2YASA

Hydroxynitrile lyase from hevea brasiliensis complexed with rhodanide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
b'AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
molecule tags Lyase
source organism Hevea brasiliensis
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
total genus 97
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yasA00
1XFDA 2GBGA 1EI9A 1Z68A 1BCSA 1XRLA 1VE6A 1ZD4A 3VJKA 4NMWA 2BUCA 4FNGA 4H7IA 1F8UA 4RE5A 1CEXA 4HS9A 2DHDA 5AJHA 5ISMA 4PSDA 4MYDA 2WILA 4MXDA 3EIOA 3R40A 4Y2QA 5HK9A 1R1DA 2WUDA 5E4TA 5F4ZA 1SCIA 4Y2SA 1ORWA 2OCIA 2P8SA 4BCBA 2WM2A 4GDMA 5JD5A 2ACKA 2WKWA 2D0DA 3D2AA 1AQLA 3RKSA 3SWWA 4IH9A 4NVRA 1E89A 4K5QA 2WJ6A 2WG1A 4YPVA 1HKHA 3G9XA 1DWQA 3EQ7A 1CUIA 2H7XA 3AUKA 3DEAA 1B41A 2IITA 3MGAA 2O7RA 4L0CA 2CZQA 1C4XA 4GBGA 3DLTA 1DX6A 4OU5A 1UKAA 4PO3X 4C4ZA 1UOPA 2Z5GA 1JMKC 1YASA 2QUBA 4Q1VA 3LIIA 2GBCA 3CCCA 2JGJA 1HL7A 1EVEA 3BL8A 1EA5A 2OGTA 4BCDA 1AGYA 5AKEA 5I8PA 4OD0A 5EFZA 2H1IA 5IVHA 4BC1A 2VTVA 1DTEA 3G9TA 2G63A 3FYUA 3V9AA 4EY8A 1UOOA 2W6CX 2O2GA 5ESRA 1A88A 5AM4A 5FP0A 5CT4A 4ETWA 1CUXA 1XRQA 4B0PA 4HAIA 1LBSA 1LLFA 2B20A 3EQ9A 2DQYA 2YXPX 4EB0A 1CUEA 5AM2A 1GQRA 1XZIA 1CUCA 3FAKA 1EHYA 4LXHA 3TRDA 1QGED 3AIKA 3H2HA 2HA6A 2OAEA 1NU6A 1LZLA 3ZLUA 4QDTA 4Q3LA 2FJPA 4N8DA 4EY7A 3I28A 3H17A 3Q8WA 2IX9A 3QBJA 4W9RA 3WLAA 1CVLA 4BP9A 5C8VA 4N8EA 2OGSA 4BAUA 4EBBA 3R3YA 1HBJA 2RAUA 5AKHA 3WL8A 3G9UA 4BRZA 3E0XA 4AMZA 3PF8A 1AZWA 4OSEA 4IO0A 4KACA 4CG1A 3T4UA 1BN6A 1YS2X 4C4XA 4B80A 1BEZA 3ICWA 5AOCA 4EY6A 1ZGBA 3P2MA 2XMQA 3R3WA 2XMBA 4LHEA 2PUJA 1XKLA 5SYMA 3D0KA 2PSEA 2G5TA 2V97A 4Y2RA 1H2ZA 1WB6A 1PFQA 1WCYA 2VJCA 4HRXA 4U2DA 2PKYX 3W05A 1UXOA 1Q84A 4DSZA 3W2TA 3GFFA 1MPXA 3GROA 1UT6A 3OTQA 3I1YA 1MX5A 3V1MA 3WWCA 3SK0A 4AXBA 3LS2A 3H1AA 1IUNA 1XKTA 2RHTA 2VT7A 4WFIA 2XUJA 1LPNA 1RP1A 2QOEA 2HM7A 1LPPA 3O9MA 2B4KA 2ZSHA 4HXGA 4F5ZA 1XRMA 2AJCA 1R88A 4G4JA 2HA7A 4FDMA 4L3WA 2GZRA 2XUAA 5D3ZA 1XZJA 4J0IA 5LLSA 3QPDA 1CUBA 5LYYA 4H35A 3KD2A 3NOXA 1AUOA 2PM8A 1UZAA 4ARBA 3V48A 3H2GA 2B9VA 2WJ4A 4KE7A 5LZ8A 1TCCA 2PL5A 2HIHA 2G5PA 4Y2UA 1EDBA 4UHEA 4S0XA 2CUTA 1IZ7A 3AJAA 1QIHA 4G9GA 1CUJA 3NWOA 4U2GA 5BV7A 2CBGA 4Y7DA 3I2GA 4W1SA 3HSSA 3G0BA 4Q82A 3VVLA 3KDAA 3QPCA 5AK5A 5JALA 1SOMA 2VSQA 1E3QA 3C6BA 7YASA 4U2CA 5CT9A 4UHHA 5DNUA 2DR0A 4I3FA 3VXKA 1QOZA 2VAVA 4B9EA 1QIJA 3S2ZA 2PVSA 4DMHA 3RK4A 1YB6A 4BVJA 1YR2A 2Y2UA 5CT6A 2XQGA 3FWHA 3IUMA 5DTJA 2VATA 4XX1A 1ZIXA 2R8BA 2ACEA 3F67A 4UFNA 3W9UA 3WK6A 4C6HA 3OG9A 3DOHA 1DINA 3UUFA 3IURA 2FX5A 1QONA 1U4NA 1WB5A 5AIAA 4BDSA 4X00A 3ZLTA 5LIPA 3R3VA 4WY5A 1WM1A 4J03A 2JEZA 4E46A 1GKKA 2ORYA 4A23A 4J0GA 1GPLA 3I2IA 4UBKA 2WIGA 3WKAA 5IH7A 2WIDA 2GBFA 1RWQA 5JAOA 1N5RA 1VKHA 1OILA 3I2KA 2HA4A 3C6ZA 4ZV9A 4H7JA 3IUQA 3G7NA 3LP5A 2VEOA 4EZIA 3DYVA 5AI5A 1XZHA 2AJ8A 3FOBA 1IUOA 2QUAA 5T4EA 4J0KA 5JYCA 3F8SA 4H7KA 3BJRA 4JUIA 5AO9A 4BE4A 1QTRA 2XUOA 2JGKA 4IHAA 2WFLB 4Y2VA 2QJRA 4DMCA 1VLQA 3STTA 4N8SA 3QMWA 3VISA 3E3AA 5AK6A 4UFPA 1DT3A 2QTBA 1QFSA 1IUPA 3ILSA 2XUGA 4UBNA 1DQYA 4H77A 1YA4A 4X71A 2XUQA 3DOIA 4JH0A 1NU8A 5FLKA 1QLWA 2QS9A 4BRSA 2R11A 1CRLA 1MJ5A 3FCYA 1UKBA 4BZZA 1XLWA 1BS9A 1X2BA 1XZLA 5HF8A 3ZV7A 3GZJA 4U2FA 1GT6A 3O4IA 3HC7A 1VA4A 2PSDA 3FNBA 3QH4A 3FCXA 4WY8A 1AC5A 1JKMA 4AZ3A 1CUUA 3AFIA 1RYYA 3STVA 4Z49A 3IBTA 4WDQA 4PNZA 2ZYIA 4AO6A 3C70A 1XQVA 5A7GA 1K63A 3WYNA 2WSLA 5KREA 3UMJA 3QPAA 3X3HA 2WIFA 1EH5A 1YCDA 1LPSA 2XMCA 1BU8A 5DYWA 5ALHA 3WKEA 4NZZA 5CW2A 4AMYA 3DL7A 3HACA 2Z3WA 3R3UA 1A8UA 4DLNA 5K3CA 3FBWA 5EI5A 2JEYA 3STYA 5LZ9A 3WYDA 5K3DA 1SCQA 4BB0A 4BATA 3QMMA 5HZGA 3AIMA 1IZ8A 2QJWA 2WHPA 1C7IA 4LIPD 2VF2A 1ZI8A 3HEAA 1YA8A 5CMLA 3HRHA 4ARAA 5ALPA 1G42A 4W1PA 3BF7A 3KWJA 1H2YA 3CN7A 1MNQA 1EB8A 2WFZA 1AX9A 3C8DA 2JIDA 5AKGA 2LIPA 5K3AA 4AZ0A 4AQDA 3WL7A 2WU3A 4BVKA 5CH8A 4PSCA 5KWIA 2IIVA 2AJBA 3CN9A 4H7FA 3G0IA 2QM0A 1SCKA 1CUGA 3BIWA 4A16A 2VA9A 5K5EA 1N1MA 1H2XA 5AICA 2HFJA 2OCKA 2V96A 1ZD5A 2BGNA 5ALEA 3ED1A 3WK8A 1HQDA 4G8BA 1H2WA 3I1IA 3FYUC 5DWDA 5KBYA 2WHQA 1ZI9A 2JGFA 3H2JA 3M83A 1A7UA 3U0VA 1CIJA 1S8OA 3I2HA 2WU4A 3H04A 1QIDA 1I6WA 4DM7A 4E11A 2CEKA 4ZI5A 4ZWNA 2Y6UA 1TCAA 2PSHA 1X70A 5LZ4A 1WPXA 3GELA 5JZ9A 3WWPA 2FUKA 2I78A 5ALXA 4EHBA 4Q34A 4FNMA 4KAJA 3WIOA 4DNPA 5ALSA 2Z8ZA 1YB7A 4TVKA 3V1KA 3FSGD 3FSGA 2JF0A 3PFCA 2Z3ZA 5AI8A 3C6YA 1JU3A 4QLAA 6YASA 3C87A 3EQ8A 4EY5A 5CT8A 3STWA 4B7ZA 3H19A 4GHWA 1P0QA 2G4LA 5DNVA 3CCBA 4W63A 2DQZA 1XLUA 4IH1A 2I03A 3DS8A 3D7RA 1PV1A 4NS4A 5LP1A 1G66A 2GYVA 3N0TA 1GGVA 4FLEA 1AMNA 1GQSA 4C4YA 1CUWA 1LGYA 1BEEA 3WJ1A 2OLEA 2HA5A 4WCVA 1DWPA 4CIBA 4QDZA 2JGEA 1CUZA 4G8CA 4OB6A 2D5LA 4UBIA 2Y1KA 2OG1A 1O6FA 1XLVA 3WWEA 1Q0RA 5JATA 5ALFA 2BFNA 2XMRA 5CH5A 4EY4A 2GYUA 3WK7A 1A8QA 2XUKA 3I6ZA 1QO9A 3AIOA 5CXUA 1ZGCA 1GXSA 2YH2A 3FYUB 3BDIA 1U65A 5IVKA 1QZ3A 5ALQA 5HK8A 1YAHA 1J07A 2HU8A 5ALVA 4FLFA 4EUSA 3H2KA 3LIPA 4AX4A 3I2FA 4UHDA 2AJDA 3D4LA 4OU4A 5LZ2A 4KE8A 1W1IA 5HF6A 3BF8A 1MU0A 2QT9A 1UOQA 3QVMA 5E4JA 3ANTA 5AKZA 3D3NA 