1I30A

E. coli enoyl reductase +nad+sb385826
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
256
structure length
248
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitors of bacterial enoyl acyl carrier protein reductase (FabI): 2,9-disubstituted 1,2,3,4-tetrahydropyrido[3,4-b]indoles as potential antibacterial agents.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
total genus 89
structure length 248
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2001-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i30A00
4GX1A 2OHXA 3WGOA 2BH9A 3NYWA 2H1SA 3D4OA 1PL7A 2Q1WA 4J7CA 4BNTA 3D1LA 4FPXA 3JCZA 4NBVA 4PLFA 1UXHA 4DLBA 2WMDA 4PRKA 2FRDA 1ZBQA 3H9UA 2IEDA 1KVUA 1EEHA 5JE8A 2DPGA 3MJEA 4ZN6A 2PZMA 5AXBA 1C14A 3D3WB 2Y67A 1R15A 4URFA 2HAEA 1MG0A 4AJPA 2PH3A 1LC3A 1G0NA 1U4OA 5BSFA 4YXFA 5BR7A 1FDTA 3I9KA 2P91A 4AJ1A 2VYVD 2AQKA 3QWFA 4IDCA 5DN9A 5L7YA 1N8KA 1Q0QA 2FR8A 4MVJH 1F17A 4R1SA 5AXAA 4YBZA 1KC3A 9LDTA 2BI7A 1BSVA 3QWAA 3EMKA 4AL4A 8LDHA 3PWSA 3QJ5A 3F1KA 5L40A 1Y5RA 1RWBA 2JD1A 2H63A 4A27A 4RO0A 4EUEA 4IS2A 3O8QA 4AJNA 1VE9A 1WW8A 3BHJA 1LDEA 1NAIA 1VI2A 2H9IA 5BNIA 3JQBC 3RWBA 3PYLA 2GPTA 1D1SA 2TMGA 1MP0A 3MWEB 4GLLA 4NQZA 2JCVA 1A4UA 3ROKA 5DULA 3ZW8A 2CDAA 3NRCA 1X0XA 3H9QA 3LC7O 5A9TA 2DUUA 4I8XA 5TSDA 5TT0A 1JWAB 2HKIA 1DIRA 2R00C 5CEEA 1GQ2A 1QP8A 1C1DA 3RBVA 3PPIA 2VT2A 1QLJA 3I6QA 3KOUA 3PYMA 1XELA 3OJEA 2QX7A 5I7SA 1EVIA 4YAKA 1YWGO 1N2SA 4RLHA 3DHNA 1UZLA 1VM6A 4S3MA 4TRJA 2UYYA 4I1IA 1Y8QB 3WLEA 2Q3EA 2EW8A 2AW5A 4CMHA 4Q3AA 2P4QA 4J4BA 4XIJA 3E1KA 4OO3A 4CMJA 4CQLB 3GHYA 1QSGA 1GDHA 2AQHA 1Y81A 3DBRB 3GY0A 3GF4A 3NT2A 2VHWA 4UVGA 2RAFA 1GPDG 4XEHA 1PJ4A 1WP4A 4P8RA 1X13A 1IZ9A 2GGSA 4OSPA 3WFIA 2QYSA 2R00A 3EZYA 1CF2O 2C59A 3SX2A 3LK7A 2GERA 3PFWO 2JJYA 1UXIA 4MP3A 2BMAA 2NQTA 5EN4A 5JYDA 3I23A 1RM4A 4DYVA 2RHCA 1H6DA 3HJAA 3WS7A 3UOGA 1NTOA 2EP5A 3RIHA 4B7XA 1CQJA 1I2ZA 1YL7A 2J3JA 4IZIA 3F46A 2IZZA 4GKBA 1QLHA 4ZU3A 4D46A 3JQCA 1UXGA 3PHIA 2ZCVA 1JA9A 1ENYA 3DAGA 2O3UA 3K5PA 4FN4A 4CM9D 1DHTA 1IZ0A 1LRLA 4RPHA 4WNIA 3I9NA 1X15A 2FPPA 2W2KB 1D7OA 1A71A 4FGWA 4UVHA 5THQA 2BF7A 4ONEA 3AM5A 2GZ3A 3F4LA 4YJHB 5L4LA 1LTHR 3AI1A 1YXMA 2P4HX 3D4NA 3GDGA 1KC1A 3GC6A 3H6KA 3UHAA 4XRGA 2OFPA 1NHWA 4CR6A 2AG5A 3W8EA 3KXDA 1NVGA 4TVOA 4M86A 4BO2A 1Q7GA 3DBRA 3VPSA 2I3GA 3FBGA 4HFRA 4BNNA 1P1RA 1G1AA 3L9WA 1DJNA 3O4RA 2JAHA 2HK9A 1UJMA 3KEOA 4N5MA 3QRWA 4E5MA 4OGWA 5JAIA 5IFLA 2NTNA 1LNQA 2C54A 2J3KA 1TEHA 2X0JA 3A4VA 1N7GA 3LQFA 3OP4A 5B12A 4JN6B 3OIFA 4BNLA 4TMFA 1AHIA 1U4SA 3WGZA 1GZ4A 2X4GA 1ZK2A 4WLOA 5CP8A 3ZN2A 4GWGA 4W82A 4BO7A 3QVTA 3OF2A 3KBOA 3PRJA 3V2UA 2LDXA 1WZIA 2X5JO 3OEWA 1JVSA 3ZU5A 2C29D 1ZW1A 3C7DB 3EUWA 3OICA 1NFFA 1DIBA 2X5KO 3PIDA 4KMSA 3QY9A 3DZFA 1GD1O 1ISGA 3DB2A 3FNGA 1MA0A 4O0LA 5IDYA 4GX2A 1E92A 1Q7CA 1D4FA 3PHHA 2Y1FA 1O9BA 1I01A 4BQRA 4N7RA 3GEMA 3DEYX 4KUEA 1U7HA 1XWFA 1ZK1A 1J49A 5F3RA 1MV8A 2VRBA 5F1KA 1IE3A 3OM9A 4L74A 1P1KA 4MVJI 1PEDA 2D3TA 1EBUA 3JQ9C 4E21A 2O2SA 2YQ4A 3M1LA 2ZJ0A 3JQAD 4FBGA 4BNKA 4CLOA 3AW9A 4WKGA 5KIAA 3C1AA 2VWGA 1DO8A 1LRJA 4M87A 1EQUA 2EJWA 1E3LA 3B1KA 4R1UA 1DFGA 3RUEA 5JNLA 1H6BA 5C7OO 5LDHA 2B4RO 4L76A 3OQ1A 5U1PA 3JD0A 4M1QA 2ZATA 3L6DA 1PS0A 1XG5A 4CM9A 1IHYA 4PCVA 3LLVA 4E2WA 1C0PA 1PJ2A 2O3JA 1SB9A 4ND1A 5DF1A 3JQ7B 4AICA 4BO9A 1PIWA 2BI8A 5JC1A 1NPYA 3N7UA 4W99A 5T67A 4J1TA 2VHXA 3TZKA 1HE3A 3JQFA 3IDSA 3ONDA 3RKUA 3PZBA 3K73O 1M2WA 4H16A 3K31A 3SVTA 2B5VA 1LSOA 3VC7A 2OMEA 2PZLA 3GVHA 4TZTA 5JAMA 1PGJA 1JDJA 4Z9FA 2WDZA 4ZQGA 1NQAO 2AXQA 1FF9A 2FR0A 3HDHA 4YEDA 2Q1TA 3IP1A 4RF2A 4PG4A 4FOOA 5JPIA 3CXRA 4IDDA 4IJUA 3DZJA 4FSHA 1XGKA 1H5QA 1V3TA 2BRUA 2GCGA 1YE3A 4ZRMA 5FF9A 1Q0LA 4Q9NA 1EUCA 1DRVA 3PI7A 1WVGA 4RVUA 3ETDA 4Z9YA 4BNVA 4IBOA 1LXCA 1PS9A 2HUNA 1J0XO 3CIFA 5H82A 5L53A 1K6JA 2EXXA 4BNIA 2NVWA 4ND4A 2HJRA 2EKQA 4PG8A 4QQRA 2VNSA 5JAQA 3TRIA 5COQA 4NBWA 4WJZA 1DC5A 4G81A 1T26A 1A27A 1WMBA 1IPFA 4OMUA 3BTUA 2X5OA 1VRWA 4XDYA 3RAJA 5C5IA 3BA1A 4BB6A 2Z5LA 3D5QA 4LCJA 5JCJA 3F5SA 1TVEA 4XQCA 2HRBA 2OUIA 5TQVA 2HCTA 2XXBA 4O63O 2R2GA 1U5CA 5AXDA 4BMNA 4RGBA 1UDCA 4BOYA 4NIMA 3DOCA 4CM5A 4A2CA 4J4HA 3ASUA 1I8TA 2J5RA 1D8AA 2GSDA 1BG6A 4FW8A 4B3IA 4AJKA 3UFXA 3W4IA 2QIOA 3GMSA 3L6OO 1O0SA 1H2BA 2OO5A 3ZI0A 5IZCA 4XX0A 2GRAA 1UAYA 3DBHB 1HDXA 4YJGA 4BGUA 5A1TA 2V6BA 3HN7A 1DC4A 3K30A 1XQ6A 4FFRA 5CEFA 5JYEA 2H6EA 4CQMB 4Q3EA 3JQ8B 3K2EA 4WGGA 2VHZA 4YB8A 2VZ8A 2VCYA 4WEOA 2CZCA 3ZWAA 4AJOA 4RPLA 3BXXA 5AOVA 4E13A 2YFHA 4ZQFA 1BW9B 2WE7A 2DLDA 3PTZA 1EFKA 3F6YA 4A73A 1KEUA 1ZH8A 5DCWA 1LDYA 1NQ5A 3O03A 3M1AA 1WMAA 3A1NA 4BO3A 4PIVA 1R4MA 3HE3A 3JYOA 3G3EA 3TJRA 4A26A 1XU9A 4UUMA 4QT0A 1VKOA 1GTMA 1QV6A 1BXGB 1PWZA 4LCEA 1EBFA 3JYQA 3S8MA 5IZCC 1WDMA 1BXKA 3UKOA 1Y9AA 3JQEA 2WYUA 4CMKA 5ADHA 3LT0A 3DL2A 4YJGB 3HDYA 1CWUA 3PLRA 5TT1A 1XHLA 3WYBA 3H5RA 1IB6A 4PG7A 2NVUA 4WPGA 1U5AA 3EHEA 4XJSA 3ZNNA 3UCEA 4G2NA 4R16A 1OOEA 1Z7BA 1ZJZA 3GNSA 3NJ4A 3KYBA 3U4IA 2FR1A 3PEFA 3TPCA 3UVEA 4FB5A 1DSSG 4RZIA 2C7GA 3ZNQA 4J7UA 4Y6PA 4NK4A 3RBZA 