1I30A

E. coli enoyl reductase +nad+sb385826
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
256
structure length
248
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
publication title Inhibitors of bacterial enoyl acyl carrier protein reductase (FabI): 2,9-disubstituted 1,2,3,4-tetrahydropyrido[3,4-b]indoles as potential antibacterial agents.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 89
structure length 248
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2001-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i30A00
4KDEA 2BLLA 4GX2A 2I3GA 1HDZA 1IL0A 4K6FA 4XQ9A 3RROA 2POQX 5CP8A 4AJLA 4UVEA 6LDHA 1GEGA 1WVGA 3GK3A 3SC4A 3AU8A 3VH2A 2CF6A 2QRKA 4CQMA 4D3DA 3HN7A 4HFJA 4BNGA 3KETA 1C0LA 1ZCJA 3RKRA 1E92A 1LRJA 3QJ5A 1Z82A 4BO4A 3GPIA 1C3VA 4KOAA 5A4DA 3GUYA 5COAA 1G1AA 3K2BA 1K2WA 4RF4A 3JD4A 4QO7A 5JO9A 3WLFA 1H5QA 5AOVA 1WZIA 4IPTA 3NRCA 1E1KA 1U5AA 1X1TA 1V3VA 2X5KO 3GGPA 4CL3A 3C85A 5BSGA 3PHHA 3AWDA 1I24A 4UVDA 4MP6A 3JQAA 3JQAD 4NFSA 4EW6A 4XGKA 4E13A 4YAGA 2IZ1A 1P1JA 1UXJA 5CPBA 1ADCA 2VTDA 3M2PA 3ZWWA 5CEJA 1E7MA 5EESA 1VM6A 3ZNOA 3QY9A 4XR4A 5FF9A 2IZZA 5L95A 2DU8A 4RVGA 1VJTA 3VH3A 2D59A 4FFOA 2VN8A 2EWMA 3MJEA 4IBOA 2ZB4A 4UUMA 5C7LO 1KVRA 4KMSA 2P9CA 4XA8A 2W2KA 5L4LA 1UXIA 3WSVA 4RGBA 3L6EA 3GVPA 2IEDA 2DPGA 3WSWA 2E48A 4I9NA 1ZH8A 3HDYA 3GG9A 2UYYA 1Y8RA 4JJFA 5A5EA 4PN3A 2PZKA 1HDOA 1BXZA 3H4VA 2YV1A 5DOZA 4B7UA 2WD7B 3DAPA 2YV3A 1DFGA 2Q50A 3AY6A 3D0OA 3GR6A 3O38A 4GL4A 3STHA 3OJEA 4YR9A 1OMOA 1GR0A 2P9EA 4NFYA 5GMOA 3K5PA 3FD8A 1DIHA 3TZ6A 1P45A 1ZMOA 4UVHA 2OUIA 2QZZA 3PJEA 3FF4A 5T8KA 1PR3A 3G0OA 2HK9A 3UXYA 4NIMA 4CMIB 3UICA 1F14A 4Z0PA 2C2XA 4CM1A 5C3MA 2X23A 2I5PO 3H7AA 5KJEA 2VUTA 1OFGA 1NQOA 4AJOA 1YL5A 3NT4A 4N5MA 4MVJA 4MVJD 2ZYAA 1PJSA 5L40A 4J7XA 4JN6B 1ZVMA 4ZVVA 4BNXA 2NUAA 4NBUA 3EGOA 3UW3A 2NTVA 4PRLA 2EP7A 2AE2A 4CLOA 4F6LA 4Q9NA 3I6QA 3KSUA 4Q39A 1EVJA 5DNAA 4B79A 4BQRA 4TKMA 4IDEA 4WCFA 1O0SA 5I8ZA 3FN4A 1YONA 1OZAA 3RUFA 1A9ZA 4E31A 2BI7A 4B4OA 2GD1O 1LSUA 1EFLA 3B1KA 3IUPA 3A28A 3T7EA 1EZ4A 2CZCA 1BWSA 2PD6A 3DO5A 3ONDA 4ZRNA 4B4WA 1QYWA 2IDZA 3CPSA 3DHYA 4MKZA 3PFWO 5G0SA 3ZDFA 3PHJA 3PEFA 1PJ2A 3ZNPA 4WLOA 3GHYA 1UP6A 1FDSA 1X1EA 3L6DA 1MG5A 1ENPA 4H16A 1PGQA 3RKUA 3BTSA 2VHXA 1HZZA 4FN4A 2VRBA 2PGJA 4MVJM 3ASUA 1I3KA 1GPJA 3E5RA 1C1XA 3KRTA 1TT5A 4NG5A 4GX0A 3TRIA 5KJFA 1YKFA 1HT0A 4I5DA 1GFSA 1XG5A 4OSOA 4TKLA 1OAAA 2HMUA 3MJSA 1Z74A 3O03A 5K0ZA 1HDCA 1A4UA 2GN9A 5AVOA 4OGWA 5A06A 1VKOA 4CPDA 3CKYA 4BUCA 1LDMA 3S2GA 2B5VA 3PK0A 1GPDG 3GC6A 4ND3A 1E3WB 4WEOA 2Y1EA 3DMYA 5ITWA 3OECA 4KUEA 2Q1UA 5JY6A 2RH8A 4CLRA 2PFGA 3INGA 3DMTA 1U4SA 1R66A 4WUVA 1LSJA 4Q3AA 3TNLA 3ZW9A 4CMAA 3OM9A 4DQUA 4BKQA 1NVGA 3WIDA 1HF3A 5DCYA 4BKUA 1LSOA 1W73A 2IEBA 4D3FA 1JVSA 4JLWA 3FNEA 5JXWA 2CVOA 3BHJA 4YRBA 4NU5A 5LDHA 3KEQA 1Z75A 3FSRA 2UVDA 3DZKA 1OI7A 5BNTA 1ULSA 4DA9A 3M6IA 3CSDA 3I9OA 4GMGA 4CMJA 1QMGA 2AEMA 4A10A 4IJUA 3DHNA 3ICCA 3GDFA 3O9ZA 4CV0A 1ZMTA 2Y67A 4BNHA 3F5SA 1B14A 1Y81A 2QG4A 2PGDA 9LDTA 1KEWA 1XR3A 3VPSA 2V6BA 4M54A 3R1IA 1Y8QB 2NU7A 3ZU4A 4INAA 3K9QO 3RC2A 4CLDA 4XZ3A 3RCBA 4YJGB 1HDYA 4Y6PA 3JQGB 4NI5A 4NHEA 3W4JA 5IXYA 4OXYA 4Y6SA 4DXHA 4GWKA 4OKNA 5HS6A 3RWBA 2PZMA 1D1TA 4MDHA 3I9NA 2GNAA 2Y93A 3S2EA 4R54A 2H6EA 4RQTA 4W9NA 2J5KA 2OP0A 4NJMB 4I5GA 4W7IA 3C1AA 4LCJA 2Y0DA 3ETGA 1X13A 5I7EA 1VE9A 1PGPA 1BRMA 1SCUA 3GN2A 2HU2A 3N58A 5IDWA 5DOVA 5EINA 3RI3A 2VYVA 3HQ4O 5LDGA 1V6AA 2HK8A 4I9UA 2PR2A 4R9RA 4YT2A 5DCUA 1DRWA 2RH4A 2R2GA 2PGLA 2OHXA 2ZYDA 5T8KC 3WMWA 4DYDA 2Q49A 2XXJA 5CG1A 4CM5A 1LJ8A 3ZN2A 4QECA 1P0FA 2Y68A 5JFOA 4ZQHA 2A4KA 3CZRA 4IXWA 3PTZA 3BMCA 1U3VA 1TB4A 1CQJA 3F6YA 1HYEA 3OQBA 1SBYA 5CEFA 1HDGO 1V3TA 2DVMA 3FTNA 5G4KB 4R51A 3NDRA 3KEOA 2VYNA 2VYND 3GVCA 3HFGA 4UEKA 4PRKA 3AI2A 4YACA 5COBA 2Y1OA 3JYPA 4CMKA 4KDFA 1W8DA 4FJ2A 3WNVA 3BA1A 1F8FA 2NSDA 3SLKA 4DVJA 5DULA 3DL2A 2Q4EA 2P5UA 2QRJA 1CYDA 1NQTA 4J7UA 1AN9A 3G1UA 4Y67A 1ZKMA 3UGKA 3OJLA 1XU9A 1FF9A 1HLPA 3UFXA 1PIWA 5AXAA 1ZIDA 4LSMA 4ALLA 5IF3A 4DMMA 3D5TA 3E1KA 3RUEA 3MJTA 2F00A 3HHPA 4J2HA 3U4HA 4E5KA 3ANLA 3DZFA 4BGEA 1C1DA 1DOHA 5I9LA 3PHIA 4DC1A 4J9UE 1H6CA 3A14A 4F45A 3P2OA 2ZJ1A 4E2ZA 2UUPA 2ZK7A 3BMNA 2UUOA 3C7AA 1KC1A 4A26A 2PZJA 1XQ6A 1PS9A 1MFPA 4HY3A 4PLPA 4TMFA 4YJHB 2JJYA 3DOJA 4NBRA 1NXQA 4P8RA 1PEDA 1V0JA 2B4TO 1PJ4A 4II3A 4EUEA 1VC2A 4CMEA 5I7FA 4GKVA 3DTYA 3K73O 1DC4A 3LF2A 1GEEA 1XGKA 1QV7A 3RIHA 3PRJA 2X9GA 2O48X 2PTGA 3WQRA 3DFZA 1KOLA 3S55A 1DPGA 4OOFA 2GGSA 3GDGA 2YUTA 4RF5A 5CDTA 1ZK1A 4RPKA 2GLXA 2X0IA 5A04A 3BMOA 2PKRA 2YZ7A 3IC5A 4GMFA 4IIUA 5L7TA 2HK7A 1P77A 1XLTA 3KB6A 2BFAA 2FHSA 3WX0A 1ULUA 3DTTA 4LRSB 5KWEA 4OO3A 4O59O 3M1LA 4PLVA 3D3WB 5U1PA 1LLDA 1M76A 5KOIA 4QEDA 3HB4X 3NJ4A 4CQLA 2E4AA 3RC1A 4M87A 3H3FA 4XQGA 1YL6A 4IY1A 5CDSA 1B16A 4XDZA 2FP4A 1U28A 4RPLA 1YJQA 1YL7A 3ZHBA 3WJ7A 4MVJG 4I08A 4ROSA 1H93A 3LC7O 1YOVA 3PP8A 2UV8A 3VDQA 1XA0A 4DBZA 4OQZA 4R4JA 1O9BA 2VNSA 2VZ8A 1Q7BA 2ZB8A 1J49A 4KP7A 3ASVA 4GI2A 2RCYA 4QX6A 4GAEA 3EAGA 1XKQA 5IJZA 