2G77B

Crystal structure of gyp1 tbc domain in complex with rab33 gtpase bound to gdp and alf3
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
173
structure length
173
Chain Sequence
RSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase activator/protein transport
molecule keywords GTPase-activating protein GYP1
publication title TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 52
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2g77B00
3KKQA 1A4RA 4JJZA 5KYKA 1XZPA 4AG5A 2DFLA 2CEAA 3KB2A 2D74A 1QVAA 2NZ8A 3PEUA 1ZVQA 4KBGA 5F9FA 1XRJA 2RB4A 3NBYC 1L4YA 2QENA 3TH5A 3NKVA 4A4DA 4A1FA 3MRSA 4TL9A 4MKFA 4BLRA 4C0KA 4IOJA 1GITA 2PMKA 5HCNA 3EPHA 1WA5A 2B7BA 4IKEA 4RZ2A 1J8MF 1GIAA 4OI0A 5FOSA 1CU1A 1OW3B 2H57A 4DHEA 1G18A 3DHWC 1ONBA 1ETUA 3AQ4A 1YE8A 4IXMA 2CHGA 2EQBA 4EPXA 3Q5DA 1DTSA 2JJ8A 2MMCA 3A1UA 4QBIA 1FPMA 1DG1G 1NMZA 2XOKD 4QG7A 1VHLA 4BLOA 1Z0DA 3DO6A 4NCKA 4C7OB 4B73A 3R7WB 1E98A 2ZJBA 4TN1A 1MO4A 1JPNA 2ZYVX 2W58A 2VPPA 1HTWA 1N3BA 3GJ4A 3T61A 2Q6TA 1BMFD 2VBCA 5ANRB 4M53A 2YHSA 2G9NA 4MDEA 2PMDA 1UADA 1Z6AA 4PHHA 4ACAA 1YZTA 2GA8A 1SVOA 3DL0A 3AUXA 1SXJE 3QXJA 2FPMA 4DKXA 2HEIA 2OEPA 4F38A 1XMSA 4JKYA 5CDFA 4ZO4A 4PTLA 2ZRLA 3TVTA 1VCNA 1GKUB 1U0HC 4RKEA 2AFIE 2CNWA 3ZDQA 4OQXA 3FFBA 2G0TA 5AUOB 1GOTA 1HA3A 3NC1C 1DAFA 4BECA 5JJLA 4OHZA 1AZSC 5TVKA 3CF0A 1W4BA 4LBZA 1P9WA 2DHRA 3UG7A 1G3QA 1G8YA 3QUSA 4BASA 5KOYA 1KI4A 4GRAA 4ZDJA 4F91B 4JBWA 3PEYA 1TX4B 2EYUA 2OUKA 3A1SA 1E9AA 4QGHA 4D4JA 4FCTA 4M4SA 2VSXA 4Q9IA 3CLVA 2O8EA 2W6ID 1NLZA 4TMVA 3TAHA 2J9RA 1A2BA 4TYPA 2ZEJA 4DLWA 5LD2C 1AIPA 4PAMA 2BDTA 5CLQA 3CRW1 4QOSA 4LHXA 5C2JB 1HT2E 1NVVR 3B85A 1G8FA 1ZP6A 1F5NA 3ICQB 2H92A 1OPXA 1Q3HA 3NEYA 2Z0MA 3Q85A 4UNQA 2QGNA 3RWOA 2QEQA 1VHTA 1OIVA 3S1AB 3I8SA 1LTQA 4JLAA 4TL6A 3MLEA 5KSZA 3UWOA 1YRBA 4N0DA 3EZFA 1OF1A 2TMKA 1KK2A 1CIPA 4KFUA 4RCZA 1TF5A 2G1KA 3FMPB 4Z1MA 3DKPA 2WOJA 3AF4A 1H8EA 5E7JA 5JJKA 3I32A 5DN6D 1M34E 5CB8A 4JBXA 4NYIR 3GLHA 1E2GA 3LWNA 4YDHB 5DGXA 4IVPA 1NIJA 1W2HA 2CCGA 2BJVA 1CKEA 1GL7A 2FZLA 2WWFA 1QRAA 2WWGA 4KLZA 5LB4A 1XPOA 2IS4A 3P4YA 1N6LA 4RD1A 1VPLA 3QIAA 1FUKA 5DHFA 4BFVA 2ZU6A 2XNDD 1RVDA 1ZUNB 5BQ5A 1Q1EA 4Q1EA 2JCSA 2Q3FA 2AKYA 4EJSA 3T1QA 4ZDWA 4YONB 2ZRGA 1S96A 2XAUA 1VG8A 3MJRA 1E2KA 2ONKA 1Z2CA 4W5WA 3THOA 4JS0A 1MR3F 3AUYA 1KSJA 3I3SR 3UPUA 4JVNA 2O8EB 4TLCA 4UNPA 1P73A 1P2SA 2WJGA 3RRMA 5E7IA 2BMDA 2EFGA 1Z0FA 4TMKA 2NO1A 4C0LA 3K9NA 1NSTA 1JPJA 4HAXA 2FF7A 2QL6A 4LJ7A 1CLUA 5DO9A 1E2MA 2LKCA 4MA4A 3BFKA 4BFWA 2V6IA 4LI0A 2P5SA 3BH7A 5FTJA 1U8AA 4KLNA 4GZLA 3M0EA 3OFND 1EX6A 1W0KA 4FWIB 1UEJA 3WYGA 3LBNA 4ILEA 3WRYC 2QT0A 4UQOA 1CULC 2BCGY 5D3MA 3KQKA 3BH6A 2ZANA 2DWQA 2H18A 2WSMA 2ZJ2A 4GI7A 4W7SA 3GLHB 3I1FA 4XWKA 1VDZA 1FFHA 1E0JA 1WP9A 4MYCA 3LY5A 4RKFA 4OK6A 1IOZA 3BFXA 4X8MA 1WB9A 1N6KA 4H1UA 4A8JA 5J4VA 4Q9KA 1TTTA 4MYUA 3X1YA 2RH5A 4DRZA 3DZ8A 3WMGA 1RRCA 3K0AA 3VX3A 5EE1A 4Q18A 4D25A 4DB2A 1E69A 3WMEA 4FD2A 4YMUA 5TXGA 1Q0UA 1IAQA 1ZNYA 4I1SA 1V43A 2D2FA 4TLAA 3BK7A 3T15A 4EJSB 3K9HA 2AWNA 5CM9C 4NTZA 4Q9HA 1M7BA 2QAJA 4JLNA 2OV2A 4XJXA 2V6JA 4OBEA 3GEHA 5IK2D 3KXIA 5C46F 1QHNA 1QG4A 4II7A 2D7CA 1X6VA 2W00A 2DB3A 3I92A 3RABA 5DYIA 4DLXA 3IHWA 4BZQA 3TR0A 1W46A 3V4FA 1W4RA 1M1YE 3BD9A 4PC7A 4OK5A 2J41A 3SNHA 3TW4A 2OBLA 3T5DA 4Q00A 4EPRA 5JEDA 3QXSA 4E5UA 3NBZC 1RRGA 2D06A 4TTPA 1VG9B 5G3YA 2JJ1A 1M2OB 2A9KA 5DSZA 4EKDA 1NY5A 2QORA 1E1QA 5TARA 4DLVA 3X1XA 2ODNA 4DSOA 2J5XA 1Q12A 1W5SA 2VP4A 3ZZUA 3QBTA 4PANA 1YR6A 1GG2A 1ZM2A 2R62A 1J99A 2P6UA 2Q21A 3CRRA 3LDAA 1XCGB 4DT1A 3X1DA 3U5ZB 3H2YA 4A0RA 3SJBA 4F92B 5EXTA 2BM1A 4A8JB 2BIFA 4MGZR 4ASUA 5EJEA 4XD7A 4BRWA 2MSEB 2RGXA 3QG5A 1WRBA 3IEUA 2ERYA 3OF5A 4QRHA 5DI9A 3DM9B 4HAVA 4HDOB 3P1JA 1EFRD 4N3NA 3KL4A 5E3HA 5HR5A 5KSPA 3KQLA 3TQCA 3GJ6A 2C78A 4A92A 2VP2A 1T5IA 3WYFA 1M8PA 3Q3JB 1OIWA 1DVRA 4KU4A 4PPFA 4NYMQ 1ZYUA 5CYPA 1E79A 1X8JA 4B71A 1UJ2A 1Z08A 2IYSA 1RC8A 3HU1A 4MKGA 1RRFA 3AGPA 1FUUA 3BOSA 3IO5A 1IN8A 2PZFA 4F4CA 4BFZA 1UBFA 4QJ4A 1OJLA 1RIFA 2YWEA 3A1WA 2ASEA 3BERA 2VTKA 5JI3E 4AWXA 1AQYA 4EPYA 2JDID 4P4TA 4DCSA 1YU9A 2GILA 3FYHA 4TZ6A 1NVWQ 5HE9A 4DUGA 4Q47A 4XIGS 2H7VA 4HDCA 3QOFA 3REFA 2IEYA 1HY3A 2N1BA 3IGFA 2ZVPX 3KJGA 1P9RA 2EFCB 3KDSE 3EIHA 1J90A 1AA9A 3M4YA 4RZ3A 4ZV4A 5KPJA 1E9CA 2C2HA 2ZR7A 2R6AA 4L8GA 1MH1A 4JBYA 4JLVA 421PA 2Q0HA 1G64A 4C2TA 1L7VC 2FFQA 2HLDA 2WKPA 5GJVC 3NWJA 4DT1B 3U44A 3W9YA 5IT5A 3GD7A 4KCGA 3FDIA 5CM8B 3U3JA 3SYKA 2ZJAA 3QEJA 4M1KA 3IBYA 4BFYA 2V7QA 1C9KA 1W5TA 4UKDA 2HF8A 3P32A 3GLGA 2ZAOA 4E09A 4D82A 2I3BA 4DCUA 1XNJA 2JATA 4M1MA 1FQKA 4F7WA 2WAYA 2ZUCA 4URWR 4V0MA 3FFAA 3C4JA 3KZ1E 1T5LA 2ZYWX 4A2WA 4EJSC 3SBDA 3VHXA 1IN6A 5FBQB 2PCLA 1OSNA 4B6EA 4LHWA 4EFLA 1JBKA 1NBMA 4EDHA 1OT3A 1JR3A 4MDFA 2VA8A 2YWHA 3ONWA 5B57C 1DG3A 4I1OA 1NIPA 1LB1B 2ZSFA 4TMWA 4B32A 3PIRA 2F7SA 4WIAA 1ZBDA 1Q57A 2Z83A 3BRWD 1NN3A 1E2FA 4LUCA 4DCTA 5SZHB 4DDUA 1BH2A 1XCMA 1XD9A 2CNWD 4AKIA 4ZCIA 2C03A 1ZNXA 3EAQA 2JLUA 3TSOA 2YVUA 1KAGA 4B75A 3GMTA 3C16C 1JQJC 2GJAA 1OFUX 