3GI1A

Crystal structure of the laminin-binding protein lbp of streptococcus pyogenes
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
277
structure length
254
Chain Sequence
b'TQGMSVVTSFYPMYAMTKEVSGDLNDVRMIIHSFEPSVNDVAAIYDADLFVYHSHTLEAWARDLDPNLKKSKVDVFEASKPLTLDRVKLYDPHTWTDPVLAGEEAVNIAKELGRLDPKHKDSYTKNAKAFKKEAEQLTEEYTQKFKKVRSKTFVTQHTAFSYLAKRFGLKQLGISGISPPSPRQLKEIQDFVKEYNVKTIFAEDNVNPKIAHAIAKSTGAKVKTLSPLEAAPSGNKTYLENLRANLEVLYQQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Laminin-binding protein of group A streptococci
molecule tags Metal transport
source organism Streptococcus pyogenes
publication title The laminin-binding protein Lbp from Streptococcus pyogenes is a zinc receptor
pubmed doi rcsb
total genus 86
structure length 254
sequence length 277
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3gi1A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3gi1A02
1QGUB 1L5HA 2XV1A 2Q8PA 4MDYA 2WHYA 3ZK8A 5JJ5A 1G21B 4ND8A 2PRSA 5HDQA 1N4AA 1G20B 2YNMD 4TKVB 5BVHA 4OXRA 3LHSA 4WNAB 3K1AA 2R79A 2M6LA 3EIWA 4MX8A 5BVGB 4GICA 2OGWA 5KOJB 1K7SN 2O1EA 4K3VA 3HH8A 1M1NA 3U7QB 1KAEA 2RG7A 4WZBA 2PS3A 3PDIB 1PSZA 1QH8B 1TOAA 5KOHA 5JPDA 2XDQA 3AEQA 1PQ4A 1M1YB 3TEFA 4WESA 5CR9A 4FKMA 4LJSA 3NU1A 3TNYA 4WESB 5I4KA 4HMQA 2PS0A 4CL2A 3ZTTA 2Q8QA 1QH1B 4OVKA 4NNOA 1K2VN 4OXQA 4UTOA 2MINB 1XVLA 3TLKA 2YNMC 4ND8B 1KARA 1G21A 1MIOB 2X4LA 1N4DA 3AERB 5KOJA 1QGUA 3MD9A 5M34A 5BVGA 2XQVA 4NNPA 3K1AB 5FLYA 4IRMA 4BBPA 5JG7A 1EFDN 1N2ZA 3LI2A 4UDOA 4TKUB 3AERA 2AFHB 3GI1A 3MFQA 1ESZA 3R5SA 4TKUA 2XY4A 4HMOA 4FNAA 3AEUB 4XPIB 2MINA 2XH8A 4B8YA 4INOA 4M7OA 1N2CB 4DBLE 5GGYA 5KHLB 5M29A 3ZKAA 3MWGA 1MIOA 3ZK9A 2AFIA 2PS9A 3MINB 3EIXA 4WN9A 5GGXA 1H1LB 2R7AA 3AEKB 5CX1B 3BE6A 2OV3A 1M34B 3HJTA 1QH1A 3UJPA 3AESA 4INPA 4N01A 3R5TA 4HN9A 1QH8A 1FP4B 4HMPA 1KAHA 3AETA 4UDNA 4WZBB 4H59A 5M3BA 3U7QA 1M1NB 1M1YA 5JOQA 3AEQB 2XDQB 4G09A 3MWFA 3PDIA 5M2QA 1M34A 5CX1A 4MO9A 1K0FA 1H1LA 4WN9B 5B58T 1G20A 3AETB 3BE5A 4PAGA 1FP4A 4TKVA 2OV1A 2M6KA 3G9QA 1L5HB 1N2CA 3AESB 4FILA 4G07A 2XUZA 5KOHB 3ZK7A 3AEKA 4WNAA 4PM4A 5BVHB 3AEUA 4WZAB 4XPIA 5HX7A 4H0FA 2AFIB 3CX3A 3MINA 2OSVA 3PSHA 1K75A 2AFHA 2PHZA 4UTPA 5AFSA 3PSAA 4WZAA 4MLZA 4LS3A 2QI9F 2WI8A 4FI3F 3HXPA 2ETVA
chains in the Genus database with same CATH superfamily
2C9OA 3FX2A 1L5HA 3TTUA 3ZV4A 2I4RA 2NGRA 5FX2A 1LBSA 1FZTA 1EQUA 1LDYA 1RWBA 3CSDA 5KYGA 4U6NA 4Y3UA 5K3FA 1UPFA 4FGUA 4DCPA 2BGKA 5I7HA 2P9BA 2VQSA 1EQAA 1FUUA 2H17A 2W6QA 4P33A 3DBIA 3V48A 3K5HA 1GNRA 3DKIA 5BRAA 4R8RA 1SVOA 2BI4A 4QFCA 1ZRSA 4JUCA 1KYXA 4NYIR 4DIMA 1D6SA 1WSAA 2C88A 3B9PA 5AM3A 2Z8XA 1T34A 5EVJA 1YZTA 2B61A 4DAOA 4Q21A 3FGZA 3SDBA 1T0PA 3BGWA 2Y1FA 3KE8A 1VRCA 3ZWQA 1VPWA 5LD2C 3GROA 3OOEA 4NYIQ 2HT6A 3T7AA 4D9EA 3LU1A 5EXSA 3J7TA 4OQFA 4MPDA 1HYEA 3R0IA 4P7KA 1MORA 3LLSA 5KJ6A 2C5SA 2ID7A 1K7XB 1J09A 1WBDA 1CG6A 2W6PA 4CEIA 1YWGO 4D9HA 1XZGA 1K2VN 4RJJA 3U7RA 4FMCF 3SI7A 1WB4A 2IUTA 1BEZA 5LQRA 2CV0A 3BRCA 4GKBA 1KP2A 2ZSBA 3IEVA 1Q92A 1B8PA 1TUIA 4D3ZA 1XDUA 4AF6A 4P0PB 2R7KA 1WUIS 4S2UA 3WQHA 1RAHA 1B0UA 1FYXA 4EJFA 2JKYA 4QDJA 1MO4A 4QPNA 5MGBA 4UBIA 2ZJ1A 2E4XA 3A6HA 1SG6A 2QM3A 1VPVA 3JD3A 1SZJG 3MNFA 2JC3A 1UZNA 2W2MA 4HATA 4N8SA 2GXUA 2RB4A 1DWQA 4O3FA 4XWYA 3WLSA 3ZGOA 4BLOA 3UPUA 3BXPA 4CKCB 1KSHA 1BYIA 1KQOA 3DL7A 3FUXA 1PZXA 4MICA 3VQTA 4OOEA 5TNXA 3FPCA 3ICVA 5LLDA 5LNK6 5JAPA 2O2CA 2ONYA 4JSTA 3BIFA 4O2BA 3JV7A 1BMQA 2FPWA 4PNZA 1JPVA 1CW2B 4RKRA 4RZUA 4UM9D 5F52A 3EQ6A 4CDGA 4LXHA 5EKUA 2C7QA 5CDFA 2DHQA 4CTKA 5I9NA 4K5QA 3U7IA 1JXOA 1WPGA 1WXEA 1NZFA 1KY4A 2FN9A 3M9XA 3RSQA 3N7AA 2CNKA 1NQTA 4JI6B 4FJ1A 3A4IA 3AIMA 1WV1A 5ARDA 2E2WA 2W8BA 3ISTA 1WSBA 3PKIA 3PHCA 1K6XA 2BFDB 2OBFA 4FXPA 4GGPA 3OQJA 4FVTA 4K81B 4KQ2A 4LVUA 2PA0A 1IY9A 2C96A 3H5IA 3IE2A 4TKLA 1O9HA 3G85A 1XEXB 1GG8A 3CRW1 3TQQA 4EZIA 2XDAA 3WGVA 4RXUA 4DVJA 1S2NA 5AWFC 1OV4A 3V4VB 3Q3HA 3WS7A 2GZSA 1E1QD 7REQA 4LJLA 3ZHOA 4L3OA 4Y2YA 1BMDA 4MUJA 2ZS8A 3PSAA 5JW6A 1BXRB 3G2IA 1BQ3A 2CLFB 3Q3IA 3ZQJA 4HVCA 1T6XA 1Q1BA 1F14A 1FSFA 1HYGA 2PMBA 1F20A 3AW8A 3R5JA 4ZEWA 4DM7A 4BUZA 1G21E 1VKHA 1NLFA 3GUHA 3DBHA 1L7VC 2GCOB 2PRSA 3N2ZB 4Z5XA 4DT1B 5JXIA 1JPJA 1I94B 2DERA 3FNQA 4G1FA 1ZI8A 5K0SA 4OMCA 5L7WA 3DT8A 5KX5A 2WT9A 4TROA 5LOVF 5GINE 1J1UA 2W6JA 3ROGA 1MC1A 1V6CA 2ABWA 2Q3MA 3FMIA 1PJ8A 3A8TA 3AR6A 3ZZUA 2PTHA 1FRVA 1KHHA 3W7BA 4HJXA 5IN4A 1GPBA 3T95A 1W5TA 3Q6MA 4CKEB 1TRHA 4DIKA 4FEYA 1WL8A 1CUUA 4C05A 1H93A 4FZ3A 5HCNA 2NU8B 3OU7A 1Q95A 3SR0A 4UTNA 1QG6A 2CJFA 2YR0A 4XD7D 1FMTA 3HY6A 3AVVA 1GDHA 1RCTE 4BMYA 2PAFA 4QUEA 3ZXIA 4JLDA 1X3SA 1K5GA 2QXYA 3A9RA 4E6EA 4ZZ0A 3BCRA 1O94A 2X2EA 4YMWA 4BPBA 3ET5A 1SUAA 2DOKA 5KU1A 4N3GA 2HN9A 4QHYA 1L1FA 4QJBA 2QYTA 1KI2A 2A5JA 2QZ9A 2XADA 4Z86A 5AK6A 3ZJ5A 4MV6A 3UMSA 1QRSA 2R751 1NT4A 1OIXA 4PN3A 2F59A 3REGA 2QMEA 5CVTA 5A1TA 2WKQA 2P9CA 2O06A 2ARKA 2PCLA 3OPNA 4EHDA 5JRDS 4BQEA 2QJOA 4RMNA 1WW2A 3GFVA 4JB3A 1C3EA 4UDOA 3W7AA 1TVKA 1JFVA 3QG5A 4DR4B 3WX0A 3BERA 5JMWA 5KCZA 4IZOA 2ZRBA 3GT7A 4OI0A 1CQIA 2QUBA 2XUOA 1H8ED 1LS6A 3KPUA 