2G77B

Crystal structure of gyp1 tbc domain in complex with rab33 gtpase bound to gdp and alf3
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
173
structure length
173
Chain Sequence
RSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase activator/protein transport
molecule keywords GTPase-activating protein GYP1
total genus 52
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2g77B00
1SGWA 4QG7A 3AVWA 3QXXA 4PAMA 1NLZA 4JKYA 1H65A 1G7TA 3C14C 1W4RA 4RD4A 5DH9A 1LW7A 2CLDX 1G7CA 3MJHA 3IIMA 4WZBE 2BCGY 3H4MA 3QPVA 4JVSB 4OI1A 4C9BA 5D3MA 3QKSB 2YOFA 3B9QA 2PX0A 2YNMA 4OQFA 4DLWA 1MRSA 3EA0A 1NMZA 1YZUA 2JJ8A 1P73A 2OXCA 2IUTA 4R9UC 1ZNWA 1E2MA 4KSCA 3GEHA 3SC3A 4LDJA 3U3JA 2RGXA 5FL3A 4H1VA 1W47A 3GJ6A 1SZPA 4J0QA 5EXSA 3LX5A 3EZFA 2RHMA 4IXNA 4M4SA 2XOKA 2QUZA 4HDCA 5AUQA 1JR3A 2Q9BA 1AZSC 4B3CA 1UFQA 2QL6A 3U2QA 2WPDA 1MO3A 1XCPA 4RVCA 2CCGA 2FEOA 3RS3A 3UG7A 2GWHA 3AGPA 3GLIE 1BIFA 2ONJA 2FFAA 3BFKA 1WA5A 2O8BA 5FBWB 2B8WA 2CLCX 3HPQA 1KI7A 4BFUA 4RCZA 2Z43A 3RNLA 2HJVA 5HKKA 5ELXA 5J5CA 1Q57A 1Z2CA 1KSJA 3A1TA 4Q18A 3TAUA 4LYHA 4LHWA 4AWXA 4DCSA 2V7QA 1NN0A 3LRPA 4ACAA 4BEBA 3P4YA 3GLGB 1M7GA 3CH5A 1W49A 2NO0A 1ZC4A 1SXJD 4A0FA 3UWOA 2A2ZA 1SKQA 3HYRA 3LNCA 4C0QC 3K9HA 2ZE5A 4O0MA 4C0SA 4DXAA 1VG1A 1RRGA 5DYIA 3TQFA 1A5TA 4RZ2A 4LOAA 2VSFA 2AKAB 2QM8A 1J90A 4L4UA 1SKYE 3MRSA 4TL6A 3QUSA 3BRWD 3HR7A 2ODNA 2XITA 3UANA 4DCTA 3RWMB 2KSQA 2J0QA 3VR3A 1W7AA 3B9PA 2C04A 4XVQA 4JLMA 3SI7A 2VEDA 5FL7D 1Q1ZA 4GP7A 1M6NA 2ECKA 2J7KA 1S8FA 2BBWA 721PA 2IYXA 3RSLA 3EPJA 3KQLA 1EWRA 3NBXX 4M1OA 5IF9A 2QGZA 3KQHA 1RC8A 2J0VA 2SHKA 5FI1B 3GLFE 2FZLA 1LY1A 2GAOA 2QPAA 1ZVQA 1A4RA 3AUYA 3FKQA 1E9BA 1C9KA 1E1RA 3WRXC 4C30A 2QROA 3QENA 3SFZA 1P60A 3SFVA 4C0AC 1TTTA 1N0WA 4POAA 1ZD1A 3T1OA 1IN5A 4P3YA 3H86A 1LS6A 4DB2A 5EP1A 3O8RA 2JLSA 2WJGA 4B76A 2JJ1A 1DAKA 4QRHA 4JLVA 4HAVA 1SXJA 4WAUA 1B23P 4XWKA 3TQCA 4D81A 2ZYWX 1E2DA 2BM1A 3KXLA 3RANA 5LDDC 3DL0A 1G1MA 1FP6A 2QA5A 2P6UA 4I99A 4LHYA 1PLJA 3QBTA 3PUVA 5FI0B 4YC7A 3MSXA 3KKQA 3ZD7A 2P2LA 2G1JA 1N5LA 2ZE7A 2JLRA 3IUYA 2XTNA 2VBCA 3BIFA 4L15A 3UIEA 2MSEB 2REXB 4TYNA 4TZ6A 1KHTA 1KI8A 2EWWA 2ZYUX 3IIKA 4D26A 3A6PC 4E03A 3U6BA 2XB4A 1LF0A 4KVAA 1Y3AA 5AK0A 4GZLA 1KO4A 3U44A 1GSIA 4KYIB 1R0YA 3TLXA 4CRWB 2YC4C 2VHCA 4D0LB 5B30A 3K8YA 2WAYA 2PBRA 2H7VA 4NYIQ 1US8B 1E1RD 2Q21A 4MGYR 4UNSA 2DPXA 2BV3A 4IOKA 1FL9A 1XTJA 3O8BA 2GNOA 2F1IA 2ZRJA 2GA8A 4ON9A 3MJRA 4WVFA 1KNXA 2AFHE 4FN5A 4NONA 3WXMA 3A37A 2MMGA 2GXQA 1J8YF 2ATXA 4LHZA 3HDTA 3I32A 4GOJA 1W36D 2QM7A 4M9SA 4TSFD 1G16A 1H8ED 2RKOA 3ZQJA 3KXKA 4RFSB 1GM5A 5FOWA 5FOXA 2IS4A 3GLGA 4Q48A 2WJYA 1L4UA 4KLNA 2HYIC 4TMTA 2GXAA 2R6DA 3NXSA 1D6JA 2BKUA 4NTZA 4G5QA 3Q7PA 2C96A 3IPXA 4N1AA 1J99A 4UNPA 4Q4HA 4B3DA 2CDNA 4DCUA 5B64A 1N6HA 1XRJA 2N42A 3EZ9A 3HP1A 4HZUA 4UNNA 2V6JA 2DBYA 1CJTC 4BWYA 1XZPA 3T1VA 4LJYA 5BXQC 1UJ2A 1MABA 2G1KA 5HTKA 1OHHA 4JLDA 3I8SA 4TMXA 4US1R 3VTKA 3EZ2A 4OI0A 4FCWA 2OSBA 3LX8A 1KI9A 2OFXA 2O52A 2OCYC 3RRMA 1KMHB 1CXZA 1ZM3A 4BFWA 2F1RA 2AWNA 4DLSA 2AX4A 2C95A 2IYZA 3OAAA 1Q12A 3OAAD 3RC8A 3IO5A 1NKSA 1JR3D 1U8AA 4LUCA 3UPUA 2ZVPX 4OHXA 1RRPA 3HU3A 1LTQA 1P62B 1XEWY 3GJ0A 4MYHA 1IHUA 3QKTA 3TIFA 3UK6A 1WRBA 3VX4A 4HUTA 1N6IA 2C8VA 3K9NA 3JVVA 3C7KA 1W4BA 3QKRB 1FUKA 4C7OA 1LNZA 4D0NA 4CZ2A 3A1WA 1G3QA 3K70B 4IOMA 3SEAA 2IYRA 4PO8A 4RKFA 1QDEA 2XEXA 1S0UA 4DZZA 1NRJB 5C46F 2NZ8A 1NN3A 5FTLA 3UXMA 2ZSDA 4DRZA 2JJ1D 2XTMA 1ETUA 4PZLA 5GJWC 2VYFA 1XEFA 1XEWX 5H68A 1E0KA 4I1UA 3VHXA 3NG1A 2O8EA 4EFMA 4M1KA 1X1RA 1HYQA 2FJUA 1VCIA 4M8NE 3K70D 1G8GA 3LXXA 2WV9A 4NBSA 1WB9A 1KKLA 4TLDA 3PFIA 2CLSA 1Z6GA 2ZI5A 2OV2A 3HYTA 3GFPA 3PVSA 3CPEA 2KI5A 1DE0A 1VIYA 2WWHA 4WA7A 5JS7A 2IK8A 1E9AA 2ZRBA 4GOKA 5FL7A 5AUPB 2RH5A 4EPVA 4NE2A 1PUIA 3SQWA 4BFVA 1JQLB 1COWA 4D25A 2QQEA 3W3ZB 4V0OA 1NVXQ 2Q9CA 4MKGA 4MA4A 4H9GA 4B47A 4B75A 1Z08A 2WAXA 3TBKA 1PZNA 3F8TA 4B73A 2VF7A 1DPFA 3GLHA 1Z3IX 1D9XA 4EAQA 1GRNA 1GNPA 3EC1A 4G1UC 4E09A 4PTLA 3OEED 2GXSA 4GP6A 3NHAA 221PA 1XMVA 4LK2A 4V02A 2PZEA 4HAUA 4QL3A 2GJ8A 1RPZA 5E4FA 4LHVA 2DY1A 4JLKA 3PENA 2BEKA 1R8QA 3C41J 3NH9A 1IM2A 4PSKA 2IS1A 1XBTA 2QORA 4AI6A 2WWGA 2CHVA 2DFKB 2P6NA 3WP0A 5SZJA 4AURA 2ZROA 3RDPA 4RD1A 5FUVA 3FHTA 3GJ8A 4UXIA 5KSZA 3BB3A 4M9QA 4EPRA 3SYNA 2IHBA 1OXUA 4PX9A 4Q66C 3AF0A 4A92A 2FN4A 1N3BA 2RGNA 5BN3A 4WZ6A 1VCNA 4RZ3A 3EZ7A 1PUJA 5HCNA 2CVHA 2JLZA 3G5UA 4JSYA 2IYLD 5G41A 1E2LA 4Q9JA 1OPXA 2ZYVX 4HZUB 1D2EA 1U99A 2QQ0A 1OXSC 4TLCA 2W0SA 2XSZA 3IPYA 3KUCA 1CR4A 4IDNA 4WZAE 4IVPA 4ZPXA 5D3QA 1C1YA 2FF7A 1UKZA 3QEJA 1GFIA 2P3SA 2GZDA 3MWYW 4DT1A 3A4LA 4UNRA 3EAQA 1ZP6A 2FMXA 3TSOA 1Q1EA 2YWHA 4W5WA 2NO7A 2J7PD 4JT4A 4C2UA 4Q9IA 5J4VA 4PPQA 1EG7A 2VHTA 1FZQA 1M74A 2FNAA 3GLIB 4YMUA 1DAFA 1NLFA 3MUFA 4CEHB 4JT2A 2PLRA 4C0BA 4AYWA 1HEIA 4W5JA 2PMKA 1FP7A 1GNRA 3ND8A 4NHOA 4BEJA 5JS8A 4EQ6A 3CRQA 5JEEA 2BEJA 3OEHA 3ZVNA 1XCGB 5FPTA 2X2EA 4V03A 3GMTA 4MGKR 3PCRB 2FPMA 2XB2A 4EPYA 1U98A 5EUQB 3KX2A 3T5GA 3THXA 2O8CA 1EFTA 2LWIA 4DLXA 1VCMA 2ZJYA 3K0AA 