1I30A

E. coli enoyl reductase +nad+sb385826
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
256
structure length
248
Chain Sequence
b'GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Inhibitors of bacterial enoyl acyl carrier protein reductase (FabI): 2,9-disubstituted 1,2,3,4-tetrahydropyrido[3,4-b]indoles as potential antibacterial agents.
pubmed doi rcsb
total genus 89
structure length 248
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2001-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i30A00
1H6DA 5A4DA 3Q9NA 3DL2A 3AJRA 1I3MA 3DAFA 1PIWA 5ENDA 5T8KC 1GY8A 3OQBA 2CMDA 5CHEA 1N1GA 2PY6A 5DCUA 1IZ9A 3OBBA 4JJFA 1KOLA 4D41A 3OEYA 2WSBA 3RC9A 1K2WA 3JQ9A 3L6DA 1XQ1A 2FR8A 1H6CA 2FHSA 2O23A 2VZ9A 2ZYAA 3LVFO 4U8GA 3U4HA 5COBA 3PLNA 3IKTA 3HE3A 1NAHA 1ZJYA 3DEYX 4Q3DA 4RLSA 4XA8A 1GZ3A 1I33A 4OO3A 3DC2A 3N74A 2VWHA 3RBXA 1LU9A 3IJPA 3QA9A 3QP9A 4D0RA 1E7WA 3RFXA 2JAPA 3I3OA 3VTFA 5CDYA 5L51A 1GQQA 1YOVA 3TZ6A 1ZMTA 1E3JA 1LDEA 2FP4A 4XR4A 2NU6A 4NFSA 1V3UA 4MVJF 3UVEA 2GN4A 5KJEA 1E7RA 4PVDA 1U3UA 5T67A 1YOVB 1NM5A 1B3BA 1Z82A 2HMSA 2RH8A 2AEMA 4B3HA 1HSZA 3TQHA 2A9FA 5FF9A 5B12A 2SCUA 4RPLA 2IRWA 2EW2A 4CLRA 1WZEA 3CINA 4ND2A 2ZIZA 3QVWA 2BD0A 4MVJP 2E4AA 5HTOA 2PH5A 5A03A 3PFWO 5JY6A 3I9KA 3TDKA 1Q7BA 5IXYA 1CETA 1M66A 2EJVA 2YHIB 4OGWA 2D8AA 2Y05A 3WNQA 3TZKA 2VHZA 2X9NA 3WOHA 4CM4B 2QRKA 2X0NA 3CZRA 4FJ0A 5T64A 4GMGA 1DFHA 4J91A 2BF7A 4CMEC 5JS6A 3ZHXA 2V6MA 3N7UA 4UVDA 3NT4A 1ISJA 4BNLA 4GBJA 4IDDA 3BAZA 1YRLA 2PZLA 2Y1OA 1KVTA 4QT0A 5TX7A 4FJ1A 3UN1A 1YQDA 3UXYA 3K92A 4JN6B 3GOHA 1ZH8A 2OP1A 2RBEA 3INGA 4HADA 2I65A 3O8QA 3JD3A 1NFRA 3HDQA 4W7IA 2ZYGA 1LLCA 4FFPA 2X1HA 2BFPA 4E2ZA 1LLDA 5KTKA 3EMKA 1KVUA 1X7HA 3DWFA 3H3JA 4BMVA 3WGZA 4MVJM 1UZMA 4AJNA 1EFLA 3D64A 2O3RA 1IULA 3DTTA 1S7CA 3TFOA 2E48A 4IUYA 1UZNA 4NI5A 3JCZA 5EQFA 1Q2XA 