2YASA

Hydroxynitrile lyase from hevea brasiliensis complexed with rhodanide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
total genus 97
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yasA00
5JAHA 1LPBB 5LZ7A 2QMQA 2W22A 4X6UA 5AI8A 4KRYA 4X93A 3BJRA 3JWEA 1QTIA 4AX4A 3WL5A 2JGIA 4OU5A 1QIKA 4G4IA 4H7HA 3F96A 3QMWA 5DNVA 3I28A 5E4TA 1X2EA 2VATA 5IKXA 5SYMA 3I2IA 4AMYA 1LZLA 5CH8A 3STTA 1XRNA 4IH9A 1XLUA 3G9UA 3S2ZA 1JMYA 2Y2UA 7YASA 3W9UA 5ALKA 3R41A 3DYVA 5I9IA 3W05A 4UBJA 1JU4A 4G9EA 4EBBA 5DTIA 1EI9A 3C5WP 1QJ4A 3BDVA 4B7ZA 2QS9A 1XRRA 2HA0A 5AKGA 5AK3A 2ZYSA 3DOIA 4KE9A 2Q0XA 2YXPX 2WHRA 4B0PA 1FFAA 1CUDA 5CBKA 3IULA 4AQDA 2NW6A 5ALQA 3I6YA 1WPRA 2JBWA 1LBTA 4Y2UA 4JUIA 1AGYA 2VJBA 4PSDA 2RI6A 1DX4A 2B61A 2XUGA 1X2BA 5CT8A 3B12A 4L72A 4HXFB 3TRDA 4MQLA 2GYUA 3SWWA 4HRXA 1CLEA 1R9NA 3WKCA 4W1QA 4F5ZA 4XWGA 4U2DA 1K8QA 1R1DA 5JAOA 4LIPD 3U1TA 1RP1A 3FSGA 1X70A 1CUXA 1JU3A 1U4NA 1YCDA 1E89A 3ANSA 4FNGA 4F60A 4HAIA 1EK1A 2FJ0A 1CQWA 4C6HA 4EY7A 1AMNA 4V2IA 5JASA 5LIPA 2XUAA 5JAPA 4ZV7A 2WJ3A 1C4XA 2I78A 3ICVA 4AN1A 2B9VA 1TQHA 2ACKA 4L3WA 4Q82A 3D3NA 4B6GA 5AKLA 3ZLVA 5ALRA 4Y2RA 4AO8A 4DMKA 1ETHA 2HA3A 3M3DA 4B82A 2Y6VA 1QOZA 4U2BA 1YB7A 4Q3KA 1Z68A 2WU3A 3A2MA 2WIFA 3WK6A 4Z49A 1YA8A 2Z8ZA 4QWMA 1ZIYA 2JGMA 1DT5A 2HU5A 2JGEA 2PUJA 2J3QA 4X7BA 2X5XA 5FRDA 1SCQA 2Z8XA 3M83A 3AZOA 5FDFA 3LCRA 3B3QA 5ALPA 5HKAA 5HQ3A 4EHBA 5J3JA 5AOBA 2BCEA 3CXUA 4C4ZA 4J0CA 1QIHA 2HFKA 1R88A 4BRZA 3PI6A 3ESDA 2JEZA 4KAAA 4FLEA 1W4LA 2HU7A 1WB6A 2Y6UA 3I2JA 3ZLTA 1ZI6A 4G5XA 4B0OA 5AM1A 5JZSA 2WFLA 2VQ6A 3I2HA 1JFRA 3WA6A 4JEIA 3C5VA 2J4CA 3SC2A 1Y7IA 2JF0A 2RAUA 4BB0A 1OILA 4W9RA 3T4UA 3PUIA 2XUHA 3RLIA 3R3WA 1ZICA 1LZKA 3I2GA 3R3ZA 4P9NA 4DGQA 4N8SA 1HL7A 1VE6A 2O2GA 3LIIA 1G5FA 4KYVA 1DX6A 2WFMA 3HZOA 1J07A 2I3ZA 1XRQA 1XZLA 3H18A 4BCDA 1XZAA 1P0PA 5JARA 5AP9A 3C6YA 3EQ9A 1BCSA 1UXOA 2B20A 3WZMA 1J06A 1DQZA 3WK9A 3G02A 4KRXA 2V97A 1K63A 5CXXA 3ESCA 1Q83A 5AI0A 2RGUA 2OGTA 4DTCA 1EB9A 4J0GA 5EHXA 1P0IA 3L1IA 4H0CA 1DTEA 1ZIXA 2PSHA 4FNMA 3G9ZA 3YASA 4UBMA 2QZPA 3SX4A 4I4CA 4IO0A 4KE7A 3FVTA 4W1SA 1IUPA 1LPMA 3DLTA 4IHAA 2JGFA 3WA7A 1W76A 4AN0A 2UZ0A 2XUJA 3QVMA 1CUHA 2ZSIA 2ZSHA 3I2FA 1H2YA 3WZLA 4GDMA 3TGLA 4PQEA 2VT7A 1L7QA 4FDMA 5CT6A 1BEEA 1XQXA 3I6MA 4DNQA 1CUZA 2OAEA 2XMRA 2VA9A 3CCCA 3HLKA 4X85A 2QUBA 1CUVA 4KJXA 3H17A 2PKYX 4UBKA 4DNFA 4LXGA 1G66A 2I03A 1CUSA 4HZGA 2QKYA 5ALVA 3FYTA 2GYVA 4H7DA 4Q05A 3RARA 4N8DA 2HIHA 3H04A 4JYPA 4CCWA 5D3ZA 1QIEA 3WJ1A 3FSGD 1PJAA 4WY5A 3HXKA 1BS9A 2V9ZA 2IITA 4U2EA 1M33A 5T4HA 3WWOA 1FFEA 3D5EA 1MU0A 3P2MA 3V1NA 2OGZA 3OURA 3I6ZA 3L1JA 5HK9A 1MAAA 2VJDA 1EINA 1CUCA 1LGYA 1ZJ5A 3R0VA 4GLBA 1MT3A 4OPMA 5KBYA 1VA5A 4EA6A 4Y7DA 3A6ZA 1IZ7A 2BKLA 1B6GA 2ZJ7A 2DFPA 5ALJA 4PSCA 1J1IA 4UHBA 4UBLA 4DYHA 4KEAA 1UWCA 2BFNA 5ALYA 1CUWA 2WUEA 3RK4A 4KAFA 5LP1A 2CBGA 1FJ2A 4PW0A 5CT9A 4H18A 1VXRA 1EVQA 4FFVA 4WJLA 4WFKA 3WYDA 3BF8A 5FKJA 5DTJA 2ORYA 2WJ6A 1VOTA 1EB8A 5K3FB 2OCGA 2XE4A 3BL8A 3H1AA 3QITA 4BC0A 3A70A 1ZD4A 4OB8A 3VISA 4I3FA 1F0NA 3DNMA 2WIGA 3HABA 1KU6A 2VAXA 4IH4A 4WCVA 1LNSA 1UKAA 2AXEA 1CR6A 5A2GA 4UHHA 5EGNA 3DKRA 4FBLA 2AJLI 2WIDA 3EQ7A 3A2LA 1E8NA 5EIHA 4X92A 2Z5GA 4C4YA 3BXPA 3N0TA 1EDDA 1GGVA 2GBFA 2WILA 5JADA 1DU4A 4W1RA 3STYA 1USWA 2H7XA 3IURA 3DYIA 5ALSA 3STWA 2YASA 1GKKA 5DLPA 4B83A 4WFIA 3KSRA 5T4EA 2IX9A 2QRUA 2P8SA 3DD5A 1F0PA 1ODCA 4MEAA 3H0CA 5A7GA 3PDCA 1L7AA 4MJ3A 4OCZA 1XZBA 5LZ4A 1MX5A 1ORVA 5CMLA 2XT0A 4FBMA 3DL4A 3V48A 2WIJA 4AO6A 5HZGA 5CTAA 3OC0A 1HLGA 4K6HA 1QE3A 1MNAA 2DHCA 2DHDA 2WIKA 3AIOA 4PNZA 1FFCA 1VXOA 4U2CA 4P93A 1XRLA 3GELA 5HK8A 1QONA 4PO3X 5AKYA 1AX9A 4XX1A 1A8SA 3I1YA 3I1IA 2O2HA 1YAJA 4ZGBA 4BCBA 2JEYA 4J7AA 1CUGA 5DYWA 1DWQA 2VJCA 2XLBA 4ZV9A 3IIIA 1VJ5A 2CEKA 4X91A 3QMMA 1WB4A 3NUZA 4LHEA 4H7EA 1LPPA 4J0JA 3WIOA 4QDXA 5C8ZA 1XLVA 1ZI9A 3CCBA 4C4XA 5LLSA 2XLCA 3WK4A 2XUPA 1SCIA 4TPKA 3IUJA 2HA2A 4B9EA 4DNOA 3G8YA 1CUBA 2OAGA 1R4ZA 2Y2VA 2AJDA 5LKAA 4BVLA 1UT6A 5BV7A 5EI5A 4DSAA 4X90A 2WJ4A 2XMBA 5C7YA 1G4HA 2WSLA 1THGA 5FLKA 4HTAA 1VZ3A 3R3VA 5ALIA 5IH7A 4MQMA 3EQ8A 4S0XA 1K4YA 2FUKA 5A71A 1I6WA 5E4YA 4YK7A 1EK2A 1LPOA 4KACA 2QXTA 3VJLA 1QO7A 1Q84A 4N5IX 1ODSA 2DSNA 4OUKX 3H2GA 4AMZA 1N5MA 4TVKA 3TJMA 5BWBA 5JZ9A 1QZ3A 4CI9A 4U2FA 1CRLA 1O6GA 4DMFA 1WHTA 4QE3A 3NGMA 2GZRA 4WY8A 3VDXA 4BAZA 3WL8A 1ZD2P 4OB6A 4H7FA 1GXSA 5ALMA 4QWWA 1MAHA 4JNCA 3VJKA 3D2BA 3KD2A 3GFFA 4A23A 4P08A 3FLAA 4M0FA 3HRHA 4QDOA 5DJ5A 1XKTA 4GW3A 2OQVA 2XMDA 4LXIA 3KDAA 1J2EA 1CQZA 3V1MA 3ED1A 4IH1A 5AKJA 4CCYB 1GPKA 1NX9A 1MX9A 1W6RA 3D7RA 4B9AA 1PFQA 1EXWA 1JI3A 1XZEA 5I7UA 1BE0A 3V1LA 3STVA 1IZ8A 4BZZA 3WK7A 4ZWNA 1TKRA 4QLOA 5HKBA 3D2CA 4B81A 3H2JA 4MEBA 3BJMA 5E2IA 1CFJA 3WQHA 3ESAA 4MWTA 3MGAA 4OU4A 3O0DA 1H2ZA 3AZQA 3IUMA 3WK5A 2YH2A 2PPLA 1XROA 3H2KA 2C58A 2LIPA 2G4LA 5AOCA 5A62A 3QH4A 1ISPA 1DQYA 2XUDA 3E0XA 1IMJA 3HYSA 2QOEA 2HRQA 5AM2A 2XMGA 5K3CA 2XUKA 4ZI5A 2H7YA 4BAUA 4FKBA 4LXHA 3S8YA 5K3FA 5AK6A 1OXMA 1LPAB 2C7BA 2VTVA 