PA 1R8JA 4DNFA 5JAPA 3FD8A 1RKUA 2FV8A 3T1NA 4GU5A 5FEUA 2ZS8A 1F14A 3NG1A 4KFUA 2GXUA 1T36B 3LD9A 4LSGA 2ON6A 4U6NA 4LZAA 1IY9A 5KJEA 3SLGA 3ZD6A 4BNNA 3E9QA 3W2TA 2DVMA 3W6UA 5DCWA 4YAIA 2AVNA 1ILEA 2GN8A 3NWJA 2P2CA 1QB8A 2V7GA 2WKPA 4JLPA 5CX1B 3TMYA 1OT5A 4I0WB 2VNAA 1IEWA 4XD7A 5I8PA 1G17A 4KGZA 4M6WA 3FFAA 1E8NA 1UPBA 1Q7EA 3RUHA 1T4BA 3W6ZA 1QRAA 1VE1A 2B6NA 5BSTA 4YAUA 2FA9A 2F62A 5CCBA 2CUKA 5DH9A 3NDPA 3OAAD 3O4JA 1OIXA 2DC1A 2ZEJA 1N6KA 1ZI6A 1YE5A 4GOKA 4OAOA 4BFYA 3HL4A 2VZ8A 3L1HA 5BSFA 1ISPA 1LU9A 1RPTA 3WLSA 3QMVA 4YRKA 3WP0A 2X8AA 4QOSA 5GOTA 3T4PA 2VTKA 4W9MC 4BNDA 3CSUA 1IJKA 1Y9DA 4GICA 3JRWA 4TMZA 4E7OA 2QN2A 3FTNA 1S3GA 4N7BA 2RARA 3EXHB 4FDTA 4US1R 5FUMA 2EGUA 3KHTA 2ZDQA 3FWPA 2QL5A 2FPPB 4RANA 3R7WA 3WB1A 5MGBA 2PXAA 2ZYIA 3DSRA 5D6NA 2CXUA 4CI0B 2AOTA 2JGIA 5FADA 4C0XA 4DUGA 3L6DA 4EVIA 1S9HA 5L3ZA 1SG6A 2AJTA 4PGGA 2FMKA 3BTUA 3PJFA 1XBTA 1R2QA 1ZW6A 2WY2D 3WJ1A 2FQ1A 1ZQ1A 3K05A 1LI7A 2ODWA 3C74A 3F46A 1WQ4A 3EDYA 3KLPX 1TD1A 1C8KA 2CBZA 2JFVA 2MR6A 4HWOA 4UM8B 3U3XA 2W2QA 4PXAA 4TWAA 3D8RA 2R87A 3QV1A 3ZNOA 4GKKB 2WQ7A 4DXDA 3WC4A 3PWZA 4JUAA 4F2DA 2VF8A 3WGIA 3WMRA 2N1MA 3FNRA 1D6JA 3GDGA 3SX4A 3WGOA 4JC8A 4DN6A 4FI3C 1Y6FA 4N7JA 1VJ5A 2ZW9A 4KN5A 1AVTA 3CVJA 4F1JA 1FVFA 2QTCA 4OFWA 4WEOA 5C5DA 3EMKA 1OBFO 5D51S 4OB7A 1DOZA 2G71A 1TM5E 2VTEA 4PINA 1M75A 3LT4A 1G8AA 1V16A 2R25B 1SBNE 1ZXLA 2P2NA 2WD7A 3QU4A 4FGZA 1FMLA 1YJQA 3GNLA 4DGQA 5CH3A 2QZ9A 1GYQA 3JAWA 4AJHA 4V0RA 2QRVB 3H9GA 4CIDA 3OMXA 3I76A 1ADGA 4LY6A 4R2MA 3C3MA 3P9CA 2PANA 4JL6A 1EI9A 2XI4A 3KD3A 1QZZA 4KK4A 2ZXEA 3NM6B 3A1VA 3NXKA 