1QYIA

X-ray structure of q8nw41 northeast structural genomics consortium target zr25.
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
380
structure length
380
Chain Sequence
b'MKKILFDVDGVFLSEERCFDVSALTVYELLMDKCYLGLHSHIDWETLTDNDIQDIRNRIFQKDKILNKLKSLGLNSNWDMLFIVFSIHLIDILKKLSHDEIEAFMYQDEPVELKLQNISTNLADCFNLNEQLPLQFLDNVKVGKNNIYAALEEFATTELHVSDATLFSLKGALWTLAQEVYQEWYLGSKLYEDVEKKIARTTFKTGYIYQEIILRPVDEVKVLLNDLKGAGFELGIATGRPYTETVVPFENLGLLPYFEADFIATASDVLEAENMYPQARPLGKPNPFSYIAALYGNNRDKYESYINKQDNIVNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLKGKDAAGELEAHHADYVINHLGELRGVLDNLLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
molecule tags Structural genomics, unknown function
source organism Staphylococcus aureus subsp. aureus
publication title X-RAY STRUCTURE OF Q8NW41 NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET ZR25.
rcsb
total genus 126
structure length 380
sequence length 380
ec nomenclature
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1qyiA01
4C4TA 2G09A 4RESA 1S8OA 4Y2QA 5AVSA 1RLOA 3OCYA 2JGAA 3ZU6A 2WF8A 3QU9A 5A3RA 4YCNA 4NABA 5IS2A 5ALLA 5ALYA 2HOQA 2EARA 3A1DA 3QU7A 2AMYA 3A1EA 3SHQA 4I9GA 3QU5A 3I6BA 4YCLA 5ALPA 1Z4OA 1MH9A 2QLTA 2IOFK 3F9RA 5AVQA 1YJ5A 1TE2A 4NV0A 3B9BA 3B8EA 2R8ZA 2CFSA 4XE5A 3KZXA 1XPJA 3ZW7A 2HX1A 2ZBGA 4UM7A 3CNHA 4XQ0A 2FUCA 4DW8A 4YH1A 3NANA 3ESQA 2G07A 3MC1A 5ALNA 1VJRA 2OM6A 3R9KA 5AW1A 5AVXA 5AW2A 4Y2RA 2W11A 3FPSA 1O08A 1U02A 1ZJJA 2FUEA 3IB6A 4Y2XA 2HEGA 5AI0A 5ALTA 3N1UA 1SWWA 2G80A 2WM8A 1FEZA 3WK6A 2FEAA 3KBBA 4EENA 1X42A 4KN8A 5ALZA 3OCZA 2HF7A 4IFTA 1O03A 3EF1A 4FFDA 4YIKA 1ZS9A 1L8OA 3M9LA 5ALWA 4BEVA 1Q92A 3QUCA 1RC8A 2I7DA 2ZOSA 2BDUA 3SKXA 2NO5A 3L0YA 5AW4A 2B1RA 4CF4A 4AS3A 1Z4JA 4KX3A 3OCWA 5AVVA 5AVZA 2O2XA 4EELA 2AH5A 3N8GA 1RKQA 4J2TA 3E8MA 1NNLA 3AR8A 3ZVMA 3M1YA 3NRJA 3FPBA 2FPRA 3L8GA 5ALHA 4I9FA 2CFTA 2EATA 5FP0A 5AKHA 4BNDA 5ALXA 3MPOA 3VAYA 2YY6A 3QU2A 2DQSA 1RLTA 4KNVA 4MUMA 5ALDA 3GYGA 4JB3A 1Z4NA 2ZBDA 5AK5A 2WF7A 5AW0A 5AI6A 2GHQA 2Q5EA 1QQ5A 1VJ5A 5AKIA 5ALSA 5A3SA 4FE3A 2C8LA 4UMFA 3EF0A 4XPZA 1Z4MA 3ZTWA 3U7HB 1WR8A 3QNMA 3S6JA 1EK2A 2NO4A 1EK1A 1QYIA 4OCZA 1YNSA 3WGVA 3AR4A 2YMQA 4CF3A 4UM5A 2GHTA 1K1EA 2D2VA 2RARA 3AR3A 2BY4A 5IT4A 5T41A 3UMGA 1TJ5A 2MSNA 5ALRA 4J03A 3QX7A 3KOOA 4OFZA 3AR5A 2HCFA 4G63A 1LVHA 3E84A 5AI8A 4DWOA 2O9JA 5JJBA 5AW3A 4NAVA 3DNPA 2HI0A 1PW5A 3ESRA 4QQFA 2IOHA 2YN4A 3ONNA 3I76A 3TLMA 3L8HA 2ZXEA 4UMVA 4UMDA 2RB5A 1YV9A 1QQ6A 3ET5A 2R8XA 5AIAA 2JAOA 5ALOA 3NAMA 3WK5A 2GFHA 5AI9A 1AQ6A 5AK6A 5ALVA 3L8EA 3N07A 1N8NA 2B8JA 3J7TA 2YJ5A 2I6XA 1XVIA 4YGYA 5AK3A 2IOFA 2P11A 2OYCA 5AK4A 3NASA 5AVTA 3L1VA 3ZX5A 3OCVA 2YJ6A 3A3YA 1Z4KA 3D6JA 4Y3UA 1RDFA 3P96A 5E0OA 2WHEA 4EX6A 2JAUA 4ZEWA 3QUBA 2P69A 4L6CA 4EZEA 3WKAA 4BX3A 4C4SA 4Y2PA 4GXTA 2R8YA 4HGQA 1JUDA 4JDPA 2B1QA 3QUTA 2JAWA 5AKYA 3UMBA 1WPGA 4IG4A 2G06A 4UW9A 3UM9A 1NF2A 4HAIA 5AW7A 4AS2A 4BBJA 2HSZA 1T9ZA 5AM5A 4EX7A 3W5CA 3U19A 4HGOA 1J8DA 3SKYA 4B6JA 4BX0A 2C9MA 4UATA 4DFDA 5ALGA 2WFAA 3L8FA 4MWOA 2HHLA 1ZD2P 3NIWA 3RF6A 5AM2A 4KYTA 4EEKA 3WK4A 3HYCA 5AW9A 5ALJA 3U13A 2FPWA 3FZQA 3U7FB 3AR2A 3AR6A 3E58A 4BKMA 3QGMA 1F5SA 2I54A 3K1ZA 1RQNA 4UAVA 4ZEVA 2YFYA 2VKQA 2GMWA 3U7EB 4CNQA 4YCMA 2HO4A 3OCXA 4OHFA 4GIBA 4Y2SA 1QH9A 1RQLA 3OCUA 3HLTA 3WKBA 1Z4IA 3ZX4A 4DCCA 2AUTA 1U2TA 3WKEA 2YMPA 4O8CA 2YJ3A 3FVVA 2YBDA 3W5AA 2P9JA 3IJ5A 1ZRNA 4AP9A 2CN1A 3ED5A 5ALKA 3EPRA 4HGPA 1CR6A 1RLMA 1ZOLA 1L7MA 5AESA 2EAUA 2AGVA 3SMVA 1ZD4A 3PGLA 2B0CA 1T5TA 5AIBA 2FDRA 4L6AA 1IWOA 1RMYA 4FYPA 5AVRA 2R8EA 3QLEA 5IT0A 1YMQA 3WKDA 3OPXA 5AVWA 1NRWA 4UMEA 3QXGA 1RMTA 1RPZA 1L7PA 3WKCA 2YMLA 3QU4A 3W5BA 2OA0A 4UARA 5AW8A 1Z4QA 3I28A 1Z5GA 1TA0A 3ZVLA 4UU0A 2C8KA 1WVIA 3BA6A 1J97A 3E81A 5AKEA 4BNDB 2B82A 5AI5A 5ALQA 1U7OA 3ZUPA 4Y2TA 5AM3A 3SLRA 2G08A 3CZ4A 3U26A 2PQ0A 3QUQA 2ZBEA 3ZI4A 2ZBFA 2WF5A 1L6RA 5AHXA 3UMCA 2Q4RA 3N5KA 5AKGA 2YJ4A 2B30A 2B8EA 4H1WA 5AICA 3SF0A 1RKVA 2FPXA 1U2SA 1Q91A 1RRCA 2I55A 4C4RA 3ZWDA 4L57A 4UASA 4Y2UA 4BEWA 1LTQA 5ALMA 1TJ4A 3AR7A 5A3QA 4KX5A 5AM1A 1TJ3A 2C4NA 3IRUA 3MMZA 5ALFA 1YS9A 4Y2YA 2FPUA 2IA5A 5AVYA 1YDFA 5ALUA 3L0CA 3QYPA 2ODAA 4KNWA 4G9BA 2WF9A 1U7PA 1SWVA 3U7GA 1ZRMA 3NUQA 2FI1A 3WK8A 4BYGA 1L7OA 1KYTA 1Z88A 1SU4A 3BWVA 2X4DA 1ZD3A 2RAVA 3DAOA 3FGOA 4QJBA 3R4CA 2QYHA 3KC2A 3DV9A 4CE6A 3FM9A 4F72A 1T5SA 3B9RA 4HGRA 1Z4PX 3NALA 4Y2VA 3ZVNA 2GO7A 3A1CA 2CFRA 2G1AA 5AM0A 2OBBA 2C88A 1L7NA 2NYVA 3EWIA 2I33A 4RETA 3L5KA 5AKJA 5AW6A 1S2OA 2Q4TA 5ALIA 3DDHA 1VFPA 2PKEA 5AKKA 2IYEA 3ZTYA 2ZG6A 1N9KA 3R09A 1XP5A 4UU1A 1QQ7A 5AKXA 3ET4A 3L1UA 4UAUA 4YIHA 1RKUA 5ALEA 2MU1A 3L0BA 5AI4A 2W43A 4CF5A 3KDPA 4HGNA 3WGUA 3RFUA 1L8LA 3AR9A 2JARA 4XOUA 4PNHA 3PGVA 1WZCA 4OD0A 4E88A 2FPSA 3SD7A 3KD3A 3I1YA 3N28A 4Y2JA 5AKZA 4ZEXA 5AW5A 4F71A 3OTQA 4HYTA 3W5DA 4NWIA 2WF6A 3PCTA 2PR7A 1Y8AA 2RBKA 4NFLA 5AVUA 3WK9A 3L7YA 1Z5UA 1CQZA 5AKLA 3WK7A 2BDEA 3MN1A 2HF2A 3ZWKA 3PDWA 2P27A 1RMQA 2G0AA 2I34A 1Z4LA 5AM4A 4BX2A 2W4MA 2YMMA 2HDOA 1ZD5A
chains in the Genus database with same CATH superfamily
