2YASA

Hydroxynitrile lyase from hevea brasiliensis complexed with rhodanide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 97
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yasA00
2OXEA 2Z3WA 2RIPA 3FYUA 4WDRA 5IH7A 4PQEA 2XQJA 1QIJA 4BVJA 4TVKA 5IVDA 3STYA 2AJ8A 1VXRA 1EH5A 1GGVA 4H7HA 1JJFA 2OAEA 2PSFA 1CUDA 5E4YA 4HZGA 3V1NA 4Q3OA 3NUZA 3AIOA 1RP1A 2OGZA 2PPLA 4UBLA 1YA8A 4E11A 4J03A 3GFFA 2PSJA 3A2NA 2C58A 2QS9A 2QXUA 1X2BA 3AIMA 3G0BA 3H2KA 2GBFA 2WHRA 1QIHA 3PI6A 2PL5A 3WL8A 3UUEA 5AK4A 4PSUA 5HFNA 1EI9A 4OYYA 2RI6A 4C4XA 2O7VA 3WWDA 5IKXA 3FLAA 3WK5A 1B41A 3AUKA 1XRLA 3C8HA 2QRUA 2PSHA 3G0GA 5A2GA 2FX5A 4KEAA 5K3CA 3H2IA 2HADA 3VVMA 2QMQA 3HLKA 2JGMA 2ZJ7A 4QZVA 3WIBA 4UBIA 1ODTC 5EHQA 2WTNA 1B6GA 5JALA 1R50A 2Y6VA 2HA6A 1ZI8A 3BJRA 3QVMA 1UK6A 4B80A 4QA9A 5EHXA 1CUBA 2OQIA 3R0VA 4P93A 4QE3A 4Q3LA 4L72A 3JYHA 5HF8A 1ZJ5A 1Y7IA 4AN0A 2HU5A 1ZIXA 5CH3A 3OURA 3IULA 5ALGA 1BROA 3KWJA 2WLSA 1JU3A 3V1LA 5K3EA 4C6HA 4EB0A 2XDWA 3BL8A 3FSGA 2XMSA 4DNQA 4W63A 1XZLA 5DNWA 1CRLA 5AP9A 1MX9A 3ZLVA 4CG3A 2E3JA 1UOOA 4Q05A 4HRXA 1DINA 4ARAA 4W1QA 4GXNA 1XFDA 5AK5A 5A6VA 2WIGA 3ZPXA 5JIBA 3O4GA 3RKSA 4MJ3A 1HQDA 5HK8A 4BBZA 4DMFA 4J3JA 3F8SA 4BB0A 1BN7A 4EY6A 3EBLA 1CUIA 1BE0A 2I78A 4F5ZA 6YASA 3F67A 3W2TA 2R8BA 3BF8A 5CBKA 3U1TA 2CMFA 2C0PA 2VJBA 4BE9A 3IUMA 1UZAA 2BKLA 2ZSHA 1K4YA 2DCMA 3VVLA 5ALTA 4H7FA 1GKKA 2WU4A 1LBSA 3DNMA 2OCKA 4EBBA 2QTBA 5DNVA 5T4EA 1LBTA 4KE8A 1SOMA 3TGLA 1BCSA 1P0IA 2I3ZA 4E15A 4DNPA 3H19A 4HXEB 2J3QA 5HF5A 4DLNA 4N5HX 3ESBA 1AX9A 2Q0XA 1Y7HA 2WSLA 1VZ2A 4PSDA 1JKMA 1HDEA 3ESDA 3LS2A 5AI6A 5HKBA 5AOCA 1SCQA 5LZ5A 3PFCA 5BV7A 1TK3A 1YB7A 4X94A 5LZ9A 1I6WA 1DT5A 2XUIA 3ANSA 3VJLA 3HACA 3K9BA 1GQRA 4I19A 1EDBA 5CW2A 2QKYA 2RAUA 3FVRA 1XZFA 4QLAA 4CFSA 3R3UA 4M0MA 4XX1A 1CVLA 1O6FA 1XRQA 5T4FA 3QYJA 4BCBA 3IUNA 1CUWA 3SC2A 4C4YA 4LKOA 1UKBA 4NMWA 4H7KA 3F97A 4Q3KA 3BJMA 3BDVA 3QPDA 1CUSA 1KU6A 2V97A 1MPXA 4UBJA 1MJ5A 2B20A 2V98A 1JJIA 2VT7A 2QM0A 3KWFA 2XT0A 2JGKA 1W52X 5C8VA 4MXDA 2X76A 1DQYA 2CEKA 4E46A 3M83A 2GYUA 1R3DA 1AC5A 4EHBA 5CURA 1JT2A 4CCWA 4J0HA 4PF1A 4Y2SA 4BRZA 4UBOA 4J0DA 2CJPA 3FYTA 4UHHA 3ESAA 1UWCA 5C81A 2PM8A 3AZPA 1QIIA 1ZGCA 5AIAA 5AM2A 5JZSA 1JFRA 3W04A 5T4HA 2Z8XA 4WFJA 2G5TA 2AJCA 3IUQA 5AOBA 1JI3A 1L7RA 2OGSA 4CIBA 4G1FA 3EQ9A 4NS4A 1TQHA 4QDUA 4C88A 5ALWA 3FYUB 3UMJA 3MUOA 2GYVA 2HA0A 3IB3A 5K3AA 5ALJA 4AZ0A 1C7JA 4JYMA 2WFLB 4UUQA 4BTVA 1WB6A 4UHEA 4GBGA 5JD6A 1L7QA 5FLKA 3PUIA 2XQIA 1G42A 4QEKA 3WKEA 3AZQA 2CBGA 5CT9A 4FNMA 3S8YA 1EX9A 1LPPA 4Y2YA 2ECFA 5KBYA 3D7RA 1FFBA 1K63A 2ACEA 4AQDA 3C6YA 5D3ZA 5ALDA 1CV2A 4KAFA 3HSSA 4EY5A 2WIJA 3VJMA 2JGLA 2O2IA 3PICA 5AIBA 4N8EA 4G4GA 5A71A 2BUCA 1A8SA 1XZDA 3QMMA 4FOLA 1CQZA 3KXPA 5HFAA 5C8XA 4EZIA 4BAZA 2BJHA 5AKYA 4BP9A 3TRDA 5JARA 3TJMA 3G0CA 5E2IA 1ZJ4A 1QIDA 3D2CA 2ZVDA 2ZYSA 4L3WA 1LPSA 4FBLA 4UPDA 4U2FA 3WWCA 1ZD2P 4X92A 1OXMA 3STWA 5ALEA 2ORYA 2BUAA 2VQ6A 1R9MA 4H7IA 3HABA 3FLBA 4NZZA 1QO7A 1U4NA 4CG1A 1MO2A 1AZWA 1CEXA 5FUMA 2X5XA 4H0CA 1K5PA 2VSQA 5ALUA 2ZYIA 4BDTA 3GZJA 4OUKX 3BF7A 5DYYA 4K6GA 3ZV7A 2R11A 1U2EA 2OPHA 4PV7A 3GA7A 2GBCA 1CQWA 1YR2A 5H3HA 5ALKA 5A7FA 2DSNA 3H0CA 2JGIA 5CH8A 1MX1A 5JAUA 4PO3X 1QIFA 4Y2UA 4ZV7A 4W1PA 1YS2X 2D0DA 3R3ZA 3WJ2A 3QMWA 2GZSA 3GBSA 2RHWA 4JH0A 5IVHA 5ESRA 4QWWA 4K6KA 4G4JA 3B3QA 3HXKA 2QT9A 5A7GA 2CUTA 2XUOA 1G66A 5LZ2A 1ZOIA 3NGMA 1VA4A 2DFPA 4N8DA 5J3JA 1CUEA 1E3QA 3C87A 1DU4A 5KREA 3GUUA 4BYMA 3H18A 3DKKA 3W06A 1XQVA 2XB6A 3D3NA 4F0JA 3ANTA 2GZRA 3WKDA 1ODSA 2HA5A 3PF9A 5SYMA 1XZBA 3BIXA 2NW6A 4CCYB 1AMNA 5F4ZA 3RM3A 2OG1A 3RK4A 4DMHA 4X93A 3M3DA 1IVYA 1UXOA 4Q82A 4OB7A 4CIAA 1MNAA 5EIAA 2JGJA 3ZLTA 2BCEA 1BN6A 1XLUA 2O7RA 2WQZA 2Y1KA 1YAHA 1BEEA 4YX9A 2DHDA 2WIKA 1J1IA 4H7JA 2QR5A 1WHSA 2HRRA 3EQ7A 1UKAA 4LIPD 1AUOA 2XUQA 1EHYA 4KAJA 1MAHA 1DQZA 4B85A 2JGEA 4WY8A 4BVLA 4W9RA 5AKIA 4B0PA 3VDXA 4DIUA 1H2YA 1UT6A 3MUNA 4FLFA 3PF8A 5AM1A 1EA5A 5IVKA 4OU4A 4EUSA 3A70A 1KEZA 3A2LA 5ALOA 2QXTA 5LZ7A 3FWHA 1IUPA 5EFZA 2HA7A 3G7NA 3FVTA 2FJ0A 3STUA 1KU0A 1XZMA 1SC9A 1IZ7A 5DLPA 5JZ9A 1HBJA 3UUFA 3OM8A 1YCDA 4UBNA 3CN9A 3IVMA 2W6CX 1BCRA 1P0QA 4EY7A 2VJCA 4PNZA 4OB6A 5ALMA 1YAJA 1QIMA 1IMJA 4WCVA 4FWBA 1QOZA 1DX4A 2H7CA 1ODCA 1LLFA 2JEYA 4YPVA 3ZLUA 4UFOA 1DWQA 3TEJA 3H17A 3V1KA 1ZD3A 3IBTA 4BAUA 1EB8A 3KSRA 4QDZA 3O95A 3QBJA 5CXUA 2DQYA 5CXXA 5ALSA 1TRHA 2OCGA 3I1YA 5AOAA 1H2ZA 5AO9A 2QUBA 2PKYX 1XLVA 1QZ3A 2VAVA 3M82A 5AKEA 1UFOA 3F98A 2WIFA 3WL7A 3I2FA 1MT3A 1CIJA 5E4TA 4PW0A 1G4HA 1YA4A 2PUHA 3D0KA 3BE8A 4JNCA 4B81A 3QMVA 4GEGA 2QUAA 1LPNA 1BEZA 3LLCA 4UHCA 3R40A 1PJAA 2DHEA 5ALXA 4OB8A 4TPKA 2AXEA 2WHPA 4KR0A 3NOXA 5CTAA 4B84A 5HF9A 4B0OA 5I9IA 3L1JA 4L9AA 3CCBA 2QOEA 5FDFA 1FJ2A 1WB5A 4Y2VA 5E4JA 2GBIA 3D59A 1U8EA 1GZ7A 4FKBA 4QDTA 2VAXA 2YYSA 3B12A 4DGQA 3FNBA 1UOQA 2I03A 5D7BA 5ALIA 3DL4A 2XLCA 3I6MA 1SCKA 3BIWA 4FTWA 3OPMA 1CUUA 2HIHA 3I28A 2QJRA 3I2GA 3H1BA 3HEAA 4DNOA 4DSAA 1X2EA 1SCIA 2RONA 4RPCA 5AI4A 2WG2A 4AMYA 2GYWA 4V2IA 4J7AA 