1IY8A

Crystal structure of levodione reductase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
258
structure length
258
Chain Sequence
b'RFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAPDAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIEGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPENPRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSAAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEVODIONE REDUCTASE
publication title The Crystal Structure and Stereospecificity of Levodione Reductase from Corynebacterium aquaticum M-13
pubmed doi rcsb
source organism Leifsonia aquatica
molecule tags Oxidoreductase
total genus 101
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1iy8A00
1HSOA 4PZCA 4R4JA 5H81A 3ZHYA 3NAQA 5J23A 3OETA 5JMWA 2JD1A 2HSDA 4K6FA 1DSSG 4ALJA 3GFGA 5I7SA 3WDSA 2YV3A 3JSAA 1PJ4A 2AEJA 3OA2A 4RVFA 2YHUA 3H9UA 1LRKA 1EQ2A 3UAGA 4D41A 2DPGA 3KUXA 3QVXA 4OXYA 3AW9A 4GSLA 1CJCA 4YPOA 2JAHA 3KLPX 3V5NA 1E3EA 5JCJD 3DAPA 2C82A 5DOZA 4ALKA 3RD5A 1GPJA 2JFHA 3AK4A 3ITDA 5BSGA 4DVJA 4TKLA 3GA0A 4NH4A 3GGOA 1DEHA 2E37A 2OO5A 2ZJ0A 1JDJA 4IXTA 3ZWVA 1NHWA 1ZH8A 5JXWA 2B4RO 2VRBA 4OMUA 2IEDA 4E5NA 3RFTA 4JROA 4E2YA 5TQVA 3C85A 1HDOA 2FSSA 1LLUA 4ZRMA 2J3KA 5GZ1A 3WGGA 3FNGA 4BO8A 2JCXA 4IQ0A 4CMEA 2JCVA 1E1MA 1JKJA 2VT2A 4GKVA 5F21A 5F5NA 2EJVA 3W6UA 4NJMB 2EKLA 3KRTA 4BKUA 1BTOA 3JQAA 4CR7A 2ZATA 4I5GA 1LDEA 4FOOA 1UJMA 4WOJA 4O0LA 3BXXA 3V2GA 2I3GA 5G4LA 1P74A 1ISHA 2P9GA 3WYBA 2CMDA 2ZQYA 4J16A 4Z0PA 1CEQA 3HUDA 2Q4EA 5JYDA 2A94A 1FXSA 3LSYA 3GGGA 5CEEA 1DC5A 5KJEA 2EEZA 1HKUA 1P1FA 1EE9A 2PLAA 4YAEA 2EGGA 4J43A 4GMGA 3AOEA 2W98A 1GV0A 1OMOA 1MLDA 5IDWA 4BHTA 4XJTA 1T1RA 3EC7A 1KOLA 4W6ZA 4IS2A 3E1KA 1U5AA 2IZ1A 4L9RA 1X7GA 4U8GA 5TF4A 1Y6JA 4G65A 4MP6A 4CV3A 4H3VA 3QVTA 1BXZA 1NFRA 1ZSVA 4DBZA 1B3BA 4NI5A 3O8QB 2GDZA 2AA3A 2BMAA 3NGXA 4UAGA 4XWYA 3L07A 3GVXA 1I8TA 1IZ9A 3DBVO 1O0SA 4YEDA 3GRKA 2PD4A 3DMTA 3MEQA 2I99A 4Z9YA 1A9ZA 4QXMA 2G76A 1FK8A 3G3EA 2EP7A 5A9SB 4XDZA 2BFMA 4GQAA 4F6CA 2C2XA 5DF1A 4KWIA 3D4OA 3KOUA 4BV9A 4CUKA 1RM4A 4ZHSA 1N2SA 1DO8A 3OA0A 3R1IA 3JTMA 4IJVA 1PGPA 4AL4A 1H2HA 3VDRA 4PRKA 4RLSA 5I7VA 5KJCA 1A9YA 2GERA 2G5CA 3JD3A 4BMNA 2IXAA 1SOWA 1E6EA 3TQHA 2GYYA 3RUCA 3W8EA 2O4CA 1YBVA 3Q0EA 3QRWA 1IUKA 4FB5A 2VNAA 3K2BA 3WMXA 4J1TA 1E5QA 1RYEA 2B0JA 2O2YA 5JDCC 5A3JA 3OIDA 3DZBA 4I08A 4WECA 4EDFA 1BVUA 3ZV4A 1NHGA 2PH5A 5C3MA 1PGJA 3AI1A 3AY7A 3EVNA 4PLWA 3UCEA 1SCUA 2W2KB 2VYVA 5AXBA 3LVFO 4NJOA 4CUZA 3QY9A 4RPKA 4Y67A 5JNLA 3VZRA 2ZYGA 3PYMA 2C2YA 2QRKA 1CDOA 3I6QA 4YT8A 2P9EA 1K5HA 4MVJE 1YL5A 1H6CA 2VNSA 1DIBA 4AG3A 4ZGWA 1MB4A 5A9RA 4RF4A 5KJFA 1VI2A 2PY6A 4N5LA 2H1SA 4E2ZA 1ONOA 2IRWA 3BMQA 3EYWA 4Z0HO 3CMCO 1BW9A 1OOEA 2NU7A 3CTMA 4RZIA 5EESA 1VL6A 2X0JA 3RUDA 2X0IA 4W9NC 1U9JA 3FF4A 3RIHA 3EZLA 4KOAA 3DZJA 4MVJD 1OBFO 4FFPA 2QQ5A 2O4UX 4GX0A 4QECA 4BKRA 3GAFA 1GADO 1PR9A 1ZEJA 4RQTA 3SC6A 4TVBA 1O95A 4A5OA 3OHSX 2CD9A 2IEBA 3LC2O 2DAPA 4KTVE 1DFHA 4Q3CA 4RV9A 4RVGA 3RSHA 4E33A 4MKRA 1HT0A 2P4HX 1MXHA 3E03A 1P45A 1XKQA 3VVCA 4B8WA 1PZGA 1PU2A 1HYEA 1PGQA 1YVEI 4XEHA 1LU9A 2NU9A 4AJKA 4KUEA 1D8AA 4FIZA 4EJ0A 1VL8A 1GQ2A 2AG5A 2O3SA 4RL6A 1D1TA 1DC4A 1N92A 4GLOA 4U6QA 4HX5A 3S2IA 1NTOA 1U7TA 2B4QA 2X23A 5KOIA 3WWZA 1LC0A 1L1FA 4CL8A 1R12A 4HY3A 4CM6A 1M76A 3WB9A 5H83A 3JQBC 3T7CA 1JKIA 4MO2A 2HJRA 2IE0A 4PN3A 4TZTA 4CM4B 4GX2A 1HE3A 4R41A 3TOXA 3UGKA 1X15A 2RH4A 2Y1GA 2PK3A 1ZMTA 3O38A 1ISJA 4XIYA 3NDIA 4IDAA 4L4XA 1EUCA 1EVJA 2O7QA 4YVFA 4CLEA 2BRUA 3TFOA 1ADGA 4EZBA 2C54A 5L95A 4N7RA 5DULA 2GPTA 4C7KA 5CDGA 1VKOA 5IXSA 3M2PA 3ZN2A 2FZEA 3QVOA 2CDBA 4BB5A 4CV2A 2BELA 1H0KA 3EGOA 2FWMX 3Q9UA 3QWHA 4R1UA 4WNIA 1HYHA 2ZB3A 3V2UA 1YB5A 1D4FA 4I9UA 2YHIB 3PJDA 2TMGA 4FDAA 2PGDA 4HWKA 5HS4A 1Z75A 4TWRA 4K1LA 4R69A 3R0IA 1SEVA 1X14A 3K31A 4UUNA 7MDHA 3PYXA 1HDGO 2VTEA 2QZZA 2W4QA 1WPQA 1NR7A 5FF9A 4N5MA 1MC5A 3UW3A 1V6AA 4ZQFA 4AJEA 4F6LA 5ENVA 3F46A 4CM9D 4A73A 4E2WA 4XYGA 4GBJA 3DONA 2YQ4A 3A06A 1F0YA 2WEKA 3H2ZA 4K9DA 2J6IA 1LDMA 4RO0A 2PZMA 1PS8A 5FFFA 3WLEA 3OEWA 3KXDA 4IMRA 3DHYA 4PG7A 4L8VA 4J0EA 3PZRA 1HLPA 1ZFNA 3KBOA 1NFFA 3UVEA 3LK7A 3O8QA 1TT5A 2GN6A 4XKJA 3O4RA 5DDIP 2AHRA 2GGSA 4FW8A 4XR9A 5JMPA 2GZ3A 3BTUA 4LRTB 3PHHA 4J7CA 4XIJA 5A9SA 2EERA 4YDRA 3TNLA 1K6XA 2CSUA 4CR8A 1MFPA 2P68A 2IYPA 1QXSA 4D0SA 1LI4A 4IDBA 2FPIA 5LDHA 4E12A 1ADCA 3SJUA 1BWSA 1L7EA 4WE3A 3FN4A 5B1YA 2HDHA 3QQPA 1H9AA 4B4OA 1I10A 1QSGA 1KVSA 1YL6A 4Y9DA 1PZFA 3A9WA 4OXNA 2Q1UA 4AJ4A 2FP4A 3U09A 5F5LA 1OAAA 2WE8A 2O50A 3ROKA 3IL2A 4TRRA 4OQZA 2QIOA 1D1SA 4PLZA 4CMBA 4EI2A 2X9VA 3S1LA 4HFRA 5ADHA 5EPOA 4BKPA 2F1KA 2AMFA 3CKYA 5DBGA 3GG2A 2W2KA 3QP9A 3S55A 2V7PA 1M2WA 1KC3A 1E6WA 3QWBA 4CM1A 4E32A 4L4SA 4RVHA 3U0BA 2GUGA 3CE6A 9LDTA 4II2A 4INAA 1VM6A 3FPLA 1HETA 4PLCA 4YT2A 3AJRA 1HRDA 3L6EA 4KQXA 3MWEB 4HP8A 4BVAA 5B12A 3MZ0A 3HJAA 2EWMA 1KS9A 4BNJA 1ZXBA 1NPTO 4U5QA 1X1EA 3OP4A 3RUFA 3WQQA 3GVHA 3L6OO 2VRCD 1OC2A 3DHNA 5TRTA 4G2NA 1QP8A 2NU6A 5LCXA 4OOFA 4OSOA 4UEJA 1Y1PA 1F8GA 1EVYA 1J4AA 3ZWYA 3ZU5A 