3CSDA 1UAYA 2WWRA 3KYBA 1LRKA 2V7PA 3KLMX 2O4CA 4BNIA 4ZJUA 3B1KA 3JQ9C 4CM9D 1RJWA 2IEBA 1PWXA 3DOCA 3QRWA 3ONDA 4PLWA 4HWKA 3ZH2A 5A04A 4RF2A 1BDMA 2B5VA 4IM7A 3B1JA 1YBVA 3V5NA 4O1MA 3AM4A 4BO9A 4R1TA 4MVJA 1TI7A 4NG5A 1VPDA 3EVTA 4PGFA 4EJMA 4DMMA 4CMHA 4P22A 1E77A 2C2XA 2XF8A 1U3VA 4GX1A 1PX0A 5B4VA 1UXKA 3A1NA 2HK8A 3RAJA 2QQ5A 3LLSA 3ZWYA 2VOJA 4ZICA 4HFNA 4NBWA 2NVUB 4QQRA 4RVHA 1XWFA 1AHIA 3Q1LA 1Y9EA 3GDFA 4IGFA 5DNAA 3DMYA 3CKYA 2GRAA 4FN4A 4O5OA 3TNLA 4BGIA 3C1AA 1HE5A 2HO5A 1DJQA 2LDXA 1KEPA 4NIMA 1P33A 2IYPA 2PKQP 3PI7A 3MJEA 2CZCA 3PHLA 4F3YA 5FYDA 3NX4A 3DHNA 3V8BA 4CQMB 4CM4A 1ZSYA 2AQ8A 3ZWOA 1HF3A 5AQ1A 3QVOA 4P4NA 3UF0A 4JX8A 4WASA 4D44A 1P9LA 5C37A 1H9AA 3WSWA 5K9ZA 2QG4A 3VH2A 5KCZA 3VZSA 2NACA 4NPCA 5IN5A 1EVYA 5JFOA 4JQCA 1X7DA 2CF5A 5IDQA 3DQPA 1XCBA 3EY4A 2QRLA 4Q3BA 1V0JA 1DLJA 4LMRA 2Y1FA 1D1TA 3VH4A 2EP5A 5ENVA 2GF2A 2QZZA 3DBRA 5JY1A 3PHHA 1GZ6A 1V35A 4ZQGA 4Z9XA 3FD8A 4YJHB 1ZFNA 4PG5A 3T7CA 2HDHA 2VCYA 4HKTA 4L9RA 2DBRA 4FJ2A 4L75A 3M2PA 3B70A 1GQ2A 1QR6A 2CSUA 1B7GO 4LISA 4J2HA 4R4JA 5B1YA 1NVMB 1PQPA 4J1NA 5G4KA 5IDXA 3TL2A 4J4HA 3DMTC 1GYRA 3AY7A 5B37A 1IZ0A 1ZSVA 2OFPA 4BNJA 3GG9A 1F8FA 4CM9A 4JLWA 1H5QA 3KBOA 1KVSA 3LLVA 3LYLA 3WDSA 2HMVA 2X5JO 2Y1CA 3IC5A 5FI5A 2CDAA 1KS9A 3ETDA 5TJ9A 1LLQA 5U4QA 3P2OA 3QWFA 2J3IA 1PZFA 4N7RA 4E5YA 1DIAA 1PZHA 1P1HA 1C1XA 1OZAA 3ORFA 4U6SA 3WICA 3RSHA 1ML3A 1NHWA 3ENNA 1N5DA 3ANLA 2DTXA 2VRCA 3JD2A 1CERA 4B3IA 2BRUA 2DUWA 5I7EA 5H83A 2P5YA 4CUKA 1E92A 1GADO 2RAFA 4JXKA 5F5NA 4QEDA 2B35A 1TT5A 3WJ7A 1JU9A 2X9GA 4BQRA 3U3XA 3JD1A 4CLHA 2XOXA 4BGUA 4IPTA 6ADHA 1MC4A 5ER6A 1NPTO 2C59A 2X58A 3ADOA 5G4KB 4E3ZA 3L77A 4Y67A 4XJTA 3JQAA 2WE7A 1M6WA 3ZHZA 1U3WA 1Y9AA 2TMGA 1ISMA 3RC2A 4IDGA 3EGOA 3I4FA 3Q11A 2UVDA 2ZB4A 2R00A 3E8XA 3WGHA 3BMQB 1P1JA 2Y67A 4XQCA 3PYLA 1C0KA 1B3RA 3DZBA 1ZIDA 3JQ8B 