3ZJTA 1XU4A 3A4LA 1RD4A 4GG1A 4AM8A 4O2AF 1F38A 5HA5A 3GZJA 4WCFA 4XEUA 5CB4F 3KJEA 1JH9A 1ZIPA 1UEJA 2PMEA 4MB6A 4MGZR 4Y2HA 5K3SA 4MR9B 3UAGA 3AF6A 1NN0A 1QVWA 4CCYB 2BAGA 2X9VA 5LQDA 3P0RA 3U19A 1M2FA 2D0PB 3NIWA 2CVZA 3AESA 5I7SA 3HDHA 3MGAA 5CYOA 2J3IA 2EFGA 2FLKA 4FGSA 4YRPA 4C1NA 4MQ5A 3ZPXA 2HO4A 4EAAA 4A91A 4EG0A 2AIRA 1MU0A 3D0OA 2FWMX 3DE1X 4F46A 5C8DA 3ZDCA 9ATCA 3P4YA 3CJQA 1JW9B 3PJDA 1HV8A 3BXXA 3S3TA 3V4RA 3IS3A 2GSDA 1V41E 4D45A 5IS2A 3M49A 2LNDA 4L4ZA 3QJYA 4LVNA 2PKYX 2VYVD 2JZCA 2IXFA 2NW6A 3PIRA 3M4ZA 4KVGA 3CNLA 3R7DA 5B7PA 3PFCA 1JAYA 1U7OA 3CSSA 1C3XA 4C7KA 2F3TA 2IBSA 3ETJA 7AT1A 1Q50A 1VKOA 2SCUA 4PG4A 4LRWA 1XELA 2OO7A 8ATCA 4N03A 4R31A 4AMUA 5K0ZA 3AHJA 1TLTA 1LTKA 3JVVA 1YC5A 1YI1A 5JCJD 2M2IA 2BGJA 3K9GA 1NE7A 4BKRA 2FVYA 2VDWB 3LD9A 4DCUA 4X66B 1QGUB 4QRDA 3N39C 3O8DA 3PI6A 3DBLB 3UCXA 3IIIA 1GGMA 4CIXA 4RIHA 3EPLA 3DL4A 1VMKA 3SPXA 4FC7A 4JBYA 1DAPA 4GHWA 1RI1A 5D3ZA 3UFXB 4GEGA 1A82A 5DM60 2IYTA 3OI7A 1ZQ1A 4YT4A 1QC5B 2QE7D 3HFGA 3N2KA 3PNQA 3Q7IA 4GECA 4RDHA 1D09A 3U5TA 1YB2A 4LYFA 2K2WA 4ER6A 3MIZA 3EA0A 1VLLA 4IXNA 5IKXA 2P35A 4Q16A 3SM9A 4DGSA 721PA 1O89A 1EWQA 3LWZA 3VR6D 4DMGA 2CZCA 1PSZA 2RAPA 2SKEA 3GQBA 4AY3A 2V7GA 1YQQA 2VBGA 2ZQYA 1CJBA 5ALVA 2NPIA 3CCFA 2PEYA 3PGMA 4MH0R 3SE0A 3V8RA 2G9QA 1PLLA 3LG2A 2VQDA 2W42A 1HKUA 5EOVA 2UYYA 1ZVVA 4HGNA 3DE6X 1SUWA 1PK8A 2PGNA 2C4NA 2Q1YA 2IYXA 2G63A 3GEHA 1PX0A 1JZQA 2N75A 1XZ8A 4U9HS 3AVUA 5KWEA 3I6IA 1N9KA 1PIWA 1YAJA 2CLMB 4BRUA 1ZWKA 3S27A 4ZZIA 1U7PA 1LGYA 1SC4A 2Q1XA 4HQNA 3VUEA 2QXUA 5AVKA 2ZGVA 5LP6B 1F4VA 3OJWA 3UFXA 4G85A 2POCA 2V03A 5HOEA 4RWZA 3K4PA 5DT9A 3TRDA 3A3OA 4XDGA 3AERA 1OLUB 2M6SA 3K0EA 4C6SA 5JAMA 2IJGX 1F0KA 1OXXK 3OZEA 4DPMA 1H2EA 1BE1A 5CD1A 4HLUA 3WWDA 3R0ZA 4DILA 4CMEA 3WLEA 3UJNA 2FY8A 1J2TA 3ESBA 1QHXA 4YRQA 2DY0A 4RQUA 1ADBA 4HWGA 1ZYUA 2W2TA 4BLTA 5ABPA 5M29A 3TG2A 2JLAA 1WY5A 4QFMA 2ZR7A 4NCAA 2AFIA 2A9PA 3HWSA 4P82A 3RSOA 2E6KA 3W3AD 3ZC3A 4F06A 3GLTA 3AEKB 4PU0A 4IXWA 2PRIA 2DKFA 5DE3A 5KTKA 1RRFA 1WTAA 4C2TA 1UH5A 1GM5A 2XE4A 3AY3A 5COQA 1P3Y1 3KVVA 3USZA 4CLHA 2Q5IA 3PX3A 5ALXA 2AK2A 2C2WA 3HI6A 4KWHA 2DX7A 2PSSA 4K9MA 1G5FA 1M72A 3R7AA 2CLEB 3A1NA 1VXOA 4NFSA 4G1MB 1TF7A 3C3MA 5EFZA 1QOZA 2W2NA 2ZYDA 1B3BA 3AFMA 4RUKA 4Y98A 5CJPA 5J4HA 5JAZA 2WWIA 5EXPA 3B9BA 1ULBA 3ZE8A 5KMGA 1RJ9B 4WN9B 2DG2A 2O8DB 2OHFA 1IAVA 4F2DA 4BNFA 4MW6A 4D80A 1PT8A 2JLUA 1Y1LA 3EVCA 1Y9DA 1RKVA 2F8LA 1XF1A 2IHNA 3FMFA 2J9RA 3OIDA 1I3LA 1P80A 2NX2A 1W30A 2P2CA 4ADSG 1L5KA 3SC6A 1NVMB 4ACAA 2CJXA 3D8RA 4LZLA 3F1KA 4U1RA 1IWBB 2JK0A 3FJ1A 1ML3A 4HDSB 2NZVG 1XA3A 1WQ1R 3X1KA 2HT1A 3AVXA 1USIA 2OCYC 1KERA 2FWIA 2AF4C 4LV8B 1F9EA 3EQ2A 1KO4A 2I7TA 5DBOA 4J1SA 1L5GB 1DARA 2CVOA 2WIJA 3HWWA 2CKDA 2QDXA 2JFGA 2HLPA 2H3EA 3G88A 1CQWA 3C6XA 3AR4A 1XAIA 4NY1A 1KS9A 3HKDA 1TMKA 3TCXB 3E61A 4IPTA 4DYDA 4PBSA 3E7PA 5EJEA 4FM9A 2C78A 2K6GA 3IVRA 2IS2A 1HEIA 2BHNA 3UMVA 3EDRA 3CVVA 1RNLA 2CT8A 1USGA 4LDZA 5IWCA 1ECFA 5JMPA 4A8JC 3EH1A 4MR8B 3NPMA 4OA5A 3W8RA 2BLNA 3PC8C 4DARA 4EHLA 4BIMA 1K7CA 2RGXA 3MS4A 4YLGA 2IEBA 4EVIA 5REQA 2PBFA 4JYCA 1YL5A 4AQYB 4CMCA 4MQ6A 2EF1A 4LWQA 5ALYA 5A02A 3CF4A 3HCBA 2FRXA 3RC3A 2B7LA 3KUCA 4Y8VA 3QJ5A 1QCCA 3M3PA 1AV6A 2B9EA 1IHPA 5L40A 3ER9A 2BZGA 5K4HA 2A59A 3TM4A 1PT7A 3L46A 1HWYA 5D6NA 5DGHA 3PUXA 3HXLA 3LUGA 2OVBA 2IVZA 3AJAA 5CLLA 3VM6A 2UXDB 1HT1E 2GYYA 1E18A 5CNKA 3B48A 1KC1A 5DNYB 3EXIA 4GI3A 1PDVA 2P9TA 2ZXFA 1SHUX 1NVWQ 5JJIA 1OFVA 1N2XA 4FFPA 5A6SB 4Z4HA 3BWYA 4NC9A 4AO8A 3BUSA 2C8LA 4L0CA 4JYAB 3HCWA 3OHMA 4B1FA 1GCAA 3KL2A 3MTJA 2VH1A 3BRWA 1OVMA 2A0KA 2OGTA 4J0HA 1ZHFA 1QXSA 2P7IA 1BXRA 2QK4A 2ETXA 2I4MA 4JYMA 2NQTA 5IBCA 4IJKA 1Z4IA 5GPBA 4GYWA 3ZWDA 2LR0A 4CLRA 5EPEA 1LBQA 1KEUA 3EULA 1E2EA 1VLHA 2I0FA 3FPSA 4E30A 1JF8A 4OQYA 2VSOA 2R6HA 4TX1A 1MQ8B 4PLYA 2IYEA 4QIHA 3ZVRA 4X41A 3V6LA 1C5KA 1FLDA 1XD2A 1X87A 2NYUA 3GJQA 3QVOA 3U3XA 3VYVA 4IDNA 4FR2A 4BO1A 4DLXA 2QL5A 2D6FA 4CKZA 4H3VA 4YNBA 1YOVA 2IFTA 2CUNA 3G2MA 2VBFA 5EWJB 4EG6A 1J0EA 5JOQA 5KTNA 2O57A 2WYIA 3UK7A 1EM6A 2PZKA 5C32A 1NXXA 1W47A 1S3GA 3B5IA 3LW8A 1HY3A 3QE0A 4M6WA 4NG5A 4X7PA 4Y2PA 3AF5A 5G0SA 3X2EA 4B6JA 1DGQA 1LPAB 4BS9A 4D0NA 3U56A 2O0MA 2HSGA 1IJFA 4NZ9A 5DNVA 3ORRA 1DX9A 1X1TA 1PBTA 5T8KA 2PX8A 3A10A 1Z6AA 1ZL0A 4KXUA 3GRPA 5P8WA 3G2PA 2BZSA 2Q29A 3VXKA 9LDBA 4G63A 5CURA 1BHO1 3GP5A 3R4CA 3IHWA 1YFKA 4RY9A 1A9RA 4U2EA 4H7HA 4L0QA 4R84A 3ADBA 4HNTA 1B6GA 1OBFO 2QS9A 3DAHA 3N74A 3RG8A 1XK7A 3I2IA 1JDZA 3QX7A 4NXMB 1EWYA 2AW5A 1E5VA 1QYWA 2BKEA 4F93B 1Z2OX 3PHBE 1BRTA 1FVFA 4PWYA 2A9JA 2QV0A 5FBLB 2HDOA 3CR3C 3MBIA 1QF6A 4KK4A 3S5JA 1RHJA 1FUEA 2WKWA 1OZGA 4NRDA 3THYA 1MBZA 1PNOA 2VYCA 2J87A 3BAZA 1LY1A 3RSFA 3HBNA 4OXIA 2CMKA 1G3IA 1J39A 2WTEA 2ZBDA 4WQMA 3RYFA 4AJHA 3CW8X 2IKSA 1UZAA 5EHNA 3VX4A 4B7XA 5FEMA 2Q9UA 5DPMA 4P4LA 1HMPA 4AY4A 5F4ZA 1QFSA 4QC2A 4KW7A 4DCNA 1RKUA 4MPTA 3MTEA 3VNBA 1VDMA 3IAS1 4DCOA 2OV4A 1XU9A 2GLTA 2IP1A 3PQ4A 3VPBA 4ZTZB 1NW7A 1L9KA 1N75A 1Y1PA 2HQOA 1J2UA 1S9HA 2VHXA 4UBJA 4ZQCB 4BP9A 2ZM6B 2AL7A 2IIBA 3CT6A 1XVTA 3VHQA 3J81k 2GZAA 