4A73A 4BNWA 4UUOA 3OA2A 4WNIA 1T2FA 2VWPA 4CV2A 5L9AA 3H8VA 1LA2A 2W8ZA 1JU9A 3K92A 2AQ8A 3NTRA 4MIEA 4NU6A 3GA0A 3WFJA 5THKA 1N7GA 3GLQA 4IINA 1GYQA 4R9SA 4J9VA 3ZH2A 4NBTA 1YB1A 2FPGA 3IL2A 5F3RA 1GZ6A 1BVRA 4AG3A 1QR6A 4LK3A 2X8LA 3ANNA 3GZNA 4OYRA 4P22A 4CM6A 3JQ8A 3Q9UA 4S1VA 4BL5A 2C07A 3GVXA 3GZ4A 1ID1A 3RAJA 1ZSNA 1OC4A 1DC3A 1KEUA 4NQZA 2NVUB 4MVJI 4WJZA 3C1OA 4ESOA 3FBGA 1GV0A 4EJ0A 2HKIA 4PLWA 3SBOA 3L9XA 3QIVA 3Q11A 4W9NC 4MKXA 1NPDA 2EW8A 1Q0LA 1F0YA 1P1HA 2D3TA 4XGNA 4YAIA 3U4IA 1DDOA 1NPTO 3MWDB 1E3JA 1JQBA 4Z9XA 3WGOA 4A03A 3B6ZA 3DZHA 4ZN6A 1LC0A 2C7VA 4AJKA 3O8QA 1MLDA 2B36A 1CERA 2E49A 3PYXA 4DL9A 4JROA 3WGTA 1HLDA 4H15A 1MG0A 3A4VA 3DBLB 2J6IA 1JN0A 3G49A 3KYBA 1DHRA 1T1RA 2AHRA 1SB9A 3JD0A 3FNFA 3C8MA 3GFBA 7MDHA 4BV9A 2HMWA 3NYWA 1HE3A 2O3UA 1RPNA 4B4UA 1GADO 5IAAA 2EG9A 3ST7A 2WEKA 4KTVE 3HG7A 2SCUA 4D42A 2ZTUA 5JYDA 3HZZA 1L1FA 3VTFA 4L73A 2O3SA 2J3KA 4OSPA 4IDCA 1I33A 1Z73A 2C7GA 5CDGA 5BT9A 3D4NA 3RD5A 1J5PA 4M86A 5DN9A 1P9LA 1VI2A 1EDZA 3D7LA 1R15A 4FJ0A 4AFNA 4ALKA 1LQTA 2O7SA 2YFHA 3DONA 1VJ1A 1UZMA 4LRTB 1PWXA 1QYXA 3B70A 1GDHA 4LW8A 1DAPA 1UDBA 4YXFA 1V35A 4KUGA 3F5QA 2NQ8A 4BGUA 3PWSA 1OOEA 2AW5A 5A9SA 4NBWA 5GZ1A 5TC4A 2GUGA 3BIOA 2HDHA 4HFNA 5IFLA 1R4NA 4ALMA 2Z1MA 5HWSA 3JQFA 2J3IA 3HDJA 4J7CA 4UUPA 4RVUA 1DC5A 1FDWA 1XYGA 1PGJA 1E6WA 3WXBA 2F1KA 1BDMA 2GF2A 2I65A 3JQ7A 4J90A 5AXCA 2O3QA 3OBBA 1KY4A 5I9MA 3DQPA 5K9ZA 1HETA 1LDEA 5TX7A 4L4XA 3JCZA 4WE3A 4YVFA 3NKLA 4NBVA 5F5LA 2RHCA 8LDHA 5G0WA 3U5TA 3U4CA 1DIBA 3LF1A 4LISA 2JKVA 5HS4A 3OF2A 5H83A 1FDUA 4QO8A 1ZXBA 2AEJA 3EY4A 5IDQA 3WQQA 3EZYA 4GLOA 3WMXA 1S6YA 4FC6A 3RFXA 3PI7A 1P33A 4LSWA 4RVSA 1GL3A 2Q2WA 3HJAA 4CMCA 1I3MA 4GVLA 4GSKA 5JAQA 2NADA 3SLGA 3GRPA 3RVDA 4B7CA 2O23A 4QXMA 2Q1TA 4ILKA 3ZI0A 5JDCA 2WMDA 4XRRA 2Q2VA 3GGGA 1SB8A 4CM8A 2EJVA 3X2FA 2DBVO 3FRJA 5T64A 2DTXA 4EBFA 2QQ5A 2XF8A 4XWYA 1V8BA 4RLSA 3D64A 4LN1A 5CHEA 4RDHA 4FFNA 5G0TA 1X0VA 4CQMD 3JD1A 3PPIA 2C29D 2EKQA 1E3LA 2RBEA 3E48A 1UAYA 2C59A 1P74A 1W0CA 3OEWA 2CVQA 2OBYA 4TSKA 3ROQA 2IE0A 1O8CA 3KYDB 3DBRB 3L9WA 3TWOA 1X0XA 1PZHA 2C2YA 1LLCA 3ENNA 3RU9A 1ZSVA 1PL8A 4NZ9A 5ENDA 2YHIA 5CDUA 1U3TA 5JO0A 3RBXA 2Q1SA 1KVTA 2CDAA 4IJWA 3ZWCA 4AVYA 2AG5A 2EIHA 3GRKA 1S7CA 4FJ1A 3U3XA 1I10A 1I2BA 3DBVO 3V2GA 3RFTA 4FGSA 2AQIA 2DBZA 2ZTVA 4M49A 1MXHA 4I5FA 2PK3A 2P4HX 4N54A 1ISIA 3U09A 4WECA 3LT1A 3DOCA 1EK6A 1XCBA 4L4SA 3BTUA 4C7JA 1BG6A 4R3WA 2JD0A 3Q2IA 1U4OA 3W6ZA 2Q1WA 2AG8A 1BXGB 4I9HA 4X54A 4MP3A 3H5RA 3KHUA 4S3MA 3UCFA 4JGBA 3UH1A 4LGVA 4CJXA 4TVBA 3DXFA 4EUFA 1XU7A 5L3ZA 5C7IO 4FD3A 3I1JA 2YJZA 1KC3A 3HB5X 5JLAA 1HYHA 1G0OA 4HV4A 2AQKA 1MC4A 2O3RA 5JSFA 1G6KA 1KVQA 3HN2A 3GHHA 3LK7A 5CPFA 4OOEA 1JKJA 3G3EA 3LT0A 4WASA 4CM4B 1DO8A 3WBFA 4IDBA 1QORA 2J3HA 4BNVA 2NACA 3FTPA 3QWHA 4LCEA 1I0ZA 2PZLA 4WPGA 1NASA 3IKVA 4L9RA 4XR9A 5ICSA 1JAXA 4O1MA 2H63A 3BMQB 4PFJA 4EZBA 2I66A 4EDFA 2Q45A 1HSZA 1VRWA 4RVDA 3CH6A 3DB2A 4ZD6A 3NGXA 2VUUA 5L51A 5EMHA 2FR0A 3ENKA 1LI4A 4E6PA 3WJAA 4N5NA 4E2YA 1MV8A 2G82A 4HBGA 1PZFA 3WWYA 3RJ5A 1P1RA 2GN4A 4AJPA 1RJWA 1PL7A 2VZ0A 1U7TA 4F6CA 1YJ8A 5TLSA 1T2DA 2VZ9A 4JIGA 4H7PA 4BMVA 4YJFB 1EDOA 5L7WA 1ZZEA 1EVZA 3NGLA 2A9FA 4J1QA 3R3JA 3INTA 1A72A 3PGJA 2PKQO 2GPTA 4OIMA 4A0SA 2IZ0A 3GF4A 4NJOA 4TVOA 4ND1A 3T4XA 4M8SA 3GAFA 4OKIA 4RJTA 4CV1A 1YE3A 2ET6A 3I83A 4OMUA 3TPCA 4E5MA 1MP0A 5LCXA 1NVMB 1EBUA 1YQGA 3Q9NA 1BW9B 4PLTA 1P1FA 1VSVA 4GVXA 4JJGA 2WSBA 1VPDA 1DLJA 3JQFC 1ZUD1 3KSDO 1GUYA 1YQXA 2V6MA 2EKPA 1T25A 1BMDA 4A27A 4W4TA 3NTOA 5JDIA 3PVZA 5ER9A 1YH3A 5DBFA 3ZWYA 1IY8A 3FWZA 3FHLA 1IPFA 1GCUA 1XWFA 1RM3A 5AXBA 4D3SA 1Q1NA 2EP5A 2WD7A 4FBGA 3QVWA 3JQ9C 5IG2A 5T6BA 2X86A 4ZA2A 1YRLA 3K8ZA 2CUKA 5KVQA 2WYWA 3BHIA 3GY0A 3ULKA 2CDCA 1DJNA 3TZHA 4RORA 3K6JA 3OETA 5IZ4A 2WJPA 3EVTA 4TROA 4E21A 3OFSA 1E7RA 5B1YA 1W6UA 2BHLA 1AE1A 1JA9A 2J8ZA 3RUDA 1UZNA 4OM8A 3B1JA 2VOEA 2VHVA 2WWRA 4U6SA 2CD9A 3LLVA 1LX6A 1SPXA 2D5AA 4YDRA 2JCXA 4PVDA 2VWHA 3BTOA 4WOJA 1EVYA 1N9GB 1PL6A 1PS8A 4FFMA 4BVAA 2CVZA 3H9UA 4BO7A 2C5EA 3WQSB 5JDCC 1R4MB 4WNCA 4JXKA 4IM7A 3IIEA 2HQ1A 4WKGA 1QP8A 1X7DA 1NWCA 4OJNA 3W8FA 2DBQA 5TGDA 4QFCA 1H6AA 3FPCA 2FR1A 3FWNA 3KYCA 1GAEO 3GVIA 4BNKA 3GAZA 5TSDA 1I3NA 3WBBA 3FCOA 2EERA 3OHSX 3U49A 1SAYA 1H0KA 2ZTMA 3L77A 3NTQA 1MFZA 4YQZA 2VHWA 3VKUA 1P3DA 5FFFA 3IOYA 3ORFA 2W4QA 1E1MA 3ZWXA 1HL3A 4K6CA 4BNMA 3PIDA 1YBMA 2H1SA 4W6ZA 3RJ9A 1BTOA 1D4FA 1UXHA 3DC2A 4K26A 1ZK2A 5JE8A 5A03A 2NWQA 3GFGA 5ILGA 4AJNA 1NQAO 1NYTA 1YXMA 4XYMA 4RL6A 4ZQFA 2ZQYA 4OAQA 4QT0A 3RC9A 3E03A 3T4EA 3AM4A 5DF1A 3E9NA 1HXHA 4DIBA 4N7RA 4NDNE 2CFCA 1J0XO 2X0NA 2DC1A 2OFPA 1CWUA 1IE3A 3BMCB 5A3JA 3A1NA 4K1LA 4FGWA 1YDEA 4ID9A 1B7GO 1VSUA 3ETEA 1ML3A 1B3BA 1Y1PA 4XQEA 4J2OA 4Y9DA 3V1YA 2NV6A 3GNSA 2DBRA 3HFSA 1UP4A 1E5QA 1K6IA 4QQRA 2O3TA 4R41A 4EEXA 2Y1DA 3OJFA 1ISMA 2W98A 3DBHB 4QSMA 1ARZA 5KVVA 1LXCA 3ZWMA 1F06A 1KBZA 1E3WA 1JWAB 5EQFA 1ENYA 2PA3A 4J4BA 5TF4A 3ONEA 3BXXA 4TRRA 1KS9A 4PZDA 3FPLA 3QE3A 2VYVD 5A9RA 1E1NA 5JCJA 1C0IA 1ZK4A 4NPCA 1DRVA 3DEYX 3BYZA 