2KWIA 1DEKA 2D3WA 2IYWA 3MCAA 2OILA 2ORVA 3OF5A 5EE0A 5TXGA 1AZTA 1II0A 2R65A 1UPTA 3CM0A 1E9SA 5E3HA 4X8OA 4YQFA 3CNNA 4DHEA 5JJLA 2DCUA 4GI7A 2DFLA 2W83A 2GCOB 2QZ4A 2ZS7A 2CK3A 3V9PA 2ZJBA 5LD2B 4K46A 3X2SA 4DUGA 2F7SA 5DNYB 5IRCD 4C7OB 1VECA 1BYUA 4EFLA 3WRYC 3NBFA 3FMOB 4HAXA 3WBKA 2DR3A 1EXMA 4KCGA 2JGNA 4V0LA 3RYTC 1ZJ6A 2J46A 3FOZA 1CTQA 3BOSA 1VHTA 3L43A 3VR2A 3K0CA 2RAPA 4URWR 3VR5A 3L0SA 1OHHD 3LFUA 3KJHA 2VP4A 2BBOA 2PCLA 5IHPA 2JA1A 4US2R 1F2TB 3AKCA 5FTNA 4KJZA 3T12A 2ZETA 2C9OA 5KNDA 4PC2A 5UKDA 1SQ5A 5F2EA 4OK3A 2F3RA 1NVWQ 2GDJA 1P4SA 4ZDKA 1G4UR 1ZM2A 5EXPA 3THYB 1JAIA 1LB1B 3OIVA 1G3IA 4RFVA 1UBFA 1OXTA 5B57C 1VHLA 1AQUA 1YR9A 3NEYA 1ANKA 1ZYUA 4DDWA 1KO7A 5DE3A 2EQBA 2OM2A 4Q9HA 1RYFA 1OYYA 2R2AA 4LJ5A 1W36C 4BASA 4X8HA 2OFWA 4OHZA 2IYSA 3THWA 2H17A 2QAGC 4RZUA 1S1CA 1Z6TA 2BKEA 3A8TA 4JVLA 5JWRA 3I61A 1ZNXA 4TSFA 3ZS8A 3TR5A 3HR8A 4BZQA 2XXAA 3DPUA 3ADDA 1NBMA 1AA9A 4IFEA 4Q4AB 1W5SA 1SHKA 2RGEA 3VR4A 1XJCA 3Q7QA 1XPRA 5K8IA 4AKIA 4B74A 3IEVA 1W0KA 4B43A 2ZITA 1YRAA 1QHHB 5TY0A 1GRQA 4M1YA 3WHKA 5H70A 1G6OA 2O8DB 1HE1C 4MH0R 4F38A 4QC2A 2DB3A 4DSNA 5SZIA 1EESA 4IOJA 4W5HA 1Z06A 1E2PA 3IO3A 3IILA 4TN1A 3TUJC 4IW3B 3R20A 4ESHA 2ORWA 4PZYA 1U94A 1GP2A 2B6HA 4PSVA 1AKYA 4HB3A 1GILA 1K6MA 2D2FA 3DVLA 1OH8A 2GK7A 1IXRC 4Q1BA 3ZLJA 2IT1A 3VR6A 4XSGA 2D7DA 1N5JA 2V54A 3SHWA 2R6FA 4AG5A 1TU3A 2WICA 1G41A 1FOEB 1QZXA 4JLAA 3SE0A 2LKCA 4DB4A 1BMFA 2QTHA 1FTNA 1CS4C 121PA 2DWOA 4K8OA 4C0KA 4OI2A 1QG4A 1OKKA 1BKDR 1OFTA 3C15C 1VCOA 1N6PA 3HWSA 3BH6A 5CJPA 1JNYA 1KMQA 3FMIA 1P9NA 1OSNA 3AVOA 4Y0AA 3T1QA 1F48A 3QNUA 2IF0A 3UMSA 4B3XA 4PSAA 1G19A 1MO4A 4JMPA 4TLEA 3HU2A 2QMEA 2DFTA 1R2QA 1EK0A 4FW9A 2QT0A 1XTSA 4EKDA 2Q6TA 5FTJA 2ZJ5A 2LKDA 5AUNB 1Z2AA 4V0MA 1WCV1 4CEJA 4BQSA 3U44B 2IYYA 2WKRA 2HCBA 4BE7B 2RGDA 1II8A 4UKDA 4A8JA 2VP9A 4HAYA 4G5RA 1HY3A 2FGKA 4TYPA 5KSYA 1BOFA 2F1JA 1C4OA 2GCNA 3VX3A 2QPTA 3P27A 2A5YB 3E2IA 4KVGA 5GJBA 3R9WA 1GIAA 3MD0A 1UKEA 5CLQA 1YR8A 4LZZA 1IXZA 3AEZA 4M9ZA 4KITB 4OK6A 4ACBA 2PCJA 1KOFA 2ASEA 2ZSEA 2YKGA 1CJKC 1VYTA 2CXXA 2QNRA 3NWJA 4U5XA 2G77B 4B3GA 1KYIA 4PHTA 4EIWA 5L3SB 2A9KA 1D2NA 4MGZR 2D74A 1E0JA 3O8DA 4BLQA 3VKHA 4GPTA 1CF4A 1II8B 2NOAA 1AGRA 1ZW6A 2BOVA 2GHIA 4BFZA 5JBQA 4CF7A 4LBYA 3K0FA 1Q3TA 2BMFA 2GVZC 1WP9A 1SVMA 2AFIE 4IDPA 3CR8A 4MITA 2W2TA 4PFSA 5DN6D 2OXRA 8OHMA 3KQKA 3RS5A 1E69A 4BLOA 2HYDA 3EG5A 3NVAA 3WNDA 5GJCA 2C2HA 3LQQA 4FCVA 1AK2A 1E9FA 2WJVA 4HEJA 5IK2D 1KI3A 4TTQA 5FTKA 2W6JA 3GJ3A 3DO6A 3R7WB 3AUXA 2YOGA 1DAEA 1Z29A 1EFCA 2P5TB 2CNWA 3KKMA 3TUIC 4E5UA 2O8FA 1KY2A 1L8QA 3FYHA 2OO7A 4IJMA 3LW7A 3AQ4A 3DZDA 4URYR 1OIWA 1AS2A 2L0XA 4GRAA 4PPGA 1G64A 2VP2A 3FGNA 2BHRA 1EX6A 1CJVC 1G21E 1XD2B 3IDQA 1OLOA 3ECCA 3X1XA 3KB1A 1NNEA 2ZJAA 2ONKA 3AV0B 1LS1A 2QSYA 2W00A 3Q8XB 4Q1FA 1E0AA 4AKHA 2HCJB 5D3MB 4GSYA 4Q4JA 1ESMA 1L4YA 2FPKA 4ZI3A 3GJ4A 4GNKA 1QHYA 1HQYE 4TL9A 1S96A 1X8KA 1KZ7B 1D8TA 5AWFC 2EFEB 1Q1QA 2F9LA 3ND9A 4FCTA 1HURA 1P2VA 1ZC3A 1VDZA 1XF9A 3PEUA 1H8EA 4HLDA 1DBSA 4FMBB 4AC9A 1A1VA 3F5FA 5EQTA 4D82A 3X1ZA 5FOTA 1E2NA 4ZI2A 2A7QA 1L7VC 3QEOA 1GZSA 2CHQA 3I8XA 4KFUA 4RFSA 3B13B 5ANRB 5JHHB 5E7IA 4BECA 4B6EA 4TQ9A 5AJVB 4JYCA 2JAQA 4DDVA 3P4XA 1KZGB 3VHLB 1Z0KA 1E2GA 4LY6A 1YRBA 1SKYB 3CR7A 2GEUA 4PHFA 3SJBA 3K0CC 1W2HA 1V43A 1J7KA 1ZU5A 2CMKA 3EPLA 5JMTA 1G3MA 1U9IA 3MMPA 2AR7A 2BBTA 5KO2A 2PX3A 4C3ZA 4DLZA 3QPWA 1KI2A 3GLHE 3M0EA 3T61A 4FWTA 1G8PA 4B35A 5EP4A 5FPKA 3AP3A 1RJ9B 4QGFA 2GKSA 4RSGA 2XTZA 3C4JA 1XU4A 1ZD9A 4M21A 4G3XA 2EVWX 1EFRA 1ZIOA 2VQSA 4DVGA 5B58C 4D6PA 2ZJ8A 1D9ZA 4M1SA 2A30A 2PT7A 2REBA 2Y8EA 3DKVA 4PZZA 2CVFA 1NP6A 3LWNA 1HE8B 3TR0A 1E2IA 3K1JA 3ADCA 5F9FA 2ZIAA 5AJYA 1E98A 1F2TA 4B71A 2RB4A 4HDOB 4HI0E 2QRNA 4UXHA 5GADl 3HPRA 1E79D 1XP8A 2OAP1 1FNMA 3G82C 3DZ8A 3E1SA 3W3AA 3R7WA 2Z4RA 3FHCB 2QE7D 4L9WA 2C9YA 5JJIA 1GL9B 2QAGB 3BAFA 2WSSA 1NSFA 3RAPR 3B1WA 4XVUA 4HB4A 5FOUA 3U4QA 3E70C 2O0JA 2J59A 3UATA 5LPNA 1NLYA 2VO1A 4UQOA 2VSXA 2X19A 3GLFB 1HT2E 1OB2A 1KTVA 2UVQA 1KMHA 3IEUA 1E2EA 2CCJA 4PC1A 1KJWA 2VP6A 3B85A 4TZ0A 1NKTA 2IL1A 3AVTA 3OESA 1GKUB 5LB4A 3QI2A 5G53C 3RC3A 2HLDD 3ZH9B 1YZQA 2Z4SA 1N2CE 2PZFA 3IHWA 1RRFA 2P65A 3BB4A 5BW8A 2WTUA 5JHGB 1GTVA 4MYCA 5IT5A 1W4AA 3T35A 5CB6A 4OK5A 1OH5A 1XTIA 3THXB 4DWJA 2E9SA 1W36B 5DSZA 4LCBA 1Q44A 2OZEA 1XJ0A 3CNLA 3TJZA 1J2JA 1ZD8A 2PZGA 3SJAA 1H8HD 2F43B 4NDZA 1FQJA 1X3SA 2DYKA 2WHXA 1TU4A 1TAGA 3EPKA 2QGNA 4D4MA 4YDSA 1P3JA 4GZMA 3IBGA 4XJXA 5J4HA 3K0SA 1G9XA 2DWQA 1Z6AA 3DKPA 4V0ME 3V4RA 4XVRA 1SXJE 2HT6A 2OBMA 3TAHA 4NZYA 3F0TA 5HR5A 1S9HA 4ZDIA 3TGPA 3KB2A 3BD9A 4G01B 2J0UA 4GT1A 2WPDD 3K09C 3KJEA 3J81k 1IY1A 2FSGA 4Q03A 2JLXA 1ONBA 4XSHA 3ZS9A 3BXZA 1QVRA 2XOKD 3M4YA 4ZV4A 4HLUC 3I73A 2W6IA 2IEZA 5HE8A 2XNSA 1D5CA 1KIMA 1P9RA 2CJWB 1JPJA 1NVUQ 2G6BA 1SVSA 1DAGA 3CWZA 4F93B 1NY6A 2QENA 4XWOA 3GQBA 3VNUA 1NI3A 5JLJA 1WXQA 4TT3A 5EE3A 4R71A 2UZ3A 1X8JA 2D4HA 3CB4A 5KNCA 2IUUA 2V9PA 621PA 1Z0DA 3LLUA 3QF4A 5L3QA 3QXJA 2R6AA 4XWAA 2A5DA 2OG2A 5KSPA 4AK9A 1FUUA 5DLQC 