1A7KA 2OUIA 4R9RA 1UH5A 3TPCA 4BNKA 5IZ4A 2DVMA 3NDRA 3VH1A 2YFHA 4I9HA 4JP2A 2HO5A 5U4QA 1E3IA 2BI8A 1DRVA 1G0OA 1AHHA 1KETA 2Q2QA 2RAFA 3PHGA 2X9NA 4J1SA 1IYZA 1ZSNA 5F1OA 3D1LA 2PTGA 4CMGA 4PLHA 4UREA 5I9NA 4B8ZA 2H5LA 1K89A 4TVOA 5JO9A 4R1SA 3WOHA 5BNFA 5F3RA 1N8KA 1VKNA 5K0ZA 1LQUA 1QYVA 5EJ2A 1AXEA 3Q11A 4JJGA 4CMEC 3H5NA 3AU8A 4OL9A 1LBEA 4RGBA 3WS7A 4P8RA 3KM0A 2CF5A 3IUSA 2DLDA 1ZJYA 3BYZA 1LSOA 3IJPA 3STHA 5U9CA 4ALMA 4BNIA 4CM4A 1Q0QA 5CEJA 3AM3A 3D64A 1R0LA 4E5KA 5JBIA 3D3WB 4BNMA 3ICPA 1UZMA 1ZK2A 4WPGA 5C5IA 4FOSA 4GVXA 3GQVA 3PFFA 1KY5A 3LF1A 5EQFA 5GZ3A 3TN7A 2ZJ1A 2TMDA 1E7WA 3B20A 3E5RA 5T8KA 3AUSA 1JLLA 2JFGA 4DC1A 1ULUA 1B8UA 2O3UA 2V6FA 5L4SA 2OP1A 1KEWA 1DPGA 3BZUA 1YQGA 5CEFA 4JQCA 4EW6A 1BHSA 4BO9A 3E48A 3GR6A 3NV9A 5JO0A 1LNQA 3AOEC 2D5AA 1GZ4A 1T2DA 1T2FA 3R3SA 4Q39A 4BGEA 3QIVA 3H5AA 4AVYA 2PKQP 1I2ZA 4LK3A 3JQAB 5DCUA 4ZA2A 5JS6A 3D3EA 3WGZA 1I0ZA 3A14A 3PHJA 4YCAA 4IDGA 1LLCA 3FTPA 3COSA 1GYPA 3NTRA 1SC6A 1WXDA 3N7UA 1SO8A 4BL5A 1KBZA 3ETGA 1NYTA 1XEAA 4BO7A 3GRPA 1DXYA 1RWBA 2I65A 1IE3A 1J6UA 1PQWA 2ZCVA 1CERA 3IP3A 5TJHA 5I9LA 1LDNA 5ES3A 2QZ9A 4A03A 2O7SA 5F1KA 4XGNA 2DBVO 3NUGA 1V0JA 3WGOA 5A1TA 3ON5A 2Q4BA 4RCVA 4E2XA 3JQAD 3PWKA 4WLFA 3CZRA 3SXPA 3VKUA 3AM5A 3QWIA 3Q1LA 1O94A 3TZCA 2FY8A 2Q1TA 4DPLA 3PFWO 2O3JA 4IIVA 2HMWA 4CUJA 4D43A 5CDSA 2GNAA 2XF8A 1WDLA 2PZKA 1ZZEA 5HRUA 3EZYA 1I2CA 3TOZA 4Q3DA 3UICA 1C1XA 3D7LA 3L6DA 1IB6A 5JC8A 2AQIA 2GZ2A 1A71A 2X6TA 2PNFA 3F5QA 4NFHA 5DOVA 4DYVA 2B37A 1QMGA 1HDXA 1R6DA 1P1IA 3B1KA 4LGVA 4WASA 3HZZA 4QO8A 1PGNA 3U62A 3RFVA 4HFNA 2BHLA 1JWAB 1HE4A 5DNAA 4RDHA 4LMRA 2YUTA 4FC7A 4OKIA 4BQPA 4EGFA 1KY4A 4KUHA 4DMMA 3B1FA 3IS3A 2J8ZA 4JK3A 1WDMA 2FRDA 4YWJA 3T4EA 3GHHA 3ST7A 1G6KA 4JBGA 2C7VA 5COBA 4AJ2A 2C59A 1LQTA 3DZIA 1UXIA 4AJNA 4EUHA 2OBYA 5TSDA 4ZN6A 3OH8A 5U1PA 5K6AA 5CDUA 4BIIA 3P7MA 3ONDA 3FPCA 2EW2A 3FHLA 4CQLB 4JIGA 3WGIA 2B69A 5DT9A 1T2AA 2VRCA 3MOIA 4ZD6A 2VWHA 1HEUA 5DBIA 4PCVA 4AJHA 4CQMB 4CM5A 4U6SA 2OZPA 1N5DA 1ONPA 2OHXA 3DOCA 4J6FA 1E3WA 1QYDA 2V6BA 2JCYA 4BNXA 3F4BA 3SBOA 2J5RA 3DO5A 5A03A 1YL7A 2AE1A 4ILKA 4QTZA 4EJ6A 4K6CA 3W4KA 5EQDA 3K92A 4M8SA 1EFKA 3S2FA 1F8FA 3DZKA 3PGJA 3CH6A 3DAFA 4GH5A 4NBVA 3VZPA 3NKLA 4JP3A 3X2FA 3MJEA 4A0SA 2JHGA 1XWFA 4CL3A 4OIMA 4BO5A 1V3VA 1Y8RB 1WLYA 3QVSA 1Y81A 5JYEA 5ICMA 1SAYA 3GEGA 1ZNQO 3NT4A 1QV7A 4FFNA 2I67A 5BT9A 2Q1WA 3UXYA 3TF5A 3VDQA 1M67A 3HFGA 1EBUA 1KYQA 1MFZA 1EFLA 3HWRA 3G0OA 1E1KA 1KVUA 2X0NA 1QV6A 3RJ5A 3RKRA 1GU7A 1ZIDA 4WUVA 1H9BA 4LSMA 3OECA 1WW8A 2HU2A 2ZTMA 3OBBA 1QKIA 4J7XA 4W82A 4XZ3A 4NNJA 5G0WA 3E5MA 1NM5A 1W0CA 3CMMA 3VZQA 3ZW8A 1X7DA 2BGLA 1AE1A 2D59A 2Y0EA 3ADPA 1JA9A 1DAPA 3D3WA 4NFYA 1IY8A 5THQA 2RIRA 2WTBA 2IODA 3OQ6A 4DIBA 1NP3A 2DTEA 2PV7A 1WMBA 2FN7A 3WQRA 3GVCA 3GEMA 2W90A 2QX7A 2VTDA 1HDYA 1I2BA 3WSWA 1SEPA 2HUNA 4BMVA 4PLYA 1LEHA 2IDZA 3LLVA 1X0VA 4KZPA 1ISFA 2ZIZA 5MDHA 2FR0A 5CG2A 1U2GA 1ID1A 2AE2A 1U3VA 4AJPA 1UR5A 3JQFA 4KUGA 3RUAA 4NU5A 4FN4A 4I5FA 1R16A 1LDGA 1UAYA 4PLGA 3RC1A 5BQFA 2CDCA 2Y0CA 1LUAA 1WP4A 1VL0A 5TS3A 3UH1A 3ZI0A 4OXKA 1TXGA 1XGKA 1NBOA 2LDBA 1YQDA 1YBMA 3FD8A 1U5CA 3EW7A 3GG9A 3GT0A 2AG8A 4UVEA 4JBIA 2CY0A 4MIEA 4MVJF 3ULKA 2D3TA 4E5YA 1UXJA 2X86A 1GCUA 4J7UA 1BG6A 4WLUA 3HN7A 3NT5A 2Y0DA 3NJ4A 4TZKA 4IM7A 5JFOA 3ZV3A 1PJ3A 3GDFA 4WOKA 3GLQA 3RI3A 2EV9A 1NQOA 1GYQA 1RYDA 4FS3A 3DR3A 4O1MA 3ZWOA 3JQDA 4JCOA 4XRGA 5DN9A 1JAYA 3INRA 3JD2A 5B4UA 1HZZA 2VCYA 1E7MA 2AXQA 3EUWA 3QLJA 1QORA 4FCCA 4CODB 5B4TA 1TT5B 2EXXA 1EE2A 2DUUA 1R66A 1XLTA 3RVDA 1E7QA 4OO3A 1JKFA 1E1NA 3IMFA 4BNNA 5IJZA 4ZJUA 2I6TA 3W8FA 4PZDA 1CWUA 3O03A 2VWGA 2R6JA 4FFOA 3KEQA 4E4YA 4XYMA 4BO3A 1VJ0A 1VLLA 1YOVB 1R4NB 3P5SA 1Y8QB 2C7GA 2AQHA 1VJ1A 2BGKA 2I5PO 2Y99A 1B26A 2CZCA 4DLLA 3VPGA 4LISA 3W4IA 3IAHA 4NK4A 4E3ZA 3RKUA 3ZWAA 1ZW1A 2ZB8A 4ITUA 3LZ6A 4PG5A 3JD1A 2FPPA 4ZICA 2HRZA 1EMDA 1K6IA 4E0BA 1EDOA 3C24A 3KYDA 4CQLA 1TB4A 3I9OA 4QO7A 3E9QA 3TWOA 2Y93A 3ZZNA 4CQMA 3OIGA 4GAEA 1Z45A 3ROQA 1E92A 4DIOA 3IDSA 4GVLA 5H82A 1WMAA 2VWQA 1T25A 3V8BA 1I24A 4E31A 3K96A 1XIVA 3GAZA 4UEKA 4RDIA 5JY1A 1QYCA 3RFXA 3KEOA 2JD2A 3BTOA 4RF2A 4BNYA 4II3A 4I5EA 2HMVA 4CLOB 3LLSA 1ENYA 1DFGA 2CUKA 2RBEA 5A04A 3ONEA 3QVWA 2NM0A 4MP8A 4HKTA 5ILGA 2O48X 1RM3A 1PQUA 1CYDA 3CUKA 4PZEA 2P5YA 2PFGA 5CFZA 5IAAA 1NPDA 1P0CA 3GNSA 4IDEA 4J0FA 3ZWNA 4B4UA 1OC4A 4TSKA 1Y8RA 1LX6A 3LYLA 3C3XA 3GDGA 3GZNB 3DMYA 5T67A 1A4UA 2P9CA 2D2IA 1X13A 5DCWA 2JJYA 3LT1A 5G0VA 5HTOA 1PJ2A 1YE3A 1W4ZA 2VHWA 4E5MA 2YDYA 5ICSA 3NTQA 1YDWA 4UUPA 4JGBA 3F47A 4MKXA 4IBOA 4J9VA 1LDBA 4EJMA 3BAZA 5TC4A 2QYSA 2DKNA 2A35A 3F9IA 3OQBA 3ZNPA 2GLXA 5T8KC 1UP6A 4BNVA 2P2SA 2DT5A 8ADHA 1N9GA 2ZB4A 1O5IA 3JD4A 5FEUA 3ANNA 2X7HA 1Z74A 3H9GA 4O63O 1IHXA 4R16A 4OOEA 1HDZA 4GWKA 3F6YA 3H4VA 4PVCA 1NWHA 4Q3NA 4DTIA 2YZ7A 4Y8VA 3BMOB 4CJXA 1EK6A 5TT0A 5L7YA 4IDDA 1JVSA 2A9FA 3TZ6A 2BI7A 3I1JA 4WKGA 3B1JA 2UAGA 2BFPA 1IL0A 1HTBA 2DBRA 3DBLB 3JQEA 3ZGYA 1C0KA 2G17A 2Y1OA 4RPHA 4YQZA 3NGLA 1KVRA 1V3UA 4P4LA 4B3IA 4D3DA 1KERA 1Y5MA 1T2CA 2GN9A 3TJRA 1PZEA 3HNPA 4ZQBA 