5KYGA

Rawv_ctd (loop structure) of 16s/23s 2'-o-methyltransferase tlya
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
207
structure length
207
Chain Sequence
b'WVSRGAHKLVGALEAFAIAVAGRRCLDAGASTGGFTEVLLDRGAAHVVAADVGYGQLAWSLRNDPRVVVLERTNARGLTPEAIGGRVDLVVADLSFISLATVLPALVGCASRDADIVPLVKPQFEVGKGQVGPGGVVHDPQLRARSVLAVARRAQELGWHSVGVKASPLPGPSGNVEYFLWLRTQTDRALSAKGLEDAVHRAISEGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxin / haemolysin homologue TlyA
publication title A Novel Motif for S-Adenosyl-l-methionine Binding by the Ribosomal RNA Methyltransferase TlyA from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 64
structure length 207
sequence length 207
ec nomenclature ec 2.1.1.226: 23S rRNA (cytidine(1920)-2'-O)-methyltransferase.
pdb deposition date 2016-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5kygA00
3GNLA 2JHCA 4YV1A 1ZGAA 2PXAA 3G88A 5LQJA 4CXMA 3EMDA 3I53A 2WA2A 3T7TA 5FQNA 4YMHA 3K6RA 3CCFA 3LL7A 4U7PB 4X61A 2NNWB 2YXDA 4X1OA 1QAMA 1IXKA 4POOA 4LG1A 3SMQA 3MGGA 3G7UA 2OY0A 3P9IA 5LQNA 2IH2A 1EQAA 1JR4A 2P1DA 3GWZA 5JUWA 4DCGA 3B3JA 3ELWA 3THRA 2VDUE 1RI2A 3OZTA 2NP7A 5G02A 1JQ3A 2GLUA 2BR4A 1QYRA 1FPQA 5E8RA 3OU6A 5FA5A 1TPYA 3OU2A 2Z6QA 1JQEA 1VP9A 5FWAA 1DL5A 2QRVA 3TM4A 4BLWA 5D1HA 3WSTA 3P9NA 1F38A 4IV0A 3P97A 5HZMA 1KR5A 2E5WA 5DX1A 1QAQA 1KHHA 3DMFA 1P1CA 2YR0A 4ISCA 5K0JA 3EGVA 4MTLA 2ZIFA 2I6GA 1OR8A 1SVUA 1INLA 2PY6A 2R3SA 3NTVA 4GOMD 1IM8A 4RTLA 5BXYA 1TW2A 5EG5A 2ERCA 3HVKA 5EKXA 3NW9A 2PBFA 1WXXA 3MERA 4KDCA 3E7PA 4C07A 2I7CA 5HIMA 3LGAA 4CTJA 3C6MA 3GO4A 3NDIA 5CVUA 3L8DA 2GH1A 3KPYA 1SQFA 1SQGA 2HWKA 3OPNA 3FYCA 4QVKA 1KIAA 3A25A 5C0OE 3CJRA 3FPEA 3DOUA 4M37A 2ONZA 3G2OA 2BZGA 3QOWA 5DTMA 3REOA 3ER8A 3CJQA 2ZZKA 5E1DA 5EZSA 2CMHA 4RX1A 3MCTA 2PLWA 3RODA 3KKZA 1RJDA 3SGLA 5DLYA 2BM8A 5EMLA 1H1DA 3HCFA 3VC2A 4RVGA 2Z6AA 4E2XA 5F2NA 1X1DA 2AN3A 3HCAA 4ZTBA 3NWEA 1JG2A 3LHDA 3MTEA 3NVMB 3FTFA 2YXEA 3TM5A 5LR6A 2GB4A 2Q41A 4XUCA 4OBWA 2PXCA 3UJBA 4E31A 3ELUA 5K0FA 3CJTA 1BKYA 5F2OA 5DXJA 3VYWA 3MB5A 4KIFA 2AVDA 5T6BA 3PT9A 3OU7A 4CKEA 3LCVB 3JWIA 2QY6A 4PYIA 4PYJA 3FUWA 5FHRA 3JWJA 5EEGA 4PYKA 3KPVA 3FTCA 4EMSA 1KPGA 2PKWA 2IBTA 1FP1D 5K0GA 2OPBA 3TRKA 2V74B 1KYZA 2FK7A 2VDWA 3DMGA 3LDGA 4PIPA 4QVGA 5E1BA 1YUBA 2OB2A 3SXJA 4GEKA 3HNRA 5T64A 1N7JA 3CBGA 5ICFA 5LQKA 1Q0SA 2Z6UA 1M0EA 1JTEA 3VC1A 3X0DA 3GCZA 1G55A 3C3PA 3A26A 4RYLA 1JSZA 2O07A 4GC9A 3FRIA 4LWOA 5DTQA 1I1NA 1B42A 3M6XA 2EJTA 2YXLA 2AOXA 5DRTA 5BP7A 3EVAA 3DXYA 3G8AA 2JHAA 4RTNA 2YUIA 4YV2A 4X41A 3KPUA 3LKDA 4RTSA 2IPXA 1VIDA 2PWYA 3P71T 3LCCA 3KHKA 2AOTB 2CMGA 3S68A 1JG3A 3UA4A 1V39A 2B3TA 2FK8A 2P7IA 2QRVB 2O0LA 3QOXA 4P7JA 3GXOA 3SSOA 3BGDA 3KQTA 2VZ9A 5IKMA 5K0CA 2HTEA 4E30A 3EVDA 3EVEA 4IKPA 2ZIGA 4PGGA 3D2LA 5HFJA 1L3CA 4FP9A 3TFWA 1JSXA 3OZRA 4FT4A 1MHTA 2ZFUA 3BWBA 4F85A 1G8AA 1YB2A 2UYHA 4OQDA 2JH9A 5FUBA 4H0NA 1EAMA 2HR1A 3ANXA 4IWNA 3FPJA 3KQPA 5DM0A 4C05A 4AZSA 3BWMA 4RTKA 1N7IA 3GIWA 3FPFA 3UJ6A 2PX2A 3C3YA 3DLCA 4NECA 5EZQA 3GJYA 3IYLW 4QPNA 4QTUB 2BM9A 2FHPA 3GRZA 1X19A 3R3HA 4BLVA 4C04A 5K0EA 5LSAA 5EVJA 5T67A 2HMYB 2HV9A 5EOVA 3UJ8A 3Q87B 1KXZA 2ZBPA 5K0BA 2Y1XA 4PCAA 4ER3A 2V7EA 5E1OA 1UWVA 2IIPA 5E1MA 3KR9A 5ICCA 3BWYA 1Y8CA 2EFJA 1WS6A 4P7KA 4PONA 1I4WA 4RWZA 2XYVA 5FTWA 4PIMA 2IFTA 3P2IA 4Y2HA 5DM4A 3OCJA 1PRYA 1HMYA 4V0QA 5BW5A 2AOTA 2NXEA 2AN4A 1QAOA 4PINA 4RV9A 4UOEA 3A7EA 1PJZA 1G6Q1 3FUVA 1BHJA 3DH0A 4R6WA 2BR3A 1XCJA 3G5TA 4FSDA 4RVDA 2ZBQA 3AXSA 4DA4A 4FS8A 5EMKA 4GBED 4FT2A 3TLJA 4YMGA 3M6WA 1NKVA 5B1SA 5K09A 2PGXA 4PYLA 3T7RA 2I9KA 3UJ9A 4HGYA 4R6XA 2NXJA 3M6VA 5FADA 1RI5A 5FWDA 4HGZA 5E9QA 2JH8A 1L3BA 2AZTA 2ZULA 3EVGA 1XCLA 2P40A 5EHIA 1QANA 1QZZA 5CUQA 2AN5A 1ZGJA 5HOQA 3SM3A 3KQWA 1M6EX 3NWBA 1FP2A 1NW3A 3T0IA 2NXNA 3ORHA 3LBFA 4P7FA 5DTRA 5LQAA 1JG1A 1D2HA 1R18A 5DM1A 3KR0A 2H11A 1NW8A 1RI3A 3UJAA 3UZUA 1UIRA 4RTPA 5EHGA 2ZVJA 2AR0A 3TKYA 5K8VA 1XDZA 1WXWA 4G56A 5KQRA 3IEIA 1O9HA 4GOOD 4DCMA 4DQ0A 1EIZA 3PFHA 5DM2A 3UJCA 1FJXA 4A6EA 3HTXA 3PX2A 3BWCA 2ZW9A 5DWQA 1JTFA 3TPZA 3CKKA 4HTFB 5K05A 3A4TA 1SUIA 2BR5A 3OFKA 3BGIA 4P58A 2XVAA 3BUSA 3MAGA 3B3GA 3MQ2A 4R05A 4PYOA 5CVEA 5DPMA 1ZG3A 5HIIA 3HA3A 3P9CA 5ERGB 3FPGA 4EKIA 1ZKDA 4M7RA 2C7PA 5FHQA 3HM2A 3UJDA 2XBMA 2XYQA 5GIOE 3HCDA 4XUDA 5C1IA 3NMUF 1XDSA 3BZBA 1SUSA 1NV8A 3F4KA 5DSXA 3VSEA 5ICGA 3NJRA 5F2KA 2NYUA 4K6MA 1XVAA 2GA9A 3R6TA 2JHPA 4AZVA 5FULA 5EMMA 1NV9A 4CTKA 5IH3A 2XVMA 3BT7A 4CKBA 4HSGA 2CL5A 2IP2A 3E05A 3TOSA 2IH5A 4YUZA 5GOZA 3R0QA 5KVAA 1AQJA 1JQDA 4MQ4A 1VPTA 1X1CA 3G2QA 4EQZA 1R6AA 3UWPA 2XYRA 5CCBA 4KRGA 5GWXA 1RJFA 3M70A 2AOUB 5K0LA 3TMAA 10MHA 2B9EA 5DX0A 1T43A 1VBFA 3DTNA 3PTAA 3BGVA 3P2EA 4HRAA 5HEKA 2O05A 2IH4A 1IY9A 1NBIA 4EVIA 1WY7A 3O4FA 2ZZNA 4HC4A 3CVOA 3DP7A 4GF5A 2QE6A 4OA8A 4QPPA 4WXHA 4RTOA 1YF3A 4F84A 4KIGA 4OQEA 2C7OA 3MTIA 4KDRA 3KQSA 2EX4A 3MCZA 4E70A 4DMGA 5M5BA 4ATNA 4GQBA 1MJFA 3HCBA 4HTFA 5DT2A 5EGSA 1X1AA 2IDKA 1ZQ9A 3BXOA 3FUXA 3P8ZA 5E8JA 1R8XA 1AV6A 2PVCA 2G8NA 1L3IA 3ELDA 4V0RA 4ER0A 2ZLBA 4PYNA 5GP1A 3TQSA 3UBTA 3AJDA 5LQUA 3P2KA 