2ZAMA 1DS6A 4B44A 5CDFE 3U7GA 1E1QD 4JBWA 1PLKA 1KK1A 5DISB 1P72A 1ZM7A 4MRNA 5KDOA 1FMJA 4XD7D 1K5DA 2FA9A 1KK3A 2MSDB 3FKSD 3OIYA 4TWZA 3TUZC 3QY0A 4G5SA 1JB1A 5JSZA 3OHMA 1NMXA 3I5YA 4YXWA 3HJNA 3P1JA 5HPYB 4HYYA 3SJZA 5GVSA 3BB1A 1XEXB 4QOSA 1NF3A 2HV8A 3BC1A 1NN1A 1ZNZA 3LBHA 1IN7A 3Q5EA 1GUAA 1XXHE 2ZI7A 4IVRA 4LRWA 1OH7A 4MGIR 1OXXK 4IFBA 2FGJA 2ZJZA 1XPUA 2PJZA 3LDAA 4A9AA 4JKIA 4ZDJA 5EXTA 1KDTA 4JBXA 4ASUA 2BDTA 4JJZA 1CRQA 1CEEA 4BLTA 1ZMXA 2JDIA 4AKEA 2EW1A 3OFND 3U7HB 3CUEF 4A0GA 4MRVA 2XGJA 1G17A 1Z0JA 5AJWA 1M1YE 3EASA 3QIAA 4P32A 1DAMA 2QP4A 3KJGA 3RRZA 3AGQA 4DLVA 4AY2A 1DTSA 1QF9A 2IXEA 5CB8A 2JIZD 4LWZA 1GNQA 1TQDA 1GITA 2OBLA 4QJ3A 2EU8A 2IYTA 2KBEA 2P6RA 3VAAA 3ZIAA 5JRJA 1U90A 4I1SA 3PUWA 1Z6XA 1Z83A 4LYJA 3DDCA 5EP3A 1G5PA 3A36A 1KY3A 2YHSA 2A3RA 4G5GA 2GESA 1CR0A 1X1SA 1E4YA 4DLRA 3ONWA 1BYIA 2WZQA 4MRPA 5C1BA 4OQLA 4FIDA 4EPTA 2OBNA 3PQCA 1E9RA 5G3YA 1Z8FA 4M1WA 3T06B 4OBEA 3K53A 1RYHA 4A1FA 5K8UA 1VPLA 4M9XA 3T5DA 3TH5A 3TSZA 2Q3FA 2GBLC 1ZCAA 3A58B 3AF4A 4BFSA 2QI9C 2JIZA 3QXHA 4A8JB 4D2IA 1JJVA 4S35A 5FH9A 2GZHA 1N6NA 3X1YA 2QP9X 4NL4H 3CLVA 3IIJA 3KJIA 3CKLA 5FBLB 1F6BA 2X8AA 5CDFA 5BQ5A 3KKNA 4KI0A 2C98A 2BBSA 4PPNA 3BH0A 3KXIA 4PHHA 4A0HA 1F2UB 1DO0A 3FMFA 4YMTA 5KNBA 2QU8A 3K70C 2ZRDA 1T9HA 2CHGA 3C8UA 4FMDB 4II7A 2H18A 4QHYA 3X1DA 821PA 2OT3B 3N2EA 1VG9B 1VYUA 3K0AB 2ZRIA 1NMYA 1KSGA 1JR3E 2F6RA 3TVDA 4ERNA 3JZAA 5L3VA 3AH8A 2IYUA 1W5TA 3GJXC 3OE7D 3PG5A 5AR1A 5IDVA 3B8HA 4Q7JB 5CK5A 4Z8YA 4LV5B 2VL7A 2R8RA 2C77A 4MRRA 2BMJA 3SOPA 4JLJA 1DAIA 1GOTA 2KJQA 1O3YA 1IY2A 1E9CA 5A5GA 2EYUA 1XJQA 3EZ6A 4DBLC 1L2TA 4LC1A 4TL7A 1HH4A 2QG6A 2ZRNA 4BLSA 3FPAA 2P0EA 2HUPA 5TMPA 5KPJA 4Q1CA 2R44A 1KDRA 1OFUX 2BC9A 1EGAA 2IS6A 4C0LA 1NIJA 3D6TB 3MFYA 1Z28A 2VTKA 3SN6A 2GJSA 1US8A 3DHWC 4Q7MB 4DSOA 3RRYA 5KYKA 1MKYA 4P4SA 3DMDA 2FE4A 3GFOA 3N5CA 3RS2A 1U0HC 5A4JA 4U02A 3LO5A 3DM9B 1KK2A 2QY9A 4OHWA 3NC0C 3NKVA 4ESVA 2QTFA 4QHTA 3AVYA 2IA5A 3FMPB 4PAQA 3UKDA 1Z0AA 3I5XA 2OLJA 1N5IA 2IWRA 4O2RA 2VF8A 5KDDA 1KI6A 5HZHA 1E2KA 2ERXA 1NY5A 1RIFA 1P5ZB 4URVR 1TNDA 2AD1A 2D2EA 5KUTA 3BJIC 4JL6A 1AM4D 2ZVQX 1CLUA 4NMMA 4OYHA 3TE6A 3PEYA 1TF7A 1NIPA 2OESA 2B7BA 2EFHB 2ZRPA 3QQ5A 2ZU6A 2B21A 1P2TA 521PA 3CZPA 3GPLA 1S3GA 1KO5A 1Z63A 2AHOA 1AKEA 2YINC 1XFAA 1A82A 4A4DA 4A6PA 4CT4B 3TW8B 1DADA 1RZ3A 1RW4A 3K0FB 3FB4A 5JWOA 2BMDA 5TDHA 1T8TA 2C78A 1YE8A 1UAAA 2ODWA 5BYKA 2AXNA 4DIEA 1R5NA 3P32A 1XTRA 3H2YA 4OHVA 5JWHA 4IDOA 3U7EB 2O8FB 4KO8A 4KU4A 3EX7C 1KDPA 5CM9C 3LLMA 4Q9KA 1ZM9A 2HF9A 5C4GB 1VYVA 4IEIA 3GD7A 2QMHA 3FE2A 2NO9A 3OIWA 1I2DA 3U3OA 4YONB 2FSFA 3QF4B 1WBDA 1YQTA 3B5JA 1G3UA 3R9IA 4QBFA 3U5ZB 4Q01A 2IS2A 3L2OB 1WE2A 1BO6A 3D8BA 1KJYA 4Q47A 2HJGA 3AVQA 4CDGA 1XPOA 1UEIA 2GCOA 4DDUA 4P0TA 3S1AB 1E2FA 1P75A 3RS7A 4ZIRA 2Z6VA 5CITA 4M0LA 3GEIA 2FSIA 2QAJA 3NH6A 2W58A 4KODA 4LJAA 3QG5A 1P2UA 2V55B 5EXXA 2O8CB 2JJ2D 5C2JB 4QBIA 5KOYA 1UDXA 4P4TA 5BWMA 1P7CA 4GL2A 1QHGA 2G3YA 1NJGA 4Y0VA 5L3QB 3TRFA 3ZIAD 5E95A 1TPZA 2ANBA 2G88A 1G20E 5FPHA 4C4PA 2RMKA 1XD2A 2V6IA 1TQ2A 3ZD6A 5FUYA 3BS4A 2WWIA 3W90A 1QRAA 4TYYA 1IONA 2PEZA 2X77A 4EUNA 5SZKB 2OCAA 3B78A 1ELOA 3QE0A 5HE9A 3ZVRA 1YZGA 1HTWA 3CPHA 3TVTA 2NO6A 3AVPA 5BN4A 3AKYA 3B60A 1TEXA 4ASUD 1NJFA 5JRZA 3PEVA 5FTMA 1KJZA 3REGA 4N3NA 2O8BB 2J9RA 2OAQ1 3GJ7A 4IDHA 2IC5A 3KTAB 2VHUA 4A0RA 5DIFA 3ZZ0A 2XZOA 3ZVMA 2WSMA 1QHNA 4HUQA 4GMXA 4LV8B 3GLGE 3L82B 4QGAA 2FX3A 1TEVA 1YR6A 1S4QA 4M2LA 4Q1EA 4TMKA 3FWYA 1EFHA 1OFIA 3EARA 4F4IA 2ZEJA 4B3FX 1AN0A 2GCPA 2NO1A 3KKPA 2R6CA 1PLLA 3B1ZA 4Q19A 4Q4JB 5CYPA 5JECA 1M34E 4UJ3A 1P2SA 3P26A 2GVDC 3MLEA 3IBYA 2ZE8A 3FHOA 1NSTA 3AKDA 4PC3A 4QBHA 4DLTA 2GBLA 4X8MA 2C5LA 4DLYA 2G9NA 5AJZA 3D7MA 2EWVA 2WBLC 3GEEA 1YU9A 2ZRKA 1XMSA 1A2BA 3ADKA 4FMCF 3U60B 2GAAA 2FFBA 3CIOA 4NYIR 1RRCA 3NHBA 1XXHB 4LYFA 4PO9A 4TT3D 3VMFA 4A2WA 1I4TD 5JI3E 4Z1MA 3RVBA 2GJKA 1HUQA 1NVVQ 1CR2A 1XTKA 4V0KA 4HDQB 2ZJ2A 1U81A 4LJ7A 4QGGA 5BYJA 4Z1MD 1QBKC 3CX8A 4URUR 1M7HA 3F3YA 3AF1A 2O8DA 3I72A 2ZPTX 3W9YA 3KUDA 5J47A 3THYA 2GEDA 1XEXA 4ZCMA 2D62A 1CRPA 5JFGA 2GF9A 4B3BA 2D7CA 2H1LA 3BFXA 3BK7A 1YZNA 2BVNA 4KAXA 4R2HA 4D4LA 5L3SA 3HU1A 2K5UA 1YZKA 2OEPA 2VP5A 2WJIA 2AWOA 4HB2A 4UXJA 1TQ4A 1JJ7A 1Q1BA 4ZDWA 4UNQA 2PH1A 4Q00A 1VMAA 4MKFA 3B1YA 3IQXA 1VG8A 5FUWA 4B2LA 3B6EA 2D06A 3FVQA 4GMDA 4QKQA 4TYWA 1RJ9A 1OW3B 2F1HA 1T8UA 2FWRA 4BFYA 1S1MA 2BJWA 1VG0B 3ETLA 5FPYA 4BRWA 3TSWA 1N0UA 3E5HA 2GK6A 1UBGA 4LPKA 3CPJB 1PVOA 4ZKDA 1Q20A 2AXPA 3KKOA 1YZLA 4O2LA 3W6OA 3GLFA 1AIPA 2Z0MA 4B34A 5F3WB 1XMIA 1XDBA 3NIBA 4LYAA 4ITRC 4IXMA 3PV0A 2VSOA 1P9WA 2WOJA 3AM1A 3U3KA 3REFA 4YMVA 1Q0UA 4S2EA 3CZQA 1OJLA 4DEXA 2ATVA 3Q9LA 3SS8A 3NBZC 4FXPA 3SBEA 1CP2A 1IBRA 3AP2A 4HLUA 5F9HA 2FV8A 2G83A 4OQNA 5DI9A 5M04A 3K0EA 1JI0A 2NPFA 1CU1A 1DELA 3SQXA 3AVVA 3NC1C 5H1YA 2H92A 4TMVA 4A2QA 3AF3A 3EIQA 4TTPA 2FZ4A 1R10A 1JQJC 4Q4HB 1E9DA 1UKVY 1TX4B 1N6RA 3WY9A 2C99A 1XD8A 2G0NA 2YWGA 2ZRFA 4OKSA 3WYGA 2J5XA 5DYGA 4I4LA 2JLUA 2V1UA 1PJRA 3CRRA 3W5IA 4QNMA 5TARA 4ZCIA 