5KYGA

Rawv_ctd (loop structure) of 16s/23s 2'-o-methyltransferase tlya
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
207
structure length
207
Chain Sequence
WVSRGAHKLVGALEAFAIAVAGRRCLDAGASTGGFTEVLLDRGAAHVVAADVGYGQLAWSLRNDPRVVVLERTNARGLTPEAIGGRVDLVVADLSFISLATVLPALVGCASRDADIVPLVKPQFEVGKGQVGPGGVVHDPQLRARSVLAVARRAQELGWHSVGVKASPLPGPSGNVEYFLWLRTQTDRALSAKGLEDAVHRAISEGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cytotoxin / haemolysin homologue TlyA
publication title A Novel Motif for S-Adenosyl-l-methionine Binding by the Ribosomal RNA Methyltransferase TlyA from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 64
structure length 207
sequence length 207
ec nomenclature ec 2.1.1.226: 23S rRNA (cytidine(1920)-2'-O)-methyltransferase.
pdb deposition date 2016-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5kygA00
5F2NA 3CJQA 9MHTA 2P40A 4RTJA 3REOA 3CJTA 1L3BA 4FZVA 4HTFA 3SX0A 3PX2A 5CVVA 2FRXA 4YUWA 2AOUB 3C6MA 5ICCA 5MHTA 1BOOA 1O9GA 2KW5A 3M4XA 3EVZA 3KR2A 4HGZA 1XCJA 3BGIA 4ER5A 3UBTA 3T7RA 3HCDA 5FUBA 1JTEA 4O29A 1R00A 2G8NA 3HA7A 2AZTA 5FWDA 4RTKA 2ESRA 3LCCA 3AXSA 5HEKA 4DM3A 3DR5A 1P39A 2IPXA 2P7HA 2ZFUA 2R6ZA 3LECA 1X1CA 4HRAA 4MWZA 3ER8A 2EJTA 2CL5A 3KQOA 3QV2A 5JR3A 1WXWA 2OZVA 4E31A 3B89A 1Q0TA 4QQKA 2I9KA 3G2QA 1YUBA 3U81A 2IBSA 1TW2A 2Q41A 5HIMA 3LBFA 2UYQA 3MCTA 4OA8A 3SGLA 1NW5A 2OPBA 3DXZA 1N7IA 4Z2YA 3TM5A 1XXLA 3OZTA 2I62A 1OR8A 2JHCA 3MTIA 3K6RA 5FQOA 3M6UA 4QPPA 3SXJA 3BWMA 5E1OA 2PT6A 4KWCA 4B17A 2NNWB 2A14A 5EVJA 3EMBA 4RTQA 1I1NA 5K8VA 3I5UA 1U2ZA 2FHPA 4X1OA 2VDUE 2ZBPA 3DMGA 2YQZA 10MHA 5DTMA 1VP3A 3PT9A 3R3HA 5DX0A 2UYHA 1NBIA 3R24A 5GWXA 4PYLA 5FTWA 5HIJA 3PTAA 1L3CA 2BR5A 3OU2A 5B1SA 5LR6A 5K03A 4PONA 3BZBA 3KKZA 2PXXA 3S68A 3KPUA 1D2GA 1G60A 3HCEA 1FPQA 3HVKA 1EG2A 2GAFA 3OPNA 4MHTA 4EMSA 5DLYA 2P1DA 3V8VA 5BW4A 3JWGA 5HILA 3EGIA 1ZG3A 4RTOA 2CKDA 4HSGA 1BKYA 2AOXA 2OXTA 4X41A 3C6KA 5GP1A 3TFWA 3HCBA 4C06A 3LKZA 4OQEA 3ER9A 4FT2A 1PJZA 5GIOE 3EVDA 4RV9A 4F84A 1NT2A 3HA5A 3EVGA 3LSTA 5HIIA 1WZNA 3G88A 5K0BA 4KRGA 5EMJA 3OZRA 3UJ8A 5EIFA 2AN3A 3ELYA 3EGVA 2VZ9A 5EIWA 2XYRA 2DPMA 4CKEA 2AR0A 5EHIA 5DTRA 5IH3A 1VIDA 5LQRA 2PKWA 3B5IA 2QY6A 1RI5A 3GNLA 3G2PA 3GO4A 3PX3A 3SSOA 3VSEA 4UOEA 4YUXA 5T64A 3TKAA 8MHTA 1XDZA 5E1MA 3EVBA 2YX1A 4DCMA 2YXLA 3OFJA 5EEHA 1KHHA 2JHPA 1UIRA 5FCDA 3NMUF 2E5WA 5K01A 4FSDA 1DUSA 5DTQA 5LQCA 1KP9A 1NW6A 4E2XA 1EIZA 3GCZA 3HM2A 4M36A 4XUEA 2PX8A 5ERGB 4EKIA 3GRRA 2AOTB 3CBGA 3EGEA 3NWBA 1XDSA 2C7PA 4GC5A 2ZBRA 3THSA 2P3LA 4BY9E 1P1BA 4PYKA 5EZQA 4C07A 4PCAA 1ORIA 4P7KA 4PCLA 5FULA 3A7EA 1QZZA 4PIMA 4YUVA 3LL7A 3FUVA 4DKJA 3KQSA 4DZRA 4BP1A 1RI2A 3KR1A 5KYGA 3ANXA 3FTCA 4AX8A 1D2HA 2AS0A 3BWYA 4X61A 4P7GA 3E8SA 1WG8A 3RW9A 4E2YA 2IIPA 2O05A 3ME5A 1VP9A 3GRUA 1SVUA 1F38A 3GJYA 3O7WA 3LDGA 5EHGA 5FA8A 3TOSA 3UZUA 3B3GA 4BLVA 4CXMA 5EKUA 2VDWA 4A6EA 3BKXA 2Z6UA 4H0NA 2AOVA 4RTMA 2ZVJA 3FRHA 3MGGA 2Z6AA 3WSTA 1XTPA 2PT9A 3P9IA 5FQNA 3T7SA 1G55A 3DP7A 3LBYA 1NKVA 4AZWA 4IWNA 4KW7A 1RJGA 2H11A 1RI3A 4HTFB 4OA5A 4QTUB 4QQNA 5E9JA 3A4TA 2IH2A 2ZZNA 2HR1A 1SQGA 4HGYA 2ZULA 3NDJA 1MHTA 4HC4A 3KPWA 2EG5A 3SMQA 5K09A 5KS2A 5ICGA 4KIFA 2ZZMA 3H2BA 3M70A 1G38A 1WS6A 3JWHA 2NXEA 4QVKA 5CVJA 2JG3A 1YB2A 3NVKI 2ZTHA 5DM4A 5C9ZA 1SG9A 4ER3A 4YUYA 5LQKA 5FADA 3BT7A 2WA1A 4P7JA 5EG5A 3LDFA 4MTLA 3UJDA 2OY0A 3FPGA 4GBED 1AQJA 3EEOA 3LGAA 2UZ4A 2I7CA 2HMYB 1XDUA 3LCVB 4NECA 1RJDA 5E1BA 5FHRA 5K0NA 3CCFA 2QRVA 4PGHA 5K0FA 1X1BA 3G5TA 3NVMB 1VE3A 2BM8A 1X1AA 2ZW9A 3GU3A 5IKMA 3FRIA 4Y30A 2PLWA 2DULA 4V0QA 5CIYA 3Q87B 5KQSA 3I53A 3OE4A 2ONYA 4MIKA 4C04A 2JHAA 3GRYA 4C08A 2HTEA 4MQ4A 3MERA 5EEGA 3P8ZA 2PBFA 2PY6A 3PB3A 4P7FA 1INLA 3RIEA 4YMGA 3P97A 3UJCA 3HVIA 1EQAA 3FPEA 5CCXA 2IFTA 1FJXA 2IH5A 3DUWA 3TPZA 2B78A 1FP1D 1QAMA 2H00A 3E23A 3PS9A 4PNEA 5E9QA 1WY7A 5EKXA 2PSSA 3KQPA 1Y8CA 3BUSA 3FYDA 3UJ7A 3BWCA 4GQBA 2OKCA 3PVCA 4IV0A 3L8DA 4AZSA 3P9NA 4BLUA 5G02A 4RTNA 3AWIA 3EPPA 3LKDA 1YFJA 1QANA 1VL5A 2ZIFA 2EX4A 4K6MA 4BP3A 1NV8A 3VYWA 5C0OE 3G2OA 3DH0A 3CGGA 1UWVA 3M6VA 4RX1A 4YV1A 4E32A 5DXJA 3DMHA 1ZQ9A 3E7PA 2G70A 4M7RA 1AF7A 4PWYA 5K0EA 3DMFA 5CM2Z 5HZMA 4KDCA 1NE2A 1YZ3A 2FYTA 3PFHA 3PLAE 2UYOA 3FYCA 3M33A 4RTPA 4KDRA 5LQNA 1KPHA 1UFKA 2BH2A 3G8AA 1AV6A 2NP7A 5M5BA 1RI4A 4FR0A 3FTDA 3KQVA 3UJ9A 1EJ6A 1O9HA 4OQDA 3K0BA 2P3OA 4RVHA 2IH4A 2FPOA 2OBFA 4RYLA 3KPJA 2ZWAA 5EPEA 2BM9A 2AOWA 3C3YA 5CVEA 3TKYA 3EVCA 7MHTA 4G56A 3ID6C 3EVFA 3E05A 3KR9A 5EMLA 3PFGA 3TM4A 2V7EA 5H02A 5KQRA 2G72A 4ER6A 5D1NA 4U7PB 5GIPE 5EGSA 3KU1A 3OFKA 3EEYA 5HOQA 3NJRA 5EOVA 4RVGA 2G1PA 5DM1A 1ZGJA 4PIPA 1G8AA 4AZVA 5CUQA 3C3PA 3HCFA 4YV2A 2PWPA 1QAQA 3KQTA 4FSXA 4GUAA 4E70A 1L9KA 2C7RA 5D1HA 1JQDA 4X60A 3AY0A 4RTSA 5DM2A 5E1DA 1X1DA 1N7JA 3M6WA 3MAGA 3DULA 3I58A 4EKGA 2ZZKA 4PYMA 2AVNA 3EVEA 3KQQA 3GGDA 4C05A 4WVLA 3DOUA 2GB4A 4QDJA 5EZSA 4CWAA 2YXEA 3G89A 3G7UA 2XVAA 5K0JA 4JXJA 4IKPA 1M0EA 2B9EA 2YXDA 2GA9A 4QVGA 2PXAA 2OB2A 3IYLW 4FP9A 4QTTB 4XUCA 2NP6A 2YR0A 2PX5A 3QOXA 2JH8A 1SUIA 5DSXA 1G6Q1 3LHDA 2P41A 2JJQA 3TMAA 3VC1A 3R6TA 1DL5A 