3V97A 2P35A 4PWYA 4B17A 3EVZA 5GM1A 5CVJA 3C6KA 4P7GA 2HNKA 1G8SA 3FUUA 4E2YA 8MHTA 3KPJA 3EGEA 2C7RA 3G5LA 4GC5A 5HIKA 4AZTA 2P7HA 1TW3A 1RJGA 4OA5A 1EG2A 1NW5A 4YUVA 1ORHA 4RTQA 4RTJA 2P3QA 4XUEA 3UA3A 4DKJA 3FYDA 3KPWA 3LCUA 3ME5A 1JG4A 3EGIA 1BC5A 3B7PA 2ONYA 3KU1A 1NT2A 2OB1A 4EKGA 4F86A 2PXXA 3B5IA 9MHTA 2AOUA 3DUWA 3I5UA 4E2WA 2OKCA 4GUAA 5E9JA 4PYMA 5EIWA 3A7DA 1YFLA 2OYRA 3BKXA 4A6DA 5KYGA 2CKDA 4M36A 3TR6A 4ER6A 3G89A 1P91A 1Z3CA 3DMHA 2PV0A 2IBSA 3A27A 4R8SA 4M38A 4X60A 2G70A 5FA8A 4L7VA 4YUXA 1XXLA 5HILA 3OE5A 5E9WA 3SX0A 3LECA 3LX6A 2A14A 5LQCA 2ZZMA 2GAFA 2PJDA 1KPIA 4FZVA 3HVJA 3DXXA 4MWZA 2NXCA 4RTMA 5D1NA 2WA1A 5EPEA 3B3FA 7MHTA 3LDFA 4FGZA 2R6ZA 5FCDA 2UYOA 1G60A 3FPHA 2H1RA 2BH2A 1P1BA 1VE3A 2OBFA 2ZBRA 1DUSA 3O31A 4ER7A 2LD4A 3MHTA 1ORIA 2ZIEA 4PYQA 2AOVA 3FZGA 3DLIA 3KR2A 3LSTA 1NE2A 3DXZA 3EVBA 3IV6A 4KW7A 3RIEA 3ER9A 4QDJA 2B78A 3ELYA 1L1EA 4PNEA 3SR4A 5CD1A 3HVIA 3M4XA 5EMJA 5K03A 4DZRA 3C0KA 4C03A 3EEYA 1RI1A 3OZSA 3JWGA 3EVFA 3ERCA 2NP6A 3LKZA 2Y1WA 2OXTA 3BKWA 3H2BA 4Z2YA 1N2XA 2ORED 3PB3A 2F8LA 4AZWA 1XJ5A 4ER5A 1UFKA 1AF7A 2PT9A 3GRVA 2PT6A 3RW9A 3KQOA 3KQQA 2EG5A 3LBYA 3IHTA 4HH4A 4QQKA 5P8WA 3SSMA 3HP7A 3PX3A 1D2GA 1EJ0A 2ZTHA 2N47A 1VL5A 3Q7EA 5E2BA 4E32A 1YZHA 4GOND 4JXJA 2QM3A 3NDJA 3PS9A 2C7QA 2AOWA 3HEMA 3EVCA 4QQNA 4X63A 2G1PA 3NVKI 1RJEA 3CGGA 2ZWVA 1KPHA 3KQVA 2FRXA 5DSTA 1I9GA 2KW5A 3FUTA 5E2AA 2FYTA 3JWHA 2PX5A 3G8BA 2UYCA 1M6YA 5EC8A 3E8SA 4MHTA 2P3OA 5HIJA 2ADMA 4O29A 5LQRA 5H02A 3KQMA 2EJUA 3ID6C 3T7SA 5CCXA 3G2MA 3GDHA 2IGTA 2ZSUA 1KP9A 2YVLA 3EMBA 2WK1A 2PWPA 3GRYA 2YTZA 3LPMA 2ESRA 3CC8A 2P3LA 3I9FA 4MIKA 1Q0TA 3HA7A 3V8VA 5KS2A 4U7TB 3PFGA 4PCLA 3HVHA 1NW6A 1WZNA 2GPYA 1D2CA 3OE4A 5EQJB 4OX9Y 3AXTA 3KQYA 2P41A 1NW7A 1WG8A 5ICEA 2YX1A 3UFBA 5CIYA 3GU3A 4RTRA 3R9XB 4YUWA 2PX4A 4KVZA 5DRYA 5GIPE 2H00A 3HA5A 1DCTA 3I64A 4C06A 1XDUA 3R24A 3LDUA 1U2ZA 4EK9A 4AX8A 2OO3A 5EKUA 3QV2A 4LECA 5MHTA 4BP1A 1ZHFA 4FSXA 4BY9E 1F3LA 3M33A 3E23A 5U4XA 5CM2Z 5KQSA 2CWWA 3PLAE 2G72A 3UJ7A 2P8JA 4RSRA 3DULA 4QTTB 3SVZA 4C4AA 4YV0A 1VQ1A 5EEHA 1R00A 5JR3A 2DPMA 3HCCA 4YUYA 1BOOA 2PSSA 4AUKA 3DR5A 2YQZA 2I62A 2K4MA 1HNNA 2JG3A 3B89A 2IDJA 3THSA 4CKCA 3G2PA 4IV8A 5CVDA 3I58A 3EPPA 1O54A 3PVCA 4FR0A 4KWCA 1SKMA 4WVLA 5GM2A 2FPOA 1SG9A 2G71A 1YFJA 1YZ3A 3FRHA 4Y30A 3U81A 4QDKA 2AVNA 1EJ6A 2VDVE 4BLUA 5BW4A 5DX8A 1O9GA 4OBXA 5CVVA 2UYQA 2PX8A 4E33A 3HCEA 5FQOA 2B2CA 4DF3A 1XTPA 3M6UA 2ZCJA 3FTDA 3GGDA 5EIFA 2UZ4A 4HG2A 1L9KA 3TKAA 1R74A 2FCAA 2O57A 2GS9A 3OFJA 2AS0A 4E2ZA 3AY0A 4GOLD 3AWIA 5DXAA 3O7WA 4CWAA 1G38A 3GRUA 4PGHA 3KR1A 3FTEA 2DULA 5K0NA 4DM3A 3K0BA 1VLMA 1FBNA 2ZWAA 3P9KA 5C9ZA 1NBHA 5K01A 1AQIA 4C08A 1X1BA 2VS1A 5GINE 2OZVA 4RVHA 1P39A 2VP3A 4XCXA 1R8YA 2B25A 1RI4A 4LWPA 2O06A 3SSNA 2QYOA 4R8RA 1KYWA 4BP3A 3EEOA 3GRRA 1VP3A 4RVFA 2JJQA
chains in the Genus database with same CATH superfamily
3GNLA 5BURA 1L4BA 2DWPA 1II9A 3C5CA 1GP2A 4N47A 1A95A 1XD2B 4RHEA 4D9HA 4BECA 2ZYVX 3TUJC 4CDMA 3H4MA 3O47A 1JIUA 1QVZA 4KMOA 2ZVDA 4JELA 1UKAA 1Y6RA 3B8EA 4E0BA 3U5ZB 5AW3A 1TVCA 2QR2A 3QHQA 2W6IA 3ZHVA 1OBFO 2NNWB 3D8SA 621PA 1A8PA 3WO1A 2GZ2A 2IH2A 1Q92A 2RD2A 4UU7A 5IKXA 4HUTA 2DSNA 3D6AA 5EWJB 3U7QA 4KYIB 3UFXB 3WRXA 1U02A 3NI2A 4FPXA 5E8RA 4RXUA 2GEJA 1GTJ1 1EG7A 1JJFA 2AT1A 2EW8A 2IEDA 3OU6A 1N9ZA 4UQPA 2DE0X 3TQHA 4YT2A 2JRCA 2Z0MA 3W77A 1QF6A 4X6LA 1T8YA 3TLBA 2DT8A 2QMHA 1RM4A 2QD1A 3PA8A 3QLEA 4K5QA 2QX9A 4F4HA 2QIOA 2FFRA 5HF8A 1ZRHA 4NCNA 1W5EA 1BGXT 1QHSA 2YL2A 1L7OA 3MMPA 2Y0BA 4W5HA 1J39A 1C30A 3QVTA 4D8UA 2P5UA 1JA9A 4YJHA 3RC9A 2VNHA 3ZGOA 4KDCA 1M5UA 2O2XA 4CTJA 5LQRA 3TLYA 1H3NA 3QQ5A 5ER6A 1ZS9A 4LZJA 5CVUA 5F3DA 3KPYA 3THRA 4MWDA 1UWLA 3WNQA 5C0OE 1KIAA 4QPCA 4FFMA 3CZPA 4FBGA 4LQDA 2NU8B 5HJ5A 4IIJB 3NBKA 1K4YA 3QELB 1DX4A 2O3JA 1SK9A 1QIIA 4WK0B 1I2DA 2NTNA 3KZCA 1QO0A 2ZWPA 2DECA 3UV3A 4F7WA 3LHSA 1LDYA 2CZQA 3CVYA 1ZQ1A 5ED0A 3CSUA 5DI3A 5ENZA 2QLJA 4L28A 5EI5A 5F2NA 3GNQA 3WL5A 3OX2A 3ZQKA 3OEHA 1W2HA 1Z17A 4RJLA 4C1NA 3LHDA 2A5YB 4TXMA 3L46A 4X7MA 3KB6A 1NONA 2PUHA 2ZE7A 4N4AA 2XCRB 1HE1C 4I6GA 4A10A 2PLFA 5BYBA 3EOAI 3ZV4A 3ZQ4A 5J58A 2FWBA 3SSAA 5K0FA 3UGJA 3NIWA 3TXAA 1MRZA 1T0IA 1U6KA 3DOEA 4AT1A 1FDUA 5LXTF 3VJLA 1KEZA 1SIUA 1JHOA 4AJEA 3DE0X 5EP4A 2HV8A 3D7KA 2EQAA 3M0EA 5H80A 1ONSA 1V71A 1YHYA 4X7PA 3NPMA 1DBPA 1HF3A 3ZHBA 1Z7BA 1XC7A 1ZK3A 5ERXA 2G1AA 3OIUA 2OPBA 1Z75A 1I7QB 2J9GA 2XA2A 1E0KA 3G3EA 4N1AA 4GR9A 4DR4B 2WWIA 2YVUA 2FV8A 2AFHE 4HEJA 3BMCA 2BFFB 2YZMA 3K1AA 3L0IB 1YRYE 3X0DA 5HZGA 1FNCA 4QXQA 4E94A 4WECA 5H68A 2Q3FA 1ML3A 1N8KA 2CF5A 2D4AA 1JSZA 2CVHA 2FZKA 4B6GA 4R8VA 4UATA 1A9QA 1UFVA 1QPGA 1ZSNA 4R7GA 5DRTA 3BJZA 5A0VA 5AHWA 4OHPA 3G8AA 2HGZA 4R1SA 3HYTA 4Y9DA 4XGQA 1T1SA 4PQYA 3MGKA 3NHSA 1RHKA 4GWLA 3IHLA 3TLGB 1BNCA 4MW6A 1NVWQ 4JGBA 2X0NA 1U2DC 3JW8A 4FOOA 4P0QB 3KB2A 3WL7A 3NHUA 1QIFA 2H0RA 4ILEA 3ZCQA 1DC4A 5DM60 4KODA 3GLFA 1AB5A 4RXTA 2W2MA 3P0FA 2PK3A 1P2FA 1N6HA 3FJ1A 2G88A 1RXSA 3I6ZA 4YP9A 2IS6A 4PS0A 2AG8A 3OZRA 2J46A 3ANMA 5CEFA 1PFQA 5TT1A 3QWFA 4ZO8A 2XKBA 4E12A 1ZA1A 3HUFA 4CKZA 