2ERXA 3EPKA 4TMZA 2B92A 1RFLA 5FOTA 3A1TA 2C77A 3NXSA 1R7RA 2V4ZA 5HTKA 4Q66C 3GLFA 4LJ5A 4NZYA 1Z47A 2NTYC 5FBRB 3LBHA 4RD6A 1Z6XA 3RSOA 5E4FA 1MV5A 3C15C 1QVRA 1MO3A 3U44B 4OI4A 4CRWB 3KQHA 1E2PA 1KMHA 1QHHA 4Q03A 2GEVA 4FMDF 4TMTA 3VKHA 1AJEA 1DO0A 1N6IA 4M1YA 2IYVA 2WHXA 4DLTA 2FFAA 4AI6A 2CE7A 4A8JC 3AH8A 3TW8B 4DLRA 4LSGA 2AKAB 2H5EA 5FOWA 3GLGB 1V5WA 1FX0A 3DZDA 2O52A 2ZI5A 3HDTA 4WZAE 4PSVA 4Z1MD 2XB2A 3KQNA 3QBVA 1SVKA 1RJ9A 2VHTA 2QPTA 2IUUA 3GCGA 4XWOA 1FW6A 1H8ED 3W6PA 1QHGA 1C4OA 5A4JA 4ACBA 2PEYA 1N5LA 2R9VA 4PR0A 1IQPA 3AP2A 1B0UA 3QKRA 3MG9A 4FIDA 3DDCA 4IEIA 5BYKA 3JZAA 1E4VA 3AP3A 2GK6A 2QA5A 3SJAA 5KNBA 2OXCA 3IQWA 4P4UA 2VP9A 3PV0A 2RKOA 4A9AA 1E94E 1GKYA 1ZD1A 4PPQA 4QJ5A 2B7CA 1XJ0A 2G88A 2QN6A 4ZKDA 5BN3A 1Z8FA 3Q8XB 1E9EA 3VR6A 2ZR9A 3IEVA 1NKTA 4JSTA 2ZSDA 4KI0A 5FR1A 2E87A 3SOPA 1XP8A 2ZYTX 4RZXA 1COWA 1LF5A 3FMFA 4OK3A 5EP2A 3DOFA 4BGDA 3LRPA 3AF2A 1E9RA 2FU5C 2ZE5A 4LV6A 3LLUA 1N6HA 4E03A 3U4QA 2IC5A 1OH7A 2A2ZA 3UMRA 2GAOA 3KB1A 1QHYA 2ZSEA 4ZKEA 4PAQA 3VTKA 2FSFA 4AKHA 1JAHA 3EXAA 1DADA 3KX2A 2PEZA 1KTVA 2X2EA 1SKYE 3GLFB 2XITA 1OHHA 1G21E 4QGAA 4EIWA 4CEHA 1I2DA 3EWAA 1SULA 2IYYA 2B6HA 1UM8A 5J40A 5F98A 1GWNA 1N5JA 5K8UA 1KMHB 1QHHB 2Q9BA 4D81A 5JZVA 4KHZA 1XEWX 1O3YA 2P67A 1BS1A 2ZE8A 1GZSA 4ABYA 4R9UC 5CK5A 4EPVA 5JBQA 1FX0B 4V0OA 1DAIA 4PQRA 3PR1A 4OQLA 5JWRA 3L2OB 1RJ9B 1W0KD 4JMPA 4JL5A 3MUFA 2CK3A 2AX4A 4O2RA 1T3HA 4AD8A 3K70B 2P6NA 3LAWA 4QHTA 2OO7A 5HKKA 1P72A 1CR4A 2O8CA 2JLSA 4ZDIA 1E6CA 1E0SA 2PCJA 3TGPA 3GJ5A 4ZIRA 3K1JA 3ICEA 1GL9B 2DFKB 2BEKA 5EXXA 4BFXA 1R10A 1OFHA 2QT1A 2YOHA 4LJ4A 3CNLA 3QKSA 1OYYA 4LHVA 2V55B 3GJ3A 3CM0A 3BBPA 1TQ2A 2ZUBA 1FP7A 5DIFA 4E22A 3C8UA 3ETLA 2QI9C 2QP4A 1G1MA 3U60B 3IO3A 3D3QA 1DS6A 3NVAA 3B8HA 2ZPTX 4V0LA 2CL7X 4HUQA 3D7MA 4B6FA 3U4QB 2CXXA 2V54A 4DEXA 1R0YA 4CZ2A 1OKKA 4C0JA 4KBFA 2V8OA 2J87A 3VR4A 5FPHA 5G53C 1NLYA 3CO5A 1MRNA 1PLLA 1E9BA 2FSGA 4IVQA 2CHVA 1EFUA 4CEHB 3FE2A 3LVRE 2QRZA 5IDVA 4LJAA 5CJ2A 2ZUDA 3L0OA 4IJMA 2ZI9A 1AM4D 2IBMA 4HAWA 4URZR 1G17A 4Z51A 1X8KA 2Z4SA 3Q72A 4P3YA 4Z54A 2QM7A 4HAYA 1DBSA 1VECA 1YVDA 1Q3TA 4PHTA 4DWJA 2A30A 2ZRMA 4EFMA 3O47A 2IS6A 4GBMA 2Q9CA 2JJ1D 2OE2A 1OLOA 4Q4AA 2EYQA 2ANBA 3JZMA 4BZXA 1E1QD 5CDFE 2FX3A 2NPIA 5KSOA 1YQTA 3E2IA 4ARZA 3LX5A 3BJIC 2ATXA 4FWTA 3TIFA 4MRSA 3TSWA 4FMBB 1RRPA 4LC0A 2IYQA 2IK8A 3KKPA 4QC2A 5SZIA 2ORIA 1ZNZA 2W2TA 2O8CB 4KFTA 3LA6A 2P6RA 1A7JA 3MAAC 2OCYC 5EXPA 4ASUD 4XD7D 3QSYA 2QMEA 2E1RA 3QE0A 3QKSB 3WP0A 3AVTA 1EK0A 1N6OA 4M1TA 2GAAA 4US0R 2CL0X 3OIVA 1Z28A 1OB2A 1PLJA 5KSYA 1KO5A 3B13B 4PQFA 4POAA 5EZ5A 3A1VA 3B1ZA 1S4QA 4A6PA 4NL4H 4DSTA 1JNYA 1IN5A 4HUQB 5H8WA 1G20E 5FFMA 2QSZA 4TL8A 1FMJA 1E79D 2OG2A 4AK9A 4PSAA 3RDPA 1XDBA 1WQ1R 2ZRIA 4B47A 4A15A 1TAGA 1F60A 4DVGA 3I8XA 4ON9A 2VIIA 2B8WA 2VRWA 2O5VA 5KUTA 1PJRA 2NMVA 1ZUIA 3K0EA 4PHFA 3IBGA 3L8YA 4C0QC 2LWIA 2FN4A 1LY1A 1KDTA 5FL7A 2GBLA 1II8A 1XBTA 3AVVA 3WRXC 3B9QA 1ZMXA 3EW9A 4XTCS 2IT1A 4HSEA 4HLDA 2CVHA 4O3MA 2IA5A 1X86B 5JHHB 2ANCA 2V1UA 1RPZA 4EPTA 4DUGD 3TE6A 3C14C 1SQ5A 1LS6A 2GVDC 4Q4AB 3QXHA 1NVXQ 3BGWA 1VIAA 4R98A 2J7KA 5AJVB 2BVNA 4ARZB 1DELA 4X8HA 1KGDA 5M04A 3U3MA 1XU4A 1TU4A 1IHUA 1ZC4A 1ZM4A 1LFDB 2HLDD 2LKDA 4B2IA 1P4SA 3K0FA 4C0BA 2ATVA 4GT1A 3K0SA 3LW8A 3K70C 3DEFA 4B43A 4YMSA 3H86A 3N5CA 4KAXA 721PA 4JYBA 1W48A 3VHLB 4ZPXA 1CTQA 1KI8A 3H4MA 1JEEA 3OAAA 1PVOA 1PUJA 1AGPA 2E9SA 2V7QD 2YWFA 1JJ7A 4Q7MB 2ODEA 4AYTA 3RNLA 4PC6A 1NNEA 5JS7A 1W2GA 2O0JA 3EA5A 4DZZA 1KNQA 2ZITA 1WBDA 5FH9A 4XH9B 4AIIA 3SYLA 1WF3A 1VMAA 3V00A 1N5KA 1U2RA 2R2AA 4YDSA 2QUZA 4I1VA 5L3VA 3U61B 2GRJA 2F3TA 3R9XA 2MMGA 2VP6A 2D7DA 1S3SA 1B23P 1NBMD 4WAUA 4XSGA 1JR3D 1NMYA 1TU3A 2IW3A 4G0NA 4LK2A 2PL3A 5FPTA 1TQ6A 2QPOA 2JLZA 4M1WA 1II8B 2ZRNA 3TRFA 5JS8A 1LW7A 3K53A 4HDQB 2NPFA 4RD2A 4Z8YA 5FOXA 2PZGA 3AP1A 3ZIAA 3ZZTA 3THWA 2P2LA 3CX6A 4WZ6A 3FTQA 2J45A 4RZUA 1XMVA 4URUR 5TB5A 3R9IA 1KSFX 1T0HB 2VP5A 4DIEA 2QE7A 2Z5FA 5FUYA 4M9ZA 1KI9A 3B1WA 3WMFA 1YZQA 2ZRHA 3B1YA 3K9LA 5EE3A 2OBMA 5KO2A 5FOVA 1P2VA 4M21A 1RW4A 4LJ9A 3FPAA 2ZIAA 4A82A 2GZHA 2IYUA 2UZIR 5HE8A 3HU2A 1R0WA 2AXPA 3K0FB 3WBKA 1DAEA 3OEEA 1SHZA 3DVLA 4TT3D 4B35A 5J4KA 5KPDA 1ZIPA 4G5SA 4J0QA 4Q48A 2BKEA 5FBLB 1QDEA 4PC1A 4UXJA 4P4SA 1NI3A 2QMOA 1A1VA 2G3YA 2R6CA 1P7CA 2A3RA 2P5TB 4L9WA 3RVBA 3VKGA 3CB4A 4MRPA 3G82C 3L43A 3FGNA 3GJXC 2NOAA 1YR9A 1SXJA 2NZJA 3CKLA 5CJPA 2D4HA 1VCMA 3K70D 2VL7A 1HURA 3UK6A 3H84A 1BYIA 1GDDA 2DBYA 4JLDA 3EZ9A 1ESMA 2H17A 5EUMA 1KI7A 3B78A 3NBXX 3R20A 5EP3A 1XPRA 4Q7KA 4AKEA 1Q22A 4DDVA 2QQ0A 4RFVA 4I99A 4M22A 2IUTA 3U3KA 2G77B 4X8LA 5CB6A 2BM0A 2C9OA 2ZRKA 1O87A 3DM5A 1A5TA 2NO6A 1A82A 4Y0VA 2KB0A 4GOKA 3N2IA 1W1WA 5TDHA 4AC9A 4UXIA 1F2TA 1COWD 1XTQA 1SVSA 2XXAA 3THWB 2AK2A 1DAGA 4A2QA 3EWSA 1OXVA 1M7GA 2HCBA 1E32A 4N1AA 1P60A 4BFUA 3ZVMA 3O8RA 1W4CA 3MMPA 2BBTA 5TY0A 3KKNA 1H65A 3R8FA 3Q7PA 4HEJA 3ZJYA 4IDNA 1OHHD 1X1RA 3VU9A 2EFEB 1YR8A 1ZNWA 4ERNA 4BFSA 1LS1A 1KZGB 4M9SA 1G3MA 3ASYA 2HYIC 3UATA 3ZVNA 1JB1A 1T3LA 4NYJQ 2X2FA 3ZD6A 