3C6BA 3O9MA 3YASA 4N5IX 2HA4A 4MEBA 1IUNA 4BZWA 3RARA 2JGFA 3DYVA 2BAGA 2O2HA 4KRYA 2WFMA 2CB9A 1MU0A 5FPQA 3WA6A 5DYTA 2C5GA 2G5PA 3DDUA 3O4HA 4WFKA 3DJYA 5AI0A 4LXIA 4IH4A 3IURA 1CUFA 4FNGA 2VATA 4M0EA 4MQMA 4Q1VA 2OAGA 4QDOA 1EXWA 2AJDA 3AINA 2VJAA 4U2DA 2JBWA 4LXHA 5K3FB 4A23A 4ZXFA 4OD0A 4LYEA 1XZCA 1ZD4A 5DJ5A 3WYDA 1ISPA 1BS9A 4C87A 1R88A 4B83A 4DTCA 3L1HA 3K2IA 2XMCA 5AKZA 1DTEA 1WCYA 2YASA 3Q8WA 2IX9A 3R3XA 3R41A 3DOHA 1WM1A 4P08A 1E89A 1ACJA 1EK1A 3F9CA 5AKGA 5AICA 4FLEA 3I6YA 2XQKA 5JASA 4FDMA 5KWJA 5BWCA 5FKJA 4BAGA 1XQXA 1XZGA 2XE4A 3W9BA 4IO0A 3G9UA 1ORVA 2WUGA 1ACLA 2PUJA 2BUBA 3T52A 1R1DA 5ISMA 4U2BA 2PBLA 1JU4A 1W1IA 2XUPA 2Y2VA 4GI1A 3AIKA 1VJ5A 3L1IA 5AKHA 2WUEA 2YH2A 4X7BA 2ZJ6A 4ZWNA 4GDMA 2BFNA 3STXA 4X00A 3MGAA 3PFBA 1NX9A 3FLEA 1VE6A 2IITA 2XQGA 5AI5A 3WA7A 2PVSA 2J3DA 2Y2UA 2B9VA 3WKCA 1VA5A 3C6XA 4B6GA 3VKFA 3D4LA 4H77A 1EINA 1VOTA 5CT5A 1L7AA 3HZOA 5EHNA 5K3BA 1LPOA 2XUHA 4HAIA 2XQFA 2HL6A 3C5WP 1XZJA 3E4DA 1EVEA 1MN6A 2WG1A 2WU3A 2WIDA 2XUAA 1CUVA 4AO8A 4BVKA 1AQLA 3WMRA 3H2GA 3WK8A 5AKJA 1A8QA 4Y2RA 2WILA 4UFPA 2C7BA 2X8BA 1TCCA 4UHDA 4K5QA 4X6YA 1E8MA 3Q0TA 4BC0A 2Z5GA 3A2MA 3WL5A 4W1RA 1XZAA 5EI5A 3LIPA 3GROA 2VEOA 4MYSA 1SFRA 4Y7DA 5DTIA 3N0TA 5LKAA 3SK0A 2EEPA 2XLBA 4ETWA 5HQ3A 2WM2A 4AN1A 4UBKA 2WG0A 3RLIA 4AX4A 5HZGA 3WZLA 5AI8A 1Q0RA 4MQLA 3P2MA 3STTA 5D6OA 1QE3A 1E8DA 3WYNA 3VISA 2GBGA 1FFEA 3I1IA 2PU5A 1GT6A 1QIEA 1CR6A 1Z68A 1ZGBA 4JYPA 5CT6A 2ACKA 1NU8A 4DSZA 4G8CA 2D5LA 1CPYA 4BDSA 1E5TA 4RNCA 4D9JA 3FCYA 4JEIA 4XWGA 3ZI7A 4U2CA 4X95A 4RE6A 5ALNA 4INZA 2QJWA 4XVCA 3AFIA 5LZ4A 1TCAA 3WZMA 3V9AA 3I2KA 4A5SA 2WTMA 1QFSA 2XUDA 2OGTA 1XLWA 3O9VA 2HFKA 4ITVA 3ED1A 5JYCA 1QIKA 4FLMA 4B9EA 2CKMA 1GPKA 3EF3A 4HXGA 4CI9A 5LYYA 1J07A 3HI4A 3G02A 3BWXA 1TAHA 1CUYA 3V48A 1XRPA 1IZ8A 3KDAA 4KRXA 4QLOA 4RE5A 4K6HA 1ZI9A 2WHPB 4WJLA 3DEAA 3I2HA 4MEAA 4BP8A 4Q34A 3O0DA 1Y37A 2EDCA 2B4KA 2HDWA 2HHAA 4BCDA 2YXPX 1DWOA 1F6WA 3DD5A 2DQZA 4BZZA 3DQZA 4K2AA 2BGNA 1AURA 3T4UA 3WI7A 2XMZA 3LIIA 4XJVA 1P0PA 1R4ZA 1H22A 1TIBA 1FFAA 4B7ZA 4OCZA 3W05A 3GELA 4G4IA 3HYSA 1HLGA 5LIPA 3VXKA 2WFZA 5ALPA 1MX5A 4ZGBA 4ROTA 1RYYA 3STVA 1IUOA 2HU7A 4HS9A 3WIOA 4IH9A 1YASA 3O4IA 4HTAA 1NU6A 1QJ4A 5C8ZA 2J4FA 4C89A 1WPXA 2ZYHA 2DR0A 1VE7A 5FV4A 5EIEA 1DWPA 2DHCA 1XRRA 2UZ0A 4QDXA 4Y2QA 1UOPA 5AM4A 1CUAA 1E66A 4X6XA 1UKCA 2C5FA 2WFLA 1JMYA 2W22A 2XI4A 3R3VA 5HCUA 1XRMA 3EQ8A 2WJ6A 4Y9SA 5D3KA 1ETHA 2LIPA 1QTIA 2CZQA 2HFJA 4UHFA 2JEZA 1USWA 4ZREA 4QWMA 1A7UA 4GECA 2V96A 2XMQA 4MWSA 4M0FA 4B82A 4FFVA 3QM1A 2WUFA 1LPAB 5JAHA 2G4LA 4BATA 3OTQA 2H7XA 4U2EA 4DMCA 3C70A 5ALZA 4XIIA 5AHXA 1ORWA 1XROA 4J0GA 4X3CA 1T2NA 5HKAA 3QPCA 1XKLA 5AKLA 2QZPA 2AJLI 2XMBA 4AB1A 5A62A 3K6KA 2PU7A 3WWEA 3C8DA 4EA6A 4J0IA 5JD5A 4F60A 5HK9A 4H7EA 3QITA 1CUHA 3ESCA 4G5XA 5AI9A 1VLQA 4IHAA 4A16A 4X6UA 3IIIA 1D07A 2H1IA 3H2HA 2ONCA 1EDDA 3E1GA 5AK3A 2Y6UA 1S8OA 1ZD5A 1FFDA 3WQHA 2WUDA 3D5EA 4X71A 4UBMA 5DYWA 2J4CA 1CFJA 1LZKA 3E0XA 5JAPA 2HRQA 3DS8A 2XMDA 1OILA 4Y2TA 2G63A 1XQYA 1JMKC 1ZIYA 5AKKA 5LZ8A 5ALRA 3PDCA 2ZYRA 2VA9A 1CUJA 4C01A 4H18A 1O6GA 4YASA 1OCEA 5JATA 4HRYA 1LPMA 3ICVA 5EHZA 1PFQA 3ZWQA 3IA2A 5JADA 1LNSA 3PE6A 1YB6A 3FBWA 2Z3ZA 3ILSA 4Y2JA 3SWWA 3OC0A 2P8SA 4AO6A 3C5VA 4DYHA 7YASA 4L0CA 4BE4A 1HKHA 5FOQA 3QH4A 1FSSA 5AH0A 1N1MA 1N5MA 1P0MA 2B61A 4OPMA 2VT6A 4X97A 1N8SA 1ZICA 4J0CA 4KAAA 4P92A 1BU8A 3D2BA 3M81A 5HQ3B 4WDQA 5FP0A 2VJDA 4CCYA 5JD4A 4N8SA 4ZV9A 5C7YA 5AJHA 2C4HA 4NVRA 3G0IA 4Y2PA 4B9AA 2ZSIA 5LLSA 2ES4A 5A7HA 4F21A 5K3DA 2XUGA 4X91A 2ZJFA 3EIOA 4LXGA 1QLWA 4X90A 5ALLA 4P9NA 1QIGA 1EVQA 1YSCA 3IUJA 5LKRA 1WHTA 5I8PA 3WWOA 4TGLA 3C43A 2PX6A 3G9TA 3HJUA 4DM7A 2JIDA 4LHEA 4RGYA 1CUZA 5CH5A 1CUXA 3O4JA 3WKAA 3JW8A 5FRDA 5JAOA 4AMZA 3HRHA 2XUKA 2OCIA 3G9ZA 3OG9A 2FUKA 1XQWA 1E8NA 4C4ZA 4U2GA 3WKBA 5JANA 5ALYA 3NWOA 3QPAA 1XZEA 3OOSA 1HL7A 4GHWA 1T4MA 1DT3A 2H9YA 1WPRA 3LP5A 4E14A 3H1AA 3DCNA 4KE9A 5BOVA 2HM7A 5I7UA 3H04A 4IQ4A 5FXMA 4BC1A 5CT8A 3C45A 3F96A 1MTZA 1F0PA 3BXPA 1GKLA 1QO9A 3LCRA 2FJPA 1EDEA 4DNFA 1GXSA 2I3DA 3DOIA 4G9EA 3QZUA 2WJ4A 1PV1A 4GW3A 1XKTA 3AILA 1CUCA 3I2IA 3C6ZA 3H2JA 3KD2A 3B5EA 5K5EA 3I6ZA 1DX6A 4FHZA 1GQSA 4OSEA 2K2QB 1GPLA 1THTA 1UK9A 3CXUA 1YS1X 1Q0ZA 1GPNA 4ZRDA 1G5FA 2QVBA 1TCBA 2VF2A 1M33A 3AJAA 1K6EA 2EDAA 4GLBA 4DMKA 3HC7A 1W75A 3FAKA 3WLAA 4G8DA 1WOMA 2H7YA 4J0KA 5CRIA 1QFMA 4AZ3A 3WJ1A 1HPLA 2O2GA 5ALFA 5HF6A 4KE6A 4X85A 2Z8ZA 1H2XA 4AXBA 3CCCA 1H2WA 5CT4A 5DWDA 4MWTA 1UK7A 1F8UA 3PUHA 1THGA 3DKRA 1WB4A 1FFCA 3SX4A 3FOBA 3FCXA 3AZOA 5SYNA 3WL6A 5AM3A 1QGED 4YK7A 4GWLA 5ALVA 1A8UA 5KWIA 1CUGA 3JWEA 4EY4A 1C7IA 3X3HA 1A88A 2WJ3A 2RHTA 5CMLA 2C0QA 2XMGA 1W6RA 4OYLA 4PSCA 1U65A 2V9ZA 4H35A 3R3WA 1EB9A 4I3FA 1CLEA 5IVIA 3IDAA 4OU5A 3BDIA 5DTJA 1X70A 3W9UA 1MNQA 4KACA 2BGRA 2HA2A 1VZ3A 4ZI5A 4G8BA 3G8YA 2HA3A 1LGYA 1EK2A 3DLTA 1ZI6A 1R9NA 5AK6A 5T4BA 4HVTA 4FBMA 2WKWA 5AM5A 2XUFA 2OQVA 4J0JA 4Z49A 2OCLA 3V1MA 1QTRA 2RGUA 3WK4A 4CG2A 5FPPA 5K3FA 4WFIA 3U0VA 5ALHA 5DNUA 4FMPA 5AM0A 1XZIA 1RWQA 2AJBA 3A6ZA 3WK6A 4QNNA 1AKNA 4O08A 1QONA 2PSDA 2IIVA 4G9GA 1BRTA 3S2ZA 3WK9A 1VKHA 3R3YA 2VTVA 4BTLA 1MAAA 1J06A 4LYDA 1Q83A 3MVEA 3WK7A 1AGYA 4H7DA 5YASA 1N5RA 4UHBA 4BCCA 2XUJA 4Y2XA 2WHQA 5EIHA 1LZLA 4KE7A 4IH1A 4UFNA 1XZHA 1F0NA 2HU8A 4EY8A 1Q84A 3KOOA 5EGNA 4WY5A 4S0XA 1XZKA 1TKRA 1VXOA 4JUIA 4ARBA 5LP1A 2XMRA 3N2ZB 3FSGD 4KJXA 3DL7A 1H23A 4AO7A 3ICWA 3CN7A 1J2EA 1UK8A 3D2AA 4W1SA 3E3AA 5BWBA 4MYDA 1LPBB 1K8QA 2OLEA 3FYUC 2PSEA 2JF0A 4I4CA 4HXFB 1W76A 3DYIA 5JZBA 3WWPA 3VJKA 1JJBA 3G0DA 5AKXA 2ROQA 5ALQA 1XRNA 4KYVA 4BRSA 1W4LA 4FFWA 1C4XA 3I2JA 3G9XA