1Q21A 4LXXA 3R8XA 3VU0A 2E85A 4TMZA 2YBDA 2Z1DA 4LIPD 4F5ZA 1UEXC 3EPRA 2RG1A 3HKEB 5EKSA 3UMCA 1USIA 5BSHA 1NURA 2GEUA 5EQDA 4NMXB 1Z5UA 3QTLA 4S2UA 2QJFA 2PMKA 5FV7A 2R8PA 4Y2PA 2HA0A 5LIPA 3K8YA 1YB5A 5EZQA 2OKGA 3QFRA 3RJMA 1WP9A 3AUYA 3PU6A 3QBVA 4MB2A 3AR5A 3WLEA 5H4GA 3QY0A 4GU5A 3VTAA 1YE5A 3Q87B 2PBLA 1WW2A 4PAQA 3M3HA 1RWMA 3TD6A 1ESDA 1AUQA 1XZFA 2HOQA 1JHYA 1J25A 4BMSA 4C3UA 3JXEA 2BFEA 4DLNA 2NNLD 1U9CA 5EN4A 3PLAE 1I2BA 1XV5A 4FCVA 5E9AA 4R3UC 4Q93A 1HFWA 1RPNA 2QIPA 2Z83A 4TT8A 3MHPA 4BL5A 1Z07A 3DB2A 4L8WB 5BOVA 4MR8A 5A03A 2GI4A 2GR9A 4FU0A 3VO9A 1PRYA 3U7FB 1L5MA 2JFOA 2PMCA 1PE0A 4HDCA 2QZPA 2AN4A 4QQ8A 1F17A 2Y67A 3HBJA 3NFYA 2ZDGA 5IS2A 1GG2A 1PFGA 2CLOB 3SICE 4Z49A 3QF4A 4FSDA 3I5XA 1NVKA 4U6SA 4AMVA 2H2WA 3TAHA 2FX2A 2FW6A 1CIVA 3FRJA 2W6NA 1HTBA 5EWLA 1P2UA 1U9YA 3TBHA 2JFNA 3WGOA 3H2SA 1G8YA 5FO1A 1Z5WA 1SCDA 2RMKA 3BJRA 4FFVA 2CYBA 3LUJA 4QUAA 3X3HA 3JQAA 1J2YA 3L1JA 4YRNA 4ZI2A 3F3MA 3B36A 3UICA 1QE3A 4QFCA 3KQHA 1UKVY 2IP1A 5CUQA 5AKLA 1MB0A 5A02A 5HOQA 3GUUA 2BFCB 4HRYA 3MLAA 1UK7A 2O3QA 1YJ8A 4C2AA 1OV6A 1B8PA 1DMRA 2GFQA 4H4EA 4INAA 3UJAA 3UZUA 3AVQA 1IM5A 1NF3A 4HQOA 2VDQB 5MDHA 1XEWX 4Q39A 1N1DA 4JV5B 1P7PA 4G23A 4RMJA 3IEIA 4MVYA 1PGPA 4O2BA 5BO5A 5AXBA 1HZZA 2RK3A 3PC3A 2XAUA 5E7MA 4F9TA 5EZYA 3ZDRA 1NXTA 2W70A 2PKCA 1AK1A 4GDMA 3RG8A 5DWDA 3ZC3A 4RSGA 3G9QA 3MAGA 4RHTA 5HIIA 4PCUA 2PZLA 4D45A 2BHTA 4MUHA 1VL0A 2YFQA 2C9CA 4PNHA 4CMEA 5A3RA 4RM3A 1E1MA 2FFHA 5TIIA 2ZUUA 1XLUA 2JBHA 2QF7A 1PV4A 4BVHA 4QTXA 2W2PA 3PFFA 4ZOBA 3IQHX 3TSAA 3PWTA 2EG9A 2GOYA 2XNHA 1RC8A 4HH1A 2G9RA 1QPBA 2CLSA 2HA5A 4U9UA 5DASA 2G5GX 3RQSA 4EPTA 2AKAB 2K2QB 4JBWA 3BT7A 3OCZA 1XKLA 2YZKA 3BFVA 4BRSA 4YNBA 4A8PA 1OLSB 3LYAA 1UPXA 2FLVA 5GOZA 1IWBB 4PZZA 4WA8A 5LBUA 2FMIA 5DCLA 4F3CA 1XTTA 3SQMA 1JEQA 2VPZA 1J23A 1P0MA 1QB7A 1SEVA 2C77A 2QNBA 2Z9CA 1AQJA 2XCQA 5CCBA 4NDNE 5ALVA 1GPNA 3QNUA 4NE7A 3W06A 2CMKA 1H1TA 3W5DA 5FWXB 2KMLA 1S2MA 2VBFA 2BGGA 3RRXA 2LKCA 2FMUA 1NXOA 1WY7A 4BO6A 2FPIA 2K2WA 3L7NA 1ECCA 2F67A 4HC4A 2G4LA 3CVOA 3OMXA 4WXHA 5BYAA 3QYJA 2X4LA 3OY2A 4UKDA 3OVMA 1I3OA 1KVUA 1GDDA 4I5GA 1PUJA 3ESBA 5KBYA 5IAAA 2BBWA 3KJIA 4Z7QB 3BIXA 4KV9A 3K05A 4HDKA 4S0XA 2IXEA 1CJCA 1GAEO 1G5PA 1L5HB 1OIVA 1WSBA 1L8OA 3BXZA 3RJ9A 1OZHA 1I2ZA 1U3DA 2HMVA 2OCAA 3KVRA 3VPHA 1K7EB 1VDMA 3L4BA 4O4JF 4BMVA 3E22B 3DE5X 5LQUA 1YR1A 1BE0A 4DCPA 1X74A 5CVJA 2P5YA 3AI7A 3BH6A 3C97A 4UCWA 1VJ0A 5L3SA 4QARA 3SVTA 2VBGA 2B2XA 3VR4D 5E6UB 2O5CA 4X6YA 3F6YA 3AEKA 2V7PA 2GXSA 2I54A 2IPOA 2YC4C 4J0GA 4CHTA 4R3NA 1RXVA 5E4YA 5E0KB 4YRIA 3HLTA 3JQ9C 1W7AA 1F5SA 1OFVA 1NBWB 4KOEC 1B0PA 3KNZA 5B5SA 2VTBA 1EBBA 5KKAA 4YAEA 2O9JA 4OQQA 3SDBA 1ISSA 3JX9A 2CFTA 3BFXA 4U6NA 3BTOA 3NBFA 5F21A 3TUIC 5J2UA 2WUWE 2JH3A 4DR2B 2ZSJA 2J5QA 3DBRA 3VZRA 3GLVA 3KZOA 3QSYA 4YACA 2PYIA 2F62A 3Q1KA 5CNIA 3REQB 1TM5E 3WIUA 3KZKA 3MOGA 3PXCX 5EUQB 1CUZA 3KTOA 3UCEA 3RUCA 3QLUA 1GTRA 3WOVA 1O8CA 4G97A 4MAMA 1I36A 1UBUS 1UANA 2AMYA 4D5EA 4RL4A 5ER9A 4TMYA 3ZS8A 3OT5A 1B74A 2GPBA 3ZLJA 4L7VA 2QPOA 3IT0A 5AK5A 1W8DA 2HT6A 3UHJA 1I33A 3SX0A 4E51A 2PUCA 3DNPA 2PUTA 3QYAA 4KIWA 2Q1UA 4JBIA 4IDCA 4D8XA 1B6GA 4OHKA 2AI1A 5A3VA 1CR0A 1ZUNB 4CV2A 1O5TA 2H18A 1AQLA 4UMFA 4BP8A 5AM1A 1ZJ6A 2MSLA 4MUYA 4EJ2A 1ZGBA 3E6AA 4CGYA 1F8YA 4WH0A 1C4WA 4ZZ2A 3DKPA 3IV9A 1EXWA 3FZGA 3NYRA 1JFFA 4TV8A 2CCKA 4GKVA 1MDBA 3WMFA 2FPXA 3SIPA 2Q21A 1GYQA 1V7CA 1CIPA 1ZEMA 2HPHA 3F2IA 1H5UA 1JDUA 5JVDF 3U1BA 3LQKA 4CEJA 2UUCB 1EDDA 3ANSA 4D4IA 3MJDA 1SIWA 2FQ1A 4O2AA 3CZMA 1P1RA 1RWKA 1WUTA 3DC2A 5ITVA 3RS4A 3NTUA 3I9V1 3PI6A 2H5IA 3PB3A 1XROA 4M86A 5BRNA 3QE3A 4BO3A 4YXFA 2FPLA 1U94A 2J85A 1GITA 2JGNA 4XM1A 2B83A 3D54D 2OESA 1PZGA 3SU8A 4WL0A 2C0PA 4ZVSA 4HDAA 1R0SA 3BMQA 4CUZA 1J99A 3R5JA 4HDOB 4IHQA 1NUSA 4W4TA 2CHQA 3A4YA 2HLDA 2C7QA 4XDYA 4QQNA 4IICA 4B6RA 2WHXA 3IP1A 5CFOA 1QKJA 3ESYA 1KPHA 1UK8A 1CS0A 4M83A 4WMLA 1NM5A 3JYPA 4BYGA 3TNJA 1F20A 3ONDA 4PG8A 2PAFA 3OSUA 5F33A 3K2BA 1XWIA 1X7HA 1IY8A 1K2VN 3HADA 1Q20A 1QUFA 1IB0A 1HUQA 3E2IA 4BZPA 2O59A 2BTQB 4ARCA 2BJWA 2WMNB 2ZSUA 2HHJA 5E4FA 2X6RA 2C92A 3P27A 1QCZA 1MC1A 4JXKA 5LNK1 3X43A 2BBOA 3LLCA 3N59A 1KP2A 1HE4A 2YQ5A 3BEDA 2YTZA 2QSZA 3CC8A 3QWBA 5FX2A 2F55A 4LF5B 3AFGA 2KWIA 1QH1B 3IE0A 4AQDA 1LBHA 3HRIA 1FSFA 1D2CA 3HFRA 4D46A 4OX9Y 3ADBA 1TQ4A 2P79A 1MEEA 3DW1X 3HMQA 2A0KA 1L7XA 4QOSA 1ISHA 5SICE 3QX3A 2ORIA 4OOEA 1PK7A 2KB0A 4AKEA 3KLNA 2E82A 4I6EA 4MW2A 3K53A 4L4SA 4KQJA 3GOHA 4KMSA 4B2IA 5T5QA 1IN7A 4RY8A 3G0IA 2P78A 3D2AA 3QLVA 1W93A 2WE7A 1FMJA 4D4LA 3RM3A 4XQCA 2UXCB 3ROTA 4BPRA 3SM9A 1OFHA 2WBLC 5CDGA 2CWWA 1LBTA 5JR3A 1V6CA 3A14A 3IIMA 2D1YA 3MZ0A 3RU7A 4WKOA 3OOHA 3PGMA 4Q3CA 2DSTA 3D0KA 4AP9A 2H1LA 2P67A 3ILVA 3ZI4A 4DQLA 1BDHA 4HXYA 3ZEAA 2FZVA 3EGCA 1IPHA 1ZK4A 4LRUA 3THSA 1NU8A 1AMOA 4IXNA 1T91A 3F3SA 1M34B 1M0WA 1J2RA 1OGYA 1XDWA 2BLNA 3DV0A 4OHBA 4FC7A 4LBVA 5E2IA 1JH8A 2JA2A 1TM2A 4PY2A 5LYYA 2V0CA 5AOCA 1ST3A 4JUAA 2ZS9A 2BL4A 3O4JA 3LUDA 4MLZA 1D1TA 2C2OA 4GO1A 4N5HX 5BNIA 2I4IA 3RJTA 1QNFA 2CFOA 3AGQA 3H9CA 4OP1A 3ZY6A 3A3PA 3CLRC 2FR8C 3M6UA 