3K8YA 3CR7A 5FOUA 2YJTD 4QHSA 1HYQA 4HAUA 1F48A 3KJEA 5FTMA 2HT1A 2XZPA 4NCJA 4V0NA 3RC8A 2VEDA 2ZI3A 1T8TA 4P4SB 3R8CA 4DLSA 2CJWA 4ZI2A 4BLTA 3NG1A 1CRPA 1D5CA 2DYKA 3MWLA 4Q1AA 4PAOA 4R71A 3OE7A 4BFTA 4LX0A 2D3WA 4A2PA 3U7HB 4L5BA 4B3FX 1SXJB 5EXSA 2CK3D 4XWAA 3SFVA 4US2R 3L0IB 2GNOA 4OL0A 3AKYA 4HZIA 3KUDA 2Z6VA 4AKGA 3UWKA 1CR2A 1SHKA 5HKKD 3PUZA 2W0MA 4FW9A 4NYMR 3MJHA 2IX3A 3NHAA 3ADBA 3C5HA 821PA 2OBNA 3CH4B 2F3RA 4A0GA 1CR1A 1P6XA 2OM2A 2QTVB 3QQ5A 1ZU5A 3TVDA 3EX7C 1AS0A 1L2TA 2AR7A 5D3MB 1W0JA 2VF7A 4B76A 1F2TB 1E0KA 1GRQA 2CDNA 2GBLC 2MSDB 1N6NA 2WJYA 3CNOA 4PPGA 2XXAB 3RRZA 5DNYB 4U02A 1WDTA 2FPLA 4D6PA 2FDCA 3GLGE 1OXXK 1Z6YA 1OKKD 3G0HA 3L82B 5BYJA 1QZXA 2GJ8A 2OFOA 1NKSA 1QHXA 2CVFA 4PZZA 4C0SA 3NEJA 3ZZ0A 3K0AB 5HZHA 4V0ME 3VU9B 4LCBA 2HUPA 4LBVA 4C4PA 5B58C 3VR5A 3AVQA 1P61B 3AVOA 1CXZA 3PCRB 1U8ZA 1NJGA 2HXYA 3I73A 5AJWA 4KFRA 4TQAA 3U2QA 2WBLC 4JL6A 3UMFA 4Q4LA 4B44A 4YQFA 4HI0E 3KJIA 2BKUA 1XTSA 5F2EA 3AF3A 4CEIA 5DI3A 2HV8A 5G41A 3TR5A 2HCJB 3ZD7A 2FFHA 3C5CA 1G4AE 4JLJA 4OQNA 3AVUA 4XVUA 1CEEA 1D2NA 1U0LA 2WSSA 3ADKA 1JAIA 4BEJA 3EZ7A 1OYWA 5JSZA 4HLCA 2ZS8A 1KI2A 4QGFA 4AURA 3V4RA 3OIUA 3DOEA 3PVSA 4K81B 1W36B 5J5CA 1OXTA 1OH6A 1GKIA 4O2LA 1KDRA 1J2JA 3FMOB 2ZI4A 4G5OA 3W8RA 1PZNA 4KO8A 4Z8XA 5SZKB 1W49A 2GTPA 1R8SA 4RD3A 1KYIA 4QGGA 5JECA 3ADCA 3AVWA 5GJWC 3O8CA 4JL8A 2JAQA 2HF9A 4MYHA 5A5GA 5J4LA 1TEVA 3F0TA 5LPNA 3ZQ6A 3GLFE 3U3OA 2IXFA 5JFGA 2C9CA 4M9XA 4HB4A 3SZRA 2ZRDA 2RMKA 1XPUA 1E4YA 1ESNA 4LDJA 1Z0KA 2ZRCA 3C7KA 1HUQA 2OLJA 3F3YA 3QVUA 1A2KC 1KY2A 2YYZA 3MWJA 5FPKA 4XVRA 4URYR 4UNSA 5DH9A 3CH5A 1XB2A 3DKVA 4WXPA 2IYTA 3SC3A 3O8DA 2CLSA 3ZYCA 3VFDA 2FGJA 2XJ4A 5G3ZA 3FKQA 1XEXA 1N6RA 1NSFA 5KNDA 1XX6A 2X19A 2FG5A 2YWGA 3OIYA 3C41J 2I1VB 2DCUA 1M6NA 3IPXA 1YJ5A 1AN0A 2FFBA 3AEZA 4W5HA 2IYZA 3K09A 4G5RA 4KVGA 1YZKA 5FL7D 4TTQA 4TYYA 3GLIE 1DE0A 2DFNA 5DI3B 3TBKA 5JMTA 5EE5B 5BN4A 1G7TA 3PFIA 3CF2A 2UKDA 5C1BA 1DPFA 4Q9JA 4IDHA 1TPZA 2H1LA 4Q1BA 1GRRA 5AJXA 2VSOA 3GPLA 5JSZB 4OHYA 1E2HA 1AQUA 3SYNA 2BV3A 2N46A 4CF7A 4LV5B 3GFPA 3VKWA 1KDPA 2VQSA 2XJ9A 1I4LD 2H8KA 2FSHA 4KV9A 3EPJA 4JT4A 1ANKA 4IFEA 3PEWA 2ZI6A 2A5GA 2J0SA 1EG7A 2GZDA 3TMKA 2QAGA 4IEEA 1U90A 1KOFA 3L0PA 1F2UA 4IOKA 2PT5A 2REBA 4OJQA 3UANA 1N0WA 2C95A 2XEXA 4CEJA 2IWRA 4W9MC 2ZVQX 1GNRA 2XSZA 4M1OA 4M1SA 1LNZA 2FEMA 3PUVA 4QNRA 2O0HA 4GNKA 4P33A 3TLXA 3ECCA 3OAAD 2PX3A 5BW8A 1BOFA 3B2EA 4G5GA 3RRYA 1Z07A 2KBFA 2ZAMA 4LY6A 4Q1FA 1K8RA 3GFTA 2ZSAA 3SHWA 4DLYA 4U7DA 5P21A 3LVQE 3GEEA 4WBSA 2JLRA 1I4DD 2ZM5A 2VF8A 2I4IA 4WVFA 2HYDA 3WYAA 4QKQA 4F93B 2VSFA 2CCJA 4HB2A 2ZS7A 5J4HA 1AZTA 2HT6A 6Q21A 2ZRAA 1OFIA 2JLYA 1XEXB 3W34A 2XB4A 1SVMA 1KJYA 5JWOA 1WMSA 2KWIA 3MFYA 3PQCA 4BLSA 2ZETA 2GF0A 1QG2A 4JLBA 1G3IA 1D6JA 2IXGA 4R2HA 5FL3A 3B1XA 3T12A 4JKIA 1ODFA 2D62A 3SEAA 2GHIA 3PENA 1L8QA 4TYQA 1D2EA 4D26A 1G291 2IEZA 2DY1A 2VP0A 2X8AA 4LYHA 3SJZA 3SFZA 1BIFA 2QMUA 2PJRA 1UAAA 1E2DA 1P9NA 3QEOA 1Q21A 4OYHA 2WMOB 4RY2A 3ZIAD 1S9HA 4EPWA 3BB3A 5EUQB 3ZVRA 3GJ7A 2CHQA 3AVPA 4CDGA 5DE3A 2FEOA 1MO5A 4U00A 3T1OA 2JJ2A 2QE7D 4A36A 1OXUA 4JLKA 2AL7A 3RHFA 3KUCA 1D9ZA 2ZS9A 4C0HA 4B2LA 1SKQA 4QBGB 1KO8A 3W8NA 2IL1A 3SE0A 3U7FB 5HZKA 3QXXA 3AKDA 3K9GA 1P2UA 1IN4A 2N42A 2ZJ8A 2QAGB 4Q1CA 3WXMA 5FTKA 1F2UB 3OEED 3W5JA 4B2PA 3AM1A 4N0EA 4GFDA 4CEJB 1RZ3A 2AHOA 4H9GA 2GCOA 5FBVB 2QG6A 1G6HA 1S0UA 1FTNA 2R65A 4YLGA 3QY0A 1KZ7B 1UEIA 1D9XA 1AS3A 3WNCA 1R8QA 2ZYUX 1XXHA 4UNNA 1ZU4A 2A5YB 1WE2A 3KFVA 1NP6A 2KBEA 4P31A 4Q1DA 1KI6A 1VKJA 2ZRJA 4YC7A 3FOZA 1CP2A 1SXJD 1E2IA 4LPSA 2WV9A 2YV5A 4AYWA 5LBIA 1XFAA 2IS1A 4PHGA 1GUAA 3OEHA 2P3SA 4ZI3A 5E95A 3WP1B 1CJMA 1DO2A 5DHAA 1VTKA 3D8BA 4MRNA 2YKGA 2QPAA 2K5UA 1R5BA 5J4YA 1KJZA 1FNMA 1K6MA 1YKSA 1EFHA 3CIOA 1N0UA 1E1RA 4JVMA 4GP6A 2HJVA 5B64A 3NTUA 3SU8A 2QMHA 1KI3A 2BCJQ 2FPKA 3ASZA 4G1UC 4OHWA 1XCPA 5F9HA 4QM7A 4BEBA 1UBEA 4QHYA 1M7HA 3QKRB 1BO6A 2ZRBA 2VYFA 4ZCLA 1GFIA 4HB0A 2ZXUA 4MGIR 2OCAA 1XZQA 4IOLA 1XEFA 3PUWA 2GXQA 3Q5EA 1HT1E 4OJKA 2WJHA 2WJIA 1T0JB 4DCNA 4Q02A 3EG5A 3ND9A 4B3BA 3WNBA 3FVQA 4MGYR 4AG6A 1AGRA 3LXRA 5C4MA 2QP9X 4D4KA 1GL6A 5SZJA 3RSLA 4GMDA 3TUJC 4ZCMA 1KO1A 2BMFA 1EWRA 2O0KA 1SVIA 2GCOB 3NDBB 4IW3B 2GXUA 2NO9A 1OH5A 1HE8B 1T6NA 4DSUA 1Z0IA 2OFWA 4NHOA 2V3CC 3BWDD 1DAMA 2A5FA 1XXHB 2IXEA 2WWWA 4US1R 5LD2B 3A8TA 1UBCA 3OE7D 2JIZA 4B34A 1KI6B 4D2IA 1W36D 5CIQA 4LGMA 2GJKA 2NIPA 1XMJA 2QSYA 3LO5A 4C0AC 4QL3A 1FL9A 3W6NA 1CS4C 1E9FA 3I4LA 4NE2A 5AJZA 5KDOA 3X1ZA 5HPYB 1ZIOA 1P62B 3EA0A 2LCFA 4JLOA 3SJCA 5IRCD 1MABA 5K8TA 4YMWA 2QZ4A 4GOXA 2NG1A 5GJBA 2WKRA 2C8VA 1VG1A 4GDFA 4IXNA 2PX0A 1E2LA 2F55A 3BH0A 3QF4A 3P27A 4F4IA 3D31A 1ZCAA 4Q7LA 2W2VA 3K09C 1K5GA 2ZJ5A 3RYTC 1W0JD 3GJ8A 3W5IA 1F3OA 2IUSA 2WZQA 5IF9A 2RGNA 1VIYA 1JECA 4KSCA 4C7OA 3AB3A 3QF7A 1R6BX 2GESA 3CPEA 4E07A 3F5FA 4ZIRB 1VYUA 2FE4A 4FN5A 4TYNA 2EVWX 4D0GA 3EIQA 3QJYA 5UKDA 1IXRC 4X8OA 1NRJB 3NHBA 1GNQA 2IHBA 3SDZA 2AN9A 2WWYA 1ZUHA 2QTFA 3FKSA 1J7KA 2P0EA 4PSKA 2KJQA 5BWMA 1FQJA 2SHKA 1DOAA 2VHCA 1GRNA 2QM8A 3SI7A 4YMTA 