3ACDA

Crystal structure of hypoxanthine-guanine phosphoribosyltransferase with imp from thermus thermophilus hb8
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
176
structure length
164
Chain Sequence
MFTPGNGPVQISAEAIKKRVEELGGEIARDYQGKTPHLICVLNGAFIFMADLVRAIPLPLTMDFIAISELLKDLRLPIHGRDVIVVEDIVDTGLTLSYLLDYLEARKPASVRVAALLSKPSRRQVEVPIHYLGFEIEDAYVYGYGLDRAQFDRNLPFITSIRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Structures of hypoxanthine-guanine phosphoribosyltransferase (TTHA0220) from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 49
structure length 164
sequence length 176
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2009-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3acdA00
3ACCA 5KAPA 2DY0A 4WMLA 1LH0A 3H83A 5KAMA 4RADA 1XTUA 3DEZA 4LZOA 1ECFA 2WNSA 4KN6A 1DKUA 1I0LA 2GEBA 1WD5A 3O7MA 4RAQA 1TC1A 4P80A 4RABA 1VDMA 3LRTA 3N2LA 1AO0A 3LPNA 1P18A 5ESXA 1QK5A 2JBHA 5HIAA 1ECBA 4JITA 3OZGA 4X44A 3OZFA 4QYIB 2JKZA 4M0KA 1BD3A 1ZN7A 4WN3A 1I5EA 4FYMA 1I0IA 1NULA 2PRZA 2XBUA 4TWBA 4RHXA 1P4AA 4RV4A 1ECJA 5HKLA 1A4XA 1XTVA 4RAOA 5BQOA 1QK4A 2P1ZA 1UPFA 1XTTA 4F8EA 1OROA 1VSTA 1A97A 1P19A 1G9TA 5EUCA 4LZAA 5K51A 1GPH1 1ZN8A 1R3UA 4P84A 1MZVA 4OHCA 3G6WA 4P3KA 4JLSA 1U9YA 1O5OA 1ECCA 1G2QA 1YFZA 5E38A 4P83A 2FXVA 1I14A 3GEPA 3KB8A 3EFHA 1NONA 4MB6A 4PFQA 1G9SA 1A98A 2PRYA 3GGCA 4M0UA 4P86A 4S2UA 2IGBA 1L1QA 4Z1OA 2YZKA 4P81A 1UFRA 1JLRA 1STOA 1A96A 2AEEA 3S5JA 3DMPA 1BD4A 4RACA 5JSQA 3MBIA 1CJBA 4RANA 1DBRA 1VCHA 2HCRA 4QRIA 4RQBA 4LZNA 1DQPA 2JKYA 3DAHA 5IPFA 4P82A 1J7JA 1QCCA 2H08A 1DKRA 1PZMA 4QYIA 5BQPA 4LYYA 4PAWA 2JI4A 1P17A 1OPRA 1IBSA 2C4KA 4IJQA 5BRNA 4M0PA 1XZNA 2VFAA 4RHUA 2EHJA 1QB7A 3GGJA 3HVUA 3ACDA 1JLSA 1V9SA 3NAGA 4RQAA 5JV5A 1TC2A 1Y0BA 1FSGA 1HGXA 1I13A 1ECGA 1BZYA 3OHPA 4RHYA 3MJDA 1G2PA 3QW4B 3ACBA 1O57A 4ZFNA 1A3CA 1QB8A 4X45A 1Z7GA 1HMPA 2PS1A 1GRVA 1DQNA 1UPUA 1XZ8A 5IAOA 2H06A 1W30A 2E55A 4RHTA 1L1RA 1QK3A 1ZN9A 2H07A 1OREA 4LYGA 3M3HA 5ESWA 1A95A 5BSKA 1D6NA 1QCDA 1U9ZA
chains in the Genus database with same CATH superfamily
3F5DA 1HZZA 3KLMX 3RVDA 1HO3A 2VTVA 2BF4A 1H9CA 5AQEA 3RUFA 4AJPA 4L4XA 4BLTA 2FEKA 4KXUA 1XZMA 5KOJA 4YACA 5DBOA 1VMAA 1U7XA 3QF4A 3R7WB 5KYYA 2BJHA 4Q19A 4TUYA 2Q5EA 5DEOA 4BKUA 2J9GA 1DT3A 2WTNA 4D82A 4F2HA 1E4YA 1PD1A 2ISSD 1WNFA 3NATA 3HL0A 2FQQA 2O5CA 4I9FA 5JS1A 1FP7A 4I7EA 4JEHA 2E5LB 3NHUA 4PLFA 2XGJA 4NBSA 4FDAA 4NYJR 1I80A 2R5FA 3ZXYA 3FNIA 4XASA 2UZ1A 3B1KA 1JIUA 4ARZA 2BRUA 1I1NA 1WQ4A 3GPIA 1GTL1 4QBGB 4TV9A 5TRTA 5HKKD 3NDBB 2DPLA 1D5WA 3OHSX 3H1PA 5AKHA 1E1KA 1SQ0A 2P6PA 1KVTA 4JELA 2DE0X 4M60A 4K6MA 2Q4EA 4KXFB 2NIPA 2QRZA 5IULC 5IKMA 2ZJ1A 4ER6A 1ANKA 4HR7A 1XCGB 2JHAA 2A5DA 5HTOA 2O8DA 4QPZA 1VJ0A 3MXOA 3ZY4A 3EGWA 3AM1A 1TYZA 1DBPA 1Q0LA 1D7OA 2H18A 1KJZA 1N1GA 3ENKA 4KVZA 5JYDA 5ENZA 1MOQA 2JHFA 3NVDA 4D44A 5D3MB 4P31A 2D0DA 2WOOA 2BBSA 3DEFA 3FOAA 3C5CA 3FNEA 4ZAFA 2HLHA 4JR2A 4IJWA 4OP2A 3U19A 1ZK0A 3I0ZA 1HEIA 4IWXA 2I4TA 3CUKA 2R1TA 4HQNA 1M8JA 2ZJ5A 1HZJA 3HUTA 3SGLA 3S2YA 3P45A 2BFDA 4BCBA 2FRDA 3I6MA 1VE9A 2G5PA 2KYRA 1THTA 1Q1EA 5CM8B 4BY9E 1QTNA 2CSXA 3ETCA 1EK2A 1RRVA 4GI5A 5FUVA 1T4CB 2R62A 4MUHA 3QHPA 1J7JA 3L9XA 4B3HA 3L79A 4FZRA 1DWQA 1DLIA 1H0HA 1JX6A 3C39A 4OLHA 4E3WA 2A9JA 1M2GA 2EYQA 2DHQA 2WUEA 4N8EA 3RKSA 5KSYA 5INTA 2BTQB 1YA8A 1AUOA 2X2FA 2C54A 3IT2A 3OCUA 1W4RA 4Q7JB 4ENVA 3HKDB 5HK8A 5F7ZA 3FUCA 1K8RA 1LV7A 2VTEA 1ECLA 4IG9A 1N32B 3L0BA 3OFND 1VL2A 5JNRA 1JLSA 3F9RA 1SMKA 2V03A 3H5NA 1HF3A 2J85A 4LY0A 5ALLA 5FBWB 3ZY6A 1JHUA 5CPFA 4HDQB 1MORA 3NEJA 4GT1A 3ZVKA 3DV0B 1E96A 4N76A 3VPGA 2H2DA 3RI3A 2IK8A 2XTMA 3MPOA 5D1HA 4E6PA 1T4BA 1LVHA 3PE4A 1CS0A 2ZRBA 3OEHD 1CUHA 1RAIA 2BOVA 3JYPA 4Q4LA 2JVJA 3DE2X 4K6FA 4IDPA 1IN1A 1FDRA 3ENVA 4MUKA 5EHQA 1ADBA 2YNMD 3EQ8A 5E2IA 4B76A 3WLOA 4JI7B 1G9XA 1W85A 1JHVA 2CUKA 4I4IA 1S1CA 2YVUA 3QLJA 3NUQA 4M2LA 1XLWA 4WZBE 1JFFB 1FXSA 2FUEA 3S68A 3WADA 1JDZA 3BPSA 5D5HA 1W5BA 3QVUA 3EFEA 4PYJA 2IPXA 4M1OA 1T36A 3OC0A 2NXCA 3VNSA 4FVTA 3WYBA 1M7BA 3Q3EA 2HK6A 3OJXA 3OMXA 4LOLA 2D1SA 4ADSG 1CZLA 5E4FA 2FVXA 2PUGA 1FS4A 1P1RA 3SZRA 3AVYA 2GPYA 2A5GA 2PZ8A 3GRPA 1YHNA 3DCNA 1I3LA 4M89A 4Y9DA 1O8CA 1QUEA 1R66A 3PXBA 4BBZA 4BWFB 4JC8A 4COKA 4JGIA 4BLWA 3S81A 1TAUA 2BH2A 3LC0A 1LEHA 3M6FA 1KFJB 1BJKA 3SYNA 3VHXB 3NV7A 3WGOA 5ED0A 5BN5A 2A5YB 1SVIA 1BVHA 1QO0D 5CVVA 2C00A 4CQMB 3I39X 3L8CA 2ZYSA 1LA2A 3PNOA 5E6SB 3DGFC 4ZVOA 3K09A 3SHWA 1KTIA 2XUDA 4WNAA 1Z75A 4AI6A 1M2JA 4V03A 4MMYB 1E2BA 1GGJA 1TUBA 4NBTA 1VDZA 4MCJA 3ZZ0A 1G21A 5CDFE 2PY6A 1CUWA 2DHRA 2RHRA 1ESCA 2M6LA 4EIWA 4QO7A 2V7QD 3PU6A 3M2TA 2NU6A 3NOXA 4WJZA 4D99A 1KOGA 1OXUA 3AT1A 2AR0A 3E4CA 1X7XA 3RW9A 2C4VA 5KTKA 1NSTA 1KS9A 2EGGA 4G4GA 4QXMA 1GDTA 5F5XA 4J4BA 1ZDMA 2E82A 3UY4A 3HO1A 1XJCA 3A1NA 3F97A 3FYDA 4GKAA 1VHTA 3ZLTA 2VSYA 1GG2A 4A0HA 1FFBA 1FQOA 1E3MA 1IDN1 1MDFA 2OXRA 1N0HA 2PD4A 2RC6A 3SX4A 1GA1A 2B69A 3CIOA 1E2LA 4CYMA 1UBNA 4ZQIA 3CN7A 4YRKA 5I01A 1NASA 1QDEA 3TOZA 3VFDA 3MT9A 4DLVA 3P20A 1YI0A 2X5NA 2I7CA 5BW6B 2Q7DA 3S3TA 1GRRA 4J0KA 