2X0JA 2YFQA 1SOVA 3RU7A 1C1DB 1XSEA 3UAGA 4BKPA 5KVSA 1E5LA 1UJMA 3DAGA 3PZRA 2R00A 3HNPA 4MJLA 5JCXA 1I32A 1X15A 1ORRA 5FWNA 4BS9A 4BNLA 1E7WA 1A71A 4II2A 5BSEA 4Z6KA 1WDLA 2EW2A 2VT2A 4PIVA 3IDSA 4FPXA 3NT5A 5B37A 2DFVA 4Y6RA 1GYPA 3JQBC 1TI7A 3FR8A 1WMBA 1IPEA 2HLPA 4R1SA 4PLZA 2I67A 1Q2XA 4BNFA 1JKIA 5TIIA 1EFKA 4U7WA 5KNLA 1W4ZA 2Y1GA 4BNJA 1Y8QA 3DZIA 2NTJA 3EC7A 1JLLA 4PLHA 1JWBB 4MP8A 1I2CA 1LDBA 1PZEA 3SX2A 4JNKA 4YRAA 2FR8A 1AXEA 2P2SA 4HKTA 4OXNA 3UUWA 1QG6A 4YJGA 1T1SA 4IS3A 1E3IA 1P31A 1T2CA 3CE6A 3Q2KA 3JQGA 1WAMA 2TMDA 3TSCA 4ITUA 3VTZA 4DLAA 3ZV4A 1TVEA 4U0KA 3PYMA 5G0VA 3WOHA 3ROPA 1YGYA 3F1LA 1ADBA 3CEAA 4KWIA 4RV9A 5COQA 1D8AA 5CDYA 3H9QA 3MTGA 3VKVA 1YBAA 5F1KA 4DRYA 5LC1A 2HMVA 2X5OA 2BELA 1NP3A 2C20A 5JDIC 4C4OA 4NJMA 1YO6A 4J4HA 3JYQA 3IAHA 5KJCA 2JAHA 1VJ0A 1WWKA 4E0BA 3R3SA 2FPIA 4LMRA 3SXPA 4RPHA 5CEEA 2X9VA 1NHWA 1PJTA 2XXBA 3QHAA 1GUFA 4HUJA 1U2DA 3VPGA 3H2SA 3DDNA 4DLLA 2NU9A 1AHIA 1Y9EA 3C3XA 3PYLA 4YTEA 1PJBA 3WLEA 3GVHA 5F1OA 1M6WA 5JS6A 5C7OO 3GNTA 2QRLA 3FNHA 2YV2A 1WXDA 2VWQA 5HTOA 4PG5A 4L8VA 5KCZA 2GZ1A 4WLUA 3WYEA 5JBIA 3BHMA 1N1EA 4MOWA 3W1VA 1YDWA 4R3NA 4HXYA 5TQVA 3AW9A 5I8WA 2HRBA 4JK3A 4R1TA 3LT2A 1DC6A 2G17A 1UUFA 5G4KA 3ZNQA 4AJIA 1RM0A 4PLCA 3ZW8A 3H5NA 2VTEA 3E18A 1GZ4A 2LDXA 1T24A 3MJ4A 3WFIA 4DIOA 1I5RA 1L7DA 5TT1A 4N5LA 4OL9A 3QLJA 4OXKA 3PLNA 3TF5A 4J0EA 1CIVA 1RYEA 2R6JA 3ZU5A 1NR1A 2DQ4A 1I8TA 2X1HA 2D1YA 3GT0A 4R5HA 4ZQEA 2I99A 4H3VA 1PJ3A 4J4TA 4OH1A 1F17A 1PGNA 3GG2A 4M1QA 2GZ3A 4XIYA 3DZJA 4DPLA 3JQ6A 3PLRA 2Q2QA 2PV7A 3RC7A 2J3JA 1HSOA 4R69A 2EEZA 3FR7A 4YT4A 3IQDB 5DZSA 3TOZA 5JPIA 4YT8A 1O94A 3LVFO 4E30A 2BI8A 1RYDA 4WLNA 5GZ6A 1VL8A 1LTHR 1QYVA 1DIGA 1IB6A 4Z9YA 1ONPA 5L45A 5HBRA 4QFDA 1CQIA 4I8XA 5IDXA 4EJMA 1MX3A 2BF7A 3EW7A 3JQCA 3F46A 2E37A 2NM0A 5C5IA 3IP1A 2GERA 5L4NA 1SO8A 3ETDA 1E0DA 2WM3A 1XDWA 4YJHA 3RBZA 1O6ZA 1DBVO 2PWZA 4XKJA 2C82A 4DWVA 2A35A 1Q7CA 3OJ0A 2C54A 1SEPA 1K3TA 2B37A 4YAEA 5AXDA 4XYEA 4CUKA 4XYLA 3D4PA 3ZGYA 1U5CA 1FDVA 3VH1A 2X0RA 4LVUA 4J1NA 3ADPA 1K89A 2DUWA 4PG4A 2Y0CA 3UHAA 3P5SA 2NVBA 1FDTA 4FC7A 1EUCA 3H9EO 4BO1A 3I5MA 5KVCA 2NU6A 1EE9A 1LBEA 2B5WA 2Z5LA 1D1SA 1SMKA 4MKRA 3VHRA 5IXSA 2ZCUA 4W7HA 4GKBA 2XOXA 1WLYA 1GTMA 3EYWA 4J49A 2RIRA 2GZ2A 3D3WA 3RSHA 2HUNA 5KKCA 1M2WA 1LDNA 2NLOA 3TFOA 2YDXA 4YWJA 3SEFA 2HAEA 3PHGA 5EL0A 4YQYA 1TA4A 1XEAA 5BNFA 2Z1NA 4Z3KA 4DC0A 1T4BA 1U9JA 4J0FA 2X4GA 4RZIA 1J4AA 5F1PA 4R1NA 4FIZA 1DLIA 3GEDA 1Q0QA 3MWEB 2R00C 1ISHA 4NFHA 4D46A 4XDYA 1EQ2A 1T26A 3VZPA 1HDRA 5TS3A 4YEDA 2ZATA 4FOOA 3EMKA 4J1SA 5G4LA 3VDRA 3OH8A 1N1GA 3MOGA 3H2ZA 3OJOA 4I1IA 4E12A 2D4AA 3B20A 3KV3O 1N7HA 2HRZA 5B12A 4XD2A 2JAPA 1B2LA 3EZLA 4NMHA 2GYYA 5ICMA 3LU1A 3L0DA 2BD0A 3I6IA 3U9LA 4JQCA 1A5ZA 4BKRA 4IMPA 5THQA 1U3WA 3QVSA 4JCOA 5AYVA 4G5HA 1GQYA 3WYBA 3L07A 5T5QA 3JYLA 2Q99A 3V1TC 1HE2A 2OMEA 1CJCA 1CRWG 4DLBA 4YCAA 5I7VA 3WIEA 2FSVA 3PQEA 3WGYA 1QLJA 2Y0EA 1WDKA 1ZJZA 1XELA 2VHZA 3VZQA 2I76A 5I9NA 1HZJA 4FS3A 3ZWOA 3OMLA 4FR5A 3OIFA 1PQUA 4UUNA 3ZU2A 3E82A 1KVUA 4K9DA 1TT7A 1MGOA 2BH9A 3PWKA 1PGOA 3GGOA 3LLSA 4O5OA 2AE1A 5A1TA 4GX1A 2AQHA 5BNIA 2OBNA 3UOGA 2NVUA 3NJ8A 1H2HA 3JTMA 4CM9A 2JHGA 1J6UA 4J16A 4ZHSA 4RZHA 4DREA 3P2YA 2Z95A 1JW9B 1ZFNA 1U8FO 3L6OO 2VUSA 5TRTA 5FEUA 3F1KA 3S8MA 2HSDA 4Q3DA 4Z3DA 4XJSA 4CLXA 3JQDA 1HWYA 1FMCA 3MZ0A 1JDJA 2DUUA 1O95A 3KLPX 5C37A 2WE8A 4YYZA 2OL4A 4BNIA 4E2WA 3C7CB 3MTJA 2Q3EA 4ALIA 2NU8A 2J5QA 3LC1O 1EE2A 2PH3A 4MPDA 5BR7A 3IUSA 3WDSA 4CQMB 3ZU3A 4Z0TA 2WE7A 5I7SA 3AOEC 4IZIA 3NDIA 3WTBA 1NAIA 2PD4A 2GN8A 1ZO8A 2JFFA 2GDZA 3JQ9A 3GNQA 4DIFA 2H5LA 2IYPA 3DBLA 1LLQA 3GOHA 4E5PA 5JAMA 3HE3A 4YAJA 1E6EA 3ONFA 1SC6A 4F46A 4D44A 2EHDA 4BOYA 1U8XX 3NUGA 4G2NA 3ZHZA 1ISJA 4XQCA 3RBVA 1Z45A 2DM6A 3JQAB 3GMDA 2CSUA 1PJCA 2B35A 2O50A 1DRUA 5BSHA 5MDHA 1M6HA 2FPPA 3VPFA 2V6GA 2C0CA 2I3AA 1ISGA 3LT4A 1E1LA 2FRDA 4J3FA 4XB2A 1EK5A 1HEUA 2X7HA 2BGLA 2GCGA 2Y1FA 1OBFO 1M66A 1NWHA 2DAPA 1DEHA 2E82A 3JD3A 4R1UA 3TQHA 1Y9AA 4HNGA 4DQXA 1DAOA 2VRCA 1BDBA 1BSVA 4TRNA 1R0SA 2B69A 2W2KB 4U6QA 3U4DA 3VH4A 5H81A 5CG2A 1BGVA 1PS0A 3CUKA 3UN1A 2AEFA 5G0UA 4XCVA 2B0JA 4RF3A 4MVJF 5A3VA 1I36A 2BGMA 4ZICA 1B8PA 3ZNNA 4BKOA 1GQQA 1Y8RB 1B3RA 3JYNA 1ENZA 1P0CA 4PG6A 5T57A 5T67A 4FB5A 1HTBA 1H6BA 1RM5A 3AU9A 1R37A 2B4QA 2FZWA 2NVWA 2WD8A 3NAQA 4ND2A 4BV8A 2PD3A 3TN7A 2OO5A 4WLVA 4BMNA 2CNBA 2FN7A 1CETA 2QHXA 2ILTA 3WGGA 3EVNA 3AUTA 3GN1A 1V3UA 1Q7GA 2AXQA 4D7AA 3GEMA 3MJVA 3L4BA 1H2BA 3E9MA 3NT2A 4BNNA 1X14A 3ZWAA 1UXGA 1ZNQO 1VL0A 3ITDA 1UAGA 4IXTA 5H82A 4CM7A 3W6UA 4BHTA 1UDCA 4FDAA 4A7PA 2CMDA 4P4LA 4CR7A 1DB3A 4L0QA 4B7XA 4D0RA 1QYCA 3MJCA 1AXGA 1U3UA 3PGXA 4RO0A 4R16A 4L4RA 4CR8A 4N18A 1JVBA 3TZQA 3VVCA 4BB5A 2FWMX 3PIIA 3JSAA 5IZCC 3I9MA 1BVUA 3UF0A 1VLLA 4HNHA 3KUXA 3S2IA 3DAFA 3RUIA 4CM3A 4KUHA 4CLOB 1DJQA 3I23A 4UULA 3WWZA 2PY6A 3KSZO 1EEHA 3LDHA 2NQTA 4FSHA 1YB5A 5EQDA 1GZ3A 4EITA 1NFRA 4CUJA 4DMLA 3JV7A 2HJSA 2DFDA 4R68A 4WCFB 4RVHA 1C0KA 3QWIA 3CIFA 4ND4A 2E6UX 1Z7BA 1H6DA 2X5JO 1A9YA 4BGVA 3AY7A 3DZGA 