2YASA

Hydroxynitrile lyase from hevea brasiliensis complexed with rhodanide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
total genus 97
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yasA00
1XRQA 3IUQA 5J3JA 4OSEA 2PUHA 5T4BA 3V1NA 1P0IA 3QPCA 1Q0RA 3WK8A 4EY5A 4CG3A 4BRSA 5FDFA 4X85A 4B85A 1LBSA 5EHZA 3FSGD 3CCCA 3M81A 4KACA 2I78A 4FFVA 3CN9A 4A16A 5AHXA 1T2NA 2NW6A 4KR0A 1G4HA 4Y2JA 4TPKA 1CUFA 3QYJA 4JH0A 4OB7A 3WMRA 1YS1X 5DYTA 5KWJA 4BCDA 3STUA 2B61A 3H1AA 5E4YA 1HL7A 4S0XA 3H19A 2OCGA 2OCIA 1FFBA 5FLKA 4KJXA 1AZWA 4BCCA 4TVKA 4J0DA 2JGMA 1UOPA 5LP1A 2VT7A 4FWBA 4E11A 1XZEA 3IDAA 3AINA 4RE5A 2WHPA 4WY8A 1IMJA 5EFZA 1Q83A 4A23A 1LGYA 4KE6A 2YYSA 5SYMA 1M33A 4BDTA 1BRTA 1CUJA 2O2HA 3IVMA 3VXKA 4Y2XA 5A7FA 3WJ1A 1TKRA 3R40A 1TRHA 4ITVA 1BE0A 5T4HA 3D4LA 2G5TA 4BAZA 2Z8XA 4QA9A 4UHBA 5EIAA 3JYHA 5C81A 1QJ4A 5KREA 1J06A 4W1PA 4WFKA 4HXGA 5K3FA 1XZCA 1VZ3A 4ETWA 3G0BA 2RHWA 3WLAA 1W1IA 3W05A 3OC0A 3O4HA 5CTAA 4BB0A 4BC1A 5ALZA 4AZ3A 3HLKA 4LYDA 2XUQA 3D5EA 3I2FA 2XMDA 2WUGA 3PDCA 4WY5A 2C4HA 4DNPA 4OB8A 4Q3LA 4N8SA 4QDXA 3FYUC 5JYCA 3ESBA 3H2IA 1N5MA 1T4MA 1XRPA 1LLFA 1ZI8A 2C5GA 3HJUA 4Q1VA 2G4LA 2WFLB 3E0XA 1ZGCA 5JARA 1XZKA 3QM1A 5AM4A 1QTRA 3ILSA 4FLFA 5DTIA 4LIPD 4UPDA 4H77A 4X3CA 1SFRA 5C8XA 4MWSA 2BGRA 1ISPA 4L72A 5JALA 1TK3A 4UFPA 1R9NA 3EQ8A 4J7AA 3UMJA 5A6VA 5HZGA 4B83A 3H1BA 1XLWA 1GPLA 3HRHA 1QO7A 4G9GA 1K8QA 1XKTA 4AQDA 4W1QA 4DLNA 2BCEA 2UZ0A 2VJBA 3A2MA 1E3QA 5CMLA 2FJPA 5AM1A 3WWEA 1UK6A 4WDRA 1HLGA 4MXDA 2J4FA 2OXEA 1EX9A 4JEIA 3SX4A 5DTJA 5ALKA 4GI1A 4W9RA 5K3CA 4KRYA 1QIGA 2C7BA 3BDVA 4P9NA 2PKYX 1K6EA 2YXPX 2OCKA 4E46A 1ZOIA 1CQWA 1XZLA 3C43A 2R11A 1MU0A 3KDAA 2H1IA 3G0GA 2DQZA 1OILA 3E1GA 5K5EA 2WUEA 5C8ZA 4HXEB 4BZWA 3GELA 3WKCA 1UK9A 4Y2UA 3H2GA 5AK4A 2Z5GA 4ZV7A 3HZOA 3JWEA 3R3XA 3A2LA 1EH5A 1TCCA 2QXTA 3WIBA 3KWJA 4XX1A 1O6FA 3I2HA 1U4NA 4H0CA 2GBCA 4IHAA 2HIHA 4CG1A 5FP0A 1UK7A 2FJ0A 4DGQA 4J0CA 3ESCA 4KEAA 4KRXA 3NWOA 4UHEA 3GBSA 1AMNA 1UKBA 2PU5A 4DMKA 3O4GA 3GZJA 4BDSA 1J2EA 2XUKA 1C7IA 2RGUA 4BP8A 2HM7A 3PUIA 4H7HA 4MQMA 2O7VA 3RLIA 4N8EA 1H23A 4H7DA 2XDWA 2GYVA 1LPMA 4Y2VA 1Q0ZA 3R3ZA 5DNWA 1EA5A 4UFNA 3C70A 1F6WA 2PSFA 2WUFA 3HC7A 2VAXA 4B84A 4CFSA 1QIMA 3IULA 3A6ZA 1YB7A 5AK6A 5AKLA 2C0PA 2JEYA 4HAIA 3WYDA 3WZLA 4G8CA 5ALOA 3K2IA 4AO6A 3TGLA 3QMVA 4QLOA 2OG1A 1WHTA 2OCLA 2HFKA 5ALVA 3STXA 1TCBA 4K6HA 3I6ZA 4P93A 4BATA 3ZLUA 2R8BA 2J3QA 2WG0A 4HRYA 2GBGA 4NVRA 1CUDA 3PF9A 2VTVA 2BFNA 4BYMA 4DIUA 2CB9A 4NMWA 5ALIA 2GYUA 1XZAA 1A7UA 1MT3A 1B41A 2FX5A 1XKLA 1CUYA 4RE6A 2YASA 2XMZA 4J0IA 3DL4A 1THTA 3GA7A 2WTNA 2DHDA 2J3DA 4ZWNA 4UHFA 1W6RA 5LZ4A 2HL6A 1K4YA 2WG1A 2WIGA 1VZ2A 2WJ6A 4ROTA 5AM3A 2H9YA 2PU7A 3FVRA 2HA4A 5LLSA 5C7YA 1MNQA 3ZLTA 3DNMA 3LS2A 3V9AA 2ORYA 5FKJA 2OLEA 3DYVA 2ZJ6A 3G0DA 5ALHA 4H18A 2HU8A 1MN6A 2QUBA 3IURA 1WPXA 1XZJA 1ZD3A 2C5FA 3MVEA 1FFAA 1XZMA 3F98A 1CUXA 3LIPA 2ZYIA 4GDMA 4FOLA 5IH7A 4I19A 1XZBA 2AJCA 4FNMA 3DDUA 4PSCA 5AO9A 4YX9A 5AIBA 3O9MA 3C5WP 3F9CA 5ALLA 1UOOA 4IO0A 1EXWA 1IZ7A 5H3HA 2QT9A 4QZVA 1VA5A 2C58A 2QS9A 4HZGA 4PSUA 1WCYA 1QIIA 1J1IA 4QDUA 4U2BA 1G42A 5ALWA 2QR5A 2Y2VA 3I1IA 5ALTA 4NS4A 3QH4A 5AJHA 2ZVDA 4MYSA 4P92A 1Y37A 2CEKA 1XQWA 2CZQA 4IH9A 2G63A 2WILA 2OQVA 2HRRA 1QIDA 3WA7A 3OPMA 5JD5A 4LXHA 4U2GA 2D0DA 3G9ZA 2HADA 2PVSA 2HU5A 4AZ0A 2XUAA 2VSQA 4W63A 4U2FA 2Z3WA 4EBBA 3ZWQA 2XUDA 3DS8A 2EDCA 1FFCA 1CLEA 5A2GA 4J3JA 3WIOA 5LYYA 3H2KA 3WJ2A 1WB4A 4LKOA 2I3DA 5E2IA 1W76A 1IZ8A 3LLCA 2FUKA 5IKXA 1BU8A 1AUOA 1Q84A 3ZV7A 2AXEA 1LPPA 4Y2SA 2XUGA 4MQLA 2JGEA 3V1LA 4C87A 1BROA 1NU8A 1SOMA 5CW2A 3ESAA 1DWPA 2V96A 2XMGA 5AKZA 1KEZA 5LKRA 5CT5A 1MNAA 2HDWA 3F67A 5AM0A 3WKDA 1JMKC 2OQIA 3FLEA 1HPLA 4XJVA 5D6OA 1QOZA 1D07A 2OGTA 4EB0A 3EIOA 2QMQA 2HFJA 5JAOA 5AKGA 2BKLA 4DNOA 1ODTC 3S2ZA 5EGNA 2PSDA 1OXMA 3QMWA 1XQVA 1NU6A 2ONCA 4TGLA 2PSEA 5LZ7A 1ZIYA 3T52A 1BEZA 4LYEA 2PX6A 5DNVA 2GZRA 2XUOA 2HA7A 2OPHA 4UFOA 4QE3A 4ZXFA 5CT9A 4BCBA 2XUIA 3E4DA 1USWA 4B7ZA 3SWWA 3HEAA 1CUIA 4JNCA 2ZYRA 1FJ2A 3AIMA 4UBNA 4OYYA 4X6UA 3WQHA 3QZUA 4ARAA 2DHEA 3C8HA 1ZIXA 3I2IA 3FNBA 4BE4A 4PNZA 1EVQA 3NGMA 3WI7A 5C8VA 1MAHA 5IVHA 1K5PA 1N1MA 2PM8A 4X91A 3B12A 2VJAA 5E4JA 3TEJA 4LHEA 1YSCA 4EHBA 3IB3A 3F8SA 2O2IA 1CR6A 1EDBA 2VQ6A 1QIEA 3FVTA 3FSGA 1A8QA 1EHYA 2VAVA 2V9ZA 5ESRA 1IUNA 4YK7A 2VA9A 3I6YA 5JADA 2V98A 5AM2A 4X97A 1YA4A 4HVTA 1U2EA 1QLWA 3STWA 1GXSA 3Q0TA 1ZI9A 3L1JA 1E5TA 1XZFA 4X94A 3H2HA 3JW8A 2ZSIA 1ACJA 4BTLA 1TQHA 1VXRA 4EZIA 5AI8A 4KE7A 4Q3KA 1XQXA 1QONA 4K2AA 2JF0A 2W22A 1UZAA 3HYSA 4FKBA 1X2EA 5IVDA 2QKYA 1CUCA 4Y2RA 1E8MA 1HDEA 5HF8A 1ZI6A 1EVEA 1Y7HA 5ALYA 1JJFA 1XLUA 3QMMA 2AJLI 1LPNA 5KBYA 2WFZA 1QIHA 1EDEA 4PO3X 4DMHA 4UBOA 1BN7A 4QDZA 3C6BA 4RNCA 3C87A 5I8PA 2HHAA 2WKWA 3VVMA 1TIBA 1E8NA 4YPVA 2RI6A 2DCMA 4BRZA 1YAJA 2WTMA 3S8YA 2I03A 4BVKA 3GUUA 2WU4A 4OU4A 1WM1A 2HA0A 1FFEA 5JIBA 1LPOA 1LZKA 5EHNA 4F60A 4WFIA 3T4UA 3RM3A 3STTA 1AQLA 4K6KA 1THGA 4UBIA 2WFMA 1DT5A 5AKEA 1YAHA 4LXIA 1UWCA 2QUAA 3AUKA 5AI4A 