4TMYA

Chey from thermotoga maritima (mg-iv)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
118
structure length
118
Chain Sequence
GKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEY PROTEIN
publication title Crystal structures of CheY from Thermotoga maritima do not support conventional explanations for the structural basis of enhanced thermostability.
pubmed rcsb
source organism Thermotoga maritima
molecule tags Chemotaxis
total genus 39
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4tmyA00
1DRKA 3Q41A 3R0JA 3F6CA 2HQBA 3HDGA 3O2SB 1PNRA 3BBLA 4E7PA 3HXMA 1USKA 3LTEA 1OXKB 4FB4A 1NXPA 4RK4A 1YS6A 1D2AA 4Z4FA 3H6GA 1NXXA 1DJMA 4H3HB 1RZRA 4KK4A 2HQOA 1D5WA 1QNLA 1P6UA 1PHRA 2IPNA 2ZAYA 3LUKA 3ROFA 1QQAA 2FEKA 2QSJA 2MSLA 5EWJB 2RGYA 2LP4Y 2A9QA 5ED4A 4LRQA 4G0YA 1JHZA 1MB0A 3M9XA 8ABPA 1QO0A 1JBEA 1M2EA 2FQWA 1T34A 2NZUG 4IF4A 2IPAB 5D2CA 3SY8A 3L6UA 3I09A 3LOPA 4WXMA 4F11A 1M5UA 5HSGA 4XARA 3RH0A 1DC8A 3H1GA 3MF4A 3OM1A 1QPZA 4M88A 3A0RB 2L19A 3LUHA 4N0QA 4MYRA 1EFAA 2CHEA 1W9HA 3N0WA 1JYFA 4EVSA 2PAFA 1DRJA 4XASA 1P8AA 5FWYB 4Z99A 3JVIA 5CNJA 2MYPA 3HS3A 3H5OA 4OLAA 4IILA 4MR7A 5EWMB 2B1JA 3CU5A 3KSMA 2YHAA 3O1IC 3GBPA 3NNSA 4G0PA 1JFVA 5JNSA 4FE4A 4MLCA 1QMPA 3UKJA 3GBVA 4OATA 3QEMA 1RXEA 1NXTA 2IPMA 4S04A 3W9SA 4HNSA 1ZY2A 1ZH2A 3GWGA 4H60A 1F4VA 2E4XA 3CZCA 3QELB 2MSKA 1NXOA 3H5IA 3KHTA 2VUIB 2FVYA 2V0NA 4RY9A 3EODA 1BDJA 1SXIA 4IRXA 3B2NA 3HCWA 1DZ3A 4EYOA 5HKOA 3OO1A 5TQ2B 2IDMA 2CHFA 3GV0A 3HK2A 5DTEA 4Q7EA 1VKRA 5DCLA 2CD7A 3DGFC 4DQDA 3RVOA 5EWLB 1JDNA 1OXBB 4LX8A 4IMJB 1JH9A 3RQIA 1JX6A 4JOQA 3IPAA 4EVQA 5IEJA 1DBQA 2L17A 2X7XA 1TVMA 4KNYA 1YMUA 1LBHA 2MSWA 3K9CA 4MS3B 1C4WA 5JNUA 4PEVA 4XLTA 4Z0NA 3O1HB 1PEAA 1XWWA 5TPWA 5FWXB 2FXIA 1EHCA 4MQEA 1VPWA 2HJ9A 3M9WA 4MS4B 5BRJA 4LZLA 4RKQA 3RVJA 4MR9B 2FMKA 3HJFA 1AB5A 1ABFA 3KKEA 4D6YA 1FFSA 3N53A 3QEKA 1LK0A 2JVIA 4KREA 2PUBA 3OM0A 1XHEA 2AYXA 4Q6WA 1Z13A 3F6PA 2F8SA 2E4UA 1NATA 1PNTA 1RNLA 2FN8A 2KYRA 1GCAA 3FDFA 1JDPA 3JPWA 1DC7A 5KC9A 3EJWA 4Z4IA 4GNRA 4ML3A 3Q9SA 3N6VA 2JBAA 1PEYA 1ISRA 1SRRA 4MRMB 5JNTA 3MQ4A 3FMVA 1NXVA 3NNNA 2JVJA 5CNIA 4KV7A 1SXHA 4HNQA 4RWEA 3LUJA 3KLNA 4QICA 1BDHA 2GKGA 2QU7A 4OLBA 1JLKA 1KGSA 4Z4GA 1U0SY 1Z2DA 1QP0A 4KPYA 2E4YA 4JB2A 1L5YA 1ZAYA 3CG4A 5BQ3A 2P4UA 5EWJA 4ZJPA 1Z25A 2FN9A 2NT4A 5KQLA 4G97A 1DP4A 1JFTA 5IUKC 4JA2A 2QVCA 5KI6A 3QX9A 1GUDA 3LKBA 5TQ0A 2J48A 1YMVA 4O5AA 1BVHA 5TPZA 3HO1A 4KQ9A 4YS6A 3O74A 3HEBA 3KLOA 3HVRA 5KWSA 1P2FA 1TM2A 2TMYA 3KYJB 3C6QA 2HQRA 2GBPA 5KQMA 4RK1A 1Z16A 4EVRA 1U04A 4MS1B 3LUGA 2WY2D 1GCGA 3N75A 4KK3A 2FMIA 3ROTA 2JB9A 4HYEA 2FEWB 3HDVA 3Q7RA 5TE9A 2PUGA 3LKVA 4UHJA 1EWTA 3IPCA 2IYNA 1K66A 3SNKA 5FWYA 2DRIA 4LDZA 9ABPA 4RK7A 4ETMA 5C5EA 2FQYA 1DBWA 4ZYLA 4DADA 2PUDA 4F8JA 5EWMA 3SQNA 3EULA 3H1EA 3FFWA 3GA5A 4YRZA 5DKFA 3L49A 3JPYA 2WJWA 4MR8B 1GUBA 5CNMA 2M98A 3QLUA 4RY0A 3TX6A 2B4AA 1YTUA 1S8NA 4JASB 3HUTA 1ZN2A 4P1ZA 1USGA 4TLMB 1H9CA 3H5WA 2IKSA 3HZHA 3QELA 3CTPA 3QX8A 4LE0A 3N0XA 3KCNA 2PKXA 1D1QA 2JCGA 4WWHA 5TQ2A 3OMWA 3OQMA 4TN5A 2LPMA 3LMKA 3OQOA 3FGZA 2PLNA 4W5NA 3IP9A 3NHZA 3QLUC 4NQRA 4RY8A 1ZH4A 4XFKA 3O75A 5EWLA 4XAQA 1TJYA 1ZITA 3IP5A 4WZZA 4XXHA 2PMCA 1F51E 4MS3A 1FQWA 5FWXA 2FTKE 4G0XA 2XDYA 3ILHA 4Z4HA 4RK6A 1ZHHA 4MQFB 4MS4A 3HSYA 3DZDA 3OLZA 1BAPA 2HSGA 4MR9A 3VNBA 4ETNA 1XHFA 3C3KA 4F06A 1WETA 3BRSA 1DCFA 4MLDA 3H5TA 2IPLA 1ABEA 2FSPA 4KZKA 4L85A 1Y1LA 2I6FA 2RJNA 4FE7A 3OLXA 3NBMA 2A9RA 2AYZA 1USIA 1FFWA 2PUAA 2PE5A 4JB0A 5T3YA 2WRZA 1NXSA 3G1WA 4ZMRA 5JS2A 4RS3A 4YR7A 2PUFA 4KRFA 3T6KA 2LBPA 1LBIA 2MYNA 3F7NA 1EAYA 5IULC 1QP7A 4RXMA 2FMFA 3EQZA 3CNBA 1TMYA 4N41A 1SXGA 3T8YA 2FLKA 3LUFA 3C3MA 3T38A 1ISSA 4EY3A 1C0EA 3NHMA 3GL9A 1YIOA 3GRCA 3UUGA 5T7BA 3BREA 2QVGA 3BILA 1LJLA 1P6QA 1MIHA 3EGCA 4KMRA 2QW1A 3LUCA 4S05A 3Q7TA 4LE2A 3JTEA 2GWRA 3S99A 1Z17A 3GT7A 2R48A 3H5LA 3KJXA 3SG0A 3RVMA 1YS7A 1ZVVA 3RVLA 6ABPA 3CS3A 3IDOA 3CHYA 3QK7A 3EQ2A 4P98A 4W5OA 4KQCA 3D8UA 1JWLA 1Z26A 4EYQA 4RKRA 4F3TA 3A0UA 3M6MD 5DGCA 1CEYA 1EWKA 2FQXA 2FW0A 4JP1A 1QQBA 1BDIA 4IMIB 3CLKA 3LUDA 3E3MA 4LE1A 4MAAA 4N0PA 5CNKA 4ZPJA 1E2BA 4O1IA 1Z12A 5JNRA 1A04A 4MS1A 3HUUA 3DBIA 3JY6A 1D1PA 1MAVA 5IC5A 5HQJA 5JS1A 4NCBA 4KVFA 5IBQA 5IUNC 1J56A 4D6XA 1E6KA 2PUCA 3EAFA 2VK2A 4MR8A 5DLEA 3K4HA 1MB3A 4PICA 5IEBA 4YV7A 1YVUA 3A10A 4YO7A 1AB6A 2A9PA 1U2PA 4G0ZA 5IUJC 1W25A 3A3KA 3IP6A 1NY5A 3CFYA 5B3JA 4NCAA 2ID7A 3DGEC 2MYTA 1K68A 2BGGA 4RK5A 4YP9A 2QZJA 3O2JA 3KS9A 4OG2A 3JVDA 1VLZA 3KYIB 3O2QB 1KMIY 5KQGA 2WB4A 3H5VA 2R25B 1HEYA 3GYBA 1URPA 2GX6A 3KTOA 2RJOA 5B3JC 2FLWA 3LUAA 1JYEA 4RK0A 4Z9AA 1DG9A 3HV2A 4YWHA 4MGEA 4WUTA 1QP4A 4YLEA 1Z15A 1DCMA 1M5TA 3MMNA 3I42A 5CHYA 4QPJC 2E4ZA 2FEPA 2OENG 2Q5CA 3IP7A 4H3KB 3VNAA 4YCSA 3MM4A 3SAJA 1E6LA 4Y9TA 5TQ0B 2H0AA 3CRNA 4TMYA 1QKKA 3HM9A 3C3WA 2PUEA 3T95A 5GOTA 5HM6A 3KG2A 5KC8A 2ID9A 4W5TA 1RXIA 1E6MA 2VYCA 4EYKA 2JRLA 2F8TA 1MVOA 4PYRA 4N47A 1TLFA 3BRQA 3TB6A 2WWVD 7ABPA 3JS5A 2ZWMA 4MQFA 2VUHB 3DLBA 5F64A 2R47A 2GI4A 2L18A 3ILYA 3RVRA 