chains in the Genus database with same CATH superfamily
2CFTA 2EBFX 2Q45A 3HUTA 4WBSA 2G9NA 2LNDA 2P27A 5AUQA 4E03A 2FG6C 5T3YA 3H87A 3L6UA 5BVGA 1G291 3UTCA 3ZBPA 2PE5A 3P5SA 3NW9A 4A8HA 2B5VA 5AVVA 2F8MA 3CZ5A 3Q5DA 3U7FB 4K9NA 1ADBA 1NVFA 2O06A 1LB1B 1UDCA 3AJ9A 4HNQA 2ZYDA 4RM2A 1U1EA 2A9VA 1UKYA 2IPNA 2IOYA 4BNWA 1EH5A 2O8EB 1GGVA 2TMKA 1GN9A 2AVDA 5CB6A 2ZYUX 1ISSA 1ATZA 4KXYA 5DHPA 4MEJA 1SG0A 2FWPA 4BX2A 4FD3A 4HZGA 3GC6A 4E1VA 1XAHA 3V1NA 3OHMA 3IAS6 3AIOA 1G5QA 3AV3A 2IUFA 3BL6A 1VYUA 3NHAA 5F51A 3TRJA 4YP6A 1YA8A 1L4GA 3H86A 1NNI1 4Q18A 3ZCUA 2ZJZA 3FKQA 3QVWA 3CA8A 4P54A 3WQRA 3R9WA 3N8DA 1KI4A 4FFOA 3WAKA 3ZD8A 3OEEA 5FOWA 2HV8A 1V8BA 2NZUG 3SHOA 1BVUA 2OBNA 3D31A 2DPXA 4EDHA 5JS7A 4GOOD 1ZWLA 4J49A 2QXUA 4B31A 3G0BA 4FCVA 4REOA 4G1VA 4ETIA 4UXHA 1GZHB 2E37A 3NHBA 4D9CA 2QRGA 4IICA 2Q1UA 1JAXA 5BWCA 3EARA 1DOAA 1OA1A 4PZPA 4QOJA 4RV4A 3O1HB 2VHUA 3CINA 4C76A 2XRZA 1E7MA 2RARA 4B6PA 3NBFA 1LBHA 3T7SA 3WL8A 1RP7A 4QBKA 5B1YA 2PWAA 2R6CA 4MI3A 1EI9A 2I7TA 4LBVA 3TFQA 4LF8B 1AUXA 1G20E 1HDIA 3B60A 2PLFA 1U0RA 3Q9NA 2XT9A 2O7VA 3FLAA 3WK5A 4E09A 2X42A 2FR1A 1HR0B 2XRYA 4OGFA 4UQOA 1XWFA 2I99A 1WY7A 3NJRA 1TEHA 5L7YA 2F1HA 3H16A 3VUEA 4HT3B 4EAAA 1Y1SA 2IK8A 3LYAA 4BU1A 2B8EA 2AGVA 4M9ZA 4O2AA 3CV3A 4KN5A 3EDQA 3G0GA 2E1RA 4KQGA 5KTTA 5K3CA 3JQCA 1R00A 3H5OA 1TVMA 3OIDA 4V0SA 5F77A 3VVMA 4CM8B 1JKXA 2JFWA 5C4IA 1UAGA 5DLQC 3FFWA 4CKBA 1H9BA 2G09A 4IDEA 2VBCA 3RE1A 3WISA 3GLGA 3TZKA 1TGYA 3TG8A 2ZSBA 2R7NA 2HSEA 4LFBB 3HH8A 4XVHA 2OBYA 2GZ2A 4BWYA 2HHJA 3BMXA 1JKFA 5KJFA 1XLTA 4U3JA 2QYOA 3NAZA 1TPYA 2M6RA 1BYIA 5FLYA 4TSRA 3P0IA 1RXWA 3L0YA 1FQJA 2NXEA 2WNSA 1FUUA 2HF2A 1E1DA 3I72A 4RZHA 1H1DA 4U0KA 4EB3A 3W5DA 3GLHB 5TEVA 2OO5A 3V1YA 2ZKIA 4HB0A 2HA6A 2HB6A 1ZCBA 2C8LA 2X3FA 1SAYA 4I1SA 5IUKC 5SZHB 1PL8A 1UK6A 3OZVA 2IIPA 3BCUA 3HYCA 4IXNA 5GM2A 1HNWB 3PUYA 1P0FA 4ZT7A 3VR5A 3RAEC 3PDUA 4WLNA 5TMBA 2X0FA 1VG1A 4ZI7A 4AZTA 4MW5A 1YL6A 2AT1A 4CF3A 2WKQA 1Q77A 3W3AA 3K30A 1BFDA 1Z8NA 1SG6A 1L1FA 1JEYA 5HF8A 2XBUA 1HEUA 1NKTA 2FN9A 3D7SA 1I0LA 2QZ4A 3E58A 1Y7IA 4NJMA 4YJHB 2KSQA 4L0QA 4HDMA 3AEZA 1W30A 5DEOA 3PRKE 3KQKA 1FX1A 1TO1E 2P6UA 2YIMA 1E3TA 2YYZA 1FP4B 4NNOA 4YRPA 5LXTF 2LWIA 1J9EA 3AKZA 4LN1A 1C14A 2BFBB 1A7AA 3OURA 4TXHA 2JJ2A 2X19A 1RRCA 3G2PA 1WL8A 5B2ZA 5KTYA 2H1OA 2HT1A 4C3UA 4KPYA 3DC2A 2VJNA 2VH2A 2PQ0A 4TRRA 2PANA 2QD5A 3UQZA 3SVTA 2BTEA 4ZYWA 4L27A 1O5OA 5KVVA 4R54A 1TUIA 4DNQA 1KHHA 3KP1A 1XZLA 2C4VA 4W63A 5DNWA 1CZRA 2VUTA 3ZW9A 3N2LA 4HEA1 4ZVVA 2DQKA 4DLTA 3PNBA 1T0IA 3HWX1 2YIDA 3HZHA 2P4EA 3JQAA 2IBTA 4HX5A 2O0JA 1P80A 1NLUA 1GJRA 3V7FA 3DMHA 3ZLVA 4B3DA 4QPJC 3ZWCA 5L51A 1FXWF 3VGJA 3EOBI 4UCQA 5DISB 3UH1A 1YIAA 1EQAA 4LGYA 3I8SA 1EKXA 2XBLA 1U04A 4HPXB 5E7QA 1O9HA 1GA4A 3AYZB 3JALB 3OJ0A 1DUIA 2NZXA 3H9CA 3ODPA 4WFQA 2RH9B 3QHQA 4QREA 4K6MA 1PYOA 3N76A 1T4CB 2IHVA 1HT2E 4ENQA 1Y6FA 3PHGA 3HDTA 2BF4A 4D8UA 4KMOA 3UFXA 3DZGA 4RK4A 2OORA 1TLFA 4L95C 1Z7WA 3VPXA 2E5LB 3GH1A 4MGIR 1ZC4A 5HK8A 3EVFA 1SCBA 1CY4A 2FEKA 5AVKA 3FUVA 2VK2A 4L3OA 3B6ZA 4E2XA 4HLQB 1X1QA 3TLGB 5AXDA 1UUFA 4XE5A 5JJCA 4J3JA 1OLSA 1YZQA 1WOYA 3KKPA 4G56A 3S8EA 1A4RA 3A58B 4LRSB 4KLZA 4RQAA 3OLZA 4OO3A 2EFYA 5U1PA 3DCJA 1U7DA 5JCOC 1CJUC 2JGAA 1BN7A 2OVFA 2BGWA 2BSQA 3AQ4A 4J16C 1BD4A 2BFFA 2JHPA 3U16A 1YS4A 1G98A 3UGTA 1T3HA 3KJGA 4HSEA 2NZ8A 3H4TA 1W85A 4PIPA 2MTBA 1M6EX 4OGLA 4CU2A 1G2IA 4AUEA 3DO6A 1J9ZA 3KTAB 4YBRA 2JNWA 3TG2A 1L3CA 2IEYA 4KQCA 2R8BA 2ECQA 1J56A 1D2RA 1QKIA 1Z6ZA 3BF8A 1DZIA 4JT8A 3U1TA 4BLPA 1CWUA 2NU8A 1FYDA 5JMOA 3U1VA 1SXPA 2I9KA 3ZY6A 1J7JA 1D9ZA 4WW0A 1HZZC 1KP9A 5CFZA 2V3VA 1XJ0A 5INTA 2R47A 1E9AA 1KS2A 2NM0A 2C0PA 3SSNA 2JLRA 3UIEA 2AB0A 1UCFA 1M73E 2CUNA 3ADBA 2YFQA 2A58A 4CKYA 4HH1A 1M6NA 3QELB 1LK5A 4QODA 4O02B 2FVXA 3K3PA 4BE9A 2XGMA 3IUMA 1UZAA 3KEFA 3NTLA 3M6IA 2RH5A 3P9KA 4MV5A 2YKGA 2GTPA 2ZE5A 3JYLA 3OA0A 2C2GA 5G53C 2GK3A 2Q4RA 4KVGA 4ND8B 1E60A 1RQLA 2HO4A 2M1ZA 3QEAZ 2X5OA 2HSWA 2JW5A 2A9OA 3F9RA 4F8YA 1NXOA 4LCBA 4DWOA 3IEVA 2O8CA 5E7IA 1E7WA 4WLOA 4JXZA 4K28A 5E6UA 1THMA 2QT1A 3W8FA 3RBZA 1FZTA 2ZU0C 1E3MA 4IVQA 1MGOA 4EG0A 1U7UA 3E9RA 2C20A 2C54A 2WA1A 4WXRA 4EI8A 1WVIA 2ZKLA 4KE8A 1DC7A 4WINA 3IUBA 4W82A 2VLIA 4YT8A 2OKGA 3I5AA 5K4AA 2I3ZA 1SIWA 2J5KA 3HDVA 4R41A 1Z13A 3ZHTA 2C99A 4OP3A 2HBZA 2Y1XA 3VA7A 1RPZA 3RVQA 2EQAA 4BGIA 2CXXA 1EX6A 2J3QA 1WZUA 4NMHA 