1I30A

E. coli enoyl reductase +nad+sb385826
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
256
structure length
248
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
publication title Inhibitors of bacterial enoyl acyl carrier protein reductase (FabI): 2,9-disubstituted 1,2,3,4-tetrahydropyrido[3,4-b]indoles as potential antibacterial agents.
pubmed doi rcsb
source organism Escherichia coli
total genus 89
structure length 248
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2001-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i30A00
2Q49A 2X0NA 5JY1A 1X0XA 3FCOA 5AXBA 2GSDA 4YR9A 1UH5A 3TFOA 1E77A 1NWHA 1PWXA 3I6IA 1RM3A 1I30A 3WWZA 1ZK0A 5COQA 1A4IA 1GCUA 1KVUA 1LEHA 2I3GA 3U4DA 1QP8A 1PZEA 3DDNA 3EZLA 4QXMA 2WYWA 3F47A 3E1KA 3AUTA 3GGPA 4I5FA 4ND2A 5L7YA 3INTA 4QSMA 3NYWA 4UREA 1PIWA 3K6JA 1LU9A 1JTVA 3GQVA 5K9ZA 4WCFB 3OJLA 1KEVA 2YFHA 1X7HA 1EQ2A 2P4HX 4A10A 3GNTA 3PWKA 2V7PA 3IOYA 4MKZA 3HN7A 2RBEA 1NX6A 1JKJA 1QKIA 4CM4B 1TT7A 4E6PA 3OICA 2I65A 2HUNA 1BWSA 2ZKLA 1BVRA 4FFNA 3AY7A 5FI5A 1GR0A 1YVEI 4PG4A 4JLWA 4OXNA 4D79A 4J0FA 1LDGA 5HM8A 5ES3A 1HYHA 3H9UA 4XYLA 2EW8A 3VDRA 3NGXA 2DPHA 4R41A 1WPQA 5EESA 4BMSA 1WMAA 3UCXA 3C7DB 5KTKA 4CQLA 4D3FA 1A9YA 3UHAA 2YDYA 1W8DA 5KVVA 4Z3DA 2W2LD 4CMCA 2HMTA 1EFKA 3QVTA 2OP1A 4CLRB 1MA0A 4TROA 4NIMA 1ISMA 3AUAA 4OXKA 1NQOA 4AJJA 1F8FA 3BZUA 3PJEA 1M2WA 4CLEA 1HDOA 1XA0A 3I9JA 1NNUA 3L77A 5T67A 1ZBQA 4WOKA 4OAQA 3GT0A 1MP0A 1LUAA 4YJGB 1NPTO 3DO5A 3DZJA 1M6WA 3FF4A 1DLIA 1U9JA 2WMDA 3BHJA 1DHRA 2XOXA 2PH3A 3COSA 1P1HA 3GC6A 4PG5A 5T64A 5A3JA 3GOHA 3EZYA 2BGKA 3Q11A 3DHNA 4R9RA 1I36A 1W4ZA 4YRDA 4YAEA 3Q0EA 5B4TA 4WJZA 1R4NB 4N5LA 1VC2A 3ENNA 3JTMA 4ILKA 4I5GA 4RZIA 2IEDA 1N9GA 2DTDA 4Y6PA 4DGSA 3HFGA 3OQ6A 4CJXA 4J1QA 4P4LA 4XB1A 3TRIA 3S2FA 3RIHA 1J5PA 3KUXA 3C85A 2TMDA 1Q0HA 3I9KA 1ADCA 3I9OA 1SNYA 1Y5RA 3AWDA 1I2CA 4PIVA 4YQZA 1H93A 2YYYA 1F0YA 3D7LA 1KC3A 2WE8A 3WX0A 4CLHA 3A9WA 2PH5A 3VPFA 5JAIA 3FI9A 4XIJA 1ONOA 4AJNA 1DO8A 1MXFA 3F4LA 1FXSA 3WGHA 4QO7A 1K2WA 3BTVA 1UZMA 3SC4A 4D0SA 3JQ8A 1A5ZA 4E5PA 4E2ZA 3F9IA 3K5PA 4CMEA 4NI5A 2X7HA 4ALJA 5JDIC 3RCBA 5KVCA 4XQ9A 3FNHA 3JQBC 4G81A 3KLMX 3KYCB 5DCUA 5JW6A 1DOHA 3WYCA 1VSVA 4TQGA 2P9CA 4IZIA 3WGOA 1WDKA 4BNLA 2GZ3A 4J1SA 4F6LA 4LMPA 2CSUA 4JJGA 1YOVA 2UUOA 3H4VA 3U9LA 4JBIA 1ONPA 1H6AA 1XR3A 2OOSA 3G3EA 2CUKA 5TSDA 1IOLA 4UULA 5G0UA 3S2IA 2I6TA 3WMWA 3SLGA 4ZQEA 4YXFA 2VN8A 4ZQBA 1GUZA 1SOWA 3MOIA 3VKUA 1I3LA 1SZJG 3BYZA 3O9ZA 2AA3A 3KHUA 1U3UA 4YDRA 1N7HA 4OYRA 2NM0A 4R5HA 4CM7A 1KETA 4KQWA 1ADFA 2QRJA 1YQXA 1J49A 3DC2A 1XHLA 3IKTA 1JA9A 4EITA 1LI4A 4DRYA 3RD5A 3FN4A 4E12A 2V6MA 4YVFA 3QLJA 1DRWA 3O26A 1LA2A 4C7KA 4ZN6A 3HSKA 1B2LA 5I7FA 3P5SA 3V8BA 2PKQP 4BNNA 4D3SA 3KXDA 2IYPA 4XGNA 3I4FA 1ENOA 3QE3A 4GSKA 3PWSA 3QWFA 3JQ7B 1BXGB 4YRAA 2O3JA 1YXMA 4AG3A 1JW9B 3H9JA 4R9SA 4PRLA 2C2XA 4BMNA 2VT3A 1UUFA 1IL0A 3K9QO 3QVWA 4HFMA 2AEFA 1U3VA 5G4KA 2ZK7A 4MJLA 4OL9A 4BNIA 3OIGA 1ARZA 3H8VA 3JQAB 5KKAA 4BL5A 1SB8A 2BI7A 3HADA 1ULUA 1P1KA 4UEOA 1JVBA 3RFTA 3WTCA 4R68A 1UR5A 1JU9A 4GLOA 3NRCA 4IDAA 4OHUA 4AJOA 4FD3A 3QWHA 3GGGA 2AE1A 5COBA 2PTGA 1X14A 4C4OA 4N54A 5U4QA 3JYNA 3F1KA 4II3A 4GBJA 3PGXA 2C07A 1T1RA 1U3WA 4GH5A 4Z6KA 4DWVA 3BTOA 1ML3A 1Z73A 4YBZA 1QRRA 2ZQZA 5IAAA 4ZQFA 1DDOA 3MJ4A 3C7CB 3KEOA 1LC3A 2X0JA 3I1JA 5A05A 3QSGA 4GKBA 3CEAA 3VTFA 4EYEA 2X5OA 3EYWA 4J9VA 3H5NA 5AYVA 2W8ZA 1IB6A 3NDJA 4PLCA 4Z9XA 3VAZA 4K6CA 4BB6A 3F3SA 3O8QA 4CR8A 2NV6A 2P5UA 4UUPA 4BKQA 3FD8A 4GPD1 2Q1WA 1DSSG 3QP9A 4FFMA 1DRUA 3D5QA 1KVSA 2Q99A 1WW8A 5DBFA 3VOSA 3ZV3A 1LTHR 4FC7A 5JO9A 4OKNA 4WUVA 1EEHA 4M8SA 4A03A 3U5TA 5H81A 3OBBA 1IHYA 5IFLA 1K6IA 4PN3A 1ZSVA 5H82A 1P45A 1KEWA 1KVRA 1CF2O 3ABIA 4BO0A 1MC4A 2I67A 4Y9DA 3A4VA 2O48X 4P38A 4H3VA 4IGEA 5JYDA 3ZZNA 4DL9A 3BAZA 4WLUA 4J4HA 2ZB7A 4WE3A 1CWUA 3JYOA 4Q3EA 4JROA 2J5KA 1BVUA 3MJEA 5HTOA 3ETDA 4YT5A 3JQGB 2ZB8A 4CM9A 4E30A 3H9QA 2O23A 1AGNA 4Z0PA 3AUSA 5T57A 1E6EA 2P9EA 1LRLA 4IDEA 4DVJA 3PJGA 4CODB 1D1TA 3ONFA 2GPTA 2VWHA 1RWBA 5A03A 2IZ0A 5ICSA 1LQUA 3GVIA 1JDJA 4E5KA 4EJ6A 2FY8A 5TX7A 1CEQA 4FN4A 1NM5A 2VTDA 1O5IA 2WDZA 1NQAO 4ALKA 4XB2A 5KJ6A 1NHWA 4DPLA 2Y67A 1Y9AA 3WGTA 1PS8A 3L4BA 4RPKA 4BVAA 2GGSA 4YRBA 1PJ3A 2GRAA 1JQBA 4RDHA 4BNHA 3WGIA 1C1DA 4ND4A 5KJ1A 1BG6A 2DFVA 2Y66A 1NAHA 3KB6A 5CAEA 2VWGA 1OI7A 5IXSA 4BNGA 4JK3A 5DCYA 4P22A 2EF1A 1PQPA 4LSMA 1HZJA 4J49A 4R69A 3X2EA 2RIRA 4YAIA 3LC7O 1H94A 3ONEA 1ZO8A 1ZK1A 4WLFA 2CF6A 1NP3A 9LDBA 4HBGA 2X9GA 4HX5A 4YT8A 4BO1A 1V3UA 3OEWA 5H83A 1LRKA 1CETA 4XGKA 3TFQA 2RAFA 4GX2A 4WEQA 1PSDA 2Q45A 4W9NC 1U7TA 3AW9A 2G17A 2ZJ1A 3C1AA 4IS2A 3IS3A 4IINA 3TOXA 2FR8A 3O03A 5DBIA 4AJLA 1NPDA 3EHEA 1GD1O 3F4BA 3CTMA 4RPLA 4BNJA 4ONEA 5HA5A 4OMUA 4R1UA 5F5NA 4R3WA 3Q1LA 4OQZA 2B4TO 2I66A 3E9MA 3MJCA 5JC8A 3DL2A 2X0RA 4J4BA 1ZMOA 2C5EA 1A7KA 2JHGA 2VTEA 4INAA 3X2FA 2GZ2A 3K96A 4CQLB 1LXCA 3GLQA 3OA0A 4CPDA 5DCWA 1KC1A 3KSUA 4CM3A 4XEHA 4B3IA 3TL2A 1QSGA 2VRCD 4EEXA 1PU2A 4AJ2A 4ALMA 4JP3A 4L75A 4L4XA 2FZWA 4XRRA 5KNLA 1NFRA 4WASA 