4EUFA 5DP1A 3GDOA 5KKAA 3JQGB 3I4CA 1YBAA 2PR2A 3BIOA 5G0TA 4CM3A 3D0OA 4QFCA 2HCTA 3GEDA 3GHYA 3AFNA 4C7JA 2RCYA 1PQPA 2W8ZA 1GZ3A 1LRJA 2NQ8A 3CSDA 3TDKA 1D3AA 5ER6A 3PLRA 1XSEA 1A27A 2EIHA 1U8XX 3JQ9C 3PJFA 3E9NA 4JJIA 3V2HA 3VTFA 3WNQA 3Q3CA 1Z6ZA 2P4QA 3U4IA 3G49A 4KDEA 5L7TA 1EVIA 4R1NA 1M75A 1P31A 1YXMA 4PRLA 2CDAA 1U8FO 2WD8A 4IXWA 3FWZA 4W7IA 4YB8A 4EEXA 1PZHA 4URFA 3WXBA 3SC4A 4D46A 3E8XA 1ULSA 3I9NA 3O26A 3GK3A 4YTEA 5AXAA 1NVMB 2IXBA 2VHVA 1U4OA 5JPIA 3I9KA 1N1EA 2B5WA 3UHAA 1XR3A 3BHMA 2R2GA 2PKRA 3T7EA 8LDHA 3OMLA 4ALIA 1H2BA 4W99A 1IULA 2V6MA 1RKXA 4S3MA 4O59O 4K26A 5K6AC 5KVCA 1QYXA 1Z82A 3WNVA 4DREA 3ICCA 4ROSA 1C1XB 4QEDA 1QLHA 1Q7GA 1KC1A 4A7PA 5KVSA 2DM6A 4GWGA 1YOVA 2OL4A 3K8ZA 1R4NA 4A10A 1Y8QA 4NK5A 4LMPA 3PWZA 4BNHA 4ND2A 4YXFA 3RU7A 3ZCXA 4IINA 3GVPA 1LRLA 1NWCA 4GGOA 2PH3A 2H63A 4F46A 4J1QA 4WLOA 4BV8A 5KWEA 5AXCA 3DBRB 2Z95A 3KVOA 2NVWA 2NNLD 4J4TA 2BD0A 1J0XO 3FBGA 3KV3O 4UVGA 4PG8A 4QFDA 3KYBA 3PYLA 4BNLA 4YT4A 2DBZA 2GN8A 5JC1A 1ZBQA 3I3OA 4CLDA 4B7CA 4PIVA 5IN5A 1I30A 1F14A 3RUIA 4A2CA 5A06A 3MOGA 1U3WA 2QHXA 2AEMA 2Y05A 3GMDA 4RLHA 4EBFA 1E5LA 1OI7A 5JE8A 1U3UA 1FDTA 4GPD1 1DFIA 3ETDA 3ITKA 2HMUA 3DAGA 3P2YA 1CRWG 4BNWA 1LA2A 3I52A 1E3WB 4M86A 1UP7A 4R1TA 5THKA 4CLOA 1DHRA 1GCOA 4RQUA 1JTVA 3RC2A 3RUEA 3QJ5A 3MJ4A 1SMKA 3KZVA 3FBTA 1PJTA 2ZB7A 3G1TA 3AUAA 1MA0A 3PQFA 3WJAA 2HAEA 2RHRA 4N5NA 4DIFA 1LDYA 1B3RA 4XQCA 1DIHA 1G0NA 4U0JA 2BKAA 1R0KA 1L7DA 1E77A 1B8PA 4FSHA 5I9MA 4MDHA 3QSGA 1LSJA 4ESOA 2P91A 3GZNA 3G17A 4ZQEA 5IZCA 3QW2A 1E3SA 5COQA 4R5HA 3OJOA 4J1NA 2C29D 5TGDA 2A4KA 5A02A 1PWZA 3KSZO 2HK7A 4CR6A 1CQJA 1I36A 3NDJA 2JL1A 1A4IA 4M55A 1IOLA 4TRNA 4BGVA 3IJRA 1FJHA 2HMSA 2NTJA 5EINA 5AVOA 3WWYA 2VYNA 5BNIA 1U28A 1V8BA 3JQ7B 2IZ0A 3OJLA 3WBFA 1HDRA 3D5TA 1YJQA 1P1KA 4M54A 1B0AA 5A05A 1YB1A 3DC2A 4RVDA 1S7CA 1B2LA 3K6JA 2H6EA 4W4TA 3HG7A 2FOIA 2NTVA 2YV2A 2GD1O 3AI3A 2W2LD 5TNXA 3AI2A 4J2HA 5A4DA 3WSVA 3KHUA 5FI5A 1MV8A 4Q3BA 1CF2O 1KIFA 1NPYA 4KQWA 3JQFC 1ENPA 3PIDA 1OZAA 4UEOA 1XDWA 1GR0A 3ZNQA 5HWSA 4R01A 1WZIA 3BMOA 5A5EA 3DTYA 4BKOA 4O5OA 4LRSB 4YJFB 3FNHA 4JX8A 4XB2A 1VRWA 4DPKA 3SVTA 1U2DA 1NQ5A 7ADHA 2Y1FA 5A3VA 4KP7A 2GRAA 1Y9EA 4B7UA 4J90A 4IGFA 3DBLA 5JAIA 2B36A 3D4NA 4HADA 3V1YA 1XG5A 2EJWA 2VHXA 1FDSA 3NX4A 1U4SA 4YQYA 3WYCA 3G1UA 1GFSA 3L4SO 4UVIA 4BO4A 1UP4A 3QE3A 1ISIA 3W4JA 3AWDA 3MWDB 4CMKA 3C7AA 2WYUA 3EMKA 3M6IA 3JQGA 2UUPA 2SCUA 4Z9FA 1IPEA 4TRMA 3PDUA 4R9SA 4WCFB 1UXGA 3RAJA 2X58A 1HE5A 3E9MA 3UN1A 2X9GA 3PHLA 3EHEA 3I9MA 1EEHA 1V9LA 1YB4A 4O6VA 2NU8A 3UFXA 1YDEA 3FI9A 2VUUA 2O23A 1A7AA 2Q49A 1BVRA 1P33A 2GF2A 3PK0A 3HDYA 1H5QA 1H6DA 1I3NA 4LSWA 1B16A 3U49A 2D5CA 5TT1A 4ALNA 2X5KO 2NADA 4XX0A 5B4VA 2H9IA 2WYWA 4D44A 1ZK3A 2NVBA 4JXKA 1HSZA 3IQDB 3GGPA 4NG5A 1WNTA 4OJNA 1LTHR 4BGIA 1EZ4A 1RPNA 3JQ8A 1JWBB 1MG0A 4BUCA 3H7AA 3PXXA 5AQ1A 1RM0A 1V35A 2AQ8A 4Y6RA 4R51A 4PLPA 3NYWA 4HFMA 4QX6A 1VE9A 3QWAA 2LDXA 1O6ZA 2Q46A 2DFVA 3ZNNA 4DXHA 1XA0A 3CPSA 3JQ9A 1QG6A 2HJSA 3X2EA 4R3WA 3WYEA 1PL8A 3B6ZA 2X4GA 5T6BA 1ZVMA 3HDJA 1UDBA 2UDPA 4I5DA 3DXFA 4UVDA 4PVDA 4UUMA 4XJSA 5C7OO 3OIFA 1NFQA 3U3XA 1R37A 5A9TA 2X5JO 3F3SA 4QQRA 4AJ1A 2FZWA 1GZ6A 2YY7A 4W7HA 4RF5A 4GMFA 4ZU3A 2E4AA 1A5ZA 2PA3A 5I8ZA 3KTDA 1TI7A 1NQTA 5HM8A 3PRJA 4TQGA 3WJ7A 5L51A 3DB2A 1EDZA 4ND1A 2EW8A 2FR1A 2ZKLA 5CPFA 1NX6A 3NT2A 3DBRA 5G0SA 2HK9A 3AUTA 3ZWXA 4FGWA 4L0QA 3VH3A 1QR6A 5L9AA 2YV1A 2UV8A 4E6PA 4OSPA 3RCBA 3VPFA 2NVUB 3UCXA 1U1IA 1U7HA 5FI3A 3MTJA 2OP0A 5G4KB 3DWFA 4LVUA 4QUKA 1W73A 2F00A 2FHSA 3KYDB 1ENOA 2HLPA 3ANMA 3R6DA 5L45A 1NAHA 3WGYA 1GY8A 2WM3A 1GAEO 1YKFA 4MIOA 1R15A 3WG9A 2WMDA 2XXBA 3ROMA 2CNBA 1TA4A 1XHLA 4FBGA 2XXJA 4NDNE 5JAZA 3HFSA 2E48A 1XELA 1GV1A 5G2OA 4OYRA 1O9BA 3JD0A 4RORA 1E0DA 3U4CA 1ISGA 1GQYA 4QSMA 4LCEA 2PGJA 1VPDA 5T5QA 3V1TC 1PR3A 3WGTA 3WTCA 2V6GA 4KDFA 1ENZA 4JJFA 3DFUA 1WDKA 1ML3A 2X1HA 3H9QA 2W2LA 5JLAA 4CQMD 2WE7A 4OQYA 5GY7A 3GNTA 4HBGA 3PHIA 3ENNA 4JNKA 4IJKA 4BNZA 2O2SA 2BFOA 4PG6A 1VJTA 4FC6A 2G1UA 3PJEA 4D3FA 3L4BA 4R54A 1LXCA 4FGSA 4MINA 4OAQA 3PVZA 3L9XA 5CAEA 4CM8A 3RU9A 3I4FA 5L4LA 1Y7TA 3K5PA 3A4VA 3JQ7A 3Q6IA 3HQ4O 3FRJA 3OEYA 1HF3A 4DPMA 2C07A 1GQQA 3KSUA 3OJFA 1LJ8A 3PLNA 3VC7A 4CLRB 3CZMA 1XYGA 3L9WA 2B4TO 1ZMOA 2Z5LA 4MVJM 4BO6A 5JAMA 2C5AA 2NWQA 2I3AA 1U3TA 4J3FA 2GCGA 2JHFA 5HBRA 1LSUA 4F45A 5KIAA 4OH1A 4BO1A 4ALLA 1N9GB 2HQ1A 3OSUA 4MVJI 1Q2XA 1HLDA 2I66A 3HHPA 4I8XA 5C37A 1P77A 2DC1A 1NR1A 4IJUA 1Q0HA 4OM8A 3GUCA 2DPHA 1E7SA 3WQSB 4YJFA 4XR4A 3HE3A 3WTBA 2Q50A 4IJWA 4MOWA 3JYPA 3M2TA 2GN4A 3D5QA 3OF2A 3PWSA 4P22A 3QA9A 3DEYX 3JYQA 4AJLA 1CQIA 4IQ8A 3RJ9A 2PZLA 4NBWA 1SPXA 2J3HA 4B79A 1IPFA 1NXQA 1ZK0A 2WD7B 1YO6A 2I76A 2CFCA 2OFPA 2ZTLA 3OICA 1H6BA 1ZJZA 4RPGA 4WCFA 5L4NA 4YA6A 1B15A 1I5RA 2XPCA 4ID9A 4BNTA 3IKVA 1E7RA 4JN6B 3ENKA 3I83A 1TT7A 4ONEA 4NBUA 5K9ZA 3ZU2A 3VTZA 5LC1A 4XYLA 4H16A 3KYCB 2C0CA 4XQ9A 1P9LA 3VPSA 3H65A 3Q9NA 4MVJH 4TRJA 4DLBA 4YJHB 1IHYA 4F3YA 1GPDG 1N7GA 2Z1MA 3C1OA 1X0XA 2Q3EA 2Y1DA 1S6YA 2HRBA 2HKIA 1R0SA 1ZEMA 1QLJA 1AXGA 2VQ3A 2WWRA 3C7CB 2VHZA 