2WKQA 4LYJA 4MRVA 4C3ZA 3UIEA 3KXKA 1VYTA 2W6JA 2DWOA 1Z5ZA 4TSFA 2OT3B 1G19A 4Q21A 3A4MA 4TMXA 4TQ9A 3QPWA 4O25A 3HPRA 1ZD9A 4PFSA 2F1RA 2A5DA 3CRVA 3B5JA 1I2MA 2W0SA 4V0KA 2WSSD 4AY2A 1E3MA 1OIXA 1UPTA 4F4JA 1CJKC 3W6OA 1NF3A 2BMEA 2GK7A 2GETA 1KO4A 3NBFA 3GLHE 4FI3C 2I1QA 3B82A 1FOEB 4DCVA 1BKDR 2VH5R 1P5ZB 2XTNA 4DB4A 5FR2A 3ZH9B 4EFNA 1SGWA 1FZQA 2YOGA 1ZCBA 1MABB 4PX9A 1E9DA 5KDDA 3EASA 3LBIA 2XNSA 1FP6A 3S1AA 5LB2A 4MGKR 3K0CA 4Q4JA 3QF4B 1G5PA 1TF2A 4TQUS 3T5GA 5FTLA 1M74A 5F3WB 3CPJB 2XX3A 3AKEA 4KFSA 1LV7A 4UJ3A 1SKYB 2IS2A 3A6PC 2FWRA 4OQFA 3IUYA 1UKYA 3CPHA 5AUQA 3A37A 3QKTA 1US8A 1IM2A 1Z2AA 2ZJYA 1KNXA 4GL2A 3RS2A 1MKYA 2GJ9A 4EQ6A 3ZVLA 1ZW6A 4LYAA 3Q9LA 1S9DA 2REOA 3CZQA 4TZ0A 4RFSA 3B60A 1ZM7A 2QTHA 3HPQA 1I4TD 2WVJA 4BWYA 1CR0A 3J81k 2R8RA 1N25A 2WICA 4V02A 3KJHA 3GJ0A 5L3SA 2QY9A 1DARA 1YHNA 4YMVA 3G5UA 2ZU0C 1JR6A 1NL3A 3EPLA 3N2EA 1R0ZA 1DAKA 4I4LA 5JCZA 1RE0A 3NH9A 2R44A 3QI2A 1TQ4A 2WWHA 3LXXA 5EQTA 4BRUA 3TNFA 1G9XA 5DLQC 5JCPA 1OXSC 2FNAA 3DMNA 1LF0A 1XTIA 5FUVA 3BE4A 4B3CA 1D2MA 1Z06A 4U5XA 4BUJA 3E1SA 1T3SA 1II9A 2DFTA 1TEXA 4NCNA 1NN0A 4KYIB 2Y8EA 4A0FA 2CLDX 2O8BA 1R4AA 1SVLA 2WJJA 2X1VA 3AVYA 1CJUC 2OAQ1 1X8LA 3IPYA 4LJYA 3L8ZA 1W47A 3CF6R 4C9BA 3HYTA 1ZC3A 4O0MA 2XSZD 2F1HA 2F9MA 5JRJA 4Q4HA 4YXWA 4JJKA 2XZOA 4Q4JB 3UMSA 1P75A 3Q7QA 3KTAA 1G16A 1G8GA 1Z3IX 4GZMA 3RWMB 3VX4A 4S35A 1E2NA 1J8YF 2GZAA 2CLCX 4ESHA 5LDDC 1AS2A 3VR2A 5EE0A 2HJGA 5D3QA 1US8B 5FPYA 4UJ5A 2C9YA 5DISB 2J46A 3IIJA 1G3RA 5EP1A 2Q3MA 1U9IA 5FUWA 4EQ6B 4MKIA 2XTMA 3TSZA 4JYCA 4L15A 3AV0B 4S2EA 2HDNB 4RJLA 4QNMA 4RFSB 2ZE7A 1Y3AA 4RVCA 3EZ2A 4QM6A 2REXB 4Q19A 1CJTC 5L3RA 3HWSA 3BB1A 4GP7A 3RC3A 1U94A 5FTNA 2RGGA 3LD9A 5L3SB 4B74A 1GTVA 2PT7A 3RRNA 1NVVQ 5B2ZA 3UG6A 3WY9A 3QKUA 4B3GA 2D2EA 2QU8A 3MWYW 3IHLA 4PXAA 3A58B 4G5QA 3W3AA 2ZRPA 2JGNA 1JJVA 2XTZA 4NYJR 3I5XA 1XF9A 1IXSB 1E2JA 1FMLA 3CUEF 2BBWA 1U8YA 2R6GA 2EU8A 2BEJA 3U6KA 5KU1A 2JJ2D 1YZUA 4D80A 4UXHA 5BXQC 3THXA 3FHTA 1FNNA 3GEIA 4PO9A 1R5NA 2J7PA 4KXFB 1EFCA 1S3GA 1VYVA 4Q9LA 1U99A 2XGJA 4URVR 3CX8A 2C98A 1YRAA 2O8BB 1Q1QA 4NYIQ 5FUXA 1TNDA 1XMIA 2GDJA 1GAJA 2GVZC 2F1IA 3AGQA 3H1TA 4RD0A 3TJZA 8OHMA 1AKYA 1CBUA 3NH6A 3TKLA 5EE9A 1W7AA 1GSIA 2EWWA 3T34A 5JHGB 4JLMA 2F43A 3JVUA 4Q4HB 1Y63A 3P4XA 1TL7C 1VCOA 1HE1C 1NLFA 1KO7A 2A5JA 3KTAB 4DXAA 3L0SA 4PC2A 4PZLA 521PA 2WM9B 1C1YA 1YZGA 5K8IA 4M9QA 1PLKA 5A0FA 5JEEA 1VG0B 4KSBA 5J47A 2GXSA 2IYWA 4NH0A 2F9LA 5KDLA 2RGNC 1P2TA 2RAPA 5AK0A 3OEHD 2AWOA 3M6AA 1D8TA 4HYYA 2EW1A 3SN6A 3MD0A 2F6RA 5JLJA 4URXR 1JXOA 2J0VA 1IONA 5AJYA 1KKMA 3QENA 2H16A 1EXMA 3IDQA 3ZS8A 1H8HA 3GFOA 3LX8A 1E1RD 1EX7A 2Q9AA 1EGAA 3TUIC 1NMXA 2AFHE 1RKBA 3B9PA 4HATA 1JQLB 3RS0A 1Z22A 1OB5A 4LRWA 4H1VA 2RGDA 2BBSA 1IJFA 3UKDA 2WTUA 2R6FA 3CNNA 4QFMA 3GP8A 1XTJA 3QXCA 1NJFA 5AWFC 3ZLJA 1N2CE 3HP1A 4P32A 3THXB 1KI1A 2ZROA 3EC1A 4LZZA 4M8NE 4FCVA 3A4NA 1KSGA 1KAOA 2CMKA 2ZREA 3VQTA 3OHMA 3B7GA 2YOFA 3PEVA 4GPTA 4JZKA 1N0VC 3WHKA 1VCIA 2GEUA 3QPVA 2KE5A 2JLVA 2C99A 3RS3A 2GF9A 4HB3A 1DAHA 1SZPA 4IHQA 1S2MA 2F43B 1G7SA 5CITA 4PC3A 1UKZA 2RHDA 3N70A 1E9SA 1UKVY 1ZM9A 2OSBA 1Z0JA 5TMPA 5E7MA 3NC0C 5EP4A 4KODA 4M0LA 1WCV1 4DEYA 4OQMA 2YC4C 3K0CC 4XOIA 3VR1A 2JIZD 5FBWB 4DBLC 2FMXA 5GVRA 2WJVA 1TUIA 4LBYA 2GCPA 2PJZA 2ZR0A 1AKEA 4JSYA 2FV8A 1CF4A 2NQ2C 1HEIA 3ZQJA 1NBME 1Q1BA 1JR3E 3LLMA 4DLZA 1AK2A 1UBGA 4DC9A 1NG1A 5DYGA 1CRQA 4MYTA 4CGZA 3I62A 2WPDA 5FI0B 2OHFA 1E96A 4B3DA 2CJWB 1GILA 4LHZA 2OAP1 1OE0A 4WOPA 2G1JA 2JEOA 1EESA 4WXRA 1KDOA 2L0XA 3LV8A 2AK3A 4IFBA 3KXLA 1UDXA 1T9HA 2B8TA 2C04A 3VAAA 4B33A 1UKEA 3CZPA 5JI2E 2WAXA 4DLUA 2WWIA 2JA1A 2ZJOA 3ZS9A 1MO6A 5EZ6B 1XEWY 3VNVA 4JVLA 3O8BA 3LW7A 4DDTA 2BJWA 2OZEA 1KK0A 4KVAA 2V9PA 3IKJA 3THYA 4XVQA 2J0UA 3GQBA 4D4MA 3RS4A 2JLWA 4HLUA 3OESA 3BAFA 2EFDB 2MSCB 1XTRA 3FKSD 3QG1A 3VR3A 1G8HA 2XOKA 4CIDA 1XWIA 1JXMA 2O8FA 3CX7A 1U98A 2ODWA 5IHPA 1KJWA 2OILA 2Z4RA 2UVQA 3KQUA 2W6JD 3BIFA 3WHLA 1Z83A 3NDPA 4TSFD 3RLFA 4NMMA 3I5YA 4IDOA 1IN7A 3H0KA 3U7GA 2C5LA 1BMFA 1WBBA 1S1MA 1Z6TA 3FMIA 1G5TA 4LPKA 4D0LB 4FMDB 5GJCA 2AXNA 2BOVA 3T1VA 1CJVC 3VMFA 1IY2A 3SQXA 1XTKA 4MH0R 5AUPB 4LJ6A 1PUIA 2NO0A 2Z43A 3RS5A 4NCIA 4JLPA 5CK4A 4DIDA 4PPNA 1RYFA 4LYFA 3BB4A 3HYRA 4WW0A 4CEIB 1MOZA 4NP6A 1U9IC 3CWZA 3E5HA 4OI1A 3AKCA 3FHCB 1S1CA 4HLQB 1TADA 1G4UR 2YNMA 4LOAA 2EFHB 3U3RA 1XD8A 2RGBA 4Q01A 2IF0A 3PUXA 4HZUA 4QXAA 2GXAA 2IF2A 1QBKC 1F6BA 1KY3A 2ORWA 2W6IA 621PA 4HUTA 2ZRFA 1SXJC 4GOJA 1KHTA 1ZM3A 2CCKA 2OESA 4FCWA 4M2LA 1G7CA 3IIKA 1W4AA 2GWHA 2P65A 3HR8A 2FSIA 1ZRHA 3WBJA 1XXHE 1ZJ6A 5K8LA 4WZBE 2J59A 2FOLA 4KITB 2WMNB 2ZE6A 3THYB 1GVNB 1Q44A 2J0UB 3HJNA 5L8VA 4CVNA 1HV8A 4PZYA 3V9PA 5KTYA 1W44A 2ZSBA 2IYRA 1NN1A 4A6XA 5L3QA 1GNPA 2DPXA 4EUNA 2WWXA 3CRMA 4D0NA 2O8FB 1II0A 2CL6X 1X3SA 1KIMA 2JASA 1ZINA 5DN6A 3WNDA 4IRUB 1TUEA 1R0XA 2R6DA 4MUBA 2QRNA 4IDPA 2Q3HA 2X77A 3P26A 1Z29A 2QNRA 3TQFA 3EIEA 5G40A 2KSQA 1N5IA 3X2SA 1OH8A 4L4UA 1IXZA 1JEDA 1U81A 2XNDA 3CWQA 3CRQA 4MRRA 4HAZA 5TV2A 5C18A 1HQCA 3CR8A 3IIMA 1KKLA 2RCNA 