1UJNA 2Q4OA 4ZVKA 3G59A 4PSVA 2WICA 2O57A 2ZRMA 3ADKA 2RC5A 3DLAA 4LBYA 4OHFA 1IONA 1AB6A 3KKLA 2VJMA 1YC2A 1TVKA 1ZWLA 4FDUA 2ODNA 2FZCA 2JI9A 3DDZX 3K0AB 3VZCA 4EHHA 2JJ8A 4DDKA 3B1YA 2F3SA 2X9NA 5IC5A 1JJBA 5K01A 4HAOA 2I2AA 1M1NB 4UVIA 4BUCA 5ALQA 1Z2PX 3NS7A 3DE4X 4XKJA 3SSNA 2FMFA 4WGGA 2Z3WA 4XSVA 2HPZA 4DT1A 4L78A 1XO1A 3QUAA 5K3CA 1NPDA 1S7GA 2HJVA 2O2EA 1ADBA 2PT5A 1YB4A 2QI9C 2YN2A 3QVGA 3R0JA 4JJ7A 2NT4A 4O25A 1Y3FE 1H2FA 1A7AA 2JGRA 2Q3CA 4ENUA 1EFDN 4DJAA 3R0ZA 4GBGA 3ZI7A 1K0FA 3ENQA 3A6HA 4MS4A 4ZAXA 1KE1A 1JR4A 1OWMA 3GWZA 1XLTA 4I1PA 1U9IC 3S40A 4MLPA 4YWHA 1T35A 3E2PA 3ZJYA 2ZQ5A 5JI3E 3QFTA 4MB6A 3N2EA 1FPQA 3IHKA 2PV7A 4KN8A 5C46F 5ITZB 3G49A 3HL4A 5I8PA 3RHSA 5L4SA 2P2YA 3NXSA 3PUJA 1IPFA 4MAFA 3R7FA 4F1KA 2FUG1 4Q7LA 3TW8A 5KX5F 4FGLA 1FXWA 1T2EA 2ZWIA 3M6FA 2CVPA 1C0EA 2RGYA 4LSMA 3IS3A 2HHAA 1NNI1 3CT4A 3OUTA 4DLWA 4ISCA 4F9EA 2ZIFA 1U5CA 2I6GA 3H2HA 1HOXA 2F3TA 2CJWA 1IM8A 4EJSA 5LD2C 2G1JA 3FIUA 1CUXA 3I76A 3MWYW 3GJTA 4I5EA 1NMQA 4RK0A 1H1LB 1O9BA 1L5SA 1PUXA 5BR1A 3ET5A 1NYRA 1VI6A 1TEHA 1BXRB 4CM4B 2P4SA 3AR2A 4IVRA 4KQ2A 1PEDA 4NBLA 4QU9A 3T7AA 4DEVA 3U1VA 3PNBA 1VJ5A 3WICA 1J0AA 3FPEA 1F4PA 3MWDB 4OG2A 3ZHOA 2IYTA 3G2OA 2Y2VA 4ECAA 2IYUA 4XWGA 1A4XA 3ER8A 3X1ZA 1G5TA 1LDEA 2JFUA 3AOEA 1XD2A 3PKJA 4ENQA 1EXVA 1Y7TA 2XV1A 2XYHA 3F7TA 2ERXA 3G9ZA 4MPJA 2D5IA 3C8ZA 3C3JA 1VZ2A 2BGTA 2VZEA 3KKZA 3ONFA 1C1XB 1G8HA 2G5TA 3P52A 1LI4A 1QVWA 1IMJA 1MT0A 3ZCXA 3ZDBA 5FBHA 2I4LA 2O8FB 4KE9A 5CDTA 3VKGA 1R0KA 1W47A 2JIZD 3I1FA 4DLAA 3HCAA 4H6WA 5AJUA 2W2OA 1JG2A 1KBOA 4BLRA 3B78A 2X8AA 1R12A 3P4YA 2IUYA 4YONB 1K08A 4DA6A 5J4KA 4EG1A 5EIBC 2PMBA 4RA6B 3UFXA 5EWJA 1OX5A 5AK0A 4EBFA 1GTZA 3HL0A 4ZT3A 4BV2A 3MOSA 2BEJA 3PPWA 4HQLA 4HDNB 2O50A 1GUBA 2O8DB 3LC2O 2BCGY 1SBZA 2D2VA 3JYLA 4PYIA 5EIBD 5AT1A 3HCWA 2AEEA 1JJVA 4D02A 1PWYE 4PYKA 4RGVA 2IHJA 1GPMA 4GBMA 2RHHA 4H59A 4RMHA 4ARIA 2D2EA 1KPGA 1OYOA 1OH6A 2X2PA 4DNPA 1KYZA 3HY4A 4NTZA 2NP7A 2FF7A 3ASVA 4IHJB 4W8OA 5G1OA 2G7ZA 1MO4A 1XNHA 1JKJB 3CBGA 1IXZA 2OZPA 5FYDA 1XU4A 2GYVA 1JIVA 2IGBA 3M8KA 1K4KA 3OEED 1U11A 2C82A 1A72A 3TQTA 4JLBA 4LF7B 3FFXA 2YCLA 3L7MA 4Z4QA 5CTAA 3I4CA 4RYLA 4RSMA 1CF4A 2O07A 1YCGA 4KLCA 2R1VA 2JGIA 4ZCRA 3PXXA 4R98A 2NU8A 3VVCA 2HRBA 4CLOB 1DBVO 2HK7A 3K6KA 5TARA 4Z4FA 3O03A 1RQ7A 2Z2XA 3G5UA 4HP8A 1DG9A 3KAKA 5HX7A 4II7A 4YROA 3UUGA 2YUTA 1CP3A 3IUEA 3HV2A 4QOEA 3ADOA 3AVOA 5A9SB 4BIMA 1IBLB 1GKUB 2FX5A 3GXOA 2CVFA 3KLBA 3RSSA 1P4HA 3SPXA 2I55A 3QRWA 4AJPA 5K0CA 4LBWA 1F8GA 2R6AA 4YAKA 1CV2A 1K7XB 5FPQA 4GYYA 3IOCA 3NM5A 2X0DA 3ZCPA 4PN7A 1LBSA 3TWOA 3WLLA 3LW7A 2WWTA 2HQRA 3F9CA 2FWJA 3R4VA 1E8MA 1XALA 4O2RA 1KH1A 4Z9YA 2E37A 4C4XA 1STOA 3RRFA 4F12A 4DVGA 1K4MA 3PGA1 3RU3A 2HA7A 2J7PA 2AJ8A 1RE0A 2VP2A 5FUBA 3I30X 3RPEA 3B1ZA 3GUHA 2VSXA 3H1EA 5HWSA 2BSQA 4YMSA 1JU3A 5JMOA 4TS1A 4BNIA 4BOYA 1MQSA 2JANA 2IEIA 1MABB 3P20A 4AECA 4OYRA 3IYLW 5JAOA 4IXWA 2FHPA 2Z04A 3F67A 5C81A 4BX0A 4BBPA 4F1WA 2BFFA 3ITKA 1E96A 3FHLA 4PFQA 1ZA2A 3ZD8A 1TYDE 3IVMA 3B9PA 3P2MA 5INTA 1XDBA 3EWNA 3G9UA 3O8LA 2OQRA 4H3SA 4MI1A 4KO1S 3TD9A 5KIAA 3NAQA 3I4LA 2FN3A 5C8ZA 4UQOA 3K2IA 3P2YA 4EMBA 5AFSA 1YB6A 2ZUBA 4OI4A 3K70B 2PMEA 2Q0SA 1CUHA 3TLGA 1JMYA 2ZITA 2NXEA 4YREA 3DVAB 3P4XA 3GLUA 4M1OA 2OVBA 4JMPA 3RAPR 1YUNA 1ODIA 1U81A 2BZ0A 2WZQA 3PDWA 4EI7A 4JODA 3A28A 5CHEA 5IP5A 4FW8A 2P1ZA 1HQKA 3MELA 1WIWA 1N6IA 1VMIA 5U9CA 4MVJH 4DLUA 4WKNA 2WFLA 1Z4PX 2HREA 2CSUA 3WIEA 1F60A 2JK0A 4RADA 3LK7A 4UVHA 3ZPXA 2VA9A 5FADA 1FNSA 4XQ9A 5CFMA 1TF2A 3IBCA 3EXAA 2PT7A 3KALA 2IOYA 2VP4A 3L6EA 2K6GA 2OK8A 3EVGA 1CLEA 3HKEA 4IDBA 1DZ3A 3CPSA 4GIBA 2GZRA 5K8UA 3ZV7A 1ZWKA 2NZXA 1ONOA 1ZLXA 1NW3A 2C2HA 1RM0A 2IUFA 2W8ZA 3KXIA 3VI4B 3ENVA 1PIWA 1J7JA 1EFVB 1HNXB 3D3WB 5JV5A 2WAXA 1E7RA 1NW8A 1PF7E 4NS4A 4NBVA 3C14C 5HHTA 2LP4Y 4J2OA 2FE4A 2ZT5A 3UV7A 1XDZA 2HMUA 4L4ZA 1NW9B 1N2BA 1W36C 1JILA 3T7KA 2I4OA 4QPDA 3AQIA 5DWVA 1VHLA 3WY9A 2OOKA 2ZRCA 2CHVA 3MW8A 1M6WA 2WD7B 4J16C 5MGBA 3LXXA 4R9VA 1MX5A 2A84A 1NLZA 3BUSA 4O1IA 1TF5A 1A8IA 4CFZA 3A04A 2FG5A 1SQ6A 3P9CA 3FPGA 4PPGA 1CB0A 4QDXA 3HM2A 1U98A 1JDBB 2XBMA 4S3MA 1TO2E 3MCWA 1ZCBA 5FV4A 3IOEA 1NF9A 3VH4A 1H0RA 1MJHA 1GD1O 1NOIA 1XVAA 4HPXB 3IDQA 3OH8A 4WRRA 5CX4A 5EMMA 1F8XA 1A50B 1PP4A 1Z36A 3WHLA 4ZK6A 4QPZA 5CG2A 2FQXA 2FSSA 4FOLA 3ZI0A 3QVUA 3CEMA 4FGKA 3QUCA 5JHGB 2L42A 3OQNA 1CUJA 1NQXA 4A8JB 1A97A 3CH4B 4IUBS 3WB1A 4Q34A 4F7DA 1NVMB 2JJ2A 3R0QA 2UVPA 1FUKA 4HPWA 4GX0A 3DPSA 4S12A 3RS0A 5KJFA 2Z2KA 3IL2A 5ECGC 1FB5A 3CX4A 1RM3A 5GWXA 4C29A 3HC7A 2AJBA 2AOUB 10MHA 2PJZA 2QA5A 3DTNA 3VR3D 1HC7A 3PTAA 1HRKA 2I7VA 3UT5B 1DKRA 2H2AA 1ZIOA 3AHCA 3GVCA 4IQ8A 4OJYA 4BYMA 4BQFA 1EX1A 5IPFA 2QP3A 3ZG6A 3K9GA 3COJA 4BV9A 1TNDA 1OBHA 4ZVLA 4GI5A 3KP1A 1ODLA 3E8XA 1S8NA 2C84A 5BUZA 3R7NA 2ZR8A 4KIGA 5LXTB 2NVOA 2ISSD 1U2RA 1V8OA 1YB1A 2X15A 3AIIA 4GX5A 4O5AA 4BVGA 2R6FA 5DN9A 2X0RA 2X1LA 3HUDA 2Q5JA 3G82C 4MPPA 3W5VA 4HR7A 3IVXA 3WDSA 4PPFA 1WLSA 1XNJA 4ITVA 3RAJA 1D0SA 1P4JA 3EC7A 3GG2A 2QTRA 3EVZA 2B21A 3C6KA 1JALA 2QP9X 4C3ZA 4EG4A 1OLUB 3JYQA 5IFKA 2I91A 1H2RS 