3GI1A

Crystal structure of the laminin-binding protein lbp of streptococcus pyogenes
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
277
structure length
254
Chain Sequence
TQGMSVVTSFYPMYAMTKEVSGDLNDVRMIIHSFEPSVNDVAAIYDADLFVYHSHTLEAWARDLDPNLKKSKVDVFEASKPLTLDRVKLYDPHTWTDPVLAGEEAVNIAKELGRLDPKHKDSYTKNAKAFKKEAEQLTEEYTQKFKKVRSKTFVTQHTAFSYLAKRFGLKQLGISGISPPSPRQLKEIQDFVKEYNVKTIFAEDNVNPKIAHAIAKSTGAKVKTLSPLEAAPSGNKTYLENLRANLEVLYQQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Laminin-binding protein of group A streptococci
publication title The laminin-binding protein Lbp from Streptococcus pyogenes is a zinc receptor
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 86
structure length 254
sequence length 277
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3gi1A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3gi1A02
4K3VA 4ND8B 4FKMA 5CR9A 4WN9A 4FI3F 3TEFA 2R7AA 3PDIA 5GGXA 1M1NB 2AFIA 3R5TA 2OV3A 4OVKA 3BE6A 3EIWA 3K1AA 4HMPA 4NNPA 2X4LA 2MINA 3MWFA 1K7SN 2XY4A 1G20A 3AEQA 3PDIB 4WN9B 5FLYA 4M7OA 2AFIB 1QH8A 4DBLE 4OXQA 3AERA 5BVGA 1EFDN 2WI8A 3TLKA 2OGWA 1N4DA 2MINB 2PS3A 2M6LA 2O1EA 4G09A 1QH8B 2XH8A 3BE5A 2AFHB 2PHZA 3AERB 1H1LA 5BVGB 4UTPA 2XDQA 3ZKAA 3PSHA 2PS9A 1XVLA 4LJSA 5KOJB 3AESB 1H1LB 4IRMA 4WESA 5HX7A 4MLZA 5M2QA 4FILA 5B58T 4WZBB 3HXPA 5CX1B 2PS0A 4WZAB 5M34A 2XV1A 3MD9A 4H59A 4WESB 1KARA 4LS3A 2OV1A 3ZK9A 4N01A 4MX8A 1K75A 1MIOA 4NNOA 1QH1A 4HMQA 4MO9A 4H0FA 4UDOA 5GGYA 3K1AB 4XPIA 2RG7A 2ETVA 3MWGA 1G20B 3AEQB 5KOHA 1MIOB 3AEKA 4INOA 5M3BA 1PSZA 2WHYA 1L5HA 3U7QA 3UJPA 1N2ZA 3AEUA 2OSVA 3PSAA 5KOHB 5BVHA 1G21A 3AEKB 1L5HB 1M1YA 3U7QB 5KHLB 1K0FA 2XDQB 3LHSA 4B8YA 4WNAA 3MFQA 4TKVA 3EIXA 2XQVA 1M34A 1FP4A 1M1YB 4UDNA 4PM4A 5I4KA 3AETA 4PAGA 1QGUA 5AFSA 3HJTA 4WNAB 5JJ5A 2Q8PA 4TKVB 1M34B 2Q8QA 3R5SA 4GICA 3ZTTA 3NU1A 1M1NA 3AETB 2YNMD 1QH1B 2QI9F 5JOQA 3ZK7A 4BBPA 4XPIB 3TNYA 4HN9A 4HMOA 3CX3A 1KAEA 3G9QA 3GI1A 3LI2A 5JPDA 2M6KA 3HH8A 4G07A 5M29A 1TOAA 3AEUB 4FNAA 4OXRA 2PRSA 2R79A 4MDYA 5BVHB 4UTOA 4TKUA 1G21B 1N4AA 2AFHA 5JG7A 1KAHA 2YNMC 4CL2A 1N2CA 3MINA 4INPA 4TKUB 5HDQA 4ND8A 1PQ4A 3AESA 5KOJA 1FP4B 4WZBA 1ESZA 1N2CB 3MINB 5CX1A 2XUZA 4WZAA 1QGUB 1K2VN 3ZK8A
chains in the Genus database with same CATH superfamily
3NIWA 1PCXA 1ZONA 1IHYA 1Z3CA 1PJZA 4UCXA 5F1KA 4E07A 1R18A 3KYCA 1Z9BA 2WWHA 5K4GA 3O92A 1BXZA 1J21A 5GOTA 3AI1A 3N5CA 4NOLA 5EQTA 5FQNA 5IK2A 5ADHA 2BEUA 3KZOA 3AH8A 3C8UA 5F64A 5T6BA 5EP2A 4OQNA 3R3HA 5DGDA 1M75A 3B6ZA 1XMSA 3FSRA 4F5WA 1WXEA 4NYIR 3T54A 3L1IA 2ATXA 5DNDA 2WOOA 3IV6A 4W6QA 2WNSA 1YJCA 2FZCA 1PFGA 2WIAA 4B35A 2VNAA 3CLRD 5CFNA 2WWTA 4QPCA 4CUJA 5KX5A 1R8YA 2FMKA 4X6YA 3IPRA 1GL7A 4YHHB 3B36A 4PR0A 1UFKA 1W76A 3FGZA 3VU0A 3FHTA 1XJ0A 1U28A 3QE4A 3P2IA 4EUEA 1UJNA 3CX8A 2NU9A 2VPZA 4N7JA 4Z4QA 2CZQA 2QENA 2VZ0A 2JI6A 3T1VA 4GVXA 1NRJB 1W59A 2A5DA 3CNLA 3L49A 3NGLA 3PNVA 6AT1A 3TOSA 1QP4A 3GAZA 2B25A 2PGIA 2V7BA 1U7UA 3K4PA 3MWJA 1NI5A 1EE9A 3KWJA 3A1VA 2XWPA 1KEPA 4MI6A 4N9WA 4TTTS 4WESB 2MMGA 3GF4A 3Q7IA 5ADWA 4HLDA 1Q6YA 1YA4A 2XB9A 4HX2A 2CBXA 1H69A 4PAOA 5K2MA 1A27A 1V3VA 1Y9AA 5FBLB 1AD2A 3O31A 3EJ6A 2Q4DA 1YH3A 2WSSD 3SYLA 1OWLA 4YJ2A 1W5TA 1TA0A 4IXNA 2F1KA 3LLSA 4ENUA 3T1TA 3F9CA 2QS9A 3GJRA 2EV9A 4RA6A 5JSZA 3P8ZA 2BGKA 4EO9A 3PDCA 5JLAA 2F9LA 3MG9A 3QOXA 5EZ5A 3B7GA 5IAOA 3GHYA 1ZD4A 2QVZX 1ZM4A 1B1AA 1MF7A 4LY6A 5EXSA 1DQZA 4LFAB 3IIMA 1GKUB 4LQ4A 1DXQA 4NF2A 2PLFA 1FLNA 1HMYA 1N8KA 2HMUA 3F8WA 4QA9A 4ZOEA 5DOZA 3E8XA 1P5ZB 3RW9A 4BASA 2C2YA 2G83A 3E27A 4RTJA 4B6OA 1KI7A 1VPVA 3HDYA 1K4MA 1O54A 1X19A 3HMKA 1QQ5A 2I4NA 3PPWA 2I4LA 4P31A 4PZEA 5DEOA 1ZW6A 4S3MA 1QVVA 1S2DA 2REXB 1WMDA 2I3GA 1HC7A 2IZ7A 3M1YA 4J0IA 3RAFC 2GAJA 4ZARA 2C5LA 3EVDA 3V5NA 1XLWA 3P94A 4AXXA 2B4YA 3ZWKA 1XDWA 4W8HA 2CNBA 4CM9D 3D4BA 4PFQA 2P30A 3IODA 4U8GA 4FFNA 2GDZA 5E9JA 4YRGA 2C2XA 3ZC3A 1VHWA 5AXDA 4DLBA 2XCOA 5KVAA 4IDFA 3RFXA 2WU0A 3GFRA 3W5VA 2QTVB 3N3AC 3GGPA 3ZCUA 2UYQA 5K4AA 1G42A 2E6KA 4TT8A 1A82A 5F4BA 4ED9A 1H8EA 2J9GA 2QYOA 1A3CA 3O5AA 1TMOA 3I4FA 4OU5A 1OA0A 3EGIA 4TMTA 1R00A 3PEUA 4FFSA 2FOXA 1AY0A 2UVPA 2V7XA 3HYRA 1OTYA 3JD2A 1J5XA 3N5KA 3KR9A 5TQ2B 1ACJA 3RYFA 4CQLA 5PGMA 2I55A 4DNQA 4LZOA 3R8CA 1D1QA 1Y5MA 4OMUA 4F3YA 2UYGA 2DF8A 5LIRA 5ER9A 2C42A 4E5NA 4IO0A 1DXHA 1L3BA 2HF8A 3PNYA 3R0VA 2RGXA 3MLEA 3SHQA 2R1VB 3WLKX 2J9YB 2BFPA 2FSHA 2O5VA 1L1EA 2ZUCA 1GADO 3BSSA 1G66A 2N1MA 5CXXA 3VR3D 4W5HA 5D5HA 4E2ZA 5BVGA 2X40A 2D1FA 1WL8A 3ES9A 4TMYA 2BC9A 4Z0HO 3HY6A 4X97A 2E0IA 3GEIA 1IM8A 1NN3A 5LQAA 5CT9A 4ENSA 2EYUA 1P2TA 3LOUA 4UBJA 5JH7B 3BBPA 1IY0A 5F98A 1ULBA 3JR3A 4EJSB 4TVKA 2ZRFA 1PDOA 4WZBE 2ZJ8A 1M2JA 3WK8A 1TL7C 5COQA 3GFSA 5EZYA 5DULA 4HDSA 3TFQA 4JJAA 3FFXA 3F6SA 4N0QA 4NEGA 5D8DA 4CPDA 3S7ZA 1I7PA 2CXNA 2VHYA 1O57A 1SZCA 3N8NA 4GM1A 3EFBA 4LE1A 4Q1AA 5TEWA 3TNDA 2JHFA 2V3VA 3O83A 3PQ4A 3Q10A 4KIUA 3S2GA 1RCTE 4Q34A 4RZ2A 4XW2A 4Z53A 4S2EA 1Q77A 3ROQA 1MIOA 2D1RA 2HJ9A 1T8WA 2IHNA 1ZI8A 2EW8A 4RABA 5AI9A 2BRUC 5DBFA 3AKCA 3VSBA 6YASA 2H1OA 2EL7A 2C3OA 3DHNA 3M2TA 2A5LA 2IBMA 2FHPA 