1IY8A

Crystal structure of levodione reductase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
258
structure length
258
Chain Sequence
RFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAPDAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIEGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPENPRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure and Stereospecificity of Levodione Reductase from Corynebacterium aquaticum M-13
pubmed doi rcsb
source organism Leifsonia aquatica
molecule tags Oxidoreductase
molecule keywords LEVODIONE REDUCTASE
total genus 101
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1iy8A00
3WS7A 1U3TA 2QZ9A 3GPIA 5KJEA 3U3XA 3WQQA 2RAFA 1EBUA 3FR7A 4YAKA 4M89A 3LT1A 4ALNA 5A03A 2C5EA 3MOGA 2O2YA 4P22A 1ORRA 4INAA 2X9NA 5JAMA 4W4TA 2Y68A 3FBTA 3GMDA 1NVTA 1E7WA 1J5PA 5AVOA 4E32A 1A7AA 2UUOA 3NT4A 4FFNA 3ZU2A 4YPOA 1PJCA 2WMDA 2I9PA 2IZ0A 3JTMA 4EEZA 1ZW1A 3H9EO 3KM0A 3F6YA 2OUIA 3QE3A 4NU5A 2HMTA 4GX2A 5JSFA 3W8DA 4YB8A 4W9NA 2POQX 1Z7EA 3VH2A 1ZK2A 2VYVD 4WLOA 4K6CA 4I5EA 3ZHZA 4W7IA 1E3EA 1LI4A 1B3RA 2JFGA 3ZN2A 1LTHR 2W2KB 4R51A 1U2DA 1ZO8A 2R00A 1VSVA 3IJRA 3ZNQA 1LDYA 5IZ4A 4J9VA 4CMEA 2PKRA 4PLGA 1CQJA 3ZV4A 2C2YA 4EJMA 3IC5A 4YJHA 4E5KA 3D3EA 3ABIA 1YJQA 2V6GA 3VTFA 3OFSA 2ZTUA 2DVMA 2VT2A 1Z45A 4KWHA 1NTOA 1EDOA 3WGHA 3S1LA 1NVMB 4Q39A 3WQRA 4DMMA 2I99A 3OJEA 3DAGA 1F0YA 4ZGWA 2FRDA 3TZQA 3NDRA 4M8SA 3O26A 1JKIA 1YB1A 4PG8A 1Q2XA 3GVXA 4NR0A 1T4DA 4BQPA 4WCFA 1E7QA 3Q2KA 1DRVA 4D44A 1P1FA 1NPDA 1GYPA 3TOXA 4TRRA 3GLQA 4URFA 4EDFA 1SPXA 4OYRA 2O4UX 3VHRA 2JFFA 4NPCA 2YV2A 4E2WA 2LDXA 2IXBA 3M1LA 4J2HA 3KVOA 4LVUA 3ZWWA 1QLHA 2PD4A 4Q3BA 3KYCA 4LW8A 4D42A 1M6WA 4E2ZA 1LRLA 3K5PA 4WPGA 3F4LA 1S7CA 2VN8A 1P0CA 1FDTA 2VUTA 4PLYA 5JDCA 1ZMOA 4UUOA 4BKOA 2WD7A 3TFOA 2J5KA 4IM7A 4MVJI 2EWMA 4E2XA 3ROKA 1E3IA 4XZ3A 3PK0A 4FSHA 4XKJA 1IZ0A 2BLLA 2I67A 1R37A 1ZK3A 3WFJA 2JAHA 3IQDB 3LC2O 3PQEA 1FDWA 4OOFA 1Y8RB 3HQ4O 2PH3A 2JL1A 4XQEA 2WJPA 1NHGA 5AXBA 3V5NA 3ETDA 3P5SA 4AJPA 4RVDA 2VUSA 3DTYA 3FNGA 3L4SO 1EQ2A 3M2TA 4XB1A 5ADHA 2PZMA 1DIRA 3EGOA 4B3HA 2E37A 1SAYA 2EG9A 4RLHA 2QHXA 2UDPA 4PFJA 1KY4A 4TRNA 4BKUA 1TEHA 2PGLA 4HWKA 4N5NA 2Y1EA 4YT5A 4BNJA 5IF3A 1F8GA 1ISJA 1PQWA 4ZRMA 4H3VA 5KVCA 1R16A 2JCYA 1V3UA 2P9CA 4YA6A 4QO8A 3JD2A 1Z74A 2ZB7A 2DTXA 3KUXA 3H8VA 5DT9A 1GYQA 1ADGA 2CFCA 4PIVA 5KVVA 1OBFO 4ZHSA 2PLAA 4FGSA 5TIIA 3KEQA 1P1HA 1R4NB 4JP2A 1UJMA 2B5WA 3ZDFA 3FNEA 1XR3A 3E82A 2VWGA 2OZPA 2PKQP 5KJFA 3C7CB 4OGWA 3I23A 4J1TA 2VZ0A 5TSDA 4P4LA 4E0BA 4TROA 3LYLA 3GNQA 4IS2A 4OKNA 4ALIA 1KEUA 1MXHA 1X13A 3L07A 4BNHA 4RLSA 3FR8A 2P68A 5L7YA 4TQGA 1J0XO 4FDAA 1P1IA 2Y0EA 2X7HA 4GX0A 4JCOA 3HSKA 3LT2A 4KTTE 1WXDA 1QYDA 1ISMA 2ZYDA 4TSKA 1QRRA 2VZ9A 1UXGA 3B6ZA 4QSMA 1XA0A 2X6TA 4U6QA 3NT2A 3OIGA 4BNWA 3ZGYA 4U8GA 3WYEA 5CPFA 2VHXA 4DXHA 3V2GA 2EF1A 5BQFA 4BNUA 3RC2A 4XYLA 5JW6A 1PGOA 5JC8A 3MTJA 7MDHA 4YDRA 3KYBA 3GN1A 3I9JA 1KEVA 3KTDA 3GMSA 3ANNA 3INTA 3DR3A 4MJLA 1IHYA 3VDQA 3NRCA 1T2DA 1ONPA 3ZHBA 1DC6A 3O9ZA 1F06A 3BHMA 3K2BA 2NVWA 4YYZA 2O3TA 3L9XA 3H9GA 2VQ3A 4MVJF 4RGBA 1T24A 3W6ZA 2VRCD 3DZKA 3UCXA 1WDLA 3GNTA 4YRBA 1D8AA 2JHFA 5IDYA 3TZ6A 1EE9A 1WAMA 1AHHA 2NTNA 3OJFA 1NAIA 3DFUA 3IUSA 4QEDA 4LVCA 4A2CA 3KSUA 1YWGO 3U4IA 1SZJG 5K9ZA 4AJKA 4HFJA 4CQMD 1L1FA 2BMAA 1PJ3A 1R4MA 1QYXA 4NDNE 3JQ9A 2E82A 3BMCB 5CAEA 3JD1A 5K6AC 1YB5A 1M6HA 3VPGA 5ILOA 3PHLA 2VOEA 1LEHA 3CPSA 3OSUA 2VTDA 5FF9A 4AG3A 2O3UA 3NEPX 1VE9A 1E5LA 4GSKA 1DBVO 4OXNA 3WX0A 2YHIA 4B4WA 5LDGA 2RHCA 3AFNA 1JW9B 1NM5A 2NQ8A 1ONOA 4GMGA 1KC1A 3QWIA 3ZI0A 2C29D 1E0DA 2QRKA 3DXFA 1W0CA 3OA2A 5L4SA 1Q0HA 4L73A 4R4JA 3DOOA 4O63O 1T1RA 4GMFA 1DSSG 4RPJA 2VWPA 5DBGA 3D3WB 1E1NA 1AE1A 4IZIA 4XX0A 4BNXA 5T5QA 3NGLA 4YAJA 3NT5A 1Q0QA 5HWSA 4PLPA 4YJDA 5L51A 5HM8A 3HB5X 4GGOA 4RL6A 4XJSA 3VZSA 1ZBQA 4NNJA 3GQVA 3DL2A 2GN4A 4XR9A 4TKLA 3PQFA 2NVUB 1HKUA 2ZTMA 1ENZA 1O9BA 1HYEA 3V2UA 4RQTA 3NDIA 1MV8A 1JVBA 1LDNA 4GL4A 5CDUA 5HTOA 3H5RA 3EZLA 1F14A 1W8DA 1ZJYA 4OJNA 4W6ZA 2I3GA 3K2EA 5EINA 3GEGA 3W1VA 3ZNPA 1UDBA 3FWZA 5T8KA 1FF9A 5L45A 4M87A 1ZEJA 4WKGA 5KJ6A 1ZH8A 2GYYA 1E1KA 1X7DA 4J0FA 3T4EA 2NV6A 3O8QB 4BGEA 3NTRA 2Y93A 1EEHA 1U3VA 1XQ1A 3UKOA 5TGDA 3PYMA 4IUYA 4MVJH 3ZH2A 4E6PA 1BXGB 3KYCB 3DO5A 2DPHA 2Q4EA 2Y1OA 1DC4A 3PFFA 3OQ6A 4RZIA 3QWFA 3L9WA 5TQVA 1P77A 3DOCA 4IDAA 1ADFA 1D4FA 2WSBA 1YGYA 3GDGA 3TZCA 3KOUA 4J43A 3UHAA 3PYXA 1NX6A 1DC3A 4FFOA 5MGBA 4TZTA 4IDBA 1GZ3A 5IFLA 1IOLA 1N7GA 1WVGA 1I2ZA 3RBZA 1J4AA 3ANLA 4Z0TA 4BB5A 4HNGA 2RCYA 4M55A 4JROA 1DJQA 1YOVB 1YKFA 3D5TA 3ROMA 3AY3A 4HY3A 2WD8A 4MVJM 4RVFA 3WGOA 5L7TA 1ENYA 1LC3A 2QG4A 4BV9A 1IE3A 4AJHA 4BO9A 4D0RA 4R3NA 4DBVO 3JYPA 4N18A 1HYGA 4ND1A 4OOEA 4CLXA 2VHYA 3W4JA 3K30A 3FCOA 1YQGA 4TZKA 3JYLA 2PV7A 5FFFA 4KMSA 3W8EA 1W4ZA 4DIBA 5DBIA 4MVJP 5EL0A 1P33A 5KIAA 4B4VA 4BNYA 4GLOA 3UFXA 4F45A 3JQBC 1EUCA 2I66A 4CQLA 3X2EA 5TJ9A 1VRWA 1QXSA 1T25A 2JD2A 5G4LA 2PH5A 2DFVA 3BYZA 3MJSA 2IZZA 1NYTA 1KETA 1GPDG 4I5FA 2FR1A 3H5NA 2BGKA 4LCEA 4JGBA 4GVXA 4PG5A 4J9UE 3OETA 