3O4GA 4CG3A 2ECFA 4JYMA 2QKYA 3FVTA 4HXEB 2WLSA 3D2CA 4MJ3A 5AKKA 5HQ3A 2HRRA 1CUVA 1UFOA 2XLBA 3OC0A 1WB4A 3V1NA 3WK9A 1HLGA 1ACJA 3WZLA 2ZYRA 5K3BA 3FLBA 1F0PA 1EVQA 3QITA 1G4HA 3MUOA 2XMGA 3F98A 1XZBA 5EHZA 1Y37A 3QMVA 1UK6A 4BAZA 4KEAA 4QDUA 3R3XA 4AO8A 1ISPA 1TQHA 5JASA 1USWA 2PSJA 1MAHA 3HYSA 4E14A 2HA3A 4KR0A 2XUIA 3L1HA 4FHZA 2XI4A 4G8DA 3ZLVA 5EHXA 4B6GA 2XMSA 2RONA 5I7UA 1LNSA 4J3JA 3PFBA 3B12A 3WK5A 2EEPA 4GEGA 4XWGA 4B81A 4Q3KA 4G9EA 4BTLA 1K5PA 1BRTA 5KWJA 4YK7A 1MN6A 3G02A 2RGUA 1WHTA 1F0NA 1ZIYA 3STXA 4Y2JA 1Y7IA 1LPMA 4BBZA 4X85A 1LZKA 1JJBA 5JADA 1QIIA 1AKNA 3G0GA 1UWCA 2HL6A 3KWFA 2ES4A 1MTZA 4BE9A 1HPLA 3C8HA 4CCWA 4FBMA 4QLOA 5EIEA 1VXOA 1PJAA 4CCYA 4B82A 4J0HA 3C43A 3HI4A 2WFLA 3TGLA 1C7JA 2OQVA 3QM1A 4B9AA 5AHXA 4ZGBA 1UK9A 5FXMA 1ZICA 3VJLA 4LYEA 4XJVA 5IVIA 1THTA 4DTCA 1XRPA 1UK7A 1FFAA 2WIJA 3IUNA 3PI6A 1FFDA 3IA2A 1E66A 3H2IA 2JBWA 2ZJ7A 4HXFB 3A6ZA 4MWTA 5YASA 2VT6A 1CV2A 2OCGA 2WG0A 1E8NA 2J3DA 4GLBA 2PBLA 3H18A 3CXUA 5HF5A 4BVLA 4UBJA 4UPDA 3PDCA 1FFEA 4BYMA 3G0CA 3K6KA 1K6EA 2C0QA 1KU0A 2I3DA 2WUFA 2OXEA 4P9NA 3N2ZB 3ICVA 5AKXA 3K2IA 4W1RA 3G9ZA 2EDCA 3F9CA 1G5FA 4AN1A 3WQHA 2PU5A 4BDTA 4Q05A 3WI7A 2C58A 4J0CA 4X6YA 4I19A 2W22A 5HFAA 3ANSA 1ZI6A 4H0CA 4LXIA 4KJXA 5HF9A 1O6GA 4X95A 1BROA 3B5EA 5C81A 4OB8A 2Z8XA 2BGRA 3QYJA 1CUYA 3IUJA 5ALTA 1YS1X 1ACLA 3BE8A 4UBMA 1KEZA 1MX1A 3ESCA 1E8DA 5AKYA 4ZRDA 3OOSA 1ODCA 4HVTA 1N5MA 2FJ0A 2NW6A 3DNMA 3HABA 2QVBA 5ALWA 3VJMA 1CFJA 1XQYA 2WUGA 5ALYA 5ALIA 3TEJA 3WA6A 1CLEA 3H0CA 3WL6A 4QNNA 5AOBA 4G5XA 1QO7A 3DCNA 3WKBA 1E8MA 5JANA 3AINA 2XUFA 3DKKA 3BXPA 4JYPA 2WHRA 4G4IA 2OCLA 3WJ2A 1ZOIA 5ALKA 3RARA 1U8EA 3F97A 4H7DA 4QDXA 1DWOA 3DJYA 2WIKA 4AO7A 5K3EA 3NUZA 5T4HA 3AZQA 2I3ZA 1VOTA 4B85A 4V2IA 5C8ZA 1YAJA 4I4CA 4K6GA 1VA5A 3WIBA 4IQ4A 2BJHA 1XQWA 5HKBA 4UHCA 4QWMA 1XZDA 5T4BA 4AN0A 4K6HA 2QRUA 3FVRA 4BC0A 3EBLA 4N5HX 1JU4A 5DJ5A 4HZGA 1K8QA 3GBSA 5ALZA 3R3ZA 3D5EA 5EHNA 2BKLA 2QXTA 5AM5A 2H7YA 3GUUA 3I6YA 3VDXA 4HRYA 1L7RA 4MQLA 1CUHA 4TGLA 1P0MA 1W76A 2GZSA 3M3DA 1XZCA 4WFJA 4OYYA 5ALJA 1CUAA 2HDWA 3BWXA 1ZJ5A 5FUMA 3ESAA 5JAHA 2O2HA 3OPMA 3PF9A 1CQWA 2J4CA 2XMZA 3DDUA 3PICA 1W52X 3C45A 1UK8A 3AZOA 2O2IA 2HHAA 2HA2A 5AM0A 5ALDA 3KOOA 1W6RA 5CRIA 5JZSA 1Q0ZA 3R0VA 2XDWA 4KRXA 2C0PA 2CKMA 1ZD2P 3WK4A 3WWDA 4KE9A 1DU4A 4LXGA 2QMQA 2BAGA 1JJIA 1T4MA 5LZ7A 4DGQA 2C4HA 4GXNA 1QIGA 3A2NA 2C7BA 4PSUA 4P93A 1TKRA 4XVCA 1R4ZA 2WTMA 3R41A 4G1FA 5BOVA 1XZGA 2X5XA 4QWWA 4P08A 3RLIA 4X93A 5JIBA 3OM8A 1VE7A 2K2QB 1LBTA 4GECA 4FWBA 3C5WP 4MQMA 5AP9A 2YYSA 4U2BA 5A7HA 1EINA 2PX6A 2XUHA 3SC2A 1GZ7A 4ROTA 1K4YA 1MX9A 2HADA 3HLKA 2XB6A 1ODSA 1Q83A 1WOMA 3F96A 4UBOA 4FBLA 4RNCA 3WKCA 2DHEA 2OAGA 2O7VA 3ZPXA 2UZ0A 3DD5A 3I2JA 4BP8A 5ALMA 2J3QA 4KRYA 4DNFA 1EDDA 4YX9A 3IB3A 5D3KA 5EIHA 2VQ6A 5JZBA 4RGYA 2ZVDA 2DSNA 1TIBA 4J0DA 3H1BA 2OGZA 4KE6A 1AURA 5ALNA 5ALRA 1XZMA 2JGIA 2JGLA 1VZ3A 4LYDA 1TRHA 4CFSA 5FKJA 3ESDA 4PQEA 5FRDA 1EDEA 4OCZA 3OURA 4EA6A 4UBLA 4Y2YA 1HDEA 2XUPA 4MWSA 3K9BA 4TPKA 1U2EA 3A2MA 1CQZA 1DQZA 1XRRA 3DL4A 1P0PA 5AI9A 5C7YA 1BCRA 2PU7A 2XLCA 2RHWA 4AB1A 3L1JA 3DQZA 4B0OA 5DNWA 2XQKA 2V98A 5AI4A 1R3DA 1X2EA 5AK4A 5DYTA 1EX9A 2CB9A 3G0DA 4IH4A 2HFKA 3M82A 4WDRA 4KAFA 4UHBA 1CUSA 4CG2A 2QR5A 1LPAB 4JNCA 1W4LA 4FFWA 2OPHA 5A62A 2AJLI 4ZV7A 1LPBB 1JI3A 1XZAA 2WG2A 3WL5A 4P92A 1QJ4A 5LKRA 5A6VA 2CJPA 4DMFA 3WMRA 4CCYB 3IIIA 1GPNA 4QZVA 4XIIA 4O08A 2PPLA 3QZUA 3FYTA 2ZJFA 1FFCA 2RIPA 4OPMA 2ZYSA 4N5IX 5H3HA 3BDVA 4DNQA 2XMDA 3B3QA 4L72A 1DT5A 5A2GA 5AM3A 5AIBA 3O9VA 3ZWQA 4FFVA 1TCBA 1W75A 4OB7A 5E4YA 5HFNA 2WHPB 2H9YA 4F0JA 2GYWA 1LPOA 4ZREA 1IVYA 4M0FA 4X3CA 1DX4A 1M33A 3VKFA 3IVMA 3D59A 2YASA 3PE6A 5D7BA 1R50A 5EGNA 3WWOA 4MEAA 5ALLA 3O0DA 2CMFA 5HQ3B 1EB9A 4FMPA 2ZJ6A 5AK3A 1QIKA 3BJMA 3T52A 2ONCA 5I9IA 5K3FB 1CUFA 3HXKA 3RM3A 4FTWA 3V1LA 1EK2A 5AKLA 4Q3OA 2VJBA 1MT3A 3O4HA 1VJ5A 3WKDA 4Y9SA 5J3JA 2QXUA 1GKLA 4G4GA 4F60A 4U2EA 1ODTC 4WJLA 2Y2VA 5K3FA 3EF3A 4BZWA 2C5FA 4X6UA 5LKAA 1R9NA 3SX4A 4BTVA 5DLPA 4L9AA 3G8YA 2AXEA 4C87A 5CURA 4RPCA 4INZA 2VAXA 4GW3A 3W06A 1TK3A 1QIMA 1UKCA 2DFPA 3O4JA 3VVMA 1F6WA 3WZMA 4M0MA 3DYIA 3JYHA 4LKOA 5CBKA 2OQIA 2X76A 5JARA 1QIFA 1FJ2A 1KU6A 5CXXA 4UFOA 5FPPA 5E2IA 3W9BA 3A2LA 4C01A 3W04A 4DMKA 1XZFA 3STUA 5T4FA 3DKRA 1T2NA 1VZ2A 3Q0TA 3FLEA 4M0EA 2WFMA 2BUBA 3C6XA 4OUKX 3MVEA 1XZKA 2XQFA 1E5TA 4CI9A 4X92A 3D2BA 5JAUA 2XE4A 2JGMA 2HA0A 4Y2XA 5D6OA 5CT5A 2HU7A 2Y6VA 1EXWA 5ALGA 4GI1A 3LLCA 3NGMA 2B61A 2VJAA 4C88A 4FLMA 4CIAA 4HTAA 1VXRA 1NX9A 1XZEA 4X94A 5CH3A 2PSFA 3IULA 2DCMA 5ALOA 3JW8A 5BWCA 5AKJA 1TAHA 4UHFA 4D9JA 1SC9A 1QTIA 1OCEA 5FDFA 1JT2A 4ZXFA 1J06A 1FSSA 3BIXA 4H18A 4ITVA 1XRNA 1QIEA 4X6XA 3KSRA 1L7AA 1N8SA 3IDAA 2ZSIA 4X91A 4RE6A 1BE0A 4Y2TA 2XQIA 5ALUA 1MAAA 3S8YA 3M81A 3L1IA 1CUDA 3FLAA 2H7CA 1JMYA 4A5SA 1IMJA 3AZPA 4KAAA 1GPKA 4DNOA 2ROQA 1H23A 2DHCA 4K2AA 4H7EA 4W1QA 1ZJ4A 3UUEA 5JD6A 4F21A 5A71A 2X8BA 2EDAA 3LCRA 2VJDA 4X7BA 3KXPA 3GA7A 1CPYA 2J4FA 3MUNA 1ZD3A 4MYSA 4BAGA 5IKXA 4UUQA 4QEKA 