3EDMA 3G79A 1V3TA 1DIAA 2GR9A 5EIOA 3N74A 2C20A 1BSVA 4KTTE 3OJEA 4X54A 4S1VA 1M66A 4Y6PA 4C4OA 3WMWA 1DJQA 5FYDA 5CG1A 1DIRA 3EY4A 1GD1O 2Q45A 5JCXA 2CVQA 1JN0A 3WICA 1UZNA 3JQ6A 1SOVA 1E1LA 5IF3A 2VN8A 4OHUA 1R4MB 4IZHA 3C1AA 2RHCA 1AN9A 4YAJA 2BGMA 5T64A 4D0RA 1DB3A 4GX1A 2Y68A 2B83A 2JAPA 3FR8A 4NZ9A 2NV6A 1ORRA 4XA8A 1YONA 2PZJA 3GPIA 3Q2IA 2VOJA 5BSHA 1DLIA 1PSDA 3INTA 2J5KA 3LC7O 2VZ9A 2ET6A 5T57A 4HUJA 4DGSA 3SEFA 4PFJA 2EHDA 1PS0A 1LLDA 2R00A 2CVOA 3GF4A 4FJ1A 3SLGA 1DAOA 1BMDA 1FDWA 1EVZA 3LT4A 3HDHA 4HNHA 1UAGA 3CEAA 3GPDG 3PIIA 4B3JA 1XU9A 1DC6A 2EKPA 3PZBA 4JLWA 3WIEA 1DIGA 1N1GA 2NVUA 2OGUA 5JAQA 4PLVA 5G4KA 4YJGA 4IQGA 3FNEA 3R3JA 4P4NA 1MUUA 2GO1A 1H6AA 2GZ1A 1DBVO 3LU1A 4I1IA 5EMHA 1MC4A 1PEDA 3I9JA 4J49A 2UVDA 4D7AA 3WX0A 3DBHB 3C8MA 4CM7A 2VHYA 1I3LA 2QRJA 4DMLA 2Y1EA 4D42A 4AICA 2OBNA 3CINA 4CMAA 5IZCC 1Z7EA 4ZRNA 3IKTA 4LW8A 2J3IA 1EQUA 2D4AA 4Z9XA 1DJNA 4Z6KA 2ZQZA 4ND4A 4ZQHA 2VUSA 4FPXA 3WBBA 9LDBA 1GYRA 3GVIA 1K0UA 1UDAA 3DZHA 1UUFA 5JDIA 1T24A 3NEPX 2RH8A 5IXYA 4Z3KA 3LQFA 4Q3EA 4U7WA 1T26A 4FD3A 3CIFA 4R3NA 3S8MA 1RM5A 3ROPA 1T2EA 3ADOA 1N7HA 1VSVA 4B3HA 4GKBA 3TRIA 4B4VA 3TZKA 1DLJA 1ARZA 2D0IA 4YACA 1LC3A 3RC9A 5BSFA 1YH3A 4FQ8A 4NIMA 4XDYA 3ANLA 4TKMA 1HL3A 1BDMA 3KO8A 1PX0A 3VH2A 4J4HA 3SJ7A 3U5TA 1PIWA 1T4DA 5I8WA 4XGIA 5HS6A 2BH9A 4M49A 4LN1A 1EK5A 5A5FA 2YJZA 2AW5A 3HB4X 4LVCA 1Y9AA 4IS3A 6LDHA 5KVQA 1KVQA 4CLRA 2ZYDA 4XQEA 4XYEA 3RQSA 3JCZA 3OQ1A 5JCJA 1NQAO 1FDVA 4XB1A 3E82A 2X22A 2PGLA 4FFLA 1HYGA 4YRAA 3FTNA 3OJ0A 3CXRA 4XCVA 2XOXA 4B7XA 4BQRA 2ZTVA 3EVTA 2FSVA 4L4RA 4DA9A 6ADHA 4PLTA 1KEVA 1BRMA 3NRCA 3W1VA 4KWHA 5CDTA 1JVBA 3PP8A 1UXKA 3E6AA 4R5MA 3GMSA 4FFRA 5TLSA 1H94A 1ZK1A 2D1YA 2PD6A 3AM4A 2EP5A 3HADA 4Y98A 1FDUA 4HFJA 5GZ6A 2VYND 2BFAA 1SNYA 1CIVA 2OOSA 3INGA 4MKZA 5BSEA 5FWNA 2WD7A 1SB9A 1KVTA 1P1HA 4PGFA 3BMNB 3HDQA 5COAA 4IMPA 4RPJA 4Q9NA 4GSKA 4CV1A 4IPTA 1E7YA 5CPBA 1PJQA 3ZHZA 4YR9A 2BF7A 3ZWWA 2NSDA 1Q1NA 1TVEA 3KYCA 2ZTUA 3ZU4A 5ILOA 1PWXA 1Q0LA 2VZ8A 4NQZA 4P38A 3ASVA 1GUYA 2ZYAA 3W8DA 2FPGA 4DUPA 4DYDA 4YJHA 1VC2A 1P1RA 3FWNA 5KJ6A 1MP0A 2E82A 2QG4A 2POQX 3BHJA 3H6KA 1GEGA 3LF2A 3LDHA 2Q1SA 3BHIA 1C1DB 2EKQA 4NJMA 3TZQA 3OFSA 5AYVA 3U4HA 4DL9A 2HMTA 3MJCA 1X7HA 5AXDA 4TROA 3IUPA 5IDYA 1JU9A 4E13A 4BNUA 1ZXLA 2ZK7A 1PS9A 5ITVA 4J9UE 3K73O 3LT2A 4IDFA 1J49A 4YJDA 4GL4A 2O3RA 1A72A 1M6HA 3VHRA 3V1UA 3JQ8B 3PQDA 2J3JA 4WK6A 1YWGO 2EG9A 3L77A 2FR8A 3DHEA 1ZO8A 1R4MA 3PEFA 4MVJG 1F12A 2NTNA 3U4DA 1O8CA 1DC3A 1W6UA 4DLAA 1ZCJA 4HXYA 3IOYA 3DL2A 5F1PA 4CMIB 5KCZA 3MTGA 5DCYA 1EUZA 3JYLA 3NTOA 4DQXA 3FNFA 2VT3A 5CDYA 4BOYA 4R68A 3IP1A 1NNUA 3BTVA 4EITA 1DDOA 1ADFA 1XU7A 4N54A 2DQ4A 5IDXA 1I3MA 4XRRA 3MJVA 2Y1CA 3SLKA 1NVTA 4CV0A 2O3QA 4UUOA 3L0DA 1BXGB 1F17A 1I33A 3RC7A 3I23A 1W8DA 1RJWA 2DBQA 4CMCA 1GTMA 2JD0A 3JYNA 3LT0A 2QW8A 3H5RA 3VOSA 3ZW9A 2WJPA 2YFQA 3MCVA 3QV1A 4PG4A 4E5PA 1ZUD1 3TFQA 3ZV6A 4JBHA 3VAZA 4MJLA 3WGQA 4ND5A 4WNCA 4B4WA 1JQBA 3PTZA 5IDQA 1P1JA 3TSCA 1ISMA 4Q3AA 4L73A 4NPCA 2O3TA 2UYYA 2AEFA 2WDZA 2V65A 4AJOA 1ZK4A 3DBHA 4BO2A 4YYZA 4Z0TA 1GUFA 2QYTA 1H93A 4BNFA 4J4BA 4E21A 4XYBA 2E49A 3MJTA 4YRDA 4EUEA 1GDHA 3ONFA 1PJCA 4J2OA 1CETA 1WAMA 5TJ9A 1P44A 2OMEA 1Z7BA 3L4BC 4YAIA 5CP8A 3RUHA 1MG5A 3F1LA 1K3TA 3C1TA 3WLFA 3OM9A 4AJJA 3M1LA 2VZ0A 3H9JA 4M89A 4CLXA 3S2GA 4Y6SA 2BLLA 1D7OA 5ER9A 3FCOA 2Y67A 4BKQA 1K2WA 1EUDA 3KSDO 4MVJA 2OORA 5BR7A 4DQUA 3VPHA 1K6JA 2X5OA 3EAGA 5EL0A 3I6IA 2HK8A 1VSUA 4M1QA 1YJ8A 4NU6A 2E6UX 2PD3A 3H3FA 1PJSA 3LC1O 3N58A 5C7IO 1BXKA 1KEPA 4K28A 2DFDA 2OXIA 1UZLA 2D8AA 3UKOA 4DRYA 3DDNA 1GEEA 5G0UA 5KVVA 5KNLA 1SB8A 4BS9A 2NACA 5ENDA 4BNGA 4J91A 4BMSA 4CM8B 4D45A 4WLVA 1BDBA 5EN4A 3JV7A 3GY0A 3VKVA 3F5SA 5DZSA 5JDCA 5AOVA 1DRUA 4DQVA 2NQTA 4UVHA 1XCBA 2YYYA 2AQKA 5JW6A 2XAAA 4I9NA 4L74A 4TMFA 3ORFA 4IY1A 3EK2A 4L76A 3FR7A 4AFNA 4DC0A 4D79A 1PJBA 2JFFA 3BMCB 1ONNA 3K9QO 5L53A 2G82A 3A28A 1MX3A 2GASA 4HNGA 3GN1A 3PDJA 3WIDA 2B5VA 3A1NA 4FFMA 3H8VA 1B14A 4WCFC 3KETA 1JAXA 3E18A 3PJGA 4UULA 3IIEA 3DZFA 3BA1A 2Z1NA 2CF6A 1PJLA 3AOGA 3WFIA 4Z3DA 4IUYA 4BB6A 4EEZA 3PQEA 4WEQA 5I7FA 1F06A 3GOHA 3UOGA 2VOEA 4BGUA 1QRRA 3HB5X 4FR5A 3ZHBA 4MVJP 4W9NA 3KLMX 1HE2A 1PTJA 4E30A 2IZZA 4H7PA 1IZ0A 3RBVA 1ZKMA 3BMNA 2Q99A 3TL3A 3K2EA 3ZU3A 3HN2A 2DUWA 3PI7A 4WLEA 3B70A 3IC5A 5LDGA 1WVGA 3WGHA 3ZDFA 2FMUA 4A27A 5BNTA 1Q7CA 1GUZA 1E6UA 2ZCUA 2PKQO 4NHEA 4NR0A 4MPDA 1NAIA 4RJTA 5KKCA 3H9EO 4L75A 5TX7A 4YT5A 5L7WA 1Z73A 1I3KA 3GZ4A 4YBZA 3AY6A 1ADBA 5IG2A 5KTKA 4RZHA 4RPLA 4BO0A 3KB6A 4CMJA 4GX5A 3ZWCA 3DTTA 1C1DA 1XQ1A 3M1AA 2Q2VA 5C7LO 1C0PA 1M6WA 1TEHA 2DTDA 4MIYA 3VH4A 1PL6A 3ABIA 3PGXA 4WLNA 3SX2A 4CM9A 5IN4A 3GC6A 4RF3A 1MXFA 3S2EA 1P0FA 5L3ZA 1J5PA 1YQXA 3JQBA 3QHAA 3O9ZA 1AHIA 2YHIA 4U0KA 1SBYA 1P3DA 5HA5A 1X1TA 1I32A 1C14A 1E3JA 1O89A 3D4PA 2R00C 3JQCA 4P4GA 1G1AA 4CMIA 1B7GO 3AU9A 3TZHA 1E3LA 3H2SA 3RBZA 2YDXA 3P2OA 3I9LA 2Q2WA 3ZWBA 5I7EA 4IZIA 3H3JA 2YW9A 5EERA 4IDCA 3DMTC 4HV4A 1B8VA 2Y66A 1HDCA 1ZSYA 4XGKA 4QT0A 1BGVA 4FJ2A 1FMCA 3RROA 1BXGA 4XD2A 2JKVA 3WR5A 3ZWPA 