1IY8A

Crystal structure of levodione reductase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
258
structure length
258
Chain Sequence
RFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAPDAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIEGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPENPRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LEVODIONE REDUCTASE
publication title The Crystal Structure and Stereospecificity of Levodione Reductase from Corynebacterium aquaticum M-13
pubmed doi rcsb
source organism Leifsonia aquatica
total genus 101
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1iy8A00
3OJOA 4W99A 1ONOA 2AG5A 3K92A 2HDHA 3HUDA 4IGFA 1LLDA 2AEJA 1SZJG 1X14A 1TXGA 4GVXA 1PJCA 1LLCA 2C0CA 1O0SA 4AICA 4E21A 5I9NA 1R0KA 4J6FA 4UUMA 1RPNA 1HLDA 4XYMA 4M86A 1I01A 1ZZEA 1GZ4A 4BNJA 2VRBA 2Y1EA 1IUKA 4UEOA 4OJNA 2WSBA 1FXSA 2PR2A 3Q3CA 2EW2A 1ZCJA 2CVOA 2I76A 4GH5A 2X0IA 1YJQA 1C0LA 1F14A 1U1IA 1AHHA 3INTA 1DC6A 3V2UA 3MJVA 3NGLA 4L4XA 1DLIA 3GGOA 4E0BA 4N18A 1NFQA 2BELA 3PJFA 4Y6SA 2F00A 2NSDA 4NDNE 2AMFA 1S6YA 1Q7BA 1MFPA 4FFNA 4R01A 1MP0A 3RD5A 1SAYA 3KSUA 1GUFA 5IFLA 4J16A 1Y8RA 3VZPA 2EP5A 5F1OA 2E6UX 4PLYA 4U8GA 3ZNQA 2NTNA 2PA3A 3LVFO 1MUUA 3SXPA 1P9LA 4QO7A 2J3JA 5L45A 3OQBA 3CXRA 3DBVO 1PSDA 1ONPA 3WG9A 5BSEA 2HJSA 5L51A 1GY8A 4UEJA 1N7GA 1GFSA 3PWZA 1TLTA 4TVBA 4HBGA 4E2YA 4YAEA 1PS8A 2VN8A 2W98A 1JVSA 1T26A 2Q45A 3QY9A 5HS6A 4E5MA 4EI2A 3LSYA 4BNIA 1JKJA 4N7RA 4RPLA 1A4IA 3RJ5A 4CR7A 1E5LA 3VPGA 4D3SA 1RM5A 4OQYA 4DYVA 1NTOA 3GG9A 2YQ4A 5LDGA 4WECA 3GVPA 2I5PO 4AFNA 3VVCA 3RKUA 3PJGA 3AM4A 4A03A 1QYDA 2VNAA 5G2OA 1E6WA 1WDMA 3AJRA 2YW9A 1K6JA 2NNLD 4UVEA 1QV7A 1KVQA 4AL4A 4CLEA 1N9GA 4YRBA 2P5YA 3RKRA 1NPTO 3IIEA 4RCVA 1I2ZA 5JDCA 3ZW9A 4RVUA 2CMDA 1B14A 1ADCA 3K9QO 1JQBA 1NVMB 4AJPA 5CDTA 3KEQA 1SCUA 3FPLA 5JAIA 4H16A 1XIVA 1PL7A 3L9WA 2RH4A 1RM4A 3NYWA 3BHMA 3QJ5A 1TA4A 4B3JA 3TFOA 4KQWA 1DRWA 2AQIA 1C0IA 1VJTA 4JJFA 3WBBA 1KS9A 4E5KA 5JC8A 4C7JA 4KUHA 1PZFA 3K30A 4BGEA 3QV1A 4NQZA 2RBEA 4RDIA 3WFJA 3NTRA 3LT2A 7ADHA 4WCDA 2TMDA 2EWMA 4PLTA 4TMFA 1XGKA 1PU2A 3W4JA 2IE0A 4N54A 3DOOA 1YL7A 4OMUA 2VUUA 2FSVA 2VHZA 4O63O 5G0TA 4RLSA 1N1GA 4G81A 5EIOA 2IZ1A 4DLLA 1HKUA 3GOHA 2GF2A 3B70A 3M2PA 1ZW1A 3PDJA 3ONDA 1FF9A 4K9DA 1ISIA 1N9GB 4FOSA 1GZ6A 2DPGA 3UICA 3TPCA 2WEKA 3FCOA 2NVWA 1A7AA 2X6TA 2W2LA 2DUWA 1ZJYA 4TRJA 2YDYA 4W82A 2VWGA 4ZQBA 3ZHBA 4EUEA 3F5QA 1HE5A 2DBQA 3QW2A 4BHTA 1LQTA 3E1KA 5AQ1A 3UXYA 2B37A 1T1RA 1XDWA 2IDZA 3H65A 2JJYA 3IP3A 2X1HA 4KUGA 1PS9A 3AY3A 3BYZA 4AJJA 5KTKA 1EUZA 2PH5A 3DAPA 4D3FA 2X8LA 3KUXA 4HKTA 4CM3A 1P1RA 3RU9A 4GWKA 1MLDA 4QO8A 5I7EA 2AE1A 3OM9A 3ZDFA 2B83A 3F6YA 3KLPX 3EMKA 4DPMA 3GGGA 1FDTA 5CHEA 4J9UE 4NBRA 4Y98A 3WGHA 3JQ6A 4CMCA 4DBZA 4E13A 3ROPA 4B3HA 2YHUA 2Q2VA 4LRSB 5T57A 1WMAA 3PIDA 5IDWA 2DUUA 4DLBA 1HETA 4CR6A 2BRUA 1YQXA 3EYWA 5C7OO 5GZ1A 2ZYDA 1XU9A 3QQPA 1GTMA 5JAMA 5JMWA 2QYSA 2XPCA 3GC6A 3TNLA 2HO5A 2EKQA 1EUCA 3AOEC 4YAIA 1PZHA 1ZIDA 4CMAA 3X2EA 1ORRA 1KEVA 2J5KA 3NJ8A 4MVJM 3UHAA 3HADA 2IZZA 3U0BA 2VYVA 4PZDA 4QECA 1AXGA 4IXWA 2HLPA 4RF2A 2C54A 3JYOA 3WWYA 1N5DA 1UXKA 2ZYGA 3KHUA 2FWMX 4BO6A 1F0YA 1Y9EA 1QSGA 2CFCA 4OKNA 4R1NA 4BS9A 2AQHA 1U8FO 4I5FA 2P68A 3S2IA 4Z6KA 3WQQA 2OOSA 1JA9A 1UDAA 3GZNA 5BSFA 3TQHA 1ISGA 1R16A 3IDSA 1U7TA 1AE1A 3OMLA 4EJ6A 4GWGA 1XCBA 5T8KA 1JKIA 3L77A 3JQ8A 3JQEA 3DEYX 2YUTA 2CF6A 3BIOA 3JQGA 1U28A 4BNMA 4CLOA 3S2FA 3ZHXA 3CUKA 2VRCD 1PIWA 2A94A 1PQWA 1QYVA 1UP7A 4PLCA 1U7HA 1QG6A 1B16A 5IZ4A 4DL9A 5KVSA 1B3RA 3F1LA 3IAHA 3DMTA 3OIFA 4BV9A 2OBNA 2SCUA 1XYGA 2XF8A 5B4VA 4P4NA 1EDZA 2BI8A 2QZ9A 5HBRA 3K2BA 2LDBA 5EQDA 5JYEA 4L4SA 3DBHB 5KNLA 4Z0TA 3VKVA 3Q11A 1VSVA 1LSUA 2O3RA 4EITA 2JD1A 2DLDA 1RWBA 3L4SO 2R2GA 4KZPA 5B4TA 1QV6A 3O4RA 2GPTA 3ZV6A 1X7HA 4TZKA 4Z9FA 3I6IA 2VZ8A 4JBIA 4ND2A 5AXBA 3NAQA 3AUUA 3B6ZA 4NBUA 4U6QA 1P1IA 3GZNB 1NWHA 4R5MA 2CVZA 1IE3A 3JSAA 5ER9A 3Q6IA 1KC1A 1H6AA 3JQGB 4PZCA 2Q99A 4XQCA 4CLOB 4U0JA 2J5QA 1P0CA 4ILKA 2EG9A 3HN2A 1YQDA 5K0ZA 5L4NA 1VJ0A 2CUKA 2XOXA 5EJ2A 5KIAA 3OSUA 4BO5A 3DZIA 4YR9A 1QP8A 4QFDA 2NACA 3D3WA 4I9UA 3PRJA 3FD8A 2Y1GA 3S2GA 2VHWA 2C29D 4DQVA 1OMOA 4E5PA 3W1VA 3JQAB 2H6EA 2NV6A 3I9NA 1H6DA 5DCYA 1CIVA 3UCXA 3EVNA 1BMDA 2Q50A 5DBFA 2PWZA 4NBVA 1E1KA 2ZQYA 1E3EA 1KEPA 2C5EA 3ZU5A 1BTOA 1HT0A 4GX0A 1PTJA 4XA8A 4FD3A 3DBLB 1ZMOA 3V1UA 3WMWA 1K3TA 3OEYA 3JTMA 4MVJE 1QLJA 4XR4A 4BKUA 5K9ZA 4L8VA 2X0RA 4RL6A 3GN1A 1Z82A 4QXMA 1W8DA 4ZQEA 2JD0A 3P5SA 4RQTA 4D44A 1XR3A 2A9FA 3JQCA 3WGYA 5A5FA 3L9XA 4HP8A 4MDHA 5CPBA 1T24A 1ISJA 3L07A 3Q2IA 2E37A 2DU8A 3EY4A 4AJLA 2FZWA 1GU7A 2WD8A 4FC7A 3AFNA 4O59O 2X0JA 1ZMTA 1GYPA 5EPOA 2WYWA 6LDHA 2WWRA 4ZQGA 3SEFA 1HZZA 1T2CA 2HKIA 3RUEA 5JC1A 4OOFA 1U4SA 4L73A 1EE2A 1HE3A 4IMPA 2GERA 4NJMA 2UUPA 1DFHA 2X5OA 2RHCA 3RFVA 4IQ0A 4DC0A 3B1FA 3EHEA 1PL8A 4MVJA 3GDOA 4J2HA 4FFLA 4CV3A 8ADHA 2WTBA 3BMQA 1NPYA 4ALJA 3IOYA 2P91A 3WGQA 3ZWWA 4BGVA 3ETGA 1H9BA 4YT4A 4D0RA 4MIOA 2PKRA 3LC1O 4IDDA 4DMMA 2O3TA 1SOVA 1GYQA 5EMHA 5BNTA 4G65A 1U8XX 5TT1A 