3P20A 5H70A 4IVRA 2NGRA 3PG5A 2PZEA 4CYMA 1OV4A 3LNCA 3LQRA 4TT3A 1PV4A 4C30A 4TLEA 1L4UA 2RGAA 1NN5A 3MWKA 2GKSA 3PITA 4B48A 2VLIA 3E70C 4QBHA 2ZQ5A 2W83A 1G3UA 4PO8A 2OLKA 4FINA 4RSGA 4HZUB 4BQSA 5AUNB 4PO1A 5C4GB 3PJRA 2O8DA 3CW2A 4LBWA 4YXWD 1FTSA 4NCHA 2VHQA 4WA7A 3KFXA 2ODBA 5H1YA 5JRZA 1JI0A 3LFUA 3BS4A 4P0TA 4BE7B 4TWZA 4UNRA 1Q20A 2IYXA 5JJIA 1W36C 1T4GA 3AVXA 1OFTA 1HH4A 5GVSA 3T35A 4TL7A 2PLFA 4LC1A 3A36A 2ECKA 1YR7A 1TMKA 5CLLA 3GLIA 2BWJA 1K5DA 1QHSA 3M1IA 4K8OA 3R9WA 1T8UA 2QBYA 1S8FA 2ZJZA 5KHOC 3X1WA 2VO1A 1Z6GA 3TUZC 2GEDA 3OFNA 1EFTA 1KSHA 3IQXA 3HR7A 1QHIA 1XJQA 2OXRA 5L3QB 1J70A 4LV8B 4OI2A 1HQYE 2DR3A 4CT5A 2QQEA 5HCIA 1UF9A 2B21A 3B6EA 1G7RA 1G5RA 4FMCB 4TTRA 4BLPA 1ZD8A 4V03A 5GADl 1G41A 3BORA 2CE2X 3MSXA 1IY0A 1DEKA 2AD5A 1E2EA 2HXSA 4CT4B 3LH5A 2OFXA 2WIAA 1KK3A 5CYOA 1N6PA 2OCBA 3JVVA 1ZAKA 2QROA 4D4LA 4TLBA 3OZXA 1R5OA 4MITA 1T91A 2BBOA 2BC9A 2J7PD 2PH1A 4NONA 2IHYA 1NY6A 4W5JA 3TK1A 2J0QA 1G8PA 1TQDA 1R2QA 2FA9A 3RAPR 2JLXA 3D6TB 3OIWA 1YZLA 1QF9A 2G83A 2C96A 3VNUA 4JVSB 2FH5B 2QP3A 3W90A 4C2UA 4B3XA 2GJSA 2A7QA 2ZTSA 4R2IA 4IOMA 4TYWA 1MT0A 1TF7A 4FXPA 5FPSA 3DPUA 3A4LA 4OHVA 4L16A 4DJTA 5IK2A 1Z63A 1MRSA 2O8DB 2QGZA 1GM5A 4GSYA 4XSHA 3IILA 3U7EB 2VHUA 2F1JA 2BHRA 4EAQA 2J3EA 2WOOA 2OCPA 2WIBA 1NVUQ 4R7ZA 4OKSA 2DWPA 4PQYA 4G01B 3BFVA 1XD2A 4Q7JB 4GMXA 1IBRA 3QVVA 3FB4A 2KI5A 3FHOA 3I72A 4NKRA 3SHFA 3SQWA 3T06B 4BLQA 2YINC 4A0HA 3BXZA 2PBRA 3QNUA 4NBSA 3SS8A 3GLIB 2ORVA 4KYUA 4ITRC 2G0NA 4LWZA 3F8TA 3ZGXA 4DDWA 1XJCA 3SR0A 4I81A 1KK1A 4MUAA 2QBYB 4XTRA 1UDWA 4Q5IA 5ELXA 1G6OA 4DSNA 1Q1ZA 2FJUA 4NPHA 3T1TA 1H8HD 3B1VA 1EWQA 4HLUC 2FZ4A 3SBEA 3RS7A 5BN5A 2NO7A 2IYLD 4L9SA 2PLRA 2IWHA 1SVWA 3HU3A 3KKOA 3TAUA 4AYXA 2RHMA 4BZPA 3ND8A 5KNCA 4IDQA 4Y0AA 3DMDA 2YC2C 1ELOA 4NDZA 3EARA 4OHXA 3EZ6A 3PXGA 1GP2A 5B30A 3RANA 2AD1A 1NG9A 3NIBA 2A78A 1UFQA 1E99A 4MQBA 2YZ2A 3LQQA 1EFRA 3MCAA 1KMQA 3ADDA 4FMCF 3QPUA 4LJ8A 4RD4A 4KJZA 2V1XA 4JIMA 4BPBA 4G3XA 2CBZA 4ESVA 4NU0A 4TLDA 3R7WA 2EWVA 2VHJA 3I61A 4RCYA 1BYUA 2FGKA 2RGCA 4ZDKA 2ONJA 2G6BA 3AF1A 1P3JA 4QBFA 5H68A 4MKHA 1RYHA 3W3ZB 2W2XA 3MGCA 1U0JA 121PA 221PA 2J1LA 4LHYA 1E0AA 1X1SA 5CIWA 2JLQA 3AF0A 3CONA 3PUYA 3CBQA 1IY1A 3FWYA 1XD2B 2BMJA 1YZNA 5FI1B 5JWHA 1E2QA 1LVGA 5AR1A 3U6BA 4CW7A 2XZLA 3REGA 1Z0AA 2RGEA 4I1UA 2JDIA 1JALA 4K46A 2GCNA 2ZI7A 2QAGC 3KKMA 4JT2A 1IJEA 3UXMA 3BC1A 3EC2A 2WPDD 4QJ3A 2UZ3A 1WXQA
chains in the Genus database with same CATH superfamily
2Q9UA 4ZV7A 5KYKA 2DFLA 3SF8B 2NZ8A 2QTZA 3O7MA 4P3PA 1QAOA 3QTBA 4EK9A 2WJ4A 1YUBA 1ZN7A 3AR3A 4ER5A 1XRJA 2JBHA 2VDWB 2GA9A 1L4YA 2QENA 3QYFA 4X9XA 3NYRA 3TL6A 2Q46A 1AK1A 1EEXB 4TL9A 2G5CA 3KG2A 1FYVA 3N2KA 1ULBA 3C4QA 4C0KA 4DAEA 4YAIA 2QM3A 5FO1A 2PPVA 1WA5A 4LEIA 3W3AH 2B7BA 4DR1B 4ODIA 1E3LA 4RZ2A 1BZYA 3SHVA 4QTUB 1WR8A 2PUFA 1GIAA 4XI9A 4ZYLA 1CG6A 1OW3B 9LDBA 4CLOB 1I4WA 3JATA 1G18A 2ZZNA 1XTPA 5HRAA 1TT5A 2W22A 3AQ4A 4BU0A 3FOWA 1W5EA 3S29A 4ATNA 2CHGA 2EQBA 3Q5DA 2UYCA 3HQ4O 3BCHA 5TQ0A 4ZTBA 3ZJ5A 5JBIA 1ZZEA 1FPMA 3BN3A 1CPYA 1YBVA 2NU8B 4U0KA 4IX9A 1VHLA 1G21B 3EWIA 2L18A 3DO6A 4NCKA 5HF5A 1F4VA 1I6LA 2HQRA 1WNTA 1PX0A 1HI9A 2NXEA 1JPNA 3PDUA 5D86A 1QPZA 2W58A 5E8JA 1IBSA 1JHQA 2VPPA 4RGBA 3GJ4A 5TRTA 3T61A 4W1QA 1J4AA 1PNQA 4QRIA 2QW1A 3NW9A 2YHSA 3VO9A 4MDEA 3FVRA 1X7XB 2TMYA 3ICCA 3A7DA 3IURA 1E7QA 1MOPA 1SXJE 4B87A 1NGSA 5CGZA 4AZ0B 4DA8A 1FDOA 3QEMA 2OEPA 3PK0A 4DKXA 1ZUNA 4LDRA 3HL4A 5I9NA 2V03A 4O4HF 4P4NA 5DEIA 4IMRA 4ZO4A 5AM3A 1CB7A 4R9VA 4X64B 3O1IC 3PKZA 2B37A 4OQXA 3FFBA 4KQEA 1HA3A 4R81A 1Q6ZA 3V1UA 4XLLA 3OQNA 1KU6A 3BE6A 1W4BA 2PDAA 2RHTA 2DHRA 4WASA 4WHMA 2JIMA 4KIUA 1G8YA 4YJHA 3TCNA 4R0VA 3UCEA 5KOYA 1NQTA 2NSJA 3FYTA 3SOZA 1EXNA 4AM8A 4E32A 4ZWNA 3KBBA 2OCDA 4ZDJA 4H7HA 2ILVA 5BQXA 1QP4A 3PEYA 3G9QA 4BO8A 1CRWG 4BRZA 4DR6B 4FCTA 1O5OA 4M4SA 4GOND 3L6UA 4INAA 1ZDMA 3SSNA 1ENZA 3O8OA 4MS1A 2W6ID 3USES 4DLWA 5LD2C 2OCXA 1A2BA 5DNWA 2AG5A 2XEDA 4X7PA 1GGNA 1L7QA 2DWUA 3CRW1 2XYRA 4R54A 5CLQA 4E14A 4LF9B 2C9BA 1I51A 2JHPA 3B85A 3IP9A 3PPWA 5ALTA 4M0DA 1CCWA 5K2OA 3S2FA 3WQQA 1I4OA 1THMA 1W85B 7REQB 3GH3A 3HE3A 4BMYA 1Q3HA 3DDWA 4PYRA 2QGNA 4GLFA 3MAGA 2VH1A 4CM7A 2QEQA 1JZSA 5T3YA 3I8SA 3S1AB 5KSZA 2OV4A 3QX3A 2TMKA 2OBYA 2JLAA 1L6IA 4KWHA 4L4XA 5F78A 1GL3A 1TF5A 1XRRA 2G1KA 1AVTA 2XYGA 2ZWOA 1UZNA 1HG1A 3BXOA 4NECA 1XTUA 3ZDBA 4GLLA 3HTXA 4HDAA 2ZBUA 3AF4A 4OGKA 1HL7A 2H2GA 4IZHA 1NMSA 2VOEA 5CB8A 4YUZA 5BR4A 2PQ0A 5BSTA 3JAWA 2V7UA 1UBHS 4OM7A 3GP3A 1EAYA 1Y34E 5ELMA 4DW8A 4IVPA 2J6CA 1NIJA 4IMPA 3GDOA 1DMSA 2HA4A 3H3FA 4OGWA 5LB4A 1TK3A 3RYHA 2WQ7A 1ILEA 1WULS 3KOXA 1EM8A 4BLWA 1YI8A 2C9ZA 1O2DA 1RVDA 3B20A 3MJCA 2GPAA 3HCOA 3BGSA 1Q1EA 1UJ5A 5IT4A 3I09A 2ZTUA 1OR8A 3OPQA 1PRYA 4G07A 3T1QA 3S2GA 4YONB 1J5EB 1G1AA 3BVPA 4NZNA 1HDEA 2IHNA 2IELA 1F7UA 4NQRA 1HQDA 3VSEA 4ZPJA 3TSAA 4LZNA 3LUHA 4QXPA 4HMQA 4XWTA 1WHSB 4F3RA 1FDSA 1E2KA 4ZVTA 4Z4QA 3GLKA 1LKZA 4YBZA 3OJ0A 5K6TA 3Q1LA 1S01A 4JS0A 1CF2O 1OWOA 1Z56C 4PYNA 4RACA 4WNAB 1MR3F 2OCLA 3OWHA 1JFTA 3I3SR 