3WGMA 4B6FA 3KJGA 1VOTA 3NAGA 3DH0A 4BOYA 2NUAB 1JLMA 1ORVA 1ETHA 4HEA6 1XXHB 1XRLA 2OUKA 4KXXA 4O4IA 1OX5A 5EJ9A 1VHJA 2ADMA 2XKJE 3LW7A 3U5ZB 4ZEXA 1IEXA 1V48A 2P90A 3GX1A 4GOLD 2V4ZA 4R1SA 3ZWKA 1DCKA 1QGUA 5LJIA 5KI6A 4C7OA 1Z8DA 3GFSA 2IGTA 2UUOA 4YCCA 4ZEOA 4EG5A 3IDSA 2W2OA 3F3SA 1WB5A 6PFKA 1V43A 2UVPA 2J6IA 4JUBA 3EAQA 4PHTA 3GFPA 4YQZA 4AXXA 1FNBA 1CFJA 2GYUA 2PT5A 3E9YA 4GP7A 1ZM9A 4S1WA 2WY2D 1H3EA 4G89A 1VA5A 1ZAKA 1NXPA 4B3JA 3CR8A 2Y76A 1C3OB 4UASA 3REFA 5AUOB 1WSDA 2H65A 3LY9A 1A50B 2QJRA 4IYRA 4MW7A 5K3DA 4DUGD 3DP9A 4QXRA 2TECE 2AOUB 3GDWA 2J6HA 3TSCA 3NGMA 2P79A 3ZZTA 2XOKA 1F6BA 2VJQA 4GXTA 1NWCA 1VHDA 4RFSB 1YE5A 1YMVA 3IQHX 3N0XA 5F5LA 2QRLA 5E1MA 5FF9A 5A4DA 5BY2A 3A6KA 1SGWA 5NULA 3VPAA 4L2IB 2YCLA 3FUUA 3GA7A 3I0MA 2WT8A 3A3PA 4XQEA 2GD1O 1MAAA 1KOLA 2PPLA 4BX3A 4GBED 2ZYVX 1BO6A 1NTRA 1ANKA 3ODPA 1L5WA 5FJJA 3DV2A 1L2TA 4EEZA 2XVXA 3EPJA 1YC2A 5M2QA 4Q7LA 4RORA 4YWJA 3DEKA 4IXTA 4NARA 4WTOA 5AOVA 2V7QA 2P27A 3HSSA 5KB3A 1ISJA 4TKVA 3VR5H 3SR4A 4ZGBA 4LJAA 2X1VA 2KJQA 2ORED 3S7TA 1UOQA 1PZNA 2NV2B 5CVDA 1SN7A 1HORA 5TSDA 3WGQA 3RTDA 2N47A 3UJDA 4B73A 3O6VA 3ZY3A 3DBOB 5ALQA 2VJKA 1E4EA 1N1GA 1P1FA 1Y4ZA 2PKWA 1V1RA 2VLIA 3FAKA 4NMXB 4QE3A 4QNRA 2VCHA 1TZCA 1K75A 5IAGA 2C7VA 1RQ2A 4JOSA 2CDCA 2V8BA 1VG1A 1OBOA 5EHIA 3FYUA 2EW1A 3COYA 3B20A 3P26A 5TLSA 5E3JA 2QVGA 3G0GA 1BE0A 1RZUA 3HU5A 4CM9D 1Q84A 4U7WA 1U5BA 4EJSC 3CZ9A 1YZNA 4G5SA 1UBRS 4II2A 1PG0A 3ZCQA 2J5QA 1XTQA 4X8HA 4ZGGA 3ESDA 1KK1A 3CSUA 2I2FA 3IKLA 5HDQA 2VHZA 1Y7IA 1MB9A 5FOWA 5HWSA 1XD9A 3RIGA 4QYWA 1CIVA 4Y6QA 3K09C 1ISMA 4I50F 4LJ4A 4FKZA 1H2ZA 1QFYA 2G5GX 1A5BB 3D7NA 1PGNA 5AESA 3M2PA 2WM9B 4DA4A 4F9TA 1WVMA 2FP4A 4YMTA 5CEJA 1NI3A 2ZIXA 5CM9C 1TADA 1UAYA 3FWKA 5AH0A 4KO1S 3WK7A 3ZE9A 3ZIAD 3HVRA 3EPHA 4ND4A 3ENNA 3Q3EA 3C7AA 1Z82A 5FOQA 3TAHA 4D4KA 1RTKA 3PGKA 3QUQA 2NLOA 5KYYB 3MOGA 1W0JD 2AN4A 2VDKB 3DE7X 4P3XA 4IIFA 4MGHA 2EW2A 1CRWG 2H2HA 1NVEA 4CFYA 1PTJC 1MNQA 1UMCB 5F1KA 2VWPA 4EJ6A 4ZV4A 1S89A 3BMOA 4HNAA 4UNQA 2POQX 5TX7A 2R97A 3UK6A 3ZZMA 1J1IA 1ILEA 1UT6A 5I8WA 4LBZA 4CM7A 3H5RA 5HM8A 2LTAA 2REQB 4EECA 5KOJA 4RENA 1DX4A 1X1EA 4OL9A 2Y71A 2WDPA 5B1SA 5TS3A 1VGVA 2FSHA 4CT0A 5JYDA 1PZHA 1HYQA 1T3LA 1E6UA 1R6AA 1RACA 2F1KA 4N1AA 3WK5A 2DKOA 2RBKA 4J0GA 3PUJA 5E2BA 2GEUA 3V8PA 4EPXA 3NNSA 1IXKA 3SKYA 1JLLA 3EE6A 3RV4A 3SEZA 1JHRA 2CFSA 3EZ6A 1RU3A 4PX9A 1VPTA 4BX0A 4ESEA 1PKXA 2OGUA 3ZDDA 4H6XA 1FS4A 1JKJB 2L82A 1LK7A 3TLJA 4KAJA 3EGWA 4FMPA 4NEQA 3A1CA 4E94A 2DSNA 4KPGA 3SVLA 3L7CA 4J7UA 5HMMA 3P19A 1RC0A 3A6LA 2BFDA 3ZW9A 5KQSA 1T8UA 4RETA 3SVTA 3KB8A 3EGVA 3EASA 4UHCA 1DAFA 1II8B 1XZBA 2NXJA 2YZGA 3R23A 4Q3EA 3F6EX 4JB2A 4GKJB 3T38A 2XUFA 4TV9F 3KU1A 5BSWA 3KLNA 3N8KA 1A8UA 1YKSA 5LM3A 4UCXA 4R05A 3BTUA 1EFVA 2PLFA 3RFVA 1W4ZA 1JWAB 3QPBA 4AYXA 1KJQA 3QLVC 1IQRA 2X6RA 3CNHA 5CVUA 1K6EA 4PYJA 3G0IA 4Y6SA 4MS1A 2B99A 3OTOB 4C7XA 3LC2O 2VHTA 3IE0A 1W36B 5FWNA 3DUFA 3QHQA 1K7YA 2ZAIA 5GZ1A 5JCOC 3C3XA 3FCCA 5FI0B 4E88A 4JXZA 4QQNA 2GZ3A 3REOA 3TIVA 3IIJA 3RPEA 3P94A 5EUMA 5EXXA 4WW0A 2C9DA 5T6BA 1QIKA 1K6IA 1X86B 3ODGA 2EW8A 4R41A 3ENWA 3B3FA 3SJ7A 1P91A 3TRFA 3S2SA 2AOVA 1T5LA 2OT3B 4FGZA 4OJKA 2E1PA 1PL0A 2OEPA 1U7WA 2YNMD 3A9WA 5EJGA 4EYEA 2GBFA 4HAIA 3DUFB 3ACDA 3PUKA 4IICA 3OTHA 5JU6A 2HLNA 3FFBA 4LOIA 3NGLA 2DJ5A 2JNWA 3IOCA 1V5WA 1N3LA 3P5BA 2KPOA 3R5FA 4ZREA 3VVBA 2ZI5A 1SKMA 1H4SA 1RI5A 4OJQA 3T7TA 4K9PA 2HMWA 1WG8A 3HS3A 1IB6A 2H7YA 2WUGA 4WACA 1M75A 1X7XB 3UJAA 1VYUA 4WZBA 2FP3A 5E3HA 2ZIVB 1TIBA 4BFZA 2BJVA 1T15A 2QTCA 4XYMA 3SX4A 5CFRA 4B80A 3AEQA 3GCDA 1P18A 3IERA 1NUQA 2UV8A 4N5NA 4Q1DA 4JR2A 2BFFB 1KAGA 3FHOA 2VZ8A 5KS2A 3DMPA 1M8GA 3K4HA 5TGTA 5FTLA 2YOGA 4PYQA 3GZNA 2VYND 1OZHA 4G0VA 5AT1A 1MXFA 4B43A 3GNTA 4AWXA 3N6VA 4G1BA 4YMIA 4B3HA 5I4KA 1OZFA 2XMQA 1SUIA 1U1IA 2O7NA 4LDPA 1JA0A 2W2LA 1DBQA 3DBVO 3KAQA 1M2VA 1R5JA 4IP0A 4WXYB 2AD1A 3BGVA 2B2CA 4P22A 3TI7A 3D6JA 3A2KA 1QUEA 1ZM2A 3PYXA 4N8EA 1HRDA 1IEQA 3QG1A 1ZH0A 2X4LA 5C3MA 1M73E 1TW3A 3KOMA 1JKJA 4NCBA 4GU5A 2M32A 4UM5A 3BB4A 2D7CA 2HV8A 3L8MA 4QFDA 5GONF 4NE7A 5I9BA 1RRGA 4RKFA 1CDOA 1YO6A 3UQYS 4ZU6X 3G2LA 5ALWA 1UFRA 2FQ1A 3TD2A 4RK4A 4WKPA 5HJEA 3NAMA 5LN1A 4QOIA 2D5LA 1MZPA 1Q7EA 1YBAA 1SVKA 3QBVA 1DOZA 3FF1A 3TAUA 2C00A 3F47A 4C3UA 4C4TA 4EG8A 4YUWA 3D8BA 2NO5A 1P3JA 4LY6A 1EX7A 4ZK2A 2QRJA 4AP9A 1XT6A 1CDZA 1GNLA 2AS0A 1CQXA 2VZ0A 3QP9A 3V1MA 4E12A 4R68A 2XR1A 3C24A 3IULA 4G6ZA 2O48X 3OJXA 4XA8A 2SKCA 3LMKA 1R6VA 3AYXB 3IUMA 4MK4A 4WK2B 1QHHB 1ZMBA 1EB8A 3BMOB 5D86A 10MHA 2JFZA 4OHPA 4AKEA 4G5XA 4K8OA 5L6LB 3LCRA 3D0RA 2NYAA 4INZA 3R44A 3O4VA 2X13A 1OAOC 2K7FA 1IQUA 3EXHB 1RM3A 2BM9A 5B1IA 2GBLA 3OOYA 1Z34A 1IWPB 3EZ9A 4JC5A 4LC0A 1F8UA 1IOLA 1P29A 1DG9A 4MQMA 3X3HA 2X41A 1EXVA 2CV1A 1OX4A 2A9QA 3HSKA 3V97A 2R0QC 3PXCX 1KKMA 2H1WA 4A2CA 2FMIA 4XR9A 5E95A 1WUTA 2PJRA 3N0TA 2QVXX 1KPHA 3TO5A 4C7JA 1WHSB 2JLQA 3E9RA 3PQ7A 4GZ5A 3UCEA 3HYLA 3IP6A 1HQYE 2HI0A 2OV2A 2ZRMA 3WL6A 4EA6A 5KVAA 2UUBB 3KB6A 5E6RB 1IM2A 1PR0A 4X20A 1PJQA 5F1PA 4C4YA 3K5WA 4IV5A 4F4HA 5E7JA 1EUDB 4MV0A 4RTLA 2IYSA 1FCJA 