1IY8A

Crystal structure of levodione reductase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
258
structure length
258
Chain Sequence
RFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAPDAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIEGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPENPRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEVODIONE REDUCTASE
publication title The Crystal Structure and Stereospecificity of Levodione Reductase from Corynebacterium aquaticum M-13
pubmed doi rcsb
source organism Leifsonia aquatica
molecule tags Oxidoreductase
total genus 101
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1iy8A00
1PWXA 1SOVA 3I9OA 1KEUA 5KJFA 4AJIA 1ZKMA 5LC1A 3MWEB 5F1OA 1B15A 4CR8A 4NBUA 1WZEA 2OUIA 3MTJA 4MKZA 1PR3A 4M55A 2PH5A 1OBFO 4NIMA 4WLNA 5HTOA 1WWKA 4W7IA 1XU7A 1Q7CA 3GZ4A 4HV4A 4OOEA 4XYBA 5JYDA 4NFHA 4BIIA 1D1SA 4JBGA 1M2WA 1A5ZA 1QORA 3PJDA 3FI9A 2O3SA 3GVPA 5TRTA 1ISGA 4B3IA 3QE3A 4CL8A 2D2IA 4IQ8A 3ICPA 4YJGA 3I9KA 3FF4A 1LBEA 3IDSA 2X1HA 4Z0HO 4GBJA 4PLYA 1UJMA 5COQA 3WGGA 3PGXA 1PJ4A 3TN7A 4XKJA 2FR1A 1P1FA 4GH5A 3JD1A 5IXYA 3C85A 4AICA 5L4LA 4KUEA 4L75A 2GN8A 3KXDA 1XR3A 1JKIA 3MJSA 4XIJA 3E48A 4X54A 2QW8A 4IIVA 2X8LA 3AY3A 2FPIA 2PGDA 3E18A 2C20A 1PL6A 1EZ4A 2PKQP 1EVYA 4ZGWA 1UZNA 2HMTA 2AEJA 1I3MA 2O3JA 4GX1A 4WLOA 5CPBA 5JCJA 5HWSA 5IZCC 1EDOA 1PGPA 4D44A 1A71A 1HYEA 1SAYA 2VHWA 4XR4A 3WS7A 1HRDA 1Z73A 2G82A 1YJQA 2B83A 3EY4A 2VTEA 4BNHA 4BQRA 3JQ8A 4DPMA 3EVNA 1PJCA 4YT8A 3OJEA 3TZ6A 1E3SA 1NFFA 3HDYA 1LRKA 2GF2A 2O3TA 2VYND 2OBYA 3JQ6A 3N74A 1PJBA 1T4BA 1LXCA 1Y1PA 3T7EA 4OXYA 1C1XB 3OMLA 2DAPA 1PQPA 3EZYA 2YV1A 3WLEA 4ZHSA 4LRTB 4BGUA 2NUAA 2OMEA 2NVWA 4J7XA 5JC1A 1LX6A 4CQMA 4IJVA 3H5AA 1VL8A 4GLLA 4N5NA 2HRZA 4NJMB 5L3ZA 4TQGA 4NH4A 4J7UA 2D4AA 2HUNA 4HNHA 2ZK7A 3HE3A 2Y93A 4JX8A 2ZB7A 3NDIA 4JJIA 3T4XA 5A4DA 4GVXA 1Z82A 4ZQFA 4A73A 2YUTA 5CEJA 1XEAA 5I9NA 4DA9A 1V3UA 3C1AA 3LT1A 1MA0A 3G1UA 1R6DA 3PVZA 3ANLA 3RD5A 4MO2A 2XOXA 4FGWA 4IQGA 3JYQA 4JK3A 4D42A 1X14A 1PS9A 2PGJA 3OA2A 4J4HA 1Y6JA 4CJXA 4YYZA 4BNNA 1XCBA 2EF1A 4FR5A 2JFFA 2R6JA 4C7JA 1YBVA 1QYDA 2QRLA 3PDUA 1C3VA 4K1LA 2FHSA 2BMAA 4M89A 5KVQA 4PLHA 1HE2A 1MC4A 5I7SA 2HU2A 1R12A 4Q3NA 3GF4A 1ZEJA 1P31A 3EDMA 5C5IA 4YJHB 4D43A 4XGKA 1E92A 2YW9A 5A9TA 2Q4EA 2PZMA 1QR6A 1DLIA 2DPGA 1YH3A 1T2EA 3GR6A 1OC4A 2PV7A 3OQ6A 1KVTA 4RO0A 5IDXA 4Z6KA 1EQUA 3H9QA 5DP2A 5AOVA 4II3A 1KIFA 2IEBA 2EHDA 1MV8A 3HDQA 2QG4A 5H83A 4KUHA 1NAHA 1YS4A 2P4QA 4D3DA 1IYZA 4FFMA 2ZYGA 3ZU3A 1P3DA 4D0SA 1U4OA 5DN9A 5IJZA 4DREA 1SB8A 4GX0A 3UCEA 1K6JA 3RVDA 2DC1A 3Q2IA 3QWBA 3KETA 4WOKA 5EL0A 3UFXA 4PZDA 3H7AA 4R51A 5KTKA 3BMCA 1NQTA 1G1AA 2VWQA 1E6EA 3O4RA 2E37A 4I5FA 1J5PA 4XWYA 4O6VA 4DIOA 3C1TA 1GV0A 1LSSA 4N18A 4PRLA 4L4RA 1EQ2A 4IBOA 3K31A 3WGIA 3GG2A 3LYLA 2DU8A 4P38A 2DTXA 3S8MA 1Y5MA 1Z6ZA 5COBA 4A5OA 4IGFA 1LUAA 1YB5A 1WAMA 4PCVA 4Y8VA 4YRDA 2Y99A 1VLLA 3INTA 1ZXBA 3ZWXA 4BNFA 3ZWOA 1H2BA 4AL4A 4CMIA 2BF7A 1P1HA 3PPIA 1ORRA 4NFSA 1NQAO 3RFVA 3ZWBA 5C3MA 2IZ0A 2GZ3A 1G0OA 3OF2A 1TT7A 1PZFA 3WFIA 1NNUA 4ROSA 4HUJA 1T2CA 5T8KA 1LQTA 2JD1A 1BMDA 1F8FA 4W4TA 4RLHA 1HZJA 1GCOA 2PR2A 4OM8A 2PK3A 3U62A 4XCVA 4EUHA 1LTHR 4KDEA 3ZHBA 5KWEA 1K89A 3M2TA 3L6DA 2D8AA 2X23A 3RWBA 1YOVA 1CJCA 3RI3A 4AVYA 3GVIA 3QVTA 4E12A 2J3KA 2A4KA 3JQCA 1LLQA 4JJGA 4CUZA 4QO7A 1RM4A 2GN6A 4B7UA 3F6YA 4XQCA 1P44A 2O50A 1KETA 3JQ8B 3DAFA 4RF5A 1LNQA 3VH4A 5KVVA 1SMKA 3DZJA 4I8XA 1GTMA 4CM5A 2W2KA 3RUEA 4E5NA 3L07A 3DMYA 3RIHA 3B6ZA 2FN7A 2UV8A 4FJ0A 4LMPA 1E7RA 2B4RO 2FWMX 3CKYA 3E6AA 1C0KA 2PFGA 3VTFA 2C54A 2YDXA 1Y8RA 2GPTA 2HMVA 3V5NA 4KQXA 4N5LA 4XYMA 3G79A 1SC6A 1S7CA 5JXWA 3E9MA 3F9IA 3IC5A 1BTOA 4B7XA 3SX2A 5LCXA 3ZHZA 1NTOA 1GUZA 1RM5A 4Q3EA 4KTTE 3FNHA 4MPDA 5AQ1A 4E2YA 3MJCA 2ZCUA 4GI2A 1RJWA 1U2DA 4YXFA 3IOYA 1EBUA 2O3QA 3GFBA 4O63O 3TOZA 5KNLA 1D1TA 1PU2A 2V65A 4D3FA 5FF9A 1WMBA 2J6IA 3I6QA 3DOCA 4P22A 1ZIDA 3T4EA 5L9AA 4QSMA 3WICA 5JBIA 4KP7A 3OJ0A 1Q0HA 4NBVA 1I2ZA 2JAPA 2X0RA 4D45A 3OHSX 1R66A 3D3EA 3LT0A 3DAPA 2HDHA 4O59O 3HADA 2R00A 3Q9UA 2BRUA 1J0XO 1E1KA 1OFGA 2B37A 1QYWA 3HDHA 1FDVA 2BKAA 1ENPA 3VPGA 2BHLA 1VJ1A 4MKXA 4TRMA 4ZU3A 1MX3A 4MVJG 5B4VA 3DWFA 4HFMA 3U4IA 1FXSA 3WQRA 2V6MA 3KM0A 4KUGA 3ZWCA 1P0FA 2Q1UA 3ANNA 5L45A 2NTVA 2WSBA 1WPQA 2X22A 4JP3A 4NPCA 2VT2A 3S2IA 3BYZA 4EI2A 3IUPA 3KZVA 4M1QA 3I9LA 4TKLA 3HSKA 2VRBA 2PD4A 2AMFA 2HQ1A 2Q2VA 1O0SA 2DBRA 1F8GA 3QWFA 4RVFA 1YE3A 4LCEA 2HJSA 4RL6A 4WE3A 4C4OA 1HYGA 4YJFB 2VZ0A 4B4OA 3AWDA 4RPLA 4TVBA 3WQSB 1N9GA 1PJLA 3TPCA 1PS0A 4GSKA 2QRKA 3FBGA 3CPSA 5G4LA 4FFLA 2I6TA 2OP1A 4CM7A 2E6UX 4E2ZA 1E6WA 5TNXA 2EJVA 2IEDA 2YHUA 3U09A 5TC4A 3ZWPA 1DJNA 1ISJA 3NTOA 4IDEA 4KWHA 2OP0A 3U49A 3NYWA 3W4JA 2JHGA 2BH9A 5T8KC 5G0WA 1RPNA 4BNYA 1GL3A 2PY6A 4A27A 5DNAA 4OAQA 3RKUA 2IYPA 1PQWA 1QSGA 3ZZNA 4FJ2A 2PWZA 5GZ6A 4CM8A 1EFLA 4Q3CA 3GPIA 2VYNA 5AXAA 1O9BA 5FI5A 4RF3A 5JDCA 4R3WA 3V1TC 1KEWA 4JXKA 1ISFA 4EW6A 5KKCA 3GOHA 5A02A 2RAFA 1CIVA 1LSUA 5L40A 2G1UA 4DIBA 1SCUA 4CUJA 1HDZA 2GDZA 3IJPA 2X0NA 3NJ4A 