1JJFA 4E15A 3AILA 4H7HA 4FOLA 5IVDA 2GBIA 5CTAA 4OYLA 4FKBA 1ETHA 2XUDA 4J0JA 5FPQA 5EIAA 5AOAA 3ZI7A 3PUHA 2BUAA 3E4DA 4K6KA 1BN7A 5DYYA 1B6GA 1SFRA 2HU5A 4WFKA 1R9MA 3HZOA 4X90A 1MNAA 5DTIA 4QE3A 1XROA 5HCUA 1QFMA 1QE3A 4PW0A 3YASA 3PUIA 5JAPA 3U1TA 1XQXA 5AI0A 1H22A 5JD4A 2XT0A 4KYVA 5AH0A 3HJUA 4DIUA 5LZ5A 1FFBA 2WQZA 4QDOA 2Q0XA 1P0IA 3O95A 1CR6A 1L7QA 5AM1A 4MEBA 2PUHA 4PV7A 1J2EA 1WHSA 4GWLA 5EHQA 5AI6A 4JEIA 4Y2PA 1MO2A 1YSCA 5A7FA 1THGA 3WA7A 2HRQA 4QA9A 1OXMA 3TJMA 2QZPA 2WJ3A 2C5GA 5SYNA 2WUEA 5FV4A 2WTNA 5AKIA 4BCCA 1J1IA 5HKAA 1ORVA 1WPRA 3E1GA 4X97A 2XQJA 4C89A 1EK1A 2ZYHA 4J7AA 4PF1A 4B83A 5FOQA 4DYHA 5BWBA 3C5VA 3ESBA 1D07A 3I6MA 4YASA 2RI6A 5C8XA 2E3JA 4B84A 1Y7HA 4DSAA 2V9ZA 1A8SA 3JWEA 2BCEA 1JFRA 3A70A
chains in the Genus database with same CATH superfamily
5CR9A 3SCZA 1C5KA 4NFLA 1VE6A 3DV0B 5A2QA 4ZAFA 3FZGA 3LOPA 1QK3A 1EWRA 1ZK0A 4FNGA 2O5RA 2WC1A 4OYRA 2JBHA 1Z7BA 4NU5A 3GPLA 1KJYA 4MTCA 5LQSA 3O1IC 1C81A 4B8YA 1QGUA 4K7JA 4D81A 1CEXA 5JISA 5AJHA 5E1DA 3KQSA 3UCXA 2JKZA 4TKZA 5EA2A 2QI9F 1ONOA 2NSDA 4D92A 3C14C 3IRUA 2WILA 2ZCVA 3S6JA 4LHVA 1BA3A 2AXPA 3WFIA 3AG6A 3IQDB 1GYQA 4JJIA 1JQAA 2QG6A 1A2QA 2PGDA 1ZUNB 3AMVA 3L4BA 4MUJA 2X2PA 1RP7A 1JFTA 1I4LD 2LBPA 3V7FA 4BIIA 3ACCA 3BE5A 3VBCA 3FJ1A 4KO2S 1CQIA 4A8HA 5T7BA 2Z2JA 5HZHA 1F1BA 3JQ7B 2OCIA 4LYFA 4QOSA 1X0XA 3AY3A 1U2GC 1WNFA 1SD2A 2ISCA 2P8SA 4GI7A 2GMWA 4KLZA 3GLIE 1IBCA 3MELA 3R7SA 5JD5A 1P77A 4Z7QB 5L7WA 3JYOA 2VUIB 4TM7A 1OXXK 2PV7A 4RVGA 5ERYA 4PNEA 4GL4A 3KUKA 3OZAA 2PD6A 2JCYA 4MV7A 1ZH2A 3CWCA 3C7KA 1BMFD 2XHZA 5I4BA 2ZSAA 1R8YA 1Y8ZA 2EKQA 4N03A 2Y71A 1WVIA 3RLFA 4WQMA 4B7XA 5AUQA 3TSCA 4JJ7A 2QRGA 3K9FC 5HJ2A 4XEUA 4GM4A 3SIXA 3KM0A 5JAQA 1E1MA 3JTEA 1OSNA 4Z8XA 3N2GA 4DLTA 1S2LA 3VR3D 1HKHA 1V95A 3T7EA 4FU0A 4DCUA 1OC4A 1R0LA 2ET6A 1LQUA 4PQYA 4CFYA 1V8BA 2WB2A 2X4GA 1E60A 1YRHA 1PJ2A 1A5AB 2OCXA 2R8PA 4XIGS 2YYZA 1CLUA 3AERB 3B2NA 4EF4A 1CUIA 2H7XA 3UWPA 5FTWA 5AUOB 4ZJPA 3AEUB 3ONEA 1XAJA 5HKLA 4YPFA 3PD0A 1CR1A 4BFVA 1A8IA 2XXBA 1F48A 1ZLXA 2BZ0A 4GPZA 2C1EA 1ULZA 3GRPA 1E5QA 3IIKA 3AF3A 3N5CA 1RQXA 5DNEA 2K4MA 2V0NA 1DX6A 3LSYA 2AYYA 3Q3VA 1C8VB 3T3EA 1OH7A 1UKAA 3FX2A 1UDCA 4C4ZA 3KS9A 3OH8A 1ZN9A 1KO1A 3ENNA 3CVYA 4OIMA 2DHQA 2Z5GA 5FLEX 2QD2A 4WEQA 5PGMA 3Q10A 3LIIA 2GBCA 1P3DA 2JFFA 3CCCA 3DT9A 1BTOA 1HL7A 4QXQA 1MZVA 3TBHA 3UJ6A 2DWPA 4UEOA 4JDPA 2VXBA 1KGSA 1RWKA 3CONA 2Q6LA 3BL8A 2CXPA 4QRDA 2EFHB 4BO1A 2CXUA 1FPMA 1Z4QA 2KBFA 1Z6GA 2VJMA 1QJCA 2W4IA 4BO8A 4M0PA 5H16A 2A7XA 5BVHB 4J90A 1PU2A 3BHJA 3QG1A 1SUDA 3WRXA 1KAOA 4DC0A 2XVAA 2VTVA 1GPBA 1HKUA 2OSBA 4EY8A 2P9EA 2Q1TA 1F2UA 2A0KA 1N2CB 4YP5A 5H68A 3ZU4A 4ER5A 1UAAA 2MU1A 4R0NA 3KKEA 2BKAA 3E2MA 3KUDA 4BQEA 2EW8A 5CT4A 6REQB 4BNTA 1YFZA 4N3BA 1JHDA 3KOMA 4FHGA 1ZONA 4RSHA 4D0LB 5J2TB 3RFTA 4ETWA 1CUXA 3U7RA 1XNHA 1Q77A 1HMYA 3A04A 1YTLA 4B0PA 4ZGBA 3QUBA 3PCXA 5J4HA 7ABPA 2P75A 5DX8A 1B74A 4Q18A 4MWDA 3GJZA 2DQYA 3HHPA 4P83A 3ZKAA 2ECOA 1AM4D 4EB0A 3WIEA 4ZI7F 1EFPB 1RXWA 4O25A 1I6LA 3AEXA 1MCZA 3H9BA 2JHGA 4XE5A 1GQQA 4LPKA 1S2DA 5K0SA 2VSNA 4O2RA 5GTDA 4YUAA 2ZR7A 3LRPA 4UNSA 4X20B 2FPOA 4YCSA 4V0MA 5BQFA 2CNDA 3G2HA 3I72A 1XYGA 2GK4A 1GGFA 3BAZA 3D4BA 5BRNA 1XJWA 2ACVA 3MIIA 3TG2A 3TRDA 3C1TA 4H31A 4QHSA 4BKUA 3KQOA 3L0BA 2HA6A 2Q3HA 3BXXA 2EZ4A 3KSZO 3HBAA 3QKIA 4ZTBA 3U62A 5JEEA 3HXMA 1J0BA 3NDBB 3IMGA 2ZJZA 3NT5A 3RHZA 4LCEA 1PWZA 3TOXA 1UBTS 2ZBVA 3PWTA 2Q8NA 3JWJA 4P35A 1DHRA 3DUWA 1FF9A 1HQKA 1A9ZA 1A4RA 1ISMA 1F06A 1M6VA 2HY7A 2O48X 4M21A 3RTGA 1PS0A 3RU9A 1CVLA 3WLAA 3FBTA 3HUDA 3KQNA 3GFVA 4MS4A 6GPBA 3D8BA 1EQ2A 1N2GA 2P9JA 3FTQA 3FOAA 2PIAA 2OGSA 3H65A 4BAUA 1YWGO 1U5AA 4QEZA 1E2EA 2RAUA 5H81A 4HNSA 2CEAA 3BH7A 3WL8A 3G9UA 3JAWA 3IPCA 2JEOA 1MABB 2HXSA 2M6RA 2ZYVX 4HUQA 1GQ2A 1YFKA 4QHTA 1F4PA 3A4LA 2BEUA 3HDHA 3AEZA 3CLHA 3OUZA 2BE7A 3PWKA 2OA0A 3UM9A 4B6OA 1OB5A 1G59A 3I23A 4ZVLA 1JL3A 3FB1A 5E1OA 4YCCA 1JPVA 1LY1A 3UWDA 1BN6A 5JJBA 1FDUA 2WSYB 1C0PA 2X3YA 5FFNA 2TECE 3PUVA 1QRAA 4B80A 4PICA 1Z5WA 4LDQA 1NVBA 3HB0A 3L06A 1L7XA 1PK7A 2Y27A 2X19A 3LT1A 4KLNA 4MGKR 4NCIA 5BQOA 3ZOZA 3RYHB 5EJ5A 3F2VA 1W36C 1XHEA 2WMYA 4ZK6A 4YECA 4WOBA 4S04A 1OH8A 1ZGBA 4ZVNA 4G85A 5DXJA 3D5QA 3L4BC 3MSXA 4RHEA 4W5NA 1DRJA 2VYCA 2BGJA 2PUJA 4KXVA 4FWTA 4PXAA 4CL8A 2IYFA 3OF3A 3CTMA 3B6JA 3CH6A 5B57C 1RM4A 4FYHA 2G5TA 2V97A 3KYDA 4X7PA 2ZKLA 2DPXA 1H2ZA 3GVCA 2FRVA 3IAHA 4DLUA 5IT9A 2C00A 4N01A 4ACBA 1BHSA 5EXXA 1NZDA 3W05A 1OZGA 4QHYA 1AUQA 5KKNB 4K9LA 2BYTA 3R4CA 3EDYA 4MDYA 4Q3NA 1MGOA 2DXIA 4DSZA 5K0NA 1XF1A 4Y8VA 4H6XA 3F9IA 4BJ3A 1Q22A 2VWHA 4K81B 1WMAA 4O2BB 2I3AA 5DTEA 3GFFA 3W2TA 5A04A 2VZEA 4B45A 2V9CA 4HAOA 2D59A 2HK9A 1DKOA 1R6BX 3U60B 3AR4A 2XSZD 3OTQA 3I1YA 3L8DA 1MX5A 4F04A 1EE2A 1DIAA 2PIDA 1DQPA 1FQKA 1WE2A 3SK0A 3WWCA 1NC1A 3RK0A 2NYVA 4HB3A 4Z3DA 2ZRKA 3C2QA 1R4MB 3LUAA 1U8YA 5E95A 1N0VC 3I92A 8GPBA 1IUNA 1XDZA 2Y66A 4UXHA 1KP3A 2ADOA 4I50B 3CB2A 5IEBA 1QRSA 4B5KA 1W85B 2ZREA 4JIGA 4DR1B 2LKDA 2D1FA 4KMOA 4PM4A 1BU5A 1PWYE 4GWKA 2VCEA 1NOKA 