1JBKA 4D4JA 1F2UA 1IJEA 3LH5A 4A36A 1ZUNB 4Q9LA 1YJ5A 4A15A 2ZE6A 1JPNA 1D2MA 3ZYCA 3PJRA 3BORA 2R62A 4LV6A 4Q02A 1P6XA 3GLIA 3ZVLA 3U7FB 1NBME 3OFNA 4G5OA 4AKGA 4CEIB 1T5IA 1QVAA 2JATA 2W2VA 1Z6YA 2R9VA 2QRZA 1UF9A 5DHFA 3TKLA 1GAJA 4PQYA 1UKYA 5CLLA 3NBYC 3QKSA 4OJKA 4V0NA 4LPSA 2GETA 5CK4A 5LD2C 1LF5A 2PJRA 1N5KA 2XXAB 1I4LD 2JLYA 4RD2A 2J87A 4KFRA 3SR0A 4LGMA 2JCSA 2ZR9A 4QJ5A 2GEVA 3CBQA 4ARZA 2UKDA 4ZIRB 2EFDB 1NN5A 1E32A 1TADA 2A5JA 2CE2X 5CIQA 2FH5B 5EE1A 1II9A 4AYXA 3BFVA 4FD2A 5E7JA 2BMEA 1OFHA 4HAZA 4OI4A 4EJSB 2WM9B 4P33A 4WOPA 3GP8A 3WP1B 2H16A 1GKIA 1VKJA 2WIBA 3PIRA 4JBYA 4JL5A 1F3OA 5EE5B 2N46A 2PLFA 3RS0A 2WKPA 4FINA 1G7RA 3AP1A 1ZM4A 3CONA 2GRJA 2QSZA 2B7CA 1KNQA 3I3SR 3LY5A 4IHQA 3ZDQA 3ASYA 2PEYA 2YOHA 4ABYA 4ARZB 2J0SA 4R7ZA 2OLKA 5F98A 3K9LA 4M53A 3B1XA 4RD0A 1U8YA 4WBSA 4NCIA 4IVQA 3GJ5A 4FMCB 1M7BA 3LAWA 4GOXA 3CRMA 3CX6A 1N6OA 1GVNB 4PR0A 5EE9A 2O8EB 3T15A 3AF2A 1E2JA 1OV4A 1XX6A 3EIHA 2VRWA 3D3QA 3EWSA 2XNDD 2XZLA 1GDDA 2YZ2A 5EP2A 5JCZA 1R5OA 4M22A 2ZUBA 3QBVA 3A4NA 4DLUA 1E0SA 1SVWA 4QNRA 4NCJA 2CK3D 2Z83A 3MG9A 4NYJR 3EWAA 4JLBA 4W9MC 2WKQA 4BPBA 1FTSA 3QXCA 4O25A 5KDLA 1W0JA 4F4CA 1SHZA 2ZJOA 2IW3A 2P67A 4YLGA 1W0JD 5LBIA 4PPFA 2PL3A 1T0JB 3I4LA 1ZU4A 1S2MA 4KV9A 4KYUA 2GILA 5FPSA 5KPDA 3AVXA 1CKEA 1CULC 4R2IA 3U6KA 3EXAA 1R6BX 4A82A 2WMNB 4ILEA 4A6XA 1EWQA 4TLBA 4CEHA 1R0XA 4L8GA 1R0WA 4LHXA 4BZXA 2W2XA 1GL6A 3OEHD 1IAQA 3CH4B 2XNDA 1R8SA 5CYOA 3WMGA 3KQNA 2DFNA 2QTVB 2JEOA 3L0IB 2CJWA 1E96A 3M6AA 3THWB 2FDCA 2FG5A 1Q3HA 4DT1B 1IOZA 1SXJC 1M2OB 4AIIA 1DG3A 2ZS8A 3PR1A 2VA8A 1XB2A 4P31A 4TQAA 2IEYA 2NPIA 1TUIA 2JLVA 1Q22A 2J0UB 3FDIA 4DCNA 5CM8B 1CR1A 1YHNA 1YR7A 4M1MA 2JLQA 3QVVA 1SVOA 4IEEA 1NVVR 2IYVA 4LJ8A 4B2IA 5J4YA 2XSZD 3VKWA 3VR1A 2HEIA 3OZXA 5FOVA 1Z5ZA 4KLZA 4DSTA 3CWQA 2TMKA 1MABB 1N25A 1OE0A 2Q9AA 1GRRA 2PMDA 4AG6A 4IRUB 1E99A 3RABA 4OQXA 2Z5FA 1RKBA 4Q21A 4TQUS 3U4QB 2FEMA 2NZJA 1XNJA 1IN6A 1E2HA 1ZCBA 4Q1DA 3WMFA 3GCGA 4KSBA 2HDNB 4NKRA 3M1IA 4EJSA 1WBBA 4UJ5A 4QHSA 3H0KA 2W0MA 4JLOA 2QBYA 5FOSA 1Q21A 4LBVA 2VPPA 1Y63A 3OE7A 1KO1A 4HLCA 4AYTA 3W6PA 1DOAA 4OL0A 4LBWA 3U61B 4HUQB 2JDID 2REOA 4JVNA 3FTQA 2AK2A 1T4GA 1YVDA 3EPHA 5JJKA 5GVRA 2IXGA 1AJEA 2RGNC 2ZAOA 5J4KA 1KK0A 3U3RA 5FBVB 1HT1E 3O8CA 3O47A 3ZJYA 3L0PA 3N2IA 1DO2A 3GFTA 4RD3A 1XD9A 1T5LA 2NGRA 4Q5IA 1W2GA 2XZPA 4XTCS 3R8CA 3U3MA 1IN4A 3LBNA 2GJ9A 4FMDF 1LVGA 1XWIA 5JI2E 3Q72A 2XJ4A 3CW2A 4H1UA 4F92B 1PV4A 1MO5A 1NBMD 2V8OA 4B6FA 2FSHA 2ZM5A 2KBFA 2VHQA 2ZR0A 4RZXA 2I1QA 1KAGA 1G8FA 1T91A 1K8RA 4TLAA 4JSTA 4MYTA 4B33A 2JJ2A 3VU9A 2IUSA 1M8PA 1MR3F 3UMRA 1WDTA 5AUOB 1OB5A 4OQMA 1ZINA 1E79A 5DI3B 5G3ZA 4MRSA 1XTQA 1YZTA 1E2QA 1RFLA 1ZUHA 2ZI4A 421PA 2IX3A 1JALA 1F60A 3R9XA 4OHYA 4QFMA 3BERA 5DO9A 3SJCA 3TK1A 1QHIA 4JVMA 1W48A 2VP0A 1BH2A 1FX0A 2V1XA 3WHLA 4BLPA 1AS0A 1EFRD 4HLQB 2CNWD 3UMFA 2WWYA 4BRUA 2JASA 3KFVA 4E22A 4Z51A 1ZIPA 1DVRA 5HCIA 2W6ID 5IK2A 2Q3MA 4PQFA 3T1TA 4JL8A 1NG1A 2NG1A 4F7WA 4MYUA 2YJTD 3X1WA 1FX0B 2CL6X 2WIAA 2HT1A 3AB3A 2C03A 4NYJQ 5JZVA 3SHFA 5K8LA 3PUXA 1G8YA 1I4DD 1KSFX 4BLRA 4DJTA 4EJSC 3AKEA 4US0R 4BZPA 1UADA 4MDEA 3SYKA 2VHJA 2ZTSA 1P61B 3CRW1 3FFAA 5J40A 4P4UA 1E4VA 4KBGA 3MWJA 4YDHB 1KAOA 3B2EA 1X8LA 2OCPA 3KZ1E 4HB0A 3QSYA 2ZR7A 3PUZA 3PEWA 3GLHB 1W44A 2AD5A 5B2ZA 4ZKEA 4HSEA 4BUJA 5DI3A 2V4ZA 3Q3JB 1MO6A 5TVKA 2ZSBA 1DAHA 2ZRLA 5DHAA 1QHHA 1H8HA 3A4MA 1E6CA 4QBGB 4DSUA 2AL7A 4YXWD 2BM0A 1OXVA 1KI1A 2EFGA 2ZUDA 1E94E 1CJUC 1TQ6A 4EPXA 2RGAA 2AK3A 1F5NA 2A5GA 4FI3C 4RKEA 4R98A 4MDFA 1DARA 4L16A 1U0LA 4GBMA 5CJ2A 1E1QA 3JVUA 4ZCLA 4I1VA 2F55A 3C5HA 4F91B 1W1WA 2RGBA 5C4MA 1U0JA 2RHDA 3FFBA 1GG2A 2WVJA 2ZRGA 4BFXA 2V3CC 1A7JA 3DEFA 4OJQA 4D80A 1NG9A 5FBQB 3EIEA 3RHFA 1CBUA 2HXYA 1ZRHA 4LC0A 1B0UA 1G5TA 1RE0A 3LW8A 4CEIA 2OHFA 4JS0A 2QPOA 3V00A 2WSSD 3S1AA 2LCFA 4DC9A 2W6JD 3Q5DA 3MWKA 2DHRA 3WNCA 1TF2A 3TW4A 2J3EA 4CT5A 5K8TA 3ADBA 4MQBA 2BCJQ 5A0FA 1XXHA 2WJHA 3RSOA 1KSHA 5JEDA 1JXOA 4LJ4A 5SZHB 3SNHA 1R0ZA 1OKKD 3C5CA 2BJVA 1JEDA 3VKGA 4JIMA 3RLFA 5KTYA 3ZZUA 4NPHA 1OIVA 3NEJA 4JLNA 5JCPA 2WMOB 1BMFD 1W46A 1TUEA 4HZIA 3WYFA 4DIDA 1Z47A 2R6GA 3V4FA 3WBJA 4EQ6B 3UG6A 4LSGA 3DOFA 3L8YA 5L8VA 2WWWA 2QEQA 3IHLA 1ZAKA 3WMEA 1SXJB 3IQWA 2ZRHA 2I3BA 3QKUA 4RD6A 1IN8A 4CW7A 2KB0A 2ZRCA 2UZIR 3PITA 5KHOC 4MUBA 4D0GA 3SBDA 2RGCA 3WNBA 4AD8A 2E1RA 2AKYA 4FWIB 4BFTA 3OEEA 2OE2A 1Z0FA 4A8JC 2NMVA 1U8ZA 2NIPA 3KTAA 2A78A 2O5VA 4KHZA 4L5BA 4YMWA 2G0TA 4CGZA 4WXRA 3LXRA 4NCHA 1XCMA 2H57A 4G0NA 3ICEA 2HLDA 1R5BA 2QAGA 4JYBA 4EFNA 1G8HA 2EYQA 4PC6A 2YWFA 1S3SA 3SDZA 4B2PA 3N70A 5J4LA 1RVDA 4NU0A 1MRNA 1LV7A 3LQRA 3WYAA 3IGFA 1JEEA 1G18A 3LA6A 5FBRB 1TL7C 3W34A 1ZNYA 1BS1A 1R7RA 1J70A 4HAWA 4F4JA 4IOLA 2MMCA 1IY0A 1E9EA 5P21A 1IQPA 3ASZA 1JECA 4KFSA 4TYQA 2MSCB 4URXR 1YKSA 5DGXA 2IF2A 2YV5A 4IKEA 5FFMA 4LBZA 1Z0IA 4NP6A 3CNOA 5LB2A 1HV8A 1T3SA 2C9CA 3EW9A 3PXGA 2IBMA 5E7MA 1LFDB 3QJYA 1FNNA 1DG1G 2H5EA 1I2MA 2WJJA 3H84A 4U7DA 3CX7A 4RY2A 4QGHA 5C18A 5CIWA 3QKRA 4PHGA 1FFHA 3B82A 3L8ZA 2CL7X 3CRVA 4WW0A 