1QYIA

X-ray structure of q8nw41 northeast structural genomics consortium target zr25.
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
380
structure length
380
Chain Sequence
MKKILFDVDGVFLSEERCFDVSALTVYELLMDKCYLGLHSHIDWETLTDNDIQDIRNRIFQKDKILNKLKSLGLNSNWDMLFIVFSIHLIDILKKLSHDEIEAFMYQDEPVELKLQNISTNLADCFNLNEQLPLQFLDNVKVGKNNIYAALEEFATTELHVSDATLFSLKGALWTLAQEVYQEWYLGSKLYEDVEKKIARTTFKTGYIYQEIILRPVDEVKVLLNDLKGAGFELGIATGRPYTETVVPFENLGLLPYFEADFIATASDVLEAENMYPQARPLGKPNPFSYIAALYGNNRDKYESYINKQDNIVNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLKGKDAAGELEAHHADYVINHLGELRGVLDNLLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
publication title X-RAY STRUCTURE OF Q8NW41 NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET ZR25.
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 126
structure length 380
sequence length 380
ec nomenclature
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1qyiA01
2RB5A 3OCZA 3L1UA 5ALMA 5AKZA 4BBJA 3AR8A 4Y2YA 3NALA 3SKXA 1XP5A 3L0BA 4I9GA 5AW2A 3A1EA 1QYIA 3QLEA 2YN4A 1N9KA 1Z4OA 2PQ0A 3QUQA 3KOOA 4DFDA 3AR4A 2RBKA 3ZTYA 1O08A 2WM8A 2YJ5A 3IRUA 2WF6A 1L7MA 3B9RA 1CR6A 3WKAA 2I33A 2I55A 3IB6A 2IA5A 2AMYA 4UMFA 4HGRA 3WKCA 2JAOA 2FEAA 2HDOA 2PR7A 3AR2A 3L8FA 3E58A 2GHQA 3SMVA 4OHFA 1PW5A 1YNSA 5AKKA 3A3YA 3QU7A 3W5CA 5AIAA 3ZUPA 3OTQA 2GFHA 2EARA 4BX2A 5AVSA 2I54A 2YMMA 3L7YA 4Y2TA 2QLTA 4CF4A 2MU1A 1L8LA 4J2TA 2OYCA 3ZTWA 2HO4A 1U2SA 4BNDA 3UM9A 3U19A 4ZEXA 5IT4A 3WK5A 1T9ZA 1S2OA 3U13A 2RARA 2YJ6A 3MMZA 3ZX4A 5AM4A 2YMPA 3QU5A 2W43A 4C4RA 2AGVA 2G1AA 2HEGA 2W4MA 5AICA 3WKDA 1Z5GA 2BDEA 5AW8A 3FGOA 5AKLA 3ZWDA 4BYGA 1VJRA 3EPRA 1L6RA 3NAMA 4I9FA 5AW9A 3ZX5A 4HGNA 1WR8A 2HF2A 3ZVLA 3OCWA 3I1YA 4FE3A 4UU0A 3AR7A 5ALXA 5AVZA 4KX5A 1YJ5A 4G63A 5ALHA 3L5KA 4Y2RA 4MUMA 2WF5A 2WFAA 2ZXEA 4UW9A 3UMBA 2IOFK 1QQ7A 3L0CA 2WF9A 1YDFA 3PGVA 3SLRA 2RAVA 1S8OA 1RPZA 2FPSA 3KC2A 4G9BA 4BEWA 1RQNA 3L8EA 3WK9A 4AS2A 4C4TA 3OCVA 1WVIA 2G0AA 3N28A 4UARA 5AI6A 2YY6A 4E88A 3I6BA 4OFZA 1RC8A 1QQ6A 3E8MA 5ALKA 2WF8A 4AS3A 5A3QA 4XOUA 1TJ5A 4KNWA 1ZJJA 2FPRA 5AVWA 2B1RA 1WPGA 5AW4A 2P11A 5AW3A 1LVHA 4HGOA 4Y3UA 3QXGA 1L7OA 3VAYA 1ZRNA 3MN1A 2OM6A 4FYPA 5AIBA 5AVQA 3ED5A 2B82A 1Z4NA 2FPWA 2YFYA 3BA6A 2YJ4A 1Z4QA 2AH5A 4UMVA 3QX7A 3W5DA 2EAUA 3KZXA 4C4SA 3RF6A 5AK5A 2NO4A 4AP9A 2VKQA 4YIHA 1WZCA 3N07A 3ESQA 3SHQA 3ZW7A 3E84A 2AUTA 3L8GA 3A1CA 2P69A 5A3RA 3UMCA 3DV9A 4DWOA 2Q4TA 3QGMA 3ZVMA 4H1WA 1MH9A 2CN1A 3CNHA 4KNVA 5AKJA 1EK2A 4XPZA 3QYPA 4Y2XA 1KYTA 1ZRMA 4RESA 5JJBA 4NFLA 5ALRA 5AI0A 4Y2UA 1Y8AA 3WK7A 1SU4A 2D2VA 5AK3A 3QU9A 1J8DA 2NO5A 3NUQA 3AR9A 3E81A 5ALYA 2O2XA 2G09A 4BKMA 3QNMA 2BY4A 2ZG6A 1ZD2P 3AR6A 2R8XA 3WK6A 1NF2A 3FPSA 3EWIA 2JARA 3R9KA 4CF3A 1U2TA 2ZBDA 2HOQA 4EX6A 1AQ6A 3U7EB 3ZU6A 3EF0A 4NWIA 1RRCA 4UMDA 2HF7A 4JB3A 5AW5A 5A3SA 5FP0A 5AW0A 4UASA 5AM5A 3QU2A 4L6AA 1RLOA 1Z4IA 4OCZA 3ESRA 4KN8A 4NABA 3J7TA 2HCFA 3WGVA 4FFDA 5AI8A 3MC1A 3FVVA 1RDFA 3TLMA 1RKQA 1ZOLA 2C4NA 4QQFA 2IOHA 3L1VA 2QYHA 1ZD4A 1CQZA 1L7NA 3A1DA 3NIWA 5AW6A 1U02A 4Y2QA 2IYEA 4YGYA 5ALDA 5AM3A 1XVIA 4IG4A 5E0OA 4Y2PA 5AKYA 4UATA 3RFUA 1YV9A 2FDRA 3EF1A 2I7DA 3B9BA 4J03A 5AI4A 1X42A 3U26A 2HHLA 4GXTA 5AVRA 2I6XA 2FUEA 3PCTA 3L8HA 2IOFA 5IT0A 4YH1A 3QUTA 4DW8A 2GHTA 1QH9A 2R8EA 3AR5A 3M9LA 5ALOA 1RMYA 5ALGA 4HAIA 3IJ5A 5AHXA 5AM1A 1T5TA 3FM9A 2ZBFA 3K1ZA 3KBBA 4Y2VA 3U7GA 2X4DA 1Z4JA 4EENA 2CFTA 2G07A 4NV0A 4EX7A 3MPOA 1Z4PX 5AKGA 1K1EA 1L8OA 3S6JA 2OBBA 1RLMA 3D6JA 3L0YA 2YMQA 4EEKA 4HGQA 2EATA 1FEZA 2YMLA 5AW1A 5AW7A 5AESA 1Z4LA 4GIBA 3NRJA 5ALNA 4PNHA 5ALZA 2CFRA 3ZWKA 5IS2A 5ALVA 4EZEA 2CFSA 2G06A 1ZD3A 4YIKA 1F5SA 3WKBA 2ZOSA 4YCLA 4QJBA 2DQSA 4Y2JA 1LTQA 1EK1A 3N8GA 3PGLA 3QU4A 4UMEA 1NRWA 4B6JA 4UM5A 2WHEA 3QUBA 5ALUA 4XQ0A 3R4CA 4OD0A 5ALIA 1VFPA 5AKIA 3DDHA 4NAVA 3I76A 1L7PA 2YBDA 4O8CA 3GYGA 2HX1A 3WKEA 1ZD5A 4F71A 3NASA 2HSZA 4BX0A 1IWOA 2YJ3A 3I28A 2I34A 2HI0A 1NNLA 5AI5A 4F72A 2W11A 2B1QA 1U7PA 2C8LA 1Z4MA 2PKEA 3F9RA 3ZI4A 1N8NA 4BX3A 2Q5EA 1T5SA 4HYTA 3SF0A 4KYTA 5T41A 2G80A 3HLTA 3OPXA 4HGPA 2JAWA 4KX3A 4CNQA 2FI1A 5ALLA 4Y2SA 1RMTA 4BEVA 1U7OA 1JUDA 1XPJA 3U7FB 4IFTA 1RKVA 1SWVA 4L57A 2C88A 4EELA 1O03A 1RKUA 2R8YA 5AK6A 1RLTA 3ZVNA 2ZBGA 1J97A 3NANA 2WF7A 4ZEWA 3P96A 4XE5A 3N5KA 1TJ3A 3W5BA 1Z5UA 2BDUA 2O9JA 2C9MA 3FPBA 3SD7A 4UU1A 1Z88A 4L6CA 4UAUA 4DCCA 2GO7A 2FPXA 3ONNA 5AM0A 3KD3A 4JDPA 3M1YA 1TJ4A 3KDPA 4YCMA 4YCNA 5AM2A 3WK4A 4UAVA 1Q92A 2P9JA 3DNPA 5ALEA 1ZS9A 5ALSA 5AI9A 3UMGA 2GMWA 2ODAA 3U7HB 5AKEA 3BWVA 2Q4RA 5ALTA 5AVVA 4MWOA 3PDWA 1TE2A 4ZEVA 5AVTA 3SKYA 5ALFA 2B8EA 4CF5A 3N1UA 2FUCA 5ALJA 2FPUA 1VJ5A 2JAUA 3FZQA 2P27A 5AVYA 3QUCA 3DAOA 2R8ZA 1Q91A 3W5AA 1TA0A 5AVXA 3OCYA 4CE6A 3B8EA 3R09A 1QQ5A 1Z4KA 3ET4A 3OCUA 2B30A 1YMQA 5ALWA 4RETA 2B8JA 3ET5A 1YS9A 3WK8A 3AR3A 1SWWA 2B0CA 2JGAA 3OCXA 2MSNA 1RMQA 5AVUA 2NYVA 5ALQA 3CZ4A 3HYCA 2OA0A 3WGUA 2C8KA 4UM7A 5AKXA 5ALPA 5AKHA 2ZBEA 5AK4A 2G08A 1RQLA 4BNDB
chains in the Genus database with same CATH superfamily