5CA0A 1W36C 3E4DA 3DP9A 5JS1A 4Q7KA 4COOA 2IT1A 4DLRA 5DT9A 5EZYF 4EGJA 4FN5A 1ZCBA 4KACA 1SVUA 1RRFA 5BW6B 5I7SA 2HLDA 1GCIA 1R8SA 2W2PA 4GWGA 4K5QA 4QFCA 4CF3A 4QUAA 1GZ5A 4G67A 3TW0A 3O4RA 3T4PA 1ZI6A 3ILXA 2AXEA 2H9IA 4RHYA 2XVZA 4HH1A 4M3NA 2HPVA 2CUZA 3DE2X 1TA9A 3RFVA 5HP4A 3DDOA 3KQOA 5HUQA 1XPJA 4R3UC 2OHIA 5HHTA 1O6GA 4B6QA 2ZJ7A 2ZSBA 2QT9A 2QPTA 5LQCA 3WTCA 5K0NA 1I9GA 4WAUA 4XARA 4JX8A 2AJBA 3WKEA 1ZXXA 1SUAA 1J0CA 3D7KA 1LWNA 2H4ZA 4IMIB 3TD2A 1YTUA 3HUTA 1PFKA 4DLNA 3I52A 4DR1B 1Y98A 3EPLA 4KMMA 4B6PA 2X6QA 3EZ9A 1WUHS 4ENTA 5DP2A 2XE6A 3A10A 3F78A 4W1PA 1JQAA 1DX4A 4JFAA 5EJ6A 1F0NA 2CXQA 2GN0A 2GM9A 4GSKA 3GARA 2RHBA 3NB0A 1G291 4O2AA 4CDRA 5A1TA 3V4LA 3DAYA 1MXFA 3IAM1 4BQFA 1G9SA 2JLUA 2PEZA 3HCPA 4OQZA 1RR6A 3TQTA 3BIWA 3G9XA 1J2RA 5LWQA 4D0GA 1PSDA 2XF2A 1CUWA 1NBAA 2IBTA 2I3AA 4G63A 4O4JF 2JLYA 5BMVB 4C1NA 2B4KA 1DTWA 2QD4A 2ZE6A 4XVRA 3QM1A 3R77A 3L7BA 3EG9A 1YB5A 2NSHA 4A2QA 1R16A 1UT8A 2J30A 3D2LA 3I9V1 1CRPA 1U7ZA 2B7BA 2I33A 1P4AA 2QB5A 3IBSA 2GPJA 4KQKA 4RD0A 4DSTA 3SE7A 3L7IA 2VHQA 3COSA 4HSEA 1QIDA 3SX4A 1EIZA 5IC6A 3OF3A 5L3SA 2NO7A 1TKRA 3EWAA 3NKLA 4LTMA 4JJ4A 2Y77A 3FWZA 1N9ZA 1OYWA 3A04A 3ET4A 2OZPA 1NR1A 4JCCA 1W4AA 5AVVA 3ROMA 4LECA 5BWBA 2B61A 3RVOA 1OV6A 3NM6B 1LK0A 1WV0A 2VRBA 2I6UA 2X8JA 3HABA 1X1DA 4FD2A 4TWBA 2NU8A 1HYEA 2INGX 2QNRA 4JP3A 3ZHSA 1H6BA 5BSEA 4D41A 2FK7A 1K6MA 3VPSA 4BN4A 1RE0A 3TYXA 4HAVA 3EFOB 3EUAA 3BDVA 1PQWA 1QVRA 1LUAA 3O8QB 4R69A 3C7DB 3IQHX 1TF7A 1BDHA 2YICA 3RK0A 1E3JA 2H4FA 2PNFA 4J16C 3R9KA 3MS7A 4M8NE 2B92A 1VE1A 2W71A 4IW3B 3USCS 4AYXA 4ECAA 4XDGA 1UKYA 4RV9A 1VJDA 3U56A 2BDUA 1Z0ZA 1JLHA 4X1KA 2OCPA 3BMOB 2XMBA 4KBYA 4AXBA 5E38A 2W6JA 2Z58A 2GYVA 4H3KB 1SKYE 2ESRA 1L4GA 1L7RA 4ND2A 4MX8A 1ZJZA 2V4UA 4CM7A 1DS6A 1ADCA 1SKBA 1GXSB 2F2TA 3HLYA 5JFTA 2JGJA 3SKXA 5ELXA 1IN6A 5BNTA 3B7WA 5KIAA 1UANA 3DBHB 5KNCH 2G08A 1PUXA 4NJOA 4B7AA 2IDMA 2WYVA 4R54A 4YJGA 2JHCA 1DC8A 3TQQA 2OA0A 2EEZA 3H1FA 2DH6A 2KMLA 1JZTA 1VKJA 1I7QB 1NYTA 3JS5A 4HAOA 3BYZA 1W75A 1UC5B 2WA2A 3GQBB 4WVFA 3M3HA 1WVIA 2WWIA 3VMMA 2VQDA 3SICE 3AL0C 2FE1A 1KSGA 3AUKA 1CJMA 5ITVA 1QGYA 3R6TA 3RAEC 3U4DA 5EEHA 4QO8A 4Z4CA 5GV7A 4A10A 2QN7A 4I55B 1XLTA 4PGFA 1A96A 4AZVA 4CCAA 1KP3A 4KU4A 4EX7A 1M6VB 5KC9A 2QE7D 1WUKS 3CRZA 1G18A 4M0UA 3F7NA 3ZGVA 4TKVB 3WV5A 3AXTA 1HTTA 1M67A 2ZBVA 3DAGA 4Q15A 1RI5A 5DH9A 1GO2A 2C0QA 3GUCA 1BEEA 4P3OA 4DLZA 1GR1A 4N49A 1BOFA 2KHZA 4Z0TA 3QXJA 1QHIA 2XYRA 3SSMA 3PE4A 1V9SA 5CYFA 1F7UA 1ORVA 5DEIA 5C7OO 4Z49A 3UYLA 4QX6A 4FZRA 4O08A 3UXMA 2C83A 2EX4A 2HC9A 4CMEC 2XCLA 5B1EA 1YQEA 3DMHA 4KMSA 4C0LA 3A7DA 4JZKA 4C01A 3K31A 1YT5A 5DBIA 5DNEA 3PV0A 1A7JA 1Y3CE 4NCNA 4BVAA 4M6WB 4ZCTA 1F5SA 1L8AA 5F76A 3WKCA 4ZJUA 2AE2A 3P0FA 4PICA 1KFCB 3I58A 2YUTA 4Q9DA 4RLHA 5G1OA 1CY1A 2C2HA 3E84A 3QF4A 4WLFA 3GL9A 3TW8A 2PWYA 5CAEA 4OK6A 2X1HA 3BGVA 3GAMA 1SBQA 3HVKA 2F3PA 4EYGA 5FI3A 3N70A 1P39A 4ZT2A 1DKUA 4JJ8A 4CMKA 2IUYA 2MMCA 4MIKA 4JNKA 3ZDFA 1KFJB 4WN9A 3TEFA 3VBEA 2UXCB 3E9NA 1XPOA 3TZHA 2XOEA 2Q4RA 3NEJA 4ZDWA 2ZI4A 3CHYA 3AG6A 3WKDA 4PGMA 2JGEA 3AOEA 4TV8F 4KKVA 1DO2A 4YO7A 4J6EA 2JH8A 2CDNA 4IX1A 1RWMA 3AEQA 3ZX5A 3UJNA 4BYMA 1HE5A 1RZ3A 1WSWA 1QCDA 3KZKA 3NBQA 4P53A 3N76A 2OHXA 2IUUA 3WVNA 4EG1A 3QEMB 3S81A 3UOAB 2DYKA 1U3DA 3W4KA 4I08A 3F46A 1M7HA 4IIJB 4AX4A 4D8WA 1H1LA 3GBPA 2B2XA 4TGLA 2A78A 3CB4A 1E4EB 4MJ7A 5H70A 2VSQA 1Q0HA 3DKRA 2A9QA 1UKZA 1C41A 1OD6A 5AM0A 3ZY5A 1ZD3A 3Q85A 4AZTA 5C8XA 1G3MA 4ZYVA 4G9BA 4HUQB 4PRLA 2IVFA 4HEQA 1PKEA 2J7KA 4TXHA 3W8DA 1V5WA 1DUVG 1YR7A 4WZZA 4Q9KA 5JYCA 4W5QA 3VR5A 1H5QA 4BLPA 4LXXA 1FB5A 3CJTA 1CT9A 3DYBA 2X76A 4DOMA 1DAOA 3DQZA 4R2HA 4O4IA 2GAFA 3H1GA 3E5HA 4HNSA 2G7MC 1PJ8A 2GCOB 2PSDA 3JRNA 3NHMA 4PLYA 3T99A 2X5KO 1J25A 3D4LA 3UQYS 4R4JA 4WDRA 2GJAA 4D4IA 2Q6LA 3GRKA 5I4IA 3COJA 1XP8A 1UEIA 2OR3A 4BATA 4XB1A 1PV1A 4Z0PA 1JZQA 3WI7A 2V1UA 4LA4A 2G72A 1ECBA 1H94A 2IDKA 2RHGB 3AUYA 2W2LD 5LXTB 2XE8A 2VP5A 1G55A 4J1SA 4AN1A 1B3BA 3LM8A 2FU5C 1H05A 1KJQA 2ANBA 3V1UA 3KQPA 4K3UA 1EE2A 3GJYA 4BQQA 2DZDA 4ZJPA 1NPTO 1FW8A 4TTVA 4CTOA 3LQYA 2HRDA 2WAOA 1E6WA 1T8UA 1VPTA 4J0CA 4RM3A 1GYPA 1LPNA 1ZK1A 3ZD6A 5ALQA 2Y3IA 1LFDB 1MJNA 4ZVOA 1HO3A 1QRDA 3I9MA 3JASA 3JQFC 3HJTA 2FN9A 2FRVA 1K86A 1T2DA 1VCMA 3WY9A 3VNRA 2ID9A 3I1FA 2DECA 1QRTA 1MT0A 1FXWF 4UAVA 1E3MA 1TT7A 4UBOA 3UK0A 1SG9A 1IBSA 4CMJA 2VYVD 3WOHA 1ZXBA 4YJFA 5JLJA 2AUTA 5BXQC 4GNRA 3FA2A 4NYMR 3ZWQA 3NIDB 3WBKA 3QMWA 2FFRA 1CC1S 3QYFA 5EQJB 4Z7NB 4L4RA 1OXUA 5DVZA 1MDBA 3OO0A 4BO1A 5J4VA 3K9NA 3BFXA 5EY5B 1JG7A 1EGMB 2WFAA 1OX4A 3F5MA 3P9QA 2ZE8A 4I8DA 2FK8A 4OHOA 1P7ZA 4RE5A 3W4JA 2IUEA 1R4MB 3N74A 4IJUA 3U3DA 5IPFA 4DW8A 1HRKA 2DCMA 1BROA 1XZFA 5KU1A 1EUZA 4OFBA 3OZWA 1CF2O 3CN7A 3NC0C 2BBTA 3FPHA 5HIIA 3X1MA 5BSWA 2Q1YA 4R98A 3JYNA 5F77A 3ENQA 4GXTA 4A36A 1GLGA 1I8TA 1EZZA 1J7KA 2P3QA 3IVGA 1UKAA 2IHJA 2WYWA 5KWVA 3EEYA 4RZIA 1Z83A 2ZUVA 5CTJA 1X3SA 3CH7A 621PA 5L3QA 4QU8A 4EP1A 1IY1A 1HR0B 1WCXA 3SJCA 5EIXA 4L4YA 3RBZA 4B6SA 1RHKA 5FULA 1KMHA 2X1MA 3U4HA 3Q7EA 4V02A 3AK4A 3BE8A 1EVEA 4D25A 4KXLA 4RXUA 4HLNA 