5CXXA 1VXOA 4DTCA 4J0KA 3C8DA 3DJYA 3HABA 4I4CA 5LKAA 1RP1A 4KAFA 1JI3A 1GPKA 1IUOA 3AJAA 2H7CA 4GXNA 3ED1A 1H2YA 4QDOA 3W2TA 1ZJ4A 3D2CA 4FDMA 4UHCA 3QITA 3PFCA 2X76A 2HU7A 5LZ9A 4BC0A 4UHHA 3MUNA 3R3VA 2BUAA 1E89A 1O6GA 3U0VA 1UK8A 5CH5A 4G4JA 4C4YA 1XROA 4H7FA 4HXFB 1QO9A 2EEPA 3IUJA 1XRNA 2XB6A 3WK4A 5JAPA 5DYWA 2X8BA 2AJ8A 2ACKA 4LXGA 3PE6A 4AN0A 5AK5A 1H22A 3W9UA 2RIPA 3G02A 4ZI5A 3DOIA 1SCIA 2EDAA 5D3KA 5AI6A 1JMYA 4GLBA 5D7BA 2QJWA 4KAJA 1DT3A 3WKAA 1MX9A 2QVBA 2K2QB 1UKAA 3KD2A 5ALUA 1Z68A 5FPPA 1C7JA 3BL8A 1WB5A 1ZJ5A 1A8SA 1YA8A 3IA2A 4KE9A 1JJBA 1ETHA 3AZOA 1ORWA 4B0PA 2ECFA 1H2ZA 3B3QA 3C6ZA 3W04A 5JD4A 2RHTA 5BOVA 3WK6A 3N0TA 5IVIA 3LIIA 3STVA 1L7AA 1LPBB 1VKHA 2ACEA 3NOXA 4DNQA 1GQRA 3BIWA 3KXPA 3AILA 4FNGA 5CURA 1ZD4A 1QIFA 4G1FA 3BXPA 5ALFA 4Z49A 5HKAA 3QPDA 2WG2A 3O0DA 4B9AA 3H2JA 1UXOA 1YS2X 5FOQA 5AH0A 2DQYA 3Q8WA 2Z3ZA 3RARA 5ALDA 1DU4A 1K63A 3LCRA 2JBWA 4MWTA 2JEZA 5A7GA 2DR0A 1ODCA 2CJPA 4OB6A 5HKBA 1XZIA 4P08A 3SK0A 1EI9A 2GYWA 3WA6A 2P8SA 3F97A 5ALSA 1JJIA 5ISMA 2WHPB 4Y2PA 3WWOA 3DKKA 3TJMA 3D2AA 1EK2A 2XUPA 5A71A 2AJBA 4OD0A 3FYUB 1VE7A 2QOEA 1CUBA 4M0EA 2PSHA 5T4FA 5CBKA 3FYTA 5K3BA 3W9BA 4INZA 4XIIA 5JZ9A 5JAHA 5AK3A 1CUZA 1PFQA 4X00A 4CG2A 1ZICA 5AOCA 3G0CA 2XUFA 5AKHA 3OG9A 2JGIA 1CUUA 1EK1A 4G4GA 1KU6A 4W1SA 4C6HA 2QRUA 5K3FB 2XMSA 4UUQA 1P0QA 4NZZA 3R0VA 4OCZA 2B9VA 1EINA 6YASA 3ICVA 3FYUA 2XT0A 2BUCA 1YASA 4H35A 1L7QA 4H7EA 3H17A 3H04A 5HCUA 3DOHA 2Y2UA 3IBTA 1U8EA 5JZBA 4FFWA 4FLMA 4H7KA 1QFMA 1JU3A 1BN6A 1HKHA 1ZD2P 1WPRA 2WFLA 3VDXA 1GKKA 3O4IA 2JGKA 3ZPXA 1BCRA 3M83A 4F21A 4PW0A 5KWIA 3FLAA 1AURA 2WUDA 4XWGA 1BCSA 3I2KA 1F8UA 1MJ5A 1JFRA 3K9BA 4W1RA 3G9TA 3RKSA 2PPLA 4IQ4A 3O4JA 5AKKA 4DMCA 3DQZA 4JUIA 3G9XA 4EY4A 5HK9A 3O9VA 1G5FA 3L1IA 2DSNA 4CI9A 5AKJA 3BWXA 3WWDA 5HFNA 2BAGA 1CUVA 4FTWA 2XQGA 2HRQA 1J07A 3EBLA 1GQSA 1JU4A 1F0PA 2JGLA 1X70A 4AMYA 2H7XA 3V1MA 1GT6A 1R3DA 1QTIA 2YH2A 4RGYA 1QZ3A 2XUJA 4FBMA 3BF8A 4BAUA 4GBGA 4PQEA 5LZ2A 1RYYA 3OURA 1PV1A 3M82A 4QLAA 4C01A 3DKRA 1QGED 3C45A 4B6GA 4UBKA 4IH4A 4KYVA 4V2IA 3D3NA 2JIDA 3D7RA 2VF2A 4RPCA 1B6GA 2Q0XA 3ANTA 1CUEA 1CV2A 5CH3A 4H7JA 1WHSA 1GPNA 1N8SA 1G66A 1DX4A 3WZMA 2WLSA 3QVMA 3WL6A 5EHXA 4U2EA 5BWBA 2VJCA 3G7NA 3I6MA 4O08A 1XRLA 2E3JA 3D59A 1C4XA 1XLVA 3V48A 1TCAA 1VLQA 5AI5A 5YASA 1R9MA 1E8DA 4GECA 4Y7DA 1UKCA 1LZLA 2QTBA 4K6GA 1GGVA 4DSAA 1FSSA 3G9UA 4G8DA 5DYYA 4H7IA 1F0NA 1JT2A 3ANSA 5T4EA 3ZLVA 1A88A 1SCQA 4FBLA 1CQZA 4AO7A 1KU0A 4E14A 1YR2A 2O2GA 1QFSA 5I7UA 5DNUA 1PJAA 4BAGA 3BF7A 4Q34A 2X5XA 3AZQA 1CFJA 4KAAA 1Y7IA 4M0FA 2C0QA 1UT6A 1R4ZA 5HF6A 1XQYA 3QBJA 5AKYA 1MX5A 3OOSA 4N5HX 3WL8A 2CUTA 1AX9A 1P0MA 1QE3A 2V97A 4QNNA 2VATA 2PL5A 2WIFA 1EB8A 2WJ4A 4HTAA 4C89A 3IUNA 3VVLA 4MEAA 3V1KA 1S8OA 2XMQA 1W75A 3FCYA 3MUOA 3P2MA 1XZHA 3CN7A 2H7YA 4B9EA 2QZPA 5AI9A 4DMFA 5AKIA 3I2JA 4BZZA 3VISA 4AXBA 2ES4A 2XI4A 4J03A 3QPAA 3OM8A 4BBZA 2QM0A 2PSJA 2WHRA 4AB1A 4FHZA 1TAHA 2LIPA 4HRXA 1MO2A 1XFDA 3AIKA 3F96A 4UBJA 1W4LA 3E3AA 1XZGA 3X3HA 5FXMA 2WIDA 1MPXA 5EIHA 4C4ZA 3DD5A 3WK9A 5CT8A 4BP9A 1H2XA 4AN1A 3H18A 1ODSA 4WDQA 3WK5A 4YASA 3I1YA 5HF5A 2QJRA 1AGYA 4OU5A 3A70A 4E15A 4C88A 1SCKA 3MGAA 2CBGA 3BJRA 1VJ5A 4G5XA 5JD6A 4WCVA 3I2GA 4KE8A 4WFJA 5JANA 3UUFA 4Y2TA 2OAEA 1DQYA 5AP9A 1CPYA 3G8YA 2AJDA 1CUAA 4EY7A 1AC5A 3AIOA 2ZJ7A 4PF1A 2D5LA 4ZREA 2XMBA 3SC2A 4C4XA 5JASA 5FUMA 1FFDA 3EQ7A 3OTQA 3HACA 2OAGA 1MAAA 3YASA 3PFBA 4J0HA 1CRLA 4QWMA 2GZSA 1NX9A 1ORVA 1RWQA 1XRMA 1CIJA 4X92A 4Q82A 1JKMA 2IX9A 2HA2A 5ALRA 1CUGA 4MEBA 4MYDA 4X7BA 5EHQA 4ZV9A 1H2WA 4G4IA 4Y2YA 2RONA 1R1DA 4EA6A 2HA3A 4Q3OA 3IIIA 4B81A 4F5ZA 2G5PA 4M0MA 1IUPA 4D9JA 1U65A 3O95A 5LIPA 3WKEA 1QIKA 2WM2A 1LBTA 1UOQA 4Y9SA 2XQIA 4FLEA 5F4ZA 5K3DA 4B80A 4UBMA 5HK8A 3WWCA 4AMZA 4BE9A 2XQKA 5EIEA 2W6CX 2OGSA 5HF9A 5HQ3A 5CT6A 4HS9A 5CXUA 4CCWA 4Y2QA 3ICWA 4BVLA 4OYLA 2RAUA 2WQZA 3KSRA 2BJHA 4F0JA 1I6WA 2XQFA 3VKFA 2Y6UA 5K3AA 4OUKX 4L0CA 4ZRDA 5AIAA 3PF8A 3C6YA 4DM7A 1BS9A 4ZGBA 2GBIA 2JGJA 1XRRA 2CKMA 4CIBA 3FCXA 5ALGA 3EF3A 3DLTA 4WJLA 5HQ3B 1L7RA 2OGZA 2VT6A 3HXKA 4X71A 5LZ8A 1HBJA 2WIJA 1DQZA 1DTEA 3FBWA 2Y6VA 1QIJA 3W06A 2ROQA 3WL5A 2BGNA 5ALNA 1IVYA 3DEAA 2O7RA 4ARBA 5E4TA 5HFAA 4MJ3A 2BUBA 2B4KA 2XLBA 1W52X 1E66A 3FLBA 4AX4A 4X6XA 3BIXA 5BV7A 4K5QA 2DFPA 2WJ3A 1ZGBA 2WHQA 1MTZA 5A7HA 3D2BA 4JYMA 2ZYHA 1BEEA 1MX1A 2XE4A 3R41A 3B5EA 1DX6A 3ZI7A 2HA5A 3WK7A 4FMPA 4L3WA 1EB9A 4B82A 1SC9A 1N5RA 4GWLA 5BWCA 3DYIA 3CCBA 2HA6A 5DLPA 3C5VA 7YASA 4X90A 1VE6A 3DL7A 4N8DA 3FAKA 1CUWA 2XUHA 1OCEA 2ZSHA 3K6KA 3NUZA 3ESDA 3I28A 1ACLA 2PBLA 4L9AA 1DINA 3R3UA 3BE8A 1VA4A 1LPSA 4X95A 1CUHA 3VJMA 3U1TA 2GBFA 2I3ZA 4G9EA 3WL7A 2WIKA 4AO8A 5IVKA 4EY8A 5AICA 3RK4A 1WOMA 2ZJFA 3H0CA 5ALJA 1HQDA 2PUJA 3LP5A 1DWQA 1EDDA 3PICA 2VJDA 3WKBA 2VEOA 2XLCA 3VJLA 4CIAA 2XQJA 3R3YA 5CT4A 1LPAB 3TRDA 3GFFA 2XMCA 1CUSA 2Y1KA 5LZ5A 4CCYB 2QXUA 1DWOA 3KOOA 3BJMA 4QDTA 2JGFA 5A62A 3KWFA 3VJKA 3GROA 2J4CA 2WSLA 4PSDA 2ZYSA 5DJ5A 1CEXA 3EQ9A 2WU3A 3HSSA 1R50A 1A8UA 3BDIA 4U2CA 1VOTA 2B20A 5EI5A 3D0KA 3DCNA 1YCDA 5JATA 4PV7A 2IITA 4DYHA 5ALXA 3N2ZB 4J0JA 2CMFA 1X2BA 4OPMA 4A5SA 5CH8A 5ALQA 3C6XA 5DWDA 4CCYA 3HI4A 5AM5A 3L1HA 1GKLA 3WYNA 5ALEA 4BVJA 1YB6A 5AKXA 5JAUA 4N5IX 4XVCA 5AOAA 5SYNA 3PUHA 3AZPA 3WWPA 2IIVA 5AOBA 2DHCA 5FRDA 4GHWA 5FPQA 3M3DA 4GW3A 3STYA 1GZ7A 1LNSA 3FWHA 4EUSA 1WB6A 1CVLA 2XMRA 4UHDA 5D3ZA 3AFIA 4JYPA 4DNFA 2Z8ZA 4I3FA 4GEGA 1P0PA 3PI6A 5ALPA 1XZDA 3R3WA 4X6YA 4G8BA 4B0OA 5AI0A 5JZSA 3FOBA 1ZD5A 1R88A 5K3EA 4Q05A 3UUEA 4DSZA 5FV4A 5ALMA 4J0GA 4UBLA 4X93A 5CRIA 4IH1A 3CXUA 3G0IA 4U2DA 4BTVA 5I9IA 4EY6A 1UFOA 3A2NA 4QEKA 4QWWA 3IUMA 1AKNA
