4TMYA

Chey from thermotoga maritima (mg-iv)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
118
structure length
118
Chain Sequence
GKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemotaxis
molecule keywords CHEY PROTEIN
publication title Crystal structures of CheY from Thermotoga maritima do not support conventional explanations for the structural basis of enhanced thermostability.
pubmed rcsb
source organism Thermotoga maritima
total genus 39
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4tmyA00
4XAQA 1QO0A 5EWJA 4W5OA 1L5YA 5KI6A 1U2PA 4MR8B 3T6KA 4RWEA 2R25B 2X7XA 3EGCA 1WETA 1TM2A 5DCLA 3DLHA 5FWYB 2FQXA 3HDGA 3SNKA 3GA5A 1BDIA 4MRMA 1DBQA 4UHKA 4ETMA 2YHBA 3EAFA 5EWJB 2QVGA 1RNLA 4G0OA 4JOQA 3MQ4A 3SM9A 4LE2A 3RVRA 2GI4A 3CU5A 3FMVA 4RK6A 2AYXA 1IIBA 3Q9SA 1FFWA 1E6KA 1F4VA 3OLVA 1FFGA 3LMKA 2R4QA 1ZH2A 3GL9A 1Z25A 3O2JA 3N6VA 3QEMA 4EYGA 4MR7A 1YK0A 1ZITA 2QU7A 3G1WA 5DTEA 2VYCA 2CD7A 1OXKB 4KVFA 2YHAA 4H3KB 3QLVA 4PEVA 4ZMRA 4JB2A 3H75A 3KLOA 4EVQA 3DGFC 3TX6A 3UK0A 1VKRA 3QEMB 1DJMA 2NZUG 4OTZA 1BVHA 1DCFA 2W42A 3LFTA 4O1HA 4HYEA 3H6GA 3KS9A 2DRIA 1EHCA 3KHTA 3ROTA 2V0NA 1USGA 3LUHA 2FMKA 3CFYA 4ZPJA 4Y9TA 2CHEA 1YMUA 2VUHB 2WJAA 3C3KA 3T38A 4RK4A 4MQFA 3N53A 4RK5A 4RS3A 2MYTA 4RU1A 3NNDA 5JS2A 1M5TA 4YLEA 4JAVC 1JDNA 1MB3A 5B3JA 4PYRA 4QPJC 3LUKA 3SQNA 1Z2DA 1B00A 5DGCA 3RVLA 3HXMA 2PL9A 1FSPA 3GWGA 4MQFB 4P98A 4WXEA 3N0WA 5HQJA 1U0SY 3CG0A 1P6UA 2ZWMA 2M98A 4MYRA 2FQYA 1GLGA 4F06A 2IPNA 3TMYA 2HQRA 2IPAB 3OM1A 2A9PA 2TMYA 5T3YA 4MR9A 5PNTA 4MS3A 2QW1A 5HM6A 3NNSA 1VRVA 2B4AA 3KSMA 3OLXA 2JBAB 4XXHA 3RVOA 1MVOA 1NY5A 2JCGA 2XDYA 4EGSA 1LJUA 4DADA 4F8JA 1JWLA 1YS7A 1ZY2A 3MMNA 4WZZA 5CHYA 5HKOA 4HNQA 4MS3B 5FBKA 4OATA 4RXTA 1A04A 4N0QA 1RXIA 1PNTA 2I6FA 3N0XA 3F73A 2FXIA 4HNRA 1BDJA 5TPZD 3Q41A 1XWWA 2NT3A 3D02A 3HUUA 4Q7EA 2GX6A 3EQZA 1ZAYA 1PUXA 3OO0A 2R48A 1QP0A 3H5IA 3OLZA 2HJ9A 4EUKA 3LOPA 4ZJPA 2WB4A 5FBHA 5ED4A 4NCBA 1D1PA 4N76A 3QEKA 1EFAA 3JVIA 3QLUA 2BGGA 4KV7A 4YV7A 1H9CA 1HEYA 2E4WA 2O20A 3Q7RA 1T34A 5D2CA 3IDOA 4Z4GA 1EWKA 4RY9A 1JBEA 1NXTA 1M2EA 3HS3A 1MAVA 4LE1A 4S05A 3I09A 3JS5A 2OQRA 3GBVA 4YRZA 3URMA 1GCAA 1YIOA 1YK1A 2IPLA 3RVMA 3OM0A 3R0JA 3GT7A 3E3MA 5GOTA 1JFVA 2E4ZA 2QVCA 2ZAYA 3HEBA 3N8IA 4Q6BA 4WWHA 1LK0A 3A0RB 2QZJA 4Z4FA 1ZDMA 4OBBA 4YGXB 2NT4A 2QSJA 3FGZA 2P4UA 3QELB 5IC5A 4YWHA 4PE5B 4KZKA 1LBIA 4RK0A 3EDCA 1KGSA 1U04A 3FFWA 2H0AA 3KLNA 4Q6WA 5JNUA 2FEKA 2A9OA 3JY6A 3SY8A 1C0EA 4MAAA 3KG2A 1I3CA 1KRWA 3OQMA 3RVNA 3H5TA 3KYJB 4KK3A 1K66A 3H6HA 1RZRA 3H5WA 5JNWA 3O2SB 1C4WA 3KKEA 3LUCA 2B1JA 4LX8A 2Q5CA 1YS6A 2MYPA 4JASB 4W5TA 5CNIA 4YR7A 3H1FA 3BRQA 1RPJA 4PICA 1TMYA 1NATA 2ID9A 2PUFA 2F8SA 3I45A 5TPWA 2M1ZA 3HUTA 5JNRA 3LUFA 4YP9A 1P6QA 2FMIA 4QYWA 1E2BA 1QNLA 2JVIA 5BQ3A 3QX9A 1ZGGA 1JYEA 2A9QA 1JFSA 4LRQA 2L2QA 4MS4A 4CBVA 2FEWB 5KQLA 4H60A 1NXWA 3N75A 4OLAA 4RXMA 3MA0A 4RY0A 3IP6A 5TPWB 1YMVA 1LJLA 1TLFA 4G0QA 4W5QA 1EAYA 3IP9A 3QX8A 1J56A 3LUDA 3TD9A 4MLDA 1Z26A 4MS4B 9ABPA 4RXUA 4QYMA 4RY8A 4YS6A 3OMWA 5DLEA 4W5NA 2H3HA 3C97A 4XFKA 1D1QA 2PUDA 3B2NA 4RZSA 2FLKA 1QO0D 6CHYA 1KMIY 3CNBA 4IGAA 4XLTA 4KQCA 3A10A 2PLNA 3CS3A 3IPCA 3O1HB 5T7BA 4EVSA 1Y1LA 2PUEA 4LZLA 5EWLA 5GQSA 5I4CA 5IX8A 1FFSA 2PUCA 1MIHA 1Z16A 3H5OA 4GNRA 4Z99A 2E4XA 3Q15C 2HQBA 4FB4A 1UDRA 2JBAA 4N0PA 3RVKA 3KTOA 4Z4HA 1JFTA 5KWSA 3HO1A 3Q7TA 1E6LA 3NHMA 4LE0A 1SXIA 5DKFA 4MQEB 4Z4CA 4G0YA 1EWVA 1EWTA 5JNTA 1QQAA 1LBHA 1K68A 3MM4A 4FE4A 1JX6A 4MGEA 2VUIB 5EWLB 1APBA 1JF8A 2MYUA 2P9HA 4PZ0A 2PUAA 2ID7A 2FMFA 1D2AA 1PEAA 2N9UA 3HZHA 3DBIA 3QLTA 4KFCA 4W5RA 4P1ZA 2IOYA 3F6CA 3H5VA 3ILYA 3OMXA 4NICA 2PUGA 5TQ2A 4XASA 3NHZA 4EYOA 3HVRA 1DBWA 4TN5A 7ABPA 3IPAA 3RQIA 3HM9A 4D6XA 4NV3A 3S99A 2L18A 4NQRA 2CWDA 4DQDA 1PEYA 3QLVC 3TB6A 2E4UA 1AB5A 3OLYA 1JYFA 4N41A 5TQ2B 3W9SA 1QPZA 5KC9A 1Z15A 1KRXA 3JPYA 3MYYA 5IULC 3H1GA 4D74A 1BAPA 1NTRA 3HCWA 2FKAA 4YO7A 4RDCA 2FN8A 5EWMB 3C3WA 4EYQA 3HJFA 2RGYA 1JHZA 2QXYA 4RSMA 1GUDA 1SD5A 1SRRA 1TVMA 3QELA 4Z0NA 2A9RA 2L19A 5KQPA 5C5CA 3LUJA 3QK7A 2QV0A 1ABFA 2JK1A 4B09A 4ZMSA 2LPMA 4F12A 1R8JA 3HSYA 2PE5A 1DP4A 4O5AA 1NXSA 1CEYA 1SXHA 1Z13A 4G0XA 3RVPA 3T95A 2FVYA 1D4ZA 2GKGA 1DC8A 4JA2A 1CHNA 5CNKA 1JL3A 1ZGZA 1A0OA 1BDHA 4TMYA 1XHEA 3JVDA 3C3MA 2FW0A 3RVQA 3LTEA 5F64A 3L49A 2CHFA 5TQ0B 3BREA 1P2FA 2FLWA 4F3TA 2MYNA 1ISSA 2J48A 2JRLA 3M6MD 4DN6A 4IF4A 3VNBA 2GBPA 4ZYLA 3OQOA 5IUNC 5TQJA 5KC8A 3C6QA 1JH9A 5FWXA 4ETNA 3LKVA 3DLBA 2RJOA 1Z2EA 1URPA 3RH0A 1YTUA 4RKQA 4KPYA 1OXBB 3CKMA 4LDZA 3O2QB 1JDPA 2LBPA 1DC7A 3KYIB 4O1IA 2PAFA 3BILA 3OO1A 4KRFA 1DRKA 2FEPA 1U2QA 3JPWA 4MRMB 2PKXA 1TJYA 1AB6A 1P8AA 1QKKA 1ZHHA 3LUAA 5FWXB 1NXPA 3L6UA 2MSKA 4MPTA 3OLWA 5JNVA 3HDVA 4Z9AA 1W25A 5BR1A 3DZDA 4RKRA 3O21A 3T8YA 4XARA 3O74A 5IUKC 1QP7A 1USIA 2AYZA 3CG4A 2FMHA 1A2OA 1M2FA 3M9WA 3MF4A 5TE9A 1DBPA 2L17A 3EQ2A 3LKBA 3QLUC 4G86A 3F7NA 2PUBA 3K9CA 3HK2A 4MR7B 3CLKA 5TPZA 3BBLA 1ZH4A 3A3KA 3O1IC 1ISRA 4MQEA 2IKSA 3IP5A 4G97A 3O1JC 1E6MA 3CTPA 3P9YA 2IDMA 2JVKA 4N47A 3MIZA 2HPHA 3H1EA 