2Y27A 4S2UA 5REQB 3RKSA 2YRWA 2XZOA 1FDOA 4B4KA 1YU6A 4KWCA 3DMRA 4U6QA 3CUTA 4ZYTA 3CO5A 3LK7A 3M6IA 3P4UA 4QOHA 3NXSA 1XROA 4OG2A 4X65B 1IJFA 1ZN7A 1K63A 3DH0A 3UMGA 2AEFA 1ZGHA 4G1MB 4MJ3A 2DFKB 1SZDA 4WGGA 5HSGA 1FPQA 5LDHA 3QPAA 1H1TA 4I46A 5CVEA 1SXPA 1ZH6A 4KI7A 4MUFA 3AU8A 721PA 1ZOPA 3C3WA 1ZI9A 1UMBA 3M6VA 1VLLA 1UKVY 2EGUA 5AVTA 1YFZA 1P72A 2GB4A 3C70A 4TVOA 5CP8A 2AQKA 3N8GA 2P40A 4LJ9A 3V4PB 4ZAFA 3CR7A 5EKUA 2B0CA 3OZFA 3IE2A 2QXYA 5AKKA 3ER8A 4LYEA 4EG0A 4HZIA 2UZAA 3ZDEA 5CDGA 1B8NA 4EMBA 4Q7MB 2PMCA 4GKKB 4M76B 3QWIA 2C00A 3EXIB 3CNNA 1F2VA 3LYUA 3DCJA 1HSOA 2BI4A 5TC4A 2GILA 4PLFA 3H11A 4W1RA 5I01A 3L4JA 4XM2A 2WFLB 3V46A 3AM4A 3TQOA 5KOHB 2QM3A 1QR6A 3HKEA 3RS9A 1HBJA 2JASA 4GMFA 3HUEA 3UYKA 5IXJA 1OIWA 2FB9A 3B8HA 4IILA 5CFMA 1H2HA 2I7DA 1E92A 3CSUA 3LNTA 5KVCA 3O2QB 1ADJA 5K6TA 3DDWA 1FJ2A 3WMWA 3MFQA 3WYCA 2PYIA 4KH1A 4YBZA 3TLGA 1MHTA 1ICEA 3QBVA 4OP1A 3QIVA 5ED0A 3ORQA 1UIMA 3H4MA 1ZICA 3RC1A 3DZBA 5C53B 1WSAA 1MN6A 4YJ3F 1NZFA 2CLKB 3GH3A 4S1VA 2ECFA 1ZJ5A 2HSWA 4FXOA 3GLFB 4PNPA 1NR7A 1Q17A 4AURA 1EAYA 1XJ5A 3UO8B 3PXUA 2RSLA 1GGMA 3NATA 1NUUA 4U00A 3SYRA 2CDRA 2IPXA 3HPQA 1JN0A 1N33B 2OCAA 3ANXA 4NKRA 2HV8A 5F7JA 4Z1MA 3T7JA 3T0GA 1SXQA 4WEOA 3HXTA 5CFZA 3HXOA 3NQ41 5F73A 4F5ZA 2OXCA 1HDZA 1WG8A 4LXHA 4R51A 4IIFA 3T1QA 4H1WA 2OO3A 3PQ5A 2XTMA 1U0NA 5AM1A 4CG0A 2BZGA 2GVZC 2FCAA 3LUBA 4P0TA 4BFLA 4M53A 1E0SA 1JYFA 4OQ4A 3SS7X 1QE5A 4DCVA 3G0IA 3KUCA 3R0IA 1FFYA 5T4BA 1WWKA 1U81A 1OWOA 1QVAA 4QUHA 3QWHA 2XQKA 1WCIB 4LGYA 4RXMA 4XGKA 2X0EA 1DTEA 2GTHA 2LIVA 3IR6A 5E95A 2RI0A 1CY4A 4JOQA 4A0FA 1Q1ZA 1F5NA 1ZIYA 3LC1O 4FSXA 3NRCA 4ZHQF 1XK6A 3MJ4A 3VJMA 4EOGA 1SCQA 1PVDA 1YULA 4HI0E 2Y68A 5DE3A 5C34B 2WT4A 3N0XA 3SQOA 3G82C 3U4QB 3O3NB 4P5EA 2I62A 1J9EA 4RH3A 2WSIA 3QKIA 2I9PA 3CSSA 4BIMA 1Y9DA 4CTMA 5AR1A 2JHAA 3A1CA 2OAEA 1TAGA 3NASA 3BEOA 3SHFA 4LBZA 4MHTA 1XF9A 4B3BA 4DFDA 2ID7A 4N5DA 1HQYE 3QU7A 1JIJA 1NURA 1CZRA 1UOPA 2DUNA 2JDIA 2WJYA 1PW5A 3MJSA 3NV9A 4MIYA 5FUVA 2VP6A 3UW1A 4LDZA 1Q12A 2Q3FA 4U6SA 3ODPA 1Z0SA 4Q39A 3K6RA 1S8NA 1PZHA 4HBZA 3WHKA 4EJFA 3DLAA 3IT1A 3BWYA 1MJ5A 2E5LB 4HPWA 3MPUA 2Z9BA 4C7OB 1J2TA 2CVHA 3RWOA 4JXKA 1YVEI 4JI3B 4IQ8A 2E9SA 1CR2A 4BGIA 1E2FA 1LC0A 3KUKA 5TEVA 1JSLA 1KO8A 3HWWA 3H1PA 1YRWA 2PMWB 4M0DA 4MS4A 4FZ3A 3EEFA 4GX0A 4HLUC 4A2PA 2H29A 5JY1A 2CW5A 4HGPA 3IDQA 5GJBA 1IY9A 1J49A 5I4CA 3LBFA 4BLWA 1XZIA 1YGPA 1ISJA 3E9RA 3C74A 1GTZA 3IEKA 5E6SA 3ZNOA 4UTXA 5TDHA 2XPCA 2C8LA 4OU4A 2VF7A 3OLWA 3U1VA 3HVRA 1JRLA 1GSHA 1XDGA 2I80A 1UINA 3DBRA 1N0UA 3T35A 1V6SA 2YHIA 4TTSA 5GZ6A 3TNFA 3DZGA 3KVRA 4A7PA 1GTMA 3QJ5A 4HEA1 3UMYA 4G0UA 3K72B 4D92A 1XC7A 3K05A 1U65A 5TPWA 3IT0A 3ZVKA 1UDCA 3R24A 1PAUA 3TBFA 4D0SA 5I4BA 2G7ZA 3Q6NA 4D6YA 3FCOA 3U1TA 2Q9UA 4WT7A 2V8BA 2VP9A 4XIYA 3WB9A 1KBOA 1M34B 4J0GA 1YJBA 4RL6A 3E3NA 2DSNA 4YLYA 1JSCA 5DN6D 1M1NA 1SQ5A 2GTPA 2QUZA 4ZTZB 2F8TA 4Q3NA 1B0PA 2Y6UA 1PHPA 1WXWA 2NSDA 1IY2A 2OGTA 3A8TA 3EZ6A 3B1JA 1U4SA 2RGWA 3OWHA 4M0EA 4P92A 5JDCC 5BURA 3O21A 5FI5A 1H8HD 1VLZA 3KXPA 5TX7A 1R6TA 4ARUA 2LKCA 4ARSA 4B7CA 1FMCA 1OT3A 4G4SP 3MLAA 3JVVA 2X2OA 5TJHA 5HRCA 1TVMA 2WWFA 4X00A 2FVYA 3RROA 1SRQA 3IMEA 3L41A 4MHOA 4RZHA 4AM8A 1XMVA 2B1JA 1VCIA 2X22A 5JU6A 4BQIA 1I4LD 1RP1A 2BRUA 2PZFA 1NLFA 3H1TA 4LUCA 4MKZA 2EJTA 1K68A 1N2SA 2VHVA 2PGAA 2XYGA 3CUKA 3DC7A 4A4DA 4DPKA 1TUGA 3IMFA 3HO1A 1UBHS 2HJSA 2BFCA 3FSGA 3GGGA 2ACKA 3UGKA 3CRVA 4TV9B 4Y8VA 2HEIA 4J0KA 5ALNA 2BF7A 3PDIA 3SEAA 2ZB4A 4JP5A 3I9JA 3THSA 3TS1A 1RXCA 3D3NA 1RAGA 2GZSA 4JJZA 1I5RA 3V1LA 4BAUA 2K7ZA 1P1RA 1VYTA 3SN6A 3VR2A 2PSJA 2BF4A 2HCRA 4UMEA 5KYWB 3KL2A 2YV4A 1GGFA 1A5SB 2O2IA 1E6MA 2Q5JA 3PJRA 2QVBA 3QELA 2X8AA 2PWZA 5LLDA 1KO4A 2G5TA 3BM5A 1SBCA 4LY3A 4TTRA 4F85A 4KXNA 2P9HA 2PU5A 5ILQA 2FZVA 2IIQA 1C9MA 3R3XA 1H22A 4K03A 2D5LA 4XIIA 1CZNA 3FTNA 3P5SA 1YBAA 4PRYA 4HWTA 1KJNA 1Y4SA 1DNPA 3A0UA 3MLBA 3ANTA 3W4IA 1DCKA 3L6EA 1UC9A 4FZVA 3ZE9A 1MEJA 2DWUA 1RI2A 1BCRB 3LDGA 2ZAOA 4DAOA 1ADGA 2BSQA 1E1CA 4I1IA 1T2AA 4IZOA 1AIPA 4XA8A 3JX9A 3LKDA 3LP5A 3ZLUA 5LP6B 1RXUA 3I9OA 3H7IA 2O2GA 4W4TA 3MF4A 1JFTA 1TEXA 3ELUA 3RYHB 5SYAA 4H3SA 2O59A 1SGWA 4MWBA 2P3OA 1NVTA 2O8NA 4V0LA 3IQXA 2H31A 5BORA 1H66A 1IJEA 2OAP1 3DB1A 2C1EA 2IJGX 1A50B 5HMMA 3TN7A 5K0TA 2AKEA 2OOSA 3DVSX 4PSCA 1NZJA 4G0XA 1VE6A 2NYAA 1HDOA 3VR6D 4CZ2A 5KWEA 2HWYA 5LDDC 3CGGA 1K5DA 4C6SA 3VC7A 5K8LA 1JDBB 3VHXA 3OD1A 4HTAA 1JXOA 5DRYA 3L93A 4RHUA 1R9JA 3IS3A 3ZDXB 4ZOAA 4DQDA 4OB8A 3NT5A 2QMQA 3OETA 4JN6B 2XMDA 5A6SB 3O75A 1QR2A 4JKIA 1FQJA 1QQTA 1VCNA 4WWHA 5HRUA 3R0XA 5EJIA 3R6LA 4BLSA 2Y0BA 1NMZA 1G7CA 5LKAA 4KIJA 5GV8A 1ZRMA 2CXTA 3DEZA 3A25A 2GVNA 4EW6A 3L5OA 4J16A 1AKEA 5I7OA 2X5JO 2XQGA 2B4QA 2CYCA 2PYZA 1UBLS 4NJEA 3LRTA 2Z6UA 3K6JA 3AR6A 4FYPA 4IG4A 2JFHA 3N8IA 1OVMA 2YHSA 1EI9A 1FDTA 3CEPB 3O8OA 1NBMD 1QVWA 2CD7A 2PX8A 5E1DA 2OHOA 5C3MA 4NV3A 2G1KA 4W1SA 2FLKA 4Q47A 1TFUA 4JQSA 5CB0A 3I5AA 3PWKA 4FUQA 4OYYA 5ALJA 4F1JA 3C14C 1ZOSA 3I8OA 1ECCA 3P0EA 2FG6C 2ZYVX 3BMXA 5K0LA 3S2EA 1N2CB 1EINA 2DH5A 2GHTA 4W7IA 4CM8B 2Q2NA 5F35A 3DVQX 2VOJA 3G1WA 