3QEAZ 4HFJA 3ELBA 1UZLA 3HKBA 3MCZA 1XD9A 1N6NA 5L4SA 5J2UF 1FFSA 4CLHA 2VI5A 3AM5A 2C20A 3MUEA 5C34B 1R0ZA 2HM7A 3GYGA 3I8SA 4YI3A 1GN8A 2IOFK 4YXWD 3O9MA 1HC7A 1V4VA 1VHDA 4NX2A 4ZGGA 1OIWA 2P4QA 5COQA 1VMAA 3BCRA 4MS3A 2YOHA 4HXGA 4IVRA 3JVUA 2AJCA 2BI7A 2VP6A 3DP9A 3DVSX 2NV2B 1ADJA 4YUVA 4M7PA 3GRZA 4H1WA 4OGKA 1E2NA 3SHQA 4FDMA 4MVJP 1SK9A 3ZBUA 1RPJA 4JJ6A 1ZCFA 1GAEO 2GZRA 2P9TA 4AULA 1Q2XA 2JLBA 1L7PA 1QG6A 4J0IA 1A9XB 2OZLA 3D54D 3I04M 4MHSA 3T1HB 4WL0A 3WSWA 5E8JA 4HZUA 1YTUA 3OU2A 4AF8A 5K8CA 1QV7A 2ZRMA 1IJBA 1IN7A 3JALB 3IYLW 3ZV3A 5BXQC 2YZ2A 3AUAA 5F35A 4RDCA 2XCUA 5BNTA 1H8ED 4HB4A 3H99A 3SSMA 4DCSA 1E2LA 2B9VA 4NTZA 2WJ4A 4BJ1A 1SUFA 3FDJA 4M99A 1OJ7A 4NDAA 4MWBA 3VVCA 3EW7A 4F7DA 4J0QA 3K4PA 2PL5A 1M0WA 1DXOA 1LI5A 1ZW6A 2BM1A 3WGVA 3QENA 3IALA 3ETCA 4R84A 4C7VA 1O89A 1M7GA 1WL8A 3NM6B 4NRDA 5ADUS 1EDBA 3UV7A 5ELXA 3H5TA 3R24A 1IZ7A 2HSWA 3AJAA 4JX9A 1CZLA 4JJFA 4DMGA 4G9GA 3RU7A 1MJHA 4LZLA 3AERA 2FKNA 4B3MB 1PGNA 2MINB 4U2GA 5IC6A 3GJQA 4U7FA 4TKMA 4JBXA 2R1TB 3RJZA 5AW8A 1L6RA 3B6EA 3PZBA 2GPBA 3S5JA 5FYDA 3HSSA 4HLDA 5CLGA 4C1NA 2E6KA 1V8FA 5EMNA 5FFMA 4DJAA 2FPLA 2ZB7A 4OHYA 1RHMA 4EKDA 4HX5A 3KELA 1RJ9A 1MH1A 2M1ZA 2P91A 3PHCA 3QWHA 4FCCA 3RREA 3W7BA 4DRXA 2B8TA 5CT9A 1FVOA 4BX0A 4QC2A 2DR0A 4CEIB 2NUTA 1KJZA 1B8UA 1VFPA 2JFNA 4I3FA 2VAVA 2BMVA 4X61A 5GGYA 1QIJA 4BKPA 4CQLB 1YZFA 3PXUA 4RAQA 3RK4A 1YV9A 5HVNA 5KTNA 5GJVC 3WLPA 2VHCA 1X1BA 1JHXA 4RL4A 3ZWPA 3UC5A 4KMMA 5K1ZA 2QU8A 3SE0A 1I2AA 4LCJA 1ZINA 1RMTA 4UU8A 1JKJA 1MF7A 1QHNA 5LQMA 1CQIB 2FW7A 1X6VA 4OM8A 5DTJA 2WTUA 2ZOSA 1G60A 5EQTA 5D2CA 4PRKA 3N3BC 4RVSA 5HFJA 1ORRA 3PRJA 2O8DA 1P9WA 2QN3A 3DHEA 4HQFA 5GM2A 2ZJ5A 1DKLA 2AFIB 1P62B 3DAOA 3OZDA 1WPQA 1R5BA 4RPIA 5IAKA 521PA 5I7FA 3ZWYA 4UUOA 4XRRA 1OZFA 4KIUA 2WMOB 5T41A 2EXXA 4IVQA 1ZM9A 3HXOA 4C6HA 4RD3A 2JIRA 3R7BA 5IJ9A 5JJLA 2QTRA 2XE7A 1U4NA 2V65A 2VP5A 1RADA 3TRFA 1CHDA 2E4ZA 4A2CA 2VT2A 3RTCA 2HGSA 1I5RA 2ASVA 2C2WA 5IW8A 3WYAA 5GY7A 4AJLA 4ARSA 5LIPA 3S1SA 2JLWA 3GT3A 3AP2A 2JHCA 3X1MA 2X8LA 2A9VA 1I3LA 4J9VA 3W79A 5GJBA 1HSZA 4B3JA 3LZ6A 2YZMA 4LECA 2ORYA 4A23A 2CL7X 2B35A 3CSSA 4NULA 4C0AC 4CCAA 1YO6A 4LZPA 5E7MA 2WIGA 4CYMA 1C0EA 5IH7A 3MD0A 2GBFA 1RWQA 4LE1A 2SICE 2NUAA 1RRMA 3KJIA 4Q1BA 2DH5A 1R27A 4PY2A 3FCUB 3A05A 2FZKA 3BMCB 2DRIA 4QGAA 3S99A 1H05A 1R4NB 2OEPA 4DZZA 1OLXA 2PGJA 2RK3A 3BA1A 4H7JA 3IUQA 1TK9A 1DIHA 3QI2A 4E5SA 2J30A 1ZXBA 2JC3A 2B98A 3C1AA 1SQ5A 4TVSA 1GRQA 5DHPA 2I76A 4B3DA 3G7NA 4MWCA 4E5VA 3KLBA 2O23A 4OJNA 1DC3A 5AI5A 5HJ5A 3CZMA 3NGXA 1XZHA 4R9VA 5CVEA 1IY8A 2XGGA 2A7QA 3JXEA 1N92A 1IUOA 3HMKA 1QPBA 2PGXA 1BXZA 2QUAA 1I1HA 3NCTA 3O8OA 4J0KA 4RJIA 4TOIA 2Q2VA 5T4EA 1NVGA 3ANLA 4G0VA 2O8CB 1N6KA 4EJ2A 4QFCA 5AFSA 4CT0A 1FMJA 2VJLA 4AVYA 3O4VA 2G5GX 3KLPX 2EX4A 2OP0A 4UNPA 4H4EA 4Q01A 3UG6A 1HXHA 2JGKA 4G5FA 4HBZA 4URVR 4CIWA 2B4RO 1C3OA 2GKSA 1JR2A 2QJRA 1VLQA 3CGGA 3CUWA 1SELA 3ZEIA 4BX2A 1RYFA 5FWAA 2NU6B 1B1CA 4WA7A 3RFVA 1LK7A 1GZ5A 1T8UA 4WFQA 3AOEA 3ZWCA 4HDAA 1OZAA 4P84A 1N6RA 4DV2B 4Z51A 5DMHA 4PX3A 4D3YA 1GZHB 4PYQA 1Z12A 5CJ2A 1YR8A 3A7EA 1QFSA 2QUJA 2YJNA 3A6EA 3FPBA 4G26A 3VU8A 4BFWA 5KWVA 3LT0A 3FHTA 2OHGA 5D00A 3I32A 2MSWA 3V3TA 4QTTB 4FEAA 4B4VA 2C54A 4JSRA 5D5PA 5DGIA 4AJNA 3I39X 4FYJA 4Q0MA 4F4DA 2HREA 3LBNA 3KKNA 3H84A 3L04A 1T9GS 4WZBA 1YS9A 5E3JA 1NVMB 2EFJA 1CZHA 4XTRA 4BFCA 1OV6A 1VKJA 1QYXA 5K6AA 4OVKA 4D80A 1PHRA 2QG4A 5A4FS 5AJTA 3VH3A 2WJJA 4MR7B 1FFYA 1RQNA 3DAPA 3KV1A 4MQ6A 4F12A 4BKRA 2QL9A 2IOQA 1UMCB 1BXKA 4QFMA 4C4AA 1BXRA 1FYVA 2NYUA 3OM0A 3S7TA 3P0JA 3WYCA 3QYAA 3RU2A 3I5UA 2QVGA 3S81A 1H1DA 1P91A 1LF0A 2HF8A 4C3OB 4BECA 3L7BA 1X2BA 1XNJA 3AR2A 4OGWA 2XTNA 1ZITA 1AHHA 1XZLA 3NIBA 3Q0IA 3ZV7A 4RHXA 3GZJA 3NW9A 4A73A 3GUCA 4FT2A 5LOVA 1KQOA 4TWAA 2CXQA 3U9TA 1E3LA 5AMXA 3F3KA 4KOEC 1D1TA 1TM4E 1ZK1A 1V5WA 4CNBA 4WZ6A 1Q2UA 1FDSA 3PFGA 4IP0A 3DXZA 1VA4A 3M9XA 1RAHA 1Y81A 1UL1X 1KMIY 3OQIB 4EKIA 4WY8A 4ESOA 1YL6A 1AC5A 3DEJA 3ASYA 5FPHA 4D0GA 4O0LA 1X1EA 3KAJA 1NN3A 4GG1A 3AFIA 4YH1A 1UQTA 1XUOA 721PA 4EJ0A 4F46A 3KWMA 3TBKA 1V5EA 2VXCA 2REQB 3OAAA 4PNZA 3SQXA 1WABA 4YCJA 4TZ6A 2ZTHA 1DGQA 1Y1LA 5JNSA 1N5JA 4AIIA 1V9CA 4MGYR 3V33A 4UM8B 2FP4B 1K3TA 3HA3A 3G6WA 1EH5A 4RIGA 1YCDA 1LPSA 2X6QA 5EP1A 5C2JB 3Q8MA 3VR4D 4OFWA 4MICA 1Z56C 2ZB2A 5ALHA 3V4FA 3OECA 1C8BA 4F5YA 3WKEA 1NVVQ 1R7RA 2QL5A 1DJLA 1RLOA 5JCPA 2EJWA 2RG1A 2WJGA 3K2BA 3KQUA 1RFLA 2IYQA 2YZNA 4L74A 5JXGA 1FX0B 1Z15A 3UMBA 4R7TA 2Z3WA 2DP4E 3T5BA 3SLKA 4P86A 2O1EA 4LC1A 3EIFA 2AUMA 4YI5A 1XFAA 3N2LA 5TEWA 1OFGA 4FHEA 2W43A 2XVXA 2VZ8A 3K5WA 3QA9A 4MVJM 5E9WA 3FKJA 3RF7A 4EQ6A 1TK2A 2QMEA 2PRKA 3GJRA 3D43A 2REOA 4LGCA 3EW9A 2Z56A 3IJ5A 1FS5A 3VPGA 5K3DA 1SCQA 4PLHA 2Q6TA 4OOEA 3SJCA 4BB0A 2OG2A 2OYCA 2PMEA 5BSHA 4RULA 4LJSA 1EXNA 5KWSA 1MB3A 4DMMA 3C3KA 1FOEB 5B5SA 1H4QA 4A36A 1S3SA 1JW9B 2C0CA 1C7IA 1FMCA 2FHPA 1XMPA 2NO5A 1Q95A 1QORA 3REGA 5LUBA 1RQRA 4B3IA 5CB4A 4L85A 3KR0A 1V6SA 3HEAA 1QGOA 3QWIA 1JB9A 1VPEA 3NVKI 2GEBA 5H7XA 4RLHA 3PXXA 4I1SA 