5KQPA 1KRXA 3N0RA 3QLVA 2QXYA 4EGSA 3MA0A 1U8TA 2OQRA 4NICA 3C97A 3UK0A 2JK1A 5FBKA 3OLYA 5GQSA 4WXEA 4L4UA 1JF8A 1JL3A 2E4VA 1BA2A 4ZMSA 3SM9A 5IX8A 1CHNA 4NV3A 1D4ZA 2L2QA 1A0OA 3N8IA 3QLVC 4RDCA 2E4WA 3H75A 1NXWA 2QR3A 4G0OA 3TO5A 1DCKA 4GPAA 3CKMA 1YK0A 2N9UA 1EWVA 1RPJA 2M1ZA 1UDRA 3OLVA 4DN6A 5PNTA 5I4CA 3URMA 4G0QA 4MR7B 5BRAA 4RV5A 3TD9A 3F73A 2FMHA 4W5QA 3O21A 2RDMA 2MYUA 4Q6BA 3CG0A 4EYGA 3O1JC 4MRMA 2H3HA 4N76A 1Z18A 1DBPA 4Z4EA 3QEMB 3FFXA 2WJAA 4E7OA 4F12A 4Z9BA 3TMYA 2IOYA 2FKAA 1ZESA 1FSPA 2CWDA 1APBA 3E61A 3FFTA 2P9HA 3Q15C 3QLTA 2W42A 5BR1A 4G0MA 1CYEA 1YK1A 3MIZA 5C5CA 1M2FA 4QYMA 3RVQA 2LUOA 4ETIA 2R4QA 1B00A 2NT3A 2JVKA 2QV0A 5E3JA 6CHYA 1IIBA 4LDAA 4O1HA 2NUBA 2LIVA 3RVSA 4PE5B 2PL1A 1A2OA 4OTZA 1ZDMA 4G86A 5TPZD 3RVPA 3D02A 4TLLB 1I3CA 4MPTA 4QYWA 2YHBA 4CBVA 5JNWA 1L5ZA 1LJUA 4YGXB 3RVNA 3EDCA 1RZRD 4KFCA 3CZ5A 2WMYA 2HPHA 1SD5A 3H1FA 3OLWA 5TPWB 5ABPA 2A9OA 4MQEB 4RU1A 2PL9A 4HNRA 4EUKA 3OMXA 3LFTA 4IGAA 3OQNA 1R8JA 4RXTA 5JNVA 1QO0D 1Z2EA 3OO0A 4PZ0A 4WT7A 1FFGA 1U2QA 1VRVA 3I5AA 3Q7SA 1ZGGA 5TQJA 3DLHA 4Z4CA 4RZSA 1JFSA 4N03A 4UHKA 2PJUA 2O20A 3H6HA 3G85A 3NNDA 3P9YA 4RSMA 5FBHA 1NTRA 4OBBA 1GLGA 3I45A 3MYYA 1PUXA 4RXUA 4D74A 1ZGZA 4B09A 3RVKA 4W5RA 4JAVC 2JBAB 2NZVG 1KRWA
chains in the Genus database with same CATH superfamily
3CONA 3Q41A 4IIGA 3DE5X 3CISA 3ZYZA 1J0AA 1NBMD 2ZJBA 3R4CA 4KMMA 3B1JA 4CETA 3TZEA 2IDKA 4PRKA 3ISTA 2ZXUA 2Q46A 4XPIB 3A9SA 1U9IC 1X0VA 2YVLA 3NDPA 3G9XA 4LYDA 4YACA 5IZCC 2QVZX 3U6KA 3QKRA 5GJBA 3PC6A 4F5YA 4DG9A 3BFVA 1YR2A 2WIGA 4FWIB 4RKYA 2G1PA 4DR4B 1PHRA 3LUKA 3VGPA 2HA3A 4LC0A 2W2TA 2A30A 5H0IA 3V34A 5EWJB 3FHTA 2B4TO 2PQ2A 1YR1A 4L4ZA 1QS0B 1TIPA 3ZHXA 4CTNA 1N3IA 4OREX 4YI3A 1C29B 2YIMA 4P4LA 5KSWB 3LD9A 2XUFA 3PNLA 3RASA 1U3FA 2DWPA 2ZQ5A 3QFHA 4O4IF 4J16A 1JJVA 2PIDA 1HYBA 1NUHA 4MMZB 1RWKA 1XA4A 3W8DA 2O8EA 1TX4B 3I09A 4IHQA 4LNUB 1ACJA 1QHXA 3H04A 3QIVA 5CJJA 2FMXA 5AVSA 1M8GA 4O2BB 1J2YA 3MWJA 1IN4A 3CX7A 1ZN7A 3U62A 1H8HD 1GNTA 1BA3A 4RVNA 2L19A 1HNNA 3K70B 2WILA 1EFAA 4NBLA 5EUQB 4EVSA 3K73O 4INPA 4XH9B 3IE2A 1IK4A 1Q0PA 1UJ4A 2Y0PA 3ELYA 5DK6A 3UWMA 3KT3A 4JVNA 4RLHA 2XT9A 2ACEA 1XOIA 3CRMA 5KJCA 2C2OA 1A95A 2X4LA 3AL3A 3TLKA 1YJ5A 5FI5A 1N32B 1RQPA 2JIPA 3SK0A 3KTFA 3ASYA 1HTWA 2OL4A 5BPFA 4HY3A 5I45A 4ARVA 1T8PA 4XYEA 2C2WA 1X13A 4IIBA 4E46A 8OHMA 4BVGA 4BQIA 1UPBA 5CPBA 1UFOA 1QGYA 4GI5A 1H5UA 4KH0A 2HI0A 4QHSA 1NMEA 3EPRA 1KZHA 4ZYXA 2FDRA 2WQ7A 2P27A 2I67A 3VHXA 4Y0AA 4MVJF 1T13A 1XLTC 5KTKA 5EHQA 1EZ4A 3GGPA 1NQ5A 4DF3A 4H4EA 4OL9A 5REQA 1EAMA 1NXOA 2RGBA 4QU0A 3V6LA 3P27A 5JANA 4IRXA 3F3SA 4PGGA 2SKCA 2NQ2C 1DG3A 2GBLC 1VHWA 3DMYA 4FGLA 3QHQA 1C0PA 2Q3BA 4ILKA 4PAQA 3WLIA 4ZDJA 2H1SA 4BLOA 4HWSA 3REFA 3UJ9A 1COWA 2BMWA 2H2FA 4BFLA 3I64A 2DWOA 5CBKA 2BR5A 2D1TA 1PK8A 2J9RA 5C4MA 1OX5A 3RVOA 1ORDA 3SLRA 2B8TA 3W8EA 4JENA 3K9GA 1GHTA 4DSZA 5JT1A 5EIEA 2B1GA 1R5BA 3PFIA 1YMUA 3VU9A 3R2JA 1V5EA 4NV0A 3ZWAA 5EJ9A 1YF3A 1TQ2A 2R6JA 3EUEA 4BO3A 1AZLA 3FPKA 5C7YA 1RQGA 1EHCA 4UBOA 1G2IA 1PTJA 4KI7A 2BTEA 2EG5A 1P75A 1ZMRA 3HU3A 1PJBA 3S3TA 3HP4A 4LYGA 2WU4A 4XDHA 5T3UA 3Q1LA 2BJVA 2CK3D 3HJGA 2YCBA 2P6MA 5F9MA 1Q95A 2YWEA 3G5MA 1IZ8A 5I7VA 1WOMA 2AHOA 4E2FA 3HJUA 1K27A 4RZIA 1V11B 2GJKA 3ETHA 3DOHA 4PZYA 5T4EA 3V3KA 1W1UA 2Y2UA 4OQXA 2HDWA 3I6ZA 3K0FA 4DVJA 2YHIB 1JDPA 1A5SB 1IPEA 1SCJA 1WPQA 1PJCA 2FWAA 3D43A 4FC7A 5CYOA 5AD1A 3DQQA 4DQ0A 1JEQB 4WK4B 1A82A 1K06A 2ZOSA 2M6SA 3THWA 1ISRA 1T36B 1JT9A 1QMGA 1WSBA 2FV8A 4JQOA 5A9SA 1CUUA 2IXBA 1J9ZA 4MUBA 3QM1A 2NZ2A 4L8VA 5ECYA 5EHGA 3UW3A 3MWDA 1RAEA 3DONA 4X6LA 4WIAA 2AOUB 3C8HA 4QICA 5COAA 5AI8A 2FFBA 5BMVF 1GPLA 2JFZA 4Q39A 1CE8A 1ESNA 1CUFA 3I04M 4X8HA 4BWGA 1G2QA 4Z4GA 4BQNA 2XOKD 1SK9A 3TRFA 1T2EA 4JB2A 1ZAKA 5DH9A 1X7WA 3GIDA 1J7KA 1JAIA 2EHDA 2WJVA 2G0NA 3LLVA 1RLTA 2NT4A 3QUBA 4Y2JA 3L02A 3PQCA 3ZJ5A 3U60B 4ZOCA 3DTNA 2IZ6A 1QBKC 4E3WA 3BMOB 4UUMA 1JFTA 2KMLA 2B36A 1U7HA 2WAYA 4NCIA 3ZN2A 4O8ZA 3TOZA 3VSEA 1UP6A 4YIKA 5A5EA 3HO1A 5EVCA 1OASA 1RRVA 3ONFA 2PJRA 4N0MA 3HVRA 2BSQA 3ZDDA 2WJYA 4Q1BA 4UEJA 5KYXA 1CUXA 2GN6A 1EP1B 2TMYA 5GMOA 1KJQA 4YPOA 2YMLA 3ITNA 3I2YX 3T5AA 2CHGA 3AI3A 4NS1A 3CBQA 2JFQA 2OZLA 3OD1A 1O6GA 2GCGA 2JGDA 3M1AA 4LVNA 1WQ4A 1D2MA 4P7JA 3FOFC 3AK4A 4LF5B 2B82A 3AEUB 3IAAA 4RUKA 2XUHA 2YYYA 3AY3A 3QKTA 3AI2A 2CCJA 3IPXA 3TZ6A 5BV8A 3ZJVA 4D4GA 1E0AA 4AZ3B 4JZYA 3T3MB 3AR6A 1O9GA 2F55A 3IUPA 2GVZC 3V7YA 4Z51A 4YBRA 5AQ1A 1C1XB 1I1OA 4D46A 3P2JA 3I1FA 1G59A 5BQPA 3FPEA 5C46F 1XNHA 2A86A 5C51B 4H7JA 5KJFA 4KE9A 1DOZA 5TMEA 3JPYA 2CMHA 4TTTS 2IEGA 1ESDA 2FI1A 1AF7A 1NA5A 2ZDGA 4Y2HA 5TRTA 1EIWA 4F4FA 3RC7A 1KWGA 1SG6A 1LTQA 3HY3A 3WWDA 4O4IA 1SKYB 1H9CA 2ZRIA 4LG1A 3KZMA 4LCEA 1YS1X 4AF7A 3JR7A 4EDFA 1T3HA 4D0RA 3R3YA 5ALVA 5LQJA 3WZ2A 3DC7A 5IXSA 3Q4GA 1KEEB 3R5FA 3OMWA 4IZHA 1RYEA 5A4KA 4QQKA 2BMEA 3PD1A 4MVCA 3LK6A 1F5SA 2GYWA 3GLFE 1Y48E 3NHZA 3WGQA 3X1XA 5J1SB 1L6RA 4J2OA 4WNAB 3PDHA 5K2MA 2Z6VA 3RUDA 3USZA 1TJYA 2FW6A 1LLUA 1SM4A 4N18A 3GJRA 4U00A 2C9YA 3INGA 1MN6A 2IUTA 1Q57A 2R1VB 