1NFQA 4BMSA 5KKAA 4XJTA 5JAIA 3B1FA 1A4IA 1AGNA 3RQSA 1M75A 2FSSA 3LC2O 3PDJA 1R16A 3EDMA 2ZCVA 1ADGA 4TWRA 4FQ8A 2G5CA 3KZVA 3SJ7A 2BMAA 1DFIA 1E3SA 3AUSA 3OEYA 1TXGA 1LDGA 1LU9A 2IODA 3FBTA 3A06A 3DBRA 2CY0A 2JCVA 2VCYA 1PJQA 3K31A 3KYDA 3PWZA 3WYCA 4D0SA 4IQ0A 4XYGA 2G1UA 1QSGA 3ZWPA 3WGHA 3TL2A 4F3YA 3JQBA 2D2IA 1WPQA 2YW9A 1C1XB 1IULA 1H9AA 1TT5B 3C1TA 4YT5A 2ZJ0A 5FYDA 3WNQA 3ZHYA 3M2TA 4KWHA 4ZQBA 3D3EA 1X7GA 2TMGA 3KLMX 4WEQA 5FI3A 3W8EA 1F12A 4ALJA 1ONOA 4J6FA 2D5CA 4Z0HO 2ZTLA 3JQEA 1LSSA 4ZRMA 2GSDA 2Y1CA 4CV3A 2BFOA 4MINA 3WGZA 5K6AA 3OA0A 5DBGA 2EJWA 3I9JA 1BXGA 4QTZA 1XIVA 3JD2A 4FFLA 4RQUA 3SVTA 3GEGA 4G81A 5ENVA 5ILOA 1E77A 4RLHA 1B26A 1ZW1A 2X6TA 4EEZA 1H9BA 4GH5A 3DHEA 3IKTA 4CLRB 3TZCA 4IQ8A 3WR5A 4P38A 4PLYA 4PZCA 1PU2A 4FFRA 4AL4A 2X22A 1BHSA 2BFPA 5L7YA 3KYCB 3QWAA 3S1LA 4YAKA 3NEPX 3QVOA 4GLLA 1KERA 1P1KA 4IDGA 4CM4A 4Q3EA 1YB4A 2BRUA 1P44A 5G2OA 1RM4A 2P91A 4NK4A 5JW6A 1QV6A 4O63O 4O0LA 1GUZA 2ZIZA 4A5OA 3P19A 3RUHA 4J1TA 3K30A 3BMQA 4HADA 5JMWA 3PZBA 1KEVA 2FMUA 3UCXA 4TRMA 2XAAA 4CMIA 3VZSA 1PSDA 3RASA 4XIJA 4Z9FA 4TRJA 4BGIA 4BNYA 3V8BA 2EKLA 4CODB 2VT3A 5KJ6A 1EMDA 3HSKA 3QWFA 4R5MA 2NTNA 4YJFA 2QYTA 4JJIA 4Y98A 1K6JA 2VOJA 1NTOA 2QZ9A 1X7HA 2DT5A 1DXYA 5DP1A 3ITKA 3TDKA 3ON5A 5TT0A 4PCVA 3PQFA 4CMHA 1CEQA 1ZEMA 2V7PA 1N92A 4AJHA 1DHTA 4MO2A 4E5NA 3H9JA 2O2SA 3ROKA 1NQ5A 4EJ6A 3QP9A 3K2EA 3GUCA 2ZYGA 3AI3A 3QA9A 3CINA 3E5MA 2AMFA 3QRWA 4OQYA 3K96A 4NNJA 2BGKA 5A02A 4GGPA 1LLUA 3AFNA 5DDIP 3HDHA 2EGGA 2P5YA 4AICA 1BW9A 1F8GA 5GZ3A 5JNLA 1UR5A 2RHRA 1T2AA 3O4RA 4D41A 5EPOA 4Q3BA 4WOKA 4Q3NA 3BZUA 3U62A 4C7KA 3ANMA 2OOSA 3AUAA 1AHHA 1O89A 2DTDA 3FI9A 4PLFA 3NDJA 5A05A 4JX8A 2IXBA 4EYEA 4XEHA 5IDYA 3H65A 1E3EA 3VAZA 3L4BC 3PJFA 4M55A 1LC3A 4EUHA 2ZB7A 3W4IA 4BNTA 3CTMA 5DT9A 1JKFA 1IHYA 4UREA 5B4VA 3GPDG 4JBIA 2OP1A 4B4VA 1HRDA 2EF1A 5JC8A 1GYRA 4D43A 1NHGA 2NNLD 4PZEA 3AI1A 1EBFA 4B3JA 1OC2A 1XHLA 5JMPA 4KZPA 3ADOA 2JFHA 3OIGA 1KETA 4O6VA 2PKQP 2Y66A 3ZHXA 3QWBA 1RWBA 2GO1A 4LVCA 5CFZA 1Q0HA 1BXKA 1R6DA 1T2EA 4JBGA 4E5YA 1U7HA 2P68A 1N9GA 2DKNA 4BO2A 1GV1A 3E9QA 5KTKA 1Z7EA 4CLEA 1R4MA 4AJ1A 2G0TA 4CLHA 3C24A 3V2HA 4AJJA 3Q0EA 2CDBA 3QVTA 4FOSA 3V5NA 4DQVA 9LDBA 4GQAA 4NH4A 4AJ2A 5JCJD 3G17A 1R12A 3WGQA 1ONNA 1KVSA 1I01A 3G79A 4D79A 2VNAA 4OHUA 2V65A 4KTTE 3D4OA 3L4SO 5GY7A 1NAHA 3BTVA 2VWGA 4UVGA 3R0IA 1QYDA 1VL6A 2YQ5A 3BMNB 4GX5A 1CDOA 3RUCA 2EGHA 3A9WA 2P4QA 5A5FA 3WG9A 3WB9A 3GMSA 2JCYA 3F3SA 2W90A 3DFUA 4HWKA 1T4DA 3I3OA 2H9IA 1DIRA 2D0IA 1A7AA 1WZEA 2Q46A 2YYYA 3AM5A 2FY8A 3ZCXA 1PTJA 4E4YA 1LEHA 4XB1A 2JL1A 1A27A 4IZHA 5TNXA 2O4CA 2VHYA 3KVOA 4GBJA 4DGSA 3AUUA 1P1IA 5BQFA 3IJRA 1WMAA 3JYOA 1IYZA 1PR9A 4ALNA 2VQ3A 3MEQA 1NNUA 3DOOA 3BMOB 5K6AC 2YDYA 2W2LA 2W2LD 1KYQA 1RKXA 4BNUA 4ZJUA 3UKOA 3MCVA 4MVJH 2QIOA 1LRKA 4YA6A 3E8XA 3ZV6A 1O5IA 4CQLB 5HA5A 3COSA 3OQ1A 2OZPA 5KJ1A 4A2CA 3DZBA 1B15A 4CUZA 3DBHA 3D5QA 1QRRA 2V6FA 2Q4BA 2J5RA 2PH5A 1V9LA 2QYSA 4IUYA 3QQPA 1H94A 1PJLA 3PJGA 1EVIA 1UH5A 1K5HA 4L74A 3KOUA 3WICA 1WDMA 1SOWA 1YOVB 2OXIA 1A7KA 4CR6A 4WCFC 1Y6JA 5IN4A 2PNFA 2UAGA 2GR9A 3NV9A 1ZJYA 3QW2A 3W8DA 3LYLA 4DTIA 1N8KA 1QKIA 4KQWA 2XPCA 3OIDA 3RFVA 5B4TA 1UXKA 2O2YA 1SZJG 4IMRA 1YQDA 3AOEA 3S2FA 3O26A 5B4UA 3I9KA 4IGFA 1K0UA 1PWZA 1VKNA 4P4NA 4YRDA 3UCEA 5U9CA 8ADHA 4GSLA 3TFQA 3MOIA 1ZXLA 2D8AA 3RUAA 4WLFA 1FXSA 3PHLA 4U5QA 1CF2O 4J43A 4Q3CA 4BIIA 5F21A 1LUAA 3GZNB 4DUPA 1E7SA 3JQ8B 4L76A 2QW8A 5J23A 1NPYA 2I9PA 4RPGA 5HRUA 4IGEA 2JD1A 4HFMA 1E7QA 1IZ9A 3X2EA 4YJDA 3H9GA 3R6DA 3KBOA 5JC1A 1B0AA 2ZB3A 5ADHA 1N5DA 1SNYA 4ONEA 3ZWVA 1C0PA 1DIAA 2OGUA 3OICA 3M1AA 1ZSYA 1ZBQA 5EERA 3PFFA 3WS7A 2I6TA 2AA3A 3KXDA 3VOSA 2O7QA 3GDOA 1AUPA 1Z6ZA 3AK4A 4QUKA 4PG7A 1GY8A 3WGIA 2PLAA 3CXRA 3I9LA 3ROMA 3ZV3A 1SEVA 1ZK3A 4JBHA 2GRAA 3H5AA 4WK6A 2IYOA 3DWFA 3FNGA 3IS3A 3NX4A 4AJEA 3N74A 2HJRA 4J91A 3DMTC 1PQPA 4KQXA 1KY5A 3ZZNA 4IJVA 3Q6IA 1MC5A 4IIVA 1B8VA 1R0KA 1I30A 3EK2A 3KO8A 2BFMA 4HFRA 1UDAA 3WTCA 3O8QB 1U2GA 1D3AA 1MA0A 3AJRA 1MB4A 3OP4A 2DPHA 4JP2A 4U0JA 2HCTA 4MVJE 4BO3A 3AY3A 1QXSA 4EGFA 1UZLA 1FK8A 4PGFA 4PLGA 3VC7A 1PQWA 3VPHA 1U1IA 4E2XA 5BSFA 1HDXA 4PG8A 4TZKA 4CL8A 3F4BA 2DLDA 3F9IA 5CAEA 5TJHA 1KEPA 3TOXA 1D7OA 3V2UA 3GQVA 1NX6A 1ISFA 3P7MA 4NR0A 2O4UX 4D45A 2OORA 2LDBA 4BO9A 4BO5A 1EUZA 3ZV5A 1B8UA 4RDIA 4GGOA 1DSSG 2BKAA 1NR7A 2JFGA 3CMCO 2Y99A 3OQ6A 3HDQA 5IZCA 1LRLA 1YWGO 1I3LA 5TJ9A 1L7EA 1N2SA 2A94A 4RCVA 4BO6A 2CF5A 1Y5RA 1Y7TA 4Y8VA 5KIAA 4E33A 4YPOA 5FI5A 4UEJA 3IJPA 4ND5A 1R0LA 3OSUA 3G1TA 4R01A 5ER6A 5A9SB 3H6KA 3BAZA 3I52A 4L75A 4BO8A 3VZRA 1JTVA 1MUUA 2JD2A 4URFA 2B4RO 1NM5A 1R4NB 3SC6A 4E32A 4LMPA 3INRA 4B3IA 1TEHA 2Y05A 2YHUA 2DTEA 3JQ7B 4EI2A 7ADHA 2X58A 2YQ4A 3IP3A 4IS2A 4JP3A 4U8GA 4DYVA 3LQFA 4GWGA 4UEOA 1NFFA 1TLTA 5JY1A 3EUWA 1HKUA 3ZWBA 4DPMA 5U4QA 3PQDA 3Q1LA 1Y5MA 3CZMA 4B3HA 4MIYA 3ABIA 2EV9A 1GD1O 5MGBA 5DCWA 1K6XA 4BQPA 3PJDA 4WCDA 4I5EA 4B8ZA 1PX0A 1PZGA 1E6UA 2HMTA 3KTDA 4IDFA 4PVCA 4UAGA 3V1UA 2ZKLA 5A9TA 4E3ZA 4CMGA 1GU7A 1NVTA 4TZTA 5IN5A 1ZK0A 4W99A 4MIOA 