2JB9A 4Z4IA 3G85A 6ABPA 3SAJA 1D5WA 1GCGA 1NXOA 2LUOA 1SXGA 3NBMA 1DCMA 1DRJA 1JLKA 2KYRA 2HSGA 1DG9A 5CNMA 4QICA 4D6YA 4JP1A 2RJNA 4MLCA 4RK7A 3E61A 5C5EA 5KQGA 1ZN2A 2FTKE 4NCAA 3IP7A 4MS1A 1RZRD 1QQBA 1ZVVA 2VK2A 2NUBA 3D8UA 1Z12A 2R47A 5IBQA 5IEBA 4EVRA 5CNJA 3GYBA 3I5AA 1NXVA 4G0ZA 4JB0A 5HSGA 1U8TA 1W9HA 2WY2D 5JS1A 2RDMA 4E7OA 4HNSA 3H5LA 1GUBA 3UUGA 4Z4EA 3FFTA 4OG2A 4L4UA 3UKJA 4YCSA 2FN9A 3TO5A 4MS1B 3EJWA 1PHRA 3CZCA 2WWVD 3SG0A 2HQOA 1L5ZA 4WXMA 4G0PA 3GRCA 1ABEA 3FDFA 5IEJA 4IMIB 4IRXA 5JNSA 4WT7A 5EWMA 3GV0A 3ILHA 5IUJC 4S04A 1Z17A 4FE7A 1NXXA 5E3JA 2IPMA 2NZVG 2QR3A 3FFXA 3LUGA 3BRSA 3N0RA 1FQWA 2E4VA 2WRZA 3Q7SA 4F11A 4TLMB 4IILA 3KJXA 3VNAA 3GBPA 4RV5A 5BRAA 1CYEA 2PJUA 3DGEC 2FSPA 1XHFA 3EODA 3O75A 3RVSA 4Z9BA 4G0MA 4EY3A 4MR9B 4OLBA 3EULA 4TLLB 4GPAA 1VLZA 4KQ9A 4EYKA 2LIVA 4RK1A 3ROFA 3OQNA 1RXEA 3HV2A 4LDAA 1DCKA 2MSWA 1F51E 2WMYA 3F6PA 1S8NA 4M88A 4E7PA 3NNNA 4ETIA 3A0UA 3M9XA 2GWRA 2PMCA 4KMRA 1QP4A 1VPWA 2MSLA 8ABPA 2LP4Y 1M5UA 1Z18A 2PL1A 4N03A 3CRNA 3K4HA 4KK4A 2IYNA 2F8TA 4L85A 1QMPA 1BA2A 3CZ5A 5BRJA 4WUTA 4H3HB 2OENG 1DZ3A 5B3JC 1ZESA 4IMJB 5TQ0A 4ML3A 4MR8A 1PNRA 1USKA 3KCNA 4KNYA 2WJWA 3JTEA 3RVJA 2FQWA 3I42A 1MB0A 5FWYA 3CHYA 4KREA 5KQMA 2JVJA 4UHJA 5ABPA 1YVUA 2E4YA
chains in the Genus database with same CATH superfamily
4M54A 4XAQA 2ERCA 4W7HA 1K0UA 2PZMA 3EPPA 1T2NA 2PX8A 3WC4A 2QJOA 3T4XA 5KX5A 3QP9A 3AEQB 4Z9XA 2IQ5A 5KTOA 5DCLA 2ZUTA 4YXWA 1LV7A 3U7GA 3H04A 5CT6A 3F9IA 1RAAA 4EO4A 5K6TA 4I08A 1INLA 2P2NA 4G24A 2YL2A 5BN3B 3E53A 4BZPA 3AOGA 2BCGY 3TSYA 1S2GA 3B89A 1RNLA 4QATA 4YJGA 2WYWA 3CVOA 4NVRA 1QHFA 2DQ4A 2DWCA 1K0FA 3EA5A 3QVVA 2VPWA 4NU0A 4S1PA 1MH9A 2GFQA 4YV1A 4F93B 3IVXA 5BO5A 4Y2XA 1S89A 1TZCA 1E6WA 2QUHA 2R4QA 2R66A 2I2XB 4Y2SA 4AJNA 2C4UA 4CQJA 1L5SA 3D7SA 3GNLA 5CA1A 5ED0A 4JUDX 4Q24A 1WD7A 2PEZA 3OI7A 1YK0A 5ALIA 4K2HA 3ZDQA 3UH0A 4RQBA 3ET4A 1IJEA 1ELOA 1UOEA 1YACA 2VL7A 3GRAA 1G41A 3NG1A 3PKZA 4W6ZA 1AGXA 4A3SA 2XCTB 2F1KA 2H8GA 4M1YA 1USWA 2RHRA 4WFIA 2YS7A 1AVTA 1WCIB 2JIMA 3C4VA 4J0EA 2VDLB 1N5OX 1ST3A 2E4AA 2G08A 1DUIA 2PRJA 5BSGA 5JC1A 3ETDA 2XQFA 1HEIA 4JLBA 3PJEA 4OM8A 2RGXA 1M72A 4RJLA 4NG5A 3D7MA 1NW5A 1KEEB 4HUQB 2ZATA 2WWWA 1KIAA 3D3NA 2PFGA 1QHHB 3JZMA 1EHCA 1RKQA 2HA4A 3CW9A 5BQFA 4QFBA 4CF3A 4O2AF 1TIBA 4P0PB 1CERA 1P77A 1WUKS 2W7TA 5GOZA 1ZOPA 4XGNA 1YZGA 3UMVA 3CFYA 4AZ3A 5KU7A 2WT8A 5FUQA 3AV3A 1QF9A 2GF0A 1W4CA 2NTJA 2WJAA 4YCAA 3FLEA 1JBQA 2XYQA 1YKSA 3ZXYA 1MJNA 3QFFA 3WTCA 2ZRMA 5FBRB 1N7HA 3NC1C 2YH2A 4D9GA 3ZBQA 1NT2A 2MYTA 1U4SA 1YO6A 3IIJA 4G0NA 4M7OA 1K88A 4L2IB 3WNDA 1NVAA 2WHPB 1JDNA 1W2HA 3K53A 4E30A 1JP7A 2H1LA 1RLMA 5DGCA 5FO1A 1O96A 1E4VA 3CZ4A 2EEZA 3N0WA 4GOKA 1EVYA 1KI8A 2QRKA 2W93A 3W8EA 5JR3A 4KVGA 2ORED 3U3JA 4QTYA 1G59A 3TMYA 1ONNA 2IPAB 2Y0CA 1E2FA 1V45E 3UV3A 4YQZA 1CJCA 1YRLA 2RJ3A 4DV6B 1K6IA 4I50A 4QNRA 3WGYA 3AL0C 1TD9A 2H6EA 3IH5A 4HNAB 3FUCA 5G53C 4KSBA 4F4CA 2GK6A 3LDFA 5JLJA 4QVIA 5ELMA 3QHAA 3PGXA 3DCNA 5IBCA 2CSUA 3F0TA 2JBAB 4P31A 4YV2A 2GM4A 3L7IA 2DEUA 4CM7A 3R9WA 2XDYA 1MN6A 4DADA 3G68A 2JHAA 4RD6A 1T9GR 4BB0A 2Y0EA 2ODQA 3FB1A 3JARB 5CHYA 5F7OA 2DWUA 2WHXA 1L7AA 4FEAA 4D5EA 2Z2YA 5IAKA 1I2AA 4LBVA 2VA9A 1Q3HA 5AVKA 1Y4AE 3EPHA 3OG9A 3IVMA 4M0UA 3IOBA 1JAHA 2QN8A 3KZNA 4N65A 1NYTA 1L7PA 4PO3X 4WOJA 5TPZD 4URVR 5LD2C 3SJCA 1NYRA 1SVIA 3D02A 2BE7A 4RM3A 5CH5A 2Q7OE 2C9OA 3RTEA 1CZRA 1HSZA 1O08A 2ZUBA 3OJEA 4ME6A 3WZLA 4ARSA 3FTNA 1E18A 2G8NA 3ODGA 5ALKA 1W5AA 4JN6B 2Y1FA 3RASA 2YZNA 5EJ2A 1UPFA 3PL5A 4G8CA 2H7VA 4V0MA 3EMVA 4BN4A 2P77A 3GW8A 1TYAE 3GMIA 3OPYA 5HFAA 4CQLB 3RCBA 1KVRA 2FG5A 4B6JA 4PO9A 4P9NA 2HXYA 1HE8B 4TT3D 1R0LA 2HJSA 2EQ5A 1SBIA 1EX1A 3JQGA 3PHJA 4YJ3F 4UOEA 4P0TA 3ESDA 3KZ1E 4D98A 2ZEJA 3PB3A 1L4MA 3NIBA 4ZRMA 2NAFA 3SFZA 4ZJUA 1W8IA 4I1PA 3L1VA 3RVMA 4COOA 2I7XA 2P2SA 2X2PA 1ZK4A 2BCEA 3AESA 4WOBA 4XQCA 3CVWA 4Q3BA 1KYYA 2C9BA 4DM4A 5F23A 2NT4A 3TE6A 1R8SA 1UBSB 5ESRA 4OQLA 3DAOA 4YUVA 2PJDA 1CF4A 4GPIB 1UXHA 4MP6A 1HFJA 4TV9F 2HIHA 4GEKA 4YUWA 2D1QA 1L3BA 3CW8X 1J8DA 4HAUA 4CMHA 4F4IA 4IKOA 3IDZA 1KRWA 1D09A 2O23A 4FR0A 1NA5A 2HHCA 3FSRA 3NBUA 3TPZA 5FPPA 1YL5A 1Q0RA 2OMKA 4QYTA 3WLOA 4B4OA 2H00A 4KK3A 5TEWA 3LIPA 4EENA 2FW9A 1OROA 3OZUA 3H5WA 3TAHA 1L5FA 1ZIDA 3A7EA 2IC5A 1C4WA 2ZVJA 3H7IA 4RGYA 1U0LA 3FZGA 4BLSA 1Z7YA 5J47A 1A3CA 4JWTA 4QYIA 5HJ7A 2OVFA 4QFDA 3AIMA 3QBJA 2JBHA 1RPJA 3KKLA 4RORA 3COZA 1KMNA 1YJAA 2ODAA 4G1EB 3CLSD 4WBNF 4FFRA 1RRGA 3BS4A 1F8FA 1JSCA 1S7GA 4QM7A 3TG2A 1UPAA 1L1EA 3DZBA 2A9QA 3AM3A 3R5KA 5BOVA 4EB3A 4AQ7A 4IH4A 1GPNA 3B36A 3D43A 1Y4SA 2OP0A 3CLSC 2Y9PB 1JVBA 4Q1EA 5IS2A 3LWBA 1JU9A 1XO1A 2YUTA 1M6YA 4U5XA 1IY1A 4XYEA 3QY9A 1EUQA 4RY0A 5A0TA 4M38A 2F43A 1CZNA 3QOFA 5M04A 3K94A 3FTDA 4NOLA 4W1QA 2CHVA 2X4LA 4C7XA 4YRMA 5F52A 1JEYA 2GM9A 2PANA 2X0DA 4C2BA 4FCTA 2WF6A 2WA2A 1PK7A 3CPJB 1A9SA 1L8OA 2YNMA 3QWAA 2M6LA 4ARZB 5K4AA 5BV2P 1MAAA 4HWOA 4F4UA 3PEYA 3LPNA 1JPNA 1UL1X 1R9NA 4PRZA 3S2UA 4UARA 1CJTC 5JAHA 3ND7A 1U28C 4JUBA 5C7IO 1CUYA 2PR7A 1CNMA 4A6EA 4YPVA 3NBFA 