3PFBA 4X00A 2D0DA 1CUYA 2CZQA 2PVSA 3DL7A 4X3CA 2VEOA 2PSFA 1EVEA 1UFOA 2WG1A 5CXUA 4CG3A 3ILSA 1FFBA 1AQLA 4WDRA 1XQVA 2ES4A 1XRMA 2R8BA 4L9AA 1BRTA 4DLNA 2J3DA 1UKCA 3W06A 1CUJA 2V96A 4WFJA 2WG0A 1K5PA 4NS4A 1R50A 1AZWA 5LKRA 1XZKA 2ECFA 4QZVA 1VZ2A 5CH5A 2YYSA 4UHCA 3C43A 5ESRA 3ANTA 5HF6A 3NWOA 3IDAA 5AK4A 4X71A 2WUFA 3GA7A 3QM1A 2HA5A 1A7UA 1TK3A 5F4ZA 5I8PA 3FYUC 3BIXA 4FWBA 2GYWA 1IUNA 1H23A 5FOQA 1LLFA 1QTRA 1SOMA 3UUEA 5CT4A 4QLAA 6YASA 1DT3A 2JIDA 3M81A 5JD5A 3PF9A 4Y2JA 2FX5A 3UMJA 1CPYA 4M0EA 2XQFA 2HADA 3EIOA 3BIWA 1E66A 2BGRA 4C88A 2XMCA 1XZHA 4AZ3A 3PUHA 4X95A 5JIBA 3C8DA 5ALEA 1ZD3A 4RE6A 3IUQA 5ALFA 2WHPB 5AJHA 1VA4A 1TAHA 2FJPA 2ZJFA 4U2GA 4E14A 1RYYA 4NMWA 1JJIA 1LPSA 1TRHA 4BZWA 2K2QB 5CH3A 3RM3A 2C5FA 4K5QA 1D07A 3WMRA 2HA7A 3WKDA 5ALUA 5AO9A 2BJHA 1UOOA 3FWHA 4AXBA 1N1MA 4QA9A 1WPXA 3EF3A 4WDQA 2H9YA 3CN9A 3FBWA 1HKHA 1EX9A 4GWLA 1EH5A 4A16A 1SC9A 1HBJA 2HHAA 4X97A 5EHQA 1N8SA 5AIBA 4BATA 3KXPA 1R9MA 5JYCA 5A7FA 3MVEA 1VE7A 4I19A 3LP5A 3IA2A 3O4IA 1XZGA 1W1IA 3G0IA 3G9XA 3GROA 4BDTA 3ZI7A 1P0QA 2XQKA 5JZBA 1YSCA 1QIGA 3WL6A 3G0GA 1QO9A 4E11A 2D5LA 3O9VA 5ALZA 4DM7A 4BCCA 5D6OA 1GZ7A 3Q8WA 5D3KA 1CV2A 2ROQA 5AI6A 5AM3A 2AJCA 1JKMA 5C81A 1WCYA 4N5HX 1FFDA 2CMFA 4K6KA 3Q0TA 1G42A 2VSQA 1MJ5A 3DEAA 3N2ZB 4Y2PA 3V1KA 2VF2A 5ALNA 3AIKA 2HA4A 4QDUA 3AINA 1UK8A 4QDTA 5HFNA 1YR2A 3R3XA 4GHWA 5LZ5A 4E15A 3OPMA 4DMHA 3SK0A 3C70A 3O4JA 3O4HA 2XUIA 2CJPA 1TCBA 4ARAA 2PM8A 2AJBA 2GBIA 2PX6A 1F6WA 2JGJA 4C89A 3FOBA 3VJMA 2WKWA 4CCYA 1QFMA 1XRPA 1BCRA 5HFAA 2V98A 3MUNA 3K9BA 2OCLA 1A8UA 3HSSA 2BUBA 1TCAA 1BU8A 2BUAA 5FPPA 3DCNA 4G4GA 5CURA 3FCXA 3ZWQA 4RGYA 5AKHA 3QPDA 1LBSA 4Q34A 4HXEB 2OPHA 2BUCA 3FVRA 3U0VA 4F21A 3R3UA 3GZJA 2QUAA 4G8CA 3H2HA 3DQZA 1YAHA 1ACJA 4BE9A 5EFZA 1CUIA 5HF8A 5K3BA 2O7RA 1YS1X 1BEZA 2DCMA 4W63A 2C0PA 4H77A 3VVMA 1KEZA 4XJVA 4MXDA 1GT6A 5T4FA 5AM4A 1CUEA 1HDEA 4YASA 4DNPA 2WM2A 2IIVA 1WM1A 2RHTA 1O6FA 4EZIA 1YB6A 2OG1A 2ZYRA 1DWOA 4LYDA 4UFPA 4FLFA 4J0DA 1MO2A 4Y2YA 4Y9SA 1XQWA 1HPLA 2QTBA 5JD4A 2HDWA 3C87A 3AUKA 1QLWA 2BGNA 4B84A 5BWCA 5AI5A 1UOQA 1F8UA 4RPCA 5ISMA 4BP8A 4UHDA 4XIIA 4HVTA 1C7JA 1UK6A 5JD6A 1PV1A 1IUOA 2HA6A 4CG1A 3K2IA 3KWJA 1W75A 3AILA 4B80A 3WWPA 1CIJA 2WHQA 4PSUA 4A5SA 4BE4A 4BC1A 4BP9A 1IVYA 4FLMA 3IUNA 1E8DA 2XMQA 2VJAA 3O4GA 4G8BA 2X8BA 2OCIA 4EY5A 5DNWA 3DDUA 3GUUA 4H7JA 5SYNA 5C8XA 3E1GA 5ALLA 1WB5A 5AK5A 5FV4A 3JYHA 5IVIA 2G5PA 5EIEA 5T4BA 5IVDA 1NU6A 4MYSA 3FNBA 4GI1A 4EY8A 2EEPA 1GPNA 4OSEA 3FCYA 3WK8A 2WHPA 3QYJA 5ALDA 5FXMA 1ZD5A 4DMCA 4XVCA 4INZA 4UHFA 3F8SA 3WWCA 1QIJA 4GECA 5A7HA 2WUGA 4DIUA 1K6EA 3R3YA 1N5RA 2Z3ZA 3WWDA 4X94A 3EBLA 1UZAA 2G63A 3ZLUA 5AH0A 1H2WA 4G9GA 4FHZA 2XQGA 4UUQA 2OXEA 3TEJA 3HC7A 1H22A 3QMVA 2WG2A 3PFCA 3F98A 3I2KA 3T52A 1KU0A 4ETWA 1QIMA 3WJ2A 4QEKA 3AIMA 2XUOA 5DWDA 2EDCA 1ZGCA 1A88A 1BROA 3VXKA 3WLAA 3HEAA 3W9BA 4N8EA 5DNUA 4W1PA 1LPNA 5JANA 3LS2A 2CKMA 1CUFA 2DQYA 4X6XA 3STXA 3OM8A 2XMSA 2E3JA 2CB9A 2QT9A 1T2NA 2WUDA 5E4JA 3C6BA 1E3QA 2PSEA 2Z3WA 2XQJA 1AUOA 4H7KA 5JAUA 1UKBA 1H2XA 3IBTA 3G0DA 3H1BA 3MUOA 4J0HA 2VAVA 4BVKA 4PV7A 3ICWA 5ALXA 5AM5A 1GQRA 2OGSA 3FAKA 3L1HA 3G0BA 3UUFA 1C7IA 4OYYA 2JGKA 3WIBA 2C5GA 5K3DA 3C45A 3CN7A 5KREA 2XI4A 2PL5A 4RNCA 2GBGA 2VT6A 3WYNA 2PU5A 3E3AA 1UK7A 5AIAA 4DSZA 1DINA 4HXGA 4FMPA 2DR0A 1AKNA 3D4LA 3IB3A 1THTA 4ZRDA 1VKHA 2WFZA 4KE8A 3G7NA 3OTQA 3NOXA 3G9TA 4NZZA 4PF1A 2O2IA 2WU4A 2J4FA 2HRRA 1T4MA 1E5TA 2RONA 4BTVA 3WWEA 1EDEA 1XKLA 3HJUA 2HL6A 4G8DA 4UHEA 1WHSA 2H1IA 2PBLA 4FOLA 4GXNA 1ZGBA 5K5EA 1FSSA 1MN6A 1HQDA 4K6GA 2BAGA 3IVMA 1JT2A 2ZVDA 5YASA 3W04A 3F67A 3WKBA 4G4JA 4UBIA 3FYUB 3KWFA 4FFWA 4KE6A 5ALGA 4QDZA 3WKEA 5FUMA 2Y1KA 4L0CA 2WTMA 4ITVA 1EHYA 5KWIA 5AOAA 2C0QA 5C8VA 1Q0RA 3M82A 4AO7A 5FPQA 4BVJA 3DOHA 3B5EA 2PUHA 5H3HA 2WQZA 4B85A 1Y7HA 4Y2TA 2HFJA 4Q1VA 3RKSA 1YASA 5ALOA 3ZV7A 5A6VA 3O9MA 4UFNA 4FTWA 1CUAA 2QJRA 3V9AA 3C6ZA 3WI7A 4O08A 2HM7A 5LYYA 5JALA 5EHZA 1EDBA 1BN6A 1QGED 1YA4A 2XDWA 2QVBA 4EY4A 1AURA 3BF7A 1XFDA 1MX1A 3QBJA 4J0KA 3KOOA 3HACA 2XUQA 2W6CX 5AKEA 3VVLA 4YPVA 2OLEA 5LZ2A 4KR0A 1GKLA 4YX9A 3W2TA 4F0JA 3AJAA 5ALHA 2XQIA 4JYMA 4OD0A 2GZSA 1L7RA 4ZXFA 5HCUA 2QR5A 4UPDA 5JATA 1QIDA 1R3DA 3JW8A 4BBZA 4QNNA 4ZREA 4UFOA 4CIBA 5K3AA 1A8QA 2H7CA 1ZJ4A 4EY6A 1TCCA 4C87A 3QPCA 2XB6A 3ZPXA 1XZIA 4Y2QA 2PU7A 3WKAA 1XZFA 1TIBA 1ORWA 2RHWA 5EHNA 1S8OA 1OCEA 4J0IA 1GPLA 2ZYHA 2QXUA 3PF8A 4TGLA 3X3HA 4Y2VA 5DYYA 3E4DA 3D59A 5ALWA 4Q3OA 4ARBA 2OQIA 4KAJA 3VKFA 4CFSA 2C4HA 4J3JA 1SCKA 5LZ8A 2QJWA 4Y2SA 1EA5A 5KWJA 4IQ4A 1E8MA 4LKOA 5AI4A 1U65A 1U2EA 5HF9A 3AFIA 3H19A 1CEXA 3QPAA 3PICA 4HS9A 1XQYA 4Y2XA 3AZPA 1XLWA 1UK9A 4X6YA 4NVRA 2I3DA 5DYTA 2AJ8A 4EB0A 4HRYA 2ZYIA 1QIFA 1MPXA 2XUFA 3WL7A 1YS2X 4H35A 1VLQA 5D7BA 4C01A 3O95A 2DHEA 5AICA 3OOSA 1XZCA 2QM0A 1W52X 3DJYA 1U8EA 2CUTA 5FP0A 2XMZA 4MWSA 1JMKC 1NU8A 2HU8A 4J03A 4CG2A 5EIAA 1SFRA 1UOPA 2RIPA 4M0MA 5AKXA 4OB7A 5LZ9A 1QIIA 2WLSA 4AZ0A 3BE8A 2PSDA 2G5TA 3DS8A 1BN7A 4BYMA 4GEGA 2GBCA 5HQ3B 2DQZA 2R11A 1ODTC 3F9CA 1B41A 2ZJ6A 3QZUA 3LIPA 4EUSA 3DKKA 4AB1A 4UBOA 4JH0A 1P0MA 2X76A 3FLEA 1QFSA 4D9JA 2OCKA 1XZDA 4BDSA 1WOMA 2WFLB 3A2NA 3STUA 5IVKA 4G1FA 3OG9A 5AKKA 3F97A 4LYEA 3D2AA 3H2IA 3HI4A 5CT5A 3ESBA 3FLBA 1Y37A 2B4KA 4OYLA 3K6KA 1CVLA 1XZJA 1ACLA 2PSJA 3D0KA 4Q3LA 2JGLA 4P92A 5AI9A 1MNQA 2ACEA 1AC5A 5K3EA 4K2AA 3G0CA 1Q0ZA 4H7IA 1JJFA 4RE5A 5AKIA 3FYUA 2EDAA 3BDIA 4E46A 5AHXA 5AM0A 5AKZA 4ROTA 1CUUA 5IVHA 1DWPA 3PE6A 5BOVA 1MTZA 3BWXA 3C8HA 2WTNA 3LLCA 1JJBA 4BAGA 4BRSA 5HF5A 4CIAA 1GQSA 3R40A 2ONCA 5CRIA 1ZI8A 1RWQA 4MYDA 1ZOIA 5ALTA 1XZMA 2O7VA 5CW2A 4BTLA 3GBSA 4GBGA 3C6XA 4UBNA