4GGPA 4B3IA 3EODA 4RQBA 1T4MA 4CT4B 1B41A 2YQZA 3WRYC 5H9WA 5JI2E 5EWMB 3QU9A 3JD4A 3QNWA 3G0HA 2AXNA 2FZEA 5D87A 4B83A 2XSZD 2ZRGA 5IS2A 3WIVA 5F12A 1DX9A 1CZOA 3OE7A 4M9SA 1MMFB 2Q46A 5HIKA 4GR5A 1F20A 5DHQA 4NE9A 1DBRA 4L50A 3VNQA 5LL6P 3V80A 3HHPA 3IPYA 4FFLA 3K8YA 3M6IA 3N0VA 5CLLA 5EE1A 3D5QA 3VPFA 2G77B 3W6OA 2Y1GA 1Y1PA 2H17A 4S1NA 2HBQA 4YCLA 4M55A 3M9XA 5IKOA 1BVUA 1X7YB 1SKQA 4HXEB 4YPOA 5BSWA 5HTOA 3EXHC 3DP7A 3D3WA 4JVNA 4MR9B 4RH3A 4NVRA 2VWPA 1K4KA 1U04A 1AIPA 2C54A 1J2UA 3FXAA 3IERA 4ZGBA 4WNAB 4KJZA 4IZHA 2B35A 2CFSA 3A9UA 4XE5A 1Q1EA 1KO1A 1WV0A 2EYUA 4Z4HA 1KIFA 5MF6A 1U5BA 4LXHA 4UM7A 3VPAA 1RJGA 4E12A 4Y1GA 4NCBA 4G4SO 4FGJA 4LV5B 3HH8A 1L5GB 3ABZA 1JEYA 4CKCA 3V55A 2HA6A 4FGKA 5ARDA 1QG2A 2Q7DA 3ZCTA 3EEOA 2C2GA 4XGKA 3IT2A 1LQTA 1RYDA 3OOSA 4KXQA 4PM4A 5AW1A 5AW2A 1CJUC 5JADA 2QD5A 4GVPA 4CBVA 1KP2A 3VR3D 3OURA 3UH0A 4E7PA 2W11A 5BV1A 1J2TA 1MZVA 3LOUA 4JLOA 2RC5A 2ZBRA 1PDOA 3IAM1 2NUTA 5GTDA 1AVTA 5A5DA 4JQOA 4O8ZA 3A6HA 2LNDA 3CEPB 4F2WA 1N78A 1B6TA 2WSBA 1S96A 3PFCA 3HYRA 5SZJA 4MR8B 3R9IA 3ZHVA 3PLAE 1WO8A 2TMDA 2Z09A 3AP1A 4O4HA 5H80A 4HDCA 2HEIA 4H7JA 5D00A 3IXMA 3M5WA 3OPVA 4DR7B 2QL7A 5BN3A 4IJ5A 4I4NA 3D64A 3E1SA 1JLKA 5I51A 4F9TA 5KTRA 3HKCA 4ZVNA 2HJ9A 2QRHA 3G2NA 4A16A 1IUKA 1H9AA 3C4JA 1K4YA 2P2GA 4P53A 3V4VB 5K0NA 4AT1A 5TVGA 4DCNA 2BJWA 3AVXA 4B8WA 1E62A 1G7CA 3EH2A 4ZT4A 3OQNA 4IUBS 1U9ZA 2QZPA 4IJWA 1IBCA 2R00C 3U7QA 3JZDA 4MULA 3ABQB 5HE8A 2ZKLA 1HMYA 3UK0A 4HADA 3KZ1E 1E7RA 3M6UA 2CLEB 4IIGA 1C0PA 5CDGA 1YT5A 1HSOA 1J70A 1EQAA 4MVJF 4WHMA 1PJ4A 3KETA 2DB3A 5MFZA 3QVOA 1Z8DA 1QIKA 2DQ4A 3CVOA 3P52A 5BSGA 4KAAA 2AV6A 3KU1A 5AVVA 4A1OA 1MDBA 1YC2A 1A5BB 3G5UA 3HCPA 3VTKA 3IOMA 1Y33E 3AR8A 2VJBA 4JI8B 1T2EA 1ICEA 1MORA 2CK3A 2ZRMA 5WRFA 2OYRA 5CBPB 3UMSA 3GELA 1TEHA 1TM4E 3AEKA 2VPIA 2O4UX 4BNDA 4HPWA 5JSQA 3EGDB 1X8KA 3I9LA 1VMDA 1UBEA 3H2JA 4GPIB 2IZ1A 4V0OA 4H7IA 1N5DA 3IH5A 2ZIFA 3DP9A 3FHCB 3TB6A 1DKNA 3ZXYA 3E8XA 4WPGA 2L69A 3V3KA 2RCYA 4N3CA 4ENVA 5TS3A 4MWGA 3OWHA 2ZTLA 1REQB 1V96A 3MUNA 4FOLA 3ZY6A 4BX8A 1W1IA 2G83A 3UXEA 2XQFA 4GX2A 1RRVA 2PQ6A 4OLJA 2O5VA 3B6JA 3MWLA 4OK6A 4WCFB 4GYWA 4WSOA 2GHQA 2Z83A 1NMXA 1E3SA 1B23P 3DLPX 4MPTA 3FCEA 3TRHA 2VRWA 1I3KA 4KZPA 3I53A 1NJ2A 2JJMA 3EXG2 1I4WA 2JFFA 2E89A 4XPZA 4YRTA 3R7FA 2QT1A 1U2DC 4PC1A 3UT5A 3KR2A 3ZTWA 4J2HA 5JAOA 2HLNA 3FKSD 3IAM6 3QNMA 3RNLA 4ZYYA 4XFDA 1FDUA 4FIZA 1TTQB 1JA0A 4WQMA 1A7KA 3NFYA 4NOLA 3BIXA 1S2LA 3L40A 3AB7A 3UWPA 3AJEA 3WMGA 4L5YA 4OG2A 621PA 1VMIA 5TX7A 3BB1A 3JU3A 5CDUA 3VX3A 1BJRE 4X3OA 2RHLA 3P0EA 3NBUA 2BY4A 4P08A 4Q1DA 1L4FA 3LCRA 1N2IA 1NQAO 3EDRA 2O1EA 2DHRA 2QNBA 2WJJA 3N8NA 4WLOA 2F9MA 4YREA 2YX1A 3TBKA 4QUIA 1MDFA 4RQUA 1T8RA 3LYHA 1PT8A 4I4CA 2NMVA 1T9AA 1JSRA 3UKJA 4RTNA 1SVUA 2PWAA 1PUJA 3CZCA 2ES4A 2OMEA 4UTRA 3LHFA 4BO4A 2GDJA 1TL7C 2YHAA 4K6CA 4RHXA 4QICA 1KZHA 1TI7A 1XRMA 3QIAA 4EHFA 1PL7A 2XHEA 3GLHA 4JVMA 3B12A 3ZV6A 1RM0A 4BVGA 1M1NA 1YTUA 2RONA 8OHMA 2ZYUX 4HDMB 3ERCA 2VO1A 1VLQA 4DSUA 4JS0A 2K87A 1EXVA 1JECA 1ZN9A 1ZJ6A 3MZ0A 1YDEA 4EVQA 1DEXA 4DDWA 3C4QA 3WY9A 1T6BY 5IBRA 3W4KA 1UZAA 4GBJA 3WGQA 2P2NA 1AXEA 2C9BA 3OTHA 4IXWA 4RY9A 5DMHA 1XTPA 3KPJA 3AESA 4FFSA 5BT9A 1Z2AA 5TR9A 4BWFB 3R3YA 2O54A 4FW9A 1LJUA 1LH0A 2ETXA 3QITA 3ZGNA 1Y5MA 4HBGA 3KWLA 1J9EA 3OHPA 5C7YA 5KQMA 1NL3A 3L1VA 2OQVA 5JISA 4CNBA 1EBUA 4ZV4A 4A8PA 3D3EA 3FOFC 3OAAD 5L4SA 5JXHA 2CLMB 2WAAA 4Q1AA 3RC2A 3I1IA 4BFYA 1KYQA 4LDZA 4EA7A 4O4IB 5A1JA 2BR3A 3FYUB 5CNIA 4LOKA 3OU2A 1R50A 3F96A 3OPQA 1VCNA 4LZNA 4EZEA 1XEWY 3WKAA 4BC0A 2HM7A 4BX3A 1HURA 4EQZA 1QYVA 1AGYA 3T0IA 4YAGA 1K0FA 1PT6A 3FUUA 1DJLA 5DBFA 1S2DA 5JY1A 4AWBA 2RK6A 4UW9A 3AUSA 4PC2A 1ESDA 1SEPA 1KNQA 1P3JA 3GUHA 2QEQA 4O4IA 1PV1A 3MRSA 4M1TA 3R7DA 4AJNA 4IV8A 3SEQA 5AXDA 4U0JA 3U19A 1M3SA 3NDPA 3PX3A 4ZAVA 4H7EA 3F5DA 2W2PA 3ZY3A 4BE4A 4QE3A 1QVVA 1EFAA 2MINB 2P9HA 2WFAA 3IB3A 3G2JA 2WSYB 3AHGA 3MBIA 4DV3B 2Q3CA 2HHLA 2GAJA 3INTA 3VSEA 4DVJA 2WB2A 1X94A 5AJHA 1L5LA 1FDSA 4EFLA 3M8KA 3IDQA 2IK8A 2BBTA 4JP3A 5E8JA 4GHWA 1Q74A 5TQ2B 3TN7A 3BOSA 3WGGA 5IG2A 1OI4A 3E58A 3RYFA 3LO8A 1AZSC 1BYIA 2OECA 2WR8A 5FUWA 1MO6A 1C4WA 2D54A 4GU5A 5TGZA 3RU9A 3NVDA 4K9QA 3VPBA 4ZEVA 1AHPA 5BY2A 4OHWA 3IP8A 4PHCA 1CY7A 3ELUA 1SQ0A 1DSSG 4I1OA 4OHFA 5LOVA 3VNAA 1QIIA 1ZA1A 4HUTA 1AA9A 2AJCA 2Z2XA 4FBMA 4KN5A 4ND8B 3MS2A 4V24A 2UYHA 4S12A 3B6EA 2P1RA 4BLQA 3HB1A 4LDJA 3M6AA 2RC6A 4PYKA 2JA1A 3UBMA 5KKNB 4UVHA 3VDNB 1KMNA 2QMZA 4DPMA 3KEGA 3LXXA 4HVCA 4JI2B 3S8MA 1TZJA 2YJ3A 2J4CA 3E9NA 1BD3A 3KSMA 2HBZA 3D3JA 5BUQA 1M1XB 5DNUA 2OXEA 1P4AA 1MJFA 3IXLA 4PHFA 2D2FA 3TKYA 4HGPA 1Z0JA 3IEPA 2FFRA 4KWCA 1ZOLA 1P1BA 1T29A 3PVZA 3Q6NA 3AI2A 1RE0A 1SQGA 4YRQA 2AGVA 4RCYA 3HBMA 1A4XA 1YCGA 4LHEA 2ZFUA 2LGJA 3PG5A 4BAZA 5DTQA 1T5TA 4KTVE 1EVEA 3HNRA 3ANNA 4OL9A 1VGVA 3ER9A 4RA6B 2UV8A 3ENKA 3HKEB 1T9KA 4RMJA 5IAGA 1PK9A 1SOMA 4NMXB 3TJZA 5AVRA 3TG2A 2C57A 2VYCA 2BTQA 3M82A 3OPXA 4D3DA 5CITA 1QIMA 1E18A 1KEEA 5ALSA 1TM7E 2YTZA 3JASB 3WGOA 4BZXA 4FEGA 4CG2A 2F3SA 3TW8B 3E5HA 4ZREA 1OV6A 4YROA 5JZBA 1OR8A 1JXMA 4EYSA 2ZB8A 1KC3A 4LJKA 2G88A 4F4DA 1I9GA 1P5JA 5FAXA 1CUJA 3PC8C 