1IY8A

Crystal structure of levodione reductase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
258
structure length
258
Chain Sequence
RFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAPDAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIEGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPENPRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEVODIONE REDUCTASE
publication title The Crystal Structure and Stereospecificity of Levodione Reductase from Corynebacterium aquaticum M-13
pubmed doi rcsb
source organism Leifsonia aquatica
molecule tags Oxidoreductase
total genus 101
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1iy8A00
4LCJA 1XCBA 5G0WA 2C2XA 2G5CA 4YB8A 3CE6A 3W4IA 4Q3CA 3OIFA 3S2EA 2X58A 3I9OA 4L0QA 3AUTA 1FXSA 3DMTC 4TRRA 2WD8A 4BKUA 4YQYA 2TMDA 3GEMA 1E6UA 4UEKA 1XR3A 2RH8A 1T2DA 1FMCA 2DVMA 3GDFA 4BKOA 3W4KA 3DZIA 3CZRA 4F46A 4YA6A 1PGOA 1XELA 4JGBA 1EUCA 3S2FA 1ZEJA 3DBRA 2Z5LA 4XD2A 2EXXA 3NTRA 2B36A 2C54A 2PY6A 1JKJA 1HSZA 3WGYA 4DLLA 4OOEA 5A02A 3I52A 4XYBA 3ANNA 3WX0A 4JBHA 1BXGA 1WLYA 2X5KO 4HP8A 2E82A 5T5QA 3IP1A 3A9WA 3AI2A 4GKVA 4ZA2A 5LC1A 3T4EA 1NPYA 4RLHA 5C7IO 3I9LA 3CIFA 5T67A 1D1SA 2VZ0A 3VDRA 3IDSA 2P9CA 4GX0A 2YQ4A 3I5MA 5L3ZA 3I3OA 2Z95A 1DRWA 4CQMD 4CQLB 1DIHA 4R5MA 2POQX 1U7TA 1X14A 3DHYA 1VLLA 1YL6A 1XG5A 1EFKA 3KM0A 4Y8VA 3FD8A 3F47A 4WOKA 4GX1A 3OETA 3I4CA 2H1SA 3VH2A 1UP7A 1KVRA 5JLAA 3SBOA 1B15A 4E2YA 4OMUA 4D42A 3F46A 3EGOA 2O3UA 4JBIA 4ZRMA 1D8AA 3C7AA 3VOSA 4CL3A 4R9SA 4CMCA 4DL9A 1OAAA 1Y8RA 2DAPA 3L6DA 4BNJA 2X6TA 5A9SA 1SCUA 5TT1A 3GAFA 4F3YA 5CDGA 3S2GA 1CDOA 4HFRA 3ZU2A 1H5QA 5IZCA 1ZSYA 3P2YA 2DTXA 4RV9A 3ZZNA 3E5MA 4XEHA 2CZCA 3RFXA 3GHHA 3PTZA 1UXIA 5F5LA 1BW9B 3HZZA 1DO8A 4R9RA 2G0TA 2VWPA 3VDQA 1DIAA 3TOXA 2W90A 1FDWA 1BXZA 1T2AA 5GY7A 4CM4A 2DU8A 3WJ7A 4CM8A 3U4CA 4A03A 3QWIA 1VL6A 4IQ0A 3GG9A 1NWCA 3S55A 4BL5A 1FF9A 3GNSA 2C59A 3DZJA 1VSVA 3DZKA 1PJ4A 3OIGA 3GDOA 1HT0A 3GRPA 4RGBA 1XA0A 1P31A 2CFCA 4RCVA 4I08A 1E3WA 2WE7A 8ADHA 4U6QA 1J0XO 2VYVA 3DC2A 4XDZA 1T2CA 4PGFA 4XIYA 4EUHA 1P45A 4HNGA 4D45A 5DCUA 1GUFA 4DLAA 1PGJA 1UAYA 1ZK2A 1I8TA 1JVBA 2J5QA 1CF2O 3PDJA 3C24A 3QIVA 4NU5A 4XKJA 3NDJA 1JTVA 4U5QA 5BSGA 4FFNA 5GZ6A 2UV8A 2PGLA 4PLZA 4BB5A 1NVMB 5IFLA 3HNPA 4W4TA 1UP4A 2AE1A 4CUZA 2Y68A 3WGIA 2GF2A 4HFJA 4Q3DA 2X9GA 3C1OA 4NNJA 4CQMB 2Q4BA 2J6IA 3ZU5A 4N54A 3JQCA 3WXBA 3QWHA 2BRUA 4E3ZA 4JNKA 3G3EA 3LU1A 1BTOA 4A73A 5L51A 4PLCA 3OHSX 2FY8A 1TB4A 1C1XA 1A7AA 1HDRA 1P9LA 4OL9A 1NBOA 2VTDA 2AW5A 5JDIC 2AQHA 1U3VA 3PWSA 4IGEA 3L6EA 3M6IA 2BGLA 1DJQA 2H63A 4UULA 1PJSA 3TRIA 3RFTA 1DB3A 3H5AA 1XIVA 3KYBA 3NT2A 9LDBA 1XYGA 3ZV3A 1A27A 1NPDA 3JYQA 1P1KA 2VYNA 4YBZA 2E48A 2VNSA 2F1KA 1Q7GA 5EERA 5KKAA 3GQVA 2HMUA 3K9QO 3T7EA 5I9NA 1ZK1A 5EESA 2AE2A 4YEDA 3GFBA 1QG6A 5JAQA 5IZ4A 4I5GA 1IE3A 3K2BA 2PZKA 3G1TA 5L95A 5KIAA 3L0DA 4YXFA 2PD3A 1F06A 3EZLA 5L4LA 1VKOA 3PHHA 4NI5A 4FJ2A 1DJNA 3E9MA 1S6YA 2X86A 2P5UA 1M67A 3GPDG 5JO0A 1PZHA 2IZ1A 1E5QA 4CMKA 5IJZA 3IUPA 2HQ1A 3NDRA 4Q39A 3WGZA 1T4DA 5FF9A 1VE9A 1DBVO 1BDMA 4E5PA 4AJLA 4CR8A 2DC1A 5BSFA 5U9CA 4WCFC 2Y67A 1A9ZA 5F5NA 4J3FA 3I9NA 1LX6A 2Y1EA 4IM7A 5B37A 3BYZA 3I6QA 2VTEA 3L4BA 4GPD1 3VH4A 1U3WA 3C3XA 2UAGA 1YBVA 3MJEA 3TN7A 3ONEA 1GPJA 2VWHA 3KVOA 5U1PA 3ZN2A 3FCOA 4RPGA 5EPOA 1E6WA 1LBEA 4R01A 3WYBA 2JCYA 1B8VA 1P0FA 2GR9A 5B4VA 2YJZA 3AM3A 1SC6A 1C1DB 3KRTA 4PN3A 1YBMA 3Q9NA 5KCZA 2OZPA 2X0RA 2NVBA 1V0JA 1DDOA 1U7HA 4W9NA 1TLTA 3U49A 2EW8A 2QHXA 2HMTA 4RVGA 1ZW1A 2UUPA 3H3JA 3MJ4A 3RUHA 4JJGA 1H6DA 1VM6A 4E2ZA 2ZB8A 3KLMX 9LDTA 1PJBA 1F0YA 3O03A 3I9JA 4WJZA 2WEKA 1VSUA 3WGTA 3GPIA 4MP8A 3V1TC 1U5AA 3JQ9C 2LDXA 2X5JO 3ASUA 3ZWAA 4N18A 2B5VA 3QWFA 1D1TA 1I36A 2C82A 4I8XA 1H93A 1ZMTA 1TT5A 2W2LA 3P5SA 4G2NA 1EMDA 3CMCO 3X2EA 3I4FA 3K73O 4BO5A 1KIFA 2NTNA 1NFRA 2G1UA 3KTDA 3RD5A 3AFNA 5ILOA 3Q3CA 3D1LA 3JYOA 2OBYA 3OA2A 5BQFA 4G65A 4XQCA 3NDIA 1EVIA 3H9QA 4EUEA 3GMDA 4LN1A 2NU8A 1V6AA 3KLPX 4CLOA 3ZCXA 1OMOA 3AOGA 3R1IA 4XRRA 2PTGA 3NGLA 1EVJA 3C7DB 3F5QA 3O8QA 3NUGA 4QO7A 3VZRA 2B37A 3H5RA 3O38A 4NQZA 3RC2A 3OMLA 2VN8A 1RPNA 4XX0A 1JAYA 2PZMA 3R3SA 4RDHA 3MTJA 2YY7A 4Z0TA 1HEUA 4H15A 3VPSA 5IXSA 4RPJA 4PLYA 1P3DA 3DWFA 2O3RA 1R16A 2Q1WA 3GVHA 1E7MA 1NVGA 3KYDB 4PLWA 4CV3A 4YJGB 1D3AA 1YE3A 3PEFA 4WKGA 3VH1A 4IDBA 2C20A 2FR0A 3DBRB 4HUJA 4UEOA 4DMLA 1R0KA 4NU6A 1MLDA 4JX8A 3JYLA 5AXDA 3RC7A 1LRJA 3A14A 1X15A 4YQZA 4KUHA 4GLLA 2EJWA 1F8FA 1A72A 3ZH2A 3EK2A 1DIBA 1GZ3A 1LXCA 3DTYA 3PVZA 4OJNA 5FI3A 5G0UA 3WQSB 3ZWYA 2C2YA 4R1TA 3I83A 2O23A 1UZNA 4TQGA 1P1JA 4BQRA 2Q49A 4OHUA 4RPHA 5T8KA 5C5IA 5CHEA 3INTA 2J3KA 4PG7A 1KS9A 1N7GA 4CMEC 1UZMA 3L6OO 2CF5A 1NFQA 4MVJH 3TZKA 5DF1A 1LSOA 2ET6A 3KBOA 4G5HA 1MP0A 3EC7A 4JP2A 5EIOA 2JJYA 2C29D 1TXGA 4FS3A 2BF7A 1HDGO 4FFRA 1DRUA 4IUYA 4B4WA 4YRBA 2PD4A 1BG6A 3E9NA 3VHRA 2Y1OA 2ZTLA 5TGDA 4ALMA 4Y98A 5KJCA 1SOVA 2IXAA 5TJ9A 3ZGYA 4M49A 2JFFA 3VZQA 3E03A 2OP0A 3U0BA 3BTVA 3GH3A 3HE3A 2PKRA 1HF3A 1ML3A 3BHMA 3WGHA 1YRLA 3NT5A 3HSKA 5ES3A 3VKUA 4YT2A 1ZBQA 4B4VA 4H3VA 1CETA 5JCJA 