3AZQA 2I4OA 4YRDA 1ITZA 1U5BB 1T2CA 3F7NA 5LYYA 1TECE 1SVWA 1Y81A 1LB1B 1WCV1 1U1CA 4J3JA 3VYSB 5L51A 4JVSB 4PW0A 3L0SA 2H8KA 4UAGA 1PEAA 1N4AA 3HYNA 1PBNA 2BCGY 1U9ZA 3UB2A 5MFPA 1XMJA 2D2IA 1CJVC 4MW5A 4AO6A 2CHGA 1G7CA 1MH1A 3EEFA 3USCS 4AECA 5JCJA 3TL2A 4CTOA 2B7BA 3CH6A 1GPKA 3FWPA 4ZT4A 3GLFA 1CZOA 2QT1A 3SS7X 5I8ZA 4WKOA 3WZMA 1NDHA 1US8B 4AULA 1D03A 3GV0A 4WJLA 4Q9NA 2PS3A 1OMOA 2AFHE 2I33A 4J29A 5H82A 1N1MA 1UAGA 5T67A 1V1MA 3C1OA 4CV2A 4LKRA 3NBQA 2UKDA 2VYVA 3KK0A 2JH9A 1VYTA 3RABA 3OOJA 1H4QA 1B16A 1TCUA 1S1MA 3M5PA 4NH4A 5DN6A 2DWOA 5CDUA 4XIJA 4M1SA 1XQVA 4C4ZA 3AY6A 1JR3E 1FX1A 3C3BA 1EVKA 4KXLA 1BXGA 1AO0A 1C41A 1IEWA 5I7WA 1N34B 3K6SA 1QGAA 1NLUA 1SCBA 4I99A 1U8TA 2WVJA 2ZVPX 4LYDA 4PZYA 4EHFA 2GRUA 5KIAA 1K27A 4M8LA 1PN3A 2VEDA 2JCSA 3JALA 1N1DA 2HU5A 1N4DA 3RUCA 2HJHA 5CDTA 2QVBA 3K5PA 3PFGA 4RKEA 1IU9A 2O6HA 3MJTA 1HURA 3OFKA 4JUFA 4MW1A 4L95C 3FNRA 4CM4A 5TQ0A 3GF4A 1Z17A 2QVZX 4UE6A 5DB4A 3RTEA 3VU1A 3WKDA 8ABPA 5JRJA 4HQKA 1NOKA 2DJIA 1RBQA 1R6DA 1C3VA 1SQGA 4QOHA 4UATA 1U8XX 5E6UB 3RBZA 4CTJA 3C97A 5BN1A 4CKWA 5JANA 2P0YA 2YWXA 3TDMA 3I92A 2D0IA 2GPSA 2BFPA 3H2ZA 3IOYA 5TPWA 2YV4A 4PQYA 5AKIA 3L93A 4OYYA 1QPZA 1EX6A 1E2DA 1Z0DA 1EK1A 1JYEA 1JYFA 4JXKA 1CJKC 1WA5A 2ZIGA 1PVDA 3K92A 3LX5A 2HZ7A 4WRRA 4A8JB 4CCWA 4PC3A 3KXIA 1LUAA 2ZSHA 4I9UA 1UM9B 2Z3WA 4QJIA 2P6UA 5HS6A 2EAUA 4YJDA 1I1NA 3KR0A 4MROA 2VTVA 3MQ2A 3CB2A 4WXPA 1C8LA 4ASUD 2ZUVA 1EB9A 1YQUA 2G1KA 2F3SA 1AGYA 3Q8WA 3IOBA 4H77A 2VAPA 2Z6VA 4P34A 5JI3E 3RKUA 3SX2A 5JS7A 5HS4A 1QE3A 5CDHA 3MAAC 2IU6A 2ZIFA 2VDOB 3DZCA 3H3FA 3PU6A 4Q4HB 4XB1A 5AKEA 2C4KA 4RC9A 3ZVLA 3LL4A 3LBIA 3AH8A 4DFDA 4JJIA 2V59A 4IFEA 3IBCA 1RTTA 2CNNA 3EIQA 3TRIA 3EC7A 1MRNA 2JFUA 4ALLA 4BV3A 5B5SA 5D1NA 2WF5A 3FCSB 1NBIA 4RS4A 3H42B 1NX6A 4ECEA 5J4VA 1RWQA 1T0HB 2BGTA 5BQ3A 4HTAA 5HX7A 4MQFB 3M0EA 1HDEA 3NIBA 2QTAA 3IAAA 1Z8NA 1J22A 2EBUA 3U81A 2GCGA 2BBSA 1AZSC 1DIAA 1FDIA 2XTJA 3F2VA 4G0XA 4P81A 4PR0A 2QRVA 3IESA 5EINA 4F72A 1NNEA 2VA8A 2YN0A 5AKGA 4MS4B 4LS3A 3R3YA 3SWWA 1FYDA 2HTFA 1CZHA 1E66A 1NUAA 1YR2A 2DPLA 3GUZA 3W8FA 1R0CA 2VRNA 3IEUA 1B8VA 3PVSA 1G8JA 2CHUA 5HKAA 5ALLA 3QEBZ 1XRRA 3HZOA 1XV5A 3FFWA 1UXIA 2I66A 1E62A 2WWRA 1UQTA 2W2VA 2M6RA 1PG5A 2YHBA 4HGOA 4B4VA 4OHYA 4LX0A 4BO8A 1ZISA 4WZZA 1XNRB 1GPH1 1PTKA 4X7BA 5ESDA 1R4NB 3D7SA 3K6JA 3FWNA 2YJGA 3A1SA 2EFDB 4TTQA 5DK4A 2H5LA 2R6AA 3I58A 2EFCB 1T29A 4IVPA 3F5SA 5EP3A 4RPCA 4EYKA 3M1YA 3OEWA 1TL7C 4J7XA 4KXMA 2OCXA 2YBDA 3I4CA 4GRDA 4RSMA 1PQ4A 1P5JA 3K8YA 4DA7A 8AT1A 2W2KB 4HY3A 4HS4A 2Y6UA 2I1WA 2X8BA 1BA2A 4WERA 4MCAA 5DVZA 3GJXC 2PLRA 2H5IA 1TU4A 4OL0A 2VBIA 4JLJA 4YCBA 4DBLC 2FOIA 1H85A 2QY6A 3E9CA 3O75A 4Q9KA 5DBHX 2J31A 1JSXA 1WLSA 3BBPA 3HC7A 4GOKA 3Q87B 2WSSD 1YQEA 4C1BA 4Q03A 5JFTA 2FX3A 4RCZA 3NEYA 4HLUC 2YY6A 3IP5A 1TIPA 2A7XA 2N3ZA 4AZ3A 1W8IA 4IQ4A 4XYGA 4G36A 4FUTA 1DBSA 3K1AB 4JFRA 2Q0SA 2YHIA 2Q1WA 4RVSA 1CZKA 2PUHA 4DXDA 4B9EA 3P9KA 2EJWA 5E9AA 3ADOA 3MMNA 4D02A 3DAOA 3JQGB 3H86A 3LPAA 5A6SA 4QSMA 2GBCA 3JQ9C 2FPIA 5EERA 1Z33A 3V4OA 2APJA 5A6VA 5ESWA 2F55A 4MB2A 5EZYF 4CGZA 1KO1A 1DMRA 3KLPX 5IJWA 2HSZA 3IUQA 1V8DA 4HEJA 3GRRA 4OEHA 2FSVC 3NHFA 4C03A 5BSVA 1SCIA 3X2FA 1E3MA 4RK1A 3O4FA 4QEDA 4INPA 5KJCA 5C1IA 4B35A 5FNVB 1XHFA 2R5FA 2X6QA 3N8IA 2OQVA 3GJRA 1Z16A 3EGXB 3K73O 1U2DC 3L7KA 1WZCA 2IQIA 1DDIA 1XEFA 1ZIOA 2L69A 3AJRA 1JHYA 1X8LA 3BICA 4KU4A 4DMRA 5ITWA 2NMVA 1JHXA 4IGEA 3RV3A 2WWHA 3AT1A 1RPZA 3CNEA 1AK1A 3MWFA 1NHWA 2R6CA 4M8KA 4MO2A 4KFTA 5FO1A 2HSEA 4BYGA 5EQFA 1G4UR 1B73A 3I6BA 5LYJB 3V1KA 4GZMA 4MR8A 2BE7A 3BXHA 3BK1A 3FTCA 3O9ZA 3T7RA 1QBKC 5K8IA 3AO0B 3MGCA 1GYRA 3DOHA 1J07A 1ZC3A 2R6DA 1SXIA 3H9UA 4X44A 4C6RA 1VBNA 1RSZA 1XCBA 1SOWA 1P75A 1Z4OA 2AVDA 4JX8A 3UC5A 3MINA 3BEOA 5AW6A 1RQLA 1JU4A 2PKXA 3CM0A 3TUIC 4UTPA 1K3FA 1NU6A 3L6RA 2O8BB 3ESZA 2HJWA 4L5CA 3GLVA 5BNFA 4NF2A 3OICA 4BGUA 2ZKLA 2FR1A 2MYUA 3K9FC 4OBBA 5E4JA 1U0FA 1J5EB 3IO3A 3QF4A 4BLUA 2IDKA 1SOUA 5LZ2A 4MKFA 2DXIA 3ZGYA 3NIGB 1DXQA 2BGIA 3FBTA 4LHXA 4L76A 1SXJD 1OAAA 3IVXA 4GOXA 3UOGA 3KELA 4RTQA 2ZXUA 3ST7A 1EVIA 3T9CA 1MC5A 2VJBA 1KFJB 3DDCA 1UP7A 1ELOA 2PMCA 1BQEA 4U4AA 1K6JA 5GM2A 5TE9A 1ZMXA 3D3QA 4M21A 1II0A 4CLXA 4CEJA 3UGTA 2QSZA 1K68A 1EEHA 1H4VB 3B3GA 3THSA 3TSAA 1C8VB 1GAXA 1VP9A 3K30A 4GMDA 4J43A 3FH0A 4GI1A 4V24A 4Z53A 3AVWA 1AQJA 3TIGA 1JEDA 2R60A 4DDKA 1WTCA 2JEYA 1V9CA 4US1R 4EDHA 5ICSA 4CMBA 5K03A 3WYAA 1QCZA 1YR8A 3M3HA 1EQ2A 2G4LA 3UV6A 4RHTA 2FPUA 5DRTA 3WAKA 4EB8A 2ST1A 2O8CB 1L3IA 2JAQA 5J2UF 3F7OA 1EZ1A 2QRZA 4A7PA 1BEEA 2CLLB 4OXQA 3KOOA 1B7GO 4ZQBA 3V46A 2I4IA 2MINB 3VVLA 1YTUA 2DQYA 1NVAA 1Y3IA 1YDFA 1G42A 4GDFA 2X76A 5DGTA 5IRCD 1M5UA 5LOVB 3C85A 1SULA 1SBHA 2QZJA 3AG6A 3CLTC 1JIVA 2O2JA 1KS2A 3AIIA 1Z56C 1B74A 5IEBA 2NU9B 2GF2A 3L7IA 2FCRA 4QOGA 2Q2VA 3A25A 4WY2A 2XB8A 1Z8HA 1R0XA 5IVPA 3F9CA 4IMJB 3IAUA 1G0OA 4ZCMA 3FPAA 3HE3A 1SELA 2MJLA 2E4WA 3NHYA 4I4CA 4NYMR 4TYMA 5KKNB 4V0RA 2VH5R 1FSZA 3UG7A 2GESA 4EFLA 5IZ4A 2B2XA 1WDMA 2HWWA 3E3LA 3QU7A 1AU9A 4MGIR 4D97A 2ZRHA 5HBGA 3O8RA 5FPPA 4CF4A 2I8AA 4WASA 4E33A 2FGKA 1OXBB 