4EG5A 2V3CC 2G04A 3R3XA 3KXIA 1QGUA 3FPCA 3JQ8A 3M49A 3LZDA 3A9RA 4FFVA 5F2NA 1QH8B 1H0KA 1SXJC 3NRJA 4YK7A 3U0BA 1PGOA 2XBMA 1FNMA 1ZCAA 4IJQA 4KFCA 5CNMA 4OYRA 4XJVA 3SOPA 2HCTA 3MYRA 2HNKA 4RM2A 2QN1A 2EBFX 2FTKE 2HRCA 3OLYA 3ZXSA 4IDFA 1VRCA 3I2FA 4I1VA 2D3TA 5EP2A 1CF9A 4W6ZA 3TSYA 3JVUA 5F3DA 1VYVA 2CN1A 5EXXA 4LNAA 3ZTTA 3UF0A 3IRVA 5JH7F 1LC0A 4PYOA 4HZUA 4RNDB 5JNTA 4PC7A 1YQUA 3ADKA 3ZTYA 4RHYA 1U31A 4JCOA 3COWA 3ZU5A 1QM5A 1ZGAA 1QJ4A 4GX0A 4C2AA 1M3SA 1J2RA 3GO4A 4ND6A 4RH3A 4GYKA 5LXTF 2FPXA 3UXEA 2I8CA 2PX0A 1U0LA 2IEZA 5L53A 1XZKA 3V33A 4C7MA 1SU4A 3T9EA 1E5TA 2J3QA 2ZDGA 1ZUD1 1XTZA 3H1TA 3THXA 3INTA 3HJTA 1QBGA 1WQ3A 1R4NA 1IXRC 2GNAA 2PMFA 4UM7A 3QX3A 4F45A 2BJWA 1G5FA 1FPMA 1N5OX 5EHNA 5FFMA 3IMGA 2OD7A 4L2IB 4TTVA 5L3QA 2G83A 4E1AA 3CF4G 3P4YA 2QYOA 3LUFA 1K8YB 5DF1A 1AS0A 1K7FB 3L43A 3TRIA 4FWBA 2RHGB 3TRDA 3W7AA 2FPGA 2ZAYA 3KLPX 3OJEA 4WESB 3DBRA 3D6MA 3NYIA 2BEWA 4L85A 4TRNA 5LCXA 2C57A 3HUEA 1Z5ZA 2C2ZA 3TX2A 4DUZB 3OCVA 1T2DA 4X7PA 2XE4A 3BJMA 3A1UA 3AINA 4NC9A 4XWYA 4HNAB 3UWKA 1GXSB 3VYUB 5ICFA 4KYVA 5BR7A 5DM1A 4X8MA 1V5IA 3DVLA 3OCJA 3D5TA 1T1JA 4QHSA 1WZCA 4HSGA 2DQSA 4NJEA 1SKYE 4Z5XA 5IX8A 1IHOA 1YUMA 3DDWA 4N03A 3U3ZA 1TM7E 3R0XA 3F3SA 4IDGA 3VSBA 2B35A 5C2JB 3GVIA 2P77A 4DVGA 4E1BA 1PR9A 1SEPA 3L07A 1QIFA 4N47A 2W43A 2G0TA 4NCHA 2COKA 1PQ4A 4KZKA 4XPIB 4ARBA 4IPTA 4PHCA 1CF2O 4EHHA 2QF7A 4IOKA 1CZNA 3DL2A 4RMIA 1ESNA 4U39A 1FP2A 1RWBA 2VHWA 4B0PA 3I2KA 3DKKA 5MFZA 4HK4A 3T3NA 1IUPA 2AJDA 2ZW9A 5FYQA 2G0AA 3EFHA 1I3NA 3IBFA 4TMKA 4UXIA 3ADOA 1G2IA 2GI4A 5J4VA 4NBKA 3WGMA 3CBGA 3T52A 3F8WA 1EP9A 2AOTA 4R2JA 1VL6A 4P81A 3WV4A 1W36D 2GCOA 4Y6OA 5AXAA 4KQGA 4L4SA 3PENA 3HYLA 4Q00A 1EFDN 1JALA 2JCXA 2WTXA 3TZKA 4BO4A 1KIAA 1L5OA 3B12A 3ZNPA 4XM1A 4UNNA 1ZD8A 2F1HA 4B32A 1PK7A 5JUWA 3ND5A 2R6AA 2WSSD 4L6CA 2YVLA 5EMJA 1NRIA 1NMZA 3LE8A 5EAIA 3T7KA 1PQWA 1VGQA 2GBIA 3T3PB 1BGXT 1TJNA 1ZM7A 2JZCA 2R8YA 3I3SR 1ZH2A 3SBOA 3MMNA 2ZRLA 2WB4A 1GYPA 3A4TA 3GHYA 3GNSA 3FNRA 2JATA 3ZQ4A 8GPBA 2HBQA 4KIJA 1IHXA 3UC5A 2IYSA 3I58A 4XSGA 3WMRA 4WA8A 5BPHA 1V9SA 1U2EA 1ZM9A 2WNIA 2VWPA 3EHEA 3NWBA 3OZRA 4MS1B 4D98A 1TEZA 1GFSA 1A88A 4DZRA 3HWRA 1QTQA 1WU8A 2VYNA 4L73A 5T4EA 4GX1A 3QEBZ 1OGYA 4QVIA 5HS6A 1WCIB 1HE2A 2C07A 1PZNA 4JWTA 2X1HA 4TL8A 1O57A 2Q3EA 2X5OA 1KQPA 5FFNA 3KSUA 1A2KC 5EMMA 4BUJA 2E37A 4QNNA 1EUQA 3FCCA 3KEOA 5C3UA 3G02A 3GFGA 1BW9B 1SBZA 4BRSA 1SC4A 2YS6A 3LT0A 5TQJA 1C9YA 3JATB 3ZGYA 3FOZA 1XBTA 3HVHA 5LOVA 4JL8A 5REQB 5BXQC 3LLSA 3PXGA 2OESA 1GQ2A 4DV5B 4WHMA 4ITRC 4MRAA 3MJHA 5FUXA 3GFPA 1U9JA 2CZCA 2CDBA 4ZU6X 3AJRA 4R0MA 1UKZA 4BMDA 1AGNA 1I2BA 1EZ1A 2VSQA 1RQLA 4LTMA 3A2LA 5GZ3A 2QRQA 2Y99A 4UEOA 3K71B 3VI4B 3O4RA 2IA5A 3O4FA 2O2IA 1DV1A 2HA2A 3OHMA 2JGEA 4Y7DA 3KKPA 3EGXA 4H2DA 4JJFA 4M8NE 4YAFA 3TUIC 3O3NB 1PT5A 4XCVA 1P39A 3NIGB 4E5UA 5K0SA 4JLNA 4EJSA 3GVXA 3H7IA 1XRNA 5ALEA 4NV3A 2HREA 2ZUTA 1U98A 4V39A 1WZEA 4BNUA 1TW3A 4PYIA 4I4CA 3OUZA 1U4OA 1YE8A 4WXRA 3UPUA 2FMFA 1IK4A 1KY4A 1DQYA 3PD0A 5AJHA 4D5EA 1DU4A 2EFYA 3TTXA 1A5ZA 1PS9A 2A3RA 4WXMA 3VR6A 5E1OA 1E4VA 3PRYA 5CYPA 3WSWA 1U7PA 5T7BA 2FEXA 5T6BA 1TAGA 2VF8A 2RHOA 1E9DA 1IB6A 3IPCA 5E4TA 4ZYYA 4BMOB 3E35A 2WTAA 3JXEA 3QA9A 2PXAA 4RZUA 3LNTA 4ZJZA 1PGQA 1YB7A 3FDFA 4QC2A 4AMZA 2GAAA 5K8JB 1FXWA 1Z26A 2ZBVA 4H6XA 2VDPB 4R4JA 4TZTA 4IHJF 2EJWA 2MYTA 4HWRA 2OT3B 1Q57A 4IQ4A 4KWEA 3QHQA 4RK4A 5FPSA 4BVJA 1B41A 3Q85A 2VUIB 3AILA 4U2EA 4DMGA 2AXNA 2EG9A 3GLGB 1XIVA 4EFLA 5HS4A 5ICMA 1ZO8A 1OX4B 3IHWA 3FYUA 4ILEA 1E9BA 3C6BA 4RSHA 3UJHA 1OH5A 3U3JA 4E5YA 3KXKA 2FN8A 3PDIB 1I1QB 1CB7A 1JFLA 1ZITA 2CLDX 4OM7A 1X7YA 2R5NA 3RNOA 4DCPA 2IXTA 5T4BA 4DIEA 1XCOA 3MGBA 2O2HA 4YJ2A 4J03A 3VSEA 4Q16A 3MWJA 5BQPA 3G9ZA 4TLDA 1R5NA 4HEJA 3S1AA 3ZGXA 2Q49A 1Q7EA 4C4YA 2JCYA 2Q29A 2ZBPA 3O8CA 1NY5A 4DIBA 3U5ZB 5E8JA 2WKWA 3D0RA 2O3RA 4PZ0A 1M1YB 3VZPA 2QG9A 3WS7A 1CY4A 1GSIA 3NDRA 3A37A 1JPNA 3M70A 3W5HA 1WPXA 3R3UA 3JQFA 2C5HA 3ORHA 5IANA 5AKYA 1RZRA 4TM7A 2MCFA 4HGZA 3LKZA 3TOSA 1DEXA 5M5BA 4LECA 2PX4A 1N0UA 3ND7A 5B1SA 1XNGA 1T2AA 2COEA 3D5EA 3E3MA 3LWDA 4JASB 3U4GA 2O8FA 4EPWA 2P4QA 3OFVA 4UUOA 2OM6A 1B6GA 3TXAA 2JW5A 2PAFA 3IXLA 2J4DA 3OE7A 1I32A 1JGTA 4JYPA 4NL4H 1QQBA 4KXXA 4KEAA 2J9YB 2DFKB 2EWVA 4Q3BA 3V4ZA 5AM2A 2ZUFA 3PTZA 3NHWA 4KBGA 1L4NA 3BB1A 4WLEA 3ZXIA 4OMCA 1H1LB 3MLBA 3AUXA 4BQIA 3K1TA 1KS2A 2JFWA 5KWEA 3BA1A 3DNMA 4Y6SA 1ZMXA 2HMUA 4NFSA 3U6BA 2DB3A 3R8CA 1DJQA 1U7TA 3OICA 4UZSA 1GN9A 2W2MA 3ELWA 5DOVA 5GONF 1E3TA 1PJ8A 3FDXA 1DEHA 4DWOA 3ROQA 3CM0A 4ZAXA 2BMWA 4CF3A 4RKEA 6CHYA 1XQ9A 2ZJ0A 5IF3A 2DF8A 1RWNA 3RRBA 3KQHA 2CV2A 1N8SA 5C7YA 4B5KA 5EJAA 5IEBA 1EGHA 5GVSA 5AJUA 3KV3O 3EPRA 3I6QA 1VLVA 3PD1A 4ZC8A 1JXOA 1HK7A 2VSXA 1M34B 1H2RS 1Z0ZA 3LA6A 3PQ3A 4KN8A 5DNCA 2ZVDA 3HS3A 2CDCA 3TJMA 2HW8A 3UK0A 2W8BA 3H6HA 4BVBA 2PE5A 5CM9C 4Q4AB 3AL0C 1KARA 5CG1A 1GGEA 2H17A 1N6NA 2ICAA 2GZDA 3OP1A 3KVVA 3D7SA 1RYZA 1D4ZA 1E3QA 2P1ZA 1JU9A 1C3XA 2AC4A 3F98A 4GOLD 3C45A 3K2IA 2A3NA 4PIPA 1TDJA 4BV8A 1DPGA 3NHPA 4HV4A 4P84A 4CV2A 1M76A 5LQSA 4WN9B 3PUHA 3FI9A 3FYTA 