2O3SA 1EK5A 3VKVA 3WIDA 2QYTA 3F5SA 1X0XA 4AJKA 2CVQA 5CDUA 2BLLA 4TRMA 1WP4A 5KWEA 1NHGA 1HKUA 4FJ0A 3ICCA 3BMQB 3RBVA 2W4QA 4F45A 1C0LA 3OJFA 4YAIA 1M76A 2AMFA 2Q3EA 3G49A 1GAEO 3A06A 4FIZA 3SXPA 5KJEA 1DFIA 1OZAA 4GBJA 4XQ9A 2EW2A 4XYMA 3WFIA 1E3WB 2VCYA 3JQ8B 3Q2KA 1BVRA 2OUIA 4CODB 4E5KA 3Q6IA 3L07A 3CXRA 4RVHA 1FJHA 3HN2A 3ZV6A 4BNUA 4RF3A 2FPGA 4NPCA 4P4LA 5GZ1A 1WZEA 1SZJG 4NFYA 3JQBC 2B35A 1HDCA 1PWXA 3BA1A 2DBRA 4J1TA 3FRJA 4WLEA 4CV0A 2NQ8A 1XSEA 3LDHA 3S1LA 4JQCA 4E4YA 3L9WA 2BFMA 1Z7EA 5CEFA 2I6TA 3OECA 1A4UA 3D5QA 3LF2A 4FCCA 4WE3A 4BO1A 5C37A 2Y0EA 1I2ZA 2E49A 1KOLA 5DNAA 4ZHSA 1J5PA 4R69A 2FPPA 1HDZA 4AFNA 1YDWA 4TKLA 2PLAA 2JCXA 3LF1A 3O4RA 4WCDA 5TS3A 3KSZO 2OXIA 1K89A 1F14A 4I5EA 1MFPA 2JL1A 3H6KA 4UEJA 4NR0A 4IS3A 1QV6A 4NK4A 2P9GA 3WGGA 3FPLA 3GAZA 5THQA 2W2KA 1EDZA 1VPDA 4N7RA 4E2WA 5CP8A 2D8AA 2ZB4A 5G4KA 4OSOA 4EJ0A 4GX5A 1XQ6A 4A5OA 5J23A 4XGKA 3ZU4A 3BMOA 2DBZA 5COAA 2OHXA 4LRTB 1N7HA 5ILGA 1E3SA 4BNIA 4KWHA 1MG5A 4RL6A 5DCWA 5TJHA 4GMFA 4IJVA 1JWBB 3BTUA 4FFMA 3TSCA 4GWKA 2CF6A 5FYDA 2JKVA 1QYDA 4K6CA 2YV2A 1FDVA 5EINA 4PIVA 5ENVA 4X54A 5JE8A 2W2LD 5I7VA 2YW9A 5LCXA 1CQIA 1MB4A 2P4QA 4J90A 5ER6A 1RYEA 3PYXA 3VPXA 4UVHA 1EDOA 3KEQA 1XU9A 3RCBA 1YXMA 2DQ4A 3DFUA 2GNAA 4Z3DA 1P1FA 3PQDA 5B4UA 4WLNA 2D5CA 3W6UA 1MFZA 2VOEA 3WQRA 2X4GA 4FFPA 4NBVA 5FEUA 1JVSA 4CMHA 3AK4A 2DPHA 3ST7A 5A06A 3U5TA 1LQTA 5DT9A 5L45A 1UR5A 3KSDO 2VUUA 4M86A 1KVQA 2WM3A 4LMPA 4PVCA 2ZJ0A 4KTVE 3PHIA 4PLTA 4AJEA 2Y99A 1MXHA 2R2GA 1U28A 1I24A 1WAMA 2A92A 1YGYA 2BFPA 4WGGA 4J1QA 1PJCA 4YJHB 2RIRA 1DPGA 2WE8A 4BMSA 2Y1FA 2J3IA 4BS9A 1HWYA 3NV9A 4JCOA 3QV1A 3PYMA 4FOOA 2VNAA 4M8SA 2HK9A 4RPLA 1DLIA 2P9EA 4AJ2A 2UUOA 2OBNA 3AI3A 1VL8A 1YL7A 4BNGA 3PJFA 1GDHA 5AVOA 4AJNA 3H65A 1JLLA 3PJEA 4ZQFA 4IDFA 1NYTA 4ESOA 1QV7A 2Q45A 3DOCA 3ROMA 7ADHA 1GCOA 3DBHA 4BMNA 5A05A 4XR9A 1CWUA 1GEGA 1QYXA 1M2WA 4B8ZA 1CEQA 3PGXA 2YDYA 3GN1A 1RJWA 3K96A 1SAYA 3DTTA 4J91A 3U4IA 3W8FA 2NU6A 1FDTA 2Z1MA 1BDBA 2ZTMA 1V3UA 4CL8A 1GU7A 1QORA 4QSMA 2P68A 2HO5A 4BO2A 2NVUB 3MTGA 3WMWA 1HETA 1I33A 2ZYGA 3BHJA 3F6YA 3QE3A 2AEFA 2V6GA 4ZGWA 3AUSA 3LZ6A 3ONFA 1DLJA 1ZVMA 3OIDA 4KUEA 3DMTA 2BMAA 4R5HA 4R1NA 4P38A 6ADHA 4MVJA 5JYDA 3IJRA 1ZXBA 3A4VA 1E7RA 3G1UA 1ZK4A 3DBLA 4CMIB 1SPXA 2CNBA 4Q9NA 4CM9D 5ER9A 4IINA 1NP3A 4E5NA 1V9LA 3W8DA 5ENDA 4RJTA 3HG7A 1EE2A 4MP6A 4FPXA 4N5LA 5FI5A 1SBYA 4W99A 4ONEA 4J4HA 3ON5A 3ZWCA 5EQFA 3ZWPA 2NACA 4WASA 5JW6A 3ZV5A 1ZSNA 2GGSA 3GZNB 1PZGA 1P1HA 3RUDA 4KUGA 4NIMA 4URFA 1O6ZA 5JAIA 1K6XA 3WSWA 5JCJD 3TZCA 1J49A 1GZ6A 1R12A 3JQGA 3ZNQA 5A03A 2I3GA 2HDHA 4L76A 1I32A 4Q3BA 2WSBA 4TRNA 1M75A 2VUTA 4IBOA 3QVOA 1LRKA 1L7DA 1N9GB 1ZKMA 4JBGA 4E21A 2O4UX 5L7YA 3TFOA 2ZIZA 3OQ1A 4RF5A 5BR7A 3WWZA 3F1KA 2V6FA 1Y8QB 5DP2A 3K5PA 4W7IA 5A9TA 4J1SA 4TKMA 2D5AA 1B16A 5JDCC 1KVTA 3DHNA 1PTJA 2D0IA 2ZTUA 3LYLA 1B0AA 2WD7B 4R54A 1QYCA 2PK3A 3E6AA 2J3HA 4DPMA 4FGWA 2DPGA 3GUYA 3RUCA 3TWOA 2RAFA 4CM1A 2X8LA 4DMMA 5CDTA 5LDHA 4BO6A 1HZJA 1HE3A 3JD3A 3WR5A 5I9LA 4CMBA 3UHAA 1U1IA 1LDGA 3BZUA 4PLGA 1ISFA 3ETGA 3PHLA 4RDIA 4C4OA 1GUYA 1FDUA 3P2OA 3FNHA 3FBGA 3WG9A 3W8EA 2RBEA 1NQAO 3OFSA 2GZ2A 2R00C 3SVTA 2VRCD 4GAEA 2RHCA 2JD1A 3DXFA 1U9JA 2DFVA 3LVFO 1NM5A 3JQ7B 1BVUA 1ENYA 4K28A 1XQ1A 5JPIA 3WNVA 3EW7A 1E1MA 3QA9A 2IZZA 4BO8A 4WLOA 2YV3A 3WTCA 3H2SA 2HK8A 4B3IA 4IXTA 3A28A 3HFGA 2P91A 4UVEA 2WYWA 4I1IA 4WOJA 1PJLA 1R4NA 5ITVA 4OXKA 2H6EA 3UCEA 4EBFA 3C8MA 3FPCA 4DREA 2ZQYA 2DBVO 2IZ0A 3PHJA 2EKPA 1K2WA 1M66A 3EVNA 3KV3O 4CUJA 1N92A 4MIOA 4J2OA 4NMHA 4OO3A 4CUKA 4EGFA 1P33A 1YH3A 1UDAA 2DTDA 1ZUD1 3PWZA 2FRDA 3EAGA 4W6ZA 3ITDA 2AQKA 1GZ4A 4GL4A 4CLRA 1QLJA 4E6PA 3IUSA 4XB1A 4DYVA 1JQBA 3IAHA 2C0CA 1W4ZA 3HADA 1X7DA 3GT0A 3V5NA 3KO8A 1GR0A 4BNYA 1YJQA 4ILKA 2UDPA 5TT0A 4NH4A 4YT8A 1ISJA 4RVFA 4WNIA 1DIRA 1R4MA 4WNCA 2QW8A 3T7CA 3U09A 4KWIA 1QR6A 1Z45A 4YT5A 4S3MA 4EI2A 3UCFA 4MJLA 4MIEA 3PLRA 4YJFB 4AVYA 1A7KA 3D7LA 1BSVA 4CM3A 5JDIA 4PLVA 1YL5A 1V3VA 4MO2A 2GLXA 2FR1A 1K5HA 4D44A 2JFGA 5I8ZA 3D3WA 4OKIA 1Y9EA 3ZWNA 3CKYA 3PK0A 2HAEA 2V6BA 4EZBA 2YHIA 4DBZA 1VJ0A 5BT9A 5K6AC 2HU2A 4I5FA 4IY1A 1PU2A 4M1QA 3KYCB 4TRJA 3PXXA 1WDKA 2CMDA 5F1KA 3JQAA 1LLUA 1YOVA 1DC6A 1ARZA 1VI2A 2AEJA 2QRLA 1Y7TA 2E4AA 3B1FA 4J9UE 4TZTA 3WS7A 3GLQA 5JBIA 4D0RA 2WJPA 3SLGA 5EQDA 1KVUA 1ZZEA 3LSYA 2OFPA 3JD1A 2ZJ1A 3UCXA 1LNQA 3UOGA 2Y0CA 4ZJUA 5B1YA 4L4RA 2FOIA 3PHGA 3BMNB 2QZZA 2VOJA 2Z1NA 3KOUA 4OXNA 4LCEA 1E7WA 1LLQA 4J2HA 4YR9A 1JKFA 3E8XA 4ZQGA 2VT3A 4WCFA 2EJVA 3LC2O 4J0FA 3ULKA 1E7YA 4K6FA 3GDGA 4ITUA 2UVDA 4PFJA 4UUMA 1W6UA 5GMOA 3IQDB 4YYZA 1E7QA 2DKNA 3AJRA 2CDCA 4RVUA 1RWBA 3GEDA 4P8RA 4MVJE 2VWGA 3AU9A 4A7PA 1R66A 2Q2WA 4QFCA 3E1KA 3HWRA 2AA3A 3KB6A 4YAEA 2HK7A 4R16A 1HYGA 1KEPA 2BGKA 5KVVA 3OA0A 3ZNNA 4U7WA 1LC3A 2NM0A 4LISA 1E6EA 1HYEA 4OM8A 1Y9AA 5T6BA 1G0OA 2VZ9A 5HS4A 1PJQA 1U8XX 1GCUA 3H9JA 1T1RA 4MVJF 3Q9UA 1GQ2A 1PS9A 1XEAA 1HLPA 3CEAA 5K0ZA 3JQDA 3IJPA 3CPSA 2Y1GA 5BSEA 2IYPA 1O95A 1VC2A 4FDAA 3FWNA 5TF4A 5COBA 1E5LA 3V8BA 3WICA 3TZ6A 4E12A 3ZWMA 1A4IA 5L40A 5I7FA 