chains in the Genus database with same CATH superfamily
2CYCA 3GNSA 3IUQA 3J7TA 3LUCA 3N59A 4J90A 2PUHA 4N03A 4YLGA 3V1NA 3KNZA 5C5EA 1P0IA 4OSPA 3UTCA 3SJUA 5EMKA 2QYSA 1KJIA 5C34B 5JI2E 5B1SA 3W8FA 1LBSA 3PFIA 2PRIA 2X8JA 2PJRA 1KSJA 5EHZA 2DFDA 4TL7A 3T7CA 4L9SA 3O5AA 3VYTB 3CCCA 3FOAA 4Q1AA 3UGQA 3M81A 2C97A 2R6R1 3AHDA 1SXJE 4J75A 1OXXK 4QPZA 1B7GO 5DN9A 5SZJA 1ULAA 1R10A 3OWHA 3UG7A 1R2QA 2WSBA 4LG1A 1E2LA 4BQPA 4ZHSA 4CVNA 1RM5A 3AERB 4Q02A 4A16A 2O0JA 1MJFA 4XPZA 4P0TA 4HAYA 2VBFA 4GVLA 4M1ZA 5TQVA 1CZRA 4UAUA 1XF1A 5EXPA 4JJ4A 4JJGA 5D51S 3C16C 1Q44A 4LSGA 3ZDFA 4PX9A 1Y33E 1CUFA 5TSDA 1KEVA 3QYJA 2AL7A 2PT5A 1N0VC 3LUBA 4JH0A 3LUDA 1BMTA 1HNNA 1YS1X 1EJ6A 2JVKA 2GPJA 3CV3A 2WAOA 2G5CA 3M9XA 4ZT4A 4BCDA 3UKDA 1XKQA 2OXRA 2ONKA 3ADCA 1ZH0A 1GCOA 1MJGA 4NG4A 1EP1B 3C74A 1ENZA 4JJEA 1H66A 2HCBA 3AF4A 2HWKA 3WGIA 1NXWA 2DG2A 5G4LA 3H19A 1FLNA 2OCGA 5DK6A 3ELUA 3S3TA 4BFWA 4N0DA 3FJOA 1C81A 4KJXA 4QQRA 1AZWA 1MC4A 1HA3A 1R8JA 2XOXA 4BO8A 1JR3A 3AM1A 4PPNA 2AV6A 3DPUA 2JGDB 2FPMA 3V32A 1IZ0A 4HWRA 2EXXA 4WNAB 5H81A 3AQIA 3GK3A 5LBTA 2OXTA 3U81A 1GLGA 5HZMA 2HJRA 2C7RA 4RBNA 3LUHA 3UKJA 5L40A 1WA5A 1U0OC 3ESQA 4MR9B 4EEXA 4QOSA 3V4FA 2F62A 2R44A 4DIFA 4DSNA 1TIKA 1QK4A 4E11A 5C5IA 4QRDA 1NXPA 4EJMA 1F6DA 1Z3IX 3THWB 5JYEA 1DRKA 2PQ6A 2WNIA 5LMUB 4TSFA 1I8TA 1JQAA 4AJ1A 1G20B 1E5XA 7MHTA 1Q83A 1ADFA 2YQZA 3OZIA 3MLEA 1WIWA 4Q3CA 3F9RA 4UEKA 4YI3A 3FROA 1GYPA 2PMCA 3A1TA 3INRA 3L01A 1U5CA 4KE6A 4DYVA 2V5VA 1EWVA 1W93A 3R7DA 4ZGGA 3IT2A 1K9SA 4KX5A 3N7AA 4BDTA 5B57C 3KETA 3IGFA 3U3XA 3IVMA 2B1JA 2H2GA 3DEKA 1SOUA 1MO4A 3F78A 3CRQA 1KVTA 3IEKA 3CPHA 1H69A 1OI3A 1JPVA 2YJ4A 1NLUA 2LTAA 3P2JA 3V8MA 1D5WA 1R8XA 1A9ZA 2FP4B 2PS0A 2Z4TA 3DHNA 4REQB 2TMGA 4EMBA 3WJ1A 5A7FA 3EB9A 1SA0A 2RGRA 4N1AA 1ZLYA 4PZYA 3D4LA 4EKGA 3FKQA 1MW8X 1QQ5A 2EFJA 3DAHA 4FGSA 4INOA 2I0FA 121PA 2YUTA 4J3FA 2FW8A 5CBPB 5KVAA 3CONA 2Z8XA 4WQMA 4E30A 3T7KA 2VJMA 5M04A 1JAZA 3NDPA 1B6TA 3B1FA 3K6SB 2O48X 3M6MD 2ZTUA 5KREA 5E3IA 4DCUA 2CMHA 2B99A 2RGNC 3QVXA 2IF2A 2EJBA 4WFKA 2FZWA 2GFHA 4D26A 2VSFA 1R4MA 5K3FA 4XWYA 2ZUWA 4PPQA 2VDMB 1UP4A 2LVBA 2O3UA 4JZYA 2Z58A 4C21A 4YRLA 3Q6NA 2LCQA 1X80A 1M2JA 3D3JA 3JQ6A 3OC0A 2ZG6A 4LZJA 3T0GA 3O4HA 3OZDA 4HLDA 3QVGA 5CTAA 4BB0A 1UXGA 4ICIA 3D3EA 4AZ3A 3RIGA 1JHAA 3CF4G 4BC1A 3ASVA 4D45A 3WOVA 3FOWA 2NYAA 2QRMA 1QKIA 4TTAA 3ASUA 2XMDA 1JA1A 4IDFA 1TA4A 1EUCA 2Q9BA 2WUGA 3FRJA 4GIBA 4NOLA 1L5KA 3ZU3A 4WY5A 2C4HA 4NCHA 2IV2X 1YVEI 4PAOA 4G84A 5EJGA 3RUAA 3NCTA 4OB8A 4X20B 4AW9A 1UBUS 5CEJA 4UMFA 4CF4A 4DHEA 3HFRA 5KYGA 2A0FA 1BQEA 2BZSA 2MSLA 1T6ZA 1O58A 1PNVA 3L6OO 1D2HA 4B32A 3TX6A 4QDXA 2PL1A 5FD8A 4W5QA 3GFBA 1YCHA 1MEJA 2CYBA 3CXRA 2GCOB 3H2IA 3H9BA 1WVIA 4LQCA 2VP0A 4P7KA 3WBKA 2QQGA 3IDZA 2AC7A 3KKOA 5B1YA 1L0BA 2B1GA 4W5NA 1LLFA 3EBPA 4GMKA 2ACWA 3BHNA 1JUDA 2ATEA 4ES6A 1Y63A 1JDUA 2HT6A 1H2FA 2WFLB 2WT4A 3R5FA 4Q1VA 3EC1A 3V8QA 3FTFA 3JATA 4KFCA 2FDXA 2A1UB 1PQPA 1RPTA 1V5EA 1ZIDA 2VNIA 1XZKA 4QD3A 3ZV6A 3GCDA 2ZAMA 2RGYA 2I8CA 3DD1A 5AM4A 2EIXA 1HM5A 3OD1A 4FLFA 5LDHA 3VFDA 1WAMA 2NSDA 4O2AA 3BH0A 2M2IA 4EABA 1T2AA 3A3OA 4JQYA 4BMYA 1AMOA 4MWSA 3EZXA 3W4IA 2J5XA 2NU6B 4L72A 4E3WA 1AGNA 4CDRA 2OBXA 2Y4NA 5EPEA 1BMQA 4UFPA 1NVUQ 5B5SA 5K8TA 1UC4B 4DRYA 4E4YA 4PN7A 3M2TA 3UMJA 4XQEA 2E48A 2F64A 1Y8QB 5A3JA 2DBQA 4E5PA 2H8KA 4D4KA 2N42A 3C5EA 3P9SA 4OGWA 4DR7B 4QHYA 4DANA 1YZQA 3MGBA 1B26A 4HFRA 2RARA 3ETHA 1R6BX 4JL5A 3SMVA 4NNOA 1AKUA 4LS3A 3L06A 3WL3A 3IERA 4HEA6 4F04A 4BHTA 1XCLA 1J0CA 1RI1A 2VJLA 2XNDA 1Z13A 3IHWA 3K9FC 2PKCA 4R2JA 4BO9A 1X7HA 3MWEB 4QYIA 4EKIA 3UBTA 2AD5A 3EZ2A 2Z30A 1ZL0A 3KKPA 3O47A 4K88A 5DK4A 1RLOA 3T3DA 4YUZA 1AY0A 3V3TA 1D6SA 4ENQA 1V9CA 1P3DA 3HG7A 2XCQA 2OXEA 1XVUA 2XD4A 3A1CA 2DQSA 4KPFC 3V7NA 1G0NA 4L73A 4WCFA 2XB8A 3G0OA 5AXAA 3E22A 5DU2A 5DTJA 1QU2A 1L4HA 3D6NB 4U9IS 5ALKA 2CL6X 1OLUA 4ALLA 5K3CA 2HMUA 1QIGA 4R1LA 1V48A 2H3EA 3IOBA 2O8BB 2FMXA 1PNOA 4O4HF 2V54A 2YXPX 4ID9A 4FZ3A 5LR6A 2IDKA 3MWKA 3P52A 5K45A 2QD2A 3K09C 421PA 3RAEC 4RF5A 1CQWA 3O6VA 3R7NA 5LQJA 4Q3AA 5DBEX 4GKVA 2R11A 3AJ8A 3UFXB 3H5AA 2H9AA 1V2GA 2WAXA 3LU1A 3LBAA 2EQ5A 1NSYA 5DCLA 3KDAA 3EUWA 3OP4A 2C2WA 3GGPA 4V0KA 4F46A 1P4SA 3OLVA 2H4JA 2W11A 3B85A 3A4NA 1FSFA 1KS2A 2QLFA 3RSFA 4F5EA 4ZFNA 2HCRA 1OASA 1QV6A 1J5PA 3PNQA 4JASB 1LQ2A 2F9MA 1JDPA 4LCEA 3MTDA 3QVLA 4HXEB 4Z9AA 2TRSB 