4HFNA 3TQHA 4U6SA 3PDJA 4YR9A 1B2LA 3NV9A 4CMIB 4XDZA 4L9RA 5G0TA 3BHMA 4CM9D 2O7SA 2FR0A 3ZH2A 1HWYA 5TS3A 4AJNA 2VN8A 3DXFA 3K2BA 4N54A 3SJ7A 5TT1A 5BNIA 4BKRA 2DUUA 4QFDA 1U4SA 2EW8A 4JIGA 4RZHA 4UVEA 3KEOA 3HNPA 3O8QA 5DDIP 3S1LA 1P1RA 1UH5A 5F21A 3R3SA 1JVBA 1PEDA 1MG0A 3WNQA 1E3WB 3TZKA 3MJ4A 3K30A 1YXMA 2OO5A 2CD9A 4MDHA 1PQUA 4QECA 4U0JA 1ULSA 1W8DA 1QRRA 5DCWA 2ZATA 4XIYA 4BNZA 1YOVB 1LSOA 4I5GA 4ALNA 3WFJA 2ZQZA 1P1JA 1DIHA 1BRMA 4XJSA 1N1EA 1K5HA 3L4BA 4BL5A 5BR7A 5JCXA 4JCOA 1CETA 5GY7A 1KBZA 1KVRA 3RFTA 1PL8A 4MVJI 5KVSA 3LVFO 1R0KA 1XDWA 4F3YA 4OIMA 2W2KB 4GMGA 4Y98A 3PHGA 1ZK3A 2EXXA 1Z45A 2Q2WA 3V8BA 1BHSA 3GQVA 2CDAA 3KTDA 2QRJA 1DHRA 1Y8RB 1U5CA 5GMOA 4J2HA 3DB2A 5K0ZA 2A35A 3GC6A 3QQPA 5C7IO 1L7EA 1VL0A 2C0CA 1D3AA 4LGVA 2DBQA 5THQA 5I7EA 1ZO8A 1B16A 5ER6A 3WJAA 3GNSA 3SC6A 4LK3A 4P4NA 3WX0A 1LLDA 3OEWA 2BFOA 3NTQA 1I01A 1Y81A 1SB9A 1JA9A 4LCJA 3F4LA 2O4CA 3TJRA 1C0PA 4YAKA 3PXXA 3OETA 4L76A 4IJUA 1P1KA 1H0KA 3GY0A 3QHAA 4TROA 2EKPA 3UKOA 3GGGA 1WMAA 4J49A 4EJ0A 3ADOA 3H5NA 1MLDA 3O03A 4PLTA 5IXSA 3Q1LA 3E9QA 3H5RA 4R41A 1T25A 3K2EA 3L77A 4G65A 1E3EA 4RPGA 2QHXA 4D0RA 6ADHA 1U5AA 4Z0PA 4UVDA 4DBVO 4L8VA 3WWYA 2VTDA 3DZBA 2WMDA 1SEPA 5C7OO 1UP6A 1QYXA 3WBFA 3EC7A 1VKOA 1GZ3A 4W82A 3LC2O 5TSDA 2OL4A 3C3XA 2YFHA 1LQUA 4DRYA 3PTZA 1EMDA 4L74A 4Q3AA 1Q1NA 2B4QA 3UF0A 4D3SA 3F5QA 5IDWA 5CDSA 1HYHA 2EJWA 3NT5A 1GYRA 4BO9A 3GRKA 4CLRB 1EEHA 5JDCC 1E1MA 1ZZEA 3SBOA 4WOJA 2ET6A 4XEHA 5KCZA 4D46A 4RVHA 2CY0A 4IZIA 1VJTA 2DPHA 3FPLA 3I52A 3DL2A 1KVSA 3ON5A 1JW9B 1CRWG 1XYGA 1RYDA 3GMDA 3AJRA 4FC6A 2FPPA 4C7KA 2ZJ1A 3PWKA 1N9GB 4OL9A 4NFYA 4PG4A 1G6KA 2IE0A 4Z3DA 5L7WA 3LLVA 2AE1A 3OICA 3CMCO 1DO8A 5F1KA 4IDBA 3OEYA 4J1NA 4FBGA 4WNCA 1FMCA 1Q2XA 4I5DA 2VZ8A 4NJMA 1YWGO 1GYPA 4B4WA 1GFSA 4CM3A 5B37A 4EEXA 5IF3A 3A06A 4FIZA 1UXGA 3RUFA 3W6ZA 5ICMA 2W2LA 3HQ4O 4PLFA 4CM8B 1DC3A 2PH3A 1YRLA 3G3EA 3KHUA 4RORA 5DF1A 3U5TA 1A27A 4EUEA 3P7MA 3QRWA 2YFQA 3QV1A 4L4SA 4AJHA 4WLVA 2AE2A 2NTNA 3JYNA 2WDZA 2EV9A 4E5YA 1MP0A 4NK4A 3AY7A 3D3WB 1BVUA 1FDUA 3VZQA 1ZW1A 4AJPA 2IDZA 3EAGA 2WM3A 1IPFA 5B12A 1Z7EA 1DC4A 1ZJYA 3RCBA 1NFQA 2UAGA 2X5KO 4ALKA 4YJHA 1I32A 4ZQGA 4ITUA 4IGEA 4CLEA 1V0JA 3KUXA 4YEDA 4MIEA 3PHLA 1HSZA 1B8VA 1ONNA 2PLAA 3ROQA 3O8QB 1GEGA 1K0UA 2UUPA 4LW8A 5I7VA 2FSSA 2WWRA 3PHIA 3GGPA 5KVCA 3RFXA 1P45A 1U7HA 1BVRA 5TX7A 3TRIA 3E8XA 5TT0A 4YA6A 3JQAD 3LF2A 3OBBA 1DIRA 3BTUA 1DIGA 1BWSA 1GADO 2NADA 4PG6A 4LRSB 4CODB 3S2FA 3AFMA 2D1YA 4AJJA 1I3LA 3JD4A 3MJTA 4EEZA 3PEFA 3GG9A 2PZLA 1J4AA 3C7CB 5FEUA 5KJCA 1ADFA 3IQDB 1E7WA 4BO0A 2Y1OA 1AGNA 1JLLA 3WYBA 4FW8A 3IJRA 4MOWA 5TJ9A 1TLTA 3E5MA 4PG7A 2B5WA 3U4DA 1MFPA 1C1DA 1KC3A 1AHIA 2B69A 3PRJA 4AJ1A 3D0OA 2V6FA 3CTMA 4A7PA 1FJHA 1DC6A 3H2ZA 4M86A 4XGNA 3ETEA 4IS2A 1P1IA 1U3UA 3G1TA 4NZ9A 3WGYA 3D7LA 3WMWA 2VNAA 3AK4A 4QT0A 2VQ3A 2RBEA 5DOVA 1R4NA 1N92A 1LDGA 1XHLA 4FCCA 4NG5A 3RKRA 2J3HA 4RV9A 1ZSVA 3WGHA 4PG8A 4ZN6A 1F0YA 2HAEA 3DONA 3I5MA 4BNGA 4RPKA 5F5LA 1A7KA 1Z74A 1VI2A 1V9LA 2XXJA 3WBBA 1R16A 7ADHA 4K6CA 5JS6A 4R4JA 4BVAA 4NDNE 1PTJA 4BV8A 2X6TA 3RU9A 1WXDA 1BXGA 1N7GA 3GZNB 2NVBA 3H9UA 1PSDA 4FFPA 3PQDA 1WZIA 3BIOA 2Q1WA 4PIVA 3DOOA 2WYWA 1FDTA 3EW7A 1XSEA 2GN9A 3GUCA 3B1JA 2JKVA 2CVOA 3RJ9A 3M2PA 1SZJG 4PLVA 2EEZA 1E1LA 2IZ1A 1X0XA 1UDCA 5DBFA 1X0VA 3TF5A 4XR9A 3PLNA 3JQBA 2WYUA 4IXTA 5JC8A 2HO5A 2BI8A 3OQBA 5ITVA 3VPXA 3DMTA 2E82A 3P2YA 2A92A 2GUGA 1PJTA 2AQ8A 3PZRA 3W4KA 3NGXA 3V1YA 3PLRA 1GU7A 4CR6A 3DZGA 1PJSA 3UW3A 4A2CA 4L0QA 1GDHA 5JPIA 4YVFA 3HUDA 3PHHA 1HE3A 1SPXA 3G0OA 5AXCA 1DFGA 3ZV5A 1ZH8A 3GAFA 1ONOA 5BSFA 3OJLA 3HFSA 1VJ0A 3RC9A 1ENZA 4HFRA 1HKUA 3R6DA 3D5TA 4JLWA 4RGBA 2A9FA 3N7UA 4H7PA 4E2XA 3GAZA 1LLCA 1F14A 1IPEA 3BHJA 3OSUA 4R1TA 3WGTA 1K3TA 1B8UA 1OZAA 1GR0A 2JJYA 4R68A 4HADA 5TJHA 3DZKA 4PVDA 3OIDA 4E5MA 4MINA 5CG2A 2ZYAA 1NX6A 3DAGA 4DMMA 3ZWMA 3VPHA 5JAIA 3QVOA 4LVCA 2JCYA 3IUSA 3GT0A 5IZ4A 5JW6A 2B4TO 2UUOA 1S6YA 3VPSA 2CFCA 1UXIA 4INAA 4ZQEA 3U4CA 3ZHXA 3X2EA 1AN9A 1E5LA 3AI3A 3TFQA 1LRJA 5G2OA 2EKLA 3WGZA 4R54A 1PGQA 5THKA 2C59A 4EITA 3GVXA 3VOSA 2EKQA 1ZFNA 2PGLA 4WECA 4GMFA 2WE7A 3ZU4A 3E03A 4ILKA 4BNVA 1E1NA 4FOOA 2B5VA 2C2XA 1Y8QA 1HETA 3LZ6A 4BGEA 2HMWA 4XZ3A 1FDWA 1KY5A 4RVSA 1ZK0A 4AFNA 4FN4A 3PZBA 3Q0EA 3RUHA 1E3IA 1RKXA 4J4TA 1CYDA 1IY8A 2IRWA 3AU9A 1I36A 4JNKA 1NWCA 1X1EA 2AQHA 3JYLA 1MC5A 1GD1O 5CDYA 2BLLA 1B7GO 1VM6A 3QWIA 3QVXA 3RC7A 1I24A 1WVGA 1OI7A 1DBVO 1YONA 2FOIA 4YJFA 2W90A 3MJVA 4F46A 1V35A 4M8SA 3FN4A 3W6UA 3KEQA 3BA1A 5JY6A 1M6HA 3A4VA 5JLAA 1NP3A 1LLUA 4TZTA 2JFHA 4Y67A 3OA0A 1VL6A 1E7MA 1ZK4A 2GR9A 1VSUA 1XIVA 5DCUA 2B35A 2WE8A 3CEAA 3FRJA 5JNLA 2O3RA 1F17A 1LDNA 2RHCA 4UVIA 1C1DB 3A9WA 3BTOA 1H93A 1I3KA 1HDRA 4BKUA 2AEMA 3KLPX 3FD8A 2CDBA 3RC2A 3WNVA 2VRCD 4H3VA 3KYCA 4FD3A 4UREA 5AYVA 4MJLA 5ILGA 1EUZA 5BT9A 4E32A 1YJ8A 3C1OA 4FB5A 1H5QA 2YY7A 3IMFA 2H5LA 2HSDA 1EBFA 4YB8A 3JQ7A 4OXNA 2VZ9A 1ZVMA 1E3JA 3QA9A 4HXYA 1R4NB 1Q7BA 3L6EA 4YQYA 2V6GA 1UR5A 5H81A 3ZNNA 4DLLA 3JQGB 4MVJE 3I4FA 4EZBA 3JQBC 1A7AA 3K6JA 1CWUA 1U8FO 2DFDA 