1PL8A 3ASVA 4GX2A 4YQZA 4EEXA 3GRKA 5CDUA 3RUFA 4DLLA 2W98A 8LDHA 3I9JA 5HS4A 1CQJA 4JK3A 1GV0A 5HA5A 5JW6A 4NU5A 3GAZA 3EAGA 1XA0A 4LCJA 2AEFA 3INTA 4Y6PA 4TZTA 5L7TA 1ULUA 5G0TA 3VPSA 4RVFA 1XG5A 4RGBA 4YB8A 1EK6A 1GCOA 1M76A 3KB6A 4TKLA 4DGSA 2AXQA 3ZWXA 1VI2A 3CMMA 2J5KA 2FR1A 3ANNA 4JJGA 3I1JA 1NVGA 4YA6A 2Q1UA 2PNFA 4D7AA 1Y81A 4CLEA 3S2IA 1Y8RB 4RLHA 5A02A 4MDHA 1PJCA 3QWBA 4ZRNA 1GV1A 1Y8QB 3WB9A 1Q7GA 3C1OA 1G1AA 3LC2O 1SEPA 3NKLA 5F1PA 4IDBA 3KEOA 1O94A 2CF6A 3EC7A 1GQYA 1NNUA 1GEEA 4CMIA 3FI9A 2LDBA 1DC4A 4ESOA 5CAEA 3H9UA 1BHSA 2W8ZA 5JC1A 2IODA 4BNVA 2G76A 5CDSA 4XGNA 5EMHA 5A5EA 1I3NA 3GVCA 3HSKA 3D3EA 2NADA 4U5QA 3PGJA 4IXTA 3CTMA 4EW6A 1FDVA 1R37A 2H63A 1N7HA 3OIFA 3IKVA 4IJUA 1BXKA 4PZCA 1MC5A 5I9LA 4WLEA 3UCXA 3MJCA 1NPDA 4RF3A 1SAYA 4PLVA 5IG2A 3DR3A 4IDEA 3B1FA 4ND3A 1C0IA 3RASA 4IZIA 4J6FA 1KY5A 1DLIA 1HT0A 1PGNA 2YJZA 5JSFA 1GFSA 2O2SA 5I7FA 3DO5A 1IY8A 2BKAA 2Y0CA 1LDMA 2DBQA 4X54A 4Y8VA 1XKQA 2FOIA 3P5SA 3DHYA 2IDZA 4AJ1A 4NHEA 1XYGA 3K2EA 4A0SA 3KYCA 1ISHA 2FPPA 4OQYA 3DZJA 3ZI0A 3WWZA 4CMAA 3LF2A 4J7UA 1ZSNA 3U0BA 1PJQA 4Z0HO 3PDJA 4N54A 1NWHA 3L9WA 4B7CA 4PRKA 4ZU3A 5IFLA 4OL9A 3FNEA 2AG5A 1ZK0A 4E31A 2XPCA 3H3FA 1UXGA 5JE8A 1GD1O 1EE2A 1UDBA 2QX7A 1WPQA 5U1PA 4CMIB 3DZKA 2Q1SA 2F1KA 3FN4A 2B36A 3PJEA 4YAEA 1QYCA 4NBRA 4D3SA 1RKXA 5IZ4A 1J5PA 1T2AA 1GU7A 2NTVA 3ENKA 4BVAA 4RZHA 5BT9A 3WTBA 1V8BA 2PTGA 2CUKA 5JAMA 3GVHA 3VPHA 4OXYA 1JDJA 2A4KA 3LQFA 3WSVA 3KYDB 3W4KA 2I3GA 2AW5A 4L73A 3IJRA 1FDSA 4TRMA 3MWDB 3WQSB 4E33A 3Q0EA 1HYGA 1CJCA 4CR8A 3KETA 4Y6SA 5AXCA 3D4PA 4QXMA 1ZO8A 1PEDA 4RPGA 5BNFA 3W6UA 1P3DA 1NR7A 3JYQA 3I52A 3ZWVA 3PGXA 1XEAA 3WGGA 2UAGA 3COSA 4D43A 2HRBA 5C7OO 3AUTA 1TA4A 3SJUA 4DLAA 3JQ8A 3I83A 4ND1A 3PLRA 1EDOA 2IZ1A 1LSJA 4BO0A 4XQGA 4Z9FA 4WK6A 1NYTA 1AGNA 1L1FA 3ZU5A 4CODB 3LSYA 1NWCA 1RM5A 2WYUA 1J4AA 1XGKA 4IS3A 