3ACDA

Crystal structure of hypoxanthine-guanine phosphoribosyltransferase with imp from thermus thermophilus hb8
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
176
structure length
164
Chain Sequence
MFTPGNGPVQISAEAIKKRVEELGGEIARDYQGKTPHLICVLNGAFIFMADLVRAIPLPLTMDFIAISELLKDLRLPIHGRDVIVVEDIVDTGLTLSYLLDYLEARKPASVRVAALLSKPSRRQVEVPIHYLGFEIEDAYVYGYGLDRAQFDRNLPFITSIRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Structures of hypoxanthine-guanine phosphoribosyltransferase (TTHA0220) from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 49
structure length 164
sequence length 176
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2009-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3acdA00
5JV5A 4M0PA 4RAQA 2XBUA 5HKLA 1IBSA 2JI4A 1TC1A 1O57A 1L1QA 4X45A 1G9TA 1NULA 4RHYA 3OHPA 2JKYA 1NONA 1ECGA 1VDMA 4IJQA 1A3CA 5IPFA 5BQOA 4RHTA 2VFAA 3LRTA 4RV4A 5BSKA 4P82A 2PS1A 1W30A 2EHJA 3MJDA 2JKZA 5KAPA 1DQPA 4ZFNA 1I14A 1XTTA 1WD5A 1G2QA 4P3KA 1MZVA 1DQNA 1BZYA 3ACCA 4RHXA 4OHCA 4S2UA 3LPNA 4M0UA 1A4XA 4WMLA 3MBIA 4PFQA 1Z7GA 4MB6A 5ESWA 5KAMA 1G2PA 4PAWA 5K51A 4RADA 4X44A 1UFRA 2PRYA 1OPRA 3DMPA 1A98A 1XZNA 3O7MA 5BQPA 5IAOA 1YFZA 4LZNA 3NAGA 4LYGA 5EUCA 4RAOA 4WN3A 3S5JA 1CJBA 1D6NA 1DBRA 1JLRA 3KB8A 2H08A 1UPFA 5JSQA 4RHUA 2GEBA 1UPUA 3HVUA 2E55A 3ACDA 3G6WA 2YZKA 1HGXA 4FYMA 4QYIB 4F8EA 5ESXA 1A95A 1QK5A 1ECJA 4RQBA 1BD4A 4P83A 1A97A 4QRIA 1XTUA 1OROA 1AO0A 4JITA 1FSGA 1GRVA 1A96A 3GGCA 3QW4B 1HMPA 1I0LA 1I0IA 1ECBA 3GGJA 1JLSA 1ECFA 1O5OA 1TC2A 1QCCA 3M3HA 1GPH1 3DAHA 1P17A 1DKUA 1PZMA 3DEZA 4RANA 1I5EA 3ACBA 1XTVA 4RABA 1ZN8A 5BRNA 5HIAA 3H83A 2AEEA 1L1RA 4M0KA 4TWBA 1DKRA 2P1ZA 1QK3A 2DY0A 2JBHA 1ZN9A 2HCRA 4P84A 1U9ZA 4QYIA 1QB7A 4RACA 1VSTA 4LZAA 3EFHA 4P81A 1I13A 2IGBA 4RQAA 1VCHA 4P86A 1P18A 2H06A 1ZN7A 1XZ8A 1U9YA 1OREA 4LZOA 3N2LA 1P4AA 1P19A 2C4KA 2PRZA 4LYYA 3GEPA 4JLSA 3OZGA 1V9SA 2FXVA 3OZFA 1Y0BA 1QK4A 1R3UA 5E38A 4Z1OA 1BD3A 1QB8A 1STOA 4KN6A 1QCDA 1J7JA 1ECCA 1G9SA 2WNSA 2H07A 4P80A 1LH0A
chains in the Genus database with same CATH superfamily
1ZSYA 1MA3A 1X1SA 3C3PA 3LTEA 2ODAA 4R69A 1JEJA 5I9TA 3VFDA 1OA0A 1WY7A 3GEDA 3TMKA 3RWBA 5H82A 2G04A 1DBSA 1YRHA 2FP3A 2DWUA 4NYMQ 1I1NA 1JTFA 4UNNA 4AJ1A 4I7EA 2OQVA 3F98A 5A3JA 2G8LA 5KDOA 1OXVA 1JHAA 3C6XA 4ZAZA 2N75A 3MJVA 4DCVA 2AJCA 1AKQA 1ECGA 2IP4A 2VK1A 4ZD6A 4B4DA 2J48A 1KGSA 3HEBA 5JJ5A 2XD4A 2FPOA 4M1OA 1O4WA 1LEHA 4ZCQA 4FYJA 4ZMBA 5L7WA 1G6Q1 3ES9A 3MSCA 3MGCA 2EHJA 2GNAA 2C5LA 4N7RA 1MR3F 2FEPA 4YUZA 1ADJA 2CLLB 3I0MA 3IKTA 1OX5A 2RGUA 3C3KA 2IYXA 2R8EA 1EU1A 3L1JA 3PHHA 2WVJA 4HQRA 1GUBA 1GFSA 2IV2X 1XEWX 1IE3A 1M1YE 1IATA 2ZVDA 4C21A 4EI7A 1DJMA 3DW3X 4M99A 2P9FA 4PZ9A 4FCWA 1ZI8A 1IFXA 1J2UA 4B4UA 2GN6A 3TX6A 3KQQA 5BVHA 4TZ0A 1A4UA 3RU9A 3RARA 3NTQA 5I7OA 3A6DA 4X60A 2LCFA 5CRIA 1Q19A 4IDHA 3GEEA 3UWDA 3ZJ4A 5MDHA 4RZHA 2X0NA 4N7BA 1ZH2A 5DYTA 5KTSA 1G4AE 5E0OA 4IS2A 5IPFA 4O08A 2PRJA 2VDMB 5F2KA 5IYZA 1EEHA 1VJGA 1YHNA 2HDOA 3G59A 2G7MC 3N87A 5EIBD 3R7WB 4DC0A 2WHXA 3EVFA 3VQTA 3PA6A 2I2FA 5H9WA 3ZUGA 2C92A 3MIIA 2PDAA 5KTPA 1LSOA 3NKVA 3O8NA 1CYEA 3NM4A 4D0NA 3HA3A 2C3PA 3DMTA 5CGZA 4UUQA 3U7QB 3AHGA 3DWGA 2OCKA 3SZLA 3AHDA 1CUYA 3SHQA 1TKBA 1UXOA 5HSGA 3GQBA 4XIJA 1F8YA 4DLBA 3VDQA 4K9MA 4DCUA 1BE0A 1K9VF 4CJXA 3F5FA 5ALYA 2HO5A 1T3ZA 2Q28A 5A4AA 4HX2A 1JHPA 4H9GA 4QJ4A 3MSXA 1E1LA 3TLEA 5J4KA 2PQ0A 3KKQA 1OKKD 4OB6A 1U4NA 3KWFA 6YASA 1MENA 2GD0A 5I7WA 2OCPA 1AUOA 1PD0A 3GEGA 1NVGA 2DQSA 4PGFA 3DKRA 3HVIA 2VNKA 4K26A 1JIVA 1ZP6A 2PLAA 4E7OA 4JCCA 3VNAA 2A0YA 1SJ9A 3OZDA 2BW0A 3FUCA 3VNSA 1QGDA 4WNIA 1CR1A 1Y7TA 2C88A 2F3QA 3TZHA 5IG2A 4BFTA 5K0FA 1ZISA 4EHLA 4F2HA 1U0BB 2O8CA 1X7DA 4LPKA 4R9VA 1D4OA 1GTRA 1BC5A 2H0RA 2C42A 5E7MA 1ANKA 2ORVA 1RLJA 2FJPA 4ZHQB 1E9DA 2WLTA 5D5PA 2ZVJA 2PRZA 3PIIA 3OZIA 2CW5A 3KUXA 4LOJA 5E4JA 1V37A 1K92A 1RQNA 1W34A 3U7HB 4PQYA 5SZIA 3LT5A 1SD2A 1UJ4A 1IM8A 3N3AC 3RUFA 1IY9A 1LDYA 2JAUA 5BY2A 5C7OO 4WADA 2E87A 5E7JA 3LDGA 4ZMSA 1J1UA 3QPDA 1KDYA 3MWKA 1D3AA 3ZK8A 1KYZA 2ZJ3A 4NBVA 1G8PA 2O07A 1QRRA 2AV6A 3DOOA 1WTCA 2JVIA 4AFNA 1JIXA 4F11A 4ZI3A 3MN1A 1A8SA 4MKGA 3LECA 5E1MA 3MCTA 3WYCA 3DLCA 5BWOA 3R5FA 5KTTA 3TH5A 1EM8B 4OOFA 4E5YA 3LP8A 4ZODA 1AF7A 4BV8A 3EGCA 4WEQA 5HE8A 4PFSA 2WB4A 4NR0A 4EF4A 4GYKA 4P4GA 1TGVA 2AR9A 3MA0A 3KC2A 4KN8A 3H9CA 3RHTA 1TAUA 1UP7A 3UY4A 1ZCJA 3IMGA 3SZ3A 4JP5A 1WETA 3NWOA 3Q98A 4M6WA 521PA 4RH1A 2WFZA 1CBUA 4G0NA 5ITZA 3CJRA 3W5IA 2BSXA 3ROKA 4G1BA 3HR7A 3KZNA 1E2UA 4QUIA 3U9LA 1LKZA 1NI4B 1IJKA 1X87A 2BEJA 1JHYA 3NG1A 3KTDA 4ZMRA 4UEJA 3FUXA 1N92A 1RADA 3D4IA 2CJWA 3I72A 1IHOA 1NN1A 2P9JA 3FSRA 3H5AA 3QV2A 5JXWA 2ONKA 4PZLA 4U6QA 5DW3A 1P60A 2NU8B 5HTOA 1FS6A 4CT4B 4OIMA 3FSGA 3NDBB 4C0AC 1F1BA 2D7CA 3HG7A 1F2UA 4F3TA 4DT1A 1T8UA 3TVDA 3OOJA 5K8VA 1M1NA 1JLRA 2A0XA 2CFRA 2JHGA 2PKQP 3CX4A 4R5HA 3E9EA 3P19A 5AI4A 4YAEA 4CQMD 4DUGA 3GXBA 5IBRA 3I30X 1N4AA 1MAAA 2JKVA 4B4KA 2A5FA 5C52B 2W2KB 4J1QA 4V0OA 4WY2A 3JCZA 2QG4A 1OH8A 1UT5A 1Q92A 4QODA 1A9YA 2H6EA 2O3JA 1YQTA 4Q03A 3UH1A 1D4AA 4ETNA 4HQOA 