4BNWA 2DFKB 1GZ3A 3GC6A 5JZVA 2C9BA 4JX9A 1GA1A 2YOGA 5FWXA 1QDUA 1E62A 3A70A 4BMNA 1LBTA 4FXOA 3SEAA 4P5DA 4CG2A 2X5NA 2YC2C 5KKCA 4H9GA 4MARA 3B53X 1Z4LA 1AKNA 2C1EA 4FYPA 1D2RA 5L4NA 3LW7A 3SEZA 3HDHA 2G0AA 3DFKA 3N05A 3RUHA 1N0UA 4LSMA 2FSPA 3W1WA 3UJCA 1BXGB 5HDQA 5FLXA 3TQCA 2IU4A 4NFLA 5JFTA 4J49A 3P2IA 2AYZA 3NMUF 2PMWB 2PUAA 2Q07A 4L6IA 4A0GA 1YS9A 1RU3A 3IHWA 1PL6A 3TYXA 1GPBA 1T0IA 3CLSD 2NAPA 1LFDB 1HQCA 1Q1NA 2O0KA 3N70A 3VVMA 4EI9A 1JA1A 4M8NE 4HVTA 1YA4A 3JZIA 3ASVA 3CNBA 1U98A 1KBZA 2D54A 3V8MA 3IELA 1MX9A 4HDSA 3BZUA 4X6YA 3D4PA 1OTHA 3AF3A 4DIBA 2ZPAA 5HCIA 1UMKA 1HETA 1LVHA 4EJFA 1L5HA 1XQWA 1OFIA 1P5JA 1RHQA 4RLQA 4B6PA 4MRAA 3RYFB 2HHHB 1ZC4A 4MV9A 2PWAA 3KZVA 4JDUA 3H5LA 2IBSA 2I5PO 1RYMA 3H5RA 4BNLA 2R62A 2V9ZA 4FB5A 2P8JA 4LOKA 3IEUA 2PN1A 2QUHA 2YVKA 1NYTA 2G04A 5JJKA 3EN0A 1JTVA 2VK4A 4P32A 1M34A 1YB2A 1MJFA 3G7UA 5GM1A 4MXDA 4B43A 4S0XA 1NDHA 5E7IA 3OCVA 3G0DA 1ZL2A 3CV3A 3TCXB 2E9SA 1JQLB 2G77B 3QBTA 4W7HA 4XUEA 5F98A 2QT9A 1DAIA 1W29A 5JD4A 1E2BA 3UATA 1L1FA 3ZDEA 2R96A 3C6YA 1ORHA 1TVEA 3F8SA 3Q3VA 2JGMA 3ITKA 1WEHA 2HUPA 4RIFA 5AOBA 5FWAA 2F1KA 1E3TA 3VYUB 8AT1A 5JMTA 4Z4QA 3QWHA 3AEQA 3G8DA 4L3WA 3ZZNA 3DBHB 2C5BA 2RCNA 1X14A 2ATVA 3KZOA 4HDOB 3TVDA 3VR6H 1SZDA 3U0VA 1E9RA 5KU1A 1QKIA 4ZARA 2PLRA 3DVQX 1KAGA 2JLCA 4R8SA 4RKFA 4BNYA 1W7AA 1NOIA 2RHMA 1EFLA 3FNQA 2GPNA 1Z4NA 2ZR0A 2ID7A 1S96A 3IKMB 1L5RA 4HDAA 4NAVA 1P5RA 5HK8A 3CCCA 3GUZA 5ILQA 4YEDA 3B6EA 1KJIA 2VDWA 4DCMA 4DAEA 2DPLA 5KKAA 4C2TA 1PS8A 3GU3A 4FCCA 4RABA 2WSSD 1ZXBA 4NX2A 4C7BA 2JANA 4R9SA 5J2TF 1IOZA 4ALIA 1QCYA 1YRBA 3A1CA 3DEJA 3P7MA 1HEYA 4D9HA 1TT7A 1V5IA 1NZJA 2HWXA 1PR9A 2EJCA 2KX7A 3JD0A 5HUQA 3LC2O 2RG7A 1E2QA 4IXTA 4B71A 1JYEA 3FNEA 3BE5A 5B58T 1E6WA 4AJOA 1RD4A 1V3VA 4YLEA 4ZAFA 1LSJA 3OF5A 4M9ZA 3L8CA 2JGFA 3GJ0A 5KZMB 1BJTA 1ENZA 2WFMA 4BNIA 4XVHA 4TTRA 4EPWA 2ZWAA 1Z28A 1PGQA 4PX9A 2C2YA 5KHAA 1ELOA 1T5IA 1YCFA 1QVZA 5AP9A 2YHUA 1REQB 3KEOA 4J0QA 1N0IA 4LPSA 1AA9A 1WABA 3NG1A 4RJIA 4W5TA 4MI6A 4U6NA 2QRZA 1OY1A 4C4XA 1I30A 4Q66C 1TLFA 2WWVD 1HE2A 3IUYA 4WLVA 5FBWB 3C4JA 4MGKR 2J0SA 2B78A 2WSMA 3CT6A 3EJ6A 3JRXA 3F1LA 2QU8A 3UHJA 4YJDA 1CD5A 1SHUX 3QJYA 1FXWF 4EZBA 5LQDA 2XR1A 3FHLA 3QUQA 4PXAA 4ZOAA 4J4BA 2IUUA 2PGLA 4OP1A 3OFJA 4MPJA 3C24A 5I7UA 1GKLA 1GT6A 4V24A 3NM5A 3NWJA 2WTAA 5DX0A 5FFMA 1W93A 2ZREA 1OWNA 3CW8X 2APJA 4G89A 2CXSA 1RPTA 2X19A 3M1YA 4A8HA 1E66A 1KVSA 1OAKA 3MMSA 4KSYA 2A1UA 4LW8A 4R2HA 4R9VA 3TL3A 3ETNA 4GMXA 4NV3A 4XIJA 5DISB 3VV3A 1BVYF 1UXKA 2E4WA 1W5EA 1IY1A 3NBUA 4EUFA 3P20A 1OTXA 1WHSB 2VZ8A 2IWRA 4ENTA 1Q22A 2P6UA 1ONSA 2OXIA 3RS2A 1VIVA 2OTCA 3OA2A 1Q5PA 3DNMA 3S2YA 3CRVA 1Y63A 1SXJA 1YMQA 2EOAA 1QHNA 2QN7A 2ZIFA 1GPMA 3I12A 3BIWA 2QY9A 1OPRA 4Y1RB 5JBIA 5M7EA 1EFCA 1ZOIA 3ZGXA 5HIKA 2WJ4A 5JQGF 2HXSA 2C8JA 2I7VA 3BGWA 3D4NA 4LJ5A 1N0HA 4RD1A 3BCRA 4BKOA 4ZVPA 2XRFA 1MQAA 2FHSA 5HGJA 4GMGA 1GL7A 2REBA 2JJYA 3NJRA 2G9RA 2PUJA 2ZJ5A 4RAOA 5IZ4A 5GIPE 2Q49A 4BO7A 3MZ0A 1TA9A 2QYOA 5FB3A 1L5KA 4MI3A 1QH0A 4ZZIA 2OO7A 1TVKB 1DKQA 4PE5B 2O7SA 1BD3A 2NXJA 4PG8A 2IVZA 3DW3X 2P6PA 4HH1A 5LP6C 4FCTA 1V8PA 4PC1A 1E7YA 1EFRD 1QLWA 2VPQA 5ALLA 5EFZA 3AY0A 3MSXA 4IHJF 4XX0A 3C3PA 4QG3A 1H2FA 1DJNA 1PRYA 2VYVA 3IEIA 5AKYA 4QYTA 4XYLA 3IJ5A 3N59A 1W5SA 3PE6A 3BB1A 1PDVA 1IN1A 2GLXA 4G1VA 4Y1EA 3V8NA 4BO6A 3RGWS 1I3LA 2X42A 4D3ZA 4IGAA 4AJ9A 3OQNA 1NBOA 4HLCA 4QLOA 2DERA 2WTEA 2A78A 1TLLA 2UU9B 1Y8AA 4ID9A 4Q4CA 3JWPA 1DCTA 4WT7A 3M81A 1ONOA 1YL7A 4WKCA 1N0WA 3SVLA 2XMPA 4YMTA 1YDFA 1SEPA 4XD2A 3TNDA 3FTEA 4TRMA 821PA 2COKA 1PQYA 5HG0A 3ZZUA 3P9ZA 1KEPA 5LBUA 3ZQJA 3MYYA 4B6OA 1N6NA 4RXUA 4BC0A 3D6FA 1WE2A 1EK5A 3F74A 2Z30A 5L3SA 4E5SA 5G0TA 4KVGA 4O4LF 3JQ8B 3CZAA 2MR6A 3OT5A 3KAKA 1HK7A 3EVBA 4HGOA 4OIMA 3L0YA 5H82A 1U2DC 1EE1A 4CF7A 2FR8A 1P74A 1VTKA 2ZS9A 3NAZA 4JLNA 3HR8A 5DYWA 1EFPA 4H7KA 1ZIDA 4NHEA 3PT5A 2XWSA 3WS7A 5BUZA 1VHLA 2B6NA 2FZGA 2W0MA 2ID8A 2VHYA 1IZ9A 4ASUA 2ZZKA 3IIKA 4QVIA 1MXHA 2WD7A 4A3SA 2XQFA 4CIXA 1IXSB 1H65A 1VECA 2YL2A 4FYHA 4QQFA 4A0SA 4BZWA 1ISGA 2NO7A 2JAWA 4AJNA 2HOQA 4GRDA 1NBME 3GFOA 4M9SA 5DXFA 1VKOA 2QQEA 1JBEA 4CLOB 1AF4A 1T34A 2V55B 4OXIA 3EVEA 4QULA 3WHIA 1OMOA 3W8NA 3GRFA 1YVDA 1ZH8A 2J08A 5ARCA 3L6UA 5DF1A 1ZM4A 1Z8DA 1E32A 3OZAA 3TNJA 4PR0A 1L3BA 4OYHA 5DV9A 1JHQA 5LA6A 2OECA 1DC8A 3P0IA 4O08A 3F67A 4NENA 1QPZA 2MMGA 3ZY4A 4C0AC 4RDXA 4YUWA 4NLLA 3WLAA 3IVGA 5K8LA 1W9HA 2YWBA 3BOSA 5ICCA 4A6DA 2PAFA 5JYCA 2H1OA 1TQ4A 4JYPA 4AS3A 5ICEA 2C4VA 3H9CA 1Q7RA 3ABZA 1SBZA 5EXTA 1CB0A 4C14A 2X7JA 1ULHA 2VJQA 4MR7A 4XGNA 3JATA 4M8IA 1E61A 2HN9A 4L22A 4PIMA 3UV7A 4C0QC 4DY4A 4YR9A 3M89A 4ZYVA 3PQ6A 3IR5A 5J4HA 5JARA 3A6JA 2BEWB 4QC2A 4Q7JB 4YHBA 5GGXA 2XADA 1FXWA 2EGHA 1JQEA 1NXTA 2J5KA 4ZRNA 3QSYA 3R41A 3G2OA 1Y1KE 1DDGA 1L3IA 2AOWA 1GPWB 1ZH2A 2JFOA 4M9RA 3MTQA 3CWCA 3ZCPA 5CEEA 4KQIA 1JKJB 4MVXA 4TVSA 3I4FA 2PRSA 4MWDA 4Q4HB 4M1ZA 1T2AA 1Z06A 2HY7A 3W5VA 2PGXA 4NPAA 3EODA 1BDJA 2PS0A 1J8VA 4XLZA 3GA0A 5DHAA 2IU0A 3OO1A 3AJ9A 4U6QA 2HBYA 3EXIB 4KR0A 3PWTA 3CKLA 1YB4A 