1MOZA 3OIUA 2ODBA 3ZZTA 3I92A 1OH6A 1O87A 2ZS9A 2ZI6A 1SVKA 2X2FA 3VQTA 1OT3A 2EFCB 5HKKD 1X86B 3QXSA 1R4AA 3LD9A 3MWLA 3KFXA 1GWNA 2FFHA 3MAAC 4KFTA 4B32A 5FR1A 1K5GA 1U9IC 1JR6A 1QG2A 4I81A 4XH9B 2I1VB 5DN6A 2QMUA 4C0HA 2CEAA 1E3MA 1KKMA 2OCBA 2ZREA 2ZSAA 3K09A 2ZUCA 1FQKA 2WWXA 4DUGD 1A2KC 1KGDA 4XOIA 2ODEA 3I1FA 3MGCA 1G5RA 3DMNA 3KL4A 3C16C 4NCNA 2RGGA 2GXUA 2F43A 4TMZA 1MT0A 4B48A 4A2PA 1T3HA 3LBIA 1AQYA 1G3RA 1ODFA 4HATA 1QHSA 4TMWA 2IWHA 3VFDA 1S9DA 2NTYC 3VU9B 2CL0X 2IHYA 2CBZA 3FKSA 1OYWA 4XD7A 1SULA 2ZU0C 4EDHA 2F9MA 1XMJA 2AN9A 5BN5A 2J1LA 4QJ4A 5JSZB 2OUKA 1Z22A 1V5WA 1SVIA 1OF1A 4Q4LA 4PC7A 4DKXA 1JAHA 2FPLA 3RWOA 4LJ9A 1NL3A 3L0OA 2ANCA 1FPMA 3R8FA 4E07A 1G7SA 4JJKA 5FUXA 3W6NA 3B7GA 4TL8A 1JXMA 2YYZA 3KDSE 3NTUA 4TTRA 3QOFA 4JZKA 1GKYA 2Q0HA 5KSOA 2XX3A 4DEYA 4XIGS 4NYMQ 1CIPA 5TV2A 1KDOA 1OIXA 4CYMA 3EC2A 4CEJB 2HXSA 1N0VC 4U00A 3CF0A 2J45A 3Q85A 2FU5C 3P20A 2PT5A 2ZI9A 1FMLA 2QBYB 4KXFB 4O3MA 4P4SB 3BGWA 4KBFA 3DOEA 1WF3A 2IYQA 2O0KA 1ZBDA 2NQ2C 4Q7LA 2WOOA 4ZO4A 3DM5A 6Q21A 3SYLA 2QT1A 1W4CA 3CF6R 4N0EA 1MH1A 3BWDD 1UBEA 4Z54A 4MKHA 3QG1A 1UDWA 3VNVA 4C2TA 1WMSA 2DWPA 4DDTA 3NDBB 1EFUA 4QXAA 1SVLA 2RCNA 3A1UA 3RRNA 1T0HB 4DCVA 2N1BA 3QPUA 1UBCA 5H8WA 4URZR 3BE4A 3LV8A 3G0HA 2A5FA 1GL7A 4C0JA 3SZRA 2QN6A 5HZKA 4I1OA 1UM8A 4MKIA 2ZSFA 2BIFA 1UEJA 1U2RA 2XJ9A 4PAOA 2XAUA 1TF5A 4CVNA 1G291 2YVUA 2ORIA 3KQUA 2YWEA 4QM7A 3QF7A 4LX0A 5AJXA 4MUAA 3LVQE 4NCKA 3W8NA 3PUYA 4LI0A 4K81B 1COWD 2FFQA 3AVUA 3A1SA 2J7PA 3JZMA 4M1TA 4Q7KA 2ZRAA 2ZQ5A 3T34A 1G6HA 4RJLA 5G40A 1AS3A 3NDPA 4RCYA 2X1VA 2VIIA 4NH0A 4XTRA 3TMKA 1TMKA 1Z07A 3CO5A 3ICQB 1KO8A 2QE7A 1HA3A 4QM6A 2BWJA 5GJVC 5FR2A 2VLIA 3UWKA 4N0DA 3TNFA 1QHXA 1WQ1R 3I62A 1XZQA 2B8TA 4IDQA 1IXSB 2ERYA 3RS4A 2Q3HA 4Q1AA 3H1TA 1AGPA 1T3LA 4GFDA 4L9SA 2CE7A 4JLPA 3ZQ6A 4GDFA 2IXFA 2OFOA 1VIAA 2VH5R 3K9GA 2JLWA 3D31A 3QVUA 2V7QD 4X8LA 2ZYTX 3LVRE 3A1VA 4BGDA 2FOLA 2O0HA 2GTPA 1N6LA 2I4IA 2HF8A 1CJMA 1ESNA 5EZ6B 4NYMR 1ZUIA 2P5SA 1VTKA 3CF2A 2GZAA 3W5JA 1EX7A 2QMOA 5L3RA 1HQCA 2WWFA 4WXPA 3IKJA 4PQRA 4Q4AA 2KE5A 2ZANA 4YMSA 5EZ5A 3W8RA 1KI4A 1N6KA 3EA5A 4PXAA 2QP3A 2H8KA 3ZGXA 4CIDA 2B92A 4PO1A 5TB5A 1T6NA 3BH7A 1FW6A 5EUMA 5EJEA 2ZI3A 1W0KD 4WIAA 4D4KA 1X6VA 3THOA 2CCKA 4LJ6A 2GF0A 2E87A 1KI6B 2GJAA 4EPWA 4Z8XA 1J8MF 3B1VA 3BBPA 2ZXUA 2YC2C 5KU1A 4PANA 2J41A 2ZRMA 4W7SA 1G4AE 3SU8A 2F3TA 1IJFA 1MV5A
chains in the Genus database with same CATH superfamily
3KCQA 5U4XA 4PAMA 1NLZA 1H65A 2X7HA 1HTBA 1NRWA 4RD4A 1A71A 4HRAA 1KDYA 2RBGA 3RSFA 1K4KA 1AZLA 4DQLA 1PR3A 1GNVA 1GXSA 4ZOQI 1H5QA 3DGEC 3IIMA 1HOTA 4ER0A 2VJNA 2BCGY 4J43A 3QPVA 3JASB 4NFLA 1I2BA 4UVGA 5ALOA 4EW6A 3PLAE 4NPAA 4G0MA 3IDOA 4RK1A 1Z4MA 1IDOA 1HE5A 2XHZA 4UBKA 1VI5A 5FOQA 2GFHA 4G56A 2VK1A 3S2IA 5K0SA 1J0DA 1F9AA 1GQSA 2B61A 3EA0A 3O5AA 4NMLA 1YZUA 4FGKA 1P73A 2RHRA 3NJ8A 3V7FA 2IUTA 4ND5A 2C4WA 1IZ0A 3QFRA 5H02A 4KSCA 2WRZA 1DTWB 1XJ5A 4M8LA 2YFQA 3F90A 1CUEA 4ISCA 1SZPA 4JVOA 5EXSA 3HA7A 4RJIA 5CCEA 2QRJA 2IH4A 2ISQA 4KH1A 1IK4A 5KCZA 1RWBA 1VE5A 1E3SA 2R5FA 4JP8A 1PG2A 1EU1A 5GZ1A 3HWX1 4NENB 2XA1A 1SU6A 2Q9BA 5C5IA 4INJA 3T6KA 4D9FA 2VAXA 1MO3A 1XCPA 3JYPA 3NYWA 2CCGA 2FEOA 3O26A 2ONJA 4X61A 2CFOA 5BSMA 3VKFA 1DEXA 2ODPA 2J3MA 1SK9A 3ZKAA 2Y4OA 2O8BA 3JQDA 5KJ1A 2HCTA 5FBWB 2XW6A 1N2XA 3TWOA 1KI7A 3H05A 4BFUA 3GT7A 3V1MA 1EM6A 3PI6A 1UQRA 1A9QA 5DK4A 3TAUA 1EUQA 3I0MA 3EDYA 4AWXA 4R1QA 4DCSA 2V7QA 4KW7A 5CAEA 4Q3DA 3SF0A 1EUDA 2QTAA 3FKJA 1CRWG 4JUCA 4C7JA 3FOFC 4IRXA 2QN2A 1U9CA 3HLYA 1F5SA 1UPCA 5DRYA 1EVEA 1W49A 3W4IA 4C4AA 3O3CA 4IV0A 4EK9A 4YUAA 1UH5A 5BN1A 1DZ3A 1QK4A 3ZWPA 2A2ZA 1XZLA 1PEKE 3EEBA 3K9HA 4G5FA 4QXRA 4QTUB 1P5FA 3BJMA 2FYTA 2Y0EA 3LHDA 4RZ2A 2VSFA 3TQFA 1NJ5A 3X43A 1J90A 4L4UA 1KZ4A 4MJ3A 5K51A 2W5UA 3MRSA 2VJCA 3FCOA 3AEKB 3QUSA 4TL6A 3RKRA 3E61A 3BRWD 4GM0A 4UU1A 2HL6A 1B7GO 2KSQA 2O59A 4CCWA 1R27A 2D8AA 3ZIDA 3STYA 4KBYA 4FWBA 5FI3A 3UT5A 3LCJA 5AKGA 4WESB 2Y1KA 4KK3A 2VEDA 2D4AA 1GNLA 4RH1A 2XQFA 2BBWA 2BR4A 1UPXA 1RM0A 3G2LA 4BO9A 4ZT2A 3L7YA 3NBXX 4M1OA 2E7ZA 2R6JA 3KQHA 3Q87B 2SHKA 4HX9A 4OQPA 3GLFE 1J07A 1J7JA 1SC3A 1TCAA 1O08A 2GAOA 1L4LA 5E0KB 1L5RA 3AY7A 1OASA 1NJ8A 1E9BA 3BK1A 4IIEA 1C9KA 2FJ0A 2YFHA 3PHHA 4AZVA 1P60A 1SKUA 1E5XA 2J5KA 1TTTA 3RJ9A 3WMWA 4POAA 4BO8A 2HDHA 2AHRA 4A23A 4QICA 3X1MA 4PZAA 2IKSA 5I8WA 4P3YA 1RT9A 4R05A 1BH6A 2HU2A 1Q83A 4L6AA 5AHXA 4B76A 3O8RA 1YGPA 2XTAA 1UIRA 4HAVA 4AXBA 2WV7A 5EFZA 4OM8A 4XWKA 1XSEA 3Q0EA 1SUDA 3KXLA 1H5UA 4I6GA 2C83A 1RKUA 5CR9A 2OORA 3DL0A 1G1MA 1FP6A 1ORTA 3O03A 4I99A 4ZZ2A 5IZ4A 1B2LA 4X91A 5A5FA 3GDHA 1PZEA 3PUVA 5BW4A 3GJRA 2P2YA 1QFJA 5E6SA 3ZXUB 3MSXA 1GU0A 1WOMA 2G1JA 2EEPA 2ZE7A 2D00A 3U7JA 4ZCRA 3QNWA 4NJOA 4JI6B 4L4RA 4L9RA 2VZ8A 3FETA 2VHXA 3G5TA 4AQYB 2GJ4A 5IYZB 2QY6A 3R0IA 2FZVA 2OFPA 2XB4A 1U6KA 1X1TA 3S70A 1X7HA 4UAJA 4KAAA 2F3PA 1R0YA 3H1BA 1DAOA 2VHCA 3DMTA 4CRWB 4D0LB 2O2CA 4ID3A 3KZCA 5EJ7A 3K8YA 2WAYA 2PBRA 4L4XA 4NYIQ 3OMXA 1US8B 2CBGA 2WZBA 4QOJA 1RI2A 1ZBQA 2OYSA 1A8QA 2BV3A 4IOKA 4OSEA 