5K0CA 2I6GA 5LQAA 4AZTA 1G8SA 1NW8A 3CC8A 5GM2A 2NXNA 4LECA 2YTZA 5E8RA 1XCLA 3HA3A 3BKWA 5DX1A 3FPFA 5K05A 2C7OA 4GOMD 2ZBQA 4R8RA 4L7VA 1JSZA 3EMDA 3NDIA 2GH1A 3ORHA 1ZKDA 5DX8A 4ATNA 1YF3A 2FCAA 3SR4A 3KQWA 2ZCJA 1V39A 3CKKA 1L3IA 4PYQA 1TPYA 5DSTA 3UJ6A 5KVAA 1B42A 5EQJB 3CJRA 3P71T 3GIWA 4GOOD 3UJBA 4RVDA 1NW7A 3V97A 3IEIA 3FPJA 4U7TB 1JR4A 4OBWA 3ELUA 4OX9Y 3P2KA 2G71A 3BXOA 2ERCA 3GXOA 3TR6A 5CVDA 1FBNA 3QOWA 2AN5A 4R6WA 5DXAA 3TRKA 2XBMA 3G5LA 2H1RA 2HNKA 1RI1A 3HVJA 2V74B 1ZHFA 5C1IA 3MQ2A 3UA4A 1DCTA 1R8YA 4ER7A 4BLWA 1YZHA 2HV9A 3B3JA 3MB5A 5F2OA 5ICFA 5CCBA 3I9FA 2P3QA 1JG4A 3MCZA 3D2LA 2CWWA 1SUSA 1TW3A 5P8WA 5U4XA 3P9KA 3FUXA 1KYZA 1JG3A 4PYIA 2QRVB 3X0DA 4E30A 3SM3A 1KYWA 2AN4A 2BR3A 4LWOA 2ADMA 2B3TA 2YVLA 5DPMA 1ORHA 3BWBA 2AOUA 2IGTA 2WK1A 2OO3A 3KQYA 5EC8A 4QDKA 3BGVA 4Y2HA 3G8BA 1JG2A 2VP3A 2PX4A 4R6XA 5E9WA 3HVHA 4CKBA 1KPGA 4OBXA 1H1DA 3GRVA 3A26A 4DQ0A 3OU7A 3P2IA 1VQ1A 2ZSUA 3FUWA 1RJFA 2Y1WA 4GOLD 4YMHA 3DLIA 3FPHA 4YV0A 2HWKA 3KR0A 3R9XB 2AVDA 3GDHA 4GF5A 3FUTA 5K0GA 2BZGA 5EMKA 4A6DA 1R8XA 3T0IA 1IM8A 1PRYA 2ZLBA 3A27A 3BGDA 1I9GA 2ORED 4R8SA 5K0LA 4LG1A 4DCGA 2QM3A 2VDVE 4P58A 1NBHA 3GRZA 3OE5A 5FWAA 4AUKA 2O0LA 2PJDA 1X19A 3AXTA 4PYOA 4X63A 3TLJA 4IV8A 3UJAA 3UWPA 1Q0SA 3A25A 1XVAA 4XUDA 2CMHA 5BP7A 5FA5A 4RTRA 3HCAA 3HCCA 3LDUA 3NTVA 5E2AA 2P7IA 1AQIA 3O4FA 4CKCA 3F4KA 3SSMA 2PX2A 4LWPA 4PYNA 3C0KA 2LD4A 5E8JA 1R6AA 2OYRA 5CD1A 1NV9A 5DM0A 2OB1A 5DWQA 1IY9A 2GLUA 2IDKA 3FTFA 1KPIA 2B2CA 5FHQA 3LPMA 5E2BA 1P1CA 2P8JA 1P91A 3IHTA 3FUUA 4ZTBA 2UYCA 1SKMA 1I4WA 3OU6A 5CVUA 5JUWA 1EAMA 3ELWA 4GC9A 1VPTA 4M38A 2F8LA 4XCXA 5GINE 1YFLA 3M6XA 3JWJA 3OCJA 3JWIA 2QE6A 4POOA 1HMYA 4C4AA 4F85A 3DXXA 1VLMA 1L1EA 4E2WA 3B3FA 4KIGA 1HNNA 3KPYA 4ER0A 5BXYA 5LQJA 1Z3CA 4EQZA 3G2MA 5F2KA 4PYJA 2NXJA 4RVFA 3T7TA 2FK7A 3Q7EA 1D2CA 4RTLA 3KQMA 3MHTA 1JSXA 3NW9A 3OZSA 3I64A 1JQ3A 1SQFA 4R05A 4DMGA 5T6BA 2ZIGA 2NXCA 4FT4A 2O57A 3NWEA 5LSAA 3GWZA 1BHJA 3P9CA 3FZGA 3HP7A 2JH9A 1M6EX 5EMMA 3CVOA 2EFJA 1BC5A 1T43A 3TQSA 5DT2A 1JTFA 5GM1A 1F3LA 1RJEA 4HG2A 3RODA 4DA4A 1KIAA 3KHKA 4E33A 4DF3A 4HH4A 4FGZA 2XVMA 3THRA 4F86A 1IXKA 5BW5A 3MTEA 1VBFA 2IP2A 2VS1A 1WXXA 4KVZA 2FK8A 2PGXA 2PVCA 3HEMA 1O54A 4ISCA 4M37A 4WXHA 3EVAA 2ZIEA 5LQUA 4V0RA 5DRTA 3HNRA 1EJ0A 3DXYA 2B25A 1KR5A 1QYRA 3DLCA 4YUZA 2GS9A 2WA2A 3ERCA 1KXZA 2AOTA 2PWYA 3LCUA 2C7QA 1N2XA 3R0QA 1QAOA 3O31A 4FS8A 2PXCA 4QPNA 3SVZA 1MJFA 2NYUA 3UA3A 2IBTA 2R3SA 3VC2A 5GOZA 3DTNA 2IDJA 1ZGAA 1R74A 1JG1A 4GEKA 1NW3A 1XJ5A 2K4MA 2GPYA 2N47A 5HFJA 2Z6QA 5ICEA 5HIKA 2CMGA 4CTKA 2ONZA 2YUIA 1FP2A 3FTEA 3KPVA 3UFBA 4GOND 1JQEA 2XYQA 3B7PA 3ELDA 3IV6A 2XYVA 3LX6A 3SSNA 2ZWVA 4PGGA 3P2EA 4EVIA 2PV0A 4RSRA 3A7DA 2O06A 4PINA 5T67A 3HTXA 4CTJA 4E2ZA 1R18A 4EK9A 1M6YA 2QYOA 4C03A 3AJDA 2Y1XA 2BR4A 2EJUA 4RWZA 5DRYA 2O07A 2P35A
chains in the Genus database with same CATH superfamily
1FS5A 3ANNA 2C5SA 4FZVA 3R5SA 5IAJA 1LFAA 3PRYA 1UH5A 3JAWB 4Y67A 5EJAA 5JMPA 5AUOB 2IUEA 3SHVA 5MHTA 1A69A 2EZ4A 2VDJA 1SGWA 3L1VA 3SHQA 3CRZA 3K5IA 4HLDA 3ZGYA 3ZS8A 1CSEE 2BGMA 2YS7A 1YI0A 4RTKA 1JEOA 1E2NA 4Z4IA 2QM0A 5HEKA 1ELOA 1HOTA 1FMCA 1PK9A 1UINA 2IPXA 2JKVA 3URMA 3SLGA 5F1YA 2QM8A 3JZDA 1E89A 1RRMA 3MWJA 1RHRA 1NFQA 4C87A 1XMPA 3W5IA 1NLMA 5FI3A 3JQ8A 5IULC 4HFNA 3P9PA 4CVNA 1B41A 1G7RA 3NO4A 4UUMA 4EENA 4OGFA 2PH7A 4X0EA 5M04A 3GN1A 1US8A 3ZLUA 1O96B 4G41A 2X5XA 4OA8A 1UOEA 4Z9BA 3SC4A 4YAKA 4KR0A 4B6QA 2FWPA 1Z0AA 3MTQA 4B6FA 4CQMA 4NBNA 2OUIA 1QV6A 4YLGA 4JX9A 3QFRA 3UAOA 3ETGA 4FZJA 2BZ1A 4MB6A 2IWRA 4C4TA 4ZI7B 3DLTA 4XQ9A 4B3IA 1RC8A 4IZIA 1V5GA 4KPEC 3N8KA 4MS1A 4N54A 1XXHA 4MW6A 3EQ8A 4Y98A 4CNQA 3Q7RA 3DWIA 4YROA 3IJ5A 3OA2A 1RRPA 1DAKA 3I5UA 4K8OA 2WD7A 4ZCRA 3FCSB 3ZHXA 3PWTA 2QJOA 1Z2PX 1ZIDA 1QPGA 5BSWA 1KJJA 2DR3A 2JFXA 3HBAA 2QR2A 3L1JA 3L7AA 4GI1A 4EO7A 5A06A 5HKKA 4TRNA 2P6NA 1AB5A 4QRDA 3EGXA 1VDZA 3AHHA 5IJZA 4LZJA 1XU7A 1N2CE 5ICMA 2W6IA 3EH2A 1XMSA 5IJ0B 5CJJA 2BTQA 1EXMA 2PZLA 3HZZA 1YXMA 3PQ2A 1A2QA 4ZU3A 4JMPA 1XF9A 1FDTA 2Q0QA 4Y2PA 1BVUA 2CHEA 4EMSA 5BW4A 2HB6A 2AQIA 2O5RA 3EGIA 3VU0A 5FWYB 4EPXA 4BX0A 2JIZD 3F8TA 4HSGA 2PBRA 4HVAA 3RYIB 4GXRA 1CEXA 1JMKC 3IOEA 4REOA 1FFHA 1OYYA 1YONA 6ADHA 1DAHA 4B9AA 2QGZA 5L7YA 4MS3B 1YQDA 3L0DA 1JR3A 1E3SA 1O0SA 4FT2A 1JFFA 3V1LA 4CMGA 1NT2A 1DWOA 1E8MA 4L3VA 2XYGA 4TM8A 3ZE1B 4LHXA 3NWOA 1E6KA 3AHGA 2WDPA 5GAJA 4O4JF 3KETA 3D5EA 2AN3A 2VZ9A 4TROA 3B12A 1Z73A 3DBHA 2Q3JA 4JYCA 1EWVA 5GQSA 1MC1A 1JKFA 4TTSA 4BFUA 3WWPA 1OVGA 1VIDA 4ZARA 1VKJA 2NM0A 3GFFA 3RAJA 2LIPA 3L04A 5T6MA 4YUXA 2ZSAA 4XLZA 4JJZA 8MHTA 5K6AA 3AOEA 1L7XA 3LX5A 4H1WA 4BNDB 2FRVA 1MO4A 1UIRA 2J6HA 1OLUB 4EEKA 4LI0A 3KYJB 2K7FA 2A9VA 4FSDA 3VZPA 4RZSA 3MCWA 5JQGF 1Y33E 4RQAA 4Q9KA 5KOYA 1T2FA 2DSNA 1ZSNA 2CUKA 3DL2A 3N2NA 1N3YA 3GD5A 3BDAA 3ZCXA 2X86A 5E0OA 4EA8A 5C1BA 2P3LA 2D5BA 1V8DA 1ZM7A 2XCOA 3DONA 4LFBB 3ZS9A 4BFTA 1H4SA 3VOSA 3PKJA 2VUSA 3CXUA 2JKYA 2H1FA 1JRLA 2OFXA 3HSKA 3TLXA 2CJFA 3K9BA 2J9GA 3EA0A 3BMOB 1ODTC 1RKBA 1JDNA 3EASA 4EKNB 2ZVPX 3ZDDA 2ZATA 2YNMC 4V0NA 1F12A 1LNSA 2FR8C 1NF9A 3B48A 