chains in the Genus database with same CATH superfamily
1SHJA 1HQCA 2YICA 1PG5A 2OV4A 2RG1A 2W22A 4KU4A 1AY0A 4BXOA 3FUUA 2VPTA 2AMFA 1WSDA 3HJHA 1KDPA 4MUHA 4X93A 3HUDA 3BJRA 1QTIA 1YIAA 3FUTA 2MMCA 4ARZA 3IIEA 3CUYA 3FFAA 2FMHA 3LUCA 5HJEA 3N7AA 1FIUA 3LQ4A 3LRPA 1A7AA 2C3UA 5A9RA 5HZKA 1G3MA 1HYGA 1QGAA 3DKIA 5BVHB 3GBVA 2XGOA 4G4IA 3F96A 5EXPA 1KK3A 4IV5A 3RSQA 5IC4A 1FQKA 2EIHA 3T3HA 2AV6A 3K0FB 3L9XA 2PA0A 2P4QA 3OEED 4D9HA 2QUKA 1CB7A 1YMQA 2QUHA 2VN8A 3V3TA 5ABPA 3JQ9A 1XYVA 3DEZA 4EY3A 2WT8A 5G1OA 3UXEA 4F8JA 2IIQA 4MCHA 1MG0A 1MDBA 5DEIA 1LZLA 1NUTA 5JBNA 1JI0A 2OHXA 2WF5A 4XDZA 1PG2A 3O3NB 4B4UA 1G8JA 1YBVA 4X20A 2BM8A 2VJLA 4RLSA 4JFRA 2Y1FA 3NIGB 4RWEA 3EDCA 3UHAA 2HY7A 3T3OA 1I2ZA 4JCCA 1DJPA 4JODA 1JDNA 1QHXA 3GCGA 1I1OA 5IBQA 4OH1A 3UOGA 3KZVA 3N70A 3DYVA 3KX2A 1S02A 2DCUA 4PYJA 5L7YA 1RQ7A 1YDFA 2HT6A 1E92A 1FS4A 4AJKA 5DXAA 4EBBA 4TKVA 3O8OB 4ZQEA 3O4VA 5FNVA 1Z8DA 2JAXA 1ESZA 2DQ4A 3AHDA 1K5DA 5KJFA 3OQIB 4ARUA 4XLZA 2VBIA 4D9BA 4F86A 4CKXA 2OHIA 1PDVA 1QJ4A 2V0NA 1E6EA 3BJZA 3C5WP 2V0GA 4EPWA 2YJNA 2Q29A 4G81A 2GD2A 5E6RA 2N0SA 4KBFA 5F76A 3ZWWA 1WBDA 4OQXA 4Y6SA 1W5SA 3CPSA 1E0AA 1E9CA 1W46A 1XRRA 4I8IA 4MS3B 2WM3A 3FPGA 3ZHXA 4O3MA 1H9AA 2ZYSA 4QOFA 2WKRA 4IDEA 3TXAA 3A9SA 3RVDA 4QNMA 1KO7A 1J2RA 2O1XA 2YXPX 1E0SA 3Q2OA 3SI7A 3A4VA 1GCAA 1OD6A 1X38A 2HK9A 2O9JA 3L9WA 3T4EA 1KXZA 3T5PA 3HBAA 3FGNA 3HM2A 1T5OA 3L6CA 1K3UB 5HG0A 3RIGA 1U6IA 5CDFA 4IAOA 4EW3A 1OAOA 1ISJA 3EBOA 3RRNA 1NQUA 1VJ0A 3IELA 5JUWA 5AFSA 1WF6A 4LCJA 2EF1A 2Z2JA 5IJ0B 3L7JA 4UPEA 3AJ9A 1E3LA 1VE1A 4JUIA 2C8LA 5B58T 1DEXA 3QTTA 2MR5A 3C3YA 4QTXA 2B1JA 2G5GX 1RLIA 4C6TA 3W5BA 1HDCA 1AKQA 5GJWC 1QZTA 4L75A 2QPLA 4MRRA 4E5PA 4DQUA 1E1CA 3SHVA 4AKGA 5GVSA 2RI6A 3O1HB 4ZV4A 2A67A 4KWTA 1SVOA 2G80A 3UBMA 1H8ED 2OV3A 1PZHA 1BDJA 3TJRA 4TXNA 1OE0A 2C1XA 2UYYA 3DKVA 4U5QA 5MN5A 3HEMA 5ENVA 5T7BA 1T9CA 2I7DA 4AP6A 3HSYA 1EBFA 1TW2A 4BVBA 2J0SA 4NIMA 4HXFB 4C9BA 1AZLA 3TRDA 1PGPA 4MDEA 3WIEA 3PGMA 3UYKA 5JW6A 3WGHA 4JIMA 2IIBA 2O2ZA 2BEJA 3O7MA 3P27A 3ZJUA 3Q87B 4XSGA 1J0AA 3LRXA 4ZZIA 1DOAA 2D5CA 2WMOB 5EIBC 4WKOA 3SEZA 1B1AA 1Z0JA 1FDUA 1KY4A 3HLYA 3K32A 1N3LA 3DMRA 2X3FA 3PXEA 3JASB 4PO8A 3UJCA 1R1DA 1MQ9A 1U9IC 2D5BA 1FMTA 3HBJA 3AHEA 3SS7X 2AZ4A 5IASA 5JAOA 4LJ8A 2MOKA 1T0JB 4MV6A 2PLRA 4O2AA 3F9IA 3FSGA 3O21A 1U4OA 4HEA6 5BW4A 4BLUA 3NYQA 1JU3A 1U4NA 4TKZA 3WP0A 3BQ9A 4FNGA 3GNLA 1TZJA 3W1WA 5FWXA 2IHYA 2OTCA 5SY4A 2KBEA 3KQQA 2GN2A 4P58A 4C4PA 1CY6A 5IJ0A 1E18A 3WOHA 4GU5A 2X6QA 3MT7A 3N5KA 3UJAA 1XEXB 4E03A 3HJFA 3LA6A 1YVDA 2YN0A 2NYAA 4G37A 3ZY5A 2KJQA 3H5LA 1IJKA 1XRSB 5FOVA 4MW1A 1CS0A 2FJ0A 2OD2A 3DOEA 3N0VA 1OIXA 4AIRA 2QG9A 2J7PD 3F4LA 1CQWA 4C6HA 4RPJA 3SU8A 5JZVA 3BCSA 2X9LA 3WS7A 2OZLB 2OFPA 2W6NA 3EZNA 3JALA 5CLQA 3V2GA 1F2UA 3KXIA 1DAGA 1T5DX 1M8FA 1Y8CA 2I67A 2VYVD 2Z2YA 3I12A 4L28A 4OJQA 3UJ8A 3ZZNA 9LDTA 4F8YA 1S96A 5JT1A 2G9UA 1U11A 2NVOA 2AX3A 3ZW9A 5IT9A 2PTHA 4UMDA 3RSZA 1Y8QA 1N9KA 4D9EA 4EG5A 1ZP6A 4RUKA 2I78A 1PRYA 1RRFA 4N0QA 1BZYA 2V7WA 1HO3A 4BMPB 2QTNA 3SZUA 3WFJA 2PX4A 4HYQA 5DCWA 3MAJA 2YZKA 2W37A 1Y0BA 3QVGB 4L3WA 1L1RA 3COWA 4Q12A 1R8JA 2BEVB 4JZKA 4Q82A 4GT1A 3TO5A 4AJIA 4ZDKA 4B3SB 2TMYA 2CDCA 3GG9A 3ZLVA 4O2RA 3CJRA 3D4BA 4NV0A 2ZBGA 1RKXA 3IPAA 4G84A 1ETHA 3PL5A 1VE9A 2HA3A 4F1JA 1W88A 3JWHA 3OQBA 3JYLA 4B82A 4ACAA 2GESA 3DDHA 4K8OA 1QOZA 5EJ4A 3HY4A 1NI3A 4F4FA 4N4AA 1IXZA 2GZHA 4RF3A 5EVCA 3ND8A 3RRFA 1KVTA 1QNLA 4U7TB 4HLDA 1K7SN 2WIFA 3WK6A 3HR4A 4ZT7A 3JYOA 1IB6A 1YA8A 5JI2E 2Z8ZA 2WA1A 1M1NB 1F0YA 3N28A 4X84A 4LF7B 4JK3A 4M54A 2FPMA 4Y18A 3OZVA 3SJBA 1M2WA 3PHGA 4YYZA 2GJ9A 1ZIYA 3AONB 3G5MA 4QGHA 5F9MA 2FPPB 2CC2A 2JFZA 5BW6B 4KAXA 4DY6A 4KVZA 2HU5A 2QD1A 2Z6AA 2WKQA 2OHVA 4CF3A 3MLBA 1KGSA 1T29A 2R62A 3ND5A 2NU6B 1V11B 3DAHA 1JQJC 3NHBA 3TZ6A 4PSAA 2QAJA 3C8UA 3O83A 5FRDA 3D8HA 5FDFA 3TW6A 4NDAA 2O19A 3M6UA 5HQ3A 3ENZA 4JYAB 5F52A 3TFQA 3TLAA 1VJDA 1QJCA 2G83A 3SMVA 3N76A 4ONEA 1CE8A 1GFWA 1ZZGA 2JAQA 2PGOA 3QX9A 3CXUA 4QRIA 3TIVA 7AT1A 1QQAA 4NENB 4MZXA 4ZHQF 4IOKA 1WY5A 4JBXA 1NRXA 3VR2D 3PDWA 1JEEA 2ASEA 3JAKB 2GSWA 1P5HA 1DAFA 2JEZA 2B6HA 4NLLA 4D96A 1Q3KA 3TTVA 4GKJB 4AUMA 4DR4B 1F5SA 1NLZA 3V4LA 2OT3B 2HU7A 1IAVA 1ZK3A 4CCSA 2OCYC 1UODA 3I2JA 3LM8A 2WA2A 3E3MA 2FPLA 4BECA 5F9HA 5JZSA 3RNLA 1DHRA 3MZ0A 4ZI7A 1Z17A 4ZQFA 2BRUA 5THXA 4BYGA 1LJUA 4IIDA 3ZIDA 2GPNA 