3DQPA 1JG7A 1SZPA 4ZQIA 2VS1A 1VYVA 4ZCRA 3GLFA 1P62B 2C3MA 3GELA 3VR4H 1UK9A 5FTWA 1PEDA 2C57A 2P4HX 3W6ZA 4DLKA 4Y2UA 3HY6A 1MIOB 1H1LA 5AK4A 2FZLA 2OHGA 4RZIA 3JWEA 4UMVA 1I0ZA 1XV5A 2H9IA 2DSTA 4R83A 2ZRGA 3S5UA 1I3MA 1YZGA 2ZE8A 3PXUA 1EH5A 1WV0A 1IHYA 2NZYA 3DW1X 3OLCX 4I46A 5JSFA 1S4MA 2QU7A 3PITA 2RH8A 4GFDA 2JCXA 2MSKA 3RROA 2RIRA 4KXVA 4MH0R 1HTWA 2VCEA 4PLYA 2FN8A 3PFHA 4KV7A 3B2NA 4QBHA 3NEPX 4DQXA 1FY2A 1SH7A 2CDRA 4QYMA 3L8EA 2FE4A 2FP3A 3ZWMA 2GOYA 2ZJ3A 2BSAA 5D87A 2D00A 5FP0A 3VZCA 4KU4A 1QPGA 1O97C 1I13A 4GEKA 2OHFA 1E2GA 3DUWA 4I50F 1HFEL 4BNNA 3E61A 3SR4A 1DBIA 3QUAA 3AR8A 4YJ2A 1U0TA 3OQMA 2X7JA 4HLUA 1TKBA 3I12A 4XGQA 3P2OA 3GZJA 4UU8A 5TEVA 3E7XA 3EDQA 2P5YA 4R9UC 4A2CA 1SXPA 4ENWA 2CN1A 5IBQA 3TOVA 3QQPA 4N76A 4XUCA 5G0TA 5BV1A 4U2KA 4EG5A 5FTLA 2VLBA 4Z86A 1LV8A 3UW1A 1DP4A 1DKMA 1Q0UA 3AR2A 3SJCA 2A58A 3GLHA 4BP8A 2AYZA 4BNJA 4E32A 2JZCA 1EUQA 3H86A 4KFRA 2E49A 2K87A 4KOAA 4ZAXA 4XWKA 2D62A 4JFAA 5ADWA 4XOUA 1NVFA 3OHPA 4LFAB 2E85A 4R5MA 1VIYA 2EARA 2O8NA 1MJGM 3LXMA 4H7DA 2XDWA 3PDHA 3X1YA 4PN3A 1E58A 3ETCA 4F6RB 3NAZA 3IJ5A 3MMPA 3DE2X 1ZN9A 1X7DA 1T8SA 1PT5A 2Z2ZA 3E48A 4LHXA 3TQRA 1M6NA 1H8ED 1T3GA 1W6UA 3M3HA 3GLFE 1NXQA 3ZWDA 3G2KA 3T6KA 5DNWA 2AKYA 3GEDA 3D8TA 3KEFA 1E3LA 1YOVB 4WXMA 2MDTA 3P2IA 4F8JA 4BGDA 2YJ5A 2MYTA 1NM5C 3PT5A 3SVZA 2I91A 3HC7A 4NBUA 5EERA 4AS3A 1IC6A 1MC5A 4JI5B 4B84A 1T4BA 1JAIA 4UEOA 2NM0A 2B2XA 2ZJYA 3F5FA 3PQFA 4BGIA 4CFSA 1QIMA 1WVGA 3OIVA 4UNRA 1UBKS 4CODB 1PQUA 3RWMB 4BB9A 1NQXA 3BREA 3GF4A 4ZVTA 2YFYA 1M6EX 1YB5A 4QASA 4HAIA 4URVR 1Y80A 5GZ1A 5B1HA 2LE0A 4XWTA 3SHVA 5KOHB 1E1NA 4U5QA 3ZV4A 1N2SA 4IRXA 2SICE 4AO6A 3TGLA 1KY3A 2H3HA 3H11A 5F12A 4EL5A 3MXOA 4EGCB 3SF0A 1M0WA 3W77A 5B30A 3IP7A 2BEWB 2H29A 4C07A 1V9SA 3DPIA 1GFZA 4LISA 2O1SA 1G6HA 1YZHA 4FOSA 1H2EA 2P2GA 1RKXA 1TCBA 3AEZA 1XUOA 2OVFA 3GRYA 4K6HA 3HXLA 3U4IA 3I6ZA 3TW8A 4BATA 3JQDA 2BVNA 3ZLUA 1NRJB 3ZHVA 1LDEA 4C7XA 2WG0A 3KB1A 4HRYA 7ABPA 4MRPA 1LRKA 5F1PA 3NAMA 3VR5A 3LUJA 3AO0B 3MTGA 5L4NA 2A0YA 2BFFA 2IU4A 4P4SA 2Z98A 3I01M 3SDZA 1KMIY 1H9CA 3GLHE 4JK3A 1XALA 1DLIA 4ZQHA 3BKXA 3T1QA 2PLRA 4RC9A 1KRWA 1TJPB 1QFZA 4DIUA 5AESA 2Z0MA 1MO3A 2K4MA 2C5BA 4UM9D 4WUVA 4X7MA 3WYAA 4CRWB 6ADHA 3QX3A 1LY1A 4IRMA 4OHBA 2Q99A 1G5RA 2GXAA 1IFXA 1J0AA 1QO0A 1B41A 2I6TA 3ONEA 1XKLA 2E55A 2FWJA 3DE5X 2ABWA 3DCIA 1NDQA 5FWAA 1W4CA 3VTAA 4ZZ0A 4F2DA 3AF0A 4C7OA 4O0LA 2YASA 2YWDA 3MS7A 3KALA 5KMGB 4BV3A 3L1VA 4B46A 1YJCA 5CM2Z 1CRPA 1T6BY 2IUSA 2WTNA 1EVLA 1H85A 1II0A 1RYZA 1S1CA 1DC4A 1YKGA 2VDOB 1U3FA 5EOVA 3ZJYA 3FNFA 4UHFA 1GUBA 1W0KA 2HLPA 4U7FA 1IZZA 2IEDA 4HCJA 2Q4DA 1KFJB 3B7PA 4TUYF 2O0KA 1PKXA 4XGKA 2FUCA 1AKWA 4A6XA 1R8QA 4BMSA 5LZ4A 3P9ZA 1K4YA 5DHQA 3RSGA 3ND8A 1GN8A 4ROTA 1WPGA 3ZNPA 4C4RA 2ZRBA 1NM5A 1WZIA 2H9YA 2PU7A 4NONA 2O2SA 2VQ3A 5HZHA 1B2RA 3FVRA 3TL3A 4N65A 3DBOB 4L76A 4X3OA 1MNQA 3LNTA 1ZNWA 4ZC8A 4DCOA 1MC1A 1QRSA 4CBVA 2SHKA 2WTEA 3A6HA 2YS7A 5FKJA 2P77A 3T9EA 1BIFA 2ZJ6A 4NJEB 3PFNA 3FMIA 5LM3A 5B12A 1BSVA 1ZK4A 4KN5A 4MYTA 4R1PA 5ALHA 5ICEA 4ZDJA 4H18A 1IRIA 4HDMB 2IS6A 4KIJA 1HI9A 3Q3HA 3OEEA 2JIZD 1MN6A 5CITA 2GWRA 2IYWA 3OIWA 4R9VA 2PH7A 3OZAA 1KOLA 2ISQA 2HN9A 5G1OA 1VCIA 3NGLA 2NXNA 1H5QA 3IURA 3KYDB 1JR3D 3LHSA 3OIDA 4JUCA 4TTIA 1ECGA 2QG6A 5C31A 2IYYA 2VDWB 2GN0A 3LHFA 1N1EA 1XZMA 3F98A 2DJ5A 4JD5A 3UZUA 521PA 3C3BA 3GFPA 1CUXA 2R8EA 1JKIA 1DPGA 4CMEC 5HKKD 3AKYA 1U0EA 2ZYIA 4EO9A 4RVOA 3IC5A 3AVPA 2JHPA 2X2OA 1XU7A 1BD3A 2IYTA 4HQKA 5LB4A 4BX9A 5LP6F 1CNFA 1TK2A 4L5CA 4LNUA 3OT1B 4CDMA 2IHYA 5DBHX 1KZ1A 5IH7A 1UBMS 1PTJA 3PEUA 3PE3A 1FU4A 2GNOA 2UZAA 1XAGA 3DDUA 4P22A 4BN4A 3QG5A 1E6WA 3LL4A 3S1LA 1R18A 1Z9BA 3C5WP 4AKSA 1Z2CA 3P9QA 1TEVA 2WYVA 2FPSA 4M7RA 1FUUA 2FQYA 4HYQA 1Z2AA 3MS4A 4HYYA 2F4NA 2OMEA 4Q7MB 1IZ7A 4MVJM 2H2IA 2C58A 4L50A 3B6EA 4CCAA 2WE7A 1IOZA 2GEFA 3AY0A 4U0KA 1CHNA 1RLJA 4TV8A 2PANA 1QIIA 2WKPA 1SK8A 1VLVA 3M6UA 1D1TA 3HRIA 5ALWA 2MMCA 3O73A 1TFUA 3NORA 4D41A 3R9XB 4ZN6A 2Y2VA 3I1IA 4IINA 4YJGB 1K8RA 2CF5A 3PJFA 3QE0A 3K1JA 2LCFA 4QOJA 4DUZB 3K0AB 1NOJA 3FUVA 3QH4A 2QAGB 4MYSA 4MPRA 1CB0A 2CEKA 4BEBA 5JRDS 4Q9DA 2VHCA 4N6OA 2MMGA 3ELBA 3HXPA 3Q8XB 2CZQA 4O4LB 3NMUF 1NLMA 3ZE2B 4IH9A 3RTGA 2YR0A 3PTAA 3D64A 4J4TA 4BNDA 4ZZ3A 4MVJF 3AHEA 2WILA 2OQVA 3IAEA 3QW4B 5TMPA 3E9EA 2GM9A 1GR1A 2GVNA 3FX2A 4L4YA 3IUSA 1NSFA 2RBKA 2P0EA 3WA7A 4JV5B 4GPAA 3KYBA 3T7RA 1NI5A 3IRVA 3E7FA 1YJBA 1NMSA 1GGEA 2ATVA 5FOXA 2D7CA 4YPFA 1NUTA 4OJNA 3KZ1E 5SY9A 4D80A 4GOOD 3AR3A 2HADA 4YRJA 5JMPA 2ZYUX 2PVSA 3HCFA 2HU5A 4YBZA 3CWZA 2XVXA 3F1KA 3FPEA 1ESEA 5GWXA 1MGOA 4W63A 1HQKA 3GLUA 1G7RA 3R5JA 1DUIA 3GI1A 4J2OA 3F5DA 4MV0A 3WLTA 2Z3WA 4MR7A 1GARA 1BX1A 3ZE9A 3TK1A 2OB1A 1AKQA 1SWVA 1FFCA 3GUZA 3C3MA 3T1VA 3R7BA 5BUSA 4DA6A 1O95A 1ILWA 3CVUA 3AI2A 2XTJA 2OD2A 3QYFA 4KL8S 1DKNA 3OZFA 5LYYA 3B3GA 4CKCB 4RO0A 2QI9C 3PXAA 1ZW6A 3BWVA 2HSGA 3RGGA 2I3DA 2B0JA 4FFRA 3RSHA 2JGRA 4J76A 5E2IA 1SBHA 4EOGA 1T1RA 2FUKA 4NARA 1SC3A 5B4VA 1CZHA 2IEZA 1AUOA 1IATA 