4DNQA 2RH4A 4I9GA 1TDJA 2QDKA 2OXTA 4EH1A 1SKYB 3ZOZA 1DAOA 1W0CA 3PNQA 1XWWA 4BHTA 3G0BA 1XPJA 2H48A 1KI6A 4RO0A 1RXUA 2BOVA 2EP5A 3N8IA 4PO8A 4WKPA 3P4YA 4M9RA 2PLWA 5FUWA 2WM3A 1L4BA 4J16C 3KDAA 5LA6F 3BCRA 4DABA 4H2DA 5KYYB 3UJ8A 1ID1A 3GFTA 2W6MA 5HZKA 5FYQA 5BR4A 5JBNA 2O7NA 4PHCA 2G4CA 3M8KA 1YB5A 2ODAA 3ZLTA 2RGNA 5ALMA 1M2JA 2WKRA 3KSRA 2WABA 1CF9A 1MD9A 4M60A 4UOQA 3C2QA 5JCOA 4UHJA 3FCCA 2CC2A 2HMAA 3DXZA 1TQ4A 1IY1A 1Y63A 5B4VA 1C7ZA 1CUBA 1NNSA 4PG6A 5TSDA 1U3VA 3ABRB 3LX6A 4X60A 1EVJA 5BT9A 4ROTA 1NJ8A 3TOCA 3KM0A 3BH0A 3A26A 2UKDA 4RWZA 4WVFA 3DV9A 3SKXA 3FHTA 4CCSA 1ECCA 1QVRA 3VR5A 2FQQA 1DI0A 1O9GA 3VPSA 3EXFA 1JI3A 4I8IA 2FP4B 4QPPA 1JNYA 4YJFB 3URKA 3VTKA 1NTOA 5E2BA 1X8JA 2FG7C 3OQHA 2J6HA 4YWHA 2ZTSA 4CMAA 1J1UA 5JYDA 4IXTA 4OH7A 4IIFA 3B20A 2WSYB 5JPIA 4HQRA 3OPNA 3L0BA 4R2XA 5KTYA 1P4AA 2QUBA 2NSHA 1W88B 4B6QA 3BDVA 1DJMA 4Y2GA 4OHUA 5EIFA 4K9KA 1B93A 1DT3A 2Z5GA 3BXOA 1EFDN 1JI0A 1H69A 3KJHA 1IIRA 3Q98A 4MUFA 4L2IA 4TKUA 3CV3A 5TGDA 3L8FA 2DPHA 1FFHA 1EGVB 3QEBZ 1RPZA 3A36A 1KK0A 3BJEA 3LFUA 4KYUA 2NO7A 4OKNA 5FYDA 1T4GA 5JAZA 2QF7A 3HWWA 4KXFB 2IE8A 3C4QA 3MGGA 4TTSA 5FR1A 1BROA 2FCAA 3K9WA 3MRTA 2HBRA 4X1KA 1U11A 4N18A 3MWGA 5IARA 1DXOA 1NT4A 2EJUA 3IQWA 2R79A 4M86A 1TAQA 3D8HA 4KRYA 4PYJA 3TCKA 1NC1A 1IYZA 3BRQA 3W2EA 4ARSA 1IH8A 1K2WA 1KP3A 5HJ7A 2GAIA 2I91A 2CLMB 5KWSA 4HS9A 3SDBA 4GMKA 1WMBA 2YCBA 1U8YA 2RGWA 4WFIA 3O47A 4YLEA 3PITA 4UUOA 3GPLA 1SH7A 3LFHA 5F4ZA 3SMQA 2QUKA 5HP4A 3NATA 4BFCA 3OQIA 1YMVA 1L6IA 2C96A 1JEDA 3DMNA 4YV0A 3LHIA 2RGAA 4MNTA 2DR2A 1R3UA 4J49A 5KNCD 2NVUB 5BVGA 1IHDA 