4GQAA 1Z74A 5BNTA 5C5IA 3S2EA 5CHEA 1VSUA 3WJ7A 4J7UA 1Q0QA 5TNXA 4BIIA 4KWIA 1E7MA 3HN2A 4HV4A 4YEDA 1GQ2A 2J5RA 3F1LA 2E49A 1QV6A 1DEHA 3ZHBA 2YV3A 3WG9A 1WDMA 5G0SA 1K89A 5IXYA 2AQ8A 1E7SA 2C54A 1K6JA 1YL6A 3FNFA 5JO0A 5KKCA 1LRJA 2J8ZA 4W7IA 1R37A 3RQSA 1UXHA 4DQUA 1ZK4A 2O2YA 5JMWA 3VPGA 4AJIA 4WGGA 3QJ5A 1VI2A 1XELA 2C5AA 4IIUA 4M86A 4DPKA 4E32A 2QHXA 4DPMA 4PLPA 3I9NA 2E37A 5GMOA 5AXDA 3VHRA 2CNBA 3JQ6A 1N9GB 4AL4A 4LCJA 1TB4A 4BNUA 3PYMA 1GPJA 3WYEA 1C0LA 5CG1A 2PZMA 3P7MA 2NQ8A 1AHIA 3AK4A 2VUUA 3MCVA 2HU2A 5I9LA 5BSHA 4ZJUA 2O3UA 3NTRA 5DNAA 4A2CA 5U9CA 2QZ9A 8LDHA 1FJHA 3ITKA 4IQ8A 4JX8A 3FPCA 3HB4X 1HETA 2PKRA 5DT9A 2BFMA 3RROA 1BDMA 5JDCC 1K3TA 1PZGA 3D4OA 3JQ8B 3EMKA 4KZPA 1YKFA 3ITDA 4J91A 5JCJA 1E3IA 1IZ0A 2FWMX 4ALIA 4NR0A 3CMMA 4B3JA 4QECA 2ZATA 2QRKA 4J90A 3S55A 4CV0A 1KVQA 1VJ0A 1I32A 3T7CA 3LYLA 2PA3A 3UOGA 4J43A 5C7LO 3GUYA 4KQXA 4U6SA 3VZSA 3ZV5A 1YOVB 2RHCA 3TL3A 3GRKA 3DZFA 1QLJA 3CIFA 1IHXA 5MGBA 3LSYA 2RH8A 2O3RA 1HYGA 1XSEA 5B12A 3WDSA 4AVYA 1YL5A 1YBAA 1TT5A 4R54A 1WMBA 2VYVA 1R15A 4BO7A 3DWFA 3E6AA 4GX0A 2BI8A 4FBGA 2PV7A 1RYEA 4U8GA 4XYGA 4XJSA 4PLTA 3JQAD 1EFLA 1ONNA 2E82A 1PX0A 2ZCVA 2DTXA 3H2SA 1C1XA 4DXHA 2P91A 4HUJA 1Y1PA 3ROKA 4FS3A 1TLTA 1ADBA 1E92A 2WD7A 3PHJA 4BO5A 2PNFA 4AJPA 4NBVA 1HRDA 4BNZA 3GZNA 2A92A 1GAEO 4PCVA 5JLAA 2LDBA 3OECA 1W0CA 4WLOA 5JAMA 4EUFA 5EQDA 5FFFA 3NDRA 3GPDG 3NUGA 4B8WA 4U0KA 1NFFA 3VDQA 3GK3A 4FJ1A 2Y0EA 4BO8A 4Y67A 4B3HA 4E2XA 2GYYA 3UFXA 3MZ0A 1T24A 3S1LA 2CZCA 5LCXA 5JCXA 3RUIA 3ZU3A 5BR7A 2AG5A 4D7AA 5G4KB 1LSUA 3UKOA 2ZTMA 1QR6A 5DOZA 4B4UA 4I9HA 2X0IA 4NBWA 3HFSA 5IN5A 3DOJA 1VM6A 1ZVMA 4WNIA 5L51A 1P9LA 4E3ZA 1YBVA 1PL6A 3KEQA 3HZZA 4TVBA 4BNFA 1GZ3A 2EKQA 3LQFA 4PZEA 3H9EO 3WIEA 1YBMA 4JXKA 3L07A 3ZWWA 3GN1A 3BTSA 3DFZA 5LDGA 4RZHA 4UVDA 2EKLA 4XD2A 1OZAA 5A02A 2B0JA 2O2SA 5CDSA 3RJ5A 1ISGA 3PDJA 3AU9A 3G1UA 2VHWA 3NAQA 3RBZA 2ZCUA 1F06A 2B36A 1FDTA 5L40A 4UEJA 5JSFA 3B20A 3JD0A 1B16A 3MEQA 2G1UA 1VRWA 1S7CA 2J3IA 1H6CA 4HWKA 3FNGA 3RU7A 3JCZA 4XQGA 4F46A 3PQFA 4YAGA 3RUHA 1A4UA 2QX7A 3O8QB 1ISIA 1DC6A 3K30A 3PLNA 1HZZA 3HE3A 4D46A 4QFDA 3M6IA 5IZCC 2H9IA 2XXBA 3IMFA 3W8EA 1D1SA 4PRKA 3CE6A 1DHTA 4I9UA 1JAXA 3EW7A 3JYPA 4OH1A 1ZZEA 3AI3A 4NG5A 4Y6SA 3U49A 5GZ6A 1EVZA 3ZWVA 4J16A 1ZEJA 5JC1A 4ESOA 1NHGA 3VVBA 3QA9A 2X58A 2NU8A 3VTZA 5IG2A 3AOGA 4L0QA 4HNGA 1YDEA 4HFRA 3OQBA 3UH1A 3FBGA 2YUTA 4IDFA 1PL8A 1LC0A 3RSHA 4BOYA 1V8BA 1G0OA 2OXIA 2VYNA 3BXXA 1ZXBA 4RDIA 4XKJA 7MDHA 4DMLA 3ZV4A 3AY6A 4EJMA 2W4QA 2O3QA 3NKLA 3MWDB 2QYTA 5JPIA 4IGFA 3PQDA 3GNSA 2BMAA 4BNVA 3OFSA 1PGJA 3QIVA 4AJ4A 1UP6A 3ZDFA 4RLSA 3PJFA 2A94A 5FF9A 5A5FA 2F00A 1MV8A 3GEGA 4L4RA 2E4AA 3NDIA 4MVJE 4FGWA 1U2GA 3JQFC 2RCYA 2GD1O 4M54A 5TJHA 1MX3A 2RHRA 1A71A 4IY1A 4Z3KA 3GNQA 4D42A 1IUKA 4IJKA 2VCYA 4A27A 3I52A 4BGEA 5THQA 2YHUA 3E9QA 1ENPA 2DAPA 4UVGA 1C1DB 3WNVA 1LSJA 3PHIA 2NNLD 4Y8VA 1Z7EA 3AI1A 4YJFA 1HDGO 1ZIDA 1P1IA 3ZWMA 4N18A 3C3XA 5JYEA 2AXQA 3GVXA 3BMOA 3DXFA 2NTNA 5AQ1A 5JDIA 1MG0A 1YJ8A 5KWEA 3OH8A 2BGMA 4DLAA 3JQBA 5DOVA 4Q39A 2HK8A 5EN4A 4GL4A 4W6ZA 2X22A 4TRMA 3GDGA 4PLVA 4MVJF 4IDCA 4YTEA 3HG7A 1SCUA 2DLDA 1LQTA 3Q9UA 2D8AA 3GR6A 1GEGA 2CDBA 3EVTA 1EVYA 4FPXA 2IE0A 1CRWG 4IDGA 4R01A 3ZI0A 3ZN2A 2IZ1A 4LMRA 1E7RA 5EPOA 1IPFA 2HSDA 3DHYA 1B3BA 3K73O 2AQIA 4IJWA 4TRRA 2D2IA 3CINA 5B4VA 4BNWA 2JD0A 1EE2A 4M1QA 1KY5A 4TRNA 3DQPA 1U2DA 5TF4A 1B14A 4ZD6A 2G0TA 5IDWA 3QQPA 3PHHA 3M1LA 1Y7TA 4MIOA 4WEOA 3TF5A 4E21A 2O7SA 3ZHYA 3QV1A 4ZICA 3C8MA 3Q3CA 1LLQA 2GCGA 2GO1A 4B7CA 2P9GA 4KUGA 4D41A 3BMQA 2EV9A 2J3KA 3ROPA 3W8FA 1IY8A 4CM8A 4MVJA 3RASA 3RC7A 1BRMA 4Y98A 2DKNA 2HMVA 4CM1A 5I8ZA 3NJ4A 3WLEA 1O9BA 2Y1OA 1LJ8A 2V6GA 2YV1A 2W90A 2W2LA 2Q4BA 5TC4A 4Q3NA 1YONA 4RQUA 5JBIA 3NT2A 1IYZA 1V35A 2X1HA 1DJNA 1Z45A 2VHYA 3ROMA 4EBFA 3ICPA 3KETA 1AXEA 3QVOA 5ENVA 4JCOA 2PWZA 3OM9A 4NBTA 1BXKA 5EIOA 2WYUA 3C7AA 1IE3A 3I5MA 4HY3A 1DIBA 1U4OA 4RCVA 3UGKA 4M55A 1LBEA 3KV3O 3ULKA 2EGGA 3TZ6A 1F17A 2OUIA 5HRUA 4UVIA 3ZHXA 3ZNPA 4BNKA 1GFSA 4O0LA 3LC1O 2NTVA 2VRBA 4LGVA 5A9SA 5KJCA 4U7WA 6LDHA 1HDCA 3DBVO 1A27A 4OQYA 2EWMA 2XPCA 1ZK3A 3AI2A 4BGIA 1QORA 4QT0A 2PD4A 4BO9A 1YQDA 1R0LA 2ZIZA 2HK9A 4HXYA 5L4NA 2PZJA 3D1LA 1QV7A 3WIDA 4YAJA 2VZ9A 1T2AA 4E13A 3JD2A 2QW8A 2O50A 3ZNNA 3Q6IA 4DYDA 2JL1A 1PJ2A 3ZHZA 1XKQA 1PZFA 1CIVA 3DBLA 4YQYA 2VWQA 3LC2O 4U5QA 3WJAA 3OSUA 4EUHA 4BKUA 4N5MA 1PGNA 1H9BA 4NZ9A 5A06A 3UUWA 2DUWA 1YJQA 3OJEA 1ZXLA 4EGFA 2ET6A 2XF8A 3MJVA 1X0VA 3FBTA 4UUNA 1ID1A 1R66A 3EAGA 3JD3A 4CR7A 2JAHA 1QG6A 3W4JA 3NTOA 2J3JA 2W2KA 2WSBA 3MTJA 1MFPA 4DMMA 5DULA 1N7GA 3IP1A 4OKIA 3WYBA 4R1TA 3UN1A 1Y6JA 4EDFA 1D3AA 3E82A 1C14A 4GKVA 2IDZA 4IS3A 1OMOA 1TA4A 3I9MA 4IZHA 3OJOA 4XWYA 4MP3A 1FF9A 1WDLA 2JJYA 2Z95A 5CDYA 2ZYDA 3PVZA 4RO0A 1R6DA 4PGFA 4CV3A 4Q9NA 4FGSA 2GR9A 2VWPA 2CVZA 3DMTC 1CYDA 1AUPA 1O6ZA 4MIYA 1UZLA 3ENKA 3T4EA 5HS6A 1TT5B 5G4LA 1ZJZA 2DVMA 1I3KA 3HDQA 1LDNA 2FSVA 3MWEB 1GY8A 3KYDA 3D4NA 4IJUA 5CFZA 4A0SA 4WCDA 2F1KA 3DTTA 1C1XB 1NWCA 3TZHA 2UV8A 2Z5LA 3ZNOA 4NJMB 2WD7B 