1C1HA 1RZUA 2O50A 3CPSA 1PFVA 1DC3A 1NW5A 4Q4JA 2D2IA 4G63A 1LVGA 3QE4A 1M5TA 4ZJUA 5E38A 4HPJB 1JLMA 4XUEA 3IDSA 2VN8A 3K9WA 3NVKI 1PSZA 1JZTA 2IS2A 3D0KA 3BQ9A 3OKCA 2D5IA 3FHJA 3SS7X 4HAVA 4XQ0A 3ASZA 1JXQA 2Z56A 3V2GA 3K6SA 4L5CA 4GKKB 4WKGA 4EELA 1ZRHA 2PN1A 3AR2A 2EJVA 4PU0A 4M0FA 5JBNA 3VOAA 2OQ2A 4NG4A 4BYMA 5B55A 3IOBA 4RK0A 4KWCA 4YRNA 5C4GB 2PR7A 4F04A 4X1YA 4Z53A 2YHAA 4JVLA 3PRHA 1F3OA 4RD4A 2AZXA 4ALJA 3RE1A 2AGVA 4XLZA 3ZCTA 1SELA 3FPKA 4B2YA 5L7WA 2ZAGA 3TW4A 1ZYUA 5C52B 7YASA 1U8ZA 3HO6A 1OCEA 3UHJA 2R65A 5IAEA 2NVWA 4LDAA 4N4AA 5I7HA 3RUPA 5JQGF 1JIVA 1FYDA 1MEOA 1F6DA 1HR0B 4PO3X 4E51A 4LSWA 5K5EA 3BXGA 3C3CA 2VT7A 4F7WA 2WWYA 4K9SA 4EUHA 1AHNA 1SKQA 4M55A 4EL5A 4WEOA 5GQSA 3AL2A 1ISJA 4ZOLB 3E84A 3L4SO 1HYQA 2NO0A 3K0SA 1KPHA 1Y4SA 4EGSA 3I9KA 1U5CA 3LY7A 4JEIA 4PV7A 3UTCA 4MR9B 4DY4A 3UJNA 3LL7A 4LY9A 4EA9A 2V45A 1YR1A 1LI4A 3L1JA 3W5JA 2YXNA 5FI0B 2VZLA 3U13A 5DMXA 5EP3A 1GKUB 3T9CA 2JGJA 1EUCA 1VL5A 4G0UA 4UNSA 2GF2A 4RHTA 3UBMA 1ILWA 1ZN9A 3QY9A 5H4HA 3GPCA 4Q66C 1C41A 4S1VA 3P96A 3W6NA 1G2OA 4A0FA 4ALLA 2Q4BA 5LU8A 2GBLA 3AF3A 3LMKA 5J9FA 2QX6A 3UJ9A 4MAMA 3EZ9A 4DLTA 5GM2A 4YECA 3MGCA 5AI0A 1Z2PX 1CQJB 1YRLA 3QVJA 1AF7A 5EIBD 2V4MA 5BNWA 3FUTA 4A27A 2G09A 5BWCA 3NRCA 4L5IA 1SOVA 3OZUA 1KZ9A 4OSPA 4X62B 1V7ZA 3DE1X 1RACA 2BAGA 2J3IA 4LCJA 4B34A 4BJ3A 3AQ4A 1XL0A 4E46A 5A5VA 1K2WA 1JFTA 4YN3A 4OX9Y 3R7LA 4CR8A 1J1IA 3P5BA 3O92A 1C9NA 4ZANA 2JVIA 4G5XA 3A4NA 1HTBA 1E7WA 3BH7A 3KV1A 3PHBE 2YFHA 2ZSHA 4GPAA 4GPEA 2XWPA 2HNAA 2PUJA 3CLTD 3HCRA 4OXRA 3UJ7A 4BHTA 5HEKA 2I4LA 2IDZA 1Z6TA 3RROA 2XQJA 1NQVA 1CW2B 2WFLB 4J76A 5TX7A 5ERYA 3ZDRA 1J1ZA 1N2CA 1NUHA 4G41A 4DCGA 4K9OA 3ZJ5A 2VF5X 3HADA 4PRLA 2ZVQX 4XYBA 5IHPA 4KWHA 4CUJA 5KNDH 3DOJA 3ICQB 4B6RA 3GJZA 4J2OA 4N7MA 3G6KA 1T9DA 4EKEA 1A9XA 3WIUA 2YNMC 3TLGB 2SECE 2VKTA 1GTJ1 1TVKB 5C80A 3H8VA 3HL4A 4JLDA 2OG2A 3V00A 3VKVA 3F2IA 3QFFA 1SK9A 2QTNA 3DZ8A 2FK7A 3IBTA 4I14A 4KQXA 3SCZA 3SOZA 3FX2A 2X5KO 1QF7A 3SJCA 1KEUA 1U94A 2IUSA 2OSBA 2OGTA 4GOND 1OQAA 4PLWA 4DDKA 1SBIA 1AT1A 4XX1A 5EQTA 1TJPB 3BUSA 1DO0A 4NH0A 1C8LA 2B37A 4RPCA 2ZYWX 1BVYF 1JEYA 2ID4A 4NI5A 3OSUA 4NEHB 2ALJA 2H31A 1DKOA 4QG7A 1FJ2A 2Y1OA 3NAQA 1J2TA 4HAIA 2IE8A 1MV8A 1U4NA 2ONJA 2HL6A 3QNMA 4WCFA 1EA7A 2VAXA 3VPAA 5IDXA 1B43A 1OPRA 1MW8X 4BPBA 2IXFA 5A0VA 4CEJA 2H5LA 3B9PA 1WDLA 4AK9A 1VPVA 3HC7A 3K70D 2VDMB 1BE0A 4AJNA 3HO8A 2H3EA 2LPMA 4N7RA 3AGPA 3AVXA 1FE8A 3EBPA 3CW2A 3II6X 1XHLA 2GT1A 4F4CA 3DCJA 4H3HB 2EBWA 2ODNA 5D86A 4DLRA 5IEJA 5JADA 3RC3A 1XEXA 1T5OA 2X0NA 3O74A 4CKEB 2QYSA 2WJJA 4QXOA 4H6VA 1JJIA 5LP6C 4UBKA 1CYEA 1FFEA 1T6XA 2PQ6A 1Y1RA 4IYRA 1K66A 1XI2A 1Z0IA 2P2YA 3L82B 4QL3A 4EL0A 4ZEVA 3LWBA 4H7IA 2H1FA 3O93A 2RHBA 3JCZA 4Y2YA 3WK4A 3O6VA 3ONNA 4GUAA 4RESA 3FVRA 1DTWB 2NN3C 1V9LA 3JU3A 1KBOA 1OKKD 2PX3A 1U0HC 5AHWA 1JAZA 1OW3B 1QIGA 3KU4A 3M4YA 4V24A 4R1SA 1GUDA 1TTPB 4YLGA 4GLLA 4JX8A 1T3HA 2TMKA 1XDGA 3QENA 3UT5A 3AF5A 4Y6LA 4QOIA 4GQBA 5JY6A 1LPBB 5AM4A 3OLXA 3AEKA 4EHJA 2DGDA 2OBBA 3BL6A 4QYTA 5HQ3A 2VR1A 2C4UA 5MF6A 5IHXA 2GPSA 2OOSA 3QVWA 5FLKA 3B7WA 4OL9A 1RABA 4RJIA 4Q4DA 5IKXA 3EWIA 2ZRKA 1LPPA 1OXMA 2F64A 4EKNB 4YCSA 3K1YA 4QTTB 2J6IA 1PUXA 2P2NA 3FPHA 4RDHA 4B4VA 5HNKA 5JVDF 4F3TA 2XKAA 3W04A 1MV5A 1NG9A 1WS6A 2BONA 1N5RA 4UQOA 2H9IA 3UVEA 1Z0UA 4AECA 3TI9A 3Q8MA 4C2UA 2PZBA 1JTFA 1WY7A 1SCUB 2HK8A 5JRZA 4W5WA 3H0CA 1U11A 5E0KB 1J21A 4OREX 2X8AA 3RJZA 2IPOA 4JYZA 4COOA 1P72A 3GT7A 1WDTA 2VSFA 2B4AA 1JJAA 3A6LA 3PUZA 5FPTA 4C4SA 2IQ5A 3AR5A 4I1YA 2PT5A 3UGKA 2B83A 4AMVA 2AF4C 4WE3A 4ZDIA 2X9LA 1XV5A 4EQ6A 2IHBA 1CEEA 3HLTA 2UYOA 3D59A 3ISVA 4XD7D 1JB1A 2ZJFA 1NWHA 1PO7A 1SULA 3HJHA 3N2YA 2WHRA 4Y6QA 1JDPA 4U2FA 3RWMB 1QFZA 4LUCA 5DHFA 3UB4A 1KWKA 2V5VA 4ATNA 4DDTA 3H65A 1W581 1W48A 2ZVJA 1Q0ZA 3JQBC 3BIWA 3HKBB 3KSZO 3OX2A 3TO5A 3NTLA 1ZXBA 3QTBA 1JHRA 4NDZA 4ZHQB 2GN2A 4WY2A 3Q5DA 1D6MA 2XJ4A 4JLAA 2OQVA 1KI8A 2XDYA 4M8SA 4G01B 5B53A 2PGOA 2Y4NA 4W82A 3WWCA 1E1LA 2TMDA 2ETXA 3ABRB 1Y5MA 5H70A 1RD4A 4NCKA 1HG1A 1X0VA 4RA6A 1J8FA 1PK9A 1W87A 1HDCA 1XJ0A 1ZD9A 1YCGA 1VKOA 3G0OA 4Q4CA 4O59O 1W7AA 1M5RA 1DKLA 3MILA 3TFQA 5H68A 4JUBA 3V4FA 1QUFA 3E81A 1P9NA 3AG5A 3PL1A 4TSFA 4IJUA 3PCRB 3ORYA 3FZNA 4YRRA 1CZUA 5IARA 9LDBA 1X8LA 3CNEA 5DI3B 3HBAA 3HYNA 3PSAA 4L3WA 5BOSA 1QTIA 3GPDG 4LYHA 2HWWA 4B3GA 1BWPA 4C0AC 1RQXA 3MERA 5TF4A 3BMXA 3OOJA 1PV1A 3RYHA 1L8XA 2XODA 2QNRA 3I9MA 2RKWA 1LD3A 3L6UA 5KJEA 2QU8A 3AEXA 1UXHA 2IDJA 2Q4DA 4O1HA 4QUKA 2B7LA 4XJSA 5L7YA 3EODA 2H54A 1JFRA 1FNBA 3DP9A 3IAXA 4HF7A 5FWYB 2EZUA 1CUDA 2AA3A 3KOWA 4JA2A 2UDPA 3HB9A 3B3GA 4ZVRA 4B33A 1CP2A 5F33A 4BFWA 4XDZA 2VDWA 1N4DA 3P9QA 3AXSA 4D81A 5BYKA 5JDCA 5LJLA 3F3KA 3X43A 2D5CA 1V43A 1T9CA 2HLDD 2ZIZA 3EB9A 3VKGA 3NHMA 2JGRA 5EIEA 5AKGA 1W2WB 2QRVA 2R0QC 3N70A 3P0FA 1CKEA 3VZBA 3VBCA 5IASA 5KWJA 1H66A 1ZM3A 2VO1A 3JPWA 4QGAA 3QFCA 4A9AA 4DPLA 2P6MA 3UBTA 3TPCA 2DCMA 1NR1A 3IC5A 1OH7A 1H1DA 3VTZA 2WP0A 3SBEA 1URPA 3HR7A 4MS4A 3WYEA 1DEKA 3PC6A 2YDYA 4O8CA 5JW6A 2V97A 2P4SA 3MPUA 3GCGA 2YQZA 4WZBA 2OPHA 3ESAA 1QHYA 