2IZZA 3RC1A 2D5AA 2QQ5A 2X9GA 4ZJUA 1DEHA 1N7HA 2PTGA 4I9NA 4MKRA 4BNLA 3AU8A 4ZQBA 4GKVA 3GLQA 1O6ZA 4DLBA 2C5AA 4HX5A 1ML3A 3GA0A 1GAEO 4TKMA 4TRNA 3VVBA 1ZBQA 1ZK1A 2DTDA 4RVUA 4BKPA 5GZ3A 1BXGB 1KYQA 2ZB3A 4CR7A 4J3FA 3GUYA 2QYSA 2QYTA 2Y0EA 3D64A 4M54A 1E3WA 3WMXA 5I7FA 5H82A 2HK9A 3AW9A 1C14A 2JCXA 3L6OO 3LC7O 3ENKA 4BQPA 3CSDA 3UGKA 3UOGA 2X5JO 2V6BA 1KEVA 3LK7A 3NRCA 1A4UA 1BDMA 1MFZA 4YAJA 3H65A 1JAXA 2PKQO 5TQVA 4WCDA 2YZ7A 4E6PA 1RM0A 2PD6A 3K73O 4B3JA 2Y67A 3VHRA 1GQ2A 2RH8A 4BMNA 5ITWA 2XPCA 2X0IA 3PYXA 1HEUA 3NJ8A 2FP4A 5DBIA 4MP6A 3SC4A 4H15A 4GQAA 4NI5A 2GZ1A 4XGIA 5C7LO 2LDBA 3GEDA 3A28A 1GQQA 2PKRA 1KVUA 3OJOA 3ETGA 5TLSA 4UUMA 1UDBA 3V2HA 3ZWWA 4IMRA 3ZN2A 1Y7TA 5ENDA 3LDHA 4A0SA 1GEEA 1R0LA 3RROA 5FYDA 2VT3A 2J3IA 3DHNA 4TSKA 2VWHA 3TZCA 1NVTA 4UUPA 1YGYA 1XQ1A 2CSUA 2OBNA 4P8RA 1RM3A 2D0IA 2NACA 3CZRA 2NU8A 3PJEA 4CLOB 4CMAA 4F6CA 5F3RA 4OH1A 1AHHA 4MVJP 2QZ9A 1U3TA 4R5MA 1X7DA 5DOZA 5C37A 5EESA 1LU9A 4XYEA 2X9NA 5A9RA 4YJDA 1NVMB 2VOJA 5KOIA 4MVJM 1HDGO 3HG7A 4ZRNA 1V3VA 3L9WA 3NT4A 2EG9A 4AJEA 1LDBA 3F5SA 3I9NA 3TNLA 5I9LA 3QP9A 3U4HA 2NNLD 1E77A 1P33A 3K5PA 2PA3A 3MEQA 1HT0A 2YHIA 2NVUA 3ZNOA 3VH3A 1Y8QB 4NBRA 2I66A 3ZU2A 3K9QO 1NWHA 2DBZA 4CLRA 3AOGA 3NAQA 3I1JA 3FNGA 4ALMA 2YDYA 3X2FA 5CG1A 1PS8A 2DBVO 1NVGA 4UEJA 5DZSA 3BMQA 4OSPA 2CF5A 1QKIA 5K6AA 1B3RA 2GNAA 2IXAA 1WDLA 3UICA 3B20A 2P68A 4RPHA 5EINA 1ISMA 2JD0A 3ONEA 3F3SA 2Y1GA 3KV3O 4J91A 4DBZA 4YDRA 4LSMA 2P5YA 4CMCA 2NU9A 3WIDA 2HKIA 3Q9NA 1R4MA 1Z7BA 1XU9A 4QEDA 2OFPA 3KYDB 1T2FA 4GGPA 1KERA 3KYCB 2G5CA 3NDRA 2Y1CA 5EJ2A 3DC2A 4Z3KA 2HK8A 2IXBA 2OXIA 3SVTA 3PQFA 1OAAA 3OIFA 1IUKA 3HB4X 4IJWA 2I76A 4CV1A 3GNQA 3UCXA 4B8WA 1ID1A 2VUTA 3JQ7B 3D3WA 4BNMA 1CDOA 3QW2A 1QMGA 3F46A 3T7CA 1EUDA 3ZWAA 2VHZA 2W4QA 2Q1TA 1CQIA 3E82A 4HFJA 4YTEA 4Z9XA 2OORA 3FCOA 3W8FA 4DPKA 1XQ6A 2ZJ0A 3H9EO 1GY8A 3AUUA 3JYOA 3HJAA 1DFIA 1O89A 9LDTA 1X13A 4OMUA 1EE2A 4R5HA 1F12A 2ZTMA 3GVHA 4BO8A 3D4NA 3R0IA 1JAYA 3HN7A 1AUPA 1CERA 3MOGA 2I3AA 4MVJD 3I6IA 5COAA 3ZU5A 1CEQA 3DBVO 4J0EA 3BMOA 2QZZA 1BXKA 3L0DA 3VZRA 2EW2A 4AJKA 4JJFA 1K6XA 1SBYA 2VWPA 2PZJA 1N8KA 3VH1A 3FTPA 4DIFA 4OYRA 3LT2A 3SLKA 1I5RA 2OGUA 1YL5A 3C24A 1E3LA 3DBHA 2YYYA 4OXKA 3E5RA 4CMHA 4A03A 3W8EA 4ALIA 1ADCA 2W98A 1IHXA 4A26A 1CF2O 2NQ8A 4CQMD 5L4SA 2R00C 4BB5A 4IDCA 2YQ5A 3PFWO 5A3JA 4RVGA 4I9HA 4I5EA 4JN6B 3DZIA 2DVMA 4GL4A 3ICCA 5ILOA 3JQAB 4BNWA 3N58A 4IINA 4LISA 4TVOA 5HRUA 1DIBA 1HXHA 1QG6A 3GN2A 4YWJA 2VUSA 2O3UA 4ND2A 4XQEA 1XGKA 1T26A 1DRVA 4ZRMA 2JAHA 4WNIA 3G17A 2W8ZA 3LSYA 4OQYA 2WJPA 3O38A 1NQ5A 1YDWA 4HKTA 5KJ6A 2Y1FA 4J16A 1PJ2A 1NR1A 4PLZA 4BKQA 1MUUA 3WYEA 3MOIA 3I4CA 3PJFA 4EJ6A 4IUYA 2C7GA 4EBFA 2AW5A 1ZEMA 1MXFA 2VRCA 4URFA 1KVQA 4BO4A 3CH6A 1FDSA 1E7QA 1GUYA 3JQEA 3O26A 1R37A 3NKLA 4KDFA 3GZNA 4R9RA 1ENYA 3TZHA 1XWFA 4IY1A 3QY9A 3P5SA 3WR5A 4D79A 4J9UE 4WEOA 4GGOA 2SCUA 4CMGA 2YHIB 4AJLA 2NVUB 1PGOA 4YBZA 4LN1A 1IHYA 3QJ5A 3TZQA 3AUAA 1LRLA 3PWSA 2CZCA 1B0AA 1NPYA 1ULUA 1HLDA 5B4TA 5HBRA 1V8BA 1H6CA 1T4DA 2WD7B 3I9JA 4BMVA 3LT4A 5CHEA 4DL9A 3JD3A 2OHXA 2XXBA 3G49A 1UXKA 4Q39A 4YT5A 4CL3A 1Z75A 3VVCA 4XYLA 5LDHA 5IN4A 5T64A 2WEKA 2NU6A 1GV1A 5BNFA 1BG6A 1LDEA 3BMQB 4JQCA 4RJTA 1L1FA 5JO0A 3DHYA 4WLUA 1M75A 1LC3A 5A3VA 1QLJA 5A1TA 1A9YA 1KY4A 1NQOA 4ND1A 4PLWA 5U1PA 3ZW9A 5L51A 2X4GA 1N1GA 4IMPA 2D5CA 1DDOA 5JE8A 1DLJA 1OC2A 1ZXLA 1XKQA 2DTEA 1DHTA 1RWBA 4WCFA 4ALJA 4BB6A 4NQZA 5DT9A 4J1SA 3JQFA 4OOFA 2Y1DA 3SEFA 1PL7A 1DC5A 1J6UA 1PZHA 5HS4A 1R4MB 1VSVA 4DUPA 4E2WA 2GRAA 1EDZA 3V2GA 3F1LA 3A1NA 3GGOA 3Q6IA 4J90A 3VKVA 4DWVA 3WSWA 5BSGA 3F1KA 3ZW8A 3WIEA 1H94A 1U3WA 3JSAA 2C29D 1CQJA 4Z9FA 1DRWA 5JY1A 3H8VA 1PJ3A 5G0VA 5T5QA 2GD1O 3TDKA 2I3GA 3AUTA 2VCYA 3L4BC 2ZB4A 1Q7GA 3ZNQA 2NU7A 3RUAA 4BNIA 4CMKA 2O2YA 3EMKA 3VTZA 1WLYA 4L4XA 3RUCA 4RQTA 5CAEA 2Q50A 3B1KA 3QVWA 2FSVA 2GO1A 1IOLA 2X0JA 4MIOA 5JO9A 4UUOA 3WJ7A 5IAAA 1G0NA 3RUDA 1ZSNA 4FFNA 3ROMA 4BGVA 1E6UA 1Y9AA 1PGNA 3NGLA 5EMHA 4BO5A 5CEFA 5MDHA 2AHRA 1T2AA 2GCGA 3K92A 4UUNA 3ONDA 3JYPA 1UAYA 3SLGA 3D1LA 1J49A 2Q2QA 3PIIA 1NYTA 1U1IA 3IKVA 3ZCXA 4U6QA 3IP3A 3STHA 4NU5A 3GRPA 1U9JA 3BMOB 4PLGA 4AJ2A 4QFCA 1KS9A 4HP8A 1ZNQO 3MJEA 4Q3DA 3SXPA 1LJ8A 4ALLA 1GZ6A 4CMBA 4I1IA 5JMPA 1X15A 1R0SA 1LDYA 1Y9EA 4B4UA 3JD0A 3D5QA 4IDFA 3IS3A 1E0DA 3BXXA 1QV6A 3GVCA 3DBHB 1V3TA 1I2BA 6LDHA 3PGJA 5F5NA 5B1YA 2FMUA 4XB1A 2VYVD 3BMNA 3ENNA 4Y6SA 2AXQA 2I5PO 2ZTUA 3ONFA 2DM6A 4HBGA 4W9NA 4E0BA 4AG3A 4E33A 1T24A 3PYMA 5ER9A 1PWZA 1QXSA 3JV7A 3ZV3A 1JKJA 5L4NA 3ETDA 2I67A 3DEYX 3ADPA 2RHRA 2VOEA 4RVDA 1EK6A 1H9AA 3KB6A 3CMMA 1MB4A 1D8AA 1AXEA 2F1KA 4IQ0A 4LSWA 4NBWA 4R16A 5IDYA 4BO6A 3JQ9A 2O23A 1SOWA 4ND4A 5A5EA 2Z95A 2H1SA 2BELA 1P74A 4HWKA 5FI3A 3IL2A 2EP7A 2BD0A 3JQGA 1TI7A 4BNJA 2GASA 2R2GA 4GSLA 4XX0A 2OZPA 4CQLB 4CM4A 3D4PA 4PRKA 4B4VA 1HDOA 3UXYA 5T57A 1YO6A 5G4KA 3WG9A 1PGJA 5CDGA 3ZWYA 1ZMTA 1BGVA 1O94A 1ONPA 4WCFC 1Q0LA 3JQFC 2E49A 4MP8A 3C7AA 3HZZA 5JYEA 1YB4A 1E7YA 3DTTA 3NUGA 3KSDO 1N5DA 1P9LA 1UXHA 2AEFA 4DYDA 5CP8A 5J23A 1YBMA 2JFGA 4CM9A 3I83A 5DCYA 