1EZ4A 3VZSA 2JAPA 5KVSA 2VQ3A 5IDYA 3SJ7A 4DUPA 1YB5A 4IDEA 4FBGA 1NQOA 1YB1A 1YB4A 1NQTA 3S8MA 1D7OA 3RBXA 3RUFA 4W9NC 1E92A 2F00A 3JQEA 2PH5A 5FFFA 4F6CA 2VRBA 2EV9A 1I0ZA 2QZ9A 1PQPA 3D4NA 1K3TA 4MP3A 2C7VA 3BMCA 1IPEA 1LA2A 2D2IA 4IDAA 4OGWA 3WDSA 4ZVVA 1EEHA 4GGPA 1DFGA 1IB6A 1T4BA 4TSKA 3JTMA 2ZQZA 1H9BA 4GI2A 4BGEA 2ZKLA 1O8CA 4U8GA 1GYPA 2ILTA 3RC9A 5DZSA 5HTOA 3IP3A 3OF2A 4NFSA 4WK6A 4A0SA 4FGSA 1WMAA 2NQTA 4A26A 5B4TA 5EN4A 2Q4EA 3QJ5A 4RF2A 2PFGA 1X13A 3KXDA 1NXQA 2WMDA 4R3NA 4CMAA 2PNFA 3MOGA 4MKRA 2A9FA 3Q11A 3I23A 3JYPA 1DIGA 4JJFA 3KHUA 4GH5A 4DQXA 2I67A 2JHGA 1ZK3A 2IEDA 1HE5A 5A5FA 2Q1SA 2H5LA 4WEOA 2PGJA 3JV7A 4Z0PA 2W8ZA 1GTMA 1XU7A 2IE0A 3VZPA 5A1TA 3UF0A 4JROA 1I3NA 1MGOA 1PGNA 2NWQA 4H16A 5DN9A 8LDHA 3UW3A 5HRUA 3IKTA 3EZYA 2NLOA 4RZIA 2GYYA 1X0VA 2VYVD 4GVLA 3ZHZA 4KMSA 1A71A 3P19A 3ZWBA 4B7CA 4CQLA 3HHPA 2J3JA 1GQQA 1H94A 1I30A 3I9KA 4DYDA 1BXGB 4YJDA 4LVUA 2YFHA 1GQYA 4IPTA 3M2TA 5DBGA 5G4LA 4BO7A 2PKQP 3D4OA 1ISMA 4O63O 3OH8A 5EJ2A 1PS0A 2YV1A 3V1YA 1EK6A 2XXJA 3CTMA 4ZICA 2Y66A 3PLNA 3H4VA 3IC5A 5HA5A 4A2CA 5C3MA 4PRKA 1YVEI 3AFMA 4O0LA 3H5NA 1HDYA 2A35A 3C1AA 2O2YA 1U4OA 3ETEA 1C0IA 4CMEA 1XKQA 4L9RA 4ROSA 5HBRA 3BIOA 1U4SA 1ISHA 1E0DA 1NR1A 2GD1O 3ENNA 5A3VA 3WNQA 5TIIA 2GRAA 2HMSA 2YZ7A 1PJ3A 2B4TO 3QW2A 3RU9A 5JY6A 1W8DA 5JNLA 4OSPA 2VT2A 1ZNQO 4ZQHA 1BW9A 1HXHA 3NTOA 5F1PA 3U4HA 3KEOA 2J5KA 5KVQA 2X0IA 5TQVA 1HE2A 1TT7A 2VHZA 4O59O 3ZWVA 3HFSA 1O0SA 1Y8RB 2B69A 2FZEA 2D4AA 2YFQA 4PG5A 1DHTA 5A9SB 1IHXA 2JD0A 3AW9A 1NPTO 5TC4A 3RIHA 2IRWA 2VYND 4ZRNA 1IUKA 3JQFC 2EGHA 1HRDA 4L4SA 5AQ1A 3OICA 1MV8A 4EEXA 1W0CA 1V3TA 3V2UA 1IHYA 1BWSA 1Y1PA 1NQ5A 4J4TA 2UYYA 3H9UA 4G81A 5K9ZA 3ASVA 1Q0LA 3F3SA 2EIHA 1UAGA 2X9NA 3OJEA 4IXWA 1PJTA 3DL2A 3MWEB 3RWBA 4CM4B 4ALLA 5H81A 1M6HA 4CM8B 1RM5A 2EERA 3TJRA 5KTKA 3PRJA 1KY5A 4WECA 3H9GA 4QUKA 5IDQA 1ZJYA 3OQBA 3MJSA 4BNVA 1GYQA 3GFGA 2VHYA 5IAAA 1E3IA 4PG6A 5IDXA 1UDBA 2EGGA 1RYDA 3C1TA 2HLPA 1O89A 2GUGA 1NWHA 5JAMA 1R4NB 2PKQO 3OJ0A 3FNFA 4WEQA 4ALKA 5L53A 3GF4A 3CMMA 3UGKA 2NU9A 4ID9A 2EG9A 4DPKA 4IS2A 3PWKA 4CQMA 1ZH8A 4NJMA 3E82A 5JFOA 5AXAA 1VJTA 3LT2A 2FN7A 3JQBA 1BMDA 5H83A 4J49A 2B0JA 4KZPA 4BO0A 4BO4A 1R6DA 1ADGA 4IIVA 3F4LA 3AU8A 1LQUA 4NHEA 5CEJA 2CD9A 5TNXA 5G0SA 1XWFA 3DHEA 1SO8A 2J5RA 4DGSA 4PCVA 4XRGA 2OOSA 3WYEA 1EBFA 4JK3A 1UXHA 1PGQA 1IL0A 1RM4A 4KP7A 3QP9A 1DSSG 2GZ3A 5TRTA 2XF8A 4ALJA 2IYOA 4NZ9A 1ZEMA 1PQUA 1GV0A 4F6LA 3FF4A 3CZMA 1E7SA 2ZTVA 4UVDA 1G0NA 5KKCA 1C1XB 4QT0A 2CDAA 5GZ3A 2Y1DA 1FDSA 3T4XA 3WB9A 3OEWA 4UVGA 2I5PO 4YRAA 4PZCA 3PZBA 2HJRA 1U3UA 1RKXA 3GNTA 4XZ3A 1UP6A 1LDYA 1OI7A 2FSVA 2QIOA 3E48A 6LDHA 1LJ8A 4EYEA 4CM7A 1U5CA 3K2EA 3A1NA 2NUAA 3FWZA 3GVIA 2P4HX 2YHIB 4DC1A 4FN4A 4XQGA 4IZHA 4XJSA 4BNMA 3H2ZA 4EW6A 1JDJA 1A9YA 3GN2A 3ZHBA 4CLXA 4E30A 4R3WA 2V65A 2Y0DA 4NG5A 3SX2A 4XGIA 3FR8A 2Q2VA 1P74A 3FHLA 4NFHA 3RKUA 1IOLA 1X7HA 1TI7A 3G79A 4LK3A 1B7GO 1GY8A 2SCUA 3GVXA 4HFMA 4IGFA 4IMRA 3JD4A 2ZK7A 4FC7A 2Q50A 5CG2A 4BKQA 3AY7A 1ORRA 4K26A 3SLKA 4BNWA 4E31A 1NAIA 1E77A 4AJIA 2A4KA 4JJIA 5DULA 3BTSA 1J6UA 1GUZA 3PFFA 4AJ1A 3G0OA 1OBFO 1MG0A 3LT0A 3R3JA 1SOWA 3DB2A 1WW8A 3IKVA 1DAOA 4YVFA 1WWKA 4R68A 3ICPA 3ZNOA 1TA4A 3HB4X 3LLVA 3OSUA 4NBUA 4RZHA 3VPHA 4WLUA 4FW8A 1ENOA 4WCFB 5IN5A 4OXYA 3Q0EA 2FZWA 2GN6A 1B3BA 2JAHA 1C1DA 2NADA 2CSUA 3ADPA 1LLCA 1Y81A 3D5TA 5EL0A 1ZJZA 4I9UA 3DZBA 1KETA 3B1KA 4DLBA 3ZWXA 5JMPA 3TQHA 2NTJA 4IJWA 4B8WA 1VKNA 4C7JA 3GEGA 3CSDA 3RSHA 1NNUA 3GGPA 2AEMA 3H8VA 3OJOA 4FQ8A 3FNGA 4RVDA 2QX7A 4M87A 1QYVA 2XPCA 4ND3A 4W82A 4P4NA 5DP1A 2GO1A 3WWYA 4Z3KA 3PP8A 3FTPA 3VVCA 2DUWA 3GVPA 3AOEC 1YS4A 3C85A 1NR7A 3OP4A 4J1NA 2JD2A 1KVSA 4MVJM 2AHRA 1EFLA 2PV7A 2FSSA 3AY3A 2CVZA 2Q46A 3AY6A 4PLHA 5DBIA 5H82A 1KEUA 5AOVA 3U4DA 4BOYA 3WLEA 4BUCA 1WDLA 3VTZA 5L7WA 2PH3A 4LW8A 1ENPA 2PA3A 4BNXA 3ITKA 3NJ8A 4GMGA 4JXKA 3RROA 4BGUA 1H0KA 5MGBA 4PZEA 4ND4A 4C7KA 4OKNA 3ANMA 4DPLA 2IXBA 1PZFA 4J4BA 1TT5B 3GRKA 4R41A 4RQTA 1ONNA 5CAEA 4RLSA 4Z9YA 1O5IA 2BFOA 1LDEA 4IDCA 3GUCA 1PEDA 4LVCA 5G0VA 5G2OA 2HRBA 3PQFA 4D46A 2YDXA 2NU7A 2BELA 3H9EO 1J4AA 3HB5X 3MWDB 3AM5A 5CG1A 5IF3A 3MJVA 3LC1O 1U2GA 4CV1A 5DBFA 1SB8A 4OQYA 3QSGA 1T25A 4YWJA 2BKAA 2O4CA 2XXBA 4Y9DA 1Z7BA 3RUAA 4FC6A 3QQPA 4CLOB 5BNIA 1KERA 3KYDA 3HJAA 2AQ8A 3M1LA 3HDYA 4HNHA 1I2BA 4YJGA 2Y93A 3DDNA 3O8QB 4LRSB 1N5DA 5AXBA 4J7XA 2YQ5A 3I1JA 4HWKA 1X1EA 4FSHA 5JY1A 1KC3A 3GOHA 3F9IA 4CM5A 3Q2IA 4DC0A 3KSUA 2X9VA 3B20A 3DOJA 3KZVA 5CFZA 4WUVA 2RHRA 3DAFA 1XGKA 5JS6A 4DVJA 2BI8A 3VVBA 3SC4A 3RUIA 1JU9A 1PZEA 3O9ZA 1PIWA 4XYLA 2GN9A 1JKIA 4ND5A 5JMWA 2EKLA 3LC7O 3WLFA 4Z9FA 3GY0A 3K6JA 1HE4A 1K0UA 3MJTA 3ZHXA 1HDOA 4OQZA 1XLTA 3ADOA 4M54A 1R37A 3PZRA 3WMXA 4I5DA 4E2XA 1N2SA 3JSAA 1LSSA 1JWAB 5JDCA 1Z6ZA 3FNEA 1X1TA 1B14A 1DFHA 3BTOA 4ZN6A 4YT4A 3ORFA 1A5ZA 1IZ0A 1ADCA 4BO9A 3WGQA 3IL2A 1GD1O 3L77A 4HX5A 1LI4A 4UAGA 1NAHA 1UXGA 4A10A 1OOEA 4K1LA 3NKLA 4EDFA 2QYSA 2GASA 1Q0HA 4BGVA 3ETDA 3HDQA 3H3FA 1PGPA 4BNKA 3RI3A 4GLOA 1QXSA 2NNLD 3CH6A 4A27A 4KQWA 2R6JA 1GV1A 4D3SA 1Q7BA 2Y05A 1UXKA 