1N6RA 3IA7A 4YJ3A 2TSYB 3CS3A 3O1HB 2OGWA 1Y1LA 4C4OA 1KMMA 2JF0A 2PRSA 2XQKA 2JIZA 3BVPA 1WHSB 2EIHA 3ZNNA 1VGQA 3A6ZA 3AR7A 4BMYA 1GLVA 3H5OA 1TAGA 4N0PA 4IDQA 3ZY4A 2AC7A 3JQ7A 4MV3A 1O2DA 4LTMA 4PZCA 4UEJA 3AR9A 4ZCTA 3N8GA 3T99A 2IIVA 3NBYC 2J6HA 2Y1LA 5DOVA 2TMDA 4A26A 3FCOA 2VR1A 4QQKA 5I45A 1JF8A 2O8VA 1Q95A 3KT3A 3HDJA 1RFLA 2GTIA 2OWEA 3M5CA 3SM3A 2Q07A 2ZUCA 5FUWA 1YA4A 3HZHA 3DBIA 1LX6A 1UBNA 3HYNA 4BQOA 2DULA 2IOYA 4CTNA 1B6GA 4RFSA 3TTSA 2XOXA 3C7TA 3QQPA 1OBOA 4NICA 3ZGNA 3OIUA 2OHJA 3CX4A 5T57A 4CCYB 1NJGA 1X7GA 1GFSA 1R0WA 1Y1SA 1EIZA 2HTEA 2JLRA 3IDQA 4JXKA 1P1RA 1ZD8A 3IT3A 1Z7EA 2CMFA 3WNQA 1CF2O 2G1JA 5CW2A 4ZT4A 4DIBA 3ADCA 1GD1O 2XAAA 4Z1OA 3TBKA 2CLKB 2QRZA 3H4VA 3KAKA 4C6RA 2WP8J 2ZE7A 4WBNA 2HLDD 2ZI7A 5JAIA 1P44A 3RC8A 2WNSA 1KI6B 2CLMB 4BX9A 1RQ2A 4IX9A 1Z15A 5U9CA 2BMJA 1NTOA 2YDXA 1ZCZA 5IBPA 1HBJA 3TZKA 2YHSA 1FVFA 1U2RA 3G5TA 1Q91A 4UZSA 5IULC 5CM8B 1P61B 3FDZB 1PZFA 3EZLA 3L02A 4GX0A 4OB6A 3SIXA 4OI1A 4HQRA 3V7NA 1G66A 3MT8A 4HBGA 3G88A 4HB0A 1TMKA 4RSMA 5L51A 3IAUA 3OP4A 4HBZA 1Q20A 3UHFA 3QEBZ 2V54A 1Z6ZA 2JH9A 3UAGA 3T9AA 1PSWA 2C94A 1KGDA 2XT0A 1V16A 1SQSA 3W8NA 5C5CA 5FTLA 2QP9X 3LUJA 1N2XA 2VJCA 5FNVB 1VDZA 1U7OA 5AK3A 3PXDA 4X7PA 3PIIA 1Q1GA 4KOAA 1R8JA 4E5MA 5FPHA 3P4UA 2JIPA 3B20A 5GM2A 3R75A 3AIIA 3CPSA 2JHPA 2ERYA 4OGLA 2ZSAA 5A7FA 1SUPA 3I1IA 2NNWB 3HPRA 4LJSA 1CZOA 3IAHA 3H9JA 1U3DA 1CHNA 3HDQA 3AONB 4PN3A 4UC0A 3WR5A 3CXUA 1BRMA 3GBSA 1ZGZA 4Q4JA 3ZEIA 3PKIA 4QGGA 3PZBA 3EBOA 4H6VA 4HYYA 4R2HA 5AYVA 2GBGA 1AS0A 4QDZA 5LMUB 2AFHA 4I8XA 1A88A 3I4LA 3IAM6 1IK6A 2I6XA 3JZDA 1UWKA 1J23A 1XCPA 1ENPA 1N5DA 3W7BA 4JLPA 4RTNA 4IIDA 1ULZA 3JTMA 4FE3A 4KWIA 4PPQA 1OA1A 4DN6A 2GD0A 1UT5A 5LDGA 4DMHA 3OQOA 1ZJJA 4ITRC 2ZRPA 4M1SA 3F9RA 3OTWA 3ZD6A 3VJRA 3K1AA 5FWXA 1OHHA 5KYUA 2Y92A 2CNNA 3H11B 2VDVE 3HY4A 3VZCA 4E32A 5LXTB 2VOJA 3GA7A 1L4UA 3RH0A 4CL3A 4BQIA 2PNFA 4IF6A 4FI3C 4ZIRB 2H5IA 3LECA 3HJGA 4ZXPA 3RYCB 1NFFA 4QQ8A 2GJ9A 2X7HA 1DRKA 2ZYGA 2C31A 1E9AA 4MRMB 4PRKA 2QW0X 3F97A 4J49A 3BB4A 1HMPA 2YWFA 3C7DB 3ZXSA 2MSKA 4G89A 2JAPA 4JJ8A 2HLNA 4MWDA 5A5EA 2C7RA 3HMQA 4F2GA 4DMKA 1BCRB 3UUEA 2MHCA 2YFYA 4ESEA 1OBHA 1RD4A 1W48A 4EM6A 3P26A 4CM8B 1WUHS 3KZOA 4C3ZA 1C8KA 4W1RA 3A6DA 3K2EA 3GPIA 3P97A 3UAYA 2DJ5A 2PUBA 1C3OA 3K9CA 2O0KA 1T6BY 1DJQA 3GJ4A 4X1KA 3QW2A 3VZSA 1HQDA 5FBZA 5LJLA 2ZJ6A 1TF2A 3FLBA 1E6MA 4LPSA 1XVTA 4DLYA 5J5AA 1AHPA 3R5TA 3AI1A 3NGXA 3ONFA 2C98A 5JQGF 3ZCQA 3H1EA 1FMTA 5E6UA 5E1DA 3MCVA 4HNTA 3D3EA 3PD7A 1ESCA 4X64B 3C98A 5DHQA 3UQYS 1QO7A 1E61A 4R41A 3I32A 3JQRA 4I5DA 2WOOA 3T0FA 1ZD9A 4KN6A 5CFPA 2BISA 4JI1B 5BQPA 4E07A 2GUWA 5IF9A 1G8FA 4MW9A 3IAXA 2XGGA 4TROA 4TS3A 2FEXA 4Y2JA 2UYQA 4QX6A 4O29A 2O50A 2MTBA 2B69A 3KXLA 2Q5HA 3D8UA 4XEHA 2QYOA 5SY6A 5DGTA 1PKEA 3G1TA 3RBXA 1CS0A 1RS0A 2CHQA 4EF6A 2WQ7A 3I5AA 4JJAA 2JIRA 4OO3A 2TS1A 1WXFA 2WK1A 3F4BA 4LX0A 1WXGA 2DLNA 5C3MA 2XNDA 4O4HA 1NRIA 2Q8QA 1YOVB 2QYHA 3W04A 5EJ6A 5HUHA 4FGLA 3OH8A 3V3KA 4PCVA 2GCOB 5H7XA 1G8HA 5H82A 5L95A 1SBZA 1RJEA 3PEVA 3IQFA 5FTMA 1RQXA 2IXTA 2Q2OA 5AKHA 1EVQA 2XYHA 5FF9A 3DKRA 1PQUA 1HQCA 1XA3A 3I30X 4L51A 5CLHA 4OAOA 2QYTA 4HEA1 3RVKA 3TRFA 3G9XA 1Z2PX 4B4VA 5HRUA 3R9IA 4YR9A 1T9BA 3ETHA 3ZJTA 1VBKA 3CZAA 1N6IA 2NZ2A 4B1FA 1Y8ZA 1GFIA 1NW6A 2XQJA 3F49S 4CL0A 3I64A 3M83A 4MWGA 1KRHA 3QTLA 4TLLB 3IAS1 1PBTA 2AQKA 4QYXA 5D1HA 3OCJA 4CL2A 2O8EA 1ONOA 4LYAA 5CCDA 5KYKA 1JR6A 2B5OA 2XOEA 3FOWA 4M0FA 3KWFA 3WKAA 2BZGA 2ZJYA 4M1KA 3GEIA 4KYIB 1JUDA 2RONA 3AINA 2B25A 1YUBA 4FYPA 4HD8A 3HHPA 2OXIA 1OREA 4KN9S 1WZEA 5EP4A 5EE5B 2AZDA 1EBBA 2AV6A 4MULA 2I4LA 2Q4TA 3K0HA 1VZ2A 4L85A 1BA2A 4REMA 4Q9JA 4BWVA 4GLFA 2V6BA 1NVFA 3JCZA 1KO7A 3C70A 4XYGA 4EY7A 1QOZA 2R87A 3CO0S 4H3HB 4Y2PA 4V02A 2QAGC 1E2PA 3CRMA 3KLBA 2HM7A 2FPSA 3BCRA 4MVWA 2XR1A 3NTVA 5JMWA 1C30B 2HADA 3WMEA 1UINA 3AHFA 2EYQA 2IXGA 2JI9A 2OZPA 2Q3CA 3HCFA 4RMIA 3UC5A 4HLNA 1C1DB 3PFHA 1IEXA 5EINA 2QA5A 1CPYA 3BH0A 2CLOB 2XKAA 4R01A 4NBSA 1I1HA 2JCVA 2ODTX 3QVJA 2V3VA 1XJWA 3J7AC 5FBQB 5JJLA 3LYLA 3B60A 4WHMA 3EXIA 5BW5A 5HOQA 3Q10A 3DDSA 3ZWPA 1BHSA 1O97D 2NSHA 3IV9A 4XCQA 3K6SA 4R1SA 1XG5A 1AZSC 1AUVA 1MOQA 1FVXA 2PJRA 3WO0A 1J42A 4ZOLF 1EZ4A 5GAJA 1XK6A 1CP3A 1TU4A 1WOYA 1O97C 4UVHA 4L76A 2HFKA 4XM1A 3N58A 5DHUA 6REQB 5G1OA 1RHQA 1LA2A 5JZSA 3S7TA 4EI9A 2Q4RA 4MO2A 2JG3A 4BQEA 2IXAA 5EIWA 1IFXA 5H3LA 4J91A 3DTNA 2X8BA 4GWGA 3UNXA 4YMUA 5HBRA 1ZIPA 3A4TA 1DWOA 3C87A 3MT0A 4D8TA 2ARKA 1LRKA 4HOYA 1ZITA 3CNNA 1BGWA 3GMTA 2VQEB 3KETA 1EFUA 3H6KA 2VYCA 4CDMA 3PHGA 3ZD9A 4C7MA 1VSQA 4UAVA 5AHRA 2H7XA 1U5AA 5DWVA 2QPOA 4YIHA 3D81A 4HX5A 4AS2A 3FCCA 2HU2A 3OQJA 3KLOA 4XPZA 5I5GA 1LPPA 5DWDA 1Z38A 2CNWD 4JCCA 1NUSA 2C03A 3NH6A 3RGGA 4G5SA 3T12A 1V8DA 4KR7A 2FPKA 2OFXA 4OSPA 3U9LA 3WHIA 4K9NA 3ZDCA 1SJ9A 3H2IA 4M8SA 4BWFB 1E1QD 5LVAA 2NSJA 1XRSB 1EFPA 2X8JA 3GRPA 2X9GA 2FY8A 2KJQA 3QUTA 4IFEA 2X0FA 3RVBA 4B4UA 3QFHA 1WXHA 4M0CA 4EJMA 1DCTA 3BSWA 3ORRA 4I4TA 2WJ4A 2GS9A 3MFYA 4G37A 2YWHA 3H83A 4JZYA 3I6IA 4OUKX 2B0JA 4DCOA 2V0NA 1K7FB 4GP7A 5CHEA 