3AY3A 2YQ5A 4ZQGA 4OKNA 3PPIA 3RASA 3DOJA 3JYOA 4WGGA 5GMOA 3DZGA 3FSRA 4ND3A 4GLLA 4YAKA 1OFGA 3T4XA 1I01A 3GH3A 4ZVVA 4IGEA 4NBRA 3UF0A 4DBVO 1MGOA 3DQPA 1UDCA 3RWBA 3GFBA 5IFLA 1YRLA 3Q2KA 4NMHA 1T4BA 5B37A 1WWKA 5JDIC 3DOOA 3K30A 3QWFA 3W6ZA 4WJZA 3RBXA 3P19A 2C5EA 4YJGB 2WSBA 2X0RA 4N18A 3F4LA 3ASUA 3U9LA 1NVGA 1HXHA 4DWVA 1FF9A 4CMHA 2EF1A 4GGPA 3UCFA 5L40A 4YAGA 3ZNOA 3VVBA 2PWZA 3MJSA 3UUWA 4LCJA 1EBFA 2QRLA 4M87A 3AFMA 1SZJG 4RVSA 3DFZA 4GI2A 2IYOA 2B35A 3F1KA 1C0IA 2VWPA 4NBTA 2CVZA 4D3SA 3GNQA 3NJ8A 4NFSA 1WZEA 1HWYA 3ETEA 4A26A 3VZSA 4G5HA 5CHEA 1DHTA 4EYEA 3GN2A 3C7DB 3VPXA 1LLQA 3I5MA 5MGBA 4WEOA 4AJIA 3ZV5A 1KEUA 2NUAA 1JW9B 4KMSA 2GSDA 2P5UA 4H15A 5KJ1A 1AGNA 1YS4A 2A92A 4FJ0A 5JY6A 2ILTA 4G81A 4XQGA 1Y5RA 1YGYA 5JSFA 1AUPA 3TL2A 4OGWA 1C3VA 2DTXA 2I9PA 3BTSA 1GL3A 1PGOA 2NLOA 5DP2A 4CPDA 5ITWA 3AUUA 1PL7A 1C0LA 5DBFA 4CLHA 2J5QA 3GUYA 1T1SA 2EGHA 3ZHXA 2UUOA 1HZJA 1TLTA 1LSSA 1Q7BA 1QYWA 3BMQB 5TIIA 2WYVA 3ZH2A 1DOHA 4RVUA 1XQ6A 1BW9B 3BMCA 4WCDA 3ZWMA 2DU8A 2X8LA 3HSKA 1UXHA 3WFJA 4IIUA 4PLFA 4MP3A 1NASA 2G0TA 2VUTA 2VYVD 1DRWA 4YRBA
chains in the Genus database with same CATH superfamily
1JHPA 3ZHYA 1KYIA 4R4JA 3NAQA 3L7IA 3N0TA 4MB2A 5IKPA 4O25A 3ECCA 1S3GA 1OU4A 4MI9A 5BSMA 2GPYA 4I55F 4NLLA 4ALJA 1VDZA 2JARA 1EFAA 1QGUB 3GFGA 2YV3A 3JSAA 1WXQA 5ILQA 4LEIA 1K8QA 1R6VA 2XUQA 3UAGA 4YV7A 3TRJA 3I01A 4TMZA 3QVXA 4OXYA 4V0ME 4KWEA 2BEWB 2F48A 3NIFB 4GSLA 4GOXA 4WI1A 5C3UA 3TDNA 3TVDA 1X7ZB 4YPOA 3GO4A 1E3EA 3SZOA 4KN8A 5JCJD 4JT9A 5GINE 2CSXA 2NUBA 3DAPA 2C82A 2FTKE 3RVMA 4ALKA 2QTBA 1WVIA 1SQGA 3BF8A 3EZNA 1OKKA 4KFUA 1RVDA 4LJ5A 2BC9A 3GLTA 2XSZA 2XB2A 4YUAA 4AZWA 1O95D 2D7DA 3QPUA 4I8DA 2QL9A 1E2IA 2RB5A 2D1RA 1E8DA 1ZGAA 3O8LA 2J3EA 4D26A 1T9KA 1TGVA 2GPBA 1DEHA 2PT7A 3GGOA 3MFYA 3KG2A 4D8TA 3TECE 2ZJ0A 1GN9A 2BWJA 3I1FA 4K03A 1ZAKA 1NHWA 4NENA 5AJXA 2BEJA 1FVHA 3NEAA 3ZGOA 4CEHA 2R66A 2B4RO 3RFCA 4AZTA 3KTAA 4RBNA 5JS1A 3NHPA 2CE7A 3AYZB 3EFOA 2J7KA 4JROA 4UZFA 1N5LA 1KP9A 5TQVA 4RY9A 1BE1A 3OCVA 5ALOA 3R9IA 5LMCA 3FNGA 3QUTA 2JCXA 4PGHA 4BO8A 4CMEA 3HKBA 5F5NA 3W6UA 1JXAA 4CI0B 1MHPA 1OXVA 2EJVA 3N3AC 1PVVA 1U0BB 2EKLA 4TYNA 1FTQA 4BKUA 3LL4A 2ZATA 4I5GA 3NCHA 4LJ7A 1BFDA 2C61A 1G8HA 2Y2UA 1ZOPA 4QDJA 4RU1A 4UBJA 2I3GA 3H5TA 3MHTA 1RJEA 5LB4A 3Q0IA 2B7CA 2P9GA 2PYDA 3FUVA 1CEQA 1G5QA 1SVWA 3ONWA 1NOKA 2PKWA 4I50F 1RI3A 4N6NA 4DJAA 2Q4EA 1EX1A 3GLFA 1KO5A 2H8KA 2HCFA 4PICA 3UBTA 4Z2YA 4E22A 3GGGA 5CEEA 1CY4A 3KB2A 4EELA 3HYSA 3STTA 3UOAB 2ODEA 1HG1A 2EEZA 1HKUA 4LOHA 4M37A 8GPBA 3EEFA 5KINB 3UJNA 3VNAA 2CCGA 1JQ5A 3PQ8A 1I6MA 2WU4A 1EP3B 1UPCA 1VKHA 2JF0A 3KT3A 2G7ZA 1FFXB 2VCEA 1ORVA 4QYWA 3HJCA 4XJTA 3D43A 2ZUTA 3RYFA 1APBA 4RGQA 3OBIA 3HU3A 1X7GA 4RTSA 4ZOAA 3O0DA 5I9SA 4MUHA 4MP6A 4HF7A 4X1IB 1USIA 2GEUA 2V7EA 4G0MA 3QVTA 3CE9A 3DEJA 4RV5A 3WNBA 3DLBA 4AKHA 5CCDA 3OZIA 1NJ8A 1TVKB 2QYHA 4E5SA 4NI5A 4DY4A 2PLNA 1B23P 1OZHA 1M5TA 4GPIB 3NGXA 3RWOA 2CJWA 3FPEA 5FA5A 4EB3A 1C9NA 1P9OA 3F2IA 1MOZA 3Q0TA 5T4FA 3S2UA 1A1SA 3AXSA 3DBVO 3QVLA 2WOJA 2QUKA 4B2LA 2RK3A 1YGPA 1MTOA 1A9ZA 4MLCA 4BMOB 4BVFA 3D8RA 3G3EA 1UC9A 4AUNA 4XDZA 4ZTZB 1T5SA 4ROTA 4DUGA 4KPGA 4GQAA 4DIDA 2CVPA 4F6CA 1IBCA 3G2MA 4GUDA 5LBUA 1R64A 1UWLA 3ER6A 3E9CA 4OV6B 4A1OA 4DDHA 1PGPA 1LTKA 3CWQA 3NBUA 5EXTA 2I6QA 1BKYA 1L5OA 3EA5A 4RLSA 1A9YA 4JV5B 2GERA 3GRCA 3VPBA 1G2QA 3FCEA 1JSXA 3C97A 1TO6A 4Y7DA 2GYYA 5CLQA 3R7WB 3HXMA 3VAAA 1BA3A 1R1DA 2N1BA 4KMOA 4L1KA 2C8VA 2FGJA 4J1TA 4K6MA 1YJ5A 2BVNA 1O6FA 3FCYA 3REFA 3G5TA 5H9WA 1R0WA 4WDQA 2ONJA 1M6NA 1L4FA 4WECA 3ZV4A 3OX4A 3S7TA 1XTPA 4MQFA 1GTZA 4PCLA 3E22B 3RRZA 3WWCA 3DG9A 4PLWA 3UCEA 2Z5VA 2W2KB 2G71A 4BX8A 1CIJA 2VSQA 3LYUA 2CLDX 5AK3A 1ODKA 2HIHA 2P5SA 4YLGA 2XUKA 4EB6B 3IQZA 3BIXA 3KKMA 1E6KA 2PRKA 2EWWA 3FMOB 1EAYA 5TB5A 2ZYGA 3PYMA 4HX9A 5KMGB 1VJGA 2VF7A 2ZE6A 1H6CA 1M2FA 2IUTA 4OB6A 5JCOC 5G41A 2IEYA 2V3WA 5E2IA 5E1OA 4ZGWA 4RF4A 2XNDA 1L5LA 4N5LA 4GYKA 4KE6A 2GNOA 2IRWA 4C0BA 2C3UA 4O2AB 1FFWA 1GG2A 1XN1A 4JKYA 4Z0HO 3UV7A 1OOEA 2PYZA 4HJRA 1VL6A 2P2CA 2X0JA 5EYPA 3G9QA 2GO7A 2HA3A 3PUWA 4FYVA 1AF4A 1CUVA 1GFIA 3F6CA 4LI3X 4KOAA 1CLEA 3DZJA 4MVJD 5BN4A 1XZJA 2O4UX 4GX0A 4JKIA 3GAFA 1BN7A 2X4LA 3NHWA 1PR9A 3L82B 4KXLA 3O8DA 4RQTA 4YP6A 3SC6A 3AUKA 3N59A 2EYUA 1O95A 3IUYA 2PPLA 4LFAB 4ZPJA 3RSHA 5LMUB 4Q3CA 4E33A 3ETLA 1V95A 4MKRA 4CKEA 3E03A 3FNIA 4URHA 1NNLA 3PHBE 4TTAA 3FHCB 2WG1A 3UC9A 4EB0A 3OZBA 1E5TA 1M0EA 1QUFA 4G63A 2UU9B 1F6BA 4JQSA 1PGQA 1IJKA 3DT6A 4DR2B 5KX5B 3WLSA 1WV1A 3I9FA 5PNTA 1NXXA 3RH0A 3VDXA 3OPYB 2WU3A 5K6TA 3W5SA 2NP7A 4ZGGA 1C7QA 4KUEA 4PCUA 4UAUA 1D8AA 4FIZA 2BFCA 1JPVA 4RL6A 4C2TA 3VSEA 1NE2A 1DC4A 5I3ZA 4U6QA 3FUXA 4CIDA 2H17A 4I3HA 2EKZA 2PE5A 1NTOA 5LYJA 2X23A 1TAGA 5FNZA 3GLGA 3CUTA 4HDKB 5J5AA 2XRMA 2ZRQA 3BF7A 3GLUA 4C3VA 3RKSA 4RNDB 4AY5A 1ZWKA 4FSXA 4ZIRB 4GZMA 1N5JA 5H83A 3FYHA 3JQBC 3ZJYA 3T7CA 1JKIA 3ZH9B 3CZ5A 1G3QA 4CM4B 4PQGA 4Z3OA 1GPUA 1HE3A 3R9KA 3TOXA 3ANTA 2ST1A 4IHJF 2I6UA 2OVFA 5GM1A 4W5QA 3O38A 1QFMA 5K0NA 2BKLA 3EVAA 3MTQA 4F85A 4Q1AA 5C53B 1E1RA 1EUCA 1O97D 