2B5WA 2I66A 2H9IA 4DQVA 1CIVA 1CRWG 3OEYA 1E1LA 1VL0A 2R00A 1NHWA 3QVXA 3ROPA 3JD0A 5HS6A 3VPFA 1Q2XA 2WDZA 5IZCC 3GGGA 4QFDA 3D3EA 1HZZA 4PG4A 1KEWA 3WBFA 4LMRA 1WDMA 5I9MA 5ICSA 4BNFA 4D3FA 5I7SA 3RC1A 5KOIA 5A9RA 3PIIA 1GL3A 1RM0A 4DQUA 3MOIA 5JO9A 1E1KA 3WQQA 1JW9B 1DC3A 1U8FO 3CINA 4PRLA 2G82A 1E1NA 1N8KA 4CV2A 4UUNA 1GEEA 2IEBA 3GR6A 3ANLA 4GGOA 3N7UA 4YCAA 5TLSA 1ZXLA 1GYRA 2WWRA 3DZGA 3IS3A 3TOZA 2OMEA 4OH1A 3GZ4A 3RU7A 2PZJA 4J7CA 2OGUA 3COSA 5DCYA 3E9QA 3BMQA 1ID1A 1EE9A 4B7XA 1Z75A 4D7AA 5A4DA 1LSJA 4BHTA 2I99A 1ZO8A 1EUDA 4OAQA 1Z74A 1K6JA 1LU9A 3DZHA 3JQ8A 5KJFA 4MVJG 1LDMA 3AI1A 1SEVA 3PDUA 4YTEA 3VH3A 1X7GA 2FHSA 3WOHA 1WZIA 2JHFA 1VJ1A 2D3TA 2G17A 3RUEA 3ROKA 3WTBA 2X0NA 4DIBA 1QYWA 1T1SA 2HSDA 3GMSA 2OP1A 3QVWA 1HL3A 3PJDA 3AUUA 2V7PA 1T24A 1ZMOA 2GDZA 3IIEA 4CR7A 1H6CA 3W6ZA 5JCXA 1BGVA 3NTQA 4MINA 2Y1CA 3WJAA 4D0SA 1PR3A 1K6IA 4QEDA 2BFAA 3DFZA 4E5YA 5L4NA 2O7QA 2I9PA 1AHIA 3D4PA 2EWMA 3PJGA 4GWGA 2DT5A 3D64A 2CVOA 3R0IA 1KY4A 4TROA 5THKA 3RVDA 5CDYA 3STHA 1UZLA 1ZFNA 5I8WA 4NJMB 4B3JA 2HCTA 4DBVO 5I7EA 1C3VA 1BRMA 4CM6A 4BVAA 1WVGA 3W4JA 4FFLA 1HYHA 3WIEA 2HMWA 4EJMA 4MOWA 4U0JA 5K6AA 3NJ4A 3GG2A 1MA0A 3PFWO 5IDWA 1KC1A 1I10A 4J9VA 3UVEA 4BNHA 1F8GA 2CY0A 3BAZA 2ZB3A 1CYDA 1LDBA 1SMKA 4OYRA 4BMVA 4CPDA 2BI7A 2WTBA 1UUFA 2ZCVA 1PQWA 3V1UA 1HTBA 1XHLA 2X7HA 1H9AA 1H2BA 4II2A 3ROQA 4FD3A 4PZDA 3EHEA 3Q1LA 1QKIA 2Q2QA 5AYVA 4KDEA 3GK3A 2O50A 4PVDA 2W2KB 4ZQEA 3U3XA 4NBRA 2YHUA 4MKXA 1I3LA 3RBZA 1IYZA 3TZQA 4IJUA 2NTVA 1ULSA 5G4KB 2PWZA 4BO3A 1YO6A 3DAPA 1PL8A 2O2SA 2X1HA 5DOZA 1SEPA 1MX3A 1SB9A 4XDYA 3BMOB 1AUPA 4Y6SA 4IQ8A 2W98A 1LRLA 3M1AA 4HV4A 1DEHA 2RCYA 2GERA 3FTNA 5CEEA 4Z0HO 2AXQA 4N5MA 4BNTA 4BV9A 4INAA 4MVJD 1R0LA 3INGA 3MJCA 3B1JA 4BKRA 3VC7A 4YACA 5KVCA 4XQEA 4RF4A 4KDFA 1ADFA 1QLHA 5IN4A 3PI7A 1I3KA 1D4FA 4WLVA 4OIMA 1YQXA 2HUNA 2FP4A 3L4SO 3E18A 4HFNA 1LLDA 1PWZA 4IJKA 3RAJA 4JN6B 3UH1A 2VUSA 1Y5MA 4U6SA 4YJHA 4PLFA 5EMHA 4LGVA 4D79A 3L4BC 3AM4A 2C7GA 5CPBA 4RORA 3GHYA 3OM9A 4FJ1A 4R1UA 4XGNA 2GN8A 3TF5A 1YONA 3ONDA 4QXMA 3ZW8A 3O26A 1ONPA 4M55A 4HXYA 3HDJA 5C7LO 2GN4A 1AHHA 2VHWA 4KTTE 1HDXA 4IDDA 2QRKA 1QRRA 4B4UA 1YWGO 2ZCUA 1BHSA 1H6AA 1Q0QA 5DDIP 3UN1A 3NT4A 3RASA 4BNNA 4OOFA 4QECA 1P1IA 3JQ9A 3UAGA 7MDHA 1C14A 4HADA 3QVSA 4MIYA 3PGJA 4JIGA 3TPCA 4M89A 3LQFA 3FSRA 3QLJA 3PYLA 1PS8A 4DIOA 1SNYA 2EF1A 1HSOA 4AJJA 1B8UA 2NVUA 5CPFA 4DIFA 2DUUA 2OORA 2GCGA 4UREA 3DBVO 3FR7A 3DBHB 1IZ9A 1LSUA 3V2GA 4P4GA 1OC2A 4RPKA 1P0CA 4GSKA 2NVWA 1IPFA 3EUWA 3ABIA 1OFGA 4GVXA 1C0KA 3S2IA 1QMGA 3ZHYA 4S1VA 3SEFA 4Y6RA 5MDHA 4CMIA 4TMFA 3F4BA 1B2LA 2GPTA 1RM3A 4B3HA 1L1FA 3W1VA 3NEPX 1B26A 4I9NA 2HJSA 4XWYA 4RQUA 4E13A 4L73A 4AJPA 5KJ6A 5T64A 1Z82A 5C7OO 2WYUA 4KOAA 4TVOA 1YBAA 4EITA 3LT1A 4L8VA 2FPIA 4CMGA 4YPOA 4E5MA 2GZ1A 2C5AA 1YQDA 2PZLA 1E3JA 4CJXA 1NX6A 4NK5A 4Z9XA 4FB5A 1G1AA 1PJ2A 3DBLB 2ZYAA 2O3QA 1NTOA 3GZNA 4ALIA 5FWNA 3EYWA 1ZK0A 3JD2A 2X0JA 5BNTA 3P7MA 4AICA 1E3LA 3GGOA 2I76A 4Q3EA 1DXYA 1DOHA 1VRWA 4HY3A 4O5OA 4XYGA 3DEYX 5AXCA 1EVYA 3OBBA 4II3A 1T26A 3IOYA 1ZCJA 1LDNA 1UXJA 1TVEA 4K9DA 1N9GA 3GNQA 3ZI0A 3EMKA 4XJTA 4RO0A 1Q7CA 1KBZA 1WPQA 3QY9A 1GFSA 4HKTA 3PIDA 3RFVA 3ZWOA 5F1OA 1AXEA 5IXYA 1Y8QA 5A5EA 5L7TA 1Z73A 3HDHA 2DTEA 3DO5A 4DTIA 4YAKA 4MVJI 4L74A 3JQGB 2LDBA 2VWQA 5L9AA 3ZV4A 3OQ6A 5BNFA 1XDWA 3VTFA 3R6DA 2WD7A 2E37A 4BNLA 1Q1NA 2Q1UA 5JAZA 5LDGA 1PSDA 3INRA 4PLPA 4RVSA 3KETA 3BXXA 1MUUA 3ZW9A 1Y5RA 3UUWA 2BHLA 1ULUA 4J7UA 3WYCA 2D59A 3WBBA 1PR9A 2PGDA 1U3TA 2C07A 4BV8A 3ZDFA 4ND1A 4WLFA 1AE1A 5T8KC 3IMFA 3JQ6A 4UVIA 4R51A 1NFFA 2WYVA 1NASA 1AN9A 4FOSA 1YDEA 2EKQA 2P5YA 3I6IA 3TNLA 4E33A 3GA0A 3TFQA 1EUZA 5JC1A 3JQ7A 3I9MA 3DONA 4MKZA 3DZFA 3JQFA 4FFOA 1WXDA 2AG5A 3HN7A 1PL7A 2HMVA 2HRZA 4KQXA 5KNLA 1HLDA 1O9BA 4XB2A 3QRWA 3MZ0A 2BH9A 3L9XA 1IY8A 4CM9A 1ENZA 3JQAD 5JSFA 2IODA 3DR3A 1F12A 4XYEA 3HQ4O 4BIIA 3TL2A 5U4QA 2IDZA 2BD0A 5A3JA 5BSHA 2AG8A 4TZKA 2OL4A 4ND2A 3UKOA 2VHXA 3DAGA 1MC4A 1GADO 2BGMA 1ZIDA 3QVTA 4MPDA 1U2DA 4ZQBA 2O3JA 4IDGA 4EEZA 5JXWA 2DFDA 4BGIA 3BHIA 2QG4A 4YRDA 3JCZA 4TVBA 1MC5A 1TEHA 2O48X 4B79A 4Q3NA 2GSDA 2OO5A 2QQ5A 4XA8A 5F21A 3RJ9A 4CLHA 5IG2A 1CERA 5ADHA 4L4XA 3C7CB 4JP3A 1N1EA 1DRVA 1I3MA 1QSGA 1YQGA 2QRJA 4ZD6A 2FWMX 3MCVA 4PG8A 3K31A 4R4JA 1T2EA 5DOVA 4CMJA 4MDHA 2E6UX 4J0EA 1H6BA 5ICMA 3NRCA 2Q1TA 3TZHA 4D43A 3V2HA 4CLRB 5A04A 2FMUA 4DWVA 4YJFA 4R1SA 3EDMA 3G17A 4N5NA 4Q3AA 4Y67A 1B8PA 3PQEA 3D0OA 3LLSA 3LK7A 2X5OA 5B12A 2C5EA 2ZATA 4I9HA 3K92A 1EVZA 3H7AA 3SC6A 4IZIA 5ITWA 4JLWA 1AXGA 3EVTA 4B4OA 5T57A 2O7SA 3B6ZA 3GC6A 3RKRA 1R4MB 1GPDG 3JYNA 4ZU3A 3QHAA 1IULA 1JN0A 1ISGA 4YAGA 3WSVA 3KYCA 3AWDA 1N1GA 1UJMA 3DMYA 1PX0A 4NBTA 4MVJP 4QTZA 5KJ1A 1G6KA 4HBGA 4J16A 4LSMA 4LSWA 4XR4A 4AG3A 2VZ8A 4FR5A 2VRCA 3D3WB 4IIUA 3ZWWA 3PPIA 4DA9A 4EUFA 1NVTA 2CUKA 3ENKA 3UXYA 5JC8A 4GQAA 3FI9A 3WGOA 3U62A 2EEZA 1P1RA 5TX7A 4QQRA 5JYEA 2HKIA 4J6FA 2B4RO 4UUOA 3DQPA 5L4SA 1DC4A 1JAXA 3BMNA 1DAPA 1KEVA 4YAJA 3JQAB 4O6VA 1YOVB 3K8ZA 3DOOA 3OJLA 2B4QA 2NSDA 4QX6A 2EP7A 5HM8A 1P77A 3QWBA 