2G77B

Crystal structure of gyp1 tbc domain in complex with rab33 gtpase bound to gdp and alf3
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
173
structure length
173
Chain Sequence
RSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase-activating protein GYP1
publication title TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase activator/protein transport
total genus 52
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2g77B00
1Z0AA 1QG2A 2OV2A 4NBSA 1CRQA 2ONKA 1KK0A 2PZEA 3TW4A 3BB4A 4M1KA 1N0VC 2YOGA 1D2MA 1TX4B 1E3MA 3LBIA 1T4GA 3IILA 1R7RA 1JR6A 3AEZA 1QHIA 3FFBA 4OK5A 1E9EA 1TQ2A 1M7GA 4YLGA 4QGFA 2G1KA 2BMEA 4D4MA 3RYTC 3QXSA 1N3BA 2O8FB 2YOFA 1KJWA 2JA1A 1W4AA 3Q5EA 4ACBA 1NLFA 2GK6A 1U99A 1BO6A 4MQBA 2IF0A 2R65A 1WQ1R 1FQKA 2REXB 1J2JA 4LBWA 2HYIC 1H65A 1ZD1A 4BFSA 5FI0B 1XFAA 1DAFA 2JLRA 4OQXA 3AVVA 3GLIE 4DLRA 1E2HA 2QPOA 4Q48A 4KV9A 3GEIA 1LTQA 2WPDD 3MWLA 1CR2A 1OIVA 2WSSA 3IIJA 5FUVA 3NHAA 1AQYA 5JHGB 4EQ6B 1IBRA 4MYHA 2ZRNA 4PPGA 1N5LA 1OKKD 2C99A 3EC1A 5CIQA 3ZVRA 4OQNA 1G5PA 4P4TA 2CK3D 4JLAA 1TEVA 4LHVA 4U00A 4A2WA 1IONA 4B3DA 4BEJA 4LHXA 3DM5A 4TLEA 1N6OA 3FMFA 3VMFA 1DTSA 2RGEA 2XNSA 1QVAA 4GOKA 3RDPA 4U02A 3K9NA 3LD9A 1W46A 3M0EA 1M74A 4AKIA 4IVQA 4ON9A 1M7BA 2CBZA 4NTZA 2R6AA 5M04A 3KL4A 1N6IA 4V0ME 2W2TA 3SEAA 3GPLA 3SQWA 4TMXA 4U5XA 2NMVA 4B74A 4LGMA 1GRQA 1QF9A 2PZFA 1KO8A 2D2EA 4Q7KA 1SQ5A 3LW8A 3TAHA 1XP8A 2QA5A 3G5UA 4F91B 5JRJA 1E9RA 4Q66C 5ANRB 4YQFA 2QAJA 4URVR 1KMHA 2OUKA 4FINA 3ZIAA 5EE1A 2GEDA 1ZW6A 1IM2A 3U60B 4TZ6A 1M34E 3Q72A 4RD4A 3RHFA 1KMQA 4HLUA 5J47A 3VX3A 4BASA 3M6AA 4DIEA 5FBQB 5H8WA 2EFDB 2QMOA 4LJ9A 2GBLA 3FHOA 1F2TA 4TYNA 1Z0DA 4K46A 1AZTA 3OEHA 3A4LA 4RCYA 2F1JA 5DHAA 2ZYVX 4XIGS 3UMFA 1RJ9B 1GM5A 3GJ6A 2DFLA 4CZ2A 2EU8A 3QXHA 5SZIA 5JWRA 3T1TA 2ODBA 1G19A 2OLKA 4B33A 1NI3A 1R5OA 4WIAA 3X1ZA 3U61B 1F48A 1S9HA 3EWAA 1S0UA 2IUSA 4TYPA 2WBLC 4ESHA 3GLHB 2CDNA 5GJBA 3U5ZB 5FOTA 1KIMA 3ZLJA 5CYPA 1FP6A 4GP6A 2RHMA 5SZJA 3ASZA 3L8ZA 1G20E 2L0XA 2ZR7A 3PUYA 3RABA 4AY2A 4DT1A 3SJAA 2HT6A 5EUMA 2FOLA 4QHYA 5CYOA 3K9HA 4CF7A 1XD8A 2GZAA 4Q1CA 3B9PA 2QN6A 4W5WA 3H4MA 1E2PA 1G6OA 1M7HA 2OHFA 2OESA 1QBKC 2BV3A 4ESVA 2IF2A 3H86A 5DYGA 4BFYA 4QJ3A 3QNUA 4LPSA 1GVNB 2OAP1 4CEJB 2HUPA 4MDFA 1P5ZB 3AVQA 1E69A 4R7ZA 3SOPA 1J8YF 2XTMA 4KXFB 3BOSA 5HE9A 1Z28A 5FBRB 6Q21A 5GVSA 3B7GA 2J0VA 3I4LA 2R44A 1US8B 1LF0A 1AK2A 2JJ1A 4Q1EA 3ZIAD 3KTAB 2QI9C 1UKVY 2R62A 2WWXA 3B82A 3D7MA 3PVSA 4IXMA 3I8XA 2DB3A 4F4JA 5HPYB 1E2MA 1G8PA 3IO3A 2ZE5A 1E2DA 1G7CA 1AKEA 4RZUA 3X2SA 4JKIA 4TTQA 4GZMA 3GLFA 2FGKA 4B34A 5CDFE 3D6TB 2ZI3A 4M1SA 4IW3B 2LCFA 3OEHD 1ZBDA 4QRHA 5AUPB 4D2IA 5JI3E 1KTVA 1G3RA 1YU9A 4TLAA 5A5GA 4KFSA 1T3HA 3TE6A 3CX8A 3AUXA 2IS2A 1KKMA 2ZTSA 1Z29A 3P1JA 4W5JA 1U98A 2ZETA 5DIFA 1N2CE 2QAGA 2BC9A 4BLPA 2BBWA 3GCGA 4DIDA 4URUR 1S8FA 4KJZA 1KO4A 4YONB 3QVUA 5J4HA 3W3ZB 4IEIA 4ZO4A 3SI7A 4NCHA 3AKDA 2FSIA 3CRMA 2GEVA 4Q03A 1SXJC 3HU3A 2WSMA 5EP3A 2BJWA 4WA7A 2VH5R 3QUSA 1RRGA 2IXFA 2NO6A 1F6BA 1Q57A 2OCPA 3QXCA 4JL8A 4TQ9A 5EP1A 5EXSA 4B73A 2AHOA 2X77A 3AP2A 1M6NA 4LJ7A 3WRXC 4KCGA 4XJXA 2MMCA 1YHNA 1R8QA 3W90A 3SC3A 2RGXA 1S9DA 4PO1A 1YR7A 2KI5A 3KKNA 3HU1A 5CJ2A 1W36B 3P4XA 3U44A 4MRPA 4I4LA 3IPXA 2OO7A 2BBSA 4ZIRB 2Z6VA 4C0HA 5BN3A 1PJRA 5D3MB 1Z07A 1ZJ6A 4AYWA 2C03A 5FTMA 5FBWB 4JBYA 2JJ1D 5DI3B 1Q1ZA 2ZRFA 3DEFA 3PUXA 5FPKA 3U4QB 3B1YA 3KXLA 1G18A 1Q0UA 4HDOB 5GJWC 3BERA 1N6KA 4ITRC 5E7IA 2HV8A 4CEHB 1MKYA 3AKYA 1W5TA 4US0R 1DO2A 3DMDA 1NIPA 1XJCA 2ONJA 1UKZA 1E9BA 1AQUA 3ZJYA 4LBVA 4Q4LA 1EFHA 2IBMA 3FDIA 1FFHA 2J7KA 1JXMA 2GXUA 1ZCBA 3MWKA 3PFIA 5AK0A 5JS7A 5EZ6B 3TKLA 2H1LA 2NZJA 4BLOA 1XPOA 1KNQA 3UIEA 1II9A 1G4AE 4NYJQ 1W0JD 3CIOA 1E1RA 4Q19A 5LB4A 1Z6XA 4JBXA 4A2QA 2D4HA 4TTRA 1B23P 4BLRA 3GFOA 4JLOA 1P62B 2ZU0C 4HB4A 5G53C 2GF0A 3PXGA 3SHFA 4Q1FA 1SHKA 3ASYA 3CH5A 4M1TA 3GJXC 4QFMA 3VTKA 1XEXA 1JALA 3CNLA 3AF1A 1IOZA 4PZZA 1GNQA 1KI6A 2WJHA 5F9FA 1SVMA 1VHLA 3MGCA 4ARZA 5CB8A 2Q3MA 3KQLA 2YOHA 1Q1EA 4L16A 3TSZA 1RPZA 4HB0A 1VYUA 1XX6A 2R6FA 2AXNA 1G21E 4O3MA 3PENA 3CRRA 4UKDA 3K70B 2VP9A 1R5NA 3CUEF 2BBTA 2ZJ2A 4LJYA 1NY5A 2BMFA 4MRNA 4QBIA 2PJZA 4XOIA 4JVMA 1CIPA 5IHPA 2HJVA 5G41A 4O25A 2QP4A 5JEEA 5TXGA 2V1XA 2P6RA 4AKHA 2NO0A 1V5WA 1XMSA 4YDSA 2FPKA 4FCWA 2V7QA 1XD2B 2CHVA 2W6IA 3OIYA 1XXHB 1T3LA 1SKYB 4JT4A 3AVUA 2W00A 1GTVA 2J45A 4NDZA 5KTYA 2E1RA 1G7TA 4WW0A 4HAYA 3R8CA 2ORWA 3DVLA 4B6EA 4B3FX 4CDGA 5JWOA 1OFTA 1RW4A 2EVWX 1ZM3A 2EYQA 3TK1A 4JVNA 1ZUHA 3GLHE 3QEOA 1YJ5A 4PC3A 4RFSB 3TIFA 4FMDB 3KJGA 3QKUA 3PIRA 3AVPA 3ICQB 1TF7A 4IEEA 4GMXA 4BFVA 4MRSA 4C0LA 4G0NA 1FNNA 1E1RD 3T61A 4OI1A 3HWSA 1GNPA 1A1VA 3L82B 1KK1A 1Z63A 5BN5A 1CKEA 2ZR9A 2OILA 1WBBA 1YQTA 2GA8A 2ZYUX 3AUYA 4Q7JB 1GL9B 3SU8A 1NBMA 1IN5A 1TQ6A 2BDTA 2QENA 1Z0FA 2YWFA 4Q18A 5E7JA 1Y3AA 2OBNA 5EE0A 3A36A 1PLLA 4M1OA 4C0AC 3THXB 1FNMA 2VSOA 3OE7D 5AJXA 5FPTA 5IK2A 2PT5A 1W49A 2A7QA 3QIAA 1ANKA 1XBTA 3NBFA 5DN6A 3IPYA 4B76A 1A7JA 1U9IC 2QE7A 1SVLA 2G9NA 2QPAA 3O8BA 4XWOA 3CF0A 3T1QA 3SBDA 