4WMLA 2QVLA 3GRCA 2OTCA 3GEEA 3O7WA 2XZPA 3SJBA 4B34A 2VBFA 2IXTA 2P4EA 1KRXA 4LXYA 2A94A 3GLRA 1NUTA 2RGDA 3L8GA 2WSSA 5HM8A 4F56A 4QIHA 2O54A 1FLAA 4EPYA 1QGZA 2AJDA 2LIVA 2KLHA 1YJXA 4FFNA 4FYHA 2J45A 2BFDB 4FZ5A 3A4TA 3KLPX 4OA5A 4QQNA 3ZWPA 3O38A 4PSCA 1OHHA 5KUTA 3AHJA 3AEQB 4P0PB 1JB1A 2I99A 5BWMA 3WO1A 2E89A 4NCKA 1SC3A 1S8FA 5KS2A 1I80A 3GBSA 4NE7A 4U7GA 3UMMA 2Q6IA 1JR3D 2VPIA 4XEHA 3AR2A 1PDVA 1G5HA 4BNKA 2R5WA 3UATA 3NOXA 3IAXA 1BTOA 2HMTA 4GBED 3TAUA 3B1YA 4YR9A 2VQSA 4PLHA 4V1CI 5KSWB 2HMYB 4V02A 5AXBA 4TYYA 1NOJA 4O1IA 3ZDFA 2PS9A 4BFCA 1J07A 5ILGA 1E60A 2C20A 3W5BA 4YCNA 4Q48A 2ID9A 2QRUA 4EEZA 1XMQB 1C3JA 2PUAA 1DG9A 5ALWA 2ZEJA 3BULA 1WMEA 4OHCA 4BC1A 3LUJA 3P0JA 1IHXA 1M83A 2HF8A 3ZUPA 3CGWA 4IFTA 4Q24A 5DN6A 3IOBA 5JXWA 2H1WA 1XHFA 3ZV7A 1HYHA 3CZAA 4GX0A 4PCVA 3Q4GA 1OREA 5IXJA 4DTIA 4MWTA 3ET5A 3DF7A 3KAQA 4KREA 2J5KA 4NK4A 2JI8A 1H22A 1XHEA 5CFRA 1FJXA 1EWKA 3H1TA 3QPCA 4BPBA 1NQWA 3ZLJA 3ZGZA 3F6EX 4PFKA 1L7NA 2C4MA 2FW1A 2VAXA 1EHIA 2W6NA 2JLSA 1WWKA 3OJEA 3DF9A 3TQCA 2FP3A 3BUSA 1ST3A 2DWOA 1IHDA 2GPAA 2NUPB 2JD1A 2QUZA 2WWVD 3ESXA 4PE5B 6YASA 3MS7A 4YRMA 2QL6A 3LQYA 3HO8A 4BP3A 1NV8A 3GIDA 5CBPB 2F1OA 4MUFA 4C7MA 5D5HA 2VPTA 4XSGA 1XYGA 1ZD3A 2QT9A 3AWDA 4E32A 1USGA 3E7PA 3HLYA 5DXJA 5CFNA 3R7WA 3DMFA 1J0DA 4NBUA 4U6NA 1B0ZA 1YZ3A 3B6ZA 2DJIA 3GLVA 1NR7A 1X0VA 2J4FA 4MV9A 4Y6RA 1W35A 1XVTA 2WSSD 4H7PA 3SN6A 1DEHA 4QREA 2G1JA 3E15A 2FX3A 3QP9A 4Q3KA 1WR8A 4AJHA 2ZWPA 1K06A 1G1AA 2W2LA 1UK8A 1UP6A 3KUUA 4JT2A 4W4TA 3WLIA 4YALA 5JCJD 5B2EA 3T34A 2PD6A 4AY2A 2AOWA 3FFAA 3KE9A 1R0BA 1VXRA 4M0FA 4PNZA 5IH7A 1XT6A 3QNWA 3GLIE 3EVFA 4E5NA 3ZCPA 3PFGA 4AJPA 1I3CA 4RK1A 1ZCJA 1EVQA 4CMIB 1RWNA 3C5EA 5EUBA 4BE4A 4DKXA 5IC5A 2O14A 1TJNA 3DQZA 2AXQA 4PV7A 4JS0A 2G1PA 4FOOA 4GZ3A 3EIEA 4PIPA 2Q4EA 5DM1A 4ZVQA 3ZHQA 4OP3A 2ERXA 4ZGGA 1CQPA 2ZIXB 1CR2A 3B1ZA 2GHRA 2PWPA 2R47A 3G0IA 4LV8B 4MR8A 3WICA 1ORVA 5CDGA 4EI7A 5DTEA 5AVRA 2Z2IA 3WLLA 5FTMA 2QX9A 1Q3KA 3KD2A 4OHPA 5L40A 3NRBA 3VPXA 4D4IA 1BO6A 1I0IA 3EXEA 1TQ6A 4RJKA 3D7MA 5FFNA 1C4OA 2I3AA 3PXCX 4GG1A 4NC9A 2JLWA 1WSBA 5TMDA 1ZN8A 1PFKA 1EE1A 1N6HA 1F2UA 1NXSA 1EVJA 3HSSA 1YGYA 1FJHA 4JXJA 2XDQA 4LJLA 5KIAA 2Q2NA 5JYBA 2FHSA 2YN4A 4AF6A 5JZOA 4RF5A 1XALA 4F2HA 4JJ8A 5C3UA 3HN2A 2JJQA 4QJ5A 1AXRA 2SKEA 1OI3A 2E1PA 2GMWA 1Y3DE 3KO8A 2ZTMA 2EHDA 2RGNA 1CWUA 1T0BA 4P53A 4AKHA 4HDNB 4Z0PA 1U2QA 4ZT7A 4EECA 3CRNA 3JVIA 1WE2A 4KWTA 3A1VA 2ZVQX 2B21A 4JBHA 4EG5A 5HNKA 2YH2A 3KSAC 2RHRA 2CL6X 4IICA 4RV4A 4UAGA 4EB3A 3T52A 2YC2C 4KAJA 4FFWA 4R7GA 1R0ZA 4MWOA 4LXGA 3SQLA 5JW6A 1T9GS 1P33A 1IQRA 1Z0SA 2EBFX 1GPH1 5AVKA 2Q8QA 1YCDA 1LDMA 2C4WA 2YN2A 4FI3C 5EVCA 3V4OA 5AQ1A 1YUMA 2PKYX 4NH4A 1HYBA 2DECA 2FQQA 1LEHA 3LCJA 1DELA 3QHQA 4MYCA 4LHSA 2ZTVA 2AN5A 1VPEA 4RGQA 4DM4A 5BQ5A 2YZ7A 3ADDA 2JVIA 4EYGA 4RD2A 3OQMA 1DCTA 1USKA 3B20A 1JQ5A 2Z5LA 3V42A 3G6WA 1V7QA 4YPOA 5KWSA 5KYUB 3ZDXB 4RJ2A 2QIPA 1DUVG 1KI2A 2IK8A 3DEAA 2UXCB 4OL0A 4ED9A 2ZRDA 4MQBA 1CF9A 2BDEA 3BE4A 2QRVB 2YW9A 4LFAB 3I1IA 2G9VA 4E30A 1T1SA 3BXHA 3PZBA 4Q1VA 4TTVA 5K3CA 3TOCA 3ZE8A 4CV3A 4D25A 3DO8A 1JXOA 1PR5A 4HP8A 5AJVB 3JZAA 4DLVA 4N9QA 4QWWA 3ND7A 5EYPB 3REQA 1TCVA 4ZK2A 1E1KA 2Q29A 3IIKA 3Q8MA 2CF6A 4M7WA 1CZLA 4N48A 2O3SA 1YZVA 3RU7A 1Q83A 4C4YA 4OK6A 1U0SY 4Y2YA 1KDYA 1V2HE 1JI0A 4NLLA 1N57A 4WY2A 5HDQA 2DB3A 1DMSA 1UMDB 4W5QA 1GPUA 5K0GA 3IEPA 2FFRA 1IM8A 3BGDA 1I9GA 1ND6A 1TA4A 1WD7A 1T10A 5C8YA 5B3LA 5B2FA 3GRZA 1F8XA 2VRCD 2PJDA 1LI7A 2IPMA 3A1FA 3AZOA 2PV7A 1HFEL 1Q7BA 4FCCA 5E2AA 2ZREA 2WB4A 3QUSA 4DRXB 2Q2VA 3MWYW 1HNWB 3H9JA 3O4FA 4O2BF 4ZQGA 2WUVA 2C4UA 1YJQA 3JALB 5FA6A 3TSCA 3IGFA 2CXPA 1Y6RA 3EXG2 1E2PA 4MKIA 1VKOA 1YB4A 4Q19A 2XV1A 1X9GA 2IHZA 4OCZA 1TT5B 2DLDA 3ML1A 4QXRA 4ZYTA 1P1CA 2B5OA 3WHKA 3FZYA 1A96A 1P91A 5DBIA 2JAWA 3K0FB 4MIYA 4GKVA 1L7VC 3M3DA 4CKEB 3CN9A 5A6VA 1EHYA 3CZPA 2QVCA 3EZ9A 3KNZA 1GPBA 3JWJA 4XM0A 5AUPB 4POOA 1CUVA 1B1CA 3S29A 1JECA 4JY7A 3RG2A 4KACA 2E9SA 2R8XA 3C3BA 1XG5A 3MW8A 3QJGA 3NWPA 4FEEA 4PZEA 5T5QA 1NYQA 4G0PA 3WK5A 4RGVA 3KQMA 4UHHA 2GN8A 4W9NC 3T12A 4IIJA 1T1EA 2W0MA 4GE3A 2J5XA 3S81A 4NYJQ 4R98A 3MHPA 2POCA 4OHWA 5BYAA 2DETA 1DHTA 1IZ9A 1K6IA 1XTRA 2QD2A 1HDIA 1BC5A 2XR1A 4WCDA 4ALKA 4MCAA 1AXEA 3RYFA 2P78A 1GPWB 1JQKA 4YJFA 2OCAA 1NBAA 2O48X 3L43A 4MRMB 5EJ4A 4RULA 3DAFA 4BNTA 4K6HA 2POQX 1DQZA 1SD1A 3IE2A 4EGQA 3GMIA 1IY1A 1G3UA 1M66A 2ZDQA 5A6SA 2Q0HA 1KK2A 5AR1A 1UXHA 2JCSA 1MIHA 4Q4HA 4ALJA 1PJQA 4W5HA 1LV8A 1VJ1A 3IO3A 1UT5A 4KVZA 4UUNA 4WH0A 2UZ3A 1P31A 3H5VA 4RE5A 3EJ6A 3P19A 1I3OA 2W4IA 4JKIA 4V0RA 2OA0A 1CR6A 5C5CA 4IYJA 2RAUA 3EZ7A 1QYRA 2RKWA 5HFNA 1XAGA 5K3AA 2E85A 1VHTA 2OD7A 2YV3A 4LZOA 3F73A 4OQMA 2VWGA 1KC3A 1RXEA 1N0VC 2QROA 1MJFA 5EJ8A 4MVJA 3DM5A 5FLXA 1ISGA 5GOZA 3W9YA 5CHEA 3IHKA 3G7NA 4W5RA 2FEPA 3GDGA 4AD8A 1L5SA 1Y7LA 3WL5A 1VLVA 3V8BA 2QW1A 3WVNA 4AP5A 2G7MC 1K5HA 1YQUA 1SOAA 3IIJA 2DSTA 3Q9LA 4YGYA 4OQPA 1OI4A 3T0FA 4OGWA 4XJXA 1ZVQA 1QHSA 3OE7A 4KO2S 3TW6A 2O06A 3FWYA 2C7BA 2WIAA 1BA3A 4M1ZA 5F12A 3X1XA 5IEBA 1DG3A 2XBUA 4CUZA 4F3KA 4DCOA 2BFMA 1W0JA 4UM5A 