5DNAA 2QYSA 5DCWA 3GAZA 5TS3A 3KRTA 3NGXA 1OC4A 4ZD6A 5KKCA 1U5CA 2X22A 1R66A 4RPGA 2AMFA 4Z0PA 4II2A 2QX7A 1PWXA 3N74A 4J1NA 3DFZA 2YDYA 3KXDA 4WOJA 2D1YA 1H0KA 3PLRA 1GU7A 3TN7A 1VPDA 3SEFA 4CM9D 4FPXA 1DRUA 3PIDA 2OP0A 2Q46A 1YJ8A 3ENKA 3KEOA 1GEGA 3K92A 4XCVA 2VWQA 4K6FA 1P31A 1C1XA 2P9EA 4PLZA 3ON5A 1VJ1A 2I6TA 2IEBA 3MJ4A 1K6JA 3WYCA 3DZGA 1LRKA 1VL0A 3UF0A 1XELA 3B70A 3PHGA 4PVDA 4NMHA 5CEEA 3HDHA 1IUKA 3ROQA 3IP1A 1DFHA 2DKNA 4FW8A 2OHXA 3S2FA 3PPIA 5DDIP 3TJRA 4ALMA 4ALLA 3I9LA 2YZ7A 2NQTA 3GEDA 1Z73A 3DBRB 1ZMTA 2UYYA 3BHJA 5JYDA 4M86A 1U1IA 4AJEA 4HUJA 4IDFA 4BNGA 2VHWA 4WE3A 3OECA 3G17A 4MVJD 1U8FO 2Q50A 5FI3A 2IODA 2PD6A 1XLTA 4RQUA 5DBFA 1ENOA 3K31A 4UVEA 5JDIC 4FC6A 3GPDG 1MUUA 4W9NC 4LMRA 4CMIA 1B26A 1HTBA 3OHSX 4R5MA 1PZHA 4JJGA 4A7PA 1EVZA 1YE3A 1HSZA 2PA3A 1X0VA 4FOSA 2I76A 2UV8A 3BIOA 5L3ZA 1B8PA 4WLVA 4OXYA 2IEDA 5FWNA 5JBIA 4CM4A 5ITWA 4ND4A 3ZWCA 2A35A 1DB3A 4BNZA 5THQA 3E48A 2YFHA 3UUWA 2O7SA 4HP8A 1GV0A 5JCJD 1RYDA 5FEUA 4Y8VA 1E7YA 1JKJA 3F5SA 3MEQA 2QRLA 3E9NA 3QW2A 3WIEA 4NFHA 3SVTA 2XXBA 1PWZA 3A28A 3TRIA 4BUCA 1YXMA 1E3WB 4FCCA 3OA0A 4B4OA 2C59A 2DFDA 3KSDO 4I9UA 4DC1A 4YXFA 1NBOA 4R3WA 3BMCA 2B35A 1HSOA 2HJSA 4JBIA 1ZSNA 2VOJA 2GZ1A 5JDCC 1WMAA 3MJEA 4PZEA 2C7VA 2QQ5A 3WIDA 1BDMA 1MLDA 1MFPA 1QR6A 2RHRA 3WMWA 1H6DA 1NXQA 4DLBA 5EESA 3AM3A 5EMHA 3BMOB 3G79A 1M75A 4EITA 4B8WA 1ADBA 3DZBA 4E2YA 1M66A 2OGUA 4Z0HO 4NJMA 2GN6A 3RJ5A 2PWZA 1GR0A 2VNSA 4KWIA 1UP6A 3UCFA 2HUNA 3DB2A 4MINA 3ZV3A 1QLJA 2D0IA 4KUGA 4YAEA 2O7QA 4M49A 4N5MA 3WSVA 4OMUA 4ZQBA 1Z75A 4Q9NA 5U9CA 1HDXA 1JWAB 3EZYA 3GHHA 4QQRA 4K1LA 3S2EA 4PLWA 3RUDA 3W4IA 4B3IA 4CM6A 3H5AA 4PZDA 4BQRA 1IYZA 2YJZA 5COBA 2B83A 1VC2A 3U4HA 1HDYA 1RM4A 2O3RA 4KUEA 5LC1A 3ZHYA 3R3SA 4JK3A 3EHEA 1U8XX 2J3HA 5CEFA 1DDOA 2C07A 4GKBA 2D5CA 3ASUA 1WDMA 3ZWNA 5KJCA 5DCYA 3RJ9A 1H9BA 4I5GA 1E7SA 1C0LA 4WCDA 2JFHA 3HDYA 3KYDA 1GQQA 4ND2A 3WOHA 5G0TA 3BHIA 3CMCO 2CD9A 4I08A 3RFTA 3HE3A 2RBEA 5COQA 4J4TA 1MGOA 2EJVA 2QIOA 3S8MA 4UEKA 5DP2A 4JP3A 3RUIA 3MZ0A 3SXPA 3WTCA 2YYYA 3I6QA 1YQDA 3E9QA 4EZBA 1DXYA 1OAAA 2J3JA 2NU9A 2FY8A 4AICA 1GFSA 5IDXA 1PZEA 4BVAA 3QHAA 4CR8A 4HFMA 2HJRA 5A3VA 3Q6IA 3O38A 4BHTA 2NWQA 4D3SA 3HB4X 2GF2A 4XJTA 4Z9YA 3B1KA 4E5PA 3JQ8B 1XQ6A 4AJ1A 5EERA 4R41A 4CUKA 3B20A 1DEHA 4NZ9A 3DMYA 1NQ5A 1ZK4A 3JQ7B 3UN1A 3K9QO 3ULKA 4LN1A 4CM7A 1LJ8A 3ONEA 2YHIB 4N5LA 4E5NA 4XGIA 2GPTA 1EDZA 2NADA 4YQZA 3A1NA 3WLEA 1YVEI 2E49A 5F21A 4A03A 2IYOA 5U1PA 1B15A 4ID9A 5JPIA 4IQ0A 5EPOA 3D7LA 4KP7A 2ZATA 4Y6RA 3U9LA 4ALJA 1UDAA 3WMXA 3HUDA 2ZCUA 2ZB3A 1CQIA 1YDWA 2PK3A 1ENPA 5DN9A 3RUEA 1KVRA 4ZICA 4CLOA 3UICA 3OH8A 4AL4A 1I2BA 1R6DA 3M2PA 4I1IA 5CEJA 1X0XA 2VYVA 3FWNA 4S1VA 4YJGA 4RJTA 3IUPA 3DZHA 4MDHA 4TRJA 2JJYA 5G4KB 3IIEA 4WLUA 3AWDA 3SC6A 1PL7A 2OORA 4O6VA 4FC7A 6LDHA 1LX6A 4WEOA 4CV0A 2FR0A 1N1GA 3R1IA 3NJ8A 3MCVA 1PJBA 1PSDA 3GAFA 4MIYA 3LU1A 1JDJA 1PS8A 1E6WA 4IY1A 4XEHA 3ANMA 5HRUA 1KY5A 4UVGA 4A73A 3IKVA 2BI7A 2CVQA 3G1TA 4PGFA 2NU8A 2XOXA 3Q9NA 2O3JA 3NYWA 4ZQEA 1P3DA 4J7XA 4R1SA 1V0JA 4YWJA 4RZHA 3PGXA 1XSEA 4I9HA 3BTVA 3L77A 3ZWPA 1ZXBA 4DPLA 4B79A 4D79A 1KS9A 5JS6A 1EK5A 4EUHA 2P5UA 2PZKA 5DP1A 1P1RA 2CVZA 3IDSA 4IXWA 2EW2A 2O23A 4HXYA 5TT0A 3WBBA 3TL2A 1CF2O 3TNLA 3BTSA 3LZ6A 1CETA 2FWMX 1IB6A 2ILTA 4UVDA 1VSUA 2H6EA 3EVTA 3F1KA 4D45A 3AOGA 3I83A 5T8KC 3WG9A 4NG5A 1ZJZA 3MJTA 1X1EA 4YAGA 2DLDA 4CMHA 3QVSA 1LLDA 3L0DA 4WOKA 3FNHA 4CMGA 3C8MA 1NR1A 1ISGA 1HDZA 3QRWA 3GHYA 5KKAA 1WMBA 1WNTA 2PKQO 2H1SA 2VTEA 3L4BA 3ZV6A 5I9LA 4DYDA 1N5DA 1GADO 2X5OA 4A0SA 4I5DA 3VZPA 4Q3DA 4DA9A 2JAPA 3E03A 2B0JA 3VTZA 3GOHA 1PJQA 5K0ZA 3C7DB 4ZQHA 4NBWA 3FRJA 2WE8A 2NVBA 2I65A 2CF6A 3E5MA 4MIOA 1DAPA 3ENNA 3ICPA 3E9MA 2QW8A 3HJAA 1GZ4A 2BFPA 4G81A 1YB4A 4Y6SA 2WDZA 2EKPA 3PGJA 3F9IA 3QP9A 4DIOA 4EUEA 1LSOA 2HDHA 4FJ0A 4O1MA 1P74A 2AXQA 5AOVA 3C1TA 2YW9A 3Q2IA 3ASVA 2GASA 4MOWA 5C3MA 3AY7A 4Y9DA 1A71A 1NASA 4LK3A 1PTJA 1CIVA 1RKXA 2NLOA 3CZMA 2DAPA 3NTOA 2OO5A 3P2YA 3PJFA 3PI7A 5BT9A 4IJUA 1PZFA 3PTZA 2FN7A 1A4IA 4FOOA 2GRAA 4BGIA 1I3MA 4DL9A 4OIMA 4YEDA 2IDZA 2ZKLA 4JX8A 2DM6A 4FBGA 3ZWYA 5B4TA 1C0KA 3FN4A 3M1AA 3EMKA 4PLCA 4XYEA 3AW9A 3DZJA 3U49A 1JTVA 1O5IA 4FFMA 4L9RA 1PS0A 4J0EA 4FIZA 1FDSA 4RO0A 3SX2A 3DBHB 4IDCA 1CERA 1H9AA 3VH1A 1ZK1A 4YAIA 1FDVA 1PGJA 2AA3A 3JQEA 1C0PA 1U2GA 3GUYA 3UW3A 4L76A 3JQAA 4UVHA 1S6YA 1U5AA 3LSYA 3RCBA 3WGGA 1E3JA 5C7LO 1UAYA 2TMDA 3DAPA 2Y99A 3HFGA 4XWYA 4CMJA 1PJLA 4N7RA 1R15A 5IXSA 2YV3A 3WR5A 2NM0A 1ZUD1 4CUJA 4AJOA 1C1XB 4BO2A 4NI5A 4AVYA 4DPKA 1D7OA 5AYVA 1Q7GA 1T1SA 1QYWA 3I3OA 3DBLB 2CZCA 3OBBA 1P44A 2J8ZA 1BW9B 3H6KA 2CSUA 1X1TA 1QV7A 1YDEA 3EY4A 3DBHA 3FTNA 3ONDA 4L74A 3RI3A 3OQBA 4OQYA 2GZ2A 5A5EA 1UZNA 3Q1LA 2GSDA 4XQGA 4NBVA 1LRJA 1RJWA 4Z6KA 5L9AA 3O4RA 1NFQA 2EGGA 1U3WA 1A4UA 2LDBA 1JVSA 1NWCA 1M67A 2F00A 1LLUA 4BNTA 4YJHB 4IJVA 2JHGA 3WWYA 2NU6A 5FYDA 3H9JA 3IL2A 4EW6A 4R68A 1HZZA 4IGEA 3AI2A 5J23A 5DZSA 1NNUA 2HMSA 2IYPA 3AFMA 4YTEA 1LLCA 3ZWBA 3QVXA 3VPFA 2V6BA 1BG6A 4W7HA 2ZYGA 4CV1A 3F1LA 4YR9A 3DZFA 2VUUA 3VH3A 4OSOA 