4JT2A 2YFHA 1QFSA 1IN8A 2CHGA 1V0JA 3H05A 1JKMA 2QSYA 4MIOA 2R4TA 3EGXB 5DGXA 5C5IA 1C1DA 4P38A 3R5TA 5IKPA 2OM6A 3FR8A 4UUPA 1UBFA 2A9OA 2ONKA 3OZXA 3KSDO 5FWYA 2MINA 4PPYA 5JXIA 2EATA 2JW5A 4HS9A 4OL9A 4GX5A 2C4HA 3ICPA 1QUEA 3JQDA 4DC9A 4M36A 3M4JA 3UHJA 3ROFA 3UAWA 4DIDA 3LLCA 1NDUA 3T15A 4ALMA 4KZPA 1YJXA 3S1AA 1N2IA 5DX1A 3DOUA 5B30A 3ZKAA 4JVLA 3H2SA 1HH4A 3QPVA 1FIUA 3AHCA 5ERYA 3AESB 3FNGA 1A4IA 2YJTD 3E9YA 4QTXA 2R25B 4C4SA 3WNQA 5CH8A 4OAQA 2QGZA 5HIAA 4JOCA 4CMEA 4EF4A 3DP7A 3DPIA 4W63A 4MQ6A 1IXKA 2FW9A 3KDPA 2C7GA 3L8HA 4AJ2A 4BRSA 1XBTA 2C29D 5BSHA 4MUJA 1WCWA 3K96A 2WG2A 5DOVA 2QTHA 1WU8A 4FDLA 4BKOA 1K1EA 3VO1A 5IKXA 3FDXA 2OCGA 4RD2A 3I6ZA 5IAEA 4ZXFA 1L9KA 3OX4A 1T9GS 1RM4A 2X7JA 3DAFA 2VNJA 3U3MA 4OQYA 5WRFA 3CRMA 3KXIA 4DNPA 2Y93A 1V41E 2WHYA 3CXRA 3CZQA 5E0OA 4OB6A 4DT1A 5ICSA 2BN4A 2D54A 4AJOA 4M1WA 1EKXA 2XRFA 3DBIA 5DTQA 1A72A 1MFPA 1YBMA 4OFZA 1ZSVA 2P69A 1HT3A 2WUVA 1GNPA 2QVXX 4BJ5A 1W581 2JFVA 2ZVQX 3STWA 1GOTA 2QRVA 4JBNA 1BW9A 3TNJA 3ZKWB 3QU9A 2CL7X 1X7ZB 3EFHA 5CJPA 5K3SA 1OJ7A 1HKHA 3L6OO 2YDYA 1Y9EA 4FFWA 3AIMA 3GMTA 1E9FA 2DCUA 3ZZMA 5JTTA 2F1IA 5ES4B 2A5JA 2W48A 4WK2B 1FEZA 5AOCA 3TTSA 1X77A 4RTRA 4ZN6A 3QPDA 1Z5GA 4FBGA 1DKRA 1YU9A 3QG1A 2D2XA 4LE2A 1YVDA 2H52A 4D1YA 1RW4A 1KL7A 1ESMA 5TQ0A 1YZ3A 3WTBA 4BNHA 4N41A 1I94B 1Y8RA 2HJVA 1WXDA 1FS6A 2ORIA 3DAPA 1DKLA 3V1NA 2C99A 3KM0A 2Q3BA 4RJIA 3IJPA 2PL1A 5GONF 1RVV1 2X0DA 2BEVB 1EBUA 4TYNA 4O2BF 4O25A 3ECSA 5H59A 2HPZA 3PWZA 1XN4A 2BUBA 4PAWA 4CTNA 2VVTA 4FCTA 1C1HA 2J3EA 2JB9A 3FTDA 4RO0A 2OBBA 5EJ2A 2FF7A 3TBKA 1M6WA 2GN9A 3CW2A 4M54A 2H7XA 4IRXA 3OLZA 3COWA 2UAGA 4MJXA 5EJGA 2BFBB 3N07A 2WV9A 5AQEA 4V1CI 4JDUA 1OU0A 4ZPXA 5LA6A 3D6AA 4N47A 1QH0A 4NMXB 3ZYZA 3FOZA 4HO1X 2H57A 3T52A 1XZQA 3L7JA 1ONSA 4MWTA 1OI4A 1V95A 2C2WA 1QK5A 2GA8A 2JEZA 3H42B 1V45E 2XODA 4IGFA 3HKDB 3GJ3A 3NX4A 3FRHA 4YP6A 4ZEXA 4UBMA 1HT2E 1HLGA 4CMIB 2ZR8A 3GVPA 4DUGA 4BKRA 1RKBA 2FZ5A 2UYOA 3WYFA 2ATVA 5BNIA 4AS1A 1IATA 2C04A 4L0MA 3QFFA 1IQ0A 4R1UA 2ZDQA 3QV1A 6REQB 3JQFA 2I6QA 5CD1A 1X38A 2C59A 2AUMA 3OE7D 4WASA 1PS9A 4I7EA 4EMUA 4QYWA 4CNBA 2NP6A 1I7DA 2QM7A 1N25A 4G6ZA 1NVAA 2JFWA 3EQ2A 3SNKA 4D4LA 5ALZA 2OCYC 5H81A 1UMDA 3BXGA 3L0CA 3V3TA 3E2PA 3PGXA 3K0FB 4X94A 1NYQA 4LWOA 1IXRC 4WZAB 1PTKA 1WDMA 3H17A 3N28A 3PWTA 4DF3A 1AKYA 2IP2A 4KW7A 2JBAA 2XNHA 3ZEAA 4CV0A 2CV0A 4GOXA 1FTWA 1YVUA 1E20A 3QFCA 1RKUA 4L28A 1T10A 4XYGA 4Y2YA 4BU0A 5CDSA 5IK2D 4W9NC 4RDIA 5JNRA 3VO9A 2JAWA 2YIDA 4Z3DA 3TLBA 4XJSA 1GDDA 1OLSA 3UWPA 3VM6A 3P9CA 2I6SA 2W6QA 2BM9A 4M87A 1K8QA 2QR3A 2YC4C 4IDBA 2G8NA 4CKBA 1D2GA 3OM8A 3OY2A 4HAWA 4O29A 4DY4A 1HDEA 5M3BA 1P3JA 4R84A 5AYVA 3I5YA 3FNIA 3HFGA 2JAQA 2VN8A 3ORSA 1HE1C 2O4CA 2R8EA 2VDNB 4PZYA 3JALB 4QTUB 3ZY4A 2CJYA 4DMMA 2XA2A 2VPQA 3L0SA 1BNCA 4Q82A 3DZFA 5FBZA 1OPXA 3QVTA 4OF4A 1O8CA 1WUYA 3PA8A 4I1RA 4N7RA 4E51A 4GZLA 3V8NA 1M1YB 3C15C 2DUJA 3G2LA 4LOHA 2EERA 4JT9A 3OO1A 4XWTA 1NJGA 2J67A 4UNRA 3MAGA 3HU2A 4REQB 1UWCA 1VGVA 3ETCA 1R27A 4JA0A 4JJGA 3SFTA 2F8SA 3WE7A 3MRTA 4TMXA 4NICA 1LBTA 1JE1A 4N3BA 4XPIB 4XCVA 5J4KA 4D3XA 1TX4B 1TU3A 4QUDA 4DIKA 3AKYA 1GY8A 3BH7A 3I9LA 4UHKA 2OXIA 3UFXB 3PFNA 1PNVA 4KO2S 2ZYSA 5ETJA 1B0ZA 2X58A 5BV1A 2UUCB 4FGSA 1W85B 2F3QA 3N05A 3IX7A 3T5MA 2XB8A 1CZUA 4A6DA 4CLXA 3C3EA 1Z36A 3VI3B 3R3WA 4HDKA 2P5TB 1XZDA 3VJLA 4BX9A 2HSJA 1UKBA 3O9ZA 3PUWA 4PAQA 5IYZF 3RHZA 1JVBA 1M0WA 1R6VA 2HIAA 3EJWA 3GN1A 3TPZA 1WD7A 4LE0A 1IUKA 2PX4A 4L76A 4RIFA 1EFVB 2JHGA 4TTQA 4ND8A 4DPMA 1P9OA 2IIPA 1NUAA 2O0HA 4TROA 3WGKA 2EL9A 1WOMA 3ZWPA 1TEVA 4EG7A 5EYPA 4Y3UA 3S2ZA 1FP2A 3L8MA 2JVKA 2Y9MB 2CMDA 4OQLA 4RJJA 1UF9A 3WLLA 3UZUA 4V0ME 1ONNA 1L1FA 1Q7BA 4YAFA 4I5EA 3ZI0A 1LPAB 4S35A 3DFKA 2DM6A 5AD1A 1Y9JA 3GJ6A 3LDUA 1XPUA 4YJHB 2IU0A 3OQPA 4URZR 2Z5VA 5K3FA 3NP9A 3CXUA 2AI1A 1JLLA 2X23A 3AF3A 3OPYB 4I3GA 1UZNA 1D9XA 4ZI7B 5EXXA 2J1LA 3HWX1 4KOAA 4HD8A 4NTZA 4QTTB 4CLHA 1SQSA 5A3QA 2BTQA 3AUAA 1ZISA 2WFZA 4YAJA 1PVOA 3QWFA 4NOJA 1Y6RA 1H8ED 2RGDA 2COUA 3REQA 4K2AA 4DDKA 4ZYWA 3ZD9A 1G17A 1Z47A 3C6BA 1D2RA 4HQKA 1NQXA 1YA8A 2DBRA 2XYPA 2YJ5A 3AJAA 4R41A 4HWPA 3KC2A 1GTL1 3OECA 1KERA 3JQRA 3PRKE 4MB2A 4QXMA 1LPMA 1WE2A 3U3ZA 2JAOA 4O3FA 1W2HA 5A3RA 4LJRA 4G0MA 1Q7EA 1OILA 1SBIA 5SY9A 1GDHA 1E3WA 1U0TA 2M98A 4IDGA 1T35A 1NF9A 3R40A 4X61A 3N53A 3E2IA 4PY2A 2XMSA 2HHCA 2J32A 4OH1A 3Q8MA 3ZDAA 1DBVO 3E18A 4GLJA 2A84A 3FETA 4J0QA 4NAHA 1PG5A 3VPXA 2DRIA 1E3QA 3D0KA 2GARA 4P81A 7REQA 4NPAA 3P9SA 3DMFA 4LF9B 3DBVO 2J5BA 3DAOA 3DB2A 3T94A 3HE3A 3W8FA 1PW7A 2ERYA 2AMYA 3AP3A 2HQOA 3S2IA 2I0FA 1RIIA 2D5BA 4M1OA 4E94A 2H51A 2D0OB 3W34A 1NWCA 3S3TA 3HN7A 4KEAA 3KOZA 3Q0TA 2QDXA 2CUNA 4AZSA 5ICEA 2ID4A 3WL6A 5CLFA 4NCXA 4A3SA 2NZUG 4EARA 1TKBA 1ZMBA 2ICAA 3E7FA 3LUFA 4QVGA 1A9YA 1LVUA 4XDZA 3EZLA 1I0LA 1QHSA 4H6XA 4ZK6A 5JCXA 1TAQA 3K70C 3DEHA 3MWEB 2OBLA 5F12A 3BT7A 1MKYA 2VJMB 3GCGA 5DO9A 1YRYE 1OGYA 3G2KA 4C2UA 1K3TA 1Z33A 2H4WA 1DXOA 1Y48E 1MVNA 5DLYA 1I33A 2JFGA 4ZOLB 5B64A 3H3XA 3NJ8A 4UQOA 3U62A 3PEWA 1AGRA 1IXSB 1IZ7A 2GTIA 5DISB 4HLUA 5E3IA 4BV8A 3ELWA 4BVGA 5BT8A 