3ZGXA 2GD2A 3CLVA 4JLWA 1Q84A 1PWHA 2AXEA 4LDPA 2ZTSA 4PG7A 4H4EA 3GJQA 1BD4A 1W8IA 1FDWA 3P1JA 2Q3LA 2PT7A 4M46A 2JGEA 1EWKA 1T9BA 2FSVA 2EYQA 2VP2A 3MQFA 1BROA 1KKLA 3NWPA 4LEIA 1TUBB 4P36A 5IASA 1IOLA 2HSDA 2P9GA 2YWJA 4S3MA 1AKTA 3ZG6A 4YRZA 1NN1A 1PTKA 5DHPA 2V96A 3P9XA 3KYCB 5TIIA 3W2GA 2GVZC 1P6QA 1HNWB 2XMGA 2B36A 2I4RA 2BF4A 2B8NA 3K5HA 5CB6A 3CVYA 1BGVA 1J5XA 5DHUA 4Y9TA 4Z0TA 2HDWA 1J0XO 2DZDA 2ZJAA 2D0IA 4LDJA 2BFDB 3K05A 4MGKR 4M1KA 1Q12A 1PIWA 2JDIA 4WBXC 3RUIA 1NBWB 4XW2A 3W6NA 3EQZA 4BQOA 3LX8A 1J7JA 1HPLA 4AZVA 3F6EX 4QG7A 2GK7A 2V5AA 2C5HA 3MTQA 2PAAA 3IUPA 2QMQA 2HFJA 1ZOOA 1JS1X 3R0QA 3GJTA 3Q7TA 4W8OA 4YA6A 4FC7A 5E6UB 4EA9A 4R1MA 3HP7A 5AKGA 2YBEA 4EATA 4ZJYA 2J85A 4MLCA 5DFAA 2E1PA 4DNOA 4KR9A 1K7YA 1E4OA 1T26A 5EGNA 3S2ZA 2YOFA 3FWYA 1ESMA 4Y6PA 3L6DA 3ZCVA 4D82A 4RMHA 4MW0A 3QMWA 3CURA 3MLAA 4KXYA 2Q0QA 4EX6A 3E05A 1FTYA 1NU6A 5KU7A 2XCSB 1FXWF 1GPDG 5JNWA 1C9EA 1ZBDA 4PLVA 4N12A 5DSTA 2EKQA 4D5GA 2B94A 3LWNA 1XF9A 3HHEA 5JTTA 4YT4A 1LSJA 2WWRA 4UNIA 2XUOA 3ZDBA 2PX8A 5DBOA 5IK2A 1C80A 3OKPA 3ITNA 4UFOA 4Q1DA 4QATA 5HBRA 1MGPA 1XJ5A 4YRDA 4ZXFA 5CT9A 3W4JA 4QQNA 5CIWA 2SKCA 3UV7A 1WQ1R 4BCBA 1HMYA 4PYKA 1PW5A 2R3SA 2AG8A 1Q0SA 3PXXA 2RKBA 1SCUB 2Z95A 2DUNA 4QSHA 3SWWA 2V7BA 2GRJA 3SOZA 3BD6A 2VHVA 3GAZA 4LMRA 1O6CA 3IX7A 4JNCA 1AQYA 5ECDA 1Q6ZA 2ZYRA 5EFOA 1CQIB 2HHCA 2VPTA 3CEJA 3QA9A 1ZHFA 4IEEA 3DBRA 4UBNA 3F47A 2H08A 5E1MA 4XIYA 2VK8A 4RK7A 3WQHA 5LN1A 1N33B 2J48A 2AFIB 4FHEA 1L4NA 1R0CA 4FE3A 4EGAA 1I2BA 4AI6A 2CJFA 1YONA 2BHSA 2NUPA 2FN9A 1KNXA 4MQ4A 2YDYA 1Z88A 4NPHA 4P7FA 2B1QA 1FFSA 3EPKA 1O6ZA 4FOTA 9GPBA 2QW0X 3HM9A 3U7GA 3VH3A 3PUJA 2J7PA 3K2QA 1YHZA 2J5QA 3C8HA 4Q1CA 4AF7A 1T2DA 1ZVJA 1NF9A 1NBMA 4LI0A 3HV2A 4CG0A 1M0EA 3IOYA 1SCJA 3V1TC 4M9UA 5IJZA 4BE4A 2J3JA 4YUAA 4PNZA 1I9CA 5L3SA 1GXSB 1V2HE 3DVQX 4F9TA 4D8XA 3WI7A 3VC7A 1ONSA 1RWKA 1ISHA 3NXKA 5KTSA 3ZE1B 3D4NA 2OAP1 5E3JA 4X91A 4O2BF 1LQTA 2PHZA 2QVLA 3AVWA 3GLRA 4W8GA 3KPWA 1PUIA 3TW0A 4YAUA 2VJAA 3EHEA 5E4JA 4D02A 1LBIA 3JQ9C 1Z5VA 4M83A 4D9BA 5BW8A 4C0SA 1R6AA 3NO4A 1SBQA 2FFAA 3OCCA 4JR1A 4LHEA 5IT5A 1VCNA 5HM6A 3TSAA 4PHGA 1CR6A 1DC7A 1EDBA 1T2UA 3LPLA 2VQ6A 1W0JA 5AR1A 1AOXA 2AEMA 3FVTA 4DR6B 4J1TC 4RK1A 4AWAA 3VHXB 3KTDA 3GBVA 1V5WA 3NH9A 5IS2A 3FUXA 3CNBA 1ZU5A 5J1TB 3OCJA 1I4DD 4M37A 4PYRA 1EVJA 4WXRA 1X8LA 3CUYA 3ZE8A 5C37A 1EVZA 3QLVC 2R8XA 1DXOA 3PSHA 5ED0A 5EE5B 1XPJA 1STOA 1P4JA 3QXJA 1COWD 1DJQA 1WV1A 4JOSA 2VA9A 1RYFA 3BWBA 3R0IA 4D92A 1A1VA 4NZPA 5AM2A 1P91A 3HBNA 5IF3A 1DKRA 4YROA 4RF2A 1PGJA 4CR6A 4JQZA 2PR7A 2PD3A 4PSAA 1TMOA 1T35A 4EO7A 1PSDA 4ZYLA 3OJCA 5JSKA 1DZ3A 3PYMA 1A9OA 2CBZA 3HS3A 3K31A 4A1FA 2XNJA 4ZICA 1N9GB 4A4DA 5JQGA 3C0KA 3EDYA 1N7IA 2QRHA 4N3CA 3ZI0A 1K27A 3OMXA 3WXBA 2GZDA 1NGSA 2EZ8A 2IXTA 1RXIA 1RJ9A 1G21E 1XZFA 3CO5A 4L8LA 4BP1A 3MCZA 2VJQA 1HZJA 3ORSA 3T7SA 2HIMA 4R01A 4KAXA 5KTTA 1TQHA 1VXRA 2PV0A 4EZIA 1MTOA 2NV0A 2GAJA 5F76A 5JY6A 3TZKA 1U02A 1URPA 5LA6B 2C03A 4ZMBA 2WRZA 3OO0A 3L8GA 2EHJA 3DDWA 4EBFA 1QR6A 1UMBA 3BWMA 1TMKA 4PYJA 1QONA 3A06A 2UUOA 4H6XA 4IEIA 4F4DA 2EL9A 2JF0A 4CNQA 2ZRHA 2HYDA 3CT4A 4QRHA 4R1UA 3AGQA 4TMKA 1REQB 4MS1A 3KKLA 4F06A 3ENWA 3L82B 5HNKA 1N0IA 5FBLB 4DEXA 5FB3A 3ZV3A 2KQUA 4MB6A 3IVRA 3HL4A 3H9JA 3NBQA 2GJSA 1T36A 4M9CA 1ZI6A 5TX7A 5REQB 4MO9A 2XEXA 3ZGYA 4HNSA 4LJ4A 5CGZA 1Q0TA 4I9GA 3R77A 5C4GB 3MAJA 2WAYA 3HEMA 3TX2A 3KEOA 2JLBA 3TM4A 4YMLA 3C3KA 3IR7A 1GZ6A 1YMUA 3INYA 3K0FA 4G56A 2HYIC 5ESXA 1XP8A 1JHDA 4MRMB 5ER9A 1LPNA 1ZNYA 2WFZA 3CF0A 3ZNOA 4C4TA 1YF3A 3MB8A 4KODA 5H80A 3ZDEA 4P0QB 2ZWOA 3SP1A 1DAHA 3E70C 3L8DA 4HDSA 2BZ0A 1JQDA 1Y3IA 2R7NA 2XGGA 4BL5A 2XRZA 2D59A 2ICAA 4E5KA 5CCXA 3L0SA 4ACBA 4DMHA 1O2DA 3ABZA 3G5AA 3VO2A 3WMGA 2AEJA 4P32A 3KX2A 4RNCA 1NE7A 1KHHA 2DTEA 1G6OA 2DRIA 4XJTA 2ZZNA 4OQNA 4UDNA 4BLRA 5TB5A 4Q9AA 3B60A 3U3JA 5C5DA 3HDTA 1GPH1 2F6RA 1Z4LA 4GPZA 1Z83A 4B5KA 4YHHB 3DFIA 4DQVA 1X9IA 4HDKB 3OQ6A 1IBLB 3IRUA 5E2AA 3H5VA 5EUBA 4IIJB 1Z22A 1ZP6A 5CXSA 1UM9B 2I03A 3QVWA 1RXYA 1XB2A 3KZKA 1XNQB 1RHMA 3C1TA 1U2TA 4JA2A 1K7FB 1GCAA 2HNBA 1XEWX 5KJ6A 3C1OA 3VR6D 5A4IS 1S2MA 5FNZA 2RH5A 4ZOLF 5JIBA 4GQIA 3ME5A 3SZUA 4FEEA 4J0EA 3HSYA 1LPOA 1D0IA 3ZZMA 5B7QA 3I72A 1E5DA 4O2LA 3T41A 3SNHA 5B2FA 1O0CA 1LZKA 2JH3A 1Z56C 2D4HA 4WX2B 1MW9X 1YQDA 1YZUA 1G3RA 3LE8A 3M4JA 4K9LA 5ELMA 1WUHS 3KFVA 4E2XA 1WVMA 2ARKA 3OOHA 4YWJA 3ZDRA 1XAIA 2WKSA 4IUBS 4IQ0A 4R8MA 1QMPA 1CETA 1E9DA 1P7CA 1QHXA 1V11B 3WS7A 2ZYGA 3S40A 5AKEA 2I4IA 3PQ2A 3OJ0A 1Q1ZA 4YYEA 4DC1A 4POOA 1UWCA 3L4SO 3CNEA 3AUKA 3P5BA 3TTYA 1Y3CE 2ZU0C 3G2PA 1UZLA 3HYCA 2PZEA 4O25A 1TX4B 1J00A 2VAMA 3PFKA 4PQRA 2QN8A 2IL1A 1NONA 1VE9A 2JH8A 2JKYA 3IQWA 1JNXX 3N2IA 3NC0C 5SZIA 4DTCA 1TUGA 1VHWA 5DRYA 3C8DA 2XKBA 1EGVB 1L5WA 2CXUA 2CXSA 4BXOB 2X13A 4CKWB 3E9DA 1H1TA 4I4CA 3C2QA 4JB2A 3AEUB 3I53A 4TL9A 1K2WA 3LT4A 3JZDA 2QM8A 2H7CA 3PYXA 2CZGA 1HLDA 3ENKA 3D5TA 4D57A 4RPIA 4Q4DA 3V46A 1HG0A 3UJ8A 2FQ1A 3VMMA 3QPVA 4R2HA 1W0KD 5ILQA 1Z12A 1NUQA 4FZRA 4GP6A 