1QLHA 4J6FA 1B26A 1ADGA 1YDEA 4BKOA 1GYQA 4KZPA 4DPLA 2HCTA 5CDTA 4BGIA 2QIOA 4XRGA 2C07A 1U3VA 2DT5A 2DUWA 3M1AA 5L7YA 3U0BA 5DP1A 2JD2A 2BFMA 4XD2A 1HZZA 4MVJA 1WDKA 1NPDA 4PLCA 4KOAA 3OP4A 1FF9A 3BTVA 4R69A 4TRRA 3FBTA 3RUIA 3GH3A 1YQGA 4ZQHA 4KTVE 2IODA 4WCFB 3QWAA 4IM7A 1HDCA 2Q45A 4J1TA 3VAZA 4IXWA 1EK5A 4Y9DA 4CLXA 2X58A 4B7CA 4WK6A 2HLPA 3GHHA 1GCUA 4WJZA 1IZ9A 3EYWA 3K96A 1JVSA 1TXGA 2BGMA 2NTJA 4UVHA 1V6AA 4QQRA 4CLOA 5A06A 2FRDA 3Q3CA 5FFFA 2RH4A 1PZGA 1YBAA 2Y05A 1UXJA 1NASA 4DTIA 3ZHYA 2GLXA 3VH2A 1M67A 3HDJA 3R3JA 1LI4A 2B0JA 4FPXA 1BDBA 4PN3A 1DIAA 4NR0A 2F00A 3PQEA 5KJ1A 1H2HA 4Z0TA 3FWNA 5JDIA 4RF2A 5JFOA 4DC0A 4P4LA 1MG5A 3DR3A 4QUKA 4NU6A 3E1KA 3F47A 2GSDA 4DQVA 3PFFA 4W9NC 2P4HX 2NLOA 3FSRA 2GYYA 2X5OA 4NK5A 2P2SA 5GZ1A 3JQDA 3LU1A 1UAGA 3ORFA 3FTNA 3H3JA 4YAIA 5FWNA 1EUCA 3D4OA 2OOSA 4J9VA 3QWHA 1DB3A 1TVEA 3AM4A 2C5EA 4RF4A 3RQSA 3DO5A 3NDJA 4OGWA 3WTBA 4BMSA 4DGSA 1I10A 3I9MA 4UVGA 5B4UA 1TB4A 3JQ9C 3GPDG 3TL3A 5IG2A 2B36A 4I08A 3FHLA 3WSVA 1I8TA 3EUWA 3GEGA 3FNFA 2J5QA 1K2WA 2ZIZA 3BMNB 3ABIA 3SJUA 4Z9YA 3WWZA 1UDAA 2BI7A 3OQ1A 2JL1A 4WLFA 3EGOA 4TRJA 1JU9A 1NFRA 1BW9A 2G0TA 2J3JA 2VWGA 4OQZA 3KYDA 3MTGA 3ROPA 3W4IA 4BNTA 4YRAA 2ZQYA 4XRRA 2XAAA 4E13A 2CNBA 4D41A 4YACA 4U5QA 4XJTA 4BNUA 3DZFA 2ZCVA 3P2OA 4AJ4A 1IE3A 4B3HA 1YB1A 3BHIA 1GQYA 1ARZA 2P91A 4PFJA 1ENOA 1HTBA 4J1QA 4WUVA 2CVQA 4FFOA 3ZWNA 1EE9A 3FR8A 1E5QA 8ADHA 2ZTVA 2UDPA 1XG5A 1YKFA 4CM6A 4XA8A 4BO7A 5JSFA 3DMTC 3H3FA 4CM4B 4DQXA 1W4ZA 4XYGA 2NM0A 4MP3A 4NJOA 4MVJF 2C82A 4G2NA 2PZKA 4R1SA 1L7DA 4YQZA 5G4KB 2O48X 3AI2A 1SEVA 3PIDA 1QYCA 3OH8A 2HRBA 4YJGB 2DFVA 1ISIA 3QIVA 2J8ZA 4CMEA 4F45A 3RSHA 4W7HA 3RBVA 4BHTA 4J4BA 3S55A 3VC7A 5CEEA 1ZSYA 3K8ZA 2EWMA 1QYVA 3ROKA 3UUWA 1F06A 3ANMA 4R9SA 2GERA 2TMDA 3TL2A 5CFZA 1YQXA 1HE5A 2FZWA 3GMSA 2G17A 1O5IA 2GN4A 2P9GA 3DBLA 3ZNPA 4DLAA 2YV3A 4YT2A 1UP7A 2Q1SA 1RYEA 1IZ0A 2ZB8A 3GDGA 2Y0CA 3M1LA 2UYYA 2X9VA 3VZSA 2RCYA 5K9ZA 4H16A 4GWGA 5ICSA 4BS9A 1FK8A 4U7WA 3TWOA 4IPTA 5BSHA 4IDAA 4DMLA 1PJQA 3MCVA 3KBOA 3IIEA 1IL0A 1TT5A 4PGFA 1D4FA 4QX6A 1TA4A 1K6IA 1UP4A 2HK7A 4FDAA 5EQFA 3KRTA 5JDIC 2GGSA 4WASA 4O5OA 5DBGA 3MWDB 1ISHA 1C0LA 3DFUA 3C8MA 3JD2A 3JQAA 4WKGA 2O7QA 5A04A 2EGGA 2W2LD 4Q3BA 4IDGA 3W8DA 2YV2A 1WDMA 3IAHA 5A5FA 1OOEA 4JGBA 5T6BA 4G5HA 4BNXA 3VPFA 3BZUA 1UZMA 3I23A 4QTZA 5AXBA 3H9JA 5TF4A 2TMGA 3GEMA 4R3NA 2JCVA 1DJQA 1EVJA 2YJZA 2VNSA 2VYVA 5BQFA 4TMFA 4ZVVA 5MGBA 4E4YA 3EZLA 2H63A 2Q46A 3CXRA 4UULA 4CQMB 3QLJA 5TIIA 1A9ZA 2P9CA 4KWIA 2AQKA 4IDDA 5EPOA 1O95A 5G0UA 1DAPA 5KJEA 3TOXA 1ZJZA 5JAQA 4OSOA 4YRBA 1Q0QA 4ZICA 4YCAA 4K9DA 4U8GA 1GPDG 1YVEI 1I30A 4N5MA 9LDBA 4MVJH 4M87A 1N2SA 4GAEA 1JN0A 4GPD1 2HJRA 4KQWA 4AJOA 2UVDA 2PD3A 3AM5A 4EUFA 4II2A 1DXYA 1KC1A 4UAGA 3GFGA 4PVCA 1GUFA 1EVIA 2AQIA 2P9EA 4E3ZA 3CUKA 3ITKA 1W73A 2WD7A 1SNYA 1JWBB 3ZI0A 3NTRA 3ULKA 1M76A 1M6WA 3A14A 4K6FA 3DTYA 3OIGA 3KSUA 5IN5A 2NSDA 3WB9A 3DBRA 3LLSA 2Z5LA 1HSOA 3ST7A 5HM8A 1DSSG 1H6BA 4N7RA 5I8ZA 1JTVA 3DHEA 1NPTO 5CPFA 2POQX 3WGOA 4ESOA 3JCZA 1IULA 8LDHA 1QP8A 3KSZO 4B79A 1PIWA 3CINA 2PNFA 3UN1A 3INGA 3WYCA 3PYLA 1UZLA 2VUUA 3OFSA 4LMRA 3L4SO 5KKAA 5I8WA 1MGOA 1JDJA 3RASA 1DFHA 1B14A 4CUKA 3B70A 1XELA 1BW9B 3LC1O 2V7PA 3BAZA 3VZPA 4E5PA 1U28A 2WTBA 4RDHA 2Y68A 4CMEC 3PI7A 3RBZA 3ITDA 4BO3A 4LVUA 4GX5A 5HA5A 3PP8A 5EIOA 5U4QA 1ZK2A 2WD8A 3S2EA 2VHVA 1H6AA 5ES3A 3H9GA 1WNTA 3UAGA 4DVJA 3BMCB 2Y1EA 4J0FA 4IZHA 5CDUA 4ND5A 4FQ8A 4EGFA 1X1TA 1AE1A 4CV3A 1U7TA 5BNTA 3UHAA 4BOYA 4RZIA 4YPOA 2BGLA 1I3NA 4FC7A 5G0SA 3W1VA 4L73A 5JCJD 4E31A 1VE9A 4J2OA 4YAGA 4RCVA 4W6ZA 2ZKLA 2BFPA 4EJMA 1EFKA 3TFOA 1O8CA 3FWZA 3B1FA 5A9SA 4ONEA 4CPDA 3FPCA 2HMUA 3OECA 4WPGA 4YAEA 3WQQA 4E21A 1DAOA 4F6LA 5KIAA 1LEHA 4G81A 1Y5RA 2Q3EA 3TSCA 4QO8A 1M66A 2DKNA 2EGHA 3M6IA 4R1NA 3DBLB 3GDOA 1PR9A 5F1PA 2FZEA 2NWQA 3JTMA 3PK0A 1T1RA 4JBHA 3DDNA 4FSHA 3V1UA 4ZA2A 2ZYDA 2BFAA 4OJNA 4BUCA 1T2DA 4DXHA 2VHYA 2I65A 4IJKA 4M49A 2EERA 4O1MA 3RAJA 4Q9NA 2FY8A 4FJ1A 2YQ4A 2ILTA 2X7HA 1NHWA 3L9XA 4KMSA 3PJGA 3V2UA 1EVZA 3NEPX 4GLOA 4TZKA 4XQGA 1TT5B 3KYBA 3UVEA 3ASUA 3ZWVA 1A72A 3AOEA 3IP1A 4GWKA 2G76A 4JROA 5EERA 4JBIA 1U8XX 3DFZA 4OKNA 1H9BA 1LSJA 3P19A 2H9IA 4ND3A 3VKUA 1DOHA 4P4GA 5L53A 1C0IA 1HLPA 4RPJA 1KOLA 1YQDA 2C7VA 2IYOA 4RDIA 2NQTA 1ZMOA 4I9UA 4PLPA 3ZV6A 3S2GA 3FNEA 3EHEA 4OKIA 1I2CA 3RJ5A 4CLDA 1ADBA 3RBXA 2E48A 2QX7A 4IIUA 4DQUA 2Q99A 5L95A 3IKTA 3PHJA 4U0KA 3QVSA 1MXHA 4UEKA 3ZV4A 3DQPA 7MDHA 2H6EA 4E30A 2ZTLA 4O0LA 1ZCJA 5BSEA 1NM5A 1AXGA 1HE4A 2DLDA 3O9ZA 4CQLA 4NBTA 1WW8A 2Y0DA 4GX2A 5IFLA 4OO3A 1HF3A 3VDQA 3KO8A 1TEHA 3FR7A 3HN2A 5K6AC 3U9LA 1SO8A 4PZCA 5IDQA 1JKFA 4E5KA 1GZ4A 3WDSA 4JP2A 2FR8A 2CVZA 3COSA 3WOHA 3KLMX 1JWAB 1ZUD1 4K26A 1LDMA 4QXMA 1WP4A 1P77A 1YL7A 2RIRA 5U9CA 1H6DA 1T1SA 2Q49A 4S1VA 2O2SA 1D7OA 2J5RA 3WGQA 3OJFA 3LF1A 1B8PA 5EN4A 5EQDA 4BV9A 4HY3A 4CMJA 3EK2A 2LDXA 2FPGA 2VHXA 3H4VA 4Y6RA 5I9MA 3RU7A 1A4IA 2CUKA 4R01A 4FGSA 4NNJA 1VPDA 4Y6PA 3HHPA 4BO2A 2BGKA 4ID9A 1X7GA 3DBRB 1IB6A 4J7CA 1LA2A 3GNTA 1E7SA 1W0CA 3GHYA 2I99A 