4IGFA 1M5UA 4P7BA 1XAIA 2H07A 2P40A 3IVMA 4C30A 1XVIA 2PUWA 1T3TA 1OTXA 3DMRA 2D13A 1UPAA 5AK5A 3KZXA 4OSPA 4U7JA 1EVKA 1L5KA 3VOTA 2VZ8A 2RI1A 2Q5LA 1G2QA 2V03A 2VAPA 3RB8A 3EVZA 1X9IA 4RC9A 2B99A 1HG1A 4KOEC 5KREA 4JHXA 2RGYA 3FOBA 4DEVA 2A0FA 3C8HA 4J0CA 5FBZA 1RBMA 3ETLA 5TARA 1MB2A 5IEJA 3VR4A 2XOKA 3B60A 4I4LA 1BX3A 1G8MA 4ZDJA 5FV7A 3L93A 1HDOA 2RC5A 5KTOA 4KSCA 1QIFA 3GN2A 3WGTA 2HA7A 1EGMB 2D8AA 1EX9A 4L5AA 1YUBA 9LDTA 1TW2A 1WSAA 2OHHA 3P0FA 4RH1A 5ITZB 1L5QA 1CRWG 2BGLA 3ZVNA 1MQSA 3W06A 3TR5A 2PQMA 5FQOA 4K9LA 1ZGBA 3K4PA 4Q00A 1Y6ZA 5K4AA 2BCEA 4LVOA 5IM4F 3WYNA 1Q1NA 2DH6A 1VSBA 2B7BA 4TMWA 4RVCA 2VJYA 1KJWA 2IXEA 2WJYA 5KINB 2FHPA 4IDDA 4JL8A 4ZZ2A 3VV2A 5C32A 2CV2A 1LW6E 3INNA 4AG3A 5JI3E 2Y1KA 5DGCA 4MW0A 5K2OA 3RR2A 4BWGA 4QOIA 1R3DA 3PI6A 4HQKA 3RS9A 4B43A 5DX0A 2F4NA 5FKJA 1G98A 3HJHA 4XPIA 4O4HF 3RI3A 1AUOA 1T3GA 2ENUA 3D8BA 4GP6A 1WHTA 2GBGA 3OZEA 4HQRA 3T3IA 4X1IB 1YU9A 1W8DA 1V5IA 3OOWA 1DDIA 2YWXA 3OPNA 4HDMA 4ZYLA 3C2QA 4EIWA 1EFVB 5HKBA 3P2MA 5JCZA 3V8VA 3EXHB 1PL0A 4BNZA 1NF8A 1QH1A 3FKJA 1Z4NA 4B3BA 1QBGA 4CF3A 1QP0A 4NBVA 2L19A 2VZLA 1BKYA 4XB2A 2D1FA 3ZY5A 2P62A 4HX2A 5AW6A 2A9FA 4LJ4A 3LKZA 4QL3A 2D4AA 2OQIA 1PJZA 3EQ2A 3ZHCA 4KC0A 1SPXA 3EVDA 3FIJA 4E7PA 2H1CA 1WZNA 3KXPA 3EHEA 4JGIA 2OFOA 3OJOA 5DMHA 1QVWA 1R0RE 3MJEA 3OZRA 3IJEB 2IV2X 1MN6A 1T8SA 3ED1A 4IIBA 1EPUA 4LF5B 1UBUS 2NACA 1DOHA 3JARA 1E1LA 2BL4A 4PHCA 2P9BA 4MR7B 4EYEA 2QTHA 3THYA 5JRDS 4HFJA 5G0SA 1CZUA 2QN3A 5LQRA 1V6CA 2OXIA 2Z57A 3B5IA 3VVBA 2CNWA 1MRNA 3HU1A 4QU8A 2GPSA 1PDOA 3EMVA 3LFHA 1UWCA 3D1LA 3DLAA 3RVOA 4FX2A 2YXLA 3VR4D 3D7RA 3NJ8A 1Q2XA 4IO0A 5J3JA 4QM7A 1H6BA 3FYUC 2DH5A 3S2ZA 4MAMA 1WD5A 3ZE6A 1R4MA 5AW5A 1IXZA 1K8XB 1ESCA 4HCJA 1FL9A 5A4AA 4J7XA 2AE1A 3GVIA 4ZT4A 1O94C 2HKIA 3BM5A 2ZIAA 3CRMA 1SKAA 4AECA 1HETA 3LWDA 2WAOA 3FN4A 3ZDYB 1ANKA 3QMPA 3LUGA 4UD6A 5G0VA 4FOPA 1SQ5A 2VWHA 4DR1B 1BDHA 3L4KA 1H2ZA 1KVTA 4DKJA 1V0JA 1HZJA 2V6GA 3C3MA 3KKOA 4O02B 5I7WA 4IDBA 3KSZO 3PHGA 3VDQA 5BUZA 2FX5A 2PUDA 4L73A 1GJRA 3JVUA 3PI7A 1UJ6A 1U28C 5C53B 2O8DB 1I3LA 3PXDA 1VLLA 3PDJA 2HAEA 2UVPA 4E2YA 2JGDA 3R3YA 2HQSA 1FUIA 3V3KA 4ZICA 4JJEA 5IFKA 5FYQA 2OEPA 4EUKA 3IAM6 3B36A 4OQXA 1RLOA 3L4BC 4OJMX 3FG9A 3AJ9A 4HRXA 3KELA 3WJ1A 2E2WA 2PH5A 2ZB3A 2R6DA 3VYRB 4EUEA 3R44A 1WKBA 4OKNA 1XA3A 4QSMA 1ZDMA 4RETA 4AB1A 3TOZA 4G9BA 3UV3A 1G3RA 2O2EA 4M53A 3LDHA 5EUCA 5G0UA 1RPTA 2XE4A 2XNSA 3DHNA 2O7QA 5E3JA 4AIIA 1GTRA 4KAXA 4DWOA 3ZOZA 3THWA 2W98A 4NNJA 1PT8A 2IEZA 2BSAA 3IAUA 3KJIA 5ULLA 3TTUA 1QLHA 3I52A 1M0TA 3B13B 2J4DA 1M1YA 1K7CA 1YB2A 7AT1A 2IC5A 1UJ4A 2M1ZA 3DHVA 3C1TA 1OV6A 4CM9A 5FADA 4W7IA 4KE7A 4CU5A 4ID9A 4P7JA 2HDNB 4IS3A 5ADHA 1ULZA 3GT7A 2FR1A 5HUQA 3PUVA 2R8BA 4M0CA 1N0UA 1RJDA 1CP3A 1SWWA 5E1BA 4EG7A 3R5XA 3U3MA 1L8LA 2HF9A 4D9BA 4F4FA 3ECSA 1XMOB 4D8XA 1WPGA 2H5IA 1DRVA 1M6HA 1VKRA 3M81A 3TQOA 2DFNA 4DGQA 4EJSB 3AO0B 3EG9A 3LGSA 2R60A 4WINA 3SHTA 2WMNB 5AJZA 3PJGA 3ZE7A 4C04A 1FDRA 3H75A 5C18A 2FQXA 3ESQA 2BZSA 3B78A 1LZKA 3NZEA 3UAXA 5LZ8A 4FYMA 1VJ0A 2DLNA 2V7UA 4YJ2F 5JARA 3W3ZB 5CCXA 3PHHA 1E94E 3IV9A 1GLGA 1BOFA 4XJSA 4J16C 4J0IA 2XD4A 4YN3A 4EHFA 1MEEA 2AG5A 1U04A 5EKXA 1TYDE 5D00A 5H81A 1XNQB 1K5DA 1CF4A 4G0UA 2YASA 1TRHA 3F6RA 3EOAI 2OKCA 3PNYA 4Q1EA 4J07A 5LDDC 3HHPA 3LKDA 2P6RA 4CM4B 2EX4A 1FLVA 2W4QA 1E92A 3HACA 4M0KA 2Y1GA 5SYAA 2ZVDA 1U5BB 5KKNB 1GZ5A 3KXIA 3CPEA 3IAS6 4KXMA 2DBRA 5KX5F 4B3GA 1JEYA 4F4HA 3SBDA 1WBBA 1TTTA 2EU8A 4AXBA 3ZE0B 2Y8EA 2NO0A 3AY3A 1DC5A 1V4NA 1C29B 3HDVA 2A1IA 4D98A 3RADC 3PLAE 2VEOA 1BAPA 2EZUA 3FJOA 4D2IA 4F2DA 1BRTA 1LPAB 1S9HA 1W4AA 3EC7A 3DT8A 2QNRA 3HN7A 3H4IA 2AWNA 3KOXA 1EJ6A 4BVFA 4OQDA 5FTLA 4HDSA 1CQWA 5DGHA 1AHPA 3AR7A 1QR2A 5JSQA 2AZMA 3AKCA 1KZ6A 3BTUA 1B6RA 1M0WA 1SVSA 2ISSD 1JYEA 1WXEA 3CRW1 5AXAA 3NTRA 1D8TA 2EEPA 3THOA 5KOJA 2C5AA 4B71A 1FA9A 3NJ4A 4KWIA 3IX7A 2G72A 1L7EA 2WFLB 4OFBA 4OMFG 2ZYHA 1BE0A 4ZVTA 4NONA 4NV0A 4U7WA 5EE0A 1N2BA 5I45A 1U9ZA 3I83A 4BASA 1KO5A 4CEIA 1K3UB 3WV4A 4MW4A 1OF1A 5LBIA 1DCFA 3AF2A 1J1IA 1L7BA 3OQOA 5B7PA 3AVQA 3RVQA 3TLGA 1I4EB 2QJTA 3MUEA 1WB4A 1E2UA 2VQ6A 1FSZA 3LKVA 4Y2UA 3HY4A 4BQPA 1W88A 1E6EA 1WJGA 1XA0A 1XRNA 1YVEI 3M6WA 1CP2A 2QTRA 3IDZA 4ETMA 2IQ5A 2QN1A 4C05A 4FNAA 3VR3A 3IT1A 3OC6A 4OD0A 4ARSA 2PMKA 1OC4A 3W9BA 3KEGA 2D2FA 3NHLA 1AMOA 4RYDA 3CVXA 3IYLW 4DB2A 3B53X 1IJKA 2VPXA 2V6MA 4QDOA 3W5CA 2BELA 2OLJA 5KJCA 2Y9MB 1GZHB 1T9KA 1P7WA 1XI2A 3H0CA 4ZRDA 1QDLB 4Q1FA 4ZVUA 1ORRA 3JQQA 4L3OA 4EPTA 5HSGA 1UBMS 2VJLA 1P1KA 2YTZA 4G36A 1LBTA 2H2DA 2VDWB 3OPYB 2B4RO 5EFZA 4ZJPA 5ALNA 3O94A 4R8RA 1DBVO 1N0IA 1R6VA 3RRXA 5HGXA 5LMUB 1F7UA 4ATNA 1V41E 1E4VA 1Z34A 2ZKLA 3EDOA 1R4ZA 4QHSA 1J8DA 5AVWA 5LNK1 1YF3A 4V0LA 1TF5A 3SJAA 2NTNA 3HXMA 2G7ZA 2NU6A 3GZ4A 3QPUA 5B7QA 4DSOA 4AFNA 3HNPA 5JWHA 1UOQA 4Z5XA 2VUHB 1B2LA 2Z2KA 3N7UA 1PIWA 3E3AA 4YDQA 1NUUA 3A4VA 5E2IA 1P7VA 1ULAA 3I73A 4ENTA 1VIAA 2E4ZA 5HTOA 1DDOA 2MSNA 2VATA 3JZMA 4D82A 3CURA 4HWKA 1PZFA 3G5LA 4IW3B 4K9NA 4OP1A 1XMXA 3GT0A 3A31A 3WNDA 3AKYA 5E0KB 2L69A 4ER7A 1SKQA 1J24A 4FQ5A 5A9SB 2Y67A 5JC1A 2A5JA 