2FI1A 2P2SA 1GAWA 1K86A 1GT6A 1TU3A 4J16A 1NLYA 1OFGA 4ZRMA 4G8DA 5D8DA 1ZUWA 4QEDA 4HOYA 2K7FA 3IJ5A 2GXAA 1Z6GA 2ZAIA 1JJ7A 1UDXA 4I1SA 3OF3A 4OHYA 1HX7A 1QS0A 4P4SB 4DOMA 4F3KA 4AJ2A 1Y4UA 2ORYA 4QDOA 4BFCA 1D4OA 1C2YA 1HC7A 1NTRA 3RRMA 1V3VA 3L7OA 2WE8A 2Q27A 3OETA 4C4TA 2NU7A 5BV2P 1QOZA 3A3KA 4MKZA 3FMIA 5T8KA 3VHQA 4QU8A 1NMSA 3KVRA 1QIHA 1REQB 2H1CA 3CH5A 4XCXA 1XFDA 4F9EA 5TMPA 1KDPA 4G3XA 2CKMA 2OLEA 4FC6A 2R25B 4UPDA 4E13A 3I1FA 3K2BA 4YJ3A 5DJ5A 4K05A 1AQIA 1EA5A 4E5SA 3ODPA 2FZWA 5CDFA 1GGHA 2ECKA 1EK1A 3G6WA 4I2VA 5LB2A 3OO1A 1DXHA 1NI5A 2AW5A 4LVNA 1RLTA 3TNLA 4P5EA 1KQGA 3CFYA 1BFKA 1RBZA 5TGZA 3UHFA 3GLIE 1W36B 2VHJA 2QTMA 3TL6A 2DTDA 1ZZGA 2ZTUA 1HOXA 4C6SA 2ZJ4A 1XPUA 1P77A 1BXRA 1YR7A 2FPIA 3QIAA 3FF4A 4WOPA 4QELA 1IJKA 1CUZA 1UFRA 1J00A 3RYTC 2OO3A 4LMRA 5KNBA 1AQYA 2OUKA 3JQPA 1X15A 1TW2A 2OBNA 3Q40A 4GPZA 3FSGA 5FL7A 5HTKA 4GNRA 5CW2A 3VJMA 5L4LA 4K1XA 4NYMQ 2AHRA 3F78A 1E6UA 3LF2A 4M99A 5IKEA 3KUDA 3TUJC 2DFVA 3F96A 2HMTA 4P35A 1L5FA 4CEHA 4P2BA 3UATA 1FYEA 1Q5PA 3HJAA 1XZBA 4MVJM 3N3BC 4XJTA 5CTAA 4MQ6A 4INZA 4RFSA 5BXYA 2F7SA 1X9GA 3DBIA 5JRDS 4ZOBA 2HFJA 3RBXA 1JR3E 3D1LA 3GH1A 1PTJC 4H3KB 1V1MA 3I0NA 2H7XA 3ER8A 2O8CA 5GGYA 1KY5A 1E94E 1ONSA 3IPLA 3O8DA 3P9KA 2C4MA 2JL1A 4PRYA 4G6ZA 4EATA 2X8LA 3QI7A 4KE6A 1ML4A 1NQWA 1XVAA 1P91A 1BXGA 2C2MA 2G67A 3E27A 4IDAA 4ZKDA 1W4AA 3WLIA 5IXSA 1O95D 1JIJA 1SBQA 4WGGA 1RLIA 3ROEA 4POAA 3GDGA 4YP9A 5FV4A 5KOIA 1DRJA 2ZYVX 3COVA 5AXBA 1OFIA 4XWWA 2ZI9A 5BRAA 1IOVA 4WNYA 3M4JA 4LTDA 3FFTA 1ELOA 3ZE2B 4OA5A 4Q1DA 4F6CA 2CBXA 1TF7A 4IZIA 4ZYXA 3IE2A 3USCS 3IOYA 3LQ2A 5LSAA 3Q7PA 1E0AA 3AY0A 2GZAA 3E61A 2VP4A 2R2GA 4QUBA 3RFUA 3ETNA 3VR1A 3BWDD 3B3QA 3JRNA 4BRZA 2ZPTX 2D4AA 1NF3A 1Y8RA 2XMSA 3HRHA 2BE7A 3IAS1 4FSDA 1UDCA 4N39A 5HKAA 4KRFA 1VIAA 4UUPA 1R4MB 4ENUA 1JRLA 3ZIAD 4POOA 1E6WA 3JQAA 1ZK2A 1LU9A 5AM1A 4B4WA 5KPJA 4C7OB 1UWVA 4CIBA 2C3MA 1KY2A 4NMMA 2FZ4A 1MT0A 3FWHA 4QDZA 3VZRA 2J3LA 1PD0A 2YVAA 3LUCA 4Q0MA 5ELXA 3H04A 3C14C 4YWJA 4MRVA 3PUWA 2XUAA 4MCIA 1E1QD 1BFDA 1QO9A 1UOOA 1NXSA 1A9ZA 1PCXA 3HP7A 3C85A 3M4NA 4A91A 2O2SA 2PKCA 5HYVA 2DBZA 2VJNA 3WXBA 1YRYE 1YRAA 3KAKA 4RORA 4F4DA 4ZQFA 5TLSA 1NT2A 4GAEA 4KQHA 1QBKC 1T24A 4QPNA 521PA 1DKPA 2ID9A 3GX1A 3TIFA 3IKTA 2PYDA 3ZY3A 5H9WA 4ER0A 3SHTA 1RR6A 2UUBB 3NNDA 4M87A 3U40A 4LZPA 4ZVSA 1C7EA 3L8MA 1O0SA 3FBTA 4JSYA 2GCIA 1MAHA 3AFGA 1IZYA 5FI1B 3SXUB 4OD0A 4IIJF 2HF9A 4YGXB 1KI4A 4K1LA 1KE1A 4DCTA 4GLBA 4IDEA 4EPTA 3DHNA 4M22A 3RYFB 5DCLA 1NBMD 1NI4A 2YRFA 1QSGA 3S5JA 1AXGA 3RNLA 3L4KA 5D87A 1Y4DE 2RGCA 5ALDA 2WWIA 3CW8X 2D1RA 1EWVA 1FDWA 3WNCA 3IUJA 3NGMA 1PU2A 4RD6A 1AQ6A 2DP4E 5EJ9A 4BN4A 4NENB 1V7CA 2BFFB 2CK3D 5JSKA 3N2EA 4P54A 1RWVA 1KETA 1U0JA 4FN5A 4YT5A 3C0KA 1P2VA 1DBWA 1XO1A 2LKDA 4I9GA 3T0GA 1C4WA 3C8DA 2PX8A 3DZKA 1XQVA 1I01A 2ERYA 2IHTA 1NXXA 2QL5A 1WIWA 3CLUD 4WJKB 1AKVA 2YZNA 4S0XA 2J9RA 3M5CA 1M2WA 4C4AA 1L4UA 4DMMA 3LPDA 3VC2A 3RR2A 5HSGA 1OUMA 3KR2A 3DTVD 4QO8A 1USIA 1GILA 4DLWA 3PLAE 3PSHA 1G8JA 4CNBA 3OHPA 3STYA 4NG5A 3FOFC 2IOYA 2OHJA 4AJ4A 1M9NA 1OHHA 5BN3A 4HDKA 1UBRS 3QUCA 4L8LA 1WLYA 4F93B 2XNDA 3QVLA 1XVVA 3EG9B 2O7NA 1J5EB 2NSHA 1Z9BA 5ETJA 1VCMA 3PVZA 1AGXA 1SKUA 2H1IA 1RYHA 2DLNA 3WBFA 4RJKA 6AT1A 1SXPA 4MJ7A 3HCOA 4V0RA 3W8EA 4EH1A 2HUPA 2FMIA 1JUDA 5KYWB 4EUEA 1OYYA 1YJAA 2BEUA 1RIFA 3UWPA 3SZLA 1XRQA 3MTIA 4MJLA 2E9SA 1DKUA 3HABA 1YGYA 4WCVA 2VHZA 1T8UA 3QMWA 3HVJA 3JD1A 4L5JA 4EAAA 1BCSA 3IQIX 1IULA 2C7BA 5A4JA 2D1QA 3HFSA 5JI2E 5FKJA 3U31A 3BGSA 4J3NA 2OHGA 3ZHSA 1OX5A 3AJAA 2CL7X 2FPLA 4HDRB 1MJGA 1X8XA 1UXGA 1AN9A 4Z0TA 4DS3A 4KP7A 1UXIA 3P2OA 1XLUA 1FFXA 3PFGA 4LHVA 5B3JA 3GGOA 4L50A 1E3LA 2Q4OA 2B1IA 3GW8A 4UEWA 4WFKA 1II8B 2FWAA 2VA8A 3G5AA 1CUBA 3LBNA 1QO7A 5BQOA 2GN1A 2N1MA 3LHKA 2PL5A 3ZQUA 2GHQA 4BFVA 5JATA 3S1SA 2NUTB 4L27A 3ZW8A 1CETA 1D2EA 4ZVPA 4HQ0A 4Y6PA 4HMPA 4C6HA 2FF7A 2H8KA 1H2AS 2NO1A 2Z9BA 3T4UA 4ZZ0A 5T6MA 4P4TA 2O9JA 1XDBA 2Y2UA 3QUTA 3KFLA 4R81A 1YR6A 3OLZA 3KB8A 4P83A 3HCWA 2QP9X 4RVCA 5DIFA 4D4HA 1XCLA 5EIBC 2X9NA 3EEIA 2A59A 5BMOA 4MRPA 2FJ0A 4PLHA 2FDRA 1MFZA 3V3KA 3FYSA 4FYYA 1G60A 4B45A 1S2DA 3FD8A 1B23P 2HEGA 1CJBA 2G3YA 2IPAB 5KQMA 3EBOA 1QONA 3KKOA 2JGKA 3QKIA 3UJ6A 2F9LA 2VYVA 4H1HA 3VHRA 3L7YA 1UZAA 1Q84A 3IIJA 2C58A 2PX2A 2Q5QA 3LTEA 2VSNA 1ORTA 3MWDB 4M49A 1T26A 3CLTC 4ZPXA 1AHPA 3U4CA 2B9EA 3MINB 4MRMA 1B0AA 3IVAA 2YY5A 5BQ5A 3FUVA 1TA4A 3WLNA 3YASA 4AUNA 3A8TA 2J3JA 2ENUA 5IJ9B 1PJ3A 4MVJD 3ROGA 2A4KA 1KEVA 2HA5A 3IDQA 5AHXA 1AURA 1RLMA 3AB3A 4UU7A 2PL1A 3UMFA 1DAEA 4AZWA 4BXOB 4R5HA 4NECA 3ZK7A 1VIYA 2K7ZA 5HUHA 3FPJA 1PSWA 2RHWA 3LHFA 5FLXA 1NOKA 2VP0A 2V0CA 1L7AA 4Q7MB 2QV0A 4GKBA 4TPKA 4JN6B 2VJBA 4AZ3B 3PYMA 3N3AC 3CC8A 2VJLA 4NNJA 5LQDA 3OOSA 5HHTA 2V9PA 3VC1A 1BXKA 4DCMA 2YJNA 2GPAA 4K9NA 4NE2A 1AS3A 3JPYA 3MBOA 2AG6A 4TRRA 1XK7A 3H86A 4IEFB 4FKMA 3TTYA 3A0UA 3DM5A 3W2GA 5ALVA 2C96A 2JBWA 2OO5C 2QUKA 2V55B 1P5RA 3DR5A 3FZYA 3LXXA 3O8QA 1VM6A 4MW9A 1WTCA 2WICA 3DQPA 3QELA 3RB8A 4ZIRA 3NHZA 4D6PA 1K92A 3JQ9C 3CR3C 2JIOA 3OIWA 3DTTA 3OUUA 5EPEA 3UXYA 1ZVMA 