1I5RA 4ZQFA 4I5FA 2P5UA 3OFSA 4MIYA 3LT0A 1WW8A 4BNWA 1F12A 2X4GA 4YAIA 1LSUA 1ZW1A 5EESA 3H9QA 1WDKA 4CLOB 4FFLA 3GEMA 2GZ1A 4OSOA 5G2OA 4BNXA 1YKFA 4RJTA 1B8PA 5IJZA 1O6ZA 1J49A 1IPFA 1RM4A 1ONOA 2BLLA 4B8ZA 1DPGA 3U5TA 4OH1A 4YQYA 4TMFA 5ICMA 3S2EA 1H0KA 4KDEA 1LUAA 1E6EA 2Z1NA 5KVCA 1Y8RA 5ICSA 3TF5A 1C1XB 2NVWA 4XJSA 3M6IA 2GCGA 2PKQO 1IUKA 1ZCJA 3PPIA 1XHLA 4ND5A 4K9DA 4Q39A 3F4BA 1Z7EA 3GT0A 4I5GA 4U7WA 5A1TA 2DLDA 2YDXA 3QWAA 5F1KA 4YVFA 1ISIA 3P2YA 3IIEA 5HM8A 3L4BC 3W1VA 2J3JA 1Z75A 2Q1TA 2PWZA 4J90A 3FPLA 1JN0A 3AI3A 2O7SA 4GKBA 4XWYA 3LT4A 3OP4A 4FFMA 2RH4A 3EDMA 1K0UA 1OFGA 4KQXA 1WLYA 1MXHA 1O5IA 1O8CA 4IZHA 1P1FA 3HDJA 4FFOA 4YJGB 1JQBA 1ADBA 2O3QA 2NNLD 5CDTA 3TFQA 1JWAB 1JKIA 2ZB8A 4PLYA 2XXBA 4CL3A 3H4VA 1D1SA 3OHSX 3KSZO 5C5IA 3I6IA 3E5MA 5FI3A 1A71A 2HMTA 4PG4A 3ONEA 3A06A 4U0KA 4LK3A 4FPXA 1NTOA 3S2FA 3BYZA 2C5EA 1I24A 1VM6A 1ZJZA 3Q2IA 4K28A 1JTVA 3KYDA 1IHXA 3UOGA 2ILTA 4QUKA 1QG6A 3FRJA 1OMOA 3AU9A 4XYMA 2HCTA 3V1UA 2EEZA 2X7HA 5G4LA 4H16A 2P9EA 3EZYA 3QVXA 4M54A 3Q9UA 1YL7A 4CMEA 1K6JA 1YE3A 2BI7A 2NTNA 2OP0A 2X0IA 1MV8A 4IDCA 2VWGA 1OC4A 2HLPA 2WTBA 1HDZA 4KUEA 1XIVA 2B69A 3W8EA 1DSSG 1E3LA 1EFKA 1GUYA 1SMKA 3WFJA 4HFMA 3RJ5A 5JMWA 1A5ZA 3DOJA 2FPIA 3K8ZA 4J3FA 3U09A 3C3XA 3OIGA 3VVCA 5L7WA 3OJLA 3VKVA 3UAGA 1Z73A 5BSEA 1V3TA 4A5OA 1SZJG 4GGOA 3H9EO 1JWBB 5KWEA 1YJ8A 1WXDA 1EEHA 4NBUA 3I6QA 9LDTA 2C7VA 2GYYA 4XB2A 3HQ4O 2JHGA 3QY9A 4UAGA 3PQEA 1K3TA 2Q3EA 1LQUA 3IQDB 2D59A 2OOSA 3DBVO 3JQ7B 4II3A 4R54A 4BNUA 1KC3A 4FGSA 1ZMOA 2GN6A 5TT0A 3HNPA 2JFGA 3AOEC 4R1SA 1DIHA 3TZHA 3JQCA 1I2CA 4E12A 3CUKA 4E2XA 3L6EA 1K5HA 3ROKA 4HNGA 3LDHA 2Z95A 3O8QB 3UH1A 5EQDA 3OM9A 3ON5A 5I7SA 3RIHA 4G65A 3OA0A 3IP1A 2EXXA 3LC1O 5A5FA 1RWBA 4J4TA 2PZKA 5DOVA 1R66A 1FDUA 4BIIA 4MVJG 2ZQZA 4ZQHA 1KEUA 4I1IA 1UP4A 3C24A 1C1DA 3KV3O 3PTZA 3ITDA 2PLAA 3JQDA 