3T4EA 4HUJA 5L3ZA 2HQ1A 1TT5B 3IKVA 4GVXA 1NWHA 2BFAA 3ON5A 3QWBA 4MIYA 4U8GA 3V5NA 4XGKA 1KOLA 4ZVVA 1LDNA 3P19A 2DBQA 1PQWA 5JMWA 2F00A 1IULA 4CV0A 5DBIA 1QYVA 3GN1A 4OQYA 3DMTC 2YJZA 3JYPA 5A02A 3A06A 1QMGA 2I76A 3D3WA 3JD2A 4NMHA 1ZSYA 3CTMA 1TLTA 1QYXA 2DC1A 3PJDA 1DFIA 5LDGA 1T24A 2VHYA 2GN4A 1ZEJA 2YV1A 4CMCA 4F6LA 2NTJA 2W4QA 4B7CA 1O94A 1F8FA 3HWRA 4DREA 5K6AA 4K9DA 1VJTA 1ARZA 2Y0EA 3GNTA 1YBVA 4MP8A 1PJTA 5JC8A 4B4UA 2P9EA 4YJHA 5DNAA 3GGPA 4CMGA 1HDOA 5ER6A 1YL6A 3UCXA 3C7CB 1V0JA 3NTQA 5ES3A 4A0SA 2Q45A 4CM4A 1V35A 4UEOA 4RDIA 4CL8A 1B26A 1GL3A 3K2BA 3PJGA 3AOEA 3PQFA 3RUDA 4CMEC 1QYDA 1YRLA 3EW7A 2RH8A 1T2CA 2ZYAA 3D3EA 2NQ8A 4LRSB 1G0OA 4L4RA 1F8GA 2HMSA 4CLDA 1T4BA 3EYWA 1E6UA 4MVJG 1YONA 2WD7A 3U4HA 4O59O 2GZ2A 5KNLA 3FCOA 1E3JA 2IZ0A 3DXFA 3RFVA 2PD6A 3QW2A 3RJ9A 3BTVA 4CR7A 2AE1A 2YQ5A 1R6DA 2I99A 3ABIA 4CUKA 4WE3A 4WCFB 2HK8A 6LDHA 1LSSA 2C5EA 3ZWXA 3LU1A 3OFSA 2UDPA 1LLQA 1YDEA 3C1TA 3ANMA 4H7PA 4MKXA 1B3RA 5L7WA 1R0LA 5BSGA 4XR4A 3R0IA 3N74A 1CYDA 4DTIA 1NVTA 1P31A 4AJLA 4RVGA 5T64A 3OECA 4HV4A 2NM0A 1MFPA 1U7TA 2JFFA 2C07A 2CDCA 4CMEA 1ID1A 3EC7A 3I9OA 4D3SA 4U0JA 2BGKA 2QG4A 3WIDA 5A9RA 4IM7A 4KWIA 2P9GA 4AFNA 3S2IA 2XAAA 5FI3A 1CERA 5L51A 3W8DA 4A5OA 3DTTA 3OJ0A 4IQ0A 4J91A 4MVJA 4CLOB 3G0OA 5EJ2A 3H9JA 4BNZA 3KM0A 1BRMA 1M67A 1O6ZA 4QEDA 2YDXA 4YT4A 3ZHYA 4BV8A 2DTEA 5A06A 1HZJA 2EV9A 4KUGA 4CM1A 1K6XA 3MCVA 4E12A 4IDAA 4UUPA 4R3NA 1H94A 4CM6A 3CH6A 1GV1A 1HEUA 5EINA 3PLNA 3VPXA 4ID9A 4Y98A 3AU9A 3DMYA 1OAAA 3LT4A 4MVJD 2F1KA 2Z1NA 2X6TA 5DBFA 3WQSB 5KKCA 4D79A 5LCXA 4XYBA 4U7WA 3U3XA 1NASA 4RVHA 5TLSA 3G79A 2Y99A 4J43A 3TFQA 2E82A 2Y1EA 1WWKA 3ONEA 5IN5A 4UUOA 5IJZA 4J2HA 2Q2VA 1VSUA 2EG9A 3KEQA 4ND3A 4QO8A 1SB8A 1KEWA 4OAQA 4MO2A 3GUYA 5CFZA 1GUZA 5KJCA 4MDHA 3WX0A 3PHGA 1SAYA 4JBIA 4XJTA 2NNLD 4GWKA 1DBVO 2FOIA 2WYVA 4ZJUA 3AK4A 1V3VA 1AXGA 3BYZA 4AJIA 3ITKA 3F9IA 3PZRA 4MVJP 1GU7A 1MXFA 1B8VA 1MGOA 4QFCA 4R9RA 3WXBA 1E5QA 1ISIA 4E4YA 4XR9A 1H9AA 5B37A 4NDNE 4YT2A 5B4VA 1I33A 3W6ZA 1IHXA 3AFMA 4GSLA 3KTDA 2B4TO 3ZNPA 1YBMA 5DP2A 1E3SA 1UR5A 4IUYA 4OJNA 2Y0DA 5L4NA 4F46A 2P5UA 4TQGA 3ETEA 2CUKA 3EDMA 4IQGA 2ZKLA 2Y1OA 4PLCA 3V1TC 3DFZA 3E48A 3GRPA 2VT3A 1U9JA 4UVEA 4NBUA 5A3VA 1LX6A 1ML3A 3F47A 3RASA 3WJ7A 3T7EA 3O9ZA 4PG6A 4GL4A 2G1UA 5ITWA 1NHGA 3OMLA 4XIYA 1NPTO 4UUNA 1HT0A 1QRRA 2ZYGA 1UP7A 1PTJA 3UUWA 1HRDA 2VRCA 2CSUA 1YB1A 3WDSA 2PNFA 3H8VA 1I3MA 1UP6A 2YY7A 3H5AA 5HM8A 4E2YA 3ZWVA 1U2GA 3BTOA 4D42A 5JO0A 3K92A 1F0YA 5HRUA 1P33A 1SO8A 3LVFO 3QE3A 5C7LO 4R9SA 2OXIA 2W2LD 4BKRA 1V9LA 2DTDA 3GA0A 4D41A 4EBFA 3K9QO 1CEQA 2CF6A 2J8ZA 2GN9A 3ASVA 1T2DA 3HSKA 3M2PA 4CV2A 5C3MA 5IAAA 1ZVMA 3JQDA 1H9BA 1I5RA 3M2TA 1UZNA 1XSEA 1KIFA 3DHEA 2BGMA 4NNJA 4X54A 1KY4A 3UCFA 1QKIA 4JQCA 3ZWWA 3VH2A 2EKPA 1H93A 1P0FA 1X7GA 1PX0A 2O3RA 5GZ3A 2IXBA 4R1NA 2V6MA 4G65A 3F5QA 4LMRA 4PLYA 3WGIA 2AE2A 4JXKA 3AY7A 1M76A 5K6AC 5F5LA 2DPHA 3JD4A 3GVPA 2BHLA 1X14A 3DONA 2YV2A 3SJUA 3H2SA 4KQWA 4YRDA 1HLDA 4BUCA 2ZTMA 3I9MA 3MOIA 4XQ9A 4YAGA 2D2IA 1E7QA 4XYLA 1UH5A 2PD4A 4Y9DA 3I6IA 4TWRA 4AJEA 4ALKA 4NJMB 5DBGA 4LISA 4UULA 4FFNA 5ILGA 2WE8A 4D3FA 3DHYA 3PQEA 5C37A 2XPCA 3PHLA 4UAGA 1T2AA 2P5YA 3KO8A 4IXWA 3RC7A 5TGDA 3QP9A 2Q2QA 4EZBA 1U3WA 3D4PA 3ZWYA 4IMRA 4LVCA 3NDIA 1PSDA 4Y6SA 4QXMA 4BNWA 1BMDA 3ZDFA 1HXHA 1X7HA 1N7HA 2PR2A 1ZZEA 1UP4A 5G4KB 2BLLA 4IPTA 5JLAA 3L4SO 1SOWA 1VC2A 4CODB 1WNTA 5KJ1A 1ENZA 1N9GA 5JDCC 2DBRA 1FDSA 5TC4A 2FPIA 1DIHA 1TT7A 1UZMA 3TN7A 1NR7A 4LN1A 1E3EA 3O26A 1ADGA 1E1NA 1O8CA 1V6AA 1WXDA 3DFUA 1DOHA 2YW9A 1R4NA 4NFYA 4HNHA 1DAOA 4FDAA 4PLPA 2Z95A 4Q39A 3NKLA 3AUUA 4WLFA 4BNXA 5L4SA 5IXYA 4BO0A 3NAQA 4RVSA 4LW8A 2RBEA 4EJ0A 1E77A 4PLGA 5CAEA 5U9CA 1T1SA 3MJTA 4A7PA 2I67A 3BMOA 4DBVO 3FTNA 5B1YA 1H2HA 1HYEA 3WSWA 4EEZA 5HWSA 1WPQA 4MINA 2PLAA 2FZEA 4Z0PA 4K6CA 4BKQA 1IYZA 5JW6A 3I4CA 2O50A 2VHVA 4GH5A 4YRBA 2Y05A 3WQRA 4C7KA 4J1NA 1H6AA 4BKUA 3ZWCA 1ONOA 2JL1A 1Z82A 3MJ4A 1T1RA 1W0CA 2O2YA 2W2LA 4M55A 3B1FA 1KS9A 1LA2A 4YT5A 3WYCA 3VHRA 2D0IA 5A04A 2A94A 2VUTA 5K0ZA 4KOAA 4DIOA 1EDZA 3FSRA 5B4TA 1P1IA 4B8WA 2WD7B 2J5QA 5CDSA 4Q3DA 1Z45A 1OBFO 2CVOA 2J5KA 4TZKA 2GR9A 2Q4EA 4II3A 4ZQHA 2WTBA 1ORRA 5KJEA 2POQX 4R3WA 2FPGA 4WCFA 3VH3A 3TDKA 1E7SA 1ZXBA 5HA5A 3BMOB 4QSMA 2I66A 3TNLA 2IODA 2AA3A 3KYCB 1BDBA 3GVCA 3RC9A 1JKJA 1GCUA 1YQDA 1BVUA 4DLLA 3RBXA 3AM4A 2NVUB 4N5LA 1A7AA 1FDVA 2D5CA 5KVVA 4MP6A 3G1UA 1ONPA 1GZ3A 3X2EA 5FEUA 1X1EA 4GX0A 1GUFA 5IZ4A 1IOLA 3ZU2A 5L95A 1X1TA 2C2YA 1EE9A 3D7LA 3MEQA 3I4FA 3SC4A 3HZZA 2DKNA 2RHRA 1DLIA 3V1YA 3GZNA 5JY6A 4M49A 3JQAA 3MWDB 1C1DB 1H0KA 4IGFA 4DQXA 2Q2WA 2JFHA 3WFJA 1TXGA 1E7RA 4D7AA 4II2A 3ZU4A 1KY5A 1I24A 1N5DA 1ULUA 3I52A 7ADHA 1P3DA 3GG9A 5G4LA 3ICCA 2FMUA 5TIIA 3OJOA 2DFDA 3LSYA 4J1SA 4IDFA 4RPJA 3ZWMA 1ISFA 3CSDA 3NUGA 3Q9NA 7MDHA 1GYRA 2CDBA 1PJCA 2ZK7A 3CZRA 3HFGA 2CMDA 3Q0EA 5H81A 4ALLA 2CNBA 2VYNA 1N1GA 3AY6A 4P4LA 1LU9A 5G0WA 3TOXA 4A03A 5U4QA 4BMVA 1Y8QA 1OC4A 1SOVA 1W4ZA 2Y0CA 3HUDA 2BD0A 2O4CA 2ZTUA 1P1JA 1B15A 4YQZA 4FC7A 4IZHA 4JJGA 