3QVGB 3VR3A 5ALNA 2A1IA 2I29A 1P4SA 3I32A 4LOHA 4RVDA 4KAJA 4A1OA 1E7RA 4LRUA 3HKDB 4LCJA 2XGSA 1JHAA 4C7OB 5TT0A 1ZSNA 2JGRA 3IPAA 3L7AA 2L17A 1QV7A 1TVMA 3PE4A 5CG2A 1O95A 1VCIA 3MYRA 1LBHA 1WD7A 5JNUA 1UFQA 1VZ2A 2C4MA 2XA1A 3D0KA 3GH3A 4PEVA 3SQDA 1GCOA 2UZ4A 2FXIA 4WY5A 1ADBA 1GGMA 4LZLA 4DNOA 1JPNA 1QZUA 4X95A 1LH0A 4QOGA 4R5MA 1GAWA 5A0VA 4ZAYA 4OX9B 3OMLA 3D3JA 1JV2B 5AOVA 3DL7A 1IQUA 1W581 4GBGA 2X22A 3DLPX 1XHEA 2BEUA 4MH0R 3RUCA 4LECA 1CF9A 3DVLA 2CNKA 2PSFA 2ZJFA 3QXXA 4BFZA 2UVQA 3KYDB 3TRDA 1EM6A 3IHTA 1AKRA 5DO9A 5FAXA 4X71A 4ND8B 4OCZA 4GNRA 2IE0A 3U9LA 1YONA 2DX7A 1DEAA 3DA8A 3S55A 3FJOA 2XI4A 4E6PA 4DANA 2NXWA 3TK1A 1GSAA 2H8KA 1RW4A 1XQVA 2BFOA 1HPLA 2JVJA 4IYJA 3HBJA 4ZI7F 3O4IA 2H3EA 5ALOA 3PCRB 4IHJA 4GOKA 3TGPA 1T9KA 1QE5A 1EVLA 2RG1A 4MHSA 4R71A 1UOEA 3CR7A 1EGVB 1XNJA 4WI1A 2F1HA 1ZJ6A 3UMVA 3F96A 4BY9E 4M53A 4CMEA 3CUWA 2HXGA 1Y3IA 1DIRA 1LUAA 1ZU4A 3ZVKA 2J09A 2O3JA 3CG4A 2XB8A 4JJEA 2P4UA 4PZLA 1KDPA 1LI5A 1S5PA 2GBIA 1DP4A 4Q7MB 1CUVA 6ADHA 1PSWA 1GUDA 5TQ0A 5CLFA 7AT1A 2R86A 1P0CA 1WZCA 3PS9A 1W59A 1Z8HA 1AZTA 3DLAA 1SKYE 3ST7A 4BFTA 3HE3A 1TLTA 3L82B 1TM2A 1YVRA 4DUZB 2BMDA 1E89A 1EDBA 4UC0A 2AEMA 4TMFA 2YOHA 1VE3A 4C3VA 3HVHA 4XPZA 1QVVA 2QE7D 4OQZA 1THGA 4MINA 2M6LA 3LI2A 4OUDB 3VR0A 2WY2D 3R77A 3L6OO 1GCGA 3KZ1E 2H31A 1M2KA 4O4LA 1TM3E 4REQA 3W8FA 2DXIA 4ETNA 3SX0A 2PUGA 2R60A 4QHTA 4UHJA 3BKWA 1NE7A 3RYTC 3WOHA 3NI2A 5AHXA 4L4XA 3OBBA 3URKA 3W1VA 5IANA 4ZU1X 2FWPA 4JXZA 2WHPB 4OD0A 2POCA 2QD4A 2YQ4A 2HBQA 3OZRA 5CXQA 1XZQA 3B20A 3H1EA 1VMDA 2O8BA 3FFWA 4IIYA 1BZYA 1D7OA 1QIHA 2OGWA 1JMYA 4W1RA 3RGGA 3ODGA 1C8VB 3A1UA 2FRDC 3JQGA 1K7CA 3OCYA 4R54A 2NV2B 1EZZA 3ZD7A 3OWXA 4F2PA 3SYNA 2B4AA 1C7JA 4W6ZA 2ZSUA 1XRNA 2CFSA 4DE5A 3TPCA 4IYRA 4QU9A 4M1TA 3H5WA 1H4QA 2PEZA 4ZA2A 3D1VA 1P5FA 4ND3A 3TLJA 3WB1A 5I8PA 121PA 1Q1GA 1W88B 3IMCA 3T7AA 4EKGA 1E3SA 1YZUA 3CQ9A 2VJPA 3O47A 4KXXA 1PQ4A 3V46A 2XIQA 2HWWA 4QXMA 1DU4A 3OQOA 4WJZA 2GPAA 3ILSA 4RY8A 3DBVO 5BYJA 1RI1A 4FS8A 2FZWA 1GA4A 4UE3S 4WZBA 3V2IA 3DV2A 3ZLBA 2CUKA 3WL5A 3OZFA 3SLKA 1BFUA 2HCFA 3KPUA 4XXHA 2GPYA 4KN5A 3ZOKA 4WLUA 3DFZA 3ESQA 3GAAA 4QYSA 1BU5A 2LKDA 5J9FA 1Q0UA 3HCAA 1ZHHA 2GJ4A 1AKUA 5DYNA 1J09A 2CBGA 2Q5LA 1VSVA 2HV9A 3ZZTA 3HWWA 1XYGA 5CYGA 3U2QA 3WDLA 2X1VA 4X6XA 3QVXA 2PWBA 2FPOA 1CR4A 1WXIA 1YBMA 4NE2A 1V96A 3OY7A 4FKBA 5DE3A 1J9GA 3OIVA 3SJAA 2YJ5A 5H7XA 2WINI 2BSXA 4IOJA 4C0WA 1PR6A 3PQFA 1CRZA 1YR8A 2NUPA 1FFWA 4IDGA 5ITZA 4G0VA 2V6FA 3MUNA 4YAEA 1JDUA 2QTCA 4UHHA 3T6KA 1XMJA 2H11A 3LU1A 3TZLA 5ITVA 1MP0A 1L0BA 3LIIA 1YBVA 3PC7A 3TNYA 1PWZA 4OIFA 3I6QA 3ZEIA 1KWKA 3UAXA 2PEYA 4JHLA 5EL0A 1DC5A 3LUFA 2ACWA 1HRKA 2IGBA 3RVBA 3ICVA 3J81A 4KAFA 4B87A 1E1RD 5LB4A 4MDEA 3GLUA 1KZ4A 2FPRA 4MLZA 4AY4A 1ZVQA 2OV8A 2WHEA 2NSHA 1MHPA 3RJMA 2GFQA 4FR5A 2YY7A 4RTMA 4RJLA 3P9PA 1I2DA 3UPUA 4CTOA 4ESEA 8GPBA 1W19A 4G8JA 3I9LA 5DBOA 1BWSA 2NTNA 3KEQA 4PZDA 4XSVA 4R9UC 1T5BA 3MJFA 4FWBA 4N3NA 1T9AA 4KQCA 2YWDA 4AG6A 3L40A 1M2VA 5K3OA 1T6XA 3P19A 1R9GA 4H6XA 4KFRA 4EHDA 1X1SA 3LF1A 1OD6A 1CHDA 1X1QA 4LE1A 3H11A 2ZYDA 4GX5A 4MAAA 4B0OA 4O1IA 4QAJA 4NMHA 4O2RA 3FZGA 1MAVA 2Q8PA 3LNTA 3OQBA 4CM5A 3PGKA 3C14C 3PQDA 4IV5A 5IBQA 1QYWA 1TT5B 4HJRA 4M8LA 4KQFA 1O5TA 2CMDA 2GEBA 2XH8A 4M9UA 5BNTA 3H19A 4YQYA 3W5BA 1RRCA 1I7DA 2XQJA 3EMVA 1YHNA 5DX8A 1KVTA 4P2GA 4EP1A 4MQ5A 4UASA 4G9BA 5I7WA 4Q4DA 1NVAA 2C94A 3RRJA 5FNZA 4XIGS 4UOZA 1ZICA 3MWEA 2YV4A 1KIFA 3G2LA 4AJJA 3O2QB 1QB8A 1KF0A 2X4GA 3VZCA 4PZCA 3QIAA 2REOA 3IIMA 4Y2VA 3LNCA 5DT9A 4ZAGA 3T1TA 1VE9A 1N2XA 2YYZA 3M3PA 3ZY3A 1JJFA 3PEWA 5B3JC 2Y6VA 4YJ2F 4EG3A 1PVDA 3FMOB 4OXQA 2ZB2A 4RV9A 4UDOA 1PNVA 1PR5A 1M74A 1DMSA 2C1XA 3ANYB 4IBOA 5ICSA 1ETHA 3K70C 1F2UB 1K92A 2EZ9A 3DOCA 1G1MA 2BE9A 3OKCA 5E6UB 3H97A 2YV5A 1LBQA 1ODIA 1G6OA 2BKEA 4UTPA 3HRIA 3A9UA 3C3WA 3K05A 4V0LA 4HHEA 1N3BA 1TW3A 2P4SA 3KG2A 5D3MA 3A32A 4P0QB 4EX7A 3O8OA 5I9MA 3H9UA 3V33A 1JB1A 3IXLA 1BCSB 2ECQA 3T7DA 3KL4A 4GOXA 6GPBA 2HNBA 4QM6A 1BOFA 2DQZA 3DLBA 5F64A 1KO5A 2QPOA 3RS4A 5IN4A 4LXIA 3FZYA 1IB0A 1NW7A 4OHWA 2RE8A 2ZK7A 1Y7IA 2VZ9A 3UOGA 4TZ0A 1JJBA 1N7GA 5CXUA 1MR3F 5EE0A 2BFDA 4EGSA 3OU2A 2YS7A 2XLCA 2A8YA 2R00A 3EC1A 2UZ3A 4QGAA 2OT3B 2JJ8A 5DN6A 3OWOA 2DULA 1XRRA 4HXEB 4G9EA 2N42A 4KI0A 5FA6A 1SXQA 4Z7JA 1OF1A 3PTLA 1Z9BA 1C14A 1A9YA 1QFZA 2E7ZA 1RQNA 4PU0A 1U2ZA 4JLVA 4S2UA 1JPJA 4KX3A 1XXHA 1T5SA 2D2EA 2P65A 4O2AF 5D1NA 2AMJA 4MW5A 1HKUA 3GAZA 4KOEC 3C3YA 3O8BA 1EEHA 621PA 3MD9A 1MMFB 1NVDA 3MRSA 5AHOA 2ZAMA 3R0VA 5EUMA 3UUFA 4D44A 3BORA 2PS1A 2VJKA 1HOTA 3AOGA 3O90A 1YRYE 3ONVA 3OQVA 3OPMA 4GXNA 4NJEB 5FUXA 5JD3A 3URMA 3WX0A 5BVHB 3DDWA 3TWOA 2QYTA 4P33A 3PEFA 5IJZA 1C1DA 2CXOA 1K4KA 1S0UA 2QIPA 5KCZA 3I3SR 1TYZA 2J7KA 4EJMA 3VPXA 2PZFA 3UPTA 1KFKB 3A9WA 1CVIA 1R4ZA 3DO8A 4PIPA 4BO5A 2VTDA 3EWNA 1R00A 3JAMA 2BMAA 3QOXA 2NO5A 4B6EA 3MCUA 5CA1B 3B78A 4QPDA 4F5WA 1M9NA 4HDMA 4G37A 4B3HA 4CIBA 1XCLA 4QOFA 5I8ZA 3E05A 5C5CA 4G1UC 1HWYA 2ODQA 2EYUA 1R0YA 3HB0A 4OFXA 1E7QA 1FMJA 3CXRA 4DSUA 5B7GA 3TZHA 3GRVA 1PL0A 3C6XA 