4CMBA 4F6CA 4BO7A 4FQ8A 4CQLB 4BO0A 3U0BA 3I4FA 1PEDA 5F3RA 2C7GA 1PR9A 3GRKA 1JKFA 4MKRA 1V3VA 1O0SA 5TT1A 3VVCA 3GFGA 2X0IA 3PWKA 4AFNA 2SCUA 3OEWA 4W82A 3GZNB 1ONNA 4JJFA 3PQDA 3NV9A 4KOAA 3DOJA 1TT5A 3WJ7A 4CMKA 1U9JA 4OSPA 1Q7CA 1J6UA 2FPIA 1EMDA 3T7CA 2DC1A 3VH4A 1LC0A 1AN9A 3UCEA 4XYBA 1X15A 3VOSA 1E7MA 1ML3A 5B12A 3HWRA 2ZJ1A 1K6IA 4R1NA 1EQUA 4NBUA 3AOEC 3RD5A 1YL5A 2AQIA 4QUKA 2PGDA 2IZ1A 5IJZA 2Q1UA 3SJ7A 4GWGA 2X86A 1E6UA 4Q3CA 3GR6A 4XRRA 2OBYA 4AJIA 2O2SA 2VRBA 1CWUA 4KZPA 4E31A 1CRWG 2D2IA 5FI5A 1P0FA 4FD3A 4FJ2A 3EDMA 5G0VA 4MIEA 1Q1NA 1N9GA 1QMGA 4L4XA 5AXCA 3P2OA 4NFSA 3ICCA 4FR5A 4B8ZA 4JNKA 4NBRA 4R1TA 2HRBA 5U4QA 4HBGA 2FMUA 3JQGB 1CDOA 2GLXA 4CMAA 1W73A 2HMVA 4J6FA 1KEWA 3IOYA 4ESOA 2GNAA 1GEEA 4YT8A 2D4AA 1RWBA 1GYRA 4K26A 4RF5A 1F8FA 3I9MA 2YHUA 2F1KA 3GGGA 3GNSA 2FZWA 3BZUA 5C7IO 3VKVA 4BOYA 4E5MA 2OBNA 3JYQA 2IXAA 4ZRNA 2X5KO 1GCOA 1ZKMA 3STHA 1B16A 1KVUA 3HG7A 4IZHA 3GT0A 3TF5A 3RUCA 1WZIA 2BELA 4DQXA 4R5HA 5BR7A 3S55A 3INRA 4XIJA 5GY7A 2Y1FA 4OQZA 4CLRB 2WWRA 1PL8A 3RKRA 3WDSA 1JWBB 4EJ6A 3JQFA 3WJAA 4PN3A 3R6DA 1O89A 1BVRA 1RYEA 4MO2A 5IG2A 2I3AA 1GV1A 3FD8A 4DPMA 2HO5A 1H93A 1UP7A 5CDGA 5A1TA 3V2HA 5BSEA 3I52A 3U4DA 4BMSA 1B0AA 3TQHA 1DAOA 2Y1CA 1T2FA 4CM9A 2A92A 1A27A 2EKQA 4Y67A 2DBQA 1NFRA 1JN0A 5KWEA 4RDIA 4HADA 4CMEC 2GUGA 4BNFA 3GVIA 1E5QA 1JU9A 2B5VA 5IAAA 3L6DA 3WLFA 4D7AA 3BMQB 1VL6A 4ITUA 2D8AA 3BMQA 1U7TA 5BSGA 4RPHA 1GZ6A 2Y05A 3PHJA 3DDNA 3M6IA 3PZBA 1IULA 2YV1A 4WECA 4IIVA 3AU8A 3LT0A 1YBMA 1Y5RA 3JQ6A 4OM8A 3JQFC 4WGGA 1K6XA 2R00C 4XYGA 4E5YA 4R9SA 1BXGA 1MP0A 3S2GA 2X1HA 1ZVMA 5KVQA 4PVCA 4CLOB 4MKZA 3LQFA 1UXIA 5I7SA 1A9YA 4FJ1A 1I3LA 4PG4A 2G76A 3DZIA 1TI7A 1E1MA 2O50A 4GPD1 1E7RA 1MXFA 2HMWA 1PQPA 1SOWA 2GD1O 2GDZA 4J1SA 1HETA 5JAZA 3WNVA 4EBFA 1RM0A 1MG5A 1SO8A 3ZHXA 5AXDA 2DUUA 3H2ZA 1KEPA 4BO1A 1RPNA 4P38A 3VKUA 1YH3A 2B69A 2IRWA 1NPYA 2FPPA 2VWHA 5I7FA 1G1AA 5I9NA 3DQPA 4QXMA 3DBRA 3BAZA 4TVBA 3KYDB 2GR9A 1T2CA 2EHDA 2FP4A 3FNFA 4HX5A 4J91A 5ES3A 2DQ4A 3H3FA 3CKYA 3QVWA 4ROSA 1PGPA 1Z6ZA 2AE1A 3K73O 4ONEA 4QTZA 1YBAA 3G3EA 3QIVA 4AJJA 3QSGA 2EEZA 1H6AA 2CVOA 1JAXA 1D1TA 2J6IA 2X0NA 1R4MB 1Y81A 5JC1A 1NPTO 4PCVA 5ENDA 2ZB8A 2X4GA 1VL8A 4KTVE 4FFLA 1VLLA 1P1KA 4Z3KA 5TRTA 3ZWVA 3RBVA 2H9IA 5LDHA 2WYWA 4KUHA 4CR6A 1QYCA 4IS3A 1LSJA 2WM3A 3PDJA 3WB9A 4LGVA 1KOLA 1DIAA 4EYEA 2CMDA 4W99A 3VPXA 3WSWA 4WJZA 1MFZA 2AG5A 4GX5A 4WLNA 4WNCA 5G0SA 4NQZA 4UUPA 5K6AA 2BFAA 1PU2A 2J5QA 4H16A 2VT3A 3WICA 4XRGA 2OFPA 4ZN6A 2C54A 5KTKA 3W4KA 3W6UA 3U09A 1QG6A 5COAA 3O03A 2W98A 2GZ3A 1MC5A 3ZWMA 1I36A 3KB6A 4TKMA 1N9GB 2CDAA 1VI2A 1JAYA 4RF4A 3GN2A 3EC7A 4MVJA 5TX7A 5L53A 2ZQZA 4L0QA 5DOVA 4FN4A 4QX6A 3E6AA 5DF1A 5JCXA 3ZWXA 1ZSYA 2W4QA 5F5NA 4BO3A 1HDRA 3C1OA 2JKVA 4BS9A 4GVLA 5GZ6A 1MA0A 1D3AA 2JCVA 4NJMB 3RBXA 5GZ1A 2BD0A 4B7CA 3V8BA 4XDZA 1E77A 4J90A 1DIGA 1N1EA 3ZWOA 5KOIA 1BSVA 3GUCA 5A5FA 3BMNB 3LF2A 2HK7A 2NSDA 2Y1GA 4MPDA 4JIGA 3AU9A 3Q3CA 2QZZA 3CUKA 1E92A 4E13A 2ZK7A 3ZU4A 4J2OA 2GN9A 4BNNA 3GVPA 3ZWAA 5I9MA 4JJIA 1OOEA 5JCJA 3K8ZA 1I24A 4PLHA 2GGSA 5DCUA 3MWDB 5IDWA 5ICMA 5CG2A 1B14A 1KVQA 2G1UA 1D1SA 2DTDA 1NQAO 3JD0A 4DBZA 2DT5A 1BXZA 3ZCXA 1ISFA 3E5RA 4L4RA 1YS4A 2BHLA 4UVIA 2P5YA 5IXYA 6ADHA 2W2LD 3EK2A 4LISA 1NWHA 4O59O 3F5QA 2JCXA 3D1LA 3QJ5A 3NDJA 3QY9A 3QLJA 3JV7A 4GQAA 1XCBA 1KVSA 2C2XA 2D59A 3AY6A 3I9KA 4X54A 5JAQA 1DPGA 4D46A 2X5JO 1HZJA 5IN4A 2PD3A 3PXXA 2OXIA 2FHSA 2G0TA 5JDIA 1H2HA 1LLQA 4P4GA 4C7JA 1BWSA 4B7UA 3ITKA 1Y8QB 2DTEA 4H15A 1Y8QA 4YT4A 3WGYA 1UZLA 1QP8A 5L4LA 3PDUA 4HFNA 5JMWA 3PHHA 2YQ4A 1PQUA 2X0JA 1KVTA 3TZKA 1WDKA 5A04A 3LDHA 4PZCA 3RKUA 4BKRA 1NQOA 3D5QA 1CEQA 1EFKA 3IMFA 4RVHA 5G2OA 5T6BA 1EVIA 5HBRA 4BNMA 1V9LA 3DBLA 3VVBA 1I10A 3CTMA 2ZYAA 4IGFA 4MVJE 5LCXA 3QQPA 1HWYA 3V1YA 5CDSA 2Q4BA 3P19A 3ORFA 4KDFA 3V1TC 4IJWA 1ZEMA 1PJ4A 1XU7A 3WQSB 3QVOA 5ITVA 1GDHA 1IZ9A 2D5AA 4LMPA 1Z82A 3P7MA 2HCTA 4CODB 5CP8A 3OQ1A 4DWVA 1P45A 1SNYA 3CE6A 2UUPA 3F47A 3RU7A 4UUMA 5F1KA 1FMCA 4F6LA 4D3FA 3ZNOA 4FFPA 1HE5A 2Q49A 1OZAA 3EAGA 2WE7A 2PFGA 5CDYA 2Q3EA 2ZJ0A 1BDBA 2Y0DA 3MJCA 4RPKA 1N8KA 4CMCA 4YJFB 4CM8A 3JQ7A 1GUFA 2HK8A 4IQ8A 5ILGA 1C3VA 2X8LA 2HQ1A 4H7PA 4S3MA 1GQYA 4OXKA 1C0IA 1V3TA 1H6BA 4J49A 5IZCC 3PLNA 4G2NA 3CEAA 3E18A 3JQDA 4JBGA 3TOZA 2PZJA 1I01A 4BL5A 5GZ3A 4IIUA 4DVJA 4RVSA 4JQCA 4MP3A 4WEQA 4BO6A 1WWKA 1I32A 2DBVO 1OFGA 4L8VA 4U0JA 3LT4A 3DHYA 3Q11A 3ZW9A 4Z9XA 2ZTLA 3FPCA 4NFYA 1YOVA 1X7GA 2Z1NA 1LDMA 5A06A 3WGZA 4R1UA 4EGFA 2P4HX 2V7PA 1X14A 2Z1MA 5AXAA 1YRLA 2B4RO 4CV3A 5JLAA 2DU8A 1XHLA 4BNIA 3WGQA 3A9WA 1CYDA 3VC7A 1IY8A 3QWAA 4XB2A 4Q3EA 3F46A 1RM5A 3NAQA 1ZIDA 2EKLA 1JA9A 1Y9AA 1Z7BA 1U4SA 3C85A 4M54A 2YY7A 2PR2A 3DTTA 4YBZA 4BKQA 1X7HA 5BSFA 2EJWA 3HN2A 1QSGA 4BNVA 8ADHA 3H4VA 4PG6A 1BMDA 2AEFA 3SLKA 3MWEB 4XQCA 4IBOA 4YCAA 2E6UX 4FB5A 4YJGB 4E33A 1A72A 1PX0A 3OIFA 2GN8A 2R6JA 3TWOA 2Q2WA 3N7UA 3OM9A 1UUFA 5C5IA 2PNFA 2P2SA 3ST7A 1PS9A 4A5OA 4IXTA 1DFGA 5CHEA 1N92A 3OJOA 8LDHA 1XWFA 2J3KA 5B37A 4A26A 1LSSA 3D4PA 4CV2A 2Q2QA 4ND5A 5TNXA 1SC6A 2PY6A 4E4YA 2Z95A 