4CM9D 1WP4A 4ZQGA 5L53A 1GQ2A 2WYVA 3LZ6A 2FZEA 3TJRA 3CMMA 2IRWA 2UDPA 4P4GA 4DBVO 1LQUA 1FJHA 3T7CA 4BB6A 1NBOA 3EHEA 5DBIA 5EN4A 3Q3CA 4M89A 4BNZA 4K28A 3AOGA 1G0NA 3TZKA 1EQUA 3F4LA 4BO0A 4ZGWA 1IZ0A 3C7DB 2WDZA 2HO5A 4XX0A 3LSYA 4CM8B 4RVFA 1LDYA 4AJ4A 2WTBA 3DR3A 3VPXA 3HUDA 5ITVA 3H3JA 1IHXA 4B8WA 4CMBA 2HMSA 4DPKA 1XQ1A 3HADA 3I4CA 5JAZA 2GN6A 1C14A 1YVEI 3ICPA 3QSGA 2JHFA 3W4KA 1MXFA 1ADFA 4YB8A 4IDDA 4IQGA 3VVBA 4NK5A 1LNQA 5DP2A 3AM3A 1KIFA 5ES3A 2G76A 2YHIB 4WGGA 5EIOA 4MVJP 1I2ZA 1HE4A 4IDAA 4CMEC 1IOLA 3KM0A 4HX5A 1E7YA 2C5AA 3D1LA 1WNTA 2ZQZA 1IUKA 2B83A 1ZEJA 3HWRA 4G65A 3QV1A 4GPD1 4XYBA 2IXAA 2P9GA 2GASA 2WYUA 4WLEA 2RAFA 4FCCA 2X9NA 5HM8A 4RF2A 2EXXA 1HE5A 3AFMA 1JAYA 1YBVA 4IJKA 3PXXA 1QLHA 1EUDA 3I4FA 4W82A 1M67A 3PDUA 2O3JA 5JYEA 1YS4A 4HP8A 3TL3A 3SJUA 3U0BA 2FOIA 4XGIA 5EJ2A 2VRCD 5AQ1A 4FW8A 4FFPA 5F5NA 1DFHA 1WW8A 5L4SA 2QX7A 3N7UA 1HYGA 3F47A 3E6AA 4RPJA 4XRGA 1ENOA 3ZWNA 1UP7A 3QVXA 3UVEA 4ZU3A 4UVIA 1GCOA 2YY7A 6ADHA 2A92A 3IMFA 4TQGA 3GH3A 4YBZA
chains in the Genus database with same CATH superfamily
3B12A 2YWGA 3H1BA 2BUBA 4K6FA 1L7NA 4XQ9A 3CCBA 3ZE8A 3IBYA 1M72A 4B45A 3TIFA 2W8BB 1WVGA 3EISA 4KVZA 5A4MS 1HQCA 2CF6A 4B1FA 4ZU1X 4CQMA 4D3DA 1CUDA 3HN7A 4BNGA 4GI1A 3L1KA 5F7ZA 1C1YA 1JSXA 3RKRA 3GRCA 4E94A 2QTTA 5HJ5A 2RI6A 1Z3IX 2PRKA 1RYNA 3PD1A 1G1AA 4WKCA 4HAXA 3TLEA 4RF4A 1YA6A 1JDSA 5LIRA 4OYLA 4MI1A 3IPLA 4XQ0A 1GARA 4X7RA 1BXRB 3HO6A 1DTWB 1T4CA 1U5AA 1X1TA 1X8KA 2OORC 2WINI 3RS0A 3GGPA 4FVTA 3P2IA 4LC9A 5K03A 3RIGA 1YHNA 2VJAA 4MP6A 3PGVA 4KFRA 4OYHA 1O9HA 3AF3A 3JQAD 4EW6A 2I6SA 4XGKA 2BKUA 2QT1A 1JFFB 2PQMA 4JKYA 3K0BA 3DPIA 4DEVA 3HYTA 2R9VA 3SDSA 4NYJR 2IT1A 4RA9B 3ZWWA 1N2ZA 6Q21A 5D3QA 4QEZA 3G7UA 4FLEA 4RHCA 1HNXB 4KIUA 1AMNA 3G9QA 1PX2A 1UF9A 3OIUA 4MW5A 3NJRA 1YJAA 3M0EA 5DNWA 4MQ4A 5L95A 1ABEA 4IBOA 4UUMA 4F38A 3GMIA 2AGVA 4N5HX 5C7LO 3MJDA 4MW9A 2HWYA 2O07A 3FCUB 4RD2A 1QO0D 2P9CA 5EVJA 4P5DA 2WUEA 4P93A 3BXOA 3FRIA 4OQPA 3L6EA 4HSGA 4RGBA 2IEDA 4NCNA 4F60A 1NXOA 2AD5A 3WSWA 2OYSA 3BRWA 1N2EA 4I9NA 4YHBA 5HIJA 4HDOB 1KTIA 3SCZA 3GG9A 2UYYA 2HJVA 1VXRA 2KLBA 1KOGA 4B6OA 2HMYB 1G3RA 4G5GA 1NVAA 2WB4A 5BWOA 4ZRDA 1Z4MA 2X77A 4F4UA 4B7UA 5HFAA 3GR6A 3D0OA 5CFOA 4H7HA 1AKEA 3KC2A 4AUKA 1OMOA 3K5PA 2YKGA 3KTAA 2G25A 4F91B 3DEIA 5KNBD 1ZRHA 3TPFA 1PQYA 4HQNA 1MABB 3Q7PA 4V0KA 2BDEA 3ZLTA 3QXSA 5J2TA 3G0OA 2CKDA 1YCDA 1MC1A 4NIMA 4C5CA 4RY0A 4CMIB 1R0RE 1R6XA 1G3UA 1QS0A 2Y92A 5AW9A 3O84A 1ECBA 1F14A 1SN7A 1KI9A 1SCKA 4L9WA 4CN8A 4CDNA 4TXHA 2RGNC 4JT2A 4Q5IA 1V8OA 1T9KA 4ZANA 1FTSA 1VBFA 1NQOA 2CXQA 3B6EA 4DLUA 5FEMA 3UV6A 4EO7A 5JFGA 4O4HB 2HSGA 1K9VF 2ZYAA 2RC5A 4HUQA 4R2WA 2NUAA 3B2EA 3FX2A 1UPCA 4BEVA 2X6RA 2PX6A 4UM5A 2EP7A 4I8IA 2QN9A 4CLOA 4F6LA 3O0TA 4LXIA 1X7YB 4DDKA 4ZHQA 2VQFB 4FX2A 5JJ5A 1QOQB 1JL3A 2WJWA 1O6BA 4YP7A 4YAWA 3KSUA 4B79A 1BFUA 1PV1A 1FQWA 2Y2VA 5DN6A 5EE1A 4IDEA 5K3DA 5KOYA 4WCFA 5BR4A 3FIUA 5AVKA 5I8ZA 3O3MB 2GK6A 4RYDA 1ESZA 2GJ9A 5I7WA 4FR0A 5KQLA 3IEMA 1YONA 4R6XA 2PS0A 4BV2A 3AM1A 2REQA 1PUIA 1GP2A 1NY6A 1TZBA 3K05A 1Z56C 2LNDA 2YOHA 1NI4A 3A70A 2GD1O 1LSUA 3LLCA 3B1KA 4O2BF 4RZSA 1UC4B 3ZDCA 2PYZA 2X40A 3A28A 4ZO7A 2HA5A 3X1JA 1DO0A 3THOA 4N1AA 4BVLA 3DHYA 4MKZA 5HIIA 4YX9A 2PSFA 2HEGA 2VTBA 2QXYA 4LZZA 2WU0A 3K2IA 5E7IA 3NOOA 5AW6A 3A4MA 3TSWA 3C3WA 4MQ5A 1J7KA 4Q1CA 5IC5A 2OZLA 1OFHA 5ARCA 4C6TA 1A8SA 2VHXA 5EJ7A 4Z4FA 3W2FA 2PGJA 1L5NA 3ASUA 3QUAA 4P92A 4KPUA 3TIGA 2XNDD 3SMQA 1L9XA 4XWGA 3D6UA 3KRTA 1EVQA 1DAFA 2ZDGA 1QG4A 4KX3A 1BEEA 1OZHA 1QTNA 1YZLA 3GWGA 3HU3A 3IVXA 4GX0A 3TLCA 2QVCA 3IOMA 3LY7A 3O73A 4DB4A 1ADYA 4NABA 1ZZGA 4UNIA 4ECEA 3L7NA 1XG5A 1OAAA 3OCYA 5EMJA 2ODAA 3O03A 5EI5A 5K0ZA 4JB0A 4BTEA 5IJ9B 2GN9A 4JU9A 3H16A 1X3SA 2NO4A 4DGQA 3CKYA 5A5VA 1LDMA 5HW0A 5AVYA 5C8DA 3P9YA 2ORWA 5E3IA 1R8XA 2VPWA 4EMTA 4IIXA 3W9YA 2C5BA 1JFVA 2WIKA 4JKOA 5ITWA 3KU1A 4MWZA 3TX2A 3K9NA 5A5DA 1AKRA 2PFGA 3NBZC 1GVNB 1P4JA 3CGWA 4LGCA 1R66A 2FV8A 1WIWA 4O4JB 2GXQA 5DISB 3WWCA 4M9XA 4QJIA 3CRVA 1CSEE 3MS2A 4WVFA 4LFAB 4Q3AA 2R1VA 1G5QA 4IIHA 3OM9A 1V2HE 3CUTA 1EFDN 4XSHA 5EIAA 1YKGA 3UW1A 4BKUA 4BMDA 4UZSA 4D3FA 3TVTA 2G9RA 5D86A 3VKGA 3KSAC 2GF9A 1Q7TA 3LUJA 4G89A 2OBFA 1PTKA 3X1KA 1XZFA 5ALYA 3PC6A 3BHJA 5EMLA 3OFND 3ICQB 2RB5A 2ZI6A 4KN5A 5DSTA 1VSTA 3FSRA 2UVDA 2GPWA 3EODA 1U02A 4Q1FA 2W5UA 3BF7A 4ZI5A 5ED4A 5EWJA 3M6IA 4AMBA 3ZIAD 2PLFA 5IU6A 4GMGA 1VIVA 5D3MB 3T41A 4Q6WA 1QMGA 1ZD8A 2RC6A 3O9ZA 2R8PA 5DKFA 5E0KB 1K8ZB 5E8RA 2WJ4A 4UAVA 4KV9A 4WT7A 2C94A 1U81A 2D1RA 1WZNA 1Y81A 2HO4A 9LDTA 1K1EA 1X39A 1VZ3A 3N5KA 5T4EA 3D6FA 2V6BA 4QSHA 2DFLA 4I4TA 2Y1KA 1TQ8A 1P17A 2P8SA 4G1CA 5AM2A 4I1RA 2AZ4A 1FW6A 1JQJC 5BR8B 4RKRA 3I5AA 4AS2A 1ZUNA 5B53A 3RVKA 3D8NA 1DBWA 1FMTA 5AHXA 3DDZX 4QDTA 2PZFA 4TWIA 2ZRIA 4YJGB 1JEAA 1GXSA 3G6WA 4Y6PA 1TD9A 1FNCA 3JQGB 4FT2A 2BY4A 4MW6A 4NI5A 3RAGA 4ED9A 2BM0A 1ZXXA 1XCLA 5IXYA 2BONA 4IIEA 4Y6SA 4GWKA 4MLPA 3CURA 4O4IF 1NW5A 4QBGB 2LCQA 1QFMA 1Y1KE 2PZMA 3E15A 3EC2A 3PPXA 1JR3D 4TX1A 2WJAA 4X3OA 3UGJA 1A8HA 4MR8B 1PHPA 3E7WA 