5KTMA 3U7FB 5KQLA 2EP8A 4C30A 3MGBA 4GI2A 4FQ7A 5ALPA 5LSAA 4II2A 4CF7A 2J87A 3IP3A 3QVLA 5JSQA 2ORVA 1M2HA 3LL4A 3M5CA 1FU7A 3B1KA 3CFYA 5I8ZA 1UWLA 4GH5A 2IIQA 4EMSA 4F6CA 5KINB 2ZWIA 1U2PA 2WKQA 3PTLA 4KO4S 4MI6A 4PCAA 1MNQA 1EB8A 3DP7A 4G36A 3P32A 2WFZA 3D0RA 5LMUB 2JIDA 5CFRA 5LQCA 1KJ9A 2C2GA 2VAWA 3KX2A 5KYXA 1CEYA 2PZGA 2LIPA 5DGHA 4AQDA 4X84A 3CNHA 1CF2O 1CZNA 2WU3A 4MJXA 3U37A 3WL7A 1EVJA 3NBZC 1QHHA 3CW8X 2POCA 4GLLA 2YVKA 5DSZA 3VSEA 2OV3A 3KFVA 4CUJA 3PXAA 3IXQA 1MTOA 2GN9A 2VLIA 2GAJA 4P7FA 3EFBA 4TTTS 4XASA 4KWIA 3RE1A 2RH8A 3TEMA 4NEQA 2WF6A 1YQ9A 1EVKA 3BA6A 3ND5A 2UUOA 5FPYA 3ST7A 4NXNB 2P6PA 2JRCA 2NV6A 5C8DA 1BMDA 4BLOA 2IYLD 2A78A 1JZTA 9LDBA 1DHTA 3ONDA 2O5EA 1MKYA 2QVCA 4N5MA 2JA1A 3GPIA 1DBQA 1ST2A 1NW4A 4KQ1A 3AB3A 4EF6A 2H63A 2AQIA 3KYIB 3REQB 4J75A 4NFYA 5CDYA 3PFHA 5BT9A 2B2NA 3KOYA 3NUQA 1H2XA 3IP9A 5AICA 1QVZA 1FSPA 1RNLA 2C3UA 4Z2YA 3HCPA 4BMZA 1Z47A 3HH8A 1EK5A 4HX2A 4K28A 1NBHA 4ZCRA 3ZE6A 1EWQA 3A28A 3GGCA 4JLOA 3PDIA 4D3DA 2IZ7A 2OCKA 3C97A 2YWCA 2BGNA 2I4LA 3D7SA 3DHYA 4MQEA 4R9SA 3OQMA 1Q3KA 5CW1A 4ARZB 1AH2A 5JO9A 1HQDA 3CPHA 3MRXA 4NARA 4KI7A 3X1XA 1C0KA 3REFA 1NJSA 4ZQFA 4B7CA 3JY6A 4J0FA 1DBVO 3JQFC 1U1IA 3FYUC 4TQGA 3K70D 2ZIWB 1QYVA 4LE2A 4JP1A 1T2FA 3KQLA 1S2NA 2IZZA 2JL1A 3Q0EA 3S2IA 5CM8B 2AS0A 3EZNA 2OXTA 5B7NA 1CEEA 5LXTB 2VR1A 4KQMA 1OAOC 3VPHA 2ATCA 4UEQA 3U0VA 3UFXA 3ZS8A 3RANA 1Z36A 1WLYA 2B1QA 2O9JA 1S8OA 1SCAA 4OYHA 4WGGA 5HTOA 4LF8B 2XADA 3E7DA 3H6KA 3UJNA 3GFBA 4Y1EA 1SHJA 4I9NA 2XYHA 4CKEB 4W5HA 3TI9A 4WN3A 1ESDA 5TF0A 1I6WA 3PDIB 3SDZA 4DM7A 2BMDA 1YJXA 3NBKA 2CEKA 2OLKA 5JT1A 4LMBA 5BNZA 4MI1A 3R20A 2PMFA 2GM5A 1X70A 4FHDA 1NV9A 2IEDA 2ZS9A 4IHKA 4JJ8A 3ROPA 3DAHA 1WPXA 5JCJD 4PYIA 5JZ9A 3NDRA 2VYQA 3WWPA 4RK7A 4TV9F 4ZQIA 5THQA 4JJ4A 1X15A 2I78A 3OJWA 4LRWA 3S5UA 1CJSA 5ALXA 4XOUA 4DABA 1JIQA 4XYBA 4EHBA 5JWHA 1ZIDA 3ENQA 4M1WA 4HEQA 4Q34A 5D3QA 4NEHB 5FO0A 2ZAMA 3I01M 1O94A 1KC1A 4L73A 1WSAA 2GEDA 1GA1A 4HDMA 3A7DA 3H0KA 3HXLA 3GIWA 4MEJA 4KSCA 3SEQA 3DONA 3FSGD 4K03A 4IHJA 4OQLA 4TV8A 2JF0A 5BRAA 3RYCA 3GLHB 3PFCA 3VO9A 2RI0A 4IOMA 5DYNA 3W2FA 2AQ8A 4AYTA 1Y3AA 4DWWA 1H2HA 3C6YA 3T3PB 1BFDA 5JNRA 4QLAA 6YASA 2AF4C 4BX9A 3BFXA 1P7CA 1O9HA 2C95A 4NMMA 4DVJA 1NIPA 2HCFA 1EK0A 1UBLS 3EQ8A 4PBRA 4QODA 2G1UA 3KB2A 4FYPA 3LU1A 2ZAYA 4XA8A 2G88A 2ZE5A 4XJSA 4BFSA 2GYYA 1XA0A 3STWA 1P7PA 4ZOQI 3H19A 4Q9JA 4OP1A 1P0QA 3GCZA 2FOXA 2G9NA 3GD7A 2COKA 2AHOA 1JHAA 2X40A 1MB9A 1TKCA 4HEHA 4PVDA 1IAVA 1JQLB 3WMEA 5IBQA 3R8XA 3OESA 1GR0A 4FEYA 4QBHA 1I1NA 1P1IA 2O06A 3W9SA 1T0IA 3FBGA 1U0BB 2H1VA 1SKMA 2OCBA 3JASA 3P71T 5ES4B 1SBCA 1TJ4A 4YJFA 4BZZA 1W5BA 3N0TA 2OBYA 1GGVA 1EAYA 2R6CA 2HO5A 3CEAA 2DYKA 1S2GA 1A3CA 1GQSA 1QFJA 3L84A 4Z86A 3AUUA 5SZHB 10MHA 1UXHA 3SVTA 4WCFB 2B7BA 1H69A 1FUKA 1T34A 2UUPA 2WJVA 4EFNA 3Q7QA 1GNPA 3QF4A 5G4KA 3UOGA 5BPHA 3LZCA 3MYRA 2RE8A 2HA5A 3D6AA 3GJXC 3N39C 4AZTA 4BO7A 3BUSA 4C5CA 1XMIA 4NJMB 3KLOA 1U2GA 4MW5A 1ECLA 2JGEA 4YAIA 3OZEA 5FI3A 2H2DA 1Z6XA 1N2CA 1T3SA 2D5LA 2H2WA 1DUIA 4Q4HA 4UBIA 2Y1KA 1CS0B 2R68A 4X8OA 3WGZA 5BUSA 2P4SA 1XLVA 4KNVA 4LHWA 3VKHA 2AKEA 1E61A 1EQUA 4ZAXA 4QJIA 5CJJA 3VO1A 2XNJA 1SUIA 4FI3F 2HWYA 4ZT2A 1QO0A 2HJSA 3U16A 2YUIA 1H66A 3I53A 5CIWA 1X13A 3PUWA 4YDSA 1YU6A 5DOZA 1SWVA 3TSOA 1R6AA 3I6ZA 1RPZA 3DTYA 3T38A 1WMEA 3FUCA 2FG6C 2RKWA 1ZU5A 3A3PA 3AIOA 4IQFA 5CM9C 3WSVA 5CXUA 1HE4A 5D7NA 4ZT4A 3CO5A 1QCYA 2HUNA 4E3WA 1YQDA 3FYUB 1J8VA 5FUWA 3T7CA 1KIAA 1PEKE 3SS9X 4TMZA 4JLKA 1K8ZB 1R0CA 2H07A 1AOXA 3QXCA 1RI4A 3BCUA 4IINA 4IS2A 4IVPA 1YAHA 1XTVA 4UNIA 1SPXA 1U80A 2IYZA 3TH5A 3KT3A 1NATA 3ZCPA 2ZCJA 2VP9A 4OXXA 2HU8A 1JDBC 4J7XA 5EE1A 4EUSA 4A7PA 3HUEA 4WX2B 2Z5FA 3I58A 1WX1A 1RJFA 1EFKA 3CRW1 4FOPA 3ROFA 1AXEA 3MWDB 1JSLA 4PLGA 5DH9A 4YT5A 2NUPA 1DC6A 1QP7A 2VDPB 2BBWA 2ZBEA 2GETA 1N7JA 2WWTA 2LE0A 3OEHD 3ZK8A 5HF6A 5KYWA 1NXQA 3BF8A 1GPJA 1BFKA 3RRFA 2FOIA 3B20A 2YJ4A 2QT9A 4BN0A 2XOKD 4PSVA 1BS2A 2JCSA 4M3NA 1QHIA 3TAXA 3VUEA 3ND8A 3HJFA 5AKZA 5KVQA 1T5LA 1E4EA 1BZYA 2FR8A 5CEEA 1NI3A 2ZWPA 5P8WA 3G6KA 3BD8A 2BM0A 2GASA 2ECFA 4P7KA 4IRUB 2CWDA 4TKUB 5NLLA 4LRQA 1YK0A 5AYVA 3M0EA 5CA1F 2PT7A 4KXQA 3OUTA 4GOOD 4OL0A 4EIWA 5C80A 1X92A 3QVWA 1U1CA 3D2CA 3W78A 4F38A 3QEBZ 4JXZA 5AKKA 5HMLA 4ZIRA 4NV1A 2JVJA 4IXNA 5KYVA 3WLRA 1E92A 5HS6A 3H0EA 2C4KA 5U9CA 3EPRA 2AFIE 4EW1A 1W0JD 2GNPA 2ZPAA 2Q28A 2PUCA 3LGAA 2W6IA 3WDMA 2P68A 4IDOA 2VH5R 1GG8A 4BN4A 5AVKA 3IO3A 4GPTA 3N8IA 4FUTA 1VL5A 3WK9A 3SHVA 4DZTA 1Z28A 3MT0A 3WZLA 2ZYRA 1LSJA 1MC1A 5K3BA 4CKBA 1B00A 1EVQA 2NZ8A 3HJTA 3HVJA 1SBZA 2VF7A 3EDQA 5AJWA 4D8VA 3JQ9C 3AJ9A 1U7XA 5EJEA 4TQ9A 3AHCA 2IS1A 5JMTA 1XZBA 1O5TA 3NO4A 4ZDIA 3AFNA 3JZMA 2ZP1A 3REQA 1H1LB 4O2BA 5F23A 2P2CA 5KSYA 4KEAA 1F2TB 4QDUA 1D2NA 3NYIA 1RAAA 3GA5A 4ZRNA 1NNSA 3P2OA 4RJTA 1MD9A 4BO2A 3UJDA 3TE6A 3M6MD 2QI9C 4TXJA 4NAVA 5C9ZA 1XR3A 4N39A 5IXSA 2X9LA 3T5CA 3VR4H 2DX7A 3D8HA 1Z13A 2PSJA 3G1TA 4KLCA 2BBSA 4FE7A 5HKOA 5KIAA 4E14A 3IP8A 3LY5A 1LRJA 2G6BA 2UYHA 3P1JA 2O2DA 3FE2A 1JPUA 1KMHA 