2ZTVA 1Q7BA 1PJSA 2WEKA 4HKTA 5G4KA 1TA4A 5CDTA 4CLEA 4U7WA 3AI3A 3SBOA 4A10A 4Q3NA 1QV6A 1B7GO 1ISHA 1QORA 5KVSA 1Y9EA 2B37A 3JQAD 2Q1SA 4RDHA 3SC4A 1LDGA 4LSMA 1XG5A 3GDFA 4UEJA 1F17A 5HA5A 3K96A 5I8ZA 2EIHA 1XEAA 3HADA 3D4OA 3B1FA 4MP6A 1EVJA 1FK8A 3A14A 5A9RA 1DHRA 1EUDA 1EFLA 5EIOA 1SOVA 1DLIA 3JSAA 1KIFA 4FFRA 1UAGA 3NUGA 3BXXA 2EXXA 2W90A 3RC1A 5GMOA 2GCGA 1ZCJA 2C0CA 4CR7A 5JY6A 2BFMA 1UH5A 5BNIA 3GFBA 2NVUA 2OL4A 3DAFA 1XIVA 2ZIZA 3GGPA 4ZQGA 5A9SB 1HYHA 1ARZA 1NHWA 1EK6A 4WUVA 1UXKA 5TF4A 4DYVA 3WWZA 3QA9A 2HSDA 1KBZA 3OF2A 1GUYA 3JD4A 1SEVA 4AJNA 3KZVA 3IP3A 4FS3A 1HT0A 3DC2A 2A4KA 4P4NA 3Q9UA 5DOZA 5I7EA 1YONA 3RVDA 1O6ZA 2X23A 3PZRA 1XU9A 4O0LA 1A9ZA 4RVGA 3GEMA 2OOSA 1ZK0A 1LA2A 4R9RA 3GK3A 1ZZEA 3AM5A 4U5QA 3GDOA 2BKAA 1YBVA 4XGNA 3HZZA 4UEOA 4LRSB 4BO4A 4L4SA 5B4VA 1VM6A 5JAIA 1DIHA 5JYEA 2B4QA 2AQ8A 5C37A 2X9VA 4LSWA 1O94A 3PYLA 3ZV5A 1LSUA 4DC0A 2Y67A 2Y66A 3L6OO 3RC7A 1HE4A 1PJTA 2Q45A 3ROPA 3CXRA 1KYQA 4CL8A 1LDBA 3GVCA 4CQMB 2R2GA 3K6JA 5ER9A 3T7EA 4PLTA 2Y1DA 4XYMA 1GQ2A 5A05A 1XDWA 4KDEA 5I7VA 3DEYX 3QWHA 1U28A 2VYNA 3RU9A 1L7EA 3GVHA 5CFZA 2VHZA 2BGMA 1H2BA 1JLLA 3ITDA 3BMOA 3CSDA 3CZRA 2AQKA 1WPQA 2AQHA 3I4CA 3KSZO 3ZW8A 1T2EA 4GAEA 2X0RA 5I8WA 3IS3A 3HHPA 3UH1A 4E12A 3BTUA 1SMKA 1GPJA 1WW8A 3JCZA 5JXWA 3WTBA 5A4DA 9LDTA 3W8FA 3INGA 1FJHA 4TVOA 4O5OA 5ICSA 3ZNNA 4CJXA 4NIMA 1I5RA 3DONA 2VCYA 1E3WA 3PHIA 4Y98A 5JE8A 3C1AA 4ZU3A 4DUPA 1DO8A 3RC9A 2X58A 1LNQA 4Q3AA 4YQYA 2G82A 4CM3A 3ADOA 1V6AA 1PL6A 2E4AA 3PJDA 4ZQFA 4CLDA 4CLRA 5HS4A 2W2LA 4RF2A 4YVFA 5CPBA 5TJHA 2Q2VA 1ZSVA 2BGLA 2YFQA 1G6KA 2G17A 2A94A 2Q1WA 4NHEA 4EI2A 1I2CA 3BA1A 3CINA 4Z3DA 4Y6PA 1LQUA 3RAJA 4R54A 4GI2A 4E30A 1DC5A 2HU2A 4CM1A 2BH9A 4ZVVA 2UAGA 4WCFC 3SLGA 3PJEA 1B3BA 3D4NA 4ZJUA 1DOHA 3KBOA 1EUZA 3JD3A 2UVDA 2OMEA 3DHEA 5F1OA 1TT5B 3KLPX 4OHUA 4GGPA 1TT7A 1HXHA 4II3A 4DQVA 2EGHA 4MKXA 1BGVA 1I8TA 1GCUA 1FXSA 4UREA 5DULA 4PG7A 3SJUA 3DMTA 4RF3A 2P4QA 2XXJA 3G0OA 4NK4A 3VZQA 1YL6A 3FBGA 3GG2A 3UOGA 3IKTA 3ZU3A 4D3DA 4WK6A 2A9FA 2I5PO 3ADPA 5B4UA 4DRYA 3JQ9C 4YJFA 1YO6A 4CM8B 3ZZNA 3VPSA 1BW9A 1C1DA 1Y1PA 3BTOA 1C1DB 3C3XA 3JQ8A 4OH1A 5EN4A 2JD0A 1EZ4A 3LF1A 2AEJA 3GA0A 3H9UA 5TC4A 4J16A 4XA8A 3ETEA 4D41A 1H6CA 1Y5MA 3OIDA 4HFRA 1R4NA 4CM5A 4DTIA 4DMLA 2X9GA 2EERA 2AW5A 4GH5A 1IL0A 2RH4A 2H5LA 2Q99A 4BIIA 1MG0A 2O4CA 4IINA 4IQGA 4XIYA 3C7AA 5ER6A 4XGKA 1PIWA 1WZEA 3JYOA 3RSHA 4BB6A 4BO5A 1HLPA 1DLJA 3WNQA 1TLTA 3WXBA 5BSHA 1HDGO 3CH6A 3F4BA 4G5HA 3HFSA 4GWKA 4BKPA 3UVEA 4J4HA 4BGVA 3FPLA 3JQCA 2CNBA 2FSSA 3A06A 3GZNA 4BV8A 3PVZA 4B3JA 1TVEA 5T67A 4J1QA 2VNAA 1R0SA 3AM4A 4F3YA 4ZA2A 1SB9A 1HRDA 2BRUA 1I3KA 4Z9FA 5THKA 4CL3A 3JQGA 5G0WA 1HE2A 2XAAA 3AUSA 1LUAA 4I8XA 1V8BA 2O48X 1NFFA 2VRCA 2ZCVA 3KO8A 2BI8A 4U0KA 1DHTA 1GUZA 3H3JA 3Q0EA 4GSLA 4XR4A 4YACA 2CY0A 3NKLA 1Y8RA 4NBTA 5BNFA 3H7AA 1K5HA 4C7KA 1OI7A 1XKQA 2WYVA 3DMTC 2QRJA 3GRPA 3CMMA 4P8RA 4CQMA 5A9TA 1A7KA 3LC1O 2D3TA 3GG9A 4F46A 1PJ2A 4TWRA 1NP3A 2WD7B 1E6EA 3H65A 3RFVA 1XYGA 3LVFO 4CPDA 4OKIA 3VPHA 1P1JA 2TMGA 3QVTA 2YUTA 3R3JA 3KLMX 2O3SA 2EW8A 4RORA 4U6SA 2FPGA 4BNKA 1U7HA 2Y0CA 3DWFA 2B4TO 1OC2A 5A3JA 1TB4A 1KC3A 2PTGA 3OICA 3U5TA 3ETGA 1T4BA 1ZNQO 3KV3O 4UULA 3PFWO 4GX1A 2CDBA 3JQAB 4UAGA 1C14A 2EV9A 3RUAA 2XF8A 4E21A 2FOIA 2P91A 4KQWA 1K89A 1K2WA 3PWZA 1DRWA 3COSA 1YL7A 5EJ2A 3TFQA 2BFOA 1PZGA 3E1KA 1AUPA 4BMNA 1BTOA 1QYVA 1SCUA 3TSCA 1OMOA 5JNLA 3LLSA 2O3QA 3AK4A 1F12A 2AG8A 2DBZA 3UXYA 2Z5LA 1Y6JA 1A5ZA 2XPCA 3O8QA 4RCVA 5EQFA 1EE2A 4NH4A 1JQBA 4N54A 4OL9A 4PRKA 1AGNA 2W2KA 3LLVA 2HK9A 3LC7O 1WP4A 4AJ2A 2C5AA 3HDQA 3WGIA 2BF7A 4EUFA 1SEPA 4UUNA 2J5RA 4ND3A 3AUTA 3BMNA 3NTQA 4LRTB 5B1YA 4HNHA 1ID1A 5KJ1A 3OEYA 3U62A 3D64A 4RV9A 4MP8A 4IMPA 2YDXA 1PGNA 1PR3A 4D0SA 4XDYA 2PGJA 5JO9A 1B8UA 1W6UA 3GGOA 2NUAA 1K3TA 3H9QA 1XGKA 2E48A 1J49A 3PP8A 2CDCA 3NJ4A 4RPLA 2OP1A 1HEUA 4IMRA 1MX3A 5H82A 4C4OA 1HDCA 4R16A 1DJNA 3N58A 1HLDA 5JMPA 4I9NA 4PRLA 4J3FA 1GL3A 4DGSA 4K28A 3RROA 3RUHA 3PEFA 4IPTA 4MVJG 4WLEA 4DIFA 1N2SA 1NR7A 3I5MA 3T4XA 1DFIA 2C82A 2B36A 3GH3A 4LCJA 2V65A 4EEXA 3R0IA 3RWBA 1HDOA 4PLFA 3L4BC 3DHNA 1R12A 4KQXA 2H63A 4L75A 4CLHA 2VHVA 3G49A 4YRAA 2FZEA 4BNLA 2V6MA 1YQXA 5H81A 3WBFA 3MJVA 2QYTA 9LDBA 3RASA 1E3SA 1R0KA 1L7DA 3CIFA 3QV1A 4IDEA 1IPEA 2C20A 1EVYA 1GTMA 1R0LA 3RFXA 4PLVA 4E3ZA 3TPCA 4CM4B 5IZCA 1LDEA 4AJLA 4R01A 3G1UA 2W8ZA 1LQTA 5F5LA 1VKOA 1UP4A 3X2FA 1BHSA 1V35A 2WYUA 3NX4A 3FF4A 5EQDA 4YT2A 1O95A 4GBJA 4NJOA 4R69A 3GY0A 2J3IA 1TXGA 1UZMA 1CJCA 2AHRA 1P9LA 3IAHA 3PJGA 4IJKA 5A02A 4IDDA 3HDJA 4IDGA 4JBHA 5T57A 2DBRA 4RVUA 5AQ1A 5HS6A 5JFOA 4G65A 1H94A 1HF3A 5A9SA 1ZFNA 1H5QA 3D3WA 1KERA 1RM3A 5JY1A 2AE2A 3I1JA 5TLSA 1SB8A 4QT0A 4J4BA 1GY8A 1FDUA 2HLPA 3E8XA 1G0NA 1QKIA 1MB4A 1HL3A 3I6IA 3WYBA 1LBEA 2EP7A 2VYND 3FHLA 1BXKA 1U3UA 1K0UA 3KETA 5CG1A 3FI9A 2JD1A 3JYNA 4ILKA 2EP5A 5F1PA 1VJ0A 2HAEA 2HRZA 3OJLA 1E1LA 2CUKA 2DPGA 2HKIA 4EJ0A 1T2AA 3HN7A 4TMFA 4BGUA 4XQ9A 3TZHA 4DLLA 1NVGA 2AEMA 4WLFA 4YRDA 4XD2A 1I0ZA 1LXCA 4QECA 3F3SA 3MTGA 2ZB4A 1O8CA 2FR8A 3TDKA 1ULUA 