4C7OA 5FUXA 1G8HA 1SVSA 4GFDA 4B75A 5AJYA 1FL9A 4A0HA 1SGWA 4P3YA 1YE8A 1S4QA 1FQJA 1DBSA 3BFKA 1HA3A 3QF4A 4TLCA 1T0JB 1NL3A 1WMSA 1NMXA 2C8VA 3E1SA 3WYAA 2ERXA 3GLGA 1DAMA 3OESA 3ZVNA 2V7QD 1G7RA 1U8YA 1VKJA 4YMVA 3AVWA 4D0LB 2Z4SA 1ESNA 2ZSDA 2ECKA 4DBLC 1DAIA 1GP2A 2BM0A 1TMKA 1XF9A 2Q3FA 221PA 4Q4HB 2XNDA 5CM9C 2W2VA 2Q9AA 2D62A 4IFBA 1XD9A 5L3SB 4EJSB 1JNYA 2XGJA 5E95A 2VHJA 4LOAA 4Q9HA 2CJWB 3VFDA 3VQTA 2ZRKA 3ZH9B 2V6JA 4A4DA 1CRPA 4HYYA 5AUQA 2H57A 2ZSFA 4HLCA 3V4RA 2ZI7A 2V4ZA 5EXXA 2GRJA 2V9PA 2GJ9A 2XJ9A 3FMOB 3FVQA 2VHUA 2FWRA 3AV0B 1DVRA 1KJYA 2V54A 5H1YA 2FJUA 4AI6A 1E0JA 1KDOA 2FNAA 3TNFA 3A1UA 1E98A 2FU5C 4JLMA 1HYQA 3L0IB 3WMGA 2CLSA 2H16A 4JLJA 1HURA 1WRBA 2ZS9A 3VR1A 3VHXA 1ZNXA 3CRW1 1RYHA 3IQXA 1P9WA 2GILA 3PJRA 1K5DA 2CE7A 2N46A 4URYR 1KO7A 2BMJA 2IC5A 1KOFA 2NPFA 3ZGXA 2VHCA 5IK2D 4EPVA 4ZV4A 3T5GA 5DN6D 2QE7D 3BXZA 4L9SA 1RRCA 2XZLA 2ZRBA 3DHWC 4D0GA 2PCJA 4V0NA 4GBMA 3U7FB 4B32A 3QG5A 2OBLA 1VMAA 4IVPA 2ANCA 2OZEA 2WKPA 4NP6A 3KB1A 3RRZA 3SE0A 4EPWA 4V03A 1FW6A 4EPTA 4OK6A 4RY2A 1TAGA 3GLIB 2CLDX 1P2SA 4TL9A 5HKKA 2F3TA 1E2JA 2GJSA 4LDJA 1OF1A 4AKEA 2G0NA 4YMWA 4A1FA 1HH4A 1N5KA 2E87A 2G0TA 4JL5A 1XMJA 3BORA 3THYA 2XNDD 3SYLA 2ZRIA 1SVKA 4PZLA 5JJLA 1XDBA 4NU0A 2XB4A 4DDWA 1TADA 1E2GA 3DM9B 3WBJA 3JVUA 4NYIR 1NLYA 4CRWB 1T6NA 2C04A 3TR5A 4B6FA 2BCGY 4DUGA 1NMYA 3R20A 4LV6A 4PQFA 5DISB 2RGNC 4LWZA 3THWA 2NIPA 3MRSA 3VR4A 2Z0MA 4LHZA 3LXRA 1EX6A 1DADA 5DYIA 1FPMA 3GEEA 1Y63A 3U3JA 1VHTA 2C9YA 4C2UA 1VG1A 2VF7A 3ZS8A 2RMKA 3QOFA 3RS2A 4CVNA 5JWHA 1XJQA 2JIZA 1MO5A 4WBSA 1KSHA 2O8BA 1Q21A 3FKSA 4G5RA 5GJVC 3K0FA 5F98A 2D2FA 3QBTA 1JB1A 3QKRA 2VSXA 4XSHA 4MGZR 4BLSA 4ZCMA 1Z47A 2GJKA 1DARA 3BFVA 3TRFA 3Q7QA 5KNBA 3IQWA 1ELOA 1BMFA 1WDTA 4GOXA 1ZRHA 3HYTA 4IXNA 5AUOB 2G6BA 5HKKD 1E9CA 4H1UA 3AVYA 2WAXA 2OG2A 1XNJA 1YRBA 5IRCD 1JR3A 4YMSA 1GRNA 1QG4A 1E2LA 3LQRA 1UJ2A 4RSGA 1NLZA 2J87A 3QVVA 1UKEA 4D0NA 1F2UA 2QPTA 2XJ4A 5C46F 3W8NA 5FBVB 3KUDA 1UF9A 3F5FA 1SVOA 4HATA 1CULC 2VPPA 2BBOA 4P4SA 3GEHA 4NCKA 1BS1A 4U7DA 4KAXA 2R6DA 2XOKA 2GCOA 5KSYA 2HF8A 2ZRCA 1RRFA 3GJ4A 1YZKA 4II7A 4Q1AA 4DUGD 4G5OA 1E0AA 2GAAA 1W2GA 1CJUC 2YINC 1TEXA 5HZHA 1KAOA 3O8RA 3C16C 5HE8A 2HCBA 1ZM2A 3RSOA 1R2QA 3ZZUA 5TARA 1XTQA 2GTPA 4RD6A 2H92A 3SYNA 3WP1B 4MYTA 1W36C 1EFTA 3GJ3A 2IS4A 4Q21A 2JIZD 2IWHA 5JJKA 4ZKEA 4BRWA 4CW7A 3TW8B 3CKLA 1XPUA 1QVRA 1JJ7A 2B21A 4CIDA 1CR4A 3WHKA 3CH4B 2BVNA 3T34A 2GXSA 4NKRA 1GITA 4QM7A 3CX6A 3V4FA 1P3JA 1BMFD 1JPJA 4GSYA 4C0KA 3LFUA 1W2HA 4YMTA 1L7VC 2FPMA 2WWWA 3I1FA 4BWYA 5AJZA 4ZI2A 2JLUA 1O3YA 5E3HA 1JR3D 3B1VA 2JLYA 1VYVA 3VR6A 4I99A 1BYIA 1A82A 2QTVB 1L2TA 3T35A 4X8LA 3C5CA 3RAPR 5E7MA 3LO5A 2HYDA 2IHYA 4M2LA 4KBGA 1RKBA 2EFEB 1J90A 1S2MA 3HR8A 4JS0A 4TL7A 1KI8A 3ND9A 2ZEJA 2RAPA 5FPSA 1E2KA 1OV4A 4NMMA 4PQRA 4M21A 3EIHA 2XEXA 2R2AA 1EG7A 1YZTA 3MD0A 4TQUS 4I1VA 1P2TA 1D5CA 1JAHA 2HXSA 3QSYA 1YRAA 1HEIA 2HLDA 4UJ3A 2J59A 1OJLA 2FMXA 2D7CA 3LAWA 3RLFA 4EFNA 5AJVB 1EFUA 3AGQA 2A2ZA 2GHIA 1XCPA 3QKTA 2HXYA 2ZIAA 3DO6A 4IVRA 2AN9A 4V0LA 1UBGA 5JMTA 4O0MA 3S1AB 3HP1A 4UNSA 3K70C 2C2HA 2J0UA 4C3ZA 2ANBA 1RC8A 4OBEA 5KHOC 1WCV1 2WAYA 3NDPA 2OM2A 1G7SA 3BC1A 4AURA 4BFZA 3B13B 3LVRE 1T91A 1U0JA 2ZI4A 2VA8A 1X8LA 2KSQA 3QKSA 2WWYA 2O8EB 1OPXA 1XTRA 3X1WA 3MG9A 2I4IA 4QC2A 1U9IA 3QI2A 1LFDB 1X8KA 4ZPXA 1G291 2PZGA 4A92A 1NN3A 4DCSA 3QG1A 2SHKA 4PAMA 4HAXA 2QG6A 1E2QA 4M9QA 4Q7MB 4E5UA 2O8FA 4RVCA 2O8CB 2W58A 1GL6A 5KDDA 3MWYW 1II8B 2W6JA 2OXRA 2RH5A 4A9AA 4BECA 4UXHA 5BW8A 2C78A 2OCBA 3HPRA 2ZREA 3LX8A 4Q4JB 1MRSA 1XTIA 3M1IA 3NBXX 4OQMA 2F1RA 1FZQA 4N3NA 3FE2A 5KSPA 4EUNA 1OH7A 4LC1A 1AS3A 2VP5A 3N2EA 2BIFA 1WB9A 1NSTA 4XSGA 4UJ5A 4C0BA 4D25A 1ZYUA 2HLDD 4QXAA 1QRAA 1U2RA 2FZ4A 1XCGB 1ZUIA 4P32A 4YXWA 4MKHA 1GILA 3BD9A 3RWOA 4DCTA 2B8WA 1F3OA 1KMHB 2ZJ8A 4HZUA 3FFAA 3F3YA 5BYJA 4LBYA 1Z0IA 3QENA 5FOUA 4B35A 1S1MA 3QPUA 3VKGA 3P32A 1COWA 3A1SA 1ZNYA 3CRQA 3U3MA 1YR6A 1ZCAA 2BMDA 2F9LA 3VKWA 4PO9A 1U94A 2QGNA 4PPNA 3EWSA 3MSXA 4TMKA 4US2R 3WXMA 1CR0A 4FWTA 2B7CA 2ZJZA 5BN4A 3AVTA 1TF5A 2P67A 3TUJC 2FPLA 2OFOA 2J7PA 4DVGA 1QZXA 1JR3E 1Q44A 1E2IA 2F43B 3NEJA 3PITA 4Q5IA 2WSSD 2A78A 2WOOA 4KLZA 4TL6A 1FUKA 1UEJA 1NJGA 1ZM4A 3I73A 5B2ZA 3U3RA 3TH5A 1VCNA 4PC6A 3P26A 1W0KA 4JBWA 1FP7A 2IYXA 4POAA 1NP6A 4OHWA 1DAEA 3G0HA 2W6JD 4HDQB 3L0SA 3EZ7A 1P4SA 2EWVA 4HLDA 3SR0A 4HUTA 3IHWA 1G1MA 3BE4A 2QMHA 4XWKA 3SHWA 2AFHE 2LKCA 4DEXA 3AQ4A 1RJ9A 4ABYA 4KSCA 4N0EA 1R4AA 4M8NE 1Z6GA 3BFXA 4JLKA 2JAQA 4S35A 3PUWA 5FTNA 3TSWA 5GVRA 4AG5A 4ASUA 1KDPA 2ZSBA 4OQFA 1QHGA 3C7KA 2PL3A 4JLPA 1DEKA 1D2NA 1R10A 4Y0VA 4RD0A 4AC9A 1IN6A 2WWIA 4YXWD 3UMSA 5FOVA 2GXAA 2G77B 1KI4A 2QORA 2P5TB 2FFQA 2FN4A 2Z4RA 3A1TA 2KE5A 3BAFA 5J5CA 1KDTA 2Z43A 1G17A 4FCTA 4BUJA 3TLXA 3TJZA 2CVFA 2XZPA 2YV5A 4LUCA 4IOJA 4B43A 1COWD 2GJAA 3EXAA 3T1VA 4Z8YA 2RGNA 1Q20A 2QSYA 3B5JA 2A30A 2RHDA 2V6IA 2PT7A 2CCGA 2DWQA 3FMPB 2GZHA 4FMCF 2XXAB 4US1R 1KI2A 4J0QA 1FX0B 1ZVQA 2TMKA 5K8LA 2CXXA 3EPLA 1NF3A 4CEJA 5BXQC 1G3IA 4NPHA 2ZITA 3HYRA 4B2PA 3ZQ6A 