5KWIA 5JSKA 4JVNA 3UPUA 4TLCA 4I4CA 4UNPA 1LU9A 2TYSB 1P73A 2WJGA 2Z8YA 2X2PA 3PE4A 4RIIA 1UZMA 2O7RA 2EFGA 2D2IA 1YJ8A 2X41A 3GPIA 4GNRA 1EVIA 4L3VA 4Y2HA 5MN4A 1XFDA 1DDIA 2NYVA 3VZPA 2VQ6A 2YTZA 1XYVA 4L78A 4LJ7A 3LYAA 2P2CA 3A04A 3TDKA 3WNVA 4NBUA 2V45A 3DH0A 3I37X 4WLNA 2QL7A 3H3XA 4CI9A 3ZX5A 1V45E 2Q1UA 3M0EA 4GZLA 4M0CA 5ULLA 4C0WA 4EB6B 2AV6A 1W6UA 3A2KA 5AVXA 1WMFA 4B40A 4F1KA 1M6VB 2GT1A 1W0KA 2Q5HA 2V4UA 3A1DA 5FO0A 3WYGA 5IABA 1WZIA 2QT0A 3AIMA 4UQOA 2BCGY 1GUZA 3U0VA 2JEZA 3W8EA 1PTJA 1PNVA 2JZOA 1R0LA 2RK6A 4UBNA 3T99A 2DWQA 2WSMA 2ZJ2A 3EHDA 3EFOA 3L4SO 3Q15C 2NN3C 4GPIB 5ALLA 3K05A 1ZMBA 5AVJA 2ZSHA 5LIRA 1WP9A 3FF1A 3LY5A 3A6KA 4OK6A 4UHDA 3TQIA 3U3DA 4BTVA 2DAPA 1N6KA 3WRVA 4W7IA 3OEWA 2IYFA 4L8VA 3WDKA 2HCFA 4RH0A 3R4CA 4MYUA 4EJ0A 3DZ8A 2JI9A 2VTDA 4V0RA 1RRCA 3R0QA 2ID7A 4NDNE 3K0AA 5EE1A 2WJAA 1HDIA 4WKBA 3OTGA 4ZARA 4DB2A 3EDYA 4INJA 1CB0A 2PL1A 2QT9A 4YMUA 4DA0A 1ZSYA 3AHCA 4OIFA 1IAQA 4TLAA 3DWIA 3T15A 2FMHA 3VC3A 4DIMA 5FUMA 1KR2A 4J1QA 3N0VA 3GLQA 3J7AC 3RJ5A 3AJRA 3HFSA 2H07A 1YBHA 5FPSA 2DQSA 2XT0A 2ZB3A 1BHQ1 4LQDA 2PUJA 5HILA 2D5LA 3IKMB 4XJXA 2OV2A 4O4LB 4NSNA 1P1KA 1B15A 1BH6A 2CL5A 1WCWA 4LYYA 2RB5A 3EAGA 5AKXA 2BEWB 3TDNA 4XPIA 4II7A 4YIKA 5I7OA 3MJEA 2D7CA 1X6VA 2W00A 2DB3A 3U49A 2PXCA 5DYIA 2EDCA 4RLQA 1D7OA 4GXRA 1V16B 4M8IA 4QFBA 2X0JA 1PR9A 1C1XA 4BZQA 2ZKLA 4CTNA 4E5PA 4ALKA 4FFRA 5KYXA 3V4FA 4TKLA 2X14A 4IJUA 3N8HA 4FR2A 2J41A 3I6YA 4EPRA 2PQMA 1H2WA 4JR0A 1JIJA 4LAFA 3T94A 3VZDA 4E5UA 1HYGA 1RRGA 2PH5A 2ZTHA 3DDHA 2Z2KA 3N6RA 2D06A 1VG9B 5C7LO 2Q0XA 5K3OA 1M2OB 1UOPA 1YS4A 2A9KA 3FR7A 1NY5A 1DC4A 3Q7TA 3D4NA 1FDTA 3KD2A 2HQBA 5ALZA 4BV3A 4EBFA 1YQGA 2WM2A 4QPZA 1HYEA 3DZIA 2J5XA 1HK7A 3ZZUA 1Z0SA 4NCAA 3QBTA 1X7YA 2HWKA 1YR6A 3L7NA 3ANXA 5J63A 1B6GA 3GFVA 2K7FA 1MNQA 3WK4A 4DPMA 1ZM2A 3KJZA 5JJBA 1B6TA 5KVAA 3AZQA 1AKNA 4PRLA 1GZDA 1KQOA 2H51A 2Q21A 2JS7A 1QXSA 1NWCA 1POXA 4Q34A 1I6MA 3TLGA 3WQSB 4EGQA 2VHVA 3QY9A 4EJMA 3F9CA 5DXJA 5EXTA 4ENPA 2DBQA 4NENB 1YCGA 1T2EA 2BIFA 3C6MA 3OMLA 4Q3LA 4A8JB 5EJEA 5F76A 1GXSB 2CV0A 2MSEB 4Y2UA 1GEEA 1P0CA 3PHBE 4DCMA 3OF5A 4UDNA 1H6AA 2WA1A 1VPDA 3HI4A 3HI6A 3IQZA 2AZDA 5E3HA 1XALA 1ZI6A 3CUYA 3DNFA 3Q2IA 4WECA 2Y3IA 1SCUB 3MHPA 5BT9A 2ZUTA 2B1JA 3JD2A 3JQPA 1T5IA 4WESB 3E3NA 4Z4EA 3Q3JB 1ODTC 1OIWA 1W76A 1DVRA 1Q0ZA 4KU4A 4PZUA 4JYAB 4PPFA 2WP0A 3HNRA 1ZYUA 4K9QA 4HDMA 4ZCRA 1OUMA 2A1UA 1ZA1A 4B71A 4BJHB 1T8PA 6NULA 1Z08A 1E3TA 1L4MA 3AHHA 4RELA 4MKGA 2B4KA 4XA8A 1C0KA 3CF4A 1ZKMA 4QUJA 2BP7A 3CXUA 3KR2A 3ULKA 3GEGA 3ELDA 3K5WA 4HEHA 1WB6A 2QRQA 5H16A 1R0BA 4BFZA 3EXG1 1AKVA 1E8DA 4WH0A 4JUBA 1OJLA 4Y9DA 1IEVA 1KARA 3BERA 3I42A 4XM0A 2J3IA 2VJNA 2P9BA 5C5IA 4OGLA 2Q49A 4N5NA 1WL8A 1B00A 2NM0A 2P62A 3OWOA 3V1KA 2ZOSA 3TG8A 5BN1A 1NVWQ 4GLOA 4ARAA 5LLDA 1RQLA 2AFHA 4HH0A 5FLYA 2XLBA 4XIGS 1JN0A 3QE3A 2QTMA 2TMDA 4NG5A 4IDAA 3V3KA 3IPLA 3REFA 1YDEA 3WL5A 3SYTA 1GZ7A 2N1BA 5KTRA 1CY4A 1T4CB 1IZ9A 5BRJA 3KJGA 2EDAA 4EGJA 3KDSE 1OBVA 1J90A 2Y0CA 3M4YA 4RZ3A 3RJMA 4YXFA 4ZV4A 4MCJA 2R6AA 4JBYA 4TM7A 5LUBA 3VR0A 421PA 1Q2XA 3BSFA 2R4QA 3WWCA 2QRLA 5KHLB 5GJVC 5LOVA 5BVHA 3NWJA 4M7RA 5FRDA 1XMXA 2JVKA 1W88A 3NTOA 3B38A 2P4EA 1P3DA 3M6IA 4EX7A 2JBAB 3GD7A 4TGLA 4KCGA 3S5JA 3G02A 5CFNA 3R3XA 1V5EA 1QRSA 5CM8B 3PJEA 4MR9B 4FT4A 4IXDA 3ESZA 1M5UA 4GMFA 1TAHA 3KQSA 1L7EA 4QX6A 2BFCB 5C52B 2GR9A 4X1IB 5AI9A 3ZTYA 5CHYA 2NV2B 4E09A 5KYYB 2PFKA 1RM0A 2I3BA 3E5NA 4D82A 4R5HA 1FQKA 3U4CA 3R1IA 1FLDA 1PZGA 2EZ9A 2ZUCA 4K0KB 1MZVA 3G2IA 2W90A 3FFAA 1NR5A 1T5LA 4JNCA 3VNBA 4RA9A 3SBDA 3WB0A 4A2WA 3M5CA 4WUVA 2FR8A 3CNQS 1DDOA 1IN6A 1LK7A 3JYLA 1KZ1A 2JHAA 1QTIA 2XYVA 3A6GA 1HORA 1XRPA 3T5PA 4DG8A 1F2VA 1NYRA 1NBMA 1BRTA 3CX3A 5LBUA 4BEVA 5DM70 4I36A 4DMMA 1UBOS 1T9GS 1K1EA 1VSQA 5B57C 1DG3A 3INTA 4YQYA 2QVXX 1LB1B 2FSUA 2Q41A 2NLOA 2F7SA 5AHXA 1Z9BA 1Q57A 3PBKA 4TKVB 4DF3A 1XU7A 5F7OA 2Z83A 4QJIA 1J0CA 4DCTA 4G2TA 1XCMA 1WPRA 2KHZA 1Z12A 3ZHRA 1ECCA 3KQPA 1KAGA 4B75A 4BGUA 4RTLA 3JQQA 3PX2A 1V6AA 2GJAA 1OFUX 4JHLA 5EJ6A 3OQBA 3VVCA 4M1ZA 5FF9A 4BN0A 3CGGA 4Y67A 4RE5A 5KVQA 1BROA 2OB1A 4K87A 1NQAO 3PRJA 4CL8A 3L6EA 1C3JA 4ID9A 5HTKA 4YRBA 4BAUA 3EEBA 1B76A 3ETJA 3W78A 5HM8A 1U4OA 3C3WA 3HC7A 3LBHA 3ND7A 5E6SB 4BMNA 4J9UE 5MN6A 5CP8A 1D2GA 1V5GA 4L4SA 5B53A 4ARSA 4CIBA 1C7RA 4QQNA 4DYDA 3PFGA 3PTZA 4CRWB 1T10A 3EY4A 1YL6A 1QHHA 3M7IA 4HH4A 1NHGA 4IHJA 1TM4E 1B73A 4B0OA 1AJEA 5IARA 1K06A 4DLTA 2Y1OA 2QZPA 2FFAA 3E84A 3TIVA 4AI6A 4IIVA 4A8JC 3AH8A 4F11A 3F6BX 3LHSA 4FC7A 4KQMA 3GLGB 2A14A 1H85A 2C31A 1IM5A 1FX0A 4RZQA 5EWMA 3IP6A 5DN9A 5DTRA 2Z6QA 5DKFA 3HDTA 4IILA 3KQNA 3QBVA 1Y6RA 3PKJA 3JCZA 3L04A 3GCGA 2QSUA 2IUUA 4P2BA 4JYZA 2VK4A 1BMQA 3F49S 2A9VA 3KO8A 7MHTA 4UDYX 1C4OA 3VHXB 1GFWA 1DJPA 4MRAA 3UYKA 3KZNA 4PR0A 4X95A 4CQMA 5C1PA 5IJZA 1SBIA 1ORDA 3DDCA 4IEIA 4TVSA 4BLUA 1E4VA 1XZJA 4TZKA 2H9IA 2QA5A 3QU5A 1XNQB 3IQWA 4JP1A 4P4UA 1NNUA 4AUMA 4PLWA 1ZD1A 3IVRA 1IYZA 4XPZA 3ZCQA 1E9EA 3CZAA 1FFXB 3DGFC 4FNMA 2FPUA 4HNRA 4AJIA 2CVQA 3BTSA 3GFGA 2DPYA 5FR1A 3Q1KA 