4QPDA 2E5FA 1FNNA 1ZJ4A 2DBZA 3RKRA 1MCZA 3VZRA 4B74A 1GV1A 4HDOB 1GCIA 1XXLA 3WSWA 1N2HA 1RYEA 1Q77A 2B5OA 4KWTA 4RZXA 1L7XA 4WADA 5FNVF 3SF8A 2AYXA 5BR8B 4D25A 2PZKA 4FS8A 3PK0A 4EG8A 2BZ1A 3LCUA 4GX1A 4MDFA 5GZ3A 4OHKA 1SIWA 2FWNA 2IYRA 3IPYA 3NBKA 5EJAA 5DASA 2ECKA 1NF3A 1FLDA 3DL0A 3EH1A 4FKZA 4RESA 1TAGA 2P9CA 2Q5FA 3A9RA 1EM8B 3Q41A 3OM9A 3O8NA 2IE8A 3P94A 1C3JA 4RQAA 3U2QA 1A8IA 1G5QA 1TC1A 3SBDA 2E2WA 4D46A 1ZR4A 4TT3D 3ETGA 5LNK1 2VRCD 1YA6A 1MKYA 4BFXA 1R9GA 3UCFA 5JJCA 2Y0PA 2JIMA 3K1YA 1WMDA 2BUAA 3VUEA 3LHKA 4TTSA 2G9RA 4RKQA 2W2VA 3L07A 2GA9A 2I55A 3OSUA 3U0VA 4CPDA 1Z0KA 1OZHA 1VP3A 2NYUA 3E0QA 3L6EA 4L8YA 2F9FA 4KMOA 4ZAYA 3QKWA 2FFQA 3AL3A 5J5CA 4DUYB 4H7FA 4L28A 1GNRA 5MN4A 4I6GA 1KE1A 1IU9A 4IO1A 5KJCA 1NVXQ 2OV6A 2QW8A 2NO1A 4FFNA 4RQBA 4A6PA 5I5EA 2XB6A 3WK4A 1A5BB 2CHGA 1DKPA 3CIOA 3HO8A 1P17A 5DYWA 2DPYA 1OZGA 3PHJA 5KINB 2X8BA 4KN9S 5HKKA 2ACKA 1AD2A 3PLNA 3PPYA 1NVMB 3L7DA 3B3JA 1FBNA 2O3JA 5AUOB 4RZUA 1QRDA 3OBIA 4AJJA 2KLHA 3QEBZ 3HYLA 3UAGA 5A9SB 1SQ5A 3PXBA 3AM5A 1AK1A 3R6TA 3CBQA 4KHZA 3AP1A 3DOIA 3P0IA 3PKZA 5KTPA 5EMHA 3TO5A 2KBFA 1CBUA 2EDAA 1NN3A 1NNI1 2F48A 2JFYA 4NLLA 4DDUA 2EFDB 4LY6A 3CLKA 2WJVA 3NVAA 3DOJA 4ZOQI 3L1KA 2J9FA 2GETA 4JODA 4TYMA 1TT5A 3GLQA 4IJ5A 5D7BA 1TO6A 4NV0A 4GO1A 4XH9B 1SJ9A 3NW9A 4YDSA 1RIIA 1VHQA 2ZPTX 1D1SA 2GN2A 4HMPA 4V0NA 4QO8A 1VSBA 2ZDQA 4MGYR 2K2QB 1JN0A 3WLNA 1VP9A 3HB0A 4I9NA 1EQUA 1QYCA 3K1ZA 5GTDA 3KQMA 3BHIA 1JHQA 1WPQA 4G25A 4LQLA 1RFGE 4KE9A 4L02A 4MQFB 4R1QA 1ORWA 1ZA1A 2I6XA 3C7DB 1MX3A 3ZHZA 3DHYA 1CRWG 3NG1A 3M6IA 1H4VB 3MOIA 3W04A 1CNEA 1Z74A 1NVBA 2DWQA 2IP2A 2YY6A 3BHMA 4FIDA 4MS3A 4ND6A 4NSNA 1YE5A 5BOVA 2GUWA 2GCNA 3VVBA 1V9LA 1L7AA 3RRXA 3L92A 3WLEA 1WU7A 3R75A 2P2CA 4OXRA 1LPBB 4U8HA 2PMEA 3PEWA 4C0XA 1F2UB 1ZWKA 2ACEA 2ORIA 1W581 3BVPA 1ISRA 2WTXA 3NOXA 3SHFA 4DNQA 2X3YA 4GR4A 1GPJA 1GQRA 4US1R 3BZWA 3DBVO 1BKYA 2VF4X 3EWNA 1RI4A 2X4GA 3F6SA 1M1XB 1SG0A 3OTIA 3KXPA 4EP1A 5INTA 3AILA 5EIXA 3QNUA 1Q7EA 4FNGA 5CURA 4MYRA 1ZD4A 4G1FA 4I5DA 3CPJB 3BXPA 1M72A 3P26A 4X7PA 5CFLA 2P67A 3EQ2A 5HKAA 3COYA 2ECQA 3QPDA 4D79A 4EW2A 4X65B 3NC1C 2WG2A 5BW5A 2IJGX 4HB3A 4K9SA 3D6MA 3O0DA 2BFCB 3QEMA 2Z2JA 2IPAB 3R9KA 2Q5CA 1TQ6A 4MVJP 1CR1A 3DUFB 4TLEA 2CMGA 1JL3A 2ZUCA 1YS2X 2GEBA 3RS2A 3BH7A 4N48A 2HJWA 1YGYA 3A1NA 3A6DA 2IWRA 3T3GA 3PLAE 2DQYA 3Q8WA 1IZYA 4FYJA 3KQUA 3M4YA 4GDFA 3VZSA 3L7OA 4DR3B 4G1CA 3NCHA 3RARA 4FZJA 3CTPA 1JFVA 4RXMA 5J2TA 4QM6A 5FUXA 3CB4A 2WP0A 4IVRA 2HK7A 5TGTA 2YWXA 1T9GR 1WXDA 5AVVA 1OFTA 2E37A 4ZVLA 3L05A 3FZYA 4NCIA 4TYWA 2KYRA 2QN3A 4MVJA 1PGNA 2RE8A 3DZDA 1H8EA 2QRNA 3BRCA 2WZDA 4CM9A 3I9V6 3QJYA 2RK6A 4LC9A 4N0QA 2EFYA 3WLOA 3K6SA 2I2FA 3LF1A 3GFVA 5MN5A 1UKZA 1YQUA 1UZMA 4CM8B 2OZVA 2VHJA 3G8BA 3OE5A 2Q0SA 1JHVA 2H1VA 2J59A 4BNTA 4DHWA 2Z6AA 3D0OA 2GO7A 3K4PA 4NYIQ 4DMRA 2RI1A 2P8SA 3E9QA 1QX3A 2G5GX 3DGEC 3T1TA 5BSEA 5IJ9B 3HN7A 3RAFC 3L4EA 3DM9B 2ZQYA 5J2UB 2WHPB 1V41E 1TE2A 3M6XA 1U7XA 1JTEA 1KGDA 3KTOA 4JVLA 4HOYA 5IKMA 1F7UA 1NJ1A 1MABB 4JKIA 1VMDA 1ADBA 1CE8A 1LSUA 2C2MA 2FSHA 1HY3A 2CW5A 3UO8B 3KEMA 1DE0A 5HSGA 1W73A 4JC0A 3UK6A 5ITWA 4PYQA 3ANXA 4O33A 1ORIA 1D2RA 1ABFA 2A9PA 2J0UA 1NKTA 3EXFA 5ILGA 1M2VA 1KO5A 2OV1A 3ITEA 2PFSA 4WW0A 3SQDA 5CNMA 5AM5A 1YZFA 3U0BA 4PXAA 5K3BA 1EFUA 3UPDA 4OXYA 5HIJA 1P4AA 2A4KA 1G5PA 4I81A 2ZSFA 1IBSA 3A1DA 3QU2A 1DEKA 4LCJA 2NXWA 5T5QA 4PR3A 2YV1A 4F3RA 4GM4A 2IHZA 2ADMA 2QTAA 5AK3A 3W90A 2W0SA 4QQFA 4CT0A 4CTMA 1AIPA 4WMLA 1PFQA 2B37A 4H2DA 4GS5A 2PY6A 1ZICA 4MRNA 1PAUA 3GG9A 5AOCA 3WB9A 2EV9A 3CTMA 3WGQA 1UJ4A 4EHJA 1PTJC 3WLRA 2XR1A 3OFKA 2FZVA 4UXJA 1CY1A 1KSHA 2JGIA 4NCNA 3IQDB 2AWNA 4CU2A 1YJQA 4NCAA 1EK1A 1I4OA 1JFTA 1C4OA 2QRUA 3ORFA 2CCKA 2XMSA 3CLTC 1TEZA 1TK9A 1N2BA 3T4PA 4HBZA 3DFMA 4KGDA 1SVMA 3PC3A 2Q4EA 3SG0A 3UOWA 5IX8A 1G5IA 1RQPA 1QLJA 1Z0UA 3C3XA 5ARBA 3ICVA 4PLCA 5KTNA 3MBIA 3UXMA 3TRJA 2ZI9A 3H83A 9LDTA 1MFZA 2G9ZA 3TSCA 4EI8A 5DHTA 4DY6A 4LDQA 2WV7A 5HTOA 2O5EA 5CTJA 3NOQA 1Y4DE 1I4TD 4H35A 4H7EA 4GOKA 4ZRNA 5ER6A 3H04A 1XJQA 2V8BA 3CF2A 4I50A 5KNCD 1HNXB 1PK9A 5JXIA 2W37A 1U8EA 3I1FA 4YBRA 4DWVA 4HUJA 5I9TA 2IBSA 2J7PD 3W7AA 5JR3A 5CDSA 3V4LA 1DIAA 2H4HA 3ODGA 4UAJA 3TM5A 4FLMA 4WOJA 5IABA 1X1DA 4PFKA 3F49S 4BV8A 1NHWA 1WDKA 2VNJA 1HDIA 1VL2A 3KT6A 3RVBA 3SX2A 1BN6A 4YQYA 3VC1A 3VGJA 1WPRA 4QL3A 2X22A 1Y89A 3PB3A 3PQ5A 4EVIA 1G6KA 1YQEA 2ZRKA 1N6HA 3W05A 2C3OA 1W36D 10MHA 4KMMA 2VBCA 3PGLA 1ZSYA 2G4VA 2V9PA 4XVUA 1GKKA 3O4IA 3QKRB 3VDMA 1J25A 1V26A 2H52A 1QYDA 3CKYA 3WV5A 2PEYA 2R7AA 5JEDA 4R0VA 1BCRA 4F21A 3IP1A 4K26A 2OTCA 3CVOA 2HWXA 1PJZA 3BHJA 3FLAA 4QGFA 4DLLA 3BQNB 2GF9A 4XWGA 2ZBVA 2PPVA 5IXJA 3CISA 5IM4A 3QWFA 3U1BA 5LBUA 2ZT7A 2VSXA 1XTQA 4DV2B 3G3EA 3KLNA 2R6DA 1MJ5A 4MP3A 4AQ7A 1MB4A 3PNPA 3HJCA 4O0MA 4EMTA 2BBWA 2DVMA 2F90A 2AG6A 2IZ6A 1OIVA 2H4WA 1ZMOA 1RJWA 3Q5DA 2H2HA 3K9BA 1RWVA 1U8YA 4YNBA 4DXAA 1U9JA 3KZVA 3EMBA 1K0FA 3AETB 4NNJA 1P1BA 3ESXA 3HGQA 1NIPA 1E3EA 4NL4H 4L4XA 2UDPA 3URKA 3PE4A 3Q87B 1NXXA 