3QMPA 4C20A 2DFLA 1N3YA 2EGGA 3BA6A 5CB8A 4YR7A 3QSYA 2Z4SA 4KNWA 1Y9JA 2FHPA 1GVNB 3BA1A 4R3NA 1FP1D 4M2LA 5WRFA 3EWSA 4M7WA 1VRVA 4BBJA 1T9BA 1O77A 3AUFA 1IC6A 3RB8A 2ASVA 2P91A 4BVHA 1E3TA 1Y7IA 2X2FA 1K6MA 4H7PA 2CF5A 2QD3A 4NJEB 4LK3A 3HDYA 3GEEA 3H6HA 1LI5A 2JF0A 3NZEA 4MULA 2I2WA 4UZSA 3A3KA 4JN6B 2VBCA 4FD2A 1ZXLA 1G1MA 1WMEA 4N01A 4Y6OA 4BB0A 4JJ8A 4DQDA 5L9AA 1X9GA 3T4UA 1D4FA 5F1YA 5CAEB 2VOEA 3TQRA 1NBWB 3PUIA 4P80A 5B5SA 3ZH9B 4FDTA 1Y5IA 4YPVA 3R3WA 1ZICA 3WHKA 4UCQA 2CB0A 2OC4A 4KH0A 1K06A 1KDTA 3NTVA 3N39C 3OIDA 4JU9A 4W9MC 4I55B 1SC4A 1TEHA 2BSAA 2HLDA 1OGJA 3W2EA 4EABA 1FFHA 1G5HA 1FLNA 4N8SA 2H2GA 2OO3A 3FZGA 3VZPA 1NNI1 5HVNA 2O2GA 2JIZD 3TOZA 3LMKA 4DADA 2JLYA 3U4QA 1IE3A 1DX6A 1Z2OX 2R6GA 4PYQA 4F7WA 1Y4SA 1L6IA 3NIFB 3ZQ6A 1XRQA 2E4YA 1BNCA 2XJ9A 4Z1MD 5ANRB 3A4YA 1XZLA 2F1JA 2WJGA 3MTQA 3P9CA 4BCDA 3ON5A 2ZBPA 3K30A 4QTTB 1TC2A 4RJIA 5JMOA 1GEGA 3L6RA 5TGDA 3FKSA 5AP9A 4XCXA 5BOSA 1RI1A 3EQ9A 1DHTA 1KTVA 2PKQO 2ZUWA 3L6EA 4RSMA 3IE0A 1NRJB 1VDZA 3PC4A 3VBEA 5KKAA 1PZMA 1NJ2A 1ZCJA 4QNRA 4M49A 1VSVA 2VDWB 4UOQA 3V7WA 4ZYYA 4CPDA 5U4XA 1FS5A 1R7RA 2F9FA 5K0NA 2INGX 3HCCA 4K86A 1NVTA 3ZVRA 2F8TA 2PZLA 1Q83A 2W0SA 3RRXA 3T7EA 4DDWA 3FZQA 1UCFA 1WTCA 1L4NA 5L8VA 1XDBA 3KFVA 1EB9A 4MGEA 4J0GA 3VZBA 4A5OA 3I9KA 1P0IA 1RXSA 3IKMB 1XGKA 1I5EA 1E77A 4ZJUA 2BFDA 1VCHA 5A3RA 1EDZA 1YK1A 3F5SA 4RD1A 4AZVA 4AS1A 4P6VF 1SBNE 2QZJA 1QG4A 3OLQA 3URKA 1BD4A 3FRHA 3RVNA 3UKJA 4P98A 2WOJA 4DC1A 4CTNA 3GJ3A 4NOMA 4FJ1A 3G9ZA 4HK4A 4N0MA 1JTVA 1MB0A 3IL2A 3LLVA 4UBMA 3SSNA 2PANA 1IN5A 3PR3A 4IVPA 3G85A 4KTTE 1B8NA 1P0CA 1UXGA 2QY6A 3ABSB 1YQXA 3GLQA 1L7BA 3HADA 4I4CA 1Y5MA 1QNFA 5K6AA 3WKEA 2CD7A 1PX0A 2HTEA 3LYAA 4W1SA 1OWNA 1CNEA 2D54A 4ZOAA 4ZKEA 4IHAA 1OVMA 2PK3A 2JGFA 3A6DA 3CKYA 3E7XA 3WA7A 1W36B 5TEVA 3W8FA 1OBOA 1O2DA 4EDHA 3RPEA 4JI4B 1XA4A 4LE2A 3MNFA 1N6LA 1ISMA 2DQSA 3TQFA 4Q1AA 4RHCA 1HT3A 2I55A 2PYDA 2NU8A 4Z4HA 1G0NA 3M4NA 4GDMA 4MHSA 2B3TA 4DREA 3BD7A 5LMZA 1JLKA 1YVEI 3RVKA 2VT7A 1Z7WA 5DGCA 1D8AA 2OV2A 3WJ7A 1DADA 1II8A 1YBFA 1EU1A 3EZXA 1GITA 1RC8A 1ZVKA 5D3MA 4XR9A 4IDGA 3T0IA 4FDMA 4JJ6A 4MRAA 4PAQA 4RIGA 4B31A 3ZGOA 2VQDA 3GX1A 4LY9A 4B4WA 2H17A 5K9ZA 4ZRMA 3M1AA 1CJCA 1X7XA 4F5EA 1I4WA 5K01A 4I9GA 3WDKA 1QMPA 3T7IA 2F9LA 3K71B 1MQSA 3OQVA 1FW6A 1RIIA 3BSFA 2QUBA 4B3IA 4FM9A 1W2HA 5ICMA 2H1CA 3DBLA 4IKOA 3N75A 2FE1A 4AG6A 4BTEA 5EXTA 5EKXA 1XAHA 1ZJJA 3W8RA 2J9FB 2NVUA 1G6OA 2V3VA 5B4UA 1QLJA 1E4OA 1ONPA 1QVAA 2ATCA 2FMIA 3AFGA 4TTQA 3R76A 4C06A 4D45A 4WBNF 2DETA 4WEOA 1D2CA 5ED0A 1EFRD 2E48A 4MWOA 2WAOA 3EC2A 1T36A 1Y4UA 3EZ9A 1VYTA 1Z0SA 3QPBA 1PL7A 1UXJA 3CW2A 2RC5A 5A4FS 5FBQB 1A77A 4TL7A 1NF9A 1Z4JA 4PZZA 3FYTA 2GYVA 4DMGA 1I3OA 3MGBA 3VAZA 2IEYA 1OHHA 1O94A 6NULA 1CP3A 5EXDA 2GILA 5IDXA 4Z53A 1WQ3A 2GA9A 3WRYC 4B40A 2HDOA 1B8OA 3EGXA 4DLUA 5HMMA 1U7DA 4BLQA 4L7QA 3EJWA 3TM5A 3KVNA 2A86A 4WY5A 1VI2A 2VYND 1QRRA 2QN2A 3LUAA 1KFBB 3TPFA 4EM6A 5I45A 1C1YA 3D5EA 3GLRA 4C7OA 3W5DA 3P2MA 4MUMA 2ERCA 3AM1A 2I2BA 3O8BA 3QELB 1IIRA 1XL1A 4KDEA 4MIOA 4R8KA 3H99A 1Y42X 5ULLA 2QPTA 5HK9A 1CUCA 2HWXA 3LLSA 4NYMR 4CMCA 4CF7A 1GILA 1ZJ5A 1Z82A 3IJRA 2FEMA 1AKWA 2G4VA 2PKCA 3R0VA 2RFLA 4GNRA 4OM7A 1GU1A 5GOZA 3L7KA 1I8TA 2D2EA 2QJTA 2WAXA 3MK31 1U94A 4MPJA 1VA5A 4EA6A 4FPXA 2ONJA 3K70C 1DCKA 3B3FA 3UCFA 3FI9A 2IU0A 1XCBA 4AK9A 3WG9A 4D6YA 3GRZA 1Y48E 4PSCA 5CFZA 4O4LB 2B2XA 2HREA 1X7YA 2Q7DA 5KHLB 2GVZC 3ISTA 3KPWA 1ECPA 3GAZA 2ZI5A 4PIMA 1UWCA 4BMXA 3C85A 3D3QA 1TM2A 3QFCA 2QTGA 3MAAC 3OZRA 2R7KA 1OJLA 1PWXA 4ALIA 4CM1A 5LM3A 2ATEA 3NGLA 5FFFA 5LXTF 2WUEA 2FPSA 2RHMA 4KAFA 4PHFA 2BFPA 3FPCA 3OA0A 1RQXA 1Y1PA 2QTHA 4JFAA 3OE4A 5EJIA 2XNHA 3ZD8A 3PX2A 5L3RA 1KH1A 1SU8A 2CBGA 4QJ5A 3ELBA 1FJ2A 1SK8A 3RVSA 1JE1A 3Q6NA 3OCZA 2QBYA 2ZR7A 3I6QA 4H18A 3P32A 4FFVA 1DFIA 3HFGA 5TJ9A 4WFKA 1Q5PA 3M6VA 1PJZA 4YJHA 5FKJA 4EJSC 1GAWA 2I3GA 3SFZA 3B7GA 3RF6A 4PWZA 3SQWA 3IDZA 2AN5A 2FZWA 1DJLA 1A5TA 5TF4A 5LQDA 4NR0A 4JX9A 2X7XA 3GLHB 3H1AA 1VDMA 1C9KA 5J63A 6GPBA 1YI8A 1YVUA 4LJKA 4MI1A 3SBDA 1NPTO 4QTUB 3RWBA 3G79A 2HMUA 3A70A 2XYGA 1P7PA 2BT4A 4OB8A 2AOTA 5J2UA 4IIGA 4UNPA 4DB2A 1JR3D 1DZIA 1CZUA 3PXBA 3DNMA 3BRQA 3QFRA 1Z5ZA 4OTZA 3VHQA 4B33A 8ATCA 4AJ1A 1GSOA 1N2GA 1KU6A 3N8HA 2VNHA 3H3JA 3PFGA 4IH4A 1LNSA 5CGZA 4O3FA 1P75A 4AY5A 5EGNA 4NCBA 5EHGA 1XK7A 3CW9A 4WOBA 1BGVA 2Z09A 1Q6YA 1RSZA 2I6UA 1E8NA 3A27A 3GP5A 5KNBA 4YFYA 1WXIA 5HXAA 4BLWA 3N0TA 3RROA 4EZEA 1J2JA 1EDDA 1NQOA 5EP2A 4D3YA 2GBFA 2X14A 3VI3B 5JADA 4NU6A 3FIJA 2Z2ZA 4J90A 3VQTA 1CJKC 4JR0A 1B26A 3NW9A 1B0ZA 4F3NA 2H7XA 2YY7A 3IURA 4GZLA 2OV1A 1JLLA 2IK8A 2YASA 3KLOA 3P5BA 1RKVA 3NOVA 3SSOA 5FI1B 2ZVPX 3UB4A 3EXHA 3QX7A 4XTRA 3OTHA 4DLSA 1GGMA 3A9CA 3NHPA 4DQLA 2B36A 2ZTMA 5J2TF 3U7JA 3Q1LA 4ETIA 5LQAA 1S2MA 4CLDA 1GPYA 1E4YA 3IP9A 2HPHA 3TLGA 4EL0A 2ADFA 1XTKA 6REQB 4B34A 5H5JA 2G6TA 1Y3CE 3PLRA 3D6TB 4K3UA 1QH0A 1VI6A 3ENKA 1MUUA 2AG0A 3ODGA 4PYNA 5EZ5A 2EBFX 3KE8A 3JQPA 4C22A 2II6A 5J4LA 1M8KA 4NBNA 2Q3DA 3DD5A 4LWQA 