3AFNA 3AM3A 5LDGA 4B8ZA 3OM9A 5T67A 1YL6A 3WXBA 4CV0A 3GN1A 1NXQA 2HMSA 3AUSA 3H6KA 1BSVA 3GDFA 3Q2KA 5ENVA 3LQFA 3KOUA 1XLTA 5A03A 1R15A 1C1XA 1B3BA 1DPGA 4RLSA 2CF6A 2I9PA 5A05A 2E4AA 3NX4A 2Y66A 3PWZA 2XF8A 4XDYA 2JHFA 3DZHA 3U3XA 3F4BA 1QV7A 3CZMA 4FOSA 3HB5X 5IZCA 3GK3A 4IS3A 4NMHA 4NHEA 2CMDA 3EVTA 4D7AA 1DRUA 3AY6A 4XQ9A 3AI1A 4CLHA 1U2GA 3CIFA 2Z1NA 3WLFA 3I3OA 3ZGYA 2J5KA 4W99A 3NT2A 1XA0A 1LC0A 2A94A 2AG8A 4R1UA 1NHGA 4J43A 3DOJA 5JAZA 1HDXA 3CE6A 4BO1A 2AA3A 1OMOA 3MZ0A 4ZD6A 2X86A 4WEQA 4WLEA 4UEOA 3ASVA 1VC2A 2Q4BA 5L7TA 3BTSA 2EIHA 1BXZA 1KEPA 1X7HA 4GVLA 1GPJA 3AOEC 1VRWA 4CM1A 3UCFA 3HFGA 2P5UA 3E9NA 2AG5A 5A9SB 2C2YA 4BNKA 4YT4A 5JAMA 1I0ZA 4TWRA 3INRA 2GZ2A 4DYVA 1P0CA 3HWRA 5AXDA 2O4UX 2CDCA 4EDFA 3ZDFA 3UH1A 4K28A 3VDRA 4FFRA 4RQUA 1NAIA 3QSGA 4S3MA 4HNGA 4OHUA 5HS6A 1PX0A 3H2SA 3WTCA 4EYEA 4WGGA 2Z1MA 4CV2A 5JMWA 1JQBA 4PG5A 1HDYA 1HL3A 1PZEA 2D59A 5AVOA 2DQ4A 4A10A 2EP5A 5DULA 1UUFA 3R1IA 4FS3A 4DC1A 1NBOA 4MIYA 2D3TA 1VKNA 2NV6A 1W6UA 3KVOA 4GKBA 5TGDA 4PZEA 5ADHA 1I33A 1NR7A 2WYVA 3C7DB 3Q11A 4XB2A
chains in the Genus database with same CATH superfamily
4QD3A 1KI6A 3IUNA 1MHPA 3EFHA 3T1NA 5B6IA 2VDJA 4QGHA 1YZVA 3VGJA 4BQFA 3QX8A 5DHRA 1SU6A 2DFLA 2H0RA 4Q15A 1B15A 1SOUA 1X39A 1JIQA 2BGRA 3MTJA 4PQFA 4ZO4A 4LQCA 1AQ6A 3GBSA 5F3DA 1VBKA 4PSKA 4C6RA 1Y1LA 2CNNA 1FU4A 4ZT5A 5FUQA 2CXOA 3UHJA 4CCAA 4OQXA 3K1YA 4OHOA 1BKSB 1QFXA 3EFBA 3E84A 2FMXA 2GTIA 1C3XA 3DLHA 1KP3A 1UOQA 1WMFA 3HCEA 1ZL0A 5ARDA 4ARUA 3UBMA 4UMVA 3LXXA 2VXYA 2C04A 2R4QA 3TZEA 1VHTA 3MF4A 5LQKA 2ZSAA 3FF4A 3R7SA 2VBFA 1ETUA 621PA 4C7OA 4QM6A 4HWOA 1UJMA 4RPIA 3PGXA 5DEIA 5FIUA 4XKJA 1G17A 2FR1A 5BSRA 2X5XA 1P1FA 4K6HA 1Z38A 2N47A 3L7IA 5L4LA 1KP9A 4L75A 4MHOA 2R1TB 2KLBA 3KXDA 1UAAA 2QRGA 1XR3A 2QTNA 2Y2VA 1CR2A 4XIJA 4IEEA 2G9QA 2Y2UA 2CXNA 5T41A 3E4CA 3SOPA 3W2EA 4EUSA 1HT2E 2IOQA 3EWSA 3E18A 1CHNA 2D1FA 2PGDA 3JAKA 1EZ4A 1EVYA 1RJGA 5CD1A 2HMTA 4LOIA 2WWVD 2E5FA 4RSMA 2HM7A 1J7JA 1GQRA 1I3MA 3HACA 2O3JA 3GROA 1Q1ZA 4GX1A 5JCJA 4TTTS 3TOVA 5LOVA 2QN9A 1EDOA 4P80A 2GPJA 3DNFA 1R27A 2Q5HA 1XE3A 3WS7A 1I4EB 3MQ4A 4XR4A 1E60A 3ADKA 1Z73A 2PU5A 5BV1A 5FTWA 4ZTUB 2WUDA 3G0DA 5IVDA 1YJQA 3R7BA 2VYCA 5K0NA 3SYTA 3EY4A 3ENZA 3EIOA 4E1BA 2IPLA 2VP6A 1PW5A 1QNFA 2FCRA 3Q7SA 5ETJA 4DNFA 3C6YA 1PJCA 3F98A 1E3SA 1N0HA 1NFFA 3HDYA 5FUBA 2UYQA 2O3TA 1XA3A 2VYND 3A6ZA 3JQ6A 1R6XA 4FFWA 3UMGA 3NXSA 1IZYA 1Y1PA 1OF1A 1DEKA 4B9EA 4YRKA 1E94E 1C1XB 5CLJA 1QP7A 8AT1A 3CEMA 1EXVA 2C99A 1PR5A 2YV1A 2EQAA 3WLEA 4G8CA 4P0TA 4URZR 3DYVA 4ZHSA 3E0QA 1PJRA 2PDAA 3GPBA 3QUQA 4MI9A 2BIFA 2CXQA 3PU6A 2OYSA 2BZGA 1YA6A 1JG3A 1ZNXA 3HYSA 5JIBA 4HTFB 5JC1A 3WKAA 4CIVA 3PF9A 1M0EA 3CIOA 3O31A 4QJ5A 5I5GA 2HRZA 2J30A 3VYTB 4EGAA 4NH4A 3GA7A 1J07A 4D98A 2G4LA 3CJTA 2GBLA 3GCXA 1YFZA 4TN5A 3L7LA 2NIPA 2ONJA 3ZXYA 3HE3A 4I5IA 3FLBA 2WFLB 4JX8A 4LF8B 2Q7OE 4P9NA 3NDIA 2YXBA 2FZ4A 3T4XA 1FFSA 3JWIA 2Z8YA 4A73A 1U98A 3UY4A 4DLRA 4M8KA 5AW4A 5KOHB 2J9FA 3C1AA 4RH1A 1S9DA 3K0BA 1E61A 1LKZA 2XOXA 4FGWA 3FBWA 3HYTA 3JYQA 4JK3A 3ZE9A 3I09A 1PS9A 1T4CA 4J4HA 2NO9A 4PPFA 4BRSA 3OPYI 4BNNA 2EF1A 3NZEA 1Y5LA 5EKTA 1QYDA 2VBGA 3SXUA 3PDUA 4OLJA 4UTVA 3H2BA 4K1LA 4CEIA 2FJUA 1UMBA 5D7BA 1Q3TA 2W6OA 1R12A 4G0QA 2IH5A 1ZEJA 1P31A 2A9KA 5C5IA 4C7BA 1Z62A 2JLZA 4D43A 2J3QA 3G85A 4XGKA 3TQFA 4RMGA 2PZMA 1EFVB 3RIXA 1QR6A 3OAAD 2LCFA 2JJ2D 2C2BA 1YH3A 5EHNA 1AIPA 3QOXA 1GCGA 4BQOA 1WUYA 5J9FA 2Q4DA 3FVVA 1ZXXA 4ZYZA 5DP2A 4IG9A 3BCHA 3PG5A 4II3A 3IIMA 1KIFA 2X5NA 4WZAE 2QL5A 3QYFA 4ZOBA 2FUNB 2QVYX 4JQYA 4PWYA 5F2EA 5B1DA 4I4LA 1OFTA 4NXMB 3B2EA 1IHPA 1OBHA 1W85A 3FHCB 3KNZA 4Y2UA 5LXTB 2G9ZA 3ANXA 4P4UA 1KYXA 1Z5UA 3L1JA 3COJA 1X1CA 2P4QA 4WZBA 4ESEA 2DE0X 4F4DA 1EP2B 1JUDA 2G9VA 1U4OA 5DN9A 1R0RE 2J9GA 2LIVA 5KQRA 2W42A 1JG6A 3WB0A 4GLJA 2AZMA 3KQHA 4M0UA 5EQJB 5AJVB 5CIYA 3QWBA 2V45A 3I1YA 3TVTA 3HVIA 4WOKA 5EL0A 4PZDA 2FN3A 4N3NA 4EKDA 3IERA 4EG6A 3A9UA 1KL7A 4OQLA 3BMCA 4D0GA 1NQTA 4AIIA 1G1AA 5HEKA 4EFKA 4N7JA 1JHYA 1ORIA 5AKEA 3UJ9A 3KQUA 2ZJ4A 2E37A 3F73A 2BFDB 4RETA 4YP9A 1J5PA 4HDQB 4NMWA 1GV0A 3OIWA 2A0WA 4BX8A 1KFJB 4EKEA 1EQ2A 1FFXB 1SU4A 2VP5A 1DKQA 3K31A 2HSGA 4H60A 2EGUA 2P0EA 4JZYA 5DJ5A 5JAHA 3LYLA 2QBYB 2XCOA 2IQIA 1Z68A 2DTXA 1ZVQA 2XUOA 4Z1MA 1Y4UA 4IGFA 1I0IA 3QE9Y 1WAMA 1OX5A 4RK1A 7AT1A 4DLVA 4G8BA 1ZONA 1Y6ZA 1J09A 3MCWA 4OK6A 3LX6A 4F2DA 2OD7A 2Y99A 3B9BA 1ZXBA 3INTA 3LFHA 5ILQA 3WL6A 2JASA 2SICE 3K6KA 4AL4A 5K3BA 4MW5A 5AWFC 2O8DB 4CMIA 2BF7A 3PPIA 4ZC8A 4RJJA 5JSHA 1Z0IA 3E35A 5JJCA 5FTNA 3HGTA 3KXIA 3VPCA 5EZSA 3G5MA 4XCXA 4JJ7A 2A30A 2PJZA 4JKIA 4QBKA 1PJ8A 4A1FA 4ROSA 1N9KA 1T2CA 5T8KA 1LQTA 4B0OA 5C1BA 4G5SA 1BCSB 1RXWA 3NNDA 4QUJA 1PNVA 2V9PA 1PR2A 1RYHA 3CLKA 4W4TA 3UIEA 1ZM9A 1HZJA 4RX1A 3HU1A 2R7LA 2PK3A 4LC9A 4DCCA 4EUHA 4IKOA 2C84A 4EHAA 5GINE 2CV2A 1AH2A 2GB4A 3FOWA 3IPRA 5GQSA 1X77A 3KEGA 3L6DA 4ZOAA 5GP1A 1CJCA 4OHZA 3B38A 1BVHA 1OU4A 3QVTA 4E12A 1JLSA 1WDTA 5J3JA 3JQCA 1LLQA 4HAVA 3ANTA 4JC0A 4JJGA 1RM4A 2DWPA 4PZYA 4RGQA 3MXTA 1HE8B 1JEQB 2G04A 4TSFA 3JZAA 4XQCA 2NQ2C 