4FW8A 4I08A 3AK4A 3NDIA 4R16A 2QW8A 1X0XA 4PVCA 1DFIA 4B4VA 1J6UA 1I8TA 2B4QA 3OJFA 4J9VA 1H2BA 2VUSA 1E6WA 3DAPA 1ADCA 3GVPA 3RI3A 3FBTA 1YL5A 3F5QA 1DC5A 4EGFA 1TLTA 4XEHA 3ASUA 5CEFA 1N92A 3GFGA 4OOFA 2AEJA 1C3VA 1LJ8A 1SPXA 3GPIA 1SEVA 4OJNA 3BMCB 3MJSA 2WEKA 2YZ7A 2PV7A 3PWSA 4QTZA 1HKUA 4M8SA 1DC3A 3IS3A 5KJ6A 4JNKA 1T1RA 5KKCA 1VJTA 3BHIA 4ND4A 3QHAA 1B2LA 4IQGA 1FJHA 3NTQA 4GAEA 4L74A 4L76A 1JVSA 2AQIA 2BHLA 1BXZA 5DOZA 4E0BA 2DTDA 1P44A 3RU9A 3IAHA 1GCUA 1E1KA 3JQGA 1PGOA 3GHYA 4XYLA 3JQ7A 5IZCC 2J6IA 4PRLA 4QX6A 4ZRMA 1YVEI 3U4IA 3G0OA 1XDWA 4CR7A 4AJ4A 3MCVA 5CDGA 4YWJA 4Q3NA 3RC7A 1IE3A 4MJLA 4H3VA 1E1NA 1KYQA 1OI7A 3IDSA 2JKVA 1HE3A 4UEJA 4Z0TA 4DWVA 1ID1A 1TVEA 1VLLA 1YBMA 3GZNB 5JO0A 3T7EA 1CDOA 1DFGA 2EERA 1NP3A 4AJKA 3ZWCA 3P7MA 5JAZA 4A2CA 4XRGA 3PFFA 1SC6A 3TOZA 4H7PA 4WCFC 4CMGA 4CQMD 4WOJA 4W6ZA 1RM0A 1G0OA 3E9MA 3PXXA 3IMFA 1SB9A 2HK9A 1R6DA 3BTVA 3DB2A 3IOYA 3JQAD 3GR6A 1EE9A 1WMAA 5EJ2A 5TLSA 4YT5A 3F6YA 4OKIA 4MVJH 5BR7A 1IB6A 4DUPA 3VPGA 1YS4A 2I67A 3VZQA 1MA0A 2CY0A 2G0TA 3ROQA 2B4RO 4CQLB 4W7HA 4ALIA 3DZFA 4UUPA 3WBFA 5F5LA 1UR5A 2NSDA 1LTHR 1SO8A 2VRCD 2H5LA 3HFGA 1GYQA 4BNNA 1QV7A 2EHDA 1UUFA 4XRRA 7MDHA 1T2DA 4XDZA 1U9JA 3JYOA 2YV1A 4OAQA 3D0OA 3BMQA 1KBZA 4Z9YA 5IXSA 3AU8A 9LDBA 2J8ZA 1LX6A 5G0UA 3HWRA 3F9IA 1BGVA 4HP8A 4MVJD 5THQA 1JKJA 1X1EA 1KEWA 2YV3A 4MIOA 2VT3A 2OZPA 3GZ4A 4ALMA 1CWUA 4JBHA 4WLNA 5HBRA 2PD4A 4XQEA 1ONPA 2C20A 4ZN6A 4DIFA 1SBYA 4KWHA 5DBFA 4UEKA 1BTOA 1EQUA 1O95A 4P38A 5KVSA 2UV8A 4JBGA 1HDCA 2ZTVA 5DP2A 4BO6A 1ORRA 3E03A 5TJHA 1A9YA 3DONA 1NFFA 1B0AA 2C7GA 3I4CA 5TF4A 5L4SA 2FRDA 3PDUA 4K1LA 3V1YA 2HMUA 3PVZA 4E4YA 3ETEA 4CLXA 2EG9A 4A7PA 4C4OA 2WE8A 5J23A 4E21A 3H9GA 4XGIA 3F1KA 1R0LA 1T2FA 4GL4A 3HZZA 3GMSA 3WQQA 2Y1EA 5K6AC 4ALLA 4AICA 3OMLA 5TRTA 3Q6IA 4M86A 5I9MA 2JCXA 1DHRA 4OM8A 1D4FA 1GR0A 1X14A 3L07A 