3OECA 5FX2A 5ISMA 5B1SA 5KNCH 5TF4A 3LT4A 3GZNA 4DMGA 4YRPA 4QXAA 2GB4A 3EEQA 1QGUB 5JALA 2V9CA 3K16A 5K0EA 1WCIB 5LQNA 3CGGA 4W4TA 3JAWA 1XKTA 2AFHB 3D8HA 3PG5A 1P7VA 1Y4UA 5KYUA 2UVPB 1U3VA 2GEUA 1HYHA 2ANCA 3MJEA 3BRCA 4OHRA 2P3SA 4YUAA 4CM9D 3L7MA 4ZCMA 4F9TA 5BOSA 3KQLA 4R3UC 3VDXA 5FOSA 1YZFA 1CKEA 1BS1A 4XWWA 1UBFA 3KUXA 4DR2B 3Q6MA 3I2IA 2X0KA 3HM2A 2VPIA 3GEGA 2AJ8A 4UE6A 4KQEA 4O0MA 3VJLA 3LYAA 4FFBA 3DEFA 1CP2A 1JEYB 4KDCA 1NOKA 1NQOA 1PR0A 2FOLA 4UVEA 5BWLA 1KO7A 1TD1A 4CMAA 3IVRA 4KTVE 3HNRA 4NC9A 3G17A 3DAHA 1MO5A 4QSMA 2RGGA 4XI9A 1GQRA 4PSDA 1EJ0A 2VI5A 3AERB 4S35A 3VAZA 1EVZA 1E69A 3Q12A 4X97A 4BZZA 3OTWA 5FL3A 3MS2A 3PNMA 5EC8A 5P21A 3H42B 2RK6A 1WEKA 1L5WA 3ONEA 4ZV9A 2OV2A 3ANLA 5TVKA 4I2VA 1GU7A 4J1SA 1E98A 3SS7X 5I4BA 2NZVG 1V37A 4DW8A 3X2EA 2ZIXA 3KVRA 3ONDA 2WKPA 4M49A 3V55A 3V4OA 2PWZA 2I6GA 4AJIA 4D9BA 1LK5A 4NECA 1DARA 4I81A 3A6DA 2QQFA 5FWDA 3CUTA 2NUAB 1GT91 1RXYA 1V7QA 2RIPA 3GCDA 4LMBA 4NFHA 4TL8A 2PO5A 3RSQA 3TTYA 4INJA 3UOAB 5KWVA 4Z4FA 1HFEL 1RZRA 3BPSA 3AL2A 2IHJA 1P6UA 2Z2KA 1WAMA 4GRAA 2A67A 1IBCA 2C84A 2FEKA 4L9WA 3PX2A 3NWPA 2R0QC 2YVAA 2P5UA 5JMPA 1T2VA 2UYQA 3P0FA 1QGAA 3RSHA 2OCKA 3VYTB 4EVIA 4F7DA 2J07A 5EKDA 3WIVA 2VP3A 2BBOA 3I9NA 4U63A 4R1UA 4ZGWA 1HFKA 3AB8A 3KHUA 2NP7A 5C0OE 3UFXA 4B8ZA 4NHOA 4NCHA 2I6UA 4XX1A 1GAXA 2ZYRA 4YJ2A 2FR1A 4INOA 3M6LA 4OAPA 4XARA 3WGOA 2XB4A 5IKOA 4AZVA 1IZYA 2J3KA 1VMAA 4W9NC 4CGYA 2OKCA 1EYZA 2WVHA 4KU4A 4DNFA 2B2CA 1F4LA 3K3PA 4FHZA 2CVFA 1WUTA 3AZQA 4YAWA 1JYFA 5EJEA 1FNDA 3TW6A 1AXRA 1DRJA 4UUNA 4XASA 4DWWA 3TE7A 4GQBA 1GUAA 3GMTA 1OHHD 3A28A 3JALA 3LY9A 3HXLA 1VG1A 3IV9A 4U3JA 3HG7A 1QHSA 2QRVA 4MUMA 2PYZA 2ZFUA 5FJIA 3BICA 4ZOBA 1PX2A 2NYRA 1CERA 3HYTA 4NARA 1BXRA 4YB8A 2GN1A 4E70A 2GM4A 4PYIA 5BNWA 4FE4A 1XAIA 1GZUA 3UKJA 1R7RA 2EIHA 5FFFA 4WN9B 3RRZA 3OD5A 5JUWA 1T1JA 5EIAA 2CHQA 1QG6A 1ZY2A 2OCAA 3CLUC 4I4TB 4IUDS 4L6AA 2YBEA 3HFJA 2GPSA 4IVRA 2FMUA 3BH7A 3HU5A 3ZQ6A 3RU2A 1TA4A 4ZGBA 1X6VA 5JMOA 3KQKA 5CTAA 3QELB 1C0KA 3H5IA 4P31A 1CUZA 4AROA 1UJMA 4QLAA 4BFVA 4FBLA 3DZFA 3W6PA 4B4VA 3S7ZA 3MXTA 1J99A 3GWZA 1K08A 4Q03A 3FPLA 3R3ZA 1MJHA 1E2PA 1Q7BA 2J41A 5CP8A 4ZI5A 3HK2A 2B61A 3A8TA 3OAAD 4MKIA 4MICA 4O2AA 2DMRA 3DGFC 3ZVRA 1RHJA 3TQHA 1IHUA 1JDNA 3IUSA 3OKFA 4JMPA 2WMDA 5EWLB 3CSSA 4J0CA 5D84A 1USWA 1YXMA 3VO2A 5IVHA 3FSGA 4XDGA 3OUUA 4LCBA 4YUYA 1ECCA 5CM2Z 3T1NA 4AUMA 3U1BA 4LZJA 4LXGA 1QZ3A 2J45A 1EP2B 1AK1A 1ZXLA 2XOEA 3M49A 4NPCA 5TC4A 1B0ZA 1EUCB 3OEYA 2HJ9A 2X2EA 3SKVA 2DHDA 1PLJA 4NV1A 2UYYA 4XWOA 2CYAA 1UQUA 4HGQA 2IOFA 3AH8A 1CEEA 1X3LA 4PPQA 4RCVA 4EY7A 1YH3A 3VZRA 3KKEA 5CYFA 2O3QA 2VQFB 1PJ8A 2C3YA 1M1NB 4NRDA 1KQGA 3NPAA 3IH5A 5J59A 5GZ3A 2PUBA 5THQA 1A97A 2C5SA 3BDIA 1QQ7A 1NX6A 1XRLA 3FDXA 3AUUA 4M0EA 2GTHA 4BP9A 1PNTA 2IUYA 1N6PA 1NP3A 1OX6A 1MOQA 4OSOA 2UUBB 1Z73A 3OZCA 3FPSA 4BWFB 2I6QA 4WA8A 1CS4C 3IOBA 4NCXA 3FKSD 2AEFA 4Z4IA 1DELA 1C7QA 3ELDA 4OHUA 5CJ2A 5A71A 3Q9SA 1U2EA 2VQSA 1DSSG 1WXGA 5EZYF 4DMKA 4E94A 3DE0X 1NASA 2BP7A 2ZVPX 3I6MA 3OQJA 4UQOA 2NVUA 5CNIA 4AP9A 3L5OA 3LPCA 4KIUA 4KV7A 4Z7QB 3LUJA 1ODJA 3KLNA 5ERXA 1XCMA 1C9DB 2O2EA 4QTXA 4B7CA 1UWKA 1NVKA 2DLNA 2GKGA 2Q3HA 2ONKA 3FI0A 3PJGA 4E5YA 1VLHA 4GW3A 4G0NA 4NZPA 1BDBA 1Q0TA 2CSUA 3MINA 3KWMA 4W9RA 2UZ1B 4BJ3A 1G8MA 4LEIA 2YOFA 3DMRA 4DDHA 4AWBA 3D4IA 1QORA 1T1RA 2XQKA 2ZS7A 3WA6A 1V2GA 2GYYA 1KI6A 1ORWA 1ECLA 2C77A 2PX5A 3LDFA 1SVMA 3OCZA 3BA1A 1NLYA 1P5ZB 4KLNA 3T61A 3VUFA 2D8AA 2OOSA 1O4VA 2XECA 2Q8NA 5IK2D 2ZWVA 2WOOA 3TXXA 4J3JA 4ZOEA 2BFMA 2QWXA 1LTHR 4H0NA 3B5IA 4UHDA 3TR0A 2JFNA 1JQKA 4BNDB 4HAYA 4RQAA 5JSHA 1UEIA 1VIAA 4LMRA 1QUFA 2PXAA 1YI8A 4MS1B 1JR2A 4RKWA 3R75A 1HURA 3GX1A 2Z9DA 2OFFA 2XRZA 4MZXA 3OE1A 5BNFA 4OHPA 3QX7A 3EA0A 1EWTA 2FSVC 2HNAA 5HXAA 2CLKB 4HWPA 1XPJA 4MWCA 4OJYA 1C1HA 4P3OA 2IC5A 4RMNA 3I1JA 5DRTA 4DZTA 5EGNA 3ML1A 1ZU5A 4P4NA 3BE8A 2O59A 5BSGA 1YBHA 2W6ZA 1TKCA 3ETJA 3SF8B 5J4VA 3OPYB 4HAVA 2PM8A 4R2LA 5L53A 1AKTA 2XCSB 4LXTA 2XWBF 3QA9A 4C6TB 2ZYWX 3CZQA 4E21A 1YUBA 4D0SA 3QX3A 1LS6A 4RF5A 2B35A 1JB9A 4NOJA 2A5GA 2YBDA 1U7PA 2QTFA 2PKRA 1IOVA 5IJ0B 3C8ZA 1YTUA 2F9FA 3OFNA 5DJ5A 4QFDA 4J0IA 3LHKA 4EAQA 3ORYA 3PGJA 2I6TA 1HZJA 4ARZB 1P9NA 4BGEA 3N0XA 1UZUA 1THTA 1SEVA 4OB7A 4XZ3A 1XCPA 3X1WA 1U5CA 3B5JA 4Q37A 4FOPA 3CVOA 4K2AA 4M0LA 4RSRA 2LPMA 4CMKA 3Q8MA 1XDZA 2IHZA 3B13B 5ALPA 5AKGA 4G41A 5SYMA 1I0ZA 3QLUC 5TX7A 1NIJA 3B51X 4HKTA 3IEPA 1CQZA 3SZMA 1XA3A 3P2MA 3ZU6A 1HH4A 2I6SA 2CJWA 1U94A 3BXFA 3IAFA 2O7VA 3QMVA 3AONB 3QVJA 4N6OA 1CLUA 2PCJA 2ZB3A 1KH3A 3VKUA 2JAXA 1PDOA 3P9KA 3B1ZA 3DHYA 1KEUA 1W94A 4X65B 3ILHA 3B85A 1R4AA 2R7NA 3IIIA 3NYWA 3T3GA 2BDEA 3FCEA 5KYNA 1O6FA 1B3RA 2QM3A 2IYUA 2C3MA 1HZZC 3C3KA 3EQ7A 1OIXA 3FUCA 1ZRNA 3BMNA 2IUFA 1WVGA 2Y27A 3KKPA 3H84A 3PC4A 3NH9A 3ECCA 2R44A 1CSEE 4QGSA 3VPHA 3AKYA 4UFNA 1H6BA 3V1LA 1ORVA 2NSLA 1N8TA 1Z4MA 2C5LA 2D59A 1B1CA 1USIA 2PBZA 4HMPA 4HYYA 3NASA 2WHYA 4QPCA 2OQVA 3SR0A 2NM0A 5KYYA 5LDHA 1TMGE 2IH4A 2HIMA 2XHZA 3NETA 3QNMA 3T7EA 3NWOA 2Q6IA 4WMLA 4CKBB 3ND6A 4FMCF 3H2IA 