2BCJQ 3E1GA 2PJRA 3MG9A 3TX6A 2AW5A 5J5CA 3DEYX 1UM9A 4RYLA 2H0QA 1PWXA 1VCIA 3IR7A 5KHAA 3WL8A 1GYQA 2FGJA 3LQRA 5JFOA 5LYJF 4M8IA 1QAQA 2V0CA 1ZIYA 1I5EA 2FSHA 4BNDB 3AYXB 3RC8A 4UQPA 1N2CE 1XD9A 3K1JA 5CX1A 3ZHYA 4C3VA 3O8BA 4KP7A 4AIRA 1Z34A 2RK3A 1H22A 2PPVA 4DC1A 1OFUA 1B42A 2QRQA 2EP5A 4HN9A 3GGSA 2J9FA 1YR2A 3I4FA 3O8QA 2QE7A 4PS1A 4BRSA 1YK1A 1UKVY 1UT5A 3OSUA 3A9CA 3T34A 2VK4A 4RHEA 3RS8A 1X80A 3S28A 4ER7A 2FW7A 5ADHA 4UUAA 2MR5A 1YJQA 5IFLA 1ZY2A 4D02A 3LQYA 3BCSA 2Z6VA 2Z2IA 2DQYA 4BRWA 4C2AA 3EZFA 1N9ZA 1HSZA 1JDBB 1H2XA 4UUMA 4HLUA 2J9FB 3I6ZA 3OEHA 3DFZA 1ODSA 5JARA 3VR2D 3GEIA 3QPAA 3I6IA 1A8IA 2C83A 4NBKA 5CA1F 3HWSA 3KXKA 1AT1A 2G4CA 3IQEA 1TT5A 1G20A 1K2WA 3WP1B 3ZDQA 1I36A 1JG2A 2I4TA 4ZVRA 1X7WB 4JT4A 2ZT8A 4QXQA 4TKVB 1F0NA 2I6QA 4N82A 1KJYA 1NBMA 4MKRA 3HE3A 1KJ8A 1RYFA 2J5BA 3HYLA 1ECJA 4RLSA 3FAZA 3NHUA 5IC4A 5HNKA 1RQ2A 2GJ8A 1FRVA 2JJ1D 2Q9CA 2QAGB 1ZG3A 1EUCB 4UHJA 4IR7A 1JDNA 1KFKB 5JEDA 1L5QA 2DCMA 2FV8A 2IEAA 3FGNA 4N6GA 2M9MA 3SPXA 5KSOA 3DOEA 4IYRA 3KJHA 1CRLA 1XJWA 4NJEA 3LFTA 3G17A 4DZRA 1BSVA 1AKEA 4JB8A 2JKYA 5DM0A 3VVCA 5IJAA 3TGWA 4TZKA 4CFZA 5DBIA 3TCNA 1JFFB 3FM9A 3K1AA 4GC9A 3U40A 4B35A 4AULA 3THWA 1JU9A 2HU2A 1Y3AA 2HLHA 4REMA 5LZ2A 2CEAA 3TR5A 4TLLB 3UATA 4BU0A 1OTYA 4ZYTA 3UJ9A 1S6YA 4LBYA 2LR0A 1J0EA 1P5FA 2G1KA 3NJ8A 1L7NA 4CV3A 4GZ6A 4LXIA 1YDHA 1ZN7A 2QZSA 1JX6A 4OFXA 5C81A 1E2DA 4O08A 1VIVA 3K0CC 3Q7IA 2OFOA 1C1XB 1N5RA 1H2EA 1KVTA 2CXSA 2QTNA 4LJLA 4CLOB 1ZIDA 2C3PA 3L02A 1P9WA 2WU8A 2Z2JA 5LCXA 1FUUA 3ZGOA 1B0AA 5K3OA 2ON6A 2VEDA 3BULA 4IOMA 4D6PA 1D03A 1ODLA 4ZALA 1HM5A 4GKBA 3WLAA 1XDGA 3GAAA 1JFLA 2Q5LA 3A1UA 4EOGA 5BW6B 3V4LA 4MQ6A 2TS1A 3NT4A 1F2TB 1ONSA 2HO5A 1DMRA 3ZIUA 1N9KA 2IV2X 2WT8A 4BYMA 2P1DA 3OJCA 4KFTA 3GRYA 3OQ1A 1XDSA 2PL1A 3PKZA 3IHLA 1GDDA 1K3TA 3MERA 4OXYA 3W9SA 1FYWA 3MT0A 1KEKA 5JJIA 4YXWA 1UBLS 1NBEA 3JQ9C 2FPPB 2BMAA 4HBZA 4NBWA 1CUZA 3VYSB 2QV7A 2R4QA 5HILA 2IV3A 4HDOB 3OI7A 2F8LA 4ID9A 4AY3A 1IZ8A 3EQ8A 3NW9A 3W0LB 4A8JC 1SXJC 3F4BA 1XWWA 3Q7TA 4EKIA 1JHYA 5CD1A 2PD3A 1B7GO 2N3ZA 3AKDA 3H1FA 1VKHA 3K5IA 2J0UA 1INLA 3H2SA 4HLQB 5JG7A 4GWKA 4XSHA 1GAQA 1S4QA 4GRDA 4P7JA 4UE6A 3L8CA 5AOCA 2OBXA 3MMNA 2RJOA 2Q9UA 1V8FA 3KPYA 3LPLA 4TROA 5KYVA 1W4AA 4XM2A 5I7SA 4NWIA 2CL6X 2IYPA 2WF6A 3GPLA 2F8TA 1JJVA 1VXRA 3BG5A 1JZSA 3OKCA 1AF7A 2Z0MA 3C14C 3KUCA 1D7AA 1MB3A 4DMGA 5AVUA 3ADCA 3RYHB 1XTVA 5CM9C 4C76A 3GLIB 2AG1A 4RPKA 2DERA 3H9EO 1JQBA 2POCA 1P4HA 1HOTA 1UXGA 2YWEA 1A5ZA 3OECA 4CETA 3BFKA 1COZA 3W78A 1FP2A 2I9PA 5BVHA 4ICIA 1RWMA 1CZKA 2RAUA 5AJUA 4MZXA 3CLRC 4PG4A 4RDIA 5GV8A 1U6KA 3SHVA 3U7JA 4AMVA 3RSQA 1JHUA 4UUNA 3GGCA 1WV1A 3CKMA 2B6NA 3GOQA 5EPOA 3SF8B 3TUIC 3A6GA 4HSGA 2ZJOA 1HR0B 4YBRA 5FOUA 2FZ5A 2HHJA 1T34A 1QGUA 4YECA 2OO5C 4OL0A 3CLTD 2ROQA 5C8XA 2HIGA 4Y6QA 4HDNA 1NASA 1P6QA 3FX2A 4YYZA 3LV8A 3RD5A 3D8HA 3IA7A 4XWWA 4WZBB 1CRPA 1F8UA 3OJWA 4XARA 5HCIA 1VCOA 3GDHA 3IBCA 1YB1A 4B4KA 4W5RA 2VK8A 5JD4A 1T9HA 3IEUA 1K5PA 1I7PA 1MPTA 2YYSA 4I9GA 1B2LA 4LK3A 3RADC 4E3WA 1JEOA 1QGUB 4WOBA 4G8DA 2V7GA 1C8KA 1ZM2A 4ARBA 3KQPA 3D54D 1U1EA 1JLHA 4PSAA 1ESNA 4KLRA 3V8VA 3S0JA 3EVNA 3GLHB 5KSZA 1GPJA 5IJXA 1GUBA 1CDDA 3BICA 4DWWA 3CLKA 3MLBA 4NXNB 5SY4A 2CCJA 2JANA 4AJJA 1FK8A 2CHUA 5TC4A 4FZJA 2BFDB 2BGMA 3JASA 3VVBA 4Q9IA 3S5UA 4QRHA 5HZMA 2HTEA 2PD6A 4GDFA 1UPFA 4LZPA 4QDUA 1OXUA 3HPRA 1JKXA 1XCGB 2P8JA 1CC1S 3GRFA 2G1UA 2Z5VA 3ZCPA 2QUZA 1DBVO 4DV6B 2Q5IA 4ECAA 2ZWAA 4A6DA 4LXXA 3KALA 2J3EA 2QD3A 5FOQA 1BQEA 1JMYA 3R3VA 6REQB 4BLPA 4WLFA 3LLCA 3PITA 5B2ZA 5B2FA 4Y2XA 1GQOA 1BG6A 4BO8A 2R751 1EZ4A 1ZD9A 2VS1A 2X9VA 4NZPA 1Y5NA 1B8NA 2WICA 4H60A 1UFQA 4WBNA 3KBBA 3WRVA 1SXJA 2A92A 1PRYA 2XH8A 1WKCA 2DWPA 2HF7A 2YN2A 3HG7A 3MCUA 3UENA 3R41A 2QP9X 2PUCA 1CWUA 1O03A 4MITA 1N2SA 4ZI7A 5BWCA 3PNSA 3F5SA 4HLNA 5L3SB 1CDZA 3H42B 4QFCA 4RTQA 1U98A 1ZJZA 2Y0EA 1Q17A 4DHEA 2CNDA 5IJZA 1VIYA 5C34B 4A03A 2P0AA 1TKAA 1I6MA 1QWSA 4GF5A 3BK1A 1NZDA 1M0WA 1BCRA 5TPZA 4Q1CA 4X1YB 3DV0A 2YJNA 2PV7A 1PS9A 3D1LA 4QUDA 4MO9A 4TUYA 2RHOA 1W9MA 3FF1A 3NHSA 4IO1A 1FZTA 3MQ2A 4G2TA 3HEMA 4O5AA 4AM8A 4HEQA 2ZANA 3A9TA 3JQ6A 5D84A 1JDVA 2X8LA 1YU6A 4E5VA 3OZAA 4OQMA 4QHYA 4BMPB 2NSJA 2OV3A 3CISA 3BB4A 3QTBA 4NEGA 2W90A 2PLNA 2X41A 4K3VA 3VNBA 5T41A 5DJ5A 3OICA 1GUZA 1S2IA 4GOXA 4OQ4A 4J2TA 5EE9A 3P9CA 2X13A 4J90A 2JFOA 5EQTA 3CZ9A 4BMVA 2B6HA 4F1WA 2G76A 3M5CA 1TIBA 2YZMA 2JATA 4WCVA 3ADKA 1ILWA 3EA5A 3TJRA 4HN4B 1GU0A 3KTOA 4IRMA 3NCHA 3OIVA 3AFOA 4FC6A 1S3IA 2HTFA 3GNSA 2EZTA 2P5TB 2NVOA 2BGTA 4MDEA 2WIGA 5TS2A 3KQNA 2E4VA 1NAIA 2GK4A 5C8ZA 1LLQA 2OORA 1KIMA 1CZRA 3B70A 4MUMA 3OM0A 1DVRA 4EF4A 1WBJB 1M7BA 1OU0A 1P60A 2VBGA 1TLFA 1KH3A 2D1RA 2H4FA 2WKQA 1P91A 1V7PC 2XUGA 2WFLA 3JPYA 4N5DA 4ZOCA 4M83A 4OQYA 5KO2A 4MQLA 3PVCA 1GPKA 1OC4A 3A7DA 5CCXA 1X3SA 4BO0A 2GHRA 3DZJA 1G2PA 3KX2A 2E1PA 3HJNA 4P3PA 4PZ0A 1S5PA 3B1YA 4DEYA 3QJYA 5TSDA 3R75A 4L0CA 1Z82A 2OKCA 2YV2A 3OPYB 3V8BA 3PTZA 2X7HA 1IHUA 3MHPA 2W6JD 3GVXA 4UBJA 4L0MA 1EK2A 3GI1A 4ZV9A 1Y3CE 1F2TA 4Y0VA 3M2TA 1P0IA 5IUKC 4RTPA 4QRDA 3ZZTA 3THOA 4HX9A 4KTTE 1XIVA 4OCZA 3SS9X 