5ITVA 2L69A 1N77A 3O8QA 3BICA 4PZEA 3B5JA 4LHXA 2Z5FA 4AJ4A 1V3VA 2BHNA 2FRVA 2XYQA 4D6PA 3O8DA 4IX9A 1CX9B 2BM9A 1NXOA 3W2GA 2ZRKA 1HLFA 3VC1A 4PCVA 5T6MA 3UPDA 3AJEA 1B6RA 4YRSA 2I2WA 4PLWA 4TS1A 1M6VA 2ZIXB 2X5NA 1K6XA 1FDTA 4KGVA 3JWJA 5FQNA 4ZZ2A 3TZCA 2ESRA 1CQPA 1V96A 2GXUA 4Q4DA 3CIOA 3Q5GA 1VQ1A 5F52A 2CL7X 4LOKA 1QHYA 3OJOA 4MDEA 4B3GA 3FZQA 1V45E 4L9WA 3A1TA 2CHUA 2VBIA 3CH5A 1VJ5A 4ML3A 3S40A 3WZ2A 4G4SO 2WQ6A 2IS2A 4UTZA 2EVWX 2DPXA 5CB4B 1YOBA 4FGKA 1IHUA 3PNOA 4OHWA 3U4MA 4MQEB 3RUPA 4AZ3B 2FPIB 4C87A 1NDQA 2CJXA 2OZKA 2II6A 5A5FA 1ZOPA 2VPYA 4LYYA 3KRTA 2HRRA 4O4JA 4P4SB 5J63A 1V6SA 2P2CA 3CPEA 2ZYAA 2COEA 3O93A 1HWYA 1RRMA 1I3CA 1D6MA 2AZ4A 5CH8A 1ZNWA 4RW0A 1JDPA 4JLPA 2CNDA 4M9ZA 3INTA 5F2EA 2MSKA 3TXYA 3UMSA 3ZOZA 1JT9A 5BR7A 4CM9D 3AVYA 4MIOA 5JD5A 3THWB 3BE5A 5E95A 5DYWA 1W2HA 3AH8A 3WVNA 1L7XA 1O57A 1NUPA 4JXKA 5DBEX 1DUIA 1N2ZA 3NBZC 3QPVA 4DV1B 1JDBC 4OXQA 5E6SA 1RPAA 4MS1B 4Z5XA 2R84A 4PLCA 1WCXA 2VHEA 2Q41A 3A6FA 2PL1A 1AC5A 2EX4A 5JQGF 1UJ5A 3IJRA 4XYBA 1BCSB 2QNIA 4YRFA 4E2XA 3N8NA 4C0BA 3ZE0B 1B6GA 2R9VA 4ND8A 5DNAA 4G1UC 5DYGA 3HSYA 3UWOA 1GTZA 2CKMA 3QXSA 4RYLA 4TRNA 4DTIA 4JI5B 4LJRA 1IEWA 2DBZA 4EJSC 2F9MA 2W11A 2Q8NA 4PCUA 3R3WA 5DBFA 3LPMA 4BV2A 3QBTA 4CEIB 5L3QA 5ALNA 4TLDA 3BIFA 2Z2JA 1ZSVA 3ZJTA 3CLRC 5FWNA 5EFZA 1EK5A 1C2TA 2DM6A 2FYTA 3P71T 4NMMA 4NJMB 1APBA 3P0IA 4DQXA 4CETA 1H1TA 5CUQA 2NU6A 4MKIA 4L8FA 5K0NA 3ESRA 3GRPA 3GHYA 5E9QA 3WB1A 1JLLB 2ZVQX 1E60A 1I3KA 2WJZB 5AW9A 1KJ8A 2W7TA 1YUMA 4YAWA 5GVRA 4NQZA 2P90A 3ABZA 1WUIS 4MS4A 4OFBA 4E1VA 2YY5A 3M6UA 2VNAA 1KYQA 3EUWA 4HMOA 4KOAA 3ZLBA 2ZT7A 3KSBC 1C7JA 2CHGA 5BV1A 4WESA 3F3SA 1SC6A 1PJQA 5A3SA 1YJAA 3KR1A 4MI1A 2R6CA 2ZJBA 3RNLA 3AFHA 1UIRA 4QRIA 3RTCA 2GXSA 4MDHA 2EKPA 3BTVA 4AYTA 2GTIA 4YT8A 1E98A 5EZSA 2P35A 1GY8A 4MCAA 4M87A 1ICEA 4J0GA 3SJAA 3W5BA 3PF9A 4B3DA 3F74A 1AV7A 4KR3A 3PEUA 1RWXA 4ZIRB 1MJFA 1A76A 4V2UA 2IW1A 3PTAA 5J47A 1PRYA 5DWQA 1UJMA 3VX3A 2NX2A 4DRZA 4DFDA 1U4OA 4CTNA 1R2QA 3BOSA 3K8ZA 1I5EA 3I8XA 3ACBA 5KSZA 2FDCA 1EDEA 2IOYA 1EG7A 2QUZA 4JVLA 5DULA 4AN1A 1V5EA 4TWBA 4HXGA 3GYBA 1ZC3A 2Q6KA 3DKPA 3ER8A 5HJ5A 1JSRA 2HV9A 2FA9A 1ZH4A 4LZWA 1I13A 5D3MB 3MAJA 1SBNE 3TQQA 5IU6A 4B09A 2I8AA 3M5DA 3U2QA 4NE7A 1DMRA 2CNKA 4OI2A 4NS1A 2IEGA 1ZZGA 3FI0A 1P19A 4P4TA 4GSLA 1E6WA 4IICA 2HF9A 1PGJA 2Q1SA 1KZHA 1GGJA 4Q47A 4CL2A 4N01A 1ZVJA 4DRXA 4YXFA 2OD2A 1YWGO 2ZSHA 1N4DA 1OBFO 2JFGA 5A4MS 1J2EA 2WF7A 2X4IA 1ZI9A 4LBVA 4MSUA 2DTEA 2L19A 1MABB 3C3EA 4OQQA 4BNLA 4JU9A 4JB3A 2QM7A 3TI7A 3OPYA 2G9QA 2XPCA 1PBTA 2PD4A 2QMYA 2X6QA 1DB3A 1Y3FE 3BCRA 4OPMA 5CW1A 1KYXA 1CNEA 3RH0A 6GPBA 1MOQA 1AV6A 3E7PA 4HS4A 3VHLB 4JV5B 3ZDBA 3NYQA 4MV4A 3FAZA 2Y1FA 4US1R 3SXJA 4DNOA 5C32A 1NBME 3DCYA 4GUDA 4KAJA 5ALDA 1O0BA 2V98A 3DMGA 3ANXA 3FSJX 4V39A 4E70A 1ZC4A 3S29A 4HNUA 1XXHA 4IXDA 1XFDA 1RP7A 3KT8A 3PQ7A 4RX1A 3BQNB 1REQA 4PG4A 1H2FA 4FU0A 4ZVPA 5B4UA 1XWIA 1NQXA 3EDQA 2JIDA 4NH4A 4J7XA 4IHQA 1ACJA 1CUHA 1VJ1A 5IC5A 4NENA 5KYNA 3U44B 2IIBA 3NKFA 2XUKA 4MUYA 3ZWXA 1D1PA 1Z13A 4XVRA 4RLQA 2ZRCA 4P32A 2ZUFA 1DG9A 3Q4GA 4KPUB 1HDIA 1PHRA 5ALTA 4E2WA 4L1KA 3OBBA 1KC1A 1CUUA 1NM5C 1U94A 4R1TA 4WMLA 5SZJA 4AJOA 5CFRA 1BYIA 5HOQA 1IBRA 1E6MA 3BWCA 4KO3S 4LWZA 1L4GA 1XTPA 4D46A 1YB6A 2PVPA 5LP1A 2LDBA 3HMQA 3PGA1 1XCPA 3EIXA 1R0ZA 4CBVA 1LC3A 3U4DA 2CF6A 1E9RA 1UPAA 5E8RA 2YJ3A 3HR8A 3DE6X 5EQDA 3CCBA 1AKEA 1M33A 1Z8HA 5ECGC 3A1WA 4DV2B 2GVDC 2SCUB 4U6NA 3NIFB 3QPUA 4M0CA 4LGYA 1GT91 4R2WA 4MROA 4W1RA 5M04A 3PR2B 1ECJA 1E7MA 2ZJ5A 3FYTA 3RSHA 1K86A 1T1SA 2XNHA 3M6WA 1X2EA 4EW2A 1FX0A 1SC1A 1AXGA 1C8KA 2YYSA 3M4ZA 2QAGB 4LMAA 4EUSA 1LI7A 3A9RA 2Q0SA 3QWFA 4Z0PA 5KHLB 3D9QX 3SS8A 1I94B 1F7VA 4TM7A 1HMPA 5FT9A 4US2R 1WA5A 4GMGA 3Q7QA 1M76A 4OJKA 2Q07A 5G1OA 3S2FA 2ISQA 1XMXA 2E0IA 2PSFA 3UKOA 1PJSA 1H3NA 3LL7A 1A82A 2B8WA 4I46A 5J3JA 4NFLA 2EF0A 4YP7A 3G0HA 2WV7A 3LLCA 4FQ7A 4IUCS 3R6DA 3D0KA 1N2XA 5DHPA 4ER6A 1YHZA 1ODLA 3L18A 1XELA 1ZMRA 4HFRA 1UFVA 4K8OA 4RH3A 4AS1A 4LFBB 2X9QA 1TQHA 2ZIAA 4LDQA 1PK7A 3BTOA 3GO4A 2ET6A 3HB1A 3TTVA 5C8VA 5AVXA 2F43B 2A6PA 1FRFS 3NGLA 3UJCA 3VNRA 2KBFA 3AYXB 4UD2A 1M1UA 4WJKB 1PS9A 4HC4A 4I81A 1E63A 3WFJA 2JI7A 5A5DA 1U63A 1OGIA 1URPA 2PZ8A 3LY7A 2OM6A 2Q8PA 2ZCUA 2I6SA 4F45A 1LSUA 5J4VA 2OFXA 4OGLA 4EUHA 4M1TA 3DDSA 2IYLD 3SYMA 4G4JA 4Z3OA 3R6WA 2C4UA 2JH8A 4OM7A 4YMHA 3M9LA 3LIPA 4XYGA 1JIIA 1FYWA 5FO1A 3V2HA 1O0CA 3ZWCA 3C74A 1E99A 5DOVA 2CB9A 3P94A 1UZUA 1W6RA 2W2XA 3SS7X 1T4MA 1M7GA 3FKJA 3H5LA 3H42B 3PUXA 5ALFA 5DCWA 4Y2HA 2H2HA 5AVUA 2C9CA 5FPHA 3NBXX 3R8FA 3EA0A 5AW2A 5TGTA 3S0JA 2HI0A 5BNIA 1ZLXA 2G70A 3HBAA 3IAAA 4MP6A 1PFVA 1AMNA 1JQ3A 1KZGB 3JQ9A 4NYMR 4IFEA 1EQUA 1ZDMA 4UDOA 2A0KA 1PCXA 2R1TA 4ON9A 3ICEA 5NULA 3LDAA 4PC7A 1T0IA 3OE7D 3M0EA 1XHLA 2H5LA 2OSVA 4G8BA 1NVBA 4GLBA 2Q3BA 3ISTA 3BS4A 3ADDA 2P9TA 1N6OA 5AJVB 1L6IA 1XRRA 3H0CA 2IEZA 4FUTA 4RQUA 4EYGA 1WU7A 1E5DA 5BSHA 1WSWA 1YDGA 2VDLB 4HWOA 4H7KA 1Y1KE 5GADl 3ASZA 4RVNA 3TZKA 3LQKA 3VH1A 3G8DA 2AMJA 2OB2A 4DPKA 1P1FA 2PU5A 4RD4A 5ESWA 4KYVA 3L77A 2V4UA 4I08A 1KO4A 