5CU7A 4PX3A 3G0DA 3S28A 1COWA 3FKJA 3FMFA 3F6RA 1EX1A 3OPYA 1XR3A 2AC4A 1TIBA 5BSKA 1T3TA 4IQFA 1E9RA 2GYYA 3H5WA 2X58A 2FU5C 3T7KA 1EXDA 4E03A 1DP4A 4PAGA 3RK4A 3E3OA 2A2ZA 2GRUA 2QI9F 5J3JA 1UC8A 3VTKA 4AKHA 5GV7A 1JAHA 1E1MA 3SY8A 1KTVA 4H35A 1ORVA 1SKYE 2YIDA 3OX2A 4Y7DA 3GLFB 2R0QC 4CEHA 4QGAA 1V8ZA 4RAQA 4WZBA 4F6LA 4KNVA 1Z7YA 2JZCA 3KUKA 1NTOA 2WF8A 2B6HA 2YXLA 4KQGA 2FEAA 3OJOA 3RU9A 3ZLVA 5IMSA 5F98A 3SHTA 3U4HA 4YRMA 4FLMA 2QE6A 1BCSA 1YQ9A 1SXIA 1VJCA 1P29A 2YY5A 4KAFA 1OAKA 2Q9BA 4RJKA 3MGKA 3SIRA 1D6NA 2A6PA 4L7VA 1J21A 1O3YA 4BNNA 2B82A 2P67A 2ZJ3A 3B8EA 1KZ9A 4PSDA 1OLUB 1WPXA 3S27A 1L5HB 1U11A 4EPVA 1OX4A 4OLBA 1NUPA 3MWFA 3RAJA 3FMVA 1L5QA 2ATCA 2F90A 2J5BA 4IG4A 4OQLA 4NG4A 4XRGA 1C0LA 5JYEA 1IN1A 3KUUA 4MCAA 1JTFA 4DARA 1XAGA 4GQBA 4LXIA 2CK3A 4TS1A 2CT8A 1K7EB 2WYIA 1GQSA 4RX1A 1WXEA 3RRXA 5EIEA 3K70B 2OO7A 2P0YA 1OAOA 2JLSA 5AKEA 1WX1A 4JB2A 1YOVA 3F2IA 4KAAA 5FIUA 3TZLA 5E3JA 4A3SA 1E0SA 1M1UA 1SBYA 3QE9Y 2OBXA 3KHKA 3MPUA 4XQEA 2DFKB 1RACA 1I5EA 3GGCA 3KKKA 3PRYA 5EXXA 3TL2A 4BFXA 1OFHA 4AWAA 3CNLA 2C8KA 1SWWA 3KOMA 1Y8QA 3QKSA 4PX2A 2GN6A 3I01M 4LHVA 2Q7XA 3RHZA 3FVTA 1TQ2A 1EQ2A 2IZZA 4HEA6 1FP7A 3SHOA 5CLHA 4UPEA 1J25A 3ZJUA 5BMVF 2XUFA 4MW1A 3K6RA 5LMCA 4E3WA 3V1MA 4ZAZA 4EHHA 3CUUA 4HNGA 4HUQA 5JAIA 2WIKA 3U4QB 5TPZA 4YT4A 4BEWA 4C4AA 1R0YA 2IW1A 4CZ2A 1EDBA 2JGFA 4HXGA 1ESCA 2ZIEA 2CHEA 2V0NA 4DSAA 1STOA 2O2CA 2FSGA 2IYPA 1E9BA 2ZIUB 4N47A 2CHVA 1GZHB 1EFUA 4QODA 2X15A 2ZBFA 3QW4B 5JCOC 4CIXA 1WHTB 2QW0X 3L0OA 1J09A 3N8KA 5CJ2A 3V8PA 1WSWA 1AM4D 1UK6A 2CZQA 2O2XA 2ZI9A 3PPYA 1G17A 2AZ4A 1X8KA 3QLJA 4EO4A 1VE5A 2P6MA 1U8UA 4HAYA 4TKMA 4WDQA 4P5PA 4AFNA 1YVDA 1Q3TA 1XA4A 3DE4X 3SK0A 5JH7A 5DX1A 2D5AA 1XZIA 2ZRMA 3B51X 3O47A 3SVLA 4OKNA 4GBMA 2FYTA 4AU1A 2FK8A 1LDYA 2JJ1D 3O4VA 4O6VA 4MQLA 5LYJB 4Q4AA 2ZIXB 3JZMA 5KU7A 1PGPA 3RODA 3G49A 1MLDA 3NI2A 1OZHA 5E9QA 2FX3A 1KPGA 2EKZA 2NPIA 1SA0A 3G68A 3N9IA 4UM7A 4ARZA 2FUG6 1NDQA 4PPYA 4CG2A 1PJLA 1QH0A 3HDQA 2LCQA 4ZI7A 4I66A 3U3XA 5EJ5A 1RRPA 2UAGA 3SE7A 2MSLA 1V0JA 1I3CA 3H04A 4QC2A 4NOJA 3DXXA 2E2WA 3GUHA 4G2NA 1KH2A 4I6EA 8AT1A 4N82A 4TZTA 2PMFA 1MJHA 2VNHA 4GF5A 4QUEA 4QGBA 1A7JA 4XVHA 2OCYC 3WDLA 5EXPA 4L2IB 3TCXB 1GLGA 4ASUD 1DB3A 4RXMA 4XD7D 3SF0A 3ISVA 4L5AA 5G1NA 3QE0A 1E66A 2ZYAA 3P7MA 6REQA 4KR6A 1N6OA 3HFGA 4EUHA 2GAAA 4F5WA 3IBTA 4TRMA 2ZSUA 5JRDS 3TPCA 1PV4A 4BX9A 3CHYA 1KO5A 3EUWA 2PUAA 1CY8A 5DRTA 4U6SA 3A1VA 4NS1A 4K05A 5EZ5A 4BXOB 1DFGA 4NE7A 2B3TA 4CCYB 4O63O 2WAOA 4DN6A 3RUCA 3C7TA 5DSTA 3TQQA 1XROA 3MRVA 4AK9A 2W42A 4RGYA 3RDPA 2I3AA 1WQ1R 2PA3A 2ZPAA 4O4JB 1F60A 1PR4A 4PGGA 4DVGA 5ALFA 2PY6A 2VIIA 1C9MA 5KJEA 5M2QA 1OZ0A 5KUTA 1ZUIA 3CEMA 5AO9A 4C0QC 4E51A 1Y5LA 1EUDB 2C2ZA 1C9EA 1N2GA 2FN4A 2LWIA 3R0VA 5B6JA 4HFMA 1MGPA 2FVYA 2Q27A 1C8KA 3ESCA 1XBTA 5A05A 1UL1X 4ZODA 3WRXC 1ZMXA 1CIVA 1L8XA 1YRWA 2IT1A 2DPHA 3HBFA 2IA5A 3KWMA 3UB3A 2ANCA 2C2MA 5JHHB 4O3MA 4ABTA 4DUGD 4BNJA 1BQ4A 1ECBA 1J1ZA 1LS6A 3G5TA 3QXHA 2J4FA 3DLAA 3KBOA 1QCDA 4R98A 5AMXA 2YHIB 1GQ2A 3CS3A 4G8BA 4UBIA 3F6YA 3WTCA 1VHJA 1DELA 2PV0A 2XPCA 1MIOB 4LHEA 3AJ9A 4RHTA 3EXHB 4D02A 3DLHA 4D4HA 4J4BA 3U3MA 1YFLA 4ZAWA 1VC2A 4PCVA 3UKJA 2JI6A 3SHQA 2LIPA 3TPFA 3HFJA 2D4AA 1J56A 2HLDD 5LQRA 1TT7A 4C0BA 1NE7A 1WMBA 1VE3A 2XLCA 3PDIA 3QUQA 1X80A 3K70C 2VUHB 3DEFA 4R9SA 1E3DA 3RREA 4JYBA 2VF4X 1FDVA 2X5XA 3JQ8B 4RFLA 1KAQA 4EG6A 3NYIA 1O54A 3PXCX 1PUJA 2DJ5A 1JJ7A 1QWOA 4AYTA 1I0LA 3RNLA 1NNEA 1XVAA 1BDJA 1W2GA 2O0JA 1K4YA 3TLCA 4DZZA 1YTUA 2EP5A 4TM8A 4FYMA 1MH9A 5EEGA 2QN7A 1B74A 1CZKA 1WF3A 5EIOA 4LOIA 3SKYA 3AR8A 2XE8A 4REOA 3TLEA 3WADA 1USGA 3SR4A 4MUYA 2Q3EA 2R2AA 1KKUA 3AJEA 1ZRMA 4NV1A 2X0RA 2F3TA 4AT1A 1CC1S 1Y37A 1S3SA 1P3Y1 1V7PC 3LC1O 4O2BF 1YOBA 5CIYA 4M7OA 4QQRA 4IJ6A 4LK2A 3D6HA 3FLMA 3FUWA 2DPMA 4GSLA 1O03A 2QAIA 4MVJG 1K6EA 5FPTA 2H1HA 5KTMA 3F2VA 3B12A 2QPOA 3OIFA 5L7WA 4LRUA 4M1WA 4AN4A 3AIIA 3UJAA 2GD0A 3CT4A 1P80A 5JS8A 4BCBA 1LW7A 3K53A 4HDQB 3DAGA 2HWXA 5FOXA 2AG0A 4ENWA 1EJBA 4MUMA 5I7HA 1HNXB 2FPRA 3C3AA 3O3OB 1TW3A 4ZN6A 5EXEA 3EDCA 1R6XA 1T5DX 2OVBA 2V7VA 3THWA 3CX6A 3DBVO 3KXDA 3FGPA 2MYPA 2J45A 1BXKA 2PWAA 3O91A 4RZUA 4BN5A 4DV0B 4OMDA 1P4RA 1KSFX 3DV0A 5EL0A 1R5JA 2ZYIA 3TB6A 1XU9A 2FQWA 3VU1A 5LDGA 2DZDA 4ECEA 3B1YA 1TQHA 5EE3A 3NYQA 1YNSA 2B78A 2QRMA 1NAIA 1P2VA 3JWJA 3MTDA 1RW4A 2I6GA 4LJ9A 4M21A 1QCCA 2ZIAA 4TTTS 1UJ6A 1HWYA 5HE8A 4AZTA 1CHDA 1R0WA 2AXPA 2EX1A 2N1MA 3NIFB 2YFYA 4JZYA 4NATA 2ODQA 5TPWB 3OEEA 4FFPA 4TVOA 3DVLA 2NTEA 2VPYA 5E1BA 2FW7A 3BZWA 3G2NA 4YV7A 1FXWF 5J4KA 1RNLA 1ZIPA 4MA0A 3Q3EA 3T7AA 3V4ZA 1ST2A 2R1TA 3WGYA 5ITWA 1X1BA 3PD7A 4Q48A 2HHJA 5FEMA 1HNWB 2JA2A 4U3JA 4QG3A 4YQZA 3I52A 2G9UA 4X71A 5ICGA 1IY9A 2CNDA 1NI3A 5ABPA 4Z7OB 1A1VA 4X66B 4BQOA 1OA1A 2OTCA 4H0CA 5CT6A 3JQAA 1SIOA 3CB4A 3L43A 3FGNA 3QFHA 1C41A 2PLWA 3GJXC 4B6QA 1YR9A 1EUCA 2NZJA 4ALNA 4J6FA 4U5QA 1U0RA 2W2LA 3G8CA 3HA7A 3UK6A 2SKDA 1BYIA 2DBYA 4GZ6A 3P2IA 3R9XB 3CE9A 2Z5VA 1DX4A 2H17A 1KI7A 2JFUA 3NBXX 3R20A 3BWXA 3PNLA 3D8RA 4MQ5A 2HRDA 3D2CA 