4J3FA 1P18A 1A5ZA 4BNJA 3X2EA 1EFRA 2ZANA 4AJ1A 1JHMA 1A77A 3K5PA 1XUOA 3PUZA 4TUYF 5CT4A 3O1IC 4B0OA 4V0RA 1ABEA 1Q1AA 4A1OA 1AQYA 4GXQA 4JH0A 5FBKA 3BKXA 1BE8A 4PINA 2JGRA 2VH5R 1DZIA 3UJ6A 3UHFA 1NF8A 4R8MA 1M5UA 2IHVA 2GMWA 3H87A 1E2IA 3ZQKA 4DRXB 4UTVA 2BMVA 1FFHA 1R6AA 1P6QA 1KQGA 2PUFA 4IUYA 4B3XA 1WBBA 3RUCA 1P0IA 1P4JA 2CGEA 4ZVRA 5HTOA 1C9KA 4L2IA 1M8JA 4LYJA 3SLGA 3CX4A 4U5QA 3MXTA 1X7GA 2V58A 2UU9B 3H0CA 1Y63A 2A1TR 2CUTA 4D45A 2H3HA 3H99A 2BHRA 3BFVA 4KQJA 3WMXA 2WIFA 4RTNA 4B9AA 3IDFA 4N7BA 5J2TB 3EEQA 4AP5A 5F3DA 3S40A 2L69A 1KDPA 1QYCA 3WRYC 4BP9A 4QIHA 5INTA 1UKCA 2PN1A 1X2BA 1E1QD 1E62A 4RQBA 5HRAA 2BDEA 2BI8A 2ZRKA 5EXEA 1XTSA 4BKQA 4DSUA 3AZOA 4LDRA 3ZXSA 4QECA 1E4VA 2PS9A 1TCBA 3SS8A 1NG9A 2UZ1A 1IUOA 3F6RA 5JDCA 3S2UA 4MW9A 5HUHA 3DTVB 5JS8A 1A98A 2IU3A 4OHFA 1L5FA 4HQRA 1QZXA 3WP1B 3EVZA 4OHRA 2OFFA 1HE3A 3G13A 5FOWA 2ZFUA 1MW8X 1CUIA 4JJKA 3L4SO 2UZ4A 1IJKA 2JI7A 4ZOCA 4PQGA 4EG5A 3W5CA 1PZEA 3C3XA 3NHRA 1YB4A 2WT8A 3IBYA 2B83A 3NEYA 4B5KA 4XGNA 4NX2A 2OYCA 3V8MA 4EA9A 1IXZA 4KSBA 4PN7A 4ZU6X 4LC9A 4Y30A 3ZHRA 4IX9A 1T26A 2FPSA 2CMFA 4RHXA 1MQ9A 5LZ4A 2FQXA 5AW2A 5THKA 1KZ9A 2RGAA 1VP9A 3DPUA 4B2IA 4YAOA 4H1UA 2OSVA 1QG4A 5CLLA 1PFQA 4UE2A 5KAPA 4EZEA 5KOIA 4KR7A 2ZJBA 1RMTA 3PUHA 3QKTA 2QTVA 2R8ZA 4RX1A 1BCSB 2Z2YA 2XDQB 3ZE6A 4TVSA 2R6AA 2ZETA 3CLTC 3LBYA 4UOEA 2HTEA 2PVCA 2BTEA 4F5EA 1CZLA 4NBSA 5GP1A 1FTNA 1FY2A 3LQRA 1Q91A 1U8ZA 2R7NA 3K0KA 2YQZA 5T4FA 1L5MA 4TYWA 3PQ3A 4G1BA 2W6JD 1SVNA 3OJLA 3U60B 2ZVPX 3PITA 2FE4A 4J1QA 2GSDA 3HFSA 1JXAA 4CQJA 4RK5A 1IONA 4LI3X 4E4YA 1KEKA 1KOGA 1JQJC 2CNWA 2DQZA 2ZI6A 5K5EA 5ALEA 5EHIA 1M2VB 4R1MA 1Z8FA 2B5VA 2GXSA 2N9UA 2P7IA 4G2NA 5BN4B 3KLOA 5HJ2A 4GDFA 2I9KA 2WK1A 4WUVA 1KEUA 5KQGA 1V2HE 5KJCA 3E2MA 3C16C 3OD5A 5F5XA 1S8AA 2ACEA 2MIIA 2Z1DA 3O9VA 4H7KA 4NIMA 2IXTA 2OD7A 2DPGA 4HCJA 3H5RA 4IIXA 3A6FA 4MLPA 4EMSA 5BWLA 1B93A 2ATEA 4J6FA 3S70A 1NG1A 4ESOA 2J9FB 8ATCA 4D43A 3JAWB 4YPOA 2XE7A 3GEPA 4LZLA 5LOVA 3EUWA 1CDZA 4O8CA 5FKJA 2BKAA 2UYHA 1B2RA 1JH8A 2JIQA 4B3MB 2XIQA 4ZCLA 1D7AA 3V1KA 5FPTA 1YUBA 3EIQA 1A8PA 4OQMA 2P1ZA 1JPJA 4FMPA 1PGQA 4AJKA 4DJFC 1BJKA 4UEWA 1T5SA 2EQBA 3DUWA 1SULA 3WIBA 3RARA 4HQNA 2P91A 4EY8A 1GRQA 1GSOA 3BSYA 5LB4A 4MPTA 4N48A 3RIXA 2A94A 4KKXB 4EI7A 1DIOB 3KQSA 2E21A 4RVGA 5F52A 5P21A 2WYIA 4CLDA 5MN4A 3MWFA 3NZEA 3JVUA 2QA5A 1QH8A 1AS2A 1B73A 1N5OX 4WA8A 4ZAXA 1Z4LA 4PG4A 2OBYA 3GZNA 4FWTA 2A35A 4E2FA 5A2QA 4ZI5A 2DB3A 2BGNA 3HBMA 1SCDA 2PS3A 1ZJ4A 2HQRA 3HVUA 3CBQA 3NOOA 4MGKR 5D3QA 2AF4C 1BX3A 3L3BA 3URMA 5DSTA 3UKOA 4DYDA 1CZHA 4FOOA 2O0KA 4JBLA 3VR4D 2NLOA 1ZDMA 2R96A 1OF1A 3TI9A 2HNBA 3CB2A 1FC0A 5FV4A 1YE8A 2VYNA 4QDOA 3NMUF 4MRMB 1OY1A 1N1DA 3AR8A 3UY4A 5JR3A 2YJ4A 4PSUA 1X7YB 1F0PA 2J8ZA 4C4ZA 1JEQB 5AP9A 3W3AD 3KCNA 2O9JA 3TKAA 3ZWDA 1XL1A 1AUQA 1CWUA 3M7IA 4QPPA 4N5NA 1PNRA 4KBFA 4U2BA 3DE4X 4GGPA 4WE3A 2WP8J 3IKMB 4Z5XA 1M54A 1ECPA 5FLEX 4I19A 3BHNA 3F73A 3T1YB 5I8WA 2ODNA 4L78A 3A2KA 4TT3A 2BE9A 4H7FA 3KWMA 4MV9A 1IHUA 4F2HA 4ZTUB 1ID8A 3ZE0B 2HRZA 3IAS1 3QNMA 3ZN2A 5HJEA 2GNAA 3UWKA 2EP7A 3S8MA 5ALWA 5J5CA 1J4AA 1EQUA 5DCYA 1VA4A 4G4JA 4JUFA 5AM3A 3A1SA 3TL2A 3W2GA 5FEMA 1GGKA 4OX9Y 2GHQA 3N58A 1NOJA 3WX0A 4F7WA 2QL6A 5BMVA 3HSSA 4CLRB 1G8FA 1GHTA 3VR5D 5B3LA 1K98A 3OE1A 4F97A 2PXHA 3VOBA 4MRVA 4YRIA 1OHHA 2OBFA 3AC0A 3NUZA 3R5XA 4M83A 5J2UF 2V9CA 4KR9A 2CJPA 5U9CA 4UU0A 1GN9A 3D4OA 2UXBB 1AQIA 4K9KA 1U8CB 1K7YA 1J8MF 2J59A 3CZ5A 1BH2A 1V3QE 1OQAA 1ZINA 3H16A 3KZXA 3ZWOA 4EEXA 5LJLA 3T0IA 1IPFA 2QQGA 3D4IA 1CUZA 1JDBC 1X7HA 3FAKA 4QOIA 4B4UA 1ZHOA 2WWWA 3V1TC 4JQCA 2NP7A 4LVUA 4FYWA 1SZPA 1TM4E 4R05A 1A2BA 1BMDA 1RYEA 5CLGA 5AW5A 3PZRA 3V8VA 2W0SA 3QJYA 4M2LA 3OLQA 3EIUA 5E4TA 3HCCA 4CV3A 3I0NA 1N3LA 4KXVA 1Q95A 2XD4A 3P19A 1HRDA 1J0DA 3O8QA 4WKOA 3GYGA 1YL7A 4PG6A 2A9PA 4YP9A 3V7FA 1U7WA 2A58A 3A6EA 4Y0VA 1Z7BA 3FMIA 4GSLA 4K40A 4X20B 4REOA 5KYKA 1K27A 3FFTA 3V32A 1CLUA 1EVIA 1M7GA 5EMKA 3BMOA 2PQ0A 3T5DA 1XWIA 2L18A 1L7QA 4IV5A 5AIBA 4JV5B 4DR6B 5JJLA 4AKEA 3K0AA 4Q9HA 1KMMA 3O1JC 3PKIA 4KIFA 4A9AA 1N7GA 2ZRGA 1WOYA 1ZSYA 2XUAA 1GXSA 3PYMA 5D2CA 3BMCA 4BBJA 2O48X 3QXGA 1R0LA 2ZT6A 5HJ5A 2VAWA 1TK2A 4UHEA 4WQMA 3DBHA 2Q0QA 1XFAA 4JD5A 4OGGA 3S7TA 3GRRA 1OH8A 1SKMA 3IJ5A 4C07A 5IULC 1ATIA 4GOLD 2X4DA 2YFYA 3FR7A 2CLIB 3FYUB 3GCDA 4C0HA 4E11A 1OT5A 2BGJA 5C31A 3QVJA 3H2KA 1SIOA 1Y8AA 1VHLA 2IYEA 2OXFA 2QQ0A 2FZKA 1URPA 2OV4A 2YWRA 3E8MA 3F1KA 1KKLA 2G0AA 3M5WA 1OFHA 4OGKA 4KSCA 4AF8A 1GPWB 2FH5B 5U4QA 1GGVA 4KQWA 3EUFA 4LSMA 1JDJA 2GGSA 3CRNA 3LP8A 2YJZA 1Q2XA 4OI2A 5JNUA 2O8CB 2K2WA 1AT1A 2ZRNA 3IA2A 2FSFA 4FQ7A 5CX1B 2AOTB 1RBMA 1EB9A 1VL5A 3R7LA 4R9NA 1I6KA 4B09A 1DKPA 2HLPA 3C3KA 3HJNA 2BKVA 3ACBA 4F72A 2FY8A 4HS4A 4BO9A 2CVPA 1RI4A 2QK4A 2V6FA 3BREA 5EIFA 3RC9A 3A32A 1YR8A 2G4LA 4EY4A 1O95D 2G09A 2EJVA 2R8PA 2J5RA 3QV2A 3UT6A 4EECA 5G40A 1GAXA 1NVUQ 4YB8A 4U6NA 4L6IA 5IBQA 5L51A 4BJ1A 1IEXA 2VUHB 2WWXA 3AUSA 3IEUA 4LPSA 1JALA 2VK1A 4OIFA 3CUEF 1N2ZA 1ZG3A 1RWWA 2MCFA 4JYBA 1N5JA 2UVQA 2O5RA 4V1CA 1DJMA 2JGMA 3UQZA 1ISMA 1QPGA 4M6WA 1F12A 1O8BA 