2C9OA 2AUTA 2Y93A 2JIRA 3S2EA 4DMHA 2EW1A 2IY7A 3FLBA 4NE7A 5C7YA 3GLHA 2O7RA 3FIJA 5A0TA 4DEYA 1F6DA 3CX7A 4AWXA 2MCFA 1M1ZA 2BM8A 4LWQA 1RHKA 1ZD2P 2V9ZA 2FPIB 3ETGA 1KJNA 1LTQA 3IALA 5JALA 3IEUA 1PGPA 1BRMA 3TGPA 1RWMA 5DOVA 2CXUA 2GVNA 5LDGA 2CL0X 1V6AA 1UWKA 2PR2A 1R88A 3HCWA 4CIDA 4MQUA 3OT1A 2RGGA 1R9MA 1VE3A 4WADA 2ZRQA 1W581 3I2KA 1CEEA 4UBNA 5KBYA 1VHQA 2Q49A 1NG1A 3A10A 3HFJA 4IIFA 4PQGA 4L5AA 1LJ8A 2L42A 3ADDA 3SQDA 2JIOA 3CLUC 5DX0A 2E55A 5JFOA 2B4KA 3CZRA 2YC2C 4IXWA 4ENSA 3U3RA 5AHWA 5C4MA 1TB4A 3TJMA 1BD3A 2G77B 1SBYA 3MQ2A 5CEFA 4KGZA 2H00A 2IYSA 2QPLA 4KI0A 4KLNA 4B7AA 5BSTA 1IIBA 4I50F 1NOIA 1QJ4A 2JKZA 2YY6A 2VYNA 5EUMA 4C0AC 3KAKA 1I0IA 1M6YA 1XP5A 4UEKA 3TI7A 3UJPA 4FYMA 2A9KA 3KR2A 5E2AA 2J4DA 2MSCB 4IKEA 3JYPA 3RB8A 3BE4A 4AMVA 1E9VA 1QU3A 2A57A 4KDFA 1EWTA 5AK4A 4KVAA 5A3SA 1F8FA 2NSDA 4QDJA 1KJWA 1Q3KA 1IBLB 1D0VA 4DVJA 1CG6A 4E4TA 2GBCA 3EH2A 3ZOKA 4FYHA 4GBGA 1JPJA 2H18A 3N8HA 5K01A 4NOLA 1H4SA 1JDTA 1SCIA 4RVOA 4TTPA 3ND6A 2GBLC 3QXHA 3UGKA 1LWNA 2JLBA 3IXMA 1RWWA 1OXXK 5CGZA 1XU9A 2VA9A 1FF9A 4LXGA 1FRQA 2XMRA 4LKRA 4Y2GA 3VTKA 4D26A 1UODA 4JR1A 5FNZA 2AKEA 3D5TA 1JGTA 3Q5DA 5AICA 3RUEA 2H1HA 2PWYA 3T52A 5FBQB 4L16A 1SWVA 3U4HA 1XALA 1QE0A 4UD2A 1J2RA 1DOHA 2YTZA 3JALB 1BH6A 4IXMA 5BO5A 3QNWA 1XL1A 2FQXA 4D25A 5I9LA 4ODIA 4BMXA 4XVCA 4F45A 3P2OA 5KJFA 2HFKA 2QRQA 1TK9A 3LBIA 1R8QA 2QQEA 2ZK7A 3BMNA 2XWPA 3NIWA 4TLAA 2IZ7A 2H4HA 3R7AA 1GTVA 1YVUA 1WY7A 1NYQA 2R7LA 3AHCA 3M4XA 4HY3A 4PYLA 1KNQA 2DH5A 3DOJA 1NXQA 5JRZA 5JH7A 1CFJA 5GOZA 2V8BA 2QT0A 1PJ4A 3OKCA 2WTUA 4WAUA 4HX2A 5JRJA 3IE0A 4BEWA 1QAOA 2GAAA 1PV4A 1DQNA 2Y6VA 1N5MA 3MFQA 4DT1B 5K1ZA 4N48A 3RIHA 2J30A 2R96A 2HV9A 3WQRA 4TYYA 3EGXB 1DPGA 1H23A 5EJ8A 1I4DD 3AETB 4EF4A 2YUTA 1Z36A 1E2EA 2BEVA 2AZDA 2TRSB 2YRWA 3KB8A 4MW2A 4ZCLA 4NL4H 3OPXA 3PKZA 3VV2A 1RMTA 2X0IA 5A04A 2Y9PB 2V7TA 2NU6B 1ODLA 3T9BA 3SQOA 2HK7A 1QIDA 4WOPA 2YHBA 4B3TB 1IDN1 2W93A 3LKDA 4JYZA 4HOYA 4JLSA 1ULUA 2W2NA 3QU7A 3WX0A 2O8FB 3IDZA 2HJ9A 5KWEA 4OO3A 3PUVA 1ST3A 4MI9A 4O59O 3RJZA 3AKDA 1KAGA 2BFDB 4WUTA 3P5BA 1JT2A 2HDWA 3OPYI 4DBLC 1LLDA 1SIUA 3QKWA 3R3VA 4MCAA 4YUAA 3L4KA 4QEDA 1JALA 3Q8XB 3N0RA 3UJ6A 2E4AA 1VTKA 4O33A 3RC1A 4M87A 3ZY6A 4BC0A 4OP3A 2OOKA 3PQ4A 2N1BA 3ANSA 2O05A 1XJCA 1W85A 2F3SA 4IY1A 4XDZA 4YRTA 1PT5A 1YL7A 1UOEA 2BMJA 1B43A 3VU8A 3WJ7A 4HN4B 4WFKA 1GAQA 1J06A 1H93A 3O47A 3OD5A 3H4TA 3R3UA 1JIJA 4QUBA 2VNSA 1ZOSA 4N7BA 1ZMRA 4MVWA 4OVKA 1Q7BA 4KP7A 5KHOC 3TLKA 1E5VA 2DT8A 4EDHA 3RVSA 1DQSA 3JQQA 1JHMA 4IHQA 4AG6A 1V9CA 1WB6A 5K20A 1FJGB 1R50A 1NVEA 2VWPA 1UPUA 4N03A 2W8ZA 4N4AA 4HB3A 3NTRA 3B9RA 3O95A 4F3KA 1FJ2A 4UCQA 5EOVA 3GJTA 4JHLA 3KNZA 4NBTA 3IT1A 4JEMA 3P2EA 1U7PA 1PNOA 1XCMA 4NU0A 2FW7A 3REQB 1QR6A 4LK3A 2X8LA 4PTYA 4OYRA 2C04A 4S24A 1G38A 4BX3A 4S1VA 4Q3LA 4ZYWA 4BL5A 5M34A 2WHEA 2JASA 3BFJA 2QE7A 1ODIA 3EULA 4ZAXA 2VJKA 2OKGA 2I55A 3OPNA 2BT4A 3FW1A 1ID1A 4D8TA 3PTAA 4X6UA 3QKUA 4D6XA 1XZKA 1OC4A 1DC3A 3UO8B 5EIFA 5MFPA 2VHCA 2ZI9A 3T38A 2HRRA 3W5IA 4MVJI 3K0KA 4B6SA 4C0HA 3HJCA 3GJ3A 1AA9A 1JRLA 2IIQA 2PXHA 4PQYA 3ZY3A 3EIUA 4QRIA 2ZYHA 3R7LA 1B6GA 4IIYA 13PKA 3GGSA 3JZMA 1BJKA 4TMVA 1U0FA 2UUBB 1MAUA 3B2QA 2R11A 4QEKA 4N8SA 1GTL1 1HTTA 3F5FA 3QIVA 2KS6A 1JNXX 1R3UA 2BKLA 3W34A 5K99A 5K0NA 2B2NA 4G26A 4CNBA 1TM1E 1T5LA 1NPDA 2EW8A 3OLZA 4DNQA 1Q0LA 1Y6FA 3NAMA 3DAOA 4ZCMA 5FPQA 1GPKA 2GF0A 3MWDB 4HN2A 1E3JA 1KU6A 3KLBA 3DO6A 5EIXA 4D3XA 3NHAA 4FSXA 2DHCA 2P2LA 3B6ZA 5TGZA 4ZN6A 3HCPA 1E9BA 2GAJA 2ACVA 3AR9A 4N6NA 4KXFB 1E1RD 4RBNA 3UT6A 1MLDA 2B36A 2B1GA 3L7CA 3PYXA 4DL9A 1RQ2A 4ZMSA 4PV7A 3VR6D 3X3HA 3NBKA 2HI0A 5CCDA 1HLDA 1NOKA 1A9PA 1R74A 5DTIA 3A4VA 2ANCA 1KMQA 4ZOLA 1FXWF 3G49A 4DLVA 5JIBA 4RVNA 3J81A 3WB2A 3G59A 3G0GA 2VI5A 1YFZA 2AHRA 1G8MA 1SB9A 2C2KA 3T4PA 1RJDA 3ZHQA 2Z8YM 3FWHA 1YRWA 1ZM9A 4DBLE 4DNPA 1EXDA 1SC4A 3LW8A 2OFWA 4B4UA 4V02A 3C6XA 4GSYA 1P7YA 3M6LA 1CQZA 2EG9A 1TAQA 2P2CA 5FTNA 1UDWA 2A9QA 3ST7A 2WEKA 3K5WA 4KTVE 4Y30A 1GNSA 4CYMA 2IYNA 4J76A 5JYDA 4X64B 4F3CA 1RNLA 4OSPA 3WIUA 1Z0UA 1L5KA 1O57A 4Q9HA 1QFXA 5EWMA 2GZAA 4OPMA 1IZ8A 4IGIA 1TKBA 1J5PA 1Z0KA 3D8SA 4PX3A 5I4IA 3MFYA 1HNZB 4BPBA 1T13A 3D7LA 4L0DA 4ALKA 2CGEA 4P6VF 2ZWVA 2O7SA 3LCJA 1VJ1A 1MOSA 1UZMA 2B8TA 4M8KA 5HILA 4LRTB 4Z4HA 4G1BA 1S9DA 4G9EA 3B70A 3AIOA 4LW8A 3SJAA 4Q9LA 2E4YA 1J56A 1NUQA 1U6IA 4FOPA 4FZRA 4D3YA 5JU6A 2OGSA 3EA4A 1N2OA 3PWSA 1CY0A 4WX2B 1FP2A 3FLEA 1F9EA 1AT1A 3V4LA 1MRZA 1H4TA 2GUGA 3FZYA 3KQQA 3L0SA 2HDHA 3BL5A 4LXQA 4REOA 5LA6F 1GSAA 2NSYA 4ALMA 1EWVA 2P40A 2I7XA 1DBRA 3RRJA 3ZZTA 4FHGA 3H6GA 2XOEA 4BFSA 1XYGA 3KPYA 1PGJA 3DE3X 4OQMA 3WXBA 3JQ7A 2I65A 4D9CA 1XPRA 1JE0A 3E0XA 3CV3A 3OOHA 5CD9A 4F7WA 1WXXA 3NMUF 3MF4A 1BYUA 2C8JA 5D7NA 5CB8A 3JCZA 1USUA 1UDXA 4WE3A 3HXLA 4GRIA 3SSNA 5D2CA 1U80A 1G60A 1YDHA 4XPIB 5DGIA 4EB6A 4YCMA 3R6WA 2FG6C 3NKLA 4FIDA 4LPSA 4EARA 3J7TA 8LDHA 1FFAA 3K9WA 3GLHE 4NCXA 3U5TA 1DIBA 4NMXB 5E3JA 4NZYA 1UBSB 4C87A 3PU6A 1X7XB 3A9SA 3OF2A 4QU5A 4E7PA 4GPZA 5HS4A 3HYSA 5H83A 4G5OA 2PRSA 1GSHA 1E20A 