3EF1A 1IEWA 3ACCA 5KAPA 4WH0A 4V0OA 1Q7TA 4UBMA 4GSYA 3WLFA 1EP1B 5KZMB 2XZDA 1XTIA 3PQDA 4JQSA 4RADA 3TMAA 1NLFA 1RHKA 2AFHE 1A27A 2QSZA 3A1SA 3NKFA 2AVDA 3RUCA 1NUAA 2E21A 3K70C 1FNCA 1JI0A 1RKXA 1T2FA 3IKLA 2EW8A 2XVMA 2VK1A 1IBMB 1UPTA 1Z8HA 2WG2A 4KPYA 1KQFA 1FU7A 3UQZA 2YVQA 2FW1A 1F0PA 1UEIA 2ISQA 2IX3A 1ZUIA 2H5EA 1R37A 2UYGA 4H7FA 4OJMX 3LIPA 4O25A 4RNCA 4ERNA 4L02A 1QANA 3PJGA 1QE5A 4G0VA 3QTLA 2ZS7A 2QPOA 3HNPA 4HNGA 5CP8A 3TIGA 1P1FA 3J81k 2CMFA 2JJYA 5DX8A 1Q95A 1SR8A 5KVVA 4OHKA 4R8RA 5AOBA 2IITA 4YMGA 1VE7A 3BRSA 1NJGA 2GLUA 4OGFA 2JLWA 1PX2A 5EUCA 1VB3A 1JBKA 3B6JA 1D2AA 5C7LO 2ZWVA 1PZXA 3AJDA 3CF6R 5I45A 4P3KA 2HKIA 5TEWA 1M6VB 3UEOA 1DRKA 2PT9A 2I29A 4RA9A 1PL6A 1JKFA 2IZ0A 2A5JA 3PC4A 5CB4A 1YOVA 2Q5IA 1KZGB 2E4WA 4WJLA 1GSAA 1KMNA 4HDSA 3WGUA 5JWRA 4PCVA 1MN6A 1EQUA 4DV4B 4XB1A 1XMSA 5CDYA 3CLHA 3RAPR 3AESB 4MR7B 4YBZA 5HIMA 1RLJA 3MCWA 4EPVA 5IWAB 3P2KA 5J59A 1ADCA 3I28A 2O4UX 4NYIR 4BMYA 5IN5A 2QQ5A 1Z5VA 5IFKA 2V9CA 3IVXA 1BROA 3C6YA 3NORA 4I5EA 4M98A 4UXHA 1FVOA 3PPXA 3QBEA 4U3JB 3VR5H 1FU8A 3JVDA 3K70B 4A1FA 1D6JA 1G8PA 1B26A 1NVVQ 1WVMA 2INGX 2JGDB 1NC3A 4R2WA 3MMXA 1UZNA 3LLUA 5K0LA 4A7PA 5BOVA 2G80A 2ECPA 4U2CA 5B6JA 1S8AA 3FMFA 3JALA 2O14A 1VL0A 2GERA 2YWEA 3M4XA 3R5TA 4MARA 4RHUA 3UENA 1ZFNA 2Z8YA 3ZI7A 1MHTA 2GZ1A 4PC2A 3BWMA 3ZDXB 3PQ7A 3KOMA 4Q3NA 4C0XA 3FTNA 5DTEA 3H2YA 4NKRA 1X1QA 4AKSA 4CMGA 2OZKA 2G06A 3V4PB 2VP3A 5EWLA 1EJ2A 5SY9A 5JAZA 3GAZA 3ND9A 3UJBA 2RCYA 3N7TA 1GYRA 4ISCA 4IDHA 3G88A 3SWWA 1NXOA 4DCSA 2ZRIA 4PANA 1D03A 4BS9A 1R8QA 5TT0A 2LXNA 3VYSB 3RYIB 4B7CA 5DXAA 4YXFA 3BE4A 4FNOA 4DAEA 4KDEA 1WU7A 1XZDA 1CRZA 1ZKDA 1I7DA 2MSNA 3MRXA 1WW3A 1FLAA 4HQKA 2GHRA 3SF0A 4BVLA 1GA6A 1UC4B 3ZG6A 1FMFA 2J9FB 2C98A 2DFTA 3T5TA 3BQMB 4A8JA 1TVEA 4I8DA 4R6XA 3W3AH 3WYFA 4BGUA 2VG8A 1G66A 1I6LA 4YP1A 4E5KA 2LUOA 4YFVA 3RIGA 3W9UA 2XUJA 2NO6A 1QYWA 1XA4A 3LG2A 4IX9A 2OB1A 4YJFA 4YDQA 3NVMB 3RD5A 3LBAA 2CVHA 5FI5A 2IHUA 3MJRA 4PQGA 4GGOA 4XRGA 2PK3A 3I01M 4LF5B 2BGJA 3FYCA 5EJ2A 4B09A 2OFOA 4JBXA 3LLCA 4BJ6A 1S7CA 4QUGA 1P3DA 1RPTA 1W59A 1KEEA 2ACEA 2NADA 3UB3A 1P0IA 2Y6UA 5JJ5A 1U65A 3DTYA 4M7WA 4YAIA 3UN1A 5B37A 3HKEB 1RHUA 2RG1A 2O06A 2RFLA 5D5QA 3KJNA 5K2MA 3QE2A 2XZPA 4JP1A 1LXCA 4B4UA 3R8FA 4XAQA 4GLOA 4KQ9A 2X0RA 2GD6A 2WVHA 1H5NA 4D79A 1PYOA 2IW1A 1U3WA 3BEDA 1VSTA 3DYVA 3H5RA 3LF1A 4GXQA 4NTZA 3OU6A 4WEQA 2FSIA 4PG6A 3BWEA 3TBHA 1JHQA 2AW3A 5EJ7A 2Q6IA 2HAEA 2WFZA 2ZUUA 3EY9A 4UAJA 4ZT3A 3TZCA 1AGYA 5KC9A 1NN5A 3ANNA 5F12A 1G5HA 1P9LA 2AXEA 2WJAA 2YWDA 5I7SA 2ZRHA 2J5BA 4R3NA 5A9RA 3BX1A 4W9NA 1GGMA 4KHPB 2ZI4A 2EX1A 5EPUA 3BJEA 4EUFA 2FPOA 1FRFS 1ENOA 2Q1XA 2Q6TA 5HE9A 3RU7A 1P60A 3W5SA 3U56A 5H3CA 5MN6A 4DANA 1T2EA 4Z1OA 3TRKA 2AXPA 4N9WA 3T35A 3T7RA 2PM8A 3L46A 3D4LA 1L4LA 3NONA 5T3YA 1BN6A 2BFBB 4NX2A 3OPNA 2WUFA 1JZQA 4HLUA 1MX3A 4UUQA 4AF7A 3SEFA 3WGHA 3NWJA 4UD2A 3HMQA 4YDHB 5AW8A 2GH1A 3N8NA 5IPFA 1GAJA 1DMRA 4O2AA 1P74A 2AYYA 4B0OA 1E61A 2QAIA 2M98A 3ZCUA 1I1OA 1U9IC 4RVSA 1I7PA 3WHLA 3CSSA 4I55A 3ZLJA 2Z57A 2K6GA 2C83A 3F3MA 4L75A 1FS6A 1QQ5A 2OV2A 5CX1A 1D2CA 2O05A 4NMXB 3QPUA 4RY0A 3VJLA 5JO0A 3ACDA 2ODWA 1ORDA 1MO3A 1W6UA 3FGNA 1ZOPA 4ND7A 3WK6A 1RVV1 1DTEA 3LY9A 4ROSA 1EU1A 4HLQB 1Q50A 4PSKA 2CVZA 4YCMA 2IWHA 4QE3A 3ZGOA 5DRYA 4P4UA 3RH0A 4Z1MD 2IXBA 2ST1A 1Y9DA 5CIYA 4AWAA 1E4OA 5JPDA 2QL9A 1H8HA 3M89A 1Z7GA 3V55A 5AM0A 1GRVA 4HRYA 1EG7A 2IXEA 3BMCB 1TPYA 4INOA 4QUJA 5SYNA 3WGYA 3J80A 4FFBA 3RFTA 3RS0A 4LC1A 4J1TC 3H7AA 1TCCA 3WB9A 3BDIA 4GPD1 2ZIWB 3A10A 3K5PA 4UCWA 2YWHA 5EKDA 4DDUA 4HNUA 1G20B 1LFDB 1B1CA 2JC3A 1N2SA 4NOLA 2ESRA 1F2UB 4UQLA 3H4IA 2O6HA 5FNVB 1PJ2A 1QHSA 2LZ0A 4I9NA 5I4BA 1BC5A 4LZOA 2D74A 5J2UF 1A7UA 1AGPA 1C81A 1Y9EA 2PXHA 3PC3A 4KQEA 1QGZA 5A7HA 3HBLA 1OA0A 3QKRB 1LDEA 2WM8A 1BNCA 1UKBA 4QQ8A 4DMRA 4DY6A 3TFWA 5C18A 4KQ6A 1NJ1A 4D0GA 3FFAA 3TW8B 4Y98A 5F35A 3PNYA 4MV0A 1AKUA 3OEEA 1NQAO 4FWTA 3K1AA 3R5JA 1UPAA 2AZDA 1M8KA 4TVOA 1QZXA 3G5LA 1ZD2P 1KZ1A 3NTVA 4K9MA 2C5AA 3AF0A 4QOGA 1JKMA 2WLSA 3B8HA 2XMCA 3C4JA 1H0RA 4Q18A 2ANBA 3JS5A 2GAIA 2GO1A 3IBGA 2O5RA 1WF6A 1O95C 1OWMA 2GN9A 3QYJA 3UMYA 3OLQA 1P1KA 3FKSA 1CYDA 3RVJA 2ZIAA 4HUTA 1QRUA 3EXHC 2BUBA 1G8GA 4YREA 2JIQA 1C9MA 1CY6A 1QC5B 1Z73A 2PWPA 5DX0A 3IUNA 5A1JA 4AL4A 3PQ2A 5LWHA 2XUQA 4UEJA 1CVIA 1IM8A 4ID9A 1GU0A 2PZGA 1NJSA 1LS6A 3TXYA 4LGCA 3VSAA 1RI1A 3OMWA 4ZO9A 4RJJA 5LMCA 5DYNA 1KXJA 3HPQA 4BUZA 1XHFA 3GP3A 4OXQA 1ODLA 1Q44A 2W70A 2IS6A 4CM3A 1M10A 3I45A 3Q98A 2BEKA 1T1SA 2FJPA 2QI9C 1ZUNB 1ZSVA 4TOIA 1E3EA 2W6IA 3L7AA 5TIIA 3NANA 4I1RA 5CMLA 3QUBA 1I9GA 4JBIA 4WBNA 3OIYA 5A9SB 5LMUB 4DEVA 1QRSA 3RTGA 3A6PC 1I1HA 2QL6A 2SKCA 3OAAD 4ETIA 2OV8A 3B1VA 2WSMA 3W34A 1NX6A 1YL5A 1Y89A 1WLSA 5HVNA 5AKJA 4LQCA 2BE9A 3NX4A 4FMDF 4XTRA 2MINB 3MUOA 4S3MA 1SC3A 5IM4A 2WEKA 5LP6F 1ZU4A 3DMTC 3R40A 5HBGA 4X60A 4JI5B 1ZL0A 1LTQA 3P9RA 3X1MA 4V3BA 1AJEA 2PRKA 1T0HB 5AO9A 3VU9A 4GSLA 5EWJB 2SCUA 1CJVC 1ESDA 2BWJA 2Z43A 3QGMA 4ZT4A 2RH5A 2C82A 1SN7A 3SEQA 1Y7LA 1MPTA 1YMUA 3JZMA 4ZN6A 2W5UA 1QRAA 3D6JA 2HCJB 2AZ4A 3QLVC 3FZGA 3K0AA 