3WSWA 1O94A 3PDUA 1WPQA 2POQX 1FDVA 1X7DA 3INGA 3QA9A 4IY1A 1GEGA 2OUIA 1B2LA 5CAEA 3G17A 4Q9NA 5GY7A 3KO8A 3FHLA 3TJRA 1I5RA 1EQ2A 4DPKA 3FF4A 5H81A 2NVBA 2ZJ0A 3AY6A 1D1TA 2PGLA 1WP4A 3JQFA 3GNTA 3WQRA 3UFXA 3PHLA 5IXYA 3KYCA 4IMRA 1ENPA 4WOJA 3ZWAA 2W90A 1I3MA 5K6AC 4B8WA 2YHIA 4ONEA 1LSJA 1N7HA 5IN4A 1SEPA 2RIRA 2NU9A 3AOGA 1Q0LA 4AJ1A 4BKRA 1I24A 1Z75A 4C7KA 4RLHA 1UXGA 4BKOA 1UP4A 2UAGA 3GUCA 3H3JA 1LRLA 3BMQB 4F46A 4XYGA 4TRMA 2EKLA 4CQMA 4ZN6A 1DJQA 5CG1A 1TT5A 4MVJP 1GYRA 2NUAA 2C2YA 4TKMA 3ONFA 4KDEA 1EQUA 5F5LA 3TZCA 3WGGA 4CLXA 1A72A 1V9LA 1ISHA 1GZ3A 1ZSNA 2IYPA 3JQBC 3OH8A 4FQ8A 2YFHA 4J1QA 3E9NA 4CQLA 1AUPA 3PPIA 3ICPA 2FPGA 4NNJA 3C7DB 1J5PA 1HTBA 5U1PA 1X15A 1QMGA 3GAZA 3T4XA 1YBMA 2JHFA 1C0PA 2B4RO 4NU5A 4RF5A 4XJSA 2YY7A 5AYVA 5A05A 3B1KA 3WYCA 4J7UA 4RPGA 4ALIA 2GUGA 2R00C 2B35A 3KYCB 3OECA 2UVDA 4QQRA 5T6BA 2NM0A 4QX6A 2OXIA 1UZNA 2ZTLA 4CMEA 3FR7A 1R15A 3KYBA 3U5TA 3STHA 1X1TA 4BO2A 2GYYA 3HSKA 1R0LA 5THKA 4IJUA 3U4HA 2NU7A 4BNHA 3NDJA 1PR3A 3GH3A 5TF4A 4CQMB 4DPLA 4YYZA 5FWNA 5AVOA 4WASA 1E3IA 4YQZA 1KETA 1TB4A 1TT5B 3ABIA 2YV3A 3PFFA 2IXAA 3ETEA 3QWBA 5A06A 2PH3A 4RPKA 3CZRA 3FR8A 3PJEA 3ZWBA 4RZHA 4LGVA 4UVIA 1FJHA 5A3VA 1W0CA 5L7TA 4I9HA 5DDIP 3WS7A 2A92A 4BO0A 3IKTA 1D3AA 3NEPX 1LEHA 4CQLB 1XA0A 3QHAA 1LSOA 5C3MA 3GPDG 1SOWA 4R1SA 3RIHA 4CM4A 1BG6A 4J7XA 2C07A 1ZEMA 3QWAA 3HB5X 5L9AA 5JBIA 4EJ0A 1F17A 1LTHR 3ADOA 4UVHA 4IDFA 5BQFA 3QVWA 2B36A 2OP0A 3ZN2A 5JCJD 4TRNA 4PLGA 1M75A 4AJIA 3ROQA 3RSHA 3DZKA 1C0KA 4JCOA 1LBEA 3TDKA 2NQTA 1KIFA 1RYDA 3BMCA 1D4FA 4ND4A 3ZI0A 3EVTA 1E5QA 1KEWA 5JCXA 4YQYA 5I7SA 1VJ1A 4LCJA 1N8KA 4F3YA 1H0KA 2V65A 2X0NA 5L7YA 3PHJA 1T2EA 4I1IA 1P1KA 3F3SA 3P7MA 4YT5A 4PG7A 2O50A 2GZ2A 2VHVA 3FRJA 3CMMA 1OOEA 1IYZA 2DTEA 3WNVA 1NAIA 1GAEO 2NVUB 2WE8A 1Z7EA 4NFSA 4Q3CA 3CZMA 1UDBA 2VUTA 3V1TC 1NPDA 2EXXA 2O7SA 4IDAA 3KM0A 4EYEA 3F47A 1HRDA 1K89A 1I2BA 3ZWNA 2BMAA 4OHUA 4HY3A 2BHLA 1GV0A 3M1LA 2DTXA 4FPXA 1B15A 3HDQA 4ND5A 3JQ9A 3RVDA 4QEDA 3ITDA 3I9JA 1ZK2A 3JYQA 1WDKA 2AQ8A 3GHHA 4YJFA 4BNYA 1DB3A 4R3NA 5C5IA 1MXFA 4A5OA 4CM9D 2A35A 2VTDA 1EDOA 1KY4A 1SB9A 3BMCB 3CIFA 2HK7A 3VH3A 1VLLA 4B3IA 2VTEA 4YWJA 3W8EA 5JYDA 2BLLA 4CM5A 4ZQHA 4FFPA 4K28A 3NTOA 1BHSA 3G79A 1RM0A 4J9VA 4WE3A 2J3KA 4BNGA 2NTVA 4ZICA 3H5NA 1QRRA 2ZTUA 4HFJA 3QVXA 4PCVA 2EF1A 4Z3DA 1X1EA 3H3FA 3VZQA 1P1JA 4B8ZA 1PQPA 4PLFA 1A5ZA 1TT7A 5HM8A 1E6UA 2C20A 1DC5A 4NMHA 3VVBA 5TT0A 4JLWA 1XKQA 4CLRA 3EGOA 5HTOA 4LMPA 5KJCA 4M1QA 3GK3A 4YJFB 1A27A 1CQIA 3KXDA 1NQOA 3ZV3A 5IN5A 1H5QA 2D2IA 2JKVA 3I9MA 3I4FA 1YOVA 5CDSA 4L76A 3T4EA 4CMIB 3GDGA 5JNLA 1U3UA 2X22A 5MGBA 5CEEA 2PTGA 3VPFA 4DQXA 1FDUA 1LA2A 4OXNA 1FMCA 1YB4A 1E77A 2IZ0A 3V2GA 2ZB7A 1Q0HA 2Q1UA 1MG0A 3FWZA 4CUJA 3C3XA 4BUCA 1PGOA 3FNHA 1RM3A 1YE3A 2O7QA 3G0OA 1FK8A 1G0OA 2B4TO 4DXHA 2YV1A 1L1FA 4P4GA 1MX3A 1Y5RA 1LSSA 1PZEA 3ENKA 3JD4A 4OQZA 3WIDA 2BF7A 4YVFA 1WMBA 2FR1A 4LVUA 3RFXA 4CLRB 3D5TA 2YJZA 4TRRA 4IDGA 3SJ7A 2EJWA 1EZ4A 3AFMA 1E7MA 4BNFA 4BNKA 4A0SA 3PYMA 3AU9A 3H6KA 1FDSA 4GX1A 3LF1A 3OA2A 3TRIA 4XJTA 3U9LA 3W8DA 1ZSVA 3IL2A 1YOVB 2NWQA 1KVTA 4HADA 5DBGA 2I3AA 2PY6A 3JYNA 3L0DA 5ENVA 4J49A 1L7EA 4U0KA 4D45A 1YVEI 3I23A 1DPGA 2HAEA 2X9VA 4RORA 2WD7A 5TJ9A 1ZVMA 1BRMA 3HFGA 3GZ4A 4U7WA 1XWFA 3WYBA 4E12A 2HCTA 3C1OA 2W2LD 3HNPA 1E1NA 4J90A 1LLQA 4FOOA 1NWCA 2J3IA 3KETA 2G1UA 1E3WA 3RUIA 1PX0A 4D3DA 4PLHA 4YAJA 4FB5A 4DYDA 3PLNA 3I3OA 4WNIA 1LNQA 5CDGA 5CP8A 2Z95A 1UR5A 1AHIA 4FR5A 4GPD1 4L0QA 1IB6A 5B4UA 1BGVA 2OP1A 1PS0A 4QTZA 2IXBA 1GV1A 4BMVA 4E31A 3VAZA 3PQDA 2BGLA 5DN9A 1O89A 5DOZA 3H7AA 2HJRA 3SC4A 1PJ2A 3MJTA 4HWKA 4H7PA 3GNQA 1I3NA 3V1YA 3TOXA 4KDFA 3GUYA 1L7DA 3H9UA 3B1JA 1YH3A 1Z74A 2WMDA 1ARZA 3GY0A 3IS3A 4BGUA 4WEOA 1LRJA 2C7VA 4YACA 1JTVA 2O3UA 1HYGA 3PQEA 3PTZA 2WD7B 2CVQA 4FJ0A 1P31A 4IINA 4JGBA 5ER6A 1U2GA 5KCZA 4A26A 3EAGA 1DIBA 3D5QA 5ADHA 1BXGA 4NPCA 3A28A 3KZVA 1E3WB 1E3SA 1SMKA 3E5MA 3GF4A 4PN3A 4IZHA 3LU1A 4W7HA 2PD6A 3PQFA 3W4KA 4ZA2A 3U49A 2VZ9A 4FDAA 1MV8A 3M6IA 4F6CA 3QVTA 4J4HA 2VYVD 4WLVA 1V3TA 1DIHA 4J43A 4J7CA 3L6DA 3PIIA 4XYLA 4BL5A 1MXHA 5G0VA 4WCFC 3ROKA 3ANLA 5DF1A 4GMFA 4UVDA 3F9IA 1IHYA 3ZU3A 4AG3A 3VH4A 1QXSA 1F8FA 2O3SA 4XWYA 5TX7A 1NR7A 1U5AA 1J0XO 4PG4A 3WXBA 4E4YA 4Y8VA 3JD3A 2H5LA 3ZCXA 3GLQA 3GVHA 4D79A 2GN8A 1P33A 3AK4A 3ICCA 3U4DA 2X58A 2FP4A 2V6MA 3DZGA 3GEGA 4FSHA 5ILGA 2WYVA 1TI7A 4J3FA 5CEFA 3VC7A 2D59A 3LF2A 1ADFA 2FY8A 5BT9A 1C14A 2DAPA 5L7WA 1WZEA 3IKVA 3GA0A 5KJFA 2PZMA 1BXGB 1HZJA 3ZWCA 3WIEA 3GRKA 3RC9A 2ZJ1A 1Y7TA 3UCFA 3LDHA 1I0ZA 1T1SA 4Y67A 5BSGA 3AW9A 1GQQA 1ZXBA 2BD0A 2AA3A 2D5AA 1DXYA 3UKOA 1A4UA 3VPHA 1JU9A 1ZH8A 4TWRA 4OOEA 1NBOA 4OL9A 1KC3A 3NX4A 5G4LA 3U4IA 1DDOA 3BMNA 5EERA 1K0UA 2D8AA 4IJKA 1OZAA 3NT2A 4XZ3A 1NQTA 3DBHA 1CYDA 1PEDA 1UAGA 1PL6A 3DBRA 4PIVA 2HMWA 1NP3A 1H93A 4OO3A 1EEHA 3V5NA 3DHNA 4B7XA 3HDHA 1HXHA 5KJEA 2PD4A 3PHHA 5KWEA 2GGSA 3QVSA 1QKIA 1E1LA 2CNBA 3X2FA 1DFIA 3W6UA 1BDMA 2GSDA 4CL3A 4WEQA 4CMKA 3PK0A 3U62A 1GQ2A 3D7LA 1YBVA 3IQDB 3GDFA 3ZH2A 1WDLA 2GDZA 1J6UA 2OORA 2PGJA 4IJVA 