1C1XB 5HS6A 4E6PA 2X7HA 2I65A 4WLUA 2NLOA 2PD3A 1I3KA 3GZNB 2VZ9A 3DTYA 5A9SA 2G17A 2Y66A 3S55A 3LZ6A 3KYCA 2PKRA 4J6FA 1MC5A 2Q1UA 4J9UE 4I9NA 5IG2A 2UUPA 4ITUA 1ZSVA 3EZLA 2NU8A 1DC6A 5DZSA 2X22A 4CM4B 1L7DA 5DCUA 5TJHA 3R3JA 3AI2A 3KSZO 3A14A 4OH1A 4DMLA 1B14A 3WBFA 4RPKA 4LSMA 1K6IA 1MB4A 5A03A 4BGEA 1E6EA 2IRWA 4ZHSA 3VPFA 2IE0A 5HS4A 4I5FA 2X9GA 4WEQA 3JQ7A 4ROSA 4BNJA 1NWCA 1EE2A 1HDCA 4RORA 3I5MA 4WOJA 3C8MA 3LF1A 5F1OA 1B7GO 3OIGA 3IS3A 2FWMX 3HB4X 4DGSA 4ZICA 4HNGA 3NGXA 3W4JA 3ZWOA 1GADO 1ZNQO 4KDEA 2JFGA 4R5MA 4XCVA 4BGIA 3RUCA 1B8UA 1F12A 4YRAA 1DB3A 2YZ7A 3UH1A 3C1OA 3JSAA 4P38A 1EUDA 1PQUA 1LEHA 1CETA 1I0ZA 5EL0A 5FI5A 1FXSA 1K0UA 1XCBA 5T8KC 3O38A 3GN2A 1OFGA 2O4UX 1E7YA 1YJ8A 2CD9A 4N54A 3RQSA 4JROA 1C1XA 4INAA 2EF1A 3WTBA 4HFNA 4BKOA 1YJQA 1GAEO 4M54A 5JDCA 1VL0A 5CDUA 5CG2A 3FPLA 3JV7A 2CVQA 3RVDA 5I8ZA 3DR3A 3FR7A 3VOSA 1M6WA 2O48X 3S2FA 3L07A 3L4BA 3U4DA 1LSUA 2A35A 2HDHA 3DWFA 2B83A 4L9RA 3RCBA 2VQ3A 4PVCA 4UEKA 1WDKA 2GYYA 3ZHZA 4UVDA 3DOOA 3AY3A 5J23A 3VDQA 3AU8A 4NH4A 3CE6A 3GZ4A 4AJHA 4RPGA 1I30A 2AQ8A 3ITDA 1Y6JA 3L0DA 1V8BA 2EHDA 1DLJA 2AEFA 2GUGA 1JN0A 4XZ3A 3ANNA 4ZQEA 2PGLA 4E30A 1GEEA 4WCDA 3R3SA 4JGBA 4BNMA 4TSKA 2VOEA 5IF3A 3MJVA 2O23A 5JY1A 1ADCA 1UXKA 2G5CA 3R1IA 1N92A 3BMNA 5KOIA 1Q7BA 2G82A 1Z6ZA 3EAGA 2VUUA 2Y1CA 4BO8A 3RUFA 2JD2A 1Y1PA 3BMQA 4H3VA 1VSVA 4G5HA 3WGHA 1P77A 4OOFA 3IKTA 1FMCA 1GCOA 4O1MA 4J0FA 3ZNOA 4BNGA 1P44A 4H15A 4DL9A 2OP1A 4OYRA 1W8DA 4FOSA 3UW3A 2EEZA 3NTOA 2VWPA 2ZJ1A 1DIGA 3JQ8A 3NV9A 2E4AA 2HSDA 1PGQA 3PJFA 4EJ6A 1LRKA 4E33A 2D5AA 3T7CA 3LC1O 2B4QA 4E31A 4Z3DA 3JYLA 3GMDA 2PV7A 3OH8A 3RU7A 3TZHA 3ZWBA 1O89A 4KWHA 2FSVA 2X9VA 4AJJA 4I9HA 3U0BA 1E5LA 1MX3A 4Y67A 1EQ2A 5CDYA 1YQGA 1QR6A 1GYQA 2IZ1A 2X86A 2Y68A 4MPDA 3VVCA 3CINA 1NX6A 1HF3A 4XQGA 2YDYA 3GEDA 2E6UX 4M8SA 1EVYA 2X8LA 4NHEA 4GKVA 1E7MA 1K89A 1D3AA 4J0EA 3DOJA 3RUIA 4NZ9A 2ZTVA 4WOKA 4RF4A 2HLPA 3MTGA 1O95A 1JWBB 5JCJD 3Q3CA 1TA4A 3WWYA 3UXYA 3RJ5A 1Q2XA 2O7SA 4UEJA 4DIFA 2VNAA 1HKUA 1LLDA 3INRA 4S1VA 4YR9A 1UDBA 4OKNA 5IN4A 3KSUA 4HWKA 3V8BA 2UV8A 4DC1A 3PXXA 3U49A 1G6KA 4FC6A 4E32A 1ISMA 1MFZA 3IIEA 5C7IO 1WZEA 3B70A 2QYTA 2AEJA 5EQFA 1U28A 3ZCXA 3GOHA 4NI5A 4EGFA 3COSA 3FNFA 3LYLA 4CM3A 1GUYA 3C3XA 3W1VA 2HMTA 4I08A 3HFSA 5BNTA 1A72A 1Z7EA 3BIOA 3W8FA 1M75A 4MJLA 3OJFA 2YFQA 4XKJA 1P9LA 2OBNA 2XOXA 4LVUA 1PGNA 1L7EA 5A4DA 4JBHA 4IDEA 3RU9A 1W73A 3GH3A 2E49A 4JNKA 1XEAA 4YAJA 1ZCJA 3U62A 3IUPA 1GQYA 4ALJA 2G76A 4Q3NA 3G1TA 3U5TA 2Z1MA 3NDJA 1QYWA 4WUVA 5L45A 4W9NA 1I2CA 5IDQA 1ZO8A 3RKRA 1GFSA 1DPGA 4P4NA 3ZV4A 3ZV6A 4CQMA 4K1LA 2RH4A 4N18A 1F06A 2LDBA 1ZKMA 4CLHA 1PR3A 4CUJA 3SC6A 4ZD6A 4DA9A 4DVJA 3AFNA 3L6EA 4BIIA 1Z75A 3ST7A 1TB4A 1YOVB 3TL3A 2A4KA 3HDQA 3I1JA 4ALMA 3E5RA 1HWYA 4ALIA 3ONFA 1HDYA 3ENKA 4LK3A 2C82A 2DU8A 4W6ZA 1LUAA 1FJHA 3QWHA 1PU2A 3KHUA 4U6QA 4NJMA 3G17A 1Y7TA 4OKIA 5GMOA 4CL3A 1BDMA 1PS8A 4NG5A 1R4MB 4R1TA 2EGGA 2QRLA 3NT4A 4DMMA 4IXTA 4XB2A 3UN1A 4F3YA 2AQIA 4CUZA 5I9NA 3TZ6A 4J7XA 2P2SA 4BVAA 2O3SA 5I9LA 5KJ6A 2DVMA 3KSDO 2GZ1A 4HY3A 4W9NC 1R4NB 3PWZA 4L73A 2DT5A 3TWOA 5MGBA 1IPEA 1VPDA 1N9GB 4FGSA 4NFSA 3WYEA 5IDWA 4ZGWA 1GR0A 1HYGA 3FPCA 3RFXA 4L0QA 3ENNA 4GMFA 4PRLA 1BXGA 1IL0A 3QQPA 3OBBA 3E8XA 3FNEA 1ISJA 3KETA 4NBRA 2AMFA 2ZCUA 4OSOA 1PZFA 2P9CA 1R37A 1S6YA 4PZDA 1I10A 4GAEA 4Y6RA 1TT5A 2JCYA 3PJEA 4EEXA 3BHMA 1RM5A 1RM3A 2X23A 4EUHA 1XLTA 2HMWA 4WNCA 2IYOA 1E6WA 3WNVA 4IIVA 3DO5A 3OETA 2A92A 1MG5A 3SLGA 3S2GA 4EITA 1UXJA 4E5NA 5EESA 4FR5A 3MZ0A 1RYDA 1YH3A 1EMDA 1ZSNA 2B69A 4YAEA 1NPDA 3NDRA 4J4TA 3HQ4O 2VN8A 4IJKA 2C7VA 2YYYA 4MOWA 5IXSA 3GPDG 5JAZA 2AHRA 4RQTA 4IQ8A 4CQLA 2ET6A 3C24A 1KERA 2X0RA 5ER9A 4AJ4A 2Q46A 3AJRA 1VLLA 3QVWA 4BNFA 2VRCD 2PFGA 3E82A 2G0TA 4TROA 2ZYDA 2ZQZA 1R12A 4YPOA 2RIRA 2V6FA 3ORFA 4FJ1A 3E9MA 5ILOA 3U4CA 4KTVE 3GHHA 4WLEA 2QW8A 4DC0A 3IJPA 1WDLA 3ADOA 3L4BC 3WGQA 3OHSX 5KVQA 3SBOA 3NT5A 3FBTA 2VWQA 2YHIB 5ENVA 4B4OA 4E5YA 4I5DA 4GBJA 3VTZA 5ICMA 2C5AA 4J90A 3HHPA 1QYCA 4I5EA 5T57A 3X2FA 4DQUA 4FIZA 2UVDA 4RJTA 1Y5MA 5ICSA 4GI2A 1EK6A 2PA3A 5EIOA 1MUUA 1W6UA 4PGFA 2EERA 2AG8A 1RM0A 4B7UA 1JTVA 5JFOA 2FZWA 3QIVA 4KUHA 4E2XA 2CF5A 1AUPA 4BQPA 2D59A 5FYDA 3GDFA 4JBGA 3CUKA 5L9AA 5DCYA 1NXQA 3Q1LA 4R51A 1UUFA 1NBOA 4RVFA 3JYNA 4XQEA 5CPFA 3ZU3A 1VL6A 3AI3A 3E9QA 2VZ0A 4BB5A 5JS6A 1UAGA 3QLJA 2BGLA 3GQVA 4DXHA 2IXAA 4EW6A 2SCUA 1XDWA 5GZ6A 3EK2A 1AN9A 4XD2A 1HDRA 1HDZA 2Y93A 4OXNA 4PLVA 4L75A 4ND2A 4M89A 3OA0A 5TF4A 1NYTA 5TX7A 4BL5A 2TMDA 3O8QB 4TRRA 3GT0A 4XYEA 5CPBA 3DQPA 3JQGB 3ZHXA 3QV1A 1ZMOA 2RCYA 4D45A 4QX6A 4PZEA 2PKQP 4NFHA 1DRUA 4W7HA 4RZHA 2OBYA 1I3LA 3KVOA 3BMNB 2DBVO 4PN3A 4FFPA 4R69A 1LBEA 2C2XA 5K9ZA 8ADHA 5EMHA 1BTOA 3ETGA 3OA2A 2X1HA 3GAFA 3JQBA 5MDHA 3B6ZA 3IMFA 4OOEA 3QVSA 2NVBA 3ZGYA 3VPHA 3GEGA 3BMCA 1PZHA 1FDUA 1YDWA 3L77A 2E37A 4HXYA 3WIEA 4LSWA 2GD1O 2EGHA 5DDIP 2VUSA 2E48A 1A9ZA 1XR3A 3ROPA 4KZPA 2J3IA 4BO5A 4CMIB 4JIGA 1HDGO 1DC3A 1A9YA 1HE2A 1LLUA 2DUWA 2GN6A 3OSUA 3GVIA 3DAFA 2VTEA 3H65A 5H83A 2B5WA 5BSHA 3IUSA 3LC2O 5THKA 