4K9KA 5FLYA 5CD9A 1DHRA 4ZCSA 5M29A 1Z74A 4ZPJA 2AOTB 2X77A 3QZUA 4WRRA 4WI1A 3IUEA 2LCQA 2H1OA 2VUHB 5HKKA 2V4UA 3TLCA 1EFVA 1LPOA 3TBHA 2D1TA 3EN0A 4RK5A 5CK5A 4BCDA 4DFDA 2G9RA 4R2LA 3UW3A 3SX2A 3N2GB 2ZZKA 2G04A 3WMRA 3L7JA 4DOMA 1TTTA 3AYZB 2QTHA 1FRNA 2A5JA 2NU6A 4WGGA 3EVDA 3LUKA 3SQNA 3EW7A 3A6PC 3LYHA 4EB8A 4R71A 1BHJA 1EFRD 3ZXIA 5FWYA 2V96A 5CFRA 1RQNA 4LHXA 1DTEA 1Y7TA 1RI3A 2ZR9A 3AO0B 4V0KA 3THSA 2JHGA 2PO5A 1Y7LA 3WIEA 2OYSA 5KUTA 1GFWA 3BTVA 5T3YA 2QAGB 3RJZA 4UM7A 1BTOA 5E9AA 4AULA 1I1NA 2PFKA 4TZ0A 4CT4B 1VRVA 5HIKA 4W1SA 2P6RA 1FNMA 1EZ1A 3JZAA 2WUGA 4D42A 1JQ3A 3E5MA 3ZV3A 4FB5A 1T0BA 5REQA 3KOMA 3C48A 5I47A 1XNRB 4HAWA 1N5LA 2G70A 4HDAA 3ZNQA 5DI3B 5LQDA 1HZJA 4XWYA 3UMFA 1NP6A 1W85A 4ZOEA 4O4IF 1TPZA 4L7VA 4R1QA 1XNQB 2X3YA 5KZMB 5JD5A 2HSDA 1QRAA 1YR8A 1M2KA 3V2GA 5A6SA 3F73A 2GZ2A 1ZGCA 3V33A 3KPYA 1UFKA 2ZS8A 4HNRA 1OASA 4K6KA 4NP6A 4TLBA 4DCVA 1UBGA 3TGLA 1F20A 2YFHA 4AUEA 4P4NA 1ZINA 2FF5A 3L82B 3F6RA 4TSRA 2HW8A 3HO1A 3E18A 4LJ7A 1V7CA 4QFMA 5JATA 2BFAA 3H5IA 3DMNA 3PD1A 4HQFA 4HDQB 3R74A 1OYWA 4ZWNA 1BVYF 4AECA 3ND8A 1D1PA 1XMOB 3ORQA 4UMFA 4C88A 1UIRA 1OI3A 2ZB7A 4ZT2A 3C8ZA 3CX6A 3VR4D 4QUIA 4OHMA 1HLDA 5A04A 4LV8B 2OQVA 3TQHA 2ZYVX 2UUCB 1M2EA 5KKNB 5B1EA 2OVBA 3KEOA 1QYCA 3B9BA 3HBMA 4ZZ0A 4YRZA 3URMA 9LDTA 1DKUA 2HQ1A 3NOXA 3GROA 4EUNA 2ZCJA 4PV7A 3Q0IA 3E3MA 1E1DA 2A92A 4IY1A 5SYNA 4RMNA 3D7NA 5LQNA 4CETA 1DX4A 4R2MA 2P9QA 3NWEA 1OWOA 5IJ0B 2ZDGA 3FPBA 3K0SA 1JTFA 3L05A 1OPXA 1CF9A 2X8WA 3DMDA 1FDWA 1SIOA 4WA7A 4XRRA 5JNLA 1ZISA 2YWEA 2QV7A 4X91A 1KGSA 4PCUA 2QQ0A 3JY6A 4BFYA 1J6UA 2J4DA 1P31A 1C0EA 2QROA 3IQWA 3LHKA 4K9PA 4R9NA 3AOEC 3O8QA 3A9SA 3SE7A 1GKLA 4BJ3A 1QIKA 2CXSA 3K9LA 1PLKA 4DR2B 5BORA 3EZ6A 1ICEA 5F7XA 1IMOA 5KYYB 3LQRA 4F9EA 1FUEA 2X2OA 3OAAD 1R6AA 3GDFA 1AS2A 5JH7B 4ND1A 3Q9NA 3TNYA 4ZCPA 5GJCA 3WB2A 2B1JA 1NG9A 1TA4A 4TL7A 4DWWA 4TVKA 2RARA 4TN1A 1D8AA 4YAWA 1IL0A 1GPYA 3UB3A 4D3XA 1FSFA 5TPWA 2M1ZA 5JNRA 2W5UA 1LXCA 3GWZA 3PTZA 3COYA 3HU5A 1G5QA 5IJXA 1ZOOA 2WG1A 4I0WB 4XB1A 3I6BA 3OD5A 4KR0A 3P9KA 2BBTA 2D13A 4GUDA 4J0FA 4NZMA 1Z4QA 2HHLA 2OXRA 5IDYA 4M6WB 1Y0BA 4U5QA 2OYRA 3REOA 1H5NA 4O4IA 5JJ5A 3KTAA 1Q2XA 2JIDA 5B5SA 2FEWB 3BHIA 4K28A 4CGYA 4JQOA 1QSGA 4HATA 3GLGE 4AY3A 5DTJA 5EJ5A 3PCRB 4KXNA 4LWZA 1M6HA 4QXQA 5KYXB 3HXOA 3ABOB 4DYHA 1F60A 2PL5A 3C1AA 3MCZA 4JJKA 5ITZA 4FYYA 1XE3A 3K72B 1DEXA 1T0IA 4CMIA 4YNBA 1ECPA 3UN1A 3D2CA 3DMHA 3DOUA 2R7MA 1RXCA 4ETWA 1E64A 1ZN7A 3REFA 1YCDA 2ZJ8A 4I1IA 3WQSB 3AHJA 3F96A 1WSWA 1QDLB 3CJQA 4EB6B 2YZ7A 2HHAA 5BWOA 2FA9A 1E3SA 1A8IA 3AG6A 4GX1A 5WRFA 4JI7B 2WVGA 2EV9A 3A10A 4B3GA 1M9NA 1DOAA 5IU6A 2XKKA 3EGXA 3GVHA 1HF3A 3IPLA 1KYXA 2Y2VA 1B8NA 3KSZO 3L6RA 3QQ5A 5LM3A 3U4QA 2V65A 2WAXA 1S2LA 3VZRA 1HR0B 1Z2AA 2E4XA 4ZDKA 2HT1A 4B44A 3HCDA 1MLDA 4XYBA 4MPRA 1SZCA 3ZDDA 4YI5A 3A1DA 4J6EA 3FLMA 3E8XA 1XZLA 5DKFA 3KBOA 3ACCA 1U2TA 3I0ZA 3OX2A 4PHHA 3EUWA 4NBVA 4YMHA 3CA8A 3L4EA 3R3HA 1JX6A 3SPXA 1NZFA 4QU9A 3UCXA 2C78A 1E58A 2MYUA 3D6NB 4LJ5A 4NJEA 4M9SA 3AJRA 2NYVA 1GAJA 2NSDA 3M49A 3MJSA 2N9UA 4BAUA 1QP8A 1RYHA 2WAMA 2EBWA 2HU8A 2IYXA 3I3OA 3QH4A 5B3AA 3BFJA 2QMEA 3QVSA 5J5CA 3ILYA 2R97A 4I19A 4NU5A 2P69A 3PR3A 1AXGA 1NVWQ 1YNSA 2BR3A 3KC2A 3X1XA 1QGUA 3GLFB 5K8UA 5E95A 2PXAA 3B1YA 3D64A 3UV6A 3OFVA 3MS2A 2EL7A 2EP5A 1E2HA 4RMHA 2XHEA 4XSHA 4F97A 3FMPB 3KX2A 1G5IA 3T7CA 1PEYA 4CEJA 2JCYA 3L43A 1J2TA 3NTUA 2R00C 2WT9A 2XQGA 4N5IX 4R5MA 4A6PA 2DSTA 4IDCA 1FYDA 1ZNZA 3AFHA 1ZM4A 1KSFX 3BFXA 4IR7A 3T54A 1I10A 1JDZA 5KC9A 1NN5A 3JAWB 3D5EA 3GHHA 2R8OA 1D8TA 1KP2A 3ABSB 5AR1A 1YI0A 5T4EA 3RIYA 1Z0SA 1B43A 1ENYA 1FFXB 4OQDA 5E1BA 3QPUA 1FNSA 4DCGA 1EFLA 1CNFA 3S2IA 3FBWA 1QZTA 2QZ9A 4NOMA 4PXYA 2FW8A 4IZHA 4Q3DA 1WXWA 4YLGA 1Y98A 5HDQA 4GPD1 2CW5A 3OY2A 4PFJA 3D6UA 4XYMA 3FKJA 4YMWA 1Z56C 2C3PA 5BXQC 2ODEA 1KEKA 3Q6MA 4OH1A 2FRDC 1Q57A 5LBTA 5JFTA 1XD9A 4D9MA 2WYIA 4ZQCB 1U98A 5HE9A 4FFVA 1K3FA 2EKQA 3N2NA 5JT1A 1GKYA 4JA2A 5JROA 4JITA 3SEFA 2VT7A 1GO2A 1VLQA 4XYLA 2MINA 3GXBA 1NVVQ 1DIBA 1ZVQA 2E5WA 3H9BA 4M1WA 3CVXA 1BDHA 4D3DA 1ND6A 1G6HA 2VHUA 3GLUA 5TDHA 4ESVA 2BEWB 3RVQA 4WOPA 2JLSA 3DP9A 3U9TA 2YIJA 5L7TA 1CW2B 4MWCA 4ZV7A 3O7MA 4OLHA 2GEKA 2P9YA 5CFZA 3QRWA 3DZCA 2Y6UA 2Z5LA 3K96A 2G17A 2EKLA 1U99A 1JV2B 1JIQA 2CUNA 4CDNA 4JQSA 3AFMA 2CLHB 1X8KA 2VJKA 4YJKA 4F5YA 1SFRA 3TZBA 2VOEA 4QXMA 2QPTA 3WRWA 2GEDA 1NJ2A 5EE0A 1EBFA 2C5AA 2XTZA 5I7HA 2QIPA 4KWCA 1R74A 3DCYA 4II3A 3PUHA 5M2QA 2G07A 4QJ3A 3IUPA 2I03A 3KYIB 1NAHA 3OO1A 5IKEA 1AV6A 1A4XA 1SPBS 4UM9D 3S27A 3Q98A 3QPBA 5AOBA 3TWOA 3G2JA 4U1RA 1QIDA 3LUAA 3RBAA 4R2JA 1RWXA 2DBYA 2OCIA 1ZXLA 2OEPA 4LXHA 3KUDA 2HL6A 2XDQB 3BPSA 3SZ3A 1QB7A 4NPAA 4PX9A 3I52A 2UVPB 1KI9A 3CG4A 4Q3NA 3HR8A 2WFAA 2FMHA 5CK4A 3MF4A 5EPOA 4O4JB 3QVMA 3IHWA 1SUAA 1T8PA 5DE3A 3OZAA 3SOZA 3SS7X 4ZJYA 4BKOA 2ZBQA 2ZYAA 3CSSA 5A5DA 3HK2A 4N7MA 1VP9A 3N07A 4LNAA 3A1SA 3TYXA 5E4FA 3NYWA 4WKGA 4L9SA 1OFUX 2QZSA 3NBQA 4XQGA 3AJ9A 4GWKA 1P9OA 5EI5A 3WRXC 1ORWA 2VVTA 4BRUA 2HPHA 5CA0A 1QAQA 4BMNA 1RXUA 1FLDA 1WHTA 4Z4IA 