4WEOA 5DVZA 1GVHA 3I9JA 3MJDA 4GMKA 1ML4A 2OXTA 1JDTA 4LDNA 3SDZA 3IALA 1WA5A 4A10A 3ZQUA 2NWQA 2RGAA 3L4BC 5D3KA 1DTSA 1YJ8A 2JIOA 7YASA 4GR5A 3GRCA 3UUGA 2W2XA 3GJ6A 3KJZA 1C3VA 2IWHA 1JILA 2NVBA 2A7QA 3D5TA 4KQGA 3SJCA 4CKEB 1QFXA 3RV4A 4ZFNA 1A8IA 4KOAA 4S05A 3ZHSA 4O4HB 4UXIA 1FXUA 5D85A 5GJCA 1SCDA 3RREA 2C9ZA 2V7WA 3DMTC 3F46A 5CYPA 1LPNA 2VHEA 4L74A 1F9EA 1FRVA 1D0IA 3TVYA 1D9XA 2C0CA 4PGFA 2O2CA 3TEMA 1IC6A 5CVVA 5KREA 2FX5A 3MCWA 3DEIA 2GQ0A 2C2XA 2G63A 2ZQZA 3EEFA 1XK6A 4TKUA 2R6CA 3WYAA 5COQA 5DEOA 4ID3A 2BFNA 4DIDA 2B8JA 4DUGA 1FYWA 1X7YB 4CEIB 4RE5A 5DI9A 2XYRA 4GYWA 5JC1A 2XNJA 1IHPA 1NYLA 3TTUA 4P93A 2W71A 4D3XA 4DM3A 5UKDA 1OKKD 1V5GA 2G28A 2GJAA 2Q3MA 3AY6A 3FVWA 1WHTA 4PO1A 3TX2A 3V8VA 1Q1AA 4DBZA 5LNK6 1D1PA 1NP6A 5LWHA 1MZVA 2ZIVB 4D4JA 1OI3A 1OXMA 5CB4F 1W5TA 2Q1WA 5AW7A 2GEJA 4MUFA 1J0CA 1GZVA 1CFZA 1LC3A 1YVUA 1Y0BA 1L6IA 2C59A 2IZ1A 1XQ6A 3DBLB 1EWQA 4JWTA 1NVUQ 1JFRA 4GC5A 3A3KA 2PYIA 5BRNA 2D1FA 2A5FA 2QD2A 1A27A 4IM7A 4E5DA 3N76A 4HZUB 4UBNA 2P3QA 3ZJTA 2FZLA 1K68A 3LQRA 3QTBA 1XVUA 4WJLA 4YP9A 5LQSA 4ZANA 3RW9A 4TL6A 4NXMB 1Y1PA 2GBCA 3PENA 3SIPA 3SU8A 2O2SA 4Y2GA 2GVNA 3A6GA 5LCXA 5A5DA 4D0LB 3HBLA 4ONEA 3H5VA 3W6ZA 3GYBA 3FNHA 3HB1A 3LC7O 3CF6R 4EA9A 5F1PA 1XRJA 1CJTC 2QRKA 1JIIA 2IYPA 2EVWX 3CUUA 2OPBA 1ZW1A 1TU4A 2Z58A 4WK6A 4YJ3A 2Y2VA 2F3TA 1VJ1A 3A4LA 1KSHA 3OZGA 2HK6A 3OJOA 1FYFA 2P7HA 4FHFA 2FFQA 3LY8A 1F2TB 2R79A 1VSQA 4IDFA 5FIUA 4OLJA 2IYSA 1PW7A 1QHFA 2A94A 1QQ6A 2EQBA 2XMRA 5CFMA 2V96A 1R4NA 4D98A 1DQZA 5A6SA 4PPYA 4BMDA 1XU7A 3ICOA 4WY2A 3DPUA 4F56A 4ZHQB 2I65A 4I08A 5B2ZA 2BM1A 2VYCA 3VNRA 1B6RA 2RSLA 3VOAA 3GB9A 4CN8A 2AF3C 2BH9A 3DZCA 2FETA 2AC7A 1K9VF 3JVEA 2Q5JA 4PCVA 2B1QA 4HFMA 4GP6A 6NULA 1CUCA 1DJQA 1TAGA 2I4RA 1FVOA 2OCIA 3PL1A 3PRHA 4GMHA 4KYTA 3RYIA 3BSWA 3O73A 4HWTA 2K7ZA 3S29A 4AXBA 5KQPA 5L7WA 1KRXA 3AEKA 5DHSA 1YCDA 4NR0A 2EDAA 2GFHA 1SKBA 4KHPB 2YJ4A 3E0XA 3T3IA 3DTVA 4X94A 3C97A 3QUSA 2FPXA 2WJJA 1CETA 1RWWA 4HLDA 3W77A 5B2FA 5F21A 1HE4A 2J5RA 2QX8A 2HLDA 4KO2S 1E8DA 5EYPB 5HRCA 4HB2A 3CZRA 2C4NA 1E3LA 2WYWA 1JMVA 1K4MA 1U0HC 1UKZA 3SM3A 4IOKA 5BR4A 4P81A 2ZI4A 1BA2A 1NF8A 1ZZGA 3QTLA 4YUXA 1N2HA 2I1WA 1IUOA 5ESRA 2AT1A 1UC8A 3N8IA 3KQHA 1NXWA 2BFWA 2VZEA 3I2GA 5GZ1A 4ZZ3A 1L7MA 2J3JA 2C1ZA 4PRLA 2AFHE 4N82A 4RLSA 1CUGA 4RQBA 4ZCQA 2M1ZA 4LDJA 3ICCA 3TDMA 5HOQA 4PSVA 3ID6C 1GILA 4OHMA 5TXGA 3C7AA 1P0QA 1VJCA 4GOMD 5D6OA 2I7XA 1JAZA 2BELA 2JAOA 1MB2A 3D3QA 4YRRA 1A7KA 5TMPA 1GZ6A 3PICA 4ZIRA 4HGNA 1BX0A 3NT4A 4RL6A 2YW2A 4U0KA 4F6CA 1L4MA 3G5LA 4Y1GA 2YINC 4ZVMA 3A1NA 1W0KD 3JQBA 3K9WA 3O3OB 4TKVB 1WCYA 1L9KA 1MTZA 2W4QA 4I55A 4B6GA 2Z2JA 2JJMA 1FZQA 1XIVA 5DBEX 3M9LA 1JZSA 3RTEA 3LVBA 1DS6A 1LI4A 3D7SA 3VTZA 2ZI9A 1N2IA 1LPMA 2ZYVX 3HR4A 5CA0B 1FZTA 1Y4ZA 3V4VB 4HEQA 4LDAA 2IYTA 2COEA 4DDWA 1KYWA 2BGJA 2BN4A 4QDUA 3PF8A 4PF1A 4HYQA 1ZP6A 3OF3A 4W1PA 3BBPA 3T7SA 1SR8A 2W9XA 4P36A 3VU8A 4GVXA 5DM70 2H1IA 5FR2A 3UYLA 1HOXA 2GF0A 3NHWA 4LWZA 5TPZD 4HT3B 3PXXA 2X41A 1CUAA 3JVVA 3KM0A 3OIYA 1FJHA 3PUZA 4LYFA 3L4KA 1OAAA 2R8BA 2VHTA 4J43A 4BEVA 5IT4A 4YGXB 5CX4A 3RVNA 4DQUA 1NI3A 4EJ6A 3CZ5A 4REOA 3UWOA 4HN9A 1EVIA 3TLMA 4OAQA 1SBTA 3QNUA 1WMEA 1TPZA 4IIJB 3O7MA 4EUKA 1R0LA 4RYLA 4O6VA 3FSJX 4FUTA 4DMMA 2DPGA 2OORC 4NNJA 1FDRA 1XL0A 2ZB8A 1VPTA 1L1RA 3M6FA 4J75A 2HZ7A 5HWSA 4OA5A 5TQJA 1ZUNB 4FE3A 2BTQA 3OU6A 4FQ5A 2PJUA 1KPIA 1ZOSA 2IXFA 2PGIA 1BXZA 3HMQA 3P2KA 3ZX4A 5C52B 3W1EA 1TKRA 4ZN6A 5C1OA 1GLGA 1QRRA 3IAXA 3O8QA 5JH7F 1UJ6A 2GZ1A 3FYHA 3L0ZA 5IJAA 2OV1A 4HPJB 2JBAB 2H0QA 1W76A 3BSFA 1KRWA 3Q2OA 1H8EA 1WUKS 3GVXA 3O2SB 2DUJA 4P86A 5JJCA 2P5TB 3EQ9A 1BVUA 4FU0A 2NOAA 4MHOA 4WKNA 1U1DA 1HE8B 4GH5A 5CB4A 2WG1A 1SN7A 3DLCA 3G2PA 1NXPA 2GARA 1A7JA 3K0CC 1KYXA 2XTZA 3IHKA 4PHTA 4RIGA 4DG8A 3HCPA 1DX9A 4B2IA 3D3NA 3E48A 5K99A 2ATIA 2QORA 1RTTA 1ZN8A 1F0NA 2J85A 3UNXA 2NO0A 4IGKA 3KSUA 1Z5PA 4OA8A 3ZGNA 3B2EA 3I5XA 1XU9A 4HSEA 1BH6A 4LRQA 3IPYA 1XFDA 2C9CA 2WWFA 4UCXA 4OQDA 2W2OA 1P2UA 3GLGE 1TVCA 1PAUA 2JDID 2QN8A 3Q7IA 2VBGA 3DZHA 2XRMA 5CH8A 5DYYA 1AMNA 3RSOA 4PN7A 2Q50A 2AR7A 4CQNA 3OCUA 1NG1A 2B8NA 3A7EA 3H8VA 3DVRX 5KDLA 2CT8A 2E55A 5DBHX 3GQBB 2ZSIA 2FPWA 3Q8XB 1IOWA 3GZJA 4PHFA 5I7FA 3N07A 1YR6A 1FTNA 5JASA 1N5OX 1SCUA 4I0WB 4B6SA 2AF4C 4LKOA 4WKGA 4FFWA 4KXWA 2FDCA 3BH0A 2B2NA 1YL5A 3ZDCA 1KI7A 1Z68A 5I7OA 3NHKA 1AUXA 4JJFA 1AS3A 2VRBA 4HFRA 1SCKA 2ENUA 3AR5A 4J2TA 2EYQA 2Q6TA 3PA6A 4XWGA 5EIFA 4OLAA 3I9KA 1NC3A 4DOMA 4IDBA 4PAGA 4Y6SA 2W6JA 4PBSA 4L0DA 1MV8A 2YHAA 3GBPA 5IVIA 2ILTA 4OQEA 1V1MB 2RI0A 4WTOA 3OQIA 4HYTA 1QMPA 5EE9A 1D2NA 4CIVA 4BVHA 4FYXA 1O87A 5G4LA 2C78A 3KJEA 2BFAA 3HV0A 2C4HA 3AILA 4URZR 3CZCA 3KOWA 2Q2VA 3L8HA 3W34A 4G0WA 2CLOB 4FHCA 4DNPA 2JCXA 2PS3A 2AOVA 4TSKA 5KUTA 1OZFA 3D0OA 3FI9A 3PXBA 3ZHZA 3AU9A 2ZEJA 3DVAB 3RLIA 2YX1A 1DKNA 1ZIPA 1KP2A 2OUKA 1N2OA 1O7JA 1H8HA 3ENWA 1KK0A 5FORA 4CKCB 2KPOA 4AI6A 3KUKA 4PLPA 5MGNA 3JAKB 1JH9A 1RJ9A 2V6JA 3KDSE 1NR1A 1PV1A 2VJMA 4J90A 4EG1A 5KMGB 4H1UA 1AK9A 3WGJA 3WGIA 2AN1A 1CRPA 3ENQA 1GNRA 4RX1A 