3WMXA 2HRZA 3FR8A 2EJWA 1E6UA 1E6WA 2XAAA 3GZNB 5A5EA 4AFNA 3R6DA 1NQ5A 2PLAA 2DTEA 2VZ0A 1U28A 3RUFA 3GGOA 2J6IA 4PLZA 4R3NA 1GZ6A 2FR1A 4KDFA 2DPGA 2NSDA 3U09A 1P0CA 1P1FA 4CLXA 5CDTA 1B0AA 1QYDA 5T6BA 2BLLA 1R4MA 2X5JO 4AJHA 3B1KA 3TQHA 3B1JA 3SC6A 2Q3EA 3F46A 4QQRA 4EEZA 5L7WA 2BFAA 3PPIA 4U0JA 2G5CA 3N58A 2NVWA 1GADO 3QRWA 4GI2A 3ORFA 1HLPA 3I6QA 5TQVA 4S1VA 4HP8A 5L53A 1C0IA 2Q1UA 1H9AA 2ZTLA 3GRPA 4PZDA 4RPJA 3RKRA 2NLOA 3VZPA 4E33A 4FC6A 1GYQA 4CMKA 3D4PA 5EINA 3R3SA 5K0ZA 1SMKA 2I76A 1HE3A 4UAGA 1I3MA 1AE1A 1KEPA 1M66A 2X5KO 3FPLA 4W9NA 3B6ZA 1N8KA 2B35A 3M1AA 4OIMA 1MGOA 5IZ4A 4BQPA 1PR3A 2Y99A 2JD1A 3FRJA 3D3WA 2QQ5A 5IDYA 3LVFO 3RFVA 5L3ZA 1H6BA 1VL0A 3NX4A 3PFWO 3GDFA 4J3FA 3WQSB 2OL4A 1OOEA 4QO8A 3FTNA 1JKFA 1YGYA 4CM9D 3G0OA 1PGPA 4FOSA 2VHXA 2X86A 7ADHA 2GLXA 3H5RA 4R16A 1I2BA 5JY6A 1P1RA 1K6XA 2YQ4A 3BMCB 3PWZA 1PTJA 4KOAA 4TKLA 5G0VA 3JD1A 3DBHA 5THKA 3GHHA 3K31A 3OJ0A 5JMPA 4NBUA 4M49A 1R16A 1P33A 1T25A 2V6BA 3P19A 4XR9A 3QY9A 3W6UA 1RM4A 2OBYA 3LK7A 1E3JA 4R51A 3SLKA 3JQEA 1Z7BA 2PK3A 3PJDA 3PK0A 1H2HA 2VOEA 3M2TA 3NV9A 3OQ1A 4NNJA 4EZBA 4OSPA 4RJTA 4F45A 4WECA 1AXGA 1E3WA 4TRJA 5EERA 5TIIA 1M75A 3PIDA 4NK4A 1KY4A 2NWQA 4I08A 3WWYA 5C7IO 3DZGA 2E6UX 4RF4A 5DDIP 4DUPA 4TZKA 3G79A 2NACA 5MDHA 1NR1A 3LT2A 1LDEA 2Y1CA 5TLSA 3GVHA 3OA2A 3PQEA 3BA1A 5IF3A 3AOEC 2C29D 1Z75A 4L73A 1PJLA 1RM5A 3OETA 1GV0A 1NQTA 4OJNA 3L9XA 2DBRA 4E5MA 4XDYA 1U8XX 5CDUA 3UVEA 2QG4A 1YL7A 4Z9YA 2PGLA 3DHEA 3PDUA 1E1KA 1JLLA 2BELA 3RUCA 1BDBA 2FSSA 4YAKA 5HWSA 1X13A 3OP4A 3VVCA 2CY0A 1I3NA 3OIFA 2DBZA 2AQKA 5JDCA 1J6UA 3PFFA 1XWFA 3DFUA 4A5OA 4YJFB 4IQ0A 3LLVA 3CSDA 5TRTA 4CM4A 3A28A 4D0RA 1HWYA 3FWNA 4XCVA 4XA8A 3MJTA 4CUKA 3BMOB 4L74A 1E3EA 1EUDA 4XX0A 3GEMA 3H7AA 5ITWA 4IBOA 5LC1A 1UXKA 3ZWPA 3K92A 3D3EA 1N92A 4BNXA 1Q7BA 5CG2A 3I83A 4NDNE 3DEYX 1PZHA 1C0KA 3LZ6A 1LLUA 1HDRA 2CFCA 1PWZA 1D4FA 3FHLA 3PHLA 3PYXA 2FP4A 2GNAA 3IJRA 1BW9A 4KTTE 2QIOA 4FB5A 3ONDA 5CDGA 3PTZA 1XGKA 1V3TA 1CDOA 4DLBA 3LF2A 5L9AA 4IDDA 2Z1MA 1VL6A 4NFYA 1U5AA 2AE2A 3L4SO 2WD8A 3R0IA 3W1VA 1LDMA 3V1TC 5IDQA 1YWGO 4KTVE 3WNQA 1C3VA 3K2BA 4P4GA 3U62A 2HLPA 4CQMA 4WLNA 3TN7A 1YE3A 1VE9A 4YWJA 2EJVA 3CMCO 4L8VA 2Y05A 2BH9A 3E48A 4BHTA 4GGOA 3IQDB 3TSCA 5CEFA 2EERA 1G6KA 1FDSA 3O4RA 4CM8B 5I7SA 3AFMA 4GWKA 5G0TA 5T8KC 3DAGA 1KS9A 4ZHSA 2C7VA 3GA0A 2Z1NA 2C2YA 5AXAA 5LDHA 1E3SA 3QWIA 4D3DA 2C0CA 3ZWNA 2VRCA 3AUUA 1GEEA 2NUAA 3GZ4A 1F8GA 3PP8A 4PG8A 3WFJA 3U4CA 1GUFA 5F1PA 1D7OA 1I24A 4G2NA 3H65A 4B79A 2P2SA 4WNCA 3ZU5A 3RUEA 5JXWA 3H9GA 1FK8A 1KERA 1T2EA 1XIVA 4DIFA 4EW6A 3W6ZA 3AJRA 4OSOA 2PKQO 1HEUA 1RPNA 1VPDA 2GASA 4EUEA 5AXCA 4O1MA 1EK5A 3HB5X 4ID9A 3GEDA 3T7EA 5A9SB 1WVGA 3KSZO 5JCJD 5EMHA 1WNTA 4YJDA 3CXRA 3WR5A 2FHSA 1H5QA 3Q2KA 4WCFC 4ALLA 1DIGA 1EVIA 3AM5A 4QUKA 4DIOA 1PR9A 2DU8A 2UUPA 4OM8A 2YQ5A 4RVUA 2PY6A 4LN1A 4W4TA 3W4KA 1OAAA 4PLHA 3DBLB 5ADHA 3E18A 2V6FA 4XR4A 5GY7A 4BNMA 4DC0A 3PZRA 5C3MA 4I5EA 4J7XA 3RFXA 2PR2A 2VYVD 5K6AC 1ZUD1 4Q3DA 1PJSA 5EJ2A 3E5MA 4IM7A 5ILGA 1UZNA 1EE9A 3AM4A 3ASUA 3AM3A 4M89A 2B69A 4FJ2A 4O6VA 5CPFA 5FEUA 3IP3A 1T2CA 5IZCA 5JFOA 4WLVA 2PFGA 3F6YA 1UAYA 4YA6A 1H2BA 1T4BA 1T4DA 1B8VA 2VOJA 2W2KB 3DOCA 4RVHA 3OIDA 3U0BA 4CV2A 1PGOA 4ALNA 1I8TA 1A72A 2NTJA 3OF2A 4CMGA 1JWAB 2VHVA 1NBOA 4DQXA 1F14A 1IULA 3SEFA 1HE5A 5EL0A 2A9FA 1PQUA 3RBVA 2WE7A 4NBRA 4RPGA 1U8FO 4FOOA 3QVSA 3H5AA 5G0WA 2XXJA 2YW9A 1E1NA 3IDSA 2VQ3A 4BKRA 1U3TA 4DBVO 3QVXA 4GVLA 4P8RA 4Z0HO 5HS4A 2JHFA 3GAFA 1PS9A 3KSDO 4E0BA 3RJ9A 1KBZA 2C82A 2HRBA 1WAMA 2JCVA 2VHZA 4MKXA 2Q1TA 1PJCA 2Q2WA 4O5OA 3RUAA 2I99A 3CZRA 3JQFA 4FFRA 1YB5A 3SJUA 5IDXA 2ZB4A 4GAEA 4MP8A 1EDOA 3ZU2A 3JV7A 1T1SA 1SB9A 2Y1DA 4NFHA 2X9NA 1A9ZA 3GMSA 4XQCA 4CL3A 1R4MB 3WBFA 3GUCA 3ZWOA 2WJPA 3D64A 3PGJA 4MVJM 4XZ3A 5ER6A 4DA9A 1Y8RA 2WEKA 1U1IA 1EUCA 2JFHA 1HTBA 4CM6A 3WGQA 2O7QA 2Y0DA 2GN6A 5BT9A 4CV1A 2I3AA 3K8ZA 1P1JA 4Z0TA 3ETEA 4B7XA 3GFGA 2HJRA 1Z6ZA 2W98A 2HMWA 3R1IA 3LLSA 2DFDA 3RBXA 2X9VA 3GHYA 5IN4A 5G2OA 1Z82A 1X7DA 4LW8A 1DIAA 3ON5A 1QYVA 1I01A 3HJAA 4GX1A 2FZEA 1HSOA 4KWHA 1PS0A 1MXHA 2OGUA 2BFOA 2IZZA 2DM6A 4K9DA 1BMDA 3TZKA 5I7EA 1AN9A 4YB8A 3MJSA 1HDYA 1X1TA 4RPHA 2YY7A 1MG5A 3D3WB 2ZJ0A 2X23A 1Q2XA 4NU5A 4RVFA 2OP0A 3E5RA 3H3JA 2P4QA 3LT0A 1GQQA 3L6OO 4DBZA 1D8AA 1F12A 3EY4A 4MVJH 2VYND 5ILOA 4QTZA 3W8DA 4OOFA 1E7YA 1ZSNA 4AJ1A 5CEJA 1XQ1A 5L7TA 4IQGA 4YJHA 1B8PA 4LISA 2I5PO 1WXDA 4UUMA 2FRDA 1H0KA 3TDKA 5EQFA 2X8LA 1GUYA 3DBHB 3E03A 4GGPA 4BNYA 2B83A 2B37A 4Q3AA 1U4SA 2GZ1A 2EP7A 4Q3BA 4A73A 3KYBA 5I9NA 5JAZA 4XJTA 3NEPX 3VH2A 2WM3A 3TWOA 1Y5MA 1ZJYA 1O95A 2BHLA 4XYMA 4MDHA 4LVUA 2AHRA 3JQ9C 3NGLA 1E3WB 2NU7A 3FNEA 1B3RA 2B5VA 1KEUA 2EG9A 1E5QA 4CLDA 5FWNA 1GDHA 4XYBA 3UF0A 3GFBA 3NTQA 2Q2QA 1E3LA 3I23A 3TNLA 1RYDA 1E5LA 1MB4A 3LU1A 4R1SA 3WXBA 5ICMA 1B7GO 3ADPA 3ZWCA 1YB4A 2O4UX 1HE2A 3WB9A 4ZQHA 1RM0A 2NADA 3JYLA 1HT0A 4FW8A 4BO3A 2CMDA 1ZW1A 2HMUA 3AFNA 2O4CA 4IPTA 3V1UA 2R6JA 4CUJA 2YFQA 1SPXA 3BMNA 3WSVA 2OMEA 1NFQA 2PZLA 5COAA 2JFFA 4I5DA 3B1FA 3PYLA 1DC5A 1HE4A 