5CIWA 3UWKA 4URZR 3HJNA 4GZLA 1US8A 5FTJA 5JSZA 3N5CA 4KYIB 5HZKA 3UG7A 3KTAA 1Q3HA 3UANA 3CLVA 2C9CA 3R8FA 2OFWA 1W0KD 2PX0A 2ZUDA 2K5UA 1G5RA 4N1AA 2A9KA 4DJTA 1EK0A 3MUFA 5EZ5A 1ZINA 3OEEA 1IJFA 1GOTA 2CCJA 3ADCA 3K09C 1QHYA 4C0SA 3CPJB 5JI2E 2JLXA 3PEVA 3ZVMA 3PUZA 5JECA 2FG5A 3H1TA 3PCRB 1CBUA 1N0UA 4UXJA 3JVVA 4ASUD 3W5JA 3NBYC 1GKYA 3OFNA 1ZC3A 2W0SA 1JAIA 3KXIA 4A15A 1OH8A 3G82C 3KKMA 1N5JA 2CLCX 1QHNA 4LJ6A 1XMIA 4D6PA 3ICEA 5FOSA 3WMEA 1QHSA 5EUQB 2PLRA 4YDHB 5K8IA 1T3SA 3FTQA 1G5TA 4QNRA 3TSOA 4A6XA 2YC4C 4A8JB 1X6VA 1C4OA 4RD2A 1P61B 2CCKA 1P2VA 3SJZA 5EXPA 4EKDA 2YVUA 3VKHA 1NVVR 3IBGA 5TV2A 4Q02A 2GVDC 2WV9A 3MJHA 2ZRHA 4DLUA 1E2NA 2DPXA 1KY3A 3OIUA 2IYVA 2HJGA 2VQSA 3U7HB 4L9WA 2VSFA 3LQQA 3CR7A 3WY9A 3U6BA 2B92A 5FOWA 4ZIRA 4PSVA 1LB1B 5B30A 3MMPA 5D3MA 1MV5A 2AX4A 3KKPA 1P6XA 5DGXA 5DI3A 3GMTA 5B64A 3FYHA 1XWIA 1QHHA 2CEAA 4Q7LA 3U4QA 2O52A 2ZE6A 3E2IA 3AF4A 2ZI6A 3WRYC 3AH8A 3BIFA 2P65A 2QTHA 4CEHA 1Z22A 2ZPTX 3Q8XB 3RC8A 2KBEA 2P3SA 3QBVA 3OEED 4KYUA 4HAWA 2NG1A 3MJRA 4AG6A 2BJVA 2UVQA 2CVHA 4IOLA 1G3QA 3CNNA 1DAGA 1KI6B 1G4UR 4MUAA 1GL7A 5L3RA 2QT1A 4JIMA 4ARZB 1VG0B 3TGPA 1ZD9A 4KHZA 5SZKB 2V8OA 2ZI9A 4LK2A 3K8YA 4JZKA 1IY2A 4PHFA 4AKGA 2ODNA 3BS4A 3OFND 2UZIR 4TMWA 1EWQA 2MSDB 4JSTA 1EFRA 2IEZA 2R6CA 3I62A 2FFAA 5KO2A 4NCNA 4W5HA 5TY0A 1MH1A 3T5DA 3JZAA 2OT3B 4ERNA 1Z08A 4D4LA 3EZFA 4GI7A 1OXUA 5HCNA 2IYZA 1ZNZA 5JBQA 1I4TD 4JVLA 4RJLA 3L8YA 2I3BA 5G3ZA 1IY0A 4DLTA 3C4JA 2HT1A 1GKUB 3NG1A 4KI0A 1KSFX 3TVTA 4CT5A 4O2LA 4KFRA 5P21A 2OBMA 1KDRA 4IFEA 1YZGA 1E32A 3IBYA 2AL7A 4HEJA 4HB2A 5CM8B 4D81A 3SNHA 4PC2A 3AVXA 1MT0A 4WZAE 2WKRA 5EP2A 1N6PA 2Q3HA 1AGPA 1L4UA 2JLWA 2PLFA 3WBKA 2WMNB 1XXHA 1MO3A 1X1SA 3GFTA 4AYXA 4BZXA 2D7DA 4L4UA 3MLEA 2XTNA 1GUAA 3QY0A 4KFTA 3K1JA 1W1WA 2GJ8A 1GSIA 2ZUCA 5JS8A 2MSCB 4YMUA 3REFA 4HUQB 4MGYR 3K9GA 2QQEA 2QP3A 3LA6A 5JRZA 721PA 4AYTA 2PX3A 2OLJA 4V0KA 2ZRDA 2GVZC 1CJVC 1XEFA 2PBRA 1EFRD 1E79A 1W47A 4QJ5A 2ZRAA 3QF4B 2IYTA 1Z6AA 1KNXA 2CHQA 4DLXA 2I1VB 3GLFE 3BGWA 1YR8A 2H18A 3W3AA 1IN4A 1N0WA 4JLNA 1W7AA 1U0HC 4JKYA 5KSZA 2ZM5A 2VP0A 2W6ID 4P33A 2UKDA 3ZQJA 4JLVA 3ZZ0A 2AKAB 4OKSA 1N6LA 3QQ5A 4NYMR 3SN6A 2EYUA 2BEKA 3F0TA 4GT1A 4LC0A 1SZPA 1XCMA 2CNWA 2RKOA 4FWIB 5A0FA 2OXCA 4F93B 3L0OA 1GFIA 2CHGA 3B1WA 3ZD6A 4TZ0A 2FX3A 5LD2B 3RS4A 2JATA 4PC1A 3TR0A 4DLVA 4TN1A 2X2EA 2ZJOA 1HQYE 2V1UA 1JQLB 2EFCB 4G5SA 3T06B 1ZD8A 2QL6A 4D80A 4PHHA 4R2HA 4LY6A 1SKQA 4UNQA 1T0HB 4MKGA 3KKQA 4Q4HA 1E0KA 4HSEA 2B8TA 3K0CC 1G41A 2GK7A 3R7WB 1DAKA 2WWFA 5L3SA 1VIAA 4M9ZA 4JVSB 4UQOA 4L8GA 1CR1A 1NBMD 1NVUQ 3Q85A 3RWMB 3IDQA 2CJWA 4ZKDA 2EWWA 3WHLA 4R71A 2P2LA 1OFUX 3SQXA 2QGZA 1G6HA 2ZJAA 1KYIA 4XVUA 1A2KC 3EAQA 2PMKA 3U2QA 4MDEA 1OE0A 1NN5A 2QT0A 3ZDQA 1E1QA 4ZDWA 3B1ZA 4JJKA 3KJHA 4OI2A 5FPHA 4IDHA 3SZRA 4B3CA 4DRZA 3E5HA 1E79D 1WF3A 3ZZTA 1Q1QA 2YZ2A 3NEYA 2NO1A 5GJCA 1CF4A 4S2EA 2JASA 1ZM7A 4Q4AB 1TF2A 1XZPA 1P2UA 4DB2A 2YJTD 3B1XA 1AIPA 4R2IA 4V02A 4OHZA 4DZZA 4BFXA 1WXQA 3AP3A 1JEDA 3JZMA 1TPZA 1SVIA 1PZNA 4WZBE 4E03A 5DO9A 4FW9A 4M1WA 1EFCA 1FUUA 1U8AA 2D74A 1Z8FA 2CNWD 2Q9BA 3LH5A 4PPFA 1P75A 4WZ6A 2PJRA 3W34A 5DSZA 1OXXK 3LLMA 3WYGA 3LNCA 1MABA 5KOYA 1UAAA 3WNBA 3O47A 2J0SA 1UADA 5DNYB 2LWIA 3GLIA 1X1RA 2IUUA 4NCIA 5JHHB 2GWHA 1A4RA 3B9QA 1R6BX 2VO1A 1NN0A 2IEYA 2QMEA 3UPUA 3THWB 2IL1A 2QM7A 3VU9B 2ATXA 4MRRA 2IYUA 5JEDA 1GDDA 4RKEA 4GDFA 3K0AB 4DLZA 1KK2A 4TYYA 1UDXA 2JJ8A 1C1YA 4LV8B 1KI9A 3BWDD 4I1UA 3EIEA 3BB1A 1FTSA 2HDNB 4UXIA 2Y8EA 4MKIA 2MSEB 1JEEA 2N42A 1OXVA 2PEYA 1VPLA 4MYCA 2QMUA 3C5HA 2ATVA 5KPDA 4TMZA 1SXJA 5TDHA 3VR3A 1E1QD 5FI1B 5LB2A 3K09A 4F7WA 5L3QB 2XB2A 4PSAA 3EZ6A 1P7CA 2F55A 1ODFA 2WJYA 2J9RA 4V0MA 1DO0A 3PR1A 4CGZA 5HTKA 1S1CA 3QF7A 2O8DB 1RIFA 2QRZA 4URWR 4XTRA 5DH9A 5FTKA 3NKVA 4PANA 2WJVA 5KNDA 3DOFA 3ETLA 4CEIB 4LYHA 5EE5B 1JI0A 2ZYWX 1DS6A 3R9IA 2IUTA 1IXZA 1BIFA 2QNRA 4NE2A 1XZQA 1UKYA 3TVDA 1PV4A 1R0XA 2G83A 4E09A 2D3WA 2ZROA 1OH6A 1XTJA 3OIVA 1XB2A 4P4SB 4LZZA 1KSJA 2J46A 3AKEA 3CONA 2WTUA 4OJQA 1NVWQ 1XPRA 2DCUA 2RB4A 5CK4A 4DC9A 4TYQA 3NC0C 1NBME 4C30A 4PPQA 5GADl 4AD8A 4D26A 3W6OA 2GCPA 2UZ3A 2AK3A 5KNCA 1Q3TA 1M2OB 1CU1A 4HAVA 4UNPA 3THOA 2ZI5A 3BBPA 3NVAA 2BKEA 1OYYA 4LJ5A 3VNVA 1OYWA 2YWEA 2NO7A 3NWJA 3UWOA 8OHMA 4XTCS 3HR7A 4DDTA 2ZVQX 4YC7A 3C14C 5CLQA 1GZSA 3ONWA 2F3RA 3FKSD 2VP6A 2Z83A 3SDZA 5TVKA 2H7VA 3P20A 4NH0A 1SXJD 3OAAA 2G1JA 2KBFA 3GJ7A 4Z51A 3MAAC 4A8JC 3RSLA 5BQ5A 1G8GA 1KZ7B 3REGA 3GLGE 4OI4A 1BKDR 3LVQE 4GNKA 3QE0A 4MKFA 1OXTA 5H70A 4I1OA 4RCZA 1R0ZA 2QBYB 3B6EA 5FUYA 4DCNA 2WVJA 821PA 4PO8A 4PR0A 2IS6A 4LV5B 2W83A 3GQBA 4TYWA 3A4MA 1I4DD 3CZPA 3EZ2A 1NRJB 2KJQA 1I2DA 5AWFC 2A5YB 3I32A 3R9WA 3ADBA 3EG5A 5EXTA 1DELA 2NOAA 1P9RA 3AF2A 1OLOA 3AF3A 3K0SA 1TUIA 2JLZA 1F5NA 2P6NA 1NVXQ 2J0QA 1TNDA 1G8YA 5D3QA 4MGKR 4NCJA 2HEIA 1NSFA 2IT1A 5JLJA 5IT5A 5CDFA 1VG9B 2G88A 3KQHA 3A1VA 2ZYTX 1CS4C 4TSFA 1VIYA 5SZHB 2GKSA 2IYQA 2XOKD 3AP1A 3EC2A 2WMOB 2O5VA 1YZNA 3HU2A 4G1UC 3OIWA 4QBGB 1UDWA 1Z2AA 2NGRA 2EFHB 3CM0A 3RS0A 5ELXA 2DFNA 