2JEOA 5JFGA 1SB8A 3OZWA 4N65A 4Z8XA 4MW6A 4ZVSA 4B31A 1UK7A 5I7HA 4RTJA 1H93A 2O8FA 2ZJ2A 3FCAA 1SKAA 4MQEA 3WKDA 3TSOA 2W8BA 2H08A 4RACA 4JI2B 4MR9B 3U7HB 3A11A 3FPHA 2PD4A 1U80A 1YB5A 1C8LA 2GCOA 3L8DA 4TS1A 3L6EA 1FU7A 4TV8B 4ADSG 2IDZA 3AOEC 3ZJ4A 4KR6A 4KREA 2C95A 1T0UA 2NSJA 5K3AA 4O63O 2Q4EA 4PTYA 1DIOB 3K9FC 1A88A 4JP3A 3C3CA 2Z2YA 1N6LA 3H1AA 3R5HA 4DLRA 5LYJB 4FTWA 4ZEMA 2WSBA 1H22A 4P2BA 2JJ2A 3UB3A 4C6RA 4F4IA 1IXZA 4GX1A 3T3NA 1TQ6A 5B1IA 2Q0QA 1Q1BA 3D6NB 1PD1A 1ZC3A 5K3DA 3WGUA 3QF4B 4V0MA 1ND5A 2GETA 1K0FA 3NNNA 3D2LA 4G4IA 2IQIA 4OI2A 4X64B 1WU7A 2VHVA 4BE9A 4JP2A 4Q4JB 3EF3A 4CIYA 2CXRA 1OW3B 2H5LA 4YCBA 4XUCA 3CUSA 1G1AA 4QA9A 4WUVA 4IIHA 1IY9A 2IIQA 1VQ1A 1BSVA 3BX1A 5EZQA 5G3ZA 4YCMA 2NP6A 3VC2A 1DWQA 5C1DA 4IJVA 3WR5A 2AEJA 1SQ5A 3F4LA 1GGJA 2VTBA 5JPIA 4DJEC 5C7OO 3L0PA 4K9PA 2QVCA 5EIXA 4MMXB 4XTRA 2J48A 2IL1A 1SWVA 1EBFA 1JIUA 1ONBA 4TUYA 1YUNA 4QXRA 4LJ4A 1U8ZA 3IMEA 4EB3A 2WJPA 5CR9A 1AUOA 1P2FA 1XHLA 5KX5B 3HL4A 2COUA 3JYHA 2NTJA 4LBZA 3AGQA 4O33A 3W5HA 4K9NA 5KS2A 1YA8A 3BD8A 3DHVA 1YTLA 4XIFA 4EG7A 3HKBB 1BEZA 4MK4A 3JD4A 2A0XA 1XJ5A 2YFQA 3JW8A 4Q47A 4D92A 4HNHA 1BMFA 1V6SA 1J21A 4KK3A 3GPBA 3HXKA 1NVTA 3HDVA 3JARB 3K1AA 4G4JA 2B4KA 4PCLA 2AN5A 1Z47A 5ILGA 3CKKA 4PGMA 3IL2A 2FPIB 1SELA 3K0BA 5WRFA 1Y1SA 2PUDA 4L0CA 4Z5XA 1OLUB 3NAMA 2PH3A 4PO8A 1I3OA 1UJ5A 3BWXA 5JAHA 1X8KA 3GFRA 4H7PA 3PWZA 4Q7LA 2JKYA 1TAQA 3AM3A 4U0JA 1JDSA 4ERXA 1IJBA 1HT3A 2X0NA 2LXNA 3K1TA 4L4SA 4BZXA 2XUQA 2IEAA 3TFQA 3U3XA 4MYSA 4ND6A 4HG2A 3V9AA 4YRMA 1GU1A 1OU4A 3PC2A 1KHTA 4PX5A 1QO7A 1IM2A 1VMEA 4LE0A 3OT1B 3E70C 2O8DB 3OA0A 4LRTB 2HNKA 3MPUA 4KLRA 4DMUB 3E9DA 4NEHB 2H4JA 4WWHA 2H92A 1VE1A 5BR7A 1P91A 2R9VA 3FGZA 5U4XA 3QYFA 4N39A 3KBBA 4H16A 4IDEA 2VDRB 3QFFA 1DBVO 1XWIA 3IAS6 2BYTA 1T9BA 3AI7A 1FVFA 3PRYA 1Z0KA 5DZSA 1LDBA 5TEVA 4KPUA 1AKQA 1PJAA 4HMQA 5EFOA 2X5JO 3M5DA 2WWWA 4WERA 1W85A 2FRXA 3JZFA 3N7AA 3W9BA 3NM4A 3PUJA 4G0XA 5CVDA 1U3TA 3ZWWA 4YXWD 1PW5A 3JWJA 3VZQA 1L5OA 4MQFB 1MA0A 2GZHA 1XTSA 1PL8A 4PHCA 4UQLA 3WYBA 4F5EA 2HA6A 1E8MA 3FSEA 4IS2A 2E1RA 1CQJA 2HTFA 3TOCA 4AO6A 2IYQA 4NIMA 3GLSA 3ZDRA 3GLHA 4BKPA 1TI7A 2O0HA 4L85A 4NE9A 3GFTA 1FA9A 5FLYA 3REGA 2Q1TA 1O03A 4Z9FA 4RTOA 5E3IA 1UOPA 4URFA 1FLDA 2O2XA 4LK2A 3Q40A 4F86A 1V0JA 1NKVA 3A36A 4TWJA 5LOVB 3K8ZA 5ALJA 2G1UA 2C7BA 1EGAA 1EAYA 3QW2A 1JJ7A 1RAIA 2CLDX 2AFRA 1UK6A 2V4ZA 2VWHA 4B3DA 1UWLA 2OHXA 5ESWA 4DCTA 2GZ2A 3B3GA 3HP7A 1C7EA 1CU1A 3HVUA 4BO9A 1XX6A 1TF2A 2FLKA 4DZRA 3TGWA 4DA9A 1HDOA 1YQQA 2PMKA 4D1YA 2B37A 3GBSA 1A8SA 3MS7A 5E4JA 1AE1A 1P9RA 4M6WA 1LJLA 1YZKA 2ZT6A 3GJZA 5DNCA 3ND9A 2FEAA 4GLFA 3V1YA 3MTDA 3PFWO 1LNQA 2C92A 1JQJC 1X1BA 3DMFA 5BWBA 2DHRA 3MWYW 3HSSA 2BFBA 2ODNA 2E49A 4R8LA 4BNTA 4RJTA 3R9XA 2EFJA 4S1WA 1PJTA 1E7MA 6ABPA 3UVEA 1RRFA 4QOSA 3D8UA 2CF5A 3PD0A 1NJSA 3PHBE 3T1HB 1Z74A 4URYR 3LC0A 1WW3A 5BN5B 1NN3A 2W11A 3N8NA 3VJMA 4QATA 1U4OA 3RC2A 2VYQA 2LZ0A 3E3MA 3NX4A 1YOVB 4N0PA 4ZPJA 3UQYS 3WMRA 5ECDA 1NL3A 2XJ4A 4C01A 1IY8A 2VH5R 4MNTA 4X41A 2WKRA 4ZQGA 3PTAA 1XRMA 4CEJA 5F9FA 3R7DA 2QXTA 1XVLA 1HSOA 5IC5A 2UYHA 3KZCA 1GU0A 3A3OA 3EW7A 5HK9A 1DL5A 1MQSA 3RYCA 3BG5A 1I3MA 1SVLA 4LIPD 2FGJA 3EXHB 5IEBA 2DT5A 4JLPA 4Y67A 4NBUA 4DC0A 4CPDA 4H7FA 2Q4BA 3D3KA 6Q21A 5HZHA 1A5TA 1L5FA 5LQAA 1K7SN 2DCMA 3EVGA 4D8TA 2Z3WA 5K6AA 1I0LA 4EG0A 1EWRA 4WOPA 1MB4A 2RAVA 3AP1A 4UNIA 3AKZA 1UMCB 3GFBA 4CCYB 4R1NA 2Z08A 2YXEA 2J3DA 1BCRA 2M1XA 2ZSJA 3A1TA 3JVDA 1O6ZA 3KQUA 4LXUA 4LQLA 3QXSA 4IEIA 1XRQA 4N3BA 2XDAA 2RGEA 3ROPA 2WZQA 3EGDB 2V6IA 2DBZA 1RYNA 1UFKA 1URPA 2HO4A 1V1RB 2Q5IA 1G9TA 3BDVA 2XVZA 4P0TA 3T9AA 3UOWA 1V8DA 2XVYA 2H2WA 3JQAD 2GRJA 2Y4OA 3LUAA 1E3MA 4S1PA 4RD2A 2JATA 2G0TA 4Z9AA 2JIQA 2V45A 3WGHA 2XDQB 1P45A 1GO2A 2G83A 1HEIA 2E4ZA 3LCVB 4WY8A 3IP7A 4JJZA 4DV3B 1OLSA 1T8WA 2H06A 3BRWA 4IH4A 3D6UA 4MMYB 2GJ9A 4Y9TA 3EEOA 1KQOA 1CNMA 3FROA 3T95A 3WG9A 3O31A 4HRYA 4NZ9A 5ILOA 3D7RA 3KLMX 1GADO 2Q29A 1PN3A 2H57A 3QKRB 1UF9A 4EYKA 5BSVA 4AMZA 5DULA 2FSFA 1DWPA 5CTJA 1MAHA 4NU8X 1LVGA 3AVPA 2Z6QA 2BEKA 5CFZA 1DADA 4I50F 1U02A 1COWD 3GDWA 3O5AA 5E8RA 3B9PA 1HE3A 1TQHA 3FLAA 3L93A 4H77A 5AESA 2WSSA 5T6BA 4ZI3A 1M54A 3OM9A 4HAOA 1KERA 1M6WA 1N2EA 4YVFA 1BKSB 1MX1A 4ARSA 1PYOA 3O8RA 5BQFA 1F2VA 2P2GA 4DDVA 2J0EA 2JK1A 1RM3A 2O8EB 1P72A 4QD3A 2YXBA 4WBNF 1GSHA 5HIIA 1CQPA 3K2IA 5F7ZA 3MIIA 3JYQA 1GTVA 1E0KA 2UXDB 2FAXA 2WDPA 3DV0A 4X5OA 2OWEA 1J9EA 1GZ7A 3PHCA 2FPUA 1A0OA 1CF2O 4RDCA 3W5JA 5JVDF 3ZWOA 2OV3A 1MGPA 2HMVA 4H1VA 4MUAA 1RPJA 1VLQA 1RLUA 5FUWA 5CDGA 4D4KA 4K6FA 4DSOA 3HYLA 4BLRA 1OBVA 2QJRA 3F73A 3ZVNA 3WGKA 3FZNA 2Q4RA 2GDJA 2RHTA 2HRCA 3OPYI 2QAJA 5EN4A 3C8DA 5CFNA 1GFZA 2QNBA 4QDJA 4DRYA 1UANA 1SBCA 1Z18A 2V54A 4B2PA 3G8YA 3FFXA 4MTCA 3HZZA 5BXYA 4DV7B 4AJLA 5AJXA 1ZWLA 4G9GA 5AMXA 1ZESA 3HDJA 2L82A 2OBMA 1W4LA 3VHXB 3NYRA 1JLRA 2I4TA 4ANFA 3ODPA 3TLCA 4H18A 3JQ9A 4QZVA 1W96A 1G8FA 3F7MA 2YICA 3K5WA 4NYIR 5TIIA 4AKHA 5REQB 3U7IA 4KWHA 5JAUA 4K46A 1E0JA 4MX8A 5FBQB 1F0YA 2NNWB 1K97A 2O2YA 4AP5A 1WBDA 3QUCA 5IAJA 2D0PB 4MUNA 