2VAVA 5JG7A 1W4LA 1ATIA 2EFYA 3KKOA 4GC5A 3WGZA 1QGUB 1Z13A 4IUYA 4DV3B 3TW6A 2IOHA 1E18A 1G2QA 3F49S 3ACDA 4RJJA 1MPXA 1AX9A 3G8YA 3T9CA 1CEQA 4CM1A 4WBNB 1JBKA 3F78A 2ZRPA 4J07A 1HTTA 1OLSA 3KE8A 4G5QA 5IKOA 4F4IA 3S2GA 5MN4A 1DHRA 2VBCA 3T94A 3SX2A 2GRJA 2IUUA 4YMLA 4AJLA 1UQUA 2O0JA 1EUZA 1Y3DE 3GDWA 2V65A 3CF6R 3EMKA 1BMFA 2PXXA 3G0HA 9MHTA 4MO2A 1FZQA 4F97A 4E2WA 2QRLA 4CG2A 1ZD8A 2FG7C 4WLUA 1OHHD 5FWXA 3U61B 1NN5A 1V1RB 1KFEB 1TCAA 1W85A 1NPYA 1SRQA 3LVQE 3IUMA 4KX5A 4LHYA 4N5DA 5ARCA 4C7OA 5BOSB 1J24A 2XTZA 4X6XA 3ST7A 3T06B 3QBJA 1G17A 1HDYA 5M7EA 5F9HA 3HJTA 1UKEA 1CF2O 2QRHA 1EFKA 2DHRA 3MJTA 3K8ZA 4BMCA 1JBEA 5HKLA 2QL5A 4HEQA 2NXCA 4RCZA 3FPCA 4JQYA 3O1JC 5TVKA 3IKTA 2OD2A 3HH8A 2DPGA 2D1QA 1L5HA 1T5BA 5JNUA 1P3JA 4MMXB 4ZAYA 2DPHA 3AEUB 1XXHE 3BB4A 4KMMA 3E22A 4PAOA 5EUBA 2NZVG 1LBEA 2Q2NA 1TCVA 5AJYA 2Z3ZA 3LSTA 4GL4A 3ZWAA 3WL3A 3T95A 1LFDB 4QDJA 5CMLA 4I1IA 4JEUA 3CIOA 4HH3C 4LN1A 3WE7A 2OCKA 2XNJA 5LP6C 4CEHA 3RVRA 3U4IA 1ZRSA 2ATIA 5E6UA 4EELA 1UOEA 4H7HA 2KYRA 4PHGA 5CLQA 1BROA 1CFZA 1NY5A 1XTVA 4XIGS 5ALFA 1E2DA 3K8OE 4B47A 4ER5A 2CHUA 1O5IA 5ALSA 4S2EA 4XM2A 3RW9A 3WMWA 4EBBA 1P77A 4BWYA 2E4AA 3U9SA 2OM6A 1Z2EA 1JHVA 1TJ4A 3FWZA 5JPIA 3UH0A 3LQYA 1B16A 4CQMD 2X0JA 4NFLA 1QHEA 2JGMA 2NZUG 3B6IA 1G20B 5KAMA 4GOND 3KXPA 3REQA 1W4AA 1PX2A 3H1FA 4MIEA 2VF2A 4OHMA 4X63A 2WPDA 5HQ3B 4DGQA 1K7YA 2ZRKA 2A6PA 4YRAA 1ZOIA 2R25B 3CSSA 3KQVA 4AKTA 1OT5A 4GZMA 1TMOA 1NDHA 3QKUA 4GBJA 1QC5B 3ZK8A 5B1YA 5TQ2B 1CQIB 1A3CA 2AUNA 2DFLA 2ADMA 2H5JA 2P6UA 1C7IA 3E1KA 1KEEB 1T5IA 4TWAA 4XX0B 5H02A 1A9PA 4HXEB 4IMIB 2P6OA 2R6CA 1PI3A 2AL7A 1YJXA 2HU7A 1HT3A 1NVAA 3GDHA 3VNAA 3CNBA 1ZUNA 4PO9A 2NO0A 3WQBA 4DQVA 1V6AA 2WK1A 1IHDA 1RFLA 4UMEA 4QGSA 1W0CA 3V8VA 1I80A 4Y6OA 1H2EA 1JL3A 1JLSA 3GFPA 4P53A 4RQAA 4K28A 2R1TB 1VC2A 4K9NA 3CZQA 1C9NA 3IERA 5FJJA 3TAXA 1NT4A 2FWNA 1A9ZA 1J06A 2FSGA 2QTZA 2WMYA 3EXEB 3I32A 4YUWA 4WZBB 1MQ8B 4Y9TA 3L7OA 3KUCA 1SU6A 5ES3A 2J32A 5ICMA 5JZVA 1YE8A 3LO5A 2QVBA 1DC6A 3RANA 4ZAWA 2XUAA 1NLMA 3HUTA 4RNCA 1ZZEA 3VR1A 4E11A 2FWPA 3I2JA 5L45A 1XRRA 3FAKA 4Z4HA 3TKLA 3OMWA 1VMKA 1EX9A 3P9SA 2PFSA 3NBQA 4M6WB 5AKXA 3FCYA 2DLCX 2I7DA 5C32A 3HCCA 3N7TA 3VR2A 4BV3A 4OU5A 1UZMA 4BNYA 4DSUA 3RF6A 3GLHB 1F5NA 1RIIA 1I51A 2IDJA 3CISA 5HW0A 1EFLA 2GWHA 2R6R1 4P2BA 1UXJA 3FPKA 4RKFA 3RJ5A 2GT1A 1QS0A 3RROA 3HFSA 4MUMA 4DNOA 3VOSA 4AF6A 5IRCD 2J4CA 1ZI8A 4RHCA 1J8VA 2I0FA 3HPQA 1IDN1 2CL0X 2BTQA 4KR6A 2RB4A 3AR3A 3DDOA 1PR2A 5DX8A 3VA7A 2YWDA 5AVZA 3OY7A 3IUSA 4YRJA 4BWVA 1NLYA 4UHHA 2XE6A 1C7FA 4EENA 4X85A 1TF7A 3KHSA 4GOJA 4BLSA 1N5KA 1JHUA 4RVSA 2PR2A 2YYAA 1QH1A 2E4YA 2NUTA 4O4LF 4KUEA 5FEUA 4JI2B 3CZRA 3TLXA 1S7CA 1JKXA 3IQZA 4QTZA 5LUBA 3SYNA 3OJ0A 2HA4A 1C8BA 3G85A 2C1XA 3LGSA 2ZAGA 2OZVA 2Z3VA 1L5WA 1A7KA 3UAYA 3Q3HA 2VRCA 3SYTA 4HD8A 2WFMA 3ORSA 2HT1A 5CLFA 2ENUA 4B3BA 5CU7A 3PFIA 1VZ3A 2GCNA 3EZ9A 4L0QA 1UFRA 3IVAA 1XZNA 4IOLA 3G88A 4PBSA 1YRQA 4UBKA 1IHXA 1Z4QA 1KEWA 1KFBB 4YCCA 3TJRA 2B3DA 3ETDA 4CG1A 4MLDA 4A5SA 1ICEA 4WFIA 2ORYA 1TKCA 1QVRA 2FSVC 3N1UA 3DJFA 3DZJA 4N9QA 2B37A 2A9RA 4J7CA 1O89A 3DC7A 2XMGA 3GA7A 4PZEA 4WKBA 1Z7GA 2CLLB 3A9VA 1HPLA 1WB4A 4WCFA 1M34A 1VKNA 4PIVA 5ITZA 1ZM3A 1ZX1A 4QULA 5CK5A 3D6UA 1X86B 4NCJA 1LCIA 1RHMA 5DBEX 2PMDA 5DK6A 1VYVA 2YJGA 3OE7D 1P0IA 4KYUA 1VHDA 1RKUA 5CB4F 1EDZA 1NPTO 3ADCA 5EXPA 4N8SA 3I73A 1W5AA 4NCXA 4KR0A 5HZMA 1UXKA 1KO5A 2A5GA 4TWRA 1QKKA 1N5DA 4CT4B 2ZI5A 3NQ41 2J5RA 3GZJA 1Y5NA 5AK4A 3C4VA 1SH7A 3R5FA 1A9XB 4WDQA 1ZY2A 4PX5A 4BMYA 5AXCA 4RTLA 4QOJA 2CJPA 4HX2A 1DB3A 4TTAA 4XLLA 2JFXA 4BVKA 3NUQA 4B74A 4U5XA 3TNLA 2XZPA 2OENG 2VRNA 3NHFA 1M1NA 4Q6BA 3QXGA 3UGTA 4TL8A 5DHTA 1QO0D 3GH3A 1VMAA 1RQ2A 3FYCA 4L4UA 1UFOA 1C5KA 4BJ3A 2HWYA 4IIDA 3OICA 5CW1A 1KZGB 4LTNA 3LF1A 3OZGA 2CNOA 1KJZA 5FOVA 3I28A 4YX9A 3NU1A 1OC4A 4NX2A 1W1IA 2A0FA 4XPZA 2BT4A 3IQWA 3TSCA 1AZSC 3TSYA 1RADA 3MCTA 4RD6A 3QXHA 3THWA 4F11A 4HT3B 1I9CA 3I2HA 1YRWA 3SGLA 1T9GS 1ZIPA 3ZBPA 2BM8A 4ZI7A 2Y1KA 1DOAA 2IKQA 4WUVA 3VC2A 4E5YA 4BDSA 5EP1A 1R5OA 5TXGA 3RC1A 2P9EA 3T3DA 4BATA 2D5BA 3CT6A 4BWGA 2O2CA 2Q1YA 3R23A 3CPJB 1LFAA 3FOCA 3FZNA 4I8XA 5DZSA 4LHSA 1L4LA 4OLAA 4B3FX 3WAGA 3IC5A 1P7ZA 1Y3AA 1P44A 4LVNA 2FUKA 5DNYB 2UV8A 1TIPA 3LTEA 2COEA 6YASA 3DNMA 3NC0C 4TWIA 5THXA 2DPLA 2OM2A 2D2IA 3PICA 4BLQA 2JIRA 1IHYA 2G77B 4L6CA 2Q7OE 4PYJA 2MDTA 2WIAA 2DC1A 1TD1A 1WDWB 4ZKEA 1DRKA 3C3MA 4PVCA 3OCYA 1XVUA 1FP1D 4QUHA 4Y6QA 3THOA 1NQUA 4L07A 5F78A 3TFQA 2V74B 5C1DA 2W98A 5LMNB 4DJJA 2OB2A 1MIOB 1ISFA 4G4SO 4EX7A 2JIQA 2BHSA 3E58A 1N8TA 1H1LA 3H87A 1MAUA 3PCXA 4MGZR 5J2TF 3C15C 2J09A 4UAJA 3USZA 4RHXA 5EE1A 3C3PA 3RWOA 1BXRA 1Y82A 2ZI6A 1JHRA 1IN8A 3IUNA 3V4ZA 1SURA 2F9FA 2W8BB 3SBOA 3MWDA 4OF4A 4JLAA 1KMNA 1FYVA 3DCJA 4HWKA 1OB2A 1TT5A 4JR2A 1CX9B 1OREA 4YGYA 5THQA 1JJ7A 1AS2A 1K06A 3YASA 2CXHA 5C31A 1VSUA 1EDOA 3WLQA 4PLYA 1D6MA 2Z4TA 1NQTA 3FYTA 1C1XA 2PD6A 5LLDA 1C9MA 1EM8B 2O8FA 1KARA 4WFQA 4K6CA 2E2WA 2F00A 4B6QA 2VUTA 1C3XA 2QORA 3E5RA 5KB3A 2VQ6A 4D5GA 5K4HA 1FDSA 2HTEA 4ERNA 4EPXA 5L9AA 3HCRA 4JYAB 1EDBA 1UOOA 1PWXA 