3T5PA 1B0ZA 3C3PA 1A76A 3I6QA 3HUTA 4AS1A 4UE3S 1WOYA 5LDGA 4HI0E 4GRAA 4NY1A 4CIDA 1JAZA 3JAWA 4JVSB 4J03A 2V7VA 4XZ3A 1VPEA 1ZONA 1K7XB 2XUPA 2O1SA 3H2BA 2OXTA 3ZEIA 8AT1A 2AMJA 2E1RA 4N1AA 4TXHA 4B5KA 3H5IA 1RAFA 3DSRA 4QLAA 4GPZA 3WISA 1T8PA 4NZOA 2WHYA 4PZPA 2FW1A 1SUBA 2D59A 2RGNC 4NAVA 4WWHA 2WB4A 2V97A 4H1VA 2IE8A 2WHQA 3KG2A 4JBWA 4PPGA 4F2HA 2V9PA 3IBSA 2C0QA 1XXHE 4OP2A 5F1YA 4EFDA 4R0NA 2X8JB 2LKDA 2CJWA 4I36A 1Z36A 1CP3A 2BF4A 3DT8A 4DDKA 2FKAA 3W2FA 1M76A 4OJNA 3OQ6A 1K06A 5ECGC 1AH2A 1CS0A 2GJKA 4P22A 3R76A 4EJ2A 4JI0B 4EECA 4CMAA 5JCXA 4B17A 1DPFA 1A9YA 4FT2A 1ISJA 1U3WA 1XVIA 2A84A 2J33A 3D43A 3H1BA 3I73A 4IV5A 3X3HA 1PYDA 4Q4CA 1WD5A 2NXCA 1E4VA 2PU5A 4CTNA 1HT3A 4JJZA 3V7UA 4JKIA 1STOA 2TECE 3H0EA 2F3RA 2FLKA 4ENRA 4ZJUA 5K8CA 1WF6A 4XDHA 1HE1C 2CXOA 4L0DA 2PX3A 3FDZA 2H1SA 3WAJA 5E0OA 4EL5A 3LVBA 4OHMA 2FW8A 5F1PA 4ZEWA 3OX1A 3HFRA 3T3OA 4X6UA 4Q1EA 1OKKD 1MRNA 1V1JA 3U61B 1MC1A 1OSNA 2QRKA 5GJWC 2Q07A 1JZQA 2X0DA 1IN6A 5LNK1 3E0XA 1S8AA 3KUUA 3IOEA 3PB3A 4ZZIA 4TS4A 1RYNA 3LXRA 2WV9A 1JSCA 1PLKA 4HAIA 2NV2B 2IPLA 5EQJB 3ST7A 1C7JA 1UADA 2Y1EA 4Q7KA 3C98A 3HFGA 1A2QA 1I7NA 1SCUB 4FT4A 3DTVD 2PH5A 1MENA 1X38A 4BVHA 5HW0A 4B47A 1OWPA 4MLCA 1TB4A 4BX0A 2AI2A 3KQOA 2B4AA 1T4CB 4G1CA 4M9XA 4IDDA 3ZXIA 1NWCA 5IAAA 5MGNA 4L16A 1I30A 5KTPA 1M34B 3T0GA 4JT8A 2E5LB 4G25A 4U4AA 4N65A 4RHTA 2XXAB 2IXTA 3WNDA 1BJKA 4BMSA 3IP6A 3TMAA 5MN5A 3WXMA 4D4KA 5IZ4A 2CJYA 4GOJA 4ZI7F 1I10A 2QRJA 2O2CA 3VPXA 1EX1A 2XCQA 2H0RA 1YFJA 1GZ7A 3GRKA 1X7GA 1L4MA 1JHVA 1AZTA 3G2QA 4HRXA 1LI4A 1URPA 3HXMA 4QNRA 1FDRA 1RTKA 3HU2A 5D6NA 1DV1A 4U2DA 3FGPA 1YZVA 1U8EA 5CAEB 3ROKA 1HT0A 3BFXA 4QXOA 1P2DA 3F97A 4PANA 3UWOA 1NBOA 1RC0A 3X2SA 5E4JA 3QY0A 4CQLA 4KQMA 3NRCA 2LWIA 5FA5A 2KLHA 3I9V1 3MQ4A 2W37A 4L8LA 2Q6TA 3MGKA 1X7WA 4V0LA 3PEYA 1YA8A 2Z57A 4NMLA 4UKDA 1FSGA 1OBHA 5E9QA 3ZDYB 4OBBA 4MW6A 4P7GA 3OT5A 2NG1A 1YDGA 1GTG1 1E8DA 3Q6IA 2A9JA 1F14A 2K2WA 5CW2A 1DJOA 4AO8A 3PTLA 3VISA 4UTVA 1IULA 4JX8A 4JR0A 5FX2A 1IUPA 2YZ7A 3CQ9A 1T4GA 3FDJA 2QN8A 3MJHA 1ZZEA 4BQFA 1J21A 3N8DA 3NEAA 3VU3A 4UNQA 4WVLA 1H9CA 3RT1A 3CR3C 1ZD4A 3B38A 3PICA 4LJ6A 1DX4A 5EMHA 1RHJA 3QE3A 4URXR 2A1UA 2WLTA 4EGCB 3O1IC 3DV2A 2NZVG 3MNFA 4JYMA 2FDRA 2ASVA 2JGLA 2R87A 1IWOA 1Z2DA 2W7TA 4MGHA 1A9PA 1IY8A 5DGCA 3V8NA 4CKYA 4DUGA 5BV8A 4R3WA 2C9YA 4CKCB 2YIDA 1DDOA 3R77A 2B9VA 3WKDA 2X5KO 1QZZA 3G59A 3HSSA 3KQYA 1EUZA 4OY3A 4Q1FA 1M2HA 1GGMA 2HA0A 4UMEA 1D9XA 4W6QA 4G1UC 2GZ3A 1KY3A 5DSTA 1RMTA 1YA6A 2IFTA 3INNA 4ZO4A 4Z9XA 3IT0A 3T9EA 3TAUA 3U49A 1RQPA 3S70A 3UUGA 4UJ5A 2M6LA 4YNBA 4CMEA 3WTBA 1Y48E 3CUVA 4KOAA 4PNPA 4BIIA 4IIJB 2VT7A 3ZVLA 2D5CA 5CH3A 4MRPA 3E81A 3M5DA 3GROA 1SHUX 3U5ZB 1GV0A 1I14A 1UKYA 2P2ZA 3AJ8A 3NWOA 2XB9A 4NH0A 4PZYA 1OLUA 1UP6A 5HOEA 1SC3A 3DF7A 4MYDA 1DI0A 1G42A 2B82A 3JAKB 2V1UA 5D3MA 4RGVA 3KE9A 1UQTA 1BXGA 4EJSA 4YY3B 2FR1A 1I3CA 1EWKA 1QANA 2QV0A 4GOOD 1YQTA 4I1VA 3ZCXA 2GZ1A 2NV6A 3WMFA 1KR2A 1A9RA 3ETHA 1IJFA 4MPPA 2HU5A 2HGSA 2Q21A 1UEJA 4TTPA 1SKYB 3NG1A 4UJ3A 2FNAA 4RZUA 3B13B 2B8EA 4GZ3A 1EWTA 3UC9A 1HDCA 4G5HA 5DP1A 1J8QA 2PRSA 3G02A 4ZARA 2XTJA 4YUXA 4AMGA 4XWKA 3CLUC 3OF2A 3SYKA 4BBAA 3OP4A 4FZRA 1E2GA 5ICMA 2HXYA 3S7ZA 1U0BB 3EMBA 1NM5C 3SZGA 2X2FA 3FDIA 4YXWD 1FXSA 2OFPA 5E3JA 1IDN1 2ZBPA 3GP3A 4L8VA 1NXVA 1UAAA 4U2GA 2FPIA 4KIWA 4ABYA 5DX8A 3UTDA 4KX5A 1N1GA 1GPNA 5EKXA 3U39A 1U3UA 1UDAA 1F6WA 2R66A 2WTBA 2ZYRA 3Q11A 2C4UA 4KQ6A 4QOGA 5ADUS 3UGQA 3P9RA 4LUCA 1YRBA 4PTZA 5DHUA 1V5IA 2DSTA 2JCYA 3ZDBA 2IRWA 4YDSA 5HPYB 1KI9A 2EGGA 2WMDA 3QBJA 4PFJA 5D6OA 4L8GA 2ZSEA 1U7PA 3ETGA 3ITEA 5DIFA 3HSKA 1SXHA 1PJLA 1UBHS 4LDNA 3L49A 1JIUA 5JS6A 3WK8A 1UAGA 4Z5XA 4US2R 4XYBA 3TL3A 1XCLA 4E11A 2AOUB 2C9OA 5KX5F 1XQ9A 1ZD3A 2QMYA 4HS9A 2DY1A 3ROEA 2I3AA 3R4CA 3ZGZA 2YVKA 3ACCA 5DDIP 2JVKA 4D8TA 4AECA 5EP4A 2SICE 1WULS 2GBLA 3M4JA 3Q85A 1M8GA 3CEHA 3QOXA 6ABPA 4LXQA 2IEGA 5CA0A 2X8JA 3ESBA 4HUJA 3THXB 4TKVA 1PFUA 2H4XA 2VR1A 4LC9A 4GLLA 4XB6B 4EB6A 4KLAA 3VYVA 5M7EA 4HFJA 1RZ3A 1TTPB 2WMOB 1SULA 4KQ9A 4PONA 3WLHA 4HQ6A 1OZAA 3IDFA 4EHJA 1T6XA 2DU8A 2C3YA 3L5KA 3X2FA 1RBMA 3TOVA 1X2EA 2GLUA 4FD2A 1L5OA 2H11A 4RM2A 1CS4C 4FMCF 5ALIA 2P9ZA 2P41A 1Y3DE 4P36A 3L7IA 3ONWA 3ZCUA 2YYZA 3OOYA 3VHLB 1ZJ5A 3B3JA 2H48A 3T38A 3WZMA 3L7AA 2B4YA 3DNFA 2OG1A 4M60A 2X3UA 1R64A 3FOBA 1KQGA 1MXFA 4K6OA 2PH3A 4LQ4A 1W29A 3VU1A 1YVPA 4YI5A 4PR0A 5B3JA 4JLDA 5AXCA 4Q3NA 5DTRA 1V3QE 2Q41A 4S1OA 1OX4A 5B1SA 4FXOA 3SZMA 2WWHA 3KEOA 1S01A 1GL6A 1Z33A 2NQ8A 4IG9A 3S1AA 3ELYA 2ZJFA 4KO4S 1JB9A 1ST2A 1WB6A 4J0EA 4RCVA 2J1LA 1THZA 2N46A 1DEOA 1WQ4A 3A27A 3QV2A 3WGUA 3LK7A 4Z54A 2V65A 2JGEA 3JTEA 4NFYA 4X9XA 1W93A 3LHIA 1ESCA 3EVTA 4OX9Y 5FORA 2PCLA 2DUMA 4FKZA 4COKA 1ZCJA 5EIFA 1S7CA 1XRSB 4HGYA 3LUFA 3A2KA 1CULC 2ODQA 3PPWA 3NIFB 3IV6A 3ISJA 4LHXA 3BN3A 4U6NA 5FWDA 1FYVA 3ASVA 3HKDA 4Q3OA 5BW5A 4DSTA 2GN0A 3L1IA 3PUHA 5CJ2A 2OD7A 3LCMA 4C2UA 4MV5A 3DVAA 5E8RA 5IDXA 4LOAA 4GL2A 1T8WA 5JMTA 2BFCA 2A3NA 3C6MA 5IT5A 2P6RA 2AZXA 3MN1A 1RXVA 4BNGA 4OOEA 1XN1A 2H4WA 5MN6A 4QU9A 1R15A 1ZUHA 2O7NA 2ZWIA 4XRGA 3IESA 1RMQA 3ZWQA 2W5UA 3C3CA 