4ZQBA 4ZQCB 1IAQA 1MB2A 3PHCA 4M1OA 3ESBA 5C0OE 5HW0A 2VDRB 4Y0VA 4C6TB 2O59A 2RDMA 4JOCA 5HKKA 3K9LA 2Q0XA 3P2JA 2JAOA 4ZAGA 2PN1A 2XYPA 3A25A 2QVZX 4DW8A 3MQ2A 3T7IA 2AOUA 1UC5B 2MMCA 4R2XA 4V39A 2W2OA 3A4YA 3LS2A 4LWZA 3G1WA 5HKBA 3RU7A 1SCQA 5LZ5A 3PFCA 1OXBB 1SHLA 2V5AA 5J5VA 5K8JB 3KEMA 2AFHB 3JQEA 3KQVA 4B3CA 3KX2A 3H97A 2JKVA 1TK3A 4KNWA 3RAJA 3O8LA 4K86A 4AZSA 5JV5A 1PT6A 1I6WA 3DP7A 1PSDA 3HO6A 4L8VA 3K0BA 4PEVA 5K0NA 2Y1GA 3VKGA 4UJ3A 2ZS7A 3EVGA 4URYR 3KQLA 2C77A 5SY9A 1KETA 2NT4A 1Y4ZA 1KS9A 4AN4A 3O03A 3DMTA 1TI7A 1U3WA 4MUEA 3L9XA 1QPBA 2VKTA 3LT4A 1Z16A 3AHGA 1ULUA 3D8BA 3DULA 1IZYA 3NBYC 1XZFA 3OJFA 3PS9A 4QLAA 1I2CA 1P7CA 2AG8A 1MJFA 3ETGA 3R5SA 4I9NA 4LCEA 2NPOA 4TKVB 4OTZA 5TV2A 5GZ3A 4TQ9A 3HO8A 4XX1A 2C7PA 1O6FA 3SBDA 3I9FA 5H70A 3TVDA 1IHUA 1H5QA 3CZRA 4O2BA 5G0SA 3ZD9A 1B8OA 3DEFA 4OGGA 2ZIGA 4BFXA 4C4YA 2C94A 1PUXA 3IB6A 4P3KA 3AESA 4R05A 2D4AA 1A82A 4EGCB 2BHSA 5L4LA 2O5CA 8MHTA 4NMWA 4FK8A 4R8LA 4CXMA 2QPOA 2GF9A 5FUQA 2A9FA 2XCOA 3BDVA 4MVJD 1NAHA 3CW8X 3QFCA 1XU9A 4L2IB 1FLAA 4WHMA 3X1YA 1HNXB 3QPDA 5ECGC 1F4PA 3L6RA 4YRIA 3OAAA 4ITRC 5I7RA 5JXHA 1MA0A 4CV1A 1MPXA 2XKBA 4HQNA 4BNFA 2O8DA 1GQOA 2B20A 2V98A 4UPEA 3KZVA 1P6XA 4CQMA 5JSZA 3NYRA 4S24A 2HRDA 5H7XA 2B25A 1JJIA 4U63A 5DM0A 2H2GA 2BSXA 2XT0A 3GO4A 5K2OA 3GOHA 3FUWA 3QFSA 3O91A 4QXAA 4YMHA 4UE3S 2DG2A 2ZAIA 1H6BA 2GEVA 1C3OA 1E6CA 1JSZA 4E46A 5I4CA 3NONA 3Q85A 2GYUA 4IJWA 3RBAA 4UU7A 5SZKB 2N1MA 1USUA 4MWDA 1QF6A 2CSXA 1OLUB 3GJXC 1SB8A 4QUIA 1YUNA 4RABA 2GCOA 4UM9B 2CEAA 2OWDA 1X8KA 4RKWA 3IALA 2HT6A 4J0HA 4YQYA 4IFTA 2JHAA 4QASA 1HT0A 4UBOA 3VOTA 4B7XA 3V6LA 1XA4A 2C5BA 2C03A 4LYJA 3QPBA 4Z99A 3RREA 3SQNA 4EW6A 3QUAA 1T5LA 3A1FA 2I1WA 2H63A 2B5OA 5DSZA 1UWCA 4PO1A 2PM8A 5JISA 3CBQA 4OUDB 4H6PA 5AJZA 5IT0A 3DV0B 5AM2A 4CEIB 3TDNA 1K5HA 3ZU2A 4EFNA 3LVRE 3MMSA 4FYVA 4MWOA 1SOWA 4CF4A 1BE8A 2I34A 2OCPA 2Z2KA 3HVHA 3KTOA 4EZEA 3OTHA 1X1CA 1K88A 1ZLYA 1ZQ1A 2OGSA 3E3LA 1T5DX 2MSNA 4MRVA 3ZS9A 1YZFA 1YVRA 4NS4A 3EJWA 2AUMA 2Q3BA 1S3GA 5C3MA 4RDXA 1U0EA 5KX5F 3ST7A 2QMUA 3K1AB 4PCUA 4HLDA 3EZ9A 3E35A 4JB2A 2PSSA 2PMEA 4C88A 5ALWA 3TZCA 2X0RA 4TWZA 4KO4S 3UMJA 3B53X 1IM2A 1II0A 2COEA 3EE6A 3IB3A 2QSZA 2VZ8A 3MCAA 5LP6A 2VBFA 4GC9A 3PCXA 4AJIA 2IH4A 4I4IA 3EWNA 5A6SB 3QEOA 3L0PA 2PUDA 3L4SO 1Z8DA 1WB6A 1N6OA 4UHEA 4WL0A 1HDCA 3L05A 5FLKA 1AKMA 4DBLC 1ZIDA 3UKOA 3LQ1A 2W93A 1N2IA 5I7AA 1EUYA 1Y5LA 1VP9A 4D45A 2W6OA 1KVSA 3WOVA 4AJHA 2EG9A 2PLNA 1B2LA 2P35A 1JVNA 3GU3A 1C7FA 5IW8A 2R4UA 2RGYA 1JR3D 3D7RA 1S01A 3PUWA 1X0VA 3CLUC 4AQDA 3NZEA 1IK4A 1ZL2A 3KQUA 4GI3A 3S6JA 4CMGA 2C59A 5GONA 2CHVA 1ES9A 2ODQA 4KO8A 2NZVG 1AUVA 5K0TA 3PDIB 5DSTA 2XY4A 5A4AA 1GGKA 3HJTA 5AYVA 3BA1A 1M34A 4XVRA 4ER6A 4CMIA 4F9EA 1KEEA 3VJMA 3WB2A 3C15C 3LYUA 1U6IA 2VNHA 4EF5A 2ZIFA 4FS8A 4O4HF 2QYSA 4I7EA 5FFMA 3A05A 3NVDA 1EK5A 2QX7A 3IESA 1EZZA 2RB5A 4IX1A 4BLRA 1DX9A 3K09C 3WC4A 4AP5A 2SKEA 1A8SA 3D4BA 3H5VA 1CQZA 4LY6A 1IOLA 3T0IA 3WR5A 3K96A 3LW8A 3PD7A 2FW7A 2HNKA 4OGWA 3FFTA 1Q95A 3ZX4A 2CCGA 2OK7A 2B2XA 4N0MA 3VO9A 4CEJB 4PYRA 4QOHA 3K0CC 3KB8A 2V6FA 3TLEA 3G0CA 3NQ41 2OXFA 3NWJA 1Q0TA 1G5IA 1DWUA 1H93A 2FR8A 3CRW1 3B3FA 3I9V6 5D6NA 1GAXA 1PD1A 4PAWA 4DLAA 3IQGX 3OE5A 2G6TA 2KMLA 3IJRA 1UMCA 3SX0A 1YUMA 3UK2A 3F4KA 1WSAA 4KH0A 3FOAA 1QG0A 2C9MA 3ZDZB 4PYOA 2YW2A 2BTQA 4WVLA 3ZU6A 3DMGA 1E3WA 3JQRA 2M6KA 3JQ9A 1BQ4A 4J9UE 2VZEA 3JVUA 2RGCA 4LHWA 4R69A 1XOIA 2ORYA 3L0ZA 1CS0A 2WV7A 4G5YA 3VNSA 4B44A 3P9RA 4KXUA 1R9MA 4H7IA 1N3LA 2E89A 5L53A 3HABA 3EEQA 2JARA 1ZD1A 4NZZA 1K7XB 1D2AA 3G5LA 1NXPA 5HEKA 3EA4A 1QO7A 4CLDA 3BTSA 2FPIB 3BWEA 2BMAA 2YHIA 2ZRBA 1PI3A 1UP7A 3LZ6A 2B3TA 2JGDB 3Q3IA 4QATA 1AZWA 3NTQA 3MLBA 1PL0A 1UBTS 3IERA 1G6KA 2ZRQA 3NTXA 4R1OA 5CB4A 5AW6A 4FGKA 1CIVA 2C9CA 1JLHA 1NYQA 3H9UA 1K92A 1K5PA 2BZ1A 3ILHA 4TLCA 1L4EA 5J1TB 4CM6A 3KOWA 5B6JA 5LNK6 3HXQA 2ZYIA 1TTTA 3IAEA 4ML3A 4PONA 2NT3A 2BFPA 1E9CA 3OJXA 1YDMA 2R8PA 1JL3A 1XXHE 1Z2OX 4WX2B 4FOOA 4K8RB 2M2IA 3V9PA 4EOGA 2XXJA 2ANBA 3V6MA 1CJVC 2CLDX 3WGGA 2ZS8A 1IPFA 1YRWA 3BE4A 2Q07A 3K05A 1EG7A 2C9YA 2IEBA 3MJFA 2B78A 4MTLA 3RRMA 2VXOA 5LYJF 5I01A 1W7AA 2I1LA 3C7CB 4G3XA 3U40A 1V6SA 1ZNYA 1CQWA 2F17A 4QHSA 4LXYA 4X3PA 3DUFA 3I45A 5H3HA 3HCEA 4HVLA 2DSNA 1SCUB 3H0CA 4D25A 1I13A 2CUZA 2J3LA 3PV0A 1ISMA 1TO2E 3VC1A 3ZD6A 1VL6A 3HCRA 1K6IA 2AH5A 3QVOA 4GU5A 2RGNA 2H29A 5CH8A 3KD3A 4IIJA 3WP0A 3Q9LA 2C42A 2QMZA 4K26A 4IZ6A 4LBZA 4GE0A 3I37X 4DDHA 4PZUA 1VBFA 5IMSA 2FPRA 3DMDA 4ZV7A 4IR7A 1KQ3A 3NVMB 1G55A 2QTVB 1RKVA 4JB8A 4PC3A 3OFJA 3ZWWA 1XD9A 5HUHA 5FFFA 1YACA 2D0DA 3OD1A 4KV9A 2VSXA 4EQZA 1G21E 1EGQA 1HDYA 4TSKA 3R3ZA 5EXSA 3Q87B 1NFFA 2D2VA 5L3ZA 3IJPA 2YNMD 2GZ1A 3AM5A 2WUWE 2XE8A 2VTBB 1GY8A 1IH8A 2GZSA 1HXHA 1KYZA 3ONEA 1MC4A 5C8YA 4OX9Y 3GBSA 2RHWA 4FZRA 1RFGE 4DIMA 3KLNA 1BMDA 5E1DA 4HL6A 1Q1GA 5C8DA 2L82A 3QX7A 2J0SA 4TZTA 1N92A 2Y9MB 1RTKA 3EUFA 1EWVA 4BRWA 2OTCA 1ZH0A 4R7TA 2WJVA 3U9TA 1PEAA 2Z4RA 5AJTA 4A0HA 3K9QO 5ILOA 1PIWA 1QWOA 1RLOA 2QLMA 1LBQA 