3ACDA

Crystal structure of hypoxanthine-guanine phosphoribosyltransferase with imp from thermus thermophilus hb8
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
176
structure length
164
Chain Sequence
b'MFTPGNGPVQISAEAIKKRVEELGGEIARDYQGKTPHLICVLNGAFIFMADLVRAIPLPLTMDFIAISELLKDLRLPIHGRDVIVVEDIVDTGLTLSYLLDYLEARKPASVRVAALLSKPSRRQVEVPIHYLGFEIEDAYVYGYGLDRAQFDRNLPFITSIRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Structures of hypoxanthine-guanine phosphoribosyltransferase (TTHA0220) from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 49
structure length 164
sequence length 176
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2009-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3acdA00
4JITA 1A4XA 1OPRA 5IPFA 4RAOA 1XTTA 1DKUA 3MJDA 2C4KA 1P19A 1ZN7A 2H06A 3GEPA 4MB6A 1PZMA 1WD5A 4M0PA 1YFZA 5BSKA 2E55A 3DMPA 4LZOA 1QB7A 4S2UA 1L1QA 4ZFNA 1BZYA 5HKLA 1QK5A 3GGJA 2JBHA 4JLSA 1QB8A 4OHCA 5HIAA 4RHXA 3DAHA 1DQPA 5E38A 3NAGA 4RHTA 1O5OA 4FYMA 4RAQA 4LZNA 1XZ8A 3H83A 2IGBA 1HGXA 4QYIB 1Y0BA 4P80A 2WNSA 5IAOA 4M0UA 4P3KA 1R3UA 1UPUA 3EFHA 3MBIA 4RHYA 4WMLA 3LRTA 4QYIA 4PAWA 1GRVA 4P82A 4LYYA 1DKRA 5BRNA 1DBRA 1G2QA 4RQBA 1D6NA 4P83A 3DEZA 2DY0A 1HMPA 1ECCA 5KAMA 1XTUA 2XBUA 4LYGA 1JLSA 1W30A 4RADA 2JKZA 4TWBA 2PRZA 1G9SA 1STOA 1ECJA 4RV4A 2JI4A 1OREA 1QK3A 1Z7GA 1G9TA 4LZAA 5K51A 1ZN8A 4PFQA 4M0KA 2YZKA 1JLRA 2EHJA 4Z1OA 1CJBA 1ECFA 5ESXA 1AO0A 2HCRA 1O57A 1J7JA 1MZVA 3KB8A 4P84A 3QW4B 1VDMA 4RQAA 1QK4A 1A98A 1I0IA 1OROA 5JSQA 1DQNA 3M3HA 4RACA 1QCCA 1I14A 3HVUA 3LPNA 1A97A 1ECGA 1FSGA 2P1ZA 4X44A 5BQOA 1BD3A 4X45A 4KN6A 1TC2A 1GPH1 1IBSA 4IJQA 1U9YA 2PS1A 1TC1A 3O7MA 2AEEA 1NONA 1P18A 1P17A 3ACBA 5JV5A 3G6WA 1BD4A 3OZFA 4P81A 4RABA 1V9SA 5ESWA 4RHUA 1VSTA 2JKYA 3ACDA 2H08A 2PRYA 3OZGA 4P86A 1XZNA 1L1RA 1XTVA 1UFRA 1NULA 3S5JA 1I13A 3OHPA 1UPFA 1QCDA 2FXVA 4WN3A 1ZN9A 4F8EA 1I5EA 5BQPA 3N2LA 2VFAA 5EUCA 3GGCA 1VCHA 5KAPA 1P4AA 1LH0A 3ACCA 1U9ZA 2GEBA 1A3CA 2H07A 1A96A 1ECBA 4QRIA 4RANA 1G2PA 1A95A 1I0LA
chains in the Genus database with same CATH superfamily
1I10A 2IKQA 4WLFA 3U6KA 3SD7A 3NI2A 5LIPA 1BQ3A 1UBRS 2IHJA 1T2CA 2HRZA 5IKMA 4FGSA 2R6R1 3DA8A 4K9KA 2G9RA 5CBKA 5HOQA 1L7OA 2C54A 2JI7A 1AKUA 4I6JA 5ICSA 5LP1A 4WASA 1NBAA 1U0NA 3KHSA 4ITVA 3QUBA 4CEIA 3K0FB 4YDRA 2HRRA 3DLPX 1I4OA 3I01M 4P4GA 1BKDR 1NBHA 1QG6A 3DEYX 1PN3A 3BS4A 4XQCA 2ROQA 3FFBA 1GDHA 2R5WA 1M54A 2R8PA 3NYIA 4RTRA 4C87A 1GQFA 3THWB 3LUPA 3JQ7A 1L5NA 1RWMA 1IHDA 2GBCA 2JAHA 3TR5A 2CD7A 3PUIA 1PFQA 4R9RA 4X20B 2KWIA 3Q7SA 3WGOA 1MX9A 4KUGA 1NJFA 3O3OB 4NMMA 4B32A 3T4UA 5AK4A 1MQAA 3AESA 1GFIA 4ZQBA 2VPWA 1MC1A 1IL0A 3N6RA 4C1BA 1DOZA 1X1QA 1AX9A 3HKCA 3ITKA 1PW7A 2VAMA 5E2IA 3ZPXA 2XQVA 3R0ZA 4S1OA 5C4IA 1N7HA 3F9RA 3G2QA 4TRRA 5BMOA 3LGAA 1EFHA 3MINA 4JH0A 2V7TA 5DWVA 4W5QA 1I3CA 4KK4A 1G9SA 4AVYA 1EP2B 3MWDB 3LVFO 5IJAA 5ICEA 1FIUA 1L7XA 5E9AA 1GUBA 2V8BA 2JFXA 2EBHX 3GHHA 4YONB 2QDKA 2RI6A 2ZJ0A 2HH9A 5AO9A 3SDSA 3GDOA 1QGDA 1T3SA 4OK3A 4WKNA 1E7WA 2HIMA 3GVIA 2O4UX 4W7IA 4F56A 5IWCA 2PUAA 3WK9A 1A04A 3ENVA 1XMVA 1G63A 2BKEA 4NJEB 1FNDA 3RYHB 3OH8A 4QUGA 5IVIA 10MHA 1P60A 1P4RA 2CLMB 3NHMA 3SIRA 4A23A 4RJJA 5BQFA 3R3HA 1WY7A 3U7JA 3O4JA 2G28A 5EJ9A 5L40A 2B37A 1TK2A 2GR9A 4JVSB 1GT6A 1N25A 1JQLB 1CCWA 1XCMA 2X0KA 4Q9HA 5JPDA 2J9XB 1I3NA 1W75A 2J9GA 3T7TA 4K9PA 3UPTA 5EE9A 2L2QA 2O6LA 1PSZA 3R09A 3NWOA 1EP3B 1RNLA 2G9VA 3H7IA 1G8YA 2Z56A 4L27A 4JL5A 2GKOA 2HMAA 2YHIB 3CUWA 1AQIA 4JI4B 2H18A 2H7VA 4PZZA 1T0PA 3FZEA 2Y1OA 1WZCA 3AF6A 5JC1A 2C8LA 2YFHA 4BVHA 1FE8A 3AT1A 3S5JA 3R3YA 2QM0A 2N42A 3JQ9A 4EJMA 1PK9A 2Q3BA 3UCFA 4QOHA 4INOA 3OCYA 2UUOA 2ZPTX 4KPUA 1B0UA 3JQBA 1TZMA 5JYCA 4PCVA 3O5AA 2QX6A 3FKSD 4HGOA 2JLVA 4AI6A 1R6TA 3HM2A 4EX7A 1KH3A 5FFNA 2VYCA 2WAYA 5DEOA 1BGVA 2GUWA 4I0WB 2ZWVA 5JANA 3R0QA 3TFOA 2D4HA 1Z5NA 4OQDA 2NN3C 3NHWA 1J8FA 1JDBC 2VQSA 2PT5A 5AKJA 4TS4A 4EG5A 3WXBA 1CJTC 1ZN7A 2V55B 2Y1LA 3V4RA 1LBSA 3NWBA 4BO9A 5KWEA 5B6IA 1HNNA 4OFXA 3AOEA 1JKXA 2V5AA 5JG7A 3IQFA 3CO0S 2ZIFA 1KP3A 2GKGA 3HUEA 4S2UA 5DNAA 1T9GS 4QGBA 4DIDA 2EW2A 1SCBA 1L4YA 1Z15A 1M76A 4XAQA 3W7AA 4D99A 1J97A 3AVQA 3B89A 4X61A 3VTZA 4CTNA 5EERA 2BKXA 4CI0B 1M33A 3HCEA 3LLCA 4OI1A 4L0MA 5SYAA 5EMLA 1NG1A 2G08A 3GRKA 4X7PA 1KMCA 3KL4A 4B6RA 3T41A 3KU4A 1CF4A 4TL6A 3K6SB 3IUBA 1NMQA 3MMZA 4RS3A 2WNSA 3DWGA 3K1ZA 3W04A 4EQ6B 4HUJA 4P3NA 5JAUA 5TT1A 3D6NB 4F71A 5CH3A 3B2NA 4JLMA 4Q4CA 1IDN1 2B5VA 5J5CA 3UGQA 3QJ5A 3LQFA 4WEOA 1T15A 2YS6A 2P3OA 3DT9A 4RL6A 3NXKA 4QTZA 2H1LA 1Q15A 2IZOA 3RT1A 4YI5A 4X92A 3KLPX 1NUSA 4X65B 4RY2A 1SA0A 4MR8A 3TKAA 4CM3A 1CJCA 1L4MA 3BA6A 3EUEA 3VZPA 2XZLA 3GUHA 3UPUA 1UFKA 2K6GA 1EQUA 2NYUA 2O6HA 2Q8QA 4HHEA 4TLDA 4CCAA 5BN3B 4QJ5A 3SFTA 5MN4A 3OCZA 1VL8A 5G0SA 2A94A 3PYMA 4W9RA 1PNQA 4CQMA 4YRQA 1Y81A 4XWGA 1XQ9A 2CBXA 2XTMA 2ANCA 4A03A 2CXPA 1N2EA 1NYLA 2Q50A 2QX9A 1IAVA 3M6WA 3PQ3A 4ND1A 1B6RA 1OTHA 2ZJ1A 4YAEA 4XYLA 2PUDA 2OCGA 3GLTA 3T54A 2MYUA 4KQCA 2VDNB 3FGNA 4L2IA 5DRYA 1T2EA 4Q3NA 4MEAA 3FNEA 3G59A 2LR0A 4QPZA 2R6AA 1QUFA 2PMBA 3WA7A 2JAWA 