1FVOA 1XZJA 3A32A 2VRCA 1EXMA 1XEAA 2H9AA 2REBA 1GPAA 1U4SA 1CE8A 1UEXC 2VYQA 5KKCA 4GG1A 3RODA 1DBRA 5JC8A 1H65A 1NMYA 3NEYA 3EYAA 3OCYA 4EF6A 1VKHA 3L6RA 5JY6A 4RVDA 1YGPA 2I65A 3PGKA 4J4BA 2WWHA 3BMOA 3BWBA 4M1EA 1PJLA 2BHTA 3ACDA 2EKQA 4P22A 4EFMA 1QIHA 5JCXA 1M0EA 1IEXA 2DHQA 1IZ9A 2XMPA 1I4LD 5CLLA 3NFYA 4JELA 2QQGA 5J40A 5AK5A 4BNDB 4CKBA 2H31A 2QLBA 1Q7EA 4FHGA 3YASA 3K09C 2DHCA 3JQRA 1CF9A 3CLVA 3IAS6 5COQA 1FYXA 2EEZA 2J09A 1FBNA 1CUZA 2QX9A 2ZYVX 1E4OA 3AP2A 3NBKA 5F76A 4O4LA 5LZ5A 5LJIA 3QW4B 4MW5A 2VEDA 1XL0A 5F73A 3WB9A 2F8MA 4US0R 2J7PD 2X3FA 1IHXA 2XUJA 1O5OA 4CMEA 2YMMA 4U02A 3F8SA 3TCKA 4YR9A 1KO7A 1NUSA 1ZGCA 3IODA 4O4IA 4UBMA 5ALLA 4W5OA 1OFIA 1QSGA 2PWAA 1SHJA 2Q3HA 1W75A 1OIWA 9MHTA 3G82C 4GP9A 4GO1A 2QRGA 4O2BA 3H9EO 2RIRA 5HGJA 3R8XA 3DEKA 3E5NA 3MWDB 4Q39A 2PRSA 4IIJF 1DP4A 1L4EA 3A1FA 2O23A 5IKXA 1T3TA 2VT3A 1YONA 4M86A 3EUAA 3DC2A 4FOSA 5ECWA 1ZM3A 4MWCA 2KWIA 4N5LA 3UJ7A 4DIKA 4NQRA 4XGKA 1X9HA 3J81A 2P0AA 4NZ9A 1COWD 1WMFA 2IYNA 1P4AA 2OCYC 2PZLA 4HAOA 1WVIA 1LRLA 3GEPA 1MH1A 3MJFA 4FD2A 4Z7OB 2AW3A 2ZYRA 4Z4QA 2W37A 1S2GA 2V9CA 4YN3A 1LCIA 5JROA 3QXXA 4ZVLA 5I9BA 1FYEA 1R5BA 4UM8B 5ILOA 3NTUA 4BNIA 4I1RA 2CVHA 3IUJA 4WNAA 1JG4A 2NZJA 4YJ2B 5LDDC 3CRVA 2LW7A 2PKCA 4ESEA 1Z5VA 4RZIA 4UM7A 3O0TA 5TJ9A 4A10A 2O05A 4F5DA 1HTTA 5EQTA 1OASA 3D4OA 5K3FB 2OV1A 3UUGA 3AY7A 2C95A 3EZ6A 3Q6IA 3DBVO 4G9BA 4PLFA 2DWOA 2VDPB 3I39X 3BFXA 3T3IA 4M1SA 3A05A 1WLSA 3MQ4A 3BAFA 3I76A 4ZVSA 1DO8A 2XZTA 3L79A 5HE9A 5CB0A 3I9JA 3H5VA 4MMZB 4BEVA 3N05A 1A9ZA 4HG2A 1IN7A 2DRIA 1CKEA 1RM5A 4B2YA 4YRIA 1XXHE 2PD3A 3BBLA 3PYXA 3VMFA 5B7QA 2X1LA 3PX2A 5BYKA 4IV0A 5J1TB 4CLEA 1GQSA 2QYOA 4LHZA 4MQ5A 4KPGA 5JO0A 1YACA 1WX1A 4LXXA 4ENVA 3GA5A 1KPGA 1JXMA 1SD1A 4LECA 5DKFA 2VCHA 4GX2A 5LNK6 2I91A 1YZHA 1K4MA 2ZR0A 4IDBA 2BKLA 1ISSA 4ZAGA 4FZJA 1N5LA 2EKBA 2ZT5A 2TYSB 3GMIA 3P0EA 4WFIA 3OTIA 2V5VA 1X38A 4B17A 3ONFA 1U7ZA 1XDSA 2C78A 2RJ3A 3NBQA 4LBZA 2WY2D 3D6FA 4NICA 1FA9A 1UKVY 2HIMA 3P2JA 2HK8A 2RK6A 2BR5A 3KDAA 1QORA 1Z29A 4LDNA 4QHTA 3T0FA 2AGVA 3MTGA 4OJNA 4XB6B 5KWJA 2JD2A 4DLAA 1Z4IA 1TVCA 3A06A 1E3SA 4BO1A 5FHRA 5G1PA 5CFNA 2BY4A 3RD5A 2GXAA 2B20A 3CUKA 2AJ8A 1TFRA 2ARKA 4ZYZA 4DSZA 1ESCA 4KQWA 1OHHA 5CK5A 4Y2VA 4CF6A 1ORRA 4N6OA 4CN8A 2ENUA 5EWLA 4AO8A 4RE6A 1Z18A 3CX3A 1OFUA 3E0XA 3FR8A 3TRIA 3HY6A 2RARA 4QJIA 3KAJA 1MQSA 3C8UA 4R2XA 5HRAA 2I4NA 2O2HA 3ODPA 1ZCFA 2XWQA 1X2BA 3MCVA 3FY4A 3DDZX 4EJ2A 2M32A 3U4QA 2J3IA 1NVXQ 2J0VA 2RGBA 3HB0A 4FK8A 1L5VA 2IBMA 1SA0A 1G7SA 2XVAA 4PX3A 4EB6A 2DFTA 4GMKA 1OXTA 1L5FA 1TJNA 2YIJA 2GBPA 2ZIFA 1M8FA 1I7QB 4E4TA 5IJ9A 3FCSB 1KYIA 1JX6A 1BJTA 2JZNA 2QIPA 1RVV1 3EQ8A 3KM0A 3N8DA 5H81A 4B32A 1DJNA 1HURA 2FWMX 9LDTA 2VSYA 1H6DA 2PSDA 3IAS1 3KD2A 3OX1A 5AVSA 3CRNA 4WZ6A 4MKZA 3FPCA 3I8OA 3F2IA 4E5SA 4IQFA 5BN4A 3TECE 1DEHA 1KAMA 3BSWA 5EEHA 5DEIA 3TVYA 4FB4A 3SLGA 3H9JA 4MKRA 4TGLA 3R3JA 1Z16A 3KUDA 1MKYA 3ZDQA 5ECDA 1MH9A 1INLA 1Y5RA 4II2A 4ZAVA 5DF1A 2FR0A 1J6UA 3R44A 2I2XB 2YYYA 3GX1A 4JBNA 1RSZA 2OTCA 3ROPA 4OQZA 2UZIR 4RLHA 5BVGB 1QK4A 2ZTLA 2H2FA 5AVQA 1UDBA 5JDCC 4GPBA 2PUTA 3DCJA 4F72A 1F8FA 1WUKS 4FMDF 2GZAA 4IWNA 2BC9A 4RGVA 4LJ8A 1UAAA 2WEKA 4LMPA 1BHJA 2JFQA 1I01A 3A6JA 2PX5A 3CINA 4JLOA 2C8VA 3WRXA 1GARA 4M0PA 5TMBA 3WFZA 3ME5A 2BD0A 3PC6A 3TRJA 3H16A 3SSMA 4B0PA 2F59A 3G6KA 1QZUA 2X8LA 3PFGA 4Q1DA 4F6CA 4P3PA 3CT6A 3DTVD 5EJ5A 1N1GA 3FFTA 4MJ7A 3OT1B 3QE9Y 5K0LA 2ZYDA 2JH3A 4GYYA 4M7RA 5K05A 2WTEA 2GN1A 1QHHB 4HDAA 4MYHA 4CMIA 5KTKA 2CNLA 2QX4A 4RYDA 5B3JA 3IIEA 4LWQA 5HQTA 1FJXA 3K6JA 5FUQA 1N3LA 3DV0A 2R6FA 5THQA 3EH2A 4TV8B 1XRLA 4IF4A 1UDCA 2C9YA 5I4IA 1CFJA 3LBAA 1ZSNA 1RP1A 1PW7A 1Z88A 4K03A 3LKZA 3ZCVA 4CKEB 4PYRA 2OAP1 5B37A 5F23A 3GNTA 4B7CA 4BNXA 1WPRA 5K01A 3QFSA 3U4GA 1N1EA 1U5BB 1HZZA 1P9NA 2QDKA 2G67A 4R1QA 7ADHA 4KKVA 4GPD1 4AKHA 3QVWA 3GVXA 3RAEC 1W9MA 2QR2A 1VHJA 3HYCA 1GZ6A 1JI3A 4YP6A 3DBLA 5LNK1 3PZBA 1PT9A 1LV7A 1YI1A 1RJDA 2D4HA 5D87A 2V55B 4F5EA 3HVJA 1GVNB 4UBJA 4R2HA 4QU8A 1QV6A 2CLKB 1R64A 1QTIA 5EXXA 2BUBA 4MLDA 4ARZA 1V8PA 2JGEA 1NN3A 4HB3A 3FPGA 4HHEA 1LBEA 2X8JB 3UIEA 3NHLA 5NLLA 3LUHA 2ZSAA 2QZPA 4ZQHA 2VP9A 4FDUA 4C20A 4FLFA 4IO0A 3DBIA 1E5VA 2I4LA 1R0BA 3OTWA 4LJSA 5DP2A 3FHJA 3IO5A 3C6KA 1W59A 4YB8A 4JLKA 5C8YA 2OXTA 3FPAA 4RVOA 4DN6A 3W06A 3T5AA 1C4XA 3EFEA 2Q5OA 3H9QA 1C3VA 4F71A 5B4TA 4HNSA 2HNBA 1F0KA 1MN6A 2A84A 1I4TD 3SEQA 3OPVA 2C5FA 5I45A 1KNQA 4GT1A 7REQB 3TTTA 3MLAA 4QGBA 1DPGA 1U3DA 3RU7A 3TUZC 2W6PA 3QXJA 3M70A 2RH9B 3PXAA 1L3IA 2DWPA 4U2DA 2WA2A 2GYWA 3DFMA 1NMQA 4BLQA 1AN9A 3REQB 2ETXA 3GFRA 3PPYA 1WNFA 5CVDA 1E3MA 3Q8MA 5FTMA 2YHUA 3TLJA 3QG1A 2NQ8A 4IX1A 4M38A 4C7BA 3A4MA 4QDOA 5CB8A 2BFWA 4DA9A 1VLHA 3K6KA 4J4TA 5DM4A 4J2OA 5TRTA 3NWBA 1FYVA 5FLXA 1DS6A 2Z6AA 4WK6A 4XOUA 4CKCB 3NO4A 4MYUA 1C7RA 1ILEA 2VWHA 4GKKB 1M0TA 2ZRQA 4G0MA 3SNKA 1QB8A 3T1YB 4M0DA 2EDAA 1Y42X 2B99A 3I42A 3IEIA 1LLFA 4AULA 2O2ZA 5JNVA 1DRUA 2O8DB 2YOGA 3Q7RA 2HK9A 4ZT4A 4W1QA 5KJEA 1TM3E 4TKUB 4LYHA 5JV5A 1L4FA 3V00A 1T0HB 3PXDA 1T24A 2H4HA 1DT5A 1F20A 2XUQA 4EPWA 4JDUA 