4Z6KA 4O1MA 1EQUA 4NDNE 4Y6PA 5TSDA 1JA9A 1F17A 3K30A 1W73A 3U9LA 3RQSA 2DBQA 3TL3A 2EHDA 1T2FA 2JCVA 2YYYA 1R0SA 4GSLA 4ALNA 1H2HA 4CLEA 1YJ8A 1I2CA 2X22A 1M6WA 5F3RA 1AGNA 4QO8A 4E0BA 4AJ4A 2DM6A 2J8ZA 4BB6A 4CLDA 4CR6A 1S7CA 2RH4A 1UDCA 4W7HA 4D41A 4XIJA 2PD6A 1L7EA 1C0PA 2NV6A 2ZYDA 3UICA 1WMBA 4J43A 1DHRA 3QWAA 3GVCA 4XCVA 5G0TA 3WFJA 1O94A 2A94A 2B83A 2X23A 2D1YA 4H7PA 1EBUA 2XAAA 4GKBA 3E5RA 4UUPA 1BXKA 2I3AA 4BQPA 3LT4A 1LC0A 1LUAA 4DXHA 3TDKA 3NYWA 4IQGA 2JFHA 1P44A 2VHVA 4BNZA 1EQ2A 1PL6A 5HWSA 2TMGA 3M2PA 1CQJA 2I65A 4P22A 1Y6JA 1MXFA 1V8BA 3N58A 4L75A 4DRYA 1ISIA 4B7UA 3ZNPA 4EJ6A 2FR8A 4E32A 2YUTA 1KYQA 1LTHR 1ADBA 2O3TA 1ZSVA 2PR2A 2ZB7A 2V6MA 5COQA 3UFXA 1I01A 1ONOA 3NX4A 4U0KA 1WNTA 2Q99A 2P2SA 3AUAA 3KUXA 4GX2A 3EY4A 2DLDA 3AOEA 1B3RA 3F1LA 1V35A 3CUKA 2G76A 1OC4A 3VAZA 4NJOA 3ZU3A 1YKFA 3NAQA 1QP8A 4AJHA 4TWRA 1DC5A 4AL4A 2CDBA 3SJUA 1I5RA 1FK8A 5CDSA 1R15A 3X2FA 3B70A 4WPGA 3FN4A 2XOXA 4BKPA 1LEHA 4D3DA 1UH5A 3HUDA 3VPGA 3RJ5A 3MEQA 3FBTA 4NBWA 4AJOA 2AQIA 3NGXA 1E3EA 4YDRA 3N74A 1CJCA 3BMCB 4IMPA 2EP5A
chains in the Genus database with same CATH superfamily
4LCJA 5DTMA 3VX3A 2C2XA 2HRRA 3HKCB 4HG2A 3C98A 3NWOA 4YB8A 3PHCA 4BWGA 2WTAA 1KDPA 1FNNA 2VSOA 3FFBA 3I9OA 4PM4A 2J5BA 4JJ4A 2VQEB 4JLNA 3FPSA 3DMTC 3KALA 3OM1A 1W85B 3QJGA 2XCRB 3IAM1 4X20B 1E32A 3L8ZA 4S1TA 3RVOA 4BKUA 4X8HA 1E6UA 3KVNA 1SVLA 1LF0A 3TDNA 4EB3A 1T2DA 1C9DB 5DT2A 1W0JD 1ZM3A 3MMNA 5GP1A 3W4KA 5E8RA 5ERYA 4JI4B 1N2HA 4X24A 4B40A 1ZI6A 3TMAA 3EPLA 4KPYA 2COEA 1BFDA 1B1CA 2PL1A 4JGBA 4L7QA 1U2PA 4HYEA 4OB8A 3T7AA 3WLKX 3IEPA 5KYGA 4GP9A 1ZEJA 2W93A 1TIKA 3PX7A 1X3SA 4CG0A 5E6RA 1Q3KA 1JDBB 4DLLA 1HSZA 4QJ4A 3WGYA 1KYVA 3DZ8A 3PQ7A 4OOEA 4XYBA 2DFPA 4KBGA 3LBIA 5AK3A 3VR5A 2RHDA 4AW9A 5CYFA 4JBHA 1WLYA 1U9CA 1GQSA 2KLHA 2N42A 1OW3B 3M6MD 1WCWA 3PQ4A 4IDQA 3IP1A 2ZBFA 1CP3A 2F9MA 2YWBA 5BV8A 1OFTA 3LFTA 1QIFA 3I9LA 3A04A 3JR3A 3CLKA 1XKLA 4IXMA 1HEIA 4TGLA 3OOSA 2DHQA 5LZ8A 3TIIA 3IDSA 1W4CA 3R3ZA 1SXJE 3PT9A 2GXAA 2BFEA 2Z2KA 1WMFA 2XTMA 4IGKA 1PAUA 1Q3TA 5DASA 5L3ZA 5A5GA 4EY3A 4Q7JB 1E6MA 1DRWA 1KEEB 2ZRBA 4XCQA 2ODTX 2FLVA 2QE7A 3WWPA 1U5BB 2JH8A 3VTKA 1EFRA 2VXOA 4H0FA 2AMLA 2YJNA 3DHYA 1UMBA 4KBFA 2X0DA 1AGPA 4K9RA 5FAKA 1Z37A 3FD8A 1EWKA 4WOKA 4GX1A 3HYTA 4V2IA 2Q21A 3ZX5A 3I4CA 2H1SA 2FKNA 2HF7A 4G1EB 2Z5VA 3Q3EA 4LECA 3CRW1 3CRZA 1P2DA 4CEIB 2IXEA 3LG2A 1QO0A 2O3UA 1VB5A 4ZRMA 1D8AA 1J56A 3MLAA 2ZPTX 4ZJZA 1V26A 4R9SA 5FHQA 2CJWA 1T13A 1NXPA 3GJ4A 4JLJA 3TLXA 2KI5A 2YMLA 3PNBA 5FLYA 1FY2A 3I2GA 3HR7A 4F4IA 2DWOA 4CF3A 4MAMA 4NAUA 2ZTSA 3PF8A 2BCJQ 1Z12A 3JPYA 3C3EA 1UMCA 3WO1A 4RV9A 3ZZNA 1ESMA 1Y7HA 3W2TA 3X1MA 3E5MA 3RFXA 3RVJA 3PTZA 3PXEA 1PVVA 3SFVA 2PGAA 4BLPA 1HNNA 1SUIA 4OY3A 2RGNA 3PFHA 4H7KA 1DO8A 4R9UC 2VSQA 4BP8A 3EPRA 2CXNA 3Q87B 3VDQA 4D8VA 1DIAA 1UMKA 2GHQA 2ODQA 3CF2A 3TOXA 1EFAA 1T2AA 2CJPA 2W6MA 4QBIA 1YK0A 5GY7A 3L0OA 2BFNA 4LTDA 4Y1RB 2REQA 2JBAA 2H48A 3FDIA 1NM5C 2ZT6A 4UD6A 3U4CA 5DM1A 4NECA 5EZYA 5HJ2A 2ZIXB 1VL6A 3A4TA 3GG9A 4LJ9A 2VKQA 4P3XA 3CSSA 5CX4A 2ZSFA 3K7EA 3S55A 3W9SA 4KG7A 3HBMA 2XMZA 3W2IA 4BB0A 1W93A 4NCHA 4U9IS 3WLTA 1G55A 2XUOA 3G59A 1UK6A 1JHYA 2FFBA 3AGPA 1XA0A 3GDOA 4GPBA 4PU0A 4YONB 5C4IA 1JFVA 2D54A 2WE7A 4Q4AB 8ADHA 4N76A 1T9DA 4Q15A 2Z83A 3L1KA 3AL3A 4HEA6 3ZOZA 3CF4A 1J24A 1PW5A 1P45A 3GFPA 4HNGA 4CCAA 1MX1A 4Z53A 3AMVA 1EBBA 5DCUA 5E4JA 3TLZA 4V38A 2CNOA 2KB0A 1Z15A 4DRZA 4ZCRA 2I4RA 1Y8ZA 1CF2O 4NU5A 3K71B 2BSAA 3C3KA 5EIBD 5IH3A 4F1KA 4ENTA 4B9EA 3QKRB 2JLZA 3OX3A 3GZJA 1ZR4A 3V00A 2QUJA 4ZI7A 5HF5A 2PAFA 1AUOA 2NAFA 2BR3A 3BF8A 3G2HA 3DNPA 1G8FA 4F9EA 4PR3A 2G4VA 4CUZA 3NOQA 5AK5A 3C1OA 4G84A 2P1RA 3MUOA 4JFAA 1UJ4A 3NBYC 3ZIUA 5ICGA 2PRIA 1ELOA 5B1EA 2QN8A 2BRUA 5CDFA 3AVVA 3AVWA 1SWWA 3LM8A 1U0SY 2GF9A 1M6YA 4A73A 1NW9B 1BH6A 1I14A 4FFBB 4PLCA 1V11B 3F6PA 3OHSX 4NLLA 4BVEA 1TB4A 1HDRA 1P9LA 2QMUA 3DL7A 2VTDA 4C4RA 3PWSA 2BONA 1JSCA 3L6EA 3PPVA 3A6PC 4CEJB 1O5OA 2BGLA 1UPCA 4OHWA 5HIIA 2EAUA 4KVGA 1JG1A 3HUEA 3IULA 4EG4A 1SD2A 3MOSA 3WLRA 3D8RA 2DEUA 3NBUA 2AMYA 4D3ZA 4OX9B 1FX0B 3NT2A 1NLMA 1FFSA 2B1GA 3A1DA 4JC4A 9LDBA 3PD7A 2J1LA 1YBHA 3VKHA 4W1RA 4EB0A 1SHLA 4J0GA 5B64A 1NPDA 3JALA 5JZVA 3O3CA 2JC3A 4LAFA 4YBZA 1SZPA 2R60A 4YRCA 3NKVA 2F1KA 5IU6A 5EYPB 5FB3A 3OZEA 2XITA 2HMUA 3K9QO 5I9NA 3I45A 5EESA 3CZ9A 1O08A 1PQ4A 3GFBA 3QMVA 2VPIA 3E9CA 4MKGA 1E2JA 4ECAA 1P5RA 3L0DA 5DHAA 4YXFA 2XT9A 1IG0A 2PD3A 3GDHA 2YZKA 4X41A 3W5JA 4WCVA 3RWMB 2ENWA 2X7XA 3NCTA 1QTNA 2IEYA 3PHHA 2PHZA 1VYTA 3FGNA 3A37A 4CHGA 4EW1A 4QVIA 1VIVA 5FH9A 1OVGA 1M67A 3CX3A 4WHMA 2NNWB 2BJWA 3GBPA 4PE5B 3MNFA 3R3VA 4O08A 1PZHA 1KFKB 2IZ1A 3IT0A 3LVBA 2Q5IA 2AXNA 2YXEA 4CMKA 5IJZA 3N8KA 2RE8A 4MUBA 2XX3A 5KQPA 2EJCA 1NXTA 3NDRA 4Q39A 3QVGA 3WGZA 4N0QA 4IP0A 4QOSA 2RGXA 1Z18A 1VSTA 1KK0A 1K98A 4YV7A 1VE9A 1LFDB 1H4SA 1U8ZA 3AHFA 4E5PA 5KWSA 2WRZA 1C3OA 4RNCA 2J5XA 1GZ5A 1YMQA 2ZYUX 5DSXA 3GPLA 3UXHA 2DC1A 1M74A 2NUPA 2SCUB 4NNOA 2Y67A 1JA0A 4OFWA 3V4VB 5DWVA 5J4VA 5FOSA 1A9ZA 5BMOA 1EWTA 4TKVB 1DUSA 4W7SA 1Z5PA 3GJ6A 4AM8A 4OHPA 