4JKIA 3M33A 3N0RA 4ZEWA 2KMLA 5K2MA 3KCQA 1Z38A 3H8SA 5J58A 5IUKC 3LZCA 1BQEA 3HXLA 2G70A 2YUIA 3GFVA 2HN9A 4YMVA 4S12A 1PO7A 4MRMB 1QGDA 3KYJB 3P97A 5AW9A 3RJ5A 3MINA 1ORVA 4XYGA 3SE0A 1NF3A 1Q1NA 5JXJA 1I9GA 2DBQA 4NV3A 5TE9A 2AVDA 1G63A 2L69A 1ECGA 4GQBA 5E7IA 3TRJA 1B6TA 1D1PA 1YZNA 1V41E 1N32B 2GS9A 2VHYA 1M1ZA 3JU3A 4TLMB 5CTAA 5ERYA 3REOA 1ENPA 4KZKA 5BQ3A 5HZGA 5I9LA 4G01B 3VPAA 1N6PA 3M5PA 3Q10A 1U0HC 4TYWA 1PU2A 4RZ3A 1V9CA 2DHCA 3RAFC 3DLIA 3GRKA 4PG7A 3AQ4A 4D3DA 1TZ2A 2W6JD 2WIKA 2NX2A 5KNDH 2X3UA 3H6KA 5KOHA 3RRZA 2CNOA 1UMDB 3C7DB 1LBIA 3CLSD 4P4NA 4P93A 4S1VA 4U9UA 1I1NA 2X9VA 1DDOA 1OX6A 1VL5A 4JROA 3I9LA 1T2CA 3EB9A 5JROA 3GH3A 2AOVA 4EGFA 5L40A 1QZZA 3NR2A 1RHMA 4L0MA 4LRTB 5I4BA 1R6DA 2Q6IA 1XQ6A 1IAQA 4MO9A 4DIDA 3ZR4B 5AKYA 3SVLA 2JLWA 4RQAA 5AVOA 3IPLA 1AX9A 3FJYA 5JXHA 1L4HA 3OJXA 4QKQA 4ALMA 1U2TA 3VHRA 1GWNA 1N2XA 4DV4B 1ZDMA 3AFHA 3N5CA 1A2KC 1BJKA 1XWWA 4ROSA 4AYTA 1PJ3A 1WNTA 3QUBA 4M7RA 1IN1A 4K81B 3FHTA 4J7AA 2HSDA 3OIUA 3MAGA 5EWLA 1H69A 3NHRA 3R8XA 3FPSA 2WLTA 3KUUA 3DTTA 2O8EB 3P19A 2VK8A 4NH4A 5GAJA 2CEKA 4KR3A 1LJ8A 2WPNA 1PHPA 1W19A 1L4MA 1I1QB 2RHCA 5HCNA 4OXIA 1Q95A 3MWEB 1L7PA 4US0R 4Z0PA 4YQFA 3QE4A 1XXLA 2PRIA 4FT4A 1SXQA 3FTFA 3NBAA 3U7FB 2Q9CA 1GNSA 2YFQA 5EGSA 3T1QA 2FQQA 1NASA 3IDSA 1Z13A 1YXMA 3AEYA 4J0JA 3W7VA 2XYQA 1Y1KE 1LC0A 4YMIA 5KYWB 3M9XA 3WIOA 5LOVF 4QDXA 4AC9A 3LOUA 3AHFA 3CCBA 4C4XA 3HJBA 3L92A 4OV6B 4NRDA 4GI5A 3SJZA 2OP1A 4CMBA 1ND6A 1AU9A 2PRSA 2XUPA 4NP6A 2F4NA 3PGJA 1VQ1A 2FETA 4FGSA 1X42A 1ZLYA 5FBLB 3IUJA 4PSVA 5GMOA 3RFVA 1P91A 1OF1A 5HIAA 4L5JA 1XJQA 4JP5A 1IRXA 4B9EA 3GJ7A 4ZJZA 4M3NA 1C0LA 3T06B 3PA6A 2OAGA 2WD8A 2AJDA 4TV9B 3L8YA 2JFGA 4BVLA 1UT6A 4G09A 2VJMB 4JJIA 2N1BA 5KYXA 2D5IA 1JW9B 3TAUA 1R5JA 4A73A 5CA1A 2AKEA 4CVNA 2WJ4A 2D4HA 2PH1A 2QENA 3GF4A 4Y67A 5DN9A 5GM1A 2H52A 1RAAA 1G4HA 3BMCB 3P0HA 1XALA 2D7JA 4N3AA 3KOXA 521PA 4KQ6A 4XA8A 5A1TA 3HN7A 3RRBA 3I4LA 4KMSA 5GPBA 4PCVA 1KEPA 1LFDB 1LU9A 2CVOA 3EQ8A 4JLDA 3ZWXA 3T3EA 4AF8A 4BQSA 2FW6A 1X8KA 2HPVA 3NQ41 1K4YA 2FUKA 2OGWA 2C61A 2QLTA 2C5EA 4LV8B 5E4YA 3QJGA 4YK7A 3D6AA 1EK2A 3RFUA 4RY2A 1LPOA 1FBNA 3OM0A 5BR7A 1SXJB 1VSTA 3ZGLA 1Q0PA 3RGGA 2AQHA 2G1UA 2P41A 4N5IX 3FPBA 2BJVA 4JVOA 3H2GA 4OUKX 2JGNA 3RUHA 1ZKMA 4LZOA 3GFOA 4MWGA 1GA4A 2KQUA 1TLFA 3GT7A 4I5IA 3JD2A 5JASA 1H4VB 1V3TA 3G5LA 4TVKA 2OQRA 2E87A 2EKDA 1QZ3A 4U8GA 3U4GA 3UEOA 4B1FA 3O8CA 3EA4A 4RADA 2PGIA 2DY0A 1KZGB 1ZRSA 3E23A 3RVPA 4AWBA 1RRCA 1SC6A 3WGGA 4KYUA 4QE3A 3T0FA 3UA3A 1BDHA 4EHJA 1EQUA 3D4IA 5BN5A 5FL7D 3NGMA 2R1TB 3I5UA 4XQEA 4LDZA 3FYSA 4WY8A 3U31A 3VDXA 1R6BX 2X6TA 4I5DA 1ZD2P 4NBUA 4L6IA 2I6GA 3WL8A 1Z4LA 4GGPA 4BFCA 2O8BA 1UBOS 3PZRA 5M7EA 4H7FA 1GXSA 3PG5A 4DV3B 2I6FA 3A0UA 1RHQA 1YB4A 1KQOA 1TADA 4V0LA 3WRXC 2Q0SA 1KVRA 4HVCA 2FX2A 1E0JA 4GOND 4QDOA 1J70A 3BUSA 4TMYA 3SGLA 5A0VA 2J48A 3H83A 4KWEA 1M2VB 5DN6D 3DWEX 4HQKA 1LH0A 3E82A 1WDKA 1Y80A 1A71A 3AEZA 3GV0A 2BGKA 2KX7A 4RLHA 3II6X 1ZVVA 4YRZA 5TC4A 1G9SA 1XZNA 4G41A 5FWNA 3KDAA 1TJ4A 3QVOA 5HOEA 2H3EA 1Z6TA 2IPMA 2RJNA 4XD2A 1CQZA 3SHTA 2A3RA 3DR3A 1ZH2A 2Q1YA 3U7EB 1HNWB 2NADA 4TTTS 4EWLA 2EFCB 2YN4A 1IHDA 4QO8A 3SG0A 4CTOA 1E69A 1WXWA 4P3YA 4XH9B 4MI6A 3WGQA 1NXTA 3JD3A 4IH1A 4LAFA 2C97A 3L7MA 5AKJA 3EX7C 4H1WA 1JVSA 2HMWA 2QUJA 1X1TA 2C2GA 2ECPA 4P5PA 1PZXA 4ODIA 1SUAA 4QPNA 4AF6A 1BCRB 4DSNA 4C3OB 1NX9A 1Z0DA 4I50F 1I0ZA 1T3HA 4L3OA 1DS6A 3NBUA 1ECBA 1M0SA 3D7RA 3SX2A 3ZWVA 5ES4B 3RWMB 5DRTA 4B9AA 3PFNA 1VPLA 1Q50A 1EXWA 3ASZA 3INYA 4FMCF 1OOEA 2BHNA 2PX2A 3DLBA 1PS9A 4TQGA 1BE0A 4XYEA 3M1YA 4YRJA 3V1LA 1JHVA 4QARA 1XCJA 4YI5A 5BW8A 2AKAB 4IRUB 3U6KA 2IXBA 1BEUB 4ZWNA 5IK2A 4D9GA 5BORA 3ZLJA 4M1QA 3JQBC 2V3CC 1M5TA 4NONA 3K5HA 3FOAA 5KNCD 4YUXA 5JR3A 4LDQA 1NVKA 4B81A 4DQKA 1W87A 1TF2A 1T15A 5ES3A 4L15A 2NUAA 4D8WA 1MP0A 1ZCFA 2AMJA 4MWTA 1A9ZA 1P1RA 2DBVO 4OU4A 1M0EA 1AJEA 2C8JA 3K94A 4UUPA 1KO5A 2NACA 1ZAKA 4FJ0A 4RVGA 3WK5A 3BIOA 3IEMA 3Q5GA 2YH2A 2PQ0A 1SIOA 1XROA 5LQRA 4J43A 3BHMA 3FZYA 5K0JA 2LIPA 4X1KA 5AOCA 1IBRA 4R68A 4WERA 3ZOZA 4JYZA 4EFNA 3VC2A 4MQFB 3FH0A 5E6UA 3U49A 2V1UA 3LLUA 3QH4A 1KZ4A 4PFJA 1WPQA 2FRDA 1E9BA 1K4MA 1V8ZA 3PC3A 4R83A 4DSTA 5A5GA 3DB1A 1O95D 1GR1A 4E32A 1JR2A 2G67A 3FX2A 2Q5OA 4Z3DA 2CXHA 3WNCA 7REQB 3H5OA 5KOJA 2DPGA 2Q07A 2XUKA 4YRGA 1ZFNA 1MEOA 4YPFA 5D6NA 3N2LA 2YJ3A 4LXHA 1Z7YA 2ZT8A 3PX7A 4IX9A 3CEJA 2FF5A 2J9GA 3UJ7A 3FCOA 1IJFA 2WT9A 1UJ6A 3ETHA 1H1DA 2I1WA 3F5FA 4FC6A 1RC0A 1H1LA 2C7BA 3JTMA 4OIMA 2QTLA 3EG5A 5M29A 3MGGA 3TINA 3CEPB 2LKDA 4RF5A 4WCFB 5LDHA 1P9OA 3QPWA 3U19A 2OPBA 2FSSA 3DL7A 3HL4A 2VEOA 4LX0A 2G9NA 1RXUA 3T54A 2CNWD 2QN9A 5BMVF 1EVEA 1UFOA 2Z1MA 4UE6A 4WLEA 2Y1GA 4NG4A 5TVKA 4DUYB 4DA4A 2J5XA 2O8CA 1A97A 1MH9A 1FFBA 1TJ3A 3K6RA 1DO8A 3SXJA 3AR2A 4R8LA 3E9ZA 1W5EA 2GCPA 4UCXA 5T8KC 1XQVA 2ES4A 5CLJA 1XRMA 2XRFA 1UOEA 4XYBA 4ZAYA 3R24A 5E1OA 1NW8A 3AOEC 4HFRA 2JJ1D 2IELA 2VLIA 2JIQA 2ZWMA 4KZPA 1E2FA 1P1KA 3T9AA 5KI6A 1JS1X 1C0PA 2ZFUA 2VR1A 1P0FA 2J3DA 2NAPA 2XAUA 