3QBDA 3L8EA 3UAZA 4N5MA 3U9TA 3BE6A 4PN7A 1SOVA 2X9NA 3NS7A 4Q1VA 1KOFA 2XB4A 3KUXA 3AKEA 3TD9A 1NPDA 1USWA 4XJSA 1ZM7A 5JY1A 1YD7A 1WOMA 2FA9A 3ANYB 1TMOA 4L72A 5FPSA 4M0PA 3HPQA 1OBVA 2B8NA 4MVJF 1XWFA 4CQMA 5AW8A 4M0CA 2X0IA 4D3YA 3ZGLA 3TN7A 5FI5A 2PAAA 3RBXA 3CT4A 2VI5A 1I8TA 4IXMA 3BH0A 2H11A 4NJMA 2FZ5A 4JJ7A 3TLYA 2QJWA 2MU1A 4LCEA 4BNNA 4RF4A 3IQEA 2XA2A 2R4QA 4U2GA 4AJEA 4EP1A 2J9XB 3CX6A 4XX1A 2ZTUA 5FYQA 1ZVKA 1E9VA 3OE1A 3DFMA 4HG2A 1CLEA 4CMIB 1E61A 3QW4B 3VO8A 1OBCA 4A6EA 4BBZA 4HH3C 4ETWA 3JQBA 1ZD1A 4WNAA 4NZNA 2GOYA 3M81A 3DVAA 3E4CA 3VOTA 5LQUA 2HR1A 3JQAB 5EIBC 5ER6A 2C7BA 4MPJA 3JQAA 3I45A 5TMBA 1K08A 3L1HA 1ORWA 3DVAB 1WPXA 2E9SA 3RJZA 2RONA 3KUKA 1PK9A 3TNYA 2G5PA 4R1TA 1A71A 4CMIA 1OJLA 4M49A 5IF3A 5IMSA 1REQA 1S9DA 4C87A 1OWOA 3RD5A 4TXJA 2QAGC 2O59A 3CKYA 3L7BA 1C2TA 3WYGA 2I9KA 3HADA 5EQJB 1BDHA 4BO9A 2BJWA 5EGNA 5CH3A 1V45E 4FEAA 4HUTA 1PQWA 1XCPA 1WW3A 3H19A 5LNK1 2HEGA 2WMDA 4WEQA 1U94A 2C2ZA 1SBQA 1Q21A 4ARZA 1PGJA 2FDRA 1L4YA 4LZJA 3SEQA 1MABA 4YB8A 4PNHA 5IDWA 2OQ2A 2ZB7A 1V25A 2Y0CA 3H5WA 4XCXA 5DHSA 1MX9A 2WKSA 3GW8A 4ZCPA 1GZSA 4KIGA 2EDAA 2CVFA 4WESA 2WTMA 3BFJA 5LU8A 1OC4A 2V9CA 1B41A 3SS8A 1RQNA 3IRUA 2JIRA 4UW9A 4XXHA 1HE8B 3EGIA 2FH5B 1LLUA 2CLOB 2ZRGA 3M7IA 3L7LA 3OESA 2R1VB 3GGPA 1TCCA 3O4RA 4W8OA 1CF2O 2JZOA 3CZ5A 3ZS9A 4CCYA 1V3UA 2RG1A 4QPJC 3RIEA 1FZQA 2BUCA 2FSSA 2WJIA 5KNCD 3TCNA 1V4NA 4DSNA 1H0RA 1SHLA 1XDDA 3GFOA 4G97A 2ZDQA 4G5QA 1RE0A 1SCDA 1E3JA 3NKFA 1PZEA 1O96A 1XRMA 2DFTA 3QELB 4KUHA 4IDOA 3EFEA 2NU9A 5JG7A 4ZCQA 3P9SA 4CNBA 1CS4C 1F1JA 2YTZA 1HE4A 2DH5A 1NXQA 3GI1A 1NVVQ 4Q4DA 5EKXA 3QYPA 5DCWA 5F33A 1WP9A 2H1SA 4LXUA 2BWJA 1WU8A 2IXEA 3I42A 1JFFB 1KMHA 1Z88A 2GCNA 3FLEA 3RVPA 1QLJA 2IOHA 5CHYA 3T5MA 3WG9A 5BW8A 1U28A 2WVAA 4LMPA 4A73A 2IH5A 1G5QA 5A4KA 1OFUX 2OBNA 2X3UA 2CNOA 1CZUA 3H9EO 3SZRA 2AK3A 4KR2A 4KMOA 4F85A 1IJEA 3EZLA 4N82A 4Q9LA 1JIXA 1F5NA 5DM1A 1I6WA 1Q0RA 3S5UA 4FFLA 1M34B 4OHMA 3RS5A 1T3SA 2NSDA 2WJVA 1ZD3A 3IOEA 4MUGA 1YCDA 2FHSA 2GF9A 3O3CA 2I29A 1E6CA 1UMDB 1TEZA 3WHIA 3WZLA 2QD4A 1KAHA 3WI7A 3B1ZA 4D0RA 2H2AA 2EC5A 4UEKA 3H9GA 4IQGA 4Z54A 3ETGA 1NJ5A 3E81A 4OXKA 4EL0A 4OX9Y 3GYGA 5EJAA 1J2YA 4C5CA 3GLUA 3W0LB 3WV4A 3TM5A 3VDQA 4FHZA 1F2DA 3DO6A 4Q7QA 1JILA 2QRMA 2ZS9A 2NAPA 1WPRA 3PWKA 3W1VA 2BP7A 4YYZA 4MKRA 1HETA 2FSPA 3RF6A 1KZ4A 5GV7A 3SXPA 1KDTA 1IYZA 4G56A 3INYA 4IJWA 2ZZNA 1NP7A 1VBFA 3LVQE 5IDXA 2VUTA 3UWMA 4DT1A 5BR8B 5CLQA 3ZKWA 3K70B 2LCIA 3PFBA 5IKEA 1Q0LA 1AZTA 3E3OA 4ESHA 2XUKA 3PYLA 4HZUA 3ZHBA 4QT4A 3QIVA 4QAJA 4ZWNA 4OY3A 4R1QA 4DEVA 4HNQA 3ZOZA 3WRVA 2BHRA 4YO8A 4PICA 4N0MA 4ND8A 1EP2B 1VPLA 2A1TS 1XC7A 2JGRA 2BEUB 3KPYA 1E8MA 3SHVA 3S28A 3VI4B 1BRMA 3UT0A 2Z3ZA 4ARSA 2IUEA 1OHHA 1UC5B 2OAQ1 3OHSX 1NY5A 3I5AA 1YS2X 3L4JA 1VLJA 2CD9A 2GWRA 1VRVA 5BW5A 4DG9A 3EXEB 4KCGA 1XEXA 1NF8A 2UYGA 5ALHA 3FVVA 3U7EB 1V5GA 3I05A 2Q5EA 5JAQA 2HTEA 5EE3A 1FSPA 3M89A 3DVRX 1E32A 2HF7A 3HJCA 4QJ5A 1HOXA 4WT7A 1Q0QA 1T9HA 1UDAA 2W6JD 3CVUA 2CSXA 5CB4A 2B5WA 1IUKA 3BGSA 2PLAA 3DEIA 2VFAA 2FFAA 2IPMA 2PQ2A 5AOAA 2GXAA 2V6JA 3FYDA 1M2OA 3FF4A 4YXFA 1XVAA 4RVFA 4EW6A 2A9VA 2WWFA 3TH5A 5CA1B 4KHPB 2HXSA 1LJLA 1T9GR 2HJSA 5EE5B 4BXOB 1I24A 3MUFA 1MVLA 2OMKA 3FNEA 4NBRA 4BO2A 1UKAA 3M4NA 4K9RA 3TXXA 1UFOA 1K0UA 2C7PA 2GJ4A 1UJMA 3K2QA 4WOBA 4B0OA 1FTQA 5CIYA 5AVXA 3AVTA 3M5CA 2A1UB 4NZZA 1NFRA 1YZFA 3NX4A 4MAAA 1MPXA 1A97A 3DUWA 3EIEA 2XBMA 3VPXA 1K4YA 4NVRA 2G9ZA 1ZXLA 2F4NA 3QKWA 4OKNA 1XLTA 1L7NA 4O29A 3W2GA 4DDHA 1ABBA 2ZKIA 1AY0A 1L4LA 4OH7A 2AX3A 2EX4A 4CI0B 3TJMA 4GH5A 2PUVA 4DYVA 1H2XA 3S29A 2A1UA 1E7WA 3HZRA 1G55A 2BUBA 3TBHA 2GHRA 2PQ0A 3AHHA 1KE2A 1PQPA 4L5YA 3BXZA 3CH5A 3HCCA 1PTJA 1XEWY 4K9KA 3TLZA 4YAJA 3LT4A 4EGQA 1CB0A 1KWGA 2OV3A 2IE0A 4KYUA 3WWZA 1QK4A 2C2BA 2ERXA 2G06A 1N3BA 3ED5A 3RS9A 2WWVD 1PZMA 2ENUA 2YRXA 5F7JA 2BMDA 2VTEA 4JLOA 1Y6FA 3MT0A 2C5HA 4N3CA 1DS6A 3ETHA 4Y0NA 3ZIDA 1R6TA 1VG8A 1YIOA 3KHUA 4DY4A 1EP3B 2WIAA 3PNYA 3QY9A 5EZQA 5JE8A 3OFND 3TTSA 1TMYA 1OTYA 1DJPA 4MXDA 4MIYA 2XTZA 3V2UA 5B4UA 2EBWA 2HX1A 1G7SA 1Y0BA 3PC7A 3W6NA 1A8QA 2I54A 2H54A 3P9RA 4Y2SA 5C80A 4HQFA 2VTBA 1PJ3A 1ZJ6A 4GE3A 1CY0A 3QLEA 4HB4A 1J7KA 5HFNA 4F5EA 1B26A 1M6YA 3VDNB 4W5HA 5AW3A 2R00C 2AKAB 3EEQA 4IGFA 5FBRB 3USES 3KVOA 3WMXA 1E9BA 2YVLA 3FOBA 1S1CA 2V5UA 1Y5MA 3C41J 2QUZA 2WTBA 5JLJA 5KSOA 2YRFA 2J9ZB 3LZCA 5IKOA 4PSAA 3AFOA 5THQA 2C2XA 3W6OA 1B8UA 3AJEA 1DJOA 3BORA 2H5EA 1TO2E 3LY5A 2OC9A 4FBGA 2C0CA 3T7DA 1QGYA 5CJJA 5FAKA 4YR7A 3ZXXA 1P9NA 5BR7A 4OXNA 1DKOA 1PJBA 2JHAA 3IOMA 4PC6A 2VPYA 3SU8A 1NUUA 2V1XA 1QQTA 3GLQA 3X43A 1JE0A 2D1YA 4ZOLF 4X84A 4FR5A 4HX5A 3SQNA 2JCGA 1YS7A 2AHOA 3GLHA 2GARA 2RFLA 5JSFA 3CEAA 5AXDA 4CWAA 2I6SA 5EUCA 2OCLA 1NFQA 2O2SA 4EB0A 5JD4A 2GPWA 1SA0A 1HLFA 2RG7A 2EWWA 1XYVA 1GSAA 5IAEA 1MNAA 2VC2B 3KHSA 2JFNA 3TR6A 3OLYA 3W5BA 2Z6QA 3G0OA 3ETNA 2GKSA 3BREA 2W2XA 4Z4FA 1R16A 2J45A 5DBFA 4TLLB 3WSWA 1JMVA 1T8YA 4IDGA 4A8JA 3CU5A 3OOHA 3LLVA 4K86A 3W7VA 2BFWA 1A4UA 2JBAA 2B8WA 3LRPA 4I5GA 2A0XA 4KMMA 4UXHA 2VDPB 1Q1AA 2XJ9A 4IDCA 1XX6A 3VU9B 5LA6A 2DVMA 2HLHA 5JARA 