3KP1A 3U7GA 1MAHA 5FI5A 1FB5A 1W4BA 1XN4A 4B3MB 3DQQA 2Q3HA 3K5WA 3LP8A 2WIDA 5KHLB 4BCBA 3AP2A 2ZRNA 3JQEA 4OIMA 5F7XA 3MJRA 2KBEA 5IXSA 2O1XA 1N5LA 2EARA 3JAWA 2ADMA 1C41A 4P22A 4XKJA 2OC9A 4LJYA 1OYVA 3PL5A 3FMFA 1J7KA 3DAPA 1XCPA 4YJGB 5E4TA 3UWDA 4PTYA 2WQ6A 1EP3B 2Y99A 1YU6A 3E58A 4GL2A 2VP3A 4BVEA 1XDBA 3E03A 2BFAA 1W85B 3HVHA 3FLAA 2MSLA 4Z4HA 1P19A 2A58A 2D54A 3IA7A 4FKZA 1IHYA 3TLEA 1O08A 3GMDA 4MRAA 2IOFK 2PO5A 4RXUA 1K6EA 2NYVA 3A58B 3B82A 2FFBA 2B6HA 2AVDA 3A70A 2GJ8A 1K4MA 1DJQA 1JH8A 2Y9PB 5SZJA 4DANA 4P58A 4WLEA 3OE5A 3WLAA 3TTXA 1RWQA 4KN8A 5FNVB 1D0VA 3GGGA 1E2IA 3M1IA 4KDFA 3EPJA 4ZI7A 4PZDA 4RMJA 5LDGA 4D46A 5SY9A 3GEDA 2DJ5A 2W9XA 4K40A 1HPLA 1SUPA 4B75A 2YZGA 4N12A 5IASA 3ZG6A 3PC8C 3KK0A 1YCHA 1KFCB 1VPDA 3PFWO 4H3VA 4OQ4A 3Q3JB 4R31A 1W1WA 4RJLA 4DIDA 4EHDA 1CY6A 1CQZA 1CZNA 2FN4A 3S1LA 1V3QE 1ZD4A 3GGCA 2WHPB 1IIBA 4I55A 2NYAA 3JQCA 2R7KA 1P60A 2VCYA 1VKHA 3U44B 1CDOA 2P8JA 3ENWA 3HN6A 3QW2A 4DARA 3VZQA 6PFKA 4DDVA 3EIFA 2PRIA 3GLQA 2NN3C 3NTOA 3K6SB 4B4DA 1IZ8A 4L27A 3QXXA 5EIOA 5FOXA 2J0SA 4IEFB 4XCXA 5D2CA 3MTDA 5JXJA 2X14A 4L0DA 3MFYA 2Z08A 3JWIA 1PO7A 1C3VA 1N2CB 3QI7A 4E2WA 5KHOC 1T6XA 1I24A 2A1TS 3SZMA 5FWYA 3U6KA 2I6SA 1RZRA 3GP8A 2XUDA 3A1UA 4KAFA 3RYIA 2H59A 3PC7A 1ZVMA 2H1VA 2MR5A 3AUUA 4KPUB 2VF5X 4LRWA 2FPKA 2C9BA 1NJFA 1M2HA 1TIBA 3GB9A 3ONVA 3SC2A 1EVLA 1QHHA 4IYRA 1YO6A 4GYJA 5C34B 2GHQA 2JD0A 1YAHA 1GOTA 1TGVA 3C87A 1LY1A 2EL9A 3GEGA 3PYXA 4BN0A 2ZP1A 1W34A 2R6GA 1QTQA 1GGJA 1G5IA 1H42A 1LQTA 1T43A 3T7AA 2C9ZA 1KDTA 4RQTA 5HOEA 2PMCA 4FCVA 3LPNA 4LY3A 4R41A 5F7ZA 2BBTA 4B79A 1ZK0A 4D6XA 4N6NA 1YK1A 4HQFA 4WBXC 1KJIA 3LD9A 4E4RA 2Z5VA 4TPKA 4QRIA 5FOVA 1IXKA 1SBHA 3PUKA 5F64A 4RENA 3KOOA 4BJ6A 3LM8A 1KYIA 3I09A 4FGKA 4QOGA 1OLUA 1VYUA 1YRQA 2G1UA 2NXWA 4M37A 4W1QA 5MGNA 2TMGA 4FDVA 1G66A 5LDHA 5TPWA 4C3ZA 5MN5A 2HW8A 1U2DC 2P5UA 3O92A 3DEZA 3U1VA 3QNUA 2HIAA 2YWDA 5C8DA 4GQIA 1YZLA 1O6BA 3ZWCA 1CHDA 2BLLA 3DFIA 1IDN1 5T7BA 1R4NB 5DM60 4Y0AA 5CYGA 1RS0A 1XJ5A 2MSKA 4F46A 3ZKAA 1PU2A 2C2YA 1C7ZA 2F2TA 3DBLA 1T9GR 1NVKA 2C00A 1FP2A 2V0NA 3NWJA 1H2FA 3ETCA 2Q1YA 4ZYUA 2GM5A 4QXMA 5ALZA 1BDMA 1TQ2A 3BYZA 1XLUA 3L7LA 3O3OB 4XASA 4DIBA 1S1CA 1XTBA 2BP7B 2XUPA 2ZSJA 3DOFA 3IUNA 4KTVE 3QWIA 4MMYB 5DE3A 4E2ZA 1A88A 2VYQA 4QM6A 4ZHQB 2AJBA 1NMZA 1PS8A 2IU4A 2X15A 2VI5A 3UM9A 4Q7KA 1U2SA 1UMKA 3L0SA 1CF2O 2P35A 3LLUA 4FVTA 4JLNA 1WVGA 3K32A 5I4IA 4Q1BA 5M7EA 2E5FA 3QJYA 1AN0A 3KJZA 1J20A 1SOUA 2IIBA 1I1QB 4MXDA 3SZUA 4E11A 4F4JA 4EGCB 5CVTA 3AEQA 4DCPA 4B82A 4RIIA 5CURA 3KR2A 1USUA 2LBPA 1Q15A 1QO9A 3E48A 1TU3A 3PRHA 3Q7SA 3RVDA 1E5XA 2GSDA 3KXLA 3TG8A 5F51A 3L0OA 3JQBC 3IOYA 4HRAA 2C4NA 3U4QA 1HFWA 2EW1A 3I8OA 5CM9C 4DABA 5JR3A 3MINB 4EPRA 2YJTD 1RRGA 1V5FA 4LRSB 4BZZA 1S2MA 1EH5A 3GPIA 1H85A 5A0TA 2IEYA 4JEMA 1DWPA 3OHMA 4BXOB 4GX1A 2ZE7A 3GLFB 2FAXA 2DTXA 1NOIA 3V1NA 1EK6A 1S2LA 2I62A 2R7NA 4DUGA 2X2OA 1I4DD 4PM4A 4IOLA 3JX9A 3AFHA 4QEKA 4JUCA 2J7KA 3RS4A 3UW3A 4MCHA 2PAAA 3J80A 2WLSA 4GWGA 1FMJA 1MA3A 1REQB 1ZD9A 3COPA 3Q0TA 4KQIA 3OEWA 2VDUE 4JJ7A 3KTFA 1KA9H 5KCZA 1DEAA 5DW0A 1D1SA 2X0IA 3EC2A 4IQFA 5FWNA 2P77A 4FHGA 3RVLA 4KMRA 4D6PA 1EG7A 2CK3A 2AI1A 3DM9B 5FTWA 4AJ2A 2NUPA 1YS9A 3VO9A 1SXJA 1SA0B 3L7OA 3OZCA 3NC1C 3KKZA 1BROA 1S5PA 4LY0A 3S68A 4KRFA 3QNMA 2ZR8A 1SY7A 3ICWA 2FN8A 1QR6A 2P9JA 3RT9A 1H2BA 1CR0A 1Z0JA 3Q12A 2FFHA 2ZDGA 1OWNA 4RIHA 4G67A 5L45A 4MHTA 1QTIA 3D0RA 1Z06A 1C5KA 1H2WA 2PIAA 3NXSA 4HX9A 1UZUA 4WXEA 2B5VA 2WE7A 1G4AE 1QVZA 2D5CA 4A92A 2KHZA 2OO5A 1TVMA 2ZS9A 5GP1A 2XE8A 4Z9XA 4G8DA 4AP9A 1QQ7A 2ZYAA 4FHCA 2YXPX 4TMXA 4BVGA 3E0XA 3DEYX 2DWQA 5JG7A 2JFZA 4KFSA 2Q3DA 5A4JA 1JS1X 3LX4A 4BHTA 5AW1A 3K0HA 1X2BA 1ZCZA 2V97A 3JQRA 3OKAA 2ABWA 3LG2A 1E66A 4GPD1 3QUBA 4CU2A 5AD1A 4P92A 2G5PA 1W25A 2XNJA 4L51A 4FB5A 2DPMA 2YW2A 4QGSA 5EHIA 3L5OA 3A0UA 3T7CA 1ICEA 4XQEA 3FBGA 4GU5A 3DFMA 3GNLA 4UOEA 2VXOA 3AF3A 2DQZA 2IOYA 4XGNA 5AI5A 1BJTA 2C1XA 4JC0A 1N5RA 3RSCA 4ETWA 3O73A 1R0KA 1E79D 5IK2D 2C5GA 2I6UA 2CYAA 2Y0DA 1HLFA 4MVJH 5IP5A 4F5WA 2ZT7A 1ZMOA 2YWFA 1G59A 1A72A 4Q7LA 1YKFA 1A4UA 1TPZA 1ZOSA 1CE8B 1VJDA 3F2IA 4U6SA 3GV0A 1ULBA 5B6IA 5JH7A 1I1OA 2PPLA 4KE8A 4OXIA 2ZIXA 3CU5A 1P5ZB 5DHUA 3GJZA 4KR3A 1YFZA 2WF8A 2HJGA 1U3GA 5AJHA 3TVDA 5C37A 2O8FB 3UB2A 1U4OA 5AHRA 2RSLA 3F49S 3EGEA 5KOHA 4GC5A 4DZZA 1CTQA 3BFXA 2D7CA 2XVYA 5FTKA 1NLZA 5D3QA 4B6GA 1FNMA 4S24A 1E77A 2CSUA 3CEJA 4PEVA 3WX0A 4E88A 3PEWA 1GNTA 4CIAA 3OQIA 3FOEC 4JODA 1S96A 5DULA 5KYVA 3D43A 2HSJA 3OCYA 4IGIA 1OFTA 4V1CA 1YJ8A 2XCQA 3DHWC 1AM4D 1YZYA 3ZBPA 4Z4CA 2X6TA 4RD4A 2CFOA 4RY0A 2E4VA 2PMDA 1G2PA 3IAS1 3TW8B 1D04A 2ZUFA 1IXRC 5FTJA 3U19A 3A36A 2VXCA 2WAXA 3VR6D 1GA1A 3LDGA 4BV3A 1WVIA 4FIZA 2O8BB 3ZTYA 2X2FA 2XI4A 1VMAA 3WSTA 1XTPA 2DY0A 1PQ4A 2OHXA 2PBZA 1PFYA 3FWHA 3IT0A 4J0QA 5EIAA 5UKDA 3WKCA 3WWCA 2H0AA 4BE9A 3LRXA 5BORA 1DXHA 3RYHB 1IWOA 3GQVA 3VR4H 4KW7A 2XUOA 2Z1DA 4QUBA 3TQIA 4YAJA 1C4KA 4ER0A 2XUJA 4ES6A 3EXFB 1SQGA 5LKRA 1ODIA 1RHUA 3W8NA 3FB4A 4U2GA 1OIXA 1OSNA 5I9MA 4BAUA 2P2CA 1G38A 3D6NB 1LD3A 1FRNA 4OX9B 5AHXA 2JLQA 1VRVA 3CWCA 