3W9UA 3EZGA 3PGVA 2GHTA 1RVV1 3OWXA 3FNFA 3DL7A 4GMDA 4PFKA 5TQ0B 2EP7A 3BE5A 3TLKA 2FUCA 3IMEA 3HG7A 1Q1AA 1R6VA 2X1MA 1Z26A 5K6RA 1GAQA 2C7PA 1HFJA 2JIBA 1TZBA 1GLNA 1XXLA 2EDAA 2NYAA 2SECE 2V7GA 5FBQB 1SEPA 3MQFA 3BZBA 2QXYA 5TPWA 1YACA 3RRMA 3TR0A 1EKXA 3KQSA 1P9LA 2HDOA 4DDKA 1MB4A 3GEMA 3MT9A 1XVTA 4RHEA 3W2IA 3PB3A 1QE3A 3HDGA 1LBQA 3H2KA 1L7PA 1D4ZA 1TYDE 1KMHB 3ECSA 3LT2A 5AIBA 3RVMA 4G0WA 5DTRA 4ZKDA 1YVUA 4FXPA 3WLHA 2PXXA 3OPXA 2ZRQA 3L7CA 3CT6A 2B8WA 1QCDA 1DAHA 1DNPA 1E5DA 1R9MA 1UBGA 1V2GA 1Z17A 2IF0A 2JPDA 2NXJA 3IAS1 2MSKA 1DDGA 3MMXA 1MG5A 3D02A 4KWEA 5TIIA 1GG2A 5JAHA 1FF9A 3GWZA 7REQB 5KAPA 4OAOA 2AE1A 2REQA 1AE1A 4O2RA 4OL9A 2Q3HA 1UKBA 2FPIB 2G72A 3K5HA 4ZQFA 1I51A 5T4HA 4ZAWA 3LECA 1ZYUA 3NHUA 4ZOLB 1B14A 3F1KA 3I5XA 3NG1A 4PIPA 1JEYA 1SBQA 5ICFA 4D4IA 3LGSA 1Q7GA 1CZKA 1FFGA 3EMKA 5K0CA 1UZLA 3CF2A 4KLNA 1KPIA 5BSKA 1N92A 2VJCA 3EC7A 2NUTA 1Z88A 5FBWB 3W9YA 1QWOA 1LFAA 3DS8A 3VO8A 3T1VA 4S0XA 1UR5A 2CZCA 4UEJA 5D5HA 5F21A 2NU9A 2DBZA 1YDGA 4TV8A 2ZAMA 1IXZA 2F8MA 2FP3A 3WYDA 5JT1A 2GYYA 1Y5LA 2JH3A 4MQFB 2EKQA 1MHTA 1G5IA 3DHEA 3ID6C 4NCXA 2Z1MA 4NENB 5A9RA 5BN5A 1PTJC 4D8YA 3ADPA 1X1EA 1Y6JA 5HIMA 3JWIA 4KIGA 5SV2A 3N8NA 1M2WA 3KKKA 2YWDA 4J8PA 2NTEA 2WK1A 1AKWA 4U1RA 3D59A 4Z86A 4OJMX 2O8EA 4MPRA 1BIFA 2NG1A 5ILOA 1E9AA 1KEEA 3BULA 2Q5IA 3QPBA 2ZCJA 3H5RA 4O4IB 5F3RA 1GRVA 3ZWXA 2IYUA 3K8OE 5K4GA 1Z12A 5LPNA 4GLJA 2C2GA 1E3IA 2PD3A 1Y1KE 5JCXA 4F3TA 5CU7A 5KYWB 1UK7A 2A78A 4IZOA 3R9XB 3NDBB 5AJVB 1C7IA 3ZD9A 3LOUA 1R6XA 3MERA 3DG9A 4FWIB 1LPPA 1XPJA 2ERXA 1O96A 5DCYA 4DAEA 1S3FA 2J9FB 2BFNA 4R6WA 4RHCA 2XYGA 4JZYA 1U8XX 2EZ9A 3I0NA 3FZGA 1ZO8A 5C8ZA 3H9EO 4PLFA 4Q1DA 1FZTA 3ORSA 4M87A 5FYQA 4B34A 1TVMA 5EGSA 4OREX 2NSHA 2QL6A 3JYLA 1DINA 1QIGA 2V58A 1Z25A 3RNLA 4MHOA 1NWHA 2IS6A 5KTOA 2CJXA 4G5OA 4ZO7A 2PQMA 2ODNA 3T3DA 3EOAI 1VOTA 5JUWA 5L53A 2AI1A 4JLVA 5F4BA 4J7CA 4MZDA 3DHYA 1AUXA 1NJ6A 2CYCA 4XUCA 5J3JA 1UJ5A 3A1DA 5IHPA 3GQVA 2W48A 3BPSA 3LDFA 5KHLB 4TSFA 5EVCA 4OGWA 3O0TA 3VZRA 4BP3A 3KSDO 3BWYA 3R5SA 1XL1A 3TTTA 4CYMA 5JH7A 4UNNA 5CA1B 3OKAA 1G60A 5CAEA 1SVKA 4TTRA 5CFLA 5KTSA 1W0KA 1XDSA 1P17A 2ORVA 1OT3A 2JI8A 1N8TA 1K4YA 1R4NA 3W3AD 4QU0A 3RS0A 3CLUC 1ULAA 4LSWA 4GU5A 4GICA 2AFIA 3TW0A 2BHRA 2HWUA 4K9QA 1P4HA 4PANA 4IWNA 1GM5A 1U0JA 3TPZA 1TM1E 5KZMB 2RGNA 4FYXA 1BCSA 2ATEA 3B2QA 4E2WA 4YUZA 1YJCA 1JQKA 4G0UA 4BO4A 5K0SA 2PT9A 3OM0A 1JQEA 1DBPA 2ET6A 1XALA 4JBXA 4K6MA 4QYMA 3TIVA 4EENA 3D8TA 1L3BA 2Q6TA 5HFNA 3N8DA 1C9EA 4FS3A 2NV6A 1KDPA 3V48A 3T95A 3BCHA 1OPRA 1QZXA 5EPEA 4DKJA 2A30A 1LWNA 4EIWA 4KO3S 4CM5A 3U1BA 2EKPA 3F0TA 5G0VA 4C4RA 1YMQA 1TUBB 4EATA 2J45A 4KOAA 3GRRA 1PDWA 2FA9A 2PN1A 2HLNA 1G291 2OGTA 4I5DA 1T5TA 4KU4A 4ZAFA 2VSQA 3NNNA 5BV7A 3O8LA 3IEVA 4A2CA 3JY6A 4GD3Q 1Z8NA 4J9UE 1BS9A 4XR4A 4ENWA 1JZQA 1QHXA 1Z0DA 4UHJA 3R20A 2F6RA 5JBIA 5A4KA 1D2NA 2G5CA 4JL6A 4ZIRA 4BZWA 3K9BA 2DKFA 1FCJA 4S35A 4NS1A 3ZGLA 4J6FA 5JYDA 3J81k 1NW9B 2DCMA 4PC6A 3W6NA 3ET4A 1XD2B 3AB8A 4BNKA 1TJ4A 1L8QA 4ARZA 2DJ5A 3OQNA 4CI9A 1PBNA 1BVYF 4MWBA 5TMPA 2BDUA 4B7UA 3PD0A 2O5CA 1PI3A 2A7XA 4G84A 1YA8A 3UOGA 3ZDYB 4P0QB 2YS7A 2FFQA 3HI6A 3MOIA 4HZUB 2AX4A 2WQ6A 2V54A 1IJFA 2FRDC 3ZWOA 5KO2A 4YJ2A 1CUEA 1XVUA 5T41A 4ZZ3A 1Y4SA 1NX6A 4CMAA 2YWEA 3WZLA 4XI9A 5L8VA 1WBJB 5C4MA 3KB2A 5EJEA 4Y6GB 1RXSA 5K9ZA 3JZIA 1R8SA 4BLPA 5TJ9A 4O4HB 4F3YA 1M1NA 2X0JA 3VU3A 2IYEA 1E0DA 3OX2A 3O82A 3QX9A 5JAMA 3ZWMA 5KINB 2GUGA 4F5EA 2WYVA 2CNDA 1SB9A 1W8DA 3B7PA 2R48A 3IKJA 5HQ3B 1P9OA 4J0QA 1SK8A 1YZHA 1RLIA 2FWJA 4I9UA 2PMKA 1CS0A 2R96A 3KT6A 4J16C 1FFDA 1SRQA 1T9GR 3FVWA 4OYLA 1KI7A 1PR3A 2W6ID 4RZHA 5EKUA 2WTBA 5ARDA 4BJ3A 3FRHA 4BJHB 2GERA 5MDHA 4HH3C 4LGVA 1Q6YA 1I94B 3TPFA 2H7YA 2LBPA 4F6LA 4I1PA 3ILYA 5A05A 3Q2OA 3QVJA 1XJCA 3K0BA 3UG6A 3EQ9A 4U4AA 4R71A 3AWIA 3B51X 5C1IA 4YUYA 3SC6A 3R9KA 3NTLA 2JHFA 2WB4A 4FINA 3BSYA 5I47A 1KJJA 1RKVA 3GCGA 1JSRA 4JLBA 3PP8A 4KRYA 1U3UA 4OHRA 5CK5A 1QP8A 5AHWA 1EZ4A 5U4QA 3COZA 5EIBC 5TMEA 1QGUB 2BJVA 1VBKA 1JVBA 2NQTA 3EMBA 1QQ5A 1WHTB 4JXJA 2J48A 4N18A 2A1IA 1ONOA 1UXGA 5AKYA 2LNDA 1MUUA 4MVYA 3R76A 1PVVA 1KR5A 3KM0A 1HOTA 5CM2Z 1SCDA 1L7EA 4CV3A 2X1VA 3DOCA 4IHQA 3PUYA 1SJ9A 3VBCA 3R75A 1QMGA 1QIJA 2HJGA 1Y7TA 3OKFA 1T6ZA 1MA0A 2IP1A 2FVXA 2L82A 3ESDA 3QY9A 4DMLA 1V41E 1TIPA 2Z9BA 4IMRA 4BRWA 1DQRA 5AW6A 1D3AA 1Q2XA 1KOFA 1GL6A 1ZRSA 2DWPA 3D7LA 4R8SA 2XQGA 5CT6A 1XTTA 1ZEJA 2VWGA 2IEYA 1GYQA 1BDHA 1XTQA 4AN1A 2C0QA 1OB5A 4BGUA 3EDYA 3QU4A 1WSAA 3NVDA 1OXTA 3BE6A 3E3AA 1SBIA 4WINA 2Z8YM 3HCCA 2C2HA 1NP6A 3CE6A 4FLEA 4J9VA 4QNMA 3RIYA 5A1JA 3YASA 4V1CA 2IUFA 2WF8A 3OC0A 1BZYA 4EA8A 3E3MA 4MW9A 3C87A 3L07A 4HADA 2OEPA 4DNPA 1M2NA 3RABA 1BXKA 1PS8A 4PR3A 2W2LD 4P7JA 5YASA 4IFIA 3GU3A 1RJGA 4FCTA 1KPGA 4KV9A 3NCTA 3WWEA 3KZOA 3TMYA 4CKZA 3NETA 3LCRA 4EVQA 3OFSA 3IEXA 1QDUA 1S2LA 2UZ4A 4KQIA 2C98A 1L4GA 2DFPA 4G85A 2JGMA 4PZYA 2ARKA 3FX2A 5FP0A 4H1HA 5JRJA 2VYVA 1U3CA 3OJXA 1E5LA 3ZZ0A 2ZRBA 1H1LA 4H3KB 1D04A 1RAHA 3OM8A 4LQ4A 4ZDWA 5BR1A 5KS2A 1RYZA 3QPAA 3AJRA 5T4EA 1WCXA 2ZS7A 4RTPA 4HRYA 3KAQA 