1IY8A 1EFLA 3FRJA 2VTDA 2Q1SA 2D4AA 3JQGA 5F5NA 4YJDA 3INGA 1OMOA 1PR9A 2W98A 4B4VA 4NBTA 1BWSA 4JP3A 5CDTA 4Z9XA 4RV9A 5G0VA 3WLFA 5I7EA 3DBVO 1EK5A 2V7PA 4BV9A 3F4BA 2WWRA 4D44A 4QTZA 4DPKA 3RUAA 2JCXA 3RC1A 2QHXA 4XB1A 1U1IA 1AGNA 2IDZA 3Q11A 4DPMA 1HETA 3GFGA 5AXCA 3RSHA 2B0JA 3IC5A 4YVFA 3BMCB 4J49A 4XDZA 1D1TA 1SC6A 3VZSA 3Q2KA 5JDIA 1E0DA 1IUKA 1PJLA 1V3UA 1I2BA 3C7AA 1I36A 1SNYA 2OP0A 4XYMA 2OGUA 1LJ8A 5KKAA 3U9LA 4KP7A 5AVOA 3WSVA 2PH5A 1RKXA 2BELA 3GVXA 1O5IA 3BHIA 3CEAA 3P2OA 2W2KA 1KEVA 2W8ZA 2V6GA 2X58A 3PK0A 1PGOA 1DDOA 3VZRA 4PLTA 1L1FA 4TKMA 4AG3A 1NQOA 4OXKA 4CLXA 3M6IA 3TZCA 2QQ5A 3K6JA 5AYVA 3FWNA 1JKFA 3GRKA 4LMPA 4ZRNA 4IDGA 3VDRA 4EUFA 3IP3A 4QFDA 4R01A 9LDBA 4MIEA 1I3NA 3BMQB 2O3QA 4KDFA 4LRTB 3GDOA 4U5QA 1A7KA 3H4VA 5JXWA 3ZZNA 2O7QA 1HZZA 4BNUA 2V65A 2FY8A 1LC0A 5EPOA 5I9MA 3GGOA 2C20A 2DAPA 4BMSA 1CIVA 1SMKA 1QORA 3WMWA 4OXYA 3I9LA 4NJOA 1AHHA 3OIDA 4UVIA 1B2LA 1B16A 3AUAA 1SCUA 5KJFA 2OZPA 4L8VA 4R41A 4WLVA 2NTVA 4KQXA 3PDUA 4R4JA 1WLYA 1DHRA 3RROA 1UDAA 1LQUA 4IIUA 1YOVA 4RLSA 4DLAA 4MVJM 3FNHA 2H5LA 4HFMA 1E1MA 3WG9A 3E6AA 4PLZA 3NX4A 3GAZA 4RL6A 3VTFA 5T6BA 3W4KA 3HNPA 2EJVA 4D0RA 3TL2A 4U0KA 3H7AA 3AWDA 2DFVA 3WB9A 2Q99A 2VYND 2WM3A 1J6UA 4HBGA 5JCXA 1JVBA 1ADBA 1PJ3A 1Z74A 2PWZA 3LT1A 3QVOA 4TKLA 3VH1A 2WEKA 3U09A 2JKVA 5LC1A 4P22A 3ZH2A 2OORA 4CLRA 2VOJA 1WAMA 3H2ZA 5JMPA 2ZQYA 3KLPX 4Z3KA 5KCZA 4R54A 1J4AA 3JQ6A 2DM6A 4HADA 5GY7A 4NU5A 2BFPA 3STHA 4J9VA 1Z73A 4QO7A 1C3VA 1F14A 3BZUA 2GF2A 2EIHA 1U2DA 1PJQA 4ZA2A 1PJBA 3CMMA 3UAGA 1PQPA 1U8XX 4GMGA 5EERA 2PKQO 3T4XA 1SEPA 5T5QA 2GO1A 3OQ6A 1GPJA 3SXPA 1KVQA 4PVDA 4K28A 4NK5A 3CMCO 3VZQA 4GLOA 2CVZA 2NACA 3AOEC 3F3SA 5KVCA 1PL8A 3H3FA 4FD3A 3TF5A 3GFBA 3ZHBA 3ZW9A 2JAPA 4Y8VA 3BAZA 3A9WA 2CFCA 3NEPX 4IINA 3DBLA 1VKNA 4AVYA 1B0AA 5ITVA 4J16A 2HMUA 1PJSA 2HMVA 3EVTA 3V1UA 2NV6A 3ZV3A 4C7JA 5A5FA 2I9PA 1U3UA 2ZB3A 1RYEA 5F21A 2EKLA 2I6TA 4CLRB 2O3TA 4ND5A 3SEFA 1YKFA 3IJRA 4JJIA 1YB5A 4JP2A 4UREA 4PZCA 4YQYA 4WASA 5G4KA 4QECA 5JO9A 2X9NA 3QHAA 4MKZA 1HLPA 5I8WA 1XIVA 3RUHA 2X0IA 3IL2A 4Z0HO 1NAHA 5G0TA 3ANLA 3AOGA 3GK3A 4Q3BA 6ADHA 5TJ9A 1JLLA 1KVRA 4MKRA 1AXEA 1OI7A 4OIMA 1T25A 4JLWA 4PLHA 1NP3A 1M6HA 4RF5A 1R0SA 3OJLA 4WECA 3N58A 5COAA 3GPIA 2ZIZA 2OL4A 1H6CA 1Y9EA 4BS9A 2HU2A 4IGEA 3MJCA 2HK7A 4YAIA 1GY8A 2NADA 4PG5A 1NFRA 1GYPA 2DQ4A 1JKIA 4IY1A 4YJFA 2OOSA 4D43A 3DZKA 3TQHA 2NU7A 4FCCA 2YHIA 3AUSA 1K3TA 1LDBA 1VJ1A 3FI9A 3JTMA 3PHJA 4JCOA 1TI7A 3HN2A 4C4OA 1HTBA 4EYEA 5KVSA 1EUZA 4L4XA 1ONNA 3TZQA 2NU6A 3ZV5A 3DBLB 2W90A 4BKPA 4FJ0A 1DIAA 1JU9A 1P1FA 2GN8A 2I3AA 1ZFNA 1QV7A 3FHLA 3I3OA 4Z6KA 3FD8A 3JD3A 4IMPA 3RD5A 1NFQA 4IJVA 4HP8A 4WK6A 3QA9A 4RVDA 1PL6A 2IEBA 1QXSA 3Q2IA 1NM5A 1ULSA 3QVXA 3LF2A 3P5SA 3VVBA 3AM3A 4CLEA 4DUPA 3E9NA 3VKVA 1A4IA 1ZK4A 2HRZA 2ZB8A 2Q49A 4B4WA 2Y1GA 1SEVA 3INTA 1ISHA 2YUTA 3DAPA 3OEYA 4NU6A 2A9FA 4IDBA 1R66A 2Q50A 2QRJA 3GLQA 1XU7A 1KEPA 1E1KA 4FFMA 4ILKA 2JHFA 1YBAA 3WNQA 5IDXA 2YHUA 3KYDA 1FDWA 4J3FA 4YWJA 1DFHA 3DZIA 3K96A 3WOHA 1CDOA 5A5EA 4GX5A 1PGPA 1BW9A 3JQAB 1VL8A 3IAHA 3PWKA 4BGVA 5JDIC 4GVLA 4IJWA 2PZKA 1E7WA 4XGIA 3C85A 2PGDA 1LDGA 1P0CA 1B8PA 4OL9A 1LI4A 1ZMTA 3EGOA 2NSDA 1BHSA 3H5NA 4GSKA 2XF8A 1JAXA 4NPCA 2BFMA 1E3WB 1SBYA 2QZZA 4NR0A 4CV3A 3QSGA 2HO5A 3GNQA 1E3IA 3TSCA 1EZ4A 4WCFC 4DBZA 2JD0A 5BT9A 3PGXA 1CRWG 5A05A 3L9XA 4K6FA 5ENDA 3PGJA 2UAGA 3WGGA 4E5KA 4PLWA 3WWZA 4O5OA 4D0SA 4JX8A 1RPNA 4R68A 4Z0TA 1I32A 5TS3A 2JHGA 1OC2A 1ZJYA 4A10A 1KVTA 1JW9B 2PZJA 4DWVA 2I5PO 4TRMA 4CPDA 3QWIA 3E03A 4WLNA 4MVJF 3JQFC 2X0NA 1LLCA 3P2YA 3PDJA 2HJSA 1T4DA 3KYDB 3LT2A 2GASA 3PIIA 4XA8A 2QZ9A 1R0KA 2FP4A 1LQTA 4XRRA 3MJSA 1JQBA 1XA0A 2GLXA 4W7IA 4L4SA 1B3BA 5G0SA 4GQAA 3PYXA 2WD8A 2DTXA 1DXYA 3WR5A 1ZUD1 4F6CA 2D1YA 3DZBA 3WGYA 2FSSA 3KV3O 1EVJA 4XYGA 1E3WA 2WYWA 4CMAA 3JD1A 3GR6A 3ZWNA 2FN7A 1JAYA 1HE4A 3HDJA 5A9SB 3P7MA 3GGGA 2BKAA 3D0OA 5COBA 5G0UA 2PGJA 4B8ZA 1PWXA 4HKTA 5JBIA 1P45A 5CDGA 3VPGA 5AQ1A 4OM8A 3UICA 2WJPA 5FFFA 4CQMD 4OQZA 2J6IA 4O6VA 3Q9UA 3CZMA 1VJ0A 4E5PA 3DC2A 1EDOA 1YL5A 3CPSA 1DRWA 1HL3A 3RI3A 3S1LA 3B1JA 4CV1A 1YB4A 4I5GA 3D5TA 4E0BA 3SLKA 4KTTE 4CR8A 1EVZA 1Q1NA 1KYQA 1ZEMA 3HADA 3G49A 4GGOA 3IQDB 1YO6A 5JSFA 4DRYA 4HX5A 4BHTA 1Y8RB 4Q3CA 2IYPA 4YTEA 3ROMA 4CMBA 3R6DA 2EWMA 4FQ8A 4OHUA 4BO6A 1DJQA 1CQIA 4FFLA 4GGPA 1U8FO 1P1HA 5DOVA 1NQTA 3FTPA 1KETA 5BSEA 3D64A 3VAZA 1DAPA 1X7DA 1ZXLA 4EI2A 3UGKA 1ENPA 1PZGA 2PTGA 1GQQA 2GDZA 1GEGA 3TFOA 1NNUA 1T2FA 5CG1A 2PK3A 2ILTA 4CMIA 4GPD1 4B3JA 1SPXA 3DZGA 5I7FA 1AE1A 4LGVA 4P4GA 3UF0A 3NGLA 5HBRA 3FWZA 1QG6A 1P74A 3H9EO 2AEMA 4JK3A 3WGTA 2XXJA 2PY6A 3H9GA 3ULKA 4FJ2A 3WMXA 3VZPA 1OZAA 3NTRA 4ESOA 3OQBA 4F45A 2DBZA 1HYHA 3FN4A 5I7VA 5DOZA 5GZ1A 5KTKA 3Q6IA 3KUXA 4YACA 3S2EA 1E1LA 4BNHA 1GZ6A 1BXZA 1ENOA 4E2ZA 4HFJA 3NJ8A 3KLMX 5L7TA 3F1LA 2Y1DA 3I83A 4B3HA 3V2GA 4CM8A 4R5HA 1XYGA 3VKUA 2B35A 4W4TA 1HSZA 1BGVA 1ZK3A 2NU9A 4DIBA 1M66A 5T8KA 4PFJA 1SZJG 4J2OA 1U3VA 2UUOA 4U6SA 4QUKA 4TVBA 2VWHA 4CJXA 3K8ZA 1MXHA 1RJWA 1Y8RA 2EW2A 5DT9A 3E5MA 