2PS3A 1AT1A 2WHPB 2QTMA 4QHTA 1KOLA 4GKJB 4QNRA 1JEEA 4PZ9A 7ADHA 1E4EB 4RA6A 2XGOA 1IRIA 1JAZA 1YZLA 1ISJA 1KFKB 3PG5A 4F85A 4F2DA 1BJRE 1G8AA 4RH0A 3F96A 4QD3A 5LZ4A 1YVEI 2C5EA 2KM1A 2XMRA 2ZJ3A 4ZYVA 1NZJA 2O8DA 1OE0A 2DR2A 2C3UA 1JF8A 3WWZA 4BEBA 3C3XA 1EAMA 1NDQA 2EL9A 3WK8A 2RKWA 1YS7A 5HF9A 5TPZD 3FPFA 1MMFB 4UHCA 5IKEA 4N48A 4CTOA 3M4NA 4C30A 2EP5A 3E0XA 1N3IA 2VHQA 3IPXA 4IHJA 4WJLA 4MKGA 4E5KA 1OFIA 1HYQA 2RGWA 3C98A 2OLKA 4Y8VA 3JVEA 3L1VA 5HNKA 4IQFA 1C9YA 4WXRA 3GCDA 1LGYA 4DRYA 1OAOA 3IPLA 3NH9A 4MCAA 4Y9UA 1VIMA 2Q5HA 4LJRA 4NH0A 3C6QA 2H1IA 5CVCA 3BWYA 5DYWA 4CLOA 4G0MA 5LNK6 3DVQX 2F7SA 2PUFA 2CHEA 2IFTA 1Z4LA 3CZCA 4GZLA 1Q83A 3MOIA 4H31A 4NYMR 4A92A 3D3EA 1K6XA 1XD9A 3K73O 4MVJI 4KFTA 4HVAA 3ONEA 3HYRA 3W5BA 4AZ3B 4YPVA 3AXSA 2CBGA 5KWVA 1V8FA 2TECE 3AKEA 2CB0A 3D6TB 3L8MA 3JQAD 4Q9DA 2RH9B 4R68A 4Q9KA 4OK5A 1ZRMA 3H6KA 4DRXB 1JR3E 3GLQA 4UCFA 3UJ9A 3ROMA 2PTHA 2AJCA 2Z5LA 5AQ1A 2WF8A 1OD6A 3ENZA 5EPUA 3SZLA 1WULS 3C87A 3SHFA 4XVRA 4I8DA 4KFRA 5F7ZA 1Z6TA 4PZDA 2P40A 2QG9A 2BJHA 5JSYA 3Q8MA 3N2GB 5I45A 5DGXA 2RHOA 3F4BA 2EKQA 4UE2A 4B8YA 1DUIA 4XCQA 3QXXA 2WIDA 1UP7A 3UHFA 3X1WA 4YV7A 2IE8A 4GKAA 4IFTA 1F4VA 1MABA 3EDOA 4M9UA 2WJ6A 1E94E 2AQIA 2EC5A 2H4ZA 2BGWA 2J3IA 1RMTA 1P9LA 2AR0A 4HX5A 1VE5A 2CYAA 4KV7A 1V16B 1ZSYA 5G53C 1O95C 1V95A 2P9HA 3RTEA 5DCWA 1GHTA 3ZHYA 3LPNA 4RCVA 3KCQA 3RSZA 1RYYA 3HBAA 5IUJC 3ZCSA 5KX5B 3TPZA 1WBJB 1MZVA 1JHDA 4QGFA 3RWBA 2Z8ZA 1C8LA 4J0DA 2C96A 1QGZA 3ESRA 1O95D 1ESNA 1IXRC 1P1IA 1X2BA 3LYUA 5SY4A 4EY5A 5ALKA 3OA2A 1Q7BA 4DDUA 1G21B 1XIVA 3DVAA 1T3GA 4P4GA 1PGNA 4IRXA 4NP6A 4EABA 4NC9A 1WU7A 5JNRA 1KOFA 1R9NA 2OV6A 1CDOA 1C9KA 1Q7RA 3UOWA 5BMVF 1A5ZA 4ARVA 2C42A 3PC6A 2ON6A 4MR9B 5BV1A 2OZLA 1T9AA 2YVAA 3PUIA 1JQDA 3MMZA 2DAPA 3BCSA 4C76A 2C57A 1E6KA 2PBZA 1S2GA 3LJKA 5CW2A 2XD9A 4RF3A 5LB2A 1J07A 1GA4A 2PNJA 2EZTA 2B9EA 5IBQA 1T43A 1Z7YA 5JS6A 4K9QA 1V2GA 4ZOLF 2G83A 3W90A 4BTEA 1EFVA 2REXB 4G1VA 4PNPA 2I6XA 3D3WA 1XDDA 4HAZA 4OH7A 1F12A 3DCYA 2X14A 3FZYA 1M67A 4QSHA 3JALB 4A1OA 4BN4A 3AY3A 2JFHA 1CQXA 2VZLA 2Q99A 2PRIA 3IDAA 3VTFA 4F84A 5AKGA 3TLMA 4Z3OA 3W9BA 4HY3A 3LI2A 5B2EA 3MRVA 1QGAA 3MCZA 4ZARA 1X7ZB 3LFUA 3THWB 4IGFA 4AJIA 2WD7A 3AI3A 2EFEB 4IH9A 1CSEE 3RTAA 2FUG6 4B09A 3WKCA 2FG6C 2EZUA 3RWMB 3UAWA 4AG6A 3LUAA 4LKRA 4ER0A 5C52B 4MDEA 1CTQA 1RXUA 2P35A 3JAWB 4I50B 5A71A 1OXSC 1KOGA 1M76A 3Q40A 4HB2A 1WZUA 5CLJA 1J8DA 2GTIA 1QFZA 1FRFS 3VR5A 5HE8A 2HCJB 3MJVA 3KPJA 3HLKA 3G5LA 2RJOA 1L5OA 3BFJA 3RARA 4DV6B 1A71A 4H35A 3KWMA 5FP0A 5HXAA 3T3EA 3JQGB 4IL5A 4ZALA 5AXDA 2PX3A 4D74A 4GDFA 5JYBA 3ZWQA 3FGNA 2JATA 4A8JA 2VTKA 4XUEA 4F5DA 1M1ZA 3N2YA 3O8DA 3RS7A 4BEWA 3LRTA 4Y9RA 4IDOA 2R4TA 4I9FA 3TTTA 5E3IA 1TZJA 1RTTA 2DERA 4PZUA 1XZPA 1PU2A 1YASA 2GJSA 3EAFA 2AOUA 3DUWA 1KS2A 3TBKA 3CV3A 3UT5A 2XQIA 1EK0A 2G80A 3MSCA 1SR8A 1GAQA 1I3LA 4HDRB 1OBOA 2IOFK 3E9QA 5AM5A 4G5OA 5JBNA 1M7HA 2R84A 3DMHA 1OYWA 3ILHA 4P4SB 3A9RA 2OT3B 3D0QA 2HLNA 1V9SA 2JZOA 3OHPA 5LQCA 5LXTA 4O8CA 3FLAA 2Q1XA 3HCPA 2CNWA 1RABA 3ZTTA 2O2GA 3ETGA 5IYZF 3EC2A 2BMFA 3ABSB 4PLPA 3TIGA 1JBQA 3WL8A 1UMCB 2QY9A 1X77A 4TM7A 2E4WA 721PA 2DOKA 5GGYA 1MB4A 1N7HA 3DGFC 4KW7A 2Q5EA 4OQYA 3ZW7A 4J9UE 2IU0A 3UY4A 3GJSA 3FCSB 1OLUA 3I9KA 1KP3A 1UWKA 3BMOB 3GEEA 5EMJA 3OWXA 4GPAA 4AKSA 4NNJA 1QGUA 2QRGA 1K89A 2OO5A 1YNOA 1W0JD 1YBHA 1SBIA 4YBZA 1AHIA 4ZPJA 4ZC1A 3H0KA 3RE1A 3TNDA 4BZWA 2X6QA 1JS1X 3GEBA 3V1NA 3ZK9A 2F8LA 3NVKI 1YDHA 4CU2A 2UVQA 2ZBVA 2ZTUA 1F2VA 3GGSA 3TFOA 2LBPA 5B6PA 3G0GA 4N5NA 1Y63A 3ZIDA 3ZU5A 3IHTA 2P9TA 5B36A 2EJVA 2QXTA 2ZIWB 3PUXA 5DW0A 3ROPA 1CQJB 1MH1A 1A2QA 2F8TA 2H2GA 1V1RA 1O57A 1V4BA 2QM3A 5LBIA 3WJAA 5LOVF 5BOSA 3K0KA 1I9GA 1ITZA 1IAQA 1AURA 2VH2A 3PTLA 4JVSB 5K51A 3RLFA 2WVJA 4I1SA 4JL8A 3NLLA 1E63A 5DHSA 7GPBA 5CT5A 2VHTA 4B6PA 5IANA 1DO0A 4YRRA 2JD1A 4GH5A 5EXSA 3KHTA 3M1YA 3ZWWA 4Z54A 2R8XA 2QR5A 3CFYA 1R4AA 2VH5R 4MMYB 3IEVA 3CA8A 3R7LA 3RT7A 4BE4A 5H3CA 3AEUA 2ACVA 5KMGB 5BV8A 4EPWA 1DWUA 4W1PA 5EESA 1E2LA 4B6FA 5KTKA 2FXIA 2MIIA 4ZAFA 3IUJA 1BYUA 3OE4A 4ETIA 5HUJA 5SZJA 1U2PA 4C7KA 5JCOC 2PH5A 2A9OA 4FN4A 4I4IA 4U2CA 4EITA 2QDXA 4RZIA 4D3FA 1U0JA 4NZZA 3RUFA 3ZY4A 4N3NA 1ZL0A 3C43A 2C4KA 2RGDA 4V0OA 5K8IA 1JDVA 2CJYA 3SYKA 4JQSA 2AX4A 4RV4A 4AX8A 1D9ZA 1W30A 1T9GR 1UC4B 1DRUA 4ZAGA 5EKUA 3UMSA 1WDTA 2G17A 2XITA 3LUKA 1E6MA 4FSXA 4GP9A 3DTVB 5C1BA 3VFDA 2IT1A 2P9CA 1E4OA 2J48A 2HZBA 2WAYA 5KJEA 1YGPA 3UJ7A 4BKQA 5KQSA 3P9QA 2WYWA 3SE0A 1G20A 3GT4A 4PZYA 2PG3A 4CFSA 3EIUA 4ZT5A 2RGNC 2G4CA 2RAFA 5HQ3A 5DN6A 3VVLA 4D9IA 3TF5A 3QXSA 3DF9A 2DWUA 3N58A 3R75A 5HS4A 3G2PA 1CQWA 1WMDA 5CVDA 4KWCA 1O54A 1QC5A 2C3PA 4OXKA 3F5FA 4ZMSA 5JZMA 3HM9A 3OQOA 1T4MA 3OM0A 1WXIA 2X42A 2J6CA 3FZQA 4RGQA 1ILEA 3L9WA 4Y30A 2IWRA 2GM5A 1OI3A 1M72A 3NM6B 4J0KA 4Z6KA 3TO5A 2FZ4A 2HN9A 2HAEA 1T15A 3HCEA 4ZREA 2BIFA 2FQQA 4TZTA 2OXEA 4Q02A 2YJNA 2XWPA 4FYHA 3JR3A 5HTKA 1GJRA 2FUCA 1GLNA 3JSXA 3SZMA 3TUZC 2HYIC 3U09A 2QN2A 4EUSA 5M04A 2IP4A 1QG0A 1PR5A 2ZYIA 1NA5A 2ANCA 2FPPA 2WPNA 4WESB 3AB3A 1KBQA 3DHEA 2R1TA 1L7QA 1MJGM 3GRUA 3LCRA 3V4VB 1H4VB 