5C5CA 4M1QA 2XCTB 4B3SB 4GKBA 2D7DA 2FB9A 3L06A 3QQPA 1EXWA 1Z63A 1SD1A 1C2YA 2GEFA 3SBEA 3ZYCA 3HY6A 1QGOA 2FEWB 1HTTA 3C6YA 2EF0A 3E0XA 4MCAA 3ZTYA 4EW3A 4WNCA 2O8NA 5IABA 4BFUA 3MLAA 1JYEA 1U1CA 1X13A 1RIIA 4HMOA 3L7NA 3PR2B 4D41A 4PAOA 5BYJA 3EHEA 4L4XA 5CX1B 5HZKA 3RM3A 4NFLA 2UKDA 2W2VA 5KC9A 1DXQA 5FL7D 1NBWB 2FR0A 1GOTA 3DTVA 1LTHR 2BZGA 3UC9A 1LNSA 2XUKA 3A8TA 3KL2A 4YRIA 3KR0A 4NARA 5FTJA 5C31A 1T35A 4FYYA 4BO8A 3PPVA 3ZDEA 2PT6A 2RCNA 1M2OA 3CEAA 1Z34A 4UU8A 1N36B 1T34A 1X0VA 1JX6A 3LK6A 3PC8A 1IIBA 4MVWA 1OH6A 2C5EA 2X8LA 2ZFUA 1RRMA 1L4UA 3FN4A 3LI2A 3NOQA 2G4VA 5F64A 4EUSA 3GZJA 4AJIA 1HT2E 5D85A 2QVXX 4AD8A 1WCIA 1J8DA 3JZMA 3N7TA 3V4ZA 1U0BB 4J43A 2IHNA 1TQHA 3ACDA 2JHGA 1QFMA 3I04A 4MUHA 2CB9A 2IHYA 1E5VA 3DOUA 4MVJA 3RRYA 2IDZA 4WLUA 2HSJA 3D3WA 1YDHA 1RYNA 3ZVRA 4QASA 1GFZA 1RC1A 2B2CA 4WBNB 3FNQA 2B4KA 2X9VA 4UUBA 1EXVA 2P5SA 1E2BA 2PXAA 4OHPA 4WEQA 4DOMA 4IJ6A 4ZVSA 2HOQA 4OHWA 2Q4DA 4R2MA 4IXNA 1A96A 1O6GA 5JW6A 3EXIB 4TVSA 5IEJA 5AI6A 5LP6A 4KREA 1V8PA 3DZKA 3NHLA 1OLOA 2OV3A 1VLMA 1M1YA 1N57A 2PS0A 2VJLA 4IPTA 4CQLB 1NFRA 1DFIA 1H0SA 1HM5A 1POXA 4HT3B 5AUOB 4QAQA 2ONKA 3HBAA 3N87A 4FCCA 2C1XA 2QIOA 3MWEB 4Q4JB 2ZRFA 4GOXA 1MXFA 1TUIA 3KJGA 2VT6A 1B0PA 1I3OA 8MHTA 1KDOA 3OURA 3QF4A 3V8PA 3HBNA 3QPVA 1A4RA 3X43A 1E7RA 5CIQA 4JX9A 2D54A 5CIWA 3DBHB 1A2QA 2I4NA 2CL0X 2ZT8A 3QU2A 2O50A 2WTNA 3HUTA 4EHIA 3QXJA 2Q5HA 4E5UA 3DH0A 1UOEA 1UPAA 1ZMXA 3O47A 1H2AS 4OJTA 4WBSA 2YWJA 2IQ5A 2JK0A 3BZWA 5A3VA 1OZFA 1X1AA 5E8RA 3S3TA 2MSCB 4ZT5A 3IAHA 4OXYA 3N28A 4B3RB 3GFQA 3RFXA 3THXB 3T0FA 2CFTA 4KZKA 3EPJA 4D5GA 2OCKA 1WZIA 1XA0A 4U7HA 5LZ2A 1QLJA 4HAVA 2OHXA 4D8WA 4C4TA 2VJAA 3IPRA 3A3PA 3UGTA 5ITVA 1S8FA 1Z4OA 4N0MA 1V2HE 4ZRNA 2ZUEA 1GA1A 3CX6A 4Y2HA 4D9BA 3ZLUA 2VC2B 2Q6KA 4IDOA 4IUYA 4YJ3A 1X42A 3IMCA 2AXNA 3GJTA 3HB0A 3KUUA 4HQ6A 4QVKA 3HJHA 1G9TA 3MGAA 4IF6A 1ZITA 2UYYA 1C3OA 3NOXA 1OTYA 4FNMA 3OPQA 1FSSA 1BA3A 4PRYA 1JHDA 1UJCA 2DR3A 2FOXA 3DP7A 2O52A 4H15A 5KTNA 1FBNA 1XELA 2D5IA 2EGGA 2QTFA 3VAYA 5LJLA 2VS1A 1JECA 5HBGA 3OKPA 5B1HA 1N2XA 4N3AA 5EP1A 4LDJA 4DREA 2I7DA 4ZAGA 1RYHA 3TD6A 3VNRA 2B6NA 1HUQA 2H16A 4GQAA 2R8EA 4U0JA 3UKOA 2CMHA 5LR6A 4ANFA 3AMVA 3DKPA 3HE3A 2NU8B 4RTOA 3NT2A 2JGAA 3G8YA 2C78A 1AY0A 1XZBA 2G3YA 4L5IA 4ZAVA 5TRTA 4KN6A 1K6IA 4CT4B 1RJ9A 2VAVA 5FTKA 3KWMA 4ZVQA 4ZXFA 4JZKA 4B8YA 1Y48E 1ISGA 4G1BA 2XDYA 2VJYA 4OAPA 5CNJA 4BEBA 4MYHA 3PRYA 3VKUA 2VSFA 1VG9B 3PA8A 5GGYA 3UH0A 3ZWYA 1PEAA 1DBQA 1ZG3A 2E6UX 3AIKA 5K6TA 4TN1A 2LKDA 2OE2A 2R66A 1QJ4A 2HN9A 1GKKA 3G79A 1KJZA 3IV7A 2C2MA 4IMPA 3STTA 1JR4A 1U8YA 2WKQA 2R87A 4GT1A 4AJLA 5IJ0B 2I4TA 5LDDC 3LUGA 4GR9A 1P8AA 1EH5A 1X8KA 1IC6A 4WN3A 4ENTA 5HR5A 2HLHA 4LY9A 4RXUA 2HGZA 4HB2A 4H3SA 3H6KA 1KC1A 3KTOA 4Q4AA 4QXQA 4UFOA 5BOSA 4QNNA 1RZ3A 2QX4A 1J0EA 3IUPA 4O33A 4RF2A 2ERCA 5IM5A 4Z4QA 1G2IA 1ECBA 2QX8A 1WXEA 2DT8A 3L8CA 4MS1B 5A5EA 1KQFA 3L0CA 1W49A 3NBQA 521PA 3UFXA 4Z99A 1BDIA 3GEIA 3AI1A 3NFYA 2PAFA 4AT1A 4EITA 3CLTD 1JJVA 3PL5A 1ZFNA 4M9CA 1RBYA 4A8JA 2C4KA 3MZ0A 5AI9A 1P1BA 4TPKA 5MFPA 3M6LA 1KTVA 1GTSA 4AN4A 1PD0A 1Q7CA 2OWDA 3C45A 1C9DB 1KH1A 1WY5A 2BTQB 2IYXA 2R25B 3CHYA 3UK1A 4R9VA 3R7WB 3OZSA 3KXDA 3AETB 5TDHA 2JG3A 3OEHA 1PRYA 3P19A 2OO3A 5JFOA 4PXSA 4K1XA 3A36A 3TVYA 2FZEA 1P91A 2J85A 2WUVA 2XPCA 3CVJA 2OCAA 1KKUA 1QYRA 5DW3A 4NY1A 3VDRA 1FP4A 2G1KA 4I55F 1OU0A 2YRFA 1NUHA 2XH8A 2OKGA 1TKRA 3HU1A 3PHLA 5EHGA 3PGKA 3W8FA 3QF7A 5KTKA 3EXHC 3GUVA 5B12A 3MGGA 4MW0A 5KSZA 2WTMA 1N5KA 3QOWA 1O1YA 3X1DA 1QV9A 1MJGA 2FR8A 3C8DA 3ZEAA 1UADA 4BN0A 4RQTA 1IBRA 2ATVA 1T6XA 13PKA 2PU5A 4N0EA 4HY3A 1AK9A 2ZM5A 5HXAA 2H54A 3E5MA 3I9V6 2J6HA 3V9PA 2GFIA 2MDTA 3QI7A 2BFFB 4J7XA 4KI7A 1Z29A 4NTZA 2BTEA 3TQQA 1KAOA 1LSUA 4HRVA 1V8FA 5BUZA 3RIHA 3U1VA 4Z0HO 3BZUA 3HYSA 4IX1A 1KRWA 1N2IA 3A25A 5D7BA 1QK3A 1AKYA 4J49A 4CETA 1UWCA 1J8MF 1PCXA 2OAQ1 3VVMA 2RHTA 1MO2A 3C24A 3EGXA 4UARA 5TPZA 3ZDQA 1ZVMA 2ONCA 5B1IA 1U7XA 3LQ1A 3DOFA 4RPLA 4KYIB 4WOPA 1ZL0A 3H6GA 3OQIA 1CK4A 4E07A 3LK7A 2HUNA 2H4ZA 1W6UA 3K35A 2OGZA 5DHPA 1EUQA 1GL9B 2E0IA 4DQKA 3GUZA 3LT0A 3NNSA 2O54A 4XARA 2P4HX 2IUSA 3DW3X 3GRAA 3O8CA 3MXOA 4F12A 4NMWA 1BNCA 4WZAE 4M9ZA 2Q5FA 2BGKA 4MVJH 2PZAA 1JHXA 2WMDA 3C3WA 5ES4B 4BQNA 4QGGA 1KAHA 1X1SA 1X3LA 3C14C 1JJFA 1MOZA 4IL5A 5EESA 4J1SA 3S68A 4L0DA 3OWHA 3NHAA 5DIZA 4G8DA 3RSOA 2O3SA 1U5AA 1W5SA 2YJ6A 3QLUA 4XX1A 3JQAA 1GZSA 5LWHA 1L5HA 4WTOA 4EX6A 5L51A 1QNFA 2DWCA 5F5NA 1U0HC 3A6ZA 1B3BA 2E21A 4ISBA 4CEIB 5IHXA 3FOAA 1DG9A 2CVHA 2WAAA 3QZUA 4J75A 3ZDCA 3UJ8A 1ZAKA 4YREA 3IQXA 4B6FA 3RYFB 3U5TA 3M7IA 1H4VB 1N7GA 1YGYA 4Y9RA 4B75A 4Y2JA 1ZXXA 5CP8A 1I6KA 1E1RA 1JILA 2ALJA 2OZKA 1IMJA 5BYBA 1MB0A 4QJIA 3ONNA 3FPSA 1LSOA 3LT5A 5LQJA 1ZUD1 1QXSA 2D1SA 2E4XA 4H35A 4PQGA 3UJPA 1P9WA 2WD7B 3D6FA 4W6ZA 2CYAA 2C2YA 3WB0A 4CF6A 3JQRA 1C4XA 3QBTA 4JJ8A 2RBEA 4QXMA 2QN3A 1QHHA 2WHQA 3F6PA 3W5VA 2W6JA 4B45A 4D9NA 4QU9A 3AR2A 1GITA 3RUDA 1J8YF 2RI0A 5CDHA 1HYGA 4U9HS 4C9BA 2A3NA 4YCBA 2FUG1 2GK7A 4M76B 3V4FA 1AZWA 3OFJA 2G8NA 3V1NA 4PNZA 3MINB 4E2XA 1PFKA 1D2CA 4P0TA 4R81A 