5FA5A 1DKRA 4PVDA 4EAQA 5DFAA 1IRIA 5J2TF 5IHPA 3EODA 1DC4A 3BMNB 2YV5A 3VKUA 1KAQA 2XYHA 4CL3A 3JTMA 2C5SA 2YHIA 4JYZA 2OXEA 3WL7A 3HVUA 1XJQA 3WWDA 5I5EA 5K8JB 1Y33E 4A2CA 2XQVA 4BKUA 2O2YA 3LKVA 1N9ZA 2H2AA 2I1VB 1U0LA 2IDJA 4IJKA 4CHGA 4K2AA 1E9CA 2M6RA 3QEBZ 4MKRA 2GAAA 2ZIVB 3QUQA 4RGVA 2KMLA 2CJFA 4TMFA 2R1ZA 4HNAB 3FZNA 2AD5A 2ADFA 4Y6LA 5DGHA 3ANLA 2QD3A 1L1EA 2WNSA 5FA8A 3F46A 4RHUA 3Q8XB 3CE6A 4KACA 4DMRA 2I4OA 3OTHA 5E1DA 5FPTA 3SXJA 3PE6A 2ZYVX 1YOVA 5IX8A 3JASA 1YRYE 2IHJA 2FFRA 3EXFA 2XIQA 1PJCA 1B41A 4P83A 2PMDA 2XV1A 4BVAA 4FR0A 3U4HA 8OHMA 3OETA 5E95A 4ALLA 4PX5A 4NCJA 4LC9A 4KJZA 3G1UA 1QNFA 3WADA 1Q15A 2YN2A 4WOCA 3ZI7A 3R9XB 3O8OB 2PZBA 1RWMA 3AK4A 1E98A 5J9FA 3SJCA 4MJLA 4BNUA 2B3TA 4BLRA 2VHXA 3ACBA 1SK9A 1NFQA 3NWOA 5HFJA 2JD0A 5IARA 2QAIA 3CYFA 1R9JA 1XTQA 3ZE6A 2X0FA 2JCSA 2GFHA 4YFYA 3LQYA 3A0RB 1MN6A 1GHTA 4D5GA 2JATA 2JK1A 2YMMA 4QGBA 4URHA 2XRYA 3B6ZA 4Y2TA 5AXCA 2C3YA 4OHZA 2G76A 4B7UA 4CF4A 3P9ZA 4PZPA 3AVQA 4HYYA 4IDHA 2OYCA 4ZCMA 1W7AA 3RJZA 2C42A 4TSFA 1L3BA 3D7NA 3W6PA 1I2MA 4Y67A 3X43A 2P9TA 3R0QA 2H4ZA 3CUEF 4MZXA 4P08A 2ZJ8A 4IV8A 3DJFA 3THSA 1OGIA 5AM4A 4RM2A 4Q4AB 1C3LA 1JAYA 1YMVA 2WHRA 1YOBA 3FVTA 4ECEA 5LD2B 3ORQA 2XD4A 4OOFA 1L7XA 2C2WA 3UMMA 3RUAA 2PTGA 4OBEA 3C8UA 3NVDA 4JWKA 5T4FA 4BLQA 1OX4B 3B13B 2FR1A 1HZJA 1MT0A 2HJRA 3G02A 3MT0A 1STOA 3MEQA 3ZDYB 3DZFA 5MHTA 3L77A 5CCDA 5IF9A 4KOEC 3WLJA 4BQRA 3WY9A 3OM9A 5DBGA 4CM9A 3AR7A 5AWFC 1Z5ZA 3UK0A 1I0IA 1KF0A 1SCJA 1TKRA 2JH8A 2O2JA 4FSDA 1U5BA 4HVCA 1N77A 1MJ5A 4RZSA 3BCSA 4MOWA 3ZBUA 4HDSA 4N1AA 1YCGA 2WF5A 5CA1A 4YAIA 1KEZA 4Q21A 1EX9A 1OU4A 3CLSD 4Z8YA 2PKQO 3E9NA 4A6PA 3I12A 3ZY5A 1Q22A 1VRCA 1Z47A 2C1EA 3NT5A 3S3TA 1K89A 1EVIA 2GZAA 2H1SA 1NI5A 1YOVB 3JASB 1Q7TA 3RDPA 4P4SB 4J29A 3N53A 2P2LA 4NYJQ 4B4DA 2J0QA 3HI4A 3CU5A 1CUZA 4JP1A 4ZDWA 4BFWA 3G23A 5B12A 2WJPA 4NTZA 4RH1A 3ODPA 4OP1A 5TF4A 3MJSA 5IM5A 4Z9AA 3GN1A 1R0ZA 3QVOA 1G9TA 1BKYA 4PBRA 4QYSA 1RQNA 4IV5A 4R9VA 4TMKA 2IPMA 4AS2A 3RWMB 1QRDA 1Z25A 3DDNA 4M55A 3WDSA 2XTZA 1P3Y1 4JIGA 4D9JA 3ORHA 1DXYA 1AKQA 3CNLA 3BS4A 4B3GA 3WOHA 221PA 2W9XA 4MYRA 1YBAA 5JEEA 4HH0A 5JASA 2OPHA 1OHHA 1F12A 1PSZA 2OB2A 2XMSA 3T1OA 1TO6A 4B3BA 4EB6B 4OYYA 4RVNA 1FYVA 1TUBA 3I73A 1MRNA 2HWWA 4JMPA 4X93A 5JW6A 2XMQA 3I1FA 1OZ0A 5F33A 1TCVA 1WVMA 1JTFA 3R7SA 4BZXA 3CLTD 3DQPA 3W9BA 2A4MA 4B7CA 3IXLA 4GE0A 3BMQB 5H8WA 3D8RA 4B3FX 1RU3A 4HN2A 4QPJC 5M2QA 4HQKA 4YPFA 1GCAA 3EXHA 1L7OA 2VPQA 2HB6A 3ZBQA 1UXOA 3PQ4A 3ILVA 2JIPA 2RGBA 3G0IA 1LUAA 1NXTA 2VYNA 2AF4C 2P8SA 3H5NA 3C3CA 3LUJA 3PZBA 4GW3A 4BO5A 3NIFB 4M53A 4GECA 2B82A 1DLJA 3JD1A 2WKRA 4UU8A 4XUGB 5HJ5A 2W37A 1L5YA 1KAOA 2WD7B 4DBLE 5B7GA 3EA0A 5MF6A 1K9SA 5A1TA 4FNMA 1TEZA 5IUNC 1UC5B 1YGYA 1TT7A 4O4HB 3WHLA 4AQYB 4URVR 4OUDA 2CNWA 4B80A 3IODA 2OCGA 2HR1A 4KH1A 4IIGA 2NO4A 5CLHA 1RCUA 2EBWA 4E46A 1JHRA 1M5UA 1WP9A 5E7QA 3WGZA 4IVPA 5I4BA 1TZKA 3CTPA 3NHLA 2OLJA 2Y92A 3SF8A 2QW1A 3DVQX 1R66A 2HXGA 4CIWA 5ADUS 3RBXA 1U5BB 3AFGA 1IBRA 4RWZA 1W6UA 3JU3A 1G2QA 1Z8HA 3WRYC 2XITA 4K9PA 4Q4HB 3USCS 5CA1B 2RGYA 3IKTA 4ZOCA 5B36A 1O6ZA 4YUAA 1YZQA 1JPJA 1T5OA 2OZEA 3BSWA 5IM4A 2WU3A 3Q3HA 5LXTB 4IGEA 3LOUA 3BAFA 1L5ZA 1Q3HA 1P2TA 3E9YA 5PNTA 2V7UA 1W581 3ACCA 3D64A 2BFNA 3C14C 4U2FA 3R3XA 3WQHA 1H0RA 3LBIA 4A26A 5IDXA 4S04A 3EW7A 4ISCA 1VBKA 2BR3A 5F78A 1UXIA 1LJ8A 2O2XA 2Q1TA 4OAPA 1C2YA 5F7JA 1Q50A 4BKMA 3TGLA 2QY9A 2SCUA 4NE7A 3LCVB 3T3OA 4ZT6A 1E7WA 3PS9A 3K1JA 3U0VA 5DNVA 3MJFA 3QPAA 2RGNC 2EF0A 2QAGC 2XVMA 2YIMA 4YRIA 4Y9SA 3SQOA 1HR0B 1Q7GA 4BFCA 2DFKB 4REQA 3BGOS 2RBEA 2YHSA 1R0SA 3G8YA 3SQMA 3ZQ6A 4B45A 1D1SA 4WA7A 1EWRA 3PLRA 2HOQA 3CUWA 2XKKA 3U7EB 2QMEA 2CD9A 3AEYA 4IFEA 3UJCA 1BC5A 1EBUA 1TUBB 3IAM1 1UDWA 1IWPB 1M5TA 1SFRA 5F1OA 2QN6A 5AYVA 3MCAA 2ZUFA 4JD5A 3QOFA 2H2IA 4MQ4A 4QUGA 5AW0A 5FX2A 5L6MB 5B3JC 3ADPA 2C2HA 1RQPA 3R5HA 3HUEA 1B0UA 4QUIA 3FOCA 4RQUA 5IVDA 4LDPA 4AROA 4MCJA 2XZTA 3NFRA 1U8TA 1ARZA 1AD2A 4HQFA 4W5RA 1L2TA 1OWNA 2VSOA 3EQ7A 3K30A 2VK8A 2H16A 4LHVA 4YMSA 3SLGA 2I6QA 3D6VA 3MOGA 5HMMA 2J5KA 3QENA 1JR3D 3A2LA 3Q7EA 3KSZO 1NBHA 1V4NA 4X1KB 2CEKA 2XNJA 4QRIA 3V1MA 2IOHA 2PTHA 2Q2VA 1UT5A 3A1DA 1T15A 2BLNA 4G5FA 3AC0A 3D1JA 5E7IA 4QOSA 3KKNA 2DBVO 3H5WA 2OWEA 2P9BA 3WMGA 4DJJA 3K70B 1N2CE 4PICA 3MS7A 4FLFA 2DBQA 5ULLA 1X70A 2JI6A 5KDOA 3MOSA 3DDZX 4H1VA 2B92A 3A9TA 3HU1A 1SGWA 1R2QA 4BRSA 1WXEA 3LYAA 4KE6A 5KCZA 1BWPA 3DUFB 4NNOA 3TRIA 3M6WA 1N1DA 4EFNA 2G0NA 2QRMA 1YL5A 3TSAA 4ZI7A 3BL6A 1GFWA 1KZ6A 2P2ZA 2GD0A 4EQ6A 1OXBB 2PH7A 4F0JA 1RW4A 3PCTA 5TF0A 3TTUA 1I7QB 4NMMA 5REQA 2WJGA 2RHDA 2VHEA 3FNIA 4NOJA 1PJLA 3VC3A 5L8VA 1T1EA 2NVUA 1BA2A 3HJUA 3PUWA 4KPUA 2R6DA 5GONB 1PK8A 2H8GA 3GN2A 1W44A 3INRA 5H4HA 3FVRA 2O4CA 2Z5FA 2C4WA 1BYIA 1E58A 2M2IA 2R44A 2VDLB 1U7WA 4Z99A 4F7DA 4M9CA 3FM9A 1PSWA 3P9KA 1K4YA 3PD1A 4MV5A 3O7WA 4O2LA 3W3AA 4IHJB 4MSUA 2BKLA 3HKBB 3KBBA 4Q3KA 3TSWA 4ARAA 2P6MA 4RPCA 2IXDA 1H3EA 3GB9A 1FDVA 4UUPA 1MCZA 1PQUA 3BGDA 3P2JA 4REQB 3N7TA 4F3YA 3O8CA 3L0YA 1T9CA 2IEDA 4WLNA 5J1TB 4OX9B 1EFTA 3DBIA 1DAEA 4L1KA 2K87A 4F3NA 2YBEA 5FDFA 3H9UA 2VF8A 1QFXA 5AW7A 1RADA 3DMDA 1ZU5A 3A1VA 3A6EA 4CEJA 3NM6B 4GKVA 4M0PA 4FOOA 4IZIA 2CE2X 4EG5A 