2R00A 2AR7A 3P4UA 3Q3JB 5BN3B 3O26A 2R4UA 1CVIA 4EPYA 1ZMBA 3KB6A 1YRYE 4L75A 4KXLA 4OH7A 1KE1A 4D25A 1DT3A 4C08A 16PKA 1N57A 2PD6A 4JC4A 3K2BA 1UODA 3KKKA 2X5XA 1VB3A 4M60A 2Q29A 2HLDD 2V6BA 3UW3A 2VQ3A 5KX5A 3NRCA 3HDQA 4U63A 2AHOA 5M3BA 1XTIA 3OMXA 1EFKA 2GHRA 1VSBA 2PKRA 1I6WA 1R8JA 4G09A 2IITA 3FWNA 4JVMA 2C9DA 1U2EA 1KP9A 3H3FA 4A6PA 4EYEA 4JT9A 2A5JA 1T6ZA 4PHTA 3D8SA 5T4FA 4NV1A 3GLFA 2AFRA 3LA6A 3H0KA 3W7BA 2XJ9A 2RHGB 1S2LA 4PVCA 2ID7A 1LK7A 2R751 3BILA 3UAGA 5AM4A 4NU0A 5I7UA 1DKQA 1NW8A 1PLLA 1AJEA 5DNDA 4IG9A 4QYMA 4CDGA 4KC0A 1G64A 2R8ZA 1JHZA 3QPAA 1JEDA 1DAEA 5LMUB 4YRNA 3OO0A 3ZW8A 1OPRA 4M8LA 2Q0HA 1EWQA 3VAAA 3O7MA 3V32A 4CQLB 1G4HA 3AB8A 2YW2A 2HRCA 2P6OA 4BKPA 2H59A 3KAKA 3M6IA 4HQFA 1J99A 4CQMB 1GG2A 3NVKI 4I99A 2JBAA 2IIVA 3ESBA 1QJ4A 5AOAA 3TLGA 3FJYA 1VKNA 1QGUA 2YJZA 1RBYA 3DEFA 5TT0A 3T1QA 3CF4G 5BXQC 3EBLA 3S2UA 1BRTA 3P4XA 1XMVA 3OD1A 3V42A 3GCGA 1EUQA 2JLWA 4Q3KA 3WIOA 1KARA 1PDVA 4JITA 5JZBA 2J46A 4O59O 3PJGA 4R1SA 2J1LA 1OLOA 1NQTA 4Z2AA 4QZVA 1XPOA 1RAHA 3RCBA 4JN6B 5EVJA 1CVLA 1EZZA 3NBFA 2YWCA 3ELDA 3BRWA 4RY2A 3FLAA 4I2VA 1C3OB 1M10A 3JQ7B 3SFZA 1YA6A 3K0AA 3DZJA 1YH3A 2B2NA 3EIEA 1KQNA 1PKXA 4HD8A 4PINA 5GJCA 4WFQA 4OYRA 4BNJA 5BSWA 1A7KA 4ESVA 5K45A 3W6OA 3UCEA 4R7ZA 3I1FA 1ZOIA 2C2GA 2NQ2C 4Q9HA 1Q77A 1RVDA 1OV4A 2Z09A 2ZUVA 5H3CA 3TSZA 3AUYA 1X1RA 3R0ZA 5EHXA 2UYQA 2F2TA 4E51A 1Y4ZA 4B74A 1L5SA 5CJJA 5TGZA 1CQJA 4A92A 2GZHA 1KGDA 4G6ZA 2GFHA 4N3NA 3LC0A 5HWSA 1JVSA 2IGBA 2PS0A 3MWFA 3QKWA 4XDYA 3F4BA 4CM7A 3TLMA 2JGRA 4HYEA 3L0BA 2FPPB 2PWZA 1WMBA 3O0DA 5D51S 4DXDA 4KO4S 1BWPA 2B9EA 2HNKA 2P3QA 1MAUA 2ZLBA 5AW5A 3H1FA 4I55F 2NZWA 5EKUA 1E89A 2YVAA 5GOZA 2W2TA 1RXUA 1KBZA 1RHKA 2P65A 1UPTA 3E15A 3PRJA 1KC3A 4XA8A 1A8PA 3B6KA 4OJMX 4WJZA 2EFJA 3BXFA 4NU8X 4TWAA 3PE4A 4BMZA 3H2SA 5LA6F 4QUDA 2C5EA 2OV4A 4G5OA 5JW6A 1Z6XA 1AGPA 2ACEA 3CG0A 3F7TA 2REQB 1HSZA 3KR2A 4HRVA 4ZQCB 2V7WA 4LJ6A 3SYTA 1OI3A 3UEOA 1DIAA 2PWBA 4URWR 3ZGXA 4WCFC 3HKDB 4ZJZA 5K8CA 2FEKA 4D4IA 1GZUA 1CRLA 3EPKA 2P67A 5IAJA 3BBPA 3MS7A 4D8WA 1KR5A 3PHCA 4U7DA 4HDMA 1K27A 3K5HA 3MT7A 2JLXA 1PJCA 3PKZA 5FXMA 1ISGA 1V2GA 2R7KA 1WW8A 2ZANA 1CZRA 4MB0A 1Y80A 2FHSA 5FBVB 4OD0A 3EUEA 3HDHA 5T3YA 3Q6NA 4ZCRA 4AC9A 4L8YA 1A5ZA 3RABA 1GZ3A 2GYUA 3VSBA 2XOXA 4GMDA 3VKUA 3PC8C 3BE4A 1EFRA 4L4XA 5CK4A 3GP8A 4IS3A 1CEYA 2XDQA 5HRCA 1FDIA 1KI6A 3IUMA 5L3RA 2PR7A 2YJ5A 3R7NA 2O3TA 2FXIA 3CRZA 2M98A 4X24A 1J2JA 1QQAA 2D5LA 4S1TA 2Q62A 3JXEA 5E9AA 4Z3KA 3AFOA 3PKJA 5AHXA 5E4YA 4B4WA 1GPLA 1D2MA 1ZJZA 4LHYA 4YRGA 5A7HA 1JHDA 1PDWA 2QRJA 3JR7A 1GZ7A 5SZKB 1PQUA 2JNWA 1EIZA 1EQ2A 3AKZA 2AFIA 1YKSA 4KR6A 1YS9A 2XKJE 3HV0A 3WBJA 1L8AA 2E18A 2I67A 1AUVA 1SCQA 1Q7RA 2CDNA 5A0FA 1LZKA 1QHNA 2J08A 1SC4A 3BM5A 3QIAA 3Q1LA 3HKBA 3LXXA 2HA5A 2J3LA 2UZ4A 2G0NA 1QH0A 4NJOA 4V0MA 2NP7A 3ZH9B 4GOLD 5DTJA 2GEVA 1V3TA 3C3BA 1IIRA 4FIDA 3LHSA 1JKMA 2I34A 3JALA 5FYDA 4DZZA 3JYHA 1FEZA 5CBPA 1XQXA 4A5SA 1FFWA 4QTTB 4RFSB 4YQYA 1HR0B 2H1VA 1QWOA 4ZYWA 4OKNA 1P7VA 4Y2YA 3MC1A 2ZP1A 4KAAA 5LB4A 5KMGA 3D1LA 1AB6A 3GOHA 3PXUA 1EFDN 2PM8A 4CIWA 3D7KA 4GPTA 2A5YB 3TW8B 2GM4A 2VDWA 3WQHA 3NQ41 1MO5A 4QXMA 2I4RA 3NAZA 4AKEA 5KI6A 1XZMA 4IDFA 4RXMA 4UUAA 1GL3A 2V0GA 3MWLA 3OCUA 5H80A 1FOEB 2I76A 3F67A 2IE0A 3B9QA 3KLOA 8AT1A 3PX7A 2XNJA 1TU3A 3KV3O 2YYZA 1ODKA 1RFLA 4PC1A 4WVLA 1F8XA 1QAQA 2Y0PA 2A78A 3LLSA 1MV8A 5AXAA 1CJUC 4AJLA 1JFFB 1GYQA 2YJTD 3P9XA 4XCXA 2EKLA 2QG6A 3K9HA 1G3IA 3HUTA 4L9SA 5AW1A 3THYB 2PX4A 2JBHA 5TQ2A 1VSTA 4A8JC 1IXSB 4F9TA 4URXR 4Z0TA 5BYBA 4HNAB 3R20A 2IUTA 1O96B 2O8NA 3OT4A 3OZBA 1WEKA 4J6FA 2YV1A 4JL8A 1V9CA 4G5SA 4EJSA 4UU8A 1O0SA 1XEWY 3RDPA 2Y1CA 4JBIA 2HXSA 1LRJA 1T8TA 2CXHA 5DO9A 2Y9PB 1YQEA 3RK4A 3UJHA 1TT5B 2XITA 1YT5A 4CUJA 2NV6A 1CUXA 3GPIA 4GBED 4HT3B 3ERCA 1RQLA 3LYLA 3T7RA 2CLEB 4MUEA 3A31A 1XJ0A 3LSTA 1PR6A 4MJ3A 5JQWA 1M2HA 2QORA 2YQ4A 3W05A 2CLOB 5EXEA 2QTRA 1PBNA 5FBWB 3ZCXA 1NF9A 2O3UA 5HUQA 2EFHB 2H51A 4AY2A 3CNNA 1DC6A 4J49A 3QEAZ 5JQGB 2PJDA 7MDHA 1LPAB 2QVXX 2WV9A 4AZSA 5FJJA 4YAIA 4MUMA 4YCDA 5EP1A 5AFSA 1AHIA 3L4SO 2LP4Y 3QLEA 3SSOA 3T9BA 3LUKA 2G9ZA 4IDQA 3I5MA 2W42A 3UNXA 4MUIA 2PZAA 3WJ1A 3QX3A 3EXIB 3FSGD 1SULA 4JBHA 3DULA 1XIVA 4JJZA 3G5UA 4LNHA 1TO6A 2XXAB 5GJBA 3DC7A 1D8AA 2FMUA 2Z08A 4ER5A 2YJNA 4LPSA 4ZT2A 3U09A 1N1DA 3SZMA 1K8YB 2CGEA 2IX9A 3B6IA 1RM3A 4B3MB 3VU0A 1T1IA 3WDMA 3R0IA 5HBRA 1H05A 2Z5GA 4QDJA 3UHFA 4EAQA 3IS3A 4R8MA 5CDGA 4LXHA 4MLCA 1DQNA 4KSCA 3HR4A 4LIPD 1DC5A 4IO1A 3RKSA 4G2TA 4HSEA 2TRSB 4YBRA 3TXAA 1UBLS 4KWTA 2PMDA 3HB9A 3MINA 3DLBA 4KEAA 1OC2A 1XRNA 1C29B 2GQ0A 2I99A 4LY0A 4X54A 4X3PA 2MR5A 2YZNA 2B4KA 4NCKA 4PNHA 2ZTVA 1HEIA 2GLXA 3TQOA 3LFTA 1R0RE 3R3VA 4DCMA 2ZPUA 1U04A 4TYYA 2EW1A 1GWNA 1ZD8A 4O63O 5IVIA 2Q2VA 3SIWA 5EKXA 2AN4A 3JD2A 3I5XA 2ODPA 2KW5A 2BM1A 2G28A 2QTWB 4N3BA 3BHJA 4JENA 3ZWNA 2XQKA 3LXUX 3OA2A 4ND5A 3FWKA 1TRHA 2E55A 4W6QA 2C2ZA 2PMBA 1BVYF 5HCNA 5A7FA 4F86A 4XYEA 5CA0A 1SIBE 2IKQA 1IQRA 5JSZB 1LLQA 2Y0DA 2Q7XA 3LH5A 2Y9MB 1J5XA 4H7JA 1XEXA 4UDNA 4OK3A 1J24A 2A9FA 1UKBA 1GGEA 2DKNA 3DZBA 3M82A 