3A14A 1GEEA 1UH5A 1PJ3A 3OJEA 1GPDG 3R3JA 4J4BA 2C5AA 4WKGA 5JPIA 5IZCC 3L6EA 5TC4A 4A73A 3BZUA 1OBFO 5IJZA 1BW9A 1IULA 1IZ9A 1O9BA 4JBGA 4XKJA 5FI5A 4IGEA 3U4CA 3WOHA 3R1IA 2EGHA 3HDJA 4RF4A 1ADGA 4IIVA 1ID1A 3MTJA 3BMNB 1BWSA 3I9OA 4I5DA 4FN4A 2ZQZA 4M54A 1D1SA 2EKPA 4RV9A 1JW9B 2CZCA 3DBRB 1HDXA 4KMSA 4Z3KA 4YT2A 2DBRA 1V0JA 2ZCVA 3JQAA 4R51A 5A9TA 4B7UA 2CY0A 2OZPA 3ULKA 2JFGA 4I5EA 4KP7A 2GZ3A 3C24A 2Y68A 3DOJA 3CH6A 3JYPA 2DT5A 3O8QA 3RUDA 4DQUA 1DHTA 1Z6ZA 1NHWA 3I1JA 3S55A 1LDEA 2GN6A 4BO1A 3Q9NA 3GVXA 3OBBA 4GX2A 3H8VA 4AJOA 1C1XA 2PZKA 4YB8A 3DBLA 4GGOA 3L6OO 3KV3O 3QWIA 1R4MA 2XXBA 1YGYA 4GBJA 1MB4A 5JW6A 3SBOA 1BW9B 1QYXA 4W9NC 1HDRA 2HU2A 2HQ1A 4RDHA 1HYEA 4PRLA 1EBFA 4E2XA 4BO9A 1IOLA 3BXXA 3ROMA 1EK6A 1T2DA 9LDTA 1KVUA 3IC5A 2OGUA 2ZATA 4GI2A 3K96A 1LDMA 1LUAA 1AGNA 3INRA 1D8AA 4GAEA 3JD0A 4TSKA 4Y9DA 5DNAA 2GD1O 1LLUA 1G1AA 1ZKMA 3QLJA 5JO0A 4Z9XA 2Q46A 2Q4BA 1HE4A 2IYOA 4MVJD 2GO1A 2VHXA 2P9CA 1YJ8A 1YKFA 4OXKA 3AOEA 2DQ4A 4DBVO 1VPDA 1ZK4A 3KOUA 3MJ4A 3O38A 2B5WA 1DC3A 1XU7A 3DHYA 2FZEA 2QRKA 4FBGA 3ZWYA 1K6XA 4RJTA 3ETDA 3RAJA 4DGSA 4LSWA 1Q7CA 5A5EA 4NK5A 3LC7O 3RC7A 1LXCA 2IODA 3QWFA 1GUYA 2W4QA 3CINA 3O8QB 3WWZA 5A4DA 3G3EA 1E7YA 3JD2A 2D3TA 1JLLA 1EVJA 3F46A 1C1XB 1DBVO 4J2OA 3K6JA 3WGTA 1IPFA 1R4MB 4XD2A 3HJAA 5DOVA 2HRBA 2VRCA 2FMUA 3G1TA 1PGJA 2BFMA 3N7UA 1WAMA 4YJDA 2D5CA 3O03A 4YJGA 2NU8A 5B37A 1E0DA 4GKVA 2FRDA 3BTOA 4GMGA 1JVBA 4O0LA 3GGPA 3PXXA 4OH1A 1KERA 2EIHA 3W4IA 3F5SA 1ZJZA 1P77A 5I9MA 4R1UA 4R4JA 2UYYA 3AUAA 3KVOA 3WX0A 3ZNNA 4UUNA 3SJUA 2AHRA 4M89A 4XRGA 2YYYA 4NU6A 2QZZA 4K26A 2JAPA 4ZVVA 2O4CA 2O3QA 4YCAA 1R6DA 4YEDA 4FFRA 4A7PA 1V8BA 2JCYA 4DA9A 3GT0A 4S1VA 4ROSA 1YB5A 2EW8A 4JJIA 2PLAA 4DRYA 1UXJA 4XRRA 1MC5A 3MJSA 1LDNA 5T5QA 4BO7A 1X13A 4CM1A 2BKAA 1E7WA 1CWUA 3DZHA 1P3DA 5IDYA 4E6PA 4XQEA 3GPIA 3OJFA 4OM8A 3DAFA 3D1LA 4HXYA 4RVFA 3OF2A 2JFHA 1PJ4A 2JD2A 1EK5A 3EDMA 3C85A 3PZRA 3ADPA 4QFCA 3E18A 1DFGA 4YJGB 1GR0A 3HB4X 3TN7A 1DEHA 1ZK3A 1GDHA 1Q0QA 1YO6A 1PWZA 2V6GA 4NZ9A 2O48X 4D7AA 5EQFA 3EW7A 3JV7A 4OIMA 4D42A 4CUZA 2D0IA 4PGFA 4RVSA 3QRWA 4MVJH 2O2SA 3EK2A 3TL3A 3TF5A 1B8UA 1F12A 3GMSA 4IM7A 3A06A 1VRWA 4BNUA 4O6VA 4ZU3A 2BH9A 3OEWA 1DIRA 3DC2A 1H2HA 3GVCA 3MCVA 5KVCA 5TRTA 3GQVA 1EE9A 3AI1A 3L4BC 3RU7A 1ZBQA 3WB9A 5C37A 5COBA 2HMVA 3ON5A 3ST7A 5JAQA 1PGNA 4YT8A 4IDEA 4DIBA 5JDIC 4BNNA 4IIUA 3WICA 1BXZA 2R6JA 5EL0A 4N5NA 4RF3A 5ILOA 1NYTA 2HSDA 1YL6A 3UN1A 3PEFA 3CTMA 4YAKA 1YRLA 4E33A 3Q2KA 3KB6A 4Q39A 4UEKA 3VKUA 1AN9A 1HDZA 2I9PA 3MEQA 4YDRA 1HSZA 2EV9A 1IPEA 2WJPA 1I30A 3BTSA 1W73A 5U4QA 3RBVA 4BNVA 4BO4A 5G4KB 3HN7A 2BFPA 2YQ5A 1DRVA 3LZ6A 4BO8A 2VWQA 4ZHSA 1DHRA 1JKFA 4BIIA 4EDFA 1U3WA 5IDQA 3RCBA 2C82A 3CE6A 3KYDA 1YONA 1NVGA 3MJCA 4XCVA 4XYBA 1E3JA 1P45A 3EZYA 4Y6RA 5EN4A 4MKRA 3GG2A 2Q4EA 3ZWVA 2GRAA 2PV7A 2HRZA 3FN4A 4HV4A 3WLFA 4ALKA 2P9EA 2Q1WA 3ASVA 1RKXA 4ZD6A 5A3JA 5C7LO 4EGFA 1PJLA 2RH8A 4GLOA 1KEUA 2WYUA 4Q3BA 2Z1MA 4DIFA 3CEAA 4R16A 2GN9A 4B79A 2XAAA 3E82A 2Y1CA 4OGWA 5DBIA 2JCVA 5U9CA 1DIGA 5TGDA 4PFJA 2YFQA 1ISMA 1I8TA 4IQGA 3NUGA 3LLSA 4OXYA 3GR6A 2NVUA 1DIAA 2UUOA 5L95A 3C8MA 4R3WA 1SEVA 4WOKA 4CM6A 4YAGA 2JFFA 1D7OA 3CPSA 3K8ZA 1B3BA 3UW3A 5DT9A 3DONA 4I08A 3NT4A 1MA0A 4N5MA 2EJVA 2DPHA 4DMLA 3OIGA 3P2YA 1NAHA 2ZIZA 3KYDB 1MG5A 4RZIA 4RGBA 1BDBA 3WDSA 1CERA 3AY7A 4YJHB 1XHLA 4LMRA 4DWVA 2Q2WA 2E48A 4FIZA 1K5HA 5K6AA 2DTDA 2DVMA 2CDCA 3H9EO 1DSSG 4AJKA 4CMJA 4TROA 2O4UX 3FBTA 3RBXA 2Z5LA 2W8ZA 4GL4A 3NRCA 5KKCA 3CKYA 2I67A 4FJ1A 3UAGA 5A9RA 1NASA 5I8ZA 1VM6A 3LYLA 3AM5A 3EUWA 5JY1A 5CG2A 5JSFA 4ITUA 1ENOA 1EMDA 3AUTA 4XDYA 4D43A 3H9JA 1A9YA 3IJRA 2J6IA 3LLVA 3PGXA 4L75A 3TOZA 4Z0PA 2BGKA 4FS3A 3D4NA 3JQBA 4WJZA 1ZUD1 3AU8A 3LK7A 4Q3AA 2VYNA 3ITKA 5IG2A 1HYHA 1T25A 1U9JA 3A1NA 1E1MA 4JNKA 2H1SA 3DB2A 3H4VA 4N5LA 4RVGA 4BNXA 1K2WA 4NH4A 3MJEA 1Z45A 4PVCA 3SLGA 4FCCA 1SNYA 2JHGA 1LX6A 3ZGYA 4AJEA 3GNSA 4E5NA 3R0IA 1Y9AA 1PJBA 4XIYA 3RC1A 1C1DB 2R00A 3GMDA 5T67A 3VHRA 4CMIA 4E30A 4E2WA 5DP1A 2Q1TA 4CM7A 1SBYA 5JY6A 3S1LA 5AOVA 4KQXA 2B69A 3I83A 4XQ9A 4BNWA 2RHRA 2D4AA 2VWHA 1GD1O 2B4QA 4MIEA 4J0EA 4KTVE 5I7VA 4M49A 3QE3A 3DFZA 2FOIA 3ZNOA 4GSKA 1G6KA 2X9NA 3PGJA 4RPJA 1SPXA 1VI2A 3C1AA 5JE8A 3DZJA 3PZBA 3TL2A 4UUOA 4RPHA 3NDRA 3COSA 2PNFA 3D64A 4H15A 4PG6A 1EBUA 2G17A 1U5CA 1PQUA 4PLZA 3NJ4A 4JN6B 4Q3EA 2ZB4A 5JCJA 2EGGA 4LCEA 4PLWA 3RUHA 3OP4A 4TQGA 3ZWPA 2GR9A 4J1TA 5DP2A 1K6IA 3PI7A 5BSHA 1J49A 1OFGA 3GRPA 1TEHA 4XB2A 4YBZA 1PJSA 1LDBA 3F4LA 4L9RA 8LDHA 3PYLA 5ES3A 3AI2A 3M2TA 4W6ZA 2D1YA 5JDCC 3TFQA 1N1EA 1DC4A 3E8XA 4ALNA 4MKXA 1I32A 2QG4A 3Q1LA 2CSUA 1GL3A 2OMEA 4XDZA 4JX8A 4ZRMA 5THQA 3SX2A 1C3VA 3LT4A 1ONNA 3AWDA 1V6AA 1NNUA 4FGSA 3RASA 2HK9A 1HDGO 1X7GA 4IDBA 4IPTA 3TZ6A 1O6ZA 4IS2A 4U5QA 3D0OA 3KTDA 3VH2A 2WM3A 4AVYA 1E7QA 1DAOA 1BSVA 3I6QA 2DBVO 2DBZA 3ZHZA 3DQPA 4MP6A 4ALLA 2NLOA 1WVGA 3I4CA 1YDWA 1O8CA 3VH1A 4HNGA 1VE9A 5JLAA 5IAAA 3I9KA 4MO2A 4CV1A 1DRUA 1ZO8A 4DREA 3H9GA 2Y1FA 3GN2A 1I33A 2NTJA 1W6UA 3ZHYA 2FN7A 1HL3A 4IUYA 3OIDA 4CM9A 3E6AA 3OJ0A 5CPFA 2PKQO 