5T64A 2FSVA 5L40A 3JQBA 2NTVA 4WASA 4CUZA 2NU7A 1EBFA 3B1JA 3OJ0A 1Y7TA 5IDQA 3L6EA 3IJPA 4GKVA 4FGWA 4JLWA 3EW7A 4NK5A 3PWSA 1UXJA 3VAZA 5L7WA 5JO0A 4M1QA 1AXGA 1N7HA 1WLYA 5H83A 3RIHA 2WTBA 3WGTA 4J7UA 1SBYA 4DREA 2Q1TA 1ISIA 5L95A 1G0OA 1UDCA 2ZQYA 3GF4A 4QFCA 2CF5A 3AUAA 3PIIA 2IE0A 3AJRA 4DLAA 3PRJA 5MDHA 1ADCA 2NACA 1B2LA 3OP4A 3UGKA 1GD1O 4B7XA 4BMVA 2G5CA 3AOEA 1UR5A 3C24A 3MOIA 3FTPA 3DBVO 4JN6B 1BRMA 4AJ4A 2V6FA 4B4UA 1LU9A 3EYWA 3EUWA 3I9NA 3AUUA 3A4VA 1ZXLA 3S2IA 1DIBA 4CMIB 4QFDA 4A27A 7ADHA 4JXKA 3I9OA 3QWBA 4K9DA 3RUFA 3HNPA 5BNTA 3ONFA 4DQUA 1IHXA 3FSRA 1Q0LA 3ZU5A 3LK7A 3AI1A 3WFIA 5KCZA 3EVNA 1I3NA 3VZRA 5KNLA 5IN5A 1M76A 4GLLA 1B8VA 1I33A 1UXHA 1MC4A 1IPFA 1PGQA 4WNIA 4HV4A 2PZLA 1ULSA 4J7CA 4BO8A 4D43A 3VDRA 3RQSA 2YQ5A 2P9GA 3UAGA 1E3LA 2RIRA 5ENVA 2GO1A 5G0UA 3GZ4A 3V1UA 4NU6A 2HMUA 2NNLD 1HE3A 4OO3A 1VKNA 5L4NA 1T26A 2DUWA 1BVUA 3OMLA 1U4OA 1NQTA 4WCFB 2GERA 1GAEO 2ET6A 1I30A 1AXEA 3TL3A 3D0OA 1NAHA 4OAQA 2RH8A 1VJTA 1AHIA 4QO7A 3GC6A 4ALKA 5C7OO 3H2SA 2VZ8A 3U4CA 2NTJA 3KHUA 1M2WA 4TRMA
chains in the Genus database with same CATH superfamily
1PLKA 1U3TA 1S8FA 1UM8A 2OV8A 4XLZA 1KO1A 1GP2A 2RAFA 3ZIAA 1EBUA 2ZE7A 5ITZA 2FX2A 3B38A 4M89A 1EJ0A 1ZC4A 4ALNA 2C5EA 2B8NA 3WLNA 3CC8A 1HNZB 2V4UA 4AZTA 2OYRA 5BORA 3JAWB 5EZYB 3L1VA 3RODA 1YB2A 2Y68A 4MGZR 3NV7A 4C3VA 3GMDA 2RH9B 5IJ9B 2B61A 4PWYA 1E7WA 1V8OA 3WADA 5HJEA 2Q4DA 2QVYX 4EUNA 4LGCA 4C29A 3NT4A 4M1YA 1YC2A 1O3YA 4COOA 2XGSA 1PJCA 3OCXA 4CIWA 1RP7A 2RIPA 4EEZA 2DKOA 5KOJA 1ZW1A 3H9EO 1NJSA 3RF7A 3HR8A 4HN2A 3IXMA 4UBNA 5IJAA 1GHTA 1VHQA 4H6PA 4NU5A 1D2EA 1J20A 4GX2A 2QJWA 4NYMR 4WFQA 4IILA 1ND6A 2N47A 1A8HA 1XT6A 3IVCA 3KE9A 1L5QA 2K7ZA 4NOJA 4HGYA 3G8DA 1AF4A 3CRMA 1E3EA 1LI4A 2HO4A 3F98A 4U7JA 3N2YA 4UU0A 2X76A 3DFKA 5D3MB 2ZJAA 1FFSA 1U2DA 1ZO8A 4NE9A 2R00A 1GQFA 2PMDA 1VSVA 3IJRA 3W9YA 1OH8A 3PA6A 3Q3EA 4N40A 4CTKA 3BG5A 4CFZA 4RV5A 3NP7A 1OREA 4A1OA 1CQJA 5BWNA 1XQ9A 3IC5A 4NV1A 2BKUA 1MO2A 3D3EA 3OPXA 1W29A 1SIUA 3PNSA 4MW6A 4YP0A 3A25A 3ABIA 4MQEA 3NEAA 4MR7B 5KVSA 2VT2A 2HM7A 2DEUA 5JWHA 4PYQA 5BUZA 2CJWB 5K0JA 2FQWA 1LY1A 1ULHA 4TMTA 1MZPA 3IPAA 4OREX 3LXRA 1RRFA 2IYQA 2HLHA 2FRXA 3NYIA 3OJEA 2A58A 1FB5A 2ETXA 1F0YA 3DAGA 3IP9A 3PT5A 1PUXA 1L8AA 1SQ5A 1GRVA 4RFSB 4MVYA 3NDRA 1UDWA 1X74A 3SC2B 1UMBB 3EQ8A 3HJFA 1ZUNA 2FMXA 3UT5B 4NR0A 1T4DA 3PKIA 4LCBA 5ESXA 4BQPA 3PGLA 4KFRA 3OWXA 1E7QA 4KSYA 3K3PA 1PNOA 1SA0B 5FLEX 3Q2KA 2ODBA 4ZPXA 4N8DA 1VPEA 2G88A 4BFCA 1SCNE 1EPUA 1XDGA 2XT9A 1P1FA 1NPDA 1GYPA 1RAIA 1SXGA 2EFHB 2GD2A 4DUZB 3TJMA 4HEJA 1XCGB 3DQZA 4TV9B 3V1LA 1P2GA 1NZFA 3FLBA 1YZHA 3VUEA 1FRZA 3WNCA 2RJOA 2VATA 2PMEA 1EDEA 5EWMB 4J2HA 5CA1B 2B5OA 4LVUA 3ZWWA 4I4TA 1QLHA 4MEJA 1RPJA 3LKBA 4PNEA 3REQB 3UOWA 3KYCA 3LPCA 2A1TS 1QVZA 5J1SB 2I87A 4BN5A 2ZIVB 4RBNA 2WJ6A 4TYPA 1LRLA 2CYAA 3JZMA 4MYSA 5E1BA 2Z8YM 3RTBA 3PFKA 3COYA 3KKPA 5JDCA 1ACJA 1R6XA 1ZMOA 4BVKA 4COKA 4CG3A 2P4EA 1RMYA 4P82A 1DBQA 3TFOA 2WP8J 3AINA 4XB6B 1QO0A 2EWMA 2LW7A 4G97A 4QHYA 4YO8A 2J59A 2V54A 2CJWA 1GG9A 4BBJA 2FE1A 5JD4A 4FBMA 1ID8A 1A98A 3RS4A 3FOZA 4OOFA 1DMRA 1Y8RB 1EWTA 3HQ4O 3W04A 4DUYB 2QSZA 2PH3A 2AN4A 4R3UC 3JWJA 1V1MA 2RI0A 1KEEB 4KVGA 5E3JA 5AXBA 3ETDA 3DLTA 5C0OE 3L1HA 2WILA 4B43A 3P2MA 2VBCA 1AVTA 2AOWA 4PAQA 5ALDA 3L4SO 5FADA 4AIIA 4D3ZA 3H1PA 2ZFUA 2PZMA 3ZQUA 2PWPA 2E37A 3JW8A 3UYKA 4BVBA 4EGAA 3T7DA 5IYZB 1KY4A 2OAEA 5IYZF 4UHBA 1JBEA 1IBRA 2BSXA 4PHFA 1TQ2A 1AX9A 3O3MB 3MK31 3G82C 4JNCA 4A23A 3KD3A 1EWQA 1MC1A 4WKOA 2WKWA 3Q7PA 1YQTA 3GBSA 3PE3A 2RHMA 5KVCA 1QRUA 5FLKA 1P72A 2GVZC 4FCWA 4OEHA 5CK5A 3CRQA 2QPOA 3L0CA 1NU8A 1Q19A 1QOQB 1Z74A 1TF2A 2H2IA 1M5RA 2JIQA 1CEXA 4EKGA 5AJTA 3PX2A 1GYQA 1NU6A 3PNYA 4M8IA 5KVVA 5IJXA 4UHJA 5FHRA 2JLWA 2PLAA 5TIIA 5FL3A 3VZCA 3W5VA 4DADA 1UJMA 3FDZA 1KMCA 3NH9A 1N36B 1R0BA 1MV5A 2GLTA 2I1VB 3FNEA 1AUXA 3AR4A 1FNMA 1GNVA 2VP5A 1LI5A 1C7QA 1M72A 1N9ZA 2OZVA 1RP1A 3JTEA 2ADFA 2NO0A 1E3QA 4J1TA 4M7OA 3UKDA 2W8BA 3FTFA 2VZ0A 2A3RA 2AWOA 3ZVLA 4REQA 2XIQA 5K99A 1X13A 1JSZA 2FETA 4C0XA 4P81A 1U8AA 4G86A 2GVDC 1CFZA 1JSRA 5L7YA 2G36A 3UQYS 2JIZA 4OLFA 2WJZB 3FOFC 4Z8XA 4F4IA 3A1VA 4UARA 1KU0A 2NSHA 4NH0A 4JCOA 1ZD8A 3HSKA 2WHQA 2GXSA 4Q9HA 1TQ6A 4KTTE 5K51A 4F6RB 4C6RA 2ZYDA 2D0PB 3EF1A 1DEKA 1M34E 2VZ9A 4F4DA 4QUGA 2MHCA 1WMDA 2H8GA 3AFOA 4Q7JB 1T6ZA 5REQB 4U6QA 3OIGA 3S7TA 4DXHA 3RC2A 4XYLA 3B6IA 1PGOA 1J0BA 3ITEA 2IPAB 3ZVMA 4ER7A 1UINA 1AQLA 5GTDA 4JB2A 1JFTA 2NO5A 3LW7A 3CH5A 2P77A 5BSWA 5C32A 4YECA 1R7RA 1CUZA 3UB2A 4N0DA 1IY0A 3GMSA 5JJCA 5LYJF 3INTA 4NWIA 4UKDA 4MJLA 1U2RA 3IOCA 3NRCA 3CLSC 1P62B 4O4LB 5TMBA 1PJAA 1DC6A 2I4TA 2ORED 1W36C 4Z86A 1VG9B 2Z83A 1RRGA 2IHKA 3K2BA 2HIAA 3MWGA 1TUIA 2PXHA 1R50A 1T9AA 2XVYA 3NHUA 2XUIA 1UC4B 3SI7A 4BEWA 5FNVB 3H9GA 2VQ3A 2XXAA 2QLBA 2FFBA 3T1NA 4WKNA 1MNQA 3HEAA 3IT2A 1LPNA 1AHHA 5EI5A 1W4LA 1F2TB 1NAIA 5LMNB 3DFUA 1V41E 3K9CA 4GC9A 4BX0A 3DLAA 3W7VA 1YZ3A 2GM3A 3EN0A 4A2CA 4AIRA 4ARBA 1ODCA 2FSGA 1HTTA 3EPPA 3GIWA 3IAUA 3MLEA 4NXNB 4K5QA 3DKKA 4CQMD 1OKKD 2C31A 1KH2A 2OXFA 2ZBEA 