4ZALA 2OOKA 4ZAXA 4BO7A 4MK4A 1H5NA 4CM1A 1NFFA 4DAOA 4X6YA 3NBAA 3UPTA 1NRIA 1VGVA 5TJHA 1UOPA 2PCJA 4X7BA 4FBGA 1M74A 2HNBA 3I34X 3IPYA 3OQVA 4NBTA 2ZU6A 3UK2A 1ZXXA 3CUSA 2P2LA 1NQ5A 3DD5A 3Q1LA 3G1TA 2QRVA 2RAVA 4PGHA 4OP2A 4JBYA 1R5OA 1RZVA 3BD6A 4HAXA 5LZ7A 2H92A 1E6MA 5EGNA 2PLWA 1PSWA 4JUBA 4BO0A 5GADl 1PQWA 2ADFA 1IQPA 1KIFA 4M1EA 4OQLA 5ALYA 2HT1A 2ZYVX 1XRRA 5EYPA 2F00A 2WUGA 4PZUA 3QMWA 3OIVA 4N8SA 4Q9HA 3GNSA 1N6KA 2NSYA 3AHIA 3BRWA 5EJGA 1N1DA 2CN1A 3OBIA 2OV3A 4HWRA 3IUYA 2XUHA 1P4RA 3U5ZB 2AN9A 2JZOA 1JKIA 2B78A 4BEVA 3MOSA 1UEJA 2LW7A 1RXCA 3NYWA 5L3RA 3ZDZB 4CDNA 4L6IA 2PSSA 3TSOA 1NNSA 3E8XA 4BS9A 3R4CA 4BDSA 4GQBA 2AXPA 4V3BA 3OUZA 1XV5A 1MUUA 4AZSA 2PZFA 3TZKA 1KRHA 4JR2A 3DJYA 4KV7A 2OYCA 4U2EA 4BJ5A 3AI3A 4K6MA 2F64A 2NWQA 4KMOA 4BIIA 1EK5A 1JBQA 1NUPA 3BMNB 5BWOA 4YFYA 5BURA 4XH9B 2IPLA 3RWBA 1HSZA 1G7CA 3KLMX 4X91A 3ZCRA 3I23A 3WAJA 3BFVA 3CPHA 3TO5A 2ZUCA 5F1OA 4DV7B 3EDYA 5AK0A 1W59A 5D87A 4DRXA 3AYZB 3G0BA 5DKFA 3MT7A 4OM7A 3MWKA 3CUWA 1M8JA 4AF7A 5JASA 1AKMA 3CZMA 4TQ9A 2IZ6A 4MI9A 1ZNZA 1E69A 2ZS8A 1SOMA 2QSYA 1YV9A 2YZMA 2EGGA 1RKVA 1X80B 3PFHA 1XZHA 4YCJA 2W71A 4CT4B 1AV6A 3I2IA 2NP7A 5HR5A 1TT5A 3ZWBA 2HQOA 1G5FA 3KEMA 4BVAA 3I4FA 1LLUA 2HFKA 4FBLA 1HF3A 2HHHB 5JV5A 2ETVA 4LI3X 3W8RA 3RJ5A 3VR2D 4EABA 4IXDA 2C94A 5CVEA 3A05A 2VJAA 1GPKA 3BWDD 3ND6A 5HQTA 1Y6GA 4I8DA 4X97A 3WL4A 3VZCA 1FY2A 4URHA 3LPDA 4N9WA 4IRUB 4EM6A 3T3NA 2Y6UA 1UDXA 1MFPA 2WJGA 3G2IA 3OKFA 1ORTA 3WL6A 4BV2A 3N58A 1KZ4A 3NJRA 2JB9A 4RIEA 3V1KA 2AFHB 1B16A 1NVWQ 3HGMA 5JAIA 1J9ZA 4HNSA 4W1PA 4DQDA 4YV2A 1FS6A 4R1LA 4H7JA 3CNEA 3X2SA 1S3IA 5C8YF 2C7RA 2UZ1B 3GZJA 1K66A 4RMNA 1KAEA 3IE1A 3WB9A 3P0IA 1AGNA 1P5HA 3ESBA 3A32A 4FFBB 4MRMA 3GGDA 4CLRB 4CIYA 4US2R 3QWAA 4C0AC 3BB4A 1FMLA 3BL8A 5KVQA 3ZU2A 5KTKA 1Q12A 2ZTSA 1S3SA 1M0EA 2IXDA 2JA2A 2Q07A 5A1TA 2K2WA 2KPOA 4BB0A 1E96A 2B1QA 2YR0A 2HIMA 3SOPA 1A7AA 4AO6A 2RCYA 4Z4EA 1VMIA 4GZMA 3UYKA 4BLSA 2J7PA 4E1VA 2I6GA 4MPTA 1NW8A 4Y9TA 4AZTA 2ZI3A 4YAIA 4FBMA 4NL4H 3NGMA 3WXBA 4U39A 1W94A 1U8XX 1RU3A 1ZH0A 3TEMA 1II8B 1B6TA 2ZJZA 3QXGA 3RKSA 4DJAA 3K9QO 3B6IA 1D2RA 1EK2A 4DC0A 5KMGB 4KLAA 1UBSB 3CX6A 4Y2XA 4GKKB 2IS2A 4LJ5A 1E6UA 3BHJA 3WGOA 2HA0A 4AY4A 4NEHB 5CH8A 4B8YA 1C3LA 1TEXA 2HHCA 4LXUA 4JP8A 2XCIA 4W9NA 2YRFA 2FZCA 4HB3A 4IIJF 4M3NA 4UMFA 4XYGA 5CPBA 3PQDA 1O8CA 2NU8B 1E3WB 2ERCA 3G9UA 3GXOA 1RQNA 1N2ZA 3DV2A 3OOEA 1FBNA 4UTZA 5KTSA 1QP7A 1QVVA 1T6NA 1R9NA 3RTDA 3UA4A 3COZA 4UTPA 1IOLA 4ZOCA 1FF9A 4KN6A 1C9MA 5DXFA 4WHMA 5HMLA 1EVEA 2FR0A 3I9FA 3PZRA 4BVHA 1S0UA 3LUKA 4YQFA 3SQWA 1RPZA 1ISIA 2X3FA 1KYZA 1XNRB 4K86A 5ERYA 5GJWC 3TL2A 1R27A 2BFBB 2GM3A 2PJUA 1PT6A 4WLVA 4ZU1X 2BI7A 1H0RA 3D5QA 3JD2A 1THTA 3FLBA 1VSTA 2QXTA 3KAPA 2RH9B 4NI5A 4PZLA 1O5OA 4YLEA 4UZSA 1ZIPA 4MKRA 5AJXA 2ZJ4A 4QBTA 5KOIA 4F11A 5L4SA 4AQ7A 3QY0A 4ZOLA 5DSZA 5AOVA 4IF6A 4OBXA 3HKCB 2M6KA 2G9ZA 3H2KA 2AFIE 3UV7A 4H08A 5BWBA 4MVJF 5JCXA 2BFOA 4J2OA 4URYR 2G0NA 4BMXA 3VMFA 3RC3A 1VBKA 1S7GA 1NVBA 2VPWA 4LDRA 2XGSA 1KH3A 1R8JA 2BZGA 3JCZA 1RAEA 3IQGX 4R16A 2DT5A 4YGXB 1MB3A 1L5ZA 2PBLA 2VK4A 1LJUA 4JELA 3GI1A 2WF9A 2NUAB 1L4YA 2W58A 5LJIA 3UJAA 4OGLA 1CJTC 3SU8A 1I4LD 3L2OB 4NNOA 5BP7A 2KWIA 4OLJA 2RGRA 3EWNA 2ZJ8A 1KK0A 1QH9A 1XUOA 3I4CA 3S5UA 5JS2A 3T5TA 1PX0A 2VJCA 1Q0ZA 2W93A 3R0XA 4C5CA 2QTMA 3PXGA 4JQSA 5K7SA 2A33A 4WK6A 3N2GB 4CR7A 4NCBA 1P2BA 3SSMA 1KZ1A 2OGWA 3DHEA 5DGDA 4EAQA 1TMKA 1DIOB 2YMLA 4NICA 4TT8A 1MD9A 4I1OA 4AO7A 1A8SA 2H3EA 4E21A 4QECA 3KWJA 1M34A 5AYVA 1WEHA 1X14A 3C1AA 1J42A 4QPZA 2J5RA 1H8HA 3W1VA 3OCUA 1CIVA 2I76A 1T3LA 4EHNA 2WTNA 2WU1A 3HJGA 4X1IA 1ONNA 521PA 2RGNC 3DR3A 1OZFA 4NDNE 3AW9A 1G8PA 2F3TA 1TM4E 4R51A 2V9ZA 2W6JD 3W4KA 4HZGA 2ZRMA 4FEAA 3EXHA 4WXMA 3TJMA 4BX9A 4QOEA 1SMKA 3V8PA 2I4TA 2R86A 1DJLA 1VSUA 1OBHA 2JLXA 4IDPA 4JLMA 2PR7A 1B76A 3KKEA 4QGFA 3MHTA 1JIKA 3DA8A 4C0SA 1P7CA 2PFSA 5IBQA 1ML3A 4Y8VA 3VX4A 3T54A 1QZXA 3NCHA 1PD0A 1I6MA 1GZVA 3DTVD 4JU9A 4RA9B 5CJPA 3VDMA 1P0PA 2I87A 3TQSA 5JBNA 3NBYC 4NOKA 1UJMA 4A0RA 5C35A 4R2WA 3BSSA 5KBYA 4TSFD 4B46A 5IKXA 3F6SA 3IPAA 2DKFA 2W2QA 4LY9A 3KIPA 1HNXB 1AX9A 3O03A 2JRLA 4GP9A 4FWTA 1XHLA 1I33A 1YASA 1DS6A 1WUIS 5BW5A 5EZ6B 1Z45A 1DEOA 1XK7A 4AP6A 5H4HA 3EF1A 2JFPA 2D8MA 3CIOA 2I4MA 3EVAA 4FINA 3A6HA 4RY9A 4DLPA 3KWFA 1W2GA 4IDEA 4UPDA 1IEQA 2NZWA 3AR8A 3RJMA 3VHXB 2WA2A 5BV8A 4YIHA 1M5RA 1IC6A 1RXIA 2ZI5A 3BERA 3CVJA 2JL1A 3WFIA 5HRAA 4FS8A 5FL7A 3K70C 3E1SA 4HVLA 4R1UA 1R8SA 1WHSB 4ZVNA 1AZSC 1WCWA 2TS1A 2IDJA 3MUNA 3ND9A 2HLNA 3L77A 4WNCA 3LC2O 5ALHA 2IHKA 1O7JA 4U6QA 1GTL1 5H9WA 1HYEA 1NVVR 1TF7A 2CJYA 2PNFA 5EWMA 1JQAA 3PDIB 2CMGA 1LXCA 1YL7A 2JK0A 3ESYA 1C3OB 3SQMA 4BNVA 1FIUA 1H4TA 1JQEA 1UXKA 2QG4A 2XYQA 2O8DA 4OJQA 3P4YA 3ZWXA 4QQFA 4ZAFA 2CHVA 1W7AA 3P20A 1BHO1 4D4LA 3A7DA 5JPCA 1YI1A 4CTJA 4Z1OA 2AZDA 1RYEA 3EQZA 4D0NA 4RCZA 2OBXA 3AJDA 1H8HD 2BR4A 2GJKA 3ZVMA 2VJQA 1DC7A 3R74A 4C6RA 3ECAA 4G4JA 3CJQA 3UMSA 1CUIA 3AJEA 9MHTA 2A5YB 4UMEA 3SQDA 3PJEA 4QBGB 2N75A 2F90A 1PWYE 2OHGA 3KJEA 4JXXA 3TQQA 1Q17A 4GH5A 4YAWA 1P1FA 1OFUX 4OYHA 3L84A 4P1ZA 