1R0SA 3QP9A 3T7EA 4I9NA 5A1TA 2FR8A 4JJGA 4BV8A 1JDJA 4JQCA 4YXFA 1JN0A 1NX6A 2V6FA 1XQ6A 2W2KA 3K31A 4LRTB 2NU6A 1XLTA 1WZIA 4E5YA 5KJ6A 3DZFA 2HUNA 3HQ4O 4FW8A 2Y99A 3CSDA 1PJTA 2I66A 3ASUA 4LK3A 1HDYA 2QW8A 2Q1SA 2VZ0A 3C7CB 4II3A 4NG5A 4OYRA 4B4OA 3WJ7A 1VSUA 3JD1A 1P0FA 1DLJA 1KVRA 3VPXA 4CMGA 3C1TA 1I3LA 1DJNA 4ND1A 4PG8A 3TSCA 5ITWA 1E7SA 3AM3A 1E7RA 1YQGA 3BTUA 3MOIA 3V2HA 3OETA 3LC2O 4YRDA 4Q3DA 1R4NA 3GEMA 3DAGA 3HFSA 1NVTA 1RYEA 4HFRA 4TKLA 3DWFA 3OQ1A 4F6LA 1EVZA 2J5RA 4JBHA 4S3MA 3RC2A 4AJHA 1H9AA 4R69A 4TZTA 1RJWA 4WLNA 4ZQFA 1JAXA 4K6FA 2X5JO 1YL5A 2VOJA 1CETA 1Y8RB 2AEMA 3PJDA 4ZRNA 2G76A 5FF9A 3R6DA 4WUVA 2X5KO 2Y0EA 1Z7BA 5TIIA 1CDOA 1Q1NA 2E82A 3UF0A 5C7IO 2W2KB 2HMTA 3NTQA 1WW8A 3IMFA 2Y1DA 1VL0A 5AXAA 5FEUA 1YXMA 4INAA 1KBZA 5J23A 2AXQA 1YWGO 2ILTA 4CLHA 4M87A 3DR3A 2FPIA 4YTEA 9LDBA 2Y66A 4G5HA 1GADO 1UDCA 2E49A 2P2SA 4AJ2A 5ITVA 4PG5A 4HFNA 5B1YA 3DO5A 4WGGA 1JAYA 2Y93A 1N2SA 4XGNA 4URFA 3I52A 4BQRA 1PWXA 4BVAA 3EC7A 3H2ZA 3QWHA 2BGMA 4CJXA 4NIMA 4WK6A 1JWAB 3GHYA 1R4NB 1CEQA 4UAGA 2PZJA 5TSDA 1P1HA 5G0SA 4E2ZA 3RQSA 2G5CA 2OO5A 4XB1A 4MVJG 3D4PA 3PFWO 5T8KC 4EW6A 4UREA 5JXWA 1UAYA 3JQ7A 3OICA 3E9QA 1W4ZA 4D0SA 3FBGA 1ENZA 4EJMA 3VDRA 3S8MA 3PHIA 3DMTC 3PLRA 3KSDO 1LC0A 3VZSA 4AJ4A 3NGXA 1T2FA 2YDXA 1Q7GA 4BMSA 4GQAA 3VOSA 4A2CA 2V7PA 3U09A 1OC4A 1QYWA 1V3VA 1KY5A 3RUFA 1B8VA 3Q0EA 1UUFA 5GMOA 2LDXA 4ZGWA 4FFOA 4DC1A 1SO8A 3IP1A 1M66A 4QUKA 3ZWOA 4BOYA 2DFVA 3FTPA 3JQAD 5F1PA 3G1UA 3MOGA 1EVYA 4LISA 1KVSA 4B7CA 1Y6JA 5L4SA 2JAHA 5TLSA 1M6HA 2XXJA 4C4OA 3ZV5A 3D4OA 1M6WA 1E6EA 3RUCA 5ENDA 1HDOA 5TJHA 2HMUA 2GASA 1AXEA 1PZGA 5H83A 4XEHA 3OFSA 4UUPA 5AXCA 1CJCA 4CR8A 1I3KA 4KTTE 5EESA 5CDUA 4MINA 3JQ7B 4WLUA 1NFRA 3H5RA 1T4DA 4HUJA 1LJ8A 5TS3A 5LCXA 3D3EA 2X86A 3MZ0A 1M2WA 2CD9A 4GLLA 2ET6A 5L4LA 1NQ5A 1U3TA 5I8WA 2EERA 4W7IA 5EINA 4Z9YA 4EBFA 3DDNA 1VKNA 2ZYAA 3NT5A 4HX5A 4KUEA 2WE7A 4Q3NA 3IUSA 5I7FA 4O5OA 4M8SA 4XGIA 4AJNA 4MVJF 2V6BA 2VQ3A 5IDXA 3FNEA 1IY8A 4U6SA 1U4OA 3BA1A 5GZ3A 3GAFA 3PYXA 1LDYA 2QHXA 1VC2A 3RI3A 4PRKA 1GCOA 2B0JA 1H94A 3FI9A 5FI3A 1YDEA 3HHPA 3S2EA 3ZZNA 5BNIA 4NBWA 3MWDB 4WCFA 2GNAA 4EEZA 4J1NA 3PWKA 4XYEA 5JO9A 2C7GA 1OI7A 2I3GA 1Y8QA 2QRJA 3HWRA 1EUDA 4YPOA 4CL8A 3M1AA 5L3ZA 4KWIA 1I10A 2Y0DA 3KBOA 2VOEA 1GQYA 3RWBA 4J91A 4YRAA 5DCUA 1OC2A 3E9MA 3FSRA 3QSGA 3SLKA 5CFZA 4CPDA 4NJOA 4Y6PA 2CF5A 2HMSA 2AG8A 4B4VA 4PLVA 2PZLA 1DOHA 1HE2A 1T4BA 2PD3A 3UOGA 2Q3EA 2X4GA 1B0AA 4BKPA 2ZB8A 5IF3A 3F4BA 5JFOA 1EVIA 1I36A 4J4TA 4D46A 3T7CA 3GEDA 3DMYA 4FGWA 1XG5A 3DXFA 1G0NA 2QIOA 2VT3A 4ID9A 4J0FA 4GKBA 3ZU4A 1MFZA 4ZJUA 5TNXA 2O2YA 3JQDA 4WCFB 3HDYA 3DZBA 2Z1NA 1Y8QB 1B26A 4EUFA 4P38A 4CV2A 1WLYA 1MC4A 2BI7A 2CDBA 3E48A 5F5NA 5AXDA 2AQKA 3JQ8B 2H9IA 1O5IA 1HSOA 2QRLA 3GFGA 1GCUA 2H63A 3QIVA 3I9LA 4WLOA 2C59A 4LVCA 1J4AA 3R3SA 3UH1A 1ADBA 1F06A 2QQ5A 3O9ZA 4CODB 3A4VA 5LC1A 3WYEA 3HG7A 1ZK0A 3H9QA 2FHSA 1QLHA 4XGKA 2GLXA 3KLMX 3JQFC 1UP6A 4OAQA 1IL0A 1ZEJA 2DKNA 4CM8A 2JCXA 4RVHA 4DIOA 2TMGA 4GX5A 4B4UA 3P2OA 5IZCA 1ZK1A 2FR0A 2NQ8A 5BNFA 4NR0A 3H5AA 1ENYA 3MWEB 3LT1A 3ZWMA 1R12A 1Q2XA 1X0XA 4OSOA 1H6CA 2DFDA 1LC3A 3DTTA 1CRWG 1E92A 2ZB3A 4BQPA 4XIJA 4IQ8A 3DL2A 1WXDA 1FDWA 4I5GA 1TVEA 2O3JA 1VKOA 3QVOA 2VHYA 2QX7A 3FWNA 1A7KA 4O1MA 2YV2A 2PFGA 4CQMD 2BFAA 4MIYA 1QYCA 1HEUA 1T2AA 3KRTA 3K5PA 3W8FA 1XELA 4PVDA 5ICSA 5HRUA 2IRWA 5KVQA 1V35A 2WDZA 1DO8A 4BMNA 4RVDA 3SVTA 4I8XA 5HA5A 4RQUA 4R41A 4XX0A 4BB6A 1YBAA 3D3WB 3ZU2A 1ML3A 3KSZO 3WMXA 5DULA 3BHIA 4NFHA 3U3XA 3NKLA 2UV8A 4CM8B 1PGPA 1LQUA 1NHGA 4GSLA 2EP7A 3PVZA 4CMEC 4CV0A 3VTFA 4R1TA 3UCEA 4II2A 5A9SA 1ZNQO 2VT2A 4W9NA 1QORA 4JK3A 4BNZA 1NM5A 2FPPA 3FTNA 3WGIA 1Z73A 1XQ1A 5G4KA 5TQVA 2F1KA 2X9GA 4BGIA 4QSMA 4W4TA 2Y05A 1O95A 4DLAA 2DM6A 2RAFA 1HF3A 2JL1A 4BKQA 1LRKA 1PJQA 2I65A 2I6TA 4P8RA 4BO3A 2OFPA 5JMPA 4WLFA 3K73O 2DC1A 3EZLA 3NV9A 3OA0A 2UDPA 3VPSA 3LQFA 2P4HX 5ICMA 1GUZA 3C7AA 3G49A 1UXHA 4ESOA 1EFLA 2ZKLA 4R68A 3ENNA 3K2EA 4DTIA 2G82A 2J8ZA 4IBOA 5A02A 5IXSA 4CMBA 3ANMA 3NDIA 2PKQP 3N74A 2HK8A 3H2SA 3TZHA 3Q9UA 3ONEA 1BXKA 4CUKA 4L4RA 1YB1A 4M55A 3V8BA 1A71A 1PGQA 1ZSYA 4X54A 4YA6A 3HE3A 4PZEA 2YZ7A 2EHDA 4ND3A 3VDQA 1ZFNA 3WFIA 3IJPA 3F1KA 4MJLA 5A9SB 3KEOA 4NJMB 3CMCO 5FFFA 2QYTA 1VL8A 1UJMA 5T64A 4EZBA 4BB5A 5LDHA 1B7GO 4WPGA 3TZKA 2ZTMA 3UVEA 3WR5A 4JROA 4FFMA 4Z0HO 4F45A 3ZNPA 2Y1OA 1LI4A 1P74A 1WNTA 3A9WA 3WJAA 4R9RA 4UULA 5F21A 4L74A 4LW8A 2O23A 1H2BA 1M76A 4KWHA 1EFKA 3UGKA 4BNTA 2GCGA 1GPJA 1Y1PA 3I5MA 4YJHA 1UZLA 5CDYA 3E5RA 4WNCA 2BFOA 4R9SA 1CF2O 2IEBA 5L40A 4GGPA 4JP2A 4OSPA 3UUWA 3O26A 4D41A 2P4QA 3MTGA 4XQGA 3IUPA 4LSMA 4BNLA 1BVUA 3JQ9C 4R5HA 3SC6A 4MVJI 1NXQA 4G2NA 3WTBA 2VYND 1IZ0A 3W6ZA 3JCZA 2ZTVA 2AEFA 2VWPA 1M67A 3WTCA 3GVIA 3P19A 1ULUA 3ZW8A 6ADHA 3ZV4A 3B20A 4J1SA 4IJWA 1P44A 4QT0A 2YHIB 3ZWXA 3FPCA 3E03A 4FC6A 2VUSA 2G0TA 5H82A 4EEXA 3LT0A 2P5UA 4IZIA 1PR9A 3VTZA 4H3VA 1KYQA 2GN4A 4P22A 5I9LA 3AUSA 1UZMA 4DVJA 2GZ1A 5HS4A 5KOIA 4IDCA 5KVVA 1Y81A 3OHSX 4RO0A 3FNFA 2Q49A 1H6BA 1LU9A 1C1DA 1NFFA 4HNHA 2NADA 3WLEA 2VNSA 