2HLPA 1JR4A 4DA7A 3EA5A 3OBBA 4M9ZA 4OGFA 3WIBA 3CUTA 3SD7A 3DZJA 1PDVA 1GRNA 1GTRA 3HKEB 3LUBA 4RXUA 2NZXA 2DFNA 5BUZA 3G5MA 1NKTA 4H7KA 3R0JA 4OMUA 1E6CA 3Q12A 4X1IB 1RAGA 5H3HA 4F1WA 4FC7A 1P1IA 3TW8A 3AY3A 2IJGX 2OG2A 3F8SA 2I8LA 1E1MA 5JH7F 4H9GA 3SLKA 4FQ5A 1CQZA 1UBFA 1QVAA 1WKCA 2YOHA 4I4TB 1TA4A 5CYPA 3WHIA 2HSGA 1SXHA 5B3LA 5KVAA 3BGVA 1CUYA 4J91A 1KIAA 5C31A 5C3UA 4R81A 3FPLA 3KZNA 1DLJA 3CVOA 1JG7A 3TX2A 4CIBA 3WGMA 4UDYX 3A1SA 1T9AA 1XOIA 3A6LA 3ER6A 3H5AA 3LIIA 4FEGA 4V3CA 3RS0A 5CFOA 4UOZA 2ASEA 2X1MA 4U2GA 2WU1A 1TAUA 1KXZA 1OROA 1CUUA 3ZC3A 5LKAA 2PMKA 1II9A 4IAOA 2QE7A 3DE7X 1GWNA 2AC4A 4JC0A 1GSOA 5AKEA 3JWIA 4QUKA 3MS7A 4YUVA 3W6OA 3MF4A 4P82A 3V2IA 3QEJA 1BEEA 1I3OA 2AOVA 2I4IA 2NQ8A 4KSYA 1AKMA 4BQEA 1NJ6A 3BB3A 2EJTA 3QKUA 4FSDA 4ZDJA 3WIDA 4OF4A 1IFXA 2VXOA 4WFQA 5FPHA 1YASA 1ZGJA 2J30A 2UUOA 3BSFA 3DZFA 4HB0A 4RCYA 1P6UA 2FJUA 1S7GA 1YONA 2ID7A 3TOSA 4EFKA 5IK2D 1E3DA 3KELA 3FNFA 3ZIAD 4Y1GA 5GIOE 1T2CA 3GNQA 1GQ2A 2V4ZA 3WNDA 1CUGA 2PX6A 3ILXA 1TVKA 2YMQA 3CMMA 3EEQA 4AQ7A 3SX0A 3BGIA 4ACBA 1S2LA 1CQWA 1M1NB 1TZMA 2FPSA 5IZ4A 5FO1A 1QKIA 4KR3A 1GCOA 4N0QA 1OI7A 1F60A 4KX5A 3WGYA 2DFKB 4CV2A 4BEBA 1W5BA 1EHIA 3CEPB 3W8RA 1ODIA 2FR0A 1LEHA 2IYUA 3F9CA 3OZCA 2PAFA 1BN7A 2G9NA 4BNKA 4DPMA 1HFEL 2Q21A 2XMSA 5ALZA 2XCTB 3M1AA 5T4BA 1MR3F 4LXGA 4NBNA 2X4DA 1FDOA 4DJFC 3UQZA 4UPEA 2FZ5A 2Z56A 3D6FA 3K9HA 4YQZA 2FUG6 3KB2A 3QSGA 1T24A 5EMNA 1YB6A 1PEAA 3OZIA 4XGQA 3SFTA 4N5LA 3BMOB 3DMTA 4B7ZA 2W2LD 4HG2A 2MSCB 4BMVA 4OD0A 1KGDA 3GO4A 4GOMD 2FWIA 5C4GB 3AT1A 5IAAA 4RH1A 2QP9X 3GDFA 3FDXA 1UOOA 2DWOA 1HFJA 