2H08A 2YTZA 3DKIA 3KLMX 3MOGA 1K8QA 4F92B 4DV0B 3G7NA 1H1DA 4KFRA 2XZLA 3E9CA 2QRQA 5JAUA 1PDOA 2GYYA 3SDBA 2I2CA 3L8GA 4MCIA 5DTQA 3GEMA 3QA9A 2WWTA 5T3UA 2X9LA 1ZKMA 2XRZA 2GNAA 2AFIA 3K9WA 3IP7A 3FF1A 4ZDWA 4N3NA 3VKHA 2EDAA 4P86A 2IGBA 3FX2A 1QQBA 2UZ3A 5HIJA 2FAXA 4JJFA 4M8IA 4O2BF 1NXQA 4HYQA 5IEBA 4EIWA 3OPYI 4DLWA 4E4RA 3EVGA 1WPGA 2Z2IA 5KMGA 5CXXA 2FE4A 4BP1A 2GTHA 5F77A 5IXJA 1FS6A 1Z6YA 4O0LA 1OFUA 3ELDA 3F8WA 1RYMA 3QKRA 2G9UA 3DMYA 4L4ZA 2GARA 4M60A 1TCAA 2I34A 2AR0A 1FU8A 3TO5A 3NV9A 4UCXA 1I9CA 2MCFA 4MV4A 2DHCA 1L5ZA 3IVGA 5DEIA 1JJBA 3BQNB 2KWIA 4RL6A 3FDFA 3PKJA 5HCIA 1SELA 4P82A 1RAGA 4AP6A 2H11A 3D59A 2Y6VA 3ZQJA 1ORVA 4BNGA 1GKKA 4IDNA 1J20A 1G8AA 1ISPA 2CL5A 2G80A 2R6R1 3BE8A 2E4VA 1G1MA 1G3QA 3DEIA 3K2IA 3NEAA 4H6XA 3QA3E 4UEQA 5BMVB 1MR3F 4NK4A 4G8DA 4EQ6A 1PGNA 1PG0A 3EFHA 1K6MA 1O1YA 1OKKA 1RP7A 2XGOA 1QC5B 1WVIA 3VTFA 4EY3A 2D1FA 1G19A 3L8ZA 1FQKA 1Z0ZA 2HF9A 4COKA 1NMXA 2H59A 1DCKA 3U56A 3M9XA 3EGWA 1QE5A 3RSHA 2IHJA 1ZS9A 3BIFA 5ALJA 3M6LA 1TRHA 2F1IA 4MVJE 3NM6B 4MPPA 3VZBA 1VKNA 5DSZA 1Q1ZA 3D2AA 4DMUB 4REQA 3RC9A 2DKFA 2RHCA 3JYQA 2X0EA 5KPJA 4FQ7A 3PVSA 3OFND 1OVMA 3LT2A 4MMZB 4AT1A 3N7UA 5DLQC 4XLZA 1QMPA 1E3JA 2AG5A 4UUAA 3PUVA 3LI2A 5U4XA 3QBEA 4QDUA 1O58A 1U2DA 1IJKA 1IULA 1J70A 1FP2A 3AM4A 4ZAXA 1GT6A 4BO0A 5B3JC 5BSVA 2XLCA 2FPUA 5A0FA 5TQ0A 1RM5A 3OCXA 1YB6A 4RACA 4LS3A 3WGQA 2WWGA 3C5EA 3BIXA 1AV7A 4RLFA 3THOA 3O3OB 2ZB3A 3C7CB 2ZJ5A 3KM0A 1U9IC 4G5GA 1UMBA 4QFCA 4QKQA 3ZCTA 4C2AA 1RU3A 4CLEA 5C37A 1TL7C 5E2BA 3ICQB 1ADFA 1TIKA 2FW7A 2JFFA 1YVUA 4WN9B 3LDUA 3ME5A 2FJ0A 3IUYA 3VC7A 2XBUA 4TKVA 4KQEA 4LCBA 3MWDB 3GG9A 3RUAA 3V97A 1HXHA 4GEGA 3FNHA 5CXSA 2FZVA 2HIAA 3DTTA 1AGYA 4KP7A 4RWEA 2J67A 1ENZA 2RB5A 4MINA 5CDYA 1WETA 2FPIB 4HLUC 3HYLA 1NW9B 2ADFA 2Y76A 3GA5A 2ES4A 4KNWA 4KITB 2PU7A 4LEIA 1P2BA 2A5LA 3CCFA 3UGKA 5I48A 3TI9A 2VPTA 1G18A 4OBXA 5YASA 1SUSA 3LF1A 1I3LA 4GBED 1P1HA 2X5NA 3L4JA 3A28A 4CKBB 3HHEA 2ZJ4A 4EUFA 1U0EA 2DFNA 1XDDA 3VU1A 2Q6VA 3ZHRA 2W2OA 4M4SA 3ZCPA 2GOYA 4PYKA 1TT5A 1FFGA 2Q1TA 1KJJA 1FFCA 4R69A 5CIYA 4J43A 1EJ2A 3EIEA 3DR3A 1J39A 4EYGA 1P75A 4Q3CA 3MTDA 5C8DA 3DPIA 2V74B 3JYPA 1C2YA 4I2VA 1GGEA 3TZCA 1YJXA 3IYLW 1Y8RA 5G4KB 4XDHA 4EVQA 1DQNA 1MO5A 3RVDA 4ZHQF 5C52B 1Q21A 5C8XA 4A9AA 4OOEA 5KSOA 5DW3A 3RHTA 2GBLC 1CB7A 1DG3A 2PKCA 4OQEA 1I9GA 3VOTA 1Q7TA 3AW8A 3RFUA 1KQPA 4NS4A 2P7HA 2NVUB 4DM7A 3H6GA 3F74A 2G40A 4UPDA 3MWGA 4WDQA 3RYFB 2GNPA 1ZH6A 3RWBA 4BWGA 3K0CA 3S44A 2CCJA 3LNCA 5CFQA 5CT8A 3AL2A 3N05A 4HB2A 5E8JA 1YMUA 2JKYA 3RSCA 1FTWA 1XMSA 4TQUS 1KE2A 4DLVA 1V1RB 1Z6QA 2NWQA 3P9PA 3E23A 4LF6B 3L1KA 1AQLA 2GJKA 3RTBA 3VKVA 4EZIA 4EZEA 2Q4EA 4JJ6A 2RGGA 4WAUA 1I7DA 3HR4A 2J6IA 2N46A 2C42A 1SKYB 2Q6OA 4C4ZA 4EKDA 5T6MA 2GSWA 2ZI5A 5EXPA 2H52A 1SK8A 1IOLA 1TW2A 2YN0A 4QPJC 3SIWA 3BT7A 1Z2DA 4Q82A 3RVLA 1V4BA 2PL9A 3CWQA 3EBPA 5EXXA 2N75A 4QUAA 3W6PA 2WLTA 1SD2A 3FPEA 1JR3D 1U0SY 3ICWA 5LQAA 4M3NA 3DJFA 4J1QA 4UBOA 5HF9A 3W3ZB 5DXFA 3P45A 3PI7A 3DVRX 4QOSA 4IOJA 1HL7A 3L79A 2N0SA 3FZNA 2QN2A 2VAXA 3HKBA 5HWSA 2QMOA 3EVZA 1YH3A 2GESA 5CDFA 5HPYB 1B76A 3WYCA 2AT1A 3UMMA 2QGFA 4UM8B 1ORTA 1RI4A 3U13A 5G3ZA 1LPSA 4KXMA 3GLQA 1LLDA 1HOTA 2XMDA 3OLXA 3PFWO 4X54A 1X1BA 1MVOA 2J08A 4JC0A 5IYZF 2PH7A 3K5PA 3ZDXB 3QSYA 3FZQA 5AW9A 4BY9E 3LX4A 2X3UA 3X0DA 2VSNA 1Y5IA 1VYTA 3RS2A 5EP1A 4E94A 1SD1A 5I9IA 1V2HE 1JWLA 4ZVSA 5HKOA 3ZX4A 1BYIA 3ZV4A 3SYKA 3IMFA 4QWWA 3KJGA 2PMDA 4D46A 1KK0A 3EYWA 3N0XA 521PA 3VH4A 3GFFA 1ZL2A 1QG0A 2VJYA 2I4RA 4RHTA 4MI3A 4CMAA 1LZKA 1YONA 4PGMA 4ZGWA 4AWBA 1JILA 4YAGA 1OLXA 3AEUA 3OT1A 1ZGJA 3EHDA 3T3GA 3QF4A 2VIIA 3G8AA 5DM4A 5DT2A 3T1NA 3OO0A 3T15A 1MB2A 5DYWA 1IWBB 1AOXA 4QDOA 4XTCS 5D00A 1S8FA 4JDUA 2CJWA 2I62A 4I8IA 5FBHA 2AE2A 1HL3A 1E2IA 2GN8A 5IRCD 1H2RS 2HHJA 3PVCA 3TTWA 5BSWA 3RTCA 1IQUA 1MH1A 1QHXA 1R5BA 3TAXA 5FEMA 3LD9A 1JBEA 2DG2A 1LSUA 1T6YA 3ADDA 1KVQA 5HJ2A 2CXUA 2BFMA 2O1EA 1NLYA 2O3SA 4WKOA 3B3JA 1R4NA 2P9BA 3SDSA 4TM8A 2I4OA 4FDUA 5EJ7A 1WS6A 3L6OO 2ZAYA 1J5XA 4ZEWA 4JOBA 5A2GA 3GGSA 5DXAA 2VXYA 4RETA 2I65A 2ZT8A 2C54A 4PSVA 3P2KA 2CFIA 2GCIA 3IR6A 3HCNA 4PYNA 4HFRA 4UDOA 3UB4A 1KPIA 4L57A 2HLHA 1QB8A 4PLZA 1LBIA 3GEGA 4X90A 2B61A 2QLTA 1YR9A 1X7YA 2VDMB 3FNIA 4CE6A 3WXBA 2GAJA 3JQ8B 3BMOB 5HGXA 5K45A 3OJLA 2P2GA 3CVJA 1G9SA 3K70D 2QBYB 4X44A 2UYYA 4YP6A 1G5HA 2Z3VA 3MBOA 5FFNA 4W99A 3GAAA 4CKZA 3HXLA 4A8TA 1XX6A 1TU0A 1BU8A 1JPJA 2Y4OA 2W6QA 3MT9A 4ZAWA 7REQA 2PSDA 4KW7A 4D9IA 3K70C 1YDWA 5FUYA 1RWNA 3OY7A 3RI3A 4EVIA 3R9XA 2B94A 3AZPA 4FN4A 3WS7A 3LC0A 4AL4A 3BICA 3L7KA 1DIAA 4M87A 4PICA 3RS9A 1GDHA 1IVYA 3L8YA 5IYZA 1GSIA 1MAHA 3N2YA 2AMJA 3FZEA 5IWAB 2Z8YA 2VH5R 5AI6A 4K46A 3VOAA 1VPLA 5JO0A 2CWWA 2W6ZA 2XXJA 2P3LA 1LFDB 3PPWA 4GR5A 4D92A 4O63O 2XWBF 2ONZA 5EFOA 5KNCA 3I5XA 5KINB 4TYQA 1LGYA 4C5CA 2R85A 2I2BA 2GUGA 4WNIA 3BWDD 2RAFA 1SC3A 3V2HA 8ATCA 4KGZA 2DWPA 2ACWA 3WWCA 2IYUA 1J56A 821PA 1YDFA 1Y1QA 2DECA 1WU8A 2NSLA 4RXUA 1LV8A 1SZPA 4X8OA 3CZRA 1T5HX 4M2LA 5H3CA 4DA4A 3UYKA 1K6XA 2UUBB 1QGAA 1LBTA 1XXHB 1UBRS 