5DCWA 3DTYA 4OKIA 2A4KA 1LDGA 1XSEA 1BVRA 3BMOA 3ORFA 4JIGA 5COAA 2AW5A 3ANNA 4KOAA 3L4BA 3WNQA 4EUHA 4ALMA 2X23A 2EEZA 5DZSA 3VZRA 2OL4A 3WGZA 1E3LA 4K1LA 2AE2A 4JXKA 1NR1A 1V3UA 2PGDA 5COQA 5JDIA 5A03A 3TZQA 1YS4A 2ZK7A 3HZZA 5BR7A 2E4AA 4DUPA 4GVLA 2J3HA 2IEDA 3GFBA 1X0VA 4JP3A 3TWOA 4R54A 1JWBB 4A10A 1SC6A 1I2CA 3PP8A 5G0UA 3RROA 4PLPA 1QR6A 3WGOA 4LN1A 4E3ZA 4IXTA 3WQSB 5G0WA 1HDCA 3PWSA 7MDHA 5KJ1A 1XEAA 2Y67A 4FJ2A 1IHXA 3JYLA 1S7CA 4MKZA 1N92A 1A9ZA 1U2DA 5B12A 2CDAA 2Y0CA 3DFUA 4B4WA 2P9GA 3OJLA 4K6CA 4MOWA 4MP8A 3AI3A 4NK4A 2OBYA 3DOCA 4MPDA 3WSVA 4CM4B 3BMOB 3N58A 1ULSA 2VCYA 4A27A 3PHGA 1ISFA 1R37A 3RJ9A 1WWKA 1MGOA 2RCYA 1HWYA 4XR9A 4NFYA 1Y5MA 3RFTA 1VL6A 3RUAA 1SB8A 3BTVA 5JAZA 1HLPA 2X7HA 5L53A 3FNGA 5CEJA 2B5VA 4NBTA 1F8GA 3RBZA 5FYDA 4CMHA 2C2XA 1OAAA 1DAPA 4IS3A 4NHEA 5F1KA 1P1FA 4WLEA 5A04A 4CLDA 4NI5A 3BHJA 4UVGA 1UXIA 3DHEA 4E32A 5GZ6A 1CQJA 1U3VA 1KOLA 2I99A 5MDHA 2PK3A 3OQ6A 4HFMA 4P4LA 5JS6A 3BAZA 4TVOA 1B8PA 5F3RA 1ZXLA 4MP3A 2FSSA 5HWSA 1R66A 2ZCUA 3WBFA 2Q2QA 5KKAA 1NQAO 2OHXA
chains in the Genus database with same CATH superfamily
1WV0A 3GQBB 5ALDA 1ONOA 3K92A 1TK2A 2FPXA 1W19A 2BE7A 3CPHA 1X86B 4KFCA 3HU3A 1KZHA 1SZJG 4TWZA 1TXGA 1ONBA 1QIHA 2G08A 5I9NA 3KJNA 5MFPA 2PQ2A 2YX1A 1SC1A 3LWDA 3WLIA 2R5FA 1GZ4A 1WPRA 3E81A 4QOIA 5BOSA 1J99A 3ZXIA 3BE6A 3RSQA 1Z0SA 2WSBA 3C3DA 1VKRA 4U9UA 1FXSA 1HUQA 3TQFA 1DEAA 1GPWB 2R25B 2R96A 3CZ9A 1KMNA 2CCKA 3Q3CA 4M0LA 3ZWQA 3ORYA 4PZ0A 1RQPA 3T34A 4FKZA 3P9KA 4YLGA 1C0LA 5ELMA 1V9CA 1KP9A 3WQHA 4X8LA 4X60A 4YUYA 3I2JA 3NGLA 2XTJA 4HGPA 4MRSA 4X64B 3GZTB 3EVAA 2SNIE 1T5OA 3GRFA 2EL7A 4MHSA 4F2GA 4Z8YA 2BH2A 1QWOA 1CQJB 2E4UA 4JC4A 3GB9A 3ZHVA 1JEJA 2FQXA 2R8RA 4Y7DA 3TX6A 4TT8A 4MYRA 3RC8A 1S6YA 3NTXA 1MFPA 4FFNA 3GL9A 1TDJA 3RD5A 4KC0A 2WVGA 3G2OA 2BY4A 4EJSA 4J16A 2B1QA 3PNMA 1FLNA 2VAPA 3H1AA 1L7RA 4KFUA 3SDSA 2E6UX 4PLYA 4Y6LA 3ZNQA 1RYBA 4B76A 1EIZA 4Y6QA 5BV8A 3TBFA 1W36C 2AN1A 5JCZA 5HZMA 5PGMA 3OQBA 1LV8A 3MUFA 2QUZA 3M4XA 5HUHA 4WDQA 4REQA 3VHXB 1L7QA 1CY7A 1U31A 3OESA 5FI0B 3SC3A 2QDKA 2HJSA 1JECA 1G5RA 2XKAA 2I1VB 2WKQA 3EXFA 4NE9A 3V4OA 2CHUA 4YRKA 2VJYA 2QU7A 3ZDAA 3K9HA 4B3FX 4TVBA 5AKKA 3W3AD 3DE2X 1EHIA 3OX4A 2C1XA 5AKGA 1OROA 4OP1A 5LZ4A 2Q45A 5HS6A 2PO5A 3ESQA 4U9HS 3LSYA 1JKJA 1KO1A 2CKMA 4RPLA 3BK7A 3RJ5A 2GM4A 1DZ3A 3WO1A 4OQYA 3DDHA 1JHDA 1NTOA 4UM7A 2JBAB 1XVUA 4MJ3A 2AJBA 4GQBA 4ZWNA 3CLSC 5F7ZA 4FUTA 2I5PO 3B9QA 5F2OA 4AFNA 4H0FA 3RKUA 1D0VA 2GPAA 3PJGA 4PSCA 3UOAB 3ZYCA 2V7EA 5G2OA 5EXXA 4CFYA 3E27A 5KQLA 3FMFA 2ZFUA 4DMCA 4BCDA 3GLGB 2EW1A 4PQGA 1BWRA 4HATA 4UVEA 3FDFA 3FF1A 3NYQA 3RJZA 4CCAA 1L4FA 1XTZA 2O1SA 3H11B 4LOAA 3U3ZA 2BR4A 3X1YA 1ESDA 1N9GA 1D03A 2P5YA 4PSKA 4TSFD 4UUBA 4WX2B 1NPTO 5DLEA 1ZESA 3W2HA 3IEXA 4FGJA 4ZHQB 2JFPA 3U7HB 2HCFA 5JNRA 2CMDA 1B14A 1KI8A 2Z5GA 1NVMB 2Y71A 4AJPA 1CUXA 1X19A 4LSZA 2E0IA 4OBEA 5JAIA 1SVLA 3E22B 4CNQA 2XF2A 4U4AA 2D7JA 4FN5A 1ABBA 3NYWA 4CHGA 1RM4A 5KNCH 4RZQA 4YPFA 1BHQ1 4EG5A 1ZUNA 3ZYZA 4LFBB 3TFOA 4KQWA 3B7PA 1DRWA 4ZDJA 4XIFA 1Z4LA 1KS9A 4E5KA 2UZAA 1XZDA 1PZFA 3K30A 2OWEA 4BGEA 5JOQA 4H3HB 2GD6A 3TPFA 1OFTA 3ELWA 1CUDA 3W78A 7ADHA 3G0DA 2TMDA 2BP7A 2FNAA 1E2KA 3KU4A 5DTIA 4BCBA 4FHEA 4D56A 1UK6A 2KPOA 2VJAA 2GPJA 1CHNA 3W4JA 2BEWA 4OMUA 3WGKA 2VUUA 3VXKA 1W1IA 2FSVA 4A6DA 2VHZA 2CDNA 3TRKA 5BQXA 2EFJA 5G0TA 1OHHA 5DK6A 1M1NA 1Y5IA 3R7WB 1GTSA 2IZ1A 1XAIA 4KQHA 1HKUA 3GOHA 2OM6A 4MS4B 3B70A 1JLMA 1UM9A 4ZO9A 4BLPA 2FVXA 3ICOA 1OIVA 4FOSA 2DPGA 2WSYB 3TPCA 2WEKA 2D54A 2HCBA 2NVWA 1A7AA 2X6TA 3DT6A 3E23A 3JWEA 4PNHA 2GUWA 5B2ZA 4AYTA 2JRCA 5CBKA 5DXAA 1ABEA 2EL9A 4W82A 5A0VA 2B4KA 2VWGA 3EVFA 3K9BA 3MTQA 3ZDRA 2WQ7A 4EUEA 1HE5A 3U9SA 5FBWB 5HRAA 2B37A 1AUOA 2ZDGA 3OZXA 2IDZA 3H65A 3VU0A 3DTVB 3IP3A 3AEUB 3VTAA 1G42A 2O8BA 1G7CA 1XJQA 2YVKA 3NTLA 1ODIA 3FE2A 2WHXA 4AKSA 2XGSA 3DAPA 2X8LA 4HZIA 2OBFA 4HKTA 3IHKA 4GMKA 2YZKA 1SU8A 2J9RA 1MLDA 3AKEA 3MWLA 4DJFC 3O8RA 3JQPA 5AW6A 2I6XA 3O0DA 3LNCA 4M7WA 1EX7A 3OM9A 4V03A 3TMAA 2IZ6A 2OPHA 4PQYA 2WNHA 3ZDFA 3WL7A 3ZGLA 4EB0A 4JLOA 3MT9A 1AKYA 4KQCA 1M1ZA 3QBVA 2JAUA 3UHJA 4BE9A 5IZ4A 3KJEA 3BIWA 5AO9A 4UATA 2PVPA 3JQ6A 4E13A 1RI2A 3NHKA 4JBXA 3ROPA 1S1CA 4EPYA 2XYPA 1WMAA 2CLCX 3PIDA 4DLBA 4M0MA 2GAAA 4CR6A 1TTHA 2ST1A 1L4NA 4GT1A 4IVRA 2IW3A 2ID7A 4BWYA 5GZ1A 1GPNA 4KQEA 3QQPA 1TJNA 3X43A 1QO7A 1KXJA 1Q1QA 1E2EA 2QYSA 2G83A 3FMIA 1V11B 3JQQA 3WK4A 4POOA 1MX1A 4YAIA 1ZIDA 4YLEA 3D6NB 2BBOA 2LGJA 3X2EA 1Y1SA 1F8XA 3PC7A 4PYNA 1RXUA 1KEVA 4MVJM 3QQ5A 4NBKA 2FW0A 5F4ZA 5K51A 2VVTA 4MR8A 5M34A 1JE1A 1RVV1 5LOVF 3DV2A 3GFRA 3KQWA 3QGMA 4UOQA 3W6PA 4RF2A 1HYBA 4HAWA 4DA8A 3JYOA 5DBOA 4DNOA 1UXKA 2CN1A 3MUNA 1QE5A 2VF4X 1ZH4A 3H84A 3KHUA 3V3TA 3T06B 3VRHA 4DTCA 1RBYA 2E85A 1C2YA 2HFKA 3MMXA 1KDPA 2ZRFA 3HJHA 4FT4A 3WK5A 4U2GA 2CFCA 1SUWA 4MHOA 2ZZMA 4BS9A 4OBBA 2DF8A 1Z7GA 5ALKA 2AQHA 3QFTA 2PWPA 1F3OA 3L7JA 1F20A 3URKA 3VKFA 2VA8A 1P4SA 1IRIA 1DO0A 3LDGA 1DTEA 1R16A 3IHWA 4YI5A 1PP4A 3IDSA 3W2FA 1US8A 4G3XA 2QIPA 2WWWA 3G5LA 3O93A 3OMLA 4HOYA 4PHTA 4YROA 4OI1A 