1NTOA 3A1NA 1EK6A 1LLDA 1XCBA 2CF5A 3RKUA 4KUHA 3L6EA 3U3XA 1VKNA 2SCUA 4MINA 1XYGA 3PEFA 1HLDA 1XEAA 4OOEA 1BXZA 3UCFA 5KIAA 1PJQA 4J2OA 4FFPA 1G1AA 2A35A 3V2HA 4DIBA 1SEPA 4Z9FA 3MTGA 3SBOA 4BV8A 4J1TA 4NH4A 3EVNA 4K6FA 4TWRA 3LF1A 4NJOA 3V5NA 1LDYA 2QYSA 3KO8A 3CKYA 4PLWA 1YO6A 1NR7A 1U5CA 4IMRA 2AEJA 4CMHA 4MVJD 3MOGA 3HNPA 1I10A 3JQCA 2POQX 4LRTB 5FYDA 3TJRA 4R1NA 4E4YA 3DMTA 5KVQA 1S6YA 3GPIA 1I33A 1BW9B 2R00C 5A1TA 4UUOA 1YS4A 2VT2A 3IKVA 2EP5A 1PL7A 1DBVO 2NVUA 4YCAA 4I9NA 1NAIA 1ZNQO 2Q4EA 2HAEA 4OXYA 1HXHA 2D4AA 3UCEA 1J0XO 1G0NA 3AU8A 5I9MA 4CQMB 3SX2A 3ZWYA 1PQWA 3DAFA 4N5NA 1E7WA 1SBYA 1T2FA 1TXGA 2PD3A 5BSGA 2P5YA 1BGVA 2EGHA 1LSOA 2DUUA 3RWBA 2OZPA 4RVGA 3T4XA 4GWGA 5ENDA 3CH6A 1J4AA 4IXWA 2CVOA 3F5SA 1DB3A 3FSRA 1WLYA 4BKOA 1DC4A 3LT1A 4J0EA 4TMFA 4BGUA 5BNFA 1ENZA 2JD2A 4MIEA 4B4WA 3WS7A 4ROSA 2HK7A 2HCTA 3B70A 3F5QA 4W82A 1RJWA 1Y81A 3HDHA 2EEZA 3WGZA 3JD4A 2FOIA 1SO8A 2H5LA 1XDWA 2E48A 5TJ9A 3DZHA 2Y93A 5TGDA 4P4NA 1V9LA 1ISHA 2R2GA 3RAJA 3VZQA 5IJZA 2HQ1A 3P2OA 1GQYA 5TT0A 3U4HA 1VL8A 1X15A 2AG8A 2IODA 3BHIA 1YQGA 3ZH2A 3RC9A 2WWRA 4YT4A 1GYRA 4DC1A 3RC2A 3VPXA 1Q7CA 1CQIA 4X54A 2Y1GA 1PJ4A 3VH4A 4G5HA 5BNIA 1N2SA 4WOJA 2X6TA 2D5AA 2EKPA 2HKIA 4JBHA 4WK6A 3WTBA 3VZRA 1ZH8A 3QHAA 1N1EA 3D5TA 3VPSA 4RVDA 4B4OA 4ND5A 1NPYA 1TI7A 3WQQA 3GVPA 4K28A 4CMBA 3GF4A 3ZW8A 4QEDA 1I2ZA 1ZKMA 2BGLA 2DBVO 3PIIA 3WQRA 1HDZA 3OJFA 4W99A 2YV2A 1A7AA 1GZ4A 4AICA 1GV1A 4ZA2A 1YDWA 4DREA 1JVSA 2D5CA 1E7QA 2Y1FA 4A26A 4AJEA 1DRVA 5CEEA 3BTUA 4KMSA 4D44A 1VLLA 2DBQA 3P2YA 2PD6A 4MO2A 4ZGWA 4BNTA 3WLFA 5A9RA 1EQUA 1IPEA 4RORA 3QW2A 1YH3A 3EGOA 1TVEA 4FR5A 4NU6A 3AOEA 1HYEA 1TEHA 2WYVA 3Q2IA 4E5NA 5ER9A 1HDXA 3TZCA 4PG7A 1Y8QA 2GERA 3ANLA 2YHIA 4UVEA 3ST7A 2IXBA 3L0DA 4Y6RA 4FFOA 3ANMA 1OC2A 4RGBA 4LCEA 2BKAA 4XIYA 3WBBA 1QYWA 4CLOA 2WTBA 1KVTA 5AOVA 2DT5A 1DIHA 3UXYA 1T2DA 1EUZA 3DONA 2Y68A 1QYCA 2AW5A 3PHGA 4AJKA 4R4JA 4YPOA 4IUYA 1XU7A 3NT5A 3I9LA 1DC3A 1PEDA 4PVCA 1N5DA 4TVOA 1JWBB 4ND1A 4NFSA 3KLPX 4MVJG 3KRTA 1VKOA 1Y8RB 2QRLA 1UDAA 2YZ7A 3UICA 4PLGA 5A9TA 3ZNQA 1UAGA 2D1YA 1PJTA 3OHSX 2CDCA 3TOZA 2TMGA 4B4VA 2FN7A 4BKPA 4CMEC 3DZKA 2B4QA 3GG9A 2GDZA 2ZTUA 1ZEMA 3PRJA 3EUWA 5L95A 1HL3A 2RH4A 5ITVA 1GTMA 3C24A 1FDUA 3H3FA 4LVCA 5DN9A 3IL2A 4OO3A 4MOWA 4L9RA 1EZ4A 1R0KA 1DFHA 3V2GA 1X7GA 4MP6A 3V2UA 2IYOA 2IEBA 4C7JA 3K2EA 4K1LA 3ZV6A 4E31A 3PLRA 1MUUA 1JAYA 1ZMTA 2HO5A 1UJMA 3GAZA 3RI3A 2ZB3A 8ADHA 5DP1A 4BMVA 4IDBA 5HBRA 2PGJA 3S8MA 2CDAA 4KUEA 3G49A 1KYQA 4CMJA 4FIZA 1T26A 3DBRA 2NQTA 3N7UA 4PLYA 3ZU4A 3NT4A 1ZFNA 4TSKA 2EXXA 5FI3A 1BHSA 4YJHB 2AMFA 2EIHA 2B5WA 5T8KA 4BS9A 1X1EA 1L7DA 1GCOA 5JE8A 4CMIA 4JBGA 2UDPA 4O63O 4K26A 3VKVA 2GUGA 1NXQA 3UAGA 4DTIA 2FPIA 2GN8A 3U4IA 6ADHA 3ROQA 4O59O 5DP2A 5BSEA 1E0DA 4HNHA 3RUDA 1UDCA 1RKXA 4N7RA 1EVJA 4J6FA 3V1YA 5JNLA 4FJ0A 4IIVA 4BGVA 1Q1NA 1P31A 4D43A 4PG6A 1PJBA 1R12A 4NK5A 1B15A 5TS3A 1MFZA 2IRWA 3ZWXA 4XYEA 2FPPA 1UP4A 3BHMA 2D0IA 2C20A 4OGWA 1V6AA 2BFPA 1QMGA 2FPGA 1H6DA 3CZMA 4WCFA 3DOOA 1L7EA 4JGBA 3LDHA 1M76A 3G1TA 1MLDA 3LT4A 4YT2A 2OBNA 4YYZA 4IXTA 1EMDA 3HQ4O 1SOVA 5CPBA 4L4SA 2NVBA 3BMNB 3KZVA 3ZW9A 1K0UA 4ITUA 4IMPA 1JKIA 4MVJP 3CPSA 2BD0A 5JS6A 5DF1A 5KJFA 1IZ9A 3S2GA 3VH3A 2CVQA 1UP7A 2VZ8A 3QWBA 5K6AA 1ENYA 4S3MA 3ICCA 1W73A 3UW3A 5L45A 2ZYGA 1V0JA 1DLJA 3JSAA 5B4UA 2Q46A 3HWRA 2JKVA 4CLRA 4CQMD 2X4GA 4J9UE 4PVDA 1ADGA 3CUKA 3WICA 5B1YA 3E8XA 5KOIA 3INGA 4BO2A 4QFCA 1PGQA 3KTDA 2H6EA 3EK2A 3OEYA 2OHXA 3BIOA 4E2YA 4FCCA 1V3VA 2D3TA 5GZ1A 3A06A 1KIFA 3RVDA 4CM5A 1VJTA 4YJGA 4JJFA 3BMQB 1WZIA 1DAPA 4G65A 3E9NA 3Q9NA 3IJPA 5L4LA 1DFIA 1FDVA 1HF3A 1HSZA 4J7CA 4JIGA 3EC7A 2NVUB 4F6CA 1DPGA 1MC5A 5F5LA 1XU9A 4XGIA 1R4NA 4BV9A 4L76A 2LDXA 5GZ3A 3GG2A 4WKGA 4ZVVA 3HHPA 1GPDG 2OO5A 1ISJA 2P68A 2B4RO 4HADA 3IAHA 3VH1A 4RLHA 2BRUA 4UEKA 1C0PA 4BO6A 2H1SA 1DFGA 1NVGA 1DAOA 1P77A 2O3TA 2JCXA 4QX6A 1HKUA 1ZCJA 3FTPA 2DQ4A 4NQZA 5F21A 4FQ8A 4RL6A 3IIEA 2V65A 3H2ZA 3DTYA 3OMLA 4PLFA 4A7PA 5C37A 9LDTA 1OC4A 3C1TA 1SAYA 3L4BC 4ZQGA 2YJZA 1Q0LA 4B7UA 3EDMA 2YDXA 5C7OO 3KM0A 4JNKA 4NHEA 3GY0A 1M6HA 1VJ1A 2HDHA 3SJ7A 1B8UA 2HJSA 4IJVA 2Q2VA 4E2WA 1WZEA 3I3OA 3I4CA 3KYCA 3GH3A 5BQFA 3TZQA 5KJEA 3ANNA 3PI7A 4ZU3A 4E5YA 4H15A 3C1OA 1I5RA 1KOLA 1ULSA 3VC7A 4BUCA 3DAPA 2PZKA 1N1GA 5CP8A 2GN4A 4FFLA 1EBUA 1B26A 3L6DA 5AVOA 3ZWAA 2QZZA 2PGDA 3HDJA 2VNSA 5J23A 3ADOA 1ISFA 2OORA 5A3VA 1UXGA 5KCZA 2BF7A 1LNQA 2FR0A 2IXAA 4LK3A 3ETGA 4XQEA 3ZCXA 2HMSA 5JAQA 4GSLA 5KVSA 4II2A 5I8WA 3KVOA 2FMUA 2ZQYA 5L4SA 1P0FA 2UYYA 3M2PA 3WGGA 5A04A 1XLTA 4GX5A 4ZRMA 2O3SA 4RQTA 2UAGA 4NPCA 4U6QA 3DZBA 3AY3A 1NASA 3JQ7A 3KYDB 3NJ8A 4MKRA 1BXGA 2EHDA 1UDBA 4LRSB 2J3HA 5B37A 3SXPA 4CR6A 4M87A 2NU9A 1GYPA 2J5QA 4NJMA 1OBFO 4GMFA 4RF2A 4URFA 3GN2A 2UVDA 3JQ9A 1XQ6A 3WOHA 2VUTA 1K5HA 4ZRNA 4JQCA 1U7HA 1R0SA 3JQAA 4XDZA 4D45A 1YRLA 4BO4A 3GDOA 1NYTA 2AEMA 4JN6B 4GVXA 3ZWBA 3JYQA 2AQHA 2ILTA 2DC1A 3HUDA 3L9WA 2GF2A 1ORRA 3ZGYA 5DZSA 4HFNA 2Y0CA 4Q3CA 3R3JA 1Q7GA 5TT1A 4F3YA 4BQRA 1P44A 1Y8QB 4KDEA 2YHIB 5DBGA 1BSVA 1FMCA 