5CLLA 3MFYA 4C4PA 3OHMA 1SVWA 621PA 5KUTA 1FMJA 4BGDA 3I5YA 4C9BA 3B85A 4B44A 1DAHA 2RCNA 3A1WA 3LW7A 4IDQA 4JT2A 2QY9A 5FL3A 4JL6A 2GF9A 3T1OA 3EZ9A 2R8RA 5CITA 1CTQA 1N5IA 2WJJA 1Z6TA 2WJGA 5K8TA 521PA 4RZXA 1D8TA 1G8FA 5B57C 1IY1A 1KI1A 3OAAD 1P73A 3QKSB 5EE3A 4EFLA 3IEVA 3AB3A 4ZCLA 1UFQA 2GNOA 4M1MA 5FR2A 3CZQA 2PCLA 2VHTA 3U3KA 4ILEA 1IJEA 3VHLB 4FMDF 2CL6X 421PA 3LDAA 1UBCA 3I61A 5C2JB 4MH0R 2F1HA 2OCAA 1TU3A 3NC1C 3S1AA 5C1BA 1OIWA 2HF9A 3A8TA 1KO1A 2A5JA 4XD7A 4F4IA 3SS8A 4GOJA 1HE1C 4HZIA 4HAUA 1MR3F 1X86B 2PMDA 4Q01A 1D2EA 1T5LA 1OT3A 4K8OA 3LBHA 1IN7A 5DI9A 1B0UA 2ZS7A 4B48A 2PH1A 3TMKA 3GFPA 1WP9A 5FL7A 2FEOA 1WA5A 3L43A 1J70A 1LVGA 4Q00A 1RYFA 4W7SA 4I81A 5KU1A 4URXR 1GAJA 4NYJR 2O8EA 4IOKA 2DWOA 2WZQA 4DSOA 2NQ2C 2QROA 2QSZA 4TSFD 1CEEA 2FSHA 2RGCA 4EQ6A 2BHRA 2X1VA 3EX7C 2JEOA 4NYIQ 2O8CA 1VYTA 1EWRA 1GKIA 4HZUB 4WOPA 1II8A 1P60A 2J1LA 4PXAA 4FMBB 4A36A 4Q4JA 1SXJE 2OEPA 2AWNA 1KI3A 2VL7A 5LPNA 3I72A 3Q7PA 4LI0A 4KO8A 3AGPA 1OHHA 3BRWD 3K53A 3RANA 3Q9LA 3PV0A 1HT1E 1F2TB 1KHTA 2BCJQ 2FGJA 2ZJ5A 3K0CA 3QXXA 5JCZA 121PA 3K0EA 3WNCA 1OFIA 3X1XA 3AM1A 4PSKA 4KSBA 5JCPA 3CF6R 1W5SA 3NBZC 1W48A 1ONBA 5EP4A 4DWJA 2BOVA 4LJAA 3PEYA 1VTKA 4RKFA 1N25A 4KITB 1OB2A 2RGAA 4IOMA 2AXPA 4DKXA 2VEDA 3B60A 3KDSE 2IX3A 1IXRC 4DCUA 1VECA 4PAQA 4XVQA 2ORIA 2DFKB 4L15A 4DEYA 4XD7D 4GMDA 5LD2C 5BYKA 1JPNA 1GNRA 1AKYA 3W6PA 3PUVA 5FOXA 2IYLD 3DPUA 4PFSA 2J3EA 2F6RA 2Q9CA 2QTFA 1KZGB 5FL7D 1OIXA 4DT1B 2GEUA 2GZDA 2FF7A 1K6MA 4X8MA 3VAAA 1N6NA 2C96A 1ZMXA 3BH6A 3IUYA 3FPAA 2IYRA 2IXGA 2GETA 5KPJA 2O0JA 3IIMA 3VR2A 3L2OB 2F43A 2WWGA 2Q21A 4F92B 2W2XA 2DY1A 2ASEA 2VBCA 1XTKA 3O8DA 3NTUA 3NHBA 3GLHA 2H17A 1OSNA 1WBDA 1Z2CA 3C41J 5DHFA 1OH5A 3ECCA 5A4JA 1JJVA 4LBZA 1W44A 1KO5A 3SJCA 4L5BA 3TAUA 2DHRA 3WMFA 1E2FA 5KSOA 1E0SA 4PAOA 4MUBA 4KODA 3CO5A 2PEZA 3QJYA 4LYAA 2JLVA 1XEWX 1OHHD 3GLFB 2NZ8A 1GWNA 2QRNA 1RZ3A 2VTKA 1HE8B 1ZIOA 3HPQA 5FH9A 1CP2A 2CL7X 5F3WB 2FSGA 2YYZA 3EPJA 1F60A 1NKSA 2AD5A 2JJ2A 2XITA 4QOSA 4BRUA 4B3GA 2J7PD 2J5XA 5UKDA 1DG1G 2P5SA 1W4BA 3BJIC 1MRNA 4A82A 5JSZB 1MOZA 3VX4A 3H2YA 2WKQA 2QAGB 4HAZA 4QBFA 1ZAKA 4EJSC 2RGGA 2OCYC 2YC2C 1HQCA 5KDOA 1T5IA 1E4VA 3RS7A 4FCVA 5B58C 4P4UA 5EE9A 3FHCB 4BLQA 1PVOA 2YHSA 3U6KA 1N6RA 2XXAA 2ZS8A 1FX0A 4P31A 2IK8A 1YR9A 3KJIA 2EW1A 2HCJB 1I4LD 4DSUA 3CWZA 3H84A 2V3CC 4LSGA 1YZQA 2AKYA 1RE0A 3DKVA 2EFGA 3Q3JB 1Z06A 1TTTA 1GIAA 1MO6A 1XU4A 2IYYA 1NKTA 3WYFA 2EQBA 3WP0A 4RFVA 1Z0KA 3EA5A 4FXPA 1W0JA 4UNNA 4M53A 3DDCA 3U44B 1BYUA 4JYCA 4QL3A 2FZLA 1FOEB 2C77A 1WE2A 2DYKA 2RGBA 4M9XA 4E07A 2WICA 4IDPA 5TMPA 4OHVA 3GP8A 3CRVA 1E2EA 2OFXA 1AS2A 3ADKA 3SFZA 2BM1A 3TUZC 2WJIA 2ZAOA 3QPWA 3EW9A 3E70C 3RVBA 1Z3IX 2RGDA 3N70A 3NXSA 4DCVA 2YWHA 4XWAA 4A2PA 2OSBA 3OF5A 3SYKA 4HB3A 4D82A 1BOFA 4N0DA 5H68A 4OQLA 3FB4A 4DDUA 3SBEA 2QEQA 4KVGA 3R9XA 3VNUA 1E9AA 2P6UA 1VCOA 1PUJA 4GRAA 2JLSA 1H8EA 4HDCA 3P4YA 2VP4A 3HDTA 3KJEA 2IW3A 3NH9A 4IDOA 2LKDA 3EA0A 1YZLA 5FFMA 1CJTC 2H8KA 2CE2X 1LF5A 1E9SA 3EARA 4QGGA 4ZDIA 2JJ2D 2NO9A 3BH0A 4LYFA 4Q9KA 4Y0AA 1Z5ZA 1T8TA 1J99A 3V00A 1U81A 3FGNA 3LV8A 3TQFA 4A0FA 4BFWA 3ZVLA 1D9XA 1UEIA 1QHHB 1QHXA 2ZANA 3UATA 4QBHA 2OAQ1 5IF9A 4A8JA 1ETUA 3I3SR 1CLUA 5C4MA 2JLQA 2A3RA 1D9ZA 3PQCA 3OZXA 1PUIA 3IIKA 2JCSA 3W8RA 1NY6A 2Z5FA 3LRPA 1XEXB 1DPFA 1GG2A 5CJPA 5HR5A 1KSGA 2QM8A 4PTLA 4Z8XA 2R9VA 2BKUA 2X2FA 1A5TA 3C15C 1TQ4A 1A2BA 1Z6YA 3DZ8A 5G40A 4B3BA 4EPRA 3GJ0A 4TT3A 2XSZA 5L3VA 4EPXA 2ZSEA 3SFVA 1ZU4A 4Q1DA 2V55B 5J4LA 5LDDC 1FTNA 2C5LA 4RD1A 4OK3A 4LCBA 4WVFA 4NONA 1R0YA 4F38A 4FI3C 3GJ5A 3OE7A 1P9NA 2F7SA 3BK7A 1CXZA 4PHGA 3IHLA 3DZDA 1KAGA 2F1IA 3KUCA 5LBIA 1UM8A 4FN5A 2MMGA 3KKOA 3PG5A 4OYHA 4C2TA 2XTZA 4M0LA 2X8AA 1ESMA 1JQJC 1VG8A 2O0HA 4WAUA 4D4JA 1H8ED 2KWIA 2WWHA 4CYMA 2AD1A 4QNMA 1AN0A 3W6NA 3UXMA 4WXPA 4JLBA 4A0GA 1W36D 1U90A 3CNOA 2DBYA 4M1YA 3X1YA 3BH7A 4QG7A 5IDVA 1HT2E 4KFUA 5JZVA 2VF8A 4GL2A 3H0KA 3A58B 4D4KA 4K81B 3PEWA 3EPKA 4ZCIA 1E9DA 4BEBA 1XD2A 3ZD7A 1Q22A 4ACAA 4UNRA 3QPVA 5AR1A 4H9GA 3SJBA 3RS5A 2C95A 3AKCA 3ADDA 1IAQA 3W9YA 2ZR0A 4DSTA 3FHTA 1G64A 3KZ1E 1ZNWA 2NTYC 1G3UA 1KJZA 1PLKA 5AUNB 1NIJA 4A6PA 2QZ4A 4RFSA 4LJ8A 3DOEA 1PLJA 1HV8A 3UG6A 4HLQB 1KY2A 4FD2A 3W5IA 4IHQA 4C7OB 4TT3D 1EX7A 2C98A 2XSZD 2ZUBA 3D8BA 4LHYA 3EPHA 2ZSAA 4EAQA 5HCIA 1N6HA 4LHWA 3X1DA 2R6GA 3FOZA 2GESA 4TL8A 2E9SA 3KFVA 1LV7A 3QXJA 1L4YA 4BFUA 3GLGB 3KFXA 4JMPA 4Q1BA 2B7BA 2WHXA 5TB5A 4ZI3A 3I8SA 3U7EB 1DG3A 5L8VA 4HUQA 1LS6A 3B78A 3CW2A 1LW7A 5JFGA 2H5EA 1M1YE 4I1SA 1VCIA 3KX2A 1QDEA 4BZQA 4BQSA 4MYUA 3K70D 1NN1A 2IA5A 4IKEA 3RNLA 2IYWA 1C9KA 1SULA 3EIQA 4PX9A 3CBQA 2N1BA 3Q5DA 2FH5B 4P0TA 4ZDKA 3RRNA 2VRWA 1ZM9A 1XMVA 4CT4B 1E9FA 1SHZA 3C8UA 4WXRA 5FR1A 5F2EA 1EGAA 4QGHA 3FWYA 1S3GA 1TQDA 1NG1A 4RD3A 3THXA 1R8SA 4PQYA 4RZ2A 1G16A 2KB0A 3IGFA 1NG9A 1EESA 4M9SA 1S3SA 3I5XA 3M4YA 3RS3A 2FEMA 3FMIA 2FFBA 2O0KA 4M22A 3CPHA 1NMZA 3CWQA 3RC3A 4B2LA 1FMLA 5CB6A 4W9MC 1AGRA 1ZIPA 4QKQA 4DSNA 1RFLA 4TLDA 1YZUA 5JJIA 2GDJA 2AWOA 2VHQA 2FV8A 3PEUA 5J40A 2ZRPA 3IO5A 