1YB2A 3LV8A 4JV5B 1W87A 4KKVA 3A3YA 4MRMA 1G66A 2X0IA 3LO8A 3RWBA 2Z3VA 4MA4A 5D8DA 3TE6A 3ZIAD 4CMKA 4DR2B 4RORA 2GZMA 4O0MA 4OH1A 1SXJC 1V71A 3ZXUB 1CX9B 3GJ3A 4ND7A 4PHTA 5FTWA 2OP0A 3MTIA 4AJLA 3MXTA 1JHYA 2V0GA 1HEYA 1GU0A 1D3AA 3IUPA 2HMVA 4ZT2A 2R87A 3OECA 4N48A 1DU4A 2BR3A 3GUUA 2XE7A 3N0VA 4DVGA 3H18A 3D4OA 5SY6A 4IUDS 3T3GA 3VZBA 2EX1A 2QDKA 2BEVA 3W06A 1DIRA 3BEDA 5KTNA 4G1BA 4G01B 1VJ0A 2ZB7A 2C2WA 1U3GA 3X43A 1NBMD 1NQ5A 4NOKA 1WWKA 5DW0A 2GZRA 4PS0A 2XJ4A 4R9NA 5EFOA 3SSMA 2YZKA 2HA5A 5TMPA 3RF6A 3AKCA 1FUYB 1V48A 3G5AA 3GZ4A 1BWPA 4FMDF 1N1DA 2TS1A 4HWGA 5E1MA 1MF7A 4JLPA 5E0KB 1QP7A 1OAOA 1ZMOA 3NTRA 2GJSA 3BIXA 1F6DA 1XCLA 1LRJA 2CCJA 3IC5A 4H16A 3TVTA 1N2XA 2H2FA 2VDOB 1WZIA 1GZ3A 3UK6A 1QYIA 3FPEA 3H8VA 3KK0A 4M1KA 4CCYB 1R6BX 4E07A 2BFEA 3DTVD 3BWCA 2Y0DA 3PIDA 5F4ZA 4PNHA 1AMNA 1WDKA 4BEVA 2Z2IA 4QPPA 121PA 1JGTA 3A1WA 1EFKA 1RAAA 3H11B 4MYUA 4ZI7F 1P44A 4P80A 7MDHA 1T5BA 2INGX 1Y8AA 3OSZA 4HDCA 3GV0A 4N0EA 3RRYA 3VTFA 2E82A 4JLSA 5KDDA 2IHNA 4FT2A 1K0UA 3IVRA 5J63A 2QPLA 1GZ6A 1JFVA 4CIAA 2H5IA 3LTEA 2QTTA 1GCOA 2YV3A 4KGXA 2ZAGA 2BCEA 4YECA 4M86A 1OC2A 3GAMA 5L4SA 3VX3A 5CFNA 1N8NA 1C9KA 2DRIA 2DH5A 3TSYA 2JAXA 3M1YA 1ZK3A 2KI5A 1YAHA 4ZDIA 4TYNA 1J0XO 1BEEA 2ZROA 3OE4A 4H1VA 5FT9A 4W7SA 1VHJA 3H9GA 1G6OA 2ZRMA 3O3CA 3UWSA 2QY9A 5HOEA 5WRFA 3CNHA 5IZCA 1YB1A 2A84A 2JASA 1OWLA 4ND3A 3IPXA 1S02A 3KR2A 4YONB 5SV2A 1OBVA 3GGOA 1J1IA 3MYYA 3PXDA 4H7JA 4E5VA 1NF8A 2QR5A 4MVCA 4E88A 1R15A 1ZC3A 1JDTA 4GKKB 1X7WA 3ED5A 1OWNA 4UNIA 2ZZMA 3EQ7A 4MKRA 1BGXT 1UKAA 2OGWA 2PRKA 5LQAA 4LIPD 2VCEA 3EW9A 1EHYA 2H17A 4KAJA 1MAHA 2JA1A 3B1VA 1B73A 2V7UA 1OIWA 1R27A 1DQZA 1C9JA 1E2GA 4XWAA 3I5XA 3I9KA 4BVLA 4H4DA 2C3UA 1D6SA 4GC5A 4X1IA 1PR9A 1W5TA 2FK8A 4EGQA 4BP3A 4DUZB 4NOLA 1K89A 4U02A 4DIUA 1H2YA 1A9QA 1QBGA 1EM6A 4FOTA 2UU9B 3DLHA 1XV5A 1P5HA 4LRYA 4D6PA 4HADA 3ZY4A 1PV2A 4O1MA 3JQ7A 1KERA 5JNSA 2IE8A 2ZJOA 2YVUA 1JQKA 2AOTB 1DOZA 1K97A 2DBVO 2PZ8A 4N4AA 3REGA 3M4YA 1KSHA 1CR1A 2YWFA 2VT2A 3A70A 4O4LA 4AT1A 4EUSA 2F1RA 4YRMA 3DONA 2WWWA 4MDYA 4PO8A 1KEZA 4M9SA 1LS1A 3RRJA 4DCTA 2ZBGA 4FFBB 2R6FA 4QFDA 3KKNA 3KS9A 5I8ZA 1SU7A 4QJIA 1Y8QB 2DY1A 5IJ0A 2JFPA 3DLAA 5I9SA 4D56A 1XJ5A 2LCIA 2G9VA 2ZJBA 3G7NA 2FJ0A 5BMVA 2NX2A 4C0WA 3SC2B 3CH7A 2XWJI 3FDIA 2UYCA 2IUYA 1C30A 3IOYA 2PL1A 3AHEA 3SVZA 1A8PA 2IUTA 3DNPA 4PZLA 5AXCA 1XZMA 1SC9A 4BO1A 2H5LA 3R5KA 1H3EA 3UICA 5BPHA 5FR1A 5DLPA 3SDSA 1JTVA 2VDVE 5DGCA 4U7GA 1PT9A 2UZ1A 3QLUC 3UJ7A 1YCDA 3PUJA 4Z2YA 2HIMA 2WWFA 2D1RA 4JR2A 2POQX 2GWRA 3ZV4A 4R16A 1BCRA 4HFJA 3GNLA 4EO4A 4QYTA 4A91A 2X9QA 4PNZA 2X8AA 1KBZA 1YAJA 3N2EA 4PPQA 1KORA 4U8HA 3GARA 5T3UA 4Q3NA 3QBDA 1GV0A 4YI5A 4QICA 1LI4A 1XWIA 4AMUA 5BWNA 3QA3E 4ZTZB 4B3GA 2ASVA 4OQ4A 1UPBA 3FTCA 4YRRA 4EG7A 4OI2A 1E6UA 3IHTA 3WOHA 3EXEB 4JSRA 3QBEA 3ZLUA 2DBYA 1EE9A 1RWOA 2AR7A 3N8IA 1DWQA 4H31A 3FTFA 1VYVA 4B6QA 4LGMA 5ED4A 1ZD3A 3VKWA 3WGIA 1M1YE 2CXNA 3LVBA 1EB8A 3P9QA 1LEHA 4FGWA 3B20A 4I4TF 4P22A 2IWHA 5KYYB 2DQYA 3RSOA 3EGWA 5CXXA 1RAIA 1NVAA 1Y42X 2OCGA 2Y1FA 3D8SA 1B26A 3GVXA 2ATIA 2VCHA 3CGWA 2IOFK 3OCXA 2V8OA 2XKJE 5IK2A 4TLDA 3TCXB 4U7FA 1J09A 1E9FA 4Q9DA 2PAFA 4E5YA 1Y98A 1ORTA 3LQYA 4CIWA 2CXQA 2G67A 4H1UA 1QZTA 3BTOA 2QL5A 4PZYA 3HVIA 2RJOA 3E05A 4PVCA 4AFNA 3L8ZA 1L0BA 1M10A 1MG0A 2VAVA 4B48A 5FLEX 1RHMA 4J90A 1E77A 3L7AA 2C4NA 3N74A 4HRAA 3AU9A 1PT8A 2O52A 3WL7A 1KVQA 1L4LA 1MT3A 1QG2A 1EVYA 2C2HA 3N2KA 3R0QA 4G5FA 4M8IA 1YA4A 2PUHA 4P4UA 1Z4OA 3BE8A 4KN8A 5H1YA 2FEWB 4FE4A 4TM7A 1QYDA 4LE2A 3H65A 2P3OA 4L28A 1N9KA 1XTSA 4AZ3B 3ORQA 4IJVA 1L7DA 5IUNC 4H0NA 1NXSA 3OOHA 4M98A 2RHRA 5EC8A 4I8XA 2WZCA 4AZ0B 4DG8A 1XK6A 3T1NA 2O3RA 4LK2A 1VMKA 4B7ZA 4D9KA 5DOZA 1LU9A 2CXHA 3LUPA 1V3UA 1WEKA 1YE5A 4M4SA 2AXEA 1NOKA 2WHPA 4M9CA 2HR1A 1PZEA 5AW3A 2EVWX 2YS6A 2VRBA 3ZDYB 5HF9A 4M60A 3D3EA 5AXBA 4QGBA 4FYHA 3VO1A 3AKEA 2PUFA 1XMIA 5K8VA 5LD2C 1F48A 1JH9A 4XPIA 5CHYA 3X1JA 5B6PA 3OQMA 5REQA 4C78A 3CCBA 3HCBA 5B4TA 1UP6A 4HAWA 1DC5A 3EUAA 2ZBUA 1RYNA 2ZWAA 5HM8A 2FQWA 4JP3A 3GG9A 5M3BA 3LGSA 1F2TA 1BGVA 4O2BF 5BW8A 1L5QA 1YVDA 1LNQA 2FKNA 3S40A 4MWEA 4I9FA 4QDTA 3KCQA 3ITNA 4A8TA 3PE4A 2WWVD 1X7GA 4LC0A 2IHTA 3RTCA 3ANLA 2A9PA 3RDPA 4DQUA 3GUHA 3H5AA 5K1ZA 2QVCA 4DCPA 2V58A 2F64A 3CRVA 4PINA 1DIAA 5B1EA 1UKZA 5CGQB 2WHEA 4BXOA 1ND6A 1X0XA 3DL4A 1JN0A 2XLCA 1LW6E 3ND6A 4IBOA 4WLUA 3VR4A 3I6MA 4DYDA 3AM1A 1XPOA 1W5AA 3TO5A 1SCKA 2N0SA 2P5YA 1US8A 2DJIA 2X1VA 3DDOA 3ES9A 4GPAA 2IU0A 1IIRA 1INLA 5JRJA 3GFSA 3EFHA 5EEGA 4F06A 4BLSA 1AUQA 2AW3A 1MV8A 2FN7A 1CUUA 3PG5A 2VR1A 3I28A 3EX7C 1NGSA 2OBLA 2XXBA 3H5NA 3I2GA 1RSZA 4NTZA 2VXCA 1UEXC 3GQBB 4JLOA 1U5CA 2PRIA 4JLNA 4S0ZA 6REQB 1U5BA 1EIZA 1P1JA 1YHNA 2AI2A 2DOKA 2P9EA 5T57A 2OZKA 3TPFA 1VKJA 1OR8A 2EP5A 2NAFA 1S2DA 3GGCA 1IPEA 2QNIA 3K20A 4YP1A 2WVAA 1C9MA 2VHQA 3U3OA 1C81A 3DWIA 1EEHA 3PE3A 4YJGA 1I80A 1LH0A 4N5IX 3WMFA 1BKDR 4HQ0A 4MEBA 4I5DA 1W5BA 4S1WA 2GNPA 2EEZA 1IUNA 5ERYA 5LBIA 3RARA 5DCYA 5CDTA 3WDMA 5CVVA 3P9YA 3QLTA 3TAUA 