3FWZA 3PZBA 4PFJA 4JJIA 4UVHA 4DQVA 2ZTVA 4CLOB 3O38A 4RF5A 4BB5A 4YACA 1I0ZA 1NVTA 3IC5A 2C7GA 3RC1A 5I7VA 1P74A 3RU9A 4H16A 1WWKA 3WFIA 1FDWA 2NU6A 1L1FA 1O94A 1O0SA 3DB2A 4B8ZA 2D59A 2Q50A 2CD9A 1E1MA 3INRA 1O89A 1Y9EA 1NVMB 4WPGA 3D0OA 3DZIA 4RVSA 4GLLA 3W4IA 4J1NA 5A4DA 4I8XA 4XRGA 1GU7A 4NMHA 4KP7A 4H7PA 4W7HA 4TKMA 1QLHA 2C59A 4R5MA 3G17A 1OFGA 2JCYA 3VPHA 4CMAA 2GN9A 2JFGA 3DMYA 3KBOA 1CQJA 2VNAA 3N74A 3PXXA 4JP2A 4CL8A 3WGYA 4WLEA 4CUZA 1LLCA 1LX6A 2OFPA 2Y1EA 1DIRA 4TZTA 1M67A 2VUSA 3HDYA 1W6UA 1EDZA 2R00A 3DR3A 3JQDA 5BSFA 4HFJA 4DLLA 2I9PA 4GMGA 3BMCA 1UXIA 4ND3A 1LSSA 3KOUA 4EJ0A 1JN0A 3IUSA 5F3RA 4MPDA 4EI2A 3JQGA 5F1OA 4J2HA 3TPCA 1CJCA 1E1LA 5F1KA 1GL3A 1AHHA 1P3DA 4I1IA 3QWAA 1SEVA 1CERA 3DBRB 1DJQA 3H6KA 1DXYA 3GMDA 2G82A 5T5QA 3WSWA 1QYXA 2Q1SA 4MVJI 4LSWA 4HKTA 3GVCA 4RV9A 1WP4A 1QXSA 1UXJA 3A14A 1BTOA 4J4TA 2JAPA 1SC6A 1ZSYA 1EBFA 2G76A 3FR7A 4FDAA 4PZCA 1YB1A 4DYVA 2A4KA 4FSHA 2EW2A 2ZYAA 5U1PA 3STHA 4CMIB 3IUPA 2H63A 1ZK2A 3SVTA 4RF3A 1LDBA 1O8CA 3ASVA 1XG5A
chains in the Genus database with same CATH superfamily
4M9CA 4MLDA 1QE3A 4Q7MB 1X0XA 4G8CA 4XIFA 3FROA 2DFPA 2O8EA 3TK1A 2GT1A 3TW4A 4QDOA 1KI8A 1UH5A 3TFOA 4DNFA 3IAEA 5FNVF 1R0XA 4GNRA 3DVSX 3DXYA 2JRCA 2OV4A 3GJ0A 2D1QA 3MOSA 4JEHA 4ARUA 1QFSA 1PLKA 1LPNA 3A10A 3UG6A 3V8NA 3U4DA 4IICA 3A0RB 1QP8A 1JXAA 3HZHA 4KBFA 2OYCA 4DKJA 2BM8A 1NN3A 5K3DA 5EMJA 2P79A 1PNTA 4I5FA 1BKSB 3HP7A 1EFVB 2BUCA 2FPPB 2XEDA 3OLWA 4QSMA 4OU5A 4BVJA 2ASVA 1P81A 2V4UA 1PIWA 5LMNB 2FPGB 1J22A 1JTVA 5K9ZA 4K9QA 1Q1EA 3OJLA 1J8DA 5HF9A 1WHTB 1I7DA 1PKXA 3TIGA 2CMHA 5A1JA 1Z4OA 3F6RA 4CEHA 1SELA 2QRPA 2BONA 2F3SA 2AFHE 2RIPA 1E9RA 1EVQA 1XRRA 2EDAA 2V7PA 1GPUA 1SY7A 1UJ2A 2RBEA 1BMFD 1NVKA 1TT7A 4IHJB 4EMUA 5EHNA 2I65A 1QHIA 3L8GA 1GR0A 4L9WA 3BGOS 1RZRD 1L5RA 3HXPA 3DV2A 3RS5A 4OXNA 2AZTA 5AK3A 2OGTA 4RHUA 5HM8A 3DB1A 5JS7A 1F7UA 5F9FA 3H9UA 2D2EA 4M1SA 4JLMA 3NGXA 1QDLB 2BTEA 2I1QA 1FJ2A 4R41A 4H27A 3GT4A 1MOZA 4AY4A 4I6JA 3O8OA 1YULA 3K9HA 4BEWA 3B9QA 3CX3A 1KQ3A 4Z7JA 3LXRA 2WAXA 1D6MA 5TQ0A 5J4VA 1CUUA 2FHPA 4MQFA 2YDYA 3MTDA 2VHQA 3ZCQA 4EG6A 3UC5A 3NDPA 2XNCA 2HMTA 5AVJA 3GLUA 3WLOA 5BNZA 1ZMXA 3HCBA 4RANA 3HI4A 4H1TA 1ZI6A 1XEWX 4HEQA 5CX1A 2IHZA 4IDQA 1E59A 3C0KA 1K7SN 2W6OA 3EWSA 1ADJA 5IT0A 4ICIA 3U3DA 4UASA 2AN4A 1DTWA 2BCGY 4R2KA 3QBEA 3GJ6A 3FYUC 1NSFA 3BZUA 4LMAA 1RI2A 3PJEA 4L08A 4YMWA 1CVIA 2QZ4A 3T9AA 5K0SA 1XA0A 1SQ6A 2GOYA 1NNUA 2Z4TA 4HI0E 2ZJ8A 3BK1A 5DTQA 5T67A 4B6FA 3M9XA 4OAQA 2FN3A 4YJGB 2YW2A 5B36A 3GLTA 4UTNA 2QN8A 3DO5A 4RS3A 4EMBA 5F5XA 1M6NA 2CLIB 4HTFA 2RHMA 1U9JA 1YKGA 3MSXA 1O77A 1DJOA 3OFNA 2OG1A 2Z6VA 5AJUA 3TLAA 3V9PA 1ESMA 3LY9A 1P1HA 4EI8A 5A3JA 2E0IA 3EZYA 3GOHA 2BGKA 5KTOA 3CLUC 3DHNA 4R9RA 4AB1A 1I36A 4A0QA 4YAEA 4YRDA 3M5DA 1R4NB 3UAZA 4TYNA 1CR6A 3D6FA 5DT2A 3O3CA 1A9QA 3ENNA 3JTMA 3TMAA 2ZT7A 4EHFA 5L3SA 3U44B 3HB7A 4OJTA 2P7IA 1WE2A 4Y6PA 2B7BA 3HFGA 1FMTA 2OXRA 3VU9B 2E5WA 4XB1A 3TRIA 1NR5A 2PRSA 4G0NA 3TD2A 4IX1A 4NV1A 3PENA 5ESDA 2BHTA 1JPUA 1TC1A 4TLBA 5EIAA 1J8VA 1LK7A 2PMFA 3I2HA 4PPGA 1WSWA 3I9OA 4CJXA 2IHYA 2HWUA 2PFKA 1F0YA 1FYDA 3QVGB 3VNAA 5B7NA 5B1DA 4AY5A 4DCPA 1Z06A 1GCIA 3VPFA 2YYAA 2OXEA 4IH4A 4MQ6A 3AHGA 3O7MA 2Z6UA 3NAZA 3A9CA 1A7UA 5LQSA 1MXFA 4PIMA 1TD1A 3FWHA 1ZRHA 3WGNA 1HTWA 1KI6A 4DWOA 2YWEA 1TIBA 1SVMA 1K2WA 1GGMA 4GR4A 5FWAA 1BJKA 2GNOA 3D7KA 1UZMA 3I12A 5M3BA 4C6HA 4D0SA 4U2EA 1NURA 2HZBA 1X7ZB 2IPLA 2ZRDA 4E5PA 1NW3A 3KS9A 3KQTA 1WDTA 2OQRA 2BE9A 2GMWA 2HQBA 2NZXA 5D2CA 2X2FA 4E2ZA 1KK0A 4RQAA 4ALJA 1FLDA 2CV0A 2XUZA 2K5UA 5C1IA 1VBFA 2YOFA 1LBSA 4XQ9A 1U2QA 3JQBC 3JQPA 3IIIA 4P7GA 1VSVA 5I47A 1LZKA 4BNLA 3H97A 3P9IA 2CSUA 3C4VA 1KYZA 1WSBA 3GXOA 4HAOA 4JBIA 5DTJA 3U9LA 2GBIA 1KH3A 1IQ0A 2FEMA 5DMHA 1GGNA 3UIEA 3RS0A 5A6VA 2YJGA 4JUCA 3K2QA 3AFIA 4BE4A 1OFHA 3DT9A 1FYEA 4ZQEA 4Q3OA 3WE7A 2GCOB 5GV8A 3MOIA 3VKUA 4LJRA 1D2EA 5F64A 5KNBD 1W94A 3KHUA 2J0VA 2WZQA 1N7HA 1O57A 3I58A 4ZYLA 1XNGA 1ZVQA 4KQWA 3GROA 4IOKA 5AKKA 4RTLA 3QTLA 3CGWA 1VZ3A 3IT3A 1ZHHA 3T9EA 3CWQA 3BFKA 4BLPA 2PYIA 2O0HA 2ZRLA 2X0DA 4EITA 3UPUA 3FKSA 2V6MA 4KODA 2REOA 4KX5A 3BN3A 5EYPA 3LUJA 4JI6B 1HQYE 4C7KA 4ZN6A 4OTZA 3SZGA 4F4CA 3HSKA 1B2LA 3PG5A 2QP9X 1F60A 2RONA 3OIYA 1L0BA 4OQXA 4OUKX 121PA 3REQB 1J8QA 2ACKA 3OLYA 5AW3A 4KLZA 1LVGA 4AF7A 5FBRB 3P0JA 2X8BA 3CLTC 4IF6A 2IYPA 3I4FA 3QE3A 4GSKA 4U3JA 3ESRA 4TLAA 3QWFA 1JSLA 2JGKA 4IUDS 2Q9CA 5A71A 1BXGB 1NUQA 1H2YA 3R6WA 3UV3A 1Z4PX 2P8SA 3FWYA 1Z6GA 4L57A 1JW9B 3H9JA 4EUSA 4R9SA 1E8MA 2PUJA 3GJYA 2CZQA 2ZJZA 1AOXA 1GNRA 1UUFA 2KLBA 2NYAA 3DNPA 3QVWA 4QEZA 1PR4A 3ECAA 3EAFA 4K9MA 4EELA 2VDWB 1NMXA 5EUBA 2P75A 1X70A 4OL9A 4MJLA 4H1WA 2FYTA 1GHTA 5KKAA 1ARZA 1E8NA 2V03A 4BNIA 4KYTA 1LS1A 4JR1A 4BL5A 2HA4A 1SB8A 4UE2A 1P5FA 1P1KA 1JVBA 3RFTA 4AZ0B 1P7VA 4GLOA 3NRCA 4GP7A 4RPIA 1WB5A 2VSNA 3MILA 1BVHA 4LHZA 3AZQA 1JHAA 3P97A 3GGGA 2FW0A 1K8RA 5HP4A 3BCHA 5TMDA 3DULA 3GJSA 4U00A 3SYLA 1S1MA 3JYNA 3MC1A 2O2IA 4E08A 4GBJA 1V9SA 3PGXA 4GBED 3CRZA 3VNSA 2J6CA 3DT8A 2IH4A 2PPVA 1E9DA 1T1RA 5EA2A 