2GZDA 4BX2A 4F38A 3A25A 2JPDA 3I3SR 4W99A 1L0BA 1W46A 3JQ8B 4I5FA 3HY4A 1E9VA 4ZQIA 3MHTA 3TRKA 1U7XA 1X80B 3HVKA 2PL5A 1EUDB 1P1CA 3HO1A 3BWBA 2IZ7A 1N0WA 4LTDA 3HCAA 4JU9A 4O4IF 2JGJA 2BEUA 4R1UA 3V2HA 1X8XA 2OZPA 4DLSA 5K2OA 5IBCA 2F1IA 1M54A 3MF4A 2ZZMA 4D4HA 1GZDA 2Z08A 5IABA 3SHQA 5FBKA 1OF1A 4Y6GB 4TTVA 1RLJA 1XZLA 2AFRA 3QFFA 4UNNA 1PJ2A 3IUPA 3O8DA 3Q0TA 3C7DB 4AURA 1TYDE 1E9RA 1CY2A 1M1UA 2YOFA 1HQYE 3CNOA 3H86A 2QLTA 3FVQA 3PRYA 1P9LA 3RIGA 1W87A 1Z5VA 4K9LA 1Y42X 1XZKA 3HPQA 2HA7A 2VP0A 3NOQA 4NS1A 2YRFA 3DBOB 1VQ1A 2G5TA 4DIBA 3RYFB 4I9UA 2XVZA 2OGSA 2QW0X 1R0XA 1H1DA 2IZ6A 4IDOA 4XYEA 4ARIA 1OYWA 1BW9B 3KZXA 3NIBA 4KLZA 3GLRA 1NNUA 3M6MD 4YRFA 5DTJA 5TF0A 5LBTA 3R7LA 2X9QA 3RE1A 3UPDA 1CVIA 2WUDA 3BRWA 1GG5A 3CURA 5DTMA 4JJ4A 3TNDA 4ZFNA 3R5JA 4DJEC 3WWEA 2P6PA 3PBKA 2DMRA 4TS1A 4M0LA 2FOLA 4GXRA 4N5LA 1C81A 2AN4A 3IYLW 2OCPA 4JJ8A 1N2CA 1FDTA 2JLAA 3AUUA 5K01A 2QTAA 3EUAA 4O6VA 1EESA 1WDLA 5G40A 4DRYA 5EIXA 3K2QA 5JLAA 4ZP1A 1IONA 2FMTA 2QSZA 3G2MA 4P35A 5ALTA 4ZCSA 1MBZA 4E6PA 2JLWA 1KJJA 1U4NA 3L4JA 5LJIA 2G80A 3CCBA 3W8FA 4QJ3A 9LDTA 1TDJA 2COUA 1DCFA 3H87A 4MW5A 4JAVC 5FOXA 2Z1DA 5AHOA 2DC1A 4LKOA 4IJ6A 1AZLA 2XT6A 3G9XA 1GIAA 1DFHA 3K0FB 4FC7A 4NC9A 5AHRA 1XRJA 3Q3JB 4FYHA 4LSZA 1E89A 1A82A 1FMTA 2FPLA 2B83A 2OLJA 1F48A 3I6YA 4QDOA 3VC2A 4D9GA 3M9LA 4YJFB 2R1UA 3GUZA 5CDTA 2JI6A 1E77A 3IAHA 1TEZA 2O8BA 4AROA 4ALNA 1WY5A 1G8JA 1NXSA 2C9ZA 1BGWA 4X00A 3CUWA 1A9XA 5FOSA 1YQUA 4UUBA 3L0OA 2ZCJA 1XQVA 3Q9NA 1CU1A 5C80A 2NO5A 5HOQA 4AJHA 1KJIA 4G85A 3FVRA 4NG4A 3R24A 1B0UA 1H66A 3HZHA 2G82A 4FI3C 3V9AA 1WMEA 3DBRA 1Z4JA 2DTDA 2Y1FA 3IALA 4HLUC 4Q9HA 1A8SA 1JPUA 4EZBA 1C30B 1Y6RA 2GZMA 3BC1A 4WERA 2YV1A 5JVDB 3ZDCA 2YWJA 4HZGA 4ZVLA 3RQIA 1P2UA 3NBAA 4EELA 5L3SA 1W5EA 3OFJA 4J29A 3L6CA 4LS3A 4PN7A 1EH5A 3FUWA 1YAJA 1L2TA 2PGNA 1U0LA 3HJCA 1CF2O 3KZKA 4LZLA 3WGJA 4KRFA 3IUEA 4JSRA 3USES 2FPRA 3KUDA 5CK5A 1FS6A 5DTEA 2YZ2A 4DCMA 1TZMA 1UMBB 3LQQA 4JEUA 4PRKA 4QL3A 5P21A 2CFTA 2J9ZB 1FP1D 2IDMA 5AKHA 4U3JB 3S7TA 1Q0TA 3VC1A 2H4JA 2GKGA 4UNSA 2XQKA 3C8DA 4F84A 2O06A 2OV1A 1MA3A 1RACA 5G4KA 1JR6A 2DQSA 2GILA 3SSMA 3PQDA 3R3HA 4KNVA 3SVLA 2Y92A 3IOYA 4N6OA 4AC9A 3DXFA 4M6WB 4GRIA 5JC8A 1ZUWA 3SICE 5HK9A 3HMQA 2CHFA 4G5YA 4CGYA 4DMMA 2W4IA 4G3XA 4I4LA 1CUFA 3G2LA 4KFRA 4R40A 5CXUA 1I2MA 1DS6A 3EDMA 2C42A 3HUFA 2I3BA 4C6SA 4FDLA 4E2WA 5DM1A 1WXQA 4Q12A 5ES3A 3WA7A 2GK3A 1R0WA 2L42A 4OREX 1T36B 3I2IA 4B3GA 1U81A 4I0WB 4ZCQA 3U0BA 2VJKA 2WD7B 2AN9A 1S0UA 3CLUD 3K0HA 1H93A 4QEZA 4BUJA 3H19A 4JC5A 2ZJ0A 3WB2A 5CVCA 3LWBA 1EFKA 5FYQA 1KQOA 2MSLA 1CNEA 3BRCA 4TXMA 1G18A 4Q21A 1O5IA 1JJAA 2H2WA 3S2FA 3TZCA 2ID7A 1C3JA 1UH5A 3EOAI 4HDMA 3TQSA 4MW7A 2H0AA 3M2PA 3TZLA 4M1QA 4NCXA 1H8HA 2RARA 2ZPUA 3OOHA 3PX7A 2SKEA 3ZD8A 1DKRA 1E5DA 1HYEA 5EJAA 1NVEA 3VKWA 1KU0A 1ZSVA 3JS5A 3C5EA 3IMFA 4JLUA 1QCYA 3E3OA 1Y4DE 2FPKA 2BEVA 1D2GA 1H3NA 3T5CA 3W8EA 1LJLA 2FX3A 3GN2A 3INRA 1ABBA 4NCKA 1DAIA 1AKQA 5AI8A 4DWOA 3JRXA 3BWXA 1VRWA 1A8HA 2E5WA 5EHGA 3NDJA 3OCJA 5KYNA 4KFCA 4PAMA 4ZN6A 1CERA 2EJTA 2H08A 3AWIA 4TLCA 3V4PB 5JNRA 3BYZA 3FTFA 1YVRA 3HDYA 2FMHA 1TF2A 4WKNA 3BHJA 2JBAA 4KB5A 3V7NA 1N1DA 2CV1A 1NNI1 1AURA 3IVMA 4HEA1 4YMLA 1OXVA 1K9VF 1OXBB 3H65A 3L6BA 5HYVA 1ISPA 3B8HA 1U1CA 2YNMA 4K9OA 4OQXA 2PKWA 1JPJA 4NOKA 2P6NA 1JEYB 1ZZGA 3IBYA 2FEOA 3KXDA 3OZBA 4PFSA 4E0BA 5ALVA 1DAKA 1F7VA 3RAPR 3LKBA 2X86A 3W5HA 2JVIA 4QWMA 2VWQA 3CRQA 1RR6A 5F2NA 5FPKA 1JAYA 1M7GA 2A33A 2C3MA 3CLRD 4WZZA 4CMKA 4EYQA 5K4AA 1LC3A 4LQDA 4HQLA 1QUFA 1JDSA 3D6JA 4KN6A 1JHRA 4TMXA 3UH1A 5LMCA 2ZRIA 3FPAA 3N0WA 1BMDA 5KCZA 5IXYA 1CQIA 1L4HA 5J4YA 3JQBA 1ZMOA 1ZOOA 4YJKA 3REGA 3VR4A 4O4HB 3TM5A 3ZWPA 4L07A 4QVGA 4RE5A 4AN4A 2G1PA 2WSSA 4DJFC 3EGEA 1IM8A 4OYHA 1FP7A 1NQOA 1YVUA 3A9RA 4ZQEA 5BMVA 1SXGA 2R47A 2BFOA 3DV0B 4BFWA 4D4MA 1DKMA 5J63A 1SC6A 1L9KA 1W4CA 5HRAA 1MX9A 2QR2A 3DO5A 3G2HA 3M3HA 3HZZA 5H68A 2HBRA 5BSUA 2HJSA 4Q4AB 3TQIA 4K0KB 1YB5A 2UYCA 1EAMA 1TQ4A 3PPVA 3W5CA 2RGBA 1UBSB 3KVNA 3OM8A 3SYTA 4B4UA 2PKCA 2XXBA 2ZVDA 3SQLA 3PR2B 3V4FA 1XTKA 2B0JA 3R6TA 4CDMA 4C7OA 1I1NA 4IDCA 3FPHA 4D3SA 1F4VA 1G3UA 1R66A 1UKAA 3N2GB 3PQ3A 3ACBA 1W36D 1EB8A 4ZQFA 1H0KA 4TZTA 2OBLA 1T2VA 4PZDA 3I83A 4Q82A 1M66A 3IAEA 4L27A 1AUVA 5FEUA 4H2DA 1O94A 4LZJA 5I47A 5K8UA 3SI7A 2B9EA 3HJRA 1VLJA 3AR2A 4JODA 2B4KA 2GAOA 3NUZA 5SY9A 4FQ5A 4FFVA 2PSJA 3W9YA 3X1WA 4BFTA 2I54A 1LFAA 4FHGA 4UAVA 3LC7O 1LPMA 5K0BA 1C7IA 2ECFA 1Z5PA 2VJMA 3G5TA 1RRGA 2A88A 1NUQA 3SZOA 3KKOA 3TDNA 1KK3A 3TCKA 1B76A 5LA6F 1EA5A 4B73A 1RQLA 5BP7A 2IEIA 1EFHA 5KDLA 3UJ3X 5KOIA 2FRVA 2J09A 1VSVA 3JQ7A 3BWMA 4D80A 1Q3TA 2WSSD 4CFSA 3P1JA 1RSZA 2I22A 2VUHB 3LPDA 4IIVA 3WLKX 3ZNNA 3IQZA 4QG3A 4B3BA 4LMPA 1QYWA 4J4TA 1B0PA 1CY4A 2WTNA 3HDJA 4Y9SA 1LLCA 3JZIA 4ZEOA 4ZT5A 2QYSA 2XI4A 2QWXA 4MEBA 4B31A 2MYUA 1FTYA 2I4RA 2P3LA 4R3UC 1MB0A 4X92A 4S3MA 5IN5A 1IBSA 3RSCA 2JDID 2FX2A 3GJ7A 1QR2A 1L5VA 1PR6A 3Q7SA 4JP5A 1XRNA 2VH2A 4R54A 4EK9A 3O84A 4CL0A 3HDHA 3KZVA 3GQVA 1NF9A 1X77A 4U8GA 1BX1A 1TXGA 4UFNA 5DYIA 5C0OE 4MW4A 4OM7A 2QG9A 3O21A 3UJCA 4HNUA 2N9UA 1L5YA 1X87A 5K8VA 