2IZ0A 3HXOA 2VXOA 2P35A 4ERNA 4FFVA 4KYVA 3ULKA 2YWXA 3LTNC 1J5EB 2NV6A 5G2OA 4RANA 5K45A 1D6MA 1ZD9A 4Y7CA 1Y6RA 1N3LA 3UG6A 5DHFA 2N46A 1GAJA 2QSYA 5F2OA 4UPVA 3CH4B 3VU9B 5B64A 3FTNA 3TL2A 2LCIA 5FADA 2RHDA 2C7PA 1Q91A 2JGJA 4PANA 2HPHA 2Y76A 4U7HA 1HR0B 4CG0A 1S7GA 3MWFA 5HOEA 3AB3A 5BNZA 2O1WA 4QTZA 3W2GA 5EUBA 5K6TA 4L3OA 2H4HA 1CRLA 1OE0A 3T34A 1KRHA 1U6KA 3GNSA 5IVPA 3RM3A 3U9SA 4JI8B 2RONA 2P9EA 1KP3A 1M3SA 2C4WA 3TBKA 4IIUA 3U4GA 4B3CA 4YROA 3ZHQA 5BN3A 4OOFA 4G36A 2CDNA 1U9IA 4V2IA 1QFJA 3GI1A 3PI7A 4K6HA 2FPLA 2X5KO 4LI0A 3SZOA 2OG1A 4TT8A 3VV2A 4DLPA 3K0FB 1VKZA 1B0PA 3CR8A 3LFHA 5EG5A 3STTA 1G66A 3LX5A 4YCCA 3I9MA 1IEVA 3HEAA 1LY1A 4AY6A 1P1IA 2HWUA 1KBQA 1TCCA 1G3UA 3A4VA 4UUOA 3TEJA 1WVIA 5JSYA 3THWB 1TAHA 5A9SB 4C0LA 2HQBA 4MIOA 1RBZA 4KC0A 3SSOA 4R16A 3QA3E 1GGVA 3MWDB 4F04A 3FHOA 3E9CA 3F3MA 3M8KA 1H9AA 3M7IA 4HX9A 1EFRA 1TDJA 2DR0A 1P0MA 2PV0A 3KU4A 3QBEA 3TKAA 1IWOA 3CTMA 1MA3A 1EK6A 1M7GA 1CE8B 2HHCA 4P84A 3Q2IA 3E7DA 3KZNA 3SYLA 4LOAA 4FDMA 3GNTA 5JS6A 1NFFA 4G07A 2C7QA 5B5SA 3WAGA 5EXSA 1FJ2A 4GVPA 2QSJA 4MA5A 1KK1A 1UZMA 2Q7XA 5T41A 1KHHA 4FW8A 1QNFA 1S1CA 2I1LA 2L0XA 3ADPA 3DP7A 3IUNA 3NTUA 4K40A 5CURA 2ZR8A 4AF6A 4G0YA 1MB0A 4ZVTA 5FOWA 1JTFA 4I3GA 3IVXA 1P19A 1DO2A 2VXBA 2IPAB 1G21A 1I6MA 4JUAA 4PWZA 5KYXB 3KVNA 1Z4KA 1I1QB 2DWUA 4AJKA 1YO6A 2R6R1 3DDHA 4PHGA 3EF0A 5JYDA 4D42A 3EBLA 1CY2A 1E4YA 2OZLB 2WDZA 3R1IA 1X1CA 2JGDB 3ELWA 2OHIA 3ZCSA 1DLIA 2PSJA 3LUHA 2ZI6A 4KBYA 1UKAA 2CHEA 4RHYA 5JXWA 4FILA 2J0QA 5EPEA 1LWOA 3VX4A 5AFSA 4H31A 1UC9A 3FF4A 3K2BA 3D2CA 3FPCA 4G8DA 2HM7A 1DAPA 1DPFA 4LJRA 4A6EA 5L6MB 1B6TA 4MVJD 4QGGA 3RHZA 1WUIS 1EFDN 1XLTA 4R0VA 3I72A 1VGVA 2J1LA 5SYAA 2V74B 3RU7A 2B1JA 4N5DA 3MFYA 4RMGA 2QLBA 3EUFA 4HGZA 1D2EA 2X6QA 5ERYA 5BYBA 3RUIA 2WM3A 4EPYA 2B21A 3FIJA 1PFVA 3FVVA 2HRBA 4HEJA 4EI2A 4I50A 1JFVA 1BEUB 2KJQA 4B7AA 1G8YA 2PZAA 4MVJM 3CLHA 4XE5A 1EZ1A 2YUTA 3RIEA 3UAOA 3PX7A 3E3AA 4HNSA 3LC1O 2F62A 3GWGA 1E3WB 4L08A 2VBIA 4O4IB 2O4CA 5K0NA 2VAWA 3HGMA 4NXNB 2CMGA 2LCFA 4ZWNA 3DD1A 4DMLA 4I5EA 1QFSA 2GMWA 1CQXA 2HXYA 4WBNA 3SX2A 4CM3A 1CZHA 2X3YA 2EZ8A 4KQ6A 5EXEA 4A1FA 1M1ZA 1SHLA 4CLDA 2J9GA 1Z5UA 5DTEA 2GBFA 2QZSA 3KD2A 4E11A 4YQFA 1N34B 1U28A 1EXDA 4MA0A 2DY1A 2NU8A 4PW0A 4AULA 4K6GA 4AVYA 2WJHA 2ZRPA 2HHJA 4M9XA 1ZH0A 3AR4A 2Q3EA 1EUZA 3K9CA 3P9CA 1ZS9A 1JI3A 4R3NA 3ZXYA 4BAZA 4EMTA 1PFQA 1X2EA 4XLTA 3RABA 3KR2A 4BPRA 5FWXB 5LQRA 4I3HA 5TF0A 3DTYA 4FFPA 1LRJA 1Y81A 2NLOA 2SBTA 3TQQA 3W5AA 1DV2A 3HRKA 1IRIA 3RVJA 4X63A 4CV3A 3GZTB 4A8TA 1B2LA 4S12A 4Z49A 4M83A 5HX7A 1JQ5A 2RGNA 4D79A 5KSPA 1KJWA 3RTBA 2F8SA 3TEFA 2QTMA 2BZ0A 2D0OB 2BWJA 4BVJA 1MH9A 4WBSA 4KXFB 4CMHA 3CC8A 4F38A 2EQAA 1LPBB 1Y5LA 2VPTA 3WIOA 1DC7A 4CIAA 4BIMA 2H51A 4FI3C 5LC1A 1PEYA 2PJDA 5LMUB 2D74A 2H1LA 3KXLA 3GJXC 3K30A 4MVJG 3H87A 4Y2YA 1ZWKA 1NXVA 2CFIA 4M22A 4D4HA 3EIQA 3QRWA 8ATCA 5KNLA 4WLEA 4HDSB 1Q20A 1T10A 2ZWOA 5CLLA 2XGJA 1K0UA 4HPWA 4UAUA 1FFBA 3H83A 4ZO6A 1BDHA 4GGOA 4Q24A 5F78A 4A15A 1L5HB 4E22A 3R6DA 2I9PA 3EZFA 3LCRA 3NM6B 2G9NA 1J2EA 2G9QA 3IV6A 3ZWDA 1P18A 1L5YA 3ZV6A 1HXHA 2A9FA 2YZNA 3AF5A 4ACAA 5BQ3A 1YFLA 1W36B 2QTBA 3OOHA 4K0RA 3WYDA 4B6RA 4N48A 3ZCUA 2H18A 1PZGA 2VDMB 4NZOA 2OO3A 4W7IA 4WAUA 3LM8A 4QTUB 4XJSA 1CY8A 2YRFA 1G5RA 4RSGA 4GT1A 4AJPA 5AW8A 5IDXA 1BH2A 4CF4A 5H3CA 4XVUA 4RK1A 3CNEA 3ER9A 2FUG6 5D7NA 2LKCA 1A2BA 2RHBA 3GFQA 4HOYA 3ZHVA 2Q3DA 3F2VA 3QI7A 1IG0A 1W1IA 2LNDA 3FDZA 1O08A 3AEQB 1Z0ZA 3BSSA 2PZKA 3D64A 3DC2A 3FVTA 2YJNA 3HJRA 4HLUA 4I4IA 5TE9A 3UTDA 2B3TA 2X58A 1AT1A 1Q0SA 4HQLA 3VDRA 1IEWA 1SOMA 4BX3A 4CUZA 3GT3A 3SNKA 1UZNA 4EFMA 2CZGA 5FI0B 1U3WA 3OP4A 2H2IA 3D6HA 2WD9A 3QFTA 4PG6A 3AUJB 4RK7A 3L7BA 3STUA 4CL2A 1D8TA 4ZYLA 3H8JA 3PE3A 3RD5A 2Z09A 4AN0A 1C3XA 4PVDA 1HSZA 2QR2A 4OHZA 2X0FA 5MN6A 1SH7A 1NFQA 2ABWA 2VDWB 3C6BA 3KQOA 1ZIXA 3TECE 3F0TA 4JODA 4BP3A 2WJWA 1WXFA 5CNMA 1K6IA 1KP9A 4Z7OB 3ROEA 5ARBA 1JQBA 3ZIUA 2G4LA 3JQEA 1ZINA 4JL8A 1KGDA 3FRIA 5KCMA 2WUFA 1SXJD 2HCRA 4AM8A 4AK9A 1R0CA 4ZI2A 1IL0A 3LDGA 1I4DD 1BJKA 2LRHA 3LZDA 4KKVA 3KCNA 4XYBA 4YMIA 5EMKA 1MRSA 3IEKA 2EJVA 4QFMA 2JCGA 1OI4A 3K4PA 1GNVA 4HATA 4NBRA 1TF5A 4UU1A 1EU1A 1QIDA 1GPKA 2QE7A 1BNCA 4WGGA 5IM4A 3G0HA 2HYIC 1WCV1 3R0IA 1J00A 1HDIA 1KKUA 2ZYGA 3BM5A 1UBGA 1RR6A 3CJQA 2OZKA 4OKIA 4TVBA 4CL0A 5A4MS 1RPZA 1ADJA 4DJDC 3VSAA 3UJBA 4MWZA 1H42A 1YZGA 4RGVA 5F33A 4XA8A 1ZITA 5TEWA 1OREA 4CT5A 4ZCTA 1PG2A 1NULA 1P1HA 4XWYA 2O6LA 2EKBA 3A25A 2IYXA 3H2GA 4LJ9A 4WVLA 2QY6A 5G0WA 4EHJA 1CTQA 3AF1A 3GEIA 4B76A 4IGFA 1EX9A 2C2GA 2CCKA 4MPPA 1QCZA 3MPOA 1EBBA 1Z5OA 3OOSA 3T9FA 4FYVA 2ZYTX 5DHQA 1KARA 4CM8A 5K3SA 4B7XA 4C4YA 2KI5A 1YIDA 1YRQA 4N3GA 1M2GA 5LP6F 3JTMA 3P0JA 4PZUA 3ECSA 4GZ6A 2VYVD 1TQ8A 3VBEA 4IQ4A 1AKVA 2GO7A 5LMZA 2YXNA 2A92A 2BAGA 2BD0A 2XITA 3OPXA 2A88A 2RMKA 2JC3A 4GOOD 4TSRA 5KOYA 3LCUA 1PT5A 1WO8A 1GG5A 5B3AA 3OUZA 4CWAA 1EWYA 3PR3A 2C07A 1D03A 3DB2A 2A1UB 1KFBB 2B5WA 3G68A 1HG1A 2I3DA 3GR6A 2BT4A 1DXHA 3HLYA 4MV3A 3PEVA 4RXMA 5GJVC 3UHFA 4N41A 3L6RA 5AI4A 2HPVA 4L0QA 4YONB