4G0QA 4GXTA 3SFZA 2NUTA 2Y1EA 4IM7A 3FAZA 3I6QA 4WZ6A 1FU8A 2MSDB 3L4BA 1JSRA 1AIPA 5FHRA 2F4VB 1FEZA 1PZNA 1Z26A 3A3PA 3CGWA 2QZ4A 1N6PA 2BOVA 1U2EA 2VWHA 3IMGA 3GCXA 3EFEA 4JYMA 4DJEC 1LBEA 1I5EA 5EMKA 1K7XB 2EBHX 3WYBA 4RHXA 1YCDA 3SSOA 4UXIA 1IBSA 2G40A 5D1NA 5K8UA 4TWIA 3VXKA 2HA0A 4DB4A 2EG5A 1Q2UA 3JVUA 2X0RA 2NVBA 4EENA 1FYXA 1V0JA 2FETA 5K4AA 1MDBA 4K7JA 1GKUB 1U7HA 4JQZA 4W9NA 4POOA 2QHXA 3NPMA 1O95C 1RQ2A 2XMDA 3UWDA 2WJWA 3N59A 3TNDA 3NHJA 4FEYA 3DPUA 2GT1A 3H1FA 2AXPA 1OA1A 3MJ4A 1S02A 2GJKA 5FPTA 5TGZA 2OD2A 4JI3B 4E2ZA 2ZB8A 4MWGA 5A6VA 3OT5A 3A7DA 3G5TA 3V48A 3FCCA 2GVZC 3O03A 1TVKB 1N6NA 2HBZA 2QE7D 1CVIA 2WEKA 1EFPA 1K6MA 2WWXA 5C3MA 1GTSA 3GPIA 1AGYA 4J6EA 3PXDA 1EFRD 4TS1A 4EM6A 5AI0A 1BIFA 1NC1A 3ABRB 3DV2A 3IKJA 4GM4A 1LBSA 4PY2A 1J25A 2XMSA 1JGTA 1I36A 2C82A 3QWFA 3COPA 4I8XA 4AN0A 2IP4A 1YZQA 2OM6A 2QE6A 4MEAA 5JALA 3HRHA 1Q77A 2WG0A 2OHJA 2APJA 3P5SA 1CJSA 5D85A 3FVVA 5HW0A 2QG6A 3X2EA 5EJMA 1XZQA 3CLRD 3K73O 1UDRA 3IEUA 4BO5A 5HX7A 2RHTA 4AXBA 1QO7A 4G1VA 5I3CA 1P75A 2DFNA 3RD5A 5B57C 1ZGGA 5BRJA 1NY6A 2KW5A 1HT3A 1SURA 4BFCA 3HCNA 2XKKA 3I05A 3C6XA 4G65A 4GRDA 4XQCA 1OF1A 3Q3IA 4A0QA 2C31A 1WUYA 1TW3A 1V6AA 3P9YA 2ERYA 2ERXA 4RACA 2PS9A 2Q7XA 3LBHA 2QM7A 4LJLA 4MQFB 4PGGA 2A1TS 2WQ6A 3B3QA 3R1IA 5CAEB 2QRNA 4XRRA 3KJGA 4C88A 4AF7A 1EVJA 3C7DB 4KN9S 4ZVKA 3F5QA 3O8QA 3Q6NA 1QCCA 2HYDA 4DUZB 1UQUA 5MN6A 4QO7A 4FUTA 4MLCA 1JDBC 3O38A 3R23A 3VNQA 3RC2A 3URKA 3C6KA 2VDKB 4RZ3A 4JI2B 1XNHA 1WEHA 4AO8A 2PZMA 1OXXK 2X8WA 2YY7A 5K5EA 1RQNA 1OLXB 3O8RA 4IHKA 4ZAFA 3SQOA 2H31A 3DWFA 3C41J 3R5JA 4IV8A 1EP9A 2ZYTX 4I6JA 3RYHA 1IMJA 3KYDB 4DNFA 2A6PA 1NF9A 5KB3A 1RJDA 4LZWA 4QPPA 3MIIA 2GEVA 1D3AA 1RQXA 1YE3A 4WKGA 3VH1A 4IDBA 3T9FA 3WL8A 1RXWA 1NZDA 3E8SA 3WSTA 4ENQA 3RKSA 4X65B 2CNDA 3B9BA 3GAAA 1MLDA 3HWSA 4GC9A 4NU6A 4ER3A 1WXFA 1X15A 4YQZA 4KUHA 1XUOA 5BWLA 4IG9A 1TLFA 3BQ9A 5CK4A 1YRHA 2NZJA 4FYPA 1GZ3A 3UATA 1PWHA 5G0UA 3DT9A 2R1VA 3D3KA 4QG7A 4LF6B 3K4PA 1SCAA 1FDIA 1T9HA 3EIUA 4TS9A 4TQGA 2QTCA 1FFWA 4OHUA 4S12A 1L4MA 1RW4A 4EELA 1NURA 3EPKA 3OOHA 4XD7A 5C5IA 3B38A 3BHNA 4D4KA 2J3KA 4PG7A 4S1WA 1KS9A 1Z0IA 4H7EA 1NJ6A 4NOLA 5BSMA 4EVRA 1ZIOA 1J2UA 1J22A 1FCJA 3SYNA 1ISPA 1HOTA 4NMMA 1TYCA 3KBOA 4G5HA 1OR8A 2GPYA 4UCXA 1BS9A 3EC7A 3VR6A 4K6GA 1AUVA 2FN8A 5G3ZA 5GM1A 1L5GB 3BIWA 3WIVA 1H2WA 3RSZA 3RVRA 1TXGA 1ZRSA 4FS3A 1HDGO 1RKVA 3NXSA 4Z2YA 4BFSA 1E2LA 3LY7A 1VJGA 2J3LA 4BX0A 3IHTA 2PD4A 5K0TA 3HDTA 5FA5A 4CE6A 4OMDA 4QAQA 3ZR4B 4ALMA 5KTTA 1UKZA 4CIDA 2IYFA 1AGRA 3ZE1B 5KJCA 1QV9A 2HA2A 3JS5A 1Z7YA 4XTCS 2WA2A 3ABSB 3M7IA 1G21A 1NKSA 2WOJA 3U0BA 1TKCA 4R8VA 4HXGA 5HBGA 5HK8A 2OSVA 3CLUC 2ZR8A 3HBNA 2PRZA 4FOPA 4OM7A 4WN9A 4EUNA 3JR7A 1HF3A 4R8MA 4ZZ1A 1ML3A 2R8OA 3BHMA 4TSFD 5AVQA 5FTJA 2PRKA 3OE7A 3RVKA 3FFXA 1VIAA 3N5KA 1DG3A 4H3KB 5FWYA 2VSXA 3AF3A 4MPPA 3QYAA 5EKDA 1VQ1A 3FOBA 4DWOA 1EK5A 2WM8A 3O0TA 4FNGA 4JBWA 4Z54A 2G5TA 3AVQA 2BLLA 4DMFA 2GBLC 1N57A 3DCIA 3H0KA 4NP6A 1NHGA 1Y0BA 4PQYA 1HKUA 3MAJA 3SSAA 5K01A 2DETA 3BILA 3TGPA 4E1AA 4DR5B 1KJJA 4C29A 3DOHA 3ICCA 4JJEA 5EZYB 1PNRA 2JG3A 3T7TA 3HB0A 3EFOB 2EZ9A 4TTJA 4LQDA 3AVYA 3G49A 3B82A 3A06A 4PRZA 4FIZA 1ZHOA 4LGYA 2FEKA 4C0LA 1WPXA 1CY4A 2NTEA 1RAFA 3DMGA 4XYMA 3WFIA 4EYSA 1APBA 3OX4A 3O1JC 1DMSA 5FRDA 3PICA 3DWIA 2GHIA 1E66A 3RGWS 3L07A 3T3OA 3L79A 3OBIA 1I3CA 3Q7RA 4EW2A 1FJHA 4BNUA 2ZS9A 3P9QA 4MWZA 1XMQB 1KF0A 2FPGA 3P0IA 5CA1A 2R3SA 1ZL2A 3FUTA 1GQOA 5E4YA 4RLQA 5EUQB 2I1LA 4K3UA 4F2WA 2Q6KA 1FTNA 1N2IA 3PQ6A 2NG1A 2WF5A 4HN9A 4L9AA 1NL3A 4CV0A 4X7MA 2ZWAA 3S1LA 3O75A 1CJUC 4L02A 3UXMA 3HCCA 3ZHSA 3NWBA 1JLRA 1KDRA 2BFMA 1Z7EA 2QK4A 3A6JA 3AKEA 4OSEA 5E2IA 4RHEA 1FVXA 2VHQA 3VJKA 4Z49A 5B2FA 2J0VA 1I2ZA 1BX0A 5CURA 4BJ1A 1NN5A 4NMXB 1ONSA 2FI1A 1Q17A 2B8EA 4O2AF 1XZCA 2D6FA 4ZV4A 3O4RA 4FS8A 3VKWA 2MYNA 3UUGA 2CXOA 4U2DA 4YRRA 3I8OA 4B3XA 1DNPA 3KSZO 4JI6B 2DR0A 5H4GA 2F2TA 2OXIA 5A6SA 1CXZA 3BSSA 2WD9A 2Y2UA 1V1JA 3M6AA 1JIUA 3G9UA 1INLA 1GFIA 1MFPA 2QDKA 3MMPA 4TKUA 3WK6A 4NR0A 2GMWA 2PDAA 1CZKA 4OJQA 3G5LA 4MRAA 4K9MA 1JHQA 4NK4A 1RXEA 2FWAA 3FVWA 2ZBVA 4Q4LA 1Y37A 3ECAA 2YWXA 5IT0A 1ZIPA 4FKBA 4M0FA 5CITA 4F4UA 4JMLA 4ZANA 1G8JA 1W5AA 1Z28A 2D8AA 2ZB4A 2HNAA 4ACBA 3HDGA 3DP9A 4LY6A 1YC5A 2ESRA 3DWGA 3GJTA 3A6LA 3KU1A 1UT6A 3DEIA 4A5OA 2ZOSA 4XGKA 4RAOA 3ZU4A 5J23A 5JI3E 1IJKA 1XNQB 1XMIA 4LRTB 4Z9BA 4YROA 2PL9A 3SZRA 1SUEA 4IJVA 3TSCA 2Q4DA 5CA0F 2DSNA 3ZKAA 2REXB 4GWKA 2CF6A 2JH9A 3QHQA 5LP1A 3F49S 4WY8A 3PRHA 1W5EA 2GZHA 1SKQA 1GRNA 5T4BA 4M9ZA 3RANA 3UC9A 5JE8A 4FOTA 3FSJX 2E0IA 1M5TA 4H60A 3SDSA 1CRPA 2WJ4A 2YW9A 4U7GA 2PIAA 3S2SA 4J90A 1T0JB 2LZ0A 3TQQA 2BGTA 4FI3C 5TS2A 2PWAA 4RTNA 4K6KA 1L5LA 2LVBA 1GTZA 2WWYA 5AJTA 1WLSA 3BQMB 2QSJA 1PR2A 1N2ZA 4URZR 2UZ4A 1OROA 2GBGA 4W5WA 3WYAA 3N0VA 3SEQA 4WLNA 4NS4A 2C5LA 4V0QA 4F92B 1MFZA 1YHYA 7GPBA 2P41A 2WF6A 3IMEA 1KFBB 4RJJA 4HQ6A 1JVSA 4EUSA 2XXAB 2A5YB 4LHSA 3OPMA 3VR2D 1D2RA 2VUUA 3OZBA 5HR5A 2IHTA 4YREA 4KIFA 3M6VA 4HVTA 4LMPA 2V03A 2FVYA 4KTVE 1X9GA 5LQNA 1NN0A 2QUKA 3BH0A 3M4NA 3UBTA 1EJ6A 2Y99A 