5B4VA 2GNAA 1K3FA 3PUJA 1ZVJA 4YCBA 4EDHA 1XTBA 1E1DA 3UUEA 4O4LB 4OSOA 1OGIA 1T10A 5IW8A 3QXGA 5JLJA 1S1CA 2VF4X 4IL5A 2JG3A 3JVEA 2CHVA 2X19A 3U1VA 1Z4QA 4RJKA 2DFTA 4YRKA 3DEAA 1Q0ZA 1J2YA 2HMYB 4IVRA 5CXQA 4UU0A 3F6EX 1JKJA 2OGZA 3AUXA 3UB2A 4L5CA 3O1JC 2Q8NA 2M32A 3LMKA 4R68A 5BYKA 1SC4A 3C1UA 3LU1A 4EUNA 4KPUA 4QSMA 3TGPA 4CEJB 2O8EA 4H1TA 2RKOA 1U7OA 1JWAB 1SUAA 1JTEA 4IVPA 4Y2TA 4RHYA 2J6BA 4V0NA 4N54A 2IODA 3KR9A 5HS4A 1QGDA 1P72A 4C0XA 2PQ0A 3ULKA 3L0DA 3ZV5A 2ZBEA 1RU3A 3PQ7A 2QP4A 2BLLA 4CR6A 3H5VA 3LOPA 1ZMRA 2J3QA 4K6KA 1SMKA 3FUVA 5AICA 2IEYA 2B37A 2RHMA 1U3VA 5F3RA 3ZQKA 4AO6A 1RRCA 1OFGA 3BERA 3V8RA 1M34E 4QT0A 4B3DA 1T1JA 4HAUA 3SDZA 4TYMA 5T6MA 4LSMA 3T94A 3JAKA 5EERA 2GERA 3PRHA 1ZMXA 3FUCA 1TJ4A 2EQAA 4NAHA 6ADHA 3F3KA 3DXXA 2BGLA 4XFKA 1MLDA 3O75A 3E6AA 1N32B 3TXXA 1R6VA 3P0RA 1GU7A 4YVFA 2FPUA 1CUEA 4C7XA 5C18A 5JJLA 1QHNA 5ALUA 4GSKA 2VQ3A 1NJGA 1H2AS 3MTJA 4MCAA 3QEKA 1QG4A 1AQNA 3RVMA 2YZKA 1QMGA 1C7FA 3GNTA 2AJTA 5BWNA 4ZZ0A 2CC2A 3IUJA 4MROA 5CB6A 1KYTA 3HN2A 3X1MA 3BWVA 1LPSA 4N7JA 4ZOLA 3ZVRA 3T9DA 3QVVA 3G5AA 3JWPA 3QEBZ 3MYYA 4I1PA 2XOKA 4N7RA 1F0KA 2OXFA 4NEHB 4LBVA 4Z0PA 1XCJA 1RWQA 1WU8A 1Y3HA 3BJIC 5FBZA 5FEMA 1ZHOA 1IN1A 1FTQA 5LR6A 3CX6A 3P0JA 3H6GA 1CV2A 1J2EA 1DWOA 4U2FA 1C9DB 1J8FA 3ZJYA 5DYTA 3BQNB 1DQRA 2NO0A 5JD6A 1HMPA 4Y9UA 4KYVA 1PZMA 1XNHA 3B3GA 3JRNA 3AF0A 2I33A 2D1FA 1OB2A 5EE5B 4FWTA 1BDJA 2EKQA 2EP8A 4LFCB 5HA5A 1QH8A 2DWOA 3A3PA 3IS3A 5CJPA 1FPQA 2ANCA 3QPBA 3E4CA 3TZHA 2P67A 1KFEB 5TVKA 2A6PA 2BGNA 3RGWS 1FTWA 4L7VA 1YGPA 1TFRA 3W4JA 1B6SA 3TNLA 2FSSA 1TA4A 2PZJA 4EFMA 3N0XA 1NR5A 1VKZA 3QUSA 2FRXA 2Q9AA 4GBED 5AVJA 3N70A 3I9FA 4IGIA 4EVSA 4HAZA 4Y9TA 4XVUA 1ISFA 1QH8B 1JBQA 1WZEA 2P4EA 1KIAA 1X13A 2BCEA 4XB1A 3CCFA 3I0MA 4NPAA 3P0FA 2AOTA 1W85A 3H11B 1GTRA 1BHQ1 4RPHA 3DO8A 2B4QA 1PTJA 1V1RB 3LYLA 3NONA 2WA2A 1FE8A 1PL8A 3MRTA 4O0MA 1U2ZA 1Z8HA 3FPCA 2KI5A 1P9RA 4RKFA 5K0LA 4R2XA 4HGNA 5JSUA 3KSBC 3EUWA 2QQ0A 1A9TA 3ECCA 2H4ZA 4Q5IA 3FBWA 4YJ3A 3T7TA 4F97A 2W0MA 4TV8A 1M2KA 4N9WA 3LQ1A 3D02A 1P2TA 2EC5A 1T2DA 2H2HA 1WZCA 4N18A 4X6LA 3HA2A 3RSOA 1DTWA 1NRXA 2Q6IA 3D2BA 2YIJA 1QGZA 1RFGE 3NBFA 3DTTA 4D3ZA 4IV0A 3FWNA 4AQDA 1EQ2A 4I66A 5I4BA 1MAUA 4TLAA 4XFJA 3GDWA 4BNHA 4CUKA 1GQFA 1KAQA 3KB1A 3USZA 5IAOA 1VTKA 4TTIA 4LRSB 4ENWA 1E6WA 4MQUA 4OQZA 3CMCO 3JWGA 1G1AA 1FLAA 3TE7A 5GIPE 3KOMA 2ZYDA 1BFKA 5LQSA 3NNSA 3ZH9B 3M4ZA 3OLWA 3E9YA 5IF9A 3A3OA 2J32A 4D9BA 3GZNA 1ZA2A 1EP9A 5AM4A 1AQUA 2AZDA 3I52A 1N4DA 2WHRA 2XDQB 3JCZA 3IR5A 2BHLA 4LEIA 1IEVA 1Z2PX 2FKNA 1A0OA 2HDOA 4Y9DA 2XKKA 3MAGA 4C4TA 4PRLA 4EABA 3EQ7A 1N0HA 5JMWA 2A57A 3GLFE 1JILA 1LY1A 1KEZA 4F5ZA 5CB0A 2CLFB 3GPBA 2NM0A 3STYA 4B3RB 2J9XB 4YONB 3RVSA 4TN1A 1XZFA 4JL6A 2D6FA 5ALYA 3CEAA 3CIFA 4G89A 2CD7A 2EARA 2IHBA 2Y1XA 3KVRA 2CE7A 2WJWA 4H7PA 2VDQB 4KKVA 4WKBA 4MRAA 2XOEA 4UTXA 4RULA 3QMVA 5EYPA 1HETA 2X0RA 3ETDA 2HXGA 2Y4NA 3AF3A 1VPVA 1E6LA 3ANTA 4W8OA 4WK4B 4YK7A 1SZPA 3Q5GA 5E2IA 1IZZA 2GD1O 1TC2A 1WXHA 3LC2O 1G9XA 3OBIA 2ZDQA 4RFVA 1U9IC 2ODWA 4ZK6A 1FDVA 1LJ8A 1Z5OA 2H54A 2X2PA 1YRQA 3GVIA 1E9FA 1QNLA 3FI9A 3I5UA 2JGMA 3ILHA 4F5DA 2ZREA 3A26A 1PIWA 3CLHA 4G86A 2A0UA 4YRDA 1SJ9A 5AT1A 5TQ2A 1Y7LA 2HX1A 1ZM4A 4YRZA 3PFGA 5KREA 2CLHB 1N5MA 4QYIB 1KVSA 3T7RA 1UJCA 1OVGA 1LWOA 2V8OA 2WYIA 2FUCA 3R5SA 1S8NA 5H70A 4FCCA 1WEKA 5ABPA 3R9XA 2NYAA 2HNBA 2O7RA 2WINI 5ALNA 3TIGA 5BYAA 3GU3A 5AVXA 3HL4A 1LNSA 3PU6A 4Y2RA 3VR6D 4TKZA 5C8DA 1FVFA 3FPSA 2LCFA 1IXKA 3C3AA 2GVNA 1JWBB 3NJ4A 2VHXA 3ISVA 4NL4H 2HXSA 2OUKA 4ZAZA 4A73A 4NEQA 2QXYA 3ZUGA 4RVNA 1CQIB 1YZKA 4GMGA 5EP2A 3GARA 5CNKA 5M04A 5U9CA 3DMYA 3RVJA 5CEEA 3T4PA 1J5EB 1KRHA 1I5RA 1TMKA 5CEFA 4H7HA 5F73A 3MTEA 2ZSBA 2IVZA 4XQEA 4DDMA 4TV8F 4R5MA 2CLOB 4MUKA 4NENB 4ZHQF 4XWGA 5KNDD 5LLDA 1ZK3A 2XMQA 1X0VA 3IAAA 2V59A 1JFTA 2CMHA 4X54A 1RC8A 3C6KA 5KX5A 3VU9B 3EBPA 4MVJM 1K63A 4ALIA 2ZR9A 3PNVA 4MGKR 1K89A 2GI4A 2RCNA 4OKSA 3O8OA 4YJGA 4FWIB 1QONA 3RF7A 2ZJYA 3OT4A 5DRYA 3ROGA 5KWIA 3DE7X 4UC0A 3BQ9A 3B7WA 5LXTF 1AMOA 3W04A 3VPHA 4RK0A 1PFGA 2Q2NA 3O83A 5ERYA 4L9WA 3AUJB 5FO1A 4CT0A 3ZHZA 1T2AA 2JAXA 2IYTA 4REOA 1ZD8A 2P0YA 4MGYR 1M6HA 1GPYA 2IHVA 3KLMX 5D3ZA 4ANFA 1OH7A 4RSGA 4ZICA 3GDGA 2QTLA 2OCXA 2QX8A 3HKDB 4LF9B 2VA8A 1PO7A 4DYDA 4F5WA 1A3CA 1Z73A 3NHFA 3H5OA 1AKYA 3F3MA 2ZETA 4BLVA 3RG2A 3PPIA 2JKVA 1VZ2A 5DT9A 4L95C 2QVXX 2EFYA 3V4OA 3U4AA 4ALKA 5JAPA 4NARA 1E2KA 1O1YA 3GUCA 4JB3A 2AOUA 1N2ZA 4NYJR 2YQ5A 4QOHA 3T9CA 3U81A 4B6FA 3QWBA 5FDFA 1R4MA 5HKKD 4C89A 1TJNA 1D1TA 3HYSA 3KB2A 3PDHA 4Q05A 5AK5A 2VZ9A 1TMYA 3SE0A 2DPYA 4C3ZA 5AJZA 3ETEA 5H5JA 1QQ5A 3MWEA 2FPIB 1I3LA 2HV9A 5IKPA 1LK0A 3O1HB 3ORHA 4PSUA 1DXQA 5K0JA 4LYGA 2C8LA 2GCGA 2QUKA 2WJ6A 3NXSA 3QVTA 2D2IA 4GGOA 4MW9A 4DIOA 3QBEA 4C07A 2AG8A 1P5ZB 3BEDA 2GFIA 4IM7A 3ENVA 5A5EA 3QF4A 4D5EA 1X1DA 1HFJA 3MXOA 4BV8A 1QYIA 3FIUA 4MJ7A 1K68A 4FX5A 1P19A 5A0TA 2BGUA 4ENTA 3A37A 4CT5A 5EINA 2QPAA 5T67A 4R7TA 3K31A 1WXEA 3HB0A 2DAPA 4GE0A 2ECQA 2I2CA 4GQBA 3UMGA 1ZCBA 1SOUA 3EBOA 1UOEA 2ZLBA 1VB3A 3L01A 3VDQA 1JHAA 3CH4B 3EGIA 3HU1A 2VATA 3KOOA 3WLLA 3R40A 4DF3A 