4RF3A 5TQ2B 3NGLA 4A3SA 4CHGA 5HCUA 5C8YF 4KH0A 1YQEA 3ZVMA 3H2SA 2F3UA 1M66A 2I71A 2JS7A 3EXHB 4CCSA 3RRNA 1FTSA 4ZYLA 1ISRA 1DIBA 2GCNA 2AN4A 2P3QA 4ZHQF 2QBYA 3AVTA 2E89A 4I9UA 5BVHB 3FWPA 4BGVA 5F3RA 1DINA 1F2TA 3R74A 4ARVA 1EYZA 2VXYA 5EMLA 4ZEXA 5I7OA 1LS1A 3DWGA 4GYYA 3UKJA 4JC5A 1CCWA 1VJRA 2L69A 5E7IA 5DYGA 1UJCA 1XPRA 1JA0A 1KI2A 1A95A 1YZKA 1YCHA 1KERA 5IC6A 4BQSA 4YHHB 1CUFA 721PA 1EVZA 4P58A 3RAJA 3RUHA 2IEAA 4GBED 4W8OA 2ATIA 5B30A 2C7PA 2PKYX 4HDOB 5CCEA 4HC4A 1H2ZA 3F67A 3FDZB 1ODFA 1CJCA 1EM8A 2O0HA 4PLPA 4CL3A 1YJ8A 1NY6A 3ENZA 1Y9AA 2G5TA 3W2FA 5CA1F 1EKXA 3GVPA 1B15A 1YB2A 1Q74A 1F1BA 3FGZA 3NQ41 4N1AA 4B85A 4O4HA 5TPZA 2W42A 3ICVA 2YMPA 2P5SA 2P27A 3CLUC 2BMDA 3HI6A 3I6ZA 3PEWA 3FTEA 4E5DA 1Z36A 1U6KA 2G7ZA 2GEFA 3KT0A 3ZVRA 3V2HA 1J0CA 3C15C 4X3OA 3ZDDA 1Z62A 3SNKA 2OWEA 5I9BA 1JAYA 1TM5E 2QNIA 3LT1A 4YJHA 3W9YA 3N39C 2HDOA 1DIGA 4ABYA 2VRWA 3BE8A 4EEKA 5JEDA 1ECJA 2JB9A 4J07A 2DPGA 5JCOA 1Z68A 5H7XA 4Q34A 3KQMA 2AOUB 5AUOB 4RTKA 1PVOA 3A05A 4LG1A 2YJ5A 4RULA 3WJ7A 1GL9B 3GNTA 3K4HA 4C20A 3OD5A 4DR1B 1RBMA 2H1VA 2FEAA 2EU8A 1F51E 1EFRA 2IX9A 2QA5A 3JASA 1B8OA 2V7UA 3AZPA 5IJ0B 1ZR4A 1ZSYA 4OHRA 1KAOA 2P9BA 4QODA 4RZQA 3P0JA 4FOTA 2AMJA 1KU6A 3DO8A 2YJGA 4LE1A 5HFNA 1QAQA 4CRWB 1PJRA 4XVQA 5LN1A 3IPRA 2H2AA 3DYIA 2JBAA 2GZMA 2PR2A 2NO4A 1G9SA 1MNQA 3BZBA 4FE3A 1R8JA 4AIIA 3EXG1 1NBAA 3QWHA 3Q7IA 4OATA 1E7SA 1ZCZA 2BHLA 3HJCA 3MAAC 3CNQS 1DUVG 1T0JB 4ZODA 3H11A 5TMDA 5AVSA 3GLIA 3TDMA 2L42A 1OFTA 2P9CA 2MR5A 4QREA 1WXFA 2JCVA 5ITSA 1GL6A 1AC5A 1RBYA 2VATA 3IUPA 2C7GA 5KKAA 4HGYA 1KOFA 1ZEJA 4G9GA 3QWIA 3PDCA 5CBKA 3BD6A 2R60A 2NVUA 4JY7A 4PPGA 2QTWB 2ZWOA 1MKYA 2FLKA 2FPSA 3KUUA 2OLKA 3BD7A 5LYYA 4I08A 3U7JA 2P2DA 2IEGA 4RPKA 3B70A 1FL9A 3DLTA 4PHGA 4YMHA 2XJ9A 1SG9A 4Q03A 1WHSB 1JDSA 5KINB 2ERCA 4O4LA 1MD9A 1OTHA 4OJNA 1IQ0A 3I30X 4PNEA 5E7QA 5HM6A 3VMMA 3KSBC 1PDWA 1F6WA 2PWZA 5E2BA 1CULC 1TEVA 1XVTA 3ONFA 4EZBA 4CIAA 1XHEA 4KO1S 3HP4A 3F0TA 3LZ6A 3MJFA 2ZULA 3BWBA 1Q19A 1LPSA 1UT8A 1Y0BA 1ZGJA 3OQBA 2BGRA 2Z30A 4IV5A 4IH1A 1FLNA 1U2DC 1JKXA 1JR3A 1XAIA 1C0LA 3ABZA 3CG4A 5K01A 1Z25A 2AC7A 2N47A 1G41A 1PWEA 2OGSA 4G5QA 5ALZA 1XRRA 2MJLA 3VRHA 3FCOA 4CM6A 1AX9A 4JGBA 4AJIA 1GFWA 2H48A 2XZOA 5AVRA 3KQKA 4BMVA 4EZEA 2OYCA 3S99A 1K08A 1J7KA 3A3NA 1JHOA 1PDOA 4JL6A 2OZLA 2A7QA 4CF5A 5KQGA 2IBTA 3UFXB 3IKMB 4R5MA 2XCSB 5H82A 2VSOA 4L7QA 3NHLA 1UINA 3VV3A 2CWDA 2OZPA 3P1JA 2VHEA 2EQAA 2QTLA 3R2JA 1OZGA 4BKPA 4X7MA 4BBAA 4KXVA 4R2IA 3M1YA 1QDUA 4W8HA 4KQJA 3U0VA 1T8TA 1QGYA 3X0DA 4N41A 2Z3WA 1K7YA 3EFOA 3EAQA 4QIHA 3LT5A 1R6DA 2JANA 2WTEA 3GLUA 4DBZA 2CT8A 1UFVA 4U6SA 2AHOA 2HNBA 2FWMX 5EUQB 5J2TB 1UM9B 5F73A 1VHJA 3V1TC 1IY8A 4CCYA 4Z6KA 3GEHA 1AO0A 3IILA 3SD7A 1KP3A 1ZW1A 1PS0A 2CEKA 3DM9B 1QK5A 4FHDA 4MIKA 4ZI7B 4NVRA 1XMVA 2G40A 5LQUA 3S2UA 1GZUA 1YS4A 3SIXA 4BTLA 3LC2O 1W4LA 1OAKA 2A5FA 5F23A 5JAPA 1E9VA 1ZZEA 2ZSUA 3DJFA 4UAGA 4DYDA 4IW3B 3ECAA 2W6OA 2R7NA 3EFBA 5AI5A 5CAEA 4RXTA 1L5MA 2XMZA 2X13A 2QRHA 4GRIA 4YQYA 1N9GB 3RSLA 1YVEI 1EVKA 2VJYA 1W9MA 3WX0A 1P61B 1C30A 4WK4B 1N7JA 3FZQA 1LV8A 2GR9A 3PICA 4DMCA 4RD2A 3QPCA 1V5WA 4YA6A 2B8EA 3HA3A 1PVDA 4GRDA 4J6FA 2AWNA 1QHHA 1SWVA 2BFEA 1ZUHA 2W00A 4JLSA 1LBHA 3EQ7A 4LJ6A 4DCOA 4N82A 4M0CA 3V8VA 2XA9A 1D9ZA 2I6GA 1QZ3A 4PM4A 4Q39A 2CYBA 5CVEA 4BJHB 1CUCA 1KJQA 4HD8A 2FPUA 3JVIA 4N3AA 4PFQA 1ZY2A 4XDYA 1TK3A 5ALUA 2D0PB 1OT5A 2PZAA 3KUXA 3QPWA 4JI0B 2PL9A 3IT0A 4YUVA 3VR4D 3G1TA 4O02B 1IG0A 4RZIA 1CTQA 1ST2A 4LTNA 2KI5A 4AURA 4DMFA 1TK2A 2AJ8A 2ZTLA 3B51X 3KO8A 1BHJA 5B2FA 1KRWA 3F2VA 1DAGA 3R9XA 2QPAA 2YINC 3Q15C 3ROMA 2KBEA 2OZVA 2OAQ1 1IWOA 4PG8A 3MUFA 2Z08A 3C24A 5G4KA 4MIEA 1JKJA 1W29A 3I32A 3UYKA 1O5IA 6YASA 2G70A 4XB6B 1DJLA 2J4FA 4OIFA 3VNVA 2ZUWA 5T4FA 3QITA 1LPOA 2RH4A 4C0BA 3OZXA 2HTEA 1ZOIA 1HT2E 5FBZA 4MEBA 3DD5A 3E9ZA 5C37A 3HHEA 4IDCA 2QN9A 2BV3A 2HSEA 5LQMA 3G8CA 4LX0A 3I5UA 5HF6A 4JOBA 2XCQA 4IMRA 4CT4B 1E0JA 2FHPA 4ZDKA 2UXBB 4M0EA 2ATCA 1AKMA 1A5BB 1TLTA 2OHVA 1JVNA 3A2MA 3NAGA 3OTGA 5IYZB 1OB5A 1EDBA 2C3UA 4XDGA 4ZU1X 2XXAA 1U99A 3JARB 1DL5A 5ALPA 1U9CA 3KPYA 3EWAA 4OXNA 5JSZA 2EJBA 4B7UA 3QVSA 1UMCB 3HXTA 1L5WA 2C4TA 4PC1A 2Q0QA 2VRNA 4K6GA 3HI4A 3QX8A 4DWVA 5DYTA 3MD9A 4NZOA 5ALGA 5A4DA 4EG7A 1J8VA 2ASEA 2FOXA 2KLBA 1RDFA 4CODB 1A1VA 1Y4AE 2H06A 1X8KA 3HDYA 3CA8A 1WXXA 4WK2B 1RVDA 5KKCA 3L6CA 2WPDA 4EHDA 4O1IA 2JKVA 3SIWA 1U3VA 3NPAA 1Z5PA 2QVGA 3A58B 1UBKS 5DKFA 4EB0A 2BDEA 5I8PA 2ZBEA 2A78A 1SCDA 3VVBA 1HLDA 2MTBA 1WABA 2XDQB 2QN8A 3AFMA 4A2PA 3IBSA 3PUVA 2RK4A 4PFSA 5LVAA 1K98A 3I64A 4EY3A 3PCTA 3RF6A 5K6TA 2WZQA 1ECFA 4CDMA 4S1NA 4IEIA 4AN0A 2WIAA 1KMHB 2HPHA 3A7EA 1FDVA 3HCPA 4IJMA 4R2XA 1CVRA 2QVLA 3NTRA 2NZ2A 2YHIB 4PGAA 3H97A 1NVDA 1NAHA 2YC4C 4FFWA 5HXAA 3S8EA 2J1LA 3OZAA 4P6VF 2UVPB 4RWEA 1QPBA 4XR4A 3V2IA 2Z5GA 1NJFA 2QLJA 1E3WA 4EYQA 1BRMA 2VNIA 1QX4A 2I6SA 4KCGA 5EVCA 2G36A 5TJ9A 3WB2A 2LCQA 5FPKA 4OUDA 2VNAA 1E7MA 1ZLYA 3ZKWB 5ECYA 1AKYA 1NPTO 1RPZA 1IY0A 1K8XB 3I1IA 3IXMA 4MYTA 4NQRA 2CNNA 1GKLA 3EPKA 4D26A 2ZB3A 4ZQEA 2PUFA 1NP7A 2Z5LA 3W3ZB 