1DCMA 1TPZA 1GGJA 1SRRA 2BGIA 2FA9A 3BGSA 2FG5A 3HLYA 4WSOA 4R0VA 2G4LA 1U28A 3ZWDA 5LYJA 4K0KB 1P0QA 3M49A 2YHSA 4G23A 3Q7EA 4ZAGA 4UDXX 4WGGA 3M6UA 4J1QA 2P40A 1Q6ZA 5CTJA 3HR4A 1H0HA 2C9DA 3IR5A 1T2UA 4C43A 4B17A 3D81A 3I1IA 4D4LA 2LPMA 2F1IA 2VJMA 4DM4A 1U1EA 3OQPA 3NV9A 1LI5A 1I5OA 3D02A 4B80A 1EJ0A 4JV5B 4HTFB 5B2EA 1ZGBA 1X1RA 1JQEA 2AFVA 3AI3A 3HN6A 1QOZA 5JS7A 5AVOA 1GDHA 3SS9X 3UO8B 3PJEA 3AY0A 2C61A 4B6QA 5CDHA 3BK7A 5GJBA 1FW8A 4IDFA 4RKQA 1NYTA 1RJEA 3CNBA 3KE9A 3KKZA 4G5OA 4GLJA 2Q45A 3GW8A 4JB2A 4LY0A 5L3RA 3P5BA 3UK0A 4QOJA 1GCOA 4ZZIA 3DBHA 3NBKA 1FXWA 4XR9A 2QW0X 3L82B 1JHUA 1WUHS 5DHRA 3A1CA 3HUTA 4OATA 3L92A 4O4LF 4DVGA 3KQHA 1C9NA 2G9VA 3E81A 1W88A 3PEEA 5KYWB 2J9FA 2O5CA 5K03A 1P4RA 1GDTA 1QQTA 1JG4A 2AX4A 3BL5A 2F90A 4TMXA 3RHFA 3PEUA 1FDTA 2J0QA 1BDBA 1BO6A 1QGYA 1V3UA 1VKHA 4CL8A 2XD9A 4QSMA 2D62A 1QPBA 1DUIA 3N28A 5AHRA 2NVUB 3MFYA 4X1YB 3MTGA 3WGNA 3WMWA 1BE8A 1HETA 2DPMA 2N0SA 4L0DA 1I33A 3P9RA 4X94A 3BHJA 1P60A 1EFPB 2VAMA 3F6YA 1FLNA 1N8NA 2VHTA 4QUBA 4ZGWA 1TC2A 2R8ZA 3MAAC 4BLVA 2IY9A 5AW1A 5AVRA 3MWFA 4ISCA 1TAUA 1L7XA 2ORED 4MQBA 1MKYA 4KXUA 2ACVA 3THWA 6ADHA 1XHFA 3B2NA 3JRNA 1TO2E 1YFJA 2E5LB 2KYRA 1J70A 3Q85A 3A4VA 3G1UA 5FR1A 3NQ41 1ZK4A 3DBLA 4CMIB 1J1UA 2CMHA 3SYTA 2WG1A 2G6TA 6Q21A 4WKOA 2V3CC 1OI2A 3L8MA 5ER9A 4C76A 4DIEA 3OU6A 1ZR2A 3D0KA 4MUHA 2KQUA 3W8DA 5CM9C 5FBHA 1EE2A 4K2HA 2EJUA 1RCFA 4P98A 5DGHA 3X43A 4DV7B 3PEWA 2CDRA 2EIXA 5D6OA 1TUGA 1U2GC 2PL3A 2R5WA 3LIIA 3B6JA 2AG1A 3NNNA 2GAOA 2QEQA 4KVZA 1NBME 5TPZA 4MMYB 5GONF 4D4IA 2INGX 2CXXA 1Z7GA 4DSAA 2A84A 3OE7D 4I4CA 4MRPA 4ZDKA 1P1HA 4BX3A 1L8LA 1DDIA 4KUGA 1LNZA 1O6ZA 1Z4IA 2J08A 4URFA 5JAIA 3LVQE 3M1YA 5J2TA 4UUAA 3IX7A 1V8FA 1J49A 1E5DA 3PU6A 1X1AA 1D07A 1RMTA 1TQDA 4JA2A 4MDYA 4PSKA 4F5YA 1NULA 1DXOA 1QUFA 3HXQA 2I3GA 3QX3A 1W4LA 3C5EA 4TRNA 1AHNA 4A2PA 1BD4A 1M75A 4R2WA 2V1XA 3B85A 4IO1A 1A2KC 2AJLI 3GCWA 3K5HA 1L7DA 1N9GB 1XMPA 2PUAA 1SUBA 3FDZA 2O4UX 1PJ8A 3TFOA 4Q18A 2RGDA 3SIXA 4O4IF 2ZIZA 1ZA1A 2ZBDA 3DDWA 4KAAA 4AKTA 1EUQA 3TRKA 5BR7A 3WWZA 2X4DA 3F1KA 4R1MA 3BIXA 3CRVA 3IE2A 5DP2A 4W7IA 2J59A 2WU1A 1X92A 2IZOA 4GGMX 3OIVA 1B16A 3TQFA 1KVTA 2JIMA 4MQEA 2J6CA 3QKUA 3AP2A 3OZCA 1B6GA 4FIDA 5AMXA 1WDWB 1X80A 5A4FS 1IM2A 3JVEA 3R40A 3UV6A 2V9CA 5UKDA 1XTVA 3QEBZ 1U63A 4R54A 2PK3A 2J3HA 4Q7EA 3ILHA 3O92A 2ZCJA 1PX2A 5CCBA 1KJIA 1D5WA 2RAFA 3IAS1 4BLOA 5BQXA 2VQDA 3T6KA 4X62B 3I42A 1V1MA 2I2BA 3OCJA 1CE8A 1HE3A 1HZJA 2XYRA 3R3WA 3WR5A 4GKKB 3UHAA 2RGEA 2CV0A 1OLSA 1LDGA 4S1NA 4TLLB 3CLRC 1Z2NX 3GJRA 3PHLA 2ZE8A 4LE2A 1J2JA 4C4OA 4MDFA 4MQ6A 2ADFA 4MR7A 4URVR 1RAEA 3OZVA 3WIBA 1Q19A 1WW3A 4P93A 4ICIA 1X8KA 4AQ7A 3D54D 2JIZA 2R00C 2PKWA 2VRCD 3EQZA 3NNSA 4DS3A 2OXFA 4O1HA 1DKNA 4KRYA 5BORA 1XCMA 2Y1KA 3JQ7B 3LLMA 4WBXC 5DLPA 1YRYE 1HTWA 4Y0NA 3RVLA 1TEVA 3ZGOA 4IKOA 1Q1GA 4FINA 1JFFA 4WD3A 5I9SA 1AURA 3WXMA 4NRDA 4B3IA 3A28A 2P91A 3UA3A 1ECJA 5HKLA 3QE4A 2HT6A 4WOJA 2XCTB 4P4SB 2VDLB 4EBFA 4MQMA 4DREA 2DBVO 2I8CA 4WNYA 1Q7RA 4ZKEA 3VPDA 1YULA 1K2WA 2NYVA 3E0XA 3GPCA 4X84A 3RK1A 3VDNB 4B4KA 2XB2A 3R6GA 4DEYA 4FHZA 3AHEA 5A3SA 4AS2A 4B34A 1QJ4A 4DFDA 1YH3A 3BFJA 3R7FA 4WN9B 1BCSA 2GOYA 5JEEA 2OBXA 4LZLA 3FFTA 2OAQ1 3K20A 3PWZA 1IXSB 4JR0A 5J9FA 3UW1A 1HLFA 3W8RA 4C07A 2UXBB 3ETLA 5IC6A 2CEKA 4PAWA 3A9VA 1FP1D 2LIVA 4DYVA 2WJYA 1JQBA 2C0CA 2GPJA 3DLIA 3W5IA 2YBEA 4B3FX 1W4ZA 1X7DA 1W0KA 3BFVA 4J0JA 2A58A 1GR0A 1VECA 2QA5A 2E1RA 2EX0A 2UDPA 2Z9DA 3TZCA 3BE6A 3KWJA 4YT8A 1ISJA 4RVFA 2WKQA 2XBMA 2LKDA 1DIRA 5GVRA 4D02A 2RB5A 4G9GA 4LXHA 2OHVA 2QW8A 4FXOA 3KOOA 1BMQA 3MQFA 3BGWA 1BS2A 1Z45A 2P6MA 2WHPA 2Z9CA 4IIJB 4S3MA 3TQCA 4KGZA 5PGMA 2P78A 4D9MA 3ROGA 4MIEA 3PLRA 2JJQA 3EVAA 1DINA 5BSRA 2QTRA 3D7LA 1CRZA 4GUDA 5EJGA 1L5WA 3IAXA 4LJ4A 5KYUA 3TIFA 4ZHQA 3C16C 4PLVA 4FLMA 1V3VA 1JT2A 4MWOA 2HR1A 5LD2B 2FPGB 2YWGA 2AK2A 3TTXA 2JFGA 4M0MA 3HCAA 3S5UA 2X19A 3CVUA 4FNAA 3R74A 1C8BA 3EA4A 3M9LA 2RAUA 2V6BA 4EZBA 1YFLA 1OBCA 1VJ0A 4PO1A 5BT9A 4DBZA 4UTOA 4IY1A 1PU2A 3R3HA 4FCWA 4MJ3A 4JR1A 5DX1A 4F4FA 2C96A 2CMDA 4EGSA 1OGJA 1O2DA 3JQAA 1R5BA 2IUEA 4GL2A 3PUVA 1V8PA 2AEJA 3NWPA 1QOQB 3C3PA 2QRLA 1BMFA 1Q21A 1Y7TA 2W83A 5B6PA 3B1FA 4FCTA 4J9UE 4TV8A 3AO0B 3WS7A 3DFIA 3AHHA 2WJPA 3R7NA 4J0KA 1KVUA 2I2DA 1WBJB 1PYGA 2IUYA 1QTQA 4R2IA 4DAOA 3HJFA 4TKUB 1Y3DE 1P5JA 2D7DA 4WVFA 1CUVA 4GQBA 4RTOA 4ZJUA 1SXPA 5B1YA 1AQIA 3WMRA 3ZKWA 1WMEA 2FOIA 1KAMA 3G0CA 2NZUG 1BE1A 2VOJA 2W2XA 2YN4A 3B3AA 4I50F 2DG2A 2YUIA 4ZC8A 4LCEA 1LLQA 4TVSA 2WK1A 2P65A 4J03A 2SNIE 1JECA 1J09A 1U6JA 3OPXA 5KU7A 4WCFA 2A9VA 4F91B 1E7YA 2X4IA 2Q07A 3GDGA 3N2GA 4U9UA 2UVDA 1DAGA 3FTCA 3K9WA 1JU3A 4UUMA 5HZMA 2W70A 1V5WA 4UU7A 4AF8A 5JOQA 1JVNA 2DKNA 2ZU0C 3AJRA 1OX5A 3MVEA 3GEDA 4PEVA 1F2DA 4RTLA 3U4QA 5AKKA 2BCGY 1RS0A 2Q2WA 4QFCA 4A7PA 2IL1A 1QHHB 1PEKE 3W6NA 4G4GA 1LJUA 1QB8A 1NW6A 5FJIA 3SQWA 3T9CA 4TL9A 4J75A 1G41A 4R16A 3O95A 3I32A 4NAHA 4ARZB 1KEPA 3K2QA 1WSAA 4CT0A 4QGFA 3V7FA 1J8QA 3PIRA 3BL8A 3IO5A 3ZNNA 4K9PA 4CKBA 1LC3A 2Q3BA 2C03A 4LISA 1HYEA 1CV2A 3ECSA 5EHGA 5HE8A 1CZUA 