4Z2AA 5BWOA 5F3WB 2R8PA 3IT1A 1IBRA 1A77A 3AZQA 1U28A 3EEIA 4C0KA 4F3CA 3ISTA 5K0GA 4H77A 4CV1A 5KSYA 2V7QD 3RTDA 1PW5A 2E4WA 2F90A 3ME5A 4Q4HA 4F5EA 1XTUA 4Q01A 1H1TA 1NNEA 1SQFA 2IP1A 1UK8A 2VN8A 3RUHA 4I4TA 4RVHA 2ANBA 2FF5A 1DRUA 4TL9A 4HUQB 5E7JA 1ZSNA 3GC6A 3TL6A 1E1YA 1LPAB 2AN5A 3GQBA 4M9RA 2BYTA 2PGIA 1R37A 1QFXA 4Z49A 4Q9LA 2LDBA 2B8JA 2G1JA 2FZCA 2YS6A 3IUYA 1DQNA 1ZFNA 4V39A 3TIIA 3ETCA 3GIWA 3BXXA 4YFVA 1HE3A 1T2FA 4DLBA 5FOTA 2ZIXB 1WABA 2I4LA 3BCRA 4OP3A 3B1FA 4Y3UA 4Z8YA 4DJTA 1C0LA 1U0GA 3VI4B 2P90A 4C22A 1NVFA 4PVDA 1M34A 3R7SA 1GGEA 4HWTA 1SURA 1EAYA 1Z3CA 3AVQA 3DEZA 2I7TA 5J2UA 1WE2A 2X0KA 5EESA 2Q3JA 1VXOA 4CTJA 4WXMA 4IGEA 3REFA 3K2IA 1A2OA 1PQUA 3G7NA 4HXGA 1M6YA 3WKCA 1FQJA 3L84A 4GAEA 3JX9A 1E9CA 3O4VA 3LIPA 1DG1G 2B1QA 1QHHA 2XQJA 3IKJA 4KQEA 5DX1A 3U3MA 2IVFA 4WKOA 3UMBA 3NNNA 4GL4A 2XZOA 1L4KA 3ROTA 1NW9B 1U31A 1E5LA 3ZE9A 5IK2D 5KVVA 1SZCA 2IYSA 1VSQA 3N9IA 3O7MA 1PTJC 2FSVA 3D3QA 1SBQA 3KZMA 3BTOA 4RBNA 4PX2A 3AP2A 1QZ3A 1H6AA 3MTGA 1U7WA 3SR3A 3MUEA 3ZS8A 1C7EA 4DE5A 4Y0NA 5PGMA 1FOEB 3NIWA 3RF6A 1XMSA 2QD2A 4KWTA 1MCZA 5FPTA 2OCKA 4BNLA 2YH2A 3IVXA 4IUYA 5ALJA 1JDTA 2GEFA 2HV8A 3OUZA 1TKCA 2FX5A 3GVHA 4QDKA 2VPPA 2DSNA 5LA6B 4IGAA 1RZRD 5I9BA 3IP3A 3LBNA 3QFRA 3FR8A 2ZXUA 4L9AA 3SP1A 4TYYA 2MINA 4P7KA 1U3GA 1FMFA 3R0QA 2FRDC 1FYFA 1LTKA 4XA8A 2YFYA 1PNTA 2WIFA 1SUSA 1XU7A 1IY9A 4JDUA 4W4TA 2J5QA 4DGSA 2JHGA 4R1MA 1MFPA 5JO9A 2QTMA 1X1RA 1YVEI 2BEUB 4KXFB 4I3FA 3LQ4A 1JIIA 4GGMX 2G71A 1HBJA 4F92B 1GL9B 5L7YA 3OIGA 2AJDA 4HVTA 3ZIAA 2BIFA 3N0RA 4KNYA 4IEIA 3DKIA 4R4JA 4RH0A 4ZYLA 2Z4SA 1M2JA 5IC6A 2BAGA 2PMDA 2H07A 4JI1B 2YBDA 5DE3A 4ZV7A 3DEFA 3W5AA 1TAQA 1V1RA 2WYUA 2X6TA 4JA0A 4B40A 1CR6A 1HA3A 4IH4A 2JH9A 3WWPA 2YNMD 5IX8A 4AZ0B 2OVFA 2QVZX 5KTYA 3L4BA 4JLPA 2P35A 3Q1KA 5KWEA 2GM4A 1TYCA 3ZU4A 4DMCA 1C0IA 1F3LA 1R4AA 4UHKA 5EMKA 5AD1A 4A8HA 4IDGA 3L7DA 2NTVA 3PGLA 4J1TA 1GN8A 1KDZA 2QY9A 1G6Q1 4BVEA 2C1EA 2O50A 1KE2A 2VT3A 4CM3A 1W0CA 3GG2A 5DBGA 1RJEA 3S81A 3QEOA 1EXNA 2D2EA 2FWAA 5ANRB 2PZLA 2EFEB 2FFJA 5CYPA 4CMEC 4MDFA 3GJSA 4GI3A 3RJZA 2WJIA 3LYAA 2Z58A 3PPXA 5LYJB 3SN6A 4LVUA 4NZMA 4JLMA 3DLAA 3EW9A 4LRQA 2F1OA 5HBRA 2FU5C 3OPMA 4JK3A 5A9RA 2JLQA 4P4SA 5KINB 4YMTA 5CRIA 3DQPA 3FMGA 3OPYI 5A9SB 1NZJA 3AEUA 1RBZA 2HK8A 3HJAA 1DRWA 3Q6MA 5AI5A 4IZIA 4X1IB 1S9DA 2QX9A 1FNDA 3PFWO 5C4GB 3TR0A 4EJFA 1ZJ4A 5HF9A 2QIPA 2FZGA 3H17A 1JG4A 4FSHA 4LC0A 4PLHA 3WWZA 2HJHA 3IVCA 4HQNA 3P32A 2I4IA 4W9NC 4G0UA 5HQTA 3DMNA 4IFEA 4NOJA 5GOZA 3RFVA 2CSUA 4FP9A 2QF7A 2CB9A 1KWGA 1M5RA 2QJWA 3GLKA 1OCEA 2B30A 3P94A 4YUVA 2PUGA 5CX1B 2EYQA 3QHQA 5FBQB 3ZWBA 1MB4A 3AIKA 2DWCA 2WI8A 2H1FA 3NC4A 3IDSA 1NX6A 3BDVA 4IDFA 1UBRS 5H3LA 3T5AA 4ZRDA 4QZVA 3IURA 4L28A 4P2BA 3BRWD 5JVDA 2HR1A 4XGIA 4EI7A 2YZNA 3T15A 4LN1A 2OFWA 1NF3A 4D9CA 1QOQB 2ZW9A 3A0UA 5C4IA 4GMHA 1AV7A 2QPLA 5ICCA 1XMOB 2OXCA 2IA5A 3TAHA 3GH1A 4FR0A 1YDFA 3ROPA 4P3NA 3IHWA 3VTZA 3I5YA 5JPIA 1FU7A 2ZU6A 1JLRA 2GBFA 4G0WA 4E5PA 4DR2B 1WRBA 1V9CA 4DCSA 1UINA 1NXQA 3F5QA 4LJ7A 3DB2A 4TVKA 4EG7A 1E7QA 4O1MA 1Z9BA 3C1AA 3PHJA 5MGBA 1XPOA 3HCCA 3QYJA 4M8LA 1X1CA 2IHTA 2NLOA 4MR7A 1T4CA 2JJYA 4C7JA 3Q98A 1SH7A 4KDRA 2E18A 1BC5A 5T8KC 1C3XA 2C2KA 2REXB 1ISHA 2ZE5A 2B2CA 3DFMA 2KBEA 4JROA 4DCVA 2FPGB 2VCHA 3D4PA 5K4HA 3AIMA 3BWDD 3FHJA 5HZKA 2WPDD 4LX8A 5ISMA 2ZYAA 4BNIA 4UEOA 3FROA 3W6UA 3ZYZA 4EA9A 1UF9A 2DECA 2XQGA 2O5RA 3E48A 1C8LA 2OSVA 3WBBA 2QU7A 2L19A 3EAGA 1SFRA 3HMKA 2REBA 2H2DA 2HHHB 2AI1A 1V6AA 3ONEA 5FBVB 4NZ9A 1C8VB 1DX6A 2QT0A 4PLGA 3K6JA 4K6FA 5FTMA 3S2IA 4CUZA 3REOA 3BH7A 1RJ9A 3QLUA 1Q11A 4FDAA 4YR9A 3R3WA 1MEEA 5DHSA 2ABWA 2R6AA 2F43B 3ETLA 4JCOA 4BB5A 4J3FA 4OF4A 2Q3LA 4PTYA 2VL7A 1VFPA 4BE9A 2PKEA 2P9TA 4N48A 3E27A 2Q5OA 2CNWD 2D06A 3FW1A 3KQQA 5E9WA 3FIJA 2IYFA 2BLNA 1L8QA 1Q77A 2Q1YA 3I12A 4B09A 4FJ2A 3UMMA 1GNTA 1KI2A 4PZAA 1PL6A 3JWHA 4WV3A 2Z95A 1CIVA 1LC0A 2DUUA 3CTPA 4EA8A 2G9UA 4LSWA 5CNMA 5DT2A 5FUBA 2WY2D 4EUEA 3K0BA 2AC4A 3L0BA 3G9UA 3PENA 2A8YA 4RHFA 2ZWPA 1ULZA 4HD8A 4BVBA 3KHSA 2BFEB 3ZDRA 4RTRA 4PIMA 3SJAA 2C4TA 2PT5A 3RC7A 2WUFA 5KU1A 1VB5A 4YMGA 4IJKA 4TV9B 1NQVA 5SYNA 2JARA 2JA2A 2XRMA 3EVAA 4GWGA 3WYCA 2AJLI 3WZLA 2RGNA 3IUMA 4CN8A 4AZSA 5GONB 4WJKB 2HPAA 3T41A 4GPEA 3KYIB 4AWAA 3G7UA 4TT8A 4DLTA 1HL7A 2N47A 2DR2A 3D3NA 1FUKA 4HYTA 5D2CA 1Y6ZA 4KR9A 5C51B 4HDAA 4ZVVA 4TM8A 1GT91 2ZJ3A 1N5KA 1HZZC 1RM3A 1ZAYA 2IP2A 1NYRA 3H1EA 3DCYA 1N6NA 3FFAA 4Q93A 1RXWA 3QH4A 5AKLA 2V6IA 5IFKA 4AG6A 4TTRA 1PNOA 3ZWKA 3GT0A 3JQ9A 2P2SA 4V03A 2R96A 1P1KA 3VYRB 1Z2OX 3E2MA 3L4KA 4FFWA 3V1UA 3EWNA 3VAZA 4L0QA 2QDXA 3LHSA 5L4LA 1TD9A 3BMQB 3CN7A 4P4NA 3FZYA 3T9BA 1X39A 1KK0A 4WECA 4M9CA 5B1IA 5F5LA 4B3FX 2VF2A 1TYBE 1KBQA 1FNBA 5JRJA 1TA9A 4LJ4A 2SECE 3MVEA 4RF4A 1ZH0A 3PHGA 4ZO8A 2QQGA 2NXEA 3PXCX 1F38A 3MT7A 3QSGA 2YXDA 5LP6C 1RTTA 3DL0A 2MYNA 3QKUA 1QOZA 1W52X 4WVFA 4DJJA 4EQ6A 5CFNA 4NZZA 2R6R1 1N6LA 3MWDA 2AMYA 1P0FA 3VR6A 4LA4A 3QYAA 3QU5A 4EPXA 3I6BA 4B45A 2P9EA 2W58A 3ESCA 1T8TA 3DB1A 2ZDHA 3H2GA 4MVJE 1C4XA 1J8MF 2BKEA 3JQGA 1GYRA 3NHMA 4H27A 4QO7A 4N12A 4CM1A 2XECA 2QSUA 2CXQA 4FGSA 4MIEA 