2QLLA 2DUNA 1GCAA 1ESMA 3BL5A 4UZSA 3TFOA 1AB6A 2BRUA 4AMGA 1LPNA 1M7BA 5ES4B 3QE4A 2WTAA 5C1DA 3BQNB 2WVHA 1Z16A 4PBTA 3WIUA 1YVRA 4NAHA 2GPTA 2FJUA 5L3QA 2BSQA 4RFVA 1X1AA 4NU0A 5JH7F 2Q3JA 3C3EA 1YAHA 2CLHB 2CDBA 2FZEA 2RSLA 3ZXIA 4CV2A 1FUEA 4M1EA 1KE2A 3EGOA 1LW7A 4UOQA 4DDKA 1A1VA 2P9QA 3A6GA 3WZMA 3G2LA 1QFJA 3GP3A 2APJA 3BJMA 4M9ZA 2VQ6A 2F67A 1R0ZA 1CHNA 1XPJA 5D3QA 4TKVA 1G7CA 3H7IA 1FP1D 2VBCA 1FYXA 1OYYA 4FDAA 4QUJA 4XJVA 2AFHE 4HWKA 1UKCA 2FW9A 1Z75A 2JAWA 4EHHA 4V1CA 4PZZA 4UUNA 2CZQA 2CLKB 3K31A 1ZICA 4JVSB 1DU4A 1HDGO 2HX1A 4CRWB 2QZZA 3MGBA 3NIDB 4AIRA 2QQEA 1QO0D 3FIJA 1AGPA 3FNBA 4N5MA 5MN5A 4JJEA 1PNRA 4HYEA 1GGEA 2VPZA 3EYAA 4V02A 1XJWA 4F6LA 2OZEA 4CM9D 1XO1A 2AFRA 1XF9A 4E2WA 1NATA 4P53A 1NMSA 3GIWA 4XYGA 4X3PA 5B1IA 5DEOA 4NSNA 4BAUA 4C04A 3DXZA 2H4XA 1X70A 3CRZA 3LO8A 5A2QA 2J6IA 3HJTA 1Y6QA 3PT9A 3UFBA 3RSGA 4RM2A 4IWXA 1SIBE 4N5IX 5JD6A 1E2MA 1CR4A 2DWQA 4J0EA 4E2FA 1N34B 3NVDA 2X8JB 3M7IA 5F2OA 4PXAA 2N42A 1FLNA 3A6LA 3DLTA 1T5DX 4C4SA 5JZBA 3G5UA 1YHNA 5LFAA 4YCMA 2UXDB 3O4RA 4XSVA 3LUPA 2VXOA 2ZBDA 1A2KC 4DA0A 1QZ3A 1E79D 2GGSA 1CJSA 2Q4OA 4GF5A 5HF8A 5C8YB 3TGPA 4QUHA 3BTUA 4BX9A 3BD9A 2YWXA 2XECA 2QYOA 3RTCA 2ZU6A 4HGZA 3TNLA 1NKSA 2ZFUA 3MUEA 1MFPA 4L07A 1ZU5A 2Y1WA 4RH3A 4XB6B 1LI4A 2OAP1 2FPIA 5LDHA 3B9PA 3E7FA 2MSWA 3SF8B 4DV1B 4KQJA 3TLKA 3F7TA 1C7FA 2BBWA 1P29A 1RLIA 2GLTA 2IHTA 2DHCA 3E0QA 3HNRA 4WE3A 5HQ3A 4B4OA 5KOYA 4OHFA 2C4UA 3GJ3A 2GK6A 4Q1CA 2V55B 3PFKA 2FWJA 3NMUF 1ZH6A 3HI6A 1IONA 1QQBA 2N46A 1V96A 2PZEA 2EGUA 4E15A 1EAMA 2FPRA 5F5LA 3QSYA 2WE8A 1JFTA 3ZI7A 4TRRA 4NOMA 1J09A 2QIOA 4OQZA 4CMBA 4QGSA 1ZQ9A 2R4QA 2QE7A 4R9VA 4HFRA 4RELA 1I3CA 3GJ7A 3F90A 1JDTA 4CT5A 2AMFA 2JLCA 2RJOA 1V5FA 3CKYA 3GG2A 3KKZA 3JALA 5DBGA 5DLDA 3R0QA 4AWBA 3THXA 3OVMA 1DXOA 3KQMA 3S55A 4D9CA 2V7PA 3NC4A 3RFUA 4XOIA 3V4VB 4FHZA 3BN3A 1E2PA 1GG8A 1JYSA 3NOQA 5AJVB 4CM1A 2ES4A 2QEQA 2AS0A 3MAGA 1N0VC 5J63A 2UVPB 3ZCSA 3ND8A 1ECLA 1WZCA 2H1VA 1V5IA 2CDNA 1VE5A 4INAA 4LGMA 3LUDA 2YRWA 1PT7A 4PLCA 1TQ2A 3TLMA 1QVRA 2EW1A 2BLNA 4AULA 3MWEB 1OH5A 4Q7JB 5BWOA 3G2PA 3GYBA 3P9YA 1TJNA 2O1WA 1ZH0A 4FYJA 4PFKA 1YU9A 3VAYA 2A59A 2EWMA 2VIIA 2IDMA 2EL9A 1J8DA 1NSYA 1ZXBA 1KOFA 1OX4B 4LDQA 1OT3A 3AZQA 1XXLA 3QFFA 3ER9A 3IULA 4G4SP 2B8TA 3L6OO 1CJKC 2VRCD 3NC1C 4CEJB 5KNBH 1EIWA 1NF9A 2ZR7A 2GYVA 2RMKA 3LQKA 3GRUA 3MCTA 4C88A 1U9IA 3DYVA 2HJGA 4FLMA 1GQFA 1AA9A 1F8GA 1KBQA 3ZU5A 4RKQA 4FZVA 2RGUA 2IF0A 3NDRA 4UMEA 2CJYA 3O6VA 3OQNA 1D04A 2A0WA 2MWMA 2R0QC 1ZGBA 2ERXA 4JP2A 3E3MA 4LDAA 3HEAA 3WYNA 4CZ2A 5TQ2B 2F3TA 1QONA 1H3EA 4KU4A 1K66A 4CI9A 3BXGA 2RAFA 5F7XA 2HV8A 3H5WA 1IYZA 5LMNB 2QSZA 5I9NA 5JSHA 4ZYYA 4F4CA 3SJCA 1KH2A 2D2EA 2H5LA 4WFQA 5F35A 3U31A 4E1BA 5JO9A 3GRVA 3H2HA 1S8NA 5F3RA 1M73E 4UMFA 3GFOA 5EMLA 1VKNA 3ZY4A 4H7KA 5K0ZA 4G1BA 1AXEA 5KYYB 3Q11A 3P4YA 1Y4AE 1A77A 1JEJA 1T2NA 2WNSA 1GZ7A 3AU8A 3MTBA 3PNPA 4ZCRA 3WS7A 3KM0A 1J22A 3OZSA 5IAEA 4IDNA 4G97A 2CF5A 1W59A 2ZIXA 5KS2A 1H4QA 3Q7SA 3BYZA 1GLGA 1J70A 4NBLA 5IAGA 2PZBA 3DVAB 5J40A 5EJ7A 1KNXA 4ZKDA 5AM3A 1AS0A 4F6RB 1EG2A 3OFND 4BNMA 1IRIA 2R11A 3K35A 2AOUB 4GVXA 1PLKA 1GZSA 1T1JA 1KY5A 2Z2IA 4WBXC 3YASA 3LUHA 5AVVA 1ZOLA 4JLAA 2GHQA 5CA0F 2TMDA 4UUAA 5ALHA 2I71A 4PSDA 4NL4H 4WJLA 3J80A 1AKMA 2O3UA 3MJRA 1E2NA 4Q6WA 2X0FA 1Y6FA 2OP1A 5FT9A 4JLBA 3D6AA 4YMGA 1YZHA 1QO0A 1P2TA 1DNPA 3PTAA 4MGYR 5H68A 1BHSA 1O8BA 4BO9A 1DWQA 4CCYB 5C8DA 3GR6A 2JASA 2XEXA 3M6AA 5A62A 3D81A 1JECA 1P3Y1 1U6JA 2W11A 3M1IA 4OCZA 3OSZA 4M46A 1NONA 1L8AA 4AVYA 5DCUA 2WWYA 5JS6A 4AS1A 2EIXA 3WGZA 2NSJA 2R5FA 2G9QA 2Q5JA 2YCBA 5BMVF 3WAGA 4U7DA 4IDGA 3FTPA 1GYPA 4TYPA 3D8BA 3L18A 3N7UA 3RF6A 4TXJA 1TL7C 1ABEA 2EBFX 2QUJA 5AUOB 1NYTA 3RS7A 3UUFA 3H18A 4YRGA 2D5LA 3F5MA 1HOXA 1XEAA 3ASZA 4HZIA 4CDMA 1A5AB 2INGX 2OXCA 5DHUA 1PQWA 2NIPA 5TJHA 1KXZA 3W2FA 1JTEA 4D5EA 3EUEA 5FA8A 5KOHB 2B34A 3PHCA 3U3OA 3M70A 3LRTA 4CG0A 4HGQA 3H42B 1QIMA 3NUGA 3SYKA 4EOGA 1YA4A 1ZVKA 2ZULA 2R1VA 2CBZA 3EA4A 3WGOA 5L3VA 4RD2A 3WGKA 2Q4BA 5DHRA 3VR5A 2JKYA 4RCVA 1ST2A 1RWMA 3UKDA 3JQAD 3KE9A 1QNFA 1I1QB 2DPMA 3OX3A 4WLFA 4ZAXA 4EWLA 3CZRA 1EFUA 5KDDA 2ORWA 2ZZNA 3QWIA 2WUWE 2FF7A 1O94A 3DHWC 5FPQA 4F9EA 3KSBC 4KH0A 2LXNA 4KEAA 4QWWA 4EHNA 4IF4A 1X8JA 4C2BA 1BCRB 1QH9A 1T8UA 3PFCA 3DMNA 1WBDA 3FCUB 5AIBA 1XD2B 2FW7A 4H7FA 5KAPA 2R6GA 2DR3A 2GNAA 3F74A 4AZ0B 1I2CA 3AGPA 1C1XA 4JP8A 4RXUA 5BQOA 1QGOA 2OB2A 3IPYA 3L6DA 2QSYA 3JZIA 2H1IA 4TV8A 1V4VA 3CLRC 3NFRA 421PA 4C78A 4QGFA 3GFPA 5HJ5A 3F5QA 3FDXA 2O8FB 2QUIA 2M9MA 4LGVA 1R6DA 4WASA 3AFIA 1YUMA 4KPEC 4KWTA 4LC1A 1XZ8A 3VTAA 1G4HA 3EXIA 4HFNA 2HGSA 4HVTA 3CZQA 3HZOA 3ZXXA 4Q4DA 1ZD1A 10MHA 5EMMA 4BQPA 1UANA 3AHEA 4OKIA 2ADFA 3RWMB 1KY4A 3PFHA 1ZLYA 4C0QC 3HM9A 3FDZA 4TS1A 4WOCA 3VR4D 2J8ZA 3F8WA 1WDMA 1KEEB 3PGMA 3QLUC 1QVWA 1R6UA 1SG6A 3GHHA 4HLNA 1RKQA 2JFXA 2VI5A 5IABA 4AJ2A 2C59A 3DZIA 2OBYA 5TSDA 3HKEA 2IX9A 5A4KA 2QK4A 4BIIA 5CDUA 2GYWA 3ONDA 3PD7A 3FPCA 5AW7A 2J6CA 1JXOA 1ECPA 1JQLB 1V9SA 3H5IA 4JIGA 3S99A 2A9QA 2B69A 3U7QB 4CQLB 2VRCA 3MOIA 2VWHA 1W0KD 1NIJA 5DBIA 