4ECAA 1PG0A 4QTYA 3UNXA 1PDOA 4FWBA 1A8HA 3N3BC 4XM0A 3GV0A 3BGVA 3M2TA 2I67A 1QHGA 2JIQA 2AWNA 3KKOA 2AQHA 3L93A 4FUTA 4MARA 5EJIA 4UKDA 5AJZA 2NZVG 1EVEA 5ALEA 1BQ4A 2XJ4A 3V8MA 3RDPA 1PAUA 1YJQA 1Z3CA 1VYHA 2Z6VA 3GNLA 1NW3A 3G85A 3Q40A 1N3BA 4H6PA 5EYPB 1XRSB 5K3EA 2BFPA 1SXJE 3L6DA 4Z49A 4F2GA 1Y0BA 4GWGA 1AKQA 4YP0A 4DM4A 2XX3A 4PZAA 3C8HA 1TL7C 1YRHA 3CLSC 3HCBA 4GW3A 3DKVA 4E08A 1NQ5A 1HXHA 4XJTA 2EJTA 3MCUA 4R9NA 5CCEA 5AH0A 5CDTA 2NO9A 3BQNB 1R27A 4HXFB 3GFFA 4MP6A 2F1KA 4CLEA 3NT5A 4B33A 3UHFA 2BN4A 1IFXA 2WICA 3KAKA 1VA5A 4EJFA 1ZHOA 1ZC4A 5FWXA 4ARVA 1GARA 4EBFA 1XRQA 2QB5A 3BE4A 4Z0PA 1BS2A 1OE0A 3FNBA 5HRAA 1ODLA 2P9HA 1C8LA 4BCDA 2C03A 4CEJB 1A9YA 2DZDA 1KAGA 2C82A 2ORED 3KKNA 3UC5A 4JJEA 3F6BX 3HKEB 4MS4B 2QRPA 4LYDA 5LA6A 4ZTZB 2ZBQA 3PGA1 1KVTA 1NNEA 1HO3A 4MTLA 1VJTA 4AURA 3ISVA 1D2RA 1RE1A 2V65A 5BMVB 3AKYA 2XXBA 3QFCA 1KWGA 1A98A 2C5LA 3F3SA 4FGLA 5EQDA 1X70A 3TLZA 2PX3A 4RM2A 5EQTA 3JVVA 4IEEA 5CW2A 1PT7A 4OSPA 1SUAA 4POAA 3KSUA 3TTVA 2NGRA 1XEWX 2PA0A 4ZTUB 2QV7A 3ZCUA 1HQKA 2QMYA 4MUJA 3G9TA 1P2UA 1F0NA 4MVJF 5M3BA 5L3QA 5GONF 3NQ41 3HBFA 2FKNA 4O2BB 2G63A 4G0QA 1VI6A 2BMDA 2AEEA 2H48A 2NVOA 1YZNA 1LGYA 2RH9B 3PHIA 4NJMA 4NQZA 3VV3A 3NKLA 1A9SA 1CB0A 2ECFA 3R1IA 4WZBB 2M9MA 4MYSA 5ALYA 2XA1A 4RA9A 4W1QA 3UW1A 2FEAA 4U7WA 3OIFA 1EDOA 2ZIXB 3QE4A 3P2MA 5ENVA 1XKQA 4OLBA 2CE2X 1I13A 3DEHA 2LIPA 2SBTA 2ZJ6A 1FS6A 5G1PA 4JLPA 4BMDA 1MIOA 1G21E 2RG1A 3D2LA 4GMHA 4KVZA 2ZE5A 4FU0A 1MNQA 5HTOA 4CW7A 1KO5A 1SHLA 4QT4A 4FMDF 4M0DA 4UTRA 4LFBB 1E6UA 5KTTA 2FHPA 2BF7A 1CQZA 2QL7A 2Y1KA 1IJBA 5DT2A 3WRVA 1K88A 2WFLB 4P2GA 4JLOA 4F72A 5AVXA 3IEMA 3OJOA 2Q5EA 3ON5A 4V38A 2C5GA 3X1XA 5BY2A 2PJDA 2ZYVX 3K8ZA 1UKAA 2C04A 4G0XA 4G07A 3IC5A 3IMKA 4CPDA 1FZQA 4N6GA 4IH1A 3TZQA 1F9EA 3UBTA 5GAJA 3GGJA 4I3GA 1D7OA 2EFHB 2EIXA 2GETA 2X0RA 1T1EA 4HFNA 5DXFA 4DSOA 5KYNA 5JTTA 4TYQA 3EDQA 1NLYA 1UIMA 2E89A 2HBQA 4R8LA 1ZUWA 3LDUA 4H2DA 3I1FA 4KDRA 3H1AA 2EDCA 3MHPA 4LXIA 4ZVNA 3SM9A 1YD7A 4U2EA 2GD6A 4PRZA 1E2KA 2I76A 3CRQA 5EKTA 2FDXA 1W4AA 3N2KA 2ODWA 1RXCA 1KL7A 1JFFA 2XGSA 3ECCA 4LJ8A 4UHFA 5EUMA 4B73A 3T5PA 5E1DA 2BSAA 2DR2A 1YH3A 3F5FA 4PAWA 3HJCA 1SR8A 2P6RA 3BMQA 2XMZA 3DAOA 3LHIA 4M9SA 4E7PA 3F67A 4RZQA 3RLFA 2Q7XA 1YMVA 2YY7A 4UCWA 3L7AA 4WADA 2CUNA 2L42A 3A2NA 4O8CA 4QYWA 1JKFA 3WVNA 3M4ZA 5JJIA 1R0ZA 2HSWA 3GA7A 3LFHA 1GNRA 1XKXA 3DJYA 1A72A 2AGVA 3MCVA 3AOGA 5BSEA 3HJNA 2X6RA 3WXMA 1AHHA 4R05A 2Y1XA 2BTOA 2Z4RA 1F5SA 4Q03A 1ZN8A 4UAUA 3TW8A 1LPAB 1RPZA 3FVRA 2LW7A 2IOYA 3T34A 4HDMA 3L8GA 3H18A 3NHZA 3I61A 2BBOA 3A6PC 5FKJA 4GZ6A 1IDOA 1B8NA 4EHAA 1PUXA 2HCRA 2QZSA 4H7FA 4LE2A 2P6OA 3OZVA 3RVPA 4UNIA 3KB8A 4BJ6A 5H4HA 3QW4B 4UVIA 2E2WA 3T15A 5HM8A 4X1YA 2HWYA 1TCAA 2XOKD 3DBVO 1ECPA 4LHXA 1JSXA 2CNWA 4PG5A 1WMBA 4D8XA 3C6MA 3MGKA 2ZYTX 2EFEB 3E84A 4QD3A 1HNZB 3VSBA 4YV7A 1QIEA 3UUEA 2VF2A 4AG3A 6REQB 3HYTA 1E0AA 1J1IA 1O9BA 3QLEA 5DRTA 3H9GA 4RX1A 5CA0F 4PY2A 2PZMA 3K1TA 2Q0SA 2HJVA 4D45A 2WU1A 3G1TA 1QH1B 2R8RA 2DB3A 2QI9C 3FBWA 2FPKA 4S1VA 5DLPA 5EJ2A 4A6XA 1W4ZA 1G20B 3EEFA 1E77A 3QFFA 1E64A 3AP2A 4K6FA 3SPXA 3UMSA 4BE4A 3HI4A 3UAXA 2VL7A 1YQEA 1XNHA 1R0RE 2OCDA 1F2VA 2G9NA 5EGNA 5J59A 2D0PB 2O7QA 1CUVA 3A4LA 3F4KA 4TTQA 4M1EA 1E79D 5FNVF 5BSVA 4GKKB 1EGQA 3QFRA 4Q48A 3DAGA 1VDZA 2FX2A 4RFVA 4E88A 3CINA 4QM7A 1QHSA 3DQZA 3PD7A 5FO0A 3OX1A 2O8EB 2K87A 4MVCA 4YAIA 1L5SA 4M8NE 1PVDA 3N2ZB 1IM8A 4OFZA 1E18A 1G2OA 2GSWA 3QFTA 1PJLA 2H1SA 4L8FA 2BKLA 4LOLA 1V8OA 1ZDMA 2C4WA 2PNFA 4RD0A 2ZE6A 4TYPA 4C4AA 4WWHA 2X4GA 1LLQA 2Y8EA 8LDHA 4CIAA 1KBZA 2Y0CA 3O83A 5CYOA 1D4FA 3NWEA 4OMCA 4TLAA 3V32A 4Q93A 2VDUE 4C7BA 1VG8A 3LP8A 3OPYI 4RH3A 2E1RA 1O97C 5E1OA 1EG7A 4R1UA 1OXSC 1YVEI 2XUZA 2Z57A 1T8RA 1UC8A 3H0EA 2QMEA 5EXEA 1CWUA 1GYPA 1W94A 2ZSAA 1Z73A 3AL2A 2HW8A 2Z2ZA 1FLAA 3RF6A 3KTFA 4AG6A 3DLCA 5BRJA 1UEIA 3M6FA 3F3KA 4FC6A 3SXUA 2HEGA 2P5TB 2YJNA 3DO6A 3LCVB 4KB5A 4Y8VA 4H7DA 4PXAA 1NLZA 2HPHA 4RHTA 5F76A 3VFDA 3FAKA 3VTAA 1O3YA 3ZHTA 5C2JB 4P7KA 1BAPA 4S05A 4PYQA 2P7HA 1TYEB 2BPOA 3NP9A 4J90A 1NXPA 3ZCQA 1EFAA 1IY1A 2P6UA 1XA4A 3EODA 2B1JA 2FVYA 3Q0EA 4BLUA 3G7NA 4G0ZA 4XW2A 2EATA 3T94A 2RC6A 3J81A 3UCEA 2OPHA 1ZW1A 3WGUA 2WDPA 2AEMA 1WKCA 1YIAA 1BE8A 1FUIA 1TK9A 2BDEA 2Z9DA 5FOUA 1HURA 3VDNB 1N32B 1TQ8A 3T7RA 3OLQA 5CAEB 2PRZA 2RHWA 2HI0A 2ENUA 4RO0A 1HE5A 1ZCAA 1VI5A 3PFIA 3VDQA 4H6WA 1C9YA 5JHHB 3D6TB 4P4UA 1Z7GA 4A8PA 3MLEA 1ZZGA 3AIMA 4GLLA 3AY0A 4FEGA 2Z2JA 3RTGA 5KX5A 4MITA 2FSVC 1ORDA 1K63A 3FYUC 5B3LA 4BFCA 1KYIA 1TA9A 2PUJA 1ZESA 1LC3A 3QG5A 4J0HA 4FYHA 5TSDA 2VDMB 1S8OA 1BCSB 5A4FS 3V97A 4X54A 3DUWA 2O2GA 4B6SA 5FHQA 1AKEA 2CLEB 5E9QA 3GLGA 4ZA2A 1IPEA 2IUYA 3B60A 3MJRA 3TDNA 3WGVA 1DGQA 5A4DA 1SIUA 4H1TA 4DAOA 3VR6A 1A50B 5GMOA 3TQTA 4CKXA 4CMIA 3CSDA 4CTJA 3VSAA 1NVFA 5KNCD 4PGGA 4DVGA 1BKSB 3KXLA 2HUPA 1U0SY 3KUCA 4BO7A 5EL0A 1PK8A 2B25A 3SGLA 3TJZA 4JLUA 4CU5A 2YY6A 2YW2A 3EYWA 3ZKAA 1EHYA 3R5XA 4GHWA 1XJ0A 1NQVA 1QR2A 4JR2A 3DL4A 2Z2IA 1DRUA 721PA 2FSFA 3KQYA 3OZFA 5BW6B 4PFSA 5IWAB 3GROA 4WKBA 2AJDA 5H68A 1ZM4A 3Q87B 2GJAA 3I45A 