2X8WA 3LPAA 1XYYA 2Z2KA 1X7XB 3KQPA 3T7IA 2WPNA 5C1IA 1CJBA 3AXSA 5T8KA 3T15A 3OPYI 3QXSA 2XI4A 2HRBA 2QZJA 4FPXA 5AVUA 2XGJA 4C06A 4S05A 2DB3A 3Q3JB 1XBTA 2C8LA 1T9DA 2QRVA 3J81k 1GEGA 1H2EA 1YQGA 3IXLA 3JWGA 2VH1A 2RONA 5KNLA 3U7QA 1P2BA 5FUXA 3SF8B 4DUZB 2FMHA 4D4GA 5HOEA 5J43A 1TPZA 5BUCA 1WIWA 3QA3E 2EEPA 1Z7WA 2A9QA 2P3OA 1V45E 3PCTA 2P1DA 1G6Q1 2BMWA 4XVQA 3L4JA 1SBHA 5J4YA 3U3DA 1S02A 4F4FA 4DPLA 1RIFA 2EW1A 2KLHA 2O3QA 2GFQA 3G23A 2HKIA 3OLQA 1GZUA 1K5PA 3GLUA 3NDJA 4KPFC 3EPJA 2C7RA 4CM9D 1GG2A 2J0EA 4YRGA 5AHOA 4XPZA 4D7AA 1XVVA 2IVZA 2B4YA 4YRPA 1K6MA 3CS3A 1HG0A 1ISSA 1F8YA 1QSGA 3B1YA 1A9TA 4G1CA 4GR5A 3IT3A 2PV0A 4XTCS 1FLVA 3UHOA 5LFAA 5M04A 2YY6A 2WZQA 4R31A 4HQRA 1J5EB 4K6MA 1DKNA 1WXGA 1NXPA 3H4IA 2Z5VA 1WY7A 1CDEA 2Y4NA 3SBDA 5AUNB 4PAGA 4WOJA 3ZD9A 3ZNQA 1ZIYA 1MIOA 5A5GA 3STXA 4H3HB 1LPMA 1PYDA 4YAWA 4X85A 4KTTE 5A3VA 1DO2A 1VHJA 2CVOA 1BEUB 1H42A 2XB4A 5JADA 5AVXA 3QG5A 1MJGA 2FG7C 3MFQA 3H4MA 3AESA 1E3DA 2ZROA 3SQDA 3EGOA 4RTSA 3OKPA 3KUXA 2V4ZA 1LC0A 5A4IS 4L0MA 4Q4JB 3FPGA 5KYKA 2HSEA 1O0SA 4JQSA 4BE9A 1J56A 3DE4X 2Q0QA 3S70A 4FI3C 4CCYA 5G4KB 1SY7A 1W59A 4NYMQ 4JYBA 3F9RA 5FUQA 4B82A 3PGJA 2GPYA 3F7TA 2FPIA 2IYYA 4ZCSA 3W5HA 2W4QA 3GDHA 4OQ4A 4AY2A 1Y8QA 4K3VA 4BYGA 3THYB 2UZ1A 2DE0X 2J3KA 4RKQA 1MMFB 4QBFA 2X7HA 1BO6A 1Y1SA 3FZYA 2VTBB 1LV7A 2PXHA 4PZLA 1FNSA 3SQNA 3PXGA 2GDZA 3DE6X 3LC7O 5IT4A 1T1GA 2GPJA 2N46A 4JLPA 5JW6A 2FPUA 1DO8A 1XL1A 1YGPA 5ANRB 3VHXA 5KYYB 3UT0A 5LM3A 2H7VA 1E5VA 2A5DA 2HK6A 3KL4A 1CR2A 1RS0A 4N4AA 3ZHXA 4HAWA 4DTCA 1GGHA 5BN1A 2CVZA 5BRJA 1NYLA 4YJHA 2GF9A 1U0LA 3NEPX 4FC7A 4YJ3A 1MXHA 2VHWA 2XA2A 3LKBA 4XSVA 3DLHA 2BGMA 4M1SA 1UK7A 3MQ4A 2DFKB 1U2RA 4CTNA 4ZEMA 3KYDB 4PX5A 4R2KA 4S0ZA 2WT8A 5CB4B 2HR1A 1CR4A 1AIPA 1D4AA 1NASA 1O9BA 1REQB 2V6JA 3W6ZA 1TIPA 1WSBA 2I2CA 2R7KA 1NQXA 1NVEA 3JQFA 4Q21A 3T8YA 1I9CA 5C8YB 4TVBA 3ZEAA 2PZKA 3IA2A 4I7EA 4DAOA 3IMEA 1ZU4A 2CXXA 3D6FA 1JNXX 2JBWA 1OLUB 3C85A 2WB4A 3DWIA 1NSFA 1EAMA 2VUTA 3N74A 3A6ZA 5CFNA 1U7PA 5EPEA 2GHTA 1NV8A 2VT6A 3EVGA 4XEHA 4B47A 1CV2A 2HBRA 3R4VA 5A4AA 4AS1A 2N0SA 2QE7D 3AUJB 4GLBA 4RENA 5LQJA 2VRCA 3FFXA 3OX1A 1QX4A 5DTMA 1WQ1R 3BGVA 3KPJA 1VPLA 2NQTA 2OC4A 1KVSA 2AZDA 1XVLA 3KR1A 1Y42X 3RGWS 3U4CA 2ZSKA 3G2QA 3G0CA 4RVNA 1HFEL 3LMKA 4IX1A 3HCCA 4BYMA 1R0YA 1K6EA 4IIEA 4KHZA 2VNJA 3BERA 4TYQA 4GGPA 1YULA 3QBTA 4NJMA 2WF7A 5LA6B 4YRKA 1Y5RA 3A31A 2R65A 5KSZA 1GO2A 2F1OA 1XV5A 3G9ZA 4JK3A 1MAUA 4YWJA 3QFTA 1MO3A 1H85A 2XYPA 2V3VA 1DJOA 3TXAA 2WU0A 1E2QA 1THZA 3LVBA 2C9MA 3HXPA 5BW5A 3V8PA 1MW9X 2O3TA 3D6UA 5CNJA 1QQAA 2RHJA 2VHUA 5D01A 1K6IA 3NIDB 4LBVA 3R5SA 1TD9A 5K6TA 3GFTA 2FQYA 2W22A 3RVNA 2PNJA 2HPHA 3S2GA 1DARA 3ANSA 2BKEA 4Q1EA 2CMHA 1J00A 4DLSA 4FB4A 4D3ZA 1PTKA 1VIVA 4D43A 4H15A 3NHJA 4Q47A 2BFEA 4H0CA 3ZW7A 3E81A 1W5EA 3WLQA 2Q3DA 1A69A 1C7ZA 2V59A 1O0CA 1OWNA 3L7CA 2Z8YA 1I5OA 1G5TA 1LJUA 4LJ6A 2AG8A 1OBCA 1A7AA 3O1LA 3OAAD 4Q7MB 1H5NA 4X95A 1S5PA 1YE8A 1J9EA 1QV9A 4CV3A 1T5TA 1NSYA 4B32A 3HNOA 1N2EA 3LKDA 5DYGA 3V8QA 4YV2A 5IT5A 2W2QA 1RZRA 3OPVA 1ISRA 3DFKA 4DKJA 5HSGA 2ZIEA 2J5XA 4IIJF 4RQBA 2JH3A 2RB5A 3MBKA 4Y1RB 1DOZA 2J6BA 2QF7A 2BGRA 3CVOA 3V97A 3PC8C 1JKIA 2BFFA 1ESNA 1MFZA 1UBEA 4PSAA 2A9KA 4QGGA 5C4MA 4KH1A 1TU4A 3KZXA 4YLEA 4M9RA 2W58A 2IIBA 3EMKA 4NBRA 2YIJA 4KDRA 1QM5A 4RD2A 1CCWA 4DEYA 4Z7OB 3NPAA 3L7LA 4TZKA 4O29A 4QARA 2V4MA 3HV0A 3MPUA 2IDMA 2WMNB 2AG0A 4ZRDA 1ODCA 1N5MA 5JRJA 2QM8A 1WEKA 4LF9B 2VTKA 4CIDA 2GZ2A 4ZHQB 1O57A 3CR8A 4CHTA 2V7XA 2WUGA 4L16A 4E03A 1VIMA 4LSMA 3DE2X 2JKVA 3MHPA 1T8PA 1G0NA 2WD7B 3BBPA 3IOMA 2EKBA 3HNPA 3L3BA 5C3MA 1D2RA 1RXIA 3MNFA 3SLRA 5ES3A 4DANA 3LLUA 3WJAA 1GUFA 1P8AA 4P33A 2E1PA 3WL6A 4QNNA 3QTBA 4PGFA 2C4UA 2ZAIA 3UC9A 4ZVOA 5IRCD 1IBKB 1WSWA 2H92A 3VVBA 3RQIA 3F4LA 2HQ1A 5IUJC 3SAJA 1IZ9A 2JIPA 1QO7A 2GA9A 3DCNA 4HNAA 4Q7EA 3U3XA 1PDWA 4TYWA 3C7AA 1JG6A 2G71A 1JZQA 2XX3A 3BXZA 4O4HA 4UNQA 4WAUA 3B5IA 3LUKA 8AT1A 5JHHB 3BXPA 3LYAA 5BW8A 2AN1A 3HG7A 5C52B 2WHRA 1F60A 2PJZA 2AT1A 2OCLA 4JODA 4LGVA 4TROA 4N6OA 5ALKA 4OHUA 1B3RA 3IELA 1G2IA 4EYEA 3VMFA 5IMSA 2EEZA 4QDXA 1DWOA 4A27A 4CDNA 2WIKA 2JNWA 5JXIA 2LNDA 4AO7A 3SFVA 5K3EA 3PQFA 4HGQA 3L6BA 3G85A 5T4HA 2C5EA 2MSEB 1XTUA 2I3ZA 9LDTA 3K6SB 2IU4A 1KMNA 1LLQA 4PWYA 1EVLA 1Y1QA 3G2KA 1ECGA 1YAJA 2DPHA 1O3YA 3BZWA 1BX3A 2SECE 3M4NA 3QX8A 4XFJA 4HPXB 1Q50A 2FKAA 4ER7A 1Z0DA 4F71A 3WIBA 3HM9A 2N1BA 3BXHA 3QNUA 4Y7CA 5BQ5A 2DH6A 1X3SA 3K73O 3URMA 4B3RB 1UMKA 2UYYA 1GGNA 1XEXA 2HPZA 4QYSA 4DA7A 1Q20A 2EWWA 3KTAA 4PZAA 2IUFA 4UHCA 5HKBA 1IN8A 3HVUA 5T4BA 1LVGA 2Q5IA 4I8XA 4AN0A 4IFBA 4AJJA 3G2PA 4US2R 2GH1A 1G7TA 1GL9B 2Q3MA 1IYZA 1KBZA 2ZYGA 4GM1A 4IIVA 1EEXB 1KYZA 1UQUA 3IVAA 2JBAB 3OOYA 4NONA 4ZRMA 1BWSA 3KQQA 3U7EB 3I76A 1W4CA 1WXWA 4FYIA 2EVWX 3DAGA 3NVMB 1BE8A 4RUKA 5DJ5A 4HVLA 3LCJA 3L40A 1RTTA 1TA4A 3PE3A 3HZRA 4X1IB 3JQ8A 2YV5A 1N9KA 1EVZA 1KFKB 3SXJA 3E15A 1GNLA 5D85A 3TB6A 4F9TA 2GZ1A 3LY8A 2XHEA 4S3MA 2R0QC 1GCUA 4FMDF 4ITRC 1WDWB 3D5EA 4JYZA 4HY3A 2ZETA 1JXMA 1BMFA 3BZBA 4IQ8A 