3ILYA 4XUCA 5FX2A 3TG8A 2A0XA 4ZYXA 4OBBA 2ZUFA 3I01A 5KB3A 3JQAA 4HNAA 4NS4A 2ZSEA 1ZS9A 3MB8A 4O0MA 4UTXA 2FPWA 2YZNA 5EIWA 5FTNA 4G97A 2W83A 3R6WA 5JO0A 2FK8A 4S35A 3M49A 5FPYA 4G25A 4BLTA 5C5IA 4HH1A 4LRUA 2I6TA 4CQMA 1ZM7A 2F3RA 3I5MA 1DE0A 2GVNA 4KO4S 4C2TA 5HF6A 2IV2X 1P4JA 2XSZD 4M88A 3DF7A 4U39A 2X6RA 2DR2A 4XLLA 2OLKA 3LHSA 3L82B 3TE7A 3AB3A 3C41J 2PL9A 4BO1A 5LP6F 3HCWA 1KJ9A 2NT4A 3FWYA 4G5HA 4YJ2F 2XYPA 1MB4A 1T8WA 4UVHA 2YBEA 3LUPA 4DJFC 3HDGA 5ARCA 2J9XB 4UM9B 3TG2A 4FQ8A 3D7MA 2D2VA 5B57C 1NW4A 3D6NB 5EIXA 4WNYA 3BIXA 4XXHA 4FWBA 2CGEA 2J30A 4YCCA 4AT1A 1EZ1A 1IUNA 3MJVA 5B1IA 1P80A 1LLFA 1AUPA 1C7ZA 1QTRA 3BCHA 4KQ1A 4D0SA 2WJHA 5J23A 2YS6A 3UUEA 5EPUA 2O4CA 4KVAA 2AR9A 4TN5A 4WXRA 2YMMA 1NUPA 4YXWA 5ER9A 3GRFA 2PH7A 1KWGA 4GG1A 1UKVY 2YJ5A 2B5VA 1JHPA 4UNSA 1TQDA 3K9CA 5B1SA 5HUJA 2OVFA 5DHUA 4P3NA 9ABPA 1VFNA 1LTHR 4RORA 3HBNA 4YRLA 5EZQA 3JAMA 3AWDA 4CJXA 4Y7CA 1FVHA 3PIRA 4MW4A 3BBPA 5F3DA 1HTTA 4PTYA 1XZHA 4J94A 1EUYA 2YWEA 5EYPA 2JATA 5B1YA 1PZFA 4KBGA 3F2IA 3REFA 3LXUX 5EUCA 4AY6A 3KU4A 4DLPA 5FWYA 2R66A 1CY4A 3DTNA 1KZ7B 1QH8B 2WHPB 5CB4A 1V5WA 1VA4A 4B4KA 2FAXA 4Q47A 5IUNC 3QU2A 1CB0A 4L76A 4TKVB 4RESA 3ML1A 5A4JA 2WJYA 2FJPA 2O3UA 2ZJFA 3EEOA 4RL6A 4FYVA 2PMFA 3REQB 2R8PA 3B60A 4NMWA 3ETJA 4M9RA 5T6MA 1O4VA 2YMLA 1RWXA 2ZYVX 3FROA 1OJ7A 3AUJB 2BBOA 4QOJA 1QQ7A 5F12A 4C0LA 3OIYA 2VH5R 2ZE6A 1LPSA 1FYFA 2BEUB 3LY8A 1QFYA 4U6QA 1L4UA 1PZGA 1AN9A 1SK9A 1TVKB 4OGWA 2HEGA 5CH3A 3U1VA 3HP4A 2GZAA 1PL0A 3NUGA 4ADSG 3BDAA 1B8VA 1HSZA 3OTIA 3TTUA 5BR8B 4ZYWA 1X19A 2BELA 3EFHA 1AF4A 1DKOA 1JJVA 3D3EA 3R5XA 4L08A 4W8OA 5LBTA 3UXMA 1JEQB 2GVDC 1WP4A 4N6NA 4LRSB 3SXPA 3ZEIA 3A3OA 3AEKA 3E48A 3KOWA 4F38A 2DWOA 3B6IA 4TTVA 2Q27A 4Q9NA 1UOOA 5FF9A 2AW3A 2XEDA 4DJ5X 3LKDA 4N48A 1ABEA 1L7XA 4PGHA 4HQOA 2ZR0A 1EVLA 3PWKA 1OX5A 8ABPA 1GZUA 2H9YA 3SJCA 3CSDA 1HNZB 3QV1A 2B30A 1VPTA 2J5BA 3AJ8A 3OZEA 5FIUA 2VXBA 3D8UA 3A4IA 1CVRA 1Z5WA 2DUUA 2W58A 3H42B 1GVHA 4GWLA 4DVGA 3ZQUA 4DUGA 1N6NA 3O0TA 1ISSA 2ZS8A 1X1DA 3COZA 2OBFA 2PT6A 3RODA 2SNIE 2JLQA 2Z9DA 3HBMA 4XPIA 2O2XA 2OB2A 3N3BC 1XELA 4GWGA 3A7DA 4V3BA 3KXPA 4BATA 4D02A 1P2SA 3ZJTA 1YJ8A 5A7FA 1YIDA 2IZOA 1VG9B 9LDBA 3GLVA 1VE7A 4BWGA 3UMRA 2WIBA 4N3BA 4LYJA 5E3HA 3KQKA 4YBRA 5AVVA 1LW6E 5HKOA 2B25A 1C81A 2C03A 1ZC4A 4IWXA 1OFIA 3NC4A 1D1TA 3BL5A 4EVRA 1IY9A 3MJFA 5DK4A 3G9XA 1E5QA 4KFTA 1E59A 4ETMA 1L6RA 1ZX1A 1T5HX 1SU6A 3B51X 4QUAA 1ZN2A 2J5QA 4DA6A 1WUHS 3I73A 1RWOA 4MVJE 1BAPA 3GLTA 1T1EA 1Q57A 3AF1A 4R1LA 5H70A 2WABA 1P0QA 1HLDA 3I42A 4FP9A 2YZ2A 1U9IA 1RAGA 3FTDA 2P2ZA 4JWTA 1YSCA 4II3A 2R6HA 4RSHA 1TUEA 1UJNA 1E2JA 3IQHX 2F67A 1C2TA 1PX2A 3WL6A 3I9V6 4WPGA 1PS0A 1QO9A 3JVEA 3NM4A 5F5XA 1N75A 2D5LA 5I51A 3DSRA 3O9VA 1K7CA 2JH8A 4LZPA 4QDKA 5FWXB 1ZUNB 2O14A 3KOYA 1I6MA 2QQ5A 2JVIA 3E61A 1OZ0A 3Q2KA 4WXPA 2P5TB 4EFKA 3OJEA 3Q8WA 1QBGA 4PC6A 5GY7A 3S0JA 3LKVA 3AKDA 2HD4A 4EITA 1OWOA 1G21E 1LC3A 2QZZA 3FBGA 1SAYA 3FHCB 1PZEA 4GE0A 3V9PA 5AI6A 1JA9A 4JY7A 4QUJA 2AJCA 4BMSA 4Q4CA 8AT1A 1JKMA 3V6LA 2PWZA 3K1JA 1WCYA 3STHA 4ZVLA 2CMFA 3RHTA 3OCCA 3DW3X 4BKMA 2G1PA 1N2CE 1MJ5A 2VSQA 1Y8RA 3DEAA 1JFFB 2QZ4A 4MH0R 2GSDA 4JC5A 1YU6A 3P4YA 4Y2PA 4DJTA 1L3CA 5BR1A 5LMUB 1V7QA 1P18A 4OLHA 1J23A 4WOPA 2EBWA 4P3PA 3RAPR 1FVOA 1PR3A 1KEEB 1IHYA 4Q93A 5HNKA 4A92A 5J4HA 3SYMA 1UK8A 4CBVA 1SPBS 3LF1A 2VTBB 2PS1A 3ORSA 5EMKA 1SA0B 5LFAA 5BSGA 4RD0A 4ASUA 4L78A 1GPJA 2NPFA 3R75A 1VJRA 4HY3A 1TM1E 4G56A 2Q6OA 1VCNA 2CCGA 4MQ6A 2AKYA 4P4UA 5LQUA 3B13B 4EKIA 3BM5A 4AZTA 1X9HA 2V6GA 4GXQA 3SEAA 2ZXFA 2NO4A 3GN1A 1PJLA 1SUCA 3EPPA 3KFXA 4KRGA 3O4HA 4IMPA 5IAOA 2JI9A 1DPFA 3GH1A 1C8KA 1A9OA 1RXCA 1TCBA 1K7YA 3HGMA 4YJFB 1L0BA 3T1HB 1D6JA 1MVLA 1QGUB 3BMNB 3H5NA 2WSSD 3ROTA 3WSVA 2DUJA 2PX6A 3FUWA 4L95C 2JGJA 2JW5A 5BN3B 3A14A 3NJ4A 2HIAA 3WLQA 2HW8A 2MSCB 2I54A 1K5GA 3FOBA 2SKCA 5BSTA 3NU1A 1VYHA 2UUOA 1T5BA 5FLEX 4CCYA 1GTSA 1QFMA 1IWPB 1V95A 3TF5A 1HFKA 3K53A 3X1DA 2X5OA 3NC1C 3RU7A 2C88A 2HJRA 2UVDA 3K9BA 1NI4A 4G5QA 4Q7EA 4EHLA 1M6VA 1CHDA 1TO1E 1W0CA 3HSSA 1X7WB 5EKUA 3HWX1 2R47A 1O9GA 2ZT5A 1PJ8A 2JZOA 5FPPA 5D00A 2YXEA 3HCAA 2WMDA 2NVWA 3L84A 4PRLA 13PKA 1B43A 4G4GA 2WVHA 3P7MA 4BNXA 5BN1A 4RVNA 5IFLA 1S6YA 4MQEB 1IQPA 2XPCA 4HWOA 1JXQA 1BXGA 3LQ1A 4IJWA 3RKUA 4J8PA 3OUZA 3ZGXA 1EG2A 4C7VA 5JXIA 3NEPX 3VNRA 3KSBC 5B55A 1W9MA 1S2DA 4BVEA 1S8AA 1ZIDA 2D1QA 3BE4A 1NUHA 1C8LA 3E03A 4ZCQA 3SQNA 4O2BA 3I9NA 3CKKA 3K92A 4Q34A 1USGA 4PZEA 3VA7A 2G9VA 2WM9B 2QX4A 1ZCBA 3BXZA 3F46A 1H1TA 4ZVPA 2PGDA 3PITA 4XWYA 3MJEA 3U0VA 3ABRB 2PMCA 4NZNA 2H6EA 3OOHA 3OPYB 2C9DA 3O8QA 3LL4A 4Q4DA 5K0SA 3OOYA 5EFZA 2W2KB 1PYGA 3L79A 1NV8A 3EUWA 4N1AA 4ESHA 5JMWA 1UFVA 3KWLA 2NXNA 3QWHA 3T1NA 4HLUC 3CUWA 4OFZA 4EK9A 1NBHA 4CFYA 5BVGB 3IX7A 5IYZA 4MQ5A 1NP6A 2FFHA 4BO2A 1IHOA 621PA 4TMKA 1BEZA 1YJQA 4Q1CA 3DAFA 4Q3DA 4W63A 4Z4EA 2NTYC 4KR2A 1HOXA 3UATA 4M0CA 1JQLB 3FYCA 3LQQA 1PQPA 1KEZA 1Y7LA 2NUPB 4UNIA 4ZHSA 4EUFA 3LHDA 1UIRA 2JLRA 1LVHA 1OZAA 1UJ5A 4MXDA 2VCYA 1U3GA 