2OV1A 1QQ6A 3PCXA 4RHFA 4AJHA 4CM5A 2MR5A 2IGBA 1DQZA 2PNJA 1CQXA 1W7AA 1H1DA 1JG1A 4V0SA 1ZPDA 2OHXA 3GB9A 5FBRB 1AK9A 3DEHA 4O4IF 3U7JA 3PKJA 1UJ2A 2V6BA 1U0RA 1C80A 1FFGA 2JCYA 3KQTA 4JSTA 3IEKA 4IQFA 4Q4JA 4GLBA 3SBOA 5LPNA 4ZOLB 4PYRA 5A03A 2BE9A 1DCFA 5F9MA 2YJ5A 4GSYA 4I9GA 2QTZA 1FXWA 4C4AA 1NUTA 1KO4A 1NXVA 1XEFA 2BJWA 1DV1A 1GKKA 1Q2UA 1ZN2A 2POCA 3GAAA 3PB3A 2DFKB 4P0TA 4RQAA 5EQDA 3TX2A 2P11A 3FI0A 3S2FA 1WHSB 4AP9A 1F8FA 2R97A 3PR2B 2Y27A 2P79A 3DAFA 4GH5A 3SKYA 2GN0A 2HBRA 4R1QA 1RE1A 1IY0A 1P2SA 4OUDB 4PW0A 3RV4A 1Z4KA 1H2AS 3QFHA 4CL3A 4EA9A 4EZEA 4IX1A 5FKJA 2GDJA 3V55A 1Y8RB 5E2AA 2EBHX 1WF3A 1R8JA 3AVQA 1FNCA 3QVSA 3PFGA 4IHKA 1Y81A 5JYEA 2I7DA 1E66A 2DLCX 2ZPUA 3GEGA 4NXMB 3DMDA 1K8ZB 4NDAA 4G1CA 3QPWA 4F5DA 1P0IA 4OD0A 5J2TB 3LP6A 1YC5A 2WV9A 3NT4A 1Z88A 5BT9A 3WGUA 3A3NA 4NE7A 3UY4A 5HPYB 4CHTA 7MHTA 1DKOA 4Y2TA 1KTIA 3N2KA 1EBUA 1KYQA 2ZOSA 1FE8A 4N7JA 2FHPA 1QDLB 1FUUA 1KRHA 1CR1A 1DO2A 3HWRA 4QJIA 1AU9A 4TMVA 3RJ5A 4R98A 1GU7A 1ZIDA 2EHJA 4IDHA 1ZUIA 1V37A 1RYFA 3IEMA 1M2HA 1T3TA 2IW3A 1GG9A 2OV8A 2NU9B 2WJ4A 1U7PA 1WW8A 1QKIA 4NNJA 3VZQA 5KYKA 2JIDA 4NP6A 4EK9A 2ZIEA 4RTQA 3FOEC 2QMOA 4S12A 4P32A 1YHZA 4UU7A 5ETJA 5TPWB 4DKXA 5F98A 2BGLA 2AT1A 1G6Q1 4QYTA 3PUIA 5LIPA 2X8WA 3SICE 1S2IA 1L4UA 1HQKA 2ZJ4A 3IO3A 3D3WA 4ACAA 3OQMA 1IY8A 3OQ6A 2IODA 4HSEA 5LXTF 4B48A 4BWYA 4OQQA 5ICEA 2H2IA 4R7GA 2DTEA 4BN5A 1WMBA 2FN7A 4JEUA 4WXEA 3GEMA 2W90A 5D5PA 4CIAA 2UZ4A 1HTTA 1RAAA 2PKXA 2WR8A 2V0GA 2XA2A 2F3PA 3GLGE 1VG9B 3WSWA 3A25A 5HK8A 4GPZA 1SEPA 3LCCA 3MTAA 4K9OA 4PLYA 4ARUA 1ULHA 1ISFA 2WAYA 2Z2JA 3P9RA 4N65A 2XT9A 2DWOA 3M3HA 2BFEB 3B85A 4PAQA 5CVVA 4B6JA 5CG2A 2ZJYA 1U2GA 4NNOA 4P86A 3F0TA 1KMMA 1IZ7A 2PQ2A 4KYVA 3K3PA 5KCMA 4CGYA 1GPMA 1RQRA 3K53A 3G89A 3ZHQA 1C8BA 4MYHA 4FN5A 3QE2A 3LECA 3U2QA 2C42A 4I2NA 3CYFA 4ZYVA 1QRDA 4W5RA 4LKOA 2PZGA 2NZ8A 1R16A 4I5FA 1QGZA 3IBYA 1LDGA 1UAYA 1UBSB 4G4JA 1DJOA 4OQDA 5BQFA 2CDCA 3ETNA 1N5OX 4OJYA 4C9BA 2PBLA 4ICIA 1WP4A 2RKBA 4IR7A 1TXGA 4WVFA 3N9IA 5E9JA 3V8RA 4KR0A 3FD8A 5B1DA 2ZYRA 3L3BA 4C06A 1UXOA 2A1TR 3EW7A 4ZARA 1BXRB 2ZJ6A 5FJIA 1N2BA 3N0VA 4A8PA 2OFWA 2ZZMA 1UXJA 5BYJA 1KPGA 2M1XA 2PMEA 2BFFA 3JWHA 2KSQA 1FMJA 1FX0B 2XYPA 4J7UA 5JV5A 1A9XA 3HN7A 3KQSA 1QK3A 1K9SA 5CA1F 2XMSA 3ANXA 3B1YA 1OFUA 3T7DA 1I51A 2X76A 3I2YX 2Z5GA 2R6DA 1NXOA 2X77A 3GLQA 2Q6KA 3RI3A 1U8UA 3K0AA 1RI5A 1KI7A 1NQOA 2O0HA 1RYDA 1ZJJA 4R71A 4KQMA 1NF2A 1PJ8A 2PLWA 1NE7A 3B7GA 5D6OA 4JCOA 3VR4A 4GDFA 3DW3X 5DN9A 1E0JA 3JD2A 2NPFA 2XHZA 3SPXA 4O2BA 5E0KB 1M2KA 4MYTA 3L5OA 3EUWA 3O4IA 3LV8A 1SURA 3QLJA 4X8MA 1I0IA 5B4TA 3QV2A 1TT5B 1EE2A 4MR8B 4P5EA 1R66A 4QJ4A 4LJRA 3UT0A 1PK7A 3E3NA 3LX6A 4Q00A 3CEMA 4DJ5X 4Z2AA 3DB1A 1W0KA 4RKWA 4ZJUA 5IJZA 5BUCA 3B5IA 4LDRA 4P0QB 4RHUA 5IP5A 3SK0A 1I6KA 1NMQA 4E4YA 4ME6A 2FPLA 3BDAA 4ENTA 1R4NB 3HLTA 4JXZA 4C6TA 2AI3A 2CZCA 1KI1A 5EE5B 4DLLA 5A1JA 4PBRA 3W4IA 3W5IA 3IAHA 3MTEA 3KQHA 3KQLA 1KK3A 5HIIA 4IOJA 2JLQA 2FU5C 2HREA 5DX0A 3RKUA 4RULA 2W6OA 1C30A 1OILA 1XX6A 3CJRA 3JATB 4WKNA 3E1GA 3BEOA 3IA7A 4R1LA 2FPPA 3KAPA 4ZICA 3K9HA 4MUEA 1Q6YA 1STOA 2EFCB 1ZNWA 3LQ2A 3X43A 4GS5A 1X3LA 3EZ2A 3KYDA 3GZTB 4JODA 4MUXA 5BPFA 1N2XA 2JATA 2SKCA 1FNNA 3I9OA 4MS4A 5SZHB 3TWOA 1IH8A 2CCJA 3KLNA 4HCJA 4F4FA 2C57A 3ZCUA 4CQMA 4GAEA 1TCUA 1E92A 4OKSA 1TKRA 5K03A 1CUZA 2LIVA 4ER7A 2OAQ1 4TL7A 4TWBA 3DAHA 4MWTA 1CVIA 4G8DA 1I24A 3K9LA 3RS5A 2IW1A 2XD4A 4E31A 3PTLA 3UPDA 2IC5A 1DQNA 1XIVA 5JY1A 1KMHA 4QOEA 3B12A 3HCPA 3HR4A 1NA5A 2JI8A 1X86B 3U9TA 1VJ5A 5EXPA 4A4DA 2JD2A 1XI2A 3MVEA 3R2JA 1J2RA 1ESCA 4BNYA 3BXEA 1OFVA 3BUSA 3LLSA 5KU7A 1KJ8A 1NNI1 2HGZA 2QN7A 2CJFA 2VPIA 3E9YA 3KDAA 2NM0A 4YFVA 3BICA 4C4ZA 5CFPA 2VHUA 3SSNA 2OK7A 3EASA 5ILGA 4L2IB 3WNZA 1CYDA 3CUKA 1FRNA 4JDPA 4UXIA 1CY8A 2JVKA 1NPDA 1C5KA 3HABA 3JR7A 3K5IA 3BGSA 4IDEA 4IVPA 3CZ9A 4B4UA 5KTYA 1MX1A 5D86A 1BHO1 2IYZA 4UHFA 2YNMD 4WZBE 5E38A 1WVMA 1S0UA 4G5YA 5ALSA 2VBGA 1JP7A 1T1IA 3LYLA 2FQWA 1ZITA 2QV7A 3GDGA 3GZNB 4Q03A 4XW2A 3A10A 1THTA 4DLSA 3VNSA 3UNXA 4MUAA 2QTHA 1KU0A 5TQ0A 1TEZA 5TGZA 1Y7PA 3WV4A 1V5WA 5E4FA 5PGMA 1XJCA 1SUCA 2EJUA 3F78A 3LT1A 2Q7DA 1PJ2A 4Q4HB 5HTOA 3ZX5A 1EZZA 4JI2B 1XBTA 3NTQA 2BEUA 2MINB 4JGBA 3WMEA 3WAKA 4AS2A 2J87A 5ICSA 4Y30A 4IBOA 3ZXUB 3UC5A 3BJZA 3CNLA 4P3OA 1DEXA 1J7JA 2I4IA 1DI0A 2BKXA 3FMFA 3K4PA 4HWGA 2F55A 1AY0A 2IH5A 1CCWA 1KDZA 2PRYA 5T7BA 1W1UA 3HO1A 4WN9A 3T7RA 1UP6A 2QJTA 2CFTA 2DT5A 4MGHA 1O5IA 3JD4A 2WYIA 3F8SA 3USCS 2GM5A 4JEMA 5FEUA 1NX9A 3MRVA 4J0CA 1Z74A 2E4YA 1UMDA 3H9GA 3T34A 3V4FA 5KAMA 1IHXA 1S1CA 1W19A 4F38A 1X2EA 1JNXX 3W79A 3RC8A 4ZV7A 3AHDA 3F6YA 3MRXA 3IBGA 1DKQA 5EZ5A 4PVCA 2AOTB 3LCVB 4Q3NA 4TUYF 1VCIA 3JWJA 2DERA 3R6GA 4DANA 4DRXA 2AZXA 2B3TA 2Q3LA 1N2CB 4XIGS 3PU6A 3PPWA 2CNLA 2AJCA 1GP2A 1SKAA 2F7SA 2WJZB 4IDDA 4TTIA 2DJ5A 2F1HA 3T5BA 2N47A 3A04A 1A8SA 3OTWA 2CL5A 3B1JA 4WKGA 2BFPA 2HT6A 1IL0A 3ZKWA 2AXEA 4ZODA 5J1TB 3TGWA 3ZKAA 4F0JA 1C0KA 2G17A 2Y1OA 4G1EB 1KVRA 4YUVA 2RGYA 1DRKA 4DILA 4D3DA 1KERA 2DHDA 2DPXA 3CUYA 2C9BA 2F1OA 2XUOA 2G5PA 2VJDA 3CXUA 1HLGA 2Y92A 