1IVYA 3QBDA 4D8TA 3JQ8B 4RF5A 3DAFA 4R6XA 3KVVA 4TS9A 1SMKA 1P1BA 3DZJA 3GCZA 4I8XA 2QTTA 2W2KA 4MMXB 3V46A 1Z7GA 4CM5A 5K05A 2EJTA 3U44A 2JFXA 3L07A 5D1NA 1MJ5A 5IPFA 2VLIA 1LTQA 3T5DA 4G9GA 2UV8A 2HT1A 4LZOA 1T6NA 1E7RA 2ERYA 4I7EA 3RRYA 2IBSA 4I4NA 4HD8A 2YDXA 3UPTA 1OXUA 1ICIA 3V5NA 1A5TA 3G79A 2ZWPA 1XPUA 1N3LA 1EI9A 4HAWA 1JKXA 5JU6A 4IGAA 3G1WA 3IC5A 3H1GA 5FAXA 1L5KA 3SX2A 4D3XA 1JIUA 5FPKA 4ND8B 2O5RA 4X1OA 4Q3EA 4PC2A 4KTTE 3GCWA 3N8KA 4MQUA 3LKDA 4IR7A 1DTEA 4URUR 4KE9A 2ZCUA 1U2DA 5DI3B 3IOYA 1EBUA 1H2YA 4HQOA 4U2GA 2O3QA 1BYIA 1H05A 2E6KA 1D1TA 2P65A 2ZSJA 4P7FA 3RHFA 3OMXA 3KSRA 4MGIR 1VIDA 3SIWA 1F2TA 3CUEF 4Z4IA 3NH9A 5FF9A 3BF7A 4W8GA 2H5IA 2J6IA 4KAJA 2RBGA 1ZMXA 3U3MA 1KMHB 2QUBA 4DUZB 2JJMA 5L9AA 5EHZA 4KP7A 5L8VA 1NL3A 3ACBA 4Y1RB 2OZVA 3NANA 3UMCA 1U8UA 4NBVA 1O77A 2JAPA 2J9XB 5AVVA 3TX6A 3OHSX 3N2NA 1TTQB 2W6PA 4FUTA 3D3EA 2ZJ5A 4NCJA 4RKFA 1H2WA 4CI9A 5C8YB 4MLDA 3BE8A 3DAPA 1JE0A 4O59O 3E3MA 3HADA 3CPEA 2R00A 1P81A 4AX8A 2I54A 5ISMA 1E1KA 1NOKA 3HDHA 3ZY3A 3P32A 1J8MF 1ENPA 2JIOA 3VU8A 3TR6A 2GF0A 1TQHA 1G5RA 1F6BA 2QQ0A 5F4BA 3VDNB 1G8SA 1I14A 2FUG1 4MVJG 4P3XA 5EP2A 2HQSA 3B6JA 2O6HA 3IE0A 2XOKD 3LPAA 4DUGD 1LPOA 4PXSA 1PRYA 4I9FA 3CFYA 3F49S 1PN3A 1XXHA 4KUGA 2REQA 2XMPA 4LBZA 4QFBA 3VDXA 3ZWCA 2Q1UA 2X3YA 4V1CA 2I3ZA 5L45A 5KYYA 3HCPA 1WPQA 2ZJBA 1SKQA 3D2BA 4NPCA 3O7WA 1VMAA 2LD4A 2R9VA 2VT2A 4QOEA 3ZDXB 3MOSA 4X3PA 3R7DA 5ECGC 1AKRA 4TV8A 1NVFA 4Z4FA 3AVPA 3I9LA 3IHLA 1XV5A 4KI0A 4TKLA 3OPMA 4W5WA 4NCNA 3RV3A 1IIBA 2FLVA 2CKMA 2Q2VA 4CTKA 2QD2A 3THYA 3TQSA 4LFAB 2JLQA 2MJLA 3E15A 3JSXA 4LQLA 5KTOA 3IPYA 2GWRA 3OD1A 4LCEA 3RODA 2HJSA 3DUFA 2FFBA 1ZA2A 4WE3A 1AMUA 4L9AA 4B4OA 3JS5A 1CUCA 4TVBA 4B33A 1N9GA 1SCAA 2BEUA 4G0PA 5LLDA 4PINA 4QPZA 3WISA 5LD2B 4WADA 1E6WA 1AKQA 3LK6A 4TX1A 4V0MA 1WW3A 2IEDA 1BQEA 5TC4A 4AKIA 5AVTA 3ORYA 4FW9A 3I2FA 3NTOA 1TYZA 4KWHA 1V4NA 3HA2A 3U49A 1FMLA 1NP7A 5KAMA 2LVBA 4JKYA 4H7KA 1VLQA 3SXJA 4A27A 4MKFA 4OAQA 2I80A 2IYPA 5EYPB 5I7RA 4CM8A 4Q3CA 2XDYA 3GPIA 1VRVA 2OHIA 5HE8A 3ZGOA 5AXAA 5BWMA 2CSXA 1TFRA 1V8ZA 3LX4A 3G2HA 3DULA 1E4OA 3QMMA 4RF3A 3TBHA 3UYLA 1E9BA 1JHOA 2HJ9A 2HQRA 3G6KA 3IEIA 2PRJA 3GOHA 1MNQA 3IT1A 3PXAA 4I0WB 4RLQA 3S1AA 3VVMA 4A82A 2JDID 5BXYA 4OQDA 2PUGA 5AJTA 2O8BA 4ZCTA 1E89A 3VSDA 3V3TA 3B2QA 3D3KA 4MAAA 3Q1KA 2V6IA 1GVHA 4PSDA 3C6QA 4C22A 1VIYA 2RKWA 3K0FB 3TQHA 4DCJA 5BUQA 4NXNB 1CUWA 4QQ8A 3IQWA 3IV7A 3VI3B 5ALGA 3NV9A 4U2EA 4YR9A 3BZWA 1POWA 3KBBA 2JB9A 3QVLA 4L9RA 2R8PA 2WFZA 2WJ3A 3BHMA 4GZ5A 2XUZA 4Q3OA 5EZYF 3UJHA 1TJNA 2HZBA 3ZH2A 1HWYA 3H1PA 4YRMA 3DXFA 3K2BA 4M46A 4HAXA 1DQRA 2R6AA 5TT1A 4AZTA 5BNIA 1CSEE 4BKRA 1F0KA 2AR0A 2FZGA 4JIGA 3S1LA 3D1JA 3KEOA 3HNPA 4WERA 4Z7OB 3ZQKA 4XFDA 1DQSA 4YAFA 1NJ1A 1Z56C 4RUKA 5F21A 2Y76A 4TZ6A 3OQHA 3KTOA 3RS9A 3WLAA 1APBA 1MG0A 4MRMB 4EB0A 4FFSA 1ID8A 3TZKA 4NBNA 2XMCA 2OO5A 2CD9A 3H75A 4U0JA 3R40A 5I48A 1ULSA 3Q12A 4FGLA 3D9QX 4OLBA 2PZFA 3HPRA 3PXBA 4HF7A 3V7UA 1T43A 3MWYW 1P1JA 1DIHA 1U3GA 4XJSA 2PVSA 2VPTA 3AIOA 1CETA 1W93A 1A5BB 2ZPAA 1DXQA 3F71A 1PL8A 3LVFO 5KO2A 1IBLB 4LOHA 9MHTA 5FWAA 1SBZA 2WPNA 4GMGA 3VR5A 2XRMA 2R1UA 2DECA 4WFKA 2X4DA 4X7MA 4CXMA 3M3DA 2AD5A 4PAGA 1XEXA 3GQVA 1YR2A 4GP6A 4H3SA 4IIEA 4F56A 2Y0PA 3A6JA 1AF7A 2J6CA 5A0TA 5JMTA 2BONA 2BRUC 2F3RA 2A35A 3GC6A 1L7EA 1P3Y1 3VYVA 1D3AA 2VDQB 2DBQA 4HQRA 4LGVA 1TUBA 3E3OA 4LRYA 5THQA 3UA4A 1WETA 3WJAA 1PWHA 4PV7A 3SC6A 3H5LA 5IJZA 1B76A 3CN9A 4L5BA 3OEWA 2BFOA 3NTQA 1RWOA 3HL0A 1IN7A 3E9RA 5C80A 1TAGA 1Y81A 2CMGA 2O8NA 3CVXA 4HNVA 3CRQA 2FUEA 4LCJA 3L7DA 2WJGA 1C0PA 4UTXA 1XTVA 3OETA 1EX1A 3KOMA 3CWCA 4HS9A 2EKPA 3OZFA 4X8MA 2NU8B 3UWDA 5DB4A 4S12A 1H1LA 4ZOLB 3N8IA 4J49A 3NVDA 2FXVA 3C3KA 4N5IX 2ZSFA 1OI2A 1K6MA 1PLKA 3QU7A 1G2QA 3O03A 5TS2A 3A6PC 1C1HA 2GJKA 1EEXB 3K4QA 1S01A 4G0WA 1A9XB 1FX0B 3UGTA 2FEKA 5DX0A 3LUHA 1XP8A 2QHXA 3CNBA 2CYCA 3OU6A 1MR3F 1BXRB 2CV0A 1DC7A 1LI5A 4YJ2B 2H17A 4MA4A 2Q6VA 1G63A 3A4TA 3NHAA 3DZBA 5CX1A 2IP2A 2WMDA 4QHYA 5C7OO 3LCUA 3WBFA 5BVGA 1RJ9B 2GWHA 1VKOA 4MJ3A 4ROTA 2BM1A 4X8OA 1LQUA 4MW4A 4TT8A 2G25A 1WL8A 3RARA 3DPIA 4Q3AA 3ODPA 4BNDB 2B4QA 2FWBA 3UF0A 4D3SA 2P2CA 3EA5A 3EJWA 4IILA 2QM3A 2XLBA 1HYHA 1JKMA 3KKQA 3NT5A 4WSOA 4JEIA 4CQNA 4Q02A 1A8UA 1KFBB 2OCGA 1WHSA 2VNKA 2I4TA 2XCUA 3S68A 4CDNA 4YMGA 3VNQA 4JBYA 4XEHA 3JATB 3B5EA 3M4JA 4NCIA 1YSCA 4O4LF 5CVDA 1D2NA 2ACKA 4D46A 3LQ2A 3R3HA 3FPLA 3I52A 1ZR4A 3HLKA 1ULZA 3HP1A 1OTXA 2JGEA 1XZAA 2R5FA 3ZXUB 4ENUA 1JW9B 1XYGA 1Q1QA 2IDMA 3EGXB 1E0SA 3CZPA 3IUQA 4FC6A 2CLCX 3N9IA 4KIJA 5CYOA 3ZCSA 4NFYA 1M2VA 4PG4A 4WXYB 2CHVA 1J21A 1KE1A 3N39C 2HK6A 5L7WA 4YRSA 2VP4A 4C6SA 3CMCO 2W2TA 1TGVA 2O7VA 1ACMA 1DO8A 2YBEA 3GELA 5F1KA 1JH8A 4J1NA 4LNUA 3RHSA 3NYIA 4QATA 2Y8EA 1FMCA 1Q2XA 3CUTA 5ALPA 4NJMA 1EPUA 3SZLA 4PYNA 3T7TA 2ADMA 1GYPA 2PRYA 3FROA 4OLFA 5IF3A 2H00A 1VHWA 4O1HA 3W6ZA 4NCBA 1M2FA 5E6UB 3Q98A 2PH3A 3VSAA 4JLNA 5DF1A 1N0WA 2K2WA 1A27A 1X1DA 4EY3A 2AYZA 2XHEA 4N82A 3WI7A 2OQVA 3V4RA 1FS6A 2YFQA 4ZZ3A 3TW6A 4Q1VA 2WDZA 2N1MA 4IYJA 2W0SA 3DT8A 5IYZF 2Z58A 5K4AA 