4CM5A 4KUHA 4BGEA 5DF1A 2VHWA 3W8FA 4AJHA 1QYDA 2P4QA 4N5LA 3OJOA 4BNKA 4XR9A 3E6AA 4N5NA 3GMDA 3DDNA 4J1QA 4BNHA 4RPJA 4XCVA 1T4BA 1NR1A 3LT2A 1Z6ZA 4E13A 2DT5A 3KYCB 3EUWA 2JD0A 3NV9A 2OMEA 4ONEA 2DU8A 4UULA 4YXFA 5L9AA 2YDYA 3AW9A 3K6JA 4PCVA 3PZRA 3RD5A 3AFNA 1W6UA 3GHHA 3CH6A 1X7GA 3NJ4A 1C14A 1UXHA 3DBHB 3VH1A 4M49A 4UVHA 2AQHA 4YBZA 4GWGA 4R01A 1X13A 3SC4A 2VTDA 2PD6A 2GPTA 5JNLA 1NBOA 4BKQA 1GPJA 4CL8A 2O50A 4L4SA 1U3TA 2VZ0A 3RJ9A 3PHGA 1HDYA 2CFCA 2QYSA 3WXBA 3EK2A 4CMCA 3D4NA 4EUHA 4NJMA 2X23A 1A27A 1M67A 3RCBA 3E18A 1F17A 2X6TA 2HJSA 3TZQA 1HL3A 3MZ0A 1E5QA 3NDJA 3HJAA 4TROA 3JTMA 4R3WA 4XQ9A 3TJRA 3HB4X 4NH4A 1QXSA 5L45A 2QIOA 1UP7A 4FC6A 2JFFA 4DL9A 4MP8A 2VWPA 5TQVA 3PQDA 4AVYA 3GK3A 3VZRA 1T26A 4D42A 4BL5A 1EVJA 2IE0A 4PZEA 3DZGA 3L6OO 3U4DA 4WNCA 3RC1A 2JAHA 5T6BA 4PZDA 4YYZA 3AOGA 3MJVA 3MOGA 1B26A 4QSMA 3H2SA 4M87A 2EWMA 3UICA 2OORA 2OO5A 2A35A 2Z1MA 4EDFA 4F46A 3LC7O 4NZ9A 1E3WA 2DPGA 1ADFA 2EKLA 2ZCUA 3GAFA 1YXMA 3H5NA 1NQAO 1ZK1A 1CRWG 2DFVA 5A06A 4NDNE 4AJJA 4E32A 8ADHA 2AA3A 5I9NA 1MGOA 4B79A 3PWKA 1NHGA 2HQ1A 3DBHA 3OEWA 4FSHA 3GN2A 4HXYA 3V1TC 2V6GA 1KERA 1QKIA 1OC2A 2Q2VA 1ISFA 3ZW8A 2WYVA 3AUSA 3VC7A 1N9GB 1O89A 3E82A 1ENPA 3WGQA 4HFJA 1Q0LA 3BHJA 5B4UA 2EGGA 2FSVA 1EUZA 2OBNA 3E48A 1F8GA 3U62A 1Z45A 3GRPA 4FQ8A 3VTZA 2ZTMA 2BFMA 3ZWBA 3GVIA 4WPGA 5AVOA 3GC6A 2P91A 3RUAA 1BSVA 5KKAA 2D5AA 2GZ2A 3E5RA 4HV4A 3H5RA 2C82A 1YONA 4AJIA 2IEDA 4QFCA 1ZKMA 1FXSA 4BO3A 4PLZA 2E49A 2JD1A 4BB5A 3OECA 4Q3EA 4BO8A 4XX0A 3GGPA 4INAA 3ZWPA 4XKJA 1JA9A 1PU2A 5G0WA 1BXGB 3EYWA 3L9XA 3V2GA 1H2HA 5AXAA 2WD7B 1U7TA 1I2BA 4HNHA 5CPBA 5A9SA 2Q2QA 1WAMA 2VHVA 1P1RA 1XSEA 2O4UX 2GN9A 4YJFB 1R0KA 2OHXA 3WLFA 5AXDA 1GTMA 3OA2A 2NM0A 3FCOA 1R16A 5DN9A 4BS9A 4UEOA 1BXGA 4FFNA 2GGSA 1X15A 3AY6A 5T8KA 4O63O 5KIAA 1HWYA 4MKZA 4FDAA 4IINA 3DBLA 4BNMA 5JCXA 4YCAA 