1JTFA 4R8LA 1RMYA 1YBAA 3BIOA 4FOLA 4Y2VA 2F2TA 3U5ZB 1QFZA 2YJNA 3M3DA 4RPIA 2W8ZA 1PQPA 4QUAA 2JFBA 3R5HA 4LTMA 3CLKA 1GZ3A 4LHWA 3STXA 1GZ5A 2ACVA 3W6PA 5IWCA 2PZ8A 3PLRA 1ZHHA 2AC4A 3F3KA 2NU8B 3UHFA 2EIHA 4BMCA 1HYQA 2ECPA 1PF7E 5IYZF 2Z30A 3TLCA 1Z6ZA 1EFPA 3RT9A 1UPBA 2QJOA 3AYXB 3GJTA 5CR9A 1TM2A 5CXSA 2IXGA 3T3GA 1YS9A 2XXAA 3EIXA 4Q0MA 4ZT2A 5D5HA 4QU0A 3GX1A 4X7MA 4XX0B 3FWZA 4GP9A 4W7IA 3A7DA 1T9AA 2NYVA 1KI4A 1E9CA 2FZLA 2Q5QA 4IV8A 1SKQA 2IHNA 3SEAA 1ULSA 2GVNA 2UXCB 3GROA 1P9RA 2I6FA 4MTCA 1EDEA 5K3OA 5DYTA 3Q5DA 5AXAA 4KYTA 1K9VF 3WVNA 5JHGB 4B73A 4ZI7A 4G5FA 3EXAA 2EVWX 3QYJA 4KODA 4M9CA 3MT8A 1HGXA 1IZZA 3T7EA 4PPYA 4JMPA 2XODA 3AF0A 4GEGA 2P5TB 1KDTA 1J2TA 2YTZA 3OMLA 4P7GA 4Y1RA 4ALIA 2V6MA 1M2NA 3L8MA 2I2BA 3NOVA 4OL0A 3ZZUA 4LRUA 3O4FA 3TAHA 5AM2A 5K6AC 4JI5B 1XCPA 2CNWA 1XA4A 4JASB 1TTTA 1Z82A 2M6KA 2UUBB 2Z8ZA 3EDYA 2Q7OE 1Q1AA 1I5EA 1KC1A 5EI5A 4A7PA 4BQIA 4GI7A 4LCBA 2DM6A 4PHFA 3K8ZA 2CLLB 4QLOA 1EXMA 3D6VA 4HAUA 1Y8QA 4L9WA 5FBLB 1V6SA 1OFHA 4JNCA 2NSLA 1V1RB 1YR3A 2WOOA 3GV0A 4ND2A 5FV4A 2ZYSA 2BBOA 3FW1A 2PH3A 1J90A 5LQCA 4F46A 1TC2A 4NE9A 4JLNA 5KWEA 5AXCA 3TMKA 3ZY3A 4FZ3A 4C2AA 5BOSB 5K3EA 4ARIA 1K6MA 5C4IA 2VBFA 4J4TA 3ZIAA 3KV3O 5AHKA 3TQOA 1FEZA 1Q5PA 2OHGA 2WW8A 2ZWVA 3KYBA 1ZGZA 2QN9A 3IAS6 3OLZA 3PYLA 4YT4A 3ZWQA 1ORTA 1ZBQA 3NETA 4ZAFA 5CNIA 1VBMA 4Y1GA 4YRZA 1WPGA 2YNMA 3V3KA 3MOGA 3FVRA 3IERA 3OZ7A 1G4AE 1MR3F 1WU8A 2K2QB 2Y05A 3CUVA 3NHJA 4PHHA 821PA 4IXMA 3HLYA 1E5LA 3LKVA 1XLUA 2B5OA 4HATA 5ALKA 2A7QA 1EXDA 3OPXA 4U1RA 1DFIA 3ETDA 3ITKA 2J41A 4UCQA 3IB6A 1XE3A 2DH6A 3G1WA 3I53A 4R1TA 1UP7A 4Z1MA 4N6OA 5EQJB 5TEWA 1O96B 3RC2A 2O6HA 5CBPB 3BILA 2ZSIA 2IZOA 3TD9A 5J4HA 2OFXA 1PE0A 3RB8A 2ZB7A 4X97A 2IXTA 1MA0A 1OFIA 3PQFA 4HB3A 2VJMA 4DG8A 4ITVA 3NKVA 2C5BA 4G8JA 4FMPA 4KK3A 2EZUA 1A4XA 2VYCA 4EHBA 1I14A 3WKEA 2VSOA 4UCWA 4Q7LA 4M1TA 3TNDA 1E77A 4FSHA 4C7BA 4IH1A 3IMGA 1LSJA 1FP7A 1IEXA 2LKCA 4ZQEA 4AMZA 2J0UB 1UZAA 2WAMA 5IZCA 1T0BA 5DM1A 1N3IA 4ZI7F 1J5XA 1UKAA 1QQTA 1V16A 3I5UA 4IIBA 2C29D 5TGDA 4NZYA 4JP5A 1VHJA 2BFDB 3KSZO 1OFUX 4KIUA 1TJYA 5FXMA 4Q9HA 5JZVA 4F5ZA 3OTOB 1BC5A 3NDJA 1JIKA 1M6VB 3GLVA 4M55A 5CAEB 1SG9A 3C4QA 4DSOA 1IC6A 2AI2A 1XCOA 3BQ9A 1J21A 4HDMB 5KSYA 4O8ZA 5AVXA 3TQSA 1S2DA 4RZSA 1Q7EA 3S8YA 5AKKA 1P1KA 1D2RA 1Y7LA 4M54A 1UOOA 3EF0A 5ALZA 3Q3JB 1IDOA 1FRZA 1M1NB 3K6JA 4UHCA 4WINA 5EPEA 1A2OA 2Z3WA 2RGGA 3MBIA 5HOEA 5DNVA 5BR8B 2D1SA 1L4LA 1II8A 2FOIA 4L4ZA 2W2LD 3I1IA 3ED5A 3ZEIA 4R9UC 3FOZA 1J00A 5FI5A 1MV8A 4Q3BA 3H8JA 5DGIA 5K8JB 2J9ZB 3K6KA 2GBCA 5MN4A 2CHGA 1NPYA 4MNTA 2WWWA 2GCOB 2TMKA 4IOLA 5KTSA 2C7PA 4XVUA 1IUOA 3U1VA 4URWR 3ZDDA 3EISA 5KNCD 3Q7EA 1QDEA 1GR0A 4M1YA 4EI9A 2BV3A 2QL6A 3V7YA 4BKOA 4LECA 2WWTA 4AG6A 2G9UA 4QBHA 3BERA 4XB2A 1OWOA 1U2DA 1DUSA 3F9RA 3ISTA 5D7NA 1JEYA 1USUA 4UM9B 1QKKA 3IAAA 2OCPA 7ADHA 2QUZA 3EGEA 4MR9A 2R47A 1W34A 1Q0SA 3LXXA 1TECE 1X8KA 2ZVQX 3NOOA 1RAEA 2CYBA 3AJAA 3WKAA 4B5LA 3DBLA 4B7UA 4WBNB 1GL6A 2HA4A 5C4GB 2VHXA 4D9NA 3WYCA 4MLZA 1JBQA 1UKYA 3G1UA 2CLEB 4GVPA 5AJYA 4LF4B 1UP4A 3QE3A 3AHCA 3MWDB 3REQB 4EJSB 4QM7A 2O8CA 1KYYA 1BJRE 1SHKA 4BX0A 1TAHA 2D2VA 5F33A 2KW5A 2MSDB 2V9ZA 4LIPD 1SBHA 2WPDD 3PDUA 3RAJA 4ZEXA 4XFDA 1T8RA 1HE5A 2IYVA 2X58A 4I6GA 4PONA 4QQ8A 3UN1A 2X9GA 3EHEA 2A5DA 4L15A 1EEHA 4MCJA 4DV0B 2GAIA 2D1TA 4NCHA 2ZAMA 4Y2HA 2D2FA 3QELB 1A04A 2AXNA 3D3QA 4TMTA 1AKYA 3UIEA 3V4OA 2A9VA 4GPTA 2GKSA 2Q49A 3EMBA 1P33A 1Z8HA 2BKEA 4P3XA 4WOPA 1LWOA 3HDYA 2GD0A 1H5QA 1H6DA 2ALJA 3RYHB 5K8IA 4DY6A 1B16A 3DLPX 3JAWA 4KE8A 2D5CA 4G0OA 3T5MA 4ALNA 1NVWQ 2AMJA 5JD4A 2X5KO 1XLTC 3DGEC 2WYWA 1ZK3A 3CLSD 4FR2A 2NVBA 4JC8A 5FNVA 2IKQA 4XCQA 4C0WA 1HSZA 2JVJA 4NG5A 2QRMA 3C7TA 4XVCA 1LTHR 2AIRA 4RKYA 3JQ8A 2AC2A 3FFBA 1SHJA 2G6TA 5CXXA 4FDMA 4Q34A 1JXQA 2P9HA 1R3DA 1FJXA 4E4RA 4A3SA 3L02A 5J5CA 1QFSA 1E89A 4YP9A 4HFMA 3SM9A 3ZS9A 4HUTA 5LQUA 1OW3B 1CUJA 2JJMA 3T95A 3TLXA 5L6MB 1C9EA 2JBAA 1ZINA 1XA0A 1CP2A 2ZR0A 4DXHA 4EFDA 4S1TA 5A6SA 1CEEA 4R3WA 3WYEA 1XHFA 1XMXA 4AZSA 4DSUA 5JBQA 4GLJA 4ENRA 4I5DA 4H7IA 1IZ8A 4XJSA 5C7OO 4FDUA 4M0MA 2QVGA 5F76A 3N8HA 1LPPA 1R5JA 1N25A 3E05A 5KYUA 2X5JO 3BC1A 1UQTA 4QQRA 1H2RS 2XYRA 1GZ6A 3Q3EA 4GMFA 1HMYA 2G9NA 3ZBQA 2M32A 3EB9A 3ZHOA 4S0ZA 3TZBA 3L84A 4ZU3A 1CQZA 3PA6A 1M7GA 2ZSEA 2PA3A 2X2EA 5D7BA 5I8ZA 5HUQA 4JLOA 1TI7A 3TQCA 1IDN1 2OCDA 2W6QA 3E3AA 5LJLA 5JZMA 2UYOA 3SIXA 3U3ZA 5L51A 2EW8A 2ODPA 3FCXA 1L8LA 3NT2A 1PFUA 1SR8A 3DBRA 3AUTA 1ISPA 1XC7A 2G83A 2CJPA 2JGLA 1TO1E 1TZKA 3LQYA 4FGWA 3TTVA 1D2AA 3VH3A 2R5WA 4G5QA 5BRAA 4R7ZA 5ICGA 5BW4A 3GPCA 1UC8A 2BI4A 2QN3A 4IV5A 3T3MB 4YLYA 1U1IA 1XEXA 3MTJA 2UVQA 3C5VA 5AMXA 5G4KB 3DWFA 5JSYA 4B2IA 1EP2B 1YE8A 2YJGA 3ZLVA 4PSUA 1JYFA 2AR9A 2C2MA 1MT3A 3ZUPA 3K0SA 3R6DA 3STYA 5B2FA 5JCPA 3B9QA 4H1UA 1J25A 1T3ZA 1R15A 4M9QA 4W1PA 3CT4A 2CNBA 1TA4A 3SS7X 4FBGA 4H77A 3TINA 2XXJA 4F3RA 3HFSA 3I39X 2AOWA 2Z8YM 4G1MB 2PWBA 3RF7A 2IOFA 4RVCA 4EG4A 1ZR4A 5G2OA 4AX4A 1TYZA 1U2ZA 4Y6GB 1O9BA 4Z7OB 1DEOA 1HI9A 3FAZA 3NHRA 1ISGA 4E08A 4QSMA 4MI6A 2IQIA 3TTUA 4EGJA 4U9UA 2JGRA