5JMOA 1ZY2A 1W75A 2NXJA 3KJQA 2AEEA 5SY6A 3IO3A 5AK3A 1WU7A 4MRSA 2FHPA 3EPKA 1B41A 5H3LA 1ZW1A 4DILA 3AESB 4DT1A 2IDZA 2WHEA 1PT7A 3EAGA 2WM3A 1JX6A 5FR1A 4FILA 1P8AA 2MWMA 3O2QB 2FH5B 1Z7EA 5T6MA 3I34X 5CLQA 1ZJYA 3VFDA 3TD6A 2UAGA 4GMXA 4YJHA 1I32A 4ZTZB 4BJHB 4CF4A 4YGYA 3URMA 2A9JA 2AJ8A 3PHLA 3QEOA 2PQ2A 4KX5A 5DGIA 2FDRA 4ZVNA 2V5AA 2D7DA 1ONNA 2PLAA 1TQ4A 4KGDA 4EJSA 3O8QB 5CVJA 3HWSA 2FSSA 3GGPA 4MARA 2EOAA 5JANA 3ROZA 1L7VC 1CUFA 3OO0A 1D2CA 3GT4A 1QHFA 4B75A 4B7AA 1J1ZA 1U7HA 3PDCA 4QRDA 1BVRA 4QWWA 2JGDA 1Q21A 2CVFA 3OBBA 1DIRA 3IPCA 4HLCA 4BN0A 2ZS8A 3AFMA 4ID3A 4AJJA 3N3BC 3K0KA 5K8LA 3HEMA 3VR0A 3NHJA 1EU1A 1SRQA 3JD4A 4EEZA 2NOAA 3OQVA 4BLRA 1XLWA 3PQ5A 1PSWA 3EG9A 4FR2A 5CR9A 3PE6A 1C3JA 5J4LA 3EBLA 1PQYA 2ZUCA 2VF7A 3K05A 2ZAOA 2H1FA 4RY9A 4BO0A 3T5TA 2H06A 1TADA 3ELBA 3GJRA 3LBNA 1AMNA 4M0PA 1J20A 2ECQA 3K2QA 3KAQA 3KKKA 4GI3A 3CNOA 2W2MA 4NPHA 4P0PB 2Z43A 3NBKA 2F17A 5AI8A 2ONYA 1C1DA 5EY5B 1AHNA 3H1EA 1NJ8A 3WK5A 4AY5A 5JXGA 1N1DA 3THWA 1O95D 2J9ZB 2H0QA 3P8ZA 4M53A 5AM3A 2UVQA 4YRQA 1DPFA 4Y7DA 3QMPA 4RL4A 2VK1A 3H2ZA 3IDQA 1P4JA 1KH2A 2A5LA 3FYUC 1GILA 2ZRPA 1S2OA 4LDAA 1EGHA 3AB8A 2CVPA 1DTWB 1G9SA 3GFSA 2O0LA 3G1TA 3N76A 3NVAA 2H7CA 3OCUA 5H4GA 2BFEB 3WMWA 4TL7A 4LE1A 4BE9A 4QTYA 1ZL2A 3NIFB 4OHVA 1ZAYA 2D06A 2D1SA 4XUGB 2YFYA 2RJOA 1R0BA 4NG5A 4ZN6A 3OTWA 2AOVA 2ZJAA 3UB4A 2FEOA 2PZGA 1XVIA 3SF0A 4LF4B 2HAEA 2HPVA 1XDDA 1Q0TA 1W36D 1U7UA 1DV2A 4PO8A 1JB9A 2LP4Y 4M0MA 1J23A 1A7KA 1AURA 1VI2A 3UAVA 3WBBA 5LUAA 2D7CA 1GITA 3ZW8A 1R16A 2F3QA 3VYSB 4F4FA 4YFVA 7ADHA 2C3MA 3LRPA 5HKBA 1CUXA 4OJTA 4R4JA 1B8NA 1UDXA 3ROGA 4WINA 3LLCA 5BW4A 1VZ2A 3N8HA 3NOXA 3RU9A 3D02A 1ZINA 2A1IA 4XFJA 4PTZA 1EG7A 4R98A 2NVBA 3H9UA 3OM1A 4FFPA 5K8IA 3PQDA 1YDHA 3ZWDA 2C97A 1WZIA 2X8JA 3BIOA 3C7KA 4RC9A 2WYWA 1FDTA 1KYWA 4QXAA 1KJIA 4L4UA 2JKVA 2CVOA 1Q0ZA 1DUSA 3AHHA 1ZGCA 3M2PA 5G53C 2VDWB 1OUMA 5FKJA 3V8PA 4Q1DA 1JHXA 3R7NA 1E1LA 2NXNA 1QAQA 5A6SB 4EI9A 2C03A 2IZ1A 3DM9B 4IF6A 1XZNA 2E4YA 2IP1A 2DUMA 2CMFA 1UDCA 5IH3A 4ESVA 1EAMA 3PLNA 1PJAA 1RU3A 2WYUA 3GJ4A 3VZBA 1TLFA 1FQKA 2HO5A 4B8YA 2WIJA 3TQQA 3NWJA 2DH6A 2O6LA 1O6FA 2H54A 5KX5B 2AQ8A 2P2NA 3FHOA 2CHUA 2XUQA 3N6VA 2H2IA 2XUDA 3PHBE 3V1YA 3WP0A 5F4ZA 5F2KA 4WL0A 3ZYCA 2W6ID 1UQUA 1PJSA 3L0IB 4RXTA 3VPDA 1YTLA 1P8JA 3K20A 3ADCA 3AR7A 4L08A 3PHHA 2HTEA 1GPMA 3VU1A 2O8VA 3AVOA 3G0OA 1PSZA 1JP7A 1U0NA 1KARA 1ZH8A 1ONOA 2EW1A 2QRUA 2P4UA 3GAFA 3HRKA 1P4RA 2H2AA 2Q5OA 3MMZA 4P4SA 5EE3A 3RC9A 4GNKA 5CITA 1HKUA 1ZX1A 5HIAA 3WKEA 2YXNA 2JFQA 2AOXA 1PYGA 4QTXA 2OFOA 4TLAA 5D84A 4CKEA 4Z8XA 4OMFG 5HMMA 3GAZA 3PTAA 4I50F 3BB4A 3RVKA 2AN9A 3WGTA 4R1TA 1K3TA 4DCSA 1B8UA 5CTAA 1UF9A 3CQ9A 2JJYA 4QDXA 5D5QA 2GKGA 4W1RA 5HJ7A 5JR3A 1EFUA 2I7DA 1CUJA 2QXTA 2WAOA 1ZJWA 3VJLA 3LDGA 221PA 3DLAA 5IH7A 1MJGM 3PKIA 5JV5A 1NX6A 1T9CA 2R7AA 3WGMA 2WMYA 2GI4A 5KNCH 3ZWMA 4G4IA 5IVHA 1QGOA 4IJ5A 3SQXA 5JAIA 3V00A 2YTZA 1CY6A 1UBUS 1ZVJA 1DJOA 2JCYA 3AH8A 3GT0A 3IUSA 4Z54A 5IZ4A 9ATCA 3B1WA 3QKUA 4ZQEA 3ZHXA 3QFFA 2YZKA 3O1HB 5B1IA 2R1VA 3TFQA 1LRJA 3GQBA 3MN1A 1DZ3A 1MDFA 2OZLB 4JAVC 2FQYA 3G9ZA 1QCYA 5AJUA 2QF7A 1B93A 1WTAA 3RSOA 2PGLA 4DRXA 5BNZA 4HDAA 1MVLA 3PDIA 3ZU4A 2HY7A 3E03A 3OX1A 1E1NA 3ILHA 1NOIA 1BWQA 2C2XA 4XAQA 2GQ0A 4LI3X 5H5JA 2FLWA 1SBQA 2XZPA 5JARA 3G0HA 4DQDA 5AP9A 3LZ6A 4XZ3A 1FDWA 1PDOA 4HRYA 4RD4A 4RVSA 3SQMA 2O0KA 2ZR0A 1JQKA 3RTGA 1ZK0A 2GK7A 4FN4A 1IY8A 3NFYA 3AU9A 1X3LA 3K0AB 1NWCA 2OWDA 2V98A 5KBYA 1DQZA 3EUFA 1X1EA 2AQHA 1W94A 4X5OA 1G59A 4JUFA 2YCLA 3QWIA 3ZZMA 3RYCB 1TF5A 3VRHA 4LCBA 4BFLA 3QOYA 4E5DA 1JEYB 3N2KB 1OI7A 2JJ1A 4JLUA 2FOIA 1YC5A 4LRWA 4H0NA 4MH0R 5DN6A 5FBWB 2ZW9A 5HKLA 3CVUA 4AC9A 4C87A 2FK7A 4DGQA 3D7KA 3KR9A 1DAGA 3KEQA 4ETWA 2JH8A 3QF4B 1M6HA 4CHTA 1NBAA 4TS4A 5JLAA 1K2VN 1G9XA 3OUZA 4WRRA 3DT9A 1NF3A 1XCGB 1E7MA 1JLLB 1VSUA 1XIVA 5FBHA 3GT3A 1IK6A 3FRJA 2KYRA 1WEKA 2ON6A 2O3RA 4M6WA 2PGXA 3I4LA 2WHQA 1VP9A 3HDGA 2RHCA 3RRMA 1JLMA 1DXOA 2D2XA 3FZYA 2XUGA 5EJMA 3RHTA 2CKDA 3FSEA 5CM9C 3BTOA 1W6RA 1HDRA 2VSXA 3KLPX 3VNRA 3FD8A 3LBFA 2YWJA 1XZIA 2Z4TA 3ZHVA 3WNVA 4BTEA 2ILVA 3KYCA 4FD3A 1M6NA 2V5VA 2WAYA 4MJLA 1K75A 1QWOA 2IC5A 3I5AA 3U26A 1F2UA 3AEUB 4TUYA 1G3QA 2GLTA 2VAPA 5DIFA 5BT9A 2NZ8A 4CCWA 2YY7A 1XROA 2OV4A 4QNNA 3R20A 4M22A 2UUCB 5H80A 1EBFA 4LDZA 1AS2A 2XDQA 1WCIB 2HOQA 3JQ7A 1FP2A 2REBA 1FDOA 3Q7TA 3I5YA 4ETNA 4QUBA 5REQB 1F3LA 2B2NA 1DINA 1Y3FE 3I4FA 4XIGS 4KL8S 4EZBA 4CKZA 1YRBA 3ZD8A 3HLYA 4FSDA 1SHUX 2H18A 4TXHA 4DG9A 3MS7A 5JASA 2KJQA 4HWRA 2OXRA 2PTGA 2HF9A 4MKRA 4YRPA 3BXGA 4BNLA 2Z6QA 3D8HA 3GLQA 4JVMA 4TKUA 3JASA 2GZSA 4D8VA 1M33A 2ODEA 3OEEA 3ETLA 2C5AA 4Q4AA 4DLBA 1SCJA 4F97A 3UB2A 2VDRB 3B2NA 3NPAA 4TRNA 4ER6A 1G8JA 1ZBQA 1RLJA 3CJRA 4PYMA 4RVUA 1CE8B 4MYRA 5DW3A 5F7ZA 4BKPA 1FXUA 3PQ2A 1IOWA 3D64A 3UH0A 10MHA 5LQJA 4DDVA 5I7FA 2F7SA 2R8RA 3L6OO 4BQPA 1QGED 3ENKA 1K5DA 4DS3A 1YTUA 2JLUA 5BWBA 3Q10A 1CVIA 1WMEA 4LVNA 2P2DA 2FPWA 2V6BA 1KDZA 3DEJA 4I55F 1BDMA 4LZJA 3I5UA 5EI5A 3GBPA 4CG1A 4XB6B 1YI0A 3GFTA 4EHIA 2PBFA 2ZP1A 1FZQA 2N1BA 1A76A 