4YQYA 4EUNA 3W6PA 2QLLA 1CZHA 2Y0PA 4ATNA 2EL9A 4BNYA 3VTFA 4PYKA 2OYCA 1KGSA 1BA2A 2VSXA 3IR5A 5TE9A 1RWBA 1V5IA 3GGCA 3W8NA 2CLOB 4B7ZA 4DMUB 2H1RA 3GP5A 2PCLA 1Z7YA 2H9YA 2WYHA 3KYDA 3PVSA 4NMXB 2O8DB 1U81A 2YUIA 2ZQ5A 3HABA 1BFUA 4WPGA 4XSHA 1G2PA 4E1VA 3QXCA 3B5JA 1U28C 2YYAA 4P7FA 3IAFA 1JIUA 3DCNA 1XMJA 4B82A 1XTBA 5HK9A 2C5AA 2H06A 4K7JA 1JG2A 5D3MA 4DIBA 2V97A 4YJ2B 1S7CA 3E61A 3T7IA 1Q2UA 3OF2A 1HYEA 1QR6A 4FGWA 3ZKWA 1KORA 3S40A 2R8XA 1M6VA 3DZFA 2A4KA 1GNTA 4ZV7A 2FW6A 3P9KA 4KFTA 4L4ZA 1TE2A 2N75A 1Z6GA 2WJ4A 2EQAA 2GXQA 4URZR 4Q9DA 3E7DA 4F9FA 5EMHA 5IJXA 5EMMA 2HK8A 3FI0A 4BO1A 2H2FA 4RLSA 1XZJA 1JEOA 1K97A 3ZJYA 4DJEC 4B9EA 2W2PA 4PLCA 121PA 1FFBA 3DPIA 3EZ9A 3MIZA 4RVHA 1DWUA 1R0CA 1I2DA 1NVAA 2D8AA 4P98A 2DC1A 4NQRA 2X7HA 3TLEA 1V6SA 3BXZA 5LQMA 3PGXA 3E81A 1JLKA 4PCLA 4MJ3A 2JANA 4C2UA 1U2TA 1ODJA 3OJCA 2DVMA 2P2NA 4U2FA 4AL4A 4CDGA 2HLPA 3PHJA 4Z6KA 5JJ5A 5HG0A 2Q1WA 4G2NA 2GVNA 4OKNA 2AUMA 4X63A 2ZLBA 4KGVA 5AKEA 2O59A 1QNLA 3NV7A 3GBVA 1GCGA 1H69A 4IIXA 3O1JC 5CT8A 1KVSA 1CY2A 5KYUA 1HR0B 4I7EA 4EG0A 4JOCA 4XCVA 1D1TA 4LA4A 4DLLA 1B15A 2VWPA 2CMGA 3T7JA 2FPLA 3ELDA 1SVNA 2OXTA 3UA4A 2WILA 3FYCA 3R40A 4W8OA 1XRMA 3WP1B 5CVDA 2P9JA 2IPNA 4RMNA 4I1YA 3DO5A 5JSYA 4AZ0A 2IEDA 1EWQA 1CXZA 4Z1MD 4F11A 3FPJA 4MPDA 5A1TA 5CB6A 1F14A 4G1VA 1UKYA 4U8HA 1RC0A 4GX0A 2NXEA 2CCKA 2BISA 2GLUA 3LLSA 3PFGA 4CL2A 1CEYA 3ZDXB 1FFCA 3VDXA 3ZZNA 4B2PA 5C46F 4U39A 2EU8A 4WD3A 5AHXA 1F48A 1XDUA 5ETJA 2BYTA 5I5EA 3VO2A 4HDAA 5FQOA 5JVDA 2GN9A 1LS1A 1IZ8A 4FR5A 4MRAA 3I9OA 3KTAB 3N0TA 3KD3A 4MRVA 4NYMQ 1LZLA 5I8PA 3PHHA 4V1CB 2H1HA 2HFKA 4KPFC 4DQ0A 1I4DD 1O0SA 5A7HA 1NPYA 3SF8B 4EA6A 3I9MA 3DE1X 4N3NA 1OZGA 1Z2PX 3NDRA 1EFUA 4DT1A 2C7GA 1U7DA 2KLHA 1LBHA 3DBRA 3TLAA 1OYYA 3S2YA 3ND6A 3EZNA 1I6WA 3QEKA 4LXHA 5EUCA 2R6CA 2ENWA 1D09A 2WV9A 1J56A 1JNYA 2NAFA 2QN2A 3FWYA 4HPWA 1ZL2A 4OMDA 5FPQA 2ES4A 5BV8A 1GEGA 1R5BA 4PFJA 2EWMA 2ZRLA 3K9HA 4ZMSA 3RTBA 4R1NA 3WSTA 1HLDA 5JCJA 3RODA 3VR2D 5A5VA 4P35A 5AVUA 2HIGA 4TT3D 5H1YA 3AVTA 3M4YA 3GRVA 3SWWA 1RWVA 2BLNA 2Y6UA 5HYVA 4DXAA 2RSLA 3VSEA 2OB1A 3B78A 3FCXA 4GH5A 5F3WB 4NCBA 1SGWA 1OF1A 1PQ4A 1L3IA 4LJRA 4RK5A 3KXKA 3JWHA 2BJHA 1YC2A 2M6SA 1UCFA 3EE6A 4WACA 2G80A 3A6DA 1HH4A 1QF7A 3BMNB 3NTQA 4WX2B 4EB3A 2R8OA 1GIAA 4KXUA 3WNQA 2FJUA 2P9FA 4MEBA 2H2AA 4PX3A 4WDQA 5TEWA 3UATA 3U09A 2G04A 4L3WA 1UJ6A 1PFWA 3MTGA 3OZRA 4BQIA 1T4CB 1E0SA 1KRHA 3AV3A 3PWZA 5C1PA 1D9XA 3FFWA 4BGEA 4H7IA 2TS1A 1EK2A 1KZ4A 1KZGB 1NQXA 2VP3A 2YFKA 3PYLA 2OYSA 4QWMA 5FWYB 4CM7A 2LE0A 5IKEA 4DB2A 1XHLA 1EHIA 2C29D 2W6QA 4TMXA 3ZWDA 2I9KA 5FPSA 4DM3A 3EB9A 4MDEA 1C3LA 2XGOA 1P7CA 5JS7A 1YONA 4RNCA 2QE7A 1DKRA 1XI2A 1HZJA 4BFXA 3KXPA 4I8DA 1JEEA 3IAXA 5K3SA 4TGLA 1HDRA 4EB6A 1T1JA 1EFVA 1XTRA 2XWJI 1I1NA 3T4XA 3ENWA 2PXCA 3E05A 1BMFA 2HK9A 4WVLA 4P33A 1Q95A 2A88A 2JJYA 2AMJA 4MV4A 4KR2A 3PEFA 3DD1A 3P2KA 3VR6H 4F7WA 5KDOA 5AVJA 1O03A 5L45A 3C7AA 4BC0A 1JHPA 1ORTA 5TT0A 3KJHA 4V0SA 2LGJA 3F6YA 5IVDA 1I32A 4IQFA 3QLVA 2QRVB 3EG5A 4X6UA 3HJUA 1DIAA 2QNBA 1IK6A 3V6MA 2HJWA 1FTYA 2VDWB 4JFAA 2IELA 2CDAA 4OI2A 3C1OA 1FXSA 4HGZA 4Y2TA 4ZO9A 4BRZA 4DIFA 4E31A 1VHWA 5CUQA 1V8DA 2F64A 2IU3A 3DV2A 3C6ZA 3E22B 1PDVA 3O9VA 4JDPA 4LK2A 4MDHA 3RVNA 4D9CA 3ROTA 4FNAA 4X6YA 3EC1A 5FR1A 2C4NA 1QFXA 3H1TA 1PJSA 2Z2XA 3ONDA 5I48A 1BEEA 1Y6QA 2C7VA 1C7FA 2HBZA 3RHFA 2YOFA 3S7TA 4OXNA 2ZVPX 2CCGA 1FSZA 3I2HA 5IKOA 3VV2A 1G3UA 2IYPA 3RS7A 3VMMA 1ETUA 2X8JB 4OQYA 3FW1A 1HA3A 2X4DA 1RKBA 1RWXA 4JR1A 2YNMA 4DSTA 2B4RO 1DARA 3IB6A 3MNFA 1GG8A 1QYIA 5DH9A 5AUQA 5ILQA 3SX2A 4D9JA 2P0YA 4I9NA 2QI9F 1DZ3A 1I8TA 3M5PA 1GGFA 1Z2DA 4XX0B 3ED5A 4DGQA 2PRJA 3AEKA 5EXDA 3WAJA 1FVFA 5JQWA 1UAGA 3X1YA 2OV6A 1V4VA 3ESZA 2NACA 2QN9A 1AXRA 3ITNA 5SZIA 3GD7A 1S9DA 3WQQA 5HRCA 2H17A 1B23P 3VOTA 4S1NA 5LCXA 3TAUA 3ROZA 5I4CA 3C8MA 2VJOA 1PJBA 1AOXA 5IN5A 1PEKE 4ZHQA 3H1FA 1I0LA 3CKLA 3EG9B 1RVDA 2IA5A 4UHKA 4WIAA 3IPLA 1K92A 1USWA 2ZUTA 4UAJA 1ZCBA 4MGZR 4NEHB 1A8SA 4P4NA 2D2VA 821PA 4DNQA 1QQTA 4EJ6A 4HVLA 3BEDA 3ANMA 5DI9A 2BEKA 2C99A 1NW7A 1TI7A 3NM5A 4GRAA 4TVBA 1U0EA 1B74A 2O2YA 3DDWA 2EOAA 3IP9A 1Y7HA 3MMSA 1YRQA 4TTSA 5E2BA 2VP0A 5E0KB 1E1DA 2X14A 1PYOA 3W5CA 4YJ3B 1AS2A 3UAZA 5KTPA 4B9AA 2HWXA 3Q7RA 1U98A 4YMWA 3D6HA 3VKWA 4A73A 421PA 2NPOA 2OG2A 1EVKA 4KFRA 4PTYA 2VHQA 5B4VA 3L49A 2J41A 4AJHA 3FPAA 3NJ8A 1SUCA 3CNBA 1YZYA 1BWRA 4HTFA 1TJ3A 2J67A 1ULSA 5ALMA 5CCDA 3FSEA 5CG1A 1I4EB 3KFVA 3GC6A 1FFYA 2VQDA 2FPSA 1JSZA 4G41A 4YAGA 2H8KA 1XJWA 3HO8A 3NOOA 4JBGA 4L1KA 4BDTA 5HQTA 4AMBA 2BGTA 2GBPA 2Q3DA 1A71A 2J9YB 2ZIAA 4DLZA 3AINA 2I03A 4AY6A 5TGTA 1ULHA 1YVRA 5E4JA 4X90A 4YMHA 5LQUA 1J7KA 1XWFA 4FOTA 3IR7A 5J1SB 4YO8A 2R47A 1ZEMA 1KK0A 2VYQA 3OJWA 4HQOA 1PL8A 3WBFA 3JX9A 1W87A 2FW9A 2X2EA 3BMCB 3WX0A 2A9QA 1QBGA 2GZHA 5C1DA 3TO5A 1JE1A 4MWDA 1L5YA 1NZFA 1UM8A 1I7SB 2EWVA 2GN8A 2IZ6A 4Q7LA 3TMAA 1RYBA 1ULTA 4W1RA 3DVAA 4CLDA 1KQ3A 2BFEA 3IJ5A 3ROXA 3IUSA 1QVAA 2WWRA 3EVDA 1HEYA 2C0PA 4LV5B 1Z2EA 3I12A 4AUKA 4F2DA 1E3MA 1K75A 3F6SA 5IYZF 3WK8A 1CNMA 4MGKR 1N8KA 4CMKA 3CRRA 2IYAA 