4GVLA 2P6MA 4QUBA 3AMVA 3M34A 4CF6A 3RNLA 1P73A 1MQSA 1R5BA 3TUJC 4TMFA 4F1KA 2GJAA 1VI2A 4DSOA 2O4CA 3OWOA 3H1TA 2CVPA 1JEEA 3A36A 4KR0A 1CHNA 2X4DA 1U0BB 1J33A 1JR2A 4Q24A 3S8MA 5JADA 2G82A 4RD6A 5B6JA 4R51A 3OETA 4R2WA 3JALB 3GARA 4IH9A 4QDUA 2IX9A 4L6CA 1FUYB 2YNMA 5BNIA 1FTGA 2Q99A 2JH8A 3TTXA 3KDPA 3WLFA 5HQJA 3K6SB 1KJZA 1K5PA 3MS2A 1NI4B 2QJFA 2R4TA 3HU1A 4RIIA 4FHGA 5KVVA 1YZGA 4S2EA 4A92A 3H1GA 3ZBQA 4BU0A 4Q4CA 1COWA 3NONA 4XVCA 1ZP6A 2EXXA 3HLKA 2J8ZA 5LQSA 3TZEA 1EGHA 1K5HA 3K70D 3IT2A 2VT2A 3FUCA 3L79A 1KKLA 4II7A 4TT3A 1JP7A 4YUVA 3SHQA 3UAWA 2BKVA 3N8HA 5FA8A 5JZOA 4JU9A 2LBPA 4ZAVA 3V3KA 1NA5A 1Q77A 1HF3A 4JSYA 1Q2XA 1Y63A 1WHTA 1H94A 2XCQA 3GRAA 4NONA 5ICMA 4RPHA 4C30A 4LRYA 1QF7A 4PLTA 1M1YA 2J67A 3M1AA 3RTCA 5I47A 5B1EA 2X2OA 1X7DA 1D2EA 3L9WA 3ACCA 5JNRA 1ZSNA 3OT5A 4M1ZA 2RAUA 5C0OE 1IUOA 3FFAA 3OLCX 2DYKA 4KI7A 3U3OA 3MJSA 4QTYA 1DAHA 1UJ2A 2ACVA 2BR5A 3SX0A 3TSOA 3WLOA 4ZCRA 1GKUB 2JDID 3GO4A 5CT5A 4B4UA 4ZOAA 3DLHA 2OV1A 2E6UX 1BS2A 1J8QA 3RUHA 1B14A 3PE4A 2PUJA 2EZUA 3U26A 2AD5A 2GEDA 2VO1A 2QG4A 1NAHA 3D4NA 4BFLA 2REOA 5KBYA 3I83A 3PDWA 4OPMA 3STXA 2PUCA 4WGGA 2X5NA 3IQZA 4AO7A 2OAEA 3PUIA 1E2JA 5EPOA 2CNWA 2IY8A 4RHUA 1U9CA 2EIXA 1P2SA 2P30A 2QYHA 5AK4A 5IANA 4KO8A 5G1OA 1JU9A 2R11A 1XZNA 2RHWA 3SQDA 4YQEA 4TOIA 4ZVSA 3N2GB 1RYNA 3TLCA 5K0FA 2IS6A 3KLBA 3D7RA 3DKKA 3MF4A 9LDTA 3I37X 5ALRA 3UMGA 3F6BX 5IAOA 5IUNC 4WNAB 2JJ1A 4L9AA 1GP2A 5BUSA 1N5LA 1SWVA 3BWDD 1VTKA 4FKBA 3OPYA 3IAM6 4BQRA 1GOTA 3I72A 5EMLA 4QUKA 1I4TD 2E0IA 2XI4A 3JR3A 3GUYA 4YASA 4GOND 4NBTA 3ULKA 1V39A 1E2QA 5JLAA 4H1WA 3VBEA 4C21A 3PDIB 4YBZA 3PC6A 3LUPA 3FZEA 3PR3A 2C5BA 2OBXA 1RLJA 1G63A 3JPWA 3MTQA 4Z1MA 2C94A 3CUEF 2CMHA 4X1IB 1ZCZA 3TLMA 1EWRA 5JD6A 2GFHA 4N54A 3C70A 2F6RA 3KYJB 1QO9A 1PDWA 1ISGA 4K9QA 3E9NA 2QTVA 2H1IA 3N8DA 3HHPA 4NNOA 5DNEA 1XNQB 1Y82A 3KB1A 4CBVA 1TYAE 1SQ0A 3VPGA 4BQSA 3I8OA 1PD1A 3GDGA 2WSMA 3S2EA 3G9TA 3VKVA 2WJ6A 5EIXA 3SIRA 4Z7JA 2PXAA 4C7MA 3UJ8A 3ONDA 1NE2A 3EC2A 1MJFA 3NWBA 2YXDA 1DWOA 3BXEA 4U5XA 4UHBA 4YJGA 2W6MA 3A7EA 5EPUA 4AG5A 1JDNA 5K3OA 4HDRA 4MCJA 4TKUA 4CJXA 3N6XA 1KNQA 1RM0A 2M98A 4MR7B 3BH7A 3A3YA 1U0SY 4IWNA 4NQRA 4ETIA 2WM8A 1DC5A 1YDWA 2ID8A 1OYOA 1YHZA 3RS8A 1BFKA 7ABPA 3ZVKA 3E15A 4HOYA 4Z8YA 5KSWB 4RQTA 3ITDA 2VYFA 3PFNA 2RGEA 2JIDA 4BVEA 1M2OB 4Z0TA 3O8QA 1LLFA 1VKZA 1CHDA 1L7AA 4P92A 3TMYA 1OH6A 4BY9E 5D7BA 1CETA 2ZJ7A 1N5MA 3EISA 4IY1A 5ILQA 3NCHA 3AI3A 2CSUA 4QODA 3Q1KA 1WKBA 1UPTA 4IIDA 2FPPB 4TN1A 5DBIA 3WHPA 3JD2A 2E4UA 2QX4A 2A5YB 1PJ4A 1TK2A 3WAGA 1OFIA 1ZMRA 2V6IA 4E6PA 2X0RA 4XVUA 1L7QA 1LLQA 2ZOSA 5T4BA 1HL7A 2QRNA 2X1HA 3AFHA 1L7PA 2QMUA 1GFZA 3DZGA 3HTXA 4RMJA 2OFFA 2MIIA 3G3EA 5IHXA 4ZYWA 4WBNA 4K7JA 2JGIA 1C1XA 3QVWA 4DJTA 2FI1A 1C1DB 4UAJA 3TMAA 4E15A 2KW5A 5EXEA 1FRFS 4A8HA 4RVNA 4S1VA 2AMJA 1QPGA 2AI2A 5TEVA 5JAOA 1MJ5A 2OFPA 3ZR4B 1S8AA 1CIPA 4EATA 4GWLA 4RADA 1QE0A 3U4AA 3Q98A 4F84A 5IF9A 4G4IA 2FUCA 2Y0BA 1RM4A 3BAFA 5A0FA 5TV2A 3DDHA 1IY0A 3AVOA 3EQ9A 5TMDA 4ZDIA 1UL1X 3FUTA 3KOYA 3N9IA 2O8BA 2R6GA 3UWKA 4KHZA 2WZCA 5F73A 3SLGA 2BP7B 2ZRNA 3DPSA 2IEIA 1E2UA 1HO3A 2ZJ3A 3GDOA 5CH5A 3MMSA 3K94A 4JBLA 1UZLA 2OLKA 3EG9B 1NSYA 5ULLA 3VH3A 3COSA 3S99A 4EKGA 3VR4A 3O84A 3OH8A 4XX0B 2O1EA 4UBKA 5GVSA 4S1PA 5BSKA 1UADA 1IVYA 1E2HA 1U5CA 1RPAA 2AXPA 4ZAFA 3DCJA 3KJQA 2GLXA 4ZOLB 2VDNB 4W63A 4JP8A 3TQFA 2QW1A 1OOEA 2NADA 1Z4MA 3O3OB 2VPIA 1P45A 1SQ6A 4KVFA 2EJBA 1M3SA 3DW1X 3QOXA 3FLAA 3DE3X 2RGWA 4ARIA 2DLNA 2JIMA 2QTTA 5LBUA 1W96A 2J32A 3EGXA 1JSZA 3H6GA 4JKIA 3SHOA 2HHHB 3R20A 2BELA 2HREA 5L4LA 3UWDA 1FXWF 1ISPA 3A1UA 4GYKA 5FNVA 5C8YA 3GEPA 2ZUBA 1J9ZA 2QM0A 1NV9A 3JSXA 3PUHA 3LY8A 4PPGA 4OK6A 4ZOLA 2Y67A 2N1MA 5JT1A 5HF5A 5H4HA 4B74A 4JI3B 1YJQA 4D98A 3VSEA 4FDAA 2XTMA 5AKHA 2PRJA 4PHGA 3SS9X 4TRMA 3DTVA 4L5BA 1AKYA 3NEPX 3HGQA 4NG4A 1A9XA 3PCXA 3OFNA 1DT3A 3U9LA 4BNLA 4L74A 1XBTA 3L1KA 3E2IA 3LGSA 2ASEA 3QVTA 4JJKA 4QOFA 3P2YA 3BKXA 1HZZC 3K9WA 1JQBA 1VPDA 4O6VA 2P4SA 4NENA 4UE2A 1Y80A 3GIWA 1QTRA 3OD1A 4XCVA 4GPTA 4XPIB 2AC2A 4K6MA 1DAEA 2GN1A 2WIBA 2R48A 2DWQA 1VKRA 3KEGA 1N0WA 1Y6QA 4L7VA 2GPTA 2R1VA 2WLSA 2XRYA 4NFHA 3VX3A 1LH0A 2XITA 4CN9A 3G5LA 1E79D 1ZHOA 1VSUA 1AVTA 2H51A 1W1WA 1KJ9A 3ROEA 2WT4A 3ZJVA 1H1LB 1A9YA 2VP0A 1YZQA 3UK0A 4B84A 4O4LB 3HB0A 5AI5A 5CX1B 5CVCA 4C78A 1JPUA 4K9LA 1SIBE 1CRZA 4OGFA 2PFSA 3QEJA 2AGVA 3FMVA 1YR9A 3T7KA 3HO1A 2JAPA 2HGZA 4ETMA 2PRYA 2WE8A 1UKYA 4QBGB 1D3AA 4U0JA 3CKKA 1L0BA 5GIOE 2XVYA 4YHBA 2HF2A 4BQPA 2IPOA 4RJIA 3UKOA 4RD2A 1DZIA 4JMLA 1Y6GA 2J9GA 3CXRA 3VR6A 4X61A 3N75A 5EIHA 3P0JA 4U2KA 1PJCA 4L0DA 4TL9A 3QQ5A 2HF9A 2W9XA 4UEWA 2C0PA 3D8TA 5LZ4A 2QX7A 1EVYA 1JR3A 2YUTA 4O2AA 1N6OA 3UA4A 1LPNA 2RGCA 2YIMA 1AF4A 1XJ0A 3RYIB 2HJRA 4FMDF 4X7RA 1E9RA 3AUUA 3P0EA 4K6GA 2DU8A 3CGWA 4RZ2A 4HLDA 5G0WA 2YKGA 5KYVA 3ERCA 5KJFA 2V98A 2H57A 2D5CA 1XE3A 3EY9A 2W2LD 3HWRA 3L8CA 3OQOA 4COKA 2PIAA 2UXCB 1KBOA 1XN4A 2J0UB 2XYHA 2WD9A 3A1FA 121PA 2IXDA 4DC9A 4ENTA 5JIBA 3ND8A 3KQUA 1UEXC 3F1LA 4DNFA 4ZEMA 4HDRB 3UFBA 3Q1LA 3LAWA 2H4YA 2N42A 2AJLI 4YJGB 4Q93A 4RLHA 4IBOA 