4G1FA 2YWFA 5IYZB 3L77A 4Q4AB 2GZSA 1I3CA 1SXJA 3DEYX 1IHDA 4JUBA 3WLKX 5KOHA 1YJAA 3QELA 3QUSA 4CLOA 5LP6C 3S2FA 2DR0A 3ZHXA 5BW4A 1Q6ZA 4ENWA 2VRCD 4LJYA 3H1EA 1BFDA 1K2VN 4ER5A 1U7HA 1QG6A 3A6ZA 1EXNA 3NC4A 1B16A 3BKXA 3QMMA 5CH5A 4LBYA 3F1LA 4DL9A 1T6ZA 3GJ7A 2XIJA 3OIFA 1DQPA 4UDYX 3RTAA 2JLRA 4C78A 1VQ1A 2FW6A 2G8NA 3HVHA 4P4NA 3IAS1 3AG5A 4C08A 4NEHB 3K2BA 3PCRB 5EQDA 3HYSA 3DBHB 3QPAA 1I4OA 2EZ9A 4DSUA 5C80A 1JJBA 1Y3AA 3L7LA 2VAWA 3VMFA 4TWAA 4IIJA 3IPXA 1LSUA 2O3RA 4YRRA 1MR3F 3T1QA 1RWBA 1NN3A 3L4SO 4GW3A 1CZKA 1OJLA 4MPTA 4TXNA 5FOXA 5B4TA 3MAGA 3O4RA 2PJRA 3QITA 1I9GA 3AVTA 2ERCA 3CLKA 3I6IA 2IZ7A 2R8YA 4WK4B 3SJCA 4UBIA 5AXBA 2E21A 3O7WA 1ZM3A 1Y98A 3EPPA 3D8HA 1X7ZB 5JVDA 4HDSA 4WOCA 3IUBA 1XV5A 2QD2A 3NYRA 5HKKD 1JKXA 3QUAA 4R2WA 1QO9A 2CLLB 4NBUA 3CB4A 1UJ5A 1Y8AA 1P1IA 3A6EA 5A6VA 2YWBA 5BW5A 1J2YA 5I7OA 1KSFX 2CVZA 2ZI9A 1IE3A 3HA2A 4YMUA 3JSAA 5ER9A 3HV2A 4PXYA 1WSWA 1U8YA 1ESCA 1M34A 2GCNA 4YP7A 1T9KA 1AY0A 1EX1A 1P1BA 4MLCA 4D0LB 4XQCA 4PZCA 1A95A 2ZSUA 5KUTA 1BDJA 3QOFA 4HZUA 1G17A 4B73A 1IHUA 3RAPR 4IQFA 1DEKA 1P0CA 1WY5A 4ASUA 4DJ5X 2EG9A 4BJ5A 5K0ZA 2QVXX 3DD5A 1WSAA 2WU4A 2AFHB 3AJAA 5TPWB 3DZIA 3PNKA 4WW0A 1TIPA 3TIXB 3D4LA 1C9YA 1FUUA 3GLTA 3ZHQA 3DOUA 2BF4A 1OU4A 5HP4A 3I0MA 2VHWA 4HDAA 3KEMA 8GPBA 2C29D 1OMOA 1DJMA 2WINI 3RGGA 4TTJA 3JQAB 5A4AA 1AKWA 2PLWA 1GU1A 2C83A 4DQ0A 4YIHA 2IH4A 2EZ4A 1H6DA 1TL7C 2QN8A 1W0KD 2QYOA 3AF2A 3C6XA 3S8YA 2ECOA 1FFWA 2NT4A 1PNTA 3EVNA 1QE0A 2ZUBA 1BMDA 4XW2A 1Y4AE 1M2JA 2FJUA 2Q50A 1UM8A 2OHVA 2PWZA 3GRZA 2PYDA 4ISBA 4NBVA 2H52A 2WLTA 1E1KA 4U3JA 3FUTA 4JA2A 1J8QA 5ADWA 4Z7QB 2ZE7A 1ZC3A 5CXXA 1DBIA 1E4OA 1Z47A 2ODPA 1CY6A 3CNQS 4RACA 2C5EA 4OLJA 2BKVA 2V0NA 4W63A 1GA1A 3Q3IA 4CN8A 1OIXA 1ZOSA 3LX8A 4LQ4A 3DBLB 3V1UA 4BEJA 3F73A 1EXWA 1EGHA 5K0NA 5BSVA 3VJKA 1K3TA 4MVJE 1Z88A 3V34A 3WMWA 5FL3A 3KKLA 1GPH1 2C4UA 3UXMA 3PQ8A 2JK0A 5BORA 3MAJA 1Z82A 4ZQEA 4RQTA 3REOA 3EIOA 1GAQA 4Q9IA 3BQNB 3CLTC 3JQCA 3FMPB 5AW4A 5EIFA 1NQUA 1QTNA 2FAXA 5JRZA 2IWHA 4MDHA 4HO1X 1T15A 1ISJA 3L07A 2GBCA 1N75A 2H17A 4JGIA 4IIDA 4OD0A 5G02A 2DU8A 5AK5A 3EY4A 4C0KA 4AN0A 2GXSA 2FZWA 1U9IA 2WZDA 3I04M 4KIUA 3AFNA 1OLXA 1BD3A 2OV6A 4M83A 2X0JA 4O4JA 2YICA 5DWDA 3SLRA 3EEIA 2ONJA 4DJEC 4RL4A 1Q1EA 2W6ID 5D1NA 1ZMTA 4NU8X 1J06A 1OXUA 1T43A 2YXEA 3D3NA 4JT2A 3AL0C 1T9BA 4NCXA 4EMBA 1HZZA 4OHYA 4MYHA 1FJ2A 4TN1A 1SCKA 3OJWA 4DLRA 1EE2A 2HQRA 4KVFA 1CLEA 4EB6A 3O8LA 1YTUA 4QXPA 1P4GA 3PEWA 3NVDA 4DA6A 4UNQA 4MVCA 1TM2A 2RHCA 4EHIA 1I3OA 3R7FA 2YWCA 1PL8A 2BDUA 2VTBA 2PSDA 3MBOA 3BMQA 1BCSB 2HO4A 1FUIA 4ARZA 2HA0A 2P91A 4YXWA 1KNQA 5EIXA 4F4JA 2GETA 4C7VA 4E5DA 4N0MA 1V1RA 1VECA 1EGQA 3CKKA 4IDDA 4I2NA 4TGLA 3AKCA 2H57A 4KV9A 1AZTA 4EX7A 2QJFA 2QMZA 1DELA 4C3VA 2JIRA 4G65A 5EZYF 1U8XX 4IH1A 2POQX 3LBAA 4HZGA 3HXOA 3INGA 3RVBA 2NO7A 3TEFA 2KX7A 5EEGA 3H17A 3GLVA 3R0QA 1OB2A 1GLGA 1WA5A 5AI6A 4CF6A 1AXRA 1SA0B 2J67A 2J4FA 4B7ZA 2HADA 4G0QA 3J7TA 4M1EA 4TWIA 5KX5B 2IFTA 2NZ2A 3SOPA 2GRJA 4DPKA 5H81A 2RBGA 3DUWA 3HCDA 5B7PA 4RTRA 2RBKA 1C9JA 1D1TA 1GQOA 1TOAA 3JQFA 1N0VC 2QR3A 4ETWA 3DJYA 1L3CA 2G1JA 3K0AB 5A7HA 3KYCA 5FLXA 4FLFA 4O4HA 4WOJA 2W90A 1I3MA 3OX1A 2OV3A 4NDZA 3ZWAA 5J4VA 4EKIA 4K3UA 2BM0A 2BEUA 2I22A 1TO6A 1PFGA 4IOKA 1R6XA 4UBLA 1SEPA 3SM9A 1H1TA 3OIUA 3AP1A 4RD1A 3DWEX 4AJ1A 1Z75A 4C7KA 5HX7A 3DE0X 3DDUA 4BASA 1UXGA 3PDHA 4BKOA 3RYHA 1SBNE 1FQWA 2CLKB 4A82A 2ROQA 2LW7A 4F46A 3ILHA 4C0XA 1N3LA 4XYGA 3DLHA 3VR6A 4I55F 4LJ8A 4RY9A 3VFDA 3WFZA 3W90A 4ZN6A 4F86A 4MB6A 1A4XA 2JLSA 2NUAA 2XAUA 3LP5A 4NOKA 5BWBA 1XMIA 3ONFA 4KDEA 4DEXA 1IWBB 5FORA 1G8AA 5F5LA 4YN3A 3FKSA 1V9LA 5EY5B 5CFNA 4DQLA 3UKJA 4FQ8A 1OT3A 3KL2A 1NUTA 2WMNB 3E9NA 4CQLA 1AA6A 2PUEA 1AUPA 4Q4JB 1QYRA 2FPGA 1ZWLA 2R1VB 3HCNA 3GJ0A 4BX9A 3QOYA 1YB6A 3I1IA 3GAZA 4EZIA 5DVZA 1NXVA 4EIWA 5B7QA 3CYFA 3I01A 4NU5A 5AVTA 2ZXFA 2XITA 2OY0A 3BE5A 4AF8A 4MGEA 1SJ9A 3AETB 5AJYA 4XJSA 1EGAA 2XMQA 2YY7A 5A05A 3B1KA 4TS1A 4ALIA 4RPGA 2PRYA 3OECA 1V5EA 4QX6A 4C43A 3K70C 2JCGA 2V7VA 2ZTLA 3PFIA 1KZ7B 1EDEA 4CMEA 3TLZA 3UHPA 3IIKA 1R15A 4DIDA 1Q1AA 3MK31 2WF6A 1CJVC 2EHJA 1X1TA 4CT0A 4N6NA 3T7AA 3RYCB 1QHYA 4GOLD 4JD5A 1PR5A 3HSKA 5THKA 4BZZA 5BMVF 1JT2A 3I37X 4ITRC 2NU7A 4BNHA 1H5NA 3A36A 5AVOA 3GLSA 1DJOA 3PFFA 3ETEA 2XCUA 2BSAA 2C8LA 5CX4A 2OHJA 5F7OA 2FDRA 1KRHA 3D9QX 1M0TA 3NIBA 1N5JA 4RPKA 3ZWBA 1W25A 4RZHA 4UVIA 1OGIA 3ZJVA 4HHEA 3VKGA 3OIWA 2ZI3A 3WS7A 3AX6A 3NORA 4LNAA 3IKTA 2A4MA 5TR9A 4Q9HA 4QUGA 3SYRA 1GNRA 2V5UA 4EVRA 3BF7A 2PRSA 4GMXA 4YYEA 1J9ZA 1F6DA 2FPSA 3DPUA 4UU1A 4GZ6A 4RFSB 2QORA 5GPBA 1Q1BA 3KUCA 4OJQA 1H8HA 4EJ0A 3Q7IA 3ADOA 2F90A 4HDRA 4IDFA 5B3LA 3F74A 1UZUA 2F8SA 4XWKA 1DEOA 4TYYA 5JCJD 4I4CA 3ROQA 3RSHA 3A70A 4G0ZA 4LHEA 1VYVA 1KU6A 1LBEA 5AM2A 2B1IA 2J31A 3PC3A 4ND4A 1G7TA 4M0EA 4P4SB 3LI2A 4YQYA 4RM2A 3KQYA 1X8KA 3HU5A 1XBTA 3WKDA 4ER7A 5I7SA 2Q8PA 3TX2A 2ZS8A 3KYJB 5IH3A 4CKEA 1KAGA 1RI5A 1H0KA 2IUYA 3RS7A 1G9TA 1XTTA 2ETVA 5T4HA 2X0NA 1XZEA 3PHJA 1T2EA 1MAWA 2HF7A 4PWYA 2C9BA 3KSRA 1P1KA 4I1IA 5TXGA 1UJBA 3OKPA 4YT5A 5F76A 