2IS1A 1M6YA 2GBIA 2OESA 1XVVA 3P45A 4BU0A 4RELA 1E2NA 3WGLA 1QMPA 3OIUA 5D5QA 3O38A 3I62A 4Y9TA 3X1ZA 4GR4A 2O8BA 2PYDA 3QA3E 3SCZA 1JKIA 1VPVA 1OI7A 1PG2A 2HPHA 1KOLA 4JJ6A 3RS8A 1WE2A 3GGPA 2WIKA 4S1WA 2QE7A 5LJLA 2XQVA 1G4UR 5CLHA 3D6NB 4I4LA 3X1MA 1XA4A 4Y8VA 1U8FO 4LE0A 4MW2A 4EEKA 3M6FA 2CMDA 3ECCA 2XYPA 4BV9A 4G0WA 1YF3A 1W4ZA 2OBBA 3RBAA 1T6YA 1QYIA 1FS4A 1X7YA 2GJ8A 3C8MA 3HFJA 4JI4B 2A33A 5D5HA 3FHLA 1OVMA 2FN9A 3QVMA 3WLOA 3VDMA 3G5MA 2IYYA 1YDFA 1DKMA 3PFHA 1G8YA 4MVXA 2P4UA 2W2QA 5JOQA 4YCNA 1LRKA 5JNLA 3FMGA 2CYBA 4TXJA 1P4RA 4EUEA 5FA5A 4OREX 5CT8A 4KFCA 1RI5A 4NOLA 4F06A 2NVOA 5EE1A 1Q6ZA 1NGSA 2PO7A 1KFEB 3B89A 3QJYA 1QDUA 4IQGA 1NM5A 1EXDA 3JWPA 1HI9A 5TVGA 3S5UA 5BV2P 4RD1A 2IXFA 2PBFA 2V45A 3TN7A 1RLOA 2A9JA 3Q9SA 1K5DA 4FE7A 4J0EA 4A26A 1L5LA 2D2EA 2BFEA 2GCOB 2ZPAA 3IBFA 4KV7A 2VJMA 2P62A 2YH2A 1BYUA 1NLZA 1PLJA 1SUFA 3FWYA 1B1AA 3RTGA 2YVUA 5JFGA 4QM6A 1LPBB 1SFRA 2EWMA 1E3WB 1P9LA 2AC4A 4FMCF 1MW9X 1PJAA 3AOGA 4AUNA 1P33A 5IVKA 3BA1A 1PFKA 1BE6A 1JW9B 1V11A 1KY2A 3RUDA 4OLBA 3KPUA 2DGDA 4EELA 3F2VA 1E79A 1IOVA 2C8JA 2PUJA 1EK1A 3L4BC 4JOBA 4P7FA 1SK9A 2PSJA 3THSA 4BFCA 4BIMA 2IYVA 3FVQA 2XZDA 2GKOA 4R1MA 3EDOA 1JTVA 2DOKA 3VZSA 3RIMA 1W94A 2H4JA 2QTVB 5EIHA 3KPVA 1ICIA 1UBJS 1XDGA 2AOTA 2ZT6A 4INAA 3A3OA 2QTHA 3WV4A 1WHTA 2C20A 1AURA 3NHWA 2UZ1B 4RVHA 4A6XA 3H5WA 4HQNA 1ONNA 1MAHA 1U1EA 3FOEC 1UKAA 1G8HA 3ZY6A 4XVUA 3F7MA 1POWA 1DVRA 2FDRA 2AFIE 1LB1B 3DXZA 3M6XA 1XDWA 4AN0A 3DBOB 4Y9SA 2QSUA 1KXZA 2GXQA 3BFKA 2HU5A 4BMCA 1M6HA 2GVZC 3DONA 5JG7A 3EG9A 1YVUA 1W8IA 1IRXA 3N39C 4EW1A 5AKYA 4DPLA 2E1RA 4DMMA 3GD5A 2YOHA 1U9IC 1FLVA 1ATIA 4V0ME 1CY4A 2EJBA 4XD7A 4BLOA 4CZ2A 2G36A 3A7EA 1LLUA 3CA8A 5G3YA 1DXYA 1G0NA 1I1OA 2Y76A 4M0LA 4F3KA 4LYEA 5MFPA 1T4CB 4MQ4A 3IVMA 3L4JA 2W6ID 3LY9A 5EZQA 4AZTA 4TYNA 4E3ZA 4JP2A 2X77A 2OM2A 4NMLA 3GLTA 4WECA 1L7QA 3VH2A 3DGFC 3O2NA 5AK6A 4EG8A 1NLUA 1L5MA 1TCAA 3NNSA 2PGNA 1E94E 1U0FA 2X0DA 2WP0A 4HPJB 3A11A 4RIGA 2PUVA 1EESA 2C31A 2TMYA 2XMDA 3O74A 4ALJA 4E1AA 2H4ZA 1GPNA 2GYYA 1MUUA 3WGTA 4FEEA 3K1AB 1CDOA 1EKXA 4FX5A 2N1MA 1PDOA 4HBZA 2KBEA 4G5GA 5GGXA 4OSOA 1M2WA 2VJYA 3C15C 3VJMA 4WXYB 2AA3A 2PXCA 2D5IA 5TQVA 1ZMOA 4OO3A 1FLAA 3A1EA 2JLVA 1W88B 3P52A 3A1VA 2DVMA 1LBHA 1K7CA 1FK8A 4MQ6A 5FQOA 2B9VA 3WISA 2ZPTX 1SUIA 1P44A 2WPDD 3I9OA 3T06B 3BD8A 3FPLA 1W2GA 2Y67A 1M2KA 2FNAA 4JK3A 4RL6A 2BONA 5E38A 4AL4A 1P2BA 1OZFA 1L7NA 3ON5A 1QDEA 2HSZA 1D0SA 3MFYA 3OQVA 4YRCA 1QU3A 1NWCA 2JCYA 1NQOA 4UTVA 1SH7A 1F3OA 4EI2A 4L4RA 4RIEA 1B0ZA 4IIXA 4Y1RB 1PWEA 2WHYA 4H7PA 1H6BA 5HIMA 4DL9A 4AN4A 1JEQB 2FTKE 3MEQA 5TQ0A 3DKVA 4HDSA 1U7PA 3G68A 5TEVA 3D2BA 2FEXA 3ILYA 4OL0A 1GHTA 4KFUA 5HW0A 2YFHA 3KTOA 1OXUA 4OLFA 3HKCB 3RT7A 4EQZA 5L4SA 3HJAA 1J9EA 1F14A 1U5AA 3C5CA 4JGGA 1SPBS 3U6KA 1G5PA 2B4RO 3NPAA 3QHAA 4WQMA 1EJ2A 1ACLA 4YXWA 4CWAA 4DCGA 2BZ1A 2DKOA 3OJXA 1XF1A 2JEOA 3UENA 3Q9UA 1H6AA 1YRQA 4YPOA 1ONBA 1T0JB 4GM1A 1XPUA 1HT3A 2P7IA 4ZZ1A 3MM4A 4Q4CA 3K09A 5C18A 3PWZA 1Z34A 2FKAA 4X97A 5IH3A 3FFXA 5LU9A 1EB8A 1PI3A 2MT9A 2Q3MA 1FP4B 2IYQA 2QI9C 3M34A 3OM1A 5CYPA 5I8PA 2ODQA 4DXHA 1T5TA 2H1WA 2ZJ7A 2CCGA 3OZCA 3IFSA 3P9RA 3W3AA 1NW4A 4BZZA 1YU6A 1XV5A 1Z0IA 5JT1A 4OBEA 3ZQJA 4M83A 2XOEA 4PYQA 5KU1A 5KYXA 4JI7B 4S1PA 1OTHA 5JWRA 1SCDA 4WIAA 4DDWA 3MMSA 4KXUA 3R6GA 3PQ3A 4PIPA 5P21A 3Q88A 3WHLA 5F7XA 4JB0A 2ODTX 1Q20A 1T5OA 3OKFA 1PNOA 4FFOA 2WU3A 5AOVA 2WB2A 3TW6A 4KYTA 1R15A 4B75A 4BZWA 2NTVA 5DN6D 4EX6A 4O4LF 2JIMA 1KOFA 3EFOB 4OMCA 4RHUA 3S99A 3ZS9A 1GNTA 5FI0B 4EFLA 3KAQA 3LT0A 4DG8A 1NNSA 2BBSA 3IKVA 5EKSA 3CEJA 3WLJA 4EL5A 5K8UA 3GJQA 2AX3A 3NGXA 1IJEA 1GTL1 4J1TA 3RSFA 4OAQA 4CIDA 4HB2A 1WUYA 5AJZA 5FTNA 1W5SA 4WKGA 3ZDAA 1Q50A 2RBGA 1RE1A 3SQDA 2N3ZA 1V8ZA 2YXLA 1QG6A 4ALIA 3BZWA 3Q41A 3FWZA 5DGCA 4BLRA 3IYLW 4E09A 2GPWA 1Z2OX 2C2YA 3UAVA 1YMVA 3TXXA 2QYSA 4H7FA 1V5GA 1XVIA 4ITUA 2C4NA 5B6PA 3CKMA 4KGZA 3GLGA 3EC1A 4JI2B 2ZKIA 1DRKA 1CQIB 1USGA 3I05A 2RHDA 2Q1UA 5L3SB 4O3MA 4G07A 4R7GA 3OI7A 1PZEA 1BVRA 2W2VA 1TKAA 1TPYA 4YQZA 3KL4A 2OKCA 1A9PA 1L6RA 2DC1A 3PNVA 2R6JA 1PQPA 2PUWA 2RIPA 3UVEA 1PZFA 4BTEA 1HX7A 4Q3LA 5I9NA 4ND3A 3DJYA 1G5RA 4HLDA 1NE2A 3GRYA 1ZICA 3IULA 4REOA 3CZAA 2QP9X 3EZNA 1YBAA 4HYQA 4IOLA 3VI4B 4B3TB 1R0XA 2A5GA 1X3LA 2AD5A 2HXYA 2CLFB 3L0OA 1A5BB 1PFWA 1ZKMA 2DQZA 4Q1BA 1LVUA 1YJQA 3DT6A 2ZTUA 3NUGA 4MNTA 5TY0A 4QOIA 4V1CA 2A35A 3K6SB 1XZ8A 4GQAA 2YY6A 4XR4A 3KQNA 3UUFA 2JAQA 5G53C 5GJVC 4I4CA 3VJKA 3P7MA 1FNDA 1HUQA 2OV6A 4P54A 2XYVA 3BXXA 1EMDA 4JEUA 2HCTA 4DNFA 1ABBA 4MW1A 2VSNA 3GB9A 4IIUA 1E4EA 4IJWA 1DC7A 1DL5A 1J8FA 1XKTA 4JQZA 4W63A 1M1YB 1QH1A 5J5AA 4BP9A 2J0UB 2FDXA 2SBTA 4N3AA 1XOIA 5EXTA 4EMUA 4W6ZA 1TK2A 3MCUA 4KVAA 5ENVA 3HKEA 4DHWA 4EQ6B 3BXZA 1QTQA 4O2LA 5E3HA 5EY5B 4AP9A 1U31A 3DTVB 4WOCA 4DXAA 1SHKA 3BSSA 1VIYA 2Y27A 4WX2B 1L5HA 4CE6A 4LRTB 1LF0A 5TSDA 1EE2A 2XYGA 4DDVA 2DR2A 3MD9A 1U11A 2B82A 2E21A 2XHEA 4K6CA 4LV5B 4RPGA 4TTIA 1VE3A 5A6SB 3ABRB 3V3KA 4XJTA 3FROA 4LOIA 1FY2A 4W5QA 3RF6A 2VRCD 2C7PA 4HLCA 1NQAO 3V9AA 5EXPA 5K4GA 4E5KA 4HNTA 2GEKA 2GZ3A 1E7YA 