2I4MA 3MJDA 2XUAA 4C43A 1W35A 4OU5A 3V4SA 1CVIA 4TS9A 1T3HA 2MR6A 4HDRA 3RKRA 4DZTA 1P4JA 2EZ8A 5ARCA 2ZLBA 1G5PA 3Q5DA 4HH1A 3CURA 5CVUA 1WO8A 4B3BA 4WE3A 3AQIA 4RLSA 4RVUA 1G5RA 1E6CA 1OTHA 1ULSA 1QK4A 2H4XA 2PSFA 1PR9A 4ZRDA 5HR5A 2YOHA 4NIMA 4C7OA 3NQ41 1DDIA 3PICA 4FB4A 2I8CA 2RI6A 1UC8A 5KWSA 4X71A 5JZBA 2WIBA 2K87A 4JLUA 4D9EA 1W1IA 3E7PA 3OP1A 3C1TA 3NBKA 3DV2A 4YRPA 1UP6A 1NBMA 1VE7A 4V38A 3QPCA 4X20A 3BF7A 3FDIA 5ALWA 1SB9A 4AO6A 4EFKA 2NYAA 4NEHB 5M3BA 2W70A 2XWJI 4S3MA 3ELWA 3CVYA 2GAOA 2D62A 3C2QA 3HLYA 3KL4A 4DQXA 1PFQA 3O5AA 3L8HA 4B6GA 1QCYA 3HEAA 3JSXA 2CMDA 1L7NA 4CKWB 4W5HA 4ZT5A 4HV4A 3IDSA 3HFGA 5BSFA 3TIVA 4Y2RA 4C4TA 1QX3A 4OSEA 5AO9A 2JI4A 5KNBD 2O8CA 1ADCA 2VDWB 1WCV1 1R0SA 3OPVA 1B4DA 4IOMA 3CH5A 4EB0A 4EO7A 1SUWA 3KD2A 3F2IA 1GRRA 2L18A 1SKQA 2D7JA 3IEIA 3QPDA 1N5MA 3FNGA 3QLVC 4Y6GB 5IXSA 1YVRA 2H0RA 3CZ9A 5AK4A 5DBOA 5JVDF 5TQ2B 4BFZA 3T06B 4NZNA 2JFOA 4PG7A 4K6FA 1BKYA 4AN0A 5FAKA 3P4XA 3JQBA 4I55F 4NYMR 1YKFA 2DP4E 1NJFA 4UU1A 2CK3D 4PWYA 3GEEA 1BAPA 1CR6A 2IYPA 1X38A 4H3SA 3TSZA 2F64A 3PUYA 4ILEA 3K70B 1Z6TA 3C24A 3C3WA 5IAGA 1IJBA 2A4KA 3PPYA 5DM1A 3R3YA 5LZ5A 4LBYA 4M9RA 1DLJA 2RK4A 1S9HA 1WUJS 2QUJA 3QUAA 3HNOA 5EA2A 1LNQA 2C2WA 2J3MA 2GN4A 1QYXA 1EJ6A 3IT1A 3CO5A 3D7LA 3OKCA 4KQ6A 3U17A 4BN5A 4WZBA 1OB5A 4JMLA 5GGXA 5EVCA 3ZE8A 1EVKA 4W8HA 3WYDA 5D1NA 2OXFA 1EH5A 4PX5A 4BXOB 3L7OA 4OU4A 1TJNA 4UAJA 5B58T 5JSKA 1DQPA 2V7GA 1MX5A 1IBCA 1XYVA 1M2VB 1CY1A 3NUGA 3OE5A 3NP9A 2CLIB 2ONCA 2D2FA 3HSKA 2VYVA 1PZXA 3WXMA 1JL3A 3ILXA 1M3SA 3TH5A 4MUEA 1DAGA 4BMDA 5K6AA 5DLYA 4DJFC 1SCNE 3WGVA 3ZHSA 3M4NA 2CB0A 2IZ7A 1ACJA 1E0KA 2KLBA 5EFZA 4ZKDA 3NDPA 1FSZA 3WE7A 4F5EA 2HJGA 3LQ4A 4C04A 1AO0A 1PJTA 3I83A 1Q77A 3I9V1 3WLAA 4F84A 3EGOA 4MUYA 1W76A 4DNQA 1JB1A 4IH1A 4ZYLA 1F4LA 1QV7A 1GAEO 4CHTA 5BN1A 1G20B 5K1ZA 1CZLA 5SICE 1FFHA 1B15A 3CEAA 2WICA 4C21A 3A9TA 4GMDA 4ZYXA 4BNZA 1URPA 2BEVB 4I66A 2O6LA 5FWAA 1CRLA 2F3UA 3CMMA 1OXBB 5TGZA 2GF2A 1ECJA 5HRAA 2VP6A 4M99A 2O2SA 2RGUA 5EYPA 3FJYA 2VCEA 2P30A 4O08A 2NQ8A 1U2QA 2CV0A 2B36A 3DAGA 3FY4A 1Z82A 4L9AA 1P8AA 4Z4QA 3ESZA 3HGQA 1HZZC 2X5JO 1DZIA 2RHDA 2YJGA 3O91A 3PCXA 4P83A 2WQ6A 2B4QA 1VKOA 3Q3EA 1DPFA 1GA1A 3CZPA 4RAQA 4XVRA 4I4IA 3A36A 4LY6A 2C7VA 4A2CA 5FKJA 2W43A 4U2GA 3R6LA 3GO4A 3FN4A 3U7IA 3WISA 4M7RA 3ZE1B 3BHNA 3H86A 3T7IA 2GT1A 2L17A 1JMVA 1FQJA 3MW8A 4ZC1A 3EFEA 1UK9A 3A1FA 4FC6A 1THMA 5KTMA 1KBZA 2ZRQA 1EP1B 2E0IA 3BBLA 1PJ2A 4MQEA 1BVUA 1BJKA 2IH4A 4UVDA 3K0BA 1SM4A 2JVKA 2BCJQ 4HLDA 3O8OB 1P9LA 2GASA 4K81B 3UMBA 1P74A 2FWAA 2EBUA 3UO8B 2LUOA 3KQVA 1SXGA 2FETA 2YJNA 3MZ0A 4U7DA 4JLDA 5CDSA 2YKGA 1UDXA 4FYXA 4XCVA 1YFKA 4QICA 5TIIA 4AMUA 1IN5A 4WTOA 3W05A 3A1NA 3OLCX 1ZCFA 4RPHA 4PQYA 1MOSA 2B9VA 5EESA 1OWMA 3FPJA 2NXNA 4RVNA 3VR4H 4ACBA 1QTRA 2XA1A 4EA7A 3IXMA 4LPKA 1F3OA 3Q87B 4BAZA 3AVTA 1PQPA 1WNTA 2HPVA 4PPFA 3PWSA 1D4AA 5HQ3A 4M22A 3BJEA 2Q28A 4GG1A 3RFVA 4YK7A 4DMLA 1IXRC 4HZUA 3IQZA 3OHPA 5BSUA 2EAUA 4TTRA 3UJ9A 1JKJA 4IUBS 4E14A 3U49A 2PUJA 2XWQA 3L7CA 4HXGA 1KH2A 3K2QA 5FTJA 4LSMA 1PGQA 1Y5RA 1P4SA 1S01A 3UOGA 1KKLA 3B82A 1QRTA 1Y3CE 2JZNA 4Q02A 3T9BA 3GV0A 5IUJC 4DV4B 2BELA 4M21A 3BGVA 5K0GA 2QR3A 4IHQA 4A03A 1RQ7A 2IYFA 2WRZA 5HGJA 1EUDA 3KSDO 4LGYA 5DO9A 4G81A 3PT5A 1V1MA 4EW3A 1RRKA 3KQOA 5AHWA 3CYFA 2FSPA 4PIPA 1LQUA 3VU9A 5C8YA 4WCFB 1SCDA 3R0VA 4FCWA 4C7JA 1M74A 2F17A 1KU6A 2JDID 4E7PA 2VJPA 2WD7B 3QMWA 3IJRA 4LW8A 1C14A 4KQJA 2ZBGA 1OT5A 4ZCIA 4OXYA 5J2UF 3EVTA 3Q88A 8ABPA 3I61A 2ZDQA 4XD7D 3FTEA 2C99A 1II0A 3HV0A 3N7AA 4WW0A 3SHWA 1SXJB 4W8OA 2PRKA 2WYUA 3RF7A 1CR1A 1GG9A 1GUYA 2NO6A 2YOFA 4R1MA 1Y81A 1WRBA 2J4FA 1G21A 1Z6XA 4Q4AB 5BRJA 3EOAI 1ULBA 2JARA 2FKNA 1E3TA 1XPJA 4L4XA 3I12A 4QSHA 3QE3A 1OLSA 1YMQA 1H2XA 2OGZA 5LDDC 1NOKA 1PVDA 3GGCA 3FG9A 1U0HC 5EGSA 3AEQA 3KCNA 5FI3A 3OEHD 5JDCC 4EHKA 5E0OA 9MHTA 1U1FA 4E4TA 1MB0A 4H31A 4M7WA 2HO4A 5LA6F 4HWRA 3NPMA 1HYBA 1GG5A 1TO2E 2JVJA 4WKNA 1VKJA 2ONYA 2YR0A 4PVCA 2XCOA 1KDTA 1LH0A 1O8BA 5F2OA 1NG1A 1IVNA 4WFQA 5KI6A 1YRWA 3EA4A 3WGLA 2P90A 3ERCA 3EGCA 3DD5A 2VHJA 2REBA 2C4HA 5CCXA 3KWJA 1VYHA 1JPUA 4L3WA 5E7QA 2EP8A 3TW0A 4RL4A 4RTRA 3D4LA 2HA6A 3FHOA 1HDCA 2YHBA 3E8SA 3EAFA 5F9MA 3PEFA 3VQTA 3HU3A 4QBKA 1KERA 2YVLA 2BVNA 5EMHA 4AKGA 1GGHA 5EHIA 1YGYA 2GDJA 2XCLA 2QVYX 3HM2A 3KVYA 3RVRA 1PR3A 4TUYF 4A4DA 3F8SA 3R5FA 1UC5B 3WNZA 2J7PA 1VIVA 1TJ4A 4H7IA 3PNKA 1NU6A 1WCIA 3CN9A 1CULC 1FYVA 4QGAA 4WXPA 1MNAA 2PT6A 3O2JA 1Q7CA 1C4OA 1VYVA 3BF8A 1PR2A 3DVAB 1COWA 3EDOA 3Q1LA 4HXFB 4M0PA 4R16A 1Q12A 4HFMA 2BMDA 4BIIA 1KEEA 1QHHA 1OU4A 1LPAB 2YIVX 1PEKE 4JB2A 1Q1NA 3L84A 5HKAA 5LZ9A 1WZNA 1XJ0A 3IHKA 4TV8F 4NYIQ 1Z0KA 1U7DA 2CL0X 2ZWOA 4E4YA 5LR6A 5AJZA 2ZTSA 2GXAA 5KSWB 2IS4A 1VSUA 1UODA 5F1OA 5K3BA 1G42A 1MXFA 5J2UA 2XCUA 2EP7A 3UAOA 4QT4A 1U94A 4QU5A 3EGDA 5CDTA 4NDAA 3BDAA 3QXSA 1H2AS 3RD5A 5KOHB 5MN6A 3M6VA 2Y1OA 2R96A 4YP0A 3ZHYA 4DIOA 3T7TA 5BSRA 5J43A 4QPZA 2IL1A 4BMCA 4A27A 2NVBA 1OH5A 1ZCJA 3PUJA 1GSOA 2A0WA 3EOZA 4XRGA 5B3LA 3ZU3A 4IOKA 3D3KA 4MUIA 2NXEA 3AHHA 4ND2A 