1TYEB 4ZI7F 3NMUF 4I1VA 3E53A 1DRUA 5FNZA 1G5TA 2FDXA 2V9PA 3A6ZA 1QQ6A 4MX8A 4OYHA 3RHTA 1GV0A 1RC8A 2FB9A 2V0CA 1OJ7A 1Z5UA 4EI7A 3WNBA 2B4TO 4FOLA 1E4YA 2AH5A 1P17A 3U13A 2EGUA 4GT1A 2X5XA 1JN0A 3GC6A 4UTZA 5EEHA 3KFVA 4E5VA 5ITVA 1EUYA 1HNZB 1U3CA 4XGRA 4UU8A 4O63O 4YQFA 1FNMA 4R81A 2C82A 4EB6A 1XZDA 1J5XA 5FTJA 4MUIA 3HY3A 3RVSA 1L7XA 2EFJA 2OHOA 3GBPA 5JASA 2I3DA 1EWTA 3CUKA 1ECJA 4NAUA 3TNFA 1OAOA 1S4QA 2YJ5A 3KAJA 3OEYA 3ZWXA 1NXVA 2HQ1A 3BK2A 2RDMA 2QGZA 1QFMA 1AUQA 2JGJA 5DRYA 3W34A 1RWNA 4Y1EA 2QAGA 3ZHTA 5KSZA 2QD3A 2DWPA 4KVAA 3AWDA 4J94A 1QHEA 2CL6X 3CUUA 4YJ2A 3UMBA 1GTJ1 1V26A 4QDZA 1CUXA 3HKEA 1E59A 2XMZA 2H2DA 3OIWA 2K7ZA 5KC8A 4MQEB 3PF9A 3SDZA 4KQMA 4S24A 5CBPA 3G2NA 2ZRKA 3VAAA 4JN6B 3R7LA 4UVGA 2PCJA 1RYDA 2MINA 4RGBA 1ZH2A 3C4VA 4HN4B 1H6CA 1KI3A 4INOA 2FWPA 4Z2YA 5FA6A 5KQLA 1I1QB 1N2CB 4QO8A 1SQSA 3GMIA 4GX1A 4PYLA 4C14A 3HB4X 1SUEA 1E2GA 1C3JA 1D4OA 1SO8A 1UBHS 3KHTA 1JFSA 4JQSA 4S1OA 3BSFA 2IHJA 3BMCA 4OMDA 4WNYA 2OBYA 2NP7A 3LIPA 1NMXA 1QCDA 3H4TA 1LF0A 5CGQB 2WNIA 5I9LA 1HNNA 5IT4A 1AGXA 5LMUB 3MCWA 1RWVA 1AQNA 1WEKA 2P5UA 3EQ8A 1CF9A 4PPNA 4YY3B 3IPRA 4TV8B 4JGIA 2BGNA 3WBJA 1U1EA 3AJ9A 3I2GA 4CEJB 2OQRA 3R0QA 4KDCA 4IJUA 4OHZA 3W5VA 5IYZF 4J16C 3VR6H 5FUBA 4H0NA 2VJCA 3N7TA 4FQ8A 3G8CA 3K0CA 2WDZA 3OLZA 3UANA 3THYB 5D51S 3VNQA 2YUIA 3SR3A 1K0FA 2XYVA 2QLNA 2ZT7A 1QYCA 4JNKA 1P6UA 2XNKA 1G8YA 4GFDA 1V5EA 1OPRA 1YI0A 4RZHA 5FYDA 4YYEA 4B2PA 1XZAA 3QFSA 2I99A 3ROXA 5I4CA 1ZG3A 2BKUA 4OQZA 2ZI6A 5CNJA 5FQNA 3WIVA 3KEOA 4YXWD 5C5IA 2PX3A 1AM4D 1NLYA 2EX0A 1GCOA 4K9OA 4EGSA 5CG1A 2IZ0A 2DH6A 4HX9A 1KYZA 1TXGA 2JIPA 1XMQB 1NI4A 1CWUA 1ENZA 2AF3C 2IA5A 3C3DA 4NCXA 2HY7A 3CN7A 4WMLA 5CFLA 2NNLD 2JEOA 4MGEA 3RVRA 4D7AA 3RNOA 3ZLJA 2A5GA 2ZIUB 2O2EA 1J8VA 3NP7A 2DCUA 1A3CA 1PV1A 4YUYA 2VWHA 3OSUA 3IDOA 1MJGA 1ISIA 2WICA 4FXOA 4DWWA 2H1RA 3L41A 1K66A 3T3GA 2C5AA 2YV1A 3DT6A 3Q8KA 2X7JA 3EUEA 3NDIA 2HEIA 2HUPA 4PIPA 1CR0A 4LF8B 3B8HA 1IULA 5COAA 4RTJA 5TPZA 3N58A 1CPYA 2R8BA 1K1EA 3QFTA 3HVHA 3ORYA 1ZGGA 1RXIA 2ZYTX 3A9SA 3GT4A 5AW0A 1IY8A 1R8YA 3MZ0A 1EVJA 2J0VA 3NQ41 3PWSA 3JQAD 4X8MA 4GBJA 4KGXA 3NUGA 3TRHA 4BASA 5FV7A 4AZWA 1C9DB 1G7TA 4KE7A 1VE7A 2QGFA 2QMZA 4NECA 3W2TA 1JEYA 1T2NA 1XA4A 4EAQA 3UJBA 4KO3S 5JJCA 3PPWA 5FUVA 2ECFA 3B7PA 4IO0A 1NJSA 2PS0A 1YK1A 4NFYA 4Z7OB 5C4IA 4PGAA 2P0EA 2WJZB 4OVKA 4UM7A 5A4MS 4MV9A 1JDBC 2FW1A 3AB7A 3MM4A 4EMSA 3PPYA 4G1CA 5CITA 1FUKA 4Z4IA 3KS9A 4FFBB 1EE2A 4PG8A 2F9MA 1BU5A 4URZR 1XTKA 3ZU5A 5KINB 1G1AA 3M9LA 1AO3A 2PYZA 1WZUA 3AZOA 4MWDA 1UJBA 2AFRA 3L8ZA 2RHOA 3O94A 5AW7A 2J41A 4G1UC 1U3GA 3JW8A 1X8KA 2P62A 1O5IA 1T0IA 3PD0A 4I1IA 4IG9A 4L16A 1Q3HA 5B3AA 2C8KA 5JSKA 1M8FA 1UOOA 4FI3C 3R8CA 3RYCB 5K1ZA 1JJAA 5A3JA 4NHOA 5HPYB 1Z36A 4JQZA 3VSAA 3STWA 3J7AC 2G1JA 1XZEA 2WMYA 2YC2C 1HQKA 4RZQA 4DG8A 4F12A 2G9NA 1ZH6A 3G7UA 2BGWA 2K2QB 3FCYA 1TA9A 1GXSB 5IP5A 2L18A 4TTSA 1T0UA 4YX9A 3ZCTA 4RTMA 3NHAA 2W2KA 1WD7A 5C5DA 2XZPA 4W99A 5AVJA 4AJKA 1BFUA 4N01A 4KP7A 5FBVB 1U4OA 3Q3VA 1DDOA 3E35A 4IKPA 4MZXA 3IO5A 3VU0A 3DMTC 1PT6A 3H04A 4IDDA 1E6KA 1U8AA 3N05A 1OASA 4GQBA 3R9KA 1AK2A 4BB5A 4LTNA 3MA0A 5AK0A 3V8BA 1XIVA 2XUIA 3M33A 3GGCA 1GD1O 4KQIA 2EDCA 4YDQA 1E9CA 1R7RA 3FR7A 1F2TA 3E0XA 4RA6B 3UN1A 1P4JA 2ES4A 3O8QB 2ZCVA 1JG4A 4JD5A 4DCJA 4NH0A 4EG3A 3F0TA 3EY4A 3ZCRA 3ORQA 1I9CA 4MI3A 4GXRA 1N33B 3CLRD 1JDBB 2CNLA 4OP3A 2H07A 4TXLA 2PH3A 2FUEA 2HQSA 1YBHA 4HAOA 3TVDA 1D5WA 3V2GA 5LZ9A 1Z6ZA 4MR7A 2G76A 4DLSA 1U31A 3P52A 2JG3A 3JRWA 2Z5GA 3CNOA 2AMYA 3R5HA 3STTA 1G17A 3K0AA 4JCOA 3VH1A 1XVIA 4L1KA 1CR6A 1GA4A 2RHLA 2EWMA 2OP1A 4PE5B 3ESAA 3B3JA 5I8PA 1FMCA 3GUUA 5IC6A 5P21A 1HUQA 2I7CA 3VO9A 4K6CA 3RRZA 2P41A 2A4KA 2PFGA 3HK2A 3ZBPA 4AKIA 2Y1XA 1ML4A 2NXNA 2I2XB 3VOSA 4RNDB 1AG9A 1DQYA 2R1ZA 3NASA 4ZT5A 2QVYX 3HM2A 3V4LA 4BFWA 1WMAA 2FV8A 4W4TA 2P65A 5LZ5A 1GKYA 2AEEA 1I80A 2Q5HA 3MGGA 4XASA 4KN8A 3RIYA 2VR1A 2Q2WA 3VU3A 4DV6B 4XLTA 3GJ5A 3INNA 1X7ZB 4G5FA 2I2BA 4R1OA 4FW8A 4EGJA 1E9FA 3Q8LA 1P0PA 1S2IA 3NHKA 4PGGA 2VPPA 3K1ZA 1ZA1A 2KS6A 3GEDA 3J81A 1L7OA 1EE9A 4LJYA 1J97A 4X60A 4B2LA 1UPBA 4EY4A 1KU6A 1T2UA 1WV0A 2D3TA 3M6LA 2W4QA 4JJ6A 4NJOA 1H2AS 3ANNA 3K0FA 4JLBA 1N6NA 1D07A 2Y9MB 1TZ2A 1UDCA 3ESXA 2Y92A 2R8ZA 2A92A 3MWJA 1P1JA 2PH7A 3RSCA 4Q7EA 5BPFA 1YBFA 1AT1A 5DN9A 1ISFA 1HM5A 2QT9A 4Q1BA 1Q2UA 1KL7A 1W49A 3MD9A 4B6RA 5IXSA 3PFWO 2ZWIA 4C22A 5AMXA 3DB1A 2VNIA 3W6PA 3SZMA 4KSBA 2JHCA 4ZV9A 4H0CA 3IUBA 2V5AA 2OV6A 3M4XA 5A7GA 2IZ7A 1NPTO 4GO1A 2IXAA 2XUQA 1OI4A 2D5AA 1P9WA 1NBHA 1KP9A 4FFWA 4ZVKA 2RHTA 3AGQA 4F3NA 1G9TA 5HBRA 3H0EA 3TEJA 3NAQA 2FMFA 4IHJA 1JTEA 4GRAA 5FPKA 1THTA 2PS9A 1O5OA 3W5AA 3OX2A 4IIVA 1LFDB 2D5IA 2ZWOA 2RGUA 2Q5LA 4Q3KA 1Y3CE 3HXKA 4MUEA 1V1MB 1OWNA 1VB5A 2R3SA 4N3AA 3CW9A 3DFUA 3ZU4A 3WB1A 2Y93A 3LRTA 4IM7A 3NM6B 2HSWA 1QRTA 3I01A 2ZYSA 4Q12A 1JT2A 1QS0A 1OW3B 3KTDA 1M1NB 4NPCA 1GAWA 4YAEA 3OIGA 5CNMA 3R3SA 4AWAA 2ZRLA 4JJAA 1QGED 3L5OA 5DBGA 1E98A 1F2UA 2IWRA 1E99A 2MSLA 1W6RA 2XUHA 2ZIXB 3FUWA 1RQGA 2EARA 2QOEA 3ZV6A 2BE9A 1F3LA 4M0UA 4BE9A 3A1DA 1DXYA 1FDSA 2A8YA 4PAGA 1M54A 3O1IC 