5CVDA 1XTJA 4U6QA 4AROA 3WSTA 1A8SA 4J4BA 2HWXA 3VHQA 2NSYA 2GA8A 3LJKA 4R5HA 5CDSA 2XF8A 4H7PA 4NONA 2MMGA 4HS4A 2GXQA 2Y93A 1J8YF 4BU1A 1P7ZA 1XWFA 1YACA 2XWQA 3HDTA 3I32A 3B8EA 2QM7A 3EJWA 2VUHB 5JS1A 5DM60 3EWIA 1H8ED 1GD1O 1MVOA 2RKOA 4CM8B 3ZQJA 5C7LO 1Z2DA 3KXKA 3WB1A 1Y8QB 1C3OB 1SKMA 2GK4A 4Y7DA 3BIXA 1ZCJA 3GLGA 4L3OA 1I9GA 4PG6A 4RDHA 1C0IA 5EIBD 2BKUA 2F2TA 3P0HA 4C1NA 3CGWA 5DASA 4DIMA 2PZMA 2JW5A 1WL8A 1FFYA 3Q7PA 3TCKA 4F85A 4MWEA 2WYOA 1S3IA 3HQ4O 3Q7SA 4MB6A 5SYNA 3WOHA 4AY6A 3B89A 3ILHA 3NV7A 1UAYA 2OBFA 4Q4HA 3ST7A 4B3DA 4MW5A 3K1YA 1U3TA 4J4TA 3NXKA 3ZZ1A 1CZKA 1QVWA 4X7BA 3LF2A 4E33A 1LDYA 1LSJA 3O4GA 3HP1A 2X13A 1CHNA 3F5MA 4WOKA 4JBGA 3ROXA 4BTLA 3QU9A 2EF1A 3HRKA 3FBGA 3T1VA 2NYUA 1HF3A 3JQQA 1UJ2A 2RI1A 2G1KA 1CY6A 3I8SA 3GMDA 4TMXA 1WUYA 3TLCA 1WETA 3LX8A 1FPQA 2O52A 3L4EA 4HWKA 5DXJA 1KMHB 5TPWB 5JIBA 1WXEA 3KUKA 1DQYA 4LDQA 2YASA 1A72A 1OA1A 2FMTA 3QU7A 1IQ0A 2IHKA 2IYZA 2XIJA 3OEYA 3O4HA 4GC9A 5ESRA 3VI4B 4AZ0A 3UPUA 4N8DA 4OHXA 2HJHA 5EMJA 4QXPA 4A8JC 1HRDA 1RWVA 2QRHA 4I9GA 5DT9A 3UK6A 1REQB 4HUTA 3VX4A 5BWNA 5CA1F 1E7YA 1I6KA 4I8DA 4ZOBA 3PJFA 3K9NA 2VHEA 2AOTB 3JVVA 4ZWNA 4CFSA 1TM2A 3MJFA 1EPUA 2BFPA 1T8YA 1RPTA 3A1WA 1UODA 2EDAA 5JALA 1G3QA 1W93A 3KP1A 3C5WP 4PN3A 1T3GA 4IOMA 4EUKA 1U1DA 2IOYA 5G0VA 2DQYA 2QYOA 2I5PO 1JL3A 2XXJA 4DZZA 2H4WA 3GROA 3V7UA 1YOVB 5C46F 1BA3A 2NZ8A 5FTLA 2ZSDA 2F3QA 2GEBA 2JC3A 2XTMA 3K9WA 1Y34E 2VDLB 4MV8A 5TEWA 3BKWA 1XEWX 2H9IA 2OHVA 4OV6B 2XZDA 4FVTA 5JMOA 4I1UA 4NAVA 3IE1A 2E49A 4XI9A 4B09A 3LYLA 2UAGA 3JD0A 1OGYA 3LXXA 2FMUA 4G9EA 2YY5A 2AG5A 5I7AA 3WMXA 5KTNA 6ADHA 4A6DA 1GL3A 1TJ5A 1WB9A 4JLSA 1DCKA 5KTOA 1ODKA 2YHUA 2OV1A 8LDHA 4S12A 2V98A 5AVKA 3ILSA 4QYXA 1VIYA 1ZEMA 2WWHA 4P4GA 4UQLA 4P3PA 3IP7A 1DQPA 1MOSA 2ZRBA 1E9AA 3GLQA 1WV1A 2BTQA 4P3OA 4R41A 2GKOA 1QO9A 3DKRA 3MGAA 2V7EA 4JI1B 5AUPB 1F4PA 2GYUA 4OHCA 4EPVA 3FBWA 1PUIA 3WK8A 2X4DA 1COWA 3PP8A 2A67A 4R2MA 1NTRA 2GBIA 3AMVA 4V0OA 4NZZA 2ZGVA 1Q7TA 5DMHA 3GFFA 5C51B 2ZB8A 1YFKA 4GR5A 4MKGA 4DY6A 5KWIA 2Q46A 1E8DA 1V5IA 1W9MA 2VPZA 1M6HA 2HMSA 2WAXA 2ODTX 4H9GA 4B47A 2D1SA 1UBHS 3DQQA 4B73A 1DPFA 3C3YA 1Z3IX 1X7YB 3KXDA 1GRNA 4QYSA 5L4NA 1UK8A 2CNDA 5GV8A 3PJGA 5GTDA 4LF9B 3NM4A 1L1EA 1JILA 3U09A 5L40A 3LGAA 3NHAA 1YS4A 3OX1A 4RENA 3FDJA 4OJTA 2YHIA 2YFYA 2HF2A 2C29D 2GTHA 2YWXA 4QL3A 3TTWA 4ZMRA 1WNTA 4N6OA 3BDVA 1KVUA 1TQ8A 1Z39A 1KXZA 1NXWA 1QE5A 2DY1A 2BEKA 1H3NA 2NU6A 3DBIA 3KVNA 5REQA 4JZYA 1IM2A 4PSKA 1GG5A 3GGPA 3EBLA 4UE6A 5DYTA 4E6PA 5F2NA 5KVVA 2IS1A 3P9ZA 5K7SA 3AUAA 3UCFA 5SZJA 4N49A 3RS9A 1YU6A 4M49A 3WRVA 4BNKA 3DT6A 2ZROA 2RDMA 4OGLA 1V25A 5KNLA 4HH1A 3FHTA 3V42A 1DUIA 1EDBA 1W9HA 1WPRA 3K32A 4M9QA 2HN9A 4L51A 3OM0A 1EBUA 1QV7A 1KZHA 3ESZA 1KHHA 3AF0A 1A9XA 2RGNA 3GVXA 3PPYA 1KR5A 4RZ3A 3K5PA 1PUJA 1Z2OX 4KQIA 5AW8A 2JLZA 2VT6A 5F5NA 1XMQB 2IYLD 5G41A 2EZTA 3OZVA 4O8ZA 3DPSA 1L7XA 1BWSA 1O89A 4HZUB 4IIUA 2QQ0A 4TLCA 2ID8A 2XUFA 3MJEA 2PSHA 4CM5A 3KQTA 1L3BA 2B7LA 4OHPA 4ZMBA 5I4KA 2WHPA 3O3OB 3SSNA 3VR4D 5K2MA 5MF6A 1JJFA 2GZDA 3MWYW 4DT1A 1JDBB 4FZJA 5JCJA 2L17A 4AG3A 1H0SA 1XNRB 3DUFA 4DV5B 2FMXA 3TSOA 2BFBA 2YWHA 2IOFK 3QU5A 4W5WA 3GFBA 5ILOA 2FCRA 3RVRA 3PA6A 4PPQA 1S7GA 2PFGA 3F8WA 3MB8A 5A6SB 5I7OA 3JRNA 1ECPA 1DAFA 3WLEA 3BMNA 1RAFA 1JHAA 5A5VA 4L5CA 2PLRA 1SUAA 2VNJA 5THKA 5WRFA 1U3WA 1S5PA 4AYWA 1HEIA 1Q0HA 2E55A 2PMKA 4W5JA 1GNRA 4Y30A 5D2CA 4G4IA 1IQRA 1JHQA 4JX9A 3W77A 1X7WB 3OCCA 2CNKA 3G79A 5EIOA 2PMFA 4YPFA 3F5DA 1QSGA 1XDGA 1HBJA 1PSWA 4JR0A 3R74A 3A25A 3STWA 4JXZA 1SHUX 1VJTA 4FYVA 5EUQB 3THXA 3QWBA 1GA1A 1KS2A 1VCMA 3Q10A 4GD3Q 4KYVA 1IG0A 4MX8A 4V2UA 5E3JA 1TIKA 2RKBA 1B76A 5I9MA 2D3WA 4TN5A 3OF5A 2JRCA 4HYEA 5EE0A 1Y5MA 3E22B 1XZMA 2YHIB 5F4BA 1K7EB 5ICFA 5AM2A 5BMOA 5DEOA 2R65A 3M3DA 1UPTA 1IPEA 3QWFA 4X8OA 2XMBA 3UJDA 4P1ZA 1R6DA 3VR2D 4JNKA 1E62A 4J75A 2DCUA 2HCFA 1VE7A 4RKRA 5JJLA 2W83A 2QZ4A 2ZS7A 3V9PA 2CK3A 4DUGA 1GN8A 4C7OB 3E4DA 2QTTA 2PX2A 4PIPA 4ZAZA 3WRYC 4BNZA 5HZGA 4LNAA 1SMKA 4IY1A 4UASA 3GBSA 4QPDA 1ZJ6A 3PPVA 1D2RA 2IZ1A 2PYDA 3F9IA 5EJ6A 1VHTA 3DVQX 5SYMA 1X94A 3HWRA 3VR2A 2RAPA 3VR5A 5CPBA 3N8KA 3LFUA 5LQDA 2UYOA 2B1IA 1A9YA 5IHPA 2NUAB 2FPRA 3OCWA 4LDPA 4WASA 1AK9A 4H3KB 1RYEA 3B3AA 1OA0A 4AUMA 2PXHA 5F2EA 2F3RA 1NVWQ 1R6TA 3BFJA 3DFKA 2GDJA 4EYOA 3E27A 4TZTA 4RPLA 3T1YB 5ICEA 1FW8A 1LB1B 2PTHA 4OFBA 1G3IA 5K3SA 4BHTA 2J3LA 1K2VN 3GT4A 2PKQO 3U9LA 3USES 2AEMA 4JI5B 2IFTA 1LU9A 3HVKA 4W1PA 4TS1A 1JA1A 1KO7A 4DDWA 2EQBA 4GF5A 4Q9HA 5DTJA 4BAZA 1RYFA 3WWCA 1LRJA 5AI4A 1ORVA 4M3NA 2R3SA 2E6UX 2OFWA 3BTUA 5E2BA 4IXTA 4ZVQA 4BJ3A 1XZAA 2FDRA 2ZDGA 2CXHA 2JD1A 4TSFA 4GI2A 5EVJA 3V1UA 1CUAA 2GUGA 1JMKC 3HR8A 4C21A 4ZCTA 3O84A 1XO1A 1WB4A 3GDOA 5IBQA 2CMHA 1AO3A 4IFEA 4JC8A 4ND8B 1QVVA 2PA0A 4Q4AB 4P3KA 1DRKA 5FNVA 4E5KA 1YVRA 2CLOB 1C9DB 3Q7QA 4U2EA 1XPRA 2AMVA 2ZITA 4FS8A 3M82A 4H35A 4LXGA 3SDSA 4UDYX 1QHHB 1S4MA 4WECA 4AZ0B 4BQEA 4M1YA 4NSNA 5MGBA 1V45E 1FXWA 2GBGA 5H70A 3TOZA 2B1QA 3G0BA 5A4AA 5AKLA 4FZRA 1UJNA 3JRWA 3IMCA 4AP5A 4M7WA 