1GT6A 4R8VA 3ZV4A 1HDRA 2NP7A 1YQGA 1VCMA 4ZTZB 1JG1A 1ML4A 3H8JA 4Y0AA 1CUEA 1F6DA 2FRVA 2H8GA 3K4QA 5HHTA 3HA3A 3INGA 4YASA 2WM2A 4DNPA 2B35A 2EBUA 4ZTUB 1P5ZB 7ADHA 1QAOA 3T7RA 1WM1A 2XTZA 3R7BA 4HUQB 1C2YA 4UMFA 1IXYA 2HMVA 1YB6A 3DNFA 3ZWYA 2VOJA 3ZU6A 1JDSA 3FJ1A 5TQ2A 4HAUA 2FI1A 4H3KB 1NJFA 5GVRA 2WSBA 1SC3A 1RCTE 1UZMA 2B92A 1MO2A 4IG9A 4HUTA 2O3QA 4Y9SA 2QTBA 2VHZA 2IQ5A 2E7ZA 2ORVA 1J0EA 2RB5A 3GGOA 3HVUA 5AI5A 2B98A 1E3DA 2NO6A 1QVWA 2Z04A 3HZRA 3P0JA 3CT4A 2GT1A 3H2SA 1SRRA 2FFJA 1E1KA 1GKYA 2OBNA 5ISMA 8OHMA 1CDDA 4K6CA 2PGJA 4CKYA 1M10A 4MRSA 1QRAA 4XIIA 2JHAA 5CDHA 2G1JA 4PIPA 4OGGA 2X58A 5EZYF 5JSFA 2VF7A 1O03A 1GM5A 2B4TO 2HB6A 2XGMA 2Q5EA 3F6EX 3GDHA 4GSYA 4WD3A 4E3WA 3UAGA 4RTKA 3IEVA 3OF2A 2GNPA 2WB4A 2ZAIA 1XSEA 1PQUA 1RQGA 3K2IA 5HS6A 1V5FA 4LXUA 4OHMA 3ERCA 5LLTA 3WLIA 2VP6A 2A57A 2M6LA 4K9LA 4QFCA 2Z83A 1CIJA 3B48A 3GJXC 3F78A 3QEJA 3IMGA 4A5SA 4B5KA 1JB1A 3AR9A 1N5LA 2JJ2A 2BBWA 3P2YA 4RMJA 4U7PB 2AFIE 3D3WB 2KBFA 4LSWA 5CPBA 1VPWA 1L8XA 4NE7A 1ZCAA 1O54A 2VSXA 2H85A 3QF7A 3UT5B 5M2QA 4RS4A 1KOFA 2PFGA 3ENWA 1UBCA 4OQDA 5A0TA 5AW1A 1J39A 1F9AA 4K9KA 1NMQA 3MFQA 1H5QA 1NMXA 1VMDA 2W71A 4U7WA 2IYLD 3MJ4A 3UXYA 1CSEE 3O2SB 3QFSA 4BQOA 1DJNA 4TTJA 1FUUA 1MH1A 1M1XB 1N1GA 2XA1A 3AJDA 4EVIA 3TLMA 4I4TB 1NTOA 4QHSA 4YB8A 4BQFA 2VJYA 2CDAA 1NW3A 2QD2A 5C8XA 1KMCA 1S8NA 1WB5A 3CONA 1SVMA 4MINA 3U7HB 3BVPA 3AR4A 4GFDA 2FPGB 4DGSA 5FV4A 1LSJA 1D2GA 5IHXA 4JSRA 4EI7A 2MYTA 2CVZA 3ESYA 4LJ4A 2ONKA 1CKEA 3LBIA 3QLJA 5EIEA 5T4BA 2QLNA 1O5IA 3EMDA 4MYSA 5D3MB 3H2BA 1YKSA 4R2KA 1D3AA 3ZWAA 1UMCB 4PYMA 1WO8A 3UXHA 4CG0A 3TOSA 2H1WA 5C80A 5BNFA 3WK8A 1WZCA 1KC1A 1UJ2A 1EFLA 3QYJA 1T2EA 2AXPA 4DMCA 4U7FA 4UHFA 3PGA1 3RU2A 2IQIA 5EP1A 2VEDA 4BWYA 3WWCA 1DQRA 1SXIA 4JJFA 3VYVA 2ZOSA 1S2GA 3ZZ0A 2OCDA 2C04A 1F48A 4Q18A 5IJWA 2WUGA 3Q3EA 4C0KA 1GO2A 1JSRA 2HF2A 2QN6A 1KMMA 1MQ8B 2Y0BA 3CF2A 4UDYX 3CVWA 4A8PA 2Z3ZA 3D0OA 4NJMB 4X94A 4YAJA 3AVTA 1CR4A 1A76A 3E81A 4GMGA 5JE8A 3DD1A 2LBPA 3C1UA 1M66A 2GOYA 5KQGA 1XV5A 1H2WA 3C7CB 4G9GA 5A9SA 2JH3A 4I9UA 1Z63A 1PT8A 1QK4A 1RYMA 2QRVB 1KK2A 3HC7A 2OILA 3NANA 4JITA 4WXEA 5AK0A 5DV9A 1X1RA 1RLJA 2PL1A 3I23A 4JLBA 1LF5A 1O94D 4LEIA 5D84A 5B58C 2ZBVA 3DVQX 2BTOA 2I91A 2ZWVA 2C7VA 5JECA 4ZU6X 3C8ZA 1CZNA 1KU0A 4ETWA 3L6BA 4CGZA 3RAJA 1UDCA 4YJ3A 2YV1A 1L1FA 3BICA 1ELOA 3MQ2A 1KMNA 2P3LA 2XUOA 5DWDA 4F92B 2P65A 2EDCA 3D8RA 3OKPA 3ZJVA 3G68A 4F4IA 3CC8A 2B8JA 3JZIA 2QORA 4GRAA 3HEAA 4LNUA 4YV1A 1ZW6A 3DZKA 3PS9A 4P7GA 1C30B 1LPNA 2C57A 3SXUA 3UKOA 5HKKA 1Y1TA 3ZCPA 4FILA 1F8GA 3TOVA 4FYKA 4NK4A 2DQYA 4PX9A 5FCDA 3STXA 2HR1A 4TMXA 3P9SA 2AFVA 2G0AA 3IP3A 1XG5A 2CB9A 2DHQA 2ZT7A 1L5FA 4XZ3A 4M60A 1UF9A 5FTMA 3OX1A 4NQZA 2ODPA 4HB4A 3N86A 4P38A 3K6JA 1SXPA 4F85A 1UBKS 4CUKA 1GP2A 1GTRA 2JA2A 1GPUA 2A9OA 3KTDA 4JLSA 3NKVA 4Q9JA 3IDOA 3GYBA 4P36A 4F56A 3TMAA 1KMHA 3M2TA 4ER5A 1JSCA 2A58A 2V5AA 3K9QO 2J9ZB 3QX8A 3THXB 5EKDA 4R6XA 5IM4F 5LQKA 3L0ZA 4J0HA 3VH4A 1KZ6A 4UTRA 4BVKA 5CJ2A 4PV7A 4JBWA 1W581 1VRCA 4M9UA 3HB0A 1ZM4A 3LXRA 5EHIA 3PQ6A 4KMMA 3GRCA 5CIQA 3F6BX 2H5JA 3KJNA 4OJMX 4RD4A 1FXWA 4YJHB 4P54A 1H6AA 3RYIA 1I7LA 3IP7A 4UEJA 5EZ6B 5IARA 1E2KA 1TUBA 4EJSA 4J0FA 4TUYA 2JGKA 2Z5LA 3G0OA 5K3DA 1DI0A 3RG2A 5FI5A 3THOA 4J7XA 3EVTA 1MO4A 4Q1FA 2XVAA 3MUEA 4S1OA 1JJ7A 4X7PA 5J5AA 2NMVA 2W8BB 4QPDA 5KX5F 4FYYA 3ASVA 3PT9A 2VA8A 3IUPA 5GONA 2ISCA 3UJBA 2AE2A 1EKXA 3MPOA 3NEAA 4R2JA 5L53A 5IT0A 2NYVA 2GHIA 4XEUA 4BJ3A 2XF8A 3A4LA 3NHWA 1YULA 3MEQA 3CX4A 4FMPA 2IS4A 5BUCA 1AKNA 4U3JB 4E0BA 3ZE6A 4QTZA 3KR9A 4ZRDA 3V7FA 2YYAA 1ABBA 3RYFB 2OZPA 4OBWA 4K9RA 4MWBA 1QO0A 4OYRA 1VLZA 3IXQA 4IGIA 5AVXA 1O57A 3G7NA 5CJJA 3JQRA 3EAQA 4H6VA 1W44A 1P2DA 2HWWA 4GOLD 4WXHA 5AW5A 2O1SA 4O4HB 4BLVA 4PFSA 3WQBA 3G9TA 2EZUA 2O2IA 4OSPA 4DV7B 3IOEA 1UFRA 4QODA 4HDSA 1W29A 3ET5A 3J81A 3CLTD 4GH5A 3U37A 3HJAA 3GA0A 2NU9B 2XTJA 1P3Y1 2DBRA 1AMOA 2JIOA 1GNTA 4DCMA 4G8DA 3MB5A 1TT7A 2P0AA 4UHEA 1WHSA 1PV4A 3COYA 2EVWX 3PFHA 3UN1A 4AKTA 3ZDRA 3VKVA 1GPBA 4KXYA 1OASA 4GXNA 2HTFA 2I1VB 4WZAE 3TWOA 2HLNA 5DPMA 5LWHA 1VL8A 2YZMA 4MVJH 3TUJC 3WLSA 4K6GA 5IJ9A 1JQBA 2J3IA 3IVMA 3EXEA 3KQMA 5D5QA 5EQJB 1WABA 4IDHA 3K9GA 4ETNA 3E70C 3P26A 4WKGA 1FPQA 5AXDA 3O2QB 1Z2EA 3PHHA 4YP7A 3DVSX 2ZVDA 3ZV6A 2GAFA 3ROFA 1OWLA 3F67A 4RAOA 1I1HA 5C5CA 4XTCS 4G4JA 4DR6B 4HYEA 1C3VA 2EHDA 1W85A 3DUWA 4FWIB 5HBRA 1ZMTA 2Y1LA 3FYDA 5NULA 4LGVA 1XNQB 4LZAA 4QDZA 3LUKA 1P2TA 4L0CA 3CUEF 3NB0A 3NJRA 3QE9Y 3E5HA 1ZESA 4OLJA 1K08A 5HWSA 4CMAA 4EO4A 1LA2A 5KWIA 4Q15A 2C0QA 3E3OA 4KC0A 4HVAA 1S89A 5JSZB 3M82A 4AO7A 4YFVA 2BF4A 2CL0X 2IHKA 2G88A 1Z4OA 4MVJF 1KSFX 1HDOA 1K6JA 5C5EA 5LIRA 2ZQ5A 5ERXA 5BNTA 5JQGF 1R5BA 2RD2A 1RE0A 2D0OB 2YWBA 3CH7A 3DTVA 1JSLA 3AFOA 4PCUA 4ZYZA 4J0EA 5EERA 1E63A 2PUHA 1VI5A 4LHZA 5JFOA 4TTAA 1ZH0A 1GTVA 1ISRA 3DC2A 2YC2C 1QBKC 1RJWA 2RG7A 3E5NA 4QXRA 4Y6PA 4D8XA 2BFEA 1G5PA 4OG2A 2HFJA 2PGAA 3CG4A 1OBFO 1CHNA 3DFIA 4Q01A 5JTUA 5IDYA 2EZ9A 4XGRA 4HZUA 4ZAXA 3UJ6A 1RHRA 3QF4A 3U81A 1IEQA 