1OGJA 1CRPA 4AUEA 5I7UA 4TLBA 4HG2A 3CIFA 3O7WA 1UBOS 1NRJB 16PKA 2D4HA 2X41A 5C34B 4BL5A 2P90A 4NCBA 2JAOA 1Q0SA 2E87A 4ZYVA 1TD9A 3NP7A 1T5HX 5C3MA 3HQ4O 1JLLB 1JSRA 5KX5F 1O5OA 1KI6B 1KC3A 3NH6A 3ZE1B 1ZOOA 3ROXA 4LISA 4D4JA 1FP1D 2QK4A 3KNZA 3TPZA 1X7DA 4YJKA 4CN8A 2YOFA 3LQ4A 4MMXB 4CKXA 4CKCB 4RX1A 4S2UA 5JFOA 4B6FA 4FEEA 2PFSA 3RABA 3QU5A 1N9KA 2WHPB 5EJEA 3OPXA 3W7BA 2C5SA 4UE3S 1TYCA 4B3XA 1P31A 4HXYA 4ZAYA 4EI7A 4KKXB 1PF7E 3PR1A 5KCMA 4OK3A 5ULLA 3OPYB 4RTLA 5KNDA 4O2LA 1G291 3K0CA 1R0WA 3C6KA 3SMQA 4BMNA 2IOFA 1DFHA 1QGOA 4KMRA 4B6PA 3SF8B 1W76A 3H17A 1HE1C 4GHWA 2R1VB 2A0YA 4IIUA 4OHWA 4Q3EA 4UUNA 1E6MA 4X90A 5CJJA 5CXSA 3RS4A 2IIPA 3WA7A 3KHTA 2OVBA 2XCOA 3BCSA 3AR3A 3KIPA 5DNWA 1YB5A 3ON5A 3JR3A 2IUEA 3DOEA 3AEQB 4CMBA 4L07A 4HWPA 1YWGO 3NYQA 1W9HA 3PEFA 2GF9A 1K9VF 2O7VA 1IVYA 3QOXA 1IJEA 4LOJA 3GCXA 3G0HA 5TF0A 3KYBA 4HLCA 2ZRAA 5SYMA 5JZ9A 1C9DB 3R3SA 3T4PA 4CFYA 2I3ZA 2I78A 4HWGA 2KBFA 1TU0A 3DE3X 4DLUA 2ZJZA 4FLEA 3PLNA 2WIBA 3IVGA 4IIEA 5K3FB 5B36A 1YNOA 1QB8A 3DDCA 1VCOA 3LO5A 4CMIA 1DJMA 3V8MA 2RGGA 1OAOA 1UPUA 1A7AA 3VR6D 4E08A 2DQZA 3FF1A 4ZHSA 2JA1A 2JVKA 4XZ3A 4Z3OA 1MEJA 4BX8A 2HZBA 1VLZA 5KOYA 1IY9A 3ZNOA 3D43A 4BMPB 1CS4C 1SOAA 3QFTA 4KQMA 4M21A 2NXEA 1YJCA 5K4HA 3INYA 3JWGA 3L8FA 1T5IA 1XNRB 1EXWA 3H83A 2GWHA 3LW8A 2A88A 5JLAA 1O89A 3ETJA 3RJ9A 1ZD5A 1D07A 2PH1A 4KTTE 3V4SA 4B4KA 3HLYA 2YFKA 4V1CB 1OTYA 1LSOA 4RCVA 4BMCA 6ABPA 3KOUA 5AVOA 5IH7A 4NU6A 1V1RB 2YXDA 4M46A 1Z2DA 1Z45A 4XFJA 3QI2A 4A0SA 2VAPA 1XJ5A 1GZ5A 1J0AA 1PBTA 2FZVA 1UK9A 3A31A 4G67A 3WDMA 2W2NA 3LXRA 3M1IA 3OUTA 3VGPA 2AFHA 1Y1QA 4PSAA 4D41A 4ITUA 1I3OA 1OBOA 2C5EA 3QX7A 2P6UA 4KJXA 1QR2A 2ROQA 3QXXA 1VSVA 3P26A 2Q3LA 2O4CA 1V8BA 3RWBA 1I5EA 4G0OA 2JIZA 4M9UA 4PN3A 2IF0A 2JLSA 4NNPA 3I5YA 4G1FA 2BFCB 4FIDA 4UU0A 1R0BA 1W0KA 2FUNB 1HDYA 2JGIA 2FWBA 2Y92A 4PIVA 4RXUA 3BMNB 5I5EA 1F20A 4XPZA 2QXTA 1ENZA 1M2KA 1YBFA 3KLNA 3GDHA 3OTIA 3TMKA 1Q0RA 1UWKA 2ES4A 3LK7A 1GU7A 3K8ZA 4U9IS 1EFPB 5EXTA 2JDIA 3M6WA 3GRCA 2RI1A 1H2HA 2A9KA 4RK1A 4P4NA 2CD7A 3Q11A 3J81A 3SKYA 5ILGA 3WO1A 3HA2A 1IHUA 4GMHA 1TF2A 2VJQA 3GGDA 4GDMA 3DXYA 4F06A 1O2DA 3RG8A 3FKQA 3GDFA 3ETEA 1VLQA 1E6EA 2C5BA 3BFXA 3DAFA 2Q4RA 4F1KA 1RWQA 3NWOA 1PWXA 4FQ8A 1GZVA 2IGBA 2Y05A 2HV9A 4M1KA 5ISMA 4RLQA 1TX4B 1HEYA 1TKCA 4I50B 1A96A 1GPUA 4A82A 3ZH9B 1ADJA 3EGIA 1YASA 4TT3A 4K26A 1PLJA 2WIFA 4HJRA 5A3SA 1PJTA 1SQ6A 5IJXA 2AQKA 1C0PA 4B44A 2F4NA 3N2KA 4TMZA 2TSYB 2VJCA 1HDOA 3EVBA 2IWRA 1KYZA 1X92A 2DHCA 3ESXA 2JCSA 4YMSA 1P17A 3TB6A 2JCBA 4BQRA 5I4CA 2WYUA 4HXFB 3GUYA 2HF8A 3T4EA 5B64A 3AB8A 2P9YA 3I52A 2L0XA 4JXJA 2JJ2A 2QT9A 2VK2A 2VLBA 3K32A 3NXSA 4MI6A 3TW6A 5HILA 4CQLB 3H5IA 4CMEC 3CUEF 2ZYHA 1P4GA 5D2CA 1UANA 1KDTA 2PQMA 5D6NA 3S7ZA 5J4LA 4ESEA 4U00A 4OH1A 4ZMBA 1I7LA 1D0SA 3AY6A 3GFTA 5HF5A 4F5WA 4F12A 3HN7A 1S3FA 2Q2QA 3U39A 4DIUA 2DR2A 4E09A 1QDLB 2EGHA 2FX2A 5K9ZA 1KO7A 2X77A 1U8EA 1ORWA 1E0SA 2ENWA 3HZHA 4BKOA 1GD1O 1JWBB 2FXIA 5ELMA 5ERXA 3SFZA 4PZYA 3BMQB 4GG1A 3SZGA 3IDFA 4ZAZA 2PKXA 5TGTA 3O5AA 3PNBA 2H4FA 2QPTA 2IY9A 3AI7A 3GZNA 1RRKA 5FEMA 3SZ3A 4K6KA 1P5ZB 4JLOA 3RRFA 4F6RB 4MROA 2DKNA 2GZ2A 2J3MA 1ULSA 3OP4A 3KJIA 5GINE 4BV3A 4MPTA 3A4MA 3OLCX 3TLCA 4B81A 1USVA 4J3JA 1KZ6A 4UBLA 3PCXA 1B00A 5C35A 3U61B 3ELBA 1HDXA 1QOQB 2ETVA 3OIUA 3P7MA 1MJFA 1X2EA 1P6UA 2D62A 3LHSA 4FQ7A 4MR8B 4FLMA 3U7FB 1Z39A 1QZTA 5LZ8A 3EAGA 4KUGA 1V71A 1F8GA 1H4TA 2IP2A 3GEMA 3T7AA 4DCCA 2X7XA 3H2KA 3VPDA 2X42A 3R4VA 5KU7A 1U3GA 1GPYA 1E2NA 1P5JA 1L9KA 1MC8A 2IZ6A 3O7MA 2CJYA 1X1SA 3GWZA 4H1TA 1OIVA 2CCGA 4K46A 2XT9A 1ZGHA 3GLGE 2F67A 3ANXA 1E4EB 3LM8A 3EIHA 1RM3A 1FMTA 1O97D 2HPZA 3CQ9A 1N9ZA 4LXXA 2WB2A 1UMDA 3CNBA 3DT9A 4CIYA 1Y3DE 2RB5A 1K7EB 4RL4A 2B7BA 1SA0B 4CTKA 4TS4A 2OHIA 1TF5A 1Y4ZA 2B1GA 4BLOA 5CDTA 1KP2A 2VJKA 1RZVA 1GNPA 4RQTA 1P4AA 1EUYA 1LI5A 2WAYA 3GZJA 2BRUC 1D1PA 3PITA 3QXHA 1H5QA 1YZQA 4Q1CA 4TXJA 1N2XA 1FCJA 3AI1A 1KBQA 3HKCA 1RM4A 4HAWA 5HRAA 4HATA 2JF0A 1M1YE 3BFKA 4L08A 3E7PA 5H8WA 1ZM2A 3ASYA 1CE8A 1M7HA 3MJCA 4CUZA 4IUDS 3TGLA 1H5UA 5JMWA 1CBUA 2ZT5A 3G8BA 3LXUX 3KZNA 4F5ZA 3QSYA 4K6HA 4MEAA 1V1JA 3ZS8A 1ULHA 1EFTA 2C29D 1QGAA 4URVR 3VAAA 4URFA 1CHNA 2G4CA 2UUAB 1K6EA 1RHRA 4IVRA 1NVAA 4MW2A 1N6OA 2LR0A 3QPAA 3TDKA 3LDHA 3K6KA 2BKUA 4PZEA 1M2OB 1UODA 4F85A 1C7FA 2C42A 1XQYA 2R6FA 2P6NA 3AXTA 3KL2A 4L3VA 4LXUA 2IYLD 3DMPA 5TXGA 4DRXA 2EIXA 4CM8A 5CVUA 4WXHA 3O2QB 2VH5R 1WEKA 2FRDC 3U5TA 4GE0A 2TMYA 2W2KA 2IPNA 2QTVA 1UBHS 3NHFA 5DGCA 1AS2A 5KYYB 5TVKA 3ES9A 3SLGA 2YJ6A 1W1UA 3EVDA 2P91A 2DWOA 1JG2A 1AGRA 1FXUA 2D7CA 3L7JA 3TBKA 3WKBA 2ZKIA 2ZSJA 2IFTA 1FX0B 1CDZA 4L5BA 1ICEA 1CFZA 5FJJA 4L74A 2GM9A 3E05A 5IC5A 2JGLA 2R8BA 2RAPA 1EVYA 1ESMA 4AY2A 3HA5A 4AMYA 4A6PA 1CC1S 3MTAA 5BMVA 3GOHA 1CDDA 3TTUA 2UV8A 2R6JA 4H18A 4EEZA 1V8OA 5HMMA 2FQWA 4ND5A 4Q01A 4FI3C 4X0EA 3GFOA 4ZREA 4YUXA 5JD4A 2OB2A 3IV7A 3I92A 4TV9B 2RHMA 1BN7A 1XZCA 3VV2A 4YMTA 3CW9A 4UHJA 1KI1A 1SJ9A 1U2TA 1I2ZA 1YK0A 4GPIB 4JBHA 5GWXA 2DUNA 1EWYA 2XV1A 4P3NA 4R05A 2I6FA 4IL5A 3AHHA 2ZDQA 4D0LB 1TUGA 1QG2A 3ZZUA 2ADFA 