2N1MA 4G09A 4M1WA 4GOLD 3JYOA 4CNBA 4ARIA 4YMWA 3P26A 4PVCA 4LFAB 1ZNXA 1VJCA 4MI3A 5DHSA 4C4OA 1KMHA 1JALA 1W87A 3CIOA 4F38A 4CKXA 3VM6A 3WKBA 2VDQB 4I2NA 3C3PA 1ZJ6A 2R7AA 3JZFA 1S2DA 2NTJA 1IULA 5JSQA 3WAKA 5FADA 4F1WA 3OOWA 3OZAA 4UD6A 1KQPA 4LCJA 4Y2HA 4UM5A 5CNMA 1T5HX 1N6NA 5DM70 1ZK4A 3RWOA 2ZREA 4MUYA 5ICSA 1UOEA 3V6MA 4A91A 2IF2A 2R5NA 3TX6A 1U2DA 5DB4A 3SYKA 2JFBA 3FUCA 3ROGA 1CZHA 2QLMA 2Z04A 5JLJA 2OAEA 2HA4A 3BE4A 4L5BA 3CWQA 1GR0A 3HYRA 3OFVA 4FFSA 4PHHA 1ZC3A 4NMLA 2HCBA 4E5NA 4GC9A 1T4BA 2R85A 5BNFA 5D8DA 1V1MA 3I83A 4F72A 4E4YA 1TW3A 2FEKA 5HZMA 4U7DA 2VRNA 3I2IA 3WDLA 1JH9A 4ETWA 1VHJA 4QZVA 3SBEA 3LUAA 3UA4A 1NF9A 4W1RA 4Y9DA 4KYTA 3U80A 1P7WA 4MZDA 5I8WA 1Y80A 1K98A 4ODIA 5K8LA 3DOEA 5FH9A 4NZNA 4S24A 2FH5B 3MWKA 5KYWB 2E7ZA 1LF5A 2RGUA 2AC7A 2G4LA 1GU0A 2GKOA 2R11A 2WAXA 3RB8A 4JITA 1TZCA 3IQDB 3AM3A 3ZHCA 2R8YA 4DR6B 1U0RA 4TTAA 4WFJA 2V7PA 4MQMA 3VO2A 3LX6A 3UXHA 5KX5A 4BFYA 1DAGA 4ND4A 1MC4A 2VHUA 2VVTA 4GXQA 4Z7QB 4IAOA 4FWBA 4RPHA 3OWXA 3AYXB 2CE7A 1E2EA 5LC1A 4RE5A 4XZ3A 4BBZA 2GT1A 3OT4A 1S89A 4LC0A 1A8QA 1QCYA 4BL5A 4DC9A 3EZGA 3RVDA 3EMBA 1KNXA 4DREA 1DEAA 3MT7A 3BL8A 5CFMA 3LP5A 5T8KA 4HZUA 4ZAWA 4B3DA 2A9VA 1QU3A 1U2QA 4U2DA 3DOOA 4G8BA 3JYLA 3M9XA 3U5TA 1IOWA 1A3CA 3PGA1 3CH6A 4CEJB 5EWLB 1N25A 1CR0A 1SELA 1SVUA 1JIJA 1WXXA 3T7CA 1J99A 1NAIA 3GFGA 1II8A 2R5FA 3D6TB 3O47A 4I4TF 5G4LA 1JSRA 3WNBA 5HS4A 4UHEA 4DMMA 4P3XA 4YI5A 3BTSA 1OCEA 1EK6A 2RGEA 2LW7A 4OI0A 3FF1A 2CKDA 5HSGA 3DOHA 5E6UB 5LU9A 5JUWA 4KQHA 2VJOA 3NTRA 3UMGA 1XP8A 2F9FA 3ZEIA 3VSEA 2YFQA 4IWYA 1HQCA 3DP9A 4JP2A 2RHCA 3A3PA 4L4UA 5BN4B 4PHFA 4CG2A 3OJEA 1QIGA 1UDRA 3HM9A 5LMNB 4DIOA 4ZOLF 1FOEB 1SU8A 5G0VA 3E3MA 3OQHA 5K05A 1BGXT 3QFSA 4CM9D 3PC8A 1ZICA 4ZHQB 5M5BA 3K7EA 1B93A 1ZIOA 3TNYA 3EYAA 3MIIA 2PVSA 4KQEA 3BFPA 2YW9A 3AJRA 4TTTS 4N3GA 4UNPA 5CA0A 3RRFA 4EABA 3BX1A 2GI4A 3QUCA 5DLQC 1HZZC 1JEDA 5AUPB 5CFQA 5ILOA 3DXFA 1KEEA 2I3ZA 3W5AA 3B2QA 2PZAA 3U40A 4O4IF 5ECDA 1CCWA 1UJ4A 3KK0A 5A7HA 5TVGA 4O33A 4DR4B 1E63A 2RI1A 4G0ZA 2IPNA 4OMUA 4PF1A 5E3HA 2N47A 3LU1A 1U1EA 2CXOA 2NOAA 4DJAA 1J42A 2G7ZA 3EAFA 4JYCA 3V7WA 2PZ8A 2DTXA 2NN3C 3GFVA 1RMQA 5L7TA 1WEKA 3OM0A 1ORDA 2ATEA 2RJOA 2WA1A 2XQGA 4JBXA 1IVNA 2O2CA 1MJGM 4NZPA 3TQCA 3V8NA 5BSGA 3WVNA 1Z5WA 4EZIA 1VMDA 1QGOA 5J4LA 1HGXA 4HN4B 5I7HA 2PHZA 1ESMA 5FD8A 2CCKA 3CLSC 3G9XA 3OCZA 1F9AA 3QIVA 2C9BA 4MVJH 5AK0A 2IW1A 2DT5A 1ZOIA 1LPOA 3DB1A 4MITA 4TV8A 4JI3B 2OCAA 1XDWA 4I9GA 1HE1C 4RXTA 3TZKA 1BXKA 1ZGZA 4R5MA 4X92A 5DXJA 5F1YA 5AW2A 3BTVA 3LKDA 5FUYA 1GLNA 3H75A 5KJEA 1EWYA 1VJDA 3VPGA 5F7ZA 2QK4A 1N3YA 3UWPA 2GBGA 2C5EA 4MEBA 4IVRA 3K9GA 4JI0B 1JSCA 3KOOA 2B3DA 3SDSA 3L0SA 1N6PA 3T3NA 1YXMA 2V7VA 1T4CB 2VL7A 3QE4A 3V8RA 2P5SA 4QOGA 1MVNA 2NYAA 4R9SA 1D07A 2X5OA 5INTA 2HZBA 3RAGA 2LP4Y 4PYJA 3B3JA 5D6OA 3I61A 3RTGA 2ZYDA 2RGAA 5MFZA 2CNWD 3G2NA 2GM9A 4AI6A 2O2HA 3ENKA 2Y4OA 1O9HA 4IYRA 4DWJA 5KNBD 3K70D 1XU9A 4KE8A 4QYTA 3CLTC 4RYLA 3JVUA 2UUCB 3H11B 1UXJA 4M21A 4F8YA 1NASA 3GGPA 3KR0A 2JA1A 3W4KA 3VR6D 3DEYX 1EFDN 3NHZA 4Q4DA 5BRJA 3MD0A 2B5WA 2SKDA 1T4MA 2YZ7A 2ZB2A 3R8XA 2QZ9A 1KAEA 1NA5A 3RYCA 3OTQA 3MRXA 3CRW1 4DIDA 3MFYA 4Q47A 1Y8RB 4BZQA 2CGEA 4JB8A 1N0VC 4F93B 1PCXA 5BMVA 4ML3A 2FR8C 1G63A 1S9HA 4UKDA 1G6Q1 5DHPA 4HTFB 3L4BC 4CMAA 4DNXA 1U2SA 1F6DA 2UVDA 2PBFA 3BHMA 3SBDA 4ZYVA 3U19A 3KJNA 3OUUA 1W5AA 3MTGA 3VNQA 3USZA 5IJ0B 1GNLA 4JIMA 4V0MA 1TC2A 4E7OA 3OLWA 2ZIGA 4GMDA 1IOVA 2W71A 5CW1A 4OHYA 3IOMA 1C1DA 1UZAA 4IDOA 2IUEA 3MJTA 1Q77A 1GGMA 2YQ5A 2JGDA 3LYUA 3K2IA 1EX6A 3W5JA 1KDZA 2DJIA 2XBLA 3ZWDA 1E6CA 1P18A 2ZWIA 5BN5B 4R83A 1BHSA 1SOVA 3CR7A 3D2LA 1F2VA 1P1KA 3CX4A 3HCNA 4QXOA 5CM2Z 1AGRA 2Q99A 3DAYA 4TV8B 2H1VA 3ZX5A 4AO7A 2XJ4A 1WR8A 1AVTA 1Z82A 2IDKA 2Y0CA 4CIVA 3RAEC 3NC1C 2F90A 1XN1A 2VPTA 3LMKA 3UH0A 3TZLA 1W47A 2NXEA 2BR4A 4PAMA 4FZ5A 3R5KA 3SE7A 4NBVA 4NPCA 2CLLB 4KVGA 3LFHA 2P5TB 3TI7A 4AG3A 1DMRA 6CHYA 3KKEA 1RWKA 4ZZ0A 2VTDA 3LL7A 2HA6A 4I9NA 5G4KB 1OXSC 5DNWA 3U49A 1SBIA 4P7GA 1PJBA 2CV2A 1H6AA 3DDCA 2CWDA 3ZD6A 1AHHA 121PA 1C0LA 3UY4A 5CG1A 3WGNA 1DEKA 4FCVA 2VDUE 2B5OA 1QUEA 1S3GA 3I6ZA 1JH8A 1SAYA 2HUPA 2JFHA 1VL2A 4OM7A 3X2SA 4DAEA 2KLHA 1FXUA 2OV6A 4II7A 2P2DA 5A9RA 4PR3A 5FHQA 2D5IA 2PUAA 1HFJA 3RM3A 2VXBA 5DKFA 4UVGA 4LDQA 4IIVA 4DCVA 4NCBA 2WUWE 1M1NA 3Q0EA 3PXGA 4UNRA 1JNYA 4OFWA 2OV8A 3N28A 3LC1O 2IUYA 4EG6A 2CZCA 4R98A 2CZGA 3EEQA 3RS5A 5CDFE 2AYYA 3RYCB 1JHXA 1MAAA 5AJYA 1E2NA 3ZEAA 5D6NA 2OCLA 3GY0A 3TS1A 3TIVA 3FROA 4NBNA 4EGFA 2B1RA 1I1OA 2F8MA 2QAJA 4U1RA 2MYNA 3VPBA 4KG7A 1OPRA 2BCGY 4RF2A 4X0EA 3WJ1A 1U7DA 3ESAA 3RNLA 1TYBE 2QP9X 3R3HA 3LD9A 4KEAA 3H1FA 5TMDA 2AB0A 3WB1A 4GUDA 4CJXA 4E7PA 5K99A 1DZ3A 1GG8A 3L7AA 4DS3A 5KZMB 1PFYA 1CW2B 3EE6A 3EPPA 3IA2A 4IDAA 1NOKA 4NDAA 4PYLA 4YEDA 3SS9X 3EG5A 2CV0A 1JHZA 5FWAA 1K3UB 5LP6A 1T9AA 3FI9A 1Z4NA 2WAMA 3LT1A 3M0EA 1RFGE 1U8AA 3T1VA 1FDRA 3MZ0A 3Q2IA 2OHGA 3SS8A 3IDQA 3AKYA 4RSGA 3C85A 2PO7A 4ESEA 1M2EA 4UEKA 2JI8A 3RFXA 4GXRA 2ZKLA 2PCJA 2F67A 3GPCA 1XKQA 4I2VA 3WV5A 3IT0A 1MPXA 2WOOA 5IAAA 4X3OA 1WIWA 4YTEA 5IEJA 1ISGA 2L69A 1QVVA 