1AS3A 5LM3A 4CIBA 4WJKB 1XJ5A 2MT9A 3V42A 2H85A 1YR1A 1LVHA 1KSFX 4HJRA 4DRXA 5TPZD 4WBNB 2FUCA 3RF6A 4HI0E 3IJPA 4MWBA 2QTFA 2FDXA 2OV4A 1CZOA 2R1ZA 4O3FA 4B4DA 4NU0A 2X9LA 4R2LA 2PCLA 3VBCA 1QANA 4DANA 1VC2A 5EXTA 2E55A 1QP7A 3SQMA 4KMOA 4EO4A 5DXAA 4YMHA 1J1ZA 4YDHB 1E2BA 5H4HA 3ZWMA 4FT4A 1Q0UA 2CJYA 5L40A 1EZ4A 3VZSA 5KVSA 2VNKA 2VQ3A 4MMZB 2GVDC 2YOFA 4ILEA 4QIHA 1GNPA 1JPUA 1D7OA 3RBXA 3UFXB 5BR4A 4W9NC 1CUWA 1LPNA 4KQEA 1KOJA 2AFRA 2QN7A 4F86A 3BOSA 1G6HA 3ZK8A 1YC2A 5FOWA 4GEKA 1E2MA 4A91A 1L6RA 1UWKA 2C7VA 4X1OA 4IWYA 1IPEA 1F4LA 2BM0A 3LUFA 4AYXA 4IDAA 1GUDA 5FP0A 4ZVVA 1EEHA 4GGPA 3NRBA 1IB6A 3JTMA 4JLOA 1FP6A 3RYCA 3R0QA 1XMOB 4U8GA 1PG5A 2ZBRA 1W48A 2A1UB 2ILTA 1XTJA 2XUIA 1KIAA 1RPAA 4RABA 4UTRA 4ARSA 2WQ7A 5KOHB 1LZKA 1DKUA 3IALA 3OF2A 4WK6A 5FT9A 4A0SA 3SG0A 2J9FB 2NQTA 3HBFA 1Y3IA 2GAFA 5GOTA 3R7LA 4E1VA 1CUUA 3GRRA 3BL6A 5BUSA 3FX2A 2A30A 4R3NA 3QHPA 2VIIA 1DUVG 2WMDA 1L9XA 1HLGA 3G9TA 1MC1A 4MZXA 5FPYA 2A9FA 3DDHA 1D09A 1KP2A 3HJTA 3I23A 4JJFA 4N0DA 4M1MA 2G08A 2VYCA 2I67A 3ENWA 2IT1A 2IEDA 1HE5A 3CIOA 4IGAA 1HTTA 5D3MB 4AUKA 4EUKA 4K9QA 2WJJA 2PGJA 2PRYA 3V8EA 4EW3A 3JV7A 2HLHA 4G5FA 4QXQA 2W8ZA 2Q3FA 1ZRMA 1L5HA 1ACJA 1GTMA 1M3SA 2IE0A 2Y76A 5L3VA 2DF8A 1XZNA 1DQYA 1I3NA 1PGNA 3EOZA 3FCAA 3HC7A 3M6LA 4NEHB 1N7IA 4G0VA 2JAQA 1E63A 3N6RA 4Q4DA 2VHJA 4TM7A 4BEJA 4ZZ3A 4RZIA 5JNTA 1X0VA 1EUCB 4TQ9A 5KO2A 3ZHZA 4MI9A 4LE1A 3TVYA 3PR3A 4IDNA 4KMSA 1A71A 5CT9A 3N2ZB 2YMMA 4A8JA 1P2VA 2FQQA 1PR6A 1GQQA 1ZG3A 1R88A 4XM1A 1ZITA 1QVRA 3I9KA 2IXFA 4DYDA 2JJ1A 4LJ5A 5IPFA 3MCTA 3DULA 1DE0A 1BZYA 2YFHA 3KQTA 5IVHA 2HQSA 3AL0C 3OOJA 2YJGA 4PINA 5ALPA 4BO7A 3ZZ1A 4FNMA 2NT4A 3UGQA 1ISMA 2HU5A 2OVFA 3LYAA 1KJZA 4MS1B 1N2XA 4R05A 3V1YA 1R00A 2XXJA 3CTMA 1QIIA 4ZICA 4AWAA 1F3OA 2ORYA 2Y66A 4LXGA 2B7BA 4D9GA 3WK9A 4S1PA 2NO9A 2Q6OA 3QBEA 3IC5A 4KMMA 3CZPA 4P36A 5EJAA 4F2HA 3ORQA 3AFMA 2A5JA 4O0LA 3E7FA 3H5NA 1W0KD 2A35A 4ZO8A 1NLFA 2O2YA 3IAM6 1U4OA 4L8LA 4UBLA 4HWOA 3GXOA 1SD1A 3VR1A 2NO6A 4C4TA 2X2PA 4P34A 4OJTA 4PFSA 2JGDA 3THYB 3F9CA 1ISHA 1WQ4A 2GD1O 3G5MA 5TIIA 1FFCA 2BFBB 4U7FA 2JGIA 1PJ3A 3QW2A 4LJSA 2VT2A 3W3AA 4TUYF 1GZ7A 3G7NA 4QXRA 5EHNA 1T5OA 2F9LA 2IOHA 2PSFA 2ID8A 4WXEA 3FOFC 2CKDA 2QUBA 4JYPA 1YQ9A 4PZ0A 1XV5A 5TQVA 3AESB 1I2DA 4OFZA 1TT7A 1MU0A 2J7PA 3H9CA 4XQ0A 1NUTA 1O0SA 4TL8A 5D01A 1Y8RB 5HKOA 2JIBA 3ZXUB 4TL6A 5A9SB 4MWTA 5HFAA 4B71A 4LHXA 1M34B 4EL5A 3AW9A 2J3MA 3LECA 4QJ3A 4YRJA 3SQLA 2QUIA 5IM4A 2JHAA 1OWNA 2EGHA 1V1MB 4N7BA 1EXDA 4UMVA 13PKA 4EEXA 5D86A 1V3TA 3MJDA 3V2UA 1KH2A 2VPXA 5LL6P 1NQ5A 3D9QX 4OHZA 3H9UA 3V4OA 4G81A 4F5DA 2W6NA 4YLYA 1XYYA 3BRCA 4GFDA 4WZBB 2UYQA 2VDJA 1XAIA 4EJ2A 3EVDA 3NTVA 1Z2EA 3MWEB 4JUBA 3N6XA 5LZ9A 1BMFD 4HNTA 1Q14A 1ADJA 4V03A 1JMKC 3PRJA 2GPSA 3DOIA 5C52B 3GT4A 4QUKA 4LXYA 1VLZA 4FDVA 1NG1A 2RBKA 4LYHA 5HUQA 2PTHA 2H92A 3EGWA 1D03A 3DG9A 4PG6A 1BQEA 2OG2A 4RPCA 2HLPA 4OLAA 3HJHA 4AP5A 1GTL1 4Q7QA 4ENWA 4K6HA 2PU7A 1JJAA 5JAMA 2EX1A 1NA5A 1N6KA 4WEQA 1D2CA 4EYGA 4YIHA 1QH1A 1PFGA 4WK0B 1QR2A 2OSBA 5F64A 4BMCA 3IVAA 2I29A 4AF6A 2VA8A 3A6ZA 4UKDA 1H0RA 3U16A 4IS2A 3DDOA 3EFHA 3FM9A 1QX3A 4CQMA 4ND6A 4RY0A 1KDVA 1VJTA 4MVWA 5ALNA 1YBFA 3RT1A 5FBKA 4F8EA 2W8BA 3JQBA 2MSKA 2GYUA 3B8EA 2B0JA 3DEHA 3OC0A 4J49A 4M21A 1KR5A 1S2IA 3ZHTA 4AULA 3W5CA 2EF0A 5HSGA 2QJTA 3VV2A 1N5LA 3F4LA 4GOND 3AU8A 1B6TA 3O8BA 2CD9A 1FFXB 1R8JA 3HSYA 3BDVA 3L7JA 4UM8B 5TNXA 1QMPA 4XRGA 4DLKA 4IEEA 3IOMA 1M72A 4MZDA 1VE5A 3WYEA 1V5IA 1SY7A 4B32A 4D8YA 5LD2C 4DIUA 5C18A 3UHFA 3LYHA 2QL9A 2FN4A 1ZIXA 3CUSA 2JDID 3ORHA 2XF8A 4ALJA 4D6PA 2AH5A 4PXYA 5J4HA 5MFPA 4F6RB 1PQUA 3AXSA 4F6LA 2CJFA 2YFKA 1WL8A 1E7SA 4PZUA 4FMCF 4YQEA 3LH5A 3JRWA 1PT9A 5KKCA 1M2NA 1RI1A 1TO1E 4FWBA 2Y1DA 3WB9A 3EUAA 5F98A 2I5PO 4W8OA 1PFYA 3O8LA 1RACA 4KR3A 1PD0A 2IPNA 3V7YA 3ZIAA 5JLJA 1U3UA 3OO0A 4LYJA 5AVTA 4DMHA 2GN1A 3GNTA 3ISVA 1E9SA 2V0GA 1LDYA 4AUMA 1OI7A 2FSVA 1YI8A 2O2HA 2YZ2A 3E48A 5HILA 1Y8AA 6LDHA 3M9WA 1LJ8A 4HGOA 3FCUB 3HGMA 4DY6A 1GA4A 1WPGA 3GFOA 3T3PB 1GRCA 3K2EA 4X6UA 4BQFA 3WKAA 3B5JA 2NUAA 3FWZA 4M0CA 2GFQA 4FN4A 4XQGA 5DK4A 3AF4A 3H2ZA 4C78A 1JDJA 2H54A 4EW6A 1PRYA 3A4LA 5LPNA 4CLXA 1ZCAA 2R7KA 2OFWA 1DBSA 2PN1A 2PO5A 3L7IA 4XGIA 2FPXA 2XYHA 3QOXA 1TRKA 3MGCA 4TLAA 5LBTA 2WJIA 4DDTA 4IGFA 1EAMA 4M8KA 4MUMA 2C78A 2XECA 5AJVB 5AHKA 4RD2A 4RTMA 3CV3A 1E62A 2R6FA 1NATA 3UV7A 2PZAA 4BKQA 4AUNA 1PJAA 2UUAB 5FR2A 3PDIA 2ZS7A 2ASEA 4BNWA 4A1FA 1RYBA 2FMKA 3W1EA 4B35A 4E31A 4ZYZA 5IC5A 3SFTA 4AJIA 1SGWA 2JLRA 3ZKWB 4F84A 1DX6A 1ZX1A 1K68A 5DGCA 5FNZA 3DAHA 1FPQA 1XZBA 3IB6A 4NWIA 3T5PA 1YRQA 4MPTA 1QP4A 2O54A 4DLNA 3T9AA 1DAOA 1QBKC 1WWKA 4L7VA 3ICPA 3CF6R 4REOA 1FFGA 3UPDA 5ARBA 5C1OA 4TL7A 3S81A 1LH0A 4MA0A 4WCFB 1CJVC 5D1HA 4I6GA 1O94C 4OBBA 4OXYA 8OHMA 1X86B 4JKOA 4C0WA 2GN6A 5F3DA 2VF7A 1IRXA 3KD2A 4KAFA 1E9RA 4H7DA 1C1DA 4JLSA 1LLCA 3AJDA 3DF7A 1MB9A 2IYVA 2IKSA 4I9UA 3V8QA 1GGMA 3B1KA 4B0OA 4DLPA 3AIKA 4EWLA 4M3NA 2ODNA 2YICA 3A9TA 4IJWA 3KZNA 2F8MA 4B8WA 1WB5A 5HCNA 3O73A 4FR0A 4NCIA 4KZKA 4IOLA 3GEGA 3OLXA 4XSHA 3A4IA 4MYDA