5BSFA 3C85A 4LE2A 3B1JA 1J1ZA 4HPJB 3EXEA 5IC4A 1U0LA 4Q05A 1NBHA 1SU4A 3MPUA 4DBLC 5EJ8A 1NVGA 1VCIA 3MTAA 1E0JA 1Y6FA 4PG5A 1EFAA 1GV0A 1YK0A 3IQXA 3ZW9A 4B3IA 5CFZA 1PV2A 5H8WA 4P4NA 1NBME 1A2BA 5C53B 2Q9AA 3BDVA 3BERA 5BXYA 1IBCA 1RXCA 3Q2KA 1ZHOA 1CYDA 4XQEA 2ATCA 2WOJA 1YR7A 4M6WA 4LDJA 3W8DA 3RSFA 5IBCA 5LDHA 4LNHA 3SMVA 4PPYA 5TNXA 4FWTA 5ARDA 5H70A 3L8HA 3EARA 3C7AA 3GLHA 1VMDA 3GRPA 5GZ1A 3G7UA 5CLGA 3PKIA 5EJ9A 3A1TA 4Z99A 2ECKA 2PHZA 4ZYLA 3OTGA 5JI2E 2D1SA 5JADA 4HMOA 4M1SA 2WWHA 4CLHA 5IASA 1KVTA 1SU8A 1H9BA 1V7PC 1WAMA 2RK6A 3Q3EA 2BBSA 4R1NA 3RR2A 4CIXA 4BQEA 5HKOA 5BV2P 5JD4A 3HK2A 1OLXB 1XKQA 3TM4A 2NUBA 1EFPB 3FROA 3BREA 4QTYA 1ZCFA 4R2XA 1QAQA 2DZDA 3WJ1A 3AUSA 3DMFA 1A69A 1QNLA 4X91A 3AONB 2XT9A 5K99A 3KOMA 1H6BA 1OR8A 3BB1A 3T5GA 4IZOA 1E3IA 2PYZA 1QHYA 3D6JA 1DQRA 3CINA 1N2IA 3N2IA 3DBLA 1T5HX 4NK4A 1F0YA 2E1PA 3E7PA 3H5RA 3HN6A 2DU8A 3LY8A 4FI3F 4QHSA 4R9RA 4CTNA 5A5GA 3KVYA 5I9BA 5KYXB 4RA9B 1IQUA 3QSGA 4JI3B 1L7AA 2PTGA 3PJDA 3HGQA 4O4JA 3K0CC 2VHVA 3E03A 3T7CA 4M37A 1TRHA 1Z39A 2GCEA 1DC8A 2YDYA 4JP8A 1EKXA 5DIZA 2ZJ4A 5DTMA 4NBKA 4YCAA 2QG6A 4RVUA 5E9JA 3SNKA 5B3LA 4UJ5A 3W0LB 2VVTA 2W6PA 4E5PA 2YWJA 3EZ2A 5FYQA 3RS8A 2P9YA 1EHIA 2DFTA 2IJGX 4HOYA 4BB0A 2OBMA 1R5JA 3CNHA 1YL6A 2ECOA 1MOPA 1SFRA 3W8RA 3H6GA 3S1AB 3RGGA 1JPUA 2ID8A 3A6DA 3E3AA 4FYXA 1RCFA 4RD2A 4IG9A 1X0VA 2X3UA 1B6SA 1GLVA 1BMQA 2FRDC 3D4NA 4R0NA 4XEHA 3TM5A 1KJQA 2CL7X 3EEIA 4PFKA 4WY5A 1E9AA 1JI0A 4Q3LA 3ZVMA 5C35A 4B45A 2C9OA 2XUJA 2HCTA 1H0HA 4FR2A 1WUIS 3LM8A 1OTXA 2RK4A 3STVA 1ZD9A 4HX9A 2NPFA 2QY6A 1OWOA 2ZATA 4FYJA 1GEEA 1J20A 1DEKA 4FFOA 4W63A 1GQRA 4WZAB 1LSUA 5TEWA 5ISMA 1JR2A 3A3NA 4ML3A 4FVTA 1QRRA 3IGFA 4YHHB 3FTCA 4MW5A 2JJ1A 3AESB 1EFRA 3IX7A 2INGX 2H52A 3A4MA 4QWMA 4AVYA 2ZQYA 4N3GA 1R3UA 2VDWA 1A9XA 2K7FA 4A82A 3MUNA 2OYCA 2YMQA 1OLOA 2XPCA 4HUQA 5D86A 3Q72A 4K86A 3P96A 4LV5B 2H54A 4UFNA 4MKHA 3PEYA 4HGOA 3QEMA 1UXHA 4JJGA 4RVCA 1OA1A 2VCHA 3I92A 4I14A 3RQIA 5IJZA 1PEKE 4AJOA 5ELXA 4U63A 1DRWA 1PJCA 3VBCA 2RI6A 1B42A 3GCGA 5AW0A 3NKFA 2HD4A 1RWBA 4UTNA 4J3JA 4OJTA 5C7YA 1GZ6A 1VE6A 4J43A 3WIBA 5L4NA 1Y8QB 2IPXA 1GZSA 1T4DA 3PXUA 5JVDA 4KGDA 3W5CA 5ESRA 2J9ZB 2CXSA 4RSHA 2VDPB 3RC7A 5CVTA 2BZ1A 4KAJA 5TT0A 2R85A 2C00A 3AP2A 4EB6A 2NZJA 1BE6A 4YRFA 1OQAA 2J7PD 5EJIA 4LK2A 1CY8A 3JY6A 4GSYA 1TQ6A 2EZ9A 2I6QA 4P36A 4K3VA 2QTLA 3AUAA 1X9IA 2VAXA 4UU0A 4CCSA 4Q3BA 4OGLA 1Z7EA 1JZSA 1I32A 2RGRA 2BMAA 2O3TA 2ODAA 2QTAA 5AUOB 2ODBA 3UB3A 4YCBA 1KEVA 1CBUA 3WGTA 1BQ3A 1J2UA 3CX7A 1MX1A 3WAJA 2IUTA 1ZN8A 3G68A 3EIQA 4FWBA 4DV5B 1JZQA 4AY5A 2CXPA 2OXFA 2AI2A 4OP2A 3MYRA 3U7GA 3JARB 4J0CA 2FNAA 4GLLA 4OB6A 4DLRA 5JJBA 1YKSA 4O4HF 3N87A 1IEVA 3B5EA 4GGMX 3DM5A 2VK8A 4M3NA 1E0SA 4MWSA 2DBYA 3AJ8A 1G66A 3PFBA 3TIVA 3E5NA 3IMFA 5DHUA 5EXEA 5E1MA 3P2JA 4UDXX 2GHRA 3VJMA 3Q8KA 3OD1A 2B4AA 5A7HA 2ZETA 2L17A 1J5EB 5EJAA 1ZH0A 1MD9A 3TTUA 1I4WA 3PPXA 2DGDA 2F1OA 2XRYA 4O4LB 3W6UA 2Z8YM 4XPIB 5KSPA 1UL1X 1GTG1 2JFYA 2L0XA 2ZI9A 1EM8A 1GNPA 1RQNA 4RV9A 3R6LA 4AJNA 4EARA 5E7QA 4LFCB 1EX7A 4BFSA 3K5PA 2ZYWX 4UTXA 3LRPA 2YYSA 1EK6A 5KTSA 1T0BA 4AWXA 4BRUA 4GBED 4FT2A 2XDWA 2W71A 2WHPA 2R00A 1R1DA 3AM3A 3GYGA 3QFSA 4GPEA 4H0FA 4MQFB 2XDQB 2IV2X 1E4EA 4J0QA 3S0JA 3TLCA 5A4JA 1N6OA 1RPJA 1G8GA 4X1YB 5AM0A 2W2XA 1ZD4A 2PSJA 3DBOB 2FU5C 5CHYA 1RI5A 3KJZA 2KI5A 4D8YA 1Z8FA 1K6EA 1UMBB 5C51B 4XIYA 3WYAA 1UWCA 2JH8A 2XCSB 3UANA 5DLDA 3ICWA 3D5EA 2C7BA 2XHEA 1GRQA 3HXKA 3EA0A 4J4BA 4A27A 3C7CB 4JS0A 3LBFA 3B5JA 3BM5A 2Q2WA 1R18A 1NBEA 3N8KA 5MFZA 1RHUA 1SHLA 3BIOA 5GV7A 1YIDA 1UIRA 2BI8A 1VE1A 4RVOA 4N7RA 1PFKA 3LNCA 1E0AA 1ICIA 1O6GA 2J0EA 1WKBA 3KJFA 3RS5A 1HRDA 5DGCA 3WGJA 2PQMA 1FMCA 2HLHA 3RYCA 1D2AA 4WV3A 5K05A 1HSOA 1TA4A 2WLSA 5B3JC 4LCJA 2DJ5A 1XZJA 1ZG3A 2IZ5A 4NEHB 1SK8A 3LOUA 1L8AA 4F04A 1EP3B 1IN6A 1J9GA 1N5OX 4HN2A 3PSAA 2NU6B 3WX0A 3UO8B 2CEKA 4JP3A 1TO6A 4TN5A 3R6TA 4AZ3A 3DQPA 1AUXA 4GAEA 2ZE8A 2BFBB 3D6HA 1A5BB 2JB9A 3B48A 3INGA 1L5FA 1ZFNA 4HBZA 3VPFA 2HM7A 3L8YA 1OASA 1ZAKA 2V6GA 4HGRA 2CBZA 2IXTA 1NOKA 3EDYA 2WIKA 1WUKS 2ZB8A 3Q9SA 4FFPA 4DRXA 1FFYA 3EXFB 5KTRA 3PQ3A 2WFZA 1QOQB 5KVAA 3Q6NA 2VJYA 3WLNA 3ZGVA 4BLTA 5A2GA 1RQLA 3CQ9A 2XYRA 1RPAA 3N2GA 2Q8QA 5HCUA 2W2KB 3NWOA 3FTNA 5JXGA 4Q3OA 2R86A 4XTCS 4C2BA 5DTJA 2OSVA 2VNKA 4JFAA 3INNA 4LZAA 1V35A 4N0QA 2VR1A 3BSYA 2QN7A 4XJSA 1ZMRA 4DY6A 2ZZNA 1XZQA 2DYKA 3C3BA 4RTOA 4GF5A 2KBFA 1JDJA 3RAFC 1V16A 2PSEA 3BDAA 3EPJA 1UBJS 3Q15C 1ABFA 4KDRA 3DNFA 1ULSA 2AXNA 3UK7A 4HLUA 3W5JA 4NZPA 2AH5A 5KX5A 2GZAA 4EUEA 2X6TA 4Q00A 1Y6JA 3P8ZA 1ZQ9A 1TK9A 3UK6A 3VKFA 2L82A 3ZU4A 4KH1A 1FXSA 3A05A 4FYVA 4B6OA 5MGNA 1TTPB 4D56A 1ISIA 4EQZA 3T12A 1H4SA 2HEGA 5LWHA 3SHOA 3ZDYB 1X14A 3DMNA 4MVCA 1IL0A 1YZFA 1ZSVA 1CJSA 5J2TB 5I6DA 3MT7A 2EX1A 1JPNA 1P4RA 3KD2A 4RDXA 1RJGA 3L6BA 4FNOA 4G07A 4P9NA 1Q44A 3ONNA 4LVOA 2C97A 3FH0A 5AI5A 5BRAA 5HKBA 4RTQA 1ORWA 4WN9B 5FTKA 2L18A 4A8TA 1W25A 4URHA 1SULA 1XLVA 2AK2A 2JAOA 3KWJA 1BX1A 2ZKIA 4DLXA 2PD3A 1GGFA 2VUIB 2Z5GA 3D1LA 3DEJA 5F35A 4ARZB 1Z47A 2OCPA 1EZ4A 2YS7A 4YRLA 2WTUA 2EQ5A 3Q7QA 4FE4A 