3Q88A 3OIGA 4PLGA 5IS2A 1JZTA 2AB0A 1EB9A 5BVGA 2P4UA 1CQJB 4DDVA 4M22A 3SM3A 3OMWA 3VISA 2XA1A 3T54A 1V37A 4M83A 3Q7SA 3K71B 2IPAB 5CB6A 2BM0A 2C9OA 5LZ2A 1O87A 4KN8A 4OUDB 4UARA 5IM4A 5DJ5A 4E31A 3N75A 4JXZA 1YBAA 3SR3A 3AEUB 4GOKA 4I55A 1E6EA 2HRQA 3Q0EA 1W1WA 4NBLA 1R12A 4C2AA 2QNBA 4OH1A 4UXIA 1F2TA 4CIYA 5H59A 3SVZA 3U80A 4G25A 1CUWA 1UP4A 1IUNA 1DAGA 3EWSA 2JFXA 2W2KA 2HCBA 3GFBA 3O4RA 3PJFA 4N1AA 2YY6A 2QTBA 3NHRA 3CEPB 3E81A 5JSYA 1ADGA 4AQDA 1BE6A 2VA9A 1MO2A 4C4OA 2ZIVB 4HNQA 4WKCA 3NAMA 4ENTA 4DDWA 3HXTA 4RLHA 3WMXA 5I45A 4TVBA 2C3OA 2K6GA 1V35A 3F90A 1JDSA 1E18A 3KWLA 4OB7A 3QWAA 2EFEB 2XZDA 3HXLA 1RQXA 3EK2A 1CJCA 2C7RA 2VK2A 5E6UB 4YACA 3MTGA 3EXHC 5IJWA 3M6FA 1MC1A 2Z5GA 1QOQB 5AQEA 3ET5A 2HYIC 1R74A 1JB1A 1T3LA 3RIHA 4D57A 4IIUA 3ZD6A 2P9EA 2CGEA 4C1BA 2DY0A 2A0WA 2EZUA 2VZ8A 4LJKA 2MSKA 4JGBA 1LCIA 1GAQA 1F48A 5EOVA 3WQHA 1ZXBA 1M34A 3LHIA 2XZPA 1C7IA 4RU1A 3GBVA 2YXEA 2HMTA 3KD3A 3R8CA 1T8TA 3JRNA 3MS2A 3ZK8A 4NIMA 2H2HA 3F78A 4IFIA 4MR7B 3X1MA 4PAOA 4BP9A 2I8AA 3N6XA 3OE7A 4R71A 5HX7A 2D3WA 2VHWA 3MGBA 4A2PA 3I04M 3O9VA 3WJAA 2I6QA 1SXJB 1KAMA 3C8DA 4XARA 3P9IA 3LYUA 1DV1A 3OURA 4BN4A 3DBHA 4AKGA 1HKUA 4EMBA 2UDPA 2E0IA 1G2QA 1KFJB 1PJCA 1XUOA 1U6KA 2W0MA 3L7CA 4LNUB 4D45A 3OTOB 4DLPA 3L93A 3GLTA 4RXTA 5BW5A 3NHAA 3GRVA 1CUFA 1E3IA 2LDXA 3ANSA 4G67A 2WLTA 4X1OA 5EZYB 3RIGA 4RF3A 3R41A 3O0DA 2XV1A 1QBGA 4NXNB 1G5HA 1PJZA 3HDHA 2AVDA 3RG2A 3UN1A 1ZKDA 2OM2A 2PL5A 2WNSA 1ZU5A 2YR0A 1T5BA 3TVDA 4BE9A 4CKCB 5D3MB 2X8WA 3FCSB 4YT8A 3TWOA 2G28A 1GRQA 1WAMA 2CDNA 2GBLC 1NU6A 2MSDB 2ZK7A 3CNOA 1OPRA 4OP3A 3AI3A 1JH9A 5FX2A 3AW9A 4R2JA 5DNYB 4ZT3A 3HRHA 3W8FA 4Y2XA 5M34A 2DFDA 3LFHA 4ZREA 2AX3A 2W2QA 1OKKD 1A9RA 3DZJA 1QZXA 1VL6A 3EVFA 1QHXA 3HCWA 2C8LA 3P0FA 3Q11A 4PZZA 1GGEA 2R4TA 1QHEA 3TEFA 4D9CA 1P19A 3HDGA 2B20A 3B3AA 2HUPA 2I7TA 1J2YA 1C3XA 3PI7A 5GQSA 3KZMA 3VH1A 2QVGA 3V3TA 4WFJA 4HDRA 4CMCA 1U2SA 3PCRB 3UJPA 2HXYA 3U2QA 1DFIA 5AJWA 4BNIA 3EIWA 3MZ0A 4GMKA 3IA2A 3MT7A 3QBEA 4JL6A 4B44A 5HUQA 2C4TA 1A5BB 1D6SA 5TS3A 5KTKA 2HV8A 5G41A 2FFHA 3C5CA 1G4AE 4OQNA 3SKXA 4BS9A 7ABPA 1SHLA 1EVYA 2Z9CA 3DTVB 4F3KA 4UFPA 1BJKA 1SKMA 3ROGA 4RBNA 1VZ3A 4JASB 1JAIA 3JWIA 5JSZA 1OYWA 3EHEA 3OF2A 2ZS8A 4IIDA 1QZUA 1X3LA 1RVV1 1V1MB 1OI3A 1Q19A 1QRDA 1KC3A 1S2IA 1T24A 2WABA 2FQXA 2WYUA 3DOEA 3FDXA 3O38A 3DMTC 4KW7A 5ED0A 5EKSA 3RG8A 4EVQA 3S2SA 1KH1A 1PT8A 1P4AA 1J2JA 4MWTA 1NLMA 3I9V1 2C9MA 4G5OA 1KQPA 4TKUA 5SZKB 3CRZA 3SSOA 2B7LA 1WY5A 3A3YA 4QGGA 3UAVA 4L95C 3H0CA 1VJRA 5FBHA 4O2AF 3AVWA 1GFSA 3KU1A 4G84A 1ZWLA 1XDGA 1HFEL 4GG1A 3H3JA 4IUCS 2BM8A 5J4LA 1TEVA 3F0TA 3OO1A 1AQLA 4EF4A 3WB2A 3ETDA 1OMOA 3UICA 4M6WB 1B1CA 5LQSA 3QNMA 4KPUA 2RMKA 1E4YA 2V6FA 4LDJA 2ZRCA 5DHSA 3KOZA 4P58A 5JD6A 1FB5A 3F3YA 1W6RA 1RR6A 4YHBA 1KY2A 1MHPA 1BJRE 2XMCA 3MWJA 4FR0A 4LCJA 4NAHA 1ENOA 1AKUA 2CB0A 3KTFA 4R2XA 4CMEA 4URYR 1T2VA 1XLUA 4UNSA 3QH4A 4B4WA 4XGQA 6GPBA 4ND2A 1XB2A 1WDMA 1V4BA 1YB7A 2A35A 2NW6A 3SC3A 5CNIA 4PGHA 1GPYA 2P3QA 3GYGA 3NT2A 3GFQA 2DCMA 2XJ4A 1QTNA 2FPWA 2GM9A 1N6RA 5FNVA 3V8EA 2QLJA 1C80A 5A6SB 2CYBA 3C5VA 2HU2A 3HB7A 3MAJA 4H3VA 3GK3A 3TN7A 4KVGA 1N2HA 4LE2A 4ZO7A 4LFAB 3KZOA 2D8AA 1WDLA 3BAZA 3U26A 2Q1WA 3O8QA 5DI3B 3IUNA 3MHTA 3HKCB 3PYLA 3PFIA 3GDFA 2UKDA 5E1MA 4QRDA 3NTQA 4ZVPA 4Q9JA 1ZWKA 1GZUA 1TPZA 2H1LA 4IDHA 2HO5A 3RK1A 3UM9A 3ZE6A 1JEOA 2A9OA 1MOQA 2QJWA 3FN4A 1RBZA 3GEDA 4OHYA 1AQUA 5AW7A 3SYNA 2N46A 3GRFA 3RO7A 5JPDA 1XRMA 5SICE 4OV6B 5CBPA 1I4LD 4H3HB 4Z4FA 1M2VB 1JPVA 2EEZA 2WFLB 3Q2KA 4JT4A 3QELB 5CJJA 1FPQA 2D3TA 1XP5A 3GMDA 4Y1RA 5F73A 1ANKA 1Y8AA 4CL3A 5ESWA 3IVCA 1G8AA 1OTHA 2E1PA 2X7JA 2QAGA 3TMKA 1Z0UA 1U02A 4OB8A 3QUCA 2OZLB 2POQX 4IOKA 4XFDA 5DEOA 4I50B 3UANA 4AZ3B 5C3MA 1N0WA 5EIFA 1YJQA 1CS0B 2CLHB 1GNRA 2RONA 4M1OA 3STUA 1P81A 1L3BA 1TYEB 2FEMA 4GNKA 4MYSA 5I5GA 5BUQA 5HUHA 2GCGA 3DKKA 2JGDA 3OAAD 4MB0A 4PWZA 3PHIA 3G59A 4PICA 2WM3A 1BOFA 4CT0A 4AF8A 2PANA 2ZAMA 2YBEA 3JALA 3KDPA 5EWLB 2ZJ1A 3G6KA 4DLYA 1BHSA 4Z7NB 3L01A 3GEEA 1GQYA 2XMPA 4KR0A 4B4KA 2JLRA 4CMIB 3OECA 1JIQA 1QYVA 2JGEA 1XDWA 4PFQA 2RIRA 2HYDA 4GOLD 4F93B 2H85A 2CCJA 4FFWA 4BNWA 1AZTA 6Q21A 4WERA 2GZSA 1JQ5A 3QVJA 3R6WA 4IGIA 3EZNA 4DIBA 1NUUA 4REMA 1LBTA 1SVMA 3CIFA 1NFFA 2NQ8A 4R3UC 3RUEA 3T41A 4UTXA 1A69A 5A3VA 1A8SA 1MXFA 2KWIA 3L7IA 2Y1EA 3ZNPA 1A50B 3G89A 3PQCA 2WI8A 2BHLA 3N0XA 3QLUA 4R2HA 1G3IA 4D97A 3PC4A 2O2DA 5FWYB 3SEAA 4UHKA 4D26A 9GPBA 2IEZA 2DY1A 1JT9A 2GCIA 3O94A 4LYHA 3L8FA 3LYHA 4N3CA 4QYSA 3JVIA 4QE3A 3ZWNA 2PJRA 1GPAA 1FUIA 1PX2A 5BRNA 4RY2A 2WMOB 5EUQB 1Y3DE 1YRYE 2LE0A 3GJ7A 4CUZA 2Z4TA 4YROA 5IHXA 2FEOA 3ETNA 1NSYA 1MO5A 4Y6SA 3T1OA 1IATA 1TMGE 2Y93A 2FN7A 2MTBA 4H0NA 5K0SA 2XIJA 3IAHA 1ECFA 1ZH4A 4JLKA 5E3IA 2AL7A 1PBTA 3KUCA 1D9ZA 4YCBA 3WFIA 2ZB7A 3DXYA 1YRHA 4C0HA 3HADA 2OFPA 1UDCA 1TEHA 1NJ2A 1GZVA 4FEEA 4HFJA 3SE0A 3RIYA 5HZKA 3QXXA 4WN9B 1ZGBA 3JARB 2NP6A 1JDNA 2ZJ8A 5HQJA 3MJTA 4HQ6A 2DT8A 4Q1CA 1L8OA 3NXKA 1LRJA 2PWZA 3BWCA 1SOUA 3EFHA 4NLLA 1IHOA 4V0QA 5CA0F 1AQNA 1Q95A 2PKQO 4GFDA 5HP4A