1N2ZA 2HQSA 4XB6B 3ZD8A 1P19A 5D3MB 3GGOA 1PT5A 3GXOA 1N2EA 4H15A 1ETUA 4HNAA 1N6OA 3DSRA 4PGFA 5LA6A 3TLJA 5K01A 3FPHA 3GLHE 3Q8MA 4WXEA 1PE0A 3SGLA 4WJZA 4R0MA 3CIFA 1C3XA 3NORA 4RWZA 4JI4B 4C7VA 1KEZA 2AYYA 2V0CA 2Y93A 4IIUA 2PA0A 1XN1A 2EDCA 1C7QA 1X0XA 2A9KA 2M9MA 2YBEA 1E3MA 4XFJA 2TMYA 4WX2B 4E13A 3M7IA 3T4PA 3JARA 4ZAFA 5JCOC 1C9MA 1EDZA 1JIVA 2QL9A 3AR5A 3LVRE 1K27A 3OPNA 16PKA 1XKXA 3U0BA 3KLPX 3UZUA 5LB2A 3CLHA 2Z1MA 2F6RA 2PS3A 3RC1A 1LJUA 1T3GA 1K7YA 4TUYA 4PX2A 1Y3DE 3FPAA 1ZA1A 3LWNA 1PG2A 2FOLA 3L0DA 3P9SA 1GWNA 2Z04A 4K0KB 3ZJ5A 1P7PA 1RXIA 5B7GA 3KE9A 2VTBA 1O94A 2DU8A 2XB2A 4KPYA 3KKNA 2PA3A 2UZ4A 1P1JA 1VHQA 2QTWB 3G17A 2FSUA 3CPHA 5B7QA 1ZBQA 3EZ2A 1RBQA 1NC3A 1K92A 4RS4A 4CQLA 3Q8LA 3Q41A 3P9XA 1NYQA 1NT4A 5FWNA 1PJ8A 3E5RA 4N6GA 1UFRA 1U6JA 3BIOA 4KXFB 1PLLA 4QBTA 4PZPA 3QWBA 3REQB 1Q1BA 3K73O 3VC3A 5KNDD 5KQSA 2ISCA 3KDPA 4EUKA 3O92A 5DP2A 2A0XA 3TLMA 2PXXA 1LS1A 2OFFA 3BE6A 2Y8EA 3G0CA 5AVTA 2VRCA 2Q1YA 4HKTA 1JHXA 4MQBA 1BFKA 2XSZD 4BWYA 3LYUA 5AVQA 5DCUA 3JQQA 5JIBA 4ZJZA 4ID3A 1JHOA 5B1HA 1Z88A 4HJXA 2PT9A 3A37A 1OC2A 2K6GA 2WHQA 4XIIA 5ELLA 2IV3A 2VPIA 4QJ5A 2HB6A 2RBKA 5EJAA 3IRUA 4DSUA 3GRFA 3OVMA 3W5IA 3GCGA 4B82A 4EPXA 2WQZA 1EK1A 4KTTE 3HJTA 3HBJA 3VR2A 4BO2A 3FVTA 2CLCX 3B6MA 2QK4A 4GBGA 4IDDA 4XH9B 2WSYB 1FMJA 3QWFA 4N3AA 2AK3A 1LZLA 2X13A 3SQWA 4OV6B 3SR3A 1RVV1 1YCGA 4FR2A 4R0VA 1GPH1 3U3XA 4N18A 2A1UB 3MMZA 1FUIA 4AQYB 1IQPA 4R6WA 5BUSA 4AKIA 2K7FA 3H9QA 4LMPA 2RB4A 4Q9NA 4JFRA 2WLSA 5FBWB 2J85A 1JNXX 3E35A 3MELA 4D9HA 5A4DA 1HKUA 1V4NA 1WL8A 3TM5A 3RG2A 4ZOBA 4JP2A 3AF1A 1RYNA 3FUXA 3OU6A 3UWSA 1HORA 3JVUA 3K6JA 3H99A 3SR4A 1KYQA 1MAWA 3EC2A 1CE8B 3VV3A 2ZB8A 1ADYA 2QRPA 4BKUA 4ZZ1A 4LJRA 2C9ZA 2R62A 1NI4A 1VLHA 1EUYA 4LXQA 1U2ZA 1UAGA 5BQ3A 3IODA 2YINC 3FDJA 2NW6A 4FLEA 3X43A 4NCXA 2D2VA 4ALKA 4BJ5A 2Z6VA 3T1TA 2L2QA 1T2EA 1XCMA 2OGTA 3EG5A 4Q7JB 1YR7A 1PJBA 1Y6RA 4FW9A 2IUFA 3G7UA 4KUEA 3VRHA 5DNCA 1XK7A 2D5BA 3PZRA 2QF7A 3PK0A 4KO8A 2VZ8A 1AXRA 1JRLA 4HWKA 5TF0A 3Q8XB 1JHVA 2YQZA 3BWVA 3PSHA 2PPVA 5I7FA 2UUOA 4EG5A 1EAYA 4BUCA 1Y63A 4AG6A 1VCHA 2R1UA 3QU5A 8MHTA 5DYNA 1ZGBA 3SICE 1JYSA 1HWYA 3ZS9A 3AUJB 4LYEA 2NVOA 3PE3A 3U5TA 3AVYA 3PS9A 5C1OA 4PNPA 1DKRA 2QLLA 2BUAA 1KZ6A 2C77A 1JLHA 4RLHA 1A7KA 3LLMA 3NHBA 3R5SA 2PX0A 3IOMA 2PVPA 1VB5A 4S12A 5F1PA 3NASA 1T43A 1SIBE 2O0MA 1K6JA 3LZDA 3OMLA 4QLBA 1AN9A 1JT2A 1E1RA 2R1ZA 5A3VA 5FH9A 1UKVY 1ISMA 1E2NA 2OSVA 4RVGA 2AUMA 4YXWD 1AQ6A 3GELA 3EIUA 4NLLA 2J59A 4IJMA 5H5JA 4GNRA 1IQRA 4V0ME 1GRNA 1YZTA 3GJ5A 2HQBA 4OEHA 4PCAA 4FCCA 3ANNA 4RFLA 3MJ4A 3IOYA 3SBOA 1Q1EA 4ROSA 4UXJA 3VO2A 5F76A 1NQOA 3SDZA 1MTOA 5FP0A 1WAMA 1ZIYA 3NWPA 4Q00A 4YH1A 1XDWA 3WP0A 3CUTA 4MGEA 5EWLB 4CCYA 4KRYA 4RTSA 1GGNA 3I58A 3P2YA 1JIXA 2CZGA 4G85A 3R76A 1J0EA 1KO5A 1OXMA 3OETA 4JB8A 1J1UA 3LH5A 4O3MA 1PZNA 1D2AA 5CG1A 4LQDA 3UG7A 3QFCA 3O4FA 4W5RA 2W48A 4HRXA 2DFTA 2FYTA 4CFYA 1O9GA 4AMBA 1N1GA 4ENPA 4MQUA 4CM4A 3JATB 4D1YA 2CL7X 3JD0A 2COKA 1BKSB 3N8KA 4JR2A 1DBWA 4TN5A 1Z4OA 4PQEA 2DC1A 5SZIA 3RQIA 2WZBA 1VMKA 4K1LA 2I76A 5KSYA 1N25A 2CWDA 3PXEA 2IOFK 1MQSA 2CVFA 4RLQA 5DGHA 5JLAA 2V45A 1CXZA 2E4UA 4JLSA 4N41A 4N0MA 5IVDA 1W4AA 3AM5A 3EDRA 1PGPA 4W7IA 1R37A 2BRUA 1AGNA 2G67A 1D4FA 2I67A 3FNQA 3KVNA 1NVMB 3WICA 3WZMA 4CIDA 2FEMA 4IJWA 5JSYA 1GA4A 3ZEAA 4N5DA 2G72A 5KJ1A 1X1EA 3OPQA 3T0GA 5EWMB 4LMAA 1FFEA 3O8DA 5LMCA 1QLJA 3ROQA 3QUCA 3FI0A 2D8MA 5FTKA 1C3EA 2PSSA 3I04A 5LJIA 3D6VA 5HQTA 3UJHA 1JDVA 1BSVA 5JSZA 1G2IA 1Q0SA 1WMDA 2BDTA 2E87A 3GZTB 4FYIA 4MW6A 2H06A 4FDLA 2IX9A 3D3QA 1FP7A 1J2RA 3DF9A 4NPCA 5IDXA 3L41A 3RRNA 1WP4A 4Y2TA 5AVRA 4DDTA 3LHDA 4JENA 2A57A 3H4TA 3HFJA 4CKCA 4F12A 3KPJA 4DDHA 1L7DA 1S96A 4PLTA 1J9ZA 4GI3A 1AKEA 1KF0A 2GN9A 4UNSA 5K8TA 4MPDA 4X7RA 5DGXA 5CB8A 1DKQA 2ICAA 4R1LA 5CNKA 3TE7A 4JI3B 3A3YA 1GR1A 4YWJA 5AW0A 2ZRFA 5EQJB 2DPYA 3CUYA 2D06A 4JX8A 1IJFA 1R4AA 1R16A 1C2TA 3QE2A 3P7MA 4PS0A 5IFKA 1S3IA 1N8KA 2WZQA 3H11A 4DF3A 4RSGA 3UK2A 5EGNA 1YBAA 4Q3KA 1V8FA 3CJTA 3R7WB 4AP9A 3ZHCA 3WLFA 4ZIRA 2PWBA 3FYSA 3GMSA 3PRJA 2GBPA 4Q47A 4GWLA 4PFSA 4HDNA 1HG1A 1YR3A 2X1MA 3KJNA 2VQSA 3C6QA 4JL8A 2FSHA 2II6A 1X70A 1GZSA 2A6PA 4KC0A 2Z5FA 1G16A 1ORRA 4MUGA 4DJ5X 1JG7A 1N3BA 1QGDA 1SOMA 2X4GA 4EATA 1K5GA 5B64A 2NMVA 3BXZA 3NFYA 1EGHA 4B35A 4D80A 3E9ZA 4EMUA 1XAGA 5B6IA 5LQKA 1BCRA 4XSVA 3E0XA 1P81A 3R8CA 1OW3B 1WMEA 1FNBA 2VAVA 2OA0A 4B0PA 4RTMA 3P0JA 1PTKA 2O1WA 5EXEA 4PNEA 3THYB 2C5LA 4U7TB 4ZVPA 3L1UA 1I6KA 3CEMA 3ZI4A 3F5MA 5F1YA 3JWGA 4XPIA 2H18A 4HNHA 3OCWA 3C7AA 4MJLA 1WMFA 1IU9A 1SCIA 2I5PO 3KQUA 3SI7A 2JGKA 2QGZA 1XV5A 5LP6F 3KYDA 3A8TA 1YGPA 2YY6A 4D0RA 5CA1B 3V9PA 3F7NA 3E9DA 3ADOA 3Q9UA 3DAFA 1JR2A 2EJUA 2GJ8A 4KJXA 4MUFA 4B8YA 2GRAA 3CLVA 4OXRA 3K2BA 2C5EA 1TW3A 1GDTA 1U8ZA 4CL8A 4OXQA 3IIKA 1XTKA 3AH8A 1FU7A 3K9GA 3GGPA 1CQIB 1WXIA 4MGHA 3UTCA 2ZBRA 1QS0A 5D6NA 1MA3A 1LNSA 3G85A 4G65A 4MVJG 5G4LA 4YPFA 1F0PA 2VP9A 1LWNA 4AX8A 4DXHA 2POQX 1A8SA 3BEOA 4MV6A 2YV1A 1WWKA 3OQ1A 5IT0A 1ZBDA 3JYNA 2O48X 1BHO1 2F4NA 2KYRA 3TVTA 4P54A 1KKMA 