1M5RA 2ZIGA 1PUIA 3HP4A 3EVBA 2WHYA 2YHUA 3GUUA 1ZJWA 1DG9A 5JMOA 1EXVA 3MERA 4ZYYA 3I6YA 5JMWA 1MORA 3HB9A 2V74B 3LQ2A 1J9ZA 1ZXLA 2QMYA 2ZBUA 2HRCA 4UDXX 4MQLA 3UAXA 4C0JA 1HLDA 4TLMB 3V4LA 4EA8A 3KTAB 4LX8A 4TGLA 2IYXA 5I7SA 1P0MA 3AEQB 1FQJA 2GZSA 2Y3IA 3K0CC 1JDVA 1X1DA 4PHTA 4YJKA 3RFCA 4A15A 2RGEA 3OIUA 4AY6A 3IKMB 4OYYA 4R6XA 2NU8A 5I9NA 2H16A 5ALJA 1XT6A 1GSOA 2YXLA 1NVWQ 1V96A 1ZJ5A 4R9RA 2PZAA 3W5AA 2VNSA 2WAYA 1S01A 4P2BA 2IU0A 3UTDA 4LJRA 2BV3A 2AOTB 3LWDA 3TKYA 3IMKA 3ODGA 2O2HA 5CIYA 4ZVKA 2XWBF 1CQWA 2J4CA 3CPSA 3MTBA 4LAFA 2AW5A 1UMBA 1W52X 2COEA 1UK8A 4NWIA 5FOWA 5HOQA 1LWOA 1NBIA 1SIUA 1T24A 1G3UA 2HHAA 4W9NC 3SM9A 1Q0QA 1IJKA 3KOOA 3BTSA 1W6RA 1EP1B 1JIVA 3CV3A 3TAHA 2GESA 3AW8A 3IUSA 3ZUPA 2ZT7A 2R87A 5CRIA 4YEDA 1T5OA 2O05A 4JHLA 2VPQA 4M1QA 5B6PA 1K06A 3R0VA 4IJ6A 4ZAGA 5KNCD 5EJFA 1SIWA 5LJLA 3BKXA 3U4QB 4KQIA 1OXVA 4EYSA 4W5OA 1ZD2P 2AMLA 2PYIA 2EKPA 2I99A 4JJGA 4YJGB 4KE9A 4FOOA 4GIBA 2BAGA 5IM4A 1FUYB 2FQ1A 1U0NA 3UCEA 3KE9A 3GFGA 4REQB 4WBNF 2GPSA 2PX0A 4PU0A 1QIGA 4PGMA 2Q5HA 5B2ZA 2C7BA 2II6A 3ESZA 3S0JA 2XODA 4A0GA 5HIAA 4Y0NA 1JAIA 2ABWA 1YDFA 3K6RA 1TKRA 4XVCA 1G21E 3DB1A 1YFJA 3A3NA 4KN8A 3NASA 5CUQA 3IVXA 2CV1A 2OT3B 1WMFA 4GEKA 1Z4NA 2WTMA 4G1FA 4RFSA 1G21A 2FW9A 2FXIA 2Z3VA 3BICA 5DSTA 5BOVA 3ND7A 2V6MA 4H1HA 2R48A 5I7RA 4F96A 1H9BA 3KEGA 5AW1A 1Z3IX 5G2OA 2GQ0A 4F8YA 2DERA 4NNOA 4E13A 1DADA 1XMJA 3OZTA 1H6BA 1RBYA 4GGOA 2B0CA 2RH4A 4FC6A 4BO4A 3KLNA 1Z0KA 5EERA 4XIFA 4JR2A 5BSTA 2DY1A 5MFPA 5AP9A 2MMCA 4M60A 3HN6A 1OOEA 4XGKA 1EINA 2LCIA 3D1VA 3PHLA 5D6NA 3TNDA 4AF7A 3UH0A 3KJZA 4HAZA 3PQDA 4KX5A 1Q1ZA 1RPTA 1THMA 3TEFA 1MX9A 2HADA 3TSZA 3ADBA 4GSYA 1Z16A 3T3GA 3QYPA 2XTJA 1PR6A 1GYPA 3GI1A 4JYCA 3LAWA 2H48A 1LD3A 1VYVA 1ZNZA 2WZDA 3O8RA 2GEKA 3GRCA 4G4SO 5B2EA 1JHPA 2QORA 1T1JA 2PNFA 3OJEA 4XARA 1XC7A 2N75A 3CPJB 3OD1A 4G5RA 4UXJA 1QYWA 1WV0A 2W48A 4HQ0A 3PGXA 1AK2A 2L18A 5KKAA 2G80A 4EHNA 3LQRA 1EBUA 3IS3A 4F3NA 4XOIA 2QD3A 1XRSB 2O7VA 4IJQA 5A9RA 1WTAA 2GHIA 4OHBA 2UZ0A 1RM5A 3CKMA 5D1HA 5E7IA 3DD5A 4AUKA 1Z6ZA 5EXEA 5J4KA 2BFDA 3LL7A 4R8SA 4ALNA 4ZCQA 4JEUA 1TMYA 2XAAA 2YVLA 1PGQA 5ALMA 2IHVA 1QO0D 4E21A 3B78A 3QU5A 1CHNA 4AJOA 2IQIA 4E30A 1A2OA 4G25A 3RDPA 3ZNOA 1MC8A 3NATA 2HXGA 4QYWA 4A82A 1AVTA 1MRZA 4YX9A 1D2MA 3Q1KA 3V9PA 1MQSA 1II8A 1M8JA 2ZJ2A 4G0XA 5EIHA 2CDNA 1J09A 3CLRC 3EZ6A 5I7AA 3N9IA 3SLGA 2YC4C 4P3OA 2BHNA 4JOQA 1QF6A 1A4UA 1LX7A 4JLJA 2QN9A 3QE0A 3DMGA 4I5GA 1GZSA 4NATA 2WE7A 1D03A 2XEDA 3PHHA 4J0DA 2V8BA 4AY5A 2OGZA 1OT3A 3LOQA 1P4GA 2QVLA 4U2KA 4KIWA 4V1CA 1E69A 3COJA 2VZ9A 5ALRA 5SV2A 4EHIA 1LDGA 1JLLB 1SAYA 2JGLA 4L9RA 2OAP1 3STHA 4CFSA 1MQAA 3HEBA 2ONJA 4YCLA 3ESDA 4YHHB 4OCZA 2NTVA 3M1AA 1ONNA 2CVPA 3ZHVA 3PEUA 2F7SA 4UBLA 2RGNA 1C80A 4YMGA 3COYA 1UXKA 3Q8XB 4WD3A 3KEFA 1FDOA 1M34B 1Y4ZA 4HAVA 1YR1A 4PC6A 3K0KA 4QG7A 1QANA 4RANA 2AOVA 3SHOA 2R47A 1I32A 2DHRA 3CRQA 4MLZA 2ICAA 3K9BA 4TPKA 3KKLA 1U2EA 4N9QA 3TLYA 3GRRA 3X2FA 4WACA 2PKQO 1OBVA 1WKCA 2XKBA 1DQZA 3IHWA 1P1HA 1E2HA 3BRCA 1RBZA 4QOGA 3UBMA 5KEIA 5F5XA 1T2CA 3DL4A 4RDIA 3U17A 3Q4GA 5C7YA 1BCRA 1E7WA 2HCRA 2ZBFA 2BEVA 4OMUA 4AB1A 5JV5A 3TRHA 1A7KA 3I8XA 2WAAA 5F1PA 4NU8X 2FF5A 3VTFA 4B0OA 1UFVA 1PJSA 2OFFA 4PHCA 5DNWA 2YTZA 4FDUA 2PGOA 2Q2OA 4HH0A 2ECKA 3BSFA 2BR5A 3KL2A 1R3DA 3R6LA 5GOZA 1YBMA 2WM8A 1EX9A 4R1LA 4GKKB 3B36A 4O63O 1YD7A 1KY3A 5DEOA 4TL9A 4DR2B 3NM5A 4G23A 3FGOA 2UVPB 4RADA 2QR5A 3IAS1 2F3UA 3NV9A 4YRTA 5A05A 1JSRA 1R5OA 3EIEA 3EJ6A 4LHXA 4AN4A 1Y5IA 1P9LA 4JOSA 3FSRA 1XSEA 4NMXB 2I66A 3SR4A 3DF9A 1AGPA 1BFUA 2AJLI 4BWVA 1MOPA 2CZGA 1CK4A 2NZJA 2W9XA 5AVOA 1FP2A 1IC6A 3SM3A 5BSWA 1L2TA 3REOA 1PG5A 3IEUA 3T7SA 6LDHA 1Y7LA 1Z8DA 5K8UA 4ROSA 4EOGA 2J6CA 1TUGA 1QJ4A 4A91A 2W6PA 5LKRA 1GGKA 3LNTA 4I4TB 1U3FA 4KQJA 5FNVB 5ELMA 3K9NA 2PD3A 1CNMA 4K88A 4EYOA 3LCMA 1U99A 1ICEA 3UAOA 4DMFA 4RWZA 3E84A 3WMRA 3IIIA 4XIIA 3DXYA 3B6IA 3SF0A 1ML3A 2Q2WA 2PPLA 2H3HA 3LT5A 4K40A 4MHOA 5EXTA 4POOA 2C7QA 1FFCA 4MMXB 5A4MS 2RIPA 4Z54A 4CEJB 4ZPXA 4QQRA 5KOYA 2I6TA 1O6CA 4W6ZA 4ALJA 2ZYSA 4N5IX 4F4JA 3O7MA 4OLFA 4DDUA 3HJRA 1U7ZA 2MYTA 3QU9A 3WQBA 4YB8A 3EBOA 1CEQA 3BDVA 1NM5C 3T7JA 3ZVRA 1G2OA 3U44B 3MA0A 3PGMA 1C1XA 3IQEA 4WNIA 1E2DA 3BHIA 3BFJA 3ICPA 4AW9A 2X5NA 4NY1A 4COKA 4PO9A 3B3QA 1O7JA 4UTRA 1DTSA 3H8WA 1N0IA 2WVAA 3HP7A 1G8YA 2A4MA 3GNTA 5IKPA 1ZVMA 1JR4A 2HBQA 3ZDDA 3AONB 3MAGA 4MRMA 1QPGA 1M67A 5C7IO 1LDMA 2X23A 2WLTA 4ZCPA 2BRUA 4OB7A 3RYIB 2O8CA 5F7JA 1OVMA 5HFNA 4PCLA 4D8UA 2H9YA 3JZDA 1G19A 1RVDA 3A10A 1HT3A 3RIGA 3QKUA 1ATIA 1KS2A 4YJ2F 4D4JA 4EELA 4KXNA 3VU9B 3C4VA 2SKDA 5I4KA 4ZREA 1STOA 3GDFA 2QB5A 5IZCC 1P9RA 1TA9A 4M0FA 1UKEA 3Q5DA 5IG2A 1SBTA 4X3CA 3TR6A 1ENYA 2NLOA 1M33A 1TFUA 1AK1A 3DEZA 2PUTA 3T35A 2PRIA 1E5LA 2XNCA 4Q9AA 1LLDA 1HQYE 2EARA 3PE6A 1R18A 3DJFA 1KDRA 1RYDA 4RKWA 2VSOA 3SYRA 1TTTA 4G5SA 4MEAA 2ETXA 3KQKA 2YX1A 3WWZA 1HWYA 3HGTA 3WYGA 1EB9A 4QLBA 1RXEA 4X62B 2D1RA 3MLAA 3DBLB 5DULA 821PA 2OILA 2C61A 2YJZA 5JQWA 2BBOA 1KI1A 3PC8A 2GUWA 4K9KA 3T5AA 4DV5B 