3QUBA 4WOKA 3PNYA 1W6UA 5JBNA 3DYVA 1PFGA 3MUEA 3SF8B 2BKUA 421PA 1XCPA 3I09A 1A9OA 2ZE7A 3L93A 5EIWA 4WK0B 3I01A 5JSQA 2ZIZA 1MU0A 4PU0A 5FPQA 3WA6A 2J08A 2X6QA 4HAXA 5JXGA 3OT1A 5HM6A 2Q3DA 2JD0A 1UJCA 1Z0DA 3DDUA 4WFKA 4ESEA 4B6RA 3VO2A 16PKA 3RO7A 5FHRA 3AMVA 1ZKDA 2J5RA 4HLUA 4ER7A 3Q7TA 2D7JA 1CC1S 4LXTA 5KNBH 4RFVA 1CHNA 2RK3A 4MHTA 1ENOA 2P0EA 4M0EA 1QB8A 2I7XA 4MDHA 2I4LA 4R31A 4Q1VA 4EEXA 1R74A 1W0KD 1WKBA 2YVAA 4D0RA 4OSPA 4JBHA 2Z9BA 3L1VA 4XWWA 2Q1XA 1ZNQO 1BXGA 1CE8B 5DT2A 2HH9A 4PAQA 5FBQB 3OP1A 3Q8XB 4NBSA 4ZXFA 4OD0A 2X8JB 4XVUA 1BKSB 3WYDA 3JWPA 1J6UA 1NULA 1T0HB 1MHPA 1XXHB 2XDQB 3CPEA 4LCJA 4AS3A 4CUKA 5L4NA 1XAGA 2QA5A 3HM9A 1BS9A 1EFDN 4LHYA 1R88A 2HXYA 2R48A 4LY9A 4BV2A 3L1HA 1Y3HA 2ZUBA 4WJZA 1PL6A 1QDLB 2R60A 3ZNQA 1ST3A 2R86A 3ETEA 3MJHA 5GIPE 2HY7A 3SXPA 1HYHA 1JZSA 3AUXA 1IMOA 2YYYA 1J23A 3HYTA 2PYIA 1W88A 2BEKA 2DLDA 1VJDA 3GRUA 3JSAA 1NXXA 2CHEA 3MMXA 4M0DA 1RWVA 2IPXA 3L4JA 4IO1A 5GONF 1UANA 3SLRA 4F92B 4TVOA 1B23P 3JQQA 4N6OA 2PUWA 3DBLB 5HCNA 4CCAA 3T8YA 3H4IA 1MR3F 1N7IA 3HS3A 3AK4A 2O2SA 2YJ3A 1IBRA 1M67A 3DKPA 3MTJA 4QYXA 2XCTB 1U8FO 1RR6A 2IYNA 5AJWA 4JLKA 1TM1E 4R8RA 5I9MA 4DLWA 1XTQA 3UMMA 2JI6A 3COJA 1PWXA 4MJLA 4L7VA 2ZBPA 3IKTA 4YRCA 3WNBA 4P08A 1PO7A 1XYVA 1Z0JA 2D1QA 1EK1A 3L5OA 2PQ2A 3SDBA 1KR2A 1OXUA 5H68A 3TLBA 5AICA 2ETVA 1NP7A 3CVUA 1B16A 3OBIA 5KWJA 5CFPA 2QV0A 1JHMA 4D0LB 1SHJA 1OH7A 5FADA 4QELA 3TLYA 2WT8A 1MV5A 1P8AA 1RKUA 2BFOA 2HJVA 4UOQA 1XZGA 2DUMA 3E2IA 2GF2A 2IZ0A 1ORVA 1OPXA 3A6FA 3CVOA 3IMFA 4WRRA 5EJIA 1V26A 1IQPA 3BMOA 3FCCA 3L8FA 1NVEA 4RY9A 2H4XA 3NT4A 4NBRA 5ETJA 3U4CA 1G8YA 2IEAA 2VHXA 2CDAA 3ETCA 1RBYA 3AIKA 4DZRA 2BN4A 1VJ5A 4GO1A 4C7XA 2KWIA 2C92A 3NHMA 4ZU3A 3IMEA 2G08A 2I6SA 4YRQA 5JFTA 1E9VA 4KPUA 2FOXA 4ZYVA 2CDNA 2GZ3A 4JIMA 5FULA 4CN9A 1PNQA 4PM4A 4ZWNA 1TRKA 3TAXA 3VOBA 2WP8J 4GDMA 4PLGA 2XX3A 4Z1MD 4EW3A 2VO1A 2OUKA 2ZJ5A 3V42A 3MUFA 4HS4A 1IG0A 3KKOA 3PFBA 3OQ1A 3MWGA 4MPRA 4NZYA 1NX9A 3KELA 3IFSA 3LPLA 3FLEA 1VE6A 4LJ9A 5AI5A 1D1TA 4HNTA 2IOHA 5CG1A 4K2HA 4KXVA 3F6EX 2P9CA 3VYSB 1IAVA 1ZOPA 3LE8A 1X7XB 2Y2UA 4JCCA 2B9VA 3FDXA 3NIWA 2VAWA 4NCBA 1E3JA 1RFLA 4PSKA 1W59A 2PRYA 3VKFA 4BKPA 3Q2KA 4HWOA 3W5CA 3MLEA 1L7AA 1ZO8A 2BEJA 1KA9H 2DX7A 1H1LB 4J6FA 4GGMX 4ZXPA 3CYFA 4UUBA 1SBTA 5K3BA 2XUHA 4G0NA 3OIVA 2F2TA 2N46A 3Q7RA 2XQFA 5BMOA 5JH7F 3M2TA 1XZJA 1XMJA 2AWNA 3E4DA 4BNYA 1MN6A 3JSXA 1S96A 1F1JA 4IIJF 4K9KA 3HA3A 4O5AA 4DRYA 2XXAB 2OZLA 3D3JA 3IBCA 5KMGA 1Z18A 1Q3HA 2G71A 1Y3IA 1AQLA 2JCSA 2UZIR 3I8XA 4HC4A 4IOMA 5ER6A 4BVKA 4CGYA 4EEKA 4UD6A 3VC3A 3BH6A 3O1JC 1TFUA 3H2GA 5AKJA 3VDRA 2DHQA 1D4ZA 4IFEA 3TSCA 1WHSB 2PWZA 2ODAA 4AD8A 2OD9A 4PQFA 4Y2RA 2WILA 1PVOA 3F7OA 1GPJA 3JTEA 2ORWA 1TKAA 2VNSA 1K8XB 3TW8A 3NBQA 3MS4A 4MW7A 3VX4A 3WY9A 1GTJ1 2WD9A 1T6ZA 4M8SA 4EA7A 1W5EA 2PT7A 2F62A 2Q5IA 1Q19A 2JDID 4ZT3A 4M8NE 2VWQA 1L4FA 1QYWA 3ACDA 1IBSA 3HE3A 4JC0A 5F2OA 1HNNA 4DLKA 1RQGA 4TV8B 2B34A 4RIHA 1N2ZA 3GRPA 2D4HA 2WYWA 3A2MA 1O2DA 1IRIA 3PHBE 1VPLA 3ZDQA 1I1NA 1NI4B 4RGQA 3HYNA 4UD2A 5FI3A 1YVPA 1RCUA 3L0CA 4RX1A 4X61A 5BV2P 1Z2CA 2A35A 3I92A 3HJFA 1G7TA 2D0IA 3QPWA 3R3JA 1IYZA 2ZPAA 2VUHB 4MYSA 4RDIA 3UF0A 2EFEB 2NNWB 5F2NA 3RUFA 1KMHA 4B46A 3W2IA 1P45A 4GUAA 4B3BA 5KYTA 5LKAA 5A9SB 1Z3IX 3UV6A 2GI4A 3OCVA 2W2LA 4HH3C 2WM2A 4AN1A 3K73O 3OQHA 5CCXA 5FUWA 3RLIA 2ASEA 2YMMA 3J81k 1DS6A 1XD2B 2HJRA 5FAKA 3S2FA 1POWA 1JU9A 2LVBA 3NCHA 3EZYA 3PNSA 3STTA 2WINI 5BSEA 4G0MA 1URPA 2RBEA 1H4SA 1E8DA 3I3OA 1TAGA 3VI4B 1LTHR 1GT6A 1QIEA 3LBYA 2ZQZA 1Z68A 4QRHA 1ZU5A 4W9MC 2IYSA 2SCUA 1TIKA 1VIMA 4M2LA 4FYKA 1RC0A 2FI1A 3DBRB 4XDHA 3UCFA 4EIWA 3BT7A 4XSHA 4JYPA 2IEDA 1MJGA 2ZBFA 4KYIB 1GUFA 3K0EA 5K6RA 5BN3B 1P2SA 2P9HA 3ZHYA 3HBFA 3BVPA 2CHGA 5B1IA 2C5EA 1Z8FA 2F43B 3FF1A 4LSWA 2C8VA 1E5TA 2Q5QA 1RXYA 2DY0A 5F7ZA 3J80A 5KOHB 2BJWA 1NX6A 2XB8A 4JEIA 1TUGA 4XWGA 5DCWA 5IPFA 4DLBA 3B9PA 1C1HA 4X95A 3BK7A 5L3SA 1J97A 1KI7A 3HMKA 3K31A 3L02A 3W6ZA 3ZHSA 2O50A 3TPZA 3OE1A 2YWBA 3EZFA 4ZQEA 2Z09A 2JIBA 4UE6A 4DLXA 1NIJA 3I9MA 1ZU4A 3HFRA 4N3BA 5DHUA 3I2KA 4DQXA 721PA 5E4FA 3WBKA 3MXOA 4LECA 1KJYA 1HOXA 3MWLA 2FDCA 1VG0B 4BQNA 1RXSA 1SQ5A 4OJKA 4Q66C 9LDTA 1QFSA 5D3MA 4CUJA 5J23A 4PCAA 5IDVA 2BBTA 2CLLB 2IP4A 1W4AA 2QVXX 3B1JA 3RFVA 4QD3A 2MYNA 4I1IA 4NOMA 3C1TA 3VHRA 5K8UA 1CXZA 1AF4A 3ZTWA 1Q1ZA 3JXEA 5ICSA 1Q1BA 2PXXA 3VKUA 1B1CA 1G2PA 1PQ4A 4J4TA 5J40A 2FPWA 2AYYA 1ZINA 2Y99A 3ED1A 4M1EA 4L75A 3F5QA 2DT5A 1T6BY 1SRQA 2GN2A 4XI9A 4WLFA 3B9RA 2R25B 5GOTA 5TT1A 4AUKA 5CNIA 4EA9A 4ZPXA 2I4NA 3DV9A 2I65A 5JYCA 2JJ8A 2L2QA 4JOSA 4YJKA 3KZOA 1XEFA 2DB3A 1PLJA 4I1PA 1XJCA 4YYZA 2VJYA 5HCIA 1WABA 4MVJI 2Q9AA 4TMZA 1ZBQA 3HI4A 1IWPB 4HWKA 4Q3DA 4EFKA 4PANA 1EDZA 3R7WB 1TAHA 3BJZA 4TUYA 3HWRA 4MYTA 2C7OA 1E3SA 1VLJA 1CUYA 1YMUA 2P9BA 4GPIB 5EP3A 3V48A 8ABPA 4EPVA 1IZ8A 3HYRA 1KOLA 1ISHA 3ZWMA 2OWEA 3WGQA 1BNCA 1JZQA 1X7ZA 4JHLA 4RE5A 1SA0A 5GP1A 4FC7A 2PFSA 4WBNB 3D7KA 1VLLA 2CF5A 2GVDC 3FZEA 5FA6A 4L4SA 1TECE 1HE1C 4EB6A 3QTLA 1CU1A 