4EF4A 5C2JB 2BEKA 5JMOA 4G2TA 2J8ZA 3A6FA 3ZJVA 2VJNA 1ZIXA 3NC0C 3QTTA 5L3SB 5I7AA 4US1R 3CCBA 5IVKA 1YOVB 2GK7A 3HA7A 3LVQE 3AF5A 4OFWA 4NHOA 5DDIP 2CFTA 3AIIA 2JS7A 3DZ8A 2P2SA 5FA8A 1JGTA 1F2VA 2LCIA 1EDBA 1RQGA 3L7MA 5JDIA 4I1PA 4RXMA 5DOZA 3ZDCA 4WK0B 4N0EA 4TS9A 3K9WA 5LZ5A 3QJ5A 2A2ZA 2EZ8A 1TB4A 4YBZA 2FSIA 1FOEB 2BEVA 2P69A 2HJ9A 3LVRE 3NPAA 2C8JA 2Q41A 2EX1A 1EFLA 3ZEIA 3DZDA 1E1RA 1BVYF 4MUGA 1DAFA 3H87A 1OWOA 1R6UA 2JI4A 5JCOA 4EJSA 5JXIA 1KBOA 1QGYA 3BWMA 1WEKA 3MCVA 4CDMA 5GZ1A 3O2JA 4XW2A 3ASUA 4RADA 3LS2A 3U49A 1MABB 2G83A 3QITA 3Q0IA 3AU8A 4XTCS 4N41A 1WF3A 3AH8A 2MR6A 5AKHA 2QRNA 4PS1A 2CCGA 3C98A 5DTMA 5AXCA 3U4GA 4OHXA 2H31A 1VP3A 4YRCA 4WFIA 3UOAB 1S9DA 1Y63A 3Q8KA 1JALA 4Q18A 1LTKA 4JD5A 5MGBA 2JIDA 3GFPA 2B4KA 8GPBA 5AJTA 3IO5A 1QHYA 2QRZA 3GEMA 2AKYA 3I04A 4XXHA 5DYYA 5G1PA 5MFZA 3DC7A 3W3AD 5JO9A 1U5BA 2LKCA 2QL5A 2WKSA 1P0QA 1J0XO 1N3LA 1ZVJA 2AHOA 2F3SA 3COSA 3G6KA 2Q4TA 1T2EA 3PPYA 1WOMA 4C6TB 4KB5A 1XRJA 1G9SA 1MJGM 2A1TR 4YI3A 2QK4A 1CUAA 4Z99A 3L49A 3FDZB 2JBHA 4G1FA 3NHBA 4YP7A 3L7KA 1ILEA 2RK6A 1RPAA 5H80A 5SZIA 1N92A 1WY5A 4BQEA 1KZ9A 5JSZB 1OH8A 1T0HB 4B47A 4KRGA 2ZYWX 3SFVA 4QTXA 5T8KA 4Q6BA 3L7DA 3PA8A 1M2JA 5EIWA 1DC3A 2XYRA 4N3BA 4UBMA 1DBIA 1Z0IA 2DQYA 2AR0A 1B1AA 4DV6B 1QG2A 1EVZA 5TSDA 1SIOA 1BCRB 2HBYA 2H51A 1MORA 1XNGA 3SSOA 3ZGVA 1DQNA 3AHFA 3WLSA 4EJFA 4YRBA 2R11A 2WFLA 3ZDEA 1MRZA 3EVBA 3B1VA 4ZXFA 1LDBA 2Y2UA 3W5HA 3OFJA 3SZGA 3IPLA 3F6YA 3VBEA 1NC1A 2J3LA 2QZZA 4YMVA 1E3EA 4OHYA 1NKTA 1U0TA 2V4UA 2P9GA 1M76A 2Y4OA 3O21A 5HCUA 4DV3B 3MIIA 3MUFA 4GLJA 3KE8A 1XD8A 1Z74A 4RU1A 3QU5A 4TT3D 1CEEA 1Z2DA 2DERA 2HBQA 2ZBRA 1ZUHA 1PGOA 5EZQA 3PHJA 1UC8A 2OYSA 3VM6A 1I4OA 3OECA 3GLKA 5BSFA 2CDBA 4Q7JB 3MMXA 4LQCA 5ALUA 1C9JA 4RZUA 3RHZA 4BC0A 5BT8A 2FMTA 3I45A 1FX0B 5AK3A 3FTCA 2J48A 4AMYA 4GT1A 1EE9A 1N5DA 2DPGA 1MAUA 2PWZA 1ETHA 2ID8A 1TK9A 4J2HA 3JSAA 1K8QA 3HCPA 2I6QA 1VPLA 3QLVA 3MLEA 5EHGA 3UZUA 2ZDHA 3IPXA 3D4PA 3FOAA 1PGQA 4G5SA 4HN9A 2VDWA 3UJNA 1PLJA 3KBBA 4EVSA 4RFVA 3DFKA 3PLRA 2C5BA 2GPNA 4GSYA 1AZLA 3QFTA 2XMPA 4YS6A 1YR6A 1JG7A 5KDLA 2OCKA 2O9JA 4LZZA 1OLSB 5E9JA 1OJ7A 4OMDA 2RHOA 4PY2A 1M2GA 1EFKA 3B8EA 2CDAA 4K9DA 5ALOA 1L4NA 3WGHA 1VBNA 2YWRA 4ND2A 4BGUA 5HG0A 5BRNA 4DQUA 5GGXA 3OWHA 2ZZMA 1HEIA 1TU4A 4WBNA 4F9TA 1Y6QA 2VHVA 2Q6TA 2YBDA 2ZTHA 4RK0A 5IW8A 3SKXA 2RONA 4C89A 3K5PA 4OJTA 3RIMA 3UJDA 3E2MA 4XOIA 1X86B 5BNZA 2RBGA 2I29A 4X8HA 4QXOA 2ECQA 4F71A 3SQXA 1YS2X 1IYZA 3ZI0A 1JLKA 2HPHA 5DNWA 3H6HA 1VIYA 4I5EA 1K27A 1X1BA 3LOUA 2ZCUA 5JPIA 5IUJC 1RJ9A 1V48A 1XXHE 3G7SA 4DWWA 1K88A 2BM8A 2Q5IA 3GU3A 2GT1A 2HDOA 5F77A 3E1GA 1VA5A 3FRIA 3DZGA 3F7MA 1VCIA 1IM2A 4YJGA 4XR9A 3FCAA 2VHUA 3LUHA 2IX9A 3NKLA 2X9GA 4XOUA 1POWA 3B2NA 1H2RS 1HRKA 3D6VA 4HEJA 5L3VA 3ZNOA 5KYKA 1F4LA 4KK3A 5HUJA 1J9EA 1FPMA 4ITRC 1XYVA 3BA1A 4NESA 1RE0A 4B32A 3ZCTA 3DUWA 1H6AA 4NCJA 5ADUS 3WXMA 1QAMA 3C8MA 4M0LA 2O1SA 4QDUA 4LF8B 2J9RA 3LT4A 3DZKA 3OT5A 1BQ3A 4BMYA 2IF0A 2AYYA 4TWZA 4EUSA 5IKOA 5BNIA 1T1IA 1XLTA 3AWIA 3OLQA 3O4VA 4N76A 3KXKA 2GBCA 4OF4A 5FNVA 2DLCX 4UM7A 2FMHA 2CLOB 2EFGA 3DDSA 3GMSA 1Q21A 2D0PB 3VO8A 3DMNA 1JFTA 2YYYA 3O8BA 4NMLA 2CMDA 4M7RA 4QUIA 2ZPTX 3HM9A 5IDQA 3W5AA 1Q6YA 3HB1A 1WQ1R 4HY3A 2VTEA 1NUAA 2FFJA 5GMOA 1WCYA 2FDXA 2Q45A 1NJ2A 2WIJA 3L8ZA 3FYCA 4AMUA 4UE3S 3S5JA 5LQNA 1LPPA 1GUDA 1TZCA 4FOSA 4QYIB 3EOZA 2YV5A 3ESCA 3F67A 3PXAA 4LE0A 2C2MA 4WECA 5IM5A 3SC3A 5IZCC 3HCOA 3U44A 3UMBA 4ZGWA 2H2AA 2EOAA 3DV0A 4CQJA 1VPWA 2B8JA 2A0WA 3QBJA 1JT9A 3WZ2A 2PSEA 2VOEA 1SB8A 3IAEA 4LSZA 3ZIAA 2BKEA 5DGTA 3D4BA 5AKJA 2WTBA 3A3NA 4CLDA 5B5SA 4JKOA 4TQUS 5JISA 4JGGA 4Z7NB 7ADHA 3UXHA 3TM4A 4LJ8A 5DI3B 1N2CA 2UUCB 2JJ2A 2ZYTX 3LXUX 2XXAB 1EX6A 1NXXA 4K26A 2PNJA 5EPUA 3ZD6A 1ESEA 3BE6A 1PJ3A 2PPVA 4KPUA 4Q21A 3RLIA 3V1YA 4N5NA 3QWBA 4NQZA 2PYDA 3ETJA 4A73A 4E22A 3UWSA 2PEYA 3LU1A 3QVGB 4PAWA 4DREA 3DUFB 3UHOA 1PG5A 2P5YA 3A6EA 3TPCA 5D1HA 1PZXA 1LLQA 1DX9A 4D9NA 1OYWA 4Q0MA 4JU8A 5DM2A 3EAQA 3HUDA 3LY7A 2WIFA 4LOJA 4R81A 4ZI7F 1QSGA 1WMDA 1BE8A 2Q46A 2WYHA 5L3QA 4BAZA 3HXOA 1E62A 3QYAA 4GR9A 4TN1A 1Y80A 2VHEA 5JVDB 2P0EA 4CKWA 1FRQA 1Y7HA 1DZIA 2SKDA 5B4UA 3IXMA 4YMWA 2WTXA 1QIEA 2IU3A 1GFZA 2YXDA 3FDJA 4IKPA 4NJEB 4OEHA 4WNAB 1LZLA 1OXUA 1U1DA 3C7AA 1QE0A 4I55F 1IRIA 2Q4RA 1KFKB 1SUIA 2QZ4A 3OJWA 4ZIRB 1S8OA 4GAEA 3F3SA 5JATA 3A1WA 3R6TA 2B2NA 4JVMA 4MSUA 1G8SA 1NVXQ 4LMRA 1T5LA 3AVOA 3UT5A 3FPFA 3K20A 4NVRA 4QFBA 1U02A 3JASB 4L7VA 3NDIA 4A2PA 1ZKDA 3I1YA 2YOFA 2HYIC 1N1GA 2FCAA 3N75A 1R4NA 3NHFA 4MUXA 2A8YA 5FIUA 5HP4A 1OPRA 1V39A 3DTVB 1HKUA 2CNKA 3WGLA 1XQ6A 3ISJA 5EQJB 1GGKA 2X7HA 3IQFA 3VX3A 1JR6A 3BHIA 1GGHA 3NUZA 2DR2A 1ABBA 4R4JA 3ZK9A 2HGZA 2YOHA 2JF0A 3CHYA 1RCTE 2W2KB 2BP7A 2CVHA 2CYBA 2EFYA 2FOXA 1P5FA 4FYVA 4X20B 3OA0A 1JUDA 4O2LA 5BYJA 3RVKA 2FW9A 1CRZA 3MTAA 4ZHQA 3AF4A 4KXXA 3B3JA 4DLSA 4PXYA 2KB0A 4NMHA 3UPDA 4P08A 1N6NA 4ZYYA 1YH3A 5F76A 1DX6A 2F55A 2O0MA 5P8WA 5FBVB 1JWBB 1JG3A 2C07A 3RUCA 6AT1A 3FX2A 2FOLA 3BAZA 3JQ6A 1HFJA 2BGKA 2FRDA 2HCRA 3ED5A 2X9VA 4N5DA 2OAGA 4M1MA 4OFZA 5CLLA 3TLYA 1R6XA 3ADPA 4OYRA 