4BTVA 3R8FA 3GFTA 4HJXA 4MUNA 1QZUA 2HKIA 2XGMA 1P73A 2DR3A 4P5EA 3ZVMA 1E1KA 2EHDA 1FNBA 4KNVA 5AKJA 4ENPA 2R62A 3NKLA 5HTKA 4G4GA 2Q3EA 3SZGA 3CEHA 5KTTA 3KCNA 1X6VA 1Q0ZA 2XE8A 3ZWAA 1XZKA 3AVYA 1QIEA 2FLKA 1RKXA 2WQZA 1HLFA 2R4QA 4GI3A 1S1MA 5DX1A 3PUZA 3L1HA 4BKRA 1S8NA 1MT3A 1I4EB 1Z6QA 3HJRA 2PV7A 2AOUA 2OYRA 3ZG6A 1XZCA 1OLUA 2XWSA 1J8DA 2TSYB 1J9EA 2QX4A 4K9LA 2Q5LA 1OJ7A 3H97A 4FUTA 4X8HA 5JG7A 2AG0A 3RC9A 4KE9A 2X3YA 1OPXA 1GKUB 4ND8B 3QNMA 5EQTA 4MRAA 3EZ9A 4ZVRA 5A4DA 5ERYA 2YIJA 1ZD2P 2DC1A 1V7CA 4ZVPA 2CDRA 3JYPA 5IDVA 3EUEA 5BNZA 1JRLA 4KMOA 4O08A 1H8HA 2JFOA 4IVNA 1O6FA 4JBYA 4QELA 5CTAA 2JFWA 4URXR 3KQWA 3HDTA 5LD2C 1OT5A 4IGIA 3C5HA 5GY7A 2HJWA 3I4FA 3M9WA 1NY6A 3GDHA 3NHJA 5I8PA 2NMVA 1NJ2A 2ZJ0A 3F7OA 2E89A 4KQKA 4EATA 5JROA 1HG0A 2BHLA 3M6UA 4UASA 1NVVR 2J45A 2OZPA 1UJMA 2J6BA 4GKAA 1GP2A 1VC2A 2VDWA 3BZWA 4I08A 3B48A 3OX4A 2MMGA 4HWOA 4XFDA 3ABZA 4NEHB 5FIUA 5JPDA 3ZDQA 2ZJOA 5BPHA 1DC8A 1ADGA 4XDHA 1CJSA 3BC1A 2QGNA 1PUXA 1WPXA 4M1EA 4IEEA 4IDCA 1DKOA 2O1SA 2Q3CA 3OE4A 4OLHA 5ELLA 1JHOA 1RKQA 4CXMA 1H0HA 2ATCA 4DA4A 3IERA 4LQCA 4P2BA 5K2MA 3V1UA 1IC6A 1UOOA 4QXPA 4H1UA 4RH0A 5L3RA 2AKYA 1N7HA 1KFBB 4G1FA 1Q0LA 1PU2A 1J7KA 2NZUG 4B5LA 2MINB 1FRZA 2QW8A 2G40A 1U3CA 1I7NA 2CHEA 1WXGA 1XTBA 4R2JA 2ANBA 3JAKA 4E12A 4OBBA 4H0NA 1W52X 3I9OA 1EQ2A 4FYXA 4ZVTA 1O57A 5BURA 1D0IA 1N2CB 1ULZA 1BW9A 4MP8A 4C14A 2DGDA 1X1CA 3V46A 1GYRA 3RFVA 3V1YA 1Q2XA 3NVKI 1X42A 4OHVA 1Q44A 3DM9B 4MP6A 4TQAA 4Z2YA 1XVVA 4GLFA 3RVJA 5A2GA 2IOFA 4MGHA 3ICPA 1Q7RA 4PC6A 3BIFA 1HNXB 3K8QA 4RM3A 1CY7A 3OBBA 3D5TA 1QYCA 2WG1A 3E5HA 1FRVA 2E5LB 2YWXA 1KSJA 2V5AA 4DANA 3QVGB 1W0CA 4KRXA 3V7UA 3MOIA 3A3KA 4WBSA 3HU3A 5GTDA 5I7WA 4YBZA 2LE0A 3GD7A 4UVIA 2XDAA 1A1VA 2YASA 1ENZA 3V80A 1ESEA 4YY3B 5AKGA 4BWYA 2I7XA 2BM8A 3PQ6A 4X1IB 5FV4A 3RU7A 3ZVKA 4IJ5A 2YWBA 3X1XA 3AG6A 1PD0A 3OECA 2QUJA 3R7LA 2XUQA 4I5GA 2ESRA 4YJ3F 4D4MA 3UKDA 1Y4UA 2O0KA 4FBMA 3BZBA 4GM1A 1N3IA 3L07A 2A1TR 4GWKA 1F4VA 3QEMA 5IZCA 1U0BB 1IIRA 3PDHA 1X8XA 1S2NA 2CFRA 3PKJA 1D5WA 3Q72A 1ODLA 3D3WA 2BEJA 3QELA 4BN4A 3C3JA 2ZSAA 4MB2A 3H1PA 3VUFA 5CPFA 3D3QA 3PVZA 5FTJA 4C76A 1EUZA 2DQSA 2H1WA 4O2BF 4OJTA 1AQJA 2LCIA 3MBOA 2ALJA 2WJVA 5CB0A 1Y3CE 1E0DA 1YBFA 1UR5A 1YJAA 3NVAA 4TMZA 1P4AA 1WL8A 2EWMA 5BYAA 3LVFO 3A6DA 3R4CA 2DWQA 4KRYA 4OAQA 2O1WA 2HRDA 2BWJA 4PPFA 5LOVF 2HNAA 4J90A 3QVTA 4O3FA 3NJRA 4MWTA 2NO9A 4OL9A 5C18A 2HX1A 3Q2KA 2F1JA 1YS1X 4XJTA 3FCCA 4XGKA 3VFDA 3FTEA 4ZYUA 2YWDA 2VRCA 2XHEA 1B8PA 2HK8A 2PX4A 2HI0A 4OQ4A 1V4BA 3ZGLA 1HV8A 3INGA 3KUDA 4A1OA 4BRUA 4LJ6A 2BHTA 4KGVA 2RC6A 4GM4A 1QRTA 3NEJA 4JMLA 2X42A 4HPXB 3OZEA 2CEAA 1CEQA 1JMVA 1ZISA 2FUNB 2V3WA 1JILA 3V4OA 4H4EA 1ZESA 5K4GA 4NJEB 4DAOA 3AONB 3DQQA 1SQSA 4LECA 1NMZA 2JIBA 4RMGA 3RCBA 3CY6A 2GM4A 2X9NA 2FI1A 4PXSA 5LYYA 2QM3A 2Q0QA 4WFQA 4V1CI 2C84A 4HNRA 3R24A 4OEHA 1PZHA 1AF7A 1X7ZB 2CUNA 3GJXC 4NH0A 4OY3A 1RKUA 3WNQA 5FJIA 1H2BA 1Z68A 3KLPX 4FZVA 2A9FA 4MVJG 1EBBA 1Y4AE 2DHEA 1KEUA 3V3KA 3TIXB 5H70A 1WETA 4I8IA 4FQ5A 1NBEA 1KPGA 3NHWA 1WU7A 3NANA 4XCVA 3HKDB 3CMCO 3EXHC 1AN0A 2PUVA 1YZLA 2VEOA 1V8PA 4DKJA 1FU8A 4B6FA 1M8FA 1YZTA 4OKNA 1BQ4A 4FGZA 4QECA 5LZ7A 2QVGA 1OGJA 3UAXA 1RQXA 3GJ0A 4ZJYA 5BV2P 3ECSA 5LPNA 3H9BA 3OHSX 3JD2A 2F8LA 3NXSA 3Q9SA 3FJOA 4X7PA 3V2UA 1Z2PX 4C7JA 2VPIA 4E31A 5FQNA 4LGYA 1VJGA 1HDXA 4POAA 4L8WB 1YQDA 3K70C 3AI2A 4IJWA 2XQJA 2Z2IA 3A8TA 3HN7A 3QM1A 5JE8A 4LJRA 4LVNA 4MPRA 1J5PA 4PZCA 3RSGA 3TINA 4YCNA 1G7TA 3ECCA 4N0EA 1U63A 1IN4A 3KETA 3AZQA 1TF7A 3VPHA 2YICA 4IQ4A 1ZS9A 3STWA 2QP3A 3EZ2A 3K8YA 4JOBA 3MQ4A 4FGJA 3WQBA 1F3OA 4J4BA 4D0RA 3TXYA 3R3ZA 3OKFA 2W58A 2ZJ2A 4R1PA 1Z6YA 4A16A 1BS9A 1JG7A 1APBA 2HW8A 1FSGA 3AW9A 5JC1A 2BBOA 2WMNB 2QX8A 1VYUA 1XZAA 3FRJA 3OAAD 4MWOA 4OGKA 3L40A 4DMUB 4WJZA 1USWA 5KYGA 1C9YA 4XRGA 3P20A 3A3OA 5EXTA 5ALJA 2Y76A 4P3KA 2W2KA 2Z83A 1QPGA 3KL4A 3C6ZA 2OQ2A 4REMA 3KPUA 1QK5A 1SR8A 2ISSD 3BMOA 5DEOA 3FOBA 4MPJA 1ODIA 2EL7A 3ZC3A 4FMDB 4CQJA 3UMYA 1YQXA 1ONOA 1DKPA 1Q91A 2BEWA 4WOKA 2O3JA 2E55A 3L8DA 3OCYA 4QU5A 3OQIA 5CH8A 3RT9A 4BVFA 5JJIA 4JHLA 3UFXB 1GRRA 1VMAA 1Z4KA 1TEHA 1O9BA 2BEVB 5FWDA 1NJSA 1UJBA 4WZAE 5D3QA 2L42A 3NETA 4PLVA 4CMJA 1KOJA 3AR3A 5BVGA 1T5BA 4QTYA 2GF9A 3G85A 4JHXA 5JXJA 3RHZA 2QRKA 3GIDA 4W6QA 5AHWA 3V2HA 1TC1A 1FA9A 1VJTA 3WGMA 5AVUA 1L4EA 1KJNA 1MIOB 2SNIE 2YZKA 3FNQA 5JS6A 1QOQB 2IOQA 1T34A 5DWVA 4G9EA 5LYJA 1A69A 2QTAA 1JZQA 2WNHA 421PA 4Y30A 1SUWA 4K6KA 2JJ8A 5LA6F 1BMFA 2EP8A 3T1QA 4BNDB 5DYYA 2RB5A 4TLDA 3UENA 5ALMA 3AUUA 4PC1A 3RHSA 3SQWA 2UYGA 1YVRA 4RKWA 5LDDC 1T91A 2JEYA 3IBGA 3EIXA 3PR1A 4U0JA 4LWPA 3L6EA 1P19A 1VG0B 3G5TA 3BCHA 2QRGA 2ZYWX 3CTMA 1P1JA 2QLJA 3FYTA 3SOPA 2GETA 3IUSA 4RD0A 1JI3A 5B3LA 1R9NA 3UZUA 2QRVB 4KXQA 2WM8A 4NL4H 1EJ6A 2C2ZA 5B1DA 2PG3A 4CKZA 1CIVA 1WXFA 2OG2A 5LM3A 2DSNA 4RV5A 5LWQA 3ICCA 4QC2A 2OC4A 4DLKA 1GAXA 1G64A 1DIGA 2PA3A 3PI6A 2UZAA 4P0TA 3DWIA 4Z51A 5BWMA 1W0KA 2GLXA 2X19A 1UKEA 3K94A 4TVKA 3FJ1A 2HGZA 2ISQA 2PUTA 3DVAB 1TAHA 3IPCA 2AXQA 1BJRE 3FCSB 1RYBA 1Q1EA 2WE8A 2CLHB 1DAKA 3K0AA 4HSEA 3HZRA 2NU9B 1Z34A 1NVBA 4WX2B 2I91A 4TT8A 1H4QA 3IB3A 4TS4A 4E5DA 2R6ZA 3C6BA 5AIAA 4BFVA 2NPIA 4WERA 1QIMA 4ZJUA 1ZUIA 2VBCA 3EQ8A 1CULC 1UFKA 4MUJA 5AVSA 3T54A 3OQIB 4RY0A 3I1IA 3ZJTA 2FYTA 4WDQA 3UVEA 1BH2A 2CJPA 2JBAB 2MU1A 2J3EA 5E1MA 5LKAA 4FP9A 3ORSA 3S2ZA 5BVGB 1E59A 1PR0A 3GEEA 2FG7C 3ZD7A 3GLRA 1LLQA 3QXSA 6REQA 3BSYA 4DLUA 4JKOA 1YTUA 4XGRA 5HFAA 3WK5A 2H2DA 4K6CA 1MW9X 3HWWA 3SR3A 4B87A 3ZX4A 3KHTA 5IKXA 2PKQP 1HURA 2TMKA 3HFJA 1FVFA 2QQFA 4E2XA 5C35A 4J76A 4D9GA 2JB9A 3RKUA 1AUOA 5LYJB 1KYZA 4DDMA 1ZGCA 2AXEA 1H8HD 4ZQHA 4O4JB 3WGOA 1PL7A 1PJ4A 1X8JA 3AB8A 4MICA 2C3UA 5GM1A 1GTRA 1VXRA 2IW3A 4FMCF 4HDQB 4D4IA 3JARA 1LPPA 3OMLA 4UCWA 3AHFA 4BDSA 4G1CA 5JH7F 3P4XA 1PE0A 1DO0A 5AW9A 4DMGA 1U1IA 2GYYA 4D44A 3T9CA 2NUAB 1KI6A 3N58A 5BUCA 2QLLA 1HE3A 4F2WA 1U2DC 3UO8B 3W4IA 1DQSA 1F2DA 1IJFA 1ZSVA 2OHIA 1H2HA 2VAXA 3A9WA 2WWWA 4LDAA 2ZR8A 1M66A 3KQTA 3K0FB 1CWUA 3WS7A 5MGNA 1H1LA 1JX6A 2G6TA 2NUPA 2QQ0A 3L5KA 4N41A 2GF0A 2VQDA 1YZHA 1N6OA 3HKEA 5T3YA 4CKCB 2IHNA 4OF4A 3H1AA 2RJNA 4OK3A 3RGGA 1YI0A 4LX8A 2C92A 4KITB 3E18A 3FIUA 3PFNA 3F5SA 3VU3A 4O2AA 3EQ6A 1MX5A 2FKAA 5KQRA 5D84A 1F2TA 1KE2A 4C2TA 2VOJA 4FCCA 2QL6A 1PT7A 3K9QO 2WF9A 3KWJA 5L4LA 5CEFA 1H2AS 2IUFA 2VBIA 3N74A 3USES 1OXXK 3DDSA 4NKRA 2PZMA 5I4CA 1O8CA 5G3ZA 5IK2A 4JNKA 4DDKA 5BWBA 3PVSA 3NBMA 4FNAA 1SKUA 5DBHX 3RK0A 4AZSA 1XRQA 5C7YA 1WD5A 5JCJA 4FILA 3VDMA 2O8NA 3F1LA 1NQUA 2XVZA 3ASUA 4PANA 1ZRSA 3KJFA 3SMQA 3UF0A 4DCGA 3KQKA 4E88A 3N05A 2JLZA 5CVCA 4ALJA 3THWA 1PW7A 1ZHFA 4WV3A 2PD4A 1YBVA 4DPLA 3C0KA 4KO1S 1ZGJA 1DUIA 2QU8A 2C58A 1H2FA 1TCBA 2ID9A 1P2SA 4LDZA 4CIYA 4YK7A 4IQ8A 1PTJA 3VKHA 1Z5NA 2Q9BA 1XAHA 2IHZA 1CRLA 2Q6KA 4QDUA 5T8KC 3TL3A 1WWKA 3KR2A 1T6YA 1N7GA 1X15A 3V4LA 5JISA 2AXNA 1MNAA 5ENVA 5F23A 2DVMA 2BJWA 4RACA 1OA1A 5EMLA 4DMLA 5C7LO 2OSBA 1EA7A 3ZCPA 1KO8A 3ONDA 3PWZA 3TLAA 1P72A 5K4HA 1DX4A 2R6AA 3JQ6A 4G41A 1Y3HA 2EFGA 4B81A 5KTKA 4DEVA 4NSNA 1E3JA 5DGTA 1EVYA 4M1KA 4WY2A 1WMSA 4E6PA 4Q00A 4XLLA 1G2OA 2EKDA 2EAUA 3I53A 4YMGA 3CG0A 3COJA 3IIJA 1AO3A 3QA9A 4YJFB 2QRPA 1T1GA 2XYPA 2ZTHA 4XW2A 2PAFA 4Z0PA 5KUTA 3PE4A 1KQGA 3AI3A 4HEA6 3WWYA 1KI6B 1FUEA 4BMSA 5DNYB 2JCVA 3NTXA 4JROA 3TXAA 3CVUA 3BOSA 3H3XA 4X44A 1M9NA 1GL9B 2JDIA 2VIIA 3HJHA 2JIQA 1H6CA 2I6FA 1N6RA 2FVYA 1X1QA 1DE0A 3AGQA 3VGJA 4A73A 3F47A 4PO9A 2FDCA 5BWCA 2NUPB 1Q0HA 2BGIA 3PC8C 4GP7A 3VOSA 2HSEA 3L1JA 5A5DA 2VJKA 5ARBA 1X0XA 5HWSA 4OQEA 3VU9B 4YJ2A 4H4CA 1SVSA 3CNQS 4NFLA 3LW7A 1Y6GA 4W7SA 3DMFA 1ZL0A 3F4LA 2XRMA 4OK6A 4CV1A 1I2BA 4QXMA 4EVRA 4JJ7A 3CHYA 4PQEA 4Q93A 5ICCA 4X1OA 1L7RA 1Z7YA 2A67A 2GCOA 2P4UA 1X19A 3PKIA 5B53A 1JE1A 5IFKA 1EDOA 5LVAA 2NLOA 3N0WA 4BO0A 2CXTA 1J0CA 2XNCA 3MBIA 4BE7B 4ZGWA 1L5WA 1Y7TA 5J4YA 1FRNA 2UUOA 2Q3DA 2Q8QA 3S68A 2PT7A 4Q1FA 3ZHTA 4EVIA 3WRVA 1OB5A 4KR3A 1T2VA 4EPXA 2G7MC 5CM8B 3OFSA 4D7AA 2H29A 1ILEA 2KS6A 4AULA 3AVUA 2BEKA 3BULA 3IE0A 4FYYA 1BE6A 4RL6A 3KM0A 5CIYA 4PZEA 1EE2A 1SIUA 1V26A 1KYXA 4EMUA 3E82A 1Z0AA 1DAOA 1ODFA 3QU2A 5KTMA 4NENA 4CU5A 1E9VA 4HXYA 4J0JA 3ER8A 3HPRA 3CO5A 3OG9A 4F04A 4TQUS 1NMYA 1J4AA 3NOOA 1BFDA 3ZN2A 5L3QB 4YMUA 1J0DA 1NM5C 5LDHA 4YJHA 2IBMA 1FDUA 2P6OA 4D80A 3DLIA 4JGBA 3TLMA 4YWJA 1BFUA 3A36A 3JR3A 3D7SA 4Z3DA 2QD1A 3W6UA 1R00A 1QR6A 4QQFA 2QYHA 2QZZA 4RHTA 5DX0A 4MDYA 5FF9A 2ZM6B 3OZSA 2ZIFA 3NUGA 2BCEA 2P9FA 2Z0MA 1P9RA 1U02A 2X13A 4ZCTA 4P7FA 1RVDA 1WXDA 2V7GA 1H94A 3HBLA 3OE7D 1XZMA 4NK4A 5DOZA 5K6TA 1I33A 4BU1A 1I7DA 4AQ7A 1A7UA 3PX3A 3ZXIA 3I4CA 4URUR 1LSUA 3Q10A 4IJMA 2FQ1A 3WB9A 3HWX1 2FDRA 2BHSA 1PL6A 2I9PA 3KV1A 3EF1A 1OI3A 2AI1A 1UADA 3FWYA 1JXOA 1AV6A 1NN1A 1RPTA 1CY1A 4YJ2B 1AS2A 1XOIA 4QLOA 4CTJA 3E7FA 1CRWG 4L85A 1CNEA 1XMJA 4LHEA 1BQ3A 4LHZA 1DLIA 3EASA 1NZJA 4GYKA 3O2NA 1C80A 4FBGA 4QDXA 3SM9A 3R9IA 4R84A 4B7XA 3ROFA 4R71A 3SSNA 4QPDA 1O3YA 3AVOA 1CUSA 4DW8A 2GHTA 3HCPA 2J3KA 4D8XA 1ZM7A 4JL5A 4UVDA 2AK3A 2CY0A 3E5RA 1QDLB 1VL6A 4C0HA 1NI4B 2V6GA 2J3MA 1U9IA 4FEGA 1SA0A 2V7WA 5ALOA 3SFVA 3IJ5A 4OQMA 3ZNPA 3EMDA 2AOXA 5FV7A 6GPBA 4RBNA 2FN7A 3DE5X 1AU9A 3DD1A 3KYBA 4NBKA 2DUNA 5I51A 1L5QA 1PV2A 5AW5A 4QARA 5ENDA 5DF1A 2QYTA 4YRKA 4FINA 4P34A 3JQCA 2F1KA 5EJ7A 3AVWA 3A14A 4W82A 4P22A 3OTIA 2UDPA 2WZDA 4IKPA 4BUJA 3BD8A 4NV1A 5B4VA 1SY7A 2ZQYA 5P21A 5E7MA 1BO6A 1R37A 2W5UA 1FLVA 3BICA 5HGXA 3K71B 5J4KA 3ROKA 4M1ZA 5AESA 2H92A 1A97A 1R6DA 1V3UA 3BBPA 5EWMA 5K0FA 1ZUNA 3KELA 4GU5A 1E3WB 2F64A 5L3SA 2BAGA 1B7GO 4Y6SA 5B64A 3EDYA 4CMIA 4UDNA 4UZEA 2C4KA 4LKRA 2C54A 3N2IA 3R0ZA 2DT8A 2P9HA 4EHKA 2AOTA 3ZXUB 2ONYA 3DFZA 1G3IA 2XOXA 1XQ6A 3O2JA 3OWHA 1ODSA 3LGXA 2DHDA 1EWTA 1MP0A 1XVUA 1YBHA 2B4AA 4F9FA 3RUCA 2DECA 4EG4A 1DP4A 4C7OB 5ALUA 4KR9A 1BMFD 3L18A 4OD0A 4DIUA 1ZM4A 2EX4A 1G8PA 3A28A 2ZTLA 3P5BA 1ZCZA 3KVOA 4I1SA 3ZXYA 5IJWA 3VX4A 3WKEA 3P9IA 3ZCVA 3QVXA 1Y9ZA 3HJCA 3V7NA 2UXDB 3FBGA 3MJEA 4ZVNA 5J58A 4HDMA 1AK1A 4FXPA 1WLSA 4B9EA 1JIIA 3IHLA 4AZWA 2ZWMA 1A50B 1LRLA 2ZWVA 3X1YA 5F98A 4RH3A 1QS0A 3QKIA 1Q7EA 1UT6A 3NHYA 2FFAA 10MHA 2EJVA 2NSLA 4JEUA 4HT3B 1NLFA 1E3QA 1WDLA 2ZRIA 3VPDA 5CAEA 3H1TA 1QVWA 1AO0A 1OXKB 4N48A 3COZA 2JL1A 5KBYA 2V9CA 1VKJA 4ITRC 3C3DA 3LY8A 4NZMA 3STVA 4NZYA 5T4EA 3DLBA 3F78A 1CZLA 3IP5A 3ZWBA 1NPTO 1BAPA 1SU6A 1UJCA 1KJZA 4L57A 2ZU0C 1G8KA 3B3QA 2Z95A 3TTWA 4ZYYA 4ZKDA 4Q3LA 1P4JA 2EU8A 1KVRA 1SA0B 2P2YA 5F5LA 4RTJA 2XADA 1ECPA 2IYSA 5KVVA 3DM5A 3OZDA 2Y2VA 3U4GA 4RTKA 1NT2A 3NJ4A 2DCUA 3ORYA 3MW8A 3PJDA 2YDXA 3G7UA 4HWPA 3RHTA 4DDHA 1T0PA 5TGZA 3A58B 3QPCA 4C6HA 3LHSA 1FFGA 1Z16A 4CG1A 4KH0A 1PNTA 2Z3VA 3O82A 4ZZ2A 5DBFA 3VJMA 4XIGS 3LT0A 2BV3A 3O3OB 4R16A 2YWEA 3TSOA 4MA4A 2GCEA 5LP6C 1ZEMA 3QKRB 1R0CA 3X1KA 1R0XA 4PYQA 5EKXA 4KQWA 1UKVY 3L01A 2BDUA 4B31A 3EBPA 1C14A 4QPPA 3UAYA 2K5UA 3K2EA 1Q3TA 1O8BA 2AN5A 3EGDB 5IJXA 4BGVA 2P90A 3G2LA 5EWMB 2Q46A 1JWAB 4AYTA 3LIIA 3J7AC 2IUUA 3I23A 4I1YA 4NU8X 2P4QA 4JUDX 4YRCA 3ZE9A 4FEYA 5L3SB 1Y8CA 4N03A 3ENQA 3FWHA 1C2TA 4HUJA 5C4IA 1CUCA 3S2EA 3KDPA 5CXXA 1K4KA 4YQZA 1QPBA 3PQ5A 2IQ5A 2VXYA 3OA2A 2AOTB 4PONA 3BJRA 3KZMA 3ZHUA 3ZWPA 1DEHA 4EDFA 4KGXA 4OP3A 3T7TA 2Q5OA 3H2ZA 3OOEA 5EY5B 4Z9FA 5H5JA 2F43B 4O4HF 3C8ZA 1NVWQ 1PWXA 2B83A 2GMWA 2C2BA 2IXBA 2WIDA 2V7TA 3CLVA 3DZ8A 3HEMA 3LT5A 4FOTA 1H93A 1YJCA 3LC0A 2I1QA 1JU3A 1ZIPA 2DTDA 2BFBB 4DCSA 5HHTA 1Q7BA 2P65A 2HHAA 2W6ZA 4K81B 4QQ8A 4ZTBA 5CFPA 3U44A 1Q5PA 1AZLA 4RF3A 2CL7X 2EG9A 4RVUA 1W36B 3KSBC 2VH5R 4HDMB 2AJCA 4OKIA 1NW3A 2QRZA 4LOIA 1JFVA 3D2CA 1U65A 3PC2A 1NIPA 3AESA 1QS0B 1ZGAA 3WIVA 1CE8A 2WHQA 3F4KA 5CA1F 1Q6ZA 1AC5A 3OJ0A 2JJ1A 5EP4A 4EG3A 2OMKA 1U1DA 4BP9A 4CU2A 3BA1A 1RYDA 3DLTA 4CR7A 4QDTA 5LXTF 2ODQA 5EIOA 4CE6A 3LLMA 4X62B 1OC4A 4L8LA 3WLIA 1LY1A 1CYDA 3T1YB 1D04A 2GNPA 3QMPA 2A57A 2LIVA 1ADJA 1WD7A 5TEWA 1WDKA 4HMPA 1GGEA 1X1SA 4NQZA 1N4AA 1Z0KA 1TF5A 3MMXA 5ES3A 5K01A 1PJ3A 3JVIA 4XIYA 3WWOA 3LDGA 2V1XA 3GEPA 3LHKA 4NEGA 5LMUB 4DA6A 3M6XA 2VDOB 2CBZA 3ADKA 1SUCA 5JCJD 3W2IA 3VAZA 5KVAA 2I78A 3WGUA 1KH1A 3A1NA 1FNMA 3CCBA 5IMBA 5F73A 1PR5A 3ILXA 3W77A 5CEJA 5H83A 1U04A 2V8OA 3CGWA 1Z8DA 4GX0A 1GY8A 4JY7A 4JYBA 4YO8A 3NALA 3GEIA 5KS2A 1YFKA 2FEWB 2HWXA 3GGSA 1N6IA 4PG7A 1QHYA 1J5EB 4P0PB 2PO5A 1B3RA 2WP0A 4Y1RA 5IBRA 2NWQA 2FQWA 5IP5A 1XTIA 4I4LA 2LTAA 1U0HC 1D09A 4A0RA 4IHAA 3EY4A 3GEMA 3CVWA 4LQ4A 3IT3A 3PE3A 6LDHA 1G6OA 1XZEA 2BM1A 2XWPA 3LVRE 3NHUA 1RYYA 1IVYA 4BKPA 2NTYC 4QPNA 3WZ2A 4DLNA 3QX9A 3NTQA 4CPDA 3KZCA 4ZIRA 4ZMRA 3GJYA 3N8IA 5TX7A 5GJVC 3O0TA 2EGHA 2ZRQA 3T7EA 2YINC 4CM5A 3I5UA 4YP0A 4Q66C 1HT3A 2O3TA 3GWZA 4JQZA 2XQKA 2J9YB 1C1XA 3BIWA 4JVLA 3U44B 1ISRA 2F55A 4N3AA 2QHXA 1JTVA 1WUKS 4I4NA 5K3DA 3IBSA 2J9FA 4H6XA 3TLBA 3AHDA 1HE4A 2UZIR 3HY3A 2R751 4TM7A 3JQQA 1K0UA 4UDYX 1TK2A 3QU7A 5JRDS 1K75A 2YQZA 1P2UA 4PSAA 4M8NE 4OIMA 4Q7EA 3ECAA 1W96A 1KK0A 2A0FA 4X54A 1PO7A 5CDUA 5IM4F 2QG9A 2VF7A 2C04A 2PMKA 4BB6A 1LLUA 1P1CA 4E5PA 3L7YA 3QVJA 3GCGA 4L51A 3CVVA 2LVBA 3N3BC 1AZWA 4YCCA 4AO6A 3W8EA 1DBSA 3EZNA 5HILA 3WL8A 1HDGO 3IUJA 3NEAA 4HEHA 3VDRA 5GONF 4INOA 3DMPA 1ICEA 4JT2A 2VATA 3T9FA 1UK8A 4BC1A 1JQ5A 3HA5A 4GR5A 2BD0A 1VG8A 4QVKA 5IBQA 5IT4A 1DADA 2FEMA 2OHVA 2P2NA 3M83A 1MAVA 4YHHB 2XE7A 3OEEA 4CEIB 4IHJF 3OQ6A 4UUMA 3C3MA 2XQFA 5AH0A 3WTCA 5IZCC 4KPEC 1E92A 1ULUA 1I4LD 2BF7A 3D81A 3MILA 4J2OA 3EXEA 2HEGA 1Z06A 4AWAA 1FX0A 5JSYA 4F9EA 5JZVA 3KB8A 1K3TA 1EAYA 1QMPA 3V1TC 3QEAZ 5JZ9A 3EXAA 2BDEA 3TIGA 4BAZA 1HE2A 2G3YA 2OB1A 3EMKA 3EPRA 4BQQA 1JDSA 1Y42X 2IYRA 1PZMA 1PNOA 4KIGA 1KDVA 2PL1A 4KXFB 3S2UA 1IOZA 1ORIA 4NU6A 4U2EA 1E2QA 2GUWA 2ID4A 3LOPA 3DWFA 3OVMA 4LRTB 1CXZA 2D1SA 3RS2A 5DEIA 2NO6A 4LFCB 3WB0A 3QWFA 1AE1A 1HSOA 2D2FA 1YASA 2HV8A 3HNRA 3RE1A 4IDDA 2P9CA 2JGEA 3G2KA 3ROEA 1KWGA 3T8YA 2RGGA 4Y2RA 1SG6A 1ZCBA 1UDCA 2YYZA 2AN9A 3AKEA 2I2DA 3B7PA 1MO5A 4HG2A 4E09A 5G2OA 3H0KA 2J09A 1D6NA 3CWCA 4B47A 5KSYA 3HJTA 1O95A 3O8RA 1U0JA 3OLXA 4K86A 4BECA 1M75A 1WCV1 1TKCA 3NP7A 3WSVA 3MTIA 1GKKA 1M1YA 1YR9A 4JUFA 2I2AA 3RARA 1HYGA 1KQNA 3TOZA 1EIWA 5CUQA 1W8DA 2Q3JA 2IEBA 1P60A 2G70A 3IP3A 1Q84A 4EUNA 1CJKC 1QH1B 2BC9A 2AQHA 2WYIA 4NC9A 2RAVA 2WTXA 1FFSA 4MIYA 2J9FB 3VR5H 4BB5A 5GGYA 4LJ7A 2OWDA 2V4UA 1PS0A 1FSFA 2HM7A 4BMZA 1XNJA 3M6MD 1KC3A 3FYUB 3IE1A 3T5AA 1OFUA 4MO2A 5AI6A 2YY6A 4RVHA 1TAUA 2ZU6A 5K5EA 2H9YA 2A58A 2G6BA 2XUGA 1NMQA 2Y1DA 1JPNA 3GGJA 4U9HS 3D7KA 4JENA 1DIHA 1L9XA 1I0ZA 4DOMA 3UCEA 5MDHA 1RJDA 2B8WA 4RTMA 2RHRA 5LQKA 2WAAA 3PDIB 1SZPA 2ZJ4A 3SY8A 3QLVC 2NTEA 2ZCVA 1SK8A 2QIPA 4ZU6X 3W7BA 1UINA 5AW4A 3M5CA 4Y3UA 1OB2A 4HLUA 1MD9A 2ODBA 2WE7A 3S8MA 3WLTA 2HTFA 1IBCA 1PT5A 1XL1A 1UBSB 4PGFA 5CXQA 4LHWA 4E4TA 5TT1A 1RXCA 4ACBA 3JYHA 4DXAA 3WOVA 2QUKA 3WIOA 1IQPA 1SXGA 2QJRA 3HB4X 3K0KA 2UYOA 2ZVQX 2FN9A 2YJ4A 3FMIA 3GXBA 3KR1A 3QK7A 4Q9KA 5C31A 4OA5A 1XA4A 1RBQA 3TRHA 3VOAA 3H4TA 3KSUA 1O0BA 4PO3X 4Q3OA 1FQOA 1LBIA 4PZDA 3RW9A 4XWYA 3L0ZA 1FZQA 2ZZNA 2WHPA 4TWZA 2GNAA 1WZCA 3CNNA 4A15A 3AUFA 4X84A 3C5WP 1SMKA 3DJYA 1IATA 1XDUA 5EGSA 4J0IA 3S27A 3PYMA 5FUBA 5JCPA 1YZ3A 4HDKB 4RD2A 2J0EA 4RO0A 2Y1OA 4QQNA 3W90A 3QH4A 5KTPA 3GVHA 3A4YA 2RJ3A 2R68A 3CW9A 2WINI 2IY9A 3CNHA 2EBHX 4OXQA 3ZDZB 2BGTA 2ZP1A 3TXXA 1X86B 3TW6A 4CKWA 3DV0A 3GRKA 1KYTA 3KQQA 2R8BA 1V8FA 4QWWA 3VVMA 1CQIA 1ZRMA 4AJNA 2VQEB 4Q4JA 3NW9A 1G8YA 1EAMA 2DJ5A 3NOXA 3S5JA 5KI6A 4PFKA 3ZE1B 2B8NA 4JYAB 1V9CA 4Y2UA 5DGCA 1E3TA 5FPHA 3QYAA 4FFBA 5A5FA 1SU4A 16PKA 1I5EA 1M1YB 3K09A 3R3WA 4BP8A 1GTMA 1SQ6A 4MW7A 3RS7A 2J31A 3RVMA 1WVGA 2BBWA 2EJBA 3FG9A 2AF3C 3QBTA 1NGSA 3ELYA 4JZKA 4MMYB 4HL6A 1OF1A 1LW6E 1U3WA 2CDBA 2XUAA 3TK1A 4ZHQF 3GUCA 3HCOA 1W36D 4NOKA 2IYNA 4LE0A 5HZGA 3F6CA 3O9MA 3KTDA 4WK4B 3ZS8A 1QF7A 2R8XA 3CA8A 2YL2A 4EW3A 3LQKA 3JQ8A 2PH5A 3ETHA 1YC2A 3NBFA 1NKVA 4TV9A 4R8VA 5BORA 1A5ZA 1C7IA 3FYHA 5DM0A 3HGQA 3R9KA 4UE6A 2HSGA 3G9QA 4MO9A 4RD4A 1QG0A 4XB6B 1RZVA 3D6FA 2ZBDA 1XZHA 1YSCA 2C98A 1AQ6A 4PYKA 1F8GA 3ZU6A 2JK0A 4BFXA 1MC5A 3EXIB 3FCUB 4MUXA 2WM9B 1KJ8A 1SUIA 4FWIB 1WUIS 2ZJ6A 3V8VA 3HKCB 1E3MA 5JSZA 1M72A 1W73A 4D6PA 2WUFA 3I05A 5IYZA 4BXOB 1BN7A 2PH3A 3F49S 4ZVVA 3SC4A 1H2ZA 1U1GA 2FU5C 3PA6A 1VCIA 4JVSB 1HETA 2Y0DA 2VG8A 3FKJA 3PBKA 5D87A 3IVRA 1OZGA 2QTMA 4WI1A 1M2VA 2R7MA 3K92A 3MC1A 4IZOA 2A30A 1YZGA 4KLAA 3PWTA 2HK7A 3LQRA 2VO1A 4BVEA 2V58A 5K3CA 3G0OA 4UBKA 2XW6A 2PGLA 4KN6A 2C4NA 3H4MA 4YP7A 3EPJA 3GPDG 4B3SB 5A3VA 5K0GA 4K6OA 2XGOA 1E5QA 3Q88A 1EUCB 1L7NA 2AE1A 2WP8J 3VDQA 1VE1A 2WHPB 3O90A 1XQXA 2WT8A 3GG9A 1SPXA 4RTRA 2GN6A 3KJHA 4BX8A 1YR6A 2NYUA 3Q7IA 2ONZA 3C6KA 1W34A 3KKPA 2AMLA 4L5JA 1OH7A 2ZYSA 3AF3A 3H5OA 3KXPA 4IG4A 1XPUA 1RM4A 3RSLA 1OWMA 1J8QA 4PZAA 1XTRA 1GPJA 1H2YA 1KMMA 3HHPA 2F17A 3I5AA 3U48A 2QVLA 3E22A 2DUMA 4IJ6A 3RYTC 4CDMA 2JLYA 2VAMA 2JFVA 2PRJA 1F2UA 5TGDA 1T2AA 3B51X 4OSPA 3DV0B 2CNKA 5DBEX 2QE7D 4Z4IA 5COAA 1VHWA 3K16A 2QSZA 3KQPA 3QV1A 4N7MA 1TDJA 2XH8A 4FFBB 1X2EA 1GVHA 3H84A 1PWYE 3QX3A 4CCYB 1C3OA 3O21A 4RKEA 4MRVA 3UK7A 3V32A 3WDMA 5LIRA 4K28A 4IYJA 2WLSA 4M76B 4O4LA 2JGRA 2D4HA 2OBFA 4JLDA 1RRMA 5D3KA 4GOOD 3UMJA 4KE7A 4DJEC 1RMYA 3RH0A 3LRTA 4ZREA 2EFYA 3LCJA 4GC5A 1XUOA 3ITDA 4PPYA 4R6XA 2BUCA 3OFNA 1KTVA 1UP7A 3LNCA 3HGMA 1RXSA 4BFTA 5J43A 1G20E 1XZFA 3GARA 4B48A 1DSSG 1WPQA 3KYJB 4LNAA 4DB4A 1PLJA 3DMYA 2ILVA 3JWPA 2F1HA 3L7JA 1JQEA 1YUMA 2JJ1D 3OO1A 2YYSA 1T4DA 2FMHA 2ZIXB 2K2WA 3G5MA 4MB0A 2NU6A 3PYXA 1BU8A 3UGQA 2PIAA 4U2BA 3YASA 1JSZA 1SEPA 3PWKA 1I0LA 1NPDA 3M1IA 5IXSA 5JNUA 4JLBA 1AHNA 4Q7JB 2B37A 3WBKA 3KUXA 3K6SB 2PSEA 1AGPA 1DARA 1FFDA 4UHJA 3AZPA 5BQOA 1QYRA 2NYRA 2PFKA 3LOQA 1OJLA 3MRSA 1UL1X 1PFKA 4LHYA 5EHXA 4JLPA 4AZ0B 4U7GA 4Y8VA 3UTDA 5T5QA 821PA 3ZWKA 5MN6A 1DEXA 4BVJA 2JPDA 2XYVA 4DLRA 2DFTA 1SKYE 2YUIA 4WKOA 4D9KA 1VGQA 1GG5A 1PHRA 2O14A 3OHMA 2X86A 1V41E 3RV3A 4RD1A 4OGWA 3A4TA 5FL3A 1M10A 1E1CA 5M34A 1K5HA 4TN1A 2XUZA 1PDVA 4UMEA 3QMVA 1U3GA 4TL6A 2RE8A 4ZDKA 1JL3A 1FTNA 2HMVA 3CH7A 3ML1A 1IHOA 3OFKA 1VPWA 1L0BA 2HK9A 4KPYA 3JWIA 4TV8F 1PL0A 3CKYA 3H9CA 2AW5A 1BMQA 2QTNA 2FZVA 2HSZA 3DHYA 4FB4A 2YYYA 2B7CA 3DEAA 4BX0A 1Y6ZA 3IILA 5E2AA 2F6RA 3T06B 4XQ9A 5TMBA 1QKJA 2IXEA 4YMIA 3E22B 1JEYA 5DW3A 2IHKA 1F2UB 3T9EA 3EIEA 2HPVA 2IPLA 3K05A 4GPEA 1Z08A 2Q5EA 4A8JA 3UT5A 1CETA 3T41A 3ZV6A 3CM0A 3RJTA 3W78A 3QW2A 1G8AA 1VSQA 1TZ2A 2BE7A 3IIEA 621PA 5IULC 5ED0A 1Y3BE 1G18A 3DR5A 3VOTA 2ZRHA 1B0PA 4LNHA 4DY6A 3F8TA 3PRKE 2XOEA 3CZ9A 4FHFA 1GLGA 1LXCA 1W49A 4YAJA 2DSTA 1F4PA 3L2OB 4KAAA 4CR8A 4O0MA 4EKGA 3S0JA 5I9MA 4XM1A 4I36A 3UTCA 2HLHA 5K8IA 1N8TA 2BMEA 2BTEA 4INAA 1J97A 3R1IA 9LDBA 2GM3A 1J39A 1X1BA 4X95A 5PGMA 4ENWA 1EESA 4ZK2A 4ZEWA 5E6RB 3FX2A 3TLXA 2CBXA 2PMBA 5CDGA 1VDMA 3BHIA 2Q6OA 4K9QA 4JBNA 3NAZA 1FQJA 3RVPA 4F3RA 5FNVA 4Q9JA 3LCMA 3TW0A 1A1SA 5BSTA 4EPWA 1QVZA 3ZLTA 1JFSA 5THQA 3X1MA 4PC3A 4AZTA 2L2QA 1S02A 4L5IA 4DJ5X 3SD7A 1KZGB 1IM2A 3GP8A 2CBGA 1V0JA 2ZYIA 4FGUA 1E2DA 3FPAA 4EITA 2XMGA 1NKTA 2XA2A 2O8EB 2C7OA 2Q6IA 3SG0A 2FJUA 1NYRA 2J0UB 2G1UA 3DT9A 2AEFA 4DQLA 4MEJA 3LUGA 5ADHA 1NOIA 1R74A 1UMDA 1Z35A 2HF9A 3QI7A 4IPTA 2GSWA 3IV6A 1E1CB 3NEPX 3P94A 3WE7A 4CFSA 3IHWA 4D8TA 3GT7A 2E2WA 3ZWNA 3ABQB 2FXIA 2FG5A 4UNIA 3H1GA 5CXUA 4Q5IA 4BV3A 2A5DA 2PD6A 1L8XA 2V7QD 1DJLA 1S96A 4NG5A 4QBGB 3H9QA 3KYDB 1U3FA 3HJAA 3IPXA 4UUQA 3ROZA 2C5FA 1XLWA 4RJLA 1TE2A 1NMXA 1UPBA 4RHFA 3OX1A 4CF5A 4HNSA 3NNSA 4BS9A 2WTNA 4EI2A 4IDEA 3RVOA 1K92A 2AQIA 4OX9Y 1CJMA 3TOXA 5CYOA 1N5DA 2WA2A 2VNSA 4UNSA 1IMJA 2J46A 3OJCA 5D3ZA 3KPJA 4PCAA 5CYGA 4KFCA 4P4NA 2X8BA 3QFFA 4MWDA 2J4CA 2FJPA 3MUOA 3SSMA 3IDFA 5JR3A 1PHPA 1U8CB 2D00A 3WO1A 4RD6A 1OZHA 1DBVO 3CZAA 3DZGA 3GFQA 5KJ1A 3CVYA 3W3AH 5EKSA 4FM9A 1DO8A 3KHSA 1QQ5A 3OCUA 1RACA 4QSMA 2HLDA 4FDLA 2HXSA 3P0EA 1P7PA 1J8VA 4HYEA 3X44A 4XXHA 3AKZA 1HFEL 2I03A 2PX8A 4OL0A 2G25A 2JGAA 4PSVA 1NIJA 3DLPX 1KE1A 2BYTA 1VBNA 4DMFA 3JQRA 2OBYA 4RA6A 2GPJA 1LKZA 1ZAYA 3EEFA 4JSRA 2PVCA 4LIPD 1JWBB 1VA5A 2IY7A 5JAHA 2H5LA 2G08A 3Q1KA 1MDBA 1B23P 4EFMA 3DE6X 3L1UA 3KALA 2QTBA 1YDHA 4EUKA 4L76A 5AKZA 3PXBA 5D3MA 4DSNA 1WXWA 2CJXA 1QHNA 1DU4A 2FOIA 3HUDA 1CD5A 2XSZD 2GJ8A 3A1EA 2B99A 1OZFA 1U5AA 4R8MA 3ZHYA 3BJEA 2RAFA 1VMIA 1XRRA 4S35A 2C7VA 4BMOB 5B7PA 1RC1A 3GAMA 4EPTA 4H08A 4L8VA 2ZSUA 1ISIA 2EXXA 1PR2A 2YN0A 4FR2A 4J1SA 3U1BA 4LBVA 4C7XA 1TJPB 3LI2A 2G63A 2ZK7A 1D1PA 4LVUA 1UMDB 1O08A 2UVPB 4IEIA 4Q1AA 4YRTA 3DV2A 3DMTA 2JFXA 3FDFA 1P4GA 5I7UA 1XZ8A 3LGAA 4HC4A 4IDBA 5KJFA 3DKIA 1RPAA 3AEQB 3PC4A 1VL5A 4C6TA 1E79A 4BCBA 1N2IA 1QIKA 1XN4A 2GCNA 2XCUA 1MQAA 3N86A 3O84A 2QNRA 3C6XA 4W4TA 