4YCAA 4AJ2A 3KB6A 4BO1A 4EJMA 5HTOA 3VH4A 1S7CA 1HSOA 3SJ7A 4YYZA 4RF3A 3GG2A 2VYVA 2B37A 1NR1A 2B36A 3FF4A 4RCVA 3LLSA 1FK8A 4FS3A 1X0VA 2CY0A 5G2OA 3LDHA 3RFTA 4DPLA 2EP7A 3HB5X 4YT8A 4FFOA 1C0IA 1ZIDA 5EQDA 2J3HA 3ADPA 5A3JA 1C0KA 5TRTA 5B4UA 3EVNA 3V2HA 3WBBA 4JJFA 2BFOA 4ALNA 3AUTA 5KWEA 1K2WA 3PFFA 2GNAA 2ZB4A 3EY4A 2C0CA 5BQFA 1ADFA 1YVEI 3WJAA 2ZB7A 1R16A 1HE5A 1YGYA 3W6UA 3DMTA 3RC2A 2FHSA 1NVMB 1U3TA 3FR8A 4IS3A 3BTSA 3DBHA 1XKQA 1C0LA 3H3JA 3PQDA 3WQQA 3DDNA 3WICA 4XGNA 4CM8B 3CKYA 2Q4BA 1KVSA 5DP1A 5F1PA 1T2EA 2D8AA 3IOYA 3TOZA 4RDHA 4DQVA 4XWYA 2YV3A 4MVJE 4YA6A 4YJFB 4DYDA 2R6JA 3ZWPA 4K26A 1GV0A 4TRNA 4MIOA 1CJCA 1J5PA 4D3DA 4YDRA 3MOGA 3WTCA 3PVZA 3ROQA 4E3ZA 5CEJA 4N5NA 1PZEA 1MC4A 1XQ1A 2QRKA 3JQ9A 3KZVA 1N1EA 1DEHA 3B20A 3I9JA 4J1QA 5BNFA 3ICPA 1MLDA 2P68A 4ZQBA 1Q0HA 1BVRA 4BNYA 5TNXA 2NUAA 2NWQA 3A28A 5FWNA 4B79A 4CM7A 2ZTLA 1KBZA 1LSJA 3PP8A 2WSBA 3HG7A 4RQUA 3DZHA 5CHEA 3GUCA 3E18A 3MTJA 1ZK0A 1K5HA 1LDMA 1YQXA 1A5ZA 4BO4A 3KRTA 4I9UA 4EDFA 1YS4A
chains in the Genus database with same CATH superfamily
3G13A 1KI3A 2PX2A 3OUUA 2HI0A 5KHOC 4BWVA 4AJLA 1LPBB 1E79D 4S12A 3FVWA 1VL5A 5IJ0B 4BPBA 4KN5A 1G4HA 2DFKB 3D4OA 3BCSA 5EFOA 2BGUA 5C80A 4NBVA 3DCJA 3OFJA 1I6KA 3PI6A 2RARA 3ORRA 5AHRA 1XX6A 3JR3A 2Q0HA 3CLTC 4QTTB 1Q7EA 5IF9A 2H2DA 3H9UA 4KNVA 1NJ2A 2YIMA 1KVUA 1EEHA 4OA8A 3E0XA 4MRSA 1W0KA 3MJEA 2IH5A 1XFAA 3PUIA 4D25A 2A5DA 1Z8FA 2Y67A 1VYTA 1WKCA 1YZFA 2RGYA 4U6NA 5FBRB 4Z1MA 2ZJ7A 2QUAA 4AJPA 4L08A 2BGIA 5F77A 2X3UA 4N5DA 4EHNA 5FNVA 1X9GA 4XOUA 3EF3A 4PFQA 3OTIA 5CUQA 1JDBB 5BSFA 1ZMRA 5F4BA 4KR2A 3OC0A 1FDTA 4HJXA 3I9KA 4LEIA 2H4HA 2ONZA 3QWFA 3S7TA 1R2QA 4O4LA 1N8KA 3IOMA 3SYRA 3V6LA 1F17A 3PD7A 1P2FA 1WDWB 1WUTA 5AXAA 9LDTA 5MFZA 5K2OA 2Q5OA 4PX3A 2O2HA 1QB7A 2I34A 3EMKA 3KXKA 3QWAA 4BLPA 4HDSA 3ZK9A 1YQWA 2LVBA 4CHGA 2XBMA 3PDWA 3QJ5A 5SICE 2O8VA 3HEBA 3F1KA 4KN6A 1W5FA 1N8TA 3HR8A 2R6CA 3ILVA 4MR8A 3ECAA 5L40A 4YRMA 2V3WA 1IM2A 2XEDA 3MQ2A 4IS2A 4INJA 3WKDA 4L7QA 3LUHA 4WUTA 4AJNA 1DT5A 2KW5A 5SY6A 4EUNA 2B92A 1Z26A 2NUPA 3MF4A 2H9IA 2BEKA 1EAMA 1BQEA 3BGOS 2ZRIA 3DVAA 3JARA 3PYLA 2TMGA 3OMWA 3MWEB 1FC0A 4L6AA 1A4UA 5IARA 1K0FA 5KNDH 1E0KA 4H7DA 5DULA 1ECJA 3JZAA 3N8IA 1Q50A 3L7MA 4P4SB 5IBRA 1X0XA 1XTUA 4ETIA 2DUUA 1JG1A 1XZ8A 4EQZA 3OOHA 3D6JA 4L8YA 1XMXA 1IY1A 1JBKA 1RQLA 2EBFX 2VPIA 2ZWAA 5TT0A 3WIBA 3ZX4A 5LDDC 3HYCA 2H7YA 4KZKA 1GQ2A 3GROA 3F6CA 2GK3A 3RBVA 3TI9A 3PPIA 4D3YA 2VT2A 3I6QA 5A0TA 3QOXA 1EX7A 1VLMA 3R8XA 4HUQA 1WHSB 5T3YA 1YWGO 3L8ZA 3UJ8A 1LPSA 1YRYE 5DHRA 1RI5A 1QWOA 3A25A 4GIBA 1BH2A 4M8KA 4ZO6A 2Q2OA 1AS3A 4GECA 5AFSA 2AW5A 1B41A 5C5EA 4PWYA 4XIJA 4L0DA 2HA6A 4OO3A 3E9EA 1EFDN 2JJ2D 4CMJA 4W5WA 1IOZA 1P73A 1GDHA 2AQHA 1IN7A 2XCIA 4OU5A 4F5WA 2Q5EA 5HGJA 2QX9A 1YNOA 4RE5A 1PJ4A 3BXEA 4XEHA 5ESRA 2I8LA 1X13A 1IZ9A 2F1JA 4OSPA 4F1KA 2Z6UA 1E94E 1ZPDA 4C6TA 1N2XA 4DCVA 2R1VB 1EJ2A 5IH7A 2XB4A 4TGLA 4B0PA 3G5MA 4NZNA 1XQWA 2GERA 3SM9A 3PFWO 3UJ7A 4DV0B 1W9HA 3QPWA 3PCRB 4MUEA 3S40A 2XIJA 4PSVA 4B6SA 1ZCFA 3UUFA 2OPBA 1TCCA 3RS5A 5JYDA 3I23A 1CUYA 4EQ6B 1RM4A 1SD2A 3D8TA 4NFLA 4R2WA 1LI5A 2FSVC 3D31A 5HEKA 1P9RA 2JRLA 3H3XA 3WS7A 2PIDA 2EP5A 3RIHA 3IELA 3QVGA 1XU4A 1N5RA 1OIVA 1ZJ4A 3FHCB 2OV8A 1OLUB 4LHYA 4JXXA 4GOXA 5LNK6 2QM7A 3CIOA 5K1ZA 3KUUA 3VJKA 4D46A 5JHHB 4W5NA 1N2CA 1C2TA 3L7LA 4ZT7A 4TVKA 1UXGA 4JWTA 4N0QA 1ENYA 1UBKS 3HCRA 4Y2UA 4CM9D 4OHCA 1NJ5A 2WM2A 4WMLA 1CVIA 2QJFA 4RPHA 4EG7A 4WNIA 1VG1A 2SKCA 3OTOB 4L28A 2FLWA 4CTOA 1JBEA 3OZAA 1LK5A 2W2KB 1D7OA 4FGWA 4Y30A 3QBJA 5ALEA 2ATCA 4ONEA 1EKXA 2MR6A 3AM5A 4QDKA 2R25B 3HEAA 2OCLA 4H08A 3L8DA 3D4NA 3GDGA 1PFWA 2FQWA 2BZ0A 1KC1A 4XRGA 1JHRA 1FTGA 3ESYA 2Q3BA 1NHWA 4X45A 4WVLA 2J46A 1P3Y1 3LBYA 3TW6A 4PPYA 3KXDA 1F9EA 1RXIA 1XYVA 3VAYA 5CH8A 3VM6A 3ZGVA 2QQ0A 4C0WA 3DBRA 3K1TA 2NUTA 3QOFA 4HFRA 4B2IA 4C78A 4D8UA 4ARIA 3Q40A 4INOA 1G1AA 2DUNA 2HGZA 4JR0A 3PNBA 5AVJA 5EWJA 2QTRA 3IUBA 1KYIA 3C15C 4KQEA 5JAIA 4JI4B 1N1DA 3GCZA 4DN6A 2C54A 2J3KA 1V11B 2PN1A 4ND7A 4QVIA 2PS9A 3OIFA 3QKUA 5CXQA 1RIFA 4BNLA 1AHIA 1UWVA 2UYHA 2HNBA 3UWDA 3BF8A 2OKGA 3WGZA 4JI7B 1GZ4A 3NI2A 1SXIA 4WLOA 4CE6A 4BO7A 2ZUBA 3CB2A 3QVTA 4RHFA 3OF2A 3KBOA 3L0YA 4C2UA 1AS0A 4LZNA 5B1IA 1T5TA 1WZIA 2W6ID 2PRKA 3DLPX 1KAHA 4R7TA 3GEPA 3ZU5A 4EZIA 3ZGZA 1ZW1A 4GLBA 4JL5A 5FBWB 3C7DB 1BHQ1 1L8LA 5HP4A 3CJTA 1DIBA 2HJHA 1VGQA 3HXQA 3QY9A 4IIJF 1GD1O 3R8CA 3DB2A 3LCMA 2RGXA 4GX2A 4KVFA 3JWEA 3NS7A 2IC5A 4KIWA 3S2UA 2FW0A 4C4PA 5K3OA 1R7RA 1E9AA 1F2DA 4KUEA 2TYSB 1XWFA 2AD5A 1J49A 1MV8A 5EZYF 3VTKA 4DEXA 4LHXA 5C8DA 4L74A 1HV8A 1L4EA 4MWTA 3ZJTA 1UPBA 3T0IA 1YKGA 2B3DA 3NIGB 1K86A 3DAYA 1MOQA 3M5WA 3LLCA 4QUIA 4CKBA 4QRHA 1YIDA 3TPZA 3M1LA 1COWD 1VJCA 2ZJ0A 4FBGA 4UJ3A 1SFRA 2BM0A 1B0PA 4ZPXA 3ZLVA 4PNEA 4CLOA 4R7GA 4WKGA 1QBKC 1I9CA 1YA8A 3CLTD 3C1AA 1NLFA 3AL2A 3ZR4B 5I7OA 4OFBA 5IT9A 2LRHA 4M87A 4Y2RA 1DS6A 5CT9A 4R1UA 2G6BA 2Y6VA 3X3HA 1H6BA 4IH4A 4GO1A 4DNQA 5C7OO 3OQ1A 5U1PA 1ZM9A 5KOJB 5AKEA 3OPYB 2GFHA 1PS0A 2OYCA 2VPXA 4PCVA 3LBIA 3LLVA 2AWNA 4U2DA 