1KNXA 3DE1X 3ZWKA 2DMRA 4E6PA 3LBAA 1WUJS 1DT5A 2EL7A 5I7WA 3D6UA 1H69A 5ALUA 3LX8A 2PCJA 2FPMA 4Q05A 5C8YF 5ITWA 4IIJA 2FP4A 1ZGAA 4MHSA 2HF8A 4UAVA 1C8LA 1XX6A 4OY3A 2BJVA 1T8UA 3DD5A 4D96A 4RXUA 3GYGA 3GEDA 4KVAA 3NONA 5DHPA 5C4GB 4PZZA 3W1EA 4AS2A 1WD5A 4TVSA 5KYWA 3LGXA 4DR7B 4YGXB 4TYWA 5LZ7A 4UUMA 2YZNA 1UDBA 1BE6A 1XN4A 2X9QA 3HY6A 1Y7TA 1L7XA 4LTMA 3LDHA 4YMUA 2CJPA 2HLNA 4AWXA 3C3PA 1L4FA 3RROA 2O0JA 2GOYA 1AKUA 4HZUA 1OY1A 2VWHA 4OHYA 2QJFA 5EIWA 4AMUA 1K4KA 3B3QA 5FPQA 3NW9A 2Q8NA 1LW6E 4XE5A 4BZPA 1XMJA 5I47A 1O5TA 2IQ5A 3PJEA 3K5IA 1J1IA 3REQB 3VKWA 5TARA 5HGJA 3T3GA 1AHHA 2WYHA 5DWVA 1U3TA 4KIGA 4WESB 1QHNA 4TTVA 5C37A 2CLIB 1PK7A 2BW0A 1IWPB 1II0A 4QHTA 5T3YA 4EY8A 4CMKA 4D0LB 5I9SA 3JRNA 2QDXA 1NVUQ 2VOJA 4F8JA 5KOIA 2O2GA 1FY2A 4MVJM 3NHYA 1HDGO 5IP5A 3DLBA 3HG7A 1VMEA 3DG9A 4J0KA 3R76A 3NKFA 4WT7A 2PTHA 2YQZA 4G26A 3WKDA 4AQDA 4DCTA 3GIWA 3HBAA 2RGGA 3HR8A 1RZVA 2R8YA 1LDBA 5AHXA 4GRIA 3TNLA 3PC3A 3I39X 3PKJA 5I9LA 2FW9A 3OLZA 3SZUA 3U4HA 2NNLD 3LDAA 5ELLA 4RWEA 2XTAA 3W2GA 1TMYA 1GL6A 1KQOA 2JJ8A 5KWSA 1P33A 2PA3A 3U1BA 2NVUA 4OBXA 4TWAA 1Y8QB 2WICA 1F4VA 1M7BA 1OLSB 1MJNA 3DMNA 1C9YA 5KTSA 2FOXA 1NVAA 1OLUB 1RT9A 1NWHA 4HDNA 4OI2A 2QORA 1QRSA 2GN2A 3MIZA 4CLRA 3MINA 3NAQA 1EUQA 4FYKA 4Z4QA 2PHZA 1MEOA 4ES6A 3EQ2A 4ALMA 3CKMA 1RR6A 2I29A 2B78A 2QTCA 5ERYA 3ACCA 3PD7A 3TTVA 4JDPA 1NVGA 2JI9A 2WRZA 2BISA 4OSPA 1QDUA 2Z83A 2MT9A 2C98A 4HYQA 1SUEA 1B3RA 1KK3A 1RI2A 2ZTSA 3AUYA 3G2PA 4H0CA 5F5XA 4GGMX 5LQRA 3EXFA 3E2MA 3PUVA 3SVZA 3TRHA 5JATA 3U6KA 1K06A 1Y7IA 2DH5A 2P68A 3O4VA 4RPHA 5EINA 5GONA 4BVGA 3ONEA 2EBFX 4ZHQA 2VEOA 2EBHX 4DBZA 2M98A 2JK1A 1S8FA 4CMCA 1HNXB 3WIDA 2HKIA 3ESXA 5H68A 5IW8A 3U4GA 2CMHA 2OCXA 3F67A 5EAIA 1QFMA 2CLHB 4DLPA 4HEJA 3DKVA 1DQPA 1X1SA 2I9KA 5IHPA 2OLKA 1D9XA 1WPGA 4NDAA 1W9HA 2XA9A 4X41A 2AHOA 2QY9A 5FBRB 3EPRA 1S7GA 3DC2A 4DMGA 4U9UA 4C29A 1T9DA 1M6VB 2ISQA 2ZYRA 3OCJA 4K46A 1WUIS 4Y2VA 4TTSA 5ECYA 1OAAA 4UDNA 1IUKA 2OXIA 3HB4X 4KQEA 4A6XA 2QMEA 4NICA 2WJ4A 4PNHA 2BZ1A 3GJ0A 4PSCA 4S1NA 2BP7B 5EHQA 3QXJA 2WAMA 3DKKA 3G7NA 5FFNA 3U7JA 3ZY5A 3D3WA 3EPLA 4QU8A 1A5AB 1JEDA 1ZAKA 1EUDA 3VYWA 2VHZA 3GLIE 3E82A 3QOFA 4Z9XA 4XCQA 5BORA 3CLRD 1ZM3A 3KZ1E 1EE1A 4DPKA 1XQ6A 3N5KA 4JLOA 3WYGA 3ZKWA 1GY8A 4C0KA 5CDFE 5JVDB 2JFVA 1KPHA 3DBIA 4FEEA 4AZ0B 3Q7RA 4WUTA 3TBKA 5C1OA 1IXZA 3AONB 4GT1A 2XNCA 4JMLA 5CH5A 3EXG2 4FM9A 1ADJA 3D4NA 3R0IA 1J9GA 3HN7A 5EEHA 1AUPA 1CERA 3CLHA 2AFRA 3GZJA 3OZXA 4CIWA 2XKKA 4M9CA 3T5BA 4YRTA 3ZU5A 1CEQA 3K8YA 3CZAA 3IJ5A 2EZ4A 1D4OA 1U2DC 3BMOA 3ND5A 3TAXA 3ABQB 4WKBA 3WNDA 3RLFA 5JEEA 4PX2A 2H8GA 2EW2A 4AJKA 3LUJA 5EWJA 4Q9DA 3A26A 3BWVA 1NR5A 4GOJA 4KYUA 3UKDA 3MBOA 1U0SY 5LA6B 3VH1A 3W3AD 4DIFA 4ZAYA 3SLKA 1I5RA 3IESA 5AJHA 1CTQA 2G6TA 2HMAA 3W9SA 3EX7C 1P6XA 3DBHA 1RNLA 4Z99A 2ZAMA 2DHRA 1EESA 4WFIA 3U4MA 4ALIA 2FWIA 5ED4A 1O87A 3LWBA 3MFQA 4FDTA 4TTJA 2MOKA 1REQB 1NUUA 1KEKA 2IYNA 3EOAI 4W5QA 3BJIC 4CQMD 1H2AS 2R00C 1O1YA 4CZ2A 4M1WA 4EEKA 4ZDIA 1K63A 4BPRA 3MCZA 3QELB 4IJ6A 4PYKA 1AKTA 3OJXA 5A5DA 5EJ8A 2OHVA 1GPKA 3ICCA 5ILOA 2JAQA 3IE1A 4BNWA 1CIJA 4IINA 1NW9B 3CLSC 4Q19A 4QBGB 2XBMA 4H6XA 4I4TB 1RRFA 1HXHA 1QG6A 1OYVA 2Z6AA 4ND2A 2X42A 2PX5A 5D2CA 2PS9A 1V45E 5IM4F 4C78A 5JHHB 1CP2A 3WIUA 3ZWQA 2BZ0A 3O1JC 2GEUA 4EZIA 3QVGB 4Y30A 1DAMA 1KTVA 1U1GA 4JMPA 3TQIA 2JLWA 1QQTA 2WJPA 4OQYA 5KJ6A 2Y1FA 3KTAB 4J16A 4KR0A 1L5LA 2IXEA 2ROQA 4Q6WA 1Q83A 3R8XA 2QG9A 3UFBA 3HXPA 1SUBA 1UKEA 3MT9A 5A71A 3TIVA 4DLTA 5JD6A 5KPDA 2JH3A 3TQRA 4MIKA 3D6VA 1JVNA 4IUYA 1I7SB 3RYHB 4FX5A 5E2IA 2G07A 3PUKA 3ZTYA 1ZEMA 4NJEA 4G1UC 1VPTA 4NOMA 2IYSA 1KVQA 4LRXA 3CH6A 2OV8A 1F8UA 3AXTA 3JQEA 3PENA 5EFOA 4B81A 4UFPA 4JA0A 2XVAA 1HOTA 2VTBA 1LK5A 1F7VA 4R05A 5FA5A 2OKGA 3QHQA 1ENYA 1ZYUA 3TZHA 5F7OA 2YH2A 4KQCA 3QY9A 3P5SA 3WR5A 3BIWA 3DFIA 3EASA 1D2MA 2RGCA 5C1IA 4D79A 4JLMA 1DOZA 2CCGA 4NTZA 4H7DA 5KTPA 4CEJB 1NN0A 3SF8B 4G8JA 3EMBA 5BSTA 2FCAA 1LPAB 4Y18A 2V7QD 3N75A 4G0ZA 4WN9A 3TZQA 3X1YA 2Z98A 5CA1B 3B51X 3PWSA 1NW5A 2QAIA 1B0AA 1KAMA 1NPYA 2MTBA 1E9EA 3TLBA 4A0RA 3T4PA 2V1UA 1ELOA 1XEFA 4BMVA 1H2RS 3I9JA 1XJQA 1EJ0A 2QP3A 2EG5A 2QAGC 4FYVA 4LPKA 3LT4A 5SZJA 1PZXA 1DCKA 1WNFA 2KQUA 2OHXA 3AR4A 1WIWA 1W0KD 3HVJA 4KSCA 5ALKA 4CL3A 5CNIA 5I51A 1BQ3A 1YS9A 2P9QA 3CUWA 1UMDB 1LDEA 1BG6A 2XH8A 3BMQB 3F5FA 3N7TA 3QVVA 5G3ZA 1L1FA 3LO8A 4RJTA 1M75A 3O4HA 2RHMA 1QLJA 3EQ9A 1YMQA 5JZBA 3AETA 3DW1X 5U1PA 1NVVQ 5L51A 2VT6A 4CFSA 1LNSA 2R6CA 3S2YA 1UZUA 1DDOA 1P9WA 2OORC 4WXEA 5JE8A 1GNTA 4C6HA 4YI3A 1ZXLA 1OC2A 1XKQA 3CRRA 3OIYA 4RQAA 2DBYA 3RH0A 5DT9A 4G4SO 1II8B 2ZBGA 4OOFA 2Y1DA 4Q3LA 3SEFA 2NU9B 1IEQA 4KKVA 3VO8A 2QPTA 2B8WA 4ZO6A 2ZREA 1ORHA 3AKCA 3NVMB 1R4MB 4FBMA 4KXXA 1V6SA 1GZSA 5K3SA 4HLUA 1G3UA 2WPDD 2A58A 1HFWA 3CM0A 1KZHA 1PNTA 1OA1A 2RK6A 3A1NA 4PW0A 4QYIA 4UM7A 4UTZA 4MYSA 4XH9B 3WSWA 3ZHTA 1Y8CA 1DWOA 2QE7A 3IVGA 1FFDA 3NIGB 4FYYA 4TWZA 1H8EA 5DXAA 4Z4GA 4G67A 2IU4A 1FXWA 2OO5C 3FB1A 3ZX5A 1PG5A 4Z9FA 1DRWA 3H8VA 3VR1A 5SZIA 5G0VA 3Q3IA 1JR3D 1PP4A 5CHYA 2MDTA 2ZI5A 2IV7A 1FYDA 2JIBA 3V42A