4Z54A 3G1UA 3H5IA 5DX1A 4DABA 4Z7NB 1OXKB 1PFUA 3T99A 5EJAA 3LSYA 1R10A 3HNOA 2BKVA 2IV7A 2Q7DA 3Q2OA 4PG8A 3G8BA 1LW7A 4OHYA 2O5VA 4ZT3A 4D57A 2H1LA 3AI1A 1EWVA 1FFGA 1UZAA 1A0OA 2C3UA 1ZM2A 2G25A 3H2GA 5DZSA 1QYCA 2SKDA 3FNGA 4QJ3A 1U3GA 3GVCA 2FJ0A 1AK1A 5FPYA 4UBOA 4OY3A 1QGZA 1MX5A 4C03A 4RKRA 2ZTHA 4V0NA 4PPNA 5A5GA 2GX6A 4W9NC 3RASA 4M49A 1MO3A 2I6GA 1H3FA 3WHPA 1DIHA 2VTVA 1X77A 3AV3A 3B12A 3ZWBA 3E2IA 2V74B 4X1KA 1GOTA 3F5SA 2ZCJA 3RTBA 1GUFA 3IP1A 3R4VA 4AKSA 4OHBA 4JL5A 4YJHA 4XWYA 5AXDA 2E4WA 1H9AA 1YD7A 1P1RA 3EMVA 2JFOA 4FD3A 4M1WA 3NHYA 3WGYA 3WOHA 2ABWA 3ZY3A 4QNRA 4BRWA 5KC8A 1Y8QB 4G56A 4KX5A 4FYMA 3TMAA 2NO0A 1YOVA 1N0WA 3CVVA 2Y1LA 4Q7JB 4LXUA 1CNFA 4RHEA 5JDCA 4KE6A 3LLMA 4CHGA 2VQEB 3V6LA 2P77A 1XTKA 4N40A 1I5OA 4HOYA 4PPGA 5KDLA 3HB7A 1KORA 2FWIA 2YVQA 2H7YA 2GD1O 4Z1MA 1Z4JA 4Q19A 5B58T 4BUZA 2YR0A 4WE3A 1MBZA 2JGFA 2Z1NA 3GLRA 3HXQA 2IA5A 3AF6A 1C0KA 4RKFA 4U5QA 5KVQA 1H0KA 1ZIDA 3UOWA 1XCMA 3FKQA 2VHXA 4FLMA 4P7JA 4OQXA 3WYNA 4E4YA 2JGDB 4R9RA 3OE1A 1N1MA 4PLGA 3R0VA 1YL7A 3L1VA 1FJ2A 2WZCA 2NSHA 4P98A 4KQGA 1PR1A 4DMGA 1G6OA 2HJSA 3DSRA 1K7YA 3UFXA 1G5TA 1TJ3A 2WMOB 3ELUA 2JIPA 2PH7A 3X44A 4HWRA 3TOVA 4FMDB 4NSNA 2DPLA 4DQDA 1OBHA 2ADOA 3P27A 4GF5A 4KLAA 5HEKA 4Q4HB 4DLVA 3R9XA 1AA6A 4Y2JA 2R7LA 3DR5A 4ZU6X 1FFXA 3H04A 5IN4A 3ZQ6A 1WSAA 5IM4F 3RUCA 1GN9A 4PLHA 2YCBA 4UZFA 1XNQB 1RKVA 4LSMA 3HVHA 1D2NA 4U4AA 1JSXA 2F3PA 4FBLA 5BRAA 1AKTA 4MR9A 3K94A 3FFAA 4Q3BA 4QARA 4YRDA 1JG6A 5LQAA 3R24A 1YVRA 2H29A 2XW6A 2IPLA 2XWBF 4PAGA 2BFFB 4XTCS 3PUYA 3CR7A 2X2OA 4D0RA 1VXOA 4LYFA 1R9NA 5FWDA 2QT0A 2Z1DA 3UXEA 3UXHA 4DM3A 3NHKA 1II8B 1GSOA 1LV8A 3N2GB 5DWVA 4ZDWA 1EZ4A 1OILA 1UINA 4F21A 3N2KB 3NB0A 3TDNA 4H15A 3ZDCA 1RABA 1EUYA 4X91A 1Q7TA 1N6HA 4MP3A 3U3XA 3F6YA 2ZI5A 3QXCA 4QEZA 2XGSA 2OZEA 3ECAA 5LZ2A 1ZJWA 1VSQA 4UJ3A 3AETA 3R0JA 2O1EA 2I8CA 1AUXA 1JR3A 2LKCA 3UCXA 3VO1A 4ENTA 4H08A 3G2LA 4INZA 4L0QA 3TZ6A 3BWDD 2WTMA 1JYEA 2YYAA 2P1DA 2W8BB 1QP8A 3COJA 1K66A 1AB5A 1WU8A 1GQFA 1IG0A 3TTYA 3OX4A 1G38A 3QX8A 4EM6A 3HN6A 1ZD4A 1O95A 1V35A 1ZIXA 2J3JA 3QLVC 4AYXA 2PUCA 4WFJA 4PFQA 1FSFA 3VRHA 1YR3A 1ZX1A 4U7GA 3HYSA 1AE1A 2XB9A 2MMCA 4L5CA 2AI3A 3REFA 1PT8A 3E3AA 2R8OA 3HCRA 4G5XA 1NLFA 2UAGA 3CVUA 1US8B 1XUOA 5M7EA 2NZ2A 4CMBA 3GUYA 5HF8A 2VP0A 3IVGA 2C8LA 1GTG1 1L2TA 1SBIA 3P9KA 3PQDA 5DHFA 5AVKA 4MGIR 1RXEA 3D7NA 2Q6LA 4C2UA 4HUQA 1O89A 4P58A 3VBEA 2ZU0C 1Z26A 3S44A 4D9HA 2GETA 5DSXA 4HNGA 5CCEA 4B8YA 5L8VA 1I6MA 2CLCX 4DGSA 2FG7C 2A1UB 3PENA 3EAQA 4H18A 5ELXA 4ER0A 3IVRA 2O7RA 3DGEC 4DEYA 1B3BA 1DI0A 3ND6A 2HDNB 2NUAB 3C3CA 3R5SA 2Z56A 2IPMA 1AT1A 2GTPA 4HEA1 3G2MA 2VYCA 1M2GA 4KLZA 4NH0A 2FW9A 2EWVA 3AU9A 1KQFA 5I7SA 2JHCA 3GLGE 4K05A 3JS5A 1Q0ZA 1XEFA 3ZQUA 3HK2A 4L0DA 4D4JA 4FWTA 1TC2A 1GGMA 4W7IA 4OU4A 3ESDA 5DJ5A 5JXIA 5KUTA 2JIBA 2A0FA 1Q74A 3MTDA 4X94A 4HTAA 4A03A 2C5GA 2VHCA 4LW8A 1MNQA 2PTGA 3B1WA 4GM4A 4GL2A 3P9ZA 4TXHA 3A6PC 5JIBA 2RGWA 3WRWA 3ZWVA 4I50A 1KI4A 1SUPA 2ID4A 2GI4A 2HHLA 2OO5A 3EMKA 3KQMA 3W1WA 3WWPA 1VMAA 4P38A 4TWJA 1BGXT 5I5EA 3PFWO 5F12A 4IIFA 5CPFA 5KSWB 1C7EA 1C7ZA 1USKA 5SY4A 5IDYA 2W6NA 3K15A 1YSCA 3AEYA 3VA7A 1T4BA 1IL0A 1TYBE 3IMKA 4HF7A 1YO6A 1G5QA 5F1OA 3ABQB 4PV7A 3EIOA 3D6HA 1SXQA 4S24A 4UNPA 5FFNA 3M1YA 4DZTA 3KKMA 1UAYA 1Z2CA 2EP8A 3EG5A 2OCDA 4G9GA 1KJNA 1P1IA 1IIBA 4HEQA 5ALEA 1ZW1A 2ZUDA 3H2HA 1XZLA 3B3GA 3BCSA 3PSHA 4EY5A 4RFLA 3NDJA 4ARAA 3GQVA 4IDEA 5BVHB 1BW9A 1E6CA 1ITZA 1S9DA 1XLWA 5CNKA 2NO1A 2PKEA 4GXNA 3VKGA 1ENYA 4O2AF 4RTPA 1I4EB 3O8BA 2XVMA 4G0UA 4K9LA 1WUTA 3NBAA 4AM8A 3OEWA 3PRKE 3N0WA 2HK7A 4NE2A 1W46A 1VDMA 3PJFA 3GLSA 3VR1A 5IYZB 5IAAA 4J03A 2CKDA 3FM9A 5K0JA 3B8HA 2XBLA 4OMFG 1LWOA 3DNPA 3LQ1A 4LBYA 1GGFA 3PWSA 1R6UA 2R62A 1BDJA 1RJFA 3MERA 2LNDA 3HWX1 4QGAA 4BJ6A 2P6MA 2N9UA 2QV7A 1JI0A 1AQNA 3GQBB 3QX7A 4HAXA 2QMEA 1XAIA 2A3RA 1O6FA 5HJ2A 3H97A 1F8UA 1QWSA 3K8OE 2Q5HA 1H3EA 4Y6QA 1DZ3A 1EFHA 2IPNA 3D4LA 2GLTA 3I04A 2WHPA 1V8DA 3FR7A 4CVNA 3LXRA 5CX1A 5EMKA 4D0GA 1IU9A 1P1KA 3BH7A 1L7OA 3WK4A 2H52A 1Z4OA 2MYPA 1M5UA 4MUNA 1PP4A 1W48A 2RAVA 2V65A 1E1QA 1W0KA 5AW7A 1U0NA 2CFTA 3FW1A 1QNLA 2CVQA 4MGZR 1AVTA 3GYGA 5AKLA 4I5EA 4E5UA 3TK1A 3D6VA 3CEPB 1BFUA 2WYOA 4DVGA 4NC9A 3A2MA 4F8EA 4FVTA 2A9OA 1DBWA 2O8CB 4CMAA 2GT1A 1TU4A 1Q17A 1GYRA 2WMNB 4TMXA 5DTRA 5E7QA 3SEAA 4KAXA 4EA9A 4QGSA 2XE8A 2XGGA 3OOWA 3HGTA 5CMLA 4B87A 3IO3A 2DPGA 1N5MA 3L8MA 1CJSA 1U3WA 3HL0A 3URKA 4EIWA 4H77A 4ZALA 3W6NA 1QDLB 4WCFA 5FL7D 4D1YA 2B25A 3C8ZA 1AKRA 3BGDA 4L22A 4TKMA 3V7NA 4BLPA 3HO6A 5ICGA 1Y8RA 4HN9A 5JCOC 1Z5OA 2QVLA 2XCIA 3DZIA 3H5OA 1ZN8A 2ZJOA 5BRNA 2AE2A 3U16A 2HQBA 1JKFA 1RI2A 2BKUA 4K3VA 1AZTA 1KJWA 3OPXA 4YP9A 4B2PA 3TCNA 2HIAA 2Q4BA 2OILA 1Y1TA 3IURA 3CURA 2XUFA 2QX6A 2DTXA 3ETGA 1K3UB 3A1NA 5H3HA 1C3XA 3PC8A 2BMJA 3PDHA 4P4LA 3ZQKA 2GBFA 1QLHA 3A9TA 3OT5A 4R05A 1E4VA 2CNBA 1DC8A 4M7PA 1WB9A 1JQEA 5F9HA 4MQEA 5IW8A 2CV0A 3SBOA 4AZ3A 4BBAA 5KREA 1L3CA 3RJZA 2RG1A 3WLAA 1S3SA 1FF9A 3WKDA 4CMCA 1MLDA 5FBRB 2P2NA 3CLTC 3Q87B 4EPTA 4LWPA 2IU0A 2UXDB 5GZ1A 2BFCA 4KL8S 5ITZB 3MBKA 