1DC8A 4BYGA 2WA2A 4BLWA 3NHYA 2BZGA 3PPVA 4YBZA 1QRRA 2ZQZA 1VI6A 1M5TA 1RYMA 1YZNA 3C7CB 1LC3A 2OFXA 4NBSA 2X0JA 4E09A 2O59A 3QSGA 1XPRA 2VDRB 2FX2A 3FXAA 4H0FA 1EHIA 2X5OA 3QLUC 3JWPA 4UUBA 3S28A 4M1ZA 1GTRA 4J9VA 4EK9A 3UJPA 4KB5A 1Q1GA 3RYIA 3LQRA 3NDJA 1XZNA 4U7GA 3D2BA 3Q3GE 5DH9A 4EIWA 2Z5VA 3JASB 2V8BA 2YV5A 3VMFA 4CR8A 4QTTB 1RXSA 2HDOA 2VPZA 4GPD1 2Q1WA 4JLOA 3QP9A 1DRUA 1CUFA 1WW8A 1EX7A 2IU3A 1E2DA 5I9BA 3SDZA 4A03A 1W76A 3GBSA 4MYTA 5KYWA 2UYHA 4Z4QA 1XKXA 5IFLA 1QU2A 2B8NA 2N42A 4UDXX 3HKCA 2EDCA 3L8ZA 5H82A 1YZLA 2VQFB 4QLBA 1WSDA 1LTQA 3OPXA 3ABIA 4KLCA 1ICEA 3UK6A 4HVLA 5B3JA 2V3VA 4CT0A 2NUPB 1P9RA 3A4VA 1B0UA 3IB3A 4POAA 3MMZA 4H3VA 1KNXA 1DBSA 4IGEA 2N1BA 1U9IA 3GAAA 1G4HA 4WLUA 4Y2HA 4WE3A 5ALRA 2JGIA 3VAAA 2AV6A 2ZTSA 3BORA 1AGRA 2IIVA 4GHWA 3MJEA 3RAPR 1T9HA 3ETDA 4YT5A 2R7NA 3B82A 4PC2A 4TXLA 4BAZA 4CM9A 4E30A 2ZZMA 3ZPXA 1JUDA 2OGSA 3HWWA 3AUSA 4XSGA 1OVMA 2WUEA 4PX2A 5T57A 2B9VA 3HBMA 3WRYC 2FRVA 4IDEA 5EJ6A 4CODB 3TLZA 1D1TA 1PK7A 1TJ5A 3ONFA 4EF5A 4DV3B 4X1KA 3E61A 1CJVC 1E2UA 3GLHB 4NE9A 3L8MA 1LQUA 2QRZA 4O4IA 1PD1A 4JUDX 2FY8A 2M32A 2F90A 3H2JA 4EJ6A 1AH2A 2Y27A 1NM5A 3RU3A 1CQPA 3H5LA 1N6KA 1G8KA 4UM8B 1NQAO 3FETA 4GS5A 5HNKA 2BHRA 2HWWA 2IHKA 3I64A 1ULAA 4RPKA 2GGSA 4QBTA 1Q21A 5CU7A 3W5JA 1VXOA 3MWKA 1J97A 1PJ3A 1IG0A 1JQBA 1JAHA 2NXWA 1Z18A 3V7NA 5KJ1A 2UUCB 4XCQA 3N1UA 4Q9LA 2DFVA 2J0UB 1NAHA 1IC6A 1OXVA 1W19A 1OI7A 3ILSA 1GZ7A 5DTRA 1M1YB 5IXSA 5DCYA 1W2GA 4MWCA 1EEXB 1ZS9A 2W6IA 3WWPA 1WL8A 3MBKA 2WJAA 4WHMA 2IE8A 1SXJA 1HZJA 2RG1A 3G8BA 4QBFA 2RIRA 4R69A 3KR2A 5HE8A 3S2SA 3T61A 2PUDA 1ZO8A 3G0GA 2ZSKA 1NP3A 3QPWA 1WZ2A 4F5EA 4KYVA 4UTZA 4DE5A 3X2SA 1UOPA 3W1WA 2W2MA 4JKYA 4IIEA 4RZQA 3T7KA 1FFSA 1H3NA 1OX4B 4PZ9A 4WEQA 4QVKA 3RQIA 1MRSA 3QJGA 3AZPA 3C48A 3CJQA 1CP3A 1ZRNA 3PXAA 4HJXA 4W9NC 1YR9A 2J4DA 4WZBA 5DVZA 2UZ0A 3FTQA 3HABA 4FQ7A 4GPEA 1G59A 1DOZA 1VHJA 3SF8A 3GPLA 1NPDA 3EHEA 1GD1O 2WJHA 3F4BA 5MGBA 3THWA 4AI6A 3OJXA 2XOKD 1UC8A 4M8IA 4JFAA 3KT0A 4HUTA 4R1UA 1ZGZA 1YB6A 3HU2A 3IKMB 3ZK7A 2I66A 5JC8A 3D4LA 3DL2A 2Q9AA 4NPAA 3VTAA 3P9SA 4ZHQF 2P90A 2P1DA 1CUIA 2QUIA 4BN0A 1C5KA 1Q5PA 3K96A 3R9XA 3KYIB 1QTNA 1ISPA 2CCGA 3L7IA 5DCWA 2EFYA 1R4ZA 2OCXA 2PRYA 3G2LA 1FYXA 3KG2A 4MWEA 1KZ1A 4WKBA 1WJGA 2MTBA 3BL8A 1MR3F 4UU0A 4CM3A 4ZO4A 2VRCD 3COWA 2JHCA 1GQSA 4L75A 1TU4A 4L4XA 2FZWA 2WF7A 1NFRA 1S01A 3JVUA 3VZCA 3L8EA 1UT8A 5FOTA 4YMSA 4FK8A 1NW6A 5TVGA 1VSUA 5AJYA 1KMNA 3WJ7A 2HA6A 3HP1A 4QUIA 4BIIA 5E6SA 4QGSA 3EIXA 3G5TA 5DW3A 4DA7A 2WR8A 4U6NA 2C5BA 2R44A 1G5QA 3HN2A 4HV4A 1GQ2A 2VP5A 1KPIA 2AMJA 5CA1F 1DEHA 2OESA 4DDTA 5I45A 1T0IA 1K89A 5IXYA 4OAOA 3S7ZA 2AQ8A 1E7SA 5AVTA 5JO0A 1DEAA 4ZOBA 2ZWAA 3R7WA 4JBNA 2J8ZA 1LBQA 1CHDA 2ZFUA 3VO8A 3QY0A 4KAAA 5F2KA 3KZCA 1SPBS 2O2YA 3PNLA 2LZ0A 3VPGA 4WGGA 4DPKA 5I51A 3NB0A 3QEBZ 1S96A 3MGGA 4IIUA 5ALLA 4EENA 2C83A 3EPHA 3X1DA 1IXRC 3BFJA 1YK0A 2QD2A 4PLPA 3VHRA 5AXDA 3WIBA 2CNBA 4AL4A 1N9GB 4CI9A 4RV5A 5D3MA 1OVGA 1P7PA 3WYEA 1WZCA 1C9NA 3EPRA 3BJRA 4OBXA 2PZMA 3P7MA 2B7CA 3U4QB 1Q0ZA 1SU4A 1MHTA 4RK1A 1RVDA 4YC7A 3D8BA 2VUUA 3UZUA 4QXPA 4DCMA 2HU2A 3RSCA 5I9LA 4LA4A 3EZ2A 3RW9A 2VHTA 5DNAA 5DGTA 5ADWA 5DXFA 4BVFA 3VO2A 4NAUA 2AZXA 4C0KA 1J5EB 4HDMA 4MKHA 3FPCA 4BFZA 4BTVA 2QIPA 3EXHB 2PKRA 2YIMA 2WT8A 2WIDA 3LFTA 2ZRMA 3M83A 4R31A 4C0XA 4AKSA 1BD3A 1BDMA 1PO7A 5JDCC 5JQGF 2V7XA 3P0RA 5J43A 5B1IA 1RYNA 2LCQA 5D3ZA 5JZOA 4URZR 3SI7A 3NASA 4QQFA 3WLMA 1E3IA 5IH3A 2VDOB 1IZ0A 1T6NA 4D9GA 1Y1TA 1F1BA 3LE8A 5F33A 3RVBA 4B3JA 5A4AA 2ZR8A 1R9GA 1RTTA 4OH7A 5KNCH 4DB4A 3QELA 1S8FA 4XUEA 1VJ0A 1JYFA 4PX5A 1KMCA 1I32A 5FUYA 3UOGA 4J43A 4U6SA 4RM3A 4JI1B 1AQ6A 3H11B 3SP1A 3UQYS 4A8TA 3B1ZA 3JARA 3QPBA 3TL3A 1PX2A 5DGXA 1P75A 1A4RA 2H59A 2JLAA 4B33A 4YUYA 1BDJA 5DNUA 4ZAWA 4AVYA 4GGMX 3TTVA 2RGEA 2BUAA 3LUHA 2ECOA 2JFPA 3BRSA 4G5QA 3KAQA 4N0MA 3DWFA 3E6AA 1N2CA 3HEMA 3NOVA 3PUZA 1JYEA 4FBGA 4ARIA 2GM3A 4U8GA 5FLYA 1U8YA 2QN7A 2X0KA 2L19A 3MWEA 4JT8A 4PLTA 5FTNA 1H2WA 4HQNA 5B3LA 4D4GA 2E82A 3ELYA 3PWTA 3H2SA 2DTXA 1TIPA 4HUJA 4B6QA 4B09A 3A9RA 2WD7A 3GJ5A 3PHJA 3SC2B 3UHFA 3FMPB 4EVQA 4NBVA 1C0EA 1HRDA 1MV5A 2QPLA 3CC8A 5D87A 5T3YA 4QJ4A 5JBNA 4NYMQ 2A92A 3DOHA 3ESQA 5SYMA 3OECA 1TKRA 2GXSA 2NUTA 5JAMA 4EUFA 5FFFA 3RSQA 2ICAA 2WILA 3L2OB 2I80A 3GPDG 2F9LA 1N9ZA 3KL4A 4RKEA 4YV7A 3TQFA 4HWRA 4FT4A 1YZVA 1ZINA 1U5BB 3OQIA 4KV9A 4UTVA 1QFYA 3G0HA 2JFVA 4MUBA 2I22A 1BROA 5AKXA 3H2GA 5LCXA 2AJTA 2BCJQ 2XA1A 2ZROA 5HJ7A 2DJ5A 1RAEA 2YHBA 4ML3A 3BD7A 1GAJA 2ZTMA 4LK2A 1I4WA 4ZAFA 1R8YA 1V2HE 3M4XA 4I9HA 4C4YA 1HFKA 2BEJA 4HXEB 3JAWA 3HFSA 3N0TA 4QE3A 1Z16A 4URWR 1ZVMA 4WNIA 2XYPA 3SXJA 5L51A 3W5CA 1PL6A 2QWXA 2J7PA 3R74A 2ZJ2A 1M8FA 3SSMA 1KO7A 1EJ0A 4FIDA 4G86A 2C95A 3EXG1 3FDIA 2ZXEA 3LQFA 3LPCA 4PZEA 2QL7A 2UVPB 3NC4A 2RHHA 4JXKA 4PHCA 3ZWWA 3NHAA 4GP9A 3S70A 3DFZA 4EFKA 5H8WA 1ABEA 1BMQA 3DYVA 1NMYA 1VGVA 2Q5QA 3AH8A 3TLCA 1OZAA 1ZIXA 2E89A 3BF8A 2B0JA 3ORQA 2O2SA 4FDLA 3DL0A 2RJ3A 3J7AC 3AB3A 2N0SA 5CDSA 4UAVA 4O2RA 3FB4A 1V4VA 4Q19A 2Z30A 4YFYA 2E4UA 2JAQA 