5ALSA 5EGSA 2RHHA 1C1XA 4YHBA 3BWBA 1QYIA 3B38A 5KWJA 5BY2A 1L7AA 4JT4A 3S28A 1CEYA 2DHCA 3F96A 3KJIA 1CUEA 4EYOA 2IYQA 5JV5A 4TXLA 2JI9A 5CCBA 1MAUA 2D4HA 4I8IA 1NVMB 3BCSA 3L05A 4IIBA 1XMXA 4TN1A 1UXGA 2GLUA 3F90A 3KT6A 4DUGD 5HKKD 4MULA 1VMIA 5K8CA 3I28A 2CHUA 4CM5A 3FTFA 4K6GA 1U2TA 2G9QA 3WK6A 1U9IC 1NV9A 1TGYA 1UFRA 2H1SA 4FCWA 2JFNA 4N40A 5ILOA 1NNI1 3UWSA 1GUZA 2IYSA 2V7QA 4H7HA 3UIEA 2PFSA 4B6RA 5FTKA 3JQGA 5G0UA 3WGQA 3QEMA 1Y81A 5K0EA 4MUNA 1BS2A 1BVUA 4LY0A 5A0TA 1SK8A 4ND7A 3G0HA 1TJYA 4I9HA 4IGKA 4KR3A 3MMZA 4CI9A 5JS6A 4QPNA 3DONA 4W9NA 3P2EA 1E4EA 1MVLA 1YDEA 3RT9A 4K81B 2AD1A 4P7KA 4TQAA 4RETA 2HA7A 4R2WA 3W9YA 2W83A 2AZXA 2GNPA 4A8TA 1WO8A 3JPYA 1Q44A 5SY6A 4ER7A 3TUJC 1LPBB 1GV0A 5B3AA 2QORA 1A2KC 5JXJA 2VXYA 4V0MA 1L5QA 2H1FA 2IU6A 2GCOA 4NWIA 1QMPA 3HGTA 2O0LA 3R3SA 4RJLA 2OV3A 3LO5A 2FLVA 1YSCA 4QOFA 4LJYA 1AKWA 4TMKA 4OHVA 2YZMA 4Z1MD 1OBFO 4F91B 1OIXA 3F7OA 3WC4A 4WBNA 1VI5A 1QOQB 3G0CA 3HP4A 3R5JA 5KNBD 2PMDA 3LF2A 4N76A 4E13A 3A05A 4BNKA 2D3WA 5GVRA 2JFBA 5CB4B 2FOLA 2HK9A 4HB2A 2V9ZA 5LXTA 4EW3A 2EFHB 4WRRA 1H9BA 1UAYA 2UVDA 1PEYA 1JDPA 3C7CB 3L40A 1K9SA 4UBNA 3ZV3A 1JPUA 1ORIA 4OHWA 1RZRA 2H0AA 4R40A 3I5UA 4OAOA 3U7RA 3BD9A 1MB0A 1SXJB 2IY7A 1CFZA 4FZJA 3K92A 3OTHA 5ALVA 1MMFB 1R3DA 3IA7A 1Q0SA 3OU7A 5AW1A 3AY7A 1NLMA 1F48A 1VRCA 1FBTA 1N0WA 1PFVA 3ABSB 4IQ0A 5F9HA 1EBBA 1JDUA 1I4DD 4TKLA 1FE8A 1KXJA 2RK6A 4UHHA 4RZXA 1UZLA 3DE5X 1TIBA 4EFMA 1N6LA 2BFDB 3LLVA 1WF3A 3N2LA 3PC4A 4ZYYA 4QEZA 4DA9A 1Y6QA 1ZAKA 2B99A 3NCTA 4FNMA 3HDGA 3G6KA 2G28A 4L5BA 1Q0ZA 4Z4HA 5B6JA 3B51X 3FRIA 2ONJA 3WXMA 4JBGA 3SGLA 1L4KA 1RAHA 2COEA 3BTUA 4EUNA 3V4SA 2O3TA 2J5KA 5BN5B 1B00A 4U7DA 2NMVA 4D97A 3DEJA 1L5HA 3BE4A 2JDID 8OHMA 3CUYA 1KWGA 1HXHA 2DFTA 4GEKA 1SOVA 4QUEA 5F5NA 2Q6VA 3B5EA 3F3KA 4DABA 1HDRA 3EIEA 3JSAA 3ZYCA 3U7EB 3AI7A 1R4MA 1W4ZA 1EX6A 2HD4A 3RASA 4DZZA 4DR7B 2GCGA 4DV4B 1QX3A 4D8XA 1YBFA 3FNRA 3A0RB 3SJBA 2CHFA 4UE3S 1LBQA 1ZCJA 3GVXA 3EDYA 1Z6PA 2C97A 3OA2A 1X7XA 3OZBA 1YKSA 3QWBA 1R0KA 3KHSA 4P8RA 2Q6IA 1VJCA 1SU6A 3OOHA 2H1VA 1FFCA 3GY0A 1JWLA 2GUGA 3ROTA 2N3ZA 5JAZA 4BY9E 1KMIY 2IPAB 4UCWA 3AHGA 4Z4GA 3JQAD 2C96A 1QH1B 4RPLA 3ELYA 1PS0A 3GEDA 3I0ZA 3LDAA 2WY2D 3V9PA 4CW7A 2RONA 5KKNB 5DBHX 2NVOA 4GOND 1FYXA 2C5BA 3K1TA 4X60A 4ESEA 1DRWA 2WF7A 3GI1A 5BNFA 3GEEA 5ESRA 2JPDA 4PX5A 2NWQA 4TZKA 2I2XB 1WMBA 2YVLA 3DF9A 5REQA 5KYUA 4D3YA 2P68A 4E09A 4DVJA 2VQ6A 1OWMA 3ZV6A 2DWOA 2B21A 2F59A 1MHPA 2ODQA 3BUSA 4J75A 4WDQA 4DMCA 3VSEA 3Q3GE 1M6HA 1DPFA 1KYWA 1MX3A 1GU1A 2PKEA 3RSLA 1OB5A 1M2OB 1JMYA 2DUUA 3I39X 3KEMA 1K08A 4MQFB 2B34A 1U0GA 2JAUA 1Y33E 3EGEA 3LQKA 4BXOA 1AKQA 4U9IS 5CNMA 1ZHHA 2V5VA 4C4YA 4JYZA 4TYQA 4XKJA 2QVCA 4EB0A 1ZJJA 2ZB8A 4H6WA 1SK9A 4YS6A 4WZAE 3QH4A 4I4IA 3T1OA 4W9RA 5A3JA 3ORRA 4FKMA 1Y6JA 1QQ7A 1G0NA 1USIA 4L51A 4OIMA 3JVDA 4BNIA 2R7AA 3EEOA 1E7SA 1JIVA 4E03A 5JISA 3NPMA 8ADHA 4OVKA 1DJLA 2K6GA 1KQFA 3ZLVA 1EJBA 5JSHA 2DKNA 5CDUA 4BO8A 1U9ZA 2VR1A 4FSDA 4DB4A 1T5BA 3PEYA 4ITVA 3DZHA 3FZQA 2Q6TA 4QNRA 1ULHA 1CQIB 1SBYA 2WFLA 3EXHB 5DXFA 4A16A 4XEHA 4BLUA 4GVLA 4MP6A 4RADA 2WIBA 3IUPA 4N6NA 1Z88A 4GP6A 2C2KA 1R5JA 3B5JA 1Z7WA 4TTPA 4A0HA 1K5PA 1VC2A 2HN9A 2OWEA 1RAIA 3VC2A 2UZIR 4C4PA 3R76A 3U5TA 1LI5A 1PDVA 4KTVE 3D6TB 2AOVA 2W4QA 4DWWA 1W36D 4KV9A 1Y1QA 4LJSA 1ULZA 3OPYI 2QN8A 1EFHA 3EPKA 3NOXA 2AKAB 1K3FA 4JLSA 4F2GA 4DDUA 4QM6A 2CL5A 2DPYA 2CXOA 3IELA 4Q1VA 1IU9A 1I1QB 5EIHA 3RRFA 1KVSA 3CEAA 4RKEA 4X3OA 1A69A 3IERA 3VMFA 1SCUA 3INTA 3WGMA 3IO5A 2OV6A 5EJMA 2QLNA 1NU8A 1YS9A 3FFWA 4P7GA 4U2GA 4XGIA 3I34X 3BHJA 4F6RA 4PXSA 4DWVA 3ANNA 4G25A 4NG4A 1P77A 1FNCA 3RUFA 3KELA 1ZMRA 3SZGA 2FPWA 2J3DA 4YWHA 3HDHA 3RSGA 3JZMA 1PJ2A 4QU0A 3WRVA 3E3LA 4JT8A 3EZNA 2CHVA 1V47A 1VPWA 3W79A 5FBHA 1MX9A 2E7ZA 4NU8X 3KZVA 4BNMA 5BQPA 5A9SB 1J00A 3LECA 4A26A 5LSAA 2F4VB 3AEXA 1K7EB 2X1LA 4IL5A 4LCEA 4UMVA 4FDAA 3KWFA 4L9WA 5DNYB 2PBFA 4CKXA 3GNTA 1SJ9A 3OLVA 1FYVA 3Q7TA 1UDRA 2VDWB 2P2ZA 1L4UA 5TT0A 1HKUA 2B37A 3NKVA 1WZ2A 2YYAA 3AYZB 5K45A 2D5AA 3WAJA 2II6A 4NDNE 2IS4A 1ITZA 2ZRIA 2NAFA 1V96A 1X15A 2Q99A 1IK4A 3I23A 5L3QB 1LF5A 3W77A 4FHEA 3LS2A 1PWYE 4MJLA 3OE5A 3KOXA 4HZGA 3ESQA 3ZK7A 5AI5A 5BYJA 2A67A 1MC8A 4FFMA 3ZZUA 2JFOA 3EDMA 6NULA 4YJDA 1P1KA 3QYJA 4FC6A 2VTKA 1ISFA 2VHCA 3UICA 2HW8A 1N5KA 5FV7A 3EAGA 2G9RA 4NENB 1NATA 1R6DA 2RHRA 4LXIA 4ZO7A 1OVGA 5IU6A 2W2KB 3K30A 1ILEA 4OXXA 3DL0A 1PIWA 5BVHB 5BOSB 2BVNA 3E7PA 2D7CA 3G3EA 3BL6A 1UBOS 5F7XA 3V2GA 1BGVA 1QO7A 1PK9A 1FYFA 4HH0A 4KAFA 1AB5A 4HEJA 4TLBA 1EUDA 3CTPA 4IEFB 3V7NA 2YKGA 4RHEA 3S8YA 2CXHA 2VNKA 1T4CB 1NUQA 5CG1A 4LV6A 1NXXA 4YMLA 1YR3A 5AJWA 3VXKA 4C7OA 3TKLA 2IYWA 2P8JA 1CERA 2HMTA 3F2IA 2H2DA 5LNK1 2C7RA 1VLHA 1YL6A 1HG0A 1ZVQA 5AVKA 2C4WA 2DWQA 4G41A 2OGZA 1MV8A 1HYQA 4PTZA 5GGXA 3QQ5A 4G65A 2RK3A 3B2NA 4IHKA 1QS0B 2IHKA 1JXMA 3ACCA 2VK4A 2JD2A 3BL8A 1X70A 2AG6A 3HEAA 4D4MA 1S2OA 1KBQA 5DSXA 1KETA 2DSTA 3S29A 3NKFA 3OKAA 4P4SA 4EQZA 1LQUA 1T3ZA 2XH8A 3I05A 4YXWD 1ZGBA 3C3YA 4IOLA 3UEOA 4ASUA 1W30A 3DMPA 3LG2A 2J4FA 4ILEA 4OGFA 1KJ9A 4XI9A 3ZHCA 2BV3A 1XLVA 2DQ4A 