4DV6B 4UTOA 1TZKA 1R0LA 2ZS8A 4W7SA 5AXBA 4KVGA 3G9XA 4ETNA 1KERA 1N36B 1G5FA 2ZIWB 3V8VA 1ENOA 1HTBA 5CFQA 3L1IA 3IL2A 1NYRA 1EFRD 4CI9A 1ODLA 4DIMA 3L43A 4HDRB 3BWXA 3WWDA 1X15A 4XWAA 5DM0A 1W59A 3DFKA 2BAGA 2IS4A 2WHYA 4CM9D 1EE9A 5D5HA 2ZQZA 4DRXA 1N9KA 4MNTA 2QXYA 5IYZA 2BN4A 1X19A 3LFUA 2CFOA 4KYUA 4UUOA 2WUWE 5EE0A 1PUJA 5LMZA 1VKOA 2PZGA 1P77A 4JYCA 1BVYF 3CGGA 2IZ0A 1BS2A 3VPSA 3WLPA 1M76A 2CHVA 5JZMA 2PS3A 3K4QA 1GQSA 4P3KA 1UPAA 4JC8A 5AMXA 1GLNA 2JGLA 3KQWA 2C31A 1TA9A 1QF7A 4K3VA 2X9GA 2G7ZA 4BLVA 3ITDA 1O4WA 5JVDA 1DKLA 1U7HA 1RAAA 2ZRAA 3T0IA 1W96A 4RABA 3DAOA 3ZHOA 3ZGOA 5FIUA 3JV7A 1GT6A 3QUSA 1G8FA 1R3DA 4GNKA 5DP2A 3KPVA 4M2LA 3PJDA 4JC4A 2C4NA 4HN9A 4BMPB 3CZRA 3R09A 3R3JA 3IJEB 5KDOA 2X5KO 4IDBA 2EHDA 3P4YA 4F91B 4Y2HA 1KYYA 5HZKA 1YJAA 1RS0A 3K8ZA 3K8OE 3Q7SA 3U09A 3BWDD 3LA6A 4YCJA 5HE8A 1YMQA 2B8EA 2O3SA 2JG3A 4ZDKA 5AW9A 1RYYA 4B6QA 4WKGA 2K7ZA 4N3AA 1I6MA 2PKQP 1AHPA 3M82A 2H51A 1ORRA 3B5IA 3H97A 1C1YA 2F8LA 2CJXA 3HWX1 4XE5A 1NMEA 4ITRC 3SYLA 4FM9A 2J0SA 1PF7E 4LSMA 2B30A 3TNDA 1SUBA 2W83A 1L2TA 5TMEA 4B6GA 1N8KA 4IH4A 2BY4A 4KB5A 4RFSB 4UBKA 3RJ9A 4YP0A 5BVHA 3B8HA 2I33A 2DFLA 4Q39A 5BYKA 1NXOA 3D3NA 5AJUA 4H3KB 2NVUB 1WDLA 4M0PA 4AJLA 5SY6A 1WEKA 2IXGA 5B53A 1F2TB 1B6GA 1USUA 3W2EA 5LQUA 4HH3C 4OL9A 2Q2QA 2EATA 2YC2C 1HNZB 1R5NA 5BY2A 2Q0XA 4DQUA 5FI3A 3ANTA 3C8ZA 4MJ7A 4ZEMA 5L4SA 2W4MA 4BFUA 1HQYE 4DV4B 2FWAA 5HW0A 1MO6A 1Z0IA 1G66A 1DX4A 2Z43A 4ZO6A 3WZMA 3M1YA 2R9VA 2XGOA 1C9KA 2F00A 2WLSA 3CF4A 1SAYA 2OILA 3GA0A 1WUKS 3QVMA 3TGPA 4KJZA 4IWYA 1V3TA 1Z7EA 4P81A 5K01A 1UFRA 3OPYA 4O08A 1RCTE 2E3JA 3BSSA 1OZFA 2ECPA 2XGSA 2XYRA 4C06A 1Y5LA 1C4XA 1XLVA 3I09A 1FK8A 3NC4A 1TCAA 4OGKA 4BEJA 4BVAA 1Z47A 4TN1A 4L5YA 3INGA 2W2LD 3QW2A 2X9QA 3ROGA 4IIFA 4N7JA 3LUFA 5KI6A 3EXIA 1HUQA 2QW1A 5BSKA 2XXBA 1A2KC 1N92A 3C3AA 3SXUB 1AB6A 3AVUA 1QZTA 3OJOA 4BJ3A 3SBEA 3VUFA 4X64B 2Q46A 3DPSA 1US8A 2F2TA 2YV3A 3D5QA 2EBHX 3U4CA 1IJFA 2NVBA 4MWZA 2HSEA 4CW7A 5CLHA 4YP1A 4C0BA 1YFLA 4O8ZA 5DT9A 2R8PA 1ZHOA 2NTYC 2VJPA 3NT2A 5LQRA 3A6PC 1F0NA 1WHSB 1EGAA 4ZEWA 5T4EA 4E94A 3NDJA 2D4AA 3DCJA 3MWYW 3MWGA 4FBLA 3GLTA 3NRJA 4R0NA 2NZXA 3GY0A 5FLEX 4AO7A 4BNMA 1KOFA 1VI5A 4BVFA 5JFOA 1KK2A 2R7MA 3HA5A 5LP6A 3AVQA 3LPMA 5I7UA 2W6ZA 1V47A 4KXXA 3AUFA 4BAGA 1XVLA 2GAIA 1HDCA 2IYXA 2OV2A 2QE7D 2O57A 3OQIA 4NE9A 4R9NA 3KEGA 4HWGA 1YOVA 4NXNB 2F3SA 1FSGA 3G8CA 4BJ1A 3H5LA 5KTYA 2G0TA 3ETEA 1CFJA 3I64A 3IALA 5BW6B 5TV2A 3SIWA 4L0QA 4UASA 3FI0A 3COPA 5F3DA 1EE1A 1HFKA 2C0QA 4H16A 4M0FA 1F38A 1R4ZA 4PQFA 4D3YA 5DNYB 5MN6A 5F7ZA 2EX4A 3X2SA 4BX2A 2CE2X 5JU6A 2IHUA 4ZTBA 2XITA 1U2ZA 3UAZA 1K1EA 4RSHA 1XCPA 2V97A 4QNNA 3VYVA 2BCJQ 2YHIA 3VO9A 5IZCA 3TFOA 2WIFA 3JTEA 4I9HA 3BFVA 2YXDA 2JEOA 3AH8A 2ZBRA 1Q20A 4BUCA 4J2TA 1KS9A 2R1VA 2Y0DA 2ZUUA 4L5BA 4MEAA 1W75A 4G0YA 2NU9A 3SHTA 3KQVA 4KMRA 1QB8A 3U7IA 3R4CA 1ZOSA 3MHTA 4DA4A 1NW5A 1FZQA 2AT1A 3H1GA 5JO0A 2JIBA 1IVNA 1NVTA 2GJAA 1O5OA 3I8OA 1Y6GA 3SLRA 3TW8B 1GA6A 3HP4A 3R76A 2Q8NA 4GMDA 3L7YA 2H7YA 1OJLA 3PDIA 2QZPA 3BXGA 3IT0A 3ETNA 2NP7A 1VPWA 2IC5A 3HEBA 4I1OA 4TV8F 4Y1FA 3ZJVA 4F4HA 1J8QA 3BGWA 1E2QA 2R1ZA 2V0NA 5FBWB 4YP7A 3TLYA 5E8RA 4DV0B 3QPAA 1U6JA 3FWZA 3SZMA 4XDHA 3A14A 3MN1A 3H5OA 2CL5A 2CJWA 1GRVA 2JHFA 3BUSA 2QM0A 1Y9EA 2FW7A 3ONFA 1U28C 3B2QA 4PYLA 4EJSA 4ZYYA 5DYIA 1TU4A 1C1HA 1MRNA 3O9ZA 5KX5B 1SULA 1TNDA 2Y1OA 3WQQA 1Y82A 1ATIA 1PFYA 2C7GA 5LOVF 3WGUA 1QAQA 3BZUA 3HHPA 1Z5UA 1F4LA 5IJXA 1OKKA 4ML3A 4P86A 2WA1A 1UWLA 4DA0A 2ID4A 5B2ZA 4UTNA 3RDPA 1QO0D 1XZGA 3LWBA 3N87A 3X3HA 4YH1A 2DR2A 3M8KA 3GRUA 1BW9B 3COZA 4QBKA 5IZ4A 2BR5A 1BA3A 3BG5A 2NPIA 5F21A 4BLTA 2H2WA 1NNEA 5D1HA 2VZ0A 5F77A 4E3ZA 1NJ2A 1HE1C 1L3IA 5CT8A 3SKVA 2PL3A 2JJ8A 2O0HA 3GLIB 1M54A 4YYZA 1MG5A 5E1BA 1HDGO 1KMMA 3K9GA 2C8KA 3CEMA 5BN4B 1YC2A 3RO7A 4EX7A 3T7AA 2ODNA 4YASA 1HURA 3I1YA 5DSXA 4BMDA 3N0VA 2HTEA 4B6EA 1VJDA 1G2PA 1RC0A 1TKAA 2AE2A 1M67A 2QJRA 3IOMA 1YU9A 5D5QA 1A69A 5DNEA 3A70A 1XDSA 1XL1A 3C4JA 1VBKA 2A4MA 3MYYA 4L9RA 3KJZA 3NIWA 1OYYA 3MGAA 4R4JA 3TB6A 4MPPA 3TSWA 5C9ZA 1DJPA 2EWWA 3VTZA 1SBZA 1B6RA 1SG9A 2QYOA 4ZOBA 2MSWA 4F86A 1AF7A 1UXKA 3D0RA 4Q7QA 1N5LA 4KQ6A 2W6OA 5P21A 3SI7A 3CWQA 4ZZ2A 3SEQA 3CH5A 4AKTA 221PA 3LP6A 3JQBC 2R84A 4MHSA 1M6VB 3CCFA 2XX3A 4WFJA 3CJRA 2PMKA 3CLUC 1DQYA 2J3LA 3DAPA 1IM2A 2W0MA 3A3YA 4CDGA 2AMYA 2C9BA 2Q3MA 3WGYA 3HO1A 1P1CA 3LBIA 4KRGA 4D8VA 1CPYA 3SSOA 1EVYA 2IYFA 1CUAA 2W8BB 3MT8A 1FRQA 3U7EB 5JTUA 1AC5A 2OHHA 3DWEX 1EQ2A 2ZKIA 4L95C 4A03A 3KPUA 4KXNA 3G2OA 1BC5A 3U7FB 5ECYA 1BS1A 5B7GA 1MAWA 1RWNA 1NATA 2FUEA 3AVTA 5D01A 1DTWA 5MGBA 1KY2A 2IZ5A 4XIGS 1PLKA 3A37A 4C4XA 4YP5A 4LPSA 2QP4A 2GZMA 3FYCA 4N40A 3N8HA 4KQGA 2PQ0A 3AUXA 4LA4A 5CYPA 5LJIA 3EQ7A 1NW9B 3OTQA 3PL5A 3B38A 4K03A 1GL3A 3T3HA 2LD4A 4BFLA 4EUFA 1N5DA 1TEXA 1MAAA 3IR5A 1XNGA 2LKDA 3O1IC 1S3GA 1KI6B 3LXRA 3B20A 4X6LA 4X44A 1CRLA 4S1PA 3ZDAA 2Z08A 3GQVA 3GLGB 1L4KA 5HUJA 4EVSA 2P2SA 4ZKEA 1P5FA 5CLGA 2VYFA 2KHZA 5TR9A 1RWQA 1YZ3A 4YRGA 2QNIA 1CR4A 3GEEA 