2BMAA 3DVQX 1PJ3A 4KQ2A 2VEDA 3TEMA 2W4MA 2WKQA 3ABSB 4QNMA 4BB9A 3JD1A 4O4HA 3DV2A 1UT5A 4RKYA 2NP6A 1QQBA 4FDMA 3MGGA 1JQJC 1OJ7A 3WGKA 1EVKA 3TD2A 5ILOA 1M1YA 2BGJA 1OFUA 3CPSA 3OSUA 4DN6A 2WKRA 5ABPA 1E5LA 2AOTB 4GSKA 5EMLA 1TC1A 5C46F 4IQ4A 5BR8B 4HVAA 5ULLA 1JILA 4R0MA 2YHIA 2H1VA 4Q7EA 5CJPA 4B4WA 2BFNA 2FP3A 5AVZA 2GTIA 4GMGA 1KC1A 1RLTA 1YZYA 2G0AA 3DXFA 3NM6B 3QWIA 1W0CA 4RVOA 1XTUA 3S2YA 3W6OA 2XVZA 5DVZA 3BXFA 4L73A 3PE4A 4FEAA 5EYPA 2V7BA 5BNZA 3WV5A 4L5YA 3L2OB 1ZH6A 5CLFA 3E7XA 1PLJA 3C3PA 3H97A 2VWPA 4MYDA 4KLRA 4RPJA 1SKUA 1YCHA 5E3IA 4E51A 3FOEC 1TAGA 2BEUB 5K1ZA 1Y63A 4XX0A 4NZOA 5AD1A 4NDZA 1VYHA 5T5QA 2PXAA 5EJEA 1IQUA 4OJMX 3NNNA 3KBBA 1AK1A 4W9RA 5A6VA 5KDOA 3NT5A 2I2FA 5HWSA 1UMCB 1GCAA 3CXUA 4YJDA 1KR2A 5HM8A 4RL6A 3VZSA 4O4HF 1ZL0A 4BDSA 1MQSA 1XZPA 4CIAA 2I80A 1SCJA 5CXSA 2CFTA 4QJ3A 2OBFA 3STYA 2EBWA 4KSCA 4E03A 1Z6TA 2NVUB 1G98A 1HKUA 4JGGA 4B3MB 2WM2A 1HYEA 2WWWA 4KXWA 1WUTA 3NDIA 4YP1A 1LDNA 3RREA 5EWJB 4CWAA 1K2VN 4K8RB 4EG4A 2OENG 5AESA 5HTOA 5E2BA 1ZJYA 2CV2A 1P0PA 1J06A 1Q1AA 5EINA 1JZSA 3QYJA 1RLJA 4RE5A 4Y1RB 5G41A 4V02A 4CYMA 4QATA 1P73A 1KYYA 1UDBA 2GZSA 4HDQB 3GWGA 4Y2PA 1FF9A 3ILHA 5T8KA 3STWA 4BLVA 1L7BA 1JSXA 1ZEJA 3BMXA 3TR6A 4TV8B 3A3YA 1Z2EA 1XJCA 3LC0A 1ZWKA 1SFRA 1AY0A 3SZUA 3MCUA 2XDQB 5KO2A 1EVEA 4L1KA 2NV6A 3LV8A 2IW1A 3N75A 1W87A 2IYUA 2R87A 3O8QB 4MAMA 3FOBA 2CMKA 3HSSA 1Z5OA 3IT3A 4MVJH 3T1VA 3S8EA 3AHGA 1L4UA 1OFTA 1IONA 1BXGB 2E2WA 2MWMA 3NPAA 3OX1A 4WOBA 5FUYA 1ZN2A 5F1YA 3OAAA 1O0BA 2IP1A 4CQJA 3PFFA 3WWOA 3OQ6A 4Q48A 2VKTA 5KQSA 4CZ2A 3L9WA 3J7TA 4RIFA 1ADFA 3DE6X 2WSBA 4HDNA 2X2PA 2Y1WA 3GH1A 4AUNA 5B30A 3OT4A 2OKCA 4J43A 2MSLA 2CDRA 3F6PA 4IIGA 1GDTA 4GBMA 1DC3A 1GTZA 5GONA 5CLJA 1TAQA 4L7VA 4IDBA 4Q1AA 2UZ1B 3PT9A 2VP0A 4HJRA 3SIXA 3EDRA 2FR8C 2JH8A 4Z0TA 5BVHA 3MAJA 1LWNA 2ID9A 1FP4A 4F2WA 1BZYA 2C3YA 2XB2A 1I9CA 4M55A 3OESA 3T5DA 1KSFX 3TLCA 4DGQA 2CNNA 4HYYA 1RCTE 3F7TA 5LD2C 4X24A 1DVRA 1S4QA 2A57A 2OHOA 2WTXA 3AY3A 2ZWIA 3WB2A 4YWHA 4JITA 1H1LB 2E0IA 2LD4A 3LKDA 4GOND 4LTMA 5BYBA 5P8WA 1SHTX 8ABPA 5E4TA 5CH3A 4F91B 2M1ZA 2AC2A 4H4EA 5FPTA 3ZE0B 4IMIB 4QODA 2JIMA 4TWZA 5CX1B 1XNJA 3RASA 4R3NA 2XADA 4FMBB 4ND1A 4Q37A 1AJEA 2VHYA 2FCRA 3W4JA 1X7YB 2XOKA 1VQ1A 3E61A 4LV6A 3VSCA 4EL5A 3R3ZA 4HS9A 4OHOA 3W8EA 4OXXA 3F6CA 3N2LA 4G1BA 1MJNA 2NUAB 3K09C 5EL0A 5HEKA 5TDHA 1HI9A 1G6OA 4HAYA 4KPYA 4B4VA 4BNYA 3HV0A 1SXQA 1GFWA 1TUGA 1YBHA 3N70A 4F45A 1CU1A 5TQJA 3VHQA 3DCIA 4QAJA 5M5BA 3CH7A 3ZGXA 1EUCA 2W37A 5J2TB 3L0OA 4M0KA 3RVRA 4BMPB 1Y42X 5G4LA 3BWDD 2PH5A 2DFVA 2QTNA 1TJ4A 3M3HA 3BYZA 2QE7D 4LAFA 3UG7A 4PQGA 1VMIA 4HH0A 4JR0A 1OLOA 1VE7A 3R3VA 2WT9A 2VK1A 4J9UE 4WKCA 2QYSA 4IGKA 2AKYA 1YI0A 3GAZA 3QQ5A 5TS3A 3NGXA 5KWIA 1OC4A 5KTSA 1XU4A 3PFGA 2X22A 3D31A 2BFBB 4PX2A 4KPFC 1FFXA 4AK9A 1F4VA 1XEXB 2QLJA 4LE2A 1KFCB 3VR1A 2XUHA 1C9NA 3AR3A 1RPZA 3LBAA 1PI3A 3HZHA 4WOJA 1NBMA 5LN1A 3DD1A 3ECAA 3DEJA 1H0KA 3PCTA 5CVVA 2CK3A 1GU7A 1UMBA 3IAXA 2FW1A 1OT5A 3IPLA 3PLRA 4HMQA 5GPBA 3GJ5A 4Z4EA 5TVGA 5JEDA 2IKSA 3U7FB 2PT6A 1CZHA 1M73E 1IN1A 1FTNA 2JANA 2FX3A 4CIDA 5A5FA 1H3EA 3EQZA 4U7DA 3SF8B 2DRIA 4CI9A 1AKWA 2GEKA 1P31A 3HM9A 3FGOA 3GI1A 4PYOA 4B6PA 4ESHA 4RANA 3SNHA 4KV9A 5CDFE 4QDZA 4MR7A 2GRUA 2I6TA 4ZEWA 2Y2VA 4O1IA 1U1CA 5ALLA 1XTVA 3T7RA 2HRCA 3TVTA 4F9EA 3VISA 4PVDA 2Y0BA 4NMHA 3W9SA 3IQFA 3G7UA 1TYEB 2MMCA 1YK1A 7ABPA 3QKRB 3UAXA 5MFPA 1C2TA 1DIOB 1N5JA 1OW3B 1XWWA 3QFRA 4U63A 3NS7A 1VE5A 5DDIP 5FV4A 2XDWA 4EFDA 1J56A 4NARA 1CS0A 2NQTA 5CHYA 3R5SA 1TK3A 1RXEA 3BHJA 1JR3D 1U1IA 2Z98A 4AJEA 5TMPA 2RHTA 2WC1A 3KQOA 4HUJA 5IAEA 3TLAA 4RDXA 5ED0A 1Z34A 4LF7B 5DGXA 2IEIA 1NURA 4X66B 2QT1A 2D74A 3G17A 4MVJD 4DMKA 2JCBA 5FI3A 3B7WA 1XZAA 1DELA 4G5RA 4LOKA 3KG2A 4ZC8A 4JYAB 1XX6A 1W46A 2FVYA 2R7NA 3FMVA 4UBOA 3JZIA 4UVEA 3WAGA 1VP3A 2OCPA 2O54A 3O74A 3OZDA 3GPDG 2WIDA 4H7EA 5CLIA 4CMIA 5MFZA 3NDBB 1OUMA 4TL6A 4I50A 2AI1A 3MBKA 4R5MA 1PZHA 1AGRA 1YE3A 1U0LA 1HSZA 2VZLA 4JT2A 1VA4A 1JVNA 2J48A 1OAKA 3IOBA 2UV8A 1QVWA 3CLRC 2P7HA 4JHXA 1R10A 4G1EB 3RTEA 4OXYA 3QY0A 2I2DA 2JCGA 1RWXA 1U9ZA 1CUJA 2QNRA 3FNRA 3PGA1 2A35A 1T4CB 4ND4A 1BYIA 4XJVA 3TGPA 1OWPA 2VFAA 3E48A 4RTMA 2G80A 4Y2SA 3UUWA 2O7SA 2KQUA 2JFBA 2W58A 3DEIA 1MIHA 2QYHA 1JKJA 3P4YA 4J8PA 4RQBA 3E9NA 5LIPA 3SVTA 4NFHA 3CQ9A 3TMAA 5BSTA 2ZWPA 2HF2A 4IHJB 4CCWA 3EXIA 5C8YF 4YI5A 1E3WB 1P4SA 2A59A 4FIDA 4M83A 3VYVA 3BL8A 3OA0A 1NLFA 1SKBA 3EAQA 3PEWA 3KSDO 2OAQ1 4PTLA 1JHRA 3HRIA 1T2UA 4YXFA 3BMCA 2B35A 1HSOA 1QVAA 4JBIA 3RSGA 2AH5A 5LIRA 1RIFA 4GM4A 3KL2A 2VOJA 2GZ1A 4OP2A 3OU7A 5JDCC 3VMMA 1TM5E 5DYYA 2C7VA 2QQ5A 3EVBA 1QUFA 1QR6A 4LYJA 4Z1OA 2ZVPX 4I1UA 1CULC 1JDVA 5EXTA 2ENUA 3VV3A 4XFKA 4E2YA 3DZBA 5EZQA 3C14C 2C9YA 4IW3B 4Z0HO 5JAUA 4UFNA 2IY9A 2WLTA 1EX9A 1QIKA 3QLUC 5AI4A 4CU5A 4M9RA 3F6SA 1NBWB 2J0UB 2PBRA 1GR0A 2PWZA 2VNSA 2XLCA 4DCNA 2HUNA 4MUBA 1JTEA 2P9BA 4DQLA 1QLJA 4WESB 1J1UA 5HCNA 4JQZA 4I55B 4KUGA 2NXEA 4N5MA 1SUDA 3WZ2A 4DLXA 4ZQBA 2J7PA 3MC1A 1Y82A 2IYLD 3GIDA 5U9CA 5DTQA 5C1DA 2P69A 3BJIC 3EZYA 3O73A 3GLIB 4XE5A 1E9EA 