3C39A 4Z51A 1SCKA 2NUPB 1AX9A 1GPMA 4AP6A 5HSGA 4NJEA 2VHWA 1FP7A 4G97A 5NLLA 3ZGYA 1OHHD 3PKIA 2OBYA 1BGXT 2XOKA 1YZHA 4KTTE 3OJOA 4M0UA 4OU5A 4BNXA 1R74A 1D03A 3NDRA 3SFZA 3U3RA 2I03A 1E9DA 3NHJA 2PSJA 2WHEA 1UMCA 3AJEA 3PK0A 1ZM2A 3BXPA 3K4PA 1N0IA 3UT6A 3ADBA 5EJ9A 4XJXA 5ISMA 1I6MA 2INGX 2YWGA 4TUYA 3RYHB 3O1HB 2JATA 3ZTYA 4AN0A 2A7XA 1Z22A 4JKOA 1X14A 4Z8XA 2IP2A 4GQAA 1RCUA 3O9ZA 2OA0A 1V8BA 5A4KA 5FX2A 3CBQA 1SKUA 1TYBE 2W6QA 3DL2A 3F97A 2PTHA 4J16A 1H4QA 1T8WA 3FOAA 4MVJF 2C9CA 3TO5A 5B30A 1IM2A 5EWLA 3K0CA 4EGCB 2ZUCA 4JUIA 2VP4A 2PT9A 3FZNA 2OGSA 3LFTA 4EJMA 1NLUA 2I33A 2REQB 4Q3CA 3UHOA 4OU4A 5DX1A 4EG4A 3K4QA 1P2SA 4K9DA 2DJIA 4AP5A 4HXYA 2Z04A 1DLIA 1UT6A 1EHYA 3JYNA 1G8PA 2A5DA 2QG6A 4DQLA 1JXQA 1EAMA 3BAZA 1EWKA 1SUWA 3DO5A 4TXNA 4MEAA 3L8CA 4AJLA 2Z3WA 1QLHA 1IWPB 1BJTA 2A5GA 1RLMA 4LX8A 5KC8A 4R5MA 1XALA 4QU5A 2J32A 4LXIA 3KKNA 5AI4A 4LA4A 3MINB 5K0JA 3FFXA 2JFGA 4LDAA 1PR0A 2AOUA 1DRJA 1TLLA 4RM3A 3H1EA 3VMFA 1VI6A 4MR7A 4MRRA 5CJ2A 3CZ9A 3ZWCA 1DFHA 2JHCA 3U4CA 2OV1A 1QG6A 3F5MA 4U7GA 1XZQA 4W63A 1C8VB 4OTZA 2PBFA 4DW8A 5T67A 1XHLA 3ZY4A 3LUGA 2VFAA 3KOWA 3BZBA 4PNHA 2NU6B 1CC1S 2CSUA 2ZI3A 4D4KA 1XHEA 4N7MA 4QDJA 3W77A 4MR9A 3KQHA 5LJIA 3NM5A 2A1TR 2X40A 1LRLA 5CLJA 4BFTA 2P5SA 3PVSA 4RMHA 1I2BA 1NVVR 3TOXA 4CM8A 5MF6A 1K97A 1V7PC 2EATA 5C2JB 5ES4B 1BS2A 5MHTA 4OQLA 2G9ZA 4OQMA 2XQVA 3HEMA 1MEJA 1JZTA 1I6WA 3S29A 2FRDC 4CT0A 3KKQA 4LOAA 2BONA 4O59O 4B3DA 5L8VA 3L46A 2Y9PB 1Q0HA 1BOFA 4PZZA 2WWVD 2AXPA 3KU1A 4MMYB 4L3WA 4BVKA 3AERA 4XSHA 2VH5R 1VL1A 1YQEA 3QHQA 2J9GA 1EH5A 2QUHA 1XVUA 3LBHA 3QXXA 2HV9A 3EOZA 