3B2EA 1Q1BA 4GP7A 4HLUC 3GD7A 3DL0A 2C9OA 4G5GA 3AVOA 2GBLC 4BFTA 2WIBA 5CK5A 3R7WA 1IN8A 1J7KA 3AF0A 4MA4A 3WNDA 3K9LA 1I2MA 1AZSC 2ZRMA 3BB3A 2X19A 3ZYCA 4F4CA 2VLIA 1UBFA 5EJEA 2YWGA 2WIAA 4LX0A 1KK3A 3THYB 5C18A 1D6JA 1U0LA 1YKSA 3IEUA 5J4YA 1KGDA 4IDNA 1DE0A 2F9MA 2ZE7A 2YKGA 1X8JA 4BE7B 3NH6A 2CMKA 3KXKA 2Q6TA 4B3XA 4JSYA 4TQAA 4KU4A 1NVVQ 1MABB 4Z1MA 1E99A 3LLUA 2BWJA 4MGIR 1KKLA 5FTLA 1JBKA 1AS0A 2ZVPX 4Q4AA 4LJ4A 3J81k 3DKPA 2WOJA 1E96A 2QQ0A 2FSFA 3A4NA 4MITA 5AJWA 4PC7A 4BZPA 1MO4A 1BH2A 2FDCA 2B6HA 1UBEA 2GAOA 4PHTA 4FMCB 4TMTA 4Q47A 1ZU5A 2D06A 4RZ3A 2VYFA 4EJSA 5KDLA 4OHYA 3CPEA 4AWXA 2ORVA 3NIBA 4G3XA 4V0OA 4DB4A 3D3QA 2WM9B 1RRPA 3A37A 3KB2A 2O8BB 2IYSA 2JDIA 1VDZA 3K0FB 3L0PA 5J4VA 3UK6A 1SXJB 1OFHA 4B2IA 3T12A 3QKRB 1AM4D 4LYJA 3EASA 4Q9LA 4DDVA 1Z0JA 3GJ8A 3LBNA 4JLDA 1OB5A 4XVRA 4BPBA 2OE2A 2FFHA 1W4CA 5DLQC 1Z83A 4QGAA 4G01B 1LNZA 1EXMA 1NJFA 2DFTA 3VU9A 4AK9A 1NNEA 4DHEA 2DR3A 3ND8A 2P0EA 3F8TA 4DLYA 3U7GA 1GRRA 1ZP6A 1OW3B 1OXSC 1E6CA 1S96A 3K0AA 5C4GB 4KLNA 4C0JA 5J4KA 1TU4A 4JYBA 4FIDA 2IS1A 1LS1A 3P27A 3VR5A 1IQPA 1O87A 4KBFA 2W0MA 1T9HA 4GPTA 2ODEA 2VIIA 1F2UB 1M8PA 2BEJA 3MWJA 4TWZA 2A5GA 5DE3A 2QAGC 2A5FA 3D31A 5E4FA 4Z54A 1XEWY 4NZYA 4H1VA 2ZJBA 3MCAA 2G3YA 1ZC4A 3T15A 5F9HA 5L3QA 1XTSA 2ZRGA 1XXHE 4Z1MD 1SKYE 1K8RA 5KYKA 1V43A 2GCOB 4TMVA 1IHUA 4DXAA 1Q12A 2I1QA 2IXEA 2O8DA 1P72A 4X8OA 1AA9A 2QP9X 4EDHA 1II0A 2QUZA 4NHOA 2FE4A 4ZDJA 1R0WA 3TUIC 4OI0A 4IJMA 4QHTA 4KVAA 4CEIA 3QEJA 1TUEA 2AR7A 2ZRLA 1DOAA 4JJZA 2AFIE 3CX7A 1G3MA 3LWNA 1H8HA 4Q9IA 2CL0X 1X3SA 3LY5A 4MRVA 5K8UA 1J8MF 4A0RA 3CF2A 2VP2A 1R5BA 2JDID 4EPYA 2ZE8A 3LXXA 2ZAMA 4QHSA 5G3YA 1L8QA 2ZQ5A 2J41A 4LPKA 3KQNA 4X8HA 1TL7C 1G9XA 3B8HA 2ZXUA 4XH9B 5FBLB 4OHXA 3KQUA 4TLBA 5BWMA 2ZRJA 2DWPA 2ZU6A 1U8ZA 2GCNA 3V9PA 2XAUA 3CR8A 2IWRA 2YNMA 1KI7A 3UKDA 4TTPA 4HI0E 1HY3A 4OJKA 2AK2A 3FKQA 1HUQA 1K5GA 1JECA 1ZUNB 2XX3A 1AJEA 3NDBB 4M4SA 4NL4H 3TQCA 2FA9A 2GXQA 1JXOA 1VCMA 1XRJA 3U3OA 3N2IA 2IHBA 3I92A 1RVDA 5FUWA 1T8UA 2REOA 3CB4A 2WPDA 4NYMQ 3RRMA 4B47A 4B71A 2Q0HA 2REBA 5FPYA 2QU8A 4EFMA 4BLTA 1HTWA 4DLWA 3A6PC 1LY1A 3O8CA 4O2RA 4G5QA 2QBYA 3UMRA 4QJ4A 1OKKA 2JGNA 2ERYA 1E4YA 4IRUB 4LRWA 2XZOA 2A5DA 1W4RA 3DMNA 1YVDA 1IXSB 4C0QC 4DLSA 1UPTA 3TBKA 3IKJA 4AIIA 4E22A 2CK3A 4OL0A 1CJKC 2ODWA 1CJMA 1E94E 2NPIA 3KQKA 3ZS9A 5EQTA 1H8HD 4QM6A 3RRYA 2J0UB 2ZJYA 4R98A 4R9UC 4EIWA 4PZYA 3LX5A 4Q9JA 1XJ0A
chains in the Genus database with same CATH superfamily
5KOJA 2ZULA 1IJKA 3ABOB 2YIVX 2OV2A 3OWHA 3GJYA 1B16A 1ODCA 2X5XA 3FDFA 3PWTA 4JELA 5F1KA 2CKMA 3R4VA 5TC4A 5TGTA 4HDKB 4J3FA 3NR2A 4P0QB 4GXNA 2ILTA 4TSRA 1Y8RA 1TX4B 1T2UA 3TMYA 1VFPA 3U1BA 4FYPA 1E3MA 2R6JA 3IILA 4PW0A 2POCA 4ARVA 3RRJA 1Q5PA 1HDGO 1CVIA 2G1KA 1NVTA 3I23A 5DLEA 2DFPA 1V7ZA 6YASA 2BHSA 3OY2A 2IBSA 1EA7A 3QXSA 1N3BA 1ODJA 3PRYA 5DRTA 2YOFA 3L8HA 4HP8A 5T41A 2E0IA 3GW8A 1W4AA 3IBCA 3PC8C 3WO0A 1U28C 4A26A 1BO6A 3ENWA 2OTCA 4AJ2A 2IF0A 4FHDA 3JD0A 1SUDA 3SXJA 4BYMA 4C7VA 4F11A 2ECFA 5FI0B 1AUXA 3PNSA 1E1YA 1JLKA 1LBIA 4OQXA 1W19A 2WFZA 3W3AH 2QPOA 5C1DA 2WPDD 4MA5A 1MEJA 3MWLA 3VH3A 5AVWA 1P4HA 3MMXA 1EMDA 3GL9A 5FUVA 4ZI7A 4JI8B 1SOWA 1KQOA 2FWMX 1XV5A 2GZSA 1AQYA 2IP4A 2WVGA 2G28A 2AI2A 5EIOA 4IHKA 4L8YA 3T95A 5JHGB 2WQ6A 4XM1A 1IK6A 2Z9BA 4G0WA 1UBRS 3JQGB 4L5YA 1EXWA 2KLBA 4BTLA 4F2DA 3G5MA 1NBAA 4RGBA 3FDJA 2O2IA 2IHTA 4G67A 2QZZA 5A03A 3VHRA 4IV8A 1X14A 4JLAA 4M0CA 1TEVA 4U00A 1BEEA 2HHLA 1JSCA 2PSFA 3ANYB 3S7TA 4B3DA 5M2QA 1N6OA 3HU5A 1ODLA 3CX3A 5IUJC 3VMFA 5LZ8A 5E7QA 3UWMA 3U17A 3AJEA 2B6NA 3QOWA 3VPDA 2RGEA 4MCHA 5KQSA 1DX4A 4ZQGA 2QMQA 4KMRA 4AKIA 2OB1A 4KB5A 3STXA 4F5WA 2HDHA 4IVQA 1DDOA 4ON9A 3BSWA 2GI4A 4X44A 4TUYB 2BHLA 1SBYA 4BKMA 5M04A 1B42A 4V0ME 5C0OE 3SEAA 4CFSA 3GPLA 2GBPA 1PSZA 4TMXA 2QN1A 4Z86A 5K3FA 4DFDA 3SQWA 2NMVA 3BBLA 3UQZA 5I47A 2EKPA 2PZFA 5BQXA 1ZAYA 3VDQA 2D2EA 2B94A 3LW8A 4MULA 3GMSA 4JX9A 3TAHA 7MDHA 4D3ZA 3SG0A 2GEFA 4YRPA 1A77A 4NV0A 4YQFA 3VSDA 4FINA 3HCWA 2EGGA 2NTVA 3LKBA 2IYEA 3H9EO 3B38A 4I1YA 4Q12A 3UK2A 3Q7RA 1ZW6A 1IM2A 2YWBA 3EXEA 4GVPA 1X2EA 3RARA 1Y4UA 4K6HA 5JSUA 3TNYA 1M34E 3U60B 4TZ6A 3N75A 4G0YA 1KMQA 1UZUA 1CUCA 4HLUA 2GFQA 5CB4F 3CIFA 2HA4A 1AH2A 2EFDB 3RV3A 2FSPA 1RHMA 2GBLA 2NZYA 2JBAA 3FHOA 4MUYA 5CBPB 1EDZA 1AZTA 3E7WA 2O7RA 3OEHA 4R81A 4CF6A 2V7WA 1A7AA 4CQNA 1YMUA 5DHAA 1TA4A 3UMFA 2YVLA 2ZYVX 5F77A 1RJ9B 3GJ6A 4L27A 2DFLA 4CLHA 5JALA 2ZBFA 4CZ2A 1HL7A 1XIVA 2O2EA 2H6EA 2GVNA 3OMWA 5JWRA 1SCQA 2ODBA 1QFXA 4G37A 2M2IA 4LCJA 1NI3A 4WIAA 5AM2A 2FEXA 1S9HA 3PIDA 2PVCA 2O1EA 3A28A 3UGTA 4CL8A 1S0UA 4EUEA 4ZMRA 3N8IA 3CJTA 4V1CI 2H48A 4ZP1A 2RC6A 5GJBA 2BELA 3FOFC 3IP5A 3C5WP 3L84A 2JHGA 3A06A 1CJCA 3B89A 2VUTA 2J07A 4J0EA 3RGWS 2Z6UA 4JR0A 3L4BC 4FNOA 4O1IA 3WIDA 3PUYA 2FW8A 4L4RA 4AY2A 1F4LA 3M4ZA 4XCQA 4AJHA 3K9HA 4Q1CA 2QN6A 3NKFA 4W5WA 3HWRA 2HJHA 2YDYA 4KOEC 1W581 2OESA 1QBKC 3NBUA 2WU3A 1YDFA 2PUTA 2QX9A 2J48A 1JHUA 1KBZA 2CXRA 3H86A 3PPIA 4KI7A 4NICA 1DCMA 1P2FA 4OSOA 4CODB 4F9FA 4QJ3A 3QNUA 1NRXA 2GAIA 2NUTB 2W2PA 