4Z0PA 1ZUD1 3JQFA 1NFQA 3EW7A 4D45A 4DMLA 2FN7A 1B15A 3FWNA 4BO7A 4CV2A 4GX5A 4I5EA 3LU1A 4EJ6A 1PTJA 2PR2A 2GNAA 4WEQA 5L4LA 4CPDA 1GDHA 4J0EA 2NWQA 3W6ZA 2EJWA 3ZV4A 4W9NA 1K6XA 4GVLA 1Y1PA 3S55A 4CUZA 4CM1A 2I3AA 4ZD6A 4EI2A 2DBVO 2DC1A 1BRMA 1UH5A 1CQIA 1R15A 2ZTLA 4I9HA 3JQAB 4KUGA 5L3ZA 4QO7A 4E5KA 2VNSA 4MPDA 4LGVA 5F3RA 4ILKA 1HDXA 1W73A 3A9WA 2E82A 4DQUA 1I30A 5JLAA 3G1TA 3K9QO 4BUCA 2CVQA 4N5MA 4FCCA 4Q9NA 1W4ZA 2I76A 4HX5A 4CJXA 3HN7A 1E3IA 1P77A 1E7YA 3AY3A 1B14A 1HDGO 4RVSA 5JYEA 2ZK7A 3BMNA 1FDTA 4XIYA 4BNYA 2O3UA 2PA3A 4WLUA 4KQWA 4CM3A 4E6PA 4OSPA 3BHMA 5L40A 4DC1A 3FPCA 4CQMA 2WD7A 3KO8A 4TQGA 2RHRA 2NQTA 4UREA 3ZV6A 3ICCA 3L4SO 3TN7A 3V2UA 2NU7A 3ICPA 4J7CA 3ZZNA 1HZZA 4GSKA 4A73A 4R5MA 3I5MA 4NJOA 4I8XA 1AXGA 5FFFA 1LRLA 4L4RA 3WIEA 5BSGA 4DXHA 2Y0EA 4W9NC 5H81A 3A28A 4WLOA 3JQEA 2HJRA 5IZCA 3BTUA 5IDWA 3QWHA 4GLOA 3DTYA 2X0RA 1ZXBA 3KXDA 2AQKA 3QJ5A 4OQZA 5DDIP 4E2YA 3VOSA 4QO8A 1LXCA 5JBIA 2NTJA 4PLTA 4XGKA 4LRSB 1LDNA 3OICA 1ADGA 4J16A 3O9ZA 2P68A 1H6BA 3I9OA 4DYDA 1PGPA 4IQ8A 4BMNA 2FMUA 3L4BA 1D3AA 2Q46A 2I99A 1TXGA 3M1LA 3IUPA 1YO6A 4I9UA 1QMGA 3C8MA 4WOKA 5I8ZA 4W4TA 4B7UA 5ITWA 1VSVA 3SLGA 3QVTA 4GLLA 3T4XA 2PZMA 4ZQEA 3D5TA 3GDOA 3ZWAA 2GSDA 4ALKA 3H8VA 4OYRA 2G82A 4B4UA 3DZHA 4WLFA 1U2GA 2JCYA 1DHTA 1XQ6A 3ZNQA 3BMNB 3QVSA 4NBVA 1WDLA 4J7XA 1Y6JA 5JO9A 7ADHA 3FBGA 3WYBA 1SOWA 4AJ2A 4OXKA 1K6IA 2JCVA 1F06A 2DKNA 1U28A 3Q2KA 4GWKA 4NFHA 3NEPX 3NAQA 3PHIA 4JCOA 3GDGA 4B8WA 4DC0A 5IN4A 3JYNA 1PJTA 4BNGA 1HLDA 3WS7A 4DA9A 3KVOA 1Y8QA 1RM3A 2OUIA 5BSFA 4HFRA 4CM8A 3O4RA 1DBVO 2DM6A 5U9CA 1HEUA 1KY4A 1JAYA 2VYND 3HUDA 1MFPA 4W82A 5CP8A 4B4OA 4RPHA 5L4NA 2QRJA 3RUEA 4ITUA 2WD8A 5F1OA 2POQX 3WGIA 1P45A 5THKA 1BW9B 4LN1A 3AI1A 4BKRA 5KJ1A 2EW8A 2ZKLA 1Z74A 1SOVA 1DAPA 1B8VA 3RQSA 4R1UA 3ULKA 1I36A 4DPKA 3AM3A 1H9BA 3WJAA 1VKOA 1IOLA 1HETA 5FEