1QYIA

X-ray structure of q8nw41 northeast structural genomics consortium target zr25.
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
380
structure length
380
Chain Sequence
MKKILFDVDGVFLSEERCFDVSALTVYELLMDKCYLGLHSHIDWETLTDNDIQDIRNRIFQKDKILNKLKSLGLNSNWDMLFIVFSIHLIDILKKLSHDEIEAFMYQDEPVELKLQNISTNLADCFNLNEQLPLQFLDNVKVGKNNIYAALEEFATTELHVSDATLFSLKGALWTLAQEVYQEWYLGSKLYEDVEKKIARTTFKTGYIYQEIILRPVDEVKVLLNDLKGAGFELGIATGRPYTETVVPFENLGLLPYFEADFIATASDVLEAENMYPQARPLGKPNPFSYIAALYGNNRDKYESYINKQDNIVNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLKGKDAAGELEAHHADYVINHLGELRGVLDNLLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title X-RAY STRUCTURE OF Q8NW41 NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET ZR25.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 126
structure length 380
sequence length 380
ec nomenclature
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1qyiA01
5ALNA 3WKDA 3PCTA 3SKYA 3QX7A 4CF4A 4J2TA 5AIBA 2R8EA 4UMEA 1WR8A 4MWOA 3PGLA 5AHXA 3U19A 1RLOA 3B8EA 2QYHA 4QJBA 1ZD4A 3QUCA 5ALUA 4IG4A 1T5TA 3AR8A 2WM8A 3W5DA 5AW4A 5AW9A 2G0AA 3UMCA 3SKXA 4EZEA 3BWVA 5AK5A 2ZOSA 4BEWA 1Z4LA 4XQ0A 4Y2SA 3ESRA 1MH9A 4DCCA 1WZCA 3KD3A 1TE2A 4YCLA 2NO5A 3A3YA 2I7DA 2ODAA 5ALSA 1YNSA 3OCUA 2HI0A 4HGPA 2HEGA 3AR9A 4YCNA 2ZG6A 4BX3A 1ZS9A 1RQLA 1JUDA 2C8KA 4BNDB 3MC1A 2FPRA 4FFDA 2P9JA 4YIHA 3L0YA 2G08A 2GHTA 4GIBA 1CQZA 1N9KA 3QUTA 5ALEA 4NABA 2YN4A 3RF6A 2ZBEA 2HDOA 2ZBGA 4UASA 3SLRA 3KC2A 5AW8A 2FI1A 2OBBA 5IS2A 2JGAA 5AK4A 4UU0A 4UATA 2I34A 4XPZA 1RKUA 4O8CA 4GXTA 3NUQA 3ZX4A 5AVTA 2BY4A 3ZW7A 1F5SA 5ALRA 2JAOA 1FEZA 1T5SA 4MUMA 4Y2UA 4KX5A 3WK6A 1RMQA 3DDHA 3WK7A 4ZEVA 2AMYA 3KZXA 1U2SA 3MN1A 4NWIA 5AKYA 4FYPA 1NNLA 2I54A 5A3RA 5AKZA 2G07A 5ALKA 1ZOLA 3AR3A 5ALDA 5AW6A 2WF5A 2G1AA 2Q4RA 1RC8A 3FGOA 4ZEXA 3ZTWA 3QLEA 1RMYA 2IOFA 4I9GA 2FUEA 3QU7A 1XVIA 5AI6A 2FPSA 3I76A 3ZI4A 3EF1A 5AKIA 4BX0A 4C4TA 2WF9A 2GFHA 3W5BA 3KBBA 4EENA 4HGOA 2IOFK 3U7EB 1RDFA 1Z4MA 2R8ZA 1Z4KA 2YFYA 2Q5EA 3L7YA 2EATA 5AI8A 3FVVA 3QXGA 4CF3A 4OFZA 2YJ6A 2ZXEA 3HLTA 3EPRA 4YCMA 3WKAA 5ALLA 5AW7A 5AI5A 3W5CA 1QQ7A 3N07A 3IJ5A 2CN1A 3ZVLA 2BDEA 2YJ5A 3FPBA 3MMZA 3VAYA 2YBDA 3NIWA 5AVZA 3A1CA 2YMMA 3OCWA 1VJRA 4EX6A 5ALPA 1SWWA 1Z5GA 1TJ3A 3D6JA 4DFDA 3ZVMA 2B1QA 4HYTA 4NFLA 3ZTYA 4L6AA 1Q92A 2ZBDA 2PQ0A 3M1YA 2NO4A 3QYPA 3N8GA 5ALFA 2Q4TA 3AR5A 3KOOA 1WVIA 3SD7A 3UMBA 2FUCA 3KDPA 4UMFA 1SU4A 4UARA 5ALZA 5ALVA 1EK1A 1RLMA 2YY6A 4YIKA 1YMQA 4Y2JA 3ZX5A 4UMVA 2HX1A 1L8LA 3QU2A 1O03A 2RARA 3F9RA 2HSZA 4UW9A 5AVRA 3BA6A 2OA0A 3L0CA 3MPOA 1TJ4A 3ET5A 1J8DA 1Z4OA 3I28A 2FPUA 2HHLA 4FE3A 1ZRMA 2VKQA 2YMPA 4EEKA 4G9BA 2C88A 1S2OA 1Z4NA 3ZVNA 4ZEWA 3ZUPA 2P27A 5JJBA 5A3QA 4HGNA 1YJ5A 5AM0A 5ALGA 5ALXA 3OCZA 2WFAA 4UU1A 3E58A 4H1WA 3ZWKA 3OCYA 2GMWA 2QLTA 2CFRA 4F72A 1ZD5A 4BBJA 2RAVA 3AR7A 2C8LA 3L5KA 3N28A 2HF7A 5AI9A 1EK2A 4HAIA 4AP9A 3WK8A 2HOQA 4Y2VA 3FPSA 5AW0A 2HCFA 5AKXA 5AVUA 1QH9A 1CR6A 1U7PA 1QYIA 3EWIA 3SF0A 1Z4PX 1L6RA 2I33A 2JARA 1K1EA 3QNMA 2C4NA 1VFPA 2RBKA 1AQ6A 3A1EA 4DW8A 2YMLA 3FZQA 3L1VA 5AICA 4BNDA 2PKEA 2JAWA 3UMGA 4Y2YA 3AR4A 1NRWA 1J97A 3HYCA 1U7OA 4KNWA 1YV9A 3SHQA 3WKEA 1O08A 4AS2A 3E84A 3K1ZA 4UAUA 4HGRA 5AM1A 1X42A 4KYTA 2WF6A 3TLMA 3CNHA 3QUBA 5IT4A 3CZ4A 5ALJA 3EF0A 4XE5A 3N5KA 5AW2A 1L7OA 5AK6A 4UMDA 2CFTA 4F71A 3GYGA 4RESA 4E88A 3NASA 1S8OA 3M9LA 3QUQA 2IYEA 3U7HB 5AVSA 2WF8A 3ET4A 4B6JA 5AI0A 1XPJA 4BEVA 3NANA 3U13A 2I55A 1ZJJA 3NRJA 3ESQA 1RLTA 1TJ5A 3U26A 2NYVA 5ALWA 1IWOA 2WHEA 1U2TA 5AVXA 2B0CA 2ZBFA 2FPWA 5A3SA 4CE6A 4YGYA 2WF7A 3UM9A 3PDWA 3U7FB 3S6JA 5ALQA 3WK4A 2G80A 1U02A 5ALTA 2B82A 3A1DA 4KX3A 2BDUA 3I1YA 3WKCA 4NV0A 4QQFA 5AW5A 1N8NA 3ZWDA 3PGVA 3QU5A 1NF2A 4IFTA 5AM3A 2B8EA 3AR6A 3QGMA 5ALMA 1RKQA 4I9FA 4NAVA 5AM4A 1Z88A 1WPGA 1QQ6A 5AVYA 4HGQA 3E81A 5T41A 4DWOA 1Z4QA 4KN8A 2YMQA 4PNHA 4XOUA 4YH1A 1ZD3A 5ALYA 3QU9A 2HF2A 1SWVA 5E0OA 4EELA 5FP0A 5AM5A 4UAVA 3OCVA 1LTQA 5AW1A 2W11A 3J7TA 4JDPA 5AKKA 1RMTA 4Y2PA 3NALA 3AR2A 3L8GA 1L7MA 4BX2A 5ALIA 3WK5A 4Y2XA 5AKHA 2W4MA 3R09A 3DV9A 4L6CA 5AK3A 4JB3A 5AESA 4Y2TA 3ZU6A 2D2VA 2OM6A 2X4DA 1L8OA 2YJ4A 3DAOA 4G63A 4C4RA 4BYGA 2HO4A 4OHFA 3WGUA 1Q91A 5ALHA 2P69A 3WK9A 2O2XA 1Z5UA 3ONNA 5AW3A 2FDRA 4OD0A 2C9MA 3NAMA 2AGVA 4CF5A 2B30A 3OCXA 4J03A 4OCZA 1QQ5A 2G06A 5IT0A 2CFSA 1T9ZA 3ED5A 2AH5A 2P11A 1LVHA 1L7PA 2G09A 1RKVA 3L0BA 4RETA 2R8YA 1RQNA 3E8MA 4L57A 3L1UA 2YJ3A 3B9BA 3I6BA 2GO7A 2W43A 4KNVA 2I6XA 1ZD2P 4Y2RA 2MU1A 3FM9A 1ZRNA 3W5AA 2R8XA 4EX7A 5ALOA 2JAUA 2GHQA 5AKLA 4UM5A 3OTQA 3WKBA 3OPXA 2DQSA 5AKEA 2O9JA 2AUTA 4CNQA 5AKJA 2OYCA 2IA5A 1KYTA 1TA0A 3QU4A 5AM2A 2B1RA 5AI4A 3L8FA 5AVWA 3P96A 3IB6A 5AKGA 4BKMA 4AS3A 2IOHA 4C4SA 1RPZA 3RFUA 3R9KA 2FPXA 3U7GA 1RRCA 1L7NA 3DNPA 3B9RA 3WGVA 2PR7A 1Z4JA 3L8EA 4Y2QA 1PW5A 2RB5A 5AVQA 3IRUA 2EARA 4UM7A 3SMVA 1YDFA 5AIAA 1XP5A 1Z4IA 3N1UA 2B8JA 2MSNA 3L8HA 4Y3UA 1Y8AA 3R4CA 1VJ5A 2FEAA 2EAUA 5AVVA 1YS9A
chains in the Genus database with same CATH superfamily
4LOJA 5BMOA 2CF6A 1NLMA 2IUSA 2R1VA 5JS6A 4UMEA 3VSBA 4AMUA 2K7FA 5G2OA 2DSNA 3B2NA 3UPDA 3UWSA 2GDJA 2RHRA 1NIJA 3IODA 3PGLA 5FPHA 4BKOA 1U81A 3BWEA 1UJNA 4DZRA 1D1QA 4ZO9A 3HM9A 1M2OA 4U9IS 1J5EB 4IRXA 4YCBA 1V0JA 5GONB 2O7VA 3IMGA 5H9VA 3JR3A 3S27A 3DOEA 5F9HA 4BFWA 1T43A 5JH7B 3NVMB 3OEWA 4GWKA 4WZAA 1BJRE 3SBXA 2BFOA 2J6IA 2Z6UA 2ZOSA 4WN3A 5C31A 1FMLA 1GR1A 2XRZA 3H9JA 3REQB 1E5VA 1CK4A 3V7WA 2H2IA 4NBNA 4N12A 1OKKD 1E69A 5DHUA 3RRBA 1QFZA 2H2GA 2Z43A 3RVNA 2PKQP 3IBGA 4UE3S 2COUA 1SKQA 2I7DA 2IU6A 3MMSA 3O82A 2H7YA 4MI1A 1OGJA 5F64A 2EQBA 4LYHA 1SOUA 1O6BA 2SICE 1CXZA 3DZ8A 4RANA 1XCLA 2R48A 4UHHA 3ROEA 1L9KA 1RHQA 3RANA 2FTKE 2D4AA 2R00A 1RCTE 3LSTA 4BVAA 2IVZA 2HJGA 2VNIA 3KYJB 5FTLA 1I9CA 2D54A 1KVQA 3EZ2A 4W5HA 3OC0A 2NVBA 2R66A 4J0IA 4LE1A 3PFWO 4XUEA 3BGVA 1L5FA 4YBRA 2IDJA 3TKYA 5CA0B 2AC7A 5AOCA 4OBXA 1ZGJA 4ZAXA 3LLVA 4D8UA 5GOZA 3B1ZA 4BMDA 1L8AA 3HBMA 2XWPA 1W2WB 1HZJA 4N3BA 2WD8A 1ZU5A 3K15A 4UVGA 5ALEA 4D9CA 3HDVA 5CVJA 2QE6A 1A50B 1QGDA 2OCYC 3ETJA 2NUTA 1M6NA 3NWOA 2ZBGA 4UASA 1UP6A 4D6YA 4WGFA 4TMVA 1IJKA 3B2QA 4UUAA 1H65A 3NAQA 1IHDA 3RTBA 1F7VA 3HP7A 1V95A 1EFKA 3H2KA 2P0YA 2GO1A 4C0WA 5CVTA 3VKGA 2GETA 2FVXA 2ZVDA 2W8ZA 1P77A 1ZW1A 2XF2A 3LOUA 4I1SA 3F5SA 1MJNA 3CX6A 2BGJA 2ZRAA 4G4GA 3AU8A 2HV8A 4OJTA 5FTKA 3RUPA 3SYLA 2SECE 3AEZA 5C8YF 1JE1A 2J4FA 4JR2A 1RSZA 2VT6A 3E70C 3JYLA 5ELMA 1U1EA 3ZW7A 1BX3A 4P7JA 4RADA 4UHDA 3ZU5A 4XLZA 1UJ4A 5A9TA 1N2SA 4D6XA 4B74A 1HEIA 5K4AA 2QQ5A 2IPLA 1JZQA 3TZBA 1VA5A 2R1TA 2ID8A 1RJ9B 3GFFA 3FNBA 5F5LA 3ZHZA 4DLKA 1KJQA 4Z4QA 1FFYA 2I3DA 4ZKEA 4BO3A 2X4LA 1FRNA 3D8RA 2QNBA 2ATEA 3LP6A 5AP9A 3TB4A 4K9KA 5P21A 2H1OA 1DC4A 3PDJA 1MGPA 2DR2A 1VECA 3NR2A 1CR1A 5AKZA 1GPUA 3H9GA 4W9RA 5DIFA 3G02A 1GPMA 3CH7A 2GLXA 4JMLA 3HDYA 2ZR7A 3GG9A 3PB3A 1MQSA 4UEJA 2HCJB 5CDFE 1KQFA 3L04A 3L0SA 1C7JA 1NVDA 3ZW8A 2DULA 2XTJA 1MRSA 4AUNA 3F6YA 2Q2NA 5JADA 4EITA 1GXSA 4RYLA 3U56A 2C7QA 2ONJA 1MEJA 3UJPA 1K66A 2VAWA 5K51A 1M1NB 5JMWA 2C2OA 5K7SA 3HCNA 4FD3A 2IDMA 4W4TA 5IJ0A 3B20A 3T5PA 1RLUA 1KTIA 4EENA 3NHYA 4Q1AA 3G1TA 1OX6A 3RSZA 2Q5QA 1IJEA 3BJEA 3FCUB 1UXOA 3A05A 3IUEA 4RGVA 5BR4A 1TPYA 3CZAA 2AI1A 3RYIB 4FXOA 3VU9B 3RTAA 1WPXA 3TQOA 3REOA 1VIMA 3AY7A 3VDQA 2X0DA 5C4IA 2Z9CA 5EXSA 2ET6A 2VF7A 2ZIAA 1NZFA 3FNEA 2AT1A 3GCXA 4DL9A 2BHTA 3HFJA 3UANA 5IKEA 5KYXA 1JHYA 1I4LD 1E2IA 5AW7A 2YRFA 3WIDA 4AU1A 5CDHA 2FPIA 3GC6A 3BSWA 4WY2A 2Z1MA 1M76A 3DB2A 4UBJA 2MT9A 1DSSG 3LCJA 2LRHA 5TMEA 3W2EA 3TTSA 3VAYA 3ZJTA 3HBAA 1J23A 4RKYA 1IATA 2WIKA 2QEQA 2QY6A 3HHEA 5JI2E 5DYNA 4N5NA 1A9YA 4PPGA 4Q7MB 2PT6A 4WOCA 3ZHOA 5IK2D 4AUEA 1JEDA 5KSZA 4JV5B 2C0PA 1BMTA 5BSRA 4REOA 1A5ZA 3QPBA 5BQFA 4AKTA 3ZVMA 3U4HA 1ZJ4A 2HF9A 3LBNA 4R2KA 3R9IA 3DEJA 3DLAA 1ZPDA 3GLIB 1GCGA 1WHTA 3M1YA 1NFRA 3T9CA 4C3VA 4YN3A 4A73A 3M4NA 4LHVA 4ND4A 4BMXA 3SD7A 5HGJA 3GN1A 2QUZA 5F3DA 3RU2A 1G9XA 1RBYA 3B3AA 1CDEA 3CRRA 3DMGA 4ND7A 1W36B 3BC1A 1WP9A 2ATCA 1SVLA 2FG5A 5D5PA 1I5OA 4C7MA 4CM9D 4DY4A 2GEFA 4YCCA 1J42A 3LF2A 2QTWB 3K4PA 2WEKA 1E79D 3CUEF 3EFOB 3WNQA 3NWBA 5C81A 5DCWA 5B6JA 2VBGA 1I7LA 1K8QA 4JK3A 1RE1A 3HY6A 4OLBA 2YVAA 1D2RA 1AQYA 1R0KA 4HBZA 1DIGA 5FAXA 1MV8A 3V1NA 2WSSA 3U3XA 3BCHA 1C2TA 2GM4A 1EJ2A 4O4IA 4IIXA 4KYUA 3MRSA 3C6BA 5IVDA 1ZUIA 3LXMA 3PE3A 4NE9A 4R6XA 1ZMXA 3O7MA 1T1GA 1U2QA 5DN6D 3B1KA 2IU4A 4CMIA 3B6MA 4MGYR 1TRKA 2BUBA 2KI5A 1BH2A 2VKQA 1DWUA 3JV7A 4XQ9A 3B9QA 1H2EA 1QGUA 1JRLA 3AEQA 3GZTB 4KXFB 3CZ9A 1ZESA 1IHXA 4R9NA 5CLLA 5EIBC 4MUXA 3RKRA 1KBOA 1C41A 4HV4A 4A0HA 7AT1A 2JGJA 4KGZA 3ES9A 4M49A 3VSCA 3VZPA 1SUSA 2WIFA 3CLTD 3ZU4A 2QT1A 1OLXB 4HGNA 4FGKA 1YJ5A 3BXEA 1NVXQ 3NC0C 2ORVA 4TLDA 5ALXA 3OCZA 4DJEC 1B4DA 5CNIA 1D2HA 4K7JA 3PYLA 5I9LA 5DT2A 3D2LA 2CVQA 5I5EA 3VZCA 4KMSA 1E3MA 2IHTA 3W3AH 3IVAA 5HG0A 2XBMA 1L5WA 5DCLA 2RI1A 4FNOA 1Z15A 4P58A 5TPWA 3W5SA 2RB4A 1PFGA 4BBJA 1IXYA 2RAVA 2NTVA 3AR7A 1GAQA 4G81A 2X7JA 1SUAA 3ZDFA 5EHXA 4TSRA 4J16A 2JJQA 5JSYA 4LRUA 4OJNA 4U39A 1CDDA 5EC8A 3VAAA 4BLOA 5AKXA 3ZEIA 3LJKA 1G7CA 1QYIA 4KIGA 3EWIA 5BW5A 2Q0QA 3KHTA 3G7NA 4JY7A 2XNDD 5TVKA 5ER9A 3RI3A 4AUMA 2IPXA 3H7IA 5DBHX 1CZUA 3T8YA 1JHRA 2E1RA 2XYHA 4JENA 3N70A 1KRXA 1Z73A 1CUUA 2HHJA 3GZNB 4M4SA 2WJWA 1TCCA 2YMLA 4X84A 4YRTA 2PBRA 1Y7HA 5CVUA 2IY9A 4LF9B 2F8TA 3QWBA 2IH4A 1WXXA 4Y6RA 4B2LA 2MSWA 1J97A 1YL5A 1DKLA 1H4QA 2NSJA 3CW8X 4X5OA 3WGNA 1M2JA 2FPMA 1QB7A 5DN9A 1Y5LA 2XQKA 3RADC 3R7AA 3RS7A 2W6CX 2O8CB 3LBIA 1R74A 2F1HA 4JLVA 4OM8A 1PFYA 1FC0A 1R0RE 4KR2A 3FYTA 4YP1A 1NSYA 4WEQA 3OJOA 2ZBRA 4DM4A 3A8TA 3KOZA 2ZB8A 4QYMA 3UGQA 4NENA 5M29A 2HK8A 3FI0A 4TL6A 1ACJA 3LE8A 3T4XA 1QH0A 3PEEA 4B0OA 4AO7A 3NHWA 2UAGA 3RVLA 4OSOA 2ZUSA 1JLLB 3L6BA 5F2OA 5H5JA 3I6ZA 3F0TA 3QUQA 3O1JC 3QWHA 1DXQA 1D04A 1ZHHA 2YBEA 3B1WA 4KLRA 1OXKB 4MVJE 3ASUA 4OUDB 1KQGA 2X19A 3AL0C 1JP7A 2X2PA 1UFVA 2PS3A 2XE8A 2LP4Y 2YWCA 1FXSA 3HKEA 4TLCA 4YMSA 3II6X 2HYDA 4B6JA 1CQIA 3FUTA 4PPYA 4BEVA 5D84A 3VTFA 4DC0A 3ZZUA 1H3FA 2CXNA 4OXKA 4RO0A 8ATCA 4FYKA 1DZ3A 4MCHA 3BULA 4BZPA 4TX1A 4DE5A 3TEFA 3V55A 3K9FC 3GCWA 2OUIA 5BYBA 3GNSA 2A9OA 4M3NA 2DECA 3CLVA 4C6TB 3G23A 4C87A 4ZCRA 2OP0A 2WSYB 3HUUA 4KJXA 3GG2A 3ZY4A 3Q40A 1RM4A 3DP7A 4A91A 1XG5A 5JSZA 2WF7A 2X13A 2ZI5A 1JNXX 4DYDA 4ENQA 3EUWA 3EVGA 1IOWA 3N2IA 2HRBA 2ZE5A 4UM9D 1KMCA 4B79A 5SYMA 4MVJD 4MVJI 2YS6A 4TWIA 4KP7A 3N2ZB 2ZXFA 5BSVA 4CMBA 3FRJA 4PYMA 4QATA 5LQJA 3T7JA 2DKFA 1BTOA 2EG9A 3TFWA 2H9IA 1VZ3A 5IG2A 3LXUX 1YULA 3AERB 3EGCA 4Q4HB 3DQZA 4RHYA 5KSYA 2J5KA 4R83A 2Z6AA 1G5IA 4OO3A 1XRLA 3LC2O 2A3RA 2B8TA 1PZXA 2YV2A 3C7TA 3KFLA 3NM6B 4UCFA 3STVA 1XTRA 2O0MA 1IH8A 4OHZA 2IEZA 1NR5A 4G5FA 1RXWA 4F1JA 1TECE 4X7BA 3V2IA 2GNAA 4YC7A 3A1SA 5C5EA 3FHCB 3QK7A 1H3NA 1XTIA 3C4VA 4I9FA 5I7VA 3E3MA 4P7GA 3WJ1A 4NAVA 3T1YB 3VPGA 4J1TC 2H08A 2VL7A 1OAAA 3ROTA 2AE2A 1WUIS 2CUTA 2X3FA 4QXAA 1O9HA 1QO7A 1XDBA 3AJDA 1G38A 4BB0A 1U0LA 3QPVA 1BW9A 4RL6A 1IE3A 3TEJA 4QG3A 3LCRA 4XGNA 1DCMA 5DYIA 5CD9A 2XUPA 4I3HA 2OQ2A 4ZZ2A 1AS3A 1NRIA 1WW3A 3H5VA 1F2TB 2YXPX 3V7YA 4J0GA 4PM4A 2VJNA 3DV0A 3EZ6A 4KWCA 5DEOA 5DIZA 3PEYA 4XDGA 4IOKA 4WSOA 1F0PA 3VPDA 1TW2A 1RYEA 3PSHA 4TM7A 1ARZA 1CRWG 2GPAA 4OHBA 3KVNA 4I4IA 4PLPA 5TB5A 3NG1A 4QTUB 4AJ9A 1X7HA 2HMSA 5P8WA 5FORA 3UPUA 1LQUA 2ZUVA 4S2EA 1AMNA 2PH3A 1IEWA 1U1IA 3SAJA 3SJAA 1KI7A 1PD1A 3OD1A 2QROA 5BQOA 3R3JA 4KVAA 2D1QA 3ZWXA 4J2OA 3R09A 4MRMB 3DV9A 3ONVA 3M0EA 1P0PA 3MLBA 1Q0TA 4YAGA 4GHWA 4KO3S 1UPFA 3WMGA 4AP6A 1RXEA 2DB3A 1EVEA 2OM6A 1XDSA 2WM3A 4G2NA 5A62A 4ZV7A 1Z39A 4ITVA 1XJCA 1JLRA 2R4UA 3RC8A 4FIZA 3ORRA 1AK2A 1YZFA 1M6WA 4B76A 4JR0A 4DT1A 1JFFA 5F52A 4WRRA 4L0QA 3KTAB 1NIPA 3P9NA 5FOWA 4NZNA 1DU4A 2O2XA 1SCDA 2QS9A 3WL8A 4ZK2A 2P4UA 3B38A 3R7FA 3WVNA 5HOQA 2AMFA 2Q45A 2H29A 3C3EA 4E6EA 5IARA 1BOOA 3M49A 3HNRA 4X3CA 4BNZA 3R74A 5HOEA 4MV8A 4OA5A 4TMFA 3Q7IA 1T9ZA 3OQ6A 3GR6A 2AH5A 2X40A 3GI1A 1EHIA 1EXNA 3VR1A 3ZGOA 2AOXA 1WU8A 2WTBA 1VCIA 3L0BA 4RETA 1JR2A 1YRHA 3PNMA 3WRXA 1PFKA 3GD7A 4YRQA 3RASA 1Z37A 1KDYA 5B1IA 2JKYA 2AB0A 1QLWA 2P3SA 3TM4A 3K6SA 4U0JA 3WGMA 1FRVA 2L2QA 4DLUA 1VPEA 5EWMA 5FWXA 5GM1A 4Q9JA 4NDZA 4EECA 4OEHA 3ND5A 4QYTA 4H9GA 1MJFA 4FFMA 4HP8A 1ZJ5A 4B3TB 1XA4A 3LG2A 1HYQA 2GF0A 4NBLA 3G8YA 1FFCA 2B8WA 3O31A 3C3AA 1QGAA 4HMQA 1UDAA 1NMXA 1J0CA 3E1SA 4LYEA 3CEAA 3L79A 4QTZA 4IEIA 3AF1A 3NUGA 3UOAB 4BNLA 4NU8X 3OY2A 4UC0A 1E1QD 4W7SA 1Z7GA 1KDRA 4QU0A 1E2DA 2IF0A 1X86B 1Q44A 5KVVA 4FFWA 3NHAA 3BL8A 4XGKA 5FPTA 4F5EA 3PTAA 4ENPA 2CLHB 2IPNA 3L8FA 2HU5A 3O9MA 2ZJ1A 1AKQA 1U0GA 1G6HA 2VYVA 3CEMA 2EF0A 4PWZA 4QM6A 2ENWA 1NWHA 1DPFA 1TM7E 4MUAA 1G8FA 2F1JA 4MAMA 5IT9A 1MPXA 2N46A 3SY8A 2AN1A 4RUKA 1K06A 3PU6A 4YFYA 1RLIA 4J91A 4Z2YA 3ND7A 2J9ZB 3BEDA 4Q4JB 3R76A 2JD1A 3TMKA 3QP9A 3TW8B 1TAHA 2Y8EA 3L46A 2EZ4A 4L02A 4QSHA 3WAJA 4AY5A 3SC2A 4FUQA 2L69A 1EUZA 1O5TA 1U9JA 3PFBA 2CUKA 2XBUA 3EG5A 3PR3A 4DA6A 5K3EA 1MV5A 4J9UE 4ZOBA 1P2VA 2HK6A 1B15A 2Z2KA 1K2VN 1IM2A 2AJLI 3BVPA 1X7XA 1XZPA 2XOKA 3OA2A 4D0RA 4DG9A 2HJWA 2OCGA 2Q6KA 1AUXA 3HG7A 3GBVA 3G85A 3WLKX 4BP9A 5CRIA 1N36B 4ZOEA 4PIVA 2FZKA 3FZYA 5A4AA 4CF4A 4WOJA 4DQLA 1DWQA 4AJEA 2C4HA 5J4VA 4BNFA 1NQTA 5AQ1A 5EMJA 2CJFA 2VK2A 3MTEA 4QJBA 4TXHA 5AWFC 1ZD4A 3UH1A 1YUNA 3AR8A 4GYYA 2Q4EA 4F2WA 1FIUA 1GYQA 2VZLA 4NPAA 5EZSA 3K92A 5FFFA 1P8JA 2O07A 3GRYA 3EPHA 1Z2DA 5TPZD 4J0HA 4X44A 2OYRA 1SNYA 2QD1A 2UUOA 2WU3A 3SKXA 4AECA 3DOCA 1G16A 2XRMA 4X00A 2QU7A 2VH2A 1R9MA 2WSSD 4BKPA 2ZE8A 4X8OA 2BKUA 3LBAA 5DDIP 4ZAWA 4BFCA 3D3QA 2E85A 3DDNA 3DF7A 3S2YA 5CB4F 4JROA 2R60A 5KWVA 1TIBA 3DXZA 3V00A 1A9QA 3JQ7A 3LCMA 2RGNA 4LX8A 3BKXA 1EG7A 3HBJA 3BMOA 4MW0A 4O0MA 1PN3A 4PCVA 4DAOA 4UQLA 1M0TA 3RS2A 4ALLA 4JC0A 1J0DA 5C4MA 3LW7A 4G0YA 1ZJZA 4X93A 2IYOA 4BN5A 4TYMA 3DMPA 5ILQA 2NV6A 4G0WA 3KOYA 3FNIA 3GAMA 2WQ6A 3H5WA 4IX9A 4B83A 4KDRA 3RJ5A 1RI5A 1N9KA 1EK6A 3QUTA 4BQIA 1FSSA 4HYQA 2CBZA 4UCXA 4KO2S 1Q21A 2XNHA 3WYFA 4CGZA 1U3GA 2WPNA 1T5OA 3X1MA 1T2VA 3MVEA 1QS0A 3F7MA 3KQWA 5DH9A 3QOXA 3QRWA 4FGLA 1IVYA 1G8JA 3AYZB 5SY4A 2PT7A 1S8FA 2A4KA 3N7AA 1J1IA 1Y9AA 2B6NA 2ZIEA 4KR9A 3KTOA 1M1YA 1W5AA 4IOJA 2NT4A 2OD9A 4HMOA 2I34A 2BL4A 1XEWY 4LS3A 2JA2A 4NATA 1W4ZA 3RSGA 4AKIA 1ZISA 3FAKA 1NWCA 2DKOA 3KEFA 3LZDA 1BSVA 3R3SA 4YJHA 1NM5C 2GGSA 5JYEA 2OHVA 5F21A 1Z18A 4ZI7F 1HDGO 3M3PA 4BLTA 3QM1A 4FFBB 4RTSA 4AXXA 1CEXA 1HQDA 2IZZA 4K88A 4F3CA 3GRFA 3C85A 3DDHA 3Q8MA 3IQDB 5AJYA 4M9UA 5TX7A 4BP8A 4CKWA 3PFHA 1TD9A 2XD4A 4H6WA 5CM9C 1F8YA 1X74A 1AUPA 2IHUA 3CH5A 3QXSA 4S0ZA 1XBTA 4MYCA 1KYQA 2D5LA 2QXUA 5HJEA 1FUKA 2OWDA 4RJKA 3RLFA 1FX0B 1XKQA 5ALDA 4L95C 4CFSA 4I4TF 3L7MA 4Z3KA 2XZOA 3DGFC 3K53A 4D8VA 1P2BA 2CCJA 4QQ8A 4A8JB 3MBIA 5TQJA 3VYVA 2JK0A 4R68A 4DKXA 1YZ3A 5TRTA 1A9ZA 3JQPA 3R6GA 1LD3A 1XVIA 3PC6A 4G07A 1E6LA 4Q12A 3OQBA 1LI4A 1J9ZA 1E6EA 3M4YA 4NMXB 3WTCA 2PUCA 1LSSA 1MF7A 2D1FA 5IVPA 3HDHA 1OH8A 1AQLA 3G8BA 1Z25A 3HCRA 4OXIA 2UV8A 3KBBA 4IIGA 1T36A 4YA6A 4PYJA 1RXVA 1E92A 4UZFA 1PEDA 1YXMA 1XWWA 1L5VA 1QR2A 3KSBC 1USUA 4NKRA 4XLTA 2D7JA 2D6FA 3NJRA 4DLVA 2VSQA 3QXGA 3P0HA 1IRXA 3DZDA 1IBSA 1XQXA 3ZXUB 2Q3MA 3EDOA 3PVSA 1HFEL 4O5AA 1H2XA 3E03A 4P53A 5C3UA 3H4TA 5KYVA 3FCXA 4LOLA 4I36A 3T34A 1NVGA 3GRZA 4E09A 4XFDA 5K4HA 1ZK4A 2FFHA 3NCTA 1FVFA 4C22A 3AF6A 4TTRA 2ORYA 1J0AA 1QQ7A 3TWOA 1T26A 2J59A 4ZC8A 2BDEA 1DC6A 4D25A 3CLRD 3OPQA 1B3BA 1WE2A 1VRWA 2PLRA 2CXRA 2WP8J 2XVMA 1NLUA 4C6HA 2PGXA 1QGYA 4C30A 5KVQA 2M6LA 5KX5A 1OYYA 1WKCA 5CNMA 2YMMA 3O8QA 5A6SA 3KYIB 1T3TA 1SU7A 1P62B 3RVPA 4HRYA 4TL9A 2HN9A 4LJAA 3QLVA 1JVBA 2P2LA 4QXMA 3C97A 1A9TA 2PZBA 2VHYA 2JFQA 5LBTA 1NBEA 3KUUA 4WKGA 2PH1A 2QENA 2GF2A 3EGIA 2AQKA 1G19A 2F1RA 5IYZF 4CIAA 2PTGA 3MT0A 3HCWA 4XWOA 5J1SB 1G8KA 4HCJA 1RT9A 3ACBA 1LBEA 3D6TB 3FPCA 3OI7A 1I6WA 5HTOA 4EUSA 1YR3A 5BQ3A 4A8HA 2BFWA 1V8PA 3BD7A 4GLBA 4CODB 1A4IA 3RNOA 1KZHA 1PNVA 1XKXA 5CNJA 2EFDB 3DMDA 2I8AA 2ZI4A 3BERA 2BHLA 3OQJA 4S3MA 4UMVA 3N6XA 4O29A 1NN5A 1FFBA 2R6HA 1X7ZB 3FSEA 2TS1A 1QH8B 1VE3A 2F62A 2P2NA 1VYTA 1WPQA 1N8TA 2GBPA 1G3UA 2HSZA 3F9RA 4OAPA 2X9LA 2PZLA 3P4YA 1W4CA 4G1EB 2ZUDA 5FNVF 4BO8A 2A6PA 2NT3A 3BIOA 4LZPA 4BLRA 1P4AA 2BZ1A 1SKYE 5H80A 3TR6A 1GFSA 2OV6A 1W0JA 1G55A 3CZ5A 3OZIA 1D2GA 3BJRA 2PRIA 4LJ6A 4QYIB 4LJ9A 4ND5A 2F90A 2Y77A 4WACA 3TQTA 2HR1A 3FVRA 2GZ2A 4RXTA 2FLVA 4M1WA 4OQXA 2XF8A 2AK3A 1FB5A 2YZMA 4OI0A 1LWOA 2ONYA 1N5RA 2HSDA 3W6PA 3CNLA 4GUDA 2OFFA 4G1VA 1Q17A 1DELA 1SVOA 1JHVA 2N1BA 3H05A 3S8YA 3G2IA 2C94A 1HT3A 4L3OA 3HCCA 5FULA 2R2AA 1FMTA 1SVWA 5L3ZA 1V8DA 4H1WA 2UZ0A 4PBRA 3ADPA 3JQ8A 1YJQA 4US0R 2A5GA 1JEEA 2Q8PA 5T3YA 3FOWA 5A0FA 3OE7A 4RFLA 1VI6A 4JSTA 4UTXA 4ZAGA 5KYTA 4ZEOA 2XUQA 5FUBA 3JAWA 1XHEA 4HQRA 1P0QA 4QNMA 3T06B 4BIMA 3IOMA 4DQKA 1GCUA 4ZVUA 2B69A 5GADl 1OIVA 2WFMA 3IPRA 1OXUA 1TTQB 4DVGA 5LD2C 2GZRA 4CEJA 1SVKA 4JVMA 2DP4E 3EVEA 3PKJA 4Q7KA 3LHSA 1EMDA 5KVCA 3S1AB 3RYFA 4FUTA 4UUOA 3BAFA 3ETDA 4N6OA 3CEPB 4DW8A 3KM0A 2QSJA 1P7ZA 3NM5A 2O2JA 1DKNA 3IAM6 3NVAA 4LKRA 3O93A 3HJBA 1TFUA 1ZSYA 3T7SA 5LP6A 1WY7A 3CLKA 3DYBA 2R5WA 4BX8A 2OCXA 4OVKA 1Y9ZA 2IYYA 1Z74A 4JYPA 4PZPA 4R3NA 3PYXA 4M1MA 1IWBB 4XARA 3VI3B 1B1AA 5HX7A 3DZCA 3CIFA 1J09A 5B3JC 1WOYA 1KOGA 3JD3A 3JWGA 2JIMA 1EB9A 4UXJA 1ZM4A 3ZZNA 2CCKA 1VLVA 1LDYA 1BWSA 1OX5A 1PS9A 3EZ7A 3OU6A 2NU6A 2AE1A 3GARA 4MWCA 2EQAA 2NO7A 2IHVA 4Q24A 3K1AA 5ALJA 3TINA 4YT5A 3I2HA 4AUKA 4WK6A 3MTIA 3RAFC 1XZQA 4LJYA 4QUIA 4RHCA 4UMDA 4MIYA 4DARA 4NFHA 5LMCA 4KRGA 3FTNA 4N8DA 1V16B 1GFZA 3DC7A 3PFGA 4YJKA 1SUCA 2F4NA 2AVDA 4B6EA 1CTQA 2VDRB 4BPRA 4R81A 1HORA 1D5WA 2UYGA 2QVBA 3KUDA 4MCAA 1MXFA 1D09A 3QTTA 4I50A 5DHFA 5EGSA 1VCOA 4B5KA 4AAYA 3MCWA 5IULC 2BI7A 4HGZA 5AI0A 2B21A 1I0LA 1Z68A 4YREA 1E1NA 3EDQA 1SEPA 2DJIA 3EEFA 1OXXK 2VYVD 4IJUA 2CNKA 1TCUA 2GK6A 2POCA 3CRZA 1TJ5A 1U90A 1KU0A 3N2EA 1JLHA 2A9KA 1KQNA 2IZOA 2XTAA 4PAGA 2IQIA 1YUBA 4HNSA 4P36A 3FVWA 4A0SA 1U2TA 1YIOA 4U6QA 4CLXA 3BA1A 4C07A 1SAYA 2C96A 4PYOA 4J1TA 1L5KA 5ILOA 5GJCA 4D1YA 1Z12A 1WEKA 5HIAA 3A4VA 1FA9A 3K9GA 1E8DA 2MCFA 2PT5A 2ZE7A 3U61B 5B1YA 4KN6A 3RROA 1TMGE 3BYZA 3D8TA 3H3XA 2HPHA 2VO1A 1J25A 1E9AA 2GI4A 2PGLA 3D3NA 3IT3A 3TRDA 4TT8A 3DL4A 4FLMA 4HNAA 1YZHA 1UBOS 5GOTA 1X8JA 6ADHA 1H4TA 3TOSA 2XZTA 1EEHA 2HM7A 3I2GA 4BC1A 5KMGB 2C58A 3RT9A 4P0TA 4UHJA 3O84A 3SM3A 3NEYA 3ZCUA 2OXEA 1VBMA 1CJCA 4MVYA 4ZT6A 2NXJA 4FZ3A 4ZYVA 1Y4ZA 3ER9A 1AUVA 4O4HF 4C2BA 2XD9A 4OB8A 3OJXA 4TS1A 3RRMA 4DEYA 4EKGA 2AEEA 1AF4A 4RHEA 5B6IA 3D7LA 1Z5OA 3HA2A 2B8EA 4K1LA 2D7DA 4G1CA 1JSZA 2GRAA 2HBRA 3KKOA 4HBGA 4QXQA 2WWGA 4U9UA 1VPDA 1HZZA 5KI6A 2NVOA 2ZDHA 3CVYA 2F43A 5AHKA 1QR6A 1JW9B 1ZNQO 5TSDA 3V8PA 3IAEA 3RAJA 4WOBA 2V6BA 4PNHA 3ZQJA 4FTWA 3R7BA 3VVBA 2QGFA 3SVTA 3RV4A 1KYWA 1QH1A 4UBLA 1ZIOA 4GPIB 2FCAA 2O19A 2QOEA 3L7OA 4R9UC 4EB6B 2QV0A 4IIJA 1GTL1 4PRKA 1W93A 1WBJB 3N0XA 3IGFA 3NBAA 4N3AA 1MW8X 1DCKA 1UM9A 2CVOA 2MYPA 2VXCA 1NVFA 4HZIA 2WD9A 4L9WA 4BWVA 5MFPA 2WVJA 1XNGA 3CWQA 2XAUA 3Q0IA 3QBTA 3TYXA 3F96A 4K9SA 3W2GA 3FF4A 4RTPA 4NK5A 5C8VA 3SEQA 2X9QA 3FHLA 4BX2A 1RACA 3OZFA 3DOUA 4QGFA 1WDTA 3OTOB 3ZS9A 3S7TA 2EF1A 2PL9A 3VO9A 1GKKA 3HKCA 1SD1A 1XEXA 4MPDA 4FR2A 4ADSG 3FFBA 3P9RA 5IHXA 7MDHA 2WU4A 4P0PB 4N65A 2DOKA 1EVKA 3AVXA 4V3BA 2D1RA 3FR8A 4HS4A 2GBCA 1WSAA 1P9OA 2FMFA 2AOVA 2KB0A 2R86A 2BMAA 3NBYC 4K6FA 4QWWA 1UP4A 2MSLA 4EFNA 1NUUA 2FJUA 3K0FB 3SDBA 3DWGA 2VWPA 2P69A 3CNOA 2Y92A 3L01A 3PHBE 1DUIA 1QG2A 2AJDA 3C39A 1U1CA 1YB6A 2FR0A 5AW3A 1SY7A 2GA9A 3ZIUA 3NAMA 3N74A 2P9TA 1PJSA 2OV8A 1NUPA 2VWQA 1VDZA 4GOOD 3WIOA 4DCJA 3OLWA 4BKRA 2QD3A 3C5WP 2G1KA 2Q46A 1NHGA 5E7JA 5EPEA 1HF3A 3T0GA 4LGCA 3SS9X 3TPFA 5TT1A 1XVAA 4M9SA 2NZJA 3AHIA 3IUJA 1RKVA 3PJFA 4YYEA 1MHTA 4BO1A 3P0RA 1Z0DA 3G6WA 4J75A 2BJHA 2LXNA 2C98A 4RKWA 2EZUA 4RLFA 5FJJA 2I6XA 2QRPA 2BIFA 1IPEA 1XD9A 5JFOA 3M9WA 2KYRA 5ABPA 2W2LA 4N0PA 2GARA 3E0QA 3K8OE 3NRCA 4NEQA 2EFEB 4F06A 1NQUA 1UAGA 4XB6B 2FN3A 2LWIA 4C3OB 3I6MA 2BMVA 2Q3JA 3D2BA 3OTQA 1UJCA 1QCDA 3WKBA 4LRTB 1C3OA 4ENWA 2B6HA 1GHTA 2BV3A 5E3HA 1ZR4A 4PZLA 3E9QA 3HV0A 3WE7A 2P9GA 4PC1A 1A8HA 2HXGA 4WN9B 2W6QA 2G0TA 3JZDA 3LBFA 2HNAA 3FCEA 3N8DA 4HATA 5AI4A 1IY1A 3P96A 2HC9A 4L4XA 5B7PA 4PE5B 5J23A 3PWSA 3QNWA 2L19A 4IQ0A 3AIOA 5HCUA 1CJTC 3MYYA 4FGUA 2ZUUA 3QPAA 1A76A 2O8FA 2ANBA 4F3NA 1EWTA 4RK7A 1UBRS 2VSOA 3B9RA 4TTSA 4XJSA 2C2XA 2VTBA 1JEQA 4ZYXA 2YVUA 4ALNA 1RM0A 3CG4A 3CX8A 1PDVA 1TD1A 2R7LA 1G20A 2FP4B 5JS2A 4BMNA 1JG3A 4HWRA 2NU7B 2JGEA 3ZH2A 1ZWKA 1Q3KA 4PS1A 4RBNA 4ZQCB 1GZUA 4KVGA 3EZXA 2BBOA 3PG5A 2CZCA 3Q3JB 2EAUA 1SVSA 5ESWA 3B3JA 1EUQA 1JPNA 3W1EA 1R12A 4XH9B 3A4LA 1LK0A 4F3KA 2DQZA 4RCYA 2BP7B 2V7EA 2XYQA 1UDRA 3ZJUA 4CV3A 3QUCA 5F73A 3Q9UA 3A4MA 3UWDA 5FLEX 3L1JA 1P74A 2P6MA 1CUJA 4ENUA 2WHRA 2PNFA 3WRVA 5K01A 4XB1A 3UMFA 2ZSFA 2M2IA 1MT3A 2CLDX 3PPXA 3STUA 4AMVA 4EZEA 3CF0A 3GGGA 1LS6A 5FUYA 1ZIYA 1KJ8A 1QIFA 3K94A 5KAMA 1YFZA 4M36A 5LYJA 4DRXA 1REQA 1G21A 1PQYA 2QRZA 4JP2A 2FR8A 3CF4G 3KD3A 1ZBDA 2PGJA 5FFMA 4EDFA 2PUDA 3AVYA 1W0JD 3KTDA 4URFA 2H2DA 1UC8A 5FOUA 4ZVNA 4E15A 1BVYF 3DNMA 3OF3A 2OL4A 4M38A 1EM6A 5I9SA 4G0MA 1FUUA 4GYJA 1GD1O 4RMGA 5HF6A 2CF5A 2ACKA 2UVPA 4ARZB 1SM4A 2XOXA 1Z0AA 3MFYA 5FTWA 4EGJA 2B7LA 1EIWA 3K70D 3VO1A 4OP2A 3BFXA 3RM3A 5EXDA 3ZLVA 5EXTA 5KQLA 2P9JA 1CZKA 5LB2A 1QG6A 2QTMA 3DCNA 4PV7A 4ZCMA 1XQ6A 3FFWA 3FNQA 4JMPA 2Q5HA 4DNOA 2XYRA 3I9NA 3TTVA 1QIDA 1O96B 3LK6A 5DVZA 2RONA 3UAOA 3QPUA 3T94A 4DIFA 4HQ6A 5JHGB 3MCAA 2M1XA 1P4RA 1YJAA 2Z58A 2F3QA 4HK4A 4EYQA 2O8EA 3G1UA 1UMCA 1V1RB 2ZAOA 2IYSA 3E05A 4CM4A 5ITSA 4LDRA 5JFGA 1SCUA 1V4VA 5C7IO 1D5CA 3OE7D 4M6WA 1RZRA 2IZ6A 1TUIA 2EKZA 3HCAA 3I4FA 4YX9A 1Z33A 2QTTA 1S7CA 3CEHA 3GA5A 5FI5A 4DMGA 4UE6A 5IC6A 5JYBA 3SJ7A 5KKCA 3NNNA 1V45E 2X6TA 5HQ3A 3NUQA 3PCXA 1G64A 4B73A 2AZDA 4IJMA 1JHDA 2BY4A 5DO9A 1D03A 3O83A 3NZEA 1RIIA 5IKXA 4WX2B 2O0HA 4LFCB 2QJTA 4CKEA 4B75A 1MBZA 4F2DA 2RH4A 3CR3C 1I51A 3C15C 1MFPA 3AILA 1K5DA 4E5UA 1I2AA 1POXA 2C77A 4LMAA 1DFIA 2HB6A 3KB8A 3GROA 5LKAA 3DE0X 2HHAA 2AMJA 1DX6A 2WG0A 4I5FA 4RTOA 3FOBA 3L18A 4BB6A 1CYDA 5ALKA 3UJDA 1WBDA 1M75A 3C43A 3NCHA 1V11B 3QWIA 4N9QA 3AHJA 5IBRA 3SZLA 3SEAA 1KXZA 2GXAA 4Q4AB 2R6AA 4FPXA 4ZEXA 3U4QB 3G17A 3PNBA 3WXMA 5HBGA 3BGSA 5DP2A 3OTIA 1A2QA 1DHTA 2CXOA 1N0WA 2JLUA 2FFRA 4EGQA 1PJ2A 2FQ1A 1TYDE 1VKNA 2SKCA 3MB8A 4ZOLF 1ZINA 1YZGA 2HA5A 1USKA 4C4TA 1Q0RA 3HQ4O 4X1YB 2FMTA 4MVXA 2FX3A 4CRWB 2E5FA 4MHSA 2NP7A 4ZO4A 4N3NA 4MS3B 1FFEA 1XTUA 3LKZA 1WM1A 5DHSA 3BQ9A 3HCEA 4BATA 3M89A 2XTMA 1V39A 2X22A 5U4XA 3W5UA 3EIQA 3V2UA 5ELXA 3DZHA 4PLGA 3GFOA 3DF9A 1CD5A 4HAOA 1SKUA 4JJZA 4DPLA 4PQRA 3AUTA 3S0JA 1ZAKA 3LYUA 2BE9A 2B8NA 3R24A 4KTVE 3FUXA 3TRKA 3NEJA 2CFIA 2C3MA 1B1CA 1FDTA 3COZA 3I01A 3NS7A 4JXXA 3AY6A 1DBQA 5FI3A 4IQFA 1K92A 1JQKA 1Z07A 3RAEC 3UY4A 2V6IA 1G6KA 2ONKA 3KL4A 3NFYA 2E6UX 3EC1A 3OMLA 1Z0ZA 5ES4B 4DJTA 3OKPA 3T3OA 1J8VA 3WB0A 3IKLA 1I2MA 2AN3A 3PFKA 1LLDA 4R31A 5HMLA 5LC1A 3EYAA 3SBEA 4BFYA 3T5DA 4I9HA 4JB8A 4CMKA 5DCUA 1T10A 1OT3A 1YF3A 3A6PC 4GI3A 3BILA 3S1LA 3CZCA 3ECCA 3PDCA 4OQDA 2XXAB 1P5FA 1SQ6A 2VVTA 4J07A 1YGYA 1X39A 4BQRA 1DTEA 1OA1A 3FWPA 1QHFA 1P2TA 2CNBA 3UUEA 3ICCA 3KAKA 5CA1F 1WVIA 1G7TA 2Z95A 3UMBA 4F5WA 4W8HA 3QF4A 3H5RA 3U09A 1CUAA 5E8JA 1D6JA 5I4CA 3Q5GA 3EBOA 1K9VF 3TK1A 2JL1A 2AN5A 3SICE 1VDMA 1K3FA 1XZFA 5CT6A 4Y2JA 2LBPA 2H5IA 3AUKA 4EG0A 1LSUA 1SHZA 1A9XB 3AZQA 4XX1A 2BCEA 4JLDA 4QDJA 3WFJA 2XB6A 1HDZA 2EX4A 2GPTA 1NQWA 3T3NA 3ENVA 4ZIRB 1JH8A 2I4NA 1SQSA 1PT6A 1RI4A 4GG1A 1N1GA 2H9AA 3FOCA 1FDVA 2VDMB 3G82C 1OVMA 2FV8A 2R65A 3C3BA 1ZH6A 3HJNA 1C1XB 3K8ZA 1GKLA 4LBVA 2YVQA 4B32A 3VR2A 4DMKA 1KK0A 1M73E 3IE0A 4GGOA 4LHYA 2REQA 2HHLA 2TECE 2YIVX 3CRVA 2DH5A 2H8GA 3CKKA 5AMXA 3SQDA 2DC1A 1Z6ZA 3SCZA 2IYZA 3ZY5A 2HA3A 2ZYWX 2OCBA 4TWJA 1SULA 1RCUA 1ZK1A 4US1R 4ZO8A 4D0SA 3COJA 3M9XA 1TK2A 3BGWA 1FRFS 5JMOA 4C0QC 2QRMA 5L95A 2WR8A 3GT4A 5JJBA 1TYBE 1F2UA 4WJLA 3K20A 1EUYA 3EH1A 2BSXA 1IZ0A 1HY3A 1NHWA 2GBIA 3GRKA 4GWGA 4MB2A 3U4GA 4D9MA 4L07A 1RXIA 1M8GA 3UCFA 4URVR 3AF5A 5TEVA 1JR6A 2XWSA 4QFMA 1U9IC 1RW4A 2WFLA 2Y99A 4HAXA 3T0FA 4PHCA 4EW1A 4XTCS 1ZMTA 2YWBA 3IV9A 4BMSA 2NYAA 3F6EX 4A6EA 3E9RA 1COZA 3IJPA 5LMUB 3OQHA 1X7GA 2GM3A 1J39A 3UT5B 1QH9A 4I55A 4EG4A 4KPYA 2E4AA 4M9XA 3WLMA 2QMQA 1ZNZA 1Z4PX 2A86A 4LZOA 2YC2C 4Q6BA 1QKJA 4AO8A 4D4IA 4C88A 4OGFA 4Z9YA 3T7TA 1R9JA 2GZ3A 4GMXA 3IR5A 4QXOA 4I1PA 4M1KA 1JT2A 3FZQA 3O0DA 1JHMA 3CVJA 2Q0SA 2BMWA 3IUPA 1Y89A 1T6NA 4Q3EA 3X1YA 3J81k 3LKDA 1MR3F 1UOPA 3CH6A 3KPUA 4FEEA 5HM6A 3LTNC 1G6OA 1CUHA 1SBZA 3VNSA 4XIFA 1YA6A 5E6SB 1P7WA 1QYWA 1YI0A 5JCOC 1UBJS 4EI7A 1MAHA 1WV0A 1LFDB 3DDZX 1DOHA 3PWTA 1DIOB 3N6RA 3TQIA 2V03A 2NLOA 4CLEA 4XM2A 1GY8A 3GLTA 4ARCA 1VLHA 2YRWA 1S5PA 4YEDA 3TLMA 2G4CA 2W2LD 4QJIA 4NFYA 4LHZA 2IXFA 1EK5A 2NSHA 2VPXA 3ICVA 3NM4A 5ARDA 2PS0A 5E2IA 1E2KA 5BVHA 3AY0A 2FJ0A 5COAA 3G2NA 3IELA 5EJ9A 2FW7A 3GOHA 4MTLA 5BWMA 3G9UA 5U4QA 3Q7EA 2WYWA 1KZGB 3DMRA 5DHRA 3ROQA 2BCJQ 1WPRA 1Y4DE 3T7IA 3GMIA 1V41E 4JWKA 3I5XA 4CF6A 3EX7C 2AFHB 4PANA 1R5JA 2DXIA 2V6JA 1KQOA 3DW3X 5E4JA 5K8UA 4HQNA 3HUFA 3QXCA 5T6MA 3TI7A 1E61A 1QGZA 1XPJA 2OUKA 4XZ3A 2V98A 5JECA 3NANA 3RVRA 4X64B 4YDSA 1UPXA 3D3JA 3OOHA 1S8NA 4GXRA 5B1SA 1BCSB 2ZJFA 4W5WA 3U26A 2GN0A 5J2UF 2PZMA 3L7DA 1II8A 3LT0A 4MCJA 1NBIA 4BNTA 1DC7A 1VCMA 621PA 4CM8A 3C5HA 4P3NA 4D3FA 3K0CA 4ENSA 4DA0A 1IY9A 3KDSE 4QHYA 2GHRA 3FLEA 3BM5A 4JHLA 4WW0A 3JWPA 1ZX1A 2D7CA 3C3XA 5ALQA 2WT9A 4M88A 1BQ4A 4MUHA 3WLHA 5IJ9A 1DIHA 2NU9B 4C1NA 4A8PA 1EVLA 5JJ5A 2Q27A 3KPWA 4KQ1A 2WMOB 1B16A 3PT5A 4MKXA 4M54A 4CW7A 1T9BA 1VKHA 3KB1A 1J90A 4NY1A 1WWKA 5AW5A 4XWWA 5FPSA 1CJMA 3RO7A 1Z5VA 4B1FA 2IFTA 1DB3A 4C0KA 1G5QA 3AL3A 4MR8B 1WRBA 2EGUA 5A3VA 4B3GA 4AN4A 3TPCA 4CCYB 2NV0A 1JDUA 4LPSA 2XR1A 4PTYA 2XW6A 3D54D 1N2CB 1SUIA 4B09A 1OZHA 4PLHA 4KH0A 1GIAA 2YIDA 5COBA 1LW6E 2C59A 4NEHB 1L4NA 3KYDB 4H4CA 2XE4A 3QIVA 3HJFA 4MUJA 5FBWB 2AFIE 3A9RA 3A4YA 4R2WA 5FWYB 1U3UA 2BR5A 4MUKA 3UWOA 4C06A 3MWEA 2QPTA 1T2FA 2FN4A 5CDSA 3BBPA 5IUJC 5K09A 1I33A 4RU1A 3OT1A 2HHHB 3DVSX 4FXPA 2ASVA 4D9JA 4N54A 2HF2A 3S8MA 1SWVA 4E70A 1CJVC 5I9BA 5KNLA 3AB7A 3H3FA 2QQGA 5FP0A 1X13A 5K0JA 3KLMX 4UNIA 4QSMA 3WQBA 1NBWB 2HK7A 3SYTA 3EGXA 1U6KA 3TD6A 1HLFA 2FRVA 2NM0A 1QTRA 3DSRA 4Y2PA 4EUNA 1XRPA 1OBVA 2QJFA 1KJYA 3NH6A 3WGIA 1STOA 4H7HA 4WLOA 1XK7A 2O8VA 4WADA 5EIWA 4CLOA 4IG9A 4OLJA 5KQPA 4FT2A 2Q7XA 1VXOA 2ID9A 2P6PA 2OV3A 1E8NA 1VIAA 4H59A 4NYMQ 4Y6LA 5AJUA 3UOGA 5HK8A 4A27A 1OX4A 3O3OB 4B3MB 1TFRA 4L6CA 4OA8A 3BXOA 3BICA 5A5GA 3I2JA 1XQYA 5AESA 1YDWA 4C9BA 1PR0A 1Z16A 2IH2A 5FA8A 3TNLA 1RZRD 1NVMB 1KBQA 2GB4A 3D8BA 3TUIC 1V25A 3GB9A 3QELA 2ASEA 4IH4A 3RUAA 3LUDA 2WV7A 1JKJA 4K6MA 4FEYA 4UTRA 2ISSD 2BEWA 4PHHA 4KQ6A 3I0MA 2G71A 4BRSA 3KWFA 2I66A 3B51X 4KLNA 5FO0A 3W78A 1QPBA 3E4CA 4FQ8A 2J67A 1DEKA 3OF5A 5DRYA 1ZM7A 4B6SA 1HRKA 5IMBA 4B4WA 3V4RA 3R23A 4BAUA 4HQFA 1A77A 1JT9A 4U2BA 1A8IA 4R41A 1CY7A 2Z2YA 3A9TA 2J5QA 4XA8A 5CW1A 4EKEA 4PYRA 3RJTA 3RSOA 3P9KA 5AJWA 1Z83A 2I9PA 3HBFA 4BGDA 2G8LA 4B45A 3DEZA 3JS5A 3U4AA 1FNMA 3PJRA 3ICQB 4RD0A 3AIKA 3UGKA 4UOZA 3VX4A 4L74A 1X70A 3KWLA 2XDYA 3GF4A 1D2CA 2JIPA 4FC6A 1RYNA 3GWGA 3FKSA 4TOIA 3ZG6A 4JKOA 1I1HA 2AMVA 3CUKA 4QUDA 5M5BA 1B76A 1NUSA 5E95A 4XWYA 2TMDA 3CUTA 2Y66A 5JAQA 1QIHA 5CPFA 5I9NA 1QQAA 1V3QE 1OB5A 2D2FA 3BQMB 2XITA 2FJPA 3W1WA 1PVDA 2C9YA 3OQMA 5DZSA 1PT8A 3RVQA 1L1QA 3N0TA 3OX2A 3PEWA 3HXOA 3U9LA 3FA2A 1JIUA 5EIAA 2J0QA 2YNMD 4YDRA 1T1EA 2YW2A 5AKJA 5ICMA 3V80A 2PMWB 5IRCD 2XVYA 5FFNA 1HLDA 4MYTA 3ZWBA 1GITA 3CS3A 5I4KA 3PUJA 1E96A 3ZD8A 4RZUA 1DG9A 3QVGB 3CSUA 1ZNYA 4W5JA 1FP1D 1J9EA 3TTTA 2Y2VA 1KH3A 3DOFA 1ADCA 4KKXB 4GRDA 3OETA 1UKVY 4J94A 3T5CA 3U3OA 4AS3A 5K0CA 5A0VA 5IVHA 5CXXA 3AHDA 5HFJA 3KWJA 3VKVA 3CKLA 3D8UA 1G6Q1 4Z9FA 2DUJA 3FPFA 4C4XA 4CDMA 2O1XA 2HMTA 2N47A 3AXSA 3L8EA 1ISGA 1QX3A 3R0XA 4R3UC 4EA6A 1JB1A 3DA8A 4HO1X 4BBZA 1FBNA 1MH1A 2XYGA 5LZ8A 4BL5A 2V59A 4LEIA 2F7SA 5DGDA 2MSNA 2GUGA 2PSJA 5IFKA 2XCLA 4PXSA 4FS8A 4ZHQA 4QDZA 5DMXA 1F8UA 1C0KA 3BQNB 1KGDA 1RQGA 3DVQX 2IUEA 4NV1A 2VATA 5DBEX 5ALNA 5ER6A 5GVRA 3T5AA 3RREA 4MS4A 2W0SA 4EJFA 2ZROA 4QTTB 3EPPA 4RZXA 1LDMA 2QYHA 4UJ5A 2EGGA 4XXHA 2W2QA 3B36A 1TA9A 1KK3A 1XQ9A 3FLMA 2NUAB 3DEFA 2X3UA 5L3QA 3BMNB 3L6OO 2BN4A 1QE3A 2Y3IA 4DR2B 1L3BA 4BRZA 4DANA 2VRCA 4TT3A 4ZYZA 3H42B 4X20B 3BWVA 2P1RA 1MCZA 3PR1A 5JFTA 2ZUWA 3ZD9A 3QTBA 4GKVA 3DZBA 3MPUA 1MORA 1V3VA 3REGA 4RS4A 4MYSA 4WZBA 5ICCA 3H2YA 3BHIA 4P98A 5ALSA 1YNSA 4DDMA 4DHEA 3T0IA 4IDAA 3LPAA 4HGPA 4W8OA 2XSZA 1GJRA 4ZI7B 1U0BB 1YB2A 1NXTA 1DJMA 4CU5A 2Q1WA 1XLUA 1OMOA 3AR9A 2DH6A 2XB4A 1GTVA 2GEDA 3KO8A 5ICFA 3BMQB 4K8OA 1TZ2A 4LQ4A 4Q15A 3IJRA 5TC4A 1O5IA 2VLIA 2VP4A 1IIRA 4S35A 2DG2A 2R6DA 4KQ9A 2EJWA 2CLKB 2OSBA 3QVWA 2CFOA 1H0KA 2RHJA 3PWZA 2G4VA 3BCRA 1GDDA 2BTOA 3DT9A 3SLGA 3HB0A 2O2EA 3JAMA 1UP7A 4ZQHA 1CY6A 1CQZA 1URPA 1HSZA 2AXPA 1NI3A 2VDKB 1X1EA 5I9MA 3WHLA 1HG1A 1NYRA 4XIJA 4DTIA 1C9EA 1Z38A 1JG1A 3NEAA 2DLCX 1Y1KE 1PL0A 1PR5A 2C5FA 2AOUA 2OESA 4M7PA 5CAEB 1UEXC 1V71A 3TRJA 5I3CA 3OFNA 2BH9A 4EF6A 1S0UA 2H4HA 4C7KA 2NADA 2W8BA 5T4HA 4DV2B 2JGAA 1ZNWA 2Q99A 1PQPA 1RI3A 3IR6A 5DX1A 2J6BA 4K3VA 5EYPA 5FF9A 2EZTA 4B7CA 3ETEA 1BRMA 2A1UA 4PNZA 4OFWA 4BP3A 2A0XA 4M0KA 2X42A 1OI3A 3PUIA 3F67A 4G0ZA 3IOYA 3KL2A 1FEZA 5T4EA 4BLQA 5A5EA 3RF7A 4WIAA 1ENYA 2XOEA 3ZBTA 4MV6A 1UWKA 3DQQA 2Z56A 3R7WB 2QTHA 5K3OA 2VQ3A 1GQ2A 2Y4OA 4WLUA 2QTVB 4U7DA 3CVXA 1NW8A 1R16A 4DCVA 2AMYA 1VL6A 1U2SA 3NONA 4NWIA 1E0DA 1T3SA 3HRHA 3HPRA 1PR9A 2BEUB 3GRRA 4J0QA 3BTUA 4G1BA 1Y6JA 2P2SA 4FYWA 4CM7A 4GZ6A 3OKFA 1JQLB 2ES4A 2F3UA 1OBHA 3NBKA 3FIJA 4OYRA 4CQJA 2HMVA 1FTGA 1Y3AA 4OXQA 1BJKA 2G1UA 2OBLA 1GEGA 2OBYA 5A7HA 2YZ2A 4CN9A 4M0CA 3SNHA 4D8XA 4KR3A 2Q6VA 3EW9A 2H4YA 5GZ3A 2XMPA 1FY2A 3KKEA 3OTWA 1QB8A 4AJKA 4CU2A 1WDMA 2OO7A 2DEUA 3ICPA 3WMEA 4X7RA 2XTNA 3LC0A 1H5UA 3BRQA 3JRWA 3Q1KA 3QFTA 3L4SO 5DM2A 2UYHA 5B3AA 4YJFB 3VV2A 1YWGO 3K9BA 4MGEA 4QUAA 2NMVA 4X61A 3A1FA 4R5MA 2QZSA 2RHHA 2Q5EA 3KR0A 4I4NA 3SU8A 3UUFA 4W1PA 5FBVB 5I3ZA 1C0LA 5AI8A 2XCUA 1W85A 4LHXA 2QRVB 4P4UA 2ZXEA 3X2FA 4Z7QB 3K2IA 5BURA 5J47A 1JQJC 3BH0A 3CT4A 1LRJA 3VR6A 1CJUC 2J5XA 2C00A 1ZR2A 2BKEA 1N75A 4DDVA 2PRJA 2YKGA 5LFAA 4J1NA 1DC3A 3F6CA 5FNVB 1RRGA 3WGLA 1JYFA 4LAFA 1LSOA 3O4HA 2WD7A 1Q7BA 3VH4A 1V3TA 2M98A 3RC1A 2XE6A 4EDHA 5DCYA 1E5TA 2O3UA 3JALA 2WUFA 1LV7A 2CJXA 4R8MA 4DLTA 5B37A 4PZ9A 3PYMA 3VNVA 1ODSA 5LQRA 1SWWA 2VDLB 1R66A 3VR4H 4XPIA 4UXIA 4DFDA 1X80B 4OQNA 5D7NA 3RE1A 2ZRIA 2EYQA 2ECOA 3OBBA 5TY0A 5IZCC 3GV0A 3N8GA 2ID7A 3HB1A 3O8NA 4AKGA 3NDRA 1GGEA 4RHTA 4Y1FA 4YNBA 1JXQA 2GTHA 4MWDA 2D1YA 3UBTA 2NSYA 1PTJC 1PHRA 3AI1A 5ALVA 1MZVA 1ODTC 1RLMA 4G0OA 1U2PA 3ZQUA 3EEQA 3CQ9A 4Y98A 1LLQA 3OZCA 1U9IA 3CTPA 3TLZA 1L5ZA 1NN3A 1GGJA 1A4XA 2VHTA 3WLOA 4WNIA 3DBLB 4CM5A 3LFTA 4N7MA 5EXEA 3GNLA 4HWOA 1C3EA 3MJSA 3PE4A 1X7YB 5LQMA 5H4HA 1T9KA 3ZK9A 4RTQA 1ZHFA 1F51E 2HAEA 1B6SA 1XJQA 4S12A 5JZOA 3P2JA 1YACA 4KO1S 1Z4OA 3OT5A 1M7HA 3CLUD 4XWTA 1P2SA 2PGIA 4U0KA 1ZRMA 2DY1A 2BGMA 1K8XB 3COVA 2PNJA 4CM1A 2UUAB 6YASA 1DS6A 1N8SA 1XVTA 4MWBA 3WAKA 3V4ZA 3BE5A 3V7NA 4ESVA 4AIRA 1GCIA 4AG3A 4WHMA 3LF1A 4S24A 1JMYA 3B78A 2X2OA 1RS0A 3H83A 3M5WA 3KSAC 2Z3VA 1B0ZA 4LRSB 5ALGA 5GONA 5DHAA 4OLAA 4P3KA 5JCOA 3ILYA 4WUVA 1I4WA 5JH7A 1LI5A 2GMWA 4JIMA 4P92A 1JEOA 2BFNA 1WF6A 3MWJA 3OWXA 1A8PA 2OG2A 2XDQB 5I7EA 1WKBA 5KNDH 4NBRA 4NZMA 2DFTA 1OGIA 4O4JF 4YJ2A 3REQA 2G7MC 2TMYA 2WOJA 1XYGA 1AY0A 1EA5A 2FMHA 4HEJA 2D5AA 4Q02A 4P8RA 1HNZB 2DFVA 4NOJA 5CLHA 3F2VA 4BDSA 4DCTA 1E8MA 4BE9A 5IJ0B 3GFTA 3LFUA 4KEAA 1DE0A 3D3WB 3WNZA 2QIPA 4KFRA 2QUBA 4OQYA 3WO1A 3QX3A 1E4EB 1H2BA 1L6RA 4IHJF 3VH2A 1XRMA 4KQCA 1K1EA 1E94E 1L7AA 2IP1A 3LAWA 1X1QA 1KFJB 4H3KB 2YZGA 1AOXA 2O06A 4ITRC 3BHJA 2OHOA 3TLAA 5CA0A 2OPBA 1NRWA 4L27A 3WTBA 1Y6ZA 3AIIA 3IMKA 4BQQA 1F5NA 2LKCA 1YU9A 3FDZB 3MSCA 3ELDA 1II0A 2L0XA 4JBHA 2H92A 1OJLA 3F7NA 4JJ8A 3CB2A 3KU1A 2VZ0A 2P0AA 3H87A 4OOFA 4XSGA 3VHLB 1O08A 4QYXA 5FPYA 4V1CB 1W36C 2J4CA 1ADJA 4ALIA 1KE1A 4PGFA 2DM6A 5LOVA 1VJ0A 2FR1A 1B8UA 2GFIA 2H1HA 3NV7A 5E7QA 5JAUA 3FKSD 1AN9A 3ICWA 1BJTA 3E53A 1C4XA 2PYIA 1N6NA 3T7RA 5LXTF 4D2IA 2WSLA 2I22A 4HWPA 2DBYA 2GPSA 1ZEJA 2VDVE 1OJ7A 4K9RA 4JX9A 1XZNA 2EXXA 3PFIA 3C3PA 1KZ1A 4BP1A 3K96A 5DASA 3CVOA 1PP4A 4R9VA 4BWFB 4YAKA 2DUUA 2OK7A 3SQLA 1V9SA 4HUTA 1BG6A 1C9JA 3BORA 3TRIA 2BOVA 1VLZA 3TBFA 4C14A 1E6MA 4O4HB 3AKCA 1AF7A 4EP1A 4AJIA 3V48A 2AW5A 1FYFA 1NFQA 1U2ZA 3UATA 4RF4A 3F49S 4II3A 1KSJA 5G3YA 1SN7A 3V4FA 4M8IA 1ZXBA 2Q5FA 4PX5A 5KTKA 4X94A 2BELA 5EUMA 4YONB 4W1RA 4L3VA 1OHHA 1FFXB 1JIKA 2D2XA 4G3XA 3WICA 1BXGB 4BGIA 1LC3A 1GL6A 1R6BX 3DP9A 2D13A 4HL6A 5EIFA 4E5MA 3NC1C 1I94B 1G3RA 4CR7A 1YCFA 4JFAA 5AUNB 4ZYTA 4URYR 1S3SA 1KWGA 2JGFA 4CQNA 1EFTA 3BFPA 2RGWA 3MINB 1YUMA 1QYVA 1RADA 3IHWA 3PP8A 3R9WA 2IOYA 2P30A 3LQQA 4JJFA 4V24A 1LVUA 3K1YA 4Z86A 5L4NA 1Z3IX 4YWHA 3BWYA 4Z7NB 4Z4EA 4WZBE 1AA9A 2HJRA 5K8TA 4UVDA 2AUNA 1YS1X 1M1NA 2PZEA 5CT8A 4AMGA 4N5HX 4EUEA 2FPPB 2PRZA 4RJTA 5JATA 2GZHA 4OKSA 3H2GA 4DDWA 3ZH9B 1TMKA 4NDAA 4LFAB 2J87A 5KU7A 1SB9A 3UT6A 4EY6A 3HUTA 4YUAA 2CJWA 3EWAA 5JDIA 5TQ2B 1PV2A 3MK31 1C4KA 1T4MA 3A70A 3HV2A 2NSLA 4FX2A 4LISA 1O95A 4HDKB 2WA2A 4WD3A 1PJCA 1USVA 2J46A 1H0RA 3QU5A 3VU9A 5K8VA 4OGLA 3CG0A 3DEIA 3FB1A 4IFTA 4J6FA 4KREA 1SQ0A 2P79A 2Q9AA 4LE0A 4YQEA 2VRCD 4TT3D 3JQQA 4UVEA 5F1PA 4UM8B 3ZGYA 2P8SA 5TEWA 1PWXA 3B60A 2QM0A 4F5YA 4PG4A 1RCFA 2I2AA 3I1IA 4R8LA 4C01A 1L5YA 2D5CA 3LVBA 4NYIR 5T41A 5A03A 3NV9A 2E5LB 4BMPB 1J99A 1WSBA 4UEKA 3A9VA 3K72B 1Q3TA 4HFJA 2JLXA 5A9SA 3PIIA 4D9FA 1DUSA 2BFCB 1QV6A 4GPBA 4DM3A 2DHRA 1L4FA 3A6HA 3R6WA 1RE0A 2XSZD 3Q87B 3QU9A 4MLZA 3T95A 4BBAA 1C80A 4A2CA 2OXFA 1LNZA 1SQGA 1CG6A 3KBOA 2A5FA 3KUXA 3N2GB 4G5HA 4K87A 4RVDA 1PX2A 3WS7A 3WL6A 1AA6A 2PX6A 4I3GA 4DJAA 1GA6A 2NXWA 2W6IA 4BUZA 2WA1A 3DQPA 1UOEA 3I2KA 3KP1A 1FNNA 1RMTA 3NTVA 5HBRA 5K3CA 5FDFA 4DV7B 3IXLA 1E5LA 2HREA 1YAHA 2H4FA 1H2FA 1JVNA 3WNVA 5BYKA 1XWIA 4Y2XA 2ODQA 2O48X 4KODA 1CX9B 2Q5OA 1N7HA 4WMLA 1JH9A 5ARCA 3DTVA 4UBMA 1W48A 2P4QA 2AF3C 1DG1G 2OVBA 4WXEA 1GRNA 3B5IA 1QNLA 3C3DA 1GSHA 2BM0A 4M0DA 4RQUA 4XYMA 3OFND 4IQ8A 3UG6A 2X4DA 1AMOA 3IKJA 2APJA 1DBSA 3ZJYA 4C4RA 4NECA 4UKDA 1PR6A 3QA3E 4O63O 1JI3A 2XWQA 4XVHA 2OHGA 4KE8A 1WZEA 2I7VA 5EE5B 4ZD6A 3VFDA 4DLRA 1P2DA 5E8RA 4BYMA 1EFPB 3DZGA 4MO2A 3DAYA 1P7VA 3R40A 1EJ0A 1E5DA 1IPFA 2YHIB 3QNUA 4GPTA 4OD0A 5ECGC 4ALJA 1S2IA 2QN3A 1ESNA 4C3ZA 4K9OA 4YV2A 2JPDA 3KSDO 1QC5B 5ITVA 1JSCA 3MBKA 2CNWA 2G28A 4QQKA 5EWJB 3H2BA 4B3BA 2FN9A 3PLRA 4D3DA 1RP1A 2VPQA 4BNXA 4LQDA 4JLSA 4PC6A 1ONBA 4QOHA 2GKOA 3QYJA 4HAWA 2C4UA 2QGZA 4V39A 2R6R1 4L57A 1SBYA 1JWBB 5FR2A 4LTMA 3HZHA 2PMFA 5K0FA 5D7BA 2B2CA 2ZIXA 3EGOA 1IWPB 1RRPA 3ZHCA 4B7UA 1GTMA 1TQHA 3ADBA 2JJ2A 1F1BA 1XHLA 1CHNA 3HB7A 5JUWA 1NGSA 1KP3A 2VJMB 5L3VA 1VYUA 2V55B 1YS2X 3P71T 4PYKA 4IYJA 4KSCA 5EKSA 2WWYA 1D7AA 1ZRNA 1RR6A 1QBKC 3IP5A 4BO2A 3NHFA 1QG0A 2VAMA 2NZYA 5FI1B 1GPKA 3D4OA 4CKYA 4FI3F 4YQFA 5KNCH 2C2WA 2X8JA 3AJAA 3BIFA 4E3ZA 2DPYA 3H2SA 1VG0B 2KWIA 1ECJA 1Y8CA 2UXDB 1UMBB 3OH8A 3O92A 4KOEC 1FFDA 4QTYA 3DM5A 4W5TA 3GDGA 1NUTA 1XPOA 2GLUA 2W6MA 3FPAA 3OZWA 2NVWA 2OZPA 3CEJA 4JR1A 1CZNA 4LF6B 1P19A 3G8DA 4QXRA 3CF4A 3GZNA 3IAAA 3LQFA 1SELA 3LO5A 2V6MA 4IMJB 1UKCA 4U1RA 2O8NA 2HU7A 3PQ2A 4XUDA 5LQSA 4MAAA 1GO2A 3DM9B 5I7RA 4RACA 1ORRA 2X58A 4GEGA 3VBCA 3VR6D 3U81A 2ZIFA 1J06A 1GSAA 4MMZB 4PTZA 3X1XA 4BLSA 1RP7A 4X92A 4D41A 2OORC 1JEJA 4XDZA 5DB4A 3KKQA 1PJ4A 4DQVA 2O8CA 1FXWF 4P80A 5JNWA 4FMCF 2JK1A 4DIDA 3W6OA 2KJQA 1Y3IA 2QN2A 4X63A 3C3KA 2ARKA 2FYTA 5CLJA 4KLAA 2JHAA 2EARA 5JZMA 4DXDA 4UM7A 4DWWA 3GLUA 1XP5A 2VDJA 2WW8A 4AL4A 2HYIC 1JLLA 4Q37A 1FJHA 5KDLA 2ODPA 4BASA 4TTJA 4FSHA 4ZAVA 3L9WA 4YO7A 5AVVA 1G60A 1HE3A 1I6KA 4R1PA 1ZKMA 1Z2CA 2R4QA 3PCTA 5GV8A 2HNKA 3P0EA 1WB5A 1EE2A 1SOAA 4YP0A 5E6UB 1ULSA 3CRW1 3HU3A 5BV8A 1Z29A 3JYPA 3QX8A 1JDBC 2HUNA 1YRBA 1E2MA 5TXGA 1F0NA 4CT4B 3NHLA 3W5DA 1RZVA 1FLVA 4ND8B 3TW6A 5AW9A 4R1NA 2ADFA 3W8RA 3UGJA 1GZ3A 4IXDA 3ZV5A 3MT9A 2JKVA 4QUEA 1I1NA 1XUOA 4A2PA 3THYB 1Z06A 3PRJA 3R0IA 4N7BA 3QSGA 4MCIA 3FMFA 1FOEB 1DQRA 2DTDA 3PQ4A 4IGEA 4B47A 4Y1RA 4PR3A 1AT1A 1H4VB 5JLJA 4KNYA 1V7QA 3PX2A 1Y4UA 1BWPA 5GZ6A 3CLSD 4JLJA 4KQIA 4TMXA 1FRZA 1TIPA 3FCCA 2EYUA 5MFZA 1J0BA 3JQEA 4I08A 4KXMA 2WKSA 4UOQA 1B42A 4GF5A 2VH5R 2ZWMA 3SEFA 3JQFC 2CUNA 1FJGB 4AZSA 1EZ1A 2D5BA 4MLPA 4Q4HA 5FWDA 4FFDA 4JLUA 4EW3A 4ZGBA 3VKHA 2ZM6B 5KBYA 3SXJA 3KZKA 2ZRKA 5FUXA 2C2KA 2B4TO 3V1LA 2YQ4A 4ENVA 6LDHA 1Z5WA 1T91A 2H4JA 5AVOA 1E7MA 1PV1A 1YVUA 4PAQA 1KOJA 2HZ7A 2QMEA 2XGMA 2XNKA 2AQHA 1CZRA 1N6HA 2VN8A 4I4LA 4P4LA 4U8GA 4JYMA 3WGJA 4LOHA 5EHIA 4BVGA 4ZOLB 4UU0A 3GP3A 1A8SA 3B1YA 1RZUA 5JD5A 4CVNA 1NV8A 1NW3A 2HMUA 4RV9A 3U48A 1K6EA 4D74A 3C6MA 1EI9A 5ENZA 1F2TA 3Q3IA 4Y6SA 3TH5A 1A7AA 1TTHA 3LKVA 5KOHA 2CMHA 2FHPA 2HQBA 3EZGA 2JAOA 1RWQA 3DBRB 5ALRA 5GPBA 1XTSA 5ENVA 3WNDA 1E6KA 1PX0A 3O1LA 4GKBA 5A0TA 2DGDA 3LOPA 5C4GB 2P2ZA 2BRUC 3WK7A 3AYXB 1IOLA 2LGJA 1PZFA 4JJIA 3WY9A 2PXXA 1YRYE 2HMWA 4FDMA 4RDIA 2OG1A 4I8DA 4Y9SA 4TXNA 4D0LB 3PBKA 5KWSA 1KP2A 4OV6B 1CY8A 3G89A 3WLPA 1COWA 2CLMB 3KQPA 2ZTUA 2ZBVA 3TOVA 1D1SA 3BWCA 1CVRA 4Q3KA 3ZQKA 1G5FA 4RTMA 4D3YA 2R6JA 1D6MA 2Q1SA 3AMVA 3FGOA 4ZOAA 3ZLJA 4LJRA 1VL0A 3ZHTA 4ZT2A 2WU8A 1R0YA 4OY3A 5BN3B 5JNRA 5KS2A 2RGDA 1PR4A 2GN4A 4URHA 2OWEA 4TM8A 1P39A 1Y3BE 2Y71A 3H3JA 2R79A 3IKVA 1Y3FE 4XLLA 4E0BA 3PXAA 2HA4A 4NOMA 4DNQA 1KRHA 4PX9A 4G1FA 3A1VA 3AM3A 3ANYB 1UC5B 4MV1A 2IZ5A 3T4UA 3E3OA 3OIUA 4TQGA 1ADYA 1IQRA 2J1LA 2OZLA 4UU8A 4O33A 4W9NA 2ENUA 4XQEA 2FNAA 4YJGB 5CA1B 1Z7BA 2DUMA 4H16A 5DYWA 1R4NB 1XT6A 2YFYA 3B89A 4RPHA 3W4JA 3L7YA 4UVIA 1RWWA 2YW9A 4PG8A 1THGA 5DE3A 4I81A 2YJ6A 2IDKA 4Y7DA 1A96A 2Q8QA 1PL7A 3OX3A 4KFSA 5IXJA 3GLHE 4C3UA 1LTHR 4DBZA 5TIIA 1DTSA 1VCHA 1WCIA 3OA0A 4BO7A 4JJ4A 1GNSA 1N6KA 4R1OA 1UWCA 2DPMA 3N07A 4BQSA 3I5YA 1O0BA 2I1WA 1R0SA 3PEUA 3FSJX 5CW2A 4BQEA 1LEHA 4XYGA 5LVAA 3M6LA 4KPGA 4ASUD 1XXHA 3ZNOA 3A1CA 3JVEA 5CFMA 3G88A 2H2HA 5DW3A 3ROXA 2C82A 2B7BA 1BWQA 4MIOA 4MV5A 2FF5A 5FUQA 1Z5GA 3LX6A 1BU5A 3AGPA 4QFBA 2AC4A 4NIMA 3FUVA 3WGKA 4W9MC 1NLFA 7REQA 1YB5A 1NLZA 3DL2A 4KUGA 3B6ZA 3PENA 1J7KA 4DTCA 3THXA 1O95D 2J45A 2FW8A 3OG9A 3GLIE 3D4IA 4KAJA 2JW5A 2OC4A 4L4ZA 4I6GA 3GDFA 1VKJA 4JI3B 4PXAA 3WLEA 3WQHA 4NDNE 2ZJ0A 4EPWA 3BPSA 2XWJI 2M32A 4B40A 1CUBA 2DFDA 3WSVA 5HZMA 1YAJA 3FHOA 2JI8A 1I14A 3L77A 1OLSB 1YKSA 3JRXA 2J3HA 3LFHA 4YIKA 2PZ8A 5L40A 3D3KA 2PX3A 2HX1A 4C5CA 2I1VB 5BN5B 5CLIA 4Q4JA 3L7NA 2I3BA 3NTQA 1MC5A 4O4IF 2GH1A 2J9FA 3L0CA 2R4TA 1EP9A 4TVOA 1MABB 2HLDA 3C5VA 1A8QA 5CT5A 5K3FA 4AKHA 1HYBA 3WSWA 4W7IA 2FEMA 1TVKA 3UXMA 3HKDA 1O7JA 4WFJA 4F4IA 1C4WA 5EAIA 1NXWA 1R6VA 2O6HA 1FU7A 1U5AA 2OOKA 4AX8A 3KFXA 2II6A 1EEXB 4PIMA 2W6ID 2WHYA 1W8DA 1QAOA 1RYHA 1VM6A 1M5UA 5BSHA 3N87A 3RC2A 4CG2A 2IS4A 4BO0A 2FEOA 4ZEWA 3FDXA 2BSQA 1FRQA 3E23A 4ZT4A 3UICA 2WY2D 1W36D 3CT6A 3KXPA 1JU4A 1PJQA 3DTVD 3P1JA 1FS5A 1K89A 1I36A 4F93B 1CUGA 1OYWA 6ABPA 4I3FA 4E4YA 4HXEB 4IW3B 1TX4B 4WDRA 3WMXA 1KYXA 3PZRA 3RGGA 4CUJA 3FOAA 4L16A 4G4IA 4U5QA 2WZCA 1TO6A 1WCWA 1XA3A 2OB2A 3RS9A 3H13A 1RAFA 1SPBS 1M2VB 2SBTA 2VI5A 4WZ6A 4NAHA 4E31A 5HPYB 4DIMA 4JI8B 1VSTA 2QIOA 2A1TS 3EXFB 3KV3O 4RJLA 4X6XA 1BA2A 3K1JA 4UDYX 3SYNA 3KJXA 5T7BA 1P0IA 2J0UB 1PW7A 4DC1A 1RWXA 3AFOA 3AXTA 4EI8A 3AB3A 2WZDA 1MEOA 4RA9A 4JVOA 3BXGA 1F8XA 3P2KA 3Q5DA 2H06A 3AONB 2CNWD 1PGQA 1DQZA 5FUWA 1RRFA 2IIVA 3QI7A 3A1EA 1VG1A 2OCKA 3OFJA 5F4ZA 1YSCA 3IVRA 3S2SA 4UAJA 3BCUA 5J2UB 5KSPA 4F8JA 2C4WA 3PPWA 1EFAA 3PDIB 1P4HA 1T2AA 3TZ6A 3DDCA 4KYVA 4M9RA 3P9ZA 2YXBA 5I7OA 2NAFA 1JALA 3T9BA 3FOFC 1NVTA 2O7SA 3C5CA 2W6JD 4KDCA 1BDBA 3ZKWB 2ZQZA 5HZGA 1W5FA 3QXXA 3ERCA 5EZYA 1DXHA 4XRRA 4P32A 2YVLA 1EQ2A 1IHUA 1GQQA 1RRMA 1ULUA 3K16A 2J6CA 5KTSA 1RJFA 4CLDA 1M3SA 1VI5A 1DKRA 4J4TA 4Q1BA 1N3LA 2Q2WA 2W00A 3GYGA 5AJHA 4E88A 3WYCA 2M6KA 4TZTA 2WVGA 3T12A 2GCPA 3AJEA 13PKA 1EE9A 1P0MA 1U8TA 3NASA 4Z49A 2FW6A 3MA0A 1C3XA 4UEQA 5KQGA 3U7HB 2EX0A 1TT5B 2DLDA 2VF5X 1I5EA 5AVJA 3RVOA 2IU3A 4EQ6B 1LPBB 4M9ZA 2X7XA 2G9ZA 2J9YB 4L73A 5DX8A 2AKAB 5EKTA 5ICGA 3UHPA 1I6LA 4EOGA 3SX2A 4B84A 1L7RA 1UZAA 4JJGA 2HWKA 3T3HA 1E77A 1SC4A 3AEYA 3MWDA 3PQCA 1JHAA 2FUNB 2V0GA 2AXQA 2B0CA 3N8NA 3MRVA 4MJ3A 1AHIA 2F1OA 4RWZA 5AH0A 4ZVVA 2Q3LA 5BNFA 3TCNA 5BSUA 1SHJA 1Z2AA 1SBHA 4LQLA 3KZVA 3FZEA 1P6QA 4YGYA 3GLGB 3NJ4A 2PTHA 4RIEA 4X91A 3OKCA 3W9UA 1O2DA 1E3WB 2CUZA 5IC5A 3EXHC 5I47A 2Z2IA 1EXVA 1IOZA 4RZQA 4E5NA 1P61B 1JBEA 1JV2B 2PMKA 1KI9A 3BZUA 3JATB 4M55A 4N76A 1IXZA 2HJVA 4QLBA 2QUJA 3FJOA 3IQGX 2ZI9A 1OT5A 1EX6A 1SG6A 4JD5A 4OXXA 5BRNA 1T3HA 3P32A 3TIVA 1BE0A 2I99A 4PQGA 3ZZTA 1KVTA 3ZD6A 1YB4A 1XCBA 2CXPA 3TRFA 3HL0A 1SC6A 5CYGA 1V6AA 2JFXA 1CIJA 5DU2A 5JVDB 5KYYA 4JBXA 2AWNA 3OOJA 3PGVA 1BDJA 1YQGA 1NF2A 1DQPA 3D43A 4P4SA 3D4LA 3UJ8A 3SQMA 3LU1A 1HKUA 1XRQA 3B48A 4MLDA 4Q3AA 1DARA 4ZCQA 4AXBA 4PN7A 5JQGA 4HEA6 3DE1X 2V7XA 4UTOA 4Y18A 8GPBA 3ISVA 2O50A 1NQVA 1L4UA 4AROA 2EU8A 2PS9A 2C2MA 3FPLA 3UV6A 3E81A 3NP9A 3TOCA 1EHYA 4DWOA 1G5PA 1E3QA