2DB3A 4Z7JA 5SZIA 1AE1A 4DYHA 1MB3A 2JL1A 5GZ6A 4RSRA 1U94A 4PSVA 1J9ZA 4DIKA 4TSKA 2AFRA 5A1TA 1N7JA 3DVLA 5DGIA 4Q1BA 4PYRA 3G3EA 4XSGA 5MDHA 2PSDA 4FNMA 1CX9B 1BKYA 3GW8A 3A4VA 3KOXA 4EO4A 4AG5A 2GPJA 2PV0A 2QG4A 4HGRA 4J07A 3Q2IA 1FP2A 4EA8A 3FWPA 4JLAA 3IPCA 4MVJF 4V3BA 3SIRA 2C8KA 2OXEA 1SB8A 3CLSD 3MINA 3OM8A 3R3VA 4FGLA 4K8OA 4C0KA 2NUPA 3VYSB 1RZVA 5JZSA 3ELBA 4FT4A 4OI2A 3HCAA 5T6BA 3OKAA 1BKDR 1OFTA 4HR7A 2EX0A 3TDKA 1EFLA 1GHTA 3C15C 3GFRA 5U9CA 2V4UA 4M0FA 3HCBA 2VOJA 4YBZA 3TD9A 4P58A 4BMNA 3HWSA 1ZVMA 1YIAA 1KMQA 1JHOA 1P4AA 3IOMA 1OSNA 3W5DA 1TKBA 5EIWA 3RU9A 2GHTA 4Y0AA 3T1QA 4B3XA 1ZK3A 3UMSA 3VVCA 3K92A 4MXDA 2KQUA 3IEIA 4X5OA 1U63A 2DFTA 4J9UE 3RRFA 3KZVA 4MMXB 1X1BA 2I2FA 2M6KA 3SC4A 4EKDA 5KQLA 2LKDA 3HY6A 1CSEE 1WCV1 4P92A 1QF6A 9MHTA 4CEJA 4RF4A 3U44B 5KX5B 4KTVE 4MTCA 2VP9A 3VZSA 2WE7A 2FGKA 3F4BA 5ADUS 4WNAA 1L7NA 4CT0A 3VX3A 5LP6B 2QPTA 3VUFA 1EZ1A 4PG5A 2OV4A 3FCCA 3W78A 5GJBA 1VI2A 1XZCA 2WB4A 4MV7A 5BT8A 1JU3A 4LZZA 2F59A 3ZGYA 5CFPA 3SLGA 4J0FA 3LCUA 4ZOEA 4ACBA 3TG2A 4NNJA 2OA0A 1KOFA 2O57A 2UYQA 4IXWA 4E30A 5HKBA 1EHCA 3E18A 5KC8A 4P36A 2CXXA 3NWJA 4HXFB 3LCRA 4JUFA 3GA7A 4GP9A 5K45A 3OTOB 3QLUC 1DC3A 3DLCA 1NBIA 3OE1A 3AFNA 2X4LA 2D74A 4PAWA 1X80A 4PYLA 4DZTA 3VKHA 5KX5A 1U5AA 2Z8YM 4AN0A 5LVAA 1BHO1 4YP5A 1R8XA 2FQYA 2IHVA 2WFAA 4BP8A 2X42A 4MPJA 5BV1A 3L7AA 1HEUA 1CQXA 5JDCC 1FZTA 4D9KA 2Z1NA 4MCJA 3KOZA 1X14A 2QDXA 1YS2X 4F11A 1R12A 3NU1A 5DEIA 5E8JA 4ARIA 2W2TA 3KQKA 1MEEA 4F86A 1FFCA 3RS5A 1Z75A 1ZIXA 1PF7E 3EG5A 3MF4A 2OBBA 3NVAA 4LDZA 3NDIA 3ELDA 4YJ2B 1VL1A 1X77A 3T41A 5C1OA 5K6AA 3ZDCA 2JAOA 3IT1A 1Q84A 3CRNA 5J2UA 1IBMB 3ZXIA 4AQ7A 1ULTA 2WJVA 4HEJA 2GD0A 5IK2D 3RV4A 3RK4A 2DUNA 2J5QA 4KQMA 3DO6A 2EGUA 4G5YA 2WHRA 4JOQA 2YOGA 1DAEA 4XDHA 3OCYA 5CNMA 1EFCA 2P5TB 5ITWA 5GPBA 3S2EA 1FC0A 3SZUA 1XAJA 3CN7A 4C5AA 4XJVA 5BNIA 4JI7B 3JALB 2BHNA 3DZDA 4QELA 3RK1A 2B82A 4YFYA 2L0XA 5E3IA 1G64A 2D1YA 3TL3A 1KAHA 1ZI9A 1OBFO 1RYDA 3X1XA 2EV9A 3LIIA 2G80A 3Q5GA 4V24A 3HXLA 3PKJA 1PV1A 3TZQA 1PQWA 4DN6A 4Q1FA 4DXHA 1E0AA 3OFSA 3FVRA 4B7UA 3EDRA 5EI5A 4ZI3A 5HKLA 5T5QA 4O8CA 3GGSA 3I5AA 1S96A 4DM4A 1EP9A 1X8KA 1KZ7B 3OJXA 1XVIA 2F9LA 4M0EA 4YRNA 3O8QA 3L06A 1HURA 1P2VA 1PG0A 1VDZA 3PEUA 5CT8A 1H8EA 1MB4A 3VJLA 5KTSA 3F5FA 5FOTA 1E2NA 2HOQA 2A7QA 2O1EA 4JOCA 3U1VA 2H59A 3ZZMA 4F9GA 2CHQA 3I8XA 5ANRB 1AY0A 3IVMA 4XB2A 3ROGA 4DIFA 4D42A 2ILTA 4E3WA 1QK5A 2Z3VA 5DHSA 1E6UA 4K3UA 5CT4A 3VHLB 2UZ4A 1O97D 5DWQA 2C8JA 3EFOA 3IP9A 3NNNA 1SKYB 5ECDA 3ETGA 3CR7A 3RIYA 2Z6UA 4PHFA 4TKUA 3SJBA 4LS3A 3N8GA 4X20B 5AYVA 1Z8DA 4YRFA 2FW9A 1FLNA 2X8LA 4P4NA 1HKHA 1G3MA 1U9IA 3ENWA 1RYYA 4QDUA 3RYFA 2EOAA 1EHIA 2GAIA 4OPMA 2BBTA 1TE2A 3AEXA 2CJXA 3JQBC 1ZICA 4EW3A 3M0EA 1L5QA 4FWTA 2P69A 3GPCA 4KPUA 1CUDA 4HKTA 3TLAA 3OVMA 3ROKA 4KR2A 1HETA 4Q7QA 4G3XA 3TKYA 5E9WA 1EFRA 2ETVA 5CLJA 4C1BA 3NTRA 3JD3A 5B58C 1A3CA 1LNSA 5CB4A 1N2ZA 3R75A 4GX5A 4PU0A 4PZZA 3DKVA 2GLUA 1NP6A 1T9AA 3KUXA 4GOLD 3TR0A 3WL8A 1N8SA 1U1GA 1RI1A 2RHBA 1KYYA 3EXHC 2GB4A 3H5NA 3K1JA 1ZS9A 5DTQA 3DEJA 1E98A 1JXAA 4B71A 4K5QA 2RB4A 1R6UA 4WLNA 4EY7A 5GADl 3D7KA 4C76A 1H4SA 1L7AA 1KU6A 1QK3A 2Q5JA 3G2QA 4WPGA 5CYGA 2HZBA 1I01A 1TB4A 3COSA 3EPPA 3W3AA 1AB6A 1THZA 3RF7A 1IRXA 2OOSA 1U8EA 2R8YA 5BUZA 3ER8A 2PKXA 1QJ4A 4YJ2F 1NSFA 2HTFA 1SUPA 2DJ5A 3DV0B 4XVUA 1PUXA 3U4QA 3F73A 5LPNA 3SG0A 1ZJ4A 3G7NA 3JAWA 3NT2A 4J3FA 5A5DA 3UJ8A 4UTNA 2HHAA 1ZOSA 1JDTA 1HRKA 2VP6A 3B85A 1QANA 1HDIA 1FU8A 5ALNA 1BCSB 2IL1A 2VT7A 3C6YA 3D8UA 4CKEA 3OESA 3ZH9B 1BE8A 4Z6KA 5EINA 1NASA 4JH0A 1WPXA 2PZFA 3CUYA 1D5WA 4PN7A 5C7OO 2CN1A 2OBXA 4N6NA 3PD1A 2AFIA 1L5MA 4GQAA 2XZTA 4OK5A 5LA6F 3WAJA 1L4EA 3Q1KA 4DWJA 2IXTA 4CMHA 4OLHA 4BCCA 3THXB 1WVMA 1JG6A 1QGZA 3FOCA 3GCWA 2IU4A 4PZUA 5FPQA 3R9KA 5DSZA 4RPHA 5JPCA 3VNVA 3CNLA 4AWAA 1J2JA 1YH3A 2AOWA 2MIIA 3H6KA 3MMNA 2F43B 1LPAB 4U7PB 2X7XA 1U2GC 3G8DA 1IB6A 1KEVA 3DQPA 3SX2A 3EGIA 3W7BA 2QPLA 3UJPA 1O4WA 2QGNA 2X0IA 2YZ7A 4RPGA 4YDSA 3DT9A 4D4MA 5C1DA 1YA6A 1ZJWA 1ZA1A 4D44A 5F3RA 2DWQA 3L8MA 3Q11A 4V0ME 3LPAA 4XJSA 3PFGA 4BKQA 4XVRA 1PEDA 4NZYA 1S9HA 5BSGA 4JELA 3EISA 1CZNA 1PFWA 3KHUA 5KYNA 3AIIA 2V7XA 5DWVA 1W1UA 1GN9A 1LV8A 3BD9A 4G01B 5EHZA 2J33A 3K09C 3JARB 2GYVA 2V7PA 4ZEXA 5JO0A 2JH8A 1QVRA 3M4YA 1DBWA 2W4IA 3UPDA 1KBQA 2FWNA 5CFOA 5GIOE 1A9OA 4P98A 1ZN8A 3PLRA 3RE1A 5JZ9A 5K20A 2PE5A 2AJTA 4MVJA 4R1MA 4AJ2A 3DHNA 3NIWA 1NVUQ 3FYUA 1BOOA 4Z4HA 5IZCC 1AUVA 1TYDE 3BN3A 4S1PA 4IDCA 4XWOA 1PNQA 3FGOA 2CUTA 4JI0B 4AECA 3VNUA 4UUAA 3VVMA 4MGEA 2PZJA 4TT3A 1ZRMA 4B6RA 2UZ3A 4HDNA 4DJEC 1DOHA 2P7HA 4ZV7A 5F77A 2KS6A 2OM6A 1NBHA 3GEBA 5AXBA 4AJKA 1NQ5A 3U7GA 3Q88A 3G13A 4Q48A 3NIDB 2AKEA 4MV9A 3CZRA 3LPNA 1E1QD 4RTLA 2BKXA 4CN9A 2WQ7A 4WXYB 5TQ0B 3W5BA 2FRDC 1V3UA 3E03A 3HKDA 3OX2A 1B6TA 4W6ZA 2FA9A 1BCRA 3FKSD 3N1UA 3OIYA 4LY9A 1YKFA 3K8ZA 4RJJA 4X44A 3QY0A 3TUZC 5JSZA 3B6ZA 4XQGA 4B7ZA 3I5YA 2OZKA 4EB8A 2QT9A 4YT2A 2PY6A 4OOFA 5HQ3A 1XEXB 4MI3A 5HK9A 4RK7A 1SURA 4FHZA 1HR0B 3TO5A 3J81A 1J1UA 1IN7A 3A2LA 2JCGA 