2HQRA 3INGA 1MT3A 4DA0A 3ANLA 3NWPA 3P9PA 2XJ4A 2O2SA 4BVFA 4L5JA 4F91B 2UU9B 3VR6H 721PA 4EJ6A 3C8HA 3UAYA 1N7GA 5ETJA 4TQUS 1HO3A 4S0ZA 3PNBA 3IE0A 2PGJA 3GQBB 4PE5B 5ED0A 4EHNA 4EUHA 4KMSA 1CX9B 1V9LA 4PZEA 1FY2A 1SGWA 2A9OA 2G36A 3MC1A 4IP0A 5KNCA 1N34B 3V33A 5JNSA 4TQGA 2VXBA 1R1DA 1V11A 3GK3A 4PW0A 1M2NA 3PC2A 4U63A 3QELA 1PI3A 1O08A 4CQLB 3NCTA 4J9VA 2AJ8A 2VI5A 4UDXX 4DRXA 4UEKA 3EGXB 3I9OA 3AHHA 4C0BA 2A9KA 1QP0A 2AOXA 2V7QA 3F5FA 1JAHA 1J90A 2CXPA 4NRDA 2C59A 3FCAA 4YAWA 2QKYA 5A4MS 1WMFA 1JR4A 2JAQA 1B3RA 2R11A 1W5FA 4CEJA 1PKXA 2JH3A 3NLLA 1C3EA 5F4BA 5AUQA 3DPUA 1W96A 2FE1A 2R2AA 1M9NA 3KD2A 3Q7PA 1F4LA 2B7BA 1IN4A 3SE7A 5BSFA 1I32A 1JTFA 4F46A 1QHFA 2GPYA 1TECE 2HL6A 5JFTA 4EW1A 1G8PA 5EIHA 4DY6A 5LOVF 5AO9A 5JBQA 4H7KA 4BEVA 4C14A 1EJBA 4RFSB 5AVOA 3C97A 1CW2B 1K7SN 1U7HA 4IJQA 4TYPA 3VO8A 3DUFB 2OWEA 1L6IA 1P1RA 5DNWA 4GXNA 4MUIA 1XELA 5K6AA 4ZHQB 3EXG1 2UZ0A 5A04A 1E79D 4Q16A 2MDTA 4A10A 1MQAA 1O4VA 3OCWA 2W0SA 4DA7A 1IIBA 1HH4A 1O96B 1LSUA 2FJPA 5CVVA 1LUAA 2O6HA 1WZIA 2Y68A 1NVUQ 5KCMA 4F1JA 3DE0X 1ECCA 2ZVQX 1UXKA 1BOFA 4ZGGA 3DM9B 4BQSA 1AV6A 3VOAA 5TMEA 2JW5A 4ZJYA 1EUCA 4CUJA 4I6EA 2EFGA 4LSGA 1SRRA 2YVLA 3I92A 1WSDA 1CE8B 4N40A 4NBUA 3L07A 4MUEA 5K3FB 3WIDA 2CXTA 2EXXA 1RXIA 3WQBA 1EM6A 4FGLA 4C06A 3GPCA 1C7QA 2OAP1 3CXUA 4HQOA 3FD8A 3CKKA 4ZCPA 2JLUA 4KQIA 3M33A 1SUWA 5FXMA 4ENSA 1LA2A 1AHHA 2EZ8A 5TMPA 1UBNA 2HPHA 1EMDA 4S1TA 2Q1WA 5HBGA 3WWCA 3DLTA 2CY0A 1ZH6A 2G72A 4WN3A 1ECPA 2NUPA 2X15A 4LXUA 3WLQA 1B43A 1C9YA 1WDWB 4CEIA 1LI7A 4DMFA 1CUSA 2WZDA 3VJRA 3FGZA 2NAFA 4MCHA 5LC1A 5CMLA 4BJ3A 4ZQHA 2Q1SA 5FTKA 2BELA 2PTHA 1FP6A 4PHHA 1EFCA 3CC8A 3WLPA 1JE1A 3PGKA 4BP8A 2O0KA 4QYTA 1QHEA 1WR8A 5L3VA 1AN0A 3AF4A 4HDKB 4QUJA 4EY7A 2DQKA 5DX0A 4FZ3A 3KB6A 4V0MA 1SC1A 4LVOA 1X7HA 1QKKA 3B36A 4TRMA 4ZANA 2ATEA 3ONVA 4DSOA 2I4NA 4FINA 5DW3A 4WCFC 3RM3A 4DAEA 5HUHA 1PR1A 5GOTA 3COJA 5BQFA 5KPJA 3VR1A 2IS1A 4RDCA 4AMBA 3B82A 4CCYA 2PZGA 3RYCB 4NCHA 4QECA 1R6TA 1O2DA 3R0XA 4MR9A 4MRRA 2DFLA 4YAOA 5FQNA 4AAYA 1NLFA 4UHDA 4F9FA 3QM1A 2H9IA 5B2EA 4QOJA 2ZKIA 2IEZA 3STUA 1YZFA 1W85B 2PPLA 3VH2A 5KVCA 2O9JA 3LFHA 1SKBA 3TZEA 1I7DA 1UBCA 2D0PB 2IOHA 2YN4A 3KKZA 3CONA 1J06A 1ZVMA 3I76A 3PYMA 4X65B 1I01A 3TZ6A 5LIRA 1TU0A 4WADA 3LSTA 4RZHA 1KMHA 4IPTA 2WUWE 1X74A 1GY8A 3S8YA 1Q16A 5CT5A 4BNWA 1AQ6A 3JQFA 4I8IA 1F8XA 4OXIA 1C0EA 1ZINA 1DBSA 2PSSA 2A9QA 2UVQA 3MINB 3QPUA 1GZHB 4RY2A 4U00A 2XWPA 3A1WA 3WIEA 2YUIA 3WWOA 3ZD9A 3N07A 1ESMA 4AMZA 2WEKA 2DFNA 4BEJA 3EZ7A 2ZIVB 5IVHA 5C37A 4OBXA 1M74A 1CUYA 1U0RA 4I5GA 4DLPA 5A5FA 4OHVA 2P11A 1CUAA 1CF9A 3JQAA 1E2BA 1ZD1A 3PNKA 4HEHA 2Z5LA 3PXAA 4C0HA 4WJLA 5GVRA 2FSIA 3TEMA 5BVGB 5HJ7A 3E7XA 1Z4KA 3NHKA 2BKAA 3AVTA 3IELA 3AEYA 2KS6A 4KO3S 1N7HA 3GFSA 3F9IA 4N8EA 2QX6A 2WHEA 3SF8A 1W1UA 1IY2A 4PCLA 4ZOAA 1O9BA 1RKBA 2ZB4A 2LRHA 4OGWA 4X7BA 4YJ3F 3GEDA 4YASA 2NUAB 3BDIA 5EHXA 3BXOA 4OXKA 1N5LA 3JALB 4XM0A 3L4BC 1TMOA 1ZQ1A 1CXZA 1VE3A 3KUKA 4RGBA 1GUFA 3COYA 4Q7JB 4XSVA 2W98A 4C20A 3O3MB 1O57A 1X7XB 2VNHA 1NF2A 2R6DA 1BYUA 3MRXA 1PL0A 3K73O 3KNZA 3OD5A 2RGDA 2AVNA 4JH0A 3WLOA 5KU7A 4CQJA 3I5MA 4ID3A 4KGDA 4OFBA 4DUYB 2WU3A 4B6JA 4KXNA 4PFQA 4TYQA 1HDZA 4MXDA 1E3IA 4FGWA 1AUQA 1Z0UA 2IE0A 3N74A 3R6GA 1N6KA 3M3PA 4PPQA 3V7FA 4B33A 4BFUA 4YT5A 5JE8A 4EF5A 4RCZA 2DFPA 3F47A 2H52A 1RWBA 2Z6UA 2BVNA 2W2MA 2O2ZA 2VWHA 2RH5A 3AEKB 2B36A 4H31A 2H1CA 1DUVG 4Q3DA 4LXTA 5IHXA 2L17A 2N1BA 2B1IA 1UMKA 5CBKA 3IMCA 3ZC3A 3DWFA 4S1WA 2P3SA 3CGGA 2P9QA 3RVPA 2PVCA 1WMDA 2VTEA 2P30A 3EXHB 4IS2A 3G6WA 4GR4A 1PR2A 4G4GA 4KGZA 4M8SA 4Q48A 4KG7A 4R05A 2P6OA 1D0SA 1MGOA 3H84A 1MPXA 2Y05A 3OCUA 3H6KA 4PPNA 3OH8A 4GQIA 4JI7B 1EXMA 3DJYA 2V5AA 3KHTA 3OZEA 2XCLA 3KFLA 2Q99A 3TJMA 3WKBA 3DZIA 3NHBA 1Z4IA 3VKVA 2C5FA 2NNWB 4DCCA 1E2PA 4FEEA 4P5DA 4BNNA 2NT3A 2R48A 1O54A 3F7MA 2YL2A 3HA5A 1DC6A 4KN9S 3CUSA 3VOBA 3UAWA 4DDUA 3V1YA 1DG3A 3IUQA 3AV0B 3GCWA 3R1IA 1DJNA 3L6OO 1ZXLA 2Q0SA 4PSDA 4MVCA 3T12A 1BDIA 3WIOA 1FYEA 1OBOA 1E8MA 1GG2A 2HFKA 4HLDA 5CFLA 2VP6A 3H9QA 4L76A 2HCTA 4QYWA 2JK1A 3KZOA 2BFFA 5LQKA 1L7MA 4HZIA 4PCVA 3WAKA 1OASA 4X8MA 3STHA 1KYWA 4MIYA 2XKAA 4D2IA 2WIJA 4V38A 2CL7X 1ZWKA 1C2TA 1L7RA 3AESB 1NW7A 3O7WA 3QLEA 4MS4A 4OKNA 1O94D 1AGPA 1HFEL 1SIOA 3PC8A 5EJ9A 4EM6A 1BW9A 4H59A 5BWMA 2A9VA 5BURA 2R7LA 3KTFA 4J8PA 3TH5A 2DBYA 1ZJWA 4KO2S 5K3EA 1GR0A 4ZYWA 1KBZA 4PRZA 1RPZA 4M0FA 3ED1A 4LHYA 1K6MA 1T5BA 5D3MB 5HG0A 3P20A 5JHHB 4AP6A 4NAUA 3B7GA 3RHTA 2Q2QA 5LKAA 3PXUA 3BA6A 4A2CA 3IVAA 4KE7A 4MQ5A 5T3YA 3ZCRA 4HCJA 4DQDA 4EGJA 1QCDA 3DDZX 2C9DA 1KP3A 1Q0LA 3P9NA 1GTVA 3WB0A 2XCRB 1KBOA 2YXBA 3LNCA 4WLEA 5T5QA 3WJ1A 2RMKA 1KI4A 1EK0A 2BFNA 2VVTA 5FADA 4ZJPA 2J46A 2WIAA 4OI4A 1VI5A 3JYNA 5CBPA 2D3TA 5DEIA 4G4SP 1E2JA 3CZ4A 1M2OA 5JCZA 4JUAA 3VR4D 1T3ZA 4NENA 5K5EA 3EIWA 1UPBA 1T5OA 1TM3E 3EGDA 4JASB 4U0KA 1EGHA 5CLHA 4ZVTA 1SAYA 3ECAA 3GHHA 3W90A 2J67A 5HVNA 4AUKA 3A6KA 1NPYA 2PJDA 4YAJA 4JUCA 1W73A 2VDOB 4KQ2A 3MAAC 4LZZA 1DAPA 4MKIA 5T3UA 4QPDA 4WJZA 3G9ZA 3UOGA 2PZEA 2VH1A 3D4LA 3WIBA 4RV9A 5CD9A 3WGKA 2HPVA 3ZNQA 1BEZA 3M6LA 4RQAA 3R7WA 3V8MA 4BNUA 5L9AA