2OCPA 1WQ1R 3KSMA 1U0LA 1KH2A 1SB9A 5KREA 4ND1A 3D8HA 1XNJA 2J7PA 1JTEA 3EQ6A 4ZGGA 1ATIA 1OV4A 5CVEA 2XYHA 3KB2A 1EU1A 3N7UA 4J1TA 1R4ZA 4W99A 2GJ8A 3TZKA 4S0XA 1W2WB 4ZALA 4Y9TA 5IFKA 2V9PA 3OZEA 2C4KA 3ASYA 4R2XA 1QYIA 3HP1A 1LCIA 3K31A 4DV7B 5JNWA 5EHQA 3A2KA 4QYMA 4HNAA 2XTZA 1LSOA 1OJLA 5BRNA 5KNDA 5E4TA 1PGJA 5K0BA 3B3JA 3QX9A 2FSGA 3OZDA 4EMSA 2AXQA 1FF9A 1KO4A 2FR0A 1FX0A 3I34X 4YEDA 4AP5A 3F9CA 3IP1A 4NCIA 4FOOA 2JA2A 5EP1A 2NSHA 2XYVA 4CKBB 1VECA 2CXQA 4G5RA 1T9AA 5JPIA 3EIOA 1DWOA 4IDDA 4RHTA 4AUKA 1Y63A 5BR8B 4QGGA 1XLVA 3DZJA 4LE1A 1XGKA 1GQOA 1E2MA 4PYMA 1V3TA 1YQEA 1R8QA 5FF9A 3R41A 1EUCA 3S3TA 3K05A 4RVUA 3WGJA 1NBIA 2W6OA 3Q98A 3NORA 2IUEA 4KL8S 2W6MA 5H82A 3V46A 4D80A 5FXMA 3K5WA 5GJCA 3Q8WA 1Q83A 2C98A 4PG8A 3KFXA 2OGZA 2ZKIA 3TRIA 5A4KA 5JRDS 3EE6A 2C0QA 4G5FA 3NBMA 4WJZA 4W8OA 3TTXA 4X6UA 3WKBA 1TTHA 1AGXA 1Z4KA 1XMQB 1Q20A 1A27A 2A1TR 1IWBB 1IPFA 2CXTA 3OG9A 4I81A 1VRWA 2BKUA 2V7EA 2VHUA 4LDJA 2WU4A 2ZJZA 3B6MA 3BA1A 3FZYA 3IPLA 1GXSA 4XDYA 4ZVNA 3GP8A 2XADA 3KWJA 2G67A 4OCZA 4MYTA 3THWB 3U7JA 1KMMA 4L3WA 1TVEA 3NMUF 3ED1A 4XQCA 4G9EA 1Q3TA 1RR6A 5B36A 2D00A 3CX8A 2JGNA 3OT5A 1ID8A 2R2GA 4MR7A 1U8YA 4BASA 4BMNA 4E4RA 1NSYA 4XM1A 4ZEMA 3NBYC 1J90A 3HGQA 1JZQA 1ECCA 1NW9B 3NEJA 3FXAA 2AXEA 4BE4A 5C8XA 1Z2NX 1S1CA 1BG6A 1GGMA 3DVRX 2GPJA 3W4IA 1KEEA 1JNXX 1ZLYA 4ZYWA 3C2QA 2CDRA 3OEED 3GMSA 1H23A 5J4LA 5AK3A 3L0PA 3OCVA 5IZCA 3U19A 2XCTB 1O7JA 5ALJA 1EG7A 2JAXA 2EQBA 3DBHB 4NONA 1W5AA 4X3OA 2E5LB 1Y8AA 4TMVA 3MTAA 2V6BA 4AY6A 2REQB 3K30A 2CLHB 3NW9A 3ZE2B 5C8YF 3LZCA 4X7BA 3PQCA 4B6JA 4JLMA 5ICEA 3A6FA 3EXG2 5CIYA 2GSWA 3K2EA 1D09A 4OL0A 1CY6A 3MUEA 4QOIA 2Y9MB 3IJEB 5AM0A 5H4HA 3BRQA 4GPBA 5FLEX 2PVCA 1IAVA 1WCV1 2CZCA 2HPZA 1RJDA 2J7KA 3K5HA 3LCVB 1IWOA 3CV3A 5DX1A 5AOVA 1EFVA 1BW9B 2WE7A 2DLDA 2FU5C 1U2SA 1EFKA 2CNWA 2OTCA 3AERB 4BMPB 4EM6A 4TLLB 4A73A 2QLJA 5F5XA 4PZAA 1A9XA 3OIYA 4DBLE 4RA9B 3BH6A 1NQ5A 1DG3A 2ADMA 3B13B 3M1AA 4KO1S 4QGAA 1WMAA 3MBOA 3ZCTA 4L78A 3TPFA 3WL7A 1TZKA 1R3UA 3I72A 3G0HA 4R9UC 1MH9A 1NLUA 3NWJA 3O1LA 1PWZA 1GGHA 3CZQA 1E2EA 3JYQA 4YN3A 3DP9A 1NW4A 3NEYA 1BXKA 2R751 2VAXA 4R81A 3UKOA 1UT6A 3PA6A 4WN9A 5TQ0A 3K94A 1CZUA 2IS6A 5EUBA 2QPOA 3GJTA 1W44A 1QANA 3RWOA 3HDYA 1CWUA 3HBLA 2G40A 1GU1A 1H2EA 4LYAA 1GVHA 1O87A 4XVHA 1IZ8A 3N0VA 3NJRA 5DO9A 5DW0A 2PUAA 2NVUA 3SIRA 4O4HA 1HQYE 5CCDA 1B1CA 1ZUIA 4Z4HA 3WL3A 5JJKA 5C0OE 3QXCA 1OOEA 2QUZA 2ZBGA 1PL0A 1XD8A 2R4TA 3U4IA 4EYGA 5C5IA 2PH7A 3PEFA 3X1YA 1TUEA 5JRJA 3U39A 2C7GA 1GQFA 1GSIA 2ZAYA 1VZ3A 4TKUB 1Z5VA 1XQYA 4RNDB 4OHZA 2QZJA 1QPBA 2I2XB 2WAAA 4A36A 4NK4A 4X95A 3RBZA 5SY9A 3IAS1 2WJ4A 3OVMA 4JC5A 5L3ZA 3IKVA 4GVXA 1NWHA 1VLJA 3QYJA 2BFAA 5T4FA 3P9YA 4AECA 1N2HA 1NN0A 4GI1A 2HZ7A 4U8GA 1N0UA 4MV7A 4LHVA 4XGKA 1Z0AA 5DRTA 4QJ3A 3RVBA 4KE7A 3P19A 5AK6A 1V5GA 5CDHA 3FTFA 1T0BA 1XOIA 3THSA 1I7LA 4DIEA 1A88A 5DBIA 4HMQA 3KQHA 1QYVA 1JHOA 4YQEA 1QMGA 1JSLA 3CN9A 1R64A 3D3WA 3IXMA 3IA2A 1ZSYA 3T1QA 3HVRA 3X1WA 1T91A 5CA1F 3HB9A 3WMRA 1XT6A 4M46A 5HFAA 2GN4A 4R8SA 4RQAA 4DNXA 3BB4A 1NI5A 3UEOA 2W4QA 4B7CA 3FNIA 1YZNA 3KHKA 2ZWOA 4TTIA 1HT1E 1IATA 2BAGA 1O4WA 1U2QA 5K6AA 1T8SA 3N07A 4GICA 4K9DA 3TQTA 4CF4A 3L7AA 1PVVA 2ZS7A 3ROTA 5KSWB 3EHDA 2Y0EA 3IVCA 5B3AA 2F8TA 3WLJA 1SUDA 4MP8A 4EG3A 2OWEA 4FHGA 5CLGA 1UKVY 4EECA 4RDXA 2ZJ8A 1GAWA 1P39A 3OY2A 1QZ3A 3GGPA 4HH3C 4J29A 4UTXA 3EOZA 5DNAA 1WPXA 1PRYA 1FDRA 1XZPA 3VNBA 3ZJ5A 2I03A 3NTQA 2A1UA 4P34A 4CM4A 1GG5A 1AV7A 3WRYA 4HB3A 5I9TA 4JD5A 5J2UB 5FPHA 2FDCA 3AOEA 2UZ3A 1KI4A 5KAPA 4NU0A 3IBFA 4DCSA 2GHTA 3OCXA 4LSGA 4UHBA 5BN4A 4P36A 2VP6A 1T2CA 1DU4A 1Z36A 1VHJA 4U1RA 1BD3A 5I4IA 3VI4B 1T4BA 4QSHA 3K72B 1LV8A 2FEKA 4IUBS 2QM0A 5IJ9A 1RNLA 1OWLA 2XT0A 3PVCA 4O59O 2GZ2A 2QXUA 4FN5A 2AF3C 1E3JA 3KVVA 3AESA 1DQRA 3Q7QA 3DXFA 4JY7A 3RJ9A 3QW2A 4EKNB 3BTVA 5BT8A 3F73A 2ZVPX 4AY2A 1IMJA 4AZSA 1R6DA 1KMQA 3KOWA 4AZWA 3ZJYA 1QZXA 4KQIA 2H5IA 5GWXA 1DO0A 6LDHA 3EWAA 5IT4A 2BFBA 3BSYA 3T12A 3OFSA 3TM4A 2UDPA 4HJRA 2BE9A 1YDEA 3C1TA 5KUTA 3ONWA 3PTLA 2PMFA 2BGNA 2XUAA 2R66A 5L7WA 2JBAB 1RMYA 3R0IA 3RB8A 2HU8A 3W5CA 3EEQA 1CYDA 3CZ5A 4NYMR 4RVGA 3GRUA 3TH5A 2IV7A 5L3VA 1U7TA 2JFFA 3DKPA 3UMCA 5IVKA 2FE1A 2CDCA 3EC7A 4RBNA 4GQIA 2BGKA 1IAQA 2IZ7A 1V6CA 4HAZA 4IO0A 5AJTA 5SYAA 1JIQA 5TMBA 1RHMA 2EX1A 3L49A 2Q7DA 3F7NA 1TTTA 1VGRA 2H16A 4RKEA 1X39A 2XAAA 5L51A 4G4IA 4W5RA 4ZC8A 2ZSAA 3EG9B 3MMZA 4TLEA 4C3VA 2CUNA 3ZKWA 1NLYA 2RGWA 3OU2A 4RMIA 1RPZA 2ZFUA 3H9JA 1ISRA 2H1FA 2G1AA 2FUG6 4Q03A 3ZS9A 4QHTA 1O6ZA 3RNLA 1MW8X 3BK7A 5K09A 4MVXA 2QVBA 1BN6A 3QLVA 4JU8A 5BN5A 3ZTTA 3K5IA 2LCQA 2WT8A 1ODKA 3B1VA 3H5IA 4OATA 3BRSA 3ZHYA 3BWMA 2AZDA 2YJNA 1K6XA 1SXJC 3L6BA 2IY7A 3QPCA 1H8HA 4IJMA 4R3NA 4CCAA 2WVJA 1FP1D 5JVDA 1EB8A 1KI6A 1GV1A 2SECE 4OMFG 4PO1A 3OT1B 5F12A 2VQ6A 3FUWA 1JR3D 3PR3A 4MYHA 4ZK2A 2VIIA 2MMGA 1TEZA 3OLVA 3ZWDA 3U4AA 1WS6A 3AU9A 3W9BA 1L1QA 2I8CA 3X44A 5K0FA 4FEAA 1UAAA 4K8OA 1EG2A 3I6MA 3TLAA 3WADA 4AN4A 4NEGA 2Z98A 4XI9A 3WHLA 1CNEA 5H3LA 3W7AA 5DLDA 3U3XA 3QV2A 4HGOA 4GRAA 3HCFA 3G79A 