3B5IA 4K05A 3FMVA 1BW9A 4Y9RA 3RUFA 1J8QA 1XXHE 4DM3A 1ORWA 1OI7A 2PANA 4OM7A 3E2MA 5D84A 5DBOA 1OXXK 1NULA 1IPHA 2P0AA 4IFBA 1SRRA 2DBVO 2DX7A 4NARA 3CVVA 4D9GA 1TDJA 3LDAA 3B6JA 4JKIA 3DA8A 2HRBA 3TTYA 4BV8A 3L1IA 4JJZA 1JQEA 4PWZA 5IJ0B 3G2KA 1FDSA 1P81A 2PQ6A 3CUEF 3N2LA 1U7XA 2XMRA 1Z0JA 3P0JA 2E4AA 3PVCA 5I5GA 2FW6A 4CHTA 4ZU1X 1A9TA 2PUHA 3KJGA 4UBMA 1ECFA 4LYGA 1DB3A 3WHIA 4AY2A 3FD8A 1DTSA 1QF9A 1ZIDA 3F46A 4KX3A 2IIBA 1F38A 4EA7A 4LWZA 1TQDA 4N12A 4CLHA 4QJ3A 3UWMA 1K1EA 1AU9A 2EU8A 2KBEA 2L2QA 3A1DA 1CVRA 4LRQA 3ES9A 1U90A 4N5MA 2V45A 3PUWA 4L75A 3TL2A 3FZNA 4QEDA 1GPDG 5TF0A 3BMXA 1ZVVA 4ICIA 4RH0A 4WCFB 5EP3A 1JRLA 4P9NA 4CM9A 4MV5A 4BO6A 4G5GA 3MIIA 5IFLA 2Q27A 3EVZA 1Z5UA 3ORYA 4H60A 3WGOA 4DV6B 1X1SA 4DLRA 3ABQB 5AVYA 3UJAA 2FK7A 2OGWA 2J4FA 4ZCQA 3CZ9A 2JGJA 2F17A 5C1BA 4FIDA 4EPTA 3SIXA 1ZVKA 3PQCA 3WK7A 3ZGVA 3KEMA 1Z8FA 4JSRA 1PHPA 3OLQA 1LTKA 1FSZA 1BFDA 1WOYA 2JHAA 3KUUA 3DL2A 1V4NA 4A1FA 1LPSA 1M72A 4M9XA 4OQDA 5DX1A 1SU4A 3TSZA 4BJ6A 4EX7A 1T2AA 3OETA 4R83A 4GKAA 4KMRA 4BFSA 2QI9C 1Y5LA 4BQNA 2IBTA 3QXHA 5FWDA 1OGIA 3ODGA 4D2IA 1N6NA 2EARA 5BN5B 3PIIA 2QN8A 2V0CA 3CLVA 3FWKA 4D8TA 3CKLA 2WM3A 2BELA 3RBVA 1MX3A 5FQNA 2I2AA 1GPLA 3KKNA 2AOVA 3QOWA 4YRJA 2C98A 1J22A 2BBSA 5LXTB 3KXIA 1F7UA 1DO0A 2XCTB 1FRZA 2QU8A 3B48A 3K70C 3K4QA 2HTEA 3WOVA 4POOA 1KFBB 1QIGA 2AOTA 2H18A 4D3YA 2UVPB 1VYUA 2QE6A 3K0AB 4UEKA 4DREA 1CIVA 1R0RE 2XKJE 1QMGA 2Q6LA 4CCSA 3HJFA 2P7IA 4M8IA 3WI7A 3TVDA 1TFUA 3AH8A 4DNOA 1O6GA 1TUBB 2IYUA 3HFGA 1GDHA 4M0MA 5EJ4A 5TS3A 2HQOA 3IB3A 4ZVUA 3CPSA 4RK0A 1P2DA 2VWGA 4FE4A 1QZ3A 2N47A 3KQYA 4YNBA 1WDWB 4MRRA 3HP7A 3GOHA 1XC7A 4KN9S 4JLJA 3HJAA 1XEAA 1EI9A 4L8VA 4H31A 2BFDB 2EYUA 4O4HF 1G20B 3BE6A 4LC1A 3MCZA 2B34A 1GTG1 3FPAA 4RVUA 4HYTA 5TMPA 3T3OA 4NZPA 5KPJA 4RVOA 2WWTA 4MI6A 1W6RA 1I1QB 2PQ2A 4LX8A 2IS6A 1EUCA 4PLYA 4DJFC 3IV6A 1NXQA 4N3BA 4UTRA 3KPWA 3UH0A 1Z28A 2E4WA 2GJSA 1US8A 3VZCA 3RC1A 2NVWA 3RRYA 4DSOA 3UMGA 5L6LB 1IUKA 4KI7A 1JSXA 2W2LA 2WMDA 2CLHB 3DMDA 3OE4A 3RK0A 2FE4A 4RE6A 1TJPB 1RI5A 3RS2A 4BVJA 1U0HC 3GAFA 5FNVF 4C7VA 5A4JA 3LO5A 4MVYA 5I4BA 4OHWA 3JQ7B 5ETJA 4ESVA 2IUEA 1GRCA 4QHTA 2IA5A 5LMNB 1H23A 1CERA 3U0VA 5CA1B 3EULA 3CWCA 2XVYA 5ECGC 4YALA 1TYZA 3HA3A 2WAAA 1Y8ZA 2ZPUA 1SUSA 4QUIA 2W2LD 3DMGA 3PC4A 2VF8A 2V5AA 3NS7A 5KDDA 1A8UA 1KI6A 4HK4A 1NHGA 4D97A 4LFBB 2CW5A 5BSHA 1OFGA 5ABPA 3SE7A 4IZHA 4LY3A 3OWXA 1GZDA 4KR9A 1RIFA 3NVMB 3UAYA 3DEYX 2D5CA 1JIXA 3W1VA 2I7CA 1F7VA 1FYVA 4NEHB 4BJ5A 3S68A 1M6VB 1CLUA 1N9GB 2ZVQX 3OJEA 1Z4QA 4UCXA 4EI8A 2GYYA 4K9QA 4QYMA 3PEYA 1VIDA 2Q5HA 1R6XA 1TF7A 2OESA 3THRA 4C3UA 3FPSA 2B8EA 4Z0NA 1ABFA 3VV2A 4CI9A 2ZU6A 2ZWVA 4N18A 2VVTA 3OOWA 3ZKWB 1K8ZB 3PQ8A 521PA 3I9OA 4HPWA 3ZHUA 4W5TA 1ND6A 3UFXA 4OHFA 4P82A 1J1ZA 3C4QA 3CZPA 3MJCA 3TH5A 3GPLA 3KOWA 1A8IA 1Z63A 4IQ8A 3N8HA 5E9AA 4QDTA 1EIWA 4CT4B 3TW8B 3ZJ5A 1H9AA 1DXHA 1CY2A 1RW4A 2BGUA 5DTIA 5TDHA 4ZYXA 2X41A 2VYCA 3ZTYA 5HMLA 4A6EA 2CEKA 1LDNA 3RU2A 1L7OA 1VGVA 3FDXA 5BYKA 4MPDA 1UAAA 1TC2A 1R5NA 4R16A 1FYWA 4OU5A 3SKYA 2R79A 1SCNE 4J0IA 1I13A 2FW1A 4GWKA 4OMFG 2QM3A 5AQ1A 1H6DA 5CM9C 2B99A 2HF9A 5C4GB 7MHTA 5IANA 5SYAA 3C6BA 4HFNA 4IEIA 3ZCXA 1DJOA 1DINA 3ZV7A 5FO1A 5M5BA 4MUYA 4OA8A 2PXXA 1PW7A 5MN4A 1W30A 1Y1RA 3C5VA 2PKRA 1ZXLA 1WUKS 3OCZA 1J24A 1F8YA 3U3OA 5EG5A 4YONB 1ENPA 5AW2A 1GFZA 4UD2A 5HJ5A 1WBDA 2QZJA 3Q4GA 4U2DA 1D2GA 1P1IA 1L8AA 1R37A 2X5XA 3E7FA 3L2OB 4Q01A 4E3ZA 4AX8A 4FHCA 5HEKA 1KJYA 1PJQA 2FW8A 4CNBA 1GGNA 1ODLA 1OU0A 2FDXA 1RHMA 4OJMX 3TOXA 2JCBA 5B58T 3PYMA 3ET4A 3S1AB 4GXQA 1E2FA 3RS7A 1VKRA 5CITA 4WUTA 2HRQA 2FWAA 1ETHA 2AUMA 2COKA 2GGSA 2QAJA 1QQ5A 4MMYB 3T5BA 4BO0A 2YCBA 5KOYA 4UM7A 3LQ4A 1R66A 1REQA 2O3TA 1EX1A 2G3YA 5K0GA 3KFLA 3KQVA 3TRFA 1DPGA 3OLXA 4LMRA 5E95A 5BWCA 3DLHA 1BS9A 2ANBA 3LUGA 4IIBA 4MS4B 3BTOA 4GS5A 4LTNA 2D59A 3V7NA 4DLNA 1LGYA 4KRFA 1PKEA 1XD2A 2V6IA 5LJLA 3ZD6A 3ZWDA 2I2BA 2VZ0A 3BS4A 3CZ4A 3EEYA 1L5FA 3I3OA 4TYYA 3UICA 4YCNA 3FUCA 4BYGA 4B87A 1AG9A 1ELOA 2BM9A 2C7GA 3B78A 3EQ8A 1FJ2A 4IJVA 2LE0A 4ER3A 1D7OA 4MICA 4QXQA 5CAEB 2NAFA 1P0IA 1DTEA 5B36A 4OYYA 2NO6A 3TVTA 1JHZA 1ECGA 2Q3DA 3AVPA 1HT3A 1FJGB 1OREA 3JD2A 3ZHQA 1TEXA 2ZP1A 3QVLA 4ENPA 3N86A 5JRZA 4E5VA 4RHUA 5GONA 4JT9A 2O8BB 4BS9A 4XQEA 2J9RA 2IC5A 3KTAB 5HQ3B 5A6VA 4OLBA 2XZOA 1OWLA 2FP3A 2OV6A 3BWBA 3V4OA 1QHNA 2WG0A 3ID6C 1JHVA 1YIDA 2DULA 4LV8B 3JVDA 5K9ZA 5LYJF 1EB9A 5EHGA 1MQSA 1TEVA 1YR6A 4K6HA 1YDEA 3FWYA 4JXXA 2D0IA 1VOTA 1D6NA 2ZEJA 3DBOB 3HBMA 3L4BC 4PYNA 5BWBA 1AN0A 2CHEA 4I1RA 3H4IA 1WKVA 3M6XA 2H1OA 4Q19A 4FLMA 4WK4B 1M34E 1Y6JA 1HE2A 3P26A 5DCLA 2QX4A 2YMLA 1NJSA 2QW8A 1XPJA 1U0EA 1GFWA 4NH4A 1SJ9A 4YGXB 4HDMB 2JI6A 4C08A 4C89A 3GAMA 1MVLA 1E5QA 1B6GA 3AKDA 3L4BA 4QBHA 3BWCA 4X8MA 2C5LA 5HGJA 4AZ3B 2G9NA 3PQDA 2EWVA 2WBLC 3GEEA 3HUEA 1TZJA 3DTNA 3I53A 3OT4A 4Y1EA 3F2IA 2GAAA 3G89A 4Z86A 2GQ0A 2FFBA 3CIOA 1FQOA 4PSUA 1RRCA 1SG9A 3NHBA 4I50B 4LYFA 4TT3D 3VMFA 3P7MA 5DOZA 3ZWXA 1NX9A 4A2WA 5JI3E 2WVGA 3LTEA 1QORA 1HUQA 2WY2D 2Y1GA 5BYJA 3VSBA 2MSWA