1ZGGA 1V25A 1NLMA 2BL4A 1KI6A 2ZJ8A 2BEUB 3CUEF 3N8DA 1IHYA 4M98A 1IH8A 4HADA 4MCIA 4ZT3A 3PI7A 3SZ3A 2KWIA 1DUVG 2QVXX 3PJGA 3PNKA 4N0DA 3O4HA 2G1PA 4G5YA 1VJ5A 4FDVA 3GDOA 2HWUA 1L3IA 5LCXA 4B6RA 2ZRGA 1BXGA 2H4YA 5J40A 4Y9SA 2Q27A 5ED4A 1JTFA 2QXUA 4R69A 4F60A 5JXHA 1XP5A 4K9OA 4PX2A 4RIHA 4U2EA 3TOVA 3WFJA 3KVOA 3RS8A 2QVZX 3OZIA 1FRQA 3KZKA 5HIIA 3RUFA 3V4PB 1ODTC 2AFIA 1K7XB 5A5EA 2Y2VA 2FWMX 4PC7A 1LH0A 5AVYA 1A9PA 4JKYA 3HL4A 1E5DA 2G6TA 2IXAA 4B75A 4Y3UA 2UZ4A 2JI4A 4IMIB 4MLPA 3RVRA 5CFMA 3AKZA 2FZVA 2XA9A 2JLUA 1R9NA 3FNFA 4I8IA 3D4OA 4WZAE 1OI4A 3F73A 2F43B 1DFHA 2IY9A 5HX7A 1QK5A 2QRJA 4C87A 3QLVC 4P7GA 3IP7A 4XGIA 3NAMA 5F3RA 3KJHA 4DLVA 4GW3A 1V43A 2X0IA 3L07A 2ATVA 3W06A 3H7IA 4GZMA 1ZH6A 3O74A 1QIMA 4BQFA 2C78A 1F6WA 3UN1A 4RK0A 1PWHA 1WCIB 3I6IA 3V1TC 5L3QA 1UPXA 5A4DA 3D7LA 4RK6A 2P69A 1DMSA 4M0MA 4ARIA 5F98A 1JYSA 3M4ZA 4LDAA 4GLJA 4L2IB 4QU8A 3SX0A 5CBKA 3K70B 4C76A 2JFPA 4RACA 5FA6A 3G7UA 1U8ZA 1KU6A 2PR2A 3C15C 3GLVA 1KPHA 5FPPA 1T3TA 1IQPA 3TDMA 3W9BA 3L8CA 4CRWB 1FVHA 4F06A 5HILA 2O3SA 3W04A 2QY9A 1N6PA 4P81A 3I9LA 3S29A 4FEGA 5EKUA 5I9MA 5JFGA 3ROTA 3WNBA 4XYLA 1J2UA 3QVXA 3INNA 3RVPA 1JF8A 3I9FA 3CLVA 3QE9Y 1OC2A 3JWIA 3MOIA 2R1UA 4C20A 2KYRA 2AV6A 1PJTA 2SCUB 3F1LA 4NECA 4X66B 4OUKX 4XSGA 2AH5A 5B2FA 1D6NA 2ZCUA 4EEKA 1XCOA 1NOIA 1E99A 2BELA 2ATIA 2XQFA 4E22A 2OMEA 4EHDA 1I14A 1C0LA 3P4UA 1HV8A 4CKCA 4LTDA 1ZOOA 1XIVA 5INTA 1H0SA 4FFBA 1PP4A 2F8LA 1KAQA 3AETB 3KEOA 1VBKA 5REQB 2PX3A 3ZJTA 5DI3A 5BMVB 4ZAZA 2DPYA 1ZEJA 3GJYA 4D9EA 2CK3D 2ZYTX 1EXWA 1Y63A 3D4PA 3RRJA 5ESDA 1SUPA 3A6JA 3EXAA 5KAMA 4AT1A 3H3JA 2BMEA 1JAZA 3CF4A 2IYOA 4DC9A 4U0JA 3UFXB 5FD8A 1MO6A 1LBHA 4MS1A 1WBJB 1HDYA 4RCYA 3DMDA 4EGSA 4FS8A 1CY7A 1GLGA 5GGXA 1IE3A 5T3UA 3PEFA 2YHIA 3JSAA 3AJ8A 2HJRA 3C6MA 2IYUA 4MAAA 1XA4A 4GI3A 3CMMA 4EENA 4HT3B 4FOTA 4X3OA 3DDCA 3N07A 2BMFA 1XAHA 2XTAA 2ZBPA 3ONNA 1FX0A 2FVYA 4DDHA 1JXAA 1Y0BA 2FUEA 3GZNB 3JW8A 5CNKA 1ZW1A 4YRDA 5EJMA 4E7PA 4RLFA 3R6DA 2BTQB 1YRBA 3H9GA 2CLSA 4M7RA 1YRWA 4FOSA 4DADA 3VZBA 5LDDC 1RZ3A 3ILVA 1RKBA 3GLKA 1OYVA 3U13A 1JSZA 2BFMA 3WAGA 3IR5A 2VF5X 1JQKA 1R37A 2X9NA 3JYNA 4M38A 4B8WA 1HNXB 1DPGA 2Q07A 2E5FA 2BLLA 2JAHA 3F8TA 4JBNA 5AXDA 3GWZA 3T7RA 4G6ZA 3EN0A 4OKNA 1CJUC 2IPAB 3QV2A 4G24A 3CVXA 3KSRA 2B5VA 2HQSA 3QSYA 2WSIA 1L7AA 1N8SA 3IDAA 4Z5XA 4X91A 3UV3A 1BE0A 1BQEA 2XQIA 1BOFA 3LVRE 3M81A 4QULA 3OMXA 1CUDA 3OZSA 5IZCA 1WZUA 2IA5A 2XUZA 2QX9A 3ZE9A 1H0RA 2FR1A 2ZDQA 2I6GA 4DNOA 1A71A 4MJLA 3NOOA 3A4IA 3E1KA 1DJQA 4GZ3A 4R01A 3WR5A 3COZA 4XCQA 2KHZA 4YAGA 4Q66C 1PG2A 3OMWA 2C9ZA 3EVZA 4DY4A 4H7EA 4W1QA 5DBOA 5IJ9B 2R9VA 3TCNA 5D84A 5DP1A 1JVNA 2BI4A 2X8BA 1WA5A 3JQ8B 4WN9A 5E6RA 5ERXA 3RVMA 4DM4A 5L4LA 2Z4SA 3LCRA 5BOSA 2VJDA 2NPIA 3L6OO 1XCPA 1J1ZA 3GLHA 5HBRA 4ME6A 2V6GA 4DB4A 3V34A 1ADFA 5EAIA 3VOAA 4F4HA 3MUNA 5KNCA 1QZXA 3AV3A 1C7EA 2HHJA 4KQXA 2D7JA 2VHEA 3K16A 3B5JA 3RC2A 4QEKA 4E15A 3AILA 2PLRA 3N2EA 1EUCA 2NO4A 4JD5A 5JROA 4WMLA 4U7TB 1ZK3A 2C7VA 4XGNA 2VSFA 5DO9A 5LQUA 1FLDA 4DCPA 3BIFA 2P5YA 2BZGA 4IZHA 1OX6A 2QAJA 3PFNA 2DF8A 1S3IA 4KODA 3D8UA 2ZJ1A 3ENVA 5FPQA 3EOAI 2NXWA 4I2NA 4M0CA 3R3HA 4TKUA 5I5EA 1UC9A 1W34A 2NO6A 3NAGA 4YAUA 2V4UA 2GCPA 1R74A 3IPYA 4OQZA 4P3XA 4B46A 4BVBA 2Q3FA 1H4TA 1F5NA 5JZMA 5BQ3A 3U49A 4G65A 1LDYA 1ECPA 1FRFS 2BUAA 2OV1A 3IUBA 2ZTLA 3QHAA 4K6KA 2CFCA 1VKOA 4KKVA 1BN7A 4GS5A 3FD8A 5ER9A 3TQFA 3VC2A 1SKBA 3TKLA 3WV4A 4D8YA 4JVSB 4OX9Y 3G8DA 3OQNA 3FHLA 4MW4A 1SFRA 3M49A 4DW8A 1Q0LA 2YIVX 2HU5A 4IKEA 1Z0UA 2HCJB 2VSXA 5CEJA 1E3EA 1U3WA 4GQBA 1FFXB 4O4JF 5D87A 2O2CA 1LCIA 1MNAA 3S4YA 2CD9A 2UUBB 5HCUA 1C4OA 2HMVA 2QLLA 2FDXA 1J0XO 2RHRA 2DT8A 2FFRA 2QQFA 3NFYA 4IDQA 4B2YA 5EWMB 5JLAA 4AG3A 4TZTA 4FFDA 1YDEA 3ZJ4A 3PUIA 1N2SA 3BQNB 3FYDA 2VLBA 3WG9A 1OX4A 4UUMA 4WXYB 4FMDB 5AI0A 4F86A 2MTBA 3RO7A 3TQCA 2FP4A 4J1SA 1CS4C 2MYNA 3OQHA 5AH0A 5DHUA 4DIUA 2I7VA 1PSDA 2Q0XA 2RHMA 3QUAA 1W19A 2RJOA 1HETA 4RVFA 1EFPA 1L7QA 4IIXA 1DS6A 1TNDA 3V2UA 4D9MA 3IP6A 4ZEOA 4RY9A 4MMZB 3N6VA 4WVLA 3FDXA 4CIYA 1KMMA 4TS9A 2QN1A 3RSGA 2PUHA 1QS0B 1WY5A 3C7DB 3DC2A 1L9KA 2JATA 3M6WA 1SIOA 4W8HA 1SUEA 4A1OA 2PEZA 3E5HA 4CMAA 4JT4A 1NDUA 1XB2A 2WSSA 2ZK7A 4J2HA 4F11A 4RVHA 1JEAA 3N1UA 4Y2PA 4Q48A 5K01A 3IR6A 4KL8S 4H7PA 3CO0S 3B52X 4QA9A 3WMWA 2QUKA 3PDWA 1VPTA 3AQ4A 1WU7A 2YRFA 1L3BA 2BEWA 5DMXA 2NVBA 2QZPA 3VR1A 2PLFA 3A3OA 5I9LA 4MK4A 4JC4A 1VL6A 4R7GA 1RC8A 4V0QA 4L8FA 3Q6MA 4FIDA 1IRXA 5HUQA 1IAQA 4EHHA 2BCJQ 4O2BF 4BCCA 4LC9A 3FLMA 5HKAA 2F1IA 4EITA 2GHQA 1JEYB 5E1MA 4JEHA 3IIEA 2I3BA 1IJEA 1RXCA 3DG9A 3PR3A 4DUPA 1RM0A 2PRSA 3GFSA 3F78A 5U4XA 4RKYA 1XJCA 1EK1A 3UPDA 4ED9A 3WO1A 1ULTA 2MSKA 3ECAA 3WB9A 3T9BA 3QKWA 3VR5H 4UMEA 2D7DA 1NUUA 4R1SA 4B83A 1SU8A 1B2RA 2PT5A 3WLEA 5FOQA 2FPRA 1LWNA 4YMLA 3F74A 2GEJA 1F8FA 1G8SA 3JAKB 1XDBA 1Z34A 4L22A 4QYXA 4TYPA 1Z18A 4L4ZA 2QAIA 3A6HA 1HYQA 3AOGA 3OKCA 1FNCA 1G41A 2E3JA 1P5RA 4LCBA 4M86A 3CX3A 4M7WA 4X3PA 3TCXB 5F1YA 2D1SA 2PCLA 3HZHA 1DEOA 3VO8A 1EBFA 5GM1A 4DSTA 3EZYA 4LWOA 1SWWA 4WK6A