2FRVA 16PKA 2Y99A 3QKTA 3R09A 1ZUHA 3BWEA 1CR6A 1T4MA 3I2KA 1AKEA 4YHBA 3TFQA 4I55A 2OZLB 3WGVA 2P41A 4CW7A 2JLWA 1SUBA 3LA8A 4F71A 2VSYA 2FYTA 3HXKA 4BQQA 3EGXA 4IUCS 3WQHA 1Z6XA 3KEQA 5CLIA 3NFYA 2A2ZA 4WK4B 1SB8A 5HCNA 3DT8A 4MB2A 3DYVA 4G5OA 3COJA 2DQYA 2YHBA 2HHAA 3NFRA 3MT7A 4IYJA 2H0QA 3WX0A 1IU9A 1DELA 3QEJA 4ENRA 3DE4X 3OTWA 2YICA 2Z3VA 4B46A 4RANA 4XJTA 3V6MA 1AHPA 4CEIA 1DBVO 1EUCB 3N8NA 3PC8A 1SXJE 2XE7A 2R4QA 3AK4A 4Z8YA 1EPUA 1T6BY 1H2AS 3GFQA 4TMWA 4DLKA 1PR5A 4F5DA 4KYVA 2PMBA 2QENA 4Q9HA 2B1RA 4Q4DA 4FKMA 1NC3A 4KSCA 4R9RA 3WXBA 1OTXA 4YUVA 1CQIB 2NZWA 2R6R1 3OT1A 1H9AA 1RQPA 3NM6B 4IRXA 4KH1A 1VP9A 4Q37A 5B37A 2O8CB 4NDNE 4YT2A 1E5DA 3L40A 1SIBE 4FE7A 3T35A 1Y3AA 1IHXA 1CY2A 1MOZA 1O57A 3IP5A 1MCZA 2C8KA 5DP2A 4M1WA 1E3SA 2VDNB 4C7VA 3CUWA 4B47A 4PC7A 3ET5A 2LBPA 2PX3A 2RHGB 2V5VA 1KMHB 2P5UA 4OHFA 5SZKB 3ETEA 3Q5EA 4Y0AA 3G1WA 3RG8A 1BXRB 3Q8XB 3DFZA 3S2ZA 4B4DA 4NBUA 1LX6A 4NVRA 3RTEA 4QXRA 1U8UA 4P98A 3K3PA 3O9ZA 4PG6A 3ROEA 5CB6A 2EZ4A 2XGSA 3JS5A 4GL4A 1OKKD 3W34A 2ZTSA 4JLBA 3OMLA 4HB0A 4UQPA 3T52A 5H3CA 4DUYB 2X4IA 4LF5B 2P9ZA 3UAVA 1N57A 4B6PA 2DH6A 3E7FA 3T1YB 1NW3A 1HRDA 4GOOD 1YB1A 3NHWA 2GK6A 2XWQA 2VF7A 5HM8A 3V7UA 4E2YA 1SUWA 3IUEA 2VQEB 2ZXFA 4WIAA 1Z6PA 1D5CA 3K92A 1FQWA 3PD1A 5BVGB 1SO8A 3KLOA 1WDTA 3LVFO 1M1YE 3PL5A 4RLQA 2WIFA 4P4TA 3RGWS 2W2LD 2C5HA 2RBGA 3FCAA 4KYIB 4EBFA 2PJRA 3CWZA 1JEDA 2QAIA 2VXBA 4J6EA 1CEQA 5JCZA 1DAIA 4TMZA 1DBQA 3M2PA 2AWOA 3ZY3A 3KQPA 2PUTA 4N3CA 1E60A 4HX9A 5GZ6A 1UZNA 1XSEA 2C4TA 4K87A 5IYZF 3M5PA 3UCFA 2AN1A 3FKQA 4MVCA 4RY9A 5F64A 3WYFA 4BPRA 3CR8A 2K5UA 2EKPA 1Y82A 1NZDA 2JJQA 3GLKA 2O3RA 5GZ3A 1DZ3A 1D2RA 3TW4A 3FW1A 1FX0B 1JE1A 1GIAA 3K1YA 3RHTA 1UBUS 3P0RA 4MJXA 4PLYA 4G5SA 1TYEB 2XB8A 1MABB 2AE2A 2ETVA 4N6OA 3EUEA 1M76A 5K6AC 1YMQA 1GQSA 5GV7A 2QMEA 4W1QA 5E4FA 2Y9PB 3GVPA 3DONA 1CS4C 4L50A 4QRDA 1GWNA 3L7IA 1GARA 4BMDA 4DR2B 1E89A 3PUJA 3IE1A 1AK1A 4BUCA 4F2DA 3IOEA 3NLLA 1CB0A 3KXLA 3ZC3A 4ENUA 1G5HA 4XLLA 5FV4A 1DJPA 1AQNA 3IAFA 4O2AB 4XQ9A 4PXSA 1NJ1A 3FSGD 3G88A 4Y9DA 5DWVA 4N76A 3EEIA 1DOZA 2ZUFA 3A9VA 5ALOA 5BSTA 1TQ2A 1VPVA 4NJMB 4JNCA 4DJJA 1PR1A 1AKTA 4FCWA 1EDBA 5DBGA 5LBIA 4UULA 3VYWA 3VZBA 5HQ3A 4EATA 1TQHA 1U3CA 2RK3A 5B53A 5EYPA 3MVEA 1GXSB 1SBCA 1T2AA 2IBMA 2OBLA 3RC7A 1G42A 5DNWA 1CJMA 4A23A 4F9GA 1JJIA 4EJSA 1ZC3A 4YYEA 4IMRA 3QNWA 5F7ZA 1PSDA 1BA2A 4C29A 2B4AA 2VT6A 3P9XA 1HXHA 1X7HA 2UYQA 2PR2A 1P5FA 2NO9A 5G4KB 3SSMA 5DLYA 2VYFA 1NVXQ 2VSOA 1V43A 4MW7A 5KJ1A 4PYNA 4Q7EA 1Q0TA 1OFIA 2FUNB 2OCBA 2IXGA 2DBRA 4LOKA 4D26A 3ROFA 2I6XA 2WRZA 3TN7A 1UMBB 2FPIA 2MSKA 2AW3A 2EBWA 4BDTA 4W5OA 4AN1A 1Y34E 1E3EA 2WC1A 3U6KA 1J0AA 1J07A 1T5HX 2V7BA 4JP8A 4X1YA 5F3WB 4TXMA 1O8CA 1V6AA 5EQJB 1GNPA 3DFUA 1LBSA 2YW9A 3MWYW 4RFSA 1QONA 3ZE1B 1J70A 1L7OA 4NFYA 2AVDA 4HNHA 3B85A 1UM8A 1RWNA 2GX6A 3DT6A 4FDAA 1HM5A 4Q39A 3CG0A 3NKLA 3IR6A 4WLFA 4WY2A 4BNXA 5L4SA 1R50A 2PPLA 1A96A 4V0LA 1TZMA 4I5IA 3DLCA 5BQOA 1P0PA 4HLUA 4LW8A 3RSLA 4P7GA 1E63A 1E77A 2HT6A 4PLGA 4RVOA 4UE6A 4B80A 1T1SA 1JFSA 3MJTA 2MSLA 2V4ZA 2AK2A 1X3SA 3A6ZA 3C16C 1XVLA 4RJLA 1WULS 3S0JA 4MLPA 1WPQA 3UMYA 3MJDA 1NVDA 1XTBA 2GBGA 3OEHA 5PGMA 4B31A 2H8GA 1C7JA 1USGA 2H54A 1BFKA 4JYPA 5F2OA 5JW6A 5EXSA 3I4CA 3UGQA 2VHVA 3X1KA 1EGVB 4YRBA 2PL9A 1V8DA 1J2UA 3ICOA 3S5UA 1RZUA 3RAGA 5JJIA 4C7KA 4AP6A 5BW5A 4J1NA 4L9WA 3QKRA 4QYXA 4GU5A 1PDOA 2RG7A 5EG5A 4MLCA 5M5BA 1KJQA 1L5WA 1Z82A 3AHHA 2W2LA 2O2YA 4M55A 1LA2A 2PWBA 2GZDA 3LVQE 4XLZA 1JV2B 1EDZA 4BIMA 5B4TA 1GTSA 3HPRA 4Z51A 1C3XA 5IJ9B 2AFIA 1I1HA 4CRWB 1XZHA 3MAGA 5CDSA 2QW1A 1HE8B 2A67A 1AQYA 2C31A 3AIOA 1Z4IA 2WUFA 4Q3DA 4TZKA 2GR9A 2Q4EA 4ZQHA 2BONA 3MUFA 1II9A 3T9CA 2POQX 4V1CB 2BFDA 4IF4A 4MX8A 2Z2XA 4WCFA 3F6PA 2R8PA 1CR0A 4KWCA 2AD1A 2J59A 3TDKA 5JFTA 5KSZA 3EAFA 1Z62A 2YRXA 1ELOA 3IV9A 1D8TA 4QAQA 3GVCA 3BAFA 4YJKA 3RC9A 2JLVA 5AHOA 1YQDA 1BVUA 4WZAA 4CDNA 4M7PA 3A58B 4N5LA 4EK9A 1FDVA 4A8JA 5KVVA 1QP0A 1ONPA 1GZ3A 1PYGA 2AUMA 5BPHA 1GUFA 3RSCA 1F0PA 4UMFA 4IXDA 3V8NA 4ZOAA 1X1TA 3ZU2A 5L95A 1DQSA 3HM2A 3I4FA 3B5EA 4CKYA 3VMMA 4MARA 4GZLA 3R0VA 4NL4H 4S35A 3ACCA 5JY6A 3MWDB 5GJVC 4IGFA 4WINA 3HVUA 1SHLA 2JEYA 3I1IA 3NXSA 1NOKA 3T9BA 2OT3B 2WU3A 3W9SA 4GP7A 4II2A 1Q2UA 5C52B 5EHXA 3QXSA 1E64A 2XB9A 3BDIA 1I24A 1QZZA 1KJZA 4G8BA 4IP0A 1YB7A 5J2TB 4IWXA 1PVOA 7ADHA 1P3DA 2BW0A 1JGTA 1YR7A 3N0XA 3NCTA 1EJBA 2JJ1A 3L0SA 1IXSB 2FMUA 3R4CA 2X5NA 2WOJA 2DFDA 2H7VA 4RULA 1G64A 3LX5A 3ZWMA 3EFBA 3P1JA 1ISFA 4RJIA 2X8AA 2GT1A 3CSDA 1Y5IA 1PTKA 4NX2A 3JWHA 4KC0A 1U28C 2CDBA 3GU3A 1XI2A 3T4PA 4H0NA 2VSNA 3OPYI 1N1GA 1M1ZA 1U3GA 4RMGA 4BCDA 4BFLA 3GLGA 2Y2VA 3VC3A 5TVKA 1SD5A 5U4QA 1Y8QA 1KTVA 1Q1ZA 1OC4A 2INGX 1SOVA 3D9QX 3FPHA 3M82A 2RHLA 1UIRA 1ZQ9A 2Y0CA 3W06A 1A9RA 1G16A 5FV7A 2SNIE 4D99A 4CWAA 1COZA 2ZTUA 5DK6A 2FPGB 1B15A 2I2FA 1BOOA 3NGMA 1PSWA 2I2WA 3GD5A 4IZHA 4RH3A 5HS6A 4WFJA 2I65A 3DQQA 4WLUA 2FDXA 1TJYA 1PW7A 1Y33E 5H80A 3GZNB 2VZ9A 4HS4A 4IJ5A 5A9SA 3TOSA 2GM5A 3OX1A 1B6RA 3SE7A 1Z4NA 3TIVA 4WN3A 4HD8A 1RYFA 2Q1UA 4J9UE 4QYSA 