3R7BA 4UBMA 2Z6UA 1KJIA 3UMFA 1OOEA 2WHQA 5BV1A 5JMOA 4ZAFA 5IWAB 2AOTB 1STOA 4JI8B 5A6SA 1Z9BA 2VATA 1T8RA 4CQNA 3FUWA 3QUBA 3B8HA 3DA8A 4MKFA 3BB3A 1K89A 1NJSA 1NI4B 5KYVA 3ZWNA 4OHUA 3GQBA 4L9SA 3PQCA 4HY3A 2MSCB 1UBLS 3EDCA 3HM9A 2Q9AA 2DTXA 3TCNA 3AHDA 4ND5A 3B60A 5F73A 1ST3A 1TM5E 1G20A 1NV9A 3UMSA 1IZ8A 5ITZB 4A2QA 5FL7A 1FP4A 3PRKE 3PL1A 2X1VA 1PFQA 1WZUA 3QF7A 3T3IA 1K98A 2FR8C 2FQWA 3DGFC 5C5IA 3YASA 1MXFA 2R3SA 4A5OA 3BQMB 4NPHA 3SR0A 3KVRA 2CHFA 5E7MA 2R6GA 4M1OA 1SB9A 5IJXA 3CIFA 1XMXA 3ELUA 4RJIA 4PNZA 1Z2CA 3CBGA 4HBZA 1X94A 3ECSA 5DM60 2NZUG 1PYOA 2C0QA 2VTEA 3O74A 3B6EA 3QNWA 2GA9A 4HAZA 1DT5A 4HNUA 2OXFA 4FFPA 3LFUA 2PWYA 1C3OB 3DMFA 3G79A 2FCRA 4EKEA 1AC5A 1RM0A 4EFMA 4BMCA 3NXKA 4DMGA 2NTVA 3JS5A 3AP2A 4IIFA 1QRRA 1V7QA 4WADA 5J4KA 3L5OA 5AVRA 2F1RA 4TM8A 2XX3A 3VYUB 1W4BA 1ZGZA 5D7BA 4Z3DA 3CW8X 4QQNA 4B8ZA 3QE0A 4NARA 4HX9A 4PLFA 1GTRA 5JD3A 4JY7A 4ND8A 4ISCA 4LF6B 2O8DA 4DR6B 1FQKA 1K7EB 1VIDA 3ONWA 3TEJA 1E79D 1OLUA 1V8ZA 1EFAA 3U48A 2OBMA 4FQ5A 4ML3A 1ANKA 4LMPA 2A1UA 5LA6F 1DOAA 3ZGOA 4D5GA 1DAEA 3GK3A 1GRQA 5KSPA 1F2VA 4PWZA 5EHXA 3S44A 1H1DA 1GGHA 3DH0A 4Z99A 3UH0A 3EA0A 2ZJZA 1H5QA 2JKVA 3DMHA 2GLUA 2ZPAA 4GEGA 4H08A 3HJFA 4TTSA 4J8PA 3VHLB 3IR7A 5CDHA 5EJFA 3WGQA 3ERCA 3GLFB 2X22A 3FPKA 3UYLA 1LBIA 2PTGA 3REQB 4EYSA 4AG5A 5CT9A 4LG1A 2RHTA 3N2LA 2V0CA 1FDUA 1N2CB 3K1YA 3FUCA 1TMGE 4P7GA 1ZLYA 1PR0A 3FWZA 4BUCA 2G06A 1YE3A 3E7DA 4ZPJA 2O7QA 4QEZA 2FW1A 1CU1A 2ZBPA 3UT5B 1U4NA 4F21A 3PI6A 3QXHA 4D3XA 1TM4E 2HW8A 4BLVA 1FSGA 1KPHA 3L1IA 5C1BA 2I8LA 3DVAB 3KOMA 3JD4A 5IEJA 3D8SA 3M4YA 4MV5A 4D3ZA 4MDFA 2BF7A 4YVFA 1WMBA 2YJGA 3L0ZA 4LVUA 3D5TA 2D1QA 1ISRA 5C31A 4HAVA 4LMAA 4RZ3A 2QD5A 4IDGA 4I46A 4UU7A 2EJBA 4BIMA 1VJCA 2Q5IA 4ZHQA 5DCLA 1L7AA 3B85A 3R24A 3K20A 2DEUA 4PS1A 1WW3A 1USUA 2ZRNA 1FDSA 3M49A 4NJEA 3TFWA 3TRIA 1QQ7A 4UKDA 3ITNA 5HGXA 2O2ZA 2B7BA 4KLCA 5K09A 3LQ2A 1WD7A 4CHTA 3IL2A 1YOVB 3I05A 4HADA 1SOUA 3U7FB 2OVFA 1QIGA 3UOWA 2FZLA 1L7EA 5HJ5A 3S1SA 1KSHA 1YVEI 1Z62A 4OQEA 1G5QA 1O6FA 1H4QA 2IY9A 1DPGA 2I2XB 1MB9A 4UM5A 3DZ8A 4A92A 2X9VA 4ZOEA 5E2IA 4RORA 1YAJA 2WD7A 3T1TA 2ZIUB 4HEJA 1BRMA 3ZIDA 4S04A 5KS2A 3F2VA 4ZC1A 2J0SA 3THOA 3GZ4A 4LZPA 1PFWA 4U7WA 5ICCA 3QYJA 2HPVA 4V2IA 2BMVA 1M73E 1NUSA 5D7NA 5IAKA 4J90A 4YY3B 4PC1A 1LLQA 1NWCA 3KETA 1M8FA 3RUIA 1XEXB 2FKNA 1QH8B 3PLNA 2BUBA 4FW9A 1AX9A 3A4IA 5DHAA 3AZPA 4YQEA 3R74A 5ED4A 1AO3A 2UYOA 2R4UA 5CP8A 3BWCA 1AVTA 2YCBA 5EMKA 4FR5A 3TJMA 1P5FA 3ZCVA 3P32A 5LYJF 1BGVA 3TI7A 4CF5A 1PS0A 1XRPA 1SUCA 2R1UA 2CXPA 1X8LA 4TKVA 4EP1A 2O52A 1UL1X 1C30B 1GV1A 2WF7A 1KQFA 4E31A 1LJLA 4Q6BA 2A0XA 4A6PA 5DN9A 2XB2A 5KNCA 3LQQA 4DMKA 1A04A 2RGNC 5DOZA 3DYVA 1C3XA 3N2GB 4E2FA 2VYQA 2XGMA 4G1VA 3CLUC 1DE0A 1N5OX 3I1YA 3WIOA 2V1UA 4Q00A 1H2YA 4KO3S 5HF9A 1SVUA 3GNQA 3V1YA 2W00A 4XOUA 4C7MA 4F5EA 5F1YA 1Y6RA 4BGUA 1YH3A 1Z74A 2PSHA 2PBFA 3GY0A 2P2ZA 4WEOA 1LRJA 4EB8A 1CUBA 1V96A 2ZRIA 3HSYA 3PQEA 5K3CA 3TUJC 1QKJA 4QUBA 2A67A 4FJ0A 1P31A 4IINA 3LUCA 2ZWPA 3O75A 4RX1A 4XFKA 5ER6A 3WDLA 4BLTA 4GXQA 2Q4OA 3L05A 3D5QA 4IOLA 4C4ZA 3QXGA 1ONSA 1P2BA 3CX3A 5K4AA 2OD2A 5PNTA 4EGCB 3NH9A 1H1LB 3E5MA 5FBHA 3LQ4A 3ICEA 3LC0A 2BHNA 4YV7A 2EX0A 1TEVA 1V43A 4ZA2A 1ZR2A 4HDNB 3PPVA 2W6QA 1K92A 3G5MA 4FDAA 3U49A 1GILA 4KR9A 4UMDA 4TX1A 1SHLA 3N2ZB 1V3TA 2EBUA 2IHKA 3O94A 3QPBA 3AQIA 3L6DA 4RKQA 3QJGA 4BL5A 2OXCA 2XOKA 3NUZA 5BQPA 1RAEA 4I14A 2D8MA 4KMRA 2CGEA 4UNPA 1HI9A 1V11A 2PSFA 3K9CA 4G84A 4F1JA 3VH4A 5KHAA 1AH2A 4LBWA 4C05A 1F8FA 2Z2XA 1O5OA 4XWYA 1FFEA 1U5AA 2O07A 4C0QC 1DX6A 1U7WA 5DI3A 1EFRA 1T4MA 2VK1A 4UTZA 4OX9B 3DMGA 5JCOC 3EISA 5J43A 2OQIA 4Q4CA 3ZZUA 2XGJA 2GN8A 1HG0A 3U4DA 1NBME 1QH0A 4FSHA 5ILGA 4DDWA 4LE2A 3LOUA 1QFSA 3BM5A 5BT9A 4KG7A 4RY2A 2XQJA 5J4YA 3IKVA 3SZGA 2WU1A 3GA0A 3R0JA 3RIYA 5KJFA 1BXGB 2X7XA 3EQ9A 3GRKA 5GIPE 2D7CA 1IXZA 2I4RA 2ZJ1A 1KSGA 3STYA 1T1SA 1QC5B 2YYZA 3EZ9A 3NKVA 5H9VA 4PXSA 4I8DA 4UU8A 3P97A 1GQQA 3COPA 5DB4A 4JV5B 4IDPA 3TSOA 5IJ9A 2B5OA 5DLDA 5HKLA 1DXYA 4MMZB 4RETA 2V97A 4UTVA 4MQMA 4OOEA 4RK6A 3C5HA 5C81A 4J7AA 1NBOA 4OL9A 5EI5A 4HXEB 3T9AA 5DBHX 5G4LA 1WXEA 2P9JA 1DDOA 1NVUQ 2W2XA 3KVVA 3R09A 3U4IA 5JSZB 1W36B 2C9MA 3E0QA 3VISA 4DY6A 3DBHA 3DD1A 4KXQA 1PL6A 4PIVA 4UAJA 2INGX 1W29A 1WW2A 2HMWA 3RYIB 5CLFA 1WPXA 2XWJI 1E58A 3LBFA 4QREA 3HEMA 2HT1A 3AJEA 4HK4A 1HXHA 2Q5QA 4QQFA 3SEQA 4O8ZA 2HPZA 4RJ2A 1QKIA 4WJLA 4LUCA 1SVNA 3IEKA 5BSUA 4RTSA 1L8LA 1JEYB 2QRMA 4WEQA 1IBCA 1EWYA 1GQ2A 4LBVA 3SMQA 1YBVA 1X7ZA 3IQDB 2YIVX 1H2EA 2O6HA 1E6LA 2A1IA 1IG0A 5GGXA 2ZUSA 4LTNA 4J4BA 1K27A 1YCGA 4WKGA 4MS3A 4NENB 1SWVA 2REQB 4QYTA 1DAIA 3TKYA 4XYBA 2QD4A 4ZDKA 3AR7A 1W2HA 2Q5JA 1UKZA 2Z5VA 1IZ9A 5FI5A 5SZIA 4UPEA 3VNUA 1E2BA 3U2QA 3KT0A 3SWWA 3TGPA 1UBTS 3HP4A 3OE1A 1Y6QA 1SC4A 1W34A 1ADGA 1U6JA 2RK3A 4PNPA 4IIVA 5DPMA 4D8VA 1CJUC 3SGLA 2J0EA 2QKYA 4KQKA 3ZGZA 3ROFA 4QM7A 1KP2A 3HKBB 3K5HA 1CR4A 4EQ6B 3TG2A 1BWSA 3I9OA 2VK2A 2ZQZA 4NYIR 4M54A 2VXYA 1YB2A 3R3UA 4I6GA 2B99A 1ZRNA 4WAUA 1YRWA 4PM4A 1HDXA 1K6EA 3JQAA 2WG0A 2ZCVA 4R51A 4WESB 2CY0A 3ADKA 