3EWNA 3ONDA 4AN1A 4CEJB 3Q11A 4JHLA 1OGJA 1P5ZB 2CXOA 3AVQA 1E69A 5ICMA 4R7ZA 3SOPA 1J8YF 3B36A 1OAOC 1DJNA 2GPNA 1SHJA 4NBWA 5F1YA 1Z28A 5TMEA 4GHWA 3RBXA 3CLSC 5CNKA 3WGZA 9LDTA 3SVLA 5I7AA 2QTBA 3GVCA 3C6ZA 2W6CX 3QOXA 2H1HA 1DIGA 3KTAB 3OUZA 3B82A 3S2EA 5JATA 5CYGA 4KXWA 3Q9SA 3I12A 4F4JA 3U3ZA 1G8PA 4Z53A 1PHRA 3CB2A 3SKXA 2HK7A 5A0VA 1P39A 1H2HA 5H16A 4JKIA 4TTQA 3BGSA 3TEFA 1Q11A 3F71A 4FNAA 4RANA 1GGHA 4G24A 4B34A 5BUZA 5CDFE 5IYZA 2GN2A 2AE1A 2NVBA 2LCFA 4IW3B 4K9OA 5EP1A 3CSUA 3D43A 3LBYA 4KPGA 4U2BA 5AUPB 1TKRA 5A5GA 3KPWA 2PUWA 2YIDA 1IUPA 1JFRA 1T3HA 1XQ6A 3CX8A 3EH2A 4WNYA 2PS3A 3TLAA 4HBGA 2Y76A 1KKMA 4GLBA 1Z29A 3P1JA 2FPOA 4J6FA 4UEWA 4MGHA 4FFPA 3NGLA 4A8HA 1XCBA 3AW9A 1LQ2A 1ISRA 4D9JA 3FTDA 3GCGA 5EHIA 1Q7TA 4KTVE 4J1QA 4URUR 3P0HA 1USKA 3R5KA 2IZ1A 3LCVB 3DZJA 4L5IA 2X0DA 2RAUA 4B8ZA 6ABPA 2V5AA 5T4FA 3FPFA 3CRMA 4GICA 2GEVA 4WCFB 4UCQA 3CCCA 1SXJC 1L4GA 3HU3A 1XG5A 1A3CA 1SQGA 2BJWA 2VH5R 2Z8YA 4KO1S 2IU0A 1VL6A 2C3MA 3F2IA 5THXA 1AKQA 5EXSA 3QXCA 4TQ9A 2BSXA 3WIVA 3D1LA 5LP6B 3FPEA 4WKBA 3VUEA 4JJ6A 5KNCH 2C8KA 5EWJA 1BWSA 1CLEA 3L0YA 3W90A 1YZ3A 1TM1E 1YOBA 2JHPA 2PBFA 1Q0RA 3HKCA 3H83A 3HU1A 3RIMA 1JDNA 1W36B 3P4XA 3MELA 4H35A 1JKXA 2B8NA 3IPRA 3ZNNA 3LZDA 1FU4A 3AO0B 3RJMA 5BN3A 4OO3A 4AYWA 1RFGE 1K08A 2H8GA 3EYWA 4JBYA 3ABSB 1Q1ZA 3DEFA 4AKSA 2IIBA 2Q99A 3MT9A 1IPFA 1XTBA 3GV0A 3MTEA 2FJPA 4IM7A 1G18A 1Q0UA 4U2CA 3UKJA 2H0RA 1L4HA 3K9FC 3KD2A 1N6KA 4MVJD 2E1PA 4CEHB 3QOYA 4CTKA 3VNSA 1GPBA 3BXEA 3NJRA 3WL6A 1W5TA 3M82A 1LDEA 1W94A 2WIFA 3KQYA 3DMDA 1NIPA 5KX5B 2JF0A 3OA2A 1UKZA 1RHUA 4LBVA 4Q4LA 2IBMA 4XDGA 3HFRA 2OV3A 3LPDA 4K2AA 2J7KA 4I9GA 3E0QA 4KQ1A 1BWQA 4MLCA 3LRXA 3R3XA 2BFMA 4ZV7A 1H4QA 3GVXA 3R0QA 4KR6A 3PFIA 3P19A 2WU8A 5IBPA 5JS7A 5EZ6B 2H1LA 1U02A 4N49A 3AOEC 1J2UA 1U2QA 1SPXA 2ONZA 1G4AE 4NYJQ 2Q3LA 3CIOA 1E1RA 4Q19A 1VBKA 2GLTA 4I8IA 4JBXA 4HEQA 1DO8A 1P4GA 1AMUA 1REQA 4TTRA 3A1EA 2Q0SA 4RGYA 4TGLA 4BLRA 1NM5A 4JLOA 1P62B 3FFTA 4BOYA 2GF0A 1M1NA 4MSUA 1SIUA 3FVRA 2NACA 4GVXA 5TMDA 3DGEC 5BWBA 2XAAA 3HB1A 4MQLA 4QFMA 4QBKA 2EP8A 1ZIYA 1YQUA 4NV1A 1M0TA 2XUGA 1IOZA 1H2ZA 4FHEA 4KQMA 1SC1A 4WXHA 5F1OA 4KZPA 1SVMA 3COVA 4ARZA 2NVUA 1JH9A 2Q3MA 3KQLA 2B9EA 2VPYA 1GGNA 1RPZA 4HB0A 2R6FA 4ZJYA 3GROA 5T5QA 1G21E 2DZDA 4N12A 3PENA 4PYQA 4WBSA 1XPJA 3NLLA 2QQFA 4JJ8A 4P82A 5CVJA 3TB6A 2VP9A 3V7UA 5B5SA 1Y8ZA 1NY5A 2BMFA 4H31A 4MRNA 3TZQA 2FSSA 4BGUA 5JZBA 5BV0A 5ECWA 1F4VA 4KX5A 1V5WA 4YDSA 4FCWA 2M9MA 1HPLA 1Y7LA 2CHVA 2V7QA 4HF7A 1C14A 3A1DA 1T3LA 1Z5NA 5BV7A 4B4VA 1X42A 2PD3A 2W00A 5CDSA 4JN6B 1UR5A 2XH8A 2GYVA 4AN0A 5B55A 4BP3A 5KTYA 4WW0A 1S2OA 4HAYA 3WLQA 2ORWA 1OUMA 3FFXA 4IJ6A 4FGWA 1T4CA 5HQ3B 2XQGA 1MAVA 2BFFA 4Z99A 2X1LA 1GZ3A 3ZWDA 3AF6A 5AM3A 2R0QC 4L4YA 5BMVB 3NPAA 2OP1A 3H16A 4RPCA 4Z49A 3PC8A 2P1DA 1ZUHA 2XCIA 3IQGX 1U28A 2IP2A 2YDXA 3DP9A 4NQZA 4LMAA 3V8RA 1MORA 4CCYA 1E4EA 1T2VA 3PQ4A 3D4PA 1CERA 2P2SA 3OX3A 3SZMA 4EYEA 4GMXA 2EZUA 4X90A 4C0LA 1IXYA 1XU7A 1FNNA 2X41A 4Z3KA 3KSZO 1QHEA 1L5MA 1KF0A 2JAXA 5BN5A 1L7AA 4HMQA 4F56A 3KQPA 1ZGZA 4LYDA 1YQTA 2GA8A 3ORHA 4Q7JB 2A86A 4I2VA 1BX1A 1NBMA 1RWQA 1XDGA 3AR6A 2CNDA 4IQ4A 4XIIA 1BWPA 1Y3AA 2OBNA 3A36A 5CXXA 4CIVA 1FNMA 7GPBA 5AJXA 5IK2A 2PT5A 5FWXA 2R8PA 3CUUA 2B4AA 3AHHA 1JWLA 3QIAA 3NBFA 3LOQA 3KYDB 2P2DA 3H75A 4TZKA 1W52X 2Y0BA 3HY4A 3NB0A 3RBAA 4B76A 3E0XA 2QPAA 3GGGA 3W9BA 4ZAGA 2EZ4A 4HTFA 1JJBA 4XWOA 5FWYA 2VJOA 3VTZA 1DTWA 5LQJA 3SBDA 3SICE 1XZKA 2GH1A 2CUTA 3HCEA 4K3UA 4AB1A 4C7OA 4GFDA 2P3QA 3PF8A 4CKBB 5DLPA 4OLBA 4XDHA 4DPMA 4A0HA 1SGWA 1YE8A 1S4QA 3BQNB 5BORA 3GAZA 3O5AA 3QF4A 4G1VA 1B73A 4Q4DA 4TLCA 1JHZA 2G4CA 1GQSA 5IH7A 4F45A 3WYAA 4MARA 1E3EA 3IH5A 5DHUA 1A4XA 4JOSA 2C5AA 1ESNA 2Z4SA 2ZSDA 5JAQA 3TIGA 2V6MA 1GUYA 3WOHA 4YAGA 1DKQA 2IPLA 3A9UA 5JCJA 1K6JA 4OHPA 4DIOA 1R27A 2YXEA 2XGJA 1NQAO 2R8ZA 4JD5A 5KOHA 2E4YA 1PJBA 1OBCA 5KVVA 3Q2IA 3P9KA 4HYYA 4FOOA 1EIZA 4ZOBA 5AUQA 1QQ7A 2E18A 2H57A 1JX6A 1UT5A 3ZDYB 1U4NA 3EE6A 1U7OA 2V9PA 5EXXA 1CZUA 3D2LA 1Q1NA 2VHUA 1L5FA 4MO2A 5EY5B 1DVRA 1TTQB 3DH0A 3PFNA 3UUWA 3AI7A 5BYBA 2FMFA 1U5AA 4CQMD 3JQ7B 3EDCA 4EHAA 4E5SA 4AI6A 3TNFA 1VKZA 2TMDA 5EWLB 4JLMA 1WMBA 1EKXA 2B35A 1N0IA 1SIOA 3L0IB 4ND4A 2O48X 1UODA 2CLSA 2P1RA 1QK5A 2H16A 2OV8A 1T1RA 4GX1A 2CWDA 2OQRA 4H6XA 3VHXA 1LD3A 1G63A 2O1SA 4GQIA 3U61B 1B8UA 1CUJA 2HTEA 4CGYA 2BGRA 3GZ4A 1LPBB 3EGIA 1KO7A 1MG0A 1OU0A 2BMJA 1PL0A 2RHCA 1YI8A 1Q2XA 5DN6D 1Z7EA 3EVFA 4LE2A 3L4BA 2ZRBA 4V0NA 3UC5A 4YUVA 3B3JA 3PGA1 3Q3GE 2VT2A 1XAJA 4YRCA 3ICWA 1Y6QA 1VKNA 1D09A 2OZEA 2WKPA 4FDTA 3KB1A 3RRZA 4Y6PA 3ENNA 2P2NA 4CLRB 4OK6A 4WASA 2GSWA 3EQZA 4DQVA 3Q7EA 3GB9A 3FKJA 5HKKA 2V7PA 4QICA 1GPKA 2WI8A 2HMTA 1Z4IA 2HRRA 2QE6A 3BICA 2VYQA 3OCCA 4IL5A 4KPEC 1AT1A 2YJNA 3I64A 4XCXA 2G0TA 1H2WA 1RI1A 2E87A 1P1BA 5AKIA 1JFFB 1YDMA 3BORA 2XNDD 4YJGB 3S2GA 1XAHA 4NLLA 1EH5A 1E60A 1WX1A 4U9IS 5FNVB 3SYLA 4PZLA 3ZBQA 5KB3A 5AXCA 1OYVA 4DDWA 4BDTA 2C88A 1KBQA 2C29D 2YZKA 1TADA 3FZQA 4B4DA 2HSGA 2ZSKA 1VPWA 3VV2A 2QM3A 1LBHA 3WBJA 5L7YA 