1M5UA 2CN1A 2GD6A 5J4VA 4JV5B 1GG9A 3WMXA 3Q3IA 2Z8ZA 4JT8A 4ZI7A 1FNDA 1EBBA 1RAIA 2GHTA 1WQ3A 4QUHA 4DXDA 3HKBB 2AJCA 2W6CX 4G25A 3HVKA 5KWJA 3T7TA 3PXGA 2LPMA 2N1MA 2YOFA 3RFXA 3VQTA 1IPHA 1P33A 3NH6A 2RHDA 3OEED 3ROTA 2AZTA 1W7AA 2HV8A 3WRWA 5JAQA 3LL4A 4AZ0A 1OKKA 1SG0A 3FJ1A 5I9SA 3VNUA 1C9YA 3HWWA 3L0PA 2R6GA 3Q6NA 1T5HX 4HGQA 1WPRA 3RNLA 4NZPA 3MHTA 1YR2A 3ZI0A 5CFPA 3GGGA 2EOAA 1N78A 1FMLA 2MIIA 3OTHA 2DBVO 4C2TA 3FRJA 1YRBA 3EB9A 5E8JA 1WV1A 3H5WA 2EFCB 2GAIA 4JI6B 3VJKA 1PJ8A 5C8YB 2C8LA 3F6EX 4OJMX 2WW8A 1V4NA 3Q41A 5G0TA 1N77A 2XTNA 3MAJA 2A59A 1X0VA 4CQMD 2IYFA 3PPIA 4R2IA 2V59A 3K6KA 3VI4B 2FKNA 3E48A 1UAYA 2C59A 2HHAA 2IVFA 4YP5A 1ITZA 4MDYA 1W0CA 3S2YA 4EQZA 2ZSUA 1UCFA 3ECAA 4I6GA 1ZRMA 2YWRA 1ZN2A 4G0QA 2IE0A 1O8CA 1GILA 1L4YA 3DBRB 3IAAA 5IJ0B 3CNQS 1B73A 1RD4A 4PAMA 1PZHA 4K6GA 1GU0A 4Z5XA 4CEIB 4XWKA 3SYLA 1TZJA 3BFPA 1ZSVA 2PGAA 5JS2A 1X70A 1RJ9A 2ASEA 2YHIA 3EVBA 1MCZA 3R7WA 4FHZA 2JGKA 5JMOA 4M0MA 5FOTA 4ABYA 2A88A 3TW0A 5T3YA 3TLGA 4IJWA 4BASA 4JR2A 2BZ0A 2EU8A 4XM1A 2JH8A 3VTAA 4RGVA 1DXOA 1D1QA 2EIHA 3GLTA 1I10A 2B8WA 4E07A 4FFWA 2JCSA 1VYVA 3RFTA 1ELOA 2PPVA 4KCGA 2DBZA 2ZTVA 3K09C 4CEJA 5AUQA 2P4HX 5JLJA 1U2ZA 1EX6A 1EK6A 3DOCA 4L4SA 3BTUA 4R8SA 4DSAA 1BG6A 2GFQA 4MA5A 2PU7A 3I09A 1OR8A 2JD0A 1F2TB 1U4OA 3Q2IA 4P98A 2Q1WA 3QITA 4MP3A 4ZKEA 1GNRA 3MCUA 5YASA 2HJWA 2Q5FA 4KGVA 2ZRGA 3DMGA 3SIXA 4S3MA 4CG2A 5A4AA 5HZMA 4HDCA 5A4JA 4DDHA 3O8CA 3GLIA 5HOEA 5CVDA 3RU2A 1IAVA 3IAXA 4KQHA 1UWCA 2ZUWA 3I1JA 5JLAA 4PC3A 3QI2A 1R4ZA 4K9OA 2ID9A 2DR3A 3ANTA 4DARA 3QE2A 3BRWD 3CX4A 3L7IA 4ZFNA 2HHHB 1XRMA 4MMXB 5JSFA 2BMWA 1PYGA 3QEMB 4QTTB 3TNFA 1G6KA 4HYTA 4N0QA 1SY7A 2AL7A 2E4VA 1C30B 1VQ1A 3GHHA 3IQWA 3LK7A 1L5HA 5ELMA 2PUVA 3TRJA 4RTSA 1JKJA 4CM4B 2Q3DA 4DIMA 2J4FA 2W2XA 1FEZA 3CEHA 2Q3FA 3ED1A 4GPTA 5DV9A 2R25B 1SQ5A 3AL0C 1ZINA 3QWHA 2BGTA 1SKYB 1EH5A 2XIJA 4EJSB 1NASA 5ICSA 1X7ZB 2H48A 2H63A 2Q28A 1C9JA 1KNXA 2FZVA 3O90A 7ABPA 2QRUA 4UNQA 4GR5A 5F64A 3SKYA 2CSXA 4X71A 4JB8A 4RVDA 2XZLA 3PXAA 3R3XA 1W1WA 5L51A 1IHUA 3CLUD 3GFTA 4U3JB 5EMHA 3VUFA 3ENKA 3DQQA 2FX3A 3ZK8A 3WJAA 4MDFA 2GKGA 2HCBA 3E7FA 3QYPA 4IH4A 4PSCA 2ZBGA 4P7FA 4UEQA 1BXRA 1P1RA 1DTWA 2GN4A 4MB2A 4TLBA 1ORHA 5DXAA 1RJWA 1XKLA 1FFDA 2VZ0A 2QRGA 2PMFA 1CZNA 1T2DA 2FSUA 2VZ9A 2MJLA 4GZ3A 4L22A 4YJFB 2A9FA 2A5YB 2C2MA 4R7GA 4W5OA 1JFFA 2GLTA 1QPBA 2ZRNA 3INTA 3HBLA 4L0MA 3OUZA 2WTMA 4HAVA 1JMVA 1PI3A 4RA9A 2C96A 2YOGA 3E23A 3ESXA 4OH7A 4BB9A 5IS2A 1F1BA 3NVKI 1FYXA 4ZTZB 3FH0A 3T35A 4TVOA 4ND1A 3KFLA 1UOQA 4JT9A 4KQ1A 4OKIA 3HP4A 4Q1AA 4Z54A 4P81A 4QVKA 1GHTA 3FFXA 4YLYA 3AZQA 3WMFA 1KI7A 4E5MA 4LQCA 2BCEA 3NTUA 1YQGA 2XGOA 3CX6A 1YIAA 4PLTA 3PC3A 1L3IA 2PX8A 1FLAA 1P1FA 4H6VA 4IFEA 4JJGA 5CYPA 3O4JA 3Q12A 1WW3A 1N6RA 1GUYA 3CF6R 3NHLA 3EUEA 5B1HA 121PA 4F06A 1G16A 1XMVA 2QZ4A 2B61A 2EKPA 1T25A 3I0MA 3VUEA 3ZLVA 5KSOA 4OLAA 5LFAA 2CCKA 3NTOA 5J43A 4G0XA 1QK4A 3WY9A 3C3MA 4RH3A 5F23A 1EDBA 1D9ZA 1XZNA 5DBFA 4BBAA 1TK3A 3FHLA 3FWZA 4JXJA 1MX5A 2NZ2A 3W5JA 3BC1A 1J23A 1XF1A 2V58A 2APJA 1Q1NA 4BMYA 3ILYA 5DIFA 4DAOA 4KWEA 1KQPA 4YMIA 5T6BA 4UW9A 4E1BA 1A9TA 4B31A 1ECCA 3EFEA 4GQIA 5C34B 1KOFA 3VBEA 1R18A 1NBME 5FLYA 1OFTA 3KKPA 5AJTA 1Z7WA 3CUVA 1N2BA 1WB4A 3GY0A 1JJFA 3IKLA 3N3BC 1NJ1A 2VTVA 3OETA 1MABA 5IZ4A 1D2EA 1YR3A 3I34X 1E7RA 3N8DA 4TROA 3F74A 2P9FA 3KFVA 3O4GA 4G0YA 4Q03A 3I32A 3U3OA 1HNWB 3U17A 1AE1A 4QBTA 4DNXA 4DANA 3HKEB 3RUDA 3VO8A 2L2QA 4OM8A 1JEYB 2VOEA 3KXLA 2WWRA 1W75A 5D7BA 3T3GA 1KAMA 4QNNA 2CZQA 5T4BA 2ZT5A 3S2SA 4G67A 1FXUA 1LX6A 1SPXA 2D5AA 2JI7A 2MSDB 3UHPA 3HY6A 4O4HA 1J7JA 3DR5A 4WA7A 4BVAA 3RVLA 5EWLA 4DV7B 2C5EA 2FRDC 4J0DA 3C3KA 4MW4A 3WQSB 1J5EB 3NBQA 3ZY4A 4IM7A 3IIEA 5IRCD 1AZLA 2HQ1A 1X7DA 1A2OA 1ND6A 1XLWA 1FYEA 1NWCA 3AHHA 4OJNA 4F3NA 1B23P 1L7BA 1P6XA 3BGWA 1Z6TA 2EDCA 3HEAA 1DUVG 3T54A 5LQRA 1SXPA 2ZAIA 3P96A 1IBSA 5I6DA 4NYJQ 4OHPA 5TSDA 1I3NA 3WO0A 3O8BA 3WBBA 4AF7A 1S89A 3OHSX 1IVSA 2ZTMA 3L77A 3ZC3A 4O1IA 3W1WA 1W36B 4JIMA 3MUFA 3B52X 5FFFA 4YV7A 3FVRA 4TXMA 3QFRA 3WRXA 4UHFA 1E1MA 1L6IA 3USCS 1HL3A 2Z98A 1PDOA 1QKJA 1C50A 3S28A 3EG5A 3LJKA 1M34E 2FSFA 3KJQA 4DM7A 1O96A 1ZITA 1NLYA 1XZDA 3DC2A 1W5BA 3S27A 4QDKA 3GW8A 2CXTA 1LBIA 2XQIA 1JSRA 2NWQA 4FDMA 1GZ5A 3GFGA 4AJNA 4XWAA 1YXMA 1Q7EA 4XYMA 4ZQFA 3T1NA 3EYAA 2PV0A 4MV6A 3WIBA 2AN1A 2CEKA 4YJKA 2B1QA 2QZPA 3E03A 2FPXA 4OHXA 3AM4A 3T4EA 3E9NA 1EM8B 4INZA 3SFZA 4GEKA 1A9QA 4GT1A 3OUUA 5DYIA 1E0KA 2DC1A 2PBRA 3HRHA 2GZHA 2OFPA 5BYAA 1VGVA 2ONYA 4J0KA 4OHOA 3F2IA 4BQSA 4BWGA 2ZAOA 1SVKA 1K7SN 1YDEA 3FNBA 4K5QA 1B3BA 5HKBA 2IYEA 4EH1A 1MIOB 1Z4PX 4DADA 2QI9C 4JLMA 5FBVB 3M4JA 3CS3A 3W2TA 3GNSA 4BQQA 2VO1A 2ZI4A 2IW1A 3M5WA 3RT1A 1S3SA 4ARBA 3L7BA 3U37A 1UFVA 3ESBA 5IJ9A 4MICA 1RYFA 3C5VA 1JG4A 1BFDA 2Z4RA 2ZRHA 2C2BA 3OJFA 1XXHE 5AHKA 5GM2A 3ENQA 3KJGA 3OQOA 2W98A 1E4EB 1ARZA 4ND6A 1Y6GA 1C80A 3BH6A 3ZWMA 1QPGA 4RCZA 1Q1ZA 1KBZA 1JWAB 2XH8A 1Y34E 3A05A 2GXUA 3T4UA 4LJ9A 5TF4A 4Y6QA 5JSZB 3ONEA 5K45A 4HAOA 3M6UA 3BXXA 4ACAA 3BGDA 3I58A 4O4JA 1JDPA 4Q7QA 4E3WA 