1CUXA 1IHDA 4PLWA 4W8HA 3S2EA 4L8FA 4BEBA 1A8IA 4LTDA 1L7RA 1CUUA 4BQRA 2AK2A 2B1GA 5COBA 2OFFA 4FMDF 3T4UA 5KYUA 1Q1EA 5FA5A 1RZ3A 4D6XA 1OJLA 3U31A 1V4VA 1XPJA 3R3SA 4C89A 3VSEA 1M0EA 4GKBA 3AKYA 1RIIA 2BR4A 4C6TB 5HJ7A 1ZRSA 1E9DA 2HX1A 3KZ1E 5KJCA 5JH7B 2ZKIA 1H9BA 4I5GA 5DNCA 1E7SA 1SBCA 3REOA 2V98A 6NULA 3ELDA 4IXMA 4QU5A 1PFYA 1C0LA 4WCDA 2JFHA 1J2YA 1ZVQA 2ZYIA 4RHXA 2FJ0A 4B82A 1T29A 3T4PA 3WOHA 5JBNA 2BEUA 1O58A 1VTKA 3CMCO 1L8XA 2JEOA 2FN4A 1TC2A 1P4HA 4MICA 2IUUA 1Q3TA 3RFTA 1RZUA 4CF5A 1NP7A 2QG6A 4FD2A 3X0DA 1FA9A 1UOEA 3GEIA 4A6PA 4DMFA 3CV3A 1TAHA 1BJRE 4QXRA 1MGOA 4GOOD 2QIOA 2NYVA 4BXOB 5I3CA 1G21B 1IWPB 4KB5A 3RUIA 3IAAA 2P0AA 4R71A 4BCCA 2XE7A 4F56A 4N03A 3FKSA 1P4JA 4JLNA 1NUQA 2FY8A 4KU4A 4AICA 3KQUA 4CR8A 4Y9SA 3F7NA 1RWOA 1KI6B 4Y2YA 4NJEA 1U8CB 3MJFA 5CLHA 3F6RA 2HEIA 3B1KA 4BVJA 2QT0A 4AJ1A 2H06A 2E1RA 4MS1B 2X0FA 2BWJA 3DAOA 3Q7IA 4R41A 1G6HA 5HCUA 4CUKA 3RSOA 2FPWA 1L5MA 3ZHQA 1BHJA 1Y3FE 4C0JA 2WPDA 1NQ5A 1ZK4A 1Z18A 5CBPA 3K9QO 2IZ5A 4R7GA 4E5UA 1T8YA 4BE9A 4CM7A 4DEXA 1KRWA 4BVHA 4YV1A 3EGEA 3NHWA 4KREA 4YQZA 3QPUA 4WDRA 1PVVA 2Z57A 3A1NA 3C3AA 3RLIA 4AP6A 4HSEA 2E49A 4G25A 4WJLA 1A3CA 2IYOA 1GRRA 3QNMA 5U1PA 4NJEB 3ZHZA 4QKQA 4B3XA 5A5VA 1KPIA 1Z28A 5JPIA 1I94B 3MN1A 1KYTA 3ZZ0A 3D7LA 1FYVA 3A9SA 3F8TA 1FQWA 3HNOA 3LA6A 1U1EA 2ZB3A 4Z7NB 3L8DA 1ENPA 5LMCA 4AO7A 2Q4TA 3BX1A 3WAKA 3UICA 1XKTA 2AGVA 4EHIA 1W2GA 3BJEA 3M34A 3EA5A 4TSFD 4W7SA 2N3ZA 4B8YA 4YJGA 4PC2A 4URVR 4KGVA 2W48A 4NZZA 3AWDA 1WSBA 3EEYA 3O31A 1PL7A 4O6VA 4AZ0A 4FC7A 2B1RA 5FR2A 5A4FS 2AN9A 1Y6QA 4WEOA 1XMIA 3RYHA 4CV0A 2FR0A 4TTSA 2VTBA 3MCVA 3GAFA 1OLXB 3AF2A 3ZS9A 3LD9A 1CBUA 5HYVA 3IDAA 5BN5B 4EPYA 3TGWA 4KVAA 1Q17A 3JR3A 4E5VA 5HRUA 1SC1A 3FUTA 1NYQA 2X5NA 4A73A 4BLUA 1WSAA 2CVQA 3IKVA 3G1TA 3Q7QA 4PGFA 2WIKA 3FUVA 5HQJA 1BQ4A 3Q9NA 4FKMA 4X91A 2M9MA 2VJLA 3NYWA 4ZQEA 1NDQA 3HVHA 2PZEA 1XC7A 2QU7A 3F5DA 4Q0MA 5KWVA 5HDQA 3I2YX 1ZI9A 2HK6A 3DDUA 3K8YA 1IAVA 1C4KA 1LLFA 2R1VB 4FZ3A 2P2DA 4OYLA 5DGDA 3SHTA 4ZYWA 1XSEA 3PRYA 4RXUA 3GLHE 1P4RA 3TTSA 2H59A 1OLUB 2QE6A 3L77A 1ZXBA 3PUKA 4WRRA 4B79A 5H4GA 1KS9A 3IBGA 5ALTA 2B8TA 2I7DA 2P5UA 1M83A 3G0HA 4OH7A 4W5QA 4HXYA 4EUSA 4BN4A 3HLYA 5FA6A 5KNDA 4AUKA 4MHTA 5D5HA 5BQ3A 2F2TA 3AVQA 4BP3A 3LZ6A 1K86A 3WKDA 4W5TA 3LUPA 1IB6A 4RGVA 1XTPA 2CKMA 3M70A 2WMYA 4UVDA 1K4MA 4ZREA 2NO4A 2Z6VA 3L7YA 3PC8C 3M6LA 4XWOA 5C18A 2XCIA 3UPUA 4YAGA 1OI2A 3CUSA 1XXHE 3L0DA 1W5AA 3FNHA 2WZDA 3QVSA 4WOKA 4EAAA 3DV0A 1ISGA 4TS1A 2DH5A 1Z4PX 4HEA1 3OCZA 3H9CA 3SQMA 2AXEA 1G3RA 1S8NA 1TADA 1WMBA 2EBFX 1I0IA 2I71A 3I8XA 4G2TA 4QHTA 4YROA 2F67A 3R7DA 3ZV6A 2DBYA 2A7XA 4BTEA 3OT1B 4CG2A 1GADO 4DYDA 1J5EB 2X5OA 2D8MA 2JFOA 4GZMA 4NULA 3ETLA 3TQIA 4CDNA 3FCCA 4EATA 3B1YA 2VJOA 621PA 5EMKA 4Q3DA 4ND7A 4DA9A 3E03A 3LUGA 3W5UA 3M8KA 1K6MA 3ESZA 5AM3A 3EXIB 3DG9A 1KHHA 3ZQJA 2EZ9A 1LWOA 2NO9A 3ENNA 1W93A 1GZ4A 2BFPA 2PWBA 4G81A 1YB4A 2OB2A 2A5LA 1FIUA 5J40A 3ER9A 1E3TA 1I9GA 2G06A 2ZYTX 1KXZA 4EUEA 2HDHA 1J0DA 5FWDA 4FJ0A 3REFA 5KYTA 2H4XA 2IH2A 1CIPA 2AXQA 1N8TA 3A10A 4F4JA 5AOVA 9GPBA 4OLJA 3FHTA 2JGKA 1NI3A 1DQSA 1ZAYA 3Q2IA 5ALRA 1WMEA 3O1LA 3IKLA 3CCFA 4CL0A 2W6QA 3R2JA 1XWIA 5KTNA 4I6GA 1YVDA 1XQYA 1YZFA 3GMIA 3VUFA 3NETA 5K8LA 2PCLA 2JBHA 3UJ6A 3EUAA 2OO5A 3NTOA 1N2XA 2RHWA 3PI7A 1FFWA 2FEOA 4YAWA 2QN7A 5CTJA 5JZ9A 2ANBA 2FN7A 1UEIA 4LF5B 1QH9A 2QN3A 1I3MA 4Q5IA 3Q5DA 4PZAA 4K2HA 2FPOA 1WG8A 2ZKLA 1NX9A 1PSZA 3QEJA 3MB8A 3RV3A 4B34A 4ZZIA 1FNBA 4KIWA 4DNXA 3EMKA 4PLCA 5ALKA 3LG2A 3JU3A 5KAMA 3MFQA 2ZAIA 3U49A 3ZHTA 4L9RA 3K16A 4FYHA 5FULA 2HC9A 3BWEA 1PS0A 1HEIA 2OO7A 3RUPA 1XHFA 4I4TB 4J0EA 1CJMA 4JLDA 3SYKA 1KI2A 5DTMA 3SX2A 3WLSA 1E60A 1CERA 4B3TB 1WW3A 2IKQA 3COZA 1PGJA 1DQRA 5EMJA 1Z4KA 2GJSA 4MXDA 3GUYA 3TW8A 3TDMA 1PHPA 3QITA 1QYIA 4PO3X 3BREA 5LYJA 1Z8DA 4WBXC 1NN5A 1NY5A 4ZEVA 2H2HA 3IV9A 4FEGA 3RO7A 3S1SA 3WE7A 4MS3B 3U3DA 2QK4A 3HFGA 4KGZA 1C1YA 4XWYA 1X8LA 2FKNA 4OATA 4Q9IA 4TSFA 2YXBA 3H0CA 4GMDA 4UNSA 5IXSA 3R7FA 2VSQA 4Z7OB 3HMQA 1JZQA 3I2IA 3RAFC 3VSAA 4BO2A 1X9HA 2BZ1A 1RLOA 2K4MA 2FWNA 2XMZA 4LRWA 3V3KA 4AVYA 3SZGA 1H4QA 2BKVA 3ZCRA 3QKIA 2C88A 4W1SA 1Q7GA 1JKXA 2VHUA 2VNJA 4MMXB 4EQ6B 1E0JA 1JMKC 1T4GA 2CZCA 3A4MA 3CUYA 5LP6A 4FGLA 4P7JA 4C87A 3B7GA 1Z0ZA 2OFXA 1X1TA 1YDEA 3IAM1 3ONDA 4GEKA 3BSSA 4QYSA 5CIWA 5GVRA 3OQBA 5KX5F 2GZ2A 2VYFA 3T7SA 1UZNA 5A5EA 2PZFA 2YKGA 2Q9UA 2AHOA 4OY3A 1UPUA 5L9AA 3QEMA 4RETA 4GKAA 1NFQA 1ZHHA 2R1ZA 2WWGA 1ZH0A 5CK4A 4B87A 1P0MA 3QU7A 4P5PA 1XROA 2X8BA 2F90A 4DJJA 5HHTA 5GJWC 2W2OA 3R20A 3BIWA 5LMZA 3STXA 1B41A 4R68A 1NVVR 1HZZA 5DX0A 3AI2A 3R6WA 4X8OA 3B5IA 5DZSA 1ZMXA 2IYPA 2NYRA 1AHPA 1LLCA 3ZWBA 3QVXA 2ZWAA 3HP4A 4QXQA 1VI6A 4CKBA 2ZYGA 3C6MA 3F1LA 4YR9A 2HMYB 4C21A 5AVSA 3R23A 2HW8A 5TPZD 4MQ4A 4AXBA 3HYTA 3NBXX 2PA0A 4EY3A 3ZBTA 4HEA6 3G02A 4F6CA 4BO7A 4DV7B 4YRNA 1CDEA 4FGUA 4BVGA 3CCCA 3DL4A 4MKGA 1OWLA 4A8JB 4C05A 3I4FA 4EG1A 2BC9A 4F4FA 5HG0A 3TPFA 4B31A 3DFFA 3UV7A 1JKFA 4U2EA 3JZFA 4E2FA 1J2JA 1S3GA 1GPWB 2Q5JA 3FMOB 5TT1A 2FSHA 3VVCA 2L42A 4JT8A 2GNOA 3QUTA 3D5EA 2WTMA 3VHRA 2GJ4A 2X0IA 4KQCA 4AFNA 5GOTA 3AQIA 2F3RA 4W82A 4F86A 1XOIA 4CU2A 1ONNA 1G8HA 1DWUA 1SIBE 3KJIA 1TT5A 2AN3A 4IDNA 4OSPA 4RK7A 2HHJA 3PS9A 4E14A 1SULA 1X3SA 1EMDA 3T7CA 1H2AS 2HL6A 3K09A 2O8BA 1LC0A 1P5JA 5EGSA 1HG1A 5B6PA 1ZS9A 4B3BA 1ML3A 4NATA 3BORA 2UVPB 1GL6A 3O4JA 4UHCA 1L0BA 3E22B 1K66A 1NVUQ 1EQUA 1QFJA 3AOEC 3EH2A 4R1NA 5EP3A 3MWDA 3K0FA 4WWHA 5FA8A 4QUKA 3HXTA 3LOPA 2ZRKA 2BE9A 2VJKA 2XODA 3NWOA 4NS4A 4EY6A 4GKKB 2Q1UA 1WKVA 1VLHA 3EWAA 1M3SA 3OM0A 2X86A 1E6UA 3OY2A 4DWJA 5K01A 3C7TA 2ZT7A 1BMQA 4ZYVA 5BWOA 4HDMB 4KZPA 4E31A 2D2IA 3O1HB 1OXXK 4GPEA 2YMMA 3T1HB 2IEGA 4XVCA 1EVLA 5E6UA 3CU5A 4QGHA 3GLTA 3PFBA 2AC7A 3LDUA 4UEQA 4WZAB 2KSQA 4QULA 3WB1A 2IQIA 3ICCA 4QPDA 4B8ZA 3N9IA 1S1CA 2Z9CA 4G67A 2Z2XA 4UDXX 1VE6A 5U4QA 3G68A 3JQGB 5ALXA 1CDOA 2VK4A 1O54A 2XDQA 5GONF 3S27A 4CMAA 4J6FA 4IVNA 5BMOA 4LF6B 5KTMA 3G13A 4AQ7A 1GEEA 2JLVA 4K26A 2ALJA 3I9MA 5HKOA 4F3TA 2YHUA 4C0WA 1VCNA 1UBUS 2FZWA 1VLZA 1G8PA 2VPTA 3K0CC 4UE6A 4A3SA 4EECA 3HL0A 4E5MA 1AK9A 2J6CA 2IXAA 4NU8X 4ZRNA 4QBFA 4WXYB 5SZKB 7REQB 2ZRFA 1G5TA 3GBVA 4IAOA 2QX6A 4ZCMA 4MX8A 3KT3A 3LCCA 1P2TA 1KVUA 2GBFA 2PZAA 3IDOA 1EP9A 3LCRA 2PJUA 4YUWA 4IZHA 3TF5A 4GRAA 2XQVA 3OKPA 4WHMA 1T6BY 1NF3A 1O6GA 1ORHA 1ZRMA 2BELA 1SG6A 4OK3A 5AQEA 3RG8A 1D1PA 5K3AA 2RAUA 1Y7HA 3NCTA 1U0SY 3RR2A 4NCBA 4S1WA 1BN7A 1W0KA 5DBEX 2FUEA 4FMCF 3JSXA 1ZM9A 4CLRB 3GJTA 4MRMA 1PL8A 3Q7EA 3WDSA 1JWBB 4NPHA 1ZGAA 1O89A 4WZBB 1CV2A 4M4SA 1H66A 2I3AA 4DPMA 2XITA 3NBAA 1R5OA 3EEFA 1VSQA 3V2HA 5BSEA 5K0GA 2ZUFA 3AHCA 5IH7A 3TQHA 1DAOA 1FYDA 5DWQA 1GIAA 1E66A 4EK9A 3SR4A 2A92A 1SK9A 1O8BA 4C06A 2V9ZA 2DBQA 3BSYA 2FZVA 4I99A 4R8RA 4RZSA 5DKFA 3UANA 3L7OA 4ENVA 5F64A 1L1QA 1M2VB 4NNOA 3FPHA 4BLRA 1IVSA 3TRKA 2WF8A 2P2LA 1XAGA 4XPZA 4EHLA 4UE2A 3GVIA 3B85A 4HATA 3BQNB 1ZICA 3L6DA 2C4UA 3Q2OA 4ITUA 3BMQA 4JUIA 1QG4A 2EDCA 5ARCA 1PFQA 2QTRA 3M4NA 1KH1A 1IPHA 2C95A 2DHQA 2ISCA 4MVCA 2ZUBA 5JU6A 2V3CC 1VMEA 3NAMA 2KWIA 3V32A 4CIVA 1P7CA 4WECA 5KQLA 3UJHA 4IIVA 3AHIA 4JDPA 2EZUA 3OMWA 1L5LA 4HQKA 1FX1A 3R3YA 2ODAA 2R00C 4I2NA 4XYGA 4C4TA 3OG9A 4A8PA 1JGTA 4E5YA 5LOVF 2C1ZA 5LOVB 4W8OA 3O83A 3ACDA 4ZO8A 1GA6A 2X1HA 4G84A 4QFBA 3PA8A 4C6SA 1PNRA 2B99A 5MGNA 1RKQA 3TEJA 1S3IA 4ZXFA 2RGNC 1GZ7A 2B8JA 4DQDA 5CBKA 3LQFA 5I48A 1BGWA 5I7SA 2CD7A 3H86A 2BN4A 4I5IA 4TMXA 4ZPJA 2HQBA 2YNMC 1KMQA 1STOA 3EARA 1QB7A 4QRDA 1FMTA 3HJGA 2G76A 1XDDA 4PG4A 3CKLA 3HCPA 4ZU1X 1E7RA 1MXFA 2BM8A 4QWWA 3R5JA 1XI2A 3RSZA 2HMWA 4CFYA 2NVOA 3PUZA 3LMKA 1PQPA 1SOWA 2A1UB 2NSJA 3ER6A 4J75A 4J1SA 5JAZA 3WNVA 4L0CA 5AJXA 2WFMA 2BFFB 3V97A 4EBFA 3ZHXA 5JCOA 1ZRHA 2DUUA 1KEPA 2DR0A 1D2GA 1SKYB 3S28A 1LX7A 5KQMA 5BN4B 3VKUA 1E4VA 3CB4A 3DC7A 1Z9BA 3HO1A 2IRWA 1E2QA 2FPPA 3OO1A 2VF2A 1THTA 4C08A 3IV7A 4TVBA 4GC5A 3BAZA 2D00A 2XOEA 1UIMA 7GPBA 1SCDA 2PX8A 5FNZA 3ZKWB 4I7EA 2FP4A 5ALEA 3TUZC 4J91A 1TKRA 2BFCB 2DQ4A 4NLLA 2GBCA 2XWSA 2PRJA 3QVWA 3SK0A 3AJ8A 5D00A 5K2MA 1T13A 3TS1A 3CT6A 4BLSA 5DRTA 3K73O 1EFHA 2ACEA 4U39A 4E5SA 4BRUA 5CM8B 2EEZA 4CVNA 2YOGA 3U7GA 3AESB 3KVVA 1Y81A 4Y9TA 3DMDA 2ES4A 1IEWA 2O6LA 3DNPA 1GNRA 4LA4A 5AK6A 4BUJA 2NTYC 1E8DA 1AKUA 1XALA 3PX7A 2JAQA 3IE0A 3TLXA 1XLVA 1P1KA 4Z3KA 1E79D 1Z12A 2HH9A 2OHJA 4CHGA 3NXSA 4MWZA 1DC7A 2BZGA 2WYWA 1AGPA 1W4CA 3LKVA 4J03A 1QYCA 4KUHA 4UQPA 2FJPA 2E4VA 1P60A 4MV9A 4V0OA 5LXTA 1D5CA 1TZCA 1KE1A 3DL0A 1YR2A 3B60A 4ZT2A 3WB9A 1JRLA 5E2IA 1DIAA 3GUHA 5EKTA 1PK7A 3HRKA 1KOLA 4EYEA 5LKRA 4M38A 5IWAB 3RRMA 3O7WA 3UK2A 1P9OA 1WF6A 4WNCA 3UEOA 4C0QC 4BZPA 3ADCA 4NQZA 3MIIA 5FQNA 2J0EA 5K6AA 3PDIA 2BFAA 2J5QA 3L04A 3QGMA 4KV7A 3NW9A 3WICA 3NEJA 1ZR2A 4NENB 4BVEA 3MELA 4QYIA 3B48A 3AVVA 3WQBA 4AY5A 2BY4A 3GRCA 1I36A 4TKMA 4WXEA 5B1IA 3SSOA 2C3UA 1A1SA 4RZ2A 1AO0A 3KQNA 1OTYA 2EWVA 1JSLA 5CM9C 5TPWB 4MVJA 1FFHA 5E1OA 1RWNA 3EQ7A 3K8OE 2FB9A 4JAVC 5DOVA 4FUQA 3V7UA 4FKBA 5K8VA 2DUNA 3V9AA 3HI6A 4S2UA 4HUQA 2NZUG 1D4AA 3N28A 3W34A 4DBLC 5M2QA 3KAKA 1L8QA 2RGGA 4BO3A 4DA0A 4NCAA 1PCXA 4GVLA 3WLJA 1DCKA 5ALSA 3CURA 3PXAA 2XKKA 4LGMA 1DP4A 1G4AE 4EB0A 3V8BA 3U39A 3RARA 4J90A 4B71A 4HH3C 1T5TA 3FYHA 4KXXA 2I4IA 5KREA 2GA8A 2JI4A 1HDIA 3GUCA 5KQGA 1TTTA 2HK7A 2NSDA 4MPDA 3W2EA 1RLUA 1PD0A 2QZZA 3TSYA 2QS9A 9MHTA 4J2OA 4BNNA 3JQRA 3GVPA 4PX5A 1DAKA 4FYWA 4MV5A 3ZWAA 3G5MA 4CCSA 2JFYA 5KOHB 4EQ6A 3U19A 1ODJA 1KFBB 4D4IA 5HFJA 4LE1A 5JCJA 5J4HA 2R86A 3EC1A 3T3EA 4PLHA 5ICMA 5D2CA 1B0UA 3DPUA 4IRUB 3BVPA 5A1JA 3NEYA 2DTDA 1NQAO 3JD0A 1EXNA 1IHOA 2IDKA 1TOAA 2P9QA 3BE8A 3C15C 2RBGA 2AFVA 4PC7A 3ZCXA 4ECAA 1O97D 1KF0A 1ZMBA 2BHLA 1B8OA 2HWUA 3P0HA 4UVIA 4AUEA 4JH0A 4ZOEA 3IODA 6ADHA 2W2LD 1RHUA 5JXHA 3U3JA 4Z5XA 5DM2A 2Q5EA 4O59O 1BRTA 4WH0A 1J8MF 2SKCA 3D1LA 3QJ5A 4C7MA 2PGXA 3K5IA 2P40A 3IJ5A 3QY9A 4IFEA 4Q3OA 1JEYB 2RC6A 3JV7A 5BQOA 2JLYA 4O2RA 2D59A 1J99A 1DPGA 2OCXA 3G7SA 2PUFA 4G0UA 3PXXA 1WVMA 1OV4A 2FHSA 2G0TA 3NBFA 5JDIA 4YMVA 3KX2A 2O6HA 3PDWA 4MNTA 1K9VF 1H2HA 1UF9A 4LVNA 2XI4A 4H60A 1CX9B 2D1FA 2ZSFA 3N2NA 1BWSA 1QZZA 2Y0PA 2O14A 4DDMA 1Y8QB 5IAOA 2DTEA 4QG7A 1GN9A 4YYEA 4Q4AA 3WGYA