2CNOA 1VPLA 2P6NA 3FGZA 3EOZA 2JZCA 3B36A 3IIJA 3USZA 1YL7A 3ZYZA 1RQNA 2G8LA 1SMKA 1PK7A 2HY7A 1JQDA 1O2DA 1II9A 3DC7A 4NCJA 4HQKA 5EHIA 3SZRA 4A0RA 4B1FA 5MGBA 4WFJA 1RM5A 4A26A 1QZ3A 4FCVA 2ZSUA 4M7PA 5ALDA 1AZTA 4U6NA 5KBYA 4DV0B 3TQRA 3GJ0A 4B2YA 3QBDA 1GGKA 2Z1DA 3RC8A 1P0CA 3WYBA 1YS4A 1WW2A 1JQ5A 3PF8A 3OZBA 1Q7RA 3N59A 4CDNA 4EQZA 4QJ3A 5HIKA 1DAFA 3VOBA 4KR0A 1V5GA 5JMPA 3R7FA 1G8HA 2PV7A 2BCEA 4HEQA 4XDYA 4DBLC 4OXRA 3JQ8A 1UDRA 2PVPA 4X8HA 2IH2A 3CV3A 5IZCC 3DLHA 1I1QB 4AC9A 4B83A 5BURA 1J0CA 2QW0X 3C5VA 3CWCA 1U65A 2VPQA 3JARA 1LLCA 1HDCA 1UKVY 2VQ6A 1EUDA 3BJIC 3TUIC 2JLZA 4F6CA 1P4GA 1T2NA 2FSGA 1ISIA 3H2BA 4L22A 1TGYA 4D81A 1AXGA 2VAXA 2RARA 2VF4X 4LAFA 4YRZA 3UV7A 2JARA 2HX1A 1ZK2A 4Z53A 1EUCA 5AQEA 3PTZA 4MZXA 1C0PA 4FSDA 5IC6A 2IHKA 1Y6GA 4Y6PA 1XTKA 2EP5A 3T7CA 1V7ZA 2LTAA 4EY3A 4AWAA 5IDWA 1U99A 1P19A 4AB1A 4ZYLA 2ID9A 3LQRA 3OC6A 3WZMA 1L5QA 5JZSA 1IWBB 3HLTA 2NSJA 3E53A 3KKQA 2QRUA 4A4DA 4OJKA 3I6IA 1XA3A 2XI4A 4I1OA 1MTOA 2VH5R 1MN6A 2WAXA 4PHTA 1FY2A 3TSZA 3TNFA 4RIHA 1TCBA 1NI4B 2B61A 3C6KA 1CY7A 1Y34E 1PQWA 2QGFA 3JD1A 3Q3IA 1YI8A 4Q9LA 5AKHA 3UVEA 3BHIA 6PFKA 2CC2A 2V7PA 3JR7A 3MW8A 4RKYA 4BWYA 1AU9A 3DF7A 3DAHA 3KEOA 4KLZA 5F1PA 4WXEA 3EGXB 2VDQB 4M9QA 4LYEA 3NAGA 2DHRA 3ODGA 4I6EA 2PFGA 1BW9A 3O73A 4M7RA 2A1TS 2ZRKA 3DMTA 2PEZA 1H8ED 1N6PA 2OZLA 1AA9A 1XAGA 2GPNA 1WDKA 4NNOA 1E94E 2NXNA 4O0MA 4A3SA 2NUPB 3ZC3A 5JC8A 1R4MB 3F9IA 1DIGA 3FNIA 2HM7A 1W9HA 2OQRA 4QULA 1KYZA 4UUQA 3LLUA 5J4KA 4BB6A 4X00A 1JR2A 3JTMA 1NVUQ 1YE5A 4TXHA 4KNVA 1Q7EA 3GBPA 1UMCA 4LV6A 2OLJA 1YZ3A 4R2HA 3I9KA 1G17A 2R6GA 3QPDA 5E6UA 2BWJA 1VECA 4LDQA 4LSZA 5LDHA 5FI1B 2K7FA 1REQB 4F5ZA 5DXJA 2P30A 4FDTA 4FJ0A 1FC0A 1JV2B 5C0OE 1L5HB 4JU8A 4MUMA 5LYJB 3EGWA 3UHOA 4G8JA 3VZCA 1W73A 3PNPA 4KXNA 2VZLA 4LECA 4LRUA 1LBEA 4D4GA 3WV5A 3Q98A 4PWYA 3SKXA 2ZS8A 3FPKA 1YRLA 4PGHA 4DMMA 1NT4A 1UAYA 2BZ1A 1LK5A 4IWXA 3VC3A 4TXMA 3ZIDA 4BZPA 2V3WA 4DHEA 5B7NA 2JD0A 3ZJVA 5K03A 1ZI9A 4BP8A 4JQOA 4KXYA 4BLQA 4DLWA 5FX2A 1NN3A 2WAOA 4XEHA 4LMRA 3G68A 1MO6A 1QF9A 4R40A 3P9QA 4AF7A 1M2VB 4ZOQI 1DQZA 1EVLA 3CZAA 4MVJE 1GPYA 1YGPA 5JY1A 2JCVA 3D4NA 4HQNA 5FLEX 2O8BA 4YV2A 2GDJA 4A0QA 2G76A 4FT2A 3WNZA 4IGKA 3WGIA 2JJ8A 1N0UA 2ZAOA 1G6HA 2QW1A 3OETA 1Y7PA 1KJIA 3K0CA 3HXLA 1MQ8B 3QKRA 4IH4A 1GTL1 1ZINA 1TJYA 1VE6A 3N76A 1Q12A 4UMEA 4D6YA 4JB0A 5DBHX 2JIOA 1P7PA 2GM3A 1PZNA 3AYXB 2XCLA 1M1YE 1J42A 1YOBA 2HCJB 1E1NA 3AB7A 3IUJA 2IV3A 1OXXK 1SUEA 2BLLA 2CFSA 2L0XA 3HO6A 4GMKA 1LJUA 2D2EA 4OHXA 5FTLA 5GV7A 4NCIA 3EF0A 4L5AA 3WMWA 5IJZA 3HXQA 3HB5X 5KPDA 1VG0B 1Z5OA 1S02A 3VH4A 3WWZA 1P1JA 2FMXA 1RD4A 2NM0A 2ZB2A 5AXBA 4DJFC 1P3DA 2R1TB 1KZYC 5AI0A 2G36A 4S24A 2ZATA 1Z0AA 1E1MA 4W5NA 3IXLA 3VNQA 2HT1A 5C8VA 5I9MA 4B0PA 5G3ZA 3CKMA 2QVCA 3CH5A 4R1TA 4U02A 2X19A 4MO9A 3CZQA 3DVLA 1XMXA 1RKUA 3BIJA 1ZGZA 1ULUA 4HCJA 4HH0A 2AH5A 3D7MA 3P26A 3U7EB 1TU4A 2I2BA 4B4WA 5J47A 3K1AB 2APJA 4PV7A 1VHJA 4ZALA 1QVWA 3ELYA 4PSVA 1FTNA 2VBFA 4R3WA 2UZ3A 3NKVA 4XSGA 5FHRA 3IUQA 4BNWA 4AG5A 3MJFA 4NF2A 4A6EA 2R6JA 2FRDA 1O58A 3PEWA 2FEKA 1GZ3A 2RGYA 2CJFA 4YECA 4C7XA 5FWXB 1YZKA 2B8EA 2XVYA 2EJBA 2NYRA 1CUWA 1DJPA 2W70A 4EJSB 5JYEA 3CRVA 1K6JA 5EIAA 5K8UA 3VI3B 2DBVO 3HGTA 4HNHA 4TVOA 1UXJA 4CIDA 1F0PA 1RAIA 1SURA 3JS5A 2ASVA 2Q2NA 2Q1TA 3P4UA 4GBED 1JTFA 2H7XA 4NZPA 3ZEIA 8OHMA 5CD1A 3MJVA 3U56A 4L28A 1F6BA 4C7OA 2JDID 1BS1A 1JHMA 4DCOA 1CZLA 2PEYA 1L9KA 3KTDA 2P2GA 5ITZB 1KMMA 4F4IA 4N0QA 1K08A 3C5HA 2LWIA 4YQFA 2CXRA 4WXRA 3S70A 1HDZA 1QRUA 2MR6A 1AUPA 1TAGA 3K8QA 3ZX4A 4ZVTA 4BGDA 4QXPA 4MI3A 2F8TA 5DGCA 1GR1A 4GVXA 2EW8A 1VRCA 4M9XA 4BBJA 3Q88A 1T5LA 3H2JA 5DW0A 3G0GA 3IEUA 1CJUC 2V7QA 4HYTA 4YP6A 4OHKA 5JU6A 5CXSA 1D4AA 1RYMA 3OQPA 3EXFB 3MSCA 1EESA 2V0GA 3EVTA 3TIIA 4OB7A 5DGDA 3UV6A 1R8QA 1XZAA 1ZNXA 4YS6A 4V0MA 4MSUA 4UUNA 4CFYA 1T8YA 4CLRA 2XF2A 4J7AA 4J4TA 3MF4A 4RPIA 3DXXA 4WERA 2CUTA 4NYJQ 1R10A 1E6KA 2VP5A 3H1GA 3ND7A 5F2EA 3N86A 2EBWA 5E7IA 2WIDA 2I2DA 2QVYX 2ZT7A 3JVIA 5IT5A 3K0AB 1YQUA 3FROA 3RVOA 5FUVA 2H65A 1XQ1A 1RXEA 1AKNA 1O9GA 1RRGA 4RXMA 3SSAA 1HDEA 5C34B 1BX0A 3UWMA 1LDGA 1P1KA 5ALLA 2ZJOA 3A9RA 1SM4A 5J5AA 3RG2A 4EFMA 1XEXB 2OC4A 3OCWA 1U2QA 5E9WA 4ARSA 1W7AA 4CFZA 5HDQA 5G0TA 1DJMA 4QTUB 2R6FA 1EU1A 1I1HA 3GFTA 5FEUA 4Q82A 5EEGA 5JE8A 1KAMA 2WVHA 5BSGA 4BRSA 1E4YA 1CJSA 4R1OA 4BAUA 2A8YA 3NBUA 2H6EA 4GECA 3O8QA 5AFSA 3O1HB 2GARA 3BTVA 3KQVA 3QFSA 4AY5A 2MSLA 5COBA 1QG2A 2OOKA 3GMDA 5FWAA 2ATIA 3BGOS 5GZ6A 3QE3A 5IH3A 2WWVD 3TL6A 5FUBA 4JI2B 4RTMA 1FRVA 4TMZA 2VEDA 1TJNA 1AGXA 4FD3A 3WKDA 4BZQA 1WMAA 2HA0A 3V3TA 2VXOA 3H1EA 3KOZA 3MFQA 5DX8A 1LV7A 1N5MA 2GN0A 4TKLA 1U8UA 1RQRA 1VCHA 1UF9A 5CG2A 5I4IA 4TZ6A 1FNCA 4CUJA 5ADHA 3R5KA 1RQLA 1OWPA 1AO3A 4RM3A 3EIUA 3WKCA 4ZI7A 5DCUA 4JQSA 1HI9A 3VR1A 3SLRA 1CX9B 4AM8A 3G6KA 1D6JA 2J33A 3AVPA 3U39A 3SFVA 3AVXA 4LSMA 1MX3A 3LY8A 1W29A 4LWPA 1E92A 2RIRA 1N6HA 1NXVA 2V98A 4PN7A 4ZVVA 4ZU3A 2RMKA 3AERA 1FX0B 3VR4D 3KEQA 3CH4B 3Q5EA 3WYGA 4PLTA 2QNRA 5JS8A 3QOFA 4GM1A 4QECA 1NVEA 2GSDA 4RFSA 3FPEA 3N74A 4PAMA 5HHTA 3I9NA 5AW2A 