1SOUA 2ZIAA 4MVYA 3COPA 2BM8A 3S2IA 1NUHA 2H57A 3I2HA 4MEAA 2ID4A 4MS3B 4FYMA 3VNRA 5JLAA 2Q2WA 1UXGA 5CPBA 1MAVA 4ILEA 1IY2A 3P52A 2FSUA 4K7JA 4N03A 3U4QB 1IHPA 2HDWA 3G49A 3DTVB 3MN1A 3MINA 1SXJE 1L7XA 4UZSA 4AY3A 5I5EA 4A8JB 4X60A 4I3GA 5CVUA 4MUKA 1P6QA 4BZZA 2HEIA 2V7QD 3AWDA 5TF4A 2PJRA 2Z2ZA 2VP2A 2JA2A 4FHEA 1DI0A 4EA8A 4HYTA 5B2EA 2XMZA 4ODIA 5EHIA 1MB4A 1X77A 2HMTA 4XJVA 1R4ZA 2JCBA 1UM8A 1H22A 3WWYA 1OFUX 3KKQA 4RZ2A 1YRAA 3NGLA 3R8FA 2C5HA 4NE2A 1T0BA 1KAGA 1RZUA 2OFFA 5H80A 2EZ4A 1RYBA 2W8BA 1TFRA 1ELOA 1OI7A 1G63A 1PS9A 2WZBA 4OXYA 3C7DB 2QE7D 3OKFA 4G4IA 3RVJA 5JXIA 4X0EA 3B8EA 2CDBA 3AGQA 4DA9A 5BWLA 4NZMA 1DV2A 2WFZA 5ALPA 2WTUA 1E4EA 2JFYA 3OJOA 2COKA 4MGHA 2X41A 4LVOA 1KSFX 4ZGBA 1PZMA 1M5TA 2AFIE 2YWRA 2ZUEA 4R9RA 4WEQA 3AJEA 3A6HA 1BQEA 2HKIA 2VPQA 3ZXYA 5DLYA 3OLXA 3UMFA 2AI1A 5LIRA 1IOVA 4YJ2A 3LLVA 5CW1A 3WHLA 3K6SB 1QANA 1G5PA 4LYGA 3HCAA 1DJOA 4LMAA 1D2MA 3L04A 2NLOA 4HDRB 4HTAA 4I2VA 1EWTA 4R6XA 5E0OA 5GZ6A 4Z6KA 1J8VA 1ILEA 2VPTA 5JI3E 2J4FA 3VSEA 2D2IA 4M9UA 1IPHA 2O23A 2GA9A 4RQUA 2JAUA 5EQDA 1TQ4A 5E6RA 1W9HA 2VHZA 2FEAA 3IQHX 2CLIB 4NEHB 1XYYA 4OMFG 5BUSA 3UNXA 3C24A 5EIEA 3DJFA 1T35A 2DHCA 4JFRA 4F2DA 1Y1PA 2BM0A 1MORA 2UZ0A 3G59A 3ECSA 4QDXA 1CUAA 4Y2QA 3VR6H 1WV0A 4A0FA 1JMYA 2Y1EA 3T94A 4A6DA 3A1SA 2A92A 4IIBA 4CMHA 2QYTA 3E82A 3GJ0A 4OBEA 5HCUA 4C22A 2BIFA 4M83A 1L5YA 3JPYA 4EI2A 2D1YA 3ZU5A 2ZTHA 5LXTB 2Q3MA 1C4WA 2Y76A 1IUKA 1L5MA 4RD2A 2AC2A 4YI3A 3RYIB 3A1CA 3OSUA 3ZHRA 2OBMA 2OE2A 5CVTA 1QTIA 3EMVA 1ZPDA 3LZCA 4BNZA 1ZD8A 2XB9A 4F91B 3LUGA 2ZUSA 3EVAA 3JS5A 5A5FA 1SKQA 1CG6A 3OZFA 2XWSA 3WQSB 4DJAA 2YBDA 2JEZA 1TM3E 4HEQA 4XTCS 2F48A 2ORIA 3RHSA 1TPZA 2R1TB 1NHWA 2BDTA 2F3SA 3P9CA 1A7UA 2H9IA 1FDOA 5E6SB 2CNKA 4LJSA 3EA5A 4BWVA 2EZ8A 4F11A 2VNAA 1D7OA 4B82A 1CF4A 1C4OA 2GEFA 1P62B 5JMPA 1MO6A 3UATA 2E6KA 1VSQA 4MRAA 1W8DA 3DCIA 4D81A 1RD4A 1NZFA 3O2QB 4E30A 2CLOB 3L8YA 2E5WA 5JAHA 2BR5A 4AUMA 1GNQA 1VMEA 3RSLA 5DI9A 4S1OA 1MAUA 3II6X 2Z6AA 5JNLA 5T8KC 3DE2X 4HB3A 1YZGA 3D1LA 3OTQA 1J33A 4D98A 5H59A 4X45A 3T7EA 3LYHA 5KINB 2R7MA 4OI0A 1NY6A 2VF4X 2CLFB 4U2EA 4DMCA 2PUVA 3AVYA 2CHQA 3K6JA 3V80A 3LP6A 1ZR2A 1ORWA 2FFHA 4MO2A 4O4IA 4NDZA 4ECEA 2NGRA 3DAGA 3EVNA 3V8EA 3FRJA 4JJEA 1SWVA 1QGAA 5EMNA 4L08A 2XYVA 4DXDA 5HKAA 1XKLA 1FFHA 1QH0A 4L5BA 4HATA 5AKLA 1A97A 2OB1A 1X86B 3KAJA 3VHXA 1ZK0A 2EZ9A 5BURA 2O5RA 3SS7X 2ZB4A 4Z86A 1XK7A 3KR1A 4EG8A 2PU7A 1E1LA 1N9GB 1W0JA 4P8RA 4YCBA 1OBFO 3OZTA 1A50B 1YBHA 3D3KA 3FCSB 4NH4A 1OT3A 1DDOA 3WWEA 1GAEO 3DPIA 3C8DA 4Q9JA 2WD8A 3ZWOA 4RGBA 3DHNA 3HZZA 4FKMA 2M98A 2RBGA 4IMJB 2WIBA 3SZMA 2GCIA 2D2XA 3EIQA 4CKWB 4F60A 5HK9A 4G4SP 4WZBE 2VVTA 3EMDA 1N32B 2B83A 2HW8A 1MB3A 2ICAA 4NRDA 3T5PA 1PS8A 2UDPA 4HN4B 5EA2A 4R2HA 4B1FA 3Q8MA 3NWBA 5FWNA 5T67A 3V7UA 3FXAA 1Q14A 1OSNA 4BO9A 3B1FA 1DC8A 1VLQA 1M8KA 3UAWA 4FE3A 1VCNA 4HZIA 4IHAA 4F3KA 1FQKA 4RIFA 2UXCB 1FRVA 2BFDB 1D07A 1EHCA 3T5BA 4TTRA 3VMMA 5BQ5A 5CNJA 3PNKA 3QOXA 3RS9A 4F86A 1II8B 3MAJA 4NULA 3MFYA 4R2WA 2I4OA 2B7BA 3ZNPA 3E1GA 3O2SB 1UBKS 5AK3A 4X64B 1E61A 4TS4A 5C32A 2DEUA 1Y5NA 1FFDA 3ZH2A 2FW6A 1U1FA 2J1LA 2WUDA 2EWMA 4Q1EA 3HNPA 1GO2A 4P58A 1QHYA 2TMDA 1GAQA 4UBMA 1BX3A 3MRXA 5DYWA 3CG4A 3DA8A 2BBOA 4W6QA 3U3ZA 1B8NA 4YMLA 5L6LB 1QDEA 4DUPA 3IQWA 5C4GB 5LFAA 2HRQA 4BZXA 2X23A 4J7CA 3PQ6A 4EFDA 4RMGA 2J3JA 2B94A 2G63A 3WYEA 4E5MA 2XKKA 3PLNA 2BMWA 4C2AA 2QJFA 4EO9A 3H4MA 4Y6GB 5ELLA 4A8JC 1JMKC 2GX6A 2WMYA 3PGLA 1C1XB 1BFUA 4DRXA 3PFWO 3KLBA 4YALA 4CV2A 1CUJA 2Y9PB 4DMRA 2AMVA 5LUBA 4C01A 5DB4A 1ZZGA 1DB3A 1E2HA 4YASA 5JHHB 4BS9A 3SSAA 4Z3OA 1G4AE 3ZJ5A 3FPKA 2I5PO 3H3FA 4YDRA 1NFRA 3ASVA 1ORRA 3T0FA 4R71A 5C2JB 1B14A 4JX8A 1LPMA 3CTPA 4TRJA 2FA9A 4DPLA 1WA5A 4IQ0A 1KY5A 1GUDA 5AUOB 1DFHA 3TCKA 1PFQA 1J8MF 2J6HA 1AKTA 2PBZA 3IP6A 5D85A 1LNSA 4F96A 1V35A 2HBQA 1D5WA 1VL2A 3LFTA 3WMGA 3MWEB 1MXHA 2Q62A 2R6GA 1GG2A 3A36A 3H0EA 3GJ4A 5KNDD 3SWWA 1E63A 3CFYA 4AO6A 1K3UB 3LX6A 1AKEA 1KO7A 3PC7A 4LTDA 4UVDA 4C08A 4CDGA 4F97A 1AU9A 4ZGWA 3VYTB 1F17A 1OUMA 4AMVA 2K4MA 2QN7A 2F9FA 4HEHA 4BIMA 4DCMA 1PTKA 4RPGA 2DFTA 1XMVA 1EUDB 3EASA 1N6PA 4ND2A 4NCNA 4ZEOA 4DJEC 4EMBA 4IGFA 4ZOBA 1ZMBA 3IV6A 2NUTA 5FOQA 4DV4B 2VRWA 1AN9A 1YZNA 1FSSA 4P3OA 1Z6YA 1K7CA 2D62A 4V0NA 2BHNA 3EC1A 3HLTA 3JQBC 4YAOA 3QRWA 3KQPA 1P0MA 3TEMA 1ZCJA 4G5GA 3HG7A 5CD9A 4K9RA 5KVSA 2BC9A 1H3FA 1L5WA 1PK8A 1ZICA 4KAAA 2IIQA 4ZHSA 8GPBA 3V55A 2IODA 1QQAA 1BU8A 4Q7QA 3D2BA 1NZJA 2HZBA 1GZSA 4BMNA 4LISA 1CETA 1DTSA 1ZGAA 3MWFA 2GVZC 1DRUA 2FSVC 2VH5R 4YEDA 5DBIA 4IIFA 5JCOA 2VJDA 4WKCA 1ZUIA 2NSHA 3TR5A 3UY4A 3ZVMA 2QMYA 5FUBA 1SGWA 2WIAA 4BQFA 4XJSA 2C4HA 1KMCA 5T6BA 5JDIA 3GLIE 4N40A 5EXTA 1U7WA 3A6LA 4Y2PA 3KOMA 2F9LA 3X1MA 1LK7A 2FCRA 5HKOA 1KQOA 1PJ2A 1L1QA 2ZSIA 4UEWA 2J9YB 3H0KA 4ITUA 3I9NA 4Y9UA 3MM4A 4CQLB 4Q19A 5A7HA 4E1BA 3X0DA 2X2FA 1SBHA 4G0PA 3RTEA 4TRNA 2P77A 4YIKA 5H5JA 1P3JA 3RVNA 1ZVQA 4Q7MB 4EECA 1OE0A 1U3UA 1A2KC 1HZZA 4JLDA 1VB5A 5KQGA 2UZ3A 3CUUA 1FNSA 1P39A 4LJ8A 4X90A 2YIVX 