4PBRA 3GH1A 3JZAA 3TQSA 3SMQA 2FMTA 5EKTA 3RW9A 4HYEA 3N28A 2C29D 4QC2A 2DH5A 4L8VA 5A5DA 4OM8A 1WU8A 1M3SA 4J9UE 4RMGA 1VKRA 2HA2A 1RM3A 4RY2A 4DJFC 1LVGA 5JSHA 3FJ1A 1C1DB 3EOBI 2XWPA 5DGXA 4ZV9A 3TVYA 5AVXA 1CY0A 4DR5B 1BOOA 1E9AA 1GKUB 5AW4A 2CWWA 1SD1A 2QLNA 3EZYA 4U9UA 1WCXA 2HPHA 1N2IA 3F4KA 1L4BA 2Z2KA 3HR7A 4ZT6A 1KQNA 1PFVA 1EWRA 1YL5A 3PC2A 2OORA 5KZMB 2K7FA 3DZKA 3GEIA 2QLJA 1GTVA 3F6CA 1VLJA 1RPZA 3L79A 4FYHA 4UEJA 1GADO 2A0WA 3LVBA 3AWDA 3A8TA 3AEKB 3KSMA 2OQ2A 5DWVA 4F5ZA 2G5PA 4LY0A 1DQPA 3DFZA 1UT8A 2R66A 1I1QB 3B53X 4KI0A 4UM9B 3HNRA 1AKEA 1QGZA 4XYLA 4I4TF 2C96A 1D7AA 1OGIA 1PD1A 2COKA 1EDZA 1ATZA 2J67A 4YDHB 4XLZA 2Q7DA 1M7BA 2FMIA 4HWSA 2H85A 2Y71A 1NW3A 2XKAA 3AJ9A 1QIKA 1J56A 3NVKI 1UOQA 2C2OA 2Q1SA 1DDIA 1QKJA 4B80A 1RU3A 4MW9A 3BAZA 3JD4A 5KWSA 4Z9FA 3SCZA 2CUKA 2K6GA 2OECA 1OFHA 2GLUA 2Q3EA 2YWRA 4BE9A 1C0IA 4CYMA 2PZJA 3ZVMA 5JG7A 2B4YA 4ISCA 1ZS9A 3GRZA 4PZLA 4XVHA 2QTCA 4WBNA 3P9CA 4LYYA 2CHFA 3UWOA 3EEBA 3EODA 4EELA 3ERCA 4HS9A 1X1CA 1G4AE 1LFDB 4QBGB 1AF4A 2XZPA 4RSMA 3C48A 4S1WA 3TF5A 2LW7A 3BSYA 1MMFB 4XTRA 2XE8A 4E12A 1XHLA 3ICWA 3OJEA 1JSZA 4ASUD 5CYFA 3EPJA 4OYLA 2PNFA 2HBRA 4N4AA 1PS9A 1G64A 2IW3A 3KOUA 3KPJA 3KSRA 5LMCA 4R5HA 2QR2A 2X4LA 4R1NA 3UTDA 3UGTA 5ADUS 3CSSA 3C5HA 3D7MA 3DBHB 4J07A 2GFQA 3JQAB 4NYMQ 1BWSA 1GZVA 2CVFA 1IXZA 3GAAA 1FF9A 3JWPA 2IYNA 4J1SA 4F5DA 1XX6A 3VNRA 3OE7D 4L0CA 2OB2A 1QK5A 1TF2A 1ZNZA 3QHQA 2E89A 4IDEA 4JAVC 1NN0A 2V45A 2FOIA 2XD9A 4NENB 4R3WA 1BS9A 1Y3HA 3UK2A 4Z0HO 1Q5PA 1XEWY 2GBIA 4XDYA 3VI3B 3C8MA 4PS1A 1LBEA 3BRSA 2O5VA 3DB2A 2Z9CA 1R12A 5BV2P 2ZUDA 2BEVB 1JR4A 1PI3A 2VUTA 4D9CA 2HCFA 3EEQA 2Z2XA 4UCQA 1P81A 2ZM6B 4GF5A 3ZWAA 2Q2WA 4RW0A 5CDYA 4QUDA 5HRCA 3FNQA 3WSTA 4ETIA 2OGZA 3JY6A 5K4HA 3C3DA 3CB2A 2XTMA 3QJ5A 3HKDA 4R84A 4X71A 5LZ8A 3DOUA 1HBJA 2AXNA 2WIJA 2DLDA 4NBKA 3RJTA 3O3CA 5IK2D 5GV8A 1NG9A 3H3JA 3NYQA 2ZRJA 3IAS6 2I99A 4IHQA 4EHKA 2VDNB 4BVHA 4DSTA 4CIYA 4JI0B 4YAJA 3I76A 3K15A 3GVPA 1QIJA 4U7HA 1PT7A 3QBEA 3S2EA 2VRCA 2XTNA 4MMZB 3T3MB 2EX1A 3MXTA 4B35A 1KIFA 2JJ1D 2OBNA 3GB9A 3PC8A 4RF4A 3U49A 4P7GA 4NULA 5E7IA 1LH0A 3EIUA 2QD1A 3FMFA 4E1VA 1BXZA 1DC6A 1M6WA 2Y05A 2I1VB 3OA0A 5E4TA 4D6PA 3ZN2A 3LLUA 2D2EA 3QUTA 1QUEA 2H2DA 3MJHA 4FP9A 5DX1A 3IEVA 2DYKA 2XLBA 5JJIA 1T15A 3SVLA 1MOSA 1W52X 2HQ1A 2QL5A 2P7HA 1P19A 2QPTA 1UEJA 2O5RA 5IRCD 1D8TA 3JU3A 1CY8A 4G1UC 4G85A 4KBYA 3CVVA 3GV0A 3M4XA 5I4CA 2O8DB 3O3NB 3GGGA 3ND6A 2XB9A 1ZGBA 3KJIA 3PL1A 2WHQA 4Q1BA 4C5AA 2IHNA 3T5BA 3A1SA 3HPRA 2IUYA 1G60A 4KHPB 1QM5A 3ZD6A 4G86A 1E0DA 3FRIA 1ZY2A 1WOYA 3D2BA 3MTAA 4Z7OB 4DRZA 3IMKA 4XM2A 4F9GA 3WGVA 3QJGA 4Z1MD 1MP0A 3VHLB 1BEEA 3R41A 3PFWO 4WXPA 1DX6A 2H1WA 2VWGA 3HB1A 5BWMA 2A0XA 3UICA 1DHTA 1AQNA 2HA5A 1YXMA 3WK7A 3ZV5A 5HCIA 3EGWA 4HDNA 4FMPA 4L3WA 1LVHA 3PQ3A 1XZQA 3F4LA 3PC6A 4GWLA 1TI7A 2EU8A 4ER5A 4F1JA 1PG5A 3DYIA 5JE8A 4A6DA 2PGNA 3TL2A 3I3SR 2WHXA 1P39A 1QOPB 3CCBA 1J23A 2DBVO 5AXCA 4LWPA 4TXHA 5C8YF 1FZTA 5JRJA 5DLPA 5L3SB 2Q28A 1RQXA 3MJRA 7YASA 4CT4B 2WOJA 1CCWA 4MQBA 1ULTA 1KYXA 3FPSA 3I6IA 1CUWA 4YDQA 5JPCA 4IXDA 1GRRA 4ZO9A 3A1EA 2OWDA 4ARSA 3NETA 2AOUA 3JASA 3NUZA 1GAEO 4IL5A 3I28A 4U9HS 1U7OA 3WNCA 5JI3E 4KK3A 4L9AA 3IYLW 4KO4S 5D84A 4AY4A 1B74A 3DT6A 5CDHA 1DFHA 4AKGA 1EX6A 1KJJA 3L49A 1LPSA 1DAIA 1Q21A 1NR5A 2XF2A 3DMTA 4P7BA 3X1XA 3EH2A 2Q6LA 4TKVB 1ZAKA 1UJ5A 2A0KA 3KTFA 4DM4A 3T1YB 3U1TA 2GBFA 5FBHA 3I9OA 3FY4A 4DG8A 2WIKA 3DP9A 3WP1B 5JHHB 1H0HA 5DHRA 1WOMA 3IBGA 5BP7A 2JFNA 4V0SA 1JT9A 4MPDA 2Q5JA 5EYPB 2XBMA 1JZTA 1QB7A 2IUTA 4FFBB 3P9YA 3HVRA 3EGOA 1UPCA 4A1OA 3OPVA 1J99A 3ZDDA 2NACA 4HY3A 3LP5A 3OF5A 3TOXA 1EDDA 2VJDA 2MJLA 1J0DA 1JQ3A 2HNKA 3DMTC 1DFGA 4HC4A 4QXMA 4R8VA 5A9RA 1HEIA 1XYGA 1N9GA 4W7IA 2YWHA 5E4FA 1EXNA 4GZ5A 5CT4A 2GJKA 1ESZA 3GFFA 5JECA 2WD9A 3NZEA 1B93A 2B0CA 2H5JA 2OT3B 4FUQA 4P4TA 1WUTA 4BO7A 4JT4A 5CDFA 4QG3A 1CUSA 3I39X 1SXJD 3ACBA 4G2TA 2QBYB 2FOLA 4PRLA 4X62B 3A3KA 1BFKA 1G2OA 4QUEA 3FZEA 5KOJB 3VU0A 5LC1A 1E1CA 1N6PA 3KL4A 4QDTA 2ZI3A 4DG9A 5EKDA 4C3VA 4QX6A 4DCSA 3Q10A 3VJKA 3N0WA 1R3UA 4F11A 4BFZA 4TWBA 1UDBA 2J4CA 3BIOA 3K6RA 4O63O 2CHQA 3G2IA 1PDWA 4HRVA 3AVOA 2HBQA 3O82A 3MMZA 1L5NA 4LX0A 3VBEA 2BFEA 1GR0A 3DMRA 4RJ2A 1KDTA 3B82A 4YRFA 3ZEIA 2J3IA 4IYJA 1REQA 4MS1B 5ITVA 2A6PA 5KYYB 2PYZA 1G17A 3GMDA 3OKCA 3KLMX 2VVTA 4PPGA 5SV2A 2FTKE 5K4AA 4EIWA 2VQFB 2G72A 1XDBA 3ADDA 3F5MA 5BRNA 2BEKA 4II7A 3VZDA 5G0VA 4F97A 4KV9A 2ZB2A 3BN3A 5TQJA 1CZNA 4XEUA 4QJ4A 3B1XA 2HMVA 1O97D 4D81A 3KYIB 3Q85A 5HMLA 4A15A 2BC9A 3N2ZB 1X0VA 3R0XA 2YBDA 3GAFA 4Q16A 1RT9A 2RHHA 1Z5GA 2H07A 3EFOA 3NWEA 3OZTA 1PEAA 2P5SA 4OPMA 4A5SA 1FCJA 2NZ8A 4C0QC 3TZQA 1RKUA 1GTG1 1KDPA 4CCYA 2BE7A 3HI4A 1O96B 2PKXA 2WP8J 2N46A 3JTMA 3KC2A 4Q9JA 2PWBA 2R6HA 4JIMA 1JPNA 5EIFA 2PUDA 1J2UA 4KWIA 2OSBA 3FNEA 4PZPA 1JKFA 1XHFA 3G6KA 3WYNA 4OHVA 1D2AA 3MUEA 4Y6SA 4BVJA 2IYOA 4B6JA 1WMFA 1ISFA 2I2BA 4DZTA 3NDRA 4OK5A 1KO4A 1FTWA 4EYEA 3AVVA 2X23A 2ORVA 3F8WA 4N5IX 4XVCA 4P5DA 4NS1A 3F9IA 1Y6QA 1XN4A