3W8RA 3WGIA 4JP1A 3RTDA 5JXIA 1GUZA 3ZX5A 4XIFA 4YRKA 1XLUA 2GCOA 1JLMA 1SO8A 1D9ZA 2XTAA 2ZQZA 1OE0A 3NTLA 1GEGA 2G9QA 2XB8A 4AZ3B 1E2JA 4FP9A 2VEOA 3EIHA 4RQUA 4HCJA 1BA3A 2OHOA 2SKCA 1M1YA 2V7UA 4HN9A 4I7EA 1SRQA 4MYTA 1VMIA 1CQWA 3UB2A 4FONA 4WOCA 1EX7A 2P4EA 4E7OA 3QVTA 3LQFA 1J2JA 1XQXA 4CIAA 1NUHA 4DDKA 1EDOA 4OXIA 1CUVA 1PHRA 3II6X 4GOMD 4UJ5A 1KEPA 4KR9A 5IT9A 1JLRA 4W9MC 1TQ4A 4DUPA 3HZOA 1ZVMA 1KY4A 1O96B 2AFHE 2NPFA 1NNEA 2O0JA 1V9CA 1YRAA 3GMDA 3PLRA 4FE7A 4QOJA 1QPZA 3FFXA 5HRCA 3D3WA 1MRZA 1FQWA 2VK8A 3GLRA 5JAOA 3OOYA 4RV5A 4EPRA 3EEOA 4FHCA 2VJDA 4EDHA 1M8JA 2YNMD 3GNTA 3UENA 3VMMA 2OHFA 3M0EA 1YS4A 2YVAA 4O2RA 5EZSA 3LXXA 4X62B 3OQNA 3QXHA 4AF8A 2E37A 1YZUA 4ETIA 3A0UA 1CFZA 4KMRA 4GYYA 4CHGA 2O59A 2YNMC 4HB3A 5HZMA 4FOTA 2P9TA 2AVDA 2QPLA 1ODCA 2HNKA 1ML4A 3TNJA 1V39A 3TKAA 1M5UA 3W4IA 4PBTA 4RA6B 1C30A 2AC4A 4MUBA 2N42A 4KKVA 4NX2A 1S3SA 3G2HA 5DK4A 1ECCA 2QORA 2Y9MB 3KXPA 2JIZD 5K3FB 1FDOA 3PUKA 3SMQA 1C1DA 4MROA 1BXGB 3CF4A 5IM4A 3GOQA 1ZSVA 4BBZA 1ZESA 4ZYUA 3NHUA 1PNRA 3CR7A 4RNCA 1A1VA 3I4FA 1Q0UA 1J33A 3JTEA 4MTCA 5HUJA 3B8HA 1LK7A 2R2AA 2MDTA 3CHYA 2AJ8A 3ZHBA 4IHJF 1TFUA 1Y33E 2QD5A 3SF0A 2O0HA 3K8QA 4M1TA 4OFBA 2WKQA 4F85A 2IP1A 2DLCX 1XLWA 5LIPA 1L5YA 1QVAA 6REQA 3OPYB 2HO5A 2QTNA 1QLHA 1RXVA 2JJMA 3WIOA 3X1JA 3WWYA 1C3LA 1RRPA 2PM8A 4BNFA 4O2AB 3IT2A 4R6XA 3RSSA 5IHXA 4G9GA 4TXMA 3I76A 4DSOA 3AR3A 4O3FA 4YP7A 5FNZA 1I3MA 4ES6A 3VA7A 4AKSA 1RHJA 3RK0A 1EXMA 3IXQA 3GNQA 3U7QB 5DSTA 5B12A 2B7CA 4XI9A 4ZXFA 4JC4A 2DE0X 4UASA 1YZQA 3ZCVA 3UK1A 3GFBA 1M8KA 3CU5A 4XDZA 5A4KA 1H85A 3S2YA 8OHMA 4L8WB 3SMVA 3FHCB 4PQRA 3OLVA 3DC2A 4EITA 3LMKA 3C3BA 1Z22A 2B3TA 2BONA 5H59A 5JC8A 1F12A 4MR7A 4MVJM 1EWYA 1C5KA 2CFTA 2Q3FA 2Z56A 4U02A 4LJ9A 4Q37A 4XDGA 3T7KA 4YCMA 4E3WA 5LL6P 2I2FA 3NHAA 1P3DA 4P8RA 4CFZA 2FU5C 2XW6A 3NIWA 4K05A 4OUDA 1O8CA 1QVWA 2G0TA 4K40A 2YYYA 4GVLA 2HK7A 2PY6A 5KKAA 1J8VA 2AOTA 2J1LA 4JZKA 3STVA 3ICVA 2CZQA 4H2DA 2HA0A 5AKEA 5HG0A 1E7SA 3GEDA 3HA2A 5KNBH 1FDUA 3H5RA 4GOJA 3G9QA 3N2GA 3IVCA 3KHTA 4TTIA 1Y9JA 2C8KA 4X7MA 5DHPA 4RAOA 4Y0NA 4CRWB 5BOSB 2ZB2A 3MHTA 4CT0A 1FZTA 3WYAA 5MN4A 1BWRA 4G4JA 2PZBA 1NBWB 4Y9TA 5AM1A 2B20A 2FWNA 4HUJA 2Y1CA 3T38A 3C3KA 2YV4A 3HLTA 3MK31 4J16A 4FGWA 4QPCA 4JI6B 3QX3A 4C22A 2I4TA 2F43B 3LSTA 1RQPA 2I7DA 1J06A 1JEYB 3I9LA 3MXTA 1NDUA 3HC7A 4F9FA 3CE9A 4MGYR 1TLTA 2ZYDA 4LXYA 3ANXA 3ZVNA 4Z7QB 1B00A 5FA8A 2N3ZA 3GWGA 2VDPB 1KDOA 3BFVA 3OQBA 3N74A 2BY4A 4FYMA 2IUYA 1P6UA 2ZWMA 3L2OB 2QTVB 1OHHD 3BIWA 4FT4A 2UAGA 4E5DA 3MD0A 4YJ3B 4PYLA 2DHDA 1T3ZA 2HNAA 2RGRA 2ZS9A 1M67A 1YA8A 2ASVA 4HEHA 4HWSA 2GPTA 5I3ZA 4RJKA 2G4CA 3EIOA 4YA6A 3E3LA 1N3LA 3QF7A 4KMSA 4LOKA 3RVOA 5J4YA 2EBHX 4MA4A 2GZSA 3WGMA 3W5DA 4IVPA 2I3DA 2IEAA 1N2IA 3DMGA 4H0FA 3HU2A 4EARA 1Y4UA 3CEHA 3WYNA 3HP1A 1NOIA 1J90A 1SU6A 2M6KA 3X1ZA 3GLIB 4OATA 5GM1A 5KIAA 4TV9B 5FTWA 2WV9A 3VH2A 2WWYA 4B4WA 3TW4A 1GU7A 2QD3A 1FJXA 3GCDA 4EOGA 1YL6A 2VJOA 3CR3C 5IJZA 1TEXA 2AOVA 3PYXA 3TJRA 4DE5A 5IKMA 5LLTA 1O4WA 4Z1MA 5IHPA 1XRNA 3HUUA 2V7VA 4HADA 3DMFA 4IICA 3DFKA 4Z7JA 2FZ4A 1FXSA 1LVUA 1Q7RA 4Q03A 5CURA 1JI0A 5F7JA 5AVSA 2HRCA 1U0BB 4JEMA 2PKRA 4CM5A 4ZJPA 3PHBE 3QJ5A 2R84A 1JNYA 1P62B 2YWRA 3G5AA 1QIFA 5A9SB 3V1UA 2EATA 2O7SA 4KAJA 5FOWA 5KOYA 3QYJA 5DPMA 3I8SA 2Y1EA 5IJ0A 3MWJA 2OE2A 2E3JA 1CUDA 1CDDA 4KPGA 4BVKA 1JZQA 3G79A 2E5FA 3QG5A 1EA7A 1SVUA 4LJ4A 1FMFA 2CNWA 2O8NA 1MVNA 2RBGA 4MV9A 1ECFA 3UMJA 1BCSB 1D1SA 4BBJA 5BV1A 4QHSA 5DBEX 3Q8WA 4I5FA 4E88A 4EKGA 3GT7A 4DCPA 1DWUA 2ZBVA 4YQYA 1P5HA 5KDOA 4LF7B 1EZZA 1O89A 1TM7E 3GCXA 1OBFO 2FX3A 2XNDD 3A0RB 3E48A 3BWMA 1ZDMA 1WB9A 2IUSA 1EUZA 1WW2A 1KZ7B 2LIPA 3ENVA 1GGFA 3Q11A 2H9AA 4XVHA 4BMSA 4FM9A 1PL0A 2H0AA 3L8FA 4GQAA 2PBRA 1DS6A 5L3QA 2C83A 4MYSA 3R77A 1RRVA 2C5GA 3KXKA 3GAFA 3HI4A 2FRXA 2GSDA 4X41A 3LZ6A 4L8LA 4P7KA 3KL2A 4E33A 1HYHA 3AUFA 4EG4A 5JZOA 2Q5FA 2IY7A 3ENQA 4FS8A 1Y89A 1DELA 3D4BA 3C4JA 2HT6A 3IEPA 3QI2A 1QE0A 1W87A 4OIFA 4ZQGA 5EC8A 1CS4C 2R6AA 3RV3A 4A7PA 3F6BX 2ZFUA 3KUCA 5IVKA 2F8SA 1GRQA 3UA3A 1RXYA 2P11A 3CZQA 4YP9A 1WY5A 1J97A 1PR1A 1XNGA 2EJWA 4LI0A 2XOKA 5AI5A 2YWXA 5JJKA 4G4IA 3CUSA 1E98A 2FWMX 2I1LA 3GR6A 4YQEA 2W0SA 3R0XA 1WY7A 5BY2A 2VHYA 2R8XA 4B32A 2QMUA 3MA0A 3K0EA 1LJLA 3FPSA 4FHFA 4ERNA 3P0FA 4EB6A 2IBSA 2JGLA 2WKWA 2CV2A 1YFZA 3C3DA 3MCTA 3NHYA 4D9JA 4A73A 3VR3A 3QVLA 5KTTA 2YHIB 1CU1A 2A5GA 5EJMA 1OA0A 1U7WA 4ND5A 1P2TA 4YS6A 1Z7WA 1KAEA 3WBFA 4W5NA 3FM9A 1Q0LA 3ETCA 3P0IA 1D1QA 4XFKA 5D3KA 4I4NA 1QJCA 3BIJA 3FFBA 3ZHTA 3O3NB 4HRVA 4H16A 3MQ2A 1RWVA 5KDDA 1BWQA 1I5EA 4B3HA 4LZLA 3P20A 2PEYA 4QJIA 2OOKA 2VSFA 3OWOA 2IXEA 4CM1A 2H7CA 2H2AA 1KI1A 1Z16A 2WU3A 1DEAA 4R9RA 1KDYA 4IVQA 3IUSA 5BWBA 1UDRA 5K8CA 1H93A 1Z75A 1C3OB 2ON6A 4ZI3A 1MV5A 1LLUA 1LC3A 2I8LA 1ZNQO 2IXFA 1BXZA 2R65A 1UDWA 2XY4A 3CKYA 1O9HA 1FYFA 1RYEA 1RAEA 3B9PA 3MMSA 2ZUEA 3COSA 1RPTA 3HN6A 4I5EA 4XJTA 4DY4A 2XNKA 2YICA 4RH0A 3STWA 3GLFA 2PQ2A 2Y1GA 1QPBA 3OC6A 4JJEA 3AG5A 2P9HA 4LZAA 3FKSA 3TDNA 1D0SA 2VP2A 3SFTA 4AJOA 1T5DX 3G13A 4DEVA 2TRSB 3WVNA