1M34A 1CK4A 2ZRAA 3S8YA 4MR9B 1IK6A 2B98A 2HDOA 2ZRGA 1P0QA 3DZKA 3OJLA 4AWBA 1DC5A 5B6PA 2OD9A 3ZQUA 4C08A 3T7KA 1P5FA 1XDDA 2P91A 4OQPA 4EHFA 1U9IC 5AQEA 2FMUA 5EJ8A 1R4NA 1T6ZA 2DFVA 3RSCA 1GSOA 1PFGA 4RHEA 1KKUA 1EG2A 1NXSA 4GZLA 3GG2A 4PZ9A 2PV0A 1V95A 1DX9A 1KGDA 4M0DA 5CTJA 1AQUA 3UHOA 3L02A 1RTTA 4F4UA 1ONBA 3BXEA 1UWCA 3NPAA 3DGFC 4OPMA 5JY6A 1OLOA 4Q3CA 3RNOA 5L9AA 2H65A 3DKVA 4LDNA 1KMIY 1MOQA 2BM9A 5J5CA 2ZBVA 4MV6A 3ZOZA 3UM9A 1UP4A 1QRRA 4GVPA 1NF3A 5BSEA 4AMUA 3N2GA 1ZI8A 3WLFA 1MRZA 2WWYA 2XIJA 1AA6A 5FWYA 1EK0A 1K7SN 4HR7A 3F73A 2Q7DA 1MJFA 1P8JA 3IIKA 1NRXA 3JD3A 5DLDA 2OESA 4RFSA 4DY4A 5EE1A 5D7NA 2W4MA 2AIRA 3GI1A 5C8YB 3GPIA 3MVEA 4OQNA 3EGCA 3THOA 4HQ0A 1YD7A 3FRHA 3D8SA 5KVQA 4Y6QA 2QORA 3HZHA 1DEOA 3K73O 1LDEA 4A0QA 3NH6A 1HDZA 4L08A 2SECE 2WK1A 3CEJA 1GKIA 4I9FA 4MW2A 4ND6A 2WYWA 5IU6A 3VV2A 5JNLA 1GAJA 3L41A 3U7RA 4ID9A 5EINA 5FBHA 3WAGA 3PL1A 4EA6A 2IGBA 3FUWA 5BW6B 1JE0A 1HDRA 4EJFA 2R2GA 5IANA 2DEUA 5JYDA 1DKUA 2OXFA 2J3JA 5IKEA 1CLEA 1AKYA 5EUCA 1W36C 1P33A 4Y0VA 3A6JA 3IO3A 4DBZA 4D9NA 1GTVA 1MLDA 5CH5A 2Z3WA 1DDGA 3MCUA 3PG5A 1SHTX 4UXJA 1QO9A 2Z58A 3SYNA 5IBCA 1ZH2A 4K46A 1RCTE 1FP4A 3MTAA 4IGFA 4OIFA 1LPMA 4A5SA 2QJTA 4OHOA 1NMEA 1EE1A 3N9IA 2K6GA 1PV1A 3EUAA 5FWXA 5I4IA 2LIPA 1KARA 2HPHA 2I4NA 4JAVC 4BDTA 1RIIA 4KWHA 5A5GA 4P92A 3OUTA 2VQSA 3ZIUA 3MUEA 4AP6A 1OKKA 5HK8A 3ICEA 3UJ3X 5IG2A 2FA9A 2YXLA 3CURA 1MF7A 1ZH6A 5DM4A 4WK6A 3EH2A 3PRYA 3HXLA 1VRWA 2GN2A 3FAZA 4N5IX 5JYBA 3SX4A 4G8JA 4H3KB 1RC8A 4JXKA 3B2EA 1H3FA 2C2MA 4D25A 1J1ZA 1EINA 4PLHA 1Y8QB 4NFYA 2Y99A 4U3JA 1I13A 2QGZA 3DMGA 4HKTA 2BPOA 2R6GA 3P2YA 4OHRA 3WGTA 5H9WA 3TJZA 2WQ7A 1IVSA 2JRLA 4QO8A 3LFTA 1X7WB 2I8LA 4MGEA 4URYR 2EKQA 3RANA 3RC1A 1SVMA 3OQPA 5BYKA 1P0MA 1CRPA 1T3LA 4F6LA 1VL8A 2VHZA 1ZXBA 2OCYC 3N2GB 3WIBA 5K0CA 2XGSA 3KFXA 3OT1A 3EGXA 3PNVA 3OFND 5K09A 1XRJA 3FFWA 4FYPA 3LY5A 3RAFC 3TR0A 1Z0FA 2EP5A 2DQKA 3DZJA 1GQFA 3KQMA 3BA6A 3FA2A 4D0GA 2CB9A 4EYEA 2F3TA 1RWBA 3OPVA 4MW4A 4BKOA 3L9WA 4KC0A 5SY6A 3IRVA 5ADVA 2X3UA 3N8HA 2OBMA 2VF4X 1M2NA 1IYZA 3BZUA 3FGNA 1Z45A 1JLHA 4QOHA 1VPVA 3GL9A 3RQIA 3U3OA 3WICA 3U7QA 1N6KA 2A9JA 2FW1A 4UHFA 4MVJA 3Q7QA 2PT6A 2FLWA 1UC9A 3ADOA 3ESQA 3C3WA 1ISFA 4ZQCB 2OFPA 1JVBA 3A1CA 1W85A 1E66A 3MQFA 3IR5A 1KA9H 3QPVA 1TB4A 1Z6XA 3B70A 4DWOA 3QGMA 5DM2A 1EX7A 1CJCA 2W2LD 2CN1A 3D3EA 1RXYA 3H2KA 4IJQA 1WTAA 1L4UA 4X8LA 4Y2XA 2I7VA 4JX8A 5KOJB 4P0QB 4O59O 1NHGA 4V0KA 3PHBE 3GLVA 3LPLA 4FT4A 1I1QB 3CG4A 1GZVA 2IODA 2YVUA 4ADSG 1FP4B 5KVCA 1F14A 4OXYA 5K3AA 1D4FA 2VTEA 4JL8A 1KSFX 1VCMA 3UUWA 2A5FA 3QU9A 1G0NA 3Q98A 3ENWA 1GTL1 5LR6A 1SO8A 2Q9AA 5GINE 2WIFA 5FA6A 3IO5A 1WCIA 2B2NA 1QBKC 1VPTA 1J00A 1N1GA 5SYMA 1NU8A 2P3OA 2BY4A 1T0IA 1TRHA 1MORA 1V2GA 2ID8A 3FAKA 3KXDA 4G3XA 4TKZA 2NQ2C 4P6VF 1XHLA 2V1UA 3HA3A 4CM8A 1RKBA 1GARA 3LSYA 2JHPA 3MF4A 2O8CA 1XTTA 5FOSA 5G41A 4FMDF 3RR2A 3PQ3A 4MR7B 3GJ6A 1GNPA 4D3SA 3E53A 3LE8A 4KK3A 4KFRA 2WZCA 4J0KA 1BS2A 3AFHA 5KAPA 4AJEA 3HB0A 4K88A 4GPZA 2WTUA 2D2IA 4WGGA 1HK7A 4Q7LA 4G4JA 1O97C 4LNUB 4MULA 2H18A 4JL6A 4DMHA 3DBHA 4R1QA 3J7TA 3OMXA 3OT1B 2AG5A 2JS7A 3L6RA 4MNTA 3JALB 2I76A 4FFDA 4JVOA 4OKSA 5FNZA 4WCFB 1EFRA 1IBKB 2BFCB 3K1YA 1E7SA 2Q5CA 4AKHA 3SHFA 4JGGA 2G77B 2X76A 4KSCA 1NXWA 5JADA 1ZOLA 2BMFA 3LQQA 4FEEA 4UU7A 4C5CA 3SXUB 3K2QA 3UW1A 4LJAA 3QNWA 2WWHA 4IILA 4ZO7A 2UXCB 3KFLA 4QULA 1VLZA 4Y2QA 3AFNA 4IDGA 2O50A 2O0MA 4TXMA 1A2QA 2JW5A 2VCEA 4GMGA 4D9HA 1P1HA 1ZK2A 2B94A 1NMSA 4JC0A 4V38A 2H52A 1M6WA 5BXYA 3THYA 2O8FA 4J0FA 1PFQA 4WESB 2HSWA 2IXGA 5GOTA 1F9EA 2X2EA 3ZK9A 4RLFA 4EB3A 3CJTA 4QT4A 1DQPA 5HJEA 3FYUC 1N6LA 1R12A 1FDOA 2VJBA 4GMXA 1FNDA 2Z6UA 3RT1A 2IHVA 1W2GA 3C16C 2OGWA 2Y05A 3AM4A 3WGYA 1PZEA 3OZVA 4DRXA 2HU2A 4QYXA 4V2IA 5DM60 4X6UA 4LZJA 1QDUA 1ESZA 2Y6UA 1FUIA 2ZRFA 3C5CA 2ZBFA 4G9GA 4H3HB 3NJ8A 1UFRA 2QP4A 4UEOA 1I5RA 3S2YA 1A88A 3SX2A 5CIQA 3TOSA 3P45A 1JDBB 4LY3A 4RZ2A 2O8CB 4N8DA 2HJHA 4Z8XA 1Z4PX 3GJ5A 1ADFA 3OZBA 2GEFA 3RC2A 3RASA 1GGVA 1CF2O 2XUDA 4A0SA 3IOEA 3H5RA 4DADA 5GJBA 1RBZA 2C0QA 3INYA 5JCOA 3MB8A 1A72A 2ZT5A 1U99A 3QHPA 1SB9A 3OZWA 1AN9A 1QGYA 2AHOA 4HWTA 3BB4A 1BXRA 3IHTA 5HM6A 2AR9A 1YL6A 4Z4CA 4HFNA 2DKFA 2GPAA 4JI1B 5BW5A 1LTHR 5GM2A 4OB6A 1NVDA 3QFRA 5A1JA 3D5EA 4FFWA 3HEAA 4TT3D 5DLEA 1YCDA 3NRJA 4Z7NB 5LQDA 1A9PA 4ZICA 1L5HA 1SOWA 1X39A 2PDAA 5E4JA 1E9BA 4DGQA 2GJ9A 2GTIA 1ZOSA 1IN7A 3KL2A 2FMFA 3GLHE 2WIKA 4ALIA 5JVDA 1DHTA 2Z8YM 2EZ4A 1T6NA 3GJTA 5LYJF 3LNTA 5IN4A 2XXAA 3MCVA 1G6KA 4A9AA 1IXYA 4O4JF 5LMCA 3OD1A 3Q4GA 5KSZA 4H0FA 4EJ2A 1UOPA 4GBJA 2JVKA 2Q5FA 4OMCA 2GN8A 4TN5A 4LY6A 4TKVB 5CVDA 3TOVA 1GG9A 4JI4B 1Y3IA 4UHHA 1A9XA 1TQDA 3DDHA 1A7JA 2H1FA 1TAGA 5J40A 1K06A 2IIPA 5CJ2A 2Y1CA 2REBA 4G0MA 4J49A 2V03A 5EZSA 1Z5OA 2QYSA 2WR8A 2GJAA 3I9KA 5TT0A 4UFPA 4JK3A 3FBWA 2JH3A 1T1IA 1XXHE 2BM0A 2QBYB 5U9CA 3N2KA 2JJ2A 2C94A 1X13A 4M1TA 2PZLA 4L5AA 4YONB 1Y9JA 4ZVQA 1MO4A 1IZ7A 1TT5B 1XO1A 1EFVA 4PLYA 3W1EA 1UJ6A 2X22A 1PI3A 5IH7A 1V1RA 4R69A 5I6DA 3C87A 4C0QC 1NVVQ 2QUIA 4RTOA 1QIHA 3F6YA 3BXZA 2Y2UA 4Y2SA 3ZHXA 2X9LA 3HMKA 3PHJA 1E79D 2QN8A 3KP1A