5KC8A 2ATCA 4ZQBA 4BUCA 4XWWA 1BHSA 2EWVA 2Z2XA 1Z4IA 2XUDA 1G5QA 1POWA 4JLWA 4LSGA 4BCDA 3RG8A 2I76A 4EY7A 3R4VA 2QUHA 3KZMA 3HJFA 4FHGA 1QC5B 1T3TA 3BK1A 3R7DA 2QPLA 4INZA 4F8YA 3R9XB 4BV2A 3QE9Y 2OQRA 3Q9SA 3MB5A 4C88A 1V8DA 4F92B 1VKHA 3WL5A 2MSLA 4EG3A 4KXQA 1WV1A 3H9BA 13PKA 2HJRA 1LEHA 1GRVA 2WUEA 3IEXA 4NR0A 5DHFA 4BMPB 2FQWA 2Z98A 4GHWA 4EH1A 2EKBA 3VOAA 1CD5A 1FQWA 2PTHA 1JB1A 1JPNA 4AROA 3D1VA 2PH5A 3AMVA 2ZROA 3AY0A 4MTLA 5LYJB 3QLJA 3EQZA 4FJ1A 4J4TA 4OTZA 2Q29A 1LFAA 1HFEL 1R10A 4HDMB 4HTFA 1SOMA 4LX0A 3T1NA 1XB2A 2XAAA 2ZR9A 3PCTA 4TXJA 1FJHA 2MYUA 4QYIA 4DDTA 4P7FA 3AVOA 1HGXA 4QUBA 2DERA 2OCDA 1L4NA 1P4GA 1QQ6A 5D5PA 4CODB 4YCCA 5HKOA 1I3NA 4F4JA 4KXMA 1PJCA 1SUSA 3AR7A 3HKBB 3ZWWA 3HUFA 1IPHA 1GGHA 4Y6OA 3TZLA 2XGSA 1HPLA 5ECWA 4EMTA 4Z99A 1YQDA 3MS2A 3NFRA 3AONB 3BD7A 3C39A 3EXEB 1C0IA 1N2JA 1V2GA 1VJ5A 4I5DA 3MCAA 3RYTC 3FF1A 4EUFA 4EEZA 2B9VA 2J6IA 3R5HA 2FGKA 1KY4A 2FRDC 4KQ9A 4M49A 1HLFA 3BD6A 4QQFA 2NUAB 3KUDA 3KJEA 5IKEA 1JMVA 5KNDH 1YFKA 2QL7A 4P4NA 1UWKA 3FOEC 4QHTA 2IYVA 3GJ0A 4DIOA 3MTAA 1ZC4A 1UMKA 4U8HA 3EC7A 3PHIA 4LOJA 3A58B 5FTNA 2AMVA 3C48A 3EASA 1W0KA 4KK4A 1EUCB 1IYZA 1VJ1A 5D3MB 5KYWA 3K6SB 1SOAA 3IEVA 2W6OA 4K9DA 2GDJA 1QO9A 2EX0A 1X80A 3DPSA 4HZUA 2Z0MA 1VL0A 2FUG1 4RFLA 3WHIA 1HNWB 2ZZMA 3V3KA 2VT6A 2PJRA 4REMA 5E2IA 3TFOA 3OFNA 3SIWA 3DA8A 4OLAA 3FZNA 1XN1A 2PBZA 1XVAA 2ZJ0A 3A4MA 1BXGA 3P52A 4JKYA 1SB9A 3R7FA 4BX3A 4R71A 4YV1A 4OBWA 1KI1A 5A2GA 1Z63A 3PB3A 3D64A 1JH9A 2VRCA 5DI3B 4N7MA 1XI2A 1L7XA 1FSFA 3O7MA 5LZ2A 1L2TA 5HEKA 5AKXA 2YOHA 5ALTA 4EY6A 5JMTA 3JYQA 1BX0A 1BCRA 2Q2OA 2M6RA 1C3XA 2ZDHA 2WTBA 3IHLA 4JLJA 3AQ4A 2ZPTX 2P0EA 4TYMA 4Q16A 4U7TB 3SX0A 5GTDA 3BXHA 4MRPA 3WLMA 1JDVA 2C3YA 2H5LA 2WTAA 3C5EA 3H3FA 2K4MA 4INAA 1CRZA 4XFJA 1GRNA 2DG2A 3KJGA 3QE3A 4N3AA 3SZRA 2CCGA 3RUIA 2BWJA 3E61A 3N6XA 4H77A 4BGUA 4EIWA 1N32B 1I10A 2QQFA 3HDVA 4MI9A 3UT5A 1N3BA 2A92A 3TCXB 1L8XA 3B70A 2FKNA 3DMDA 4D82A 2PUBA 2G36A 1AKNA 1OBCA 1E66A 1VA5A 2J3MA 3K9QO 4QRHA 2P1DA 1L5KA 3SU8A 4AFNA 5A4FS 3A1NA 3TIVA 5KTMA 3INGA 3RUEA 4IHJB 2ZWAA 1GEEA 1JB9A 2IS1A 1MABA 1Y42X 1ZMTA 1Z25A 4C0SA 1G5TA 3OAAA 4IV8A 3GOQA 3KKKA 2R97A 4D57A 3IP6A 3TIXB 1JT2A 4UDYX 4A91A 3MD9A 4PCAA 2HDHA 1XX6A 4X8MA 1ZLXA 3GRYA 5A6SA 3UFBA 1RLIA 5DGTA 2E4ZA 4KYUA 3PFCA 3WDSA 1CUHA 3OJFA 1XDBA 3QFTA 1SPXA 1KYZA 4D0NA 1NLYA 2O2EA 2JH9A 2LE0A 1KJYA 2W93A 4KRYA 4Q3OA 2WSMA 2YXEA 5C5EA 3T3NA 3VDNB 4ENVA 2CF5A 2LNDA 1I2AA 1DOHA 1PL6A 4HB4A 1X1AA 1XTVA 3AR9A 1OLOA 5H9VA 2P2YA 3H9QA 3C7AA 5IZ4A 2N75A 3TTUA 3QG5A 4EUHA 2J09A 3T5AA 5AJHA 1NVBA 4J43A 5C8DA 5IC5A 4X1OA 2DTEA 2QU8A 5IAAA 4IIHA 3PICA 1YZTA 3D6NB 2H06A 2PT5A 3OH8A 4IS2A 1G6Q1 4HATA 5KTSA 1C8KA 2CVFA 2ZSKA 2QTTA 3FKSA 3ENNA 3OBBA 3QX9A 1ZOIA 3V7WA 3WFJA 2NM0A 3DD5A 3U4MA 3EIXA 2GZHA 3N3BC 1DFGA 1ZOOA 4HG2A 2R6FA 1Z0KA 1T0UA 2AYXA 1C8BA 2J08A 2QN2A 3GV0A 4UVHA 3OY7A 4OXYA 2FQQA 5I7VA 2A0YA 2Q8PA 2P35A 3TMYA 3V55A 3ASZA 3CSDA 4NBRA 4IVRA 1N1GA 5H0IA 1FYWA 1JILA 1YE5A 1J97A 4ZYXA 9GPBA 2G1UA 4RIHA 2CT8A 3KYDB 1TUEA 2P62A 3B7PA 4MW1A 2D1YA 4AYWA 2PRYA 1QRSA 4UM8B 3BXFA 5EP4A 1TMYA 3WZLA 2P6RA 4NH4A 2D5IA 2PWAA 3HP1A 3H2YA 4GI5A 4YRFA 3KTDA 1Q84A 1QP8A 1R0WA 1QU2A 4BVHA 3X1KA 2IRWA 4X9XA 1OV4A 4PYMA 2WAYA 2PRSA 1XEWX 4Y2JA 3ADCA 3LRXA 4CKWA 5HWSA 2PAFA 1FF9A 2D74A 3O8NA 5B55A 1U0SY 1B43A 3THYB 1ULTA 8MHTA 2HK6A 5HS6A 3PUIA 2IL1A 2BAGA 4Q4CA 1NR5A 3GMIA 3HJRA 3OP4A 2NTNA 3N2KB 4OSOA 4ZO6A 3AESA 1SUCA 1XPRA 4ZRNA 2ZS9A 2PGOA 1LZLA 1MO5A 1N8TA 1W73A 4Q9JA 4EDFA 5JCJA 5K0GA 1PZMA 3L7KA 2AHOA 2AHRA 2HT6A 1YA6A 3HY3A 3HBJA 1R9MA 4WK4B 5HJ7A 1FSPA 1PFUA 5IJ9B 1I2BA 2ZBDA 4CQMA 3BSWA 2DGDA 3M1LA 4DARA 1Y3IA 4Q4HB 1BD4A 3ZD8A 5AVXA 3NTQA 4RVHA 4Y0AA 2YJNA 4YUYA 5CFPA 2ZRQA 4LDQA 2O2DA 1K7SN 2Z2JA 5DX0A 2O7NA 2BEUB 1XQ9A 1OC4A 4KWTA 4BGVA 1HDYA 4HQFA 4HX9A 3AVTA 4LISA 1AF4A 3BD8A 5CX4A 4D8YA 4L8YA 5A05A 3H3JA 1F3OA 5DTJA 1ZQ9A 2HZ7A 2WJIA 2QE6A 2ZIFA 4K0RA 1JLMA 2DQSA 1M8PA 4MVJD 3BTOA 1QZZA 2NU6A 4R6WA 3W1VA 5KX5B 1U9IA 3IB6A 5KOJB 2VHEA 1X7ZA 3R3VA 1PJRA 1DFHA 3GYBA 4BP8A 3RKRA 3L8ZA 4PCUA 5BPHA 2KLHA 3I2IA 2NU9B 4IGAA 4KVAA 2BR5A 4KODA 2MSEB 3E9EA 5FBWB 4P93A 3W0LB 4TWJA 3M6UA 2P9BA 3LZ6A 4NARA 2ZRBA 5JQGF 4LI0A 3PE3A 4HMQA 3WYDA 1ONOA 8AT1A 1D8TA 2BZSA 4BZWA 4M21A 4EWLA 4WECA 1IZ8A 4R9UC 4HNGA 2RH8A 5KDLA 3FUWA 1T2FA 3RWBA 2FUKA 1NGSA 2OFOA 2ZUUA 4LCBA 1E1MA 2HRCA 3IEPA 3LA8A 4IINA 1C7IA 2SKDA 2R60A 3NHSA 1LSSA 1YZQA 2JA1A 3Q7PA 4IV0A 1W46A 1DQSA 1JQ5A 1RJGA 4RA6B 3WDKA 3FB1A 1LS6A 3W8RA 1ADBA 2DTXA 1HZZC 3RD5A 4CN9A 2BH2A 2O5CA 1JAXA 3OOYA 4ZT4A 3TWOA 1QBGA 2C7BA 4AG6A 4M8SA 1W4RA 3CNEA 3Q3JB 4G56A 5G0SA 1FVHA 4K9NA 3SQMA 3S0JA 1Y5NA 3I6MA 2PK3A 3QEOA 2IPMA 2WILA 3Q9UA 2WTXA 4OI4A 2QV7A 1QK3A 4HNRA 4WNCA 5K0ZA 1QX4A 4H35A 2YYYA 1FQOA 1PZNA 5B53A 4FOLA 5T3UA 2RHWA 1ST3A 1PWEA 1YDGA 5KQPA 4UU7A 2Y1XA 1P1HA 3MN1A 5GVSA 3K0HA 5MF6A 2PJDA 4WI1A 5JBNA 2XZTA 3HKDA 5LQSA 2PA0A 2CV2A 3LWZA 3WLFA 1FK8A 1VP3A 4P54A 4CMIA 4MVXA 2G1PA 1QHFA 2HUPA 3DM9B 4D9IA 3QEBZ 4MYCA 3TCNA 2Z3WA 3IL2A 2X14A 1Y1SA 4MO2A 3B1ZA 1I3OA 3WS7A 4K7JA 4NSNA 