3JASA 2BGLA 1I24A 3EGEA 2O9JA 1Q0PA 4DTIA 2OXIA 2JIMA 4UEQA 1CZOA 1NI3A 2DBYA 3DEAA 3SK0A 1F6DA 1A5AB 2P2CA 1NZJA 1G8SA 1ZNZA 2PM8A 3WL5A 4I1IA 5K8JB 1WEKA 3LRTA 1BU8A 3Q2IA 1U3TA 4WN9A 2R2AA 2XUDA 2DETA 4FHDA 2QJRA 4HBZA 3ER6A 3GP3A 4WXHA 3JXEA 4JJ6A 1XRJA 1UP4A 3BXFA 5KTYA 1QFJA 4JBHA 3ZV5A 3RJ5A 1RXUA 2WYOA 3KJNA 4PEVA 1GQ2A 3FB1A 2AR7A 3NT4A 2HNBA 2QM3A 2WWWA 3M6MD 2VR1A 3BTUA 3PGJA 5K8VA 2VRNA 3U81A 4N8DA 1VJCA 1ZKDA 3G23A 5BSRA 4BYMA 3ZW9A 3HB9A 4JI5B 3MCTA 3JZAA 4FR2A 4WKOA 5GIPE 1VA4A 1CUCA 4GPTA 2O3JA 4YMSA 5LZ8A 3HR7A 3OVMA 4EUHA 3EDCA 1QZUA 4M37A 5L7TA 4OM7A 4C76A 3CX8A 1R00A 5E6SB 5G0WA 1SCNE 1U3VA 4CHTA 5JWRA 3L7OA 1IOZA 1OCEA 2D7JA 4O4JF 4A91A 1LDYA 1CUYA 5DBFA 3GLIA 1Y3DE 1QTIA 4YC7A 3K09C 2OCBA 2WMOB 4L72A 3RROA 4A1FA 4N7MA 3QTTA 2IXEA 2I6QA 1YTUA 4LJSA 1TVKA 1I2BA 3C6XA 5BR4A 3NMUF 5LB4A 5F2NA 4TRJA 4RNDB 4L15A 1A0OA 2L69A 3PVCA 5J40A 1F7VA 4JC0A 4OX9Y 2H5LA 1TZJA 4BBPA 4HPXB 3DKRA 1WVMA 2VRCA 5FO1A 3ICEA 4IY1A 5C5DA 4A36A 4KXQA 4M9UA 1KXZA 4R2XA 1DTWB 2ZJBA 2A5JA 2CL7X 3OQJA 4LQLA 2Q3LA 4BWVA 5BWMA 1RWPA 1MJFA 2FPGA 1BKYA 2YDXA 3H8WA 4IBOA 4X1KA 4Y2XA 3BH6A 1O6ZA 3WJ7A 1B42A 4KO4S 4RKWA 3ECAA 1T2UA 1ZXBA 2G7ZA 3M6UA 4QBKA 5IBCA 1SPXA 4KPEC 3LWNA 1XB2A 4C2BA 1MO5A 3NFRA 2GPWA 4OHZA 3QV1A 1ZUNA 4KIJA 3O31A 4GFDA 1NJGA 4YUVA 3JAWA 3PVZA 4A7PA 5JI2E 3DZDA 3UT5A 5K4HA 4FR0A 2YV2A 1IN1A 3GHYA 1N33B 5FEMA 1NVVQ 4NE2A 1YRBA 1PJ4A 3LX8A 3MWYW 1JFVA 1TPYA 1XTSA 3CEMA 4LUCA 4H7HA 1B2LA 4E32A 4LHZA 5I6DA 1FUKA 1T36A 1Z37A 3WBJA 1E69A 2CXXA 2B1IA 3A6HA 2GK3A 2W2KB 3TRJA 5JDIC 1XZGA 3S2EA 5E1BA 4YAKA 3K9WA 3L7BA 4BQSA 1EBUA 1HT1E 1JLLA 1E1QA 1XCGB 3W8RA 5L6MB 1U1DA 1I7QB 1D6MA 4CFSA 4WZ6A 4IILA 2NZUG 3G5AA 2DWQA 3ABSB 3CJQA 2GCOB 2YJ5A 3OQ6A 3OUTA 3TCKA 2HD4A 5DSZA 5EKXA 4UUOA 2YXPX 4LOKA 4KMRA 4L8LA 2GMWA 5FBZA 1UQUA 5AESA 1F17A 1RAFA 2EJCA 3DNPA 3HKBB 4JVLA 1XZ8A 1TZCA 1GT91 3AXSA 5FAKA 5ALRA 2IGBA 3NHRA 4JXZA 4B43A 1KA9H 4PXYA 2GF9A 4TV9F 3UJAA 5C51B 2PGAA 4DSNA 1R3UA 2I6UA 4KGXA 5H80A 1E1CA 4QO7A 3VX3A 5U9CA 1ISMA 4EPVA 2B7BA 3SYKA 2ZAYA 3IHKA 4C0JA 2NVUA 3L0ZA 1XDZA 2F55A 2VDPB 2C84A 3DMFA 4ZN6A 4DJTA 1JR3D 3ZVKA 4Q1VA 2TMGA 1GTZA 4ETMA 5JSHA 1WXWA 1H0KA 1WMSA 4NMHA 4IW3B 2X7JA 4EL0A 2V5VA 2IPLA 4G1FA 2W7TA 3N75A 4ND3A 4RWZA 3AM4A 1XPOA 2EQ5A 4LQDA 4Y6SA 4QGHA 1TMYA 3KKPA 1H3FA 3Q1KA 3HFRA 2BFCB 3ZWBA 3EULA 1OFHA 3DMNA 4N6OA 4IDCA 4QGAA 3ZCVA 4F45A 4BKUA 4AICA 4RDXA 2QL5A 2HZ7A 1D9ZA 1EX9A 1FJHA 2VOJA 3CYFA 1E3WA 5J2UF 3IAM1 4WOKA 3TTWA 2JRCA 2JK1A 4D79A 4DDUA 3N8IA 1BXRB 5I7OA 1O5IA 3BTOA 5J4HA 3MTIA 3PG5A 2GPYA 2JIZA 4DIOA 4OX9B 4IDGA 3IE1A 3HCFA 2P4UA 2QAJA 3AR9A 5DNCA 3GLHB 4HVTA 1L5FA 5B30A 1TEHA 4ZP1A 1TVCA 1I80A 2Q62A 2OT3B 4KAFA 4XIYA 3PV0A 3ZWCA 1W2GA 2YCLA 3HR8A 1ISSA 1FUEA 1V3VA 3KFXA 4TKUB 1L7BA 5C3MA 3FCEA 4B3XA 3WE7A 4AUMA 2YASA 2M6KA 1QYDA 2VJMA 4MUNA 3M5DA 3RSLA 4MR7B 1FMLA 4PSDA 1QU3A 3WLSA 2GD1O 2BUBA 5BWLA 4G5SA 4KI0A 1DI0A 4CE6A 2JA1A 4YQZA 3BXOA 3C4VA 1EFCA 4D3SA 2JJ1A 3SYMA 3VR5A 5BVHA 1WABA 3RAPR 3RC3A 2PU7A 1L7NA 3TB4A 4GUAA 4YWHA 5JS6A 1VFNA 1NMXA 1UK9A 1VPVA 2BJWA 3THYB 3NBFA 3EY4A 2XMRA 2G77B 3IALA 3R4VA 4M38A 4CTMA 5KC8A 9LDBA 2QLTA 3W5AA 1YRAA 5D01A 5KKCA 2COUA 3M82A 3ZE8A 1BTOA 1GVHA 3GEHA 5KNDA 1IIRA 5WRFA 1OX4B 5GADl 1M67A 1HT0A 4H3HB 1UFQA 2WA1A 1A3CA 1KERA 5I5GA 3RU9A 5F1OA 3BA1A 3ODPA 1X9HA 4BVKA 1KFBB 2VPIA 1FYVA 3W6ZA 4DIUA 4YP5A 3AEYA 4J07A 4PR0A 3SC2B 3VPGA 3LFTA 3O4FA 1BMTA 1R9NA 1LW6E 2FI1A 1B1CA 5C80A 4HZGA 4Z0TA 1PGNA 1NBMA 3EA5A 5CYFA 1CQXA 1E98A 2ZJ5A 3SSOA 3TJMA 5D8DA 1J0DA 1R37A 1U2PA 2RKWA 1AZLA 3B1ZA 5HGJA 4N7JA 3ZWQA 1TKCA 1T8WA 1O77A 2WSSD 2IUEA 2XY4A 3T1OA 1P3JA 5JSKA 2H1IA 2ZE8A 1HRDA 1Z4LA 3OX3A 4UQLA 5D1HA 1U9CA 4BB9A 5K0EA 3F5DA 1GPUA 2AK2A 2RHHA 4FSXA 3WWCA 4H3VA 2O05A 5AXAA 1OLXA 3PNVA 4L8GA 5TQ2A 3M3DA 4NFYA 1M73E 3INTA 3LC2O 4OCZA 1SOAA 2R1ZA 3SYNA 3ZCSA 4NU8X 3AP3A 4DG8A 2B9EA 2KJQA 4GPIB 2XWPA 2ABWA 2YJGA 3GCWA 4QVGA 1QVZA 1E3SA 1ZGGA 4LZJA 4MW1A 1KE1A 3V4PB 2DUNA 5B3KA 1UAAA 1G8JA 2Q9BA 1GN8A 1H1TA 3DE4X 4TS3A 4EYOA 3L92A 5LMUB 4MVJI 4ZPXA 5JD3A 1W1WA 2OVFA 5B2ZA 3KOYA 4QDJA 1KYVA 1X1BA 4ENPA 1I4WA 5JO0A 4C7JA 2FSUA 5FOVA 4IYJA 4LC1A 3TZKA 5JVDB 2DOKA 2DPHA 1F2TB 4I4TF 5AYVA 2KX7A 4G8CA 4IIYA 4W5HA 3QKSA 5IP5A 2PO7A 4D80A 3A4YA 1JS1X 3EFOB 3SBXA 4JOQA 4HOYA 2BW0A 5E7MA 1NMYA 3RRFA 1KI6B 5LYYA 3AFNA 2ZDHA 1MEOA 4EWLA 3L0PA 4JP3A 1LJ8A 1QDEA 3R7NA 3IT0A 3ZE7A 2YN2A 4K3UA 1N0VC 1R6AA 2WQ7A 4CIYA 1JAHA 3A4IA 1F2UA 4WFIA 3WLOA 4MQBA 4D8VA 3K6KA 3FSGD 2OY0A 3NM6B 4MQMA 4XB2A 4L5BA 2P6MA 1OD6A 4NESA 3OJFA 5AKLA 2A0WA 2ACEA 2HMWA 3AF1A 1BD3A 4B6EA 1WHSB 1TC2A 3HH8A 4EEZA 2I1WA 1LB1B 1P1HA 4YXFA 4YR9A 4ZEMA 2BMVA 4TZTA 3KC2A 1M6NA 4LJAA 3MPOA 1NQAO 2WUGA 2CJWA 5L3SB 2H4HA 3EVEA 1MR3F 2QY6A 4OEHA 4V24A 3L0SA 4CLOA 4JQZA 4K9NA 4RS4A 1VLZA 2HEIA 1PR5A 4IGEA 6GPBA 1LK0A 4JI6B 5HX7A 5I7EA 3KQMA 8GPBA 4R5MA 4C5BA 3P4XA 2JJQA 3UJHA 2HXSA 3PHBE 5L6LB 1NNUA 5KYGA 1ZM3A 1Z6PA 3B5IA 4FI3C 4CDMA 3GT3A 4BFVA 4GP6A 4K87A 1P77A 4R84A 3ZHRA 2YRXA 4XFJA 3KS9A 3VI4B 4MWOA 2ZI3A 1JXAA 5FCDA 1OB2A 1DQYA 1A27A 