2Q5JA 5BWBA 1FYFA 1ZYUA 3EOBI 2Q1XA 3MJCA 2COKA 4G81A 4BO8A 4B5KA 4ZYUA 2X1VA 1RQ7A 4B9EA 5IDQA 4ZAXA 1PUJA 3RAJA 1NYLA 3HCWA 1Z63A 4KPEC 1JFTA 1SXGA 2Y4OA 4NJEA 1IBSA 4QBGB 3W9BA 1X94A 1RT9A 3MLEA 4I4TF 1SRQA 4Z8XA 3S2EA 1Z5ZA 4MZDA 4R8VA 5FOUA 5TV2A 1BWQA 4G37A 3THRA 3ZTYA 2EW8A 1IK6A 1F2UB 3MG9A 1OCEA 4DT1B 4EGSA 1RC8A 3T3PB 5J4HA 1UBMS 3CW8X 1M1NB 2V8OA 3IT2A 1JPVA 1YR6A 1NSFA 1NOKA 1YFKA 2HCJB 4OJQA 4RCVA 3WMWA 1Z5NA 3DR3A 3ROGA 5IJWA 3UMRA 3KVRA 3MJDA 1CY6A 4NCNA 3PNBA 5IJ0A 3KALA 3SYLA 3AUAA 1PWZA 2OQRA 3IAM6 1J1ZA 1FUEA 4F92B 3T7KA 4IV5A 2EZUA 3KXKA 3PWKA 1G3QA 1F12A 4JS0A 3O8QB 1HNWB 4K9QA 4LRUA 3S68A 5IF9A 2PO5A 3EA4A 3X1YA 2ZU6A 3GGOA 1YGYA 3T3NA 3L4EA 3WMRA 1A98A 2GBLA 2WM8A 4QT4A 2R0QC 3KLMX 4FYPA 3WSVA 1YFZA 4CIBA 5IAOA 1ZRMA 4Z49A 1FZTA 1M6VB 2RHJA 5HCUA 1DRJA 1QQTA 1CJBA 5FBQB 2HF8A 2JL1A 2AS0A 1JLLA 3AEKA 1X6VA 3STYA 1HYHA 4MV1A 3WBKA 3U3OA 2VXYA 4A8JA 3RFVA 4P3YA 1VMIA 3FIUA 3UWSA 3E48A 3N76A 4WAUA 4ABYA 1B26A 2ANCA 1TVMA 2YZKA 5FB3A 3LMKA 3OPQA 2HFKA 4MRNA 5E9WA 3L7JA 3AVPA 1L5OA 3A4IA 3KSMA 3Q3EA 4HFJA 4Y1GA 4AWXA 3GWZA 5BWCA 4EH1A 4OHKA 3W2TA 4DJFC 3E18A 3T94A 3CSUA 3EZLA 5EZYF 4BCCA 5D7NA 1JLHA 4OGFA 2OYSA 4ENUA 2LD4A 1QO9A 3LO5A 4M54A 4O4JB 5EKDA 2YIDA 3AKEA 4ZQGA 5DVZA 5ALHA 3WLSA 1DLJA 4TOIA 5ANRB 1C2YA 1R74A 1IOZA 2BH2A 4BQSA 1G8JA 4D9FA 4QM7A 3L4KA 1Y98A 2YN4A 1XC7A 1ULSA 4WTOA 3RWMB 2XMZA 5LYJF 3NX4A 3AHIA 3HACA 3KLPX 3HY3A 3OJEA 2H1RA 2A0UA 3F6CA 2Q3FA 3SE7A 3G8AA 4PSKA 1NY5A 2AN9A 4J91A 1JECA 1WP9A 5E6SB 2OK8A 3IH5A 2ZYGA 4HAWA 2EATA 5JFTA 1ESDA 3D4NA 3QYPA 4Y2RA 2PGOA 3RRYA 1J0XO 4B6SA 4ETIA 5B6JA 4W5TA 4OP1A 2UV8A 4B9AA 4MARA 1H4QA 2ZE7A 4CLDA 5LYYA 5JZMA 1W36B 2ZTMA 4GAEA 5DRTA 1T9BA 3X1KA 5CDFA 3DOUA 3O3OB 3WLMA 2K7FA 2EKDA 2IUFA 3K6RA 4ND8B 4M0MA 1A2KC 4ARUA 1WZIA 5DV9A 3KYDA 3BD9A 4ZXFA 1EFRD 3FTCA 2JHAA 1Z6AA 2A58A 2PQ2A 3GBSA 3JAKA 3LVQE 2QMUA 1GGHA 3NPMA 1I2BA 1FMLA 3QVTA 4D9BA 2JEZA 1WXGA 5JNRA 5L3QB 2G1JA 4D4LA 1UOEA 1Q57A 2Y3IA 2VUIB 3EE6A 2IH5A 2IOQA 3T52A 1R8SA 3R1IA 1HT1E 3O91A 4ZEWA 1JAZA 3UJ6A 2FK8A 3O75A 2B36A 3HHEA 3NH6A 1VIDA 3STTA 4GPZA 4DV5B 5IFKA 4CCWA 3BKWA 2H5JA 3D8TA 2RHBA 5B6IA 4UVIA 3W79A 2ZSBA 2QT1A 1PL7A 3ONDA 1T0PA 4NEQA 5IWCA 4B3FX 2VKQA 1XVAA 1G7TA 4MS4B 3WMFA 1GTSA 4OQYA 2ODBA 4L2IA 3CLSC 1P1HA 4BFYA 3G0IA 3TSCA 3X2EA 2GKGA 3U44A 4WESB 3WIBA 4L6AA 3DO8A 3DB1A 4WBSA 1Z0SA 5B1IA 2XR1A 4JC8A 1OGYA 1H0HA 1LVGA 3EGVA 4JUBA 4WOBA 4BNVA 3UV7A 4GBMA 1YZQA 2QBYA 5B2FA 3PGXA 1DEKA 1XRQA 3DM9B 3Q0EA 4QPZA 4XDGA 1UFRA 5EJ9A 2BGMA 2PLFA 1Q2UA 2WAAA 4GOKA 2EW2A 3SBXA 1BOOA 2QXTA 4MPDA 4TV9F 4KJZA 3HV2A 4FEGA 2Z5LA 3CJTA 1R9GA 2IZOA 3QGMA 1QE5A 3MFQA 4HN2A 4E07A 2EGUA 4KG7A 1NBIA 1MNAA 2QRUA 4LY9A 4DMUB 2E4YA 2C07A 1RMYA 3IKLA 2IP2A 3B3JA 5DNUA 1KEZA 1PJBA 5JZSA 2GM9A 3E1KA 2V7UA 4MGHA 4JROA 1KAHA 1JJFA 2R5NA 4TRJA 1A7JA 4LJKA 1G42A 2CXOA 2FUCA 4X85A 1PWYE 3TW4A 4RGBA 1GKLA 1NUAA 1JPUA 1M1ZA 2H4FA 2W90A 3QVUA 2Y92A 2G4LA 4IWYA 3R75A 3TBKA 5KNBH 1F2TA 1ZGJA 2EBWA 1IVSA 2I6UA 4QHYA 2ZKLA 4B35A 2PA3A 3FOFC 3DP9A 5EHIA 3DF9A 3AR2A 2HWYA 4GKAA 4DRXB 1UJ6A 5A62A 3CLRD 3BIWA 3ITEA 3SDSA 1FE8A 1RQRA 2CXUA 3IQIX 4J43A 4J7UA 4TT8A 4BP8A 2WSIA 2E3JA 3OPYB 2NVBA 2WKWA 2IYWA 1ADCA 2ZAYA 4OXRA 4AKIA 2A2ZA 2AHRA 2CBZA 3ETEA 3ST7A 1I6LA 2EV9A 3GAFA 3H6KA 4N0EA 3RVRA 5F7ZA 3NANA 3NMUF 3CUYA 2B1IA 2Z5VA 4GI5A 3QNWA 1TRKA 1WQ1R 3K53A 5DLYA 3U0VA 1A5SB 1VMDA 3L4BA 4KQHA 1D2AA 4WLUA 4F84A 4IVQA 5F21A 1XXHB 2OKGA 3N2NA 4AURA 2W4QA 4FYWA 2R1UA 4AX4A 1GAJA 4DLPA 3KZ1E 3IE2A 3NJ4A 5L7TA 4PGMA 1REQB 1E6UA 2J9YB 3PFIA 1CY1A 5FUBA 2NOAA 2Q6TA 2WKPA 4H0FA 1IB6A 1ZR4A 1OF1A 3C2QA 3ZCRA 3LP5A 4NENB 2A0WA 3AUTA 4OHXA 4BO4A 1CR2A 3KJFA 4Y2XA 1L5GB 3VR6D 3AUXA 3OHMA 3EIHA 1SHLA 3OLXA 4FMCB 4B31A 1W7AA 2PMWB 3QVOA 4OI4A 1Z6PA 1TLLA 3IUEA 2KSQA 1SVOA 4YIKA 1ORIA 5COAA 3DHEA 3TM5A 3QK7A 5JYDA 4GX0A 3C5VA 3CV3A 4NHEA 2EFGA 2GR9A 3SYKA 4Q7KA 3K71B 1H2WA 4XM0A 3AJDA 3ROMA 3QRWA 1PU2A 4MK4A 1XT6A 4ND2A 5JPCA 3ER6A 3RLFA 2CDRA 1R4ZA 2PGJA 1NSTA 4MLPA 3DXXA 5DX8A 1ZEJA 4DC9A 1U9IA 3AZPA 4DNQA 2JFVA 2JJ2A 2W2LD 1J9GA 4GLLA 5A0TA 2DWCA 3DLHA 4YMVA 1I7PA 4NIMA 1JXOA 2O2GA 2ZRJA 1T1JA 3HJNA 3A28A 1NR7A 4R01A 5IF3A 1CDEA 2DR0A 4IZIA 3CRQA 3RFUA 5IHXA 3TF5A 3G5AA 4B85A 4HADA 3VPXA 1UADA 1A8HA 1I36A 4LDRA 2PAFA 4MWGA 5K0ZA 1YB2A 2I2AA 4YONB 1XQYA 3FPBA 3MWYW 3OEYA 5FBZA 1ZH0A 2O2EA 1TECE 3IHLA 4BYGA 5KQGA 1FX0B 3GEHA 1EUDB 3B7WA 4OHCA 1N0VC 4KQ6A 4WLVA 1BSVA 4IVPA 1LLDA 1QGAA 2IPOA 1DIGA 2FRDA 1FDWA 1GUYA 1H69A 3MCZA 4HSGA 2GASA 1L1FA 3TG2A 1I6KA 3MBOA 1U1GA 4ZP1A 4K9RA 2Q4DA 4KH0A 4NK4A 2FWJA 4RNCA 3I09A 5BORA 1E2EA 1GL6A 2G77B 4F6RB 3DVSX 1QONA 3IDFA 3AY6A 4LFAB 1UPFA 2QE7D 4RNDB 4XIIA 1D2EA 1QVAA 5ER6A 4G26A 3LA8A 1UPUA 5LBTA 5C9ZA 5C35A 2JI9A 4FYXA 4NAUA 1YCHA 5EMHA 1KO8A 1VFPA 4HI0E 3O3MB 1V8BA 2I8LA 1ZZEA 3GJ8A 1IJBA 3EGEA 4CT0A 4B33A 3K73O 1QR6A 3E3MA 1YASA 2HSEA 1YRWA 2J4FA 3VKFA 4QKQA 5A04A 5IUNC 3BFJA 4ZOLF 1N7GA 1XZPA 2ZRFA 2Q5QA 4LRWA 4NS4A 1QE3A 1S2NA 2FWPA 4CIXA 3JWHA 3B9PA 4J94A 2FPUA 4M9SA 4ARIA 4AY4A 4AY5A 2YZ2A 3NC0C 5FEMA 1OVGA 4P7KA 