3F5DA 3GZTB 1BXZA 2JHGA 4EMBA 1E6LA 1E7WA 1ECGA 4DBLE 1QO7A 2JANA 1ZEMA 1YKGA 4G8CA 1E9VA 1E0SA 1PJSA 1C14A 2FB9A 2GRJA 3DSRA 2VTKA 2QMUA 2FPMA 1P74A 2V45A 3HBMA 4X1KB 3MINA 1A9RA 1FP4B 2WPDD 1HDZA 2G67A 5JAQA 2BMEA 1L4BA 2V7VA 5BN5A 3GLTA 2OGSA 4CR6A 3FPBA 2EX0A 4JUAA 1HE8B 3WLOA 4BXOA 2VH1A 4ENPA 1H9CA 2YJ4A 1YULA 4KGXA 3TQRA 3N8DA 4Z53A 1Z6XA 1UM9B 2B3DA 1CUEA 3AC0A 3ILXA 3PGVA 5E6RB 5GJCA 3T0GA 4FK8A 1C7EA 3ZK7A 3BB3A 4YA6A 2Z43A 4IMRA 4DADA 1X92A 1Q0LA 1E1DA 4LE2A 2DGDA 2I65A 1E1MA 3AEYA 1REQA 1WW8A 2IZOA 3ZU3A 3OT4A 4D3FA 5CGQB 3RJTA 1UAGA 2XCRB 3MWEB 3C0KA 3WK4A 1L5RA 5TC4A 5HRUA 1MV8A 3AF0A 3CYFA 1ZJJA 3I6MA 4E5PA 4IDHA 1LI4A 4DSUA 4ZJYA 4LS3A 5FHQA 4LOKA 3TUZC 1H2YA 4HH0A 2ETXA 4V24A 4PANA 1SA0A 4RVNA 1Z7WA 2ZAIA 2ZUUA 4Y9DA 3VKHA 1I4WA 2BHNA 3GRAA 4XIGS 4WN3A 4EWLA 1R0YA 1FVFA 2XMRA 4W7HA 4IUCS 3RSSA 1IN1A 4JVNA 2J3EA 2FPSA 2ZRGA 2DWPA 3I92A 5DU2A 3C3AA 3HCWA 1KMQA 4FUTA 1YDHA 1F8UA 2BOVA 3QI2A 4XDGA 1UKVY 1FFDA 2JH3A 3HI4A 1T6ZA 1S2IA 2AJTA 3OX4A 2FSHA 3PT5A 4XLLA 4O63O 2RK4A 5DHPA 5KNCA 2DAPA 3H11B 2P79A 1X6VA 2UDPA 3EQ7A 3MELA 1TJ5A 4I2VA 2NXCA 4WOPA 3TH5A 3BD8A 3NWEA 3AETB 2GN9A 3H5IA 3WKBA 1SIUA 3MWDA 3SYNA 4EW3A 2JI7A 2YWHA 3IOCA 3NEJA 1DBRA 2XTAA 5HF5A 1EWTA 1J7JA 4L57A 4S0ZA 4H3HB 1C0PA 2BH9A 2WPNA 1ZN7A 3HP4A 3MJDA 3RVNA 2GVDC 4BVLA 1W4CA 4KXFB 3VKFA 1TCUA 4GRAA 2R25B 2JJ8A 5FUVA 2R96A 4W1SA 1GPMA 3O5AA 3CTMA 4DMCA 3M6IA 2X1HA 3ZWVA 3ZZMA 3DLPX 4HJXA 4HZUB 2RG1A 1ZL0A 2ZRQA 1JFLA 3DW1X 1VDMA 4IGEA 5TQ0B 3THRA 5KAMA 2NU9B 3GLIA 2JRCA 2RGWA 2VT2A 1CE8A 1Y5IA 5JNVA 3JPYA 1CJKC 5K3FA 5A3RA 3RK4A 5DRTA 3AUJB 4JA0A 1CB7A 4I50B 3QVKA 4I2NA 4YLYA 4YO8A 3ERCA 5LJLA 1KXZA 1YQEA 2PWYA 5KNCH 2P4SA 3BAFA 1W1IA 2OENG 2I8AA 2QJFA 4BFLA 2DBVO 4GMFA 2G1KA 4UULA 1P45A 3GVPA 3ZTTA 1P2GA 4BO5A 3JVDA 4Z1MD 4ZKDA 1GV0A 3F5FA 4KH0A 4IHJB 4PGFA 2XIQA 1ZK1A 3CZQA 1Y34E 2N47A 4JI1B 3BJRA 1S7CA 1JHMA 1H1LA 1SU4A 3JVEA 2GYYA 2I22A 2I3GA 5LCXA 4LBYA 4N0MA 2REBA 4YQYA 3B70A 2WAAA 3UNXA 4D80A 1T8WA 4I5GA 5HA5A 2Z1NA 1OGJA 2AD1A 4E1AA 2IGBA 2QG6A 3GX1A 1ZU4A 1WUJS 3KHUA 5K3DA 5T67A 5H8WA 1SVKA 2XGMA 1XTQA 3DDOA 3L7JA 3OAAA 2J3DA 4EK9A 2WDZA 2HSDA 4J75A 4QOJA 5SZHB 3WSWA 2XUIA 3VNAA 4CIDA 4FQ8A 4JA2A 3KKLA 1JBKA 5A9TA 3E5HA 4X95A 5B12A 2FZ4A 3IMKA 4WWHA 3SHOA 1AKNA 2CLSA 3CV3A 1YQQA 5F2NA 1WTAA 4UUAA 1GY8A 1XTTA 5DLDA 4C0XA 1NNEA 3RYHA 2FWAA 3NG1A 4CV2A 3DOOA 3OOJA 3PX2A 4GRDA 1PWXA 2A5DA 1RW4A 3NAMA 4NU8X 1EX7A 3KSDO 3ZKWB 2AOUB 3C6MA 4ZZ0A 3KJNA 1RQXA 3UEOA 3AG5A 1S02A 2G8LA 5IJAA 4MINA 1YS1X 1DWUA 4TUYB 2CVZA 3ILYA 1F9AA 3QEMA 5I8WA 5JH7F 4S05A 3UBTA 3PWZA 2G8NA 1PW5A 2IHYA 5DTJA 2J9FA 3ST7A 4XLTA 5JSUA 4BGEA 1A5SB 4MUBA 1P39A 1XWFA 4PGAA 1X1CA 1JFRA 3WB1A 1QB8A 1YK0A 1EAYA 5ADVA 3TOXA 5FX2A 2W42A 8LDHA 2E3JA 3GCXA 1CQJB 3HBFA 1DX4A 4LBZA 9ATCA 2I6FA 2O8EB 2QUBA 1WM1A 3R3ZA 5DHQA 4LNHA 3LBFA 3I72A 3SGLA 1BVHA 1N7IA 1Y5MA 2B98A 1IVSA 2JHCA 1T4MA 4G4SP 2FQYA 4R5HA 1FU8A 1GGNA 1X38A 2J6CA 3FCXA 2Q3BA 5FWXA 1NVGA 2I80A 1IY2A 3KDAA 1GILA 4LHVA 2R00A 5JYDA 4GW3A 4ZA2A 5A71A 5KAPA 4J2TA 1NXVA 3WGMA 5LN1A 3PEEA 4MRSA 4DR4B 2FZWA 1BS2A 3H3JA 4BB9A 2I03A 2ET6A 5IUNC 2YQZA 5BSMA 4IJVA 2C97A 5KI6A 2JIPA 4I66A 1AGPA 2I71A 2HD4A 1M2FA 3OICA 3V00A 4CG2A 1EB8A 2PYIA 3IERA 3LHSA 5AIAA 5FO1A 2WRZA 1PJTA 5E7JA 2IKSA 2ASVA 2J9YB 3KPUA 1O6ZA 2Y1FA 1NQAO 3BMNA 1P1RA 3DZBA 4OK3A 1KOLA 5HPYB 4A6XA 4C5AA 4BQQA 4U5XA 3TSWA 3QPBA 1LF0A 1R0LA 4JDPA 3CQ9A 4I6GA 4PO9A 4B9EA 1WPXA 3LK6A 5B53A 2V96A 2G40A 3QY9A 1N5MA 4P4NA 1FE8A 1DBQA 1FDSA 2EQAA 2D4HA 4CFSA 5GIOE 3MPUA 4B7AA 4F84A 1KEKA 3HA5A 4OU5A 3UWMA 1RP7A 4QQ8A 4UEOA 1A8PA 2OZEA 2E1RA 4B0OA 2VWQA 4RL6A 5KSPA 2VHWA 3SR0A 4PN3A 4PHHA 1LX7A 2D59A 1OROA 5CDUA 1YRHA 1K08A 1XMJA 3P27A 3MXTA 5KHAA 5LBUA 1FP6A 3I3OA 3Q3GE 3R8FA 4II3A 3HYRA 2QNIA 1ZCFA 1Z5WA 2GXQA 3HP1A 4NCAA 1DXYA 3RTAA 4MEJA 3DDNA 4ZRNA 4DPMA 2J5QA 2P9EA 3O91A 4FPXA 3ONEA 3K1ZA 3RUAA 3TKAA 1VL6A 3J7AC 4GOXA 5DT9A 3SM9A 4OG2A 2TMKA 3ZWKA 2WAMA 1T8YA 2ODBA 4HH3C 5BQOA 3L0IB 621PA 4BQRA 4E08A 5D5QA 3A04A 4H18A 1J39A 2PR2A 1KP9A 3NEPX 1NR5A 3OJLA 3V2GA 2GYWA 3HM2A 5BN3A 5P21A 1QG6A 1VLHA 2UZ1A 3DEJA 4D5EA 2E4UA 4OHRA 4C0WA 1DU4A 2IUSA 3VZDA 4YQEA 2AEFA 2VDMB 3VU1A 1BH6A 1UKAA 3CINA 1GTG1 1TLLA 4FFBA 4NDZA 1B8NA 4CLRA 4PCAA 5FULA 4MKZA 1CRPA 2WIBA 1RI2A 4Z2YA 4ZAWA 3R9WA 5ENVA 1RTTA 1DXOA 3S7ZA 1OYOA 5L95A 3H9GA 2CYCA 2AQKA 3LHFA 4OHFA 4X61A 5G2OA 5KQLA 4MLPA 3CT6A 1MTZA 2CSXA 3W90A 4YH1A 2FJPA 4CEJA 2BPOA 3LQFA 3LY8A 4C7OB 2FI1A 2QTWB 3FGZA 3T1QA 2Y05A 2ZYDA 3WLTA 4TMKA 1DRKA 3BKXA 1P4JA 1RT9A 4LXXA 1RXWA 1FRVA 3QW4B 4FNGA 2NVOA 3EJWA 1CUCA 2BHSA 3P9XA 1SR8A 3D8NA 1LJLA 2WE8A 5D7BA 3BF7A 1PCXA 2Q5EA 1Y3FE 1TAHA 2XUQA 3CXRA 1Q44A 4I99A 3FMIA 4KXVA 4BFYA 1I2BA 3WBFA 3PCTA 3QRWA 1KAQA 3E5MA 4UD2A 2WV9A 4NSNA 3C1OA 3FNEA 2X0JA 1E3WA 1DKLA 1SXJC 3K2IA 5F9MA 3Q7PA 5H3LA 3ZWQA 4B85A 4JI8B 3GQBB 3V2UA 1T1RA 2ZBEA 2GTHA 2P5SA 4X9XA 2GRAA 1GRCA 2B8TA 2I1QA 4K6OA 2W90A 3UJHA 1ZC4A 2WR8A 3N0XA 5EG5A 1ZLYA 2F59A 3C3JA 3DB2A 3FPGA 4V0ME 4ZQIA 5HS6A 3I2HA 4ENUA 5BV0A 2NV2B 2RFLA 2CUTA 3E9CA 4NECA 5IT5A 4DRZA