3PJEA 1M1ZA 3ZY5A 4AUNA 3NOXA 1U8UA 1NLYA 3W79A 3K71B 4Q34A 3WLEA 2C04A 1M6VB 1OXKB 4L3WA 3GLKA 5FOQA 5KWEA 1B43A 2C97A 3L8FA 1K1EA 2IU6A 2I54A 1X7YA 3K2BA 4RWEA 1ZA2A 3PQ2A 3ZCVA 3HZHA 3ABQB 3MUNA 4P7KA 5LA6A 1IY8A 2H9AA 2YFHA 4PF1A 4LWZA 2I7CA 3OQMA 3THWA 4LWPA 2FETA 2IXBA 4N5HX 4JI4B 4XQGA 4LHZA 1T24A 1NPDA 3TGLA 1UC5B 1XNHA 5E6SB 2OGUA 2XOEA 2WQ7A 1YJ8A 3COPA 2R66A 1BG6A 4ZYYA 4WMLA 1SVUA 3FNFA 4AO8A 3C7TA 3N8DA 4GM4A 3PTZA 4TZTA 5AW2A 3T4EA 2OCKA 2RMKA 2JGDA 5BSFA 4QQNA 1XJQA 1MO5A 1PNVA 3N2KB 5H80A 1Q21A 3WISA 5GJVC 3TOCA 4EKYA 4OH1A 4PRLA 3M3HA 4YRLA 1DOHA 2D2FA 1VPDA 5GPBA 4F3CA 1SBIA 4JQOA 4BP1A 1M34B 3HKDB 3QKRA 1G60A 5JXGA 2Z95A 4XSHA 4MGZR 4BO7A 4HD8A 3FG9A 1K4MA 3KLOA 3BFVA 4CR6A 1RYYA 3Q7QA 3TRFA 1JEYA 1ELOA 1BMFA 3NPMA 3UY4A 1ZRHA 3HYTA 2P6MA 5DTIA 1H69A 2XA9A 5AUOB 3USCS 1E9CA 1YMVA 1RKUA 2QN2A 3AVYA 1W25A 1C4KA 3DMGA 4YMSA 5ILOA 1GRNA 1DL5A 5FUBA 2OZLA 3H5OA 3URMA 3E9MA 2O2JA 1PQYA 3TDMA 3AY3A 2QD1A 1BJKA 1XRLA 1UKEA 4TRNA 3LL4A 3O75A 4D0NA 1F2UA 1XYGA 2QPTA 2VNKA 3LC1O 1Z5VA 3ANSA 2I6XA 3OX2A 3AG6A 3W8NA 2BMVA 1IB0A 5EZYF 3GAMA 1VXOA 3B9BA 3C3JA 3WKEA 4XJSA 1JHDA 3TLYA 1V4NA 1Z12A 1ZMTA 1JWBB 2XQVA 2CV0A 5K4GA 2XZDA 3DE3X 2SCUB 4RV9A 1KGSA 4R1NA 2FP3A 4H27A 1CYEA 1C1XA 4P5EA 3HUTA 2PSSA 4DQDA 3WL3A 2GAAA 4JXKA 1PZEA 3WI7A 1W2GA 1XVVA 3B7WA 5AH0A 1ZXXA 1V45E 1W85A 3N0VA 4JHXA 1GDHA 5TQ2A 5JNTA 2MSNA 4LOJA 5KYXB 3X2EA 3EB9A 4GOOD 2P9TA 1ZM2A 4XYGA 5EPEA 5TJ9A 3RSOA 3ZGOA 4CUJA 5JPDA 5AI6A 3BD7A 3AOEA 1FEZA 1RQ2A 3N39C 3I05A 1ZH2A 4Y2GA 4F1JA 1QBGA 2XVMA 3WP1B 3VPBA 2NXEA 3A6JA 2BF7A 4Q21A 3G68A 1TZCA 3PXUA 1D1QA 1VBNA 2PKEA 3IV7A 2VUIB 2GUGA 3NCTA 4UPVA 4FK8A 3A3KA 2BTQB 4CW7A 3WGNA 3AJAA 4BAZA 2F8TA 1QVRA 3K5IA 1E3IA 4HBZA 2D1YA 4N8SA 2CEKA 4DM4A 3CH4B 1QANA 2BVNA 3F98A 3U13A 1C2YA 1JAYA 2PWPA 2IW1A 3T34A 2QX8A 2GXSA 3RW9A 1J2EA 3ET4A 1GITA 5KNBD 3I9NA 1SBCA 3A31A 3IUEA 3V4FA 4FNGA 1P3JA 4IH4A 1JPJA 3JZDA 3X3HA 4YMTA 3UAYA 3DT6A 4FXOA 4R5HA 3TEJA 4HWRA 4I1PA 4HRVA 1RLTA 4BWYA 1NXVA 5AJZA 3TTTA 1G2OA 4RTRA 1HDXA 2JLUA 4Z4EA 3B1VA 2WMDA 2JLYA 1VYVA 1CG6A 3ORRA 1XZFA 1A82A 1FDIA 1YOVB 4FPXA 1ZUNA 1Z75A 3T35A 4X8LA 4KGXA 3JAMA 5IJ9A 1JHMA 1R3DA 4J0FA 2HYDA 2IHYA 1BE0A 4M2LA 3NNNA 1RKBA 3ELUA 4KR9A 1KI8A 1U8TA 3ZUPA 4R2JA 4AAYA 4F3TA 1FSZA 3X0DA 2HX1A 3T0GA 5JDIC 3PNYA 3EN0A 2NN3C 4L8FA 1O08A 1E2KA 3SD7A 1IEVA 4LRYA 3ZDZB 3MRTA 1VLZA 5AI8A 2O14A 4QQ8A 4TQUS 1Y8RB 5CCDA 1FP2A 5JC1A 1PJSA 2JRCA 5IBRA 3QSYA 1YRAA 1HLPA 1R9GA 4P5DA 4IIUA 2J59A 1OJLA 3RLFA 5BUQA 5ESRA 3BCUA 3ZCSA 2PJUA 3JAKA 1G5QA 1U65A 4W82A 1EFUA 2NPOA 3OVMA 5K7SA 3QELA 4I6GA 2GBIA 2HXYA 1C7JA 3DO6A 1V1RA 1JI3A 3KQQA 4EFDA 1Q0HA 3V34A 1NDQA 4FGLA 1S3IA 4IVRA 2VCYA 2OC9A 4MCAA 4U7TB 4XJTA 4R0NA 3M7IA 3R75A 4OCZA 5IM4A 1ZVJA 3BIXA 4F2WA 1WQ4A 3N8HA 3F9RA 2DP4E 3CE6A 4RM3A 1U04A 3RJ9A 3UAGA 1C9YA 1RC8A 4OBEA 1PP4A 1WBJB 2WAYA 3D3JA 3NDPA 3OKAA 3QNMA 2ZTMA 2OM2A 1G7SA 3SQOA 2HWWA 4IRMA 4AURA 2CY0A 1I2AA 4BFZA 4CUZA 4WHMA 3D64A 3I2GA 2AZDA 2JFOA 1XI2A 4LTNA 5KYUA 3JWPA 4OGGA 4ZI7B 1TQ8A 2KSQA 1GV1A 1PWZA 1DX9A 3BJRA 3OQNA 4CLDA 4HGOA 4YRZA 5HHTA 5LP1A 4OB6A 4E5MA 3TRKA 2XUJA 3AL2A 4OEHA 1CUXA 2HREA 3K7EA 3E9CA 4QC2A 4DCSA 1WXIA 1SD1A 3MS4A 3QG1A 4X1KA 1UK8A 2ZAIA 3GLTA 2MT9A 2WVAA 1CZOA 3DTVD 1O6FA 3K9QO 1JYSA 4Q7MB 4E5UA 5J58A 5KVCA 4RVCA 4LYYA 3RRXA 5A04A 3NALA 1K68A 4LHEA 2K2QB 2GN0A 5KDDA 1A4IA 3C8MA 5LBTA 2C61A 2RH5A 4CI0B 5I9SA 4OYRA 2AR0A 3FUCA 2C78A 3OCXA 4PAGA 2ZREA 3LX8A 4QATA 1N2GA 1NNLA 4XCVA 5KINB 5CNJA 1CIVA 5HZMA 4MWBA 3M1IA 1C1DB 3QM1A 3FE2A 3RYFA 3I6YA 4NESA 2A1UB 2VP5A 5IAEA 2B99A 3D6AA 4HDSA 2YV2A 1EWKA 3BHMA 2X0EA 2JCVA 3ZZMA 1O6CA 1QE5A 4B6RA 4UJ5A 4C0BA 4IIVA 5DU2A 4UUAA 3S1LA 4EB6B 2WZDA 1N7HA 4GXTA 4ARCA 1PGQA 3PJGA 5CVDA 2DPGA 3TE7A 2RI1A 3ADOA 1BTOA 4S3MA 1YH3A 4CL2A 2CMDA 4HZUA 1TMOA 1JBQA 3ACCA 4MQ4A 4Y6SA 5BYJA 1G21B 2H1SA 3QK7A 1S01A 3OZIA 2QLNA 1VB3A 3EXEB 3GWGA 4PTZA 4BB0A 3B6JA 2WNHA 4NJMA 4HPJB 3GGDA 3KR2A 2O7VA 4KYTA 3IPLA 3NV9A 3VKWA 5L51A 3FPLA 2P9GA 1HSOA 3DEIA 1UINA 1VI6A 4MB0A 3EWSA 5E6RB 5B36A 3TF5A 4US2R 1EGMB 3WXMA 1CR0A 3FPBA 3W5CA 4FWTA 2B7CA 4J7XA 5ALVA 2H4FA 3IDOA 1SU4A 1JVNA 1TF5A 1I4EB 2H9YA 2P67A 3FUTA 3IQFA 1SCBA 3JQ8A 3KWLA 4XX1A 1T25A 2OFOA 1FP1D 10MHA 5TQ0B 2D6FA 1CDDA 4UDOA 3WGUA 4NOLA 2W2KA 1E2IA 3K4PA 4Q5IA 2ZB4A 3LL7A 4MDYA 1NUTA 2VNIA 3ZLVA 1F0NA 2WOOA 3N0XA 4KLZA 3FGOA 1P31A 3R77A 1C7RA 1X7ZA 3S3TA 3AM4A 1TIPA 3U3RA 5F5LA 3TH5A 4P6VF 2JS7A 4KREA 4XXHA 1W0KA 1R8YA 1XC7A 1ZJ5A 4JBWA 1GUFA 2IYXA 2NVWA 3DEZA 4POAA 3GMDA 5CRIA 4E14A 5LIPA 1TYDE 3BMQB 2ZB8A 3PJDA 3U7JA 4E08A 2WAMA 1POXA 4HDQB 3G0HA 2QWXA 2XODA 4AICA 4DPKA 4HUTA 1NVEA 4B6SA 4JDUA 4ZCTA 4Y18A 5ENZA 4I50B 4EYQA 1G1MA 3I0MA 5G0UA 2JCGA 4DEXA 4JJIA 5BW5A 1NATA 4MV5A 4ABYA 3QEAZ 3TXXA 4M8NE 2GUWA 2IU3A 4DA9A 3BFXA 3F8SA 2JAQA 4JLKA 3DUWA 4XM2A 3PUWA 4ZA2A 5GVRA 4F1KA 4KQJA 4KXXA 1Y1TA 3PQ8A 4TTAA 3T41A 3CC8A 3VNBA 3R0JA 3VU8A 3C7KA 3IE0A 3IP3A 1H93A 2QI9F 2PL3A 2WVHA 4D57A 1DEKA 1D2NA 2UVPB 4KIGA 5FCDA 2G5GX 4MS1A 2P9YA 3FCUB 3UMSA 