3RK1A 3TEJA 1RCTE 1O6BA 1MO2A 2VI5A 3FSEA 4Q4LA 1SUBA 1ZA2A 5CJ2A 4HX9A 1DFHA 2I2BA 1CU1A 2JC3A 4I1YA 2O3RA 4LJ9A 1J9ZA 3L0YA 4WXRA 3LU1A 2PLRA 4JLBA 1C9YA 2W6ZA 3WG9A 4P92A 1GNSA 3GUVA 3LE8A 1OD6A 1LPSA 3P8ZA 4K0RA 4WUTA 2RONA 2FGJA 1PZGA 4QFDA 1FP6A 3MMNA 2HCBA 4YECA 2GKSA 4WHMA 4EWLA 4BJHB 4AK9A 3TL6A 4EZBA 4C2BA 4ODIA 1TEHA 2WAOA 1EX9A 4MV7A 1EZ1A 1EUZA 4RH0A 5K8TA 3DEHA 3T38A 2VUSA 2R1TB 3T1OA 3JQAD 2BVNA 4OYYA 1X0XA 3RYHA 4R9UC 1YJ8A 2EF1A 1DDOA 5IJXA 3CNEA 4URYR 4RJIA 3DFFA 2PUFA 2OXFA 1Y7HA 4H1VA 4XM1A 3O8RA 4HDQB 3WL3A 2JGLA 3T1VA 5CDFE 4CV0A 2QGZA 4FI3F 4N0DA 3F5MA 1MG5A 4UZSA 4DSAA 3ND5A 2DH6A 5E1OA 3W2EA 1XU9A 1J0AA 4RJLA 1DAOA 2ZE5A 2P4EA 1RZRA 1QC5A 3GG2A 3U0BA 3IALA 5GQSA 3COWA 5KNCD 3NHBA 3UK7A 3U9TA 3WAGA 1FXWF 4Q01A 3O1JC 4O0LA 1NYRA 3GCXA 5BSFA 1RWQA 2VZ0A 2X8AA 5K3FA 3KVVA 2W71A 2G1KA 1W4BA 4GW3A 3BZBA 1YMQA 2PEZA 3OQIA 1GNVA 1CE8B 2F7SA 3B3AA 1GNLA 3OEEA 1RZUA 5ISMA 4RVGA 3F9IA 1LJLA 4DA8A 2Q3EA 1GA4A 5JYCA 2AUMA 2HQOA 5A9TA 3BMOB 4B81A 3ECSA 4C14A 3OIDA 2P8SA 3V1MA 9GPBA 2ZYIA 3LPLA 2HY7A 2VUTA 2J30A 1IHPA 3KCNA 5T4BA 3REGA 1B0AA 3HJFA 1L7RA 1ZK1A 3TSWA 2BSAA 2G9VA 2B35A 1FMJA 2ZJ0A 3K5PA 4W8HA 4XD7D 4JI1B 4CKBB 3SKXA 1UP6A 2F62A 3WV5A 1FP1D 1X7WA 2LDXA 4DRYA 1HFEL 2CUTA 3ORYA 3PT9A 5J5CA 2JHFA 3LDUA 1JDNA 1UMKA 4KKXB 4O4LB 4QYSA 4UULA 4QSMA 2NT4A 2ZSUA 2LVBA 5ITWA 3FFWA 4RENA 4CGYA 2JFBA 3R9IA 4TPKA 3L6EA 4ND1A 2Q2QA 1JSZA 4EX7A 1E3QA 2ZYHA 1LBQA 1XAHA 1NMSA 3A9SA 3QITA 1T3SA 1VI2A 3LRPA 4O4IB 3B78A 2DJ5A 3L1UA 1IEQA 1CUIA 2PZFA 3K05A 1H1LB 3G79A 1YXMA 3O82A 4BX9A 1MX9A 1UC9A 1YAHA 1Z17A 4U0KA 3KQHA 2J0SA 1DAHA 4IQ0A 3KOZA 2BELA 3AW8A 1H4SA 3V1KA 4RK6A 5ALWA 1N32B 1VKRA 5AXBA 3V7YA 1DXQA 2OV3A 3KBBA 3BVPA 3OUTA 3E61A 4WLOA 4LF7B 1BXRA 3R77A 1OV6A 2JLCA 4RCYA 4UMDA 3GFOA 1MQAA 3AY3A 3DAYA 5ICCA 3W4JA 1NU6A 1YIDA 1P5ZB 4YREA 4AJNA 1PT7A 2GHTA 3KEGA 2FZCA 4JVSB 4UVGA 2VL7A 8MHTA 3QYJA 4XH9B 3MIZA 4WNAB 1WZEA 4YCBA 1XD2B 3RVPA 4BKMA 4EG0A 5BV8A 5CM9C 4IL5A 5GGYA 2ZXUA 1LK5A 2QTCA 2AG5A 4G0VA 1U1FA 4D9GA 3K0SA 4IXWA 4GEGA 2JS7A 1CRQA 5F2NA 3BJMA 1P3Y1 5I7FA 3Q8XB 4Y0VA 3EQ9A 2VQSA 4LQCA 1VLLA 1ZCAA 1WDKA 1K0UA 4WDQA 4OEHA 3F3MA 1FU4A 2AUNA 4RD6A 3W6PA 3QZUA 1IWPB 1T35A 4B3BA 5CH5A 1X70A 3WQRA 3WWZA 1J49A 1KAQA 2AMLA 2AI2A 1LBIA 4X93A 5ESRA 4DANA 1S89A 1AM4D 1Z0FA 5DLQC 4YXWD 3GELA 4YRTA 2PJUA 3LQFA 3LY5A 4IPTA 1NMEA 1A9SA 2I55A 1SCNE 4KHZA 3MRVA 4QFBA 2CXPA 2PXAA 1YZKA 4Q34A 2WU8A 3SC4A 4J7AA 5I7VA 3PNLA 1LH0A 2V9PA 2ZULA 4ISCA 1TZ2A 1RACA 1VJRA 1CYDA 4FW8A 4M4SA 4W9NA 1FDSA 3DL4A 2ZWPA 4JP8A 5FD8A 3W3AD 1VC2A 2B37A 3DV2A 4H7IA 2AK2A 4BNKA 5DNYB 2FLVA 3O8LA 2DUWA 4ZQEA 1F38A 1AHNA 1HYBA 2OENG 2HFJA 4MMYB 3GLQA 1THTA 2ASEA 1G3MA 1O94C 4W4TA 2NZYA 3OT1A 3ZHSA 2W2MA 4CMKA 5AJHA 2YL2A 5WRFA 4QPPA 2ES4A 3IQHX 2GILA 1YHYA 2VLBA 3NYWA 4QX6A 4UEQA 1B23P 2ZJ2A 1PS8A 3IUPA 5HUJA 4OB7A 4A0FA 3IP7A 1VCOA 4FX2A 1Z7EA 3WMGA 1UJBA 5ULLA 3ER9A 1K06A 4D9JA 3QNMA 4TV8A 3GP3A 1Y48E 3W6UA 1YNOA 2AE1A 3K9NA 2GWRA 3BGOS 5JAMA 1JJIA 5EWLB 4CQJA 2LKDA 4BATA 4MUAA 4LZJA 2ZZNA 4J4HA 4K6HA 4ME6A 4BMPB 1DZIA 4I36A 3ADCA 1V8FA 2X0RA 4LVOA 3ZZTA 2A8YA 4YMGA 2H8GA 2XMRA 3RSLA 2G5PA 3U4QB 1RPJA 2JGJA 1T91A 2QRMA 1VLMA 3HWSA 1SA0B 1P7CA 1U8EA 1PTJC 3NVMB 1RXCA 4EB6B 1DOHA 2XLCA 3ZIDA 1G2OA 3ONNA 3P2OA 3DYBA 3I37X 2H8KA 4EHBA 5IEBA 4OFZA 4XJXA 2RJNA 4AXXA 4XVHA 5BQFA 1CP3A 2C7BA 4AO6A 3RFCA 2B83A 3O2JA 1DC4A 4NCIA 2PNFA 2COUA 1SCKA 2C5SA 4TMFA 4V0LA 3AZOA 5CFQA 1JNXX 1WBJB 1P9WA 3FMFA 1BROA 1R88A 1U3FA 2I4OA 2ZQZA 4LYDA 1E9CA 4UNIA 1CJMA 3MF4A 3ETHA 1EGHA 3ILSA 2R8YA 2VQ6A 2NM0A 1TT7A 1SXJC 3H19A 4DREA 4DLWA 3W1EA 4KQIA 5KYTA 1DKOA 1P0QA 3AM3A 3GFBA 1OI2A 3CXRA 2ZB4A 4RS3A 1ZWKA 5JRJA 3AR4A 4EI9A 3PPXA 5CLQA 4F56A 4KCGA 3KR0A 5JXHA 2OFFA 2V9ZA 3L0PA 4PTLA 2QNBA 3SR3A 4Q82A 2QTTA 2F1RA 4N49A 1XD8A 3EIFA 2P2YA 2QN9A 1E5QA 3BORA 1PLKA 2B1GA 1XYVA 2VKTA 5HIAA 1I30A 1WM1A 1X1BA 1ZXBA 3IBSA 3VR2A 3KWLA 3M3PA 5FI3A 1IMOA 3RIYA 3VPBA 1BDIA 9LDBA 2WBLC 4PZZA 4YJFA 4YYEA 1OH6A 3EVNA 1U2DA 1NJSA 2VVTA 4RVCA 4X20A 2VH5R 5GMOA 2VPZA 3DV0B 1U2PA 1WUJS 2QN7A 4NLLA 1QG0A 2QRVA 2RAFA 2X7XA 4I9UA 3OSUA 4JJAA 3LAWA 2P8JA 4LY3A 5D3QA 4ZVUA 3NHUA 1OFTA 1VJ0A 1VL0A 1HQYE 3I9LA 3QLVA 4Q7QA 2DJIA 3LX8A 3SR4A 2HAEA 3KSDO 4RPKA 2QJWA 3QUCA 1Q7BA 1UBCA 1ZM7A 2O8DA 3KZOA 3COPA 5J58A 1Y8ZA 1EXVA 4CQNA 1AKYA 5LN1A 3L41A 5K3BA 1X7ZB 3AT1A 2PIDA 4CFYA 2E1PA 3WADA 1X7HA 3M89A 5CFMA 1YKFA 2VHYA 3LO8A 3M3DA 4JGBA 3SHFA 1UQTA 2P91A 1Q2XA 3I83A 3TQSA 1ZI6A 2ECFA 3N7AA 3U4IA 4UUMA 4X7BA 3DBLB 3MVEA 5KJ6A 4BCDA 4C7KA 2JKYA 2D2IA 3FPHA 5EJGA 4V03A 1F5NA 3CX8A 3GMDA 4R83A 3CE6A 4TUYF 5BWNA 1G0OA 5JBQA 5JUWA 3C87A 1JE1A 4KWEA 2CHEA 4XDZA 1RKBA 4A73A 1SBCA 4ARZB 2VP3A 2BE9A 4B4VA 1KA9H 3OM9A 3B1KA 1I3MA 1K5GA 2X6RA 1IAQA 3HM2A 3NTXA 4G67A 4DCJA 2Z43A 1SU8A 1NIJA 1O8CA 3V97A 3RYTC 4JCOA 1MX1A 1Y3CE 2HD4A 5C8YB 3I8SA 1Z0KA 2QK4A 4MV9A 3OZTA 1W1UA 3BGVA 4UMVA 2H5EA 1U98A 2OQIA 4QASA 3L43A 1OWOA 4KXWA 2O0HA 3KKZA 5KS2A 1PR3A 2MYNA 3KT0A 3M4JA 4HS9A 3GAAA 5AW4A 1FXSA 1MGPA 4OBWA 1SUCA 5AW0A 2Z1MA 3HY4A 2CNOA 3IDAA