4O2AF 4BB9A 1D04A 2IGTA 2J6HA 2WTEA 4G4SP 1QE3A 1L7DA 1L8AA 1L5SA 3PRKE 5ALHA 4OH1A 3WISA 4MAFA 4DMLA 4LJ9A 3EODA 3ZOZA 2FQXA 1K6IA 3AFGA 3GJ3A 5JWRA 4BGEA 4KPUA 1E6EA 4B3SB 1X9HA 1DAHA 5FUYA 4UTPA 4EG1A 3OQJA 3TLCA 4J03A 4R0NA 4WEQA 3TQSA 1LWNA 4ROSA 3S27A 5CFPA 2ZUEA 4ZVKA 3UHJA 2C58A 4P3YA 2BM1A 4KBYA 3VX3A 4C4SA 2X4DA 3LF1A 3ZUGA 3ZVKA 3E8SA 4GLFA 4RA6B 3IS3A 2AZTA 3NDBB 2FWMX 2JEZA 1XTSA 2QVYX 5D3MA 4DGSA 1I9GA 3MXTA 1ULBA 2R1ZA 1NI4A 1UOOA 2N42A 5FLXA 3NGXA 2AOTB 2DMRA 2QVCA 2E4WA 4KFSA 3JU3A 1PNRA 1RADA 3UC5A 4AKHA 3RS0A 2J3QA 5EMJA 3WRWA 2JIZA 4M0PA 3QKSB 4CF7A 3CEJA 1EUQA 4XCVA 4BRWA 1B8UA 1F12A 2PM8A 4BP1A 1THMA 2P69A 3ADKA 4YRAA 3UH1A 1PUJA 4IHQA 5EZSA 4J3NA 1F1BA 2VSFA 5C4GB 4YV1A 5DTRA 3T3PB 2F90A 1C3JA 1JJVA 2CLCX 3QX7A 5EJ4A 3UAWA 4P35A 3ER8A 1FXSA 1K0UA 1XCBA 1PFVA 3MTDA 1MZPA 3ORYA 1XPOA 1CZNA 5HX7A 3VISA 1WXIA 1YJ8A 4FX2A 3QLTA 5EE5B 3RYCA 2J45A 2YVKA 4INAA 1OD6A 2EF1A 4I19A 3WGUA 1LFDB 4F91B 3U16A 4HFNA 4HDNA 2FSHA 1NC1A 4A4DA 1QX3A 5JROA 1K6MA 1ESDA 3SS7X 3JV7A 1TAGA 2O7VA 4K8RB 3L7YA 5C5DA 1BDHA 3L8EA 3LL4A 2RKOA 2JH9A 3H84A 1M6WA 3AF6A 4WL0A 1XYYA 2PGIA 3U4DA 2CWWA 2HDHA 1Q1BA 5F33A 2GS9A 4JOSA 4KWTA 3RCBA 2D1FA 4BNDA 4C5BA 3LM8A 4CYMA 4ZZ1A 3RVQA 4G01B 4UHFA 3UWPA 3LXUX 5BV7A 3CWQA 3JWPA 2VTBB 2VPTA 5KINB 4MUYA 3K0KA 1I30A 2ZITA 5THXA 1IONA 1G2OA 1V8BA 2JVIA 2ZIFA 5AM4A 1MB9A 2VCEA 3BERA 3DV0A 1A2OA 4YRZA 1NXSA 3RYIB 4EF4A 1IN6A 3Q5GA 4JIMA 3IUNA 3D4BA 2O23A 3HB0A 1O03A 4OKSA 3ZXUB 1WVMA 2G5CA 2CXSA 1N92A 3BMNA 1SHTX 3LBAA 1XZLA 4JT9A 4C01A 3DXZA 1K4MA 2QX6A 2JD2A 4AMYA 1Y1PA 4XWKA 4H1VA 4MW9A 4UQOA 1VSVA 1M1YB 1N25A 2QZ4A 4OOFA 4DARA 1VE5A 1LKZA 2VFAA 5K6RA 2AMVA 3IQWA 2REQA 4ZVUA 1JXMA 1S5PA 2W2QA 4BKMA 1DAEA 4TM7A 4KR3A 2OP1A 4C6HA 4K9KA 4YECA 3UW3A 1J1ZA 3SFTA 4BWYA 2EEZA 2BUCA 3NTOA 1E20A 5LQCA 1DIGA 3M6WA 2WTMA 2YWGA 5EXEA 3NV9A 3ZD9A 2E4AA 2OAQ1 3PJFA 3H5TA 5BOVA 3VXKA 5LOVB 1NMYA 3GJQA 3T7CA 2X0FA 3LC1O 3W0LB 2V96A 3QK7A 3OHMA 4CQNA 3SF8B 2I7CA 2IYQA 2ZR8A 4HRXA 2IIVA 4CHTA 2UUAB 1RKBA 3N8KA 3WBJA 4KWHA 4B71A 3LNCA 5M2QA 3UK6A 1E18A 1TFRA 3NASA 4AJJA 4I9HA 3MN1A 4U2BA 1MX3A 1XDUA 5KNCH 1QK4A 1YQGA 5FJJA 4XCXA 3ZCVA 3GT4A 2AC4A 2QKYA 1HF3A 5C3UA 2YDYA 2XSZD 4HOYA 3UATA 3GEDA 2WM9B 1GKIA 1FLDA 4XEUA 3NV7A 3O4IA 4X63A 4TYWA 2Q5LA 1E8NA 3DGEC 4MTCA 3IVXA 4H1HA 1D3AA 5HTKA 1BFUA 2ZTVA 3DLBA 1M1YA 2ZWVA 1RS0A 5ALPA 2I6UA 5EVJA 2H8KA 2J5BA 3AIIA 3NP7A 3UXYA 2W37A 2FMXA 1LPAB 3IP6A 2AS0A 2FE4A 3A26A 1Q2XA 3PR2B 4LMBA 4ZOCA 3RJ5A 1Y6GA 3H4MA 4YR9A 1J00A 2FOXA 3QEMB 3R5SA 5IN4A 4CCYA 2OCXA 4FLEA 4TPKA 3ZI7A 4EPRA 3EXFB 1G6KA 2IOFA 5HW0A 1MFZA 1QCZA 2D1SA 2Y77A 3CONA 2DFPA 3R23A 5AT1A 5EUQB 3TAHA 1XK7A 2P2YA 3KB1A 3GLSA 3ZDRA 2C3PA 3GOHA 4HYTA 3TXXA 4IX9A 4AB1A 1KJNA 4H60A 4CM3A 1F6DA 2RJOA 5B55A 1L5FA 3W1VA 3CVOA 3HWWA 1Z7EA 1M75A 4FZ3A 4GWLA 1BWPA 2QRUA 4LVUA 4QUGA 4EYSA 3IDOA 2YBDA 3A1CA 1GZVA 4O8ZA 2WZDA 1XZIA 5AI5A 4LFBB 3D7MA 1N6NA 1KFEB 3QVJA 1Q1EA 3EA5A 4B6GA 4YAJA 1ZCJA 1ZUWA 3U62A 5DEOA 1GQYA 5E38A 1BGXT 2G76A 4Q5IA 4Q4AB 3T1OA 2YWHA 3H1AA 3KZ1E 3ACBA 1E2FA 1I2CA 2QGNA 1H4VB 1F8UA 2G9ZA 4IF6A 4MLZA 5F51A 3RVOA 5JJBA 1V3QE 2WKSA 5G02A 3MMSA 5IHPA 4K1LA 4G0WA 2RH4A 4X20B 1SCUB 1SG6A 1TU3A 1PR4A 3TLBA 4CCYB 4CLHA 1NXWA 2WUVA 5I8PA 4CUJA 5JEDA 2MWMA 3SC6A 4DA9A 5DLEA 1X8JA 4I8DA 1AUQA 3IQXA 2QTAA 4HLNA 2JFBA 3FMIA 1ZCAA 2A4KA 3F0TA 4JLSA 3WIVA 4H35A 4Y2JA 1EJ6A 1RZRD 2FWIA 3R7LA 2PNJA 1GR1A 3NBUA 4D96A 1OWMA 2C82A 5FFMA 1T5IA 1LUAA 4CT5A 1JKJB 1FJHA 1OZ0A 3V48A 1PU2A 5CDFE 4FEYA 4EUSA 3WJ1A 2ZRQA 1CNMA 2C03A 5KWJA 3CNQS 1RXUA 4D9FA 1GN9A 1Y4UA 1PJRA 1Y7TA 1PFUA 3G17A 4OKIA 2CLKB 5AO9A 3KOYA 4HDKA 5J9FA 2W2VA 4NG5A 4C08A 2GYUA 3NOOA 5IJXA 3MMXA 3ZS8A 2AC2A 5FNVB 3VPDA 1AKUA 1SCBA 3KT0A 4M0EA 4RTOA 1QVRA 4S1OA 2G8LA 2JI4A 2Q0XA 2QM8A 1OXTA 1RXCA 4V0MA 1MD9A 3FUUA 3O4FA 2O3SA 4R40A 5I9LA 2I4NA 2DVMA 2OV4A 2GZ1A 4HY3A 1WXHA 4W9NC 1R4NB 5AHKA 1D07A 3A3OA 5C8YA 4MS4B 1DJLA 2CSXA 5MGBA 5CJPA 4ARUA 3GMIA 2WILA 1BJTA 3ZZ0A 2ZE5A 3TB4A 3LMKA 4RABA 2H7CA 4RTKA 1QKKA 3GDHA 3ZIUA 1Z6AA 1CULC 4M7RA 3EARA 1IY9A 4NTZA 2H08A 4RIEA 4GMFA 5IVIA 5IABA 4HR7A 4RNCA 1RVV1 2WYOA 4GOLD 1R74A 2B94A 3L43A 1EX6A 2WUDA 5T4EA 1RXEA 3CO0S 4LJ8A 4OD0A 4I3HA 3EMVA 4YBRA 2GAOA 4Q01A 2ZCUA 3MUNA 1DBIA 3U37A 1EK0A 2XZPA 2YZ2A 1FSZA 1WW2A 3GMTA 4BP8A 5GTDA 2E4ZA 4C7OB 1R37A 2DGDA 1S6YA 3NETA 4PQFA 5BR4A 2LV8A 3A1DA 2PYZA 3HRHA 5HM6A 3KEGA 5EKTA 5I4BA 4I14A 3E70C 1MQAA 1OASA 4ZMRA 1O5TA 3LQRA 3EVFA 4NP6A 5FUXA 2EKZA 3BHMA 3DMRA 3Q6NA 4MUHA 4EUHA 2HMWA 1CUUA 2B9VA 3DWEX 3IAUA 5IKOA 1PW5A 1Z0FA 2WW8A 1GA4A 3V4VB 5K0GA 2O0HA 2WWFA 3D54D 3WNVA 4Q1VA 5D87A 3IPAA 1TEVA 2BJVA 3AYZB 4RK1A 1CXZA 4CZ2A 3FKSD 1EWVA 3KXPA 1KYWA 5KKNB 3COVA 5HZKA 2AJ8A 4K9PA 4CI0B 1Y7HA 4E5NA 5EESA 5A4FS 2JHPA 5B30A 4EKIA 1P2GA 4IWYA 5NLLA 1RYZA 3IBTA 3O8BA 4QYTA 3IP9A 1CJSA 4BTEA 1L4YA 4DW8A 1GPYA 1EMDA 4S1TA 1PR6A 3RVJA 1OKKA 4PYKA 4IQ4A 3D59A 4RQTA 4CQLA 1AD2A 5EJ6A 3C24A 3FSJX 1KERA 1TO6A 3OQIA 4XIGS 4HRVA 1G20B 2JAQA 4KPUB 5JS1A 2XYRA 2FUKA 1D2CA 3WB2A 5GINE 3HFRA