2XSZA 4KJXA 1GSAA 2WIBA 3EVCA 3CRZA 3L8YA 3LBAA 2AYZA 5A2GA 3DXYA 3DHVA 5KB3A 5ESRA 2ST1A 2FWAA 4NULA 1GVNB 3CRW1 3WSVA 3MJDA 3N07A 3N53A 4XUDA 2AG8A 1UKZA 1Y4UA 2ZBRA 3E8XA 5A6SA 4GNRA 3D3QA 1EFVB 4ERNA 2E55A 4YLGA 2C8JA 3IB3A 1ND6A 4IUDS 1E9CA 4WY2A 5AI4A 3MRSA 2GXSA 2C00A 2WPDA 1IUOA 4Q34A 2JATA 3GJ8A 2PMDA 2AQKA 4OLHA 3T4EA 5HMMA 1Z33A 1H2FA 4I50A 4E22A 4KQ1A 1D2HA 2Y05A 5A5DA 5JZBA 3ZGVA 4RTKA 3N1UA 4QUAA 1LX7A 3D31A 3TTUA 4ESHA 2YIMA 4DMCA 5B58T 3N8GA 3UTCA 3E3OA 3UKJA 3GGPA 3W4IA 1KP9A 2IYQA 3LU1A 2ZP1A 2AJCA 1NYTA 1EFPB 3G2IA 4P6VF 4EI2A 1Z6YA 2QUBA 3BDAA 3GZNB 1JI0A 3T0GA 3HV2A 1JUDA 3NS7A 1YHYA 1JSLA 3CIOA 3SQNA 3MELA 1IN8A 3P0IA 3DV0A 3GF4A 4LXYA 3LL4A 3Q8LA 5EXSA 2IYOA 3E1SA 2NIPA 4Q6BA 4OQQA 2OAP1 4G0YA 4ER6A 1FXWA 1TLFA 4ML3A 1KYQA 3DULA 3RQIA 2MT9A 3KKEA 2I4LA 4XQ9A 4JN6B 1ESDA 1W19A 3MCWA 5JNWA 3GLGE 4Z51A 1JDBB 1YTLA 1BOFA 1GN9A 2IX9A 2J9RA 1M8JA 3OF3A 3URMA 2C31A 1Z08A 3U4QA 2KE5A 2GZDA 2O48X 2UYQA 4OFWA 1OI2A 2Z30A 3AI2A 3B6ZA 2ZR7A 1MOSA 3B1VA 3ZWKA 4HNUA 5MGNA 3G9ZA 3Q8WA 3WGNA 3L5OA 2G5GX 3KUXA 4IIJF 3BMXA 3WWDA 3CLRC 4GEGA 2XKJE 5EWLB 4XTRA 4CM6A 5JD6A 2FZ5A 1UT6A 5GWXA 5D51S 2W00A 3AEQB 2N9UA 3U7GA 3COJA 1GQRA 2YQZA 3WDLA 1QO0D 3FCAA 2CXNA 3VR5H 4CMJA 2QGNA 4LWQA 2FCAA 1P0PA 2JI9A 5BVGB 3EDRA 3KG2A 5TY0A 4EFLA 3PEEA 1UBFA 4M1TA 3AY7A 1TVEA 1EDEA 1U80A 4FLFA 1U7HA 2PWBA 3IOEA 5KYXA 4EHHA 5B64A 3U9SA 1K7XB 3Q7PA 1MEEA 5C8DA 3K32A 3T06B 5KNDH 4G5QA 5AOCA 1SC4A 3BHNA 1QIHA 4F2WA 1IH8A 2VHJA 2X40A 3GGSA 4NHEA 5CB0A 5I7UA 4KHPB 4HAOA 4GDMA 1NN0A 2FMHA 2XB6A 4LNAA 3EBPA 5DHQA 4URHA 3T7SA 3LOPA 2H4JA 4CIVA 4ZI3A 4XWKA 2VHCA 4I8XA 5CM9C 3TQIA 2PZKA 1NN5A 4YYEA 3EGCA 3IS3A 4YROA 3ETJA 2BGNA 3RKSA 1D1SA 1NXSA 2IIBA 2P91A 3KT8A 3S4YA 2C97A 2XNDD 3DNFA 2VRBA 4B76A 1C0EA 1E99A 1QOPB 1SD2A 2OBMA 3L9WA 4MLDA 5CHYA 2OBNA 5KQLA 1LUAA 1MQ9A 1AV6A 1RCTE 2D6FA 3PZRA 1UBEA 1J33A 2FN3A 2AUTA 3DBLA 1GFWA 4P36A 1KTIA 1HEIA 1KNQA 3DZ8A 3HB7A 1J20A 4ZEXA 3VYTB 5CDSA 3TQSA 1JL3A 2UZ1B 3A4TA 4GXNA 4XWTA 4MRMB 3EW7A 5T64A 3P0HA 3UH1A 1EG2A 1WNTA 3QXXA 5ENZA 4WOCA 1ZMTA 5HQJA 3ME5A 3DHWC 2ZXUA 1DJOA 3A10A 2VSOA 3JW8A 4D4KA 2R1VB 4DA7A 3Q3HA 1VXOA 4UCXA 3QELB 4OQZA 4ZVUA 1CDOA 1D2MA 2EKZA 2WDZA 3RWOA 3WFJA 2IXDA 4C3OB 2DEUA 3OU7A 3CNHA 4KFSA 4OHVA 1JBQA 1AM4D 1L0BA 4LFCB 3W4JA 4UULA 4AP9A 1JGTA 3FUCA 2O2XA 3MTAA 3Q1LA 1ISFA 3SP1A 3B38A 3X1KA 3L2OB 5F1YA 5CB4F 4V0KA 3H4VA 5EVJA 2V1UA 1EMDA 4C6SA 1VGQA 1V16A 3OZXA 4UNPA 3MTJA 4Q39A 4D3FA 3E03A 5T4FA 1SHJA 2EBFX 3L82B 3TN7A 2ODAA 1NTRA 5CVVA 5C32A 1EVQA 2Q4BA 4ZTBA 3SEZA 4KQMA 1TTTA 5ALUA 3L6CA 5IAOA 3BFJA 5EXXA 5IDQA 5BPHA 4HFRA 1COWD 5CH8A 1HNWB 4WJLA 2H4XA 3TRDA 4W5TA 2J7KA 2C3PA 5LJIA 4R7GA 3W06A 2H2DA 2BI8A 1T4DA 2WKSA 4IEFB 3WGLA 2CF5A 8ABPA 4OFBA 3B8HA 1PLKA 1PF7E 2EFCB 2V6IA 1AUOA 4XDGA 7YASA 3TF5A 3FTEA 4DPLA 2QXUA 3Q5GA 1VLVA 1AT1A 4HDOB 4V2IA 1DO2A 3ABZA 1R18A 3BJMA 3HU3A 3MWFA 4HUQA 3A9VA 5AWFC 1BHJA 2CNKA 1WLYA 3AK4A 3KO8A 4Q6WA 3OE7A 2HIAA 2L19A 4JHXA 4B3CA 4CEJA 1SWVA 1ACJA 2FE4A 4M99A 2ZSKA 4PO8A 5LN1A 1XNGA 3AU9A 1L9XA 3KU1A 3DMDA 3S1AA 2BEWA 1VM6A 3CO5A 3ZN2A 2XIJA 4WLEA 2P6PA 3VH2A 4C88A 5IASA 1SU6A 3CLUD 2FX3A 3JAMA 1OI3A 1X1DA 1ZVKA 1NJ5A 4IDPA 2DFLA 4CJXA 5K3DA 4ABTA 5FWDA 1FLVA 4LHEA 2POQX 4FSHA 2NWQA 5HZMA 2E4UA 2O8DA 1IM2A 3HFSA 3CZ5A 3VPDA 4BNTA 1F7UA 2HCFA 1Z0FA 4EVIA 2O3UA 3T0IA 4GM4A 1R5JA 2V6JA 3GPCA 3TEJA 4AJEA 3GAZA 2SNIE 4OYHA 2DBQA 4FGKA 2W2TA 3H3JA 4YT5A 4DCUA 3IX7A 4RVUA 2I9PA 3GLRA 2DQKA 3H5WA 5KJCA 1YZFA 3CVOA 4Q7JB 5AK3A 2X4LA 4OBEA 5IAEA 1Q1ZA 5DWQA 1Y9ZA 1XF1A 1C0KA 5IVKA 2ZTVA 2VATA 4HJXA 4R16A 5ERYA 4QUEA 5ALHA 1PLJA 3Q72A 3X44A 1HEUA 4O2AF 5LNK6 4C0QC 2ORYA 2RHOA 5JNTA 5A3JA 2GWRA 3PDIB 1Q77A 1XKTA 5KUTA 1TA4A 1B8UA 3QI2A 4W5OA 4ZI5A 3OT1A 1N2GA 3Q3VA 4UJ5A 3GARA 4UAVA 4FE4A 5BSUA 1JEDA 4PQFA 2VHXA 2QTAA 3I3SR 1NI5A 3OT5A 4KX5A 4MLZA 4KQHA 3MPUA 3HYCA 3CISA 2XW6A 3W2TA 3UHJA 2OM6A 5AW3A 1NKVA 5EMNA 2W6MA 2IYVA 4PICA 5DOZA 5EG5A 2OD2A 3CLVA 1GAJA 3DCIA 4ZPJA 3K0SA 1CP3A 1U5BB 1G3RA 5AJUA 5EFZA 5HF8A 3KSBC 4XCQA 1HFEL 1XHFA 4DEXA 4MA4A 3UHPA 6LDHA 1YR9A 5EP2A 3WIOA 1GD1O 5JZ9A 2DECA 2IHTA 1TMOA 2XEDA 3F74A 4UXJA 4EPRA 2LDBA 3U4AA 2W8ZA 2O19A 3TUJC 4C78A 1U8EA 2CFOA 4CKYA 3ITDA 2IXAA 1CZNA 2JJMA 3CX3A 3LUBA 3ZLVA 2D8MA 3K0FA 2A9KA 4NONA 4XQEA 5M2QA 5AHKA 4WK0B 1QRSA 1T9KA 2FSVA 4KSBA 4J6EA 3FYUA 4CG3A 5M34A 1YOVB 1FJGB 3A9UA 5SY9A 2EHDA 3OZDA 4ESOA 1PJ2A 1I4LD 2Y67A 1O89A 4WXPA 1BC5A 5A4AA 2SICE 1U9IA 4X20A 2JAPA 3SZ3A 4LOIA 5BRNA 2WWHA 1J5XA 3AONB 3SHFA 4OSOA 1UOOA 3Q3CA 1FNMA 3F90A 4MIEA 3QNUA 4FFNA 3KX2A 5TF0A 2ZI4A 4KFCA 3N05A 4EB0A 3HTXA 2QMQA 2YX1A 4C4YA 3PJFA 1LDMA 3B5EA 4J0KA 3VHLB 1FTQA 2ODBA 3VHQA 2N47A 4RV4A 3W3ZB 1O0CA 4ZCIA 3FRIA 1TF2A 4UDXX 5KSPA 3BBLA 3V34A 4MI9A 1KHTA 2AD5A 1NRXA 2HLDD 1Z45A 2REBA 3CCCA 3GUUA 3MWDA 1P2SA 2QXTA 3KLNA 3DOJA 3R4CA 4L50A 3KJFA 1HG1A 1UPXA 4M83A 4XD7D 1UWLA 4C2AA 4DANA 1W36D 1DLIA 2ZIZA 4RVDA 1TW3A 4BCBA 4D6XA 3ZJTA 4I55B 1OZ0A 3I83A 5J2TF 1CC1S 3H19A 1SZDA 1BYIA 3SIXA 2E85A 2H0RA 1MB3A 2FW1A 2VNHA 2Z3WA 3DE0X 4MA0A 4U63A 5CLGA