3WGTA 2JIQA 3BWCA 3HCEA 4FC6A 5TS2A 5J43A 2JLZA 5J4LA 1P7VA 2WAXA 4MRVA 2B21A 3L01A 4LMAA 5A4FS 4X95A 2JD2A 2F3QA 4BLUA 5K45A 3BBPA 1NRXA 3TVDA 1YZYA 2JI4A 2YY5A 3DA8A 3T35A 2GBGA 4C4SA 5A1JA 3THYB 2EWWA 1GRVA 4PO1A 5TRTA 2IDZA 1ZD3A 2FSVA 3QXHA 3CZPA 1NE7A 3CONA 3D54D 3GEEA 3L0DA 4IUCS 5JW6A 4GFDA 2WIDA 1T8RA 5IJXA 2IEAA 1G21B 4F2HA 1Z4KA 3AJDA 2FX5A 4WXYB 5I8WA 3NZEA 1DVRA 2GPNA 3TW4A 4HNRA 3JWPA 5HIMA 3JD1A 3OH8A 3P45A 2VWHA 3U0VA 4ESOA 3HKDA 4B4UA 2ID4A 3IO5A 5LQDA 3FYTA 4N8EA 3VO9A 4NABA 4KAJA 2VCYA 3LVQE 4NDAA 4ZJYA 4CF3A 1Q15A 2CUZA 3F2IA 4PO9A 3GJ8A 5GONF 4CTNA 4YIHA 5JZOA 4DCVA 3KEQA 3KZOA 1LCIA 1ULHA 1ZLYA 4MLCA 3HXPA 2HFKA 1D4OA 2Q1XA 2R7NA 2Z1DA 1CUDA 1EWTA 2FG6C 1IDOA 2QKYA 3DWIA 4TS3A 2B4TO 2HJRA 3W2IA 5KO2A 2J67A 3PNYA 4XD7D 2E5FA 3CX3A 1PEDA 4DLTA 3KZXA 3QWHA 4X20A 2ICAA 1NZJA 1UBJS 2ZDHA 2JVKA 4XUGB 2SCUA 3A6ZA 2WJGA 4IPTA 1K7SN 1JYSA 1E9RA 3X1KA 3L0PA 3HDJA 4R1TA 3UFXB 4YJ3B 1AQYA 1K6MA 5G2OA 3S27A 3VJMA 4JLBA 5DGCA 2QM7A 1UPXA 1I2CA 3RHTA 4AJJA 1C3LA 3HE3A 1XNHA 3IX7A 2TECE 4AS3A 1KZGB 3N0XA 1OOEA 2PMFA 2YWDA 4J1SA 4LHZA 2VYCA 4LXUA 5T4FA 5LQSA 4DEXA 3CO5A 1SOUA 1XKXA 3A4YA 2WILA 2VQEB 4CM6A 2C5LA 2HMVA 4RDHA 3GT7A 2BSQA 4MJ7A 2WUGA 2EFJA 3CZRA 3DUFA 1XTRA 3NWBA 5LU8A 2D7JA 4IFEA 4R68A 1N1GA 2GO1A 1UK9A 1GLGA 1XNGA 3HCAA 2WA2A 4L8LA 5EUCA 3C3BA 3T0IA 3HJTA 5A5EA 3AGQA 4P7GA 4V1CI 2XKKA 3E35A 2O8BA 1I33A 1ZO8A 4PN3A 1ZWKA 1BJKA 2PRKA 1I0ZA 2BD0A 2ZBFA 4I55B 5FB3A 5CLGA 5AI9A 2G7ZA 1D8TA 1SU7A 4B8ZA 1D2CA 1F6WA 2RHLA 3DDOA 4DRXB 2N9UA 1G0NA 4C21A 2I1WA 3GCWA 5ECDA 1GUFA 3DVSX 3G5UA 1XNQB 2G06A 1Y6ZA 2JASA