1JSZA 4H0CA 4KQGA 3G1UA 3OLXA 3RBZA 4BFSA 2ZCUA 1TDJA 1KAQA 4JT2A 1F06A 4G0XA 2WUWE 3KJFA 3IAS1 5JNVA 2ZBQA 3JD0A 3MEQA 5EHXA 3AG6A 5AW8A 3ABRB 4J0JA 5CNMA 2I55A 1TYCA 3EDQA 1H6CA 3DLIA 1OSNA 1SULA 3P94A 4F46A 4TKZA 3ACBA 3ILHA 2BGJA 2V9ZA 1QZXA 1DIOB 2WP8J 3W5BA 3SK0A 5B1EA 1EGVB 4KQHA 3FPKA 1KDOA 3PLNA 1WCYA 2NXNA 2OVFA 1CY0A 4KQJA 5E6RA 4C1NA 1NX9A 2YMQA 1P9OA 5IZCC 4KVFA 4L28A 1RI4A 1M2GA 2H9IA 2XXBA 3IMFA 3W8EA 1N6NA 3YASA 5BW4A 1Y1QA 1Y3HA 3N2GB 4I9UA 3KLNA 3QNWA 4MB6A 4R71A 4YCJA 3U1VA 3DLCA 1ZZEA 2K4MA 2BUBA 2NSHA 2QAGA 3IOBA 3U49A 1EFAA 4ZYWA 1E98A 1NHGA 3QA9A 2C84A 2X58A 2RDMA 3AOGA 4CKBA 1YDEA 1M10A 3OQBA 4IDFA 4TXJA 1OJ7A 2WWVD 1PL8A 4C7XA 3ILXA 4YCBA 4RD0A 3RSHA 3W9YA 5JAOA 2G9VA 3AVXA 2ATXA 2FQQA 1KJQA 1VLVA 2OXIA 2Z83A 3SYMA 3CG0A 3M4ZA 4RDIA 5JSZA 7MDHA 1U8CB 4LJ4A 4XTCS 3FTDA 2V4ZA 2ORYA 2W4QA 4KAFA 3O1JC 3QKUA 2O8DA 4F6RA 3ZZ0A 2QR3A 3GNSA 4WW0A 3V48A 1QPBA 2BMAA 1MGPA 1ZN7A 4AJ4A 1EX9A 4OHKA 1E0AA 4K9LA 4JJ6A 1COWA 2QUAA 4OYHA 1MDFA 4RIFA 1EDBA 3PJFA 2A94A 2GFQA 5A5FA 3ZE8A 3HC7A 3HRIA 5F1YA 4ZOLA 5SZJA 5TGZA 3EVCA 3TOVA 4EY3A 3OLZA 4GOJA 1WUJS 4BNDB 2XDYA 3MRSA 1I1NA 1U2GA 5I9IA 1CS0B 3FHOA 2GM9A 3JQFC 1V1JA 1MAHA 2QLJA 1K6EA 2RHRA 4KIUA 4TV9F 4IY1A 3FB1A 2XSZD 3I9V1 3SYTA 1EDDA 2GJ4A 1YIAA 2WG2A 5PGMA 2VCYA 4A27A 4X60A 1ZCAA 2C5FA 3AEZA 3HO8A 2YHUA 3O4FA 1G7SA 3VR4H 1ENPA 2DAPA 1JSXA 2CLSA 3WNVA 1Z07A 1FC0A 2XZDA 2NNLD 1L8AA 3VHLB 1ZIDA 1P1IA 4P3KA 4LS3A 4N18A 5FA6A 5CAEB 3ZWMA 1IUNA 4FYYA 1F9AA 3PCRB 4LWOA 4TMWA 3U3ZA 3LXUX 2AOTB 4Z2AA 3KQLA 2EHJA 3DXFA 3GVXA 2NTNA 4HK4A 4R8KA 5KWEA 1USIA 4DLAA 4DV7B 4G41A 2WJJA 3A6ZA 3TQTA 1JR3D 2OR3A 2ABWA 1DQSA 1USUA 3COPA 3H5WA 1QGZA 2G6BA 4GL4A 3VC3A 2LRHA 2J85A 2DX7A 4M99A 1U0NA 1SCUA 3W2EA 1LQTA 3FYHA 3Q9UA 3W7BA 3FGPA 2P8JA 2DKFA 3AIKA 3OE4A 1NE7A 1QR2A 4AN0A 2CDBA 1SUCA 2IE0A 1CRWG 4R01A 5C31A 3TBKA 2IZ1A 1F20A 2JAUA 1LQ2A 4LMRA 4C7VA 3D8HA 3K73O 2AQIA 2RGCA 4IJWA 4TRRA 2WFAA 4CKEB 3CINA 4GLBA 1T3TA 4PZUA 2FMFA 1GN9A 1I6MA 2JD0A 2VRNA 4M1QA 3BH6A 4ODIA 3SQNA 4F71A 1YA6A 4DMRA 4MVXA 5LZ2A 1E2HA 1U3CA 2RKOA 1MTZA 4ISBA 4D4HA 1U2DA 2IU4A 5EJAA 5DX1A 1B14A 4ZD6A 5JMOA 2GEFA 2WHPB 4Y30A 4L0CA 1NP7A 4KPUB 1NVDA 4WEOA 2FJPA 3IA2A 3Q7RA 1PT6A 3QXXA 4PYRA 5GGXA 3SE0A 3ZHYA 4C4PA 3Q3CA 4JZYA 2WU4A 1SUEA 4EVIA 4RS4A 1C3OA 3IAFA 1WKCA 3CZ9A 4B7CA 4J7AA 3W6PA 3WK4A 1K4KA 3QLTA 2AUNA 1PEYA 1ZCZA 2H07A 3GXBA 4CM8A 1JQ3A 4QKQA 3RC7A 4DC9A 1ZQ9A 1XZQA 3PRHA 4ZTBA 2YZ2A 2PJUA 3AG5A 1UKBA 2HMVA 5I8ZA 5A5GA 4PFQA 4V0RA 1EG7A 1JJAA 1TM4E 2Q4BA 2W2LA 3UWDA 4UZSA 4RQUA 5F73A 5FA8A 1TM7E 3ROMA 1QNFA 3KETA 2XECA 1LBHA 4G1MB 2HCBA 4P0QB 3QVOA 1O95C 1TECE 2FSFA 2PWZA 4MUJA 5M29A 3L4EA 3LGAA 4HN2A 2PWPA 2DCMA 3UGKA 4AZ3A 4EHJA 4M55A 2GK3A 1VYHA 4HNAA 4CFYA 3HRHA 3EQ8A 2ZJ4A 2YRWA 3ZNPA 3DKRA 4BNKA 3W5SA 3RSZA 4O0LA 2NTVA 2X3FA 4LGVA 3WNZA 3NIBA 3O84A 5A9SA 6LDHA 4GD3Q 4J0CA 4LRWA 4EDHA 1GG5A 1ZK3A 4WIAA 5CH5A 3ZYZA 1WHSB 4ZC1A 2LE0A 1ORDA 1RWWA 2M98A 3H4TA 1GIAA 3N2NA 3EBOA 1YZUA 5IMSA 4QVIA 2AG0A 3M3DA 1QV7A 1CUSA 1U99A 2R66A 2RGDA 2BKXA 3LUCA 4GR5A 1NA5A 1JB9A 1KSGA 2O8BB 1HC7A 5B2EA 1PJ2A 4DDHA 1G63A 2REXB 5KI6A 2FN8A 2TSYB 5B58T 4X45A 2GKGA 3LC2O 1U7ZA 4H4CA 4ND6A 3WJAA 2P6PA 3OSUA 2Q7DA 1JIKA 4K6MA 5LVAA 4EUHA 3ICOA 2WU0A 4X1OA 4FMDB 4BKUA 3HCFA 1VI5A 1JWLA 2XUAA 1VBMA 3BE5A 2DUWA 1IJEA 1YVRA 4KMMA 1FYVA 3B2EA 1I4LD 1CQZA 1KDTA 3ICEA 1KDPA 1TJ3A 3IEUA 3L6BA 3TFWA 2VK1A 4C14A 4AF8A 1XD2A 4I1OA 1GPNA 4H4EA 4O4HA 3RTGA 3HCCA 4GNKA 4K7JA 4X84A 4MV3A 1KEKA 1Z4JA 2J3JA 2WSBA 5AM5A 1MFPA 5DULA 3IP1A 4KIWA 5LSAA 2DG2A 2XQVA 3TS1A 4RHTA 3P4XA 1C14A 1Z8DA 4LHEA 3G0DA 4DAEA 5IKPA 3KKLA 1TA4A 5SZKB 1L5MA 2P9BA 1DAKA 2GM4A 3ANSA 3QENA 4U9UA 1TJNA 5FO0A 4G1EB 4F84A 8AT1A 2QMHA 2C04A 5K3FA 5LBUA 2AH5A 2WB2A 3GRVA 4RO0A 1KAGA 1A77A 4PGFA 3RLIA 1PT5A 2CE7A 3ELWA 3F4KA 2GR9A 1JHQA 1RI5A 4Q9NA 2QA5A 1TZJA 1E99A 2GARA 3CVYA 2CVZA 1X7XA 3DMTC 1AUPA 1O6ZA 4Y9SA 5KYXA 4YJ3A 3PQ8A 3L0YA 3T9FA 2H2GA 1TT5B 2J08A 3BSSA 1B1CA 3HDQA 1XZLA 1G98A 5CYGA 5HOQA 1GY8A 1M7GA 3D4NA 1XXHA 4A0SA 3NOOA 1QAOA 3QVVA 4MUGA 4ZDJA 2F1KA 3TZHA 1NWCA 3FE2A 3MMNA 2BM1A 1UADA 4G97A 3ZVKA 2HRZA 4WSOA 3WGMA 2BBWA 5E7QA 2XQJA 3RVJA 3VHXB 4BPRA 1TTTA 5IW8A 4XJXA 3GEEA 4ED9A 2DTEA 1Y42X 1PHPA 2DSTA 1W30A 1T4GA 3REOA 3TEFA 5CB4B 4PLZA 3H75A 4R3NA 1AVTA 3NM4A 1GZ6A 2FR1A 1CRLA 5EIBD 3PQ5A 4A82A 4CL0A 3CSUA 2DPGA 2NSDA 2VH1A 4KDFA 4WZAB 5BUQA 3U09A 1IN6A 1M5UA 2FFRA 3B1VA 4I8IA 5F77A 3MM4A 5G1NA 1W0KA 1J9EA 1ONSA 5KAMA 5T6BA 4BLQA 3L84A 4CN8A 4O3FA 5ADVA 4BQOA 1JALA 3BKWA 1RADA 4LDZA 4MW1A 1IH8A 3SC6A 1Y4AE 1DKOA 1NRJB 4A0GA 1YB2A 4QQRA 1G8HA 5L7WA 4DDVA 3ZHTA 3RRBA 2CUZA 1WBJB 5IABA 4G0MA 1U7OA 1FIUA 3I6QA 1PQYA 4Z9AA 4HP8A 1GG2A 1GT6A 1C0IA 3QHPA 4Z4HA 3C3PA 4B46A 2ZTLA 4PZDA 5JAPA 1A9SA 4E33A 4G85A 4ANFA 2WABA 3SHQA 1H1TA 4KQ6A 4CMKA 4LDNA 2VCEA 4OHZA 5LZ9A 2ZJ7A 1AUQA 3SFTA 1SMKA 3BF7A 1HE3A 1NY6A 1R0RE 2X6RA 1SBHA 4AT1A 3Q8LA 3EN0A 4BJ3A 4CE6A 3B6ZA 4HDRB 3ZQUA 5FAKA 4LF6B 4AX4A 4JV5B 3JATB 4B47A 4I4IA 1RQNA 3O9MA 4TMZA 4ZZ1A 3H16A 3OBIA 