4HAIA 4C6TB 4EKYA 3KU1A 4B81A 1NT2A 1J7KA 2REBA 3I5UA 5EKDA 2GA8A 2V96A 2OKCA 2W6OA 3ABZA 4J03A 3WGKA 2CCGA 4YCLA 5KYYB 3FCUB 1YZQA 4I99A 1RXWA 3G79A 3OKCA 3RVLA 3O8CA 1NVXQ 2W9XA 3UCXA 2JVKA 3QXCA 1Y33E 4FGJA 3A27A 5HCIA 4D6XA 3JALA 5CFQA 5JASA 1MH9A 2F4NA 3REFA 3L93A 1SKUA 2R48A 3LGXA 2VSQA 2Y68A 1VM6A 4PAGA 4E5UA 2O3RA 1QV9A 1YQGA 5J40A 5IULC 1TEZA 4B3SB 1X7ZA 2DKFA 1U5AA 3GGGA 4KXMA 5D1NA 1FSZA 421PA 1AQYA 2D0PB 3FPHA 1M2WA 4AJ4A 2R87A 3AY6A 3DBVO 3DT9A 4ER7A 3ER6A 1MX9A 1W44A 2GNOA 4UUAA 1FYFA 2NO1A 3JAWA 1FRZA 3EAGA 3WLMA 1QZ3A 2ZUDA 2QM0A 3HRHA 4H7DA 4MGEA 4REQB 3Q7PA 5FLYA 4E21A 2CMDA 3G9XA 4PBRA 1KAMA 1Z29A 4AO8A 4DL9A 4P8RA 2H5EA 4PQRA 2XRMA 4R2WA 1WXQA 2IXDA 1F1BA 1OILA 2X5OA 3JWGA 4IFBA 1VL1A 3LKZA 1L5LA 2CFIA 3JQGA 2DWQA 4OKNA 2H1FA 1HSZA 1PZMA 4LXIA 4QATA 4YS6A 3MN1A 3TNFA 1MF7A 3TQOA 4V3BA 1OIWA 4Q18A 1I7PA 1DCFA 5BQOA 1TD9A 1GPUA 3K4QA 1XF9A 1U1GA 4FDTA 1Y9EA 4R0VA 1XTJA 2QUZA 3IR6A 2NSLA 2ONKA 1P1KA 3Q7EA 3GJQA 1HT0A 2QLLA 3HHPA 1VLJA 5GJBA 3ZWNA 1EFUA 1Y34E 5JJKA 1L1RA 4PTYA 3WWEA 4HDRA 1GGKA 5A0FA 5DSTA 4QXOA 3OM1A 4WPGA 3L04A 2ZTSA 4P4SA 1L7MA 3I01A 1XQYA 4GXTA 2E89A 4O29A 5E6SB 3SCZA 3FYUC 3INRA 4D9CA 2NN3C 4HCJA 1FNNA 3ID6C 1XRJA 4ASUA 2EKBA 3D4OA 4PW0A 2OHFA 1XA4A 2PZMA 1U8FO 3CUWA 1UMCA 2VK4A 3WV5A 2XKJE 5KWJA 2C0QA 5JMWA 4P3PA 1G1MA 2DT5A 1CU1A 2ZJAA 4CLDA 4UVDA 1DU4A 1E8NA 1V48A 2KS6A 1YBAA 3X2SA 4KPFC 3NHYA 3PNLA 4LYHA 4FFLA 1WG8A 3T3NA 2N42A 5KSZA 1U7ZA 4HDQB 3Q8XB 5G4KB 2FPKA 3AV0B 1KRHA 3H4IA 1UDWA 1RMYA 1KYIA 4E09A 4TTQA 3P5SA 2UYYA 2PGOA 3I2KA 4UULA 4YDHB 2GBLA 4DSZA 3RYIB 4BP1A 2PSFA 3QVJA 4W1SA 1R9MA 2ZSKA 2QAGC 2NLOA 1JVSA 3VR2D 4R9SA 4OBBA 4OFWA 4HNUA 5FJIA 3RVJA 4B4KA 4BKOA 5HUQA 2P8JA 3OD5A 1V3VA 2H29A 1CQJA 1VQ1A 4NSNA 3HXLA 3OLYA 1SM4A 2P5TB 1W4ZA 5L4LA 1X70A 3CF4A 3LQ1A 5LP1A 5EFOA 1KBZA 3ZNPA 4JBNA 5AM2A 4CNBA 1M7BA 1WZCA 4UE3S 4GLFA 4LV6A 1KTIA 3LFHA 4YCSA 2EJBA 1PS8A 3MS2A 3OJEA 2RCYA 3PGVA 2E1RA 3VH2A 4NZYA 3D4PA 1T2NA 4RK1A 2E9SA 2FZEA 3LUBA 1QHIA 4TLBA 4X93A 4IDFA 4TTVA 2XDYA 1PQYA 4K3UA 3RTBA 1YCDA 2Z2JA 3IT2A 2IXGA 3B1KA 3KRTA 4XI9A 3T9DA 4CN9A 3W5HA 5LP6F 3DA8A 1YDGA 4FFBB 1E2KA 4ZOLB 5KMGA 3MWFA 4Z0HO 3IP9A 3OLXA 2UZ4A 1KMCA 1J09A 2XSZA 1XEFA 3GPBA 3I8SA 5BWBA 1BCRA 3L3BA 5CXQA 1PD1A 1R5NA 3NTXA 4MS3B 2CLIB 3CRW1 3OM9A 4WVFA 4J1TC 4BE7B 2VRCD 4L3OA 4ZJPA 3DL2A 1XDGA 2EBHX 2J4DA 1KIMA 3GFVA 1THGA 3I3OA 3LF2A 4KWHA 4DM3A 5JQWA 5ILOA 4YY3B 2OP1A 3HB7A 4C08A 2D00A 2GCOB 3DPIA 5GINE 3E48A 3RRMA 4LGMA 3BE5A 4L0MA 4R8RA 1D2RA 3SZUA 1D4OA 4MUXA 2DQKA 5FPPA 3DTVA 3ZZ1A 4CF5A 5I7UA 5T7BA 1PTKA 5J1TB 1ETUA 1JDSA 4JJAA 4N82A 5B53A 4IEEA 3VR6D 4C78A 2X4GA 3D7MA 1WHTB 3ZV3A 1ZN7A 3FWHA 3L6OO 4KWIA 1N78A 5JAZA 1HDXA 1TQ2A 2C3OA 4D9KA 2IF2A 1BEZA 1YZYA 4RKRA 1E79A 4EWLA 3MBOA 4US1R 1D4AA 2D1TA 4OQ4A 3DDNA 4LG1A 2QRMA 1M1YA 2WIJA 1ZNYA 4X94A 4DBLE 3FBWA 1GNRA 1MDFA 1RI2A 5BSVA 4NR0A 1B43A 1T34A 3MWEB 4KXVA 1CP2A 1T9HA 5DH9A 2EBWA 5TLSA 1IOZA 2V5UA 4B7XA 2N75A 1XMQB 3COYA 2P2DA 3T52A 4DNFA 1J0CA 1O08A 1W1WA 2RAPA 4MCIA 3GEGA 2Z6QA 2VJQA 1UDCA 5ETJA 4BLWA 3JU3A 1UC8A 2RE8A 1NVDA 3P9NA 3ESCA 1TZKA 2XVZA 2VIIA 1KR5A 1OF1A 2MU1A 2Q5CA 3ITDA 4GHWA 2PLRA 4JJEA 1L4FA 4TV9B 3T7JA 1UFQA 5BUCA 2CDAA 4OLFA 4TLMB 3EGVA 4NEGA 1E3SA 3BJMA 4P5EA 1QRUA 3S7TA 3L01A 4BO4A 4URZR 1RAFA 1TW2A 3BEOA 4YECA 2WSIA 3EXIA 1OW3B 2HSZA 4RJKA 1ORTA 1WEHA 2CE2X 4UEKA 3TRIA 2WKWA 5IYZB 2B99A 3EF3A 2FSPA 2X2FA 3KTDA 5JH7F 3OPNA 4QVKA 2R68A 5CM8B 1RBZA 2OLEA 3EQ6A 4LDPA 2WVHA 2ONZA 1M2NA 5PGMA 2JLWA 2EVWX 4K9MA 3IUBA 4XR4A 1EVEA 2IZZA 4EF5A 3FF1A 3IBYA 1NBOA 1SBHA 1RJDA 3M2PA 2QG4A 2HMAA 1W0KA 1FC0A 2B36A 3K94A 1X38A 2G1UA 3B20A 3D1VA 3GT3A 5SV2A 4E2XA 1KEKA 4EATA 1JDZA 4FHDA 3MTEA 3VOTA 4R1MA 1IIBA 4HXGA 1U4OA 4EL0A 1RVDA 1YI1A 1DEOA 1ZOOA 3EXHC 3KFLA 4EP1A 4CW7A 5I8WA 3JQFA 4LXTA 3TRHA 4XLZA 1OLXA 3JCZA 4JR1A 5DCUA 3SEZA 3FETA 1VHTA 3BULA 4M22A 1QYDA 4E7OA 4PZ0A 1YU6A 3CZ4A 2KE5A 1T0PA 4Z1MD 5B3AA 2H2FA 3M34A 5D3MB 4Y7CA 3OC6A 1QH0A 2A0WA 4RQUA 1QQBA 1XZAA 2PKWA 1KZHA 3KTFA 1PJTA 2C4NA 4W5RA 1U0TA 4HFNA 1Z18A 1TLFA 2FAXA 2I1QA 3DAGA 1JZTA 1PHRA 4ZOCA 4P3NA 2ZUTA 1PBTA 1XJWA 1M0EA 4D3ZA 4L57A 5JQGF 3WGHA 2PKQO 2PUGA 2FZLA 4RA9A 3WXBA 4LWOA 5TR9A 4INJA 4BZQA 4I9HA 4Y2JA 3CW2A 4C01A 1LUAA 2IBMA 4TYPA 1EJ2A 2Q3DA 3G8DA 2QAJA 1D6NA 1MGOA 4YT4A 4RTNA 4LF8B 4HTAA 1UBLS 4YVFA 4AMBA 4X41A 1X6VA 5IZCA 4XJTA 4KN5A 3T61A 3LCCA 2CMGA 1V39A 3DHNA 2B3TA 3WQRA 4HS9A 1NJGA 2BRUA 1NATA 3G1WA 2PUDA 2XCIA 3BGDA 4KVFA 3S1AA 3MUFA 2WJPA 1P2GA 3QPVA 3ROZA 5JAUA 4B83A 1WW3A 2BW0A 1L5VA 3NEYA 1Z34A 3I39X 4LY3A 4L4YA 4D9GA 3UT6A 3FVVA 3RUPA 3ZHZA 4JI1B 2WJYA 4CM8B 3F0TA 3HB9A 3NCHA 2WJ4A 4F6LA 3CLTD 2JFQA 5KC9A 1U2QA 2ZSEA 3FPSA 1R6XA 1C3JA 4AZSA 1RLUA 1C4XA 4HMPA 1MX3A 1T36B 4EW3A 1RZRA 4QUKA 1MW8X 5GVRA 1AKVA 2JCVA 2ZAOA 1I2CA 1YJQA 3E53A 4NARA 4YP6A 1NNLA 3HDQA 2AKYA 2XUOA 4BPBA 4XTRA 5EOVA 3BCRA 1B6RA 2AE1A 2QJOA 3T0GA 5K0BA 2CCJA 1RWVA 1TK3A 3HEAA 1MJ5A 1Y8CA 1GSOA 3GJZA 5HCNA 1EVKA 4IYJA 1XT6A 4W5TA 1B8VA 3P2IA 2RHCA 4JNKA 3TZLA 1CRWG 4Q7JB 3VZPA 2FPSA 4JMLA 1Y8QA 1DAIA 1HMYA 3NBXX