3UUGA 4P9NA 1D2GA 1H0SA 2NQ8A 1H9AA 4ICIA 1V4VA 4WN3A 2RHMA 3CNEA 2D7DA 3Q41A 2Q7DA 1YJBA 1N6KA 2OD2A 5ITVA 2QM3A 2F9MA 3WWOA 3G13A 4TGLA 1U7PA 3IVAA 4IWYA 4RCVA 2PKRA 2C9DA 2VPIA 4FN5A 2A0FA 3CW2A 4KWHA 3NOOA 2F59A 4R68A 5EWLA 3PFFA 1CLUA 1LDEA 2YWXA 4PC7A 5KX5B 4Q6WA 3GGDA 4NFSA 1VHQA 1DO0A 1GPWB 1SQSA 1CJSA 3ZXXA 1T91A 2BTOA 1WRBA 1PZFA 1J22A 2WJGA 4RGYA 3L7NA 4E15A 1E2BA 5CH5A 4BRUA 1CUXA 2P1ZA 4GPD1 821PA 3JAWB 1YF3A 4R4JA 3WFZA 5IJ9B 3JW8A 1NMXA 1XPRA 3SR0A 1AGRA 2YDXA 1KJ8A 3MOSA 4YAFA 4EGAA 4FYIA 3TTUA 3DEYX 2BT4A 3EOAI 2UVDA 2Z1DA 4H1WA 3I58A 4D9NA 3ADDA 2FPKA 2GM5A 2BGJA 3H5IA 3G9ZA 3TBKA 1TDJA 4XCXA 2H52A 1J2UA 4EPYA 3AVTA 4JLAA 3WKBA 4MAFA 2IYTA 1M2EA 5JANA 2AZDA 1V96A 2JI4A 4CKCB 3IE1A 4DR5B 4E0BA 4CM8A 5ALYA 3V4FA 4C4TA 1AG9A 2A78A 1UPTA 4MZDA 2X2OA 3NUGA 3QPAA 1V1MB 5JPCA 4GHWA 1DKMA 1H9CA 4CL0A 3VBEA 1V8OA 4IY1A 2H9YA 2IYXA 3BMQB 1RBQA 1GA1A 1WPRA 3QFFA 3QHAA 4KXNA 4F3NA 3QK7A 3FWYA 5D87A 3DCNA 1E2MA 3IRUA 3RR2A 5IASA 1RRKA 3OOWA 4DS3A 6ADHA 2OFXA 2Q6OA 4Z9AA 3RW9A 1TTPB 4I6GA 5I7UA 2GWHA 4D9IA 3F4LA 2BGMA 1N1EA 2Q50A 2QVGA 4HFNA 2YFYA 1WNFA 2TMGA 2A0WA 3GLHA 4FFRA 4ZYZA 2EYQA 5DXFA 4XOIA 1NW9B 1UMBB 3UMRA 4AJOA 2BFMA 4ZU1X 4CETA 1UFRA 2E21A 2PKCA 2W00A 3O73A 4OM7A 4LPKA 3ZQ6A 2ZUDA 1CEEA 5JQGB 4RSHA 4BEWA 2EP7A 3DWFA 3VTZA 1E2LA 2ZDQA 4YBZA 3TIVA 2AQHA 4CL8A 3QZUA 4DL9A 1XD8A 4UULA 5IXSA 2CMDA 4F2GA 2CBXA 5EJAA 4HGYA 4E4RA 4DOMA 4LPSA 3I2IA 3CWQA 3C6ZA 4YJHA 1VLZA 3NIBA 2D13A 3M5WA 2VSFA 4DM3A 2PKXA 5A0FA 1FC0A 4JQCA 4FHZA 3R0ZA 1CJKC 2P9ZA 2BFBA 2IYRA 2Q8NA 4OSEA 1THTA 5AVRA 3IAM6 2HJ9A 5BQPA 5MFPA 4OHZA 2ZXEA 4HDAA 5D5QA 1OGJA 4M1YA 4DLRA 2NV0A 3SE7A 2JLZA 1L5SA 3NH6A 2C1ZA 3I05A 4BN5A 4W6ZA 5FEUA 1CDDA 4ZRDA 1XEWX 1F3OA 2EGHA 1RRFA 3H05A 3GEDA 1R0ZA 1OIVA 2QZSA 2YHAA 1I5EA 3R8XA 3UXMA 1Z6TA 3OM1A 1LI5A 4BJ5A 3L8MA 2QD2A 1YZHA 1K4MA 2C04A 1KXJA 1E2DA 1TCBA 3JQGA 4AF7A 1MRZA 2G07A 2NO7A 1L4MA 3LRXA 1E5XA 2W4MA 4HHEA 1M33A 1M8PA 1WSWA 3UT5B 4D8XA 2R5WA 1K6EA 4YP0A 3VAYA 4CFYA 4DMKA 3WLAA 1W75A 3BD8A 3FYCA 4I6JA 2QAGB 2O6LA 1YQEA 3VMFA 3AVQA 1RYEA 4J0KA 2ZLBA 1C7QA 2AF4C 5AJUA 4M6WB 3JALA 3WJ1A 4C0XA 1FMFA 2XIQA 3W4JA 4KFRA 3X1WA 3B2EA 4L4UA 3QU4A 2ZQYA 1T4CA 3LU1A 4NZOA 5EJFA 3GPIA 1JIUA 1Z37A 2WZQA 3M0EA 3OD5A 2L42A 1QC5B 1WNTA 1SUIA 3KUXA 3UENA 3V8NA 5HIAA 3MD9A 4D9EA 4HH4A 2GILA 4NV0A 3RHTA 5I51A 2WRZA 4QTTB 2F3RA 2H2HA 5EPOA 3WNDA 2OC4A 4TL6A 2YUIA 3HHEA 4RD0A 2G76A 2EL9A 4NQZA 3ZKWB 1ISFA 2G36A 2DPLA 1ESNA 1TT7A 5T5QA 3TLGA 4AYTA 5KNBA 5C52B 3O7WA 3B48A 1GEEA 5CLQA 1FMJA 3DKRA 4FPXA 4E5KA 4KAXA 3ANXA 1SUSA 4XDZA 4OJNA 2QP3A 3QNUA 2PMWB 5KNCA 4TUYF 3GGSA 2VNKA 2H1RA 3AY0A 3DXYA 3FOBA 5HZKA 3KSBC 5FL3A 3FETA 4JWKA 4DEYA 5AM3A 1ZM4A 3TSOA 2D3TA 3AM4A 1Y5IA 1BS1A 3R7BA 4UU0A 2YC4C 4PAOA 2A2ZA 4BQSA 5HDQA 1RABA 2G6BA 1PG5A 4M88A 3I8OA 4KUHA 2YJ6A 1Z0IA 3KTAA 3C85A 1A8UA 3Q40A 4PCVA 3WGOA 4Y8VA 4ZFNA 1C8KA 1CUGA 3RWOA 3RSZA 4YAUA 3L6OO 1C7IA 1Q11A 2L19A 1GD1O 2GTIA 2J3HA 4HPJB 3GGPA 3DAYA 1SD5A 1KI6B 1JG6A 5A4KA 3RSQA 2WJ3A 3AP2A 2C1EA 5JS2A 2C0QA 1M2VA 3FKJA 4FZ5A 4RK6A 4OYLA 1PW5A 2YQ5A 4PG5A 4I5FA 3WX0A 4US2R 4GPTA 3QELA 4OAQA 2DF8A 1A69A 3CB2A 1L5FA 3LA6A 2HRCA 2HMSA 1QS0B 5GGYA 2FZLA 3R3WA 4JJ4A 1EB9A 5K6AC 4QTUB 4I3FA 2VP9A 3U7EB 3IDAA 5DTJA 3BDIA 3QW2A 4M8KA 4ND8A 3W9UA 4JASB 3JTMA 3DEJA 4EWLA 1NRIA 1MNQA 1PZXA 2PX5A 2QLLA 3ECCA 1DAHA 4L5AA 5BOSB 4JI7B 2Q4TA 1H8HD 3DQPA 2HA2A 3I64A 1QVWA 1J2JA 3L7JA 3MB8A 1HDGO 4RC9A 1GLGA 1M6VB 5KQPA 5BUQA 2ZI6A 1ZA1A 1PTJC 4ZVLA 3RU9A 4R1NA 3RS0A 4G8BA 3V4SA 2X3UA 5A04A 3K0CA 3PSAA 2FW8A 1PP4A 4XA8A 3USES 1MRSA 3WLSA 1LGYA 2D00A 2E9SA 4W9NC 5ADHA 3JVVA 3T3HA 2ZWOA 1R9NA 3JASB 1SUCA 3O83A 2DECA 4UXIA 3TI7A 1TCVA 3RHFA 5AK6A 5FAXA 3ZCSA 2W42A 2IV2X 3SFZA 1PBNA 4H3SA 4KPFC 1Z7BA 4C03A 4KWIA 5T4BA 5EJ8A 4C6TA 5EUBA 2QU8A 2XUFA 2Z8YM 3UYLA 5ER9A 3WGUA 2X8LA 2XZOA 3UGQA 1DPFA 1LRLA 2H4ZA 4L8LA 2QRQA 4M9XA 1XP5A 4DAEA 1IQ0A 5BYKA 1C3XA 4CQNA 3GGGA 3NOVA 1N4DA 2AFHA 1T10A 5ENVA 1TUEA 3LHFA 4MQEB 3T3MB 1KZ7B 3LGXA 3Q0IA 5FPPA 3PPWA 4N7RA 5LWQA 3F0TA 4PIMA 3GEEA 4MWCA 5KJ6A 3ZW8A 2YRFA 4EJ2A 4A36A 4D3XA 4CLXA 1GL6A 3H84A 1SK9A 4RH0A 3P45A 1VI5A 1BHJA 1JEEA 4GD3Q 1ENPA 3TS1A 1XZIA 3S99A 4BB9A 3R6TA 2V3CC 1RWQA 3WK6A 4W5HA 2GPSA 1TZ2A 1VJGA 4ROSA 4TKVA 4MLCA 4D5EA 3RNLA 2FHPA 2G3YA 1ZSYA 1C0KA 1G4UR 2XODA 4WERA 5IFKA 1I7LA 5C51B 5P8WA 2FWAA 5JO0A 2AN1A 4US1R 1M2FA 1Z2NX 3OX3A 1RJDA 1J06A 4LYDA 1Q83A 3GCZA 1X15A 1G8GA 3F5FA 2HLDA 3AB8A 3JY6A 3MVEA 4I4NA 4LRTB 1RIFA 3C3YA 3ICEA 1N5RA 4NP6A 5H0IA 5B4VA 3DTNA 3GLFA 5JZVA 2WF9A 4BCCA 2XUJA 4CM5A 4P5PA 2WHQA 3W77A 4L2IA 4QPCA 1M0SA 3ZE0B 4KE7A 4IH1A 1JJAA 1YS7A 1ZXLA 3AYXB 4QJBA 5IBCA 4Q1AA 2G1UA 1BX0A 1L5HB 2IVZA 4UFNA 3U3JA 4RXTA 3VNQA 3H5TA 4GM4A 4RVOA 2NU9B 2KE5A 2WFAA 3TX2A 1TVCA 4EJMA 3IBGA 3KHUA 4KPGA 1XQ1A 1NL3A 4NNJA 3PZBA 2P67A 3KB6A 4MVXA 2V4ZA 3VRHA 2FW9A 5NLLA 1Q0UA 5IN4A 4R5MA 2GKSA 2QTGA 4TSFA 5C35A 3KOOA 3FI9A 5EGNA 1JHUA 2QJTA 1M2NA 2G8LA 1GGNA 1XZKA 1QPGA 2J3IA 1QQTA 3CQ9A 3GDHA