1IATA 1MC4A 4A2QA 3OCJA 1DEKA 1R12A 1SU6A 5DEIA 2QN9A 4JXJA 4YN3A 4KR6A 1O7JA 4HQRA 4JGGA 3R3ZA 4AY5A 1ZONA 1J4AA 2IP2A 4DDVA 3JQ7B 2QX9A 3C3PA 4F60A 3U09A 5A9SA 4BJ1A 5K8UA 3KXKA 4QQ8A 2ZE7A 2H5JA 4J2OA 1JDJA 4Z9AA 1H4TA 1QKIA 3ICWA 1CIJA 1T2VA 1MFZA 2ADOA 3BN3A 1Q19A 1UXKA 4PIMA 1TJPB 1Z4JA 1W48A 2BHLA 3EHEA 1WXHA 1WOYA 4YJHB 2ZJ6A 5JBQA 5BNTA 3EUFA 1R3UA 3CUSA 1M2GA 1U0OC 3VU9A 3D6TB 5DP1A 1GR1A 1JALA 9ABPA 3TR0A 1ND5A 2RH5A 3IHLA 2DBZA 3OT1A 4LGMA 1NSTA 3EXHA 2WQ6A 1H1DA 1C9NA 4XGIA 2NUTB 2HJGA 2DPGA 4FDUA 4YMSA 2G28A 4Y18A 2DQKA 2PFKA 1HT3A 1T1IA 2F3UA 4PZLA 4L5AA 3QKTA 4RXTA 5CXUA 4N5IX 3LX8A 3WRYA 1U04A 3KQYA 1KIMA 3DKVA 1HGXA 2XF2A 3EFHA 2QP4A 4QTTB 3H11A 2EQAA 3UTDA 3BWCA 3OE7D 3ROMA 4CU5A 2O5RA 2ZP1A 3QV1A 3BGOS 2OHXA 4HRAA 4LIPD 4Q4LA 4DE5A 3WRYC 1XMSA 1UFVA 3EMBA 2QIOA 4C0BA 3TI9A 4ZYYA 5HDBB 2R8YA 1PL7A 1G5HA 3S4YA 2DT8A 1H5NA 1Z3CA 2V7WA 5LWHA 2C83A 2FR8A 4OI4A 5I7EA 5FOUA 1NR5A 1R66A 1X39A 2RMKA 1UP6A 4FYPA 1VRWA 3QF7A 3KKKA 3QYAA 4G25A 1QYVA 1G2OA 2I6UA 4KX3A 4DM3A 2X23A 4BRZA 5AXAA 3EBPA 4YACA 1YS6A 4BMSA 4OHFA 1FFDA 2ZYWX 6CHYA 4FS8A 1BC5A 2ERYA 5JDCC 1QHGA 4IMRA 2NZUG 2GZ2A 2QVCA 1OFTA 5I51A 4PNPA 4AN1A 4B3MB 4KDEA 1GGJA 1O2DA 4OK3A 3NTVA 3ICCA 1IG0A 2IYFA 4XZ3A 4B8YA 3ZGZA 1O03A 2VAVA 1A1SA 1PR6A 2X4GA 2XODA 3O31A 4JCCA 2PZGA 1Y9AA 3P2JA 4MWSA 5HE9A 5IG2A 1PD0A 1VE9A 1EEXB 1NVKA 3DNMA 2FN7A 4TMXA 4B3RB 2RKBA 3GZNB 4L5JA 1M34E 3PV0A 4MYTA 1VL1A 4FONA 4IHAA 3I5XA 2CHQA 4FTWA 4Q05A 1W7AA 5E1DA 5FV4A 2H1FA 3OZWA 3Q7SA 1D6NA 2H08A 3RVBA 3HR4A 2PL1A 4BV8A 3R9IA 2C2GA 2ORYA 2IU3A 3T9AA 3KETA 1QHSA 3WGHA 3N0VA 2VAMA 4DDMA 5EIWA 2G0TA 3N2EA 1UJ4A 1SB9A 3TVYA 1A9PA 2ET6A 2XDQB 1MAHA 3HUUA 4L28A 2IT1A 4IMPA 4LE1A 1RW4A 2HA0A 1C0EA 2D8MA 3CC8A 3GJ4A 4G26A 4P5EA 5ALUA 3SAJA 1M7HA 3FOEC 1CJUC 4GX2A 3MJEA 1CCWA 3T3DA 2ZRIA 1BN7A 3WA7A 4HN2A 3FSGA 3QRWA 3HYTA 3DV0A 4TV8F 5AP9A 4TWAA 4BCCA 2DR3A 3PRHA 4NEGA 4WXEA 4HLCA 1OYVA 1KO5A 2C92A 3RE1A 4DCSA 4F5DA 5LPNA 1KEKA 4FP9A 3NUZA 5CG2A 3HXQA 5IMBA 1YSCA 3D6MA 3OHPA 1ZK4A 4M54A 2HRCA 4K0RA 2ZUEA 1EVEA 3ABSB 3QUCA 3FOFC 1E1RD 2VRCD 3PGVA 5CFZA 3ER8A 1I33A 4ERNA 4Q5IA 5LA6F 1SUSA 3HBAA 3QYJA 4IOJA 4I8IA 2XWPA 2JKZA 3AP2A 1XTVA 4PZPA 4YRAA 4X1YA 1V7QA 1X7WB 3D8HA 2IQ5A 4PO3X 3SZ3A 3CE6A 3DPIA 1IOVA 4XR4A 5BVGB 4LTDA 3M1LA 3QIAA 1EFVB 1XTBA 4Q47A 2RHJA 1ZSVA 3M4YA 4KMSA 4II3A 1DIBA 5AJTA 2YXEA 4HNRA 4DMHA 3OA0A 3KQVA 2F1OA 1E1MA 3FTFA 2IOFA 2WHXA 1HPLA 1UPAA 1X1CA 2FKNA 5BV8A 5IXJA 5JAHA 3IUPA 2OCBA 5IM4A 1E60A 1XTTA 4KGVA 2LKCA 5CA0A 1QO0D 2EYQA 5CR9A 4CM6A 3ZD7A 3KT3A 3AI2A 3SQLA 3DQZA 1D2AA 3FNFA 1SC3A 4WWHA 3ELDA 3VBCA 2JDIA 1TI7A 2Y99A 3UHPA 3VTAA 3AJDA 4WD3A 2G09A 4RD1A 4Y2GA 5KO2A 1ETUA 3MLBA 1MO6A 4ZRNA 1R2QA 5HF8A 1O87A 1EFKA 3WJ7A 4ZRMA 1PRYA 4EELA 2BEUA 1J99A 5TJ9A 2P3OA 3MWKA 4H7IA 1W4CA 3LOPA 1G21A 4BZQA 4YI5A 1JWBB 1Q83A 1ZEJA 2BM0A 4Z0HO 3JS5A 2C2MA 3RJTA 2ECPA 1A5TA 2H4XA 3UJ9A 1T36A 3IV9A 4ZIRA 3QXXA 1H5QA 4FJ0A 5LR6A 2E4AA 3P0HA 3ZV3A 5JWHA 1VGRA 1A95A 2H1LA 1QP8A 2PH5A 3LKZA 2OORC 3FCXA 1YDMA 3NFRA 1ZUNA 2CN1A 1K7FB 3BB1A 3RARA 2NVUB 1T9GS 4WAUA 2CD7A 1VYVA 1E89A 3I2YX 4JC0A 3L0OA 5G40A 1R5NA 3SF8B 3SYLA 1WVGA 5BPHA 1YFJA 1L6IA 1I3KA 1URPA 2HIAA 2PBRA 3EZYA 4DQ0A 1YU9A 5BWOA 2P9HA 1PO7A 3ZQ6A 1O8BA 2R7AA 4IHQA 2ROQA 2DUUA 3JZIA 3PP8A 1O57A 1KTVA 1UM8A 2PH1A 5J23A 5CYPA 2FR8C 4BVHA 1DRVA 2W4MA 3D02A 3OX4A 4WH0A 5C1DA 3RB8A 1OPXA 2EX1A 3LXRA 4NESA 4Z0PA 3UUFA 5BMVF 5KNBA 4DV0B 1FU8A 2TMGA 3BE4A 1B43A 2RK6A 3ZDZB 1I0ZA 3VR2A 3SCZA 4KN9S 4QG3A 5F9HA 1SIWA 1QU3A 1E0JA 4BDSA 1MB2A 4LNUA 5ED4A 3BQMB 1K8RA 2JCBA 1CNFA 4F0JA 3OZAA 3A6DA 1EM8B 1Q15A 3EVAA 4TYNA 1XKTA 5HGJA 3X1ZA 5L3QA 3ASUA 1RPJA 2J7PD 3KXDA 4IF6A 4TZ6A 2QENA 2VUHB 4XEHA 3WP1B 3WGOA 1GITA 2QMQA 2FPPA 3LCCA 3P45A 4Y0AA 1A72A 3SJUA 5JYCA 1MQ9A 1YT5A 1BCRA 4RL4A 5KNLA 1UANA 2R62A 1UPUA 2NIPA 3HKDB 3U60B 1CZRA 1QNFA 3DP7A 4PHCA 1UKCA 1XLTC 1Y98A 2XUAA 3STUA 1IPEA 3ZBUA 4D0SA 4CM5A 4WSOA 3NVKI 2Y4NA 1KSFX 1LC3A 4WZAE 3NBUA 3C3AA 4QL3A 1V2GA 3AUYA 3O8OA 1AHIA 4C4SA 1CC1S 2PZAA 2QQFA 1TQDA 3T06B 4CODB 4K9NA 4HTFA 2QY9A 4HDSA 1Z75A 3GNSA 3LOUA 1ONPA 1E2KA 3H0CA 3KOWA 1NBWB 2IXTA 3C45A 3JY6A 3WA6A 1GQYA 2M6LA 3ECAA 4MQ4A 3DULA 3FETA 4KNYA 3FDXA 3LH5A 4BE4A 1CY8A 4MPPA 2X22A 5JSYA 3GRYA 4F9FA 2QNRA 1FFCA 1L1EA 5B30A 2IIQA 3UTCA 3HZHA 2YFYA 3U4DA 1J56A 4MJ7A 2R84A 4K3UA 2ACKA 2WBLC 5CDYA 2KM1A 1DKPA 1WE2A 3OD5A 3IAFA 1R3DA 5IJZA 2XQJA 4OSEA 2H16A 3EQ7A 3IA2A 4TTVA 3RS3A 3DS8A 4E09A 3FWYA 4NKRA 3JWPA 3OY7A 2D00A 4UNPA 4KXFB 3TWOA 1ISRA 1QFZA 1J9GA 3AQ4A 1VJRA 3P9ZA 2OAGA 1NXTA 4UFOA 2B20A 2H29A 3MWYW 3PL1A 1PU2A 4GBMA 3KEQA 2O1XA 3EEYA 1KO8A 3AV0B 2RHGB 2IP4A 3CQ9A 1T9KA 3H87A 1RJFA 2WM2A 1A77A 4ALNA 2VUUA 1V8OA 4NYJR 1UAAA 2F8MA 1Z37A 5LSAA 1LSJA 3ONEA 1M6HA 3GEIA 4L22A 1ORDA 2BTOA 1VCOA 5M34A 3FYUC 5T64A 5FWAA 4B7ZA 5AVSA 5FBHA 4W1RA 2X8AA 2OENG 2WU3A 3I6MA 4QGFA 3KTFA 3OJLA 1Q7BA 4XI9A 4BP8A 2AQIA 4TVOA 3COZA 3HU2A 4G1VA 2Q1UA 3GZTB 4CN8A 5B3KA 2MYPA 3BS4A 3BIOA 4O4IB 4PLPA 1QORA 3R8FA 4QXMA 1GAJA 3ANMA 5FIUA 4IRXA 1RRCA 4E08A 2QRVB 2GJ9A 3EGCA 2ZRPA 3I61A