4WH0A 5JS7A 3R8XA 2GZ3A 4OU4A 4BWGA 4ZZ0A 2GAIA 1I1HA 1QF9A 3DG9A 1RWQA 5FUXA 1P0QA 2ONZA 5TMDA 1CQZA 3P2IA 2QVBA 3X44A 2A0WA 2P4EA 4QOHA 1NHWA 3I1JA 2OSBA 1LDEA 3AUYA 4HG2A 3W79A 3WHIA 4BO1A 3GVXA 4UD2A 5TS2A 4H3KB 5JALA 3H8VA 4CKXA 3ZVMA 3A1CA 3DBLA 1PDOA 3IR6A 4I1VA 4TTTS 2QL9A 4ZVOA 1QTQA 1DKUA 4GGOA 5EPEA 3KV3O 2XXBA 1YGYA 4BN0A 4BC0A 1PR2A 3LBIA 1N32B 3AL3A 2HQ1A 4PRLA 3LA6A 4BO9A 3NASA 3N53A 1IONA 3TTUA 4MYTA 3HPQA 3IC5A 3S68A 3S8EA 3LKZA 4YQZA 4Q3OA 3DHVA 1D8AA 3NHJA 3SDBA 3ZVNA 1R6TA 1T9DA 4IHKA 2XUQA 1LLUA 3EASA 4ZVPA 5KC8A 4P0TA 3QLJA 1NQWA 5JO0A 2Q46A 3CRZA 4S35A 2R60A 2BFCB 3U1TA 2B2NA 4PRYA 1X9HA 2VHXA 1YKFA 4OXKA 1VPDA 5EJGA 1O95D 4R1QA 3DE4X 3MJ4A 4CEJB 4MQUA 1VCIA 2ZLBA 1SKYE 3DZDA 1HMPA 3EXAA 3ICVA 3KT3A 3HKDB 1CX9B 1JJ7A 1JU3A 3ETDA 3KJGA 4RE6A 3RAJA 2N1BA 4LSWA 3JSXA 4QDZA 3HABA 1E5XA 1LXCA 2FSHA 4H4CA 4LJ4A 3QWFA 3W3ZB 1E64A 1GUYA 3O8QB 2POCA 4X54A 1NUQA 3JD2A 1B41A 2J6BA 2ZT5A 4ZV7A 1EVJA 3C7TA 1ORTA 3F46A 3HWSA 1ZQ9A 3Q7PA 4W9RA 1RJFA 1C1XB 1OIWA 4FSDA 4UTOA 2ZVPX 3L1UA 4YAFA 3RHZA 3TOVA 2B3DA 3WGTA 2C96A 4JKIA 4MMYB 4TKZA 1M0EA 4UM9B 2ZR0A 4EY4A 1IPFA 1XTSA 1RPTA 4KACA 1TAGA 1ZISA 3WIUA 1C9KA 2IKQA 4D8UA 4F4FA 3N05A 1RQRA 2BFMA 3EX7C 2H51A 1T8YA 1WAMA 4YJDA 1E99A 4QDTA 1YFLA 1G8FA 2NU8A 4ER6A 3CO0S 4QYMA 1E0DA 4BMXA 5K8CA 1JVBA 4M6WA 2O1XA 4XQ0A 3B2EA 3GGPA 2ZSBA 1M2HA 2QB5A 3I5YA 2FZVA 3Q4GA 5KX5A 1H9CA 3W4IA 1GCIA 4LDQA 2ZCJA 1NKTA 1I7QB 2X15A 4EA6A 1GIAA 2UYYA 4Q15A 4INPA 1N1MA 4TWBA 2YWRA 3SJUA 2P2NA 4Z1MD 3KT8A 2YYYA 1BC5A 3IVGA 4OCZA 1YRYE 3FETA 4X1OA 4K26A 4G67A 1W59A 2CNWD 2OBLA 2GM3A 3OEED 2O4CA 1UBCA 4QBKA 1R6DA 4Z4CA 4A7PA 1V8BA 1EXVA 1RLUA 2ZPTX 1S2OA 1F4PA 1N5KA 2WHPA 4XIIA 3B51X 3EY9A 3ZH9B 4DRYA 3PA8A 4XRRA 1WU7A 2F6RA 5FHQA 6YASA 3I72A 2P62A 4DZZA 2GHIA 4IMIB 4UBNA 3WADA 1S3FA 1BWPA 1XQYA 3DCYA 4YPVA 5I3CA 5CK4A 1PBNA 2OGTA 2QTNA 2AD1A 1WHSB 5K1ZA 1Q77A 2G1KA 5KNBH 4L9AA 3GPIA 2QVCA 1K5DA 4HXYA 4R0MA 3P9CA 1HNZB 1JFLA 3GUZA 1GNQA 2NXCA 2XD9A 3V4PB 4Z1OA 4RTQA 2ZS7A 3ZE1B 1MBZA 2QQFA 1NJ2A 1QDUA 3C6BA 1DFGA 4NAHA 2I7XA 4YJGB 5FOTA 1QB7A 2IYQA 2R1VA 3G8DA 1XB2A 1T29A 2H3HA 1P6QA 3BS4A 1N5LA 1Q50A 2NO4A 1Q0QA 2X8WA 4LXGA 5C4GB 2SBTA 3W0LB 4D7AA 4DLYA 4ZTBA 2OV4A 3JV7A 4OIMA 4DSAA 3OLYA 2OOKA 1KH2A 4CL0A 3ZBUA 2CYAA 5HFJA 4MVJH 1RP7A 3EK2A 3TF5A 1ZH2A 2JBHA 1AIPA 4BQEA 1D1PA 4KSYA 4BPRA 2PQ6A 4FYVA 3VR5H 1IU9A 1RXEA 4KOEC 4IM7A 2J3LA 3B52X 1VRWA 4NRDA 4BNUA 4O6VA 1H3NA 3K4PA 2C4VA 5AOBA 3ZX5A 3G0HA 3MWYW 2PGNA 4C3ZA 5IXJA 4QOSA 1PR1A 2YNMD 2JGLA 4RMIA 5TRTA 1GLVA 3RYCA 1EE9A 5LL6P 3EWIA 1LK5A 5LOVB 3QBDA 2VP2A 1K88A 1E9AA 4RK1A 5C37A 4JYBA 2HMVA 5IVKA 1XMOB 2HWYA 3DLBA 3LSTA 5JAQA 1RRVA 2C9YA 5FUQA 1BA2A 5C3UA 4IDEA 1N8SA 3IT3A 4IIUA 4MRVA 3UANA 3WICA 3ZKWB 4DRZA 2MOKA 3L7NA 5KNDA 1G21B 3FTDA 2JDID 3DO8A 1YL6A 2R8XA 3H04A 3QUQA 4IEIA 3T0GA 4CDNA 4YDQA 3HCEA 1ORHA 1TCCA 1Z0JA 2VXOA 4MAFA 4EG0A 4YAKA 3Q2KA 3T1NA 2FFHA 2I9PA 4YDRA 1D4AA 1HSZA 3D3KA 4DADA 5EGNA 2EV9A 1IPEA 4JAVC 2OUKA 5E8JA 2WJPA 4N8EA 4ZYVA 2WR8A 4BNVA 1W73A 1KEEB 3RBVA 4NH0A 4RVOA 5DX0A 5G4KB 1TKBA 3HN7A 5EVJA 4EW1A 1V5FA 3LZ6A 3PEUA 1DHRA 1GUDA 3UO8B 2J5BA 3RCBA 3MJCA 5IRCD 5DGIA 1KY2A 1LF0A 3RPEA 1P45A 2HHJA 4RLFA 4BVEA 2CXOA 2XVMA 4HC4A 4MVWA 5LQSA 5KINB 1RTTA 3IOEA 4L5JA 4LF9B 5EN4A 4MKRA 2FU5C 3KJHA 3ORSA 2G04A 4TN5A 2WHYA 3PVCA 2GRAA 3ZWVA 1J56A 1VCNA 2IYFA 3FN4A 1FYVA 1WNFA 3THRA 5A3JA 2AR7A 3ASVA 2J08A 5C7LO 1FSPA 4Q1CA 2AVDA 2JFZA 2OCBA 5ALFA 2R7AA 2LWIA 4EGFA 3AKZA 2VDRB 3FPGA 2P6PA 2WYUA 4MNTA 4WA7A 1WD5A 2PA0A 4BJ1A 1FVOA 2PX3A 4F4UA 4PXAA 1JQJC 1KI7A 1SN7A 2IIBA 4MV4A 3HXMA 1D2CA 4OGWA 5DBIA 1LVHA 3HZHA 1REQA 5U9CA 4Y2YA 4C2UA 3CS3A 4PFJA 1ISMA 1EE1A 1WUJS 1T5TA 3AB3A 3NUGA 4UW9A 1RHJA 4ZEXA 4TUYF 5HEKA 3H1GA 1T9ZA 3CUVA 1DIAA 2E1PA 2HJHA 3VUEA 1G2PA 4FUQA 1TYAE 1E32A 4YJ2F 2GOYA 4DBLE 4JLUA 1TCVA 1Z7YA 3CLRC 2CLIB 4ZDIA 1U9ZA 3CPSA 3FMGA 1B3BA 4KREA 3EEFA 3HA7A 1OXKB 1CKEA 3FM9A 5JECA 3NT4A 3FAZA 4FFWA 3HBLA 1K5GA 1J2UA 2QN7A 3L49A 4BY9E 2DPHA 2XMPA 4IL5A 4C4TA 3S81A 5ITZA 4ZT4A 2AI3A 2X4LA 2HC9A 2ZIZA 4UCWA 3TW0A 4LX8A 3INYA 1BDBA 2GI4A 4RGBA 3LT5A 5BWLA 4LFAB 2YMMA 4DLPA 2E4VA 3AY7A 1K8YB 4YJHB 4C87A 2Q2WA 3LUDA 2E48A 3P4YA 3M9WA 4M9CA 1KORA 1RCUA 2QPTA 3LLMA 3U3KA 2Q3HA 1YC2A 3BFXA 1PEKE 1UK7A 1WOMA 4XFDA 4DN6A 1G3UA 1DSSG 2NO9A 4AJKA 4B82A 3RBXA 2CJYA 2RAUA 4W8HA 4H2DA 1V5GA 4PQFA 4FLEA 5SZJA 3UAGA 1TTTA 3OWHA 1HM5A 2RGAA 4EYKA 3FOAA 3AM5A 1SVSA 2HJGA 3OQIA 5D00A 2C7PA 4BLWA 5BOVA 5CG2A 1U8ZA 3F8TA 2RGUA 4AI6A 3CY6A 4LJ9A 4MW0A 3VDMA 2H1LA 3TLCA 3G2KA 1KDOA 1QK4A 2UXDB 4AKTA 4AKIA 3CXUA 2UUBB 2R62A 5K99A 3PXEA 2FKAA 2Z3ZA 1J2JA 1QO0A 2BGKA 4FS3A 3PNPA 1WV1A 3JQBA 1SVKA 2AYZA 4KI0A 3M7IA 5L3ZA 4BNXA 4RVGA 5BN4A 2H1SA 3QFRA 4N5LA 1WUTA 5KX5F 1K2WA 2EG5A 5E1MA 4F2HA 2C4NA 1PN3A 1FPMA 2Z3VA 1VPWA 1UPUA 1DAHA 2RI0A 3Q8KA 1LX6A 3FCCA 3THXB 4ZTUB 3GNSA 2EAUA 2EQBA 2OLJA 3JQRA 1Y9AA 2QJTA 1WCIB 3RC1A 1C1DB 1K97A 2R00A 5DV9A 3GMDA 3LIIA 4DG8A 4E2WA 4D5EA 2YWGA 1D6JA 4CM7A 2XBMA 5JY6A 1QZZA 2WUWE 3REQA 1AOXA 1MOPA 4D9IA 4X6YA 3I83A