1WCXA 4QAQA 1XPRA 1K66A 3OPVA 3ZV7A 5CITA 2JS7A 1FZQA 3O9MA 1GDHA 3QU4A 4KX5A 1P1FA 4Q3EA 3KT0A 3Q41A 2Y76A 3F7MA 2W2XA 4MX8A 5B7NA 3V8QA 4FTWA 1CUAA 1GCIA 1X94A 2QJRA 3C6ZA 1VJGA 2IZ0A 4S2UA 3FHOA 4GLLA 4ML3A 1AK1A 4LQDA 4P0TA 2HI0A 1MT0A 4OMDA 2PN1A 1QCYA 3MWJA 1U8CB 2XVZA 4OK3A 2GBLC 1MKYA 1OA0A 4Z7NB 3V80A 5LC1A 4YONB 5C3UA 3EC1A 1WDMA 1YA4A 2Z2IA 2YHIB 2JLCA 1P7WA 2MSKA 4MLZA 2DPXA 2H1HA 2QVBA 2WAAA 3SN6A 3TX2A 2Q1TA 4QFMA 1G59A 3BF7A 1XFDA 3AHJA 4B3FX 3QYFA 1O9HA 3SHQA 5JNSA 4PS1A 2H2AA 3A7EA 2GO1A 5JH7B 1LB1B 4KGVA 2QE7A 3K2EA 4XB6B 3SQOA 4G0VA 3MQ4A 3DT9A 1KF0A 4UUNA 1IPFA 1OXXK 1XE3A 1QF6A 2YVQA 4BQNA 3U0BA 2QEQA 1DBWA 3FETA 1YE5A 5AKEA 1TDJA 4PFQA 2E4UA 4D6PA 8LDHA 4J7CA 1AQYA 1CQIA 2O57A 1OH5A 2OLEA 4HMOA 2BDTA 4Y1RB 1OLXB 4R40A 5LZ2A 3TQQA 3AI1A 3G2JA 1NGSA 3A1VA 1GKLA 3OJCA 4ZVSA 2Q5QA 5E38A 1GRCA 2O0MA 2O2YA 3BFKA 3K8YA 5HYVA 3EPJA 1E5LA 1L4LA 3BB3A 3PXCX 3UF0A 4ZAFA 5IU6A 4OD0A 5EZSA 4YCJA 4D9IA 4N3GA 3KO8A 4DAEA 1A50B 1V8DA 3BE6A 4P3KA 1T24A 6ABPA 5ECGC 2ZIEA 1XMIA 4MV9A 4UPDA 2AZMA 1R3DA 2X5NA 2Q3HA 2X4GA 2C42A 4QNNA 5FD8A 4BKRA 5EJ6A 4ZREA 3LOPA 3TNYA 2IHBA 4UFOA 5BW5A 3D8TA 1SBHA 1FP7A 4YV2A 1F14A 4RLFA 3ABIA 1U9ZA 1NP7A 3UYLA 5EKTA 3GDWA 1OY1A 2ID8A 2CLKB 2QTVB 3B6KA 5BQ5A 3KYBA 2L17A 2NM0A 1P1CA 4L0DA 4WA7A 2Q7XA 4B2LA 4G1EB 1R2QA 3NONA 1WAMA 1ODKA 2Q9UA 3QPCA 1YC5A 1ZC3A 5BWMA 1M34B 5K4AA 3DFKA 4GPEA 4CT5A 5CCEA 3GP8A 3LJKA 1TEVA 1NR5A 2PZBA 4HQFA 4NCJA 4MZDA 3PNLA 3I0ZA 3IMFA 4DDVA 4RGBA 1TX4B 1NBAA 1FP4B 3DUFA 2PU7A 4Q9IA 1NYTA 1QDLB 4XSVA 5DFAA 4AROA 2BTQB 1F20A 5BQFA 2NV6A 3HG7A 1Z5VA 3BEDA 1TIBA 3A36A 4LJ7A 4N7JA 4N9WA 2RHWA 3I6IA 4RDHA 3VOSA 3BKWA 3GPCA 3GLGA 4JXZA 2CVQA 4AUKA 4R16A 2ONYA 4N3NA 4J0IA 4MMXB 1N0VC 3LKZA 4NMXB 4YMGA 1PJQA 2ZSKA 4D4KA 4H0NA 1KYWA 1AXGA 2QN8A 4WKNA 3RJTA 1NW6A 2IOQA 2FH5B 1GFZA 1V1RB 5A02A 4LGYA 4YJDA 2X8WA 4K9OA 4MJXA 4GQIA 4QJ4A 2PLFA 5I9MA 4KAJA 1RYZA 3QXCA 2C4HA 4FJ2A 4J3JA 4CFSA 1U7PA 3OFKA 5LZ8A 4UC0A 1VJCA 4W7IA 1HE5A 3SD7A 5EFOA 4ER0A 4OQPA 2ZJOA 4QVKA 2R48A 3R0JA 3TTWA 3NALA 2DH6A 2LGJA 3TJZA 3EA0A 2NU7B 5AI4A 3ER6A 1N25A 3DMPA 4O4JA 3TPCA 1P74A 5AHKA 2IPNA 3ZE0B 4IYRA 2EZTA 4ABYA 2IP2A 3OU6A 5E9QA 4DCNA 1G55A 3ANLA 3CEHA 1AXRA 3AFIA 3WRXA 5CTJA 2A59A 4FR0A 3LNTA 1T6NA 5T57A 5T5QA 3H19A 1QE0A 3QPAA 2H48A 1T9AA 3NP7A 4B3RB 2EKLA 2IYRA 1IM8A 4MUAA 3GPLA 1W36C 2Q8NA 2JA1A 4DLYA 2HBYA 3AZPA 1HDXA 3S4YA 2G1AA 3LWZA 3NM5A 4NZYA 4JXXA 4PVDA 3HPRA 3K9HA 5TMBA 2OENG 3RHZA 3HHPA 1N9GA 1UK9A 2FMFA 4HPWA 2CFSA 2DKOA 4Y6QA 3K0SA 4Z9YA 2I3DA 2DUNA 2IGBA 3IT0A 3KEMA 1VHLA 2AJ8A 5I3CA 3GLSA 4WMLA 2O0KA 2G8NA 4E5YA 4O5OA 3OQNA 2DE0X 3LQYA 4G3XA 4QUIA 4IIVA 2A8YA 3WYCA 2XUFA 4BHTA 2ZUVA 1RLTA 2H5EA 2BIFA 4MVJI 2D7DA 2VP5A 4QPZA 2JI8A 3ECCA 3OF5A 4I81A 3F90A 4IDQA 4RKFA 4Q7MB 3V33A 3ND6A 4BO8A 2AG8A 1A5BB 3F8WA 1VCIA 4MUIA 4OXRA 4PBSA 3LBHA 3DZBA 5ILQA 3O95A 1T1IA 4OK6A 1RBQA 2Z8YA 3NDJA 4LOAA 3WLTA 4I8XA 2ECOA 4YMUA 2B2NA 2N46A 3EVBA 1KNXA 3TSZA 4TWRA 4UOZA 2Z08A 3OOSA 2HPAA 1FZTA 1DAHA 1EVIA 4N7RA 1VKZA 3U9SA 3ESRA 4XIJA 2BH2A 4J3FA 1U5BA 2MYUA 4GI7A 1HETA 1XA3A 3LVFO 4HQNA 3ECSA 3JQBA 4IWNA 3KZOA 4JVSB 2O7SA 5HA5A 2OY0A 5IK2D 3B3JA 4PX5A 3WJAA 1U8EA 2IYNA 3R9XA 1IM5A 1T2UA 5FP0A 4NCNA 3A31A 2Q21A 3L4SO 1K8XB 3NIWA 4JB8A 4C04A 2ZRPA 1KSHA 4CG2A 2X4LA 2GWRA 2H00A 3EDQA 1QQTA 1UOPA 2RIPA 4M0MA 3N7TA 3O8LA 3UMBA 5M34A 2PUEA 4XCQA 1G1AA 4MMZB 3B36A 4FI3F 4DMMA 4X1KB 3RHSA 2YTZA 1FJXA 2OO7A 1W96A 4IM7A 4DDTA 2Z30A 3WLHA 3E18A 1YJAA 2QL5A 1GY8A 3EW9A 2Z6VA 2A9VA 4GPIB 4W6ZA 4QT4A 3NVDA 1WD5A 2JVKA 4IDAA 3LC2O 2EEZA 5AVWA 1GQYA 5A4AA 4ND2A 4AZ0A 5D7NA 2YMQA 4U0KA 3S1AB 1EZ4A 3UWKA 1Q3HA 1BN7A 4XD7A 3ZS9A 4BYMA 2G36A 2C07A 5JVDA 3TZKA 3P9KA 4JENA 2GBCA 2QW0X 3A6PC 1P4GA 4EG8A 1DCTA 2WU8A 3CGGA 3I9OA 3W2IA 4PTZA 4EUHA 1A9YA 1ODTC 3F9CA 4ARVA 5ICCA 2ZE8A 3KT3A 5IBCA 1RXWA 4NXNB 3DP7A 1FL9A 1G18A 1P33A 4LDRA 1ZSYA 5FBZA 3TSAA 3KOUA 1P17A 4N39A 3HB9A 5KQLA 4OREX 1KI8A 1XWIA 5B7PA 2OWDA 3SAJA 4YAUA 1WW2A 2PZMA 1ILEA 1J56A 1UKZA 3GA5A 4JT4A 2FDCA 1P0MA 2FXVA 4BNDB 4TTRA 4L5IA 2YV2A 4RV4A 2GNOA 5K3OA 2VPIA 5TJHA 1ZWKA 3PXAA 1N1DA 1XZDA 2JLSA 2AG5A 2FY8A 4FGJA 5T8KA 4AAYA 4AJ4A 3CNLA 3BX1A 4KW7A 4GC9A 4RGVA 3AOEA 1V1MB 3OG9A 1HRKA 1Q7EA 4CLHA 2G4CA 3RIHA 2QRNA 5HTOA 4NV1A 1WZIA 3RS2A 3WYFA 2VWGA 2GM4A 4RFLA 3H2IA 1XVUA 2NPOA 4DW8A 2P1ZA 4PN7A 4QYMA 1Y37A 2VQSA 4FCCA 3NP9A 2A5GA 3EXFA 2FWJA 3GP3A 4F9TA 1KYQA 3T5DA 3K6KA 1R4MB 3OQHA 4NYIR 4KI7A 1CVLA 1XZJA 2CK3D 3HVRA 1IIBA 3OJ0A 1WVGA 1BVHA 4QRDA 5KDDA 2VQ3A 4GLOA 1E9AA 1T8SA 2VC2B 4L5AA 4CQMB 2QL6A 1G5RA 2PSJA 3D0KA 4R31A 4G24A 1C1XB 3BSSA 4CCAA 4R1MA 1Z16A 2EG5A 3ROZA 4EG7A 1JVBA 1QSGA 4NYMQ 3GJTA 2BPOA 3O8RA 4LF4B 3VYTB 1WDTA 4XVHA 5CDGA 2PO7A 1TGYA 3W3AD 2XHEA 4IOMA 4F9FA 1JPJA 4K2AA 3DR5A 3A4MA 1GZHB 4RK0A 2F3TA 1G6HA 1NBMA 1FMCA 4ENRA 3NDPA 2DJ5A 3ZU5A 1RKBA 1DXYA 4IHJA 1CT9A 4H7IA 3GPDG 4O4IB 4WADA 3VR0A 2DBYA 4TS3A 2EL7A 2V7UA 3AETA 4IMJB 4MB2A 5KNDD 1CXZA 1LDNA 4TQ9A 4A2CA 1JDPA 1DC3A 1L5HA 4R3UC