4N5MA 2GXAA 1YKGA 2QORA 3BF8A 3HJTA 5JNLA 4YY3B 2E5FA 1EVJA 1MQSA 1T9BA 3BAFA 3MXOA 5J5CA 2A0FA 4YT5A 2CHFA 2EOAA 4E4YA 3ESRA 1GRVA 5IWAB 1TZ2A 5H02A 3B5EA 3UF0A 2GJAA 2L18A 3A04A 3DEYX 4GR4A 4BO0A 1Q92A 3B5JA 2XGGA 2QSYA 2FRXA 2Q4EA 4WCDA 1NVKA 1QOPB 2X8JB 1FSSA 3D4BA 3V4PB 5IYZB 3PGKA 3FMPB 3FZEA 3OFVA 2IXTA 2J6BA 5LQUA 3EEOA 1N33B 4B6JA 5JU6A 2NTNA 4RA6A 3V9AA 3GBVA 3DUFA 1M1YA 2N3ZA 5CIWA 3AEKA 3VU0A 1Z9BA 1K5HA 1C80A 1UWCA 2Q5IA 1KJQA 1PEDA 1Q3HA 4TL8A 4C7KA 1M1XB 5LQKA 1RM4A 4TV8A 3B3QA 1LSJA 5JOQA 2D8MA 5DN9A 3EGDA 5FX2A 2K5UA 4GI1A 1GVHA 1G5RA 2PQ2A 5E3JA 1O0CA 2LCQA 5EZ5A 1YFJA 1M9NA 2GRAA 2O0MA 2P9JA 1IJFA 2Q2WA 2WD7A 3C3EA 3ILSA 3ADCA 2JLXA 2V65A 1JDPA 1VHDA 5K0NA 5JECA 2PU5A 3TXAA 3OOHA 3W5HA 1EDDA 2BFOA 1N0UA 1H9BA 1U7PA 1NJ1A 4EFKA 5A7FA 3W5JA 4C4YA 1AQLA 2Z30A 3RFTA 4YRQA 2C3PA 1FBNA 1GKYA 2R6R1 3L3BA 3HM2A 3LLCA 3N28A 3H2GA 4MR7A 5AT1A 1M0EA 2C4KA 2ZYDA 1RRMA 3TSWA 5IW8A 1GQOA 1RE1A 1J39A 2X4IA 4NNPA 5H59A 3T4XA 4C1NA 5BN3B 1N5JA 1N92A 4UHHA 5ALDA 4RVSA 2IH5A 4MUIA 5FOSA 3WMEA 3QV1A 4DJDC 1JZSA 2PLRA 2XHEA 2X86A 3O31A 4MV0A 4AW9A 5GGYA 3UV6A 3LP6A 2AQHA 3AY6A 2GZ2A 4Q16A 4BNTA 3R7DA 1W87A 5KMGA 2AC7A 1UK6A 4X66B 2OY0A 5EHQA 2D54A 4FFLA 1P2VA 3ZGVA 5EXPA 2F62A 3PE3A 3VKHA 1GJRA 1KEUA 4EMBA 3IBGA 1T9GS 2OBBA 5TV2A 4AJ4A 1NUQA 2WV9A 3GDHA 4BU0A 3OJCA 5AYVA 2XVAA 3BZUA 5HKLA 1E3WA 1U3GA 4V2UA 2M1XA 1ZJ4A 2VQSA 1GNSA 1QAQA 1B1AA 5IBQA 1STOA 3VAYA 1HNXB 3LPAA 2YUIA 1C4WA 1MPXA 4UULA 3CR7A 3ET5A 2DR2A 5IN4A 4J1NA 5FOWA 4ZVTA 3QX8A 2CMGA 2R96A 4MR8B 4YMHA 2AC4A 3KKPA 2HSEA 3K05A 4BVGA 1XVIA 1PV1A 5KZMB 3FYHA 1QHHA 2CEAA 4JYZA 1FYEA 2W6PA 3AF4A 5C4IA 1SN7A 3AH8A 1AQIA 1IHDA 4CTNA 4DJAA 3GRUA 5ALYA 2QTHA 3QPBA 4JDPA 1YZHA 1M1NB 2APJA 4AXBA 3X1ZA 3AERA 2ZPTX 3Q8XB 3S8YA 4CNQA 3JWEA 2P3SA 4E5PA 2HHHB 1KH2A 2PXXA 2VEOA 3OEED 1Z4OA 3BTVA 1S8OA 3MJRA 1L8XA 4AG6A 2BJVA 2IZ6A 4MUAA 1O97D 3CNNA 1X7XB 1BQ4A 2I7DA 4R05A 4XJVA 1GL7A 5L3RA 3HTXA 2VWQA 4ARZB 3KEQA 4NZNA 2EZ8A 2D13A 3OZTA 4CKXA 2IYPA 1MX3A 1V3VA 4N65A 2JH9A 1J8VA 1TQHA 2QK4A 3C4QA 1MB9A 4LK2A 3V8NA 3VOTA 1CZRA 1VLQA 4EHDA 2AF3C 3O1JC 4Z4HA 4M0KA 4AKGA 3BS4A 3MRVA 5AVZA 3NGXA 2VDVE 1K7XB 1KL7A 3PDWA 4A5OA 2MSDB 1IAVA 4BN4A 2R6CA 3I62A 4GYKA 5JDIA 4NCNA 5TY0A 2P6OA 3JZAA 2OT3B 1E7YA 4D4LA 1ZKDA 1IM8A 4MKRA 1SOVA 1WWKA 4NMXB 5FXMA 4XLZA 4KACA 4PZEA 5D84A 1U1FA 3RTGA 4OLFA 2NSYA 1LXCA 3EBLA 3KQWA 2CB9A 1N57A 1RABA 2JHCA 2QRKA 1PEAA 3H65A 3KBBA 4RPJA 3TVTA 3NM4A 2XA2A 3ED1A 4TVOA 1QU3A 1U5BA 3CGGA 1PK8A 3FCOA 1WCIB 3UKOA 3PQ5A 5P21A 2OBMA 5FKJA 3GNTA 5KCZA 4U2GA 1YZGA 1E32A 3SBOA 3IBYA 3ZHRA 4BCCA 1Z5WA 1G9TA 3DPSA 3MF4A 4IJUA 4JP8A 3DMHA 3WLKX 5E2IA 3PJFA 4CG1A 5LWHA 3ZTTA 1E5TA 2XRFA 2JLWA 2PLFA 4N5DA 4XUEA 1YSCA 1CQXA 2EX0A 2IGTA 3WBKA 4EZEA 3A11A 3A70A 3PGJA 5BN5B 1X1SA 2XD4A 3G2IA 4BZXA 2FPIA 5DGHA 4JI5B 4L4UA 3ROZA 2D7DA 3G5AA 3IEPA 4RGQA 1BH6A 1W1WA 3LPNA 4XPIA 3KOXA 4YP7A 3H3XA 2WD8A 2EARA 1GGJA 4JQYA 5IC5A 4GLFA 2MSCB 3I39X 5FWXB 3OCJA 1B6GA 5JARA 4EGSA 4ILKA 3REFA 3A25A 1SFRA 4INZA 4E0BA 5LMCA 3K9GA 2AFIA 5AW0A 1I5RA 2BEWA 1MJFA 2FR1A 3OM8A 4H7KA 3JPYA 3PB3A 1DTWB 721PA 5SY6A 3I9JA 2ZRDA 3NAGA 4QUBA 2F3SA 5FHQA 1MH9A 3CS3A 3FJYA 3GJQA 4TWIA 1ZOPA 1PFUA 3QF4B 2H06A 2EQAA 4Q9NA 1KNXA 2CHQA 1LDMA 2E4ZA 2I1VB 3K2EA 1R18A 2FKNA 5CFNA 3GLFE 1EBUA 3BGWA 2H18A 1TA9A 1IN4A 1EWYA 2N9UA 2XUAA 1E2BA 3RT9A 1G59A 4OFWA 1H94A 1N1GA 4RLFA 1Y98A 1CZNA 4IUYA 4UHCA 3QE3A 3IMEA 4JLVA 2AKAB 4GAEA 1ZRMA 5K03A 2NUAA 4G4SP 3SN6A 3P9NA 4MWEA 1SZPA 3LKVA 1V8PA 4WTOA 1M8KA 4PGMA 4MYSA 3OMLA 1YQXA 4J7UA 2YJ4A 3FGPA 3QWFA 3GDWA 3HWWA 2WJZB 5IWCA 2CHGA 2I22A 4PC1A 4ZAWA 3TR0A 5IC4A 2CFRA 4TN1A 4OLAA 4MV9A 1HQYE 1PL8A 1UFRA 2DM6A 3G2OA 2Z2IA 3KPJA 2V1UA 1FMCA 1JQLB 4BIIA 4FONA 2RE8A 1MMFB 4Y2VA 1EHYA 4BVEA 1BFUA 2QL6A 3G85A 4FKZA 1U7WA 5I4BA 1CUHA 1QGAA 5ALHA 5D6NA 3BTOA 2DX7A 3KKQA 5CB4B 1YC2A 6REQB 4K9RA 5ENDA 3VH1A 1E0KA 5JSHA 4LG1A 4PNZA 3R0VA 5D51S 1PFVA 4NE7A 3K0CC 1CQZA 3PVCA 4ALJA 1HE3A 3VHXB 1VIAA 2YZ7A 1HYBA 4M9ZA 2HF7A 2WT8A 4UQOA 4L8GA 2XMQA 5DIZA 1BNCA 4P1ZA 2HQBA 3K6SA 2X6RA 5JUWA 4OMDA 4CDMA 4KAJA 3NJ8A 2CLLB 3WKBA 2QB5A 3EEBA 1IL0A 1G6HA 2CFCA 1CNMA 4C2AA 4KQXA 2B4TO 1YFZA 4MDEA 1E66A 1NN5A 2QT0A 3ENZA 2ILVA 3IQIX 4M9UA 5FYDA 1CUGA 2OOSA 3O83A 3RFCA 5HF9A 3SZRA 1L4KA 1FQOA 2C9MA 3BAZA 4C78A 2R8YA 3OTIA 1E79D 2BGTA 2CJYA 2PR2A 2QVXX 2O07A 1UXJA 2YZ2A 3HY6A 4ML3A 2C00A 3A1NA 5B37A 2I03A 1CF4A 3C7CB 2JASA 1V3QE 1O89A 1TIBA 1YJAA 3HXKA 4IKPA 5L9AA 3EZLA 3ROQA 2XB9A 4H3KB 2I71A 2JG3A 3STHA 4V02A 1AIPA 3T6KA 4DZZA 2VSNA 1SUAA 2WTMA 1KYVA 4ZOEA 3ECSA 2H08A 2FDXA 1CY1A 2IQ5A 1O96B 2GMWA 1Y5IA 1XE3A 3CNQS 3F7OA 3RS9A 1EFCA 3FR7A 4G1CA 4EELA 1Z8FA 1T0PA 3L1KA 5A5EA 1MRZA 1EYZA 2D4AA 2HLHA 3DJYA 3FOBA 3JTMA 3N3AC 4PE5B 5DSZA 2PM8A 1KQGA 2XUKA 4HKTA 1S2NA 4F9TA 2QHXA 1GSAA 1JDZA 3ZLTA 5KOYA 1WS6A 1ADFA 1IIBA 2Q62A 2Z2KA 4KUGA 3GRYA 3ZIUA 2LWIA 1SD2A 1ZGAA 2GWHA 3NNDA 3B9QA 3J80A 1C8LA 1R6BX 1NWHA 2AOVA 1XTVA 2YYAA 1PT9A 2QMEA 3BL6A 3L7CA 4BBPA 5BR1A 3THWB 2HWUA 3NCHA 3P0RA 2ATXA 5IC6A