3A4YA 1BFUA 4ETMA 2VQFB 1PUJA 3SEFA 1IN7A 3SR4A 2AR9A 2A7QA 4AQDA 4CBVA 1CS4C 3I01A 7MHTA 1BHO1 1IOVA 1CBUA 4XJVA 1Q1GA 3QY0A 5GOZA 4KVGA 4DDVA 4JQZA 5CIQA 4XWKA 3WKBA 3CWQA 1FOEB 4PO1A 1Z5NA 1RT9A 2XZDA 3N8DA 5HZGA 3Q8KA 4R8SA 4WZAA 3DVAA 2J4DA 4UAUA 2F00A 4WA7A 5D1NA 4UAJA 4B82A 1BWPA 3P5BA 4N0PA 1O03A 3RYFB 5FYDA 4PYQA 3U09A 1NUSA 3QKWA 4X64B 5KPDA 4MS1A 1ZGAA 3AUUA 3TZEA 4AJ9A 2C4UA 3DZ8A 4ES6A 1E2QA 3G2OA 4DCCA 2GRAA 4FE4A 4EENA 1IQRA 3MK31 2ZRAA 1HDIA 1Q74A 1NJ5A 2EKLA 2FCRA 4GQIA 2IVZA 5EE0A 5JMWA 2GASA 3GNQA 2A1UB 1GSIA 4HH3C 3IP1A 3VUEA 2O07A 3HRIA 3JALA 1J0EA 5EFOA 5BVGB 2VP0A 5JFOA 2BKEA 4IXMA 4MW2A 1I2ZA 4DWOA 3KL4A 5JE8A 2AW3A 1SQGA 4MUGA 1PJTA 4Y98A 2JJ8A 4FPXA 5ILGA 4HYEA 1TRHA 4IQ4A 5A04A 4URVR 4UM9B 3IEMA 5G1NA 2HADA 1RXVA 5C0OE 2L82A 4ZI3A 2E49A 1K0UA 5EZYB 4HDSB 3ONWA 5IH3A 1X92A 1I32A 1LDNA 4REQA 1SHLA 3QXSA 1GPKA 3S1SA 1KS2A 2DQKA 2O2HA 1SXJC 1A04A 5B1DA 5U4XA 4GPD1 5EIBD 3JW8A 4JNCA 4XPIA 3AF6A 1FA9A 1V11A 1CYEA 1WMFA 3DFIA 5BQOA 1T5OA 4YUXA 2I6GA 1VJ0A 2R8XA 4KLCA 1GPYA 1D2MA 1FU8A 1MIOB 2YDXA 3HP7A 3MJCA 4H7PA 3UFXA 1EK0A 5C46F 3CRW1 4MQBA 4J7AA 4IUBS 1W85A 2GRUA 1GZ6A 1C80A 5CA0B 5NULA 5DP1A 4AQ7A 3ESZA 1Y9ZA 2NYUA 1E6EA 2O20A 2WKWA 3DDNA 3MT9A 4G5FA 4MVWA 4DGQA 1DRUA 5LU8A 2BMFA 2Y1KA 3FLBA 2VDMB 4HAZA 2F17A 4BO3A 4BGDA 2G5PA 4HXFB 2B8NA 2FZEA 3KK0A 4ZT6A 1EFVA 1VE3A 4Q9LA 3PNLA 3OHPA 4DDWA 1RHRA 2FV8A 3EC1A 2JL1A 2Z6VA 2GJ4A 1W4CA 1U8TA 4P9NA 3QVWA 1H3NA 4PGHA 3L0PA 1HURA 3E9DA 3G2JA 5BR1A 1LZKA 2R8RA 3CPEA 2Q5OA 4C9BA 4DJTA 1BAPA 1RQRA 1RYHA 3LY9A 1XQWA 2WVAA 2JH3A 1VMAA 3V4FA 3CCFA 5AJTA 5FPKA 2ZQ5A 2YTZA 2LXNA 3CS3A 4XJTA 1E59A 3HB5X 2WKPA 3HG7A 2OSBA 3TR6A 4K86A 4XWGA 1YUNA 2H48A 3FH0A 3L7AA 3KKZA 5D01A 2WOJA 4O4JB 3A9SA 3EIOA 3V42A 5EE9A 3X44A 3UF0A 3ZDDA 1OUMA 1ZN9A 1XQXA 3OPYA 1M83A 2CSXA 2FVXA 3AFGA 3UJ7A 4DB2A 1EGVB 2X13A 5EQDA 3WWDA 4IFBA 3I04M 3WWYA 4TKUA 1NIJA 2RJNA 3JYPA 3QE0A 1G5PA 2D6FA 2NNLD 2O3RA 3BJEA 3HY4A 5FBQB 4C4RA 1CNFA 2GK4A 2HM7A 3NHZA 4NMWA 4RPIA 3Q72A 4UHBA 5ALGA 3I2GA 4QLOA 5M5BA 4CV2A 2AOUA 1DC3A 1O4WA 3LBHA 1IH8A 4DA4A 2RBGA 5JZBA 4LYYA 1GFZA 3AV0B 3HYNA 1BYUA 1NQWA 3WZ2A 4KRXA 1Y0BA 2PLAA 4NV0A 1H0HA 2BDTA 1DTWB 3INRA 3JQ7B 4CKCB 2CNWD 4KE8A 4LGCA 4O4HA 4YRCA 3EG9B 1FMTA 4J4BA 1GZ3A 4B2PA 2ETXA 1ESEA 4V2IA 2C88A 4L4UA 1JR3D 3VQTA 1IC6A 1V4BA 4JSRA 1NMEA 1M73E 4L75A 4A2WA 5FWXB 1PR0A 1QF6A 3AB8A 1LSOA 5L3SB 2VKTA 1GTG1 3ROXA 1PNQA 1O1YA 4I1SA 4N0DA 4QOJA 5C4IA 4AK9A 1WPXA 2BGRA 1ODIA 3D0RA 2FA9A 3ZWNA 3KU4A 4KFSA 5BQXA 4RDXA 2P6UA 3RS2A 2A6PA 3G7UA 3M9WA 4ZCPA 1KDYA 3K4HA 3MGAA 4JJ6A 4L07A 2X8JB 3HPRA 4NNJA 2NU8B 4NYIQ 1Q3HA 1IIRA 1XAJA 2H07A 3IPXA 2GYUA 1KJIA 2PVPA 3L0IB 3UHPA 3VBCA 2ERXA 1XVLA 1T36A 1Q92A 2QAIA 4G5XA 5ALPA 3DT9A 3UAGA 4FCCA 3ZE7A 1EPUA 3WMFA 4BMNA 2K5UA 1SNYA 5BRNA 1XRPA 1Z7GA 1ZNYA 3IBGA 5CD9A 1K7XB 4Q1DA 1GA6A 4MZDA 4YRNA 1OGIA 2FXIA 4WLVA 5FPPA 1D3AA 5HQJA 4CT0A 1KAOA 4X1KB 1WZCA 4F1KA 5B7NA 4F8EA 4X5OA 3K1AB 1B8UA 1PLLA 1WRBA 4M38A 3PJFA 1R6XA 2OV8A 3GT4A 3VR5H 1TF5A 2XVYA 3RVLA 3N87A 4LOKA 3GLIB 1QDUA 2J9XB 3OFVA 4H08A 1YHYA 4I81A 4J1TC 4OBXA 4OD0A 4BFZA 2LD4A 2PZKA 3EH2A 1PL8A 5BV8A 1J07A 1E99A 5C18A 1NRIA 1SUEA 1TO2E 1WKVA 4FMDF 4GZ6A 4I4TA 4TLDA 4W5OA 2Q7DA 4ZOLA 4IIEA 5KQSA 4HX5A 1DADA 1JA0A 2V7UA 3DOFA 1KGDA 3FB4A 4MV3A 2FDRA 1LWOA 1JR2A 3VX3A 3F7MA 3S8EA 4DS3A 1ISSA 3REOA 1UQTA 1BVRA 2FJ0A 4HSGA 2ZJ5A 4C0QC 2ZUDA 5FCDA 3SG0A 2DWPA 2G6BA 2IF0A 2Y2UA 3G79A 3I6IA 4M9XA 9LDBA 3TW4A 1S9DA 2Q28A 3P4YA 4E1VA 1QJ4A 3K2EA 1E1YA 5J59A 2BM1A 4IQGA 1R66A 5ULLA 3MTBA 2I1QA 4MVJF 5C1IA 4DRXA 4EUKA 1XXHE 1WR8A 3AV3A 2TSYB 4BMZA 4B4VA 3RJMA 1ZHFA 1Q5PA 3QE2A 2ODTX 3AM1A 1KY2A 1U5CA 1UJ5A 5FUXA 2CFIA 4CUKA 1WNFA 1ZL2A 4ENPA 2QD5A 4G1UC 4N5IX 1Y4DE 2HSEA 2F43B 2JJ1A 4GO1A 3ZHUA 2QGNA 4FEGA 5AXCA 5J2TA 4XH9B 3I5XA 3GJZA 4ND3A 4H0NA 1G21B 1L7MA 1DBRA 2EP8A 3Q9NA 4AJJA 3AO0B 4XLLA 2I4OA 2V45A 2HIHA 3EVTA 3BZBA 3KPVA 4RVDA 3VKUA 1WB5A 2HCJB 2QVYX 1MB2A 4IF4A 4NYJR 4K05A 5SYNA 4DA8A 4ZAZA 2ZRCA 5DNVA 2PH1A 2D0DA 4TV8B 3SSNA 3TEMA 1OYYA 1TJ3A 2GT1A 4R8RA 3DTVA 4PFSA 2X9VA 5SICE 2QP3A 4A6EA 1J0BA 3QF4B 2WD7A 1L7OA 1YHNA 1YZFA 2IZ5A 4KAJA 3SZOA 3TW8B 3U7JA 3DL2A 1VM6A 5CAEB 2E4UA 1RM5A 2SECE 2GXAA 3BILA 1ZUWA 1FRNA 4MRAA 2CDBA 1VG0B 3AEZA 3FE2A 4TKMA 2VJOA 2YV2A 2HMYB 3RK1A 3GZJA 3RRBA 2XGGA 1QFMA 2C9ZA 1OLXA 1K88A 3NUQA 4PIPA 4WN9B 4CUZA 1I9CA 1USKA 3BK2A 1TAHA 3ASUA 3T9EA 4RULA 2YL2A 4A2CA 1C9DB 3SQXA 4AG3A 3CZCA 3REGA 3ZLJA 3CA8A 3L9WA 3UH1A 1J0AA 1RACA 2H17A 2ECPA 3W6NA 5F9FA 4IDPA 1NUHA 2W5UA 3GA7A 4GP9A 4R2XA 1WX1A 3CLSC 3ED1A 5EIEA 4M9QA 1BCSA 1AHNA 1NL3A 1IL0A 2BLLA 2XDQA 3P0RA 3HVHA 4CCWA 2FRDA 5K6RA 2YRXA 1NQ5A 5LMNB 3GROA 1BO6A 3B20A 4PSVA 1NNEA 1LRJA 1V5EA 1H1LB 3H84A 3LE8A 5TMDA 3RCBA 4EK9A 4GMKA 1TZJA 4TSFD 5G2OA 3BC1A 1V6CA 2C9DA 3G1UA 5DHSA 3IESA 1CVIA 5K6AC 3GUHA 4HPXB 3F4LA 2H59A 2LZ0A 2ZZNA 2ZT7A 4IDCA 4E5DA 4CEIA 4DSOA 2P90A 4EW2A 3B6MA 3UAXA 4QODA 5KQRA 1M1ZA 3R7BA 5LP1A 3BX1A 5BN4A 1Y7PA 2XOKA 1YCDA 1VHJA 3FNFA 2VH1A 5IEJA 3GCWA 3RGWS 2HGZA 2OP1A 3SDSA 2ISCA 1CUDA 3AJEA 1HOTA 3OQOA