5JAOA 1OU4A 2VHEA 2Z6VA 5HBGA 2ZJOA 1NI5A 3NKFA 4M0CA 5F51A 1NJ2A 3CUEF 5DTQA 4EY8A 2CJXA 1DRVA 2IU0A 3GELA 3KZOA 2YFQA 3NM6B 3UAGA 3NHWA 1C1DB 1XSEA 3VISA 1OREA 4BKPA 5KVSA 1E5LA 2B30A 4QG7A 2BSXA 2PZEA 4MJLA 1J8DA 5TMDA 4ASUA 3RYCA 3C6MA 4O4LB 5E38A 3C3EA 4PO8A 4RMHA 4BNLA 5LMNB 1VPLA 4A5SA 1A71A 3KWLA 1MZVA 2ZYVX 4UCWA 4DJ5X 5DNDA 4IIJB 4JAVC 1FYVA 2EW2A 4UE3S 3S4YA 5D3MA 4LKOA 2XT9A 3PX2A 4IF4A 2DFVA 1J9ZA 3B89A 3LUCA 5SZJA 1GYPA 2ATVA 4ZV4A 2D0OB 3LRXA 1XP8A 3N5CA 4R1SA 5NLLA 2XUJA 1TQHA 5IP5A 4UQLA 4WFIA 1U1FA 5EJIA 4MRRA 4BGDA 3DLBA 2Q21A 3FUVA 2W37A 5H68A 1SCJA 1XJ0A 4B3XA 1I2CA 2QJWA 3GJYA 1ZIOA 2OXCA 2QVZX 2RCNA 4U2EA 1TYBE 1MJFA 2P2SA 2JFBA 2IHZA 4N3AA 1VLHA 4YJGA 4X44A 4IS3A 1QHXA 4DYHA 1E3IA 3HKCB 1P31A 4JLKA 2G9ZA 2CNOA 2IHVA 3Q2KA 1ZNYA 3DKRA 3JQGA 5E0OA 5EXPA 3TSCA 4TYWA 1XFDA 2COEA 3ZV4A 1OJLA 3TR5A 1GPMA 3PYMA 3SXJA 2HRDA 3WOHA 1MOZA 1Q7RA 3RTEA 3CEAA 1YCHA 1JHZA 3MTGA 1DQPA 4MR8A 3C5WP 3S70A 2LGJA 2JEOA 3G6KA 4WBXC 3QXXA 5GGYA 4FYKA 3RSGA 3WHPA 1YSCA 3GGJA 1RCUA 1NP3A 2C20A 3MGCA 3X1XA 4DQKA 1UJ4A 4KITB 1TKCA 4J4HA 3T7SA 4BZQA 3BDIA 4WVLA 4PN7A 4XWTA 1VJ0A 1NYLA 3DUFB 4E0BA 4AK9A 1P4GA 2FPIA 3R3SA 5CFNA 4LY0A 1B6SA 1BRTA 1Z37A 2XXBA 3JPWA 3T3NA 1Z9BA 3K9CA 1U2DA 1WCIB 3DDNA 1W76A 1KYTA 1A5AB 1AHIA 3L8HA 4F3TA 2AI2A 4UM7A 1PJBA 1VECA 4RTPA 5JS6A 3S3TA 1ES9A 2QTVB 3DG9A 2QRLA 4RSGA 2EX4A 2YV2A 3OM8A 2VWQA 1XZHA 3QPAA 4DV1B 3R8XA 4BMCA 3GUVA 4IRUB 3TCXB 3WYEA 3BHMA 1N1EA 1HMYA 2CMHA 3BKWA 3G23A 4Q1DA 2JGAA 4JK3A 3B9QA 1R5JA 2R751 2VHUA 5LPNA 1MQ9A 2QQ0A 3N28A 3VHQA 5LQDA 3TRDA 2K4MA 2JGIA 4DLTA 4ZZ1A 3K35A 2CDRA 1P18A 2CWDA 4DHEA 2HYDA 3ZY5A 4PLCA 4EL5A 2E6KA 5IHPA 1TJYA 1GZ4A 2LDXA 3MJ4A 4KPGA 3WFIA 4DIOA 5K8UA 3NTLA 5BRNA 4N5LA 1CJSA 4NX2A 2ANBA 2Q5LA 3BE6A 2A0YA 3DGFC 4OXKA 3PLNA 3TH5A 4HNSA 3ZU5A 2R6JA 1H1DA 4C21A 4BKMA 1TAGA 2TSYB 1W4CA 2DQ4A 1RQGA 1XEWX 3FZGA 3MWJA 4C6HA 3GT0A 4ZQEA 2I99A 1D2HA 3OZVA 4GF5A 3B9PA 1O6FA 1E2LA 3R7FA 3K72B 4JA0A 4OQ4A 2CLCX 3VMFA 3H83A 3JQ6A 1C5KA 2AXNA 2K6GA 4KNYA 5DHPA 3RDPA 4ZYYA 3EDOA 2VJOA 1CW2B 3FR7A 3I04M 3IOBA 4YT4A 1XPOA 4EAQA 2ODQA 2ZSIA 3WRXC 1EQAA 1YKSA 5ANRB 5HF6A 5TMPA 4AAYA 1RYDA 1RXYA 1XLUA 4GYJA 4RELA 1QYVA 4A2QA 3KQMA 4JYPA 4Z9YA 4AQ7A 2C9CA 3M9XA 3JALA 4QFDA 3UWMA 2CVHA 2Z2XA 1GZUA 3MGAA 4FI3C 4Q66C 3OOWA 5CLIA 3EW7A 4E14A 3OOSA 4KFCA 2D54A 3GJ4A 2NM0A 4FFVA 1WMSA 5FAXA 3VI3B 2GERA 5L4NA 3CNNA 1LD3A 1SO8A 2X2FA 3ETDA 1E0DA 3Q8KA 1DJMA 1XUOA 1P2GA 1YC2A 3D8HA 4LXTA 4BZZA 1O6ZA 1DBVO 5BY2A 3BVPA 2PYIA 2A35A 1C8KA 1T4MA 2I4MA 1QG0A 1MVOA 2OB2A 2QE7D 1J0AA 3LDFA 3QKRB 4NLLA 1FP4B 1KAQA 4IHKA 2YFYA 2AMVA 3GPLA 4ZTUB 2Z6AA 4XYLA 4JJAA 4DT1A 1U5CA 2PO5A 4MITA 1BKYA 3VH1A 1IVNA 1RRCA 1Q22A 3QU5A 4YGYA 1XQXA 3OUTA 3AETA 4JUIA 1GU1A 4NVRA 3CNEA 5CVJA 1H22A 1HL7A 2NIPA 2R8EA 4L27A 4LF9B 1D2NA 2JATA 1VG1A 3I5MA 3MERA 5E1OA 3CONA 2NU6A 3V4ZA 2IYUA 2B5WA 4MKRA 4R8VA 5LP6F 3I76A 5EJMA 2WSIA 3SYTA 2VBCA 3W2GA 4DUGA 5FAKA 2O8FA 4Y9UA 3ZXIA 3WK7A 4GKBA 2LVBA 2P3OA 4B71A 2VUIB 3EYWA 4J49A 2BFDA 2PS3A 5ALDA 5EPEA 3RWOA 5BMVF 3RSHA 5KKCA 1LDNA 1P5JA 2EJUA 2NLOA 5K0SA 4XX0B 3TOCA 1V5WA 4YWJA 2VDVE 4H1HA 4JYAB 1RTTA 1W88B 1D2AA 2F59A 4QQNA 4W5JA 3BBLA 3N2EA 5BNFA 4HAUA 1Q11A 3T3PB 3T5PA 1E2PA 1T4BA 1V9SA 3L0ZA 4C88A 1VJRA 2ZP1A 5IKOA 4EP1A 4UTRA 4HH1A 1Z63A 5F1PA 2JIDA 2IUSA 1ULBA 1DP4A 3GEDA 1Q0QA 2DFPA 3N53A 4Y1GA 5AJZA 4LY3A 3MWEB 4S04A 4HI0E 1JJ7A 4EFKA 4YPVA 4XDYA 1HT2E 4MNTA 1OLUB 3GPBA 2E4UA 1HDRA 3D31A 2V55B 4YEDA 5CYGA 1ACMA 1HYBA 2QN6A 3CLSC 1IK4A 1AX9A 1C9EA 1K8QA 3EMKA 4CCYB 3OKAA 5BPHA 4BJ3A 3MOGA 4ZKDA 2OHHA 4I1IA 5CM9C 4LECA 5DXJA 2HRZA 2GARA 1QWSA 2CXRA 2DP4E 2J41A 1OV6A 2PN1A 2PX5A 2WVHA 2GYYA 2ZITA 3EZLA 4NMHA 2QLJA 2WK1A 3DD1A 3UOAB 1A5ZA 5D87A 1LS1A 4HEJA 1RI2A 1S1MA 3WYBA 3L07A 5T5QA 1R5BA 1VB3A 4QATA 4QBHA 2HF7A 2HF2A 2QMOA 3REQA 4DLBA 1OXBB 3MRTA 3NM5A 4YCAA 3ZXYA 3HVRA 4BQFA 4QOIA 4X1YB 3I6BA 2HNBA 1WDKA 1DWQA 1I9CA 1XELA 3OLWA 5I9NA 3ZWOA 1RAHA 1MH1A 4GGMX 4M0EA 1PVOA 1PR1A 3GCXA 2GK3A 2QNBA 3TYXA 4CHTA 4H3SA 5BNIA 2AQHA 2C7BA 3IR5A 1GRQA 1AQYA 4YR7A 2ZYIA 4FKZA 3AJ8A 4JUCA 4E88A 3OF5A 1QZZA 4N3GA 4RZHA 1PKEA 2ON6A 1MKYA 3OP1A 1JW9B 1ZFNA 5CW2A 4Y3UA 2AZXA 2HLDA 3UMJA 3NNDA 1XHEA 2HSDA 4O3FA 3B85A 1NP7A 1DCMA 2JBWA 3D3NA 2DULA 5AJVB 3W3AH 2B20A 2YS7A 1TUEA 2F9MA 5J4HA 1O95A 3KLPX 2WE8A 3OJXA 1F6WA 3FE2A 1F8YA 4YYZA 3P9QA 1G41A 3N7TA 5HJEA 4BNIA 4E2WA 3U81A 5GV8A 1SVSA 1T5BA 3C7CB 1KL7A 4M0KA 1L4GA 2J5QA 3MWDA 4G86A 1A4RA 1EE2A 3QTTA 4HZUB 3KK0A 3T7KA 3BJZA 4CKBB 4XXHA 3SHVA 1GN8A 2F8SA 5BR7A 4D57A 1E1QD 4I1SA 2RHGB 2G7MC 1MQ8B 4QM7A 3AOEC 5LOVA 2OO7A 2VIIA 4S1PA 4HHEA 4XIFA 1T8UA 2GN8A 2JFFA 3LYHA 4Y7DA 5CT6A 5FWYB 3NPAA 4RMGA 2LRHA 3RFUA 2I1WA 3GCWA 4E2FA 1B93A 1PZNA 1C9MA 2QM0A 8ABPA 1K8YB 2Q4DA 2ZR7A 3QNUA 3WYNA 4E5PA 5JAMA 1SC6A 4LZOA 4B44A 1SD1A 5E95A 4D44A 1DTSA 1P61B 2EHDA 1JB9A 1ORIA 1Y98A 4IMIB 3B48A 4M9RA 4RA6B 3RRZA 1QJCA 1G7CA 1E6CA 4L2IB 3KWMA 1Q1BA 1NIJA 3GFSA 1ML4A 4JJ6A 2CSUA 5MDHA 1L1RA 4GEGA 4IIDA 4MI6A 4UBLA 1TC1A 4V39A 4YMSA 3OE5A 1K7YA