2JJ8A 1N75A 2Q9BA 3N7UA 2X58A 4QXPA 4JI3B 4AYXA 1L1RA 2VYQA 3B1XA 2IXDA 4QHTA 1GO2A 2CLKB 3LU1A 4X6UA 3T1HB 3ONEA 4IMPA 4KPFC 1E3SA 5FA8A 4HBZA 1HDGO 4K6CA 3UO8B 2ZSBA 4KE8A 1T6BY 4HBGA 1QYVA 4MP8A 5JNWA 4R7TA 2Z6AA 4B73A 3RSQA 3A7DA 5DPMA 3I3OA 1KJJA 3DOHA 1ZD4A 4P3YA 4PYLA 4WA7A 4J49A 3RAEC 4MDEA 1I0LA 2BFDB 3ANYB 1NF2A 1QYRA 3ZHOA 2WG0A 4GXRA 3IS3A 1NL3A 4DL9A 2CHQA 3ESRA 3KHUA 3B1JA 2ZJ7A 3G82C 1Y3AA 4TKVA 4PPFA 4MUIA 5AXDA 3FDIA 4DXHA 3VM6A 3SSNA 1U2ZA 1WDWB 1YIAA 2LCIA 3DSRA 3NM4A 1DPFA 1ORHA 4KXYA 3OT4A 3BXHA 4XE5A 3V9AA 3ZV6A 1HUQA 2EBUA 2RGUA 3W5UA 3C3XA 3BT7A 1OLUA 4ENPA 2ZXEA 1N4AA 1CF4A 1XMXA 1MABA 4IOLA 1HSOA 2QMEA 2QR5A 2FEMA 3K09C 4RAOA 1QK4A 4ZI5A 2HA6A 5B6PA 3VOBA 1A97A 5LD2B 3KJQA 5JISA 1E8DA 1V35A 3RPEA 2BMFA 4DJEC 1YFJA 3C3AA 3AUTA 4O4JA 5DGIA 4MQFB 4UUAA 3R75A 3SM3A 2VP6A 1VI5A 4YALA 2J3DA 3AIOA 4X7BA 1CS0B 1E9FA 1GLGA 4IR7A 4BNYA 5ESDA 4ZI3A 2XCIA 4F5DA 2H4HA 5DHPA 1QH9A 2CCKA 5GOTA 4KMOA 4B7XA 2WD9A 4DKJA 4N01A 5A3QA 3TLBA 1XZJA 3BC1A 4LRSB 2VHTA 5I9SA 1EFVA 1W85B 3H18A 1M2HA 2IU6A 2WMNB 3G59A 2EEPA 1KDVA 4AYWA 3UMGA 5CLGA 4W5JA 4BNDA 3DQZA 1PLKA 4WKPA 4QVKA 4CMHA 1TZBA 5JJLA 4NONA 3WIVA 3GRZA 4J0IA 3ITEA 1ZRMA 5BSTA 3U26A 3EZ6A 2HB6A 2BD0A 4I1UA 4EENA 4Y7CA 4PINA 5AUQA 3IIKA 3N76A 1YAJA 2NAFA 1R00A 2QN2A 3PEEA 3TBFA 1BWRA 1US8B 2GXSA 3B8EA 4JT8A 4X20A 1E7YA 3V7WA 3A6HA 1QMGA 1T1IA 2QZPA 5KNLA 1Y8CA 1OFVA 4DVJA 4UTPA 3E7XA 2BFAA 2OMKA 1D8TA 2OK8A 4F56A 1RXSA 3ENQA 3OZEA 1N33B 2WMOB 1SNYA 2IW3A 2GO7A 1CQIA 2JIRA 2QY9A 3JVEA 2H52A 4D3SA 3SC2A 5ILOA 2QXUA 4B3MB 1JV2B 5KVAA 4N9QA 2HO4A 3NTQA 2AJTA 2WWXA 1KQNA 3NJ4A 3LS2A 1WPRA 3H8JA 4WNAB 2Q3MA 4DGQA 2Y93A 4G9EA 3AVWA 4AS1A 2VT3A 4LNUB 2B1JA 1D1TA 3QXSA 1G21B 5CRIA 3ZCQA 2R84A 2ZTHA 5KQPA 4OTZA 4YAOA 2YJ4A 4YCAA 3L84A 2NU6B 4P3OA 1S9DA 1SUPA 2PT6A 4MAFA 1COWD 4P7KA 4YV1A 2C4NA 5KTRA 5DISB 3JWHA 2NU9B 3K53A 1FUIA 2M6KA 4BIMA 1X7XB 1HV8A 4WGFA 4ALKA 1I36A 4CMCA 1GWNA 2Q5LA 4QNMA 2C4WA 3D0OA 3RARA 1ABBA 2D8AA 1C3OB 3C8HA 2A9FA 5L3RA 1WA5A 4BNFA 1PBNA 3OQNA 3O4JA 5CVTA 2F90A 3UOAB 3I42A 3HJNA 2OFFA 5DHRA 3VUEA 3T7CA 4XM0A 4IGKA 3AIMA 4RW0A 1V48A 1CY2A 3QYPA 4HYTA 4QATA 2CNLA 3ZCRA 4BCDA 4DCUA 4YUYA 1CZKA 1E1CB 2JJ1D 5LM3A 2IU0A 2WHYA 4MTLA 3PG5A 2C9DA 5FQOA 4AZ0A 1XTJA 2P7HA 4DADA 4O29A 3A06A 2FQXA 4U7GA 3QEMB 1HMYA 2YWGA 1N2JA 7REQB 1BDJA 3KZXA 4DARA 1Z5UA 2QU7A 1AUXA 1OBCA 2F43A 3Q7SA 4PSUA 3H9CA 4HX2A 4LA4A 4KLCA 5G1NA 4D4MA 2JLBA 4Q3KA 3B82A 5JSYA 3BXPA 3G8AA 4L95C 1T9AA 4UKDA 4TSFD 1Q1NA 3NALA 4V3CA 4B3FX 5BWMA 4CEIA 5I7FA 1A9QA 3W90A 2B2CA 4H08A 2LDXA 4BGDA 1EWQA 1MU0A 4E7OA 5JQWA 5DVZA 2PUBA 4FPXA 4HB0A 4LMAA 4O2BA 4HZUB 5LJIA 1DELA 4BDTA 4Q9DA 4FZ3A 3H5WA 2WF9A 1ULAA 1YIDA 2B82A 4M7PA 4MLZA 1THGA 3PXCX 4RDCA 1PQPA 1VG0B 3EGVA 5CA0F 2QI9F 2VL7A 4NLLA 1RRPA 3LL4A 1FYFA 3BWXA 3L04A 2MMGA 2II6A 2QN7A 1XKLA 2FB9A 2P11A 3LP6A 3M5PA 3THRA 2QJRA 3F90A 4OKNA 2LBPA 421PA 1H3FA 1E9AA 5HKOA 3PJRA 3RVSA 1S4MA 2HXGA 1Z0DA 3AKEA 4O4IA 3UK7A 1R5OA 1Z3CA 3EDMA 2ZBUA 4UFOA 4AROA 3CJRA 2QROA 1MGOA 1YVRA 3KOYA 2QW0X 4S05A 2R6DA 4PWYA 3ZCSA 2XUKA 1MG5A 4URWR 3ZHYA 5FX2A 3VPBA 2OCIA 4D4LA 3GRAA 3NEPX 1SVKA 3DOUA 1VXRA 4M76B 3FPEA 4WFQA 3WRXA 3RC2A 9GPBA 1VA5A 3UJDA 1DIHA 1YTUA 5L3QB 3LBHA 3RVKA 3EEQA 2FOIA 4AMGA 2O2XA 4C04A 1WHTA 1E79A 4E30A 3T9AA 4XGNA 3T5DA 2YR0A 3COPA 1YGPA 1GIAA 1N7HA 3OKFA 3Q1KA 2ZB2A 4ZVLA 3I6BA 4ISBA 3CN9A 3FSJX 4WOCA 5LFAA 1QG4A 1ZJYA 3G2OA 1YA6A 1PFYA 3NOQA 5FRDA 1V3TA 5M34A 3TM5A 5LZ2A 3NASA 1JEQA 5DV9A 2QB5A 2R7LA 3C7AA 4IXTA 2PHZA 3R7WA 3RQSA 2WWFA 1NBIA 2HRBA 1QNLA 4FDLA 4TTSA 2FW7A 2XQFA 4NSNA 3CONA 1ZK4A 4F84A 3KKKA 1WG8A 3TDNA 5FULA 4LBVA 1OWPA 2Y76A 2HH9A 2W6ZA 2ZBRA 3V5NA 1BS1A 3NPMA 5FHRA 4EVRA 1JU4A 5G3YA 4JBWA 2QUHA 3OQOA 2HM7A 1ULZA 3ISJA 1DOZA 4L5AA 4XW2A 4MZDA 3PUIA 3T1OA 1Q7BA 3FVVA 4ENTA 3H1BA 4DDMA 2ODTX 3OD1A 1VHLA 4ARSA 5EZYF 4DV3B 2FFBA 4JZYA 4NBRA 3DB1A 4DG8A 3F1KA 1NW9B 1Y7IA 3G13A 3W5IA 3CRW1 4QSMA 4RHEA 4PW0A 1T0PA 2QLBA 2BP7B 2AOTB 3L1HA 4BNVA 1MHPA 4RMGA 1UT5A 3UYLA 5A02A 3TJRA 2YV5A 1K7CA 4NAVA 4EGJA 2H1HA 3T54A 2AE2A 2BMAA 2HGSA 4BNNA 2P79A 2OHXA 4ZTBA 5KNBD 5AHRA 4OLAA 3AU8A 4J90A 3N0TA 1WZUA 4ZZ3A 4DQVA 3PHGA 4DSOA 1E63A 1NTOA 1M0WA 1Z4JA 1ZMRA 3LX5A 3W06A 3TFOA 1L7XA 3JAKB 1PEDA 3VDXA 2C8JA 3E5MA 2EF1A 5IK2A 4EJSC 1TQ8A 4Q1AA 3AETA 2R8XA 1PJAA 2CLFB 1IQRA 4G1VA 1J42A 5EFOA 1AMUA 2ZIGA 4NABA 4B6EA 1KKUA 3GAAA 3GLQA 2PLAA 3Q5GA 4UNRA 3G85A 5FBVB 1PL7A 4B1FA 2OR3A 1P0FA 1RI3A 1SUAA 4FKZA 4Z7QB 1T4CA 3PKJA 1Z4PX 5AXCA 2WT8A 4C06A 4ARCA 1A9YA 4LRUA 1ISPA 1I4EB 4L8YA 1GGVA 2PMEA 4GRAA 3TB4A 3TEMA 3ZUPA 4HDAA 2XWJI 1VL8A 1B3BA 5FOQA 3RVOA 3FTDA 4AUKA 5EUBA 1MO6A 2QORA 2EP7A 4PX3A 2BTQA 4CT5A 2IF2A 1A1SA 4ZAWA 4Z2AA 1RWKA 3N05A 1KI7A 2EVWX 4W1QA 3H1EA 1LW6E 4UTVA 1SHLA 2OFWA 1AO3A 2JPDA 4QVGA 4EPXA 1XP5A 2G82A 2REOA 1W19A 4OFBA 2OA0A 3CURA 4BRWA 3WGQA 3ADCA 1SBCA 4G97A 2VPZA 3OVMA 1JSXA 1SCIA 2ZTSA 1E66A 1QXSA 1MTZA 3DV0A 2VP5A 5G1PA 1CUSA 4F96A 4ZI7F 1VFPA 5IBQA 4MQUA 5BR8B 4QFDA 2I1WA 3OIDA 3EPPA 3FYUC 4W63A 4HGPA 1T25A 1RM5A 4Z4CA 3T3HA 5EMKA 3GMIA