4TYPA 2AJLI 4N5DA 3WHPA 3K32A 3W6NA 2I7DA 1JB1A 2XF2A 4EBBA 3T7JA 4ZYXA 1TZMA 4C89A 3D3WA 2JI6A 3FZQA 2NYRA 3EGXB 3LVFO 5D51S 5L3ZA 1E3MA 1H6BA 5E7MA 4EABA 4ER3A 2CL5A 3K09C 1O9GA 1WPGA 3CPHA 4H6PA 2DP4E 4X8HA 1JH8A 2ZYIA 3L6CA 1DJPA 4OB8A 2IXGA 4H6WA 3LYAA 4A0FA 3V4FA 5K05A 4IDOA 1YR7A 1UC4B 3CGGA 2A9OA 3NBMA 1HQKA 2ZULA 3G0OA 5T41A 1A1SA 3KEMA 3NOQA 4F04A 5KMGA 4EHNA 4FOSA 2WPNA 2YBEA 4MGEA 1OU0A 3TW6A 2GLXA 5JY6A 4HNTA 2C2OA 1P4HA 3V1KA 2YQ4A 1XQWA 3PWZA 4DLSA 1PTJA 3H1BA 1W1IA 4OLHA 2D74A 3EZXA 4F85A 2AF3C 3AEUB 2ORIA 5JMPA 2GK7A 1FW6A 1G20A 4IXMA 4M49A 1T25A 3FYUB 3DM5A 5C8XA 3K1TA 3QY9A 3TKLA 1WCV1 1YZYA 3CLSD 2G8LA 5FL7D 2OBYA 1LS6A 4B35A 3UAYA 1Z34A 3QMWA 4RJLA 4M4SA 3QKRA 1D7AA 1TCAA 5ICGA 1PEAA 1RD4A 3TMYA 1I4OA 2AN3A 1Z7BA 3P9XA 3PK0A 2WMOB 4NNJA 1KPGA 2GBGA 3WDMA 4TL7A 3WQHA 1PFQA 4WECA 1E3WA 2JAOA 3HY3A 5EERA 4Q9AA 3UA3A 3AW8A 1KY4A 3M6FA 1Y8ZA 3HCOA 1QG2A 3C3KA 4B3CA 1KKLA 4DUPA 3K70C 2QMYA 3D7RA 1II8B 1ETUA 1CT9A 1XUOA 1AGYA 3JYHA 3MUFA 1U63A 3B51X 4AXBA 1OKKA 2QPAA 1NR1A 3Q4GA 1UWVA 2M6KA 3VR6H 2Y1CA 4BU1A 4WVFA 4RY0A 3OA2A 5LMUB 2ZSAA 2E4XA 1JR6A 2YNMC 3KJGA 5EJ5A 3IBGA 1GV0A 3UBTA 1NQTA 4NMWA 4N3CA 1USGA 1FVXA 1N2EA 3OKAA 5IT5A 2IV7A 2Z6AA 3BSYA 2DBRA 3R3UA 2Q28A 3UJDA 2ZIEA 4UDYX 4PY2A 1HOTA 2XWSA 3UVEA 5HKAA 1W581 1GZVA 2QG4A 4Z9YA 4OX9Y 5CFMA 2PGLA 1UIRA 1FFXB 3DHEA 3SBDA 4ZV9A 4MV7A 3U26A 4REOA 2BELA 2P2ZA 2FEOA 2G5PA 3AO0B 2DF8A 3OP4A 2VBCA 1SC3A 2FG6C 1SC4A 3BILA 4YROA 5H68A 3OJWA 1E8DA 2AQKA 2VXCA 4QU8A 4BDSA 1J6UA 1BH2A 4FWTA 4M8NE 2AEEA 1RWQA 3K0EA 4RIHA 1GRVA 2ZYUX 3U7RA 4DN6A 3A28A 4IHJA 3UK2A 1JKJB 4PXYA 2JIDA 3GRUA 4XA8A 4HWSA 1VCNA 3OWXA 3G9TA 2Q5OA 5FPSA 4B6SA 3QUSA 4MVCA 2MOKA 2ZRFA 3GEMA 3H7AA 4MX8A 1PFUA 5BWLA 5ITWA 5KWSA 1MZPA 1ZZGA 3K92A 1DI0A 4G0ZA 2P2LA 4FFWA 4IYJA 3I83A 1H3FA 4GRAA 4KNYA 3I0MA 4TYYA 3OCYA 4PYQA 4ERXA 4KH1A 1GPYA 2H2HA 5LOVA 1BX1A 1KWKA 4L7VA 1FDOA 2RKWA 3FCAA 4B6EA 2QN2A 3INYA 2CFCA 5IPFA 4ER6A 4JYAB 3FUTA 1G5FA 1O1YA 2FP4A 3IAM1 1PD0A 3F7OA 4KFSA 4PYJA 2IGBA 2GNAA 2V0CA 1CZKA 3IJRA 5J5VA 3QA3E 4NMXB 3BFPA 4FDUA 5CDGA 2BC9A 1XGKA 3PTZA 5KTMA 4N5HX 1HTTA 1P17A 2G9QA 4IVRA 1L4MA 3ESZA 4DLBA 3LUGA 2CNNA 4Y1RB 3OY7A 6YASA 1U5AA 2GN2A 3FVQA 3LTEA 5ESXA 3W1VA 5EKSA 5AKZA 2ZJ3A 4Z53A 3V1TC 2B94A 1HH4A 3O8BA 3GPBA 4KTVE 3VSCA 2W2VA 4X00A 3TSWA 4QRIA 1U9CA 3CZQA 4P4GA 4QIHA 3NKFA 1Z2CA 3ZTTA 1T3SA 1D03A 1ZUIA 2HOQA 3OZIA 3DT6A 4BATA 3SDSA 2BIFA 2BH9A 4OQ4A 1TK2A 3TSCA 3V97A 3CG4A 2ROQA 1D2CA 1KL7A 3EQ7A 1FDSA 4B3XA 2OGWA 4M88A 3O4RA 4DDMA 1C8BA 1M74A 3ERCA 3AFMA 4KPGA 3DE6X 5DIFA 4LDRA 2QRVB 4F72A 2XADA 4DMUB 3QPUA 1IJKA 2VTVA 2YXEA 3TG2A 1JP7A 3FYCA 4O2LA 4XWGA 3R8CA 4EKIA 1CU1A 3LO5A 3FVTA 1RYBA 1MB0A 3CX6A 4G25A 3AUUA 2CMFA 3HKDA 1YZHA 5AKLA 2D0DA 1C9DB 5EMLA 2V9PA 5HUJA 2B6HA 3GZ4A 1M2OB 1A50B 3VZDA 1GN8A 1O08A 3O95A 4AW9A 4YJ2B 5EC8A 4NDAA 4B79A 2P2SA 4RYLA 3GP3A 2O6LA 3ZU5A 4GMXA 1FK8A 1IAQA 1RQ2A 4MB0A 5M5BA 1JPVA 4EW6A 1YJ5A 3QUAA 4EUEA 4FM9A 1OBVA 1RPNA 3S68A 4LF4B 5AXCA 2YZNA 4ID9A 5KNDH 4TTTS 2XUKA 5JCJD 1OHHA 3MGAA 1AX9A 4N40A 3ZLTA 4HXGA 2Q5LA 5BN1A 4UMVA 1EG2A 3N70A 1VSTA 4WCFC 4ALLA 1V1MB 3DDCA 3AM5A 4MCAA 2BLNA 3H2YA 1NUAA 3BWVA 1KRWA 2G0NA 2UUPA 4LBYA 4B5LA 4IGIA 1T3ZA 2VUHB 2CLEB 4UXHA 3VC1A 4AUMA 1OAAA 4II7A 3E9EA 4S1TA 3I6MA 4JVMA 1WXIA 3DBLB 4DBLE 3O0TA 3PZRA 3L0IB 5DBHX 3IX7A 5JXHA 4Y9RA 4J7XA 3T0GA 5EWLB 2VYVD 4TVSA 4HLDA 4M7RA 4H77A 1ZUD1 5K6AC 2J6BA 1PJSA 4IIHA 2EQBA 4IM7A 4E15A 4QAQA 1ZR2A 5EFOA 2Q9BA 1EE9A 1Z5ZA 3DEKA 1J25A 4N6OA 4WJLA 3OHPA 2B69A 3PEUA 4FJ2A 2BZ1A 4FVTA 3PXBA 1T2CA 4QDTA 4YMGA 3Q0TA 4NABA 4N3BA 2PFGA 3F6YA 1UAYA 1OI3A 1P2DA 3OIWA 2IFTA 2W2KB 3ELUA 1OI2A 2B3DA 2OCKA 1C30A 4ESVA 1PGOA 2R65A 3EISA 1I8TA 2KX7A 2W0SA 1IDOA 4CG1A 2PQ6A 1RJFA 3W34A 3ZDEA 5AW1A 2VHVA 2PVPA 2Y92A 4QATA 1IULA 1UM9B 3UY4A 2JEZA 3AUJB 2A9FA 2JASA 3CLKA 1Z56C 4FZVA 3BE4A 3KJXA 5IJWA 1UOQA 2FZLA 3ZVRA 4FOOA 1U81A 4GQIA 2MHCA 2ZPUA 4P0PB 1FUEA 3H5AA 2QJFA 3DKKA 3FDZB 3GRAA 5AKEA 3I72A 2JK1A 4JZKA 1E1NA 1CPYA 1UIMA 4N01A 3IDSA 3D59A 1YFKA 3T1VA 4LNUB 4BZPA 3THXA 4ZDKA 3QVXA 4GVLA 4Z0HO 4I1SA 5HS4A 5B30A 3KAKA 1CRPA 1PS9A 2HSGA 2MYPA 3DC7A 3Q8KA 3BWYA 2ZUWA 1KBZA 3BJIC 2VDUE 2VHZA 1WAMA 1ZESA 4FGZA 1GL9B 3ESCA 4MKXA 4HT3B 4XWWA 5C4MA 4O5OA 1WABA 2ZIFA 2GBPA 4KGXA 4NNPA 3EGWA 3VNBA 2X8JA 3CW8X 3OQVA 3ONWA 1Z6TA 1NT2A 1E1YA 1FYFA 4QYWA 3TEMA 5KBYA 3CZRA 1JFFB 3EEFA 4ZT2A 4RZ3A 5E0KB 4HAUA 1VPVA 2O2ZA 2XHZA 3IP6A 3MQFA 2V6IA 4MJXA 4V0OA 3A26A 1GVNB 2D2FA 3EVFA 5GJBA 3JV7A 5IYZF 4C7OA 1LFDB 1T1SA 1SB9A 2Y1DA 4XQCA 4L5JA 4X6YA 4CU2A 3PC3A 4V3BA 4BE7B 3HB1A 1JAIA 3GUCA 3VX4A 1A8UA 3W5HA 3V8EA 4X63A 1T36B 3PGJA 1STOA 4MVJM 1Y8RA 2WEKA 2ZVPX 4NCNA 4P4UA 1HTBA 4GP6A 4IVQA 1EWQA 1P7WA 2Y0DA 2GN6A 4TMTA 5KDLA 2JLWA 2QB5A 1B74A 1FSZA 3GI1A 4TS3A 3K8ZA 5AM4A 1NXPA 3ZIAA 2EJBA 4OQLA 1GITA 3KAPA 4B7XA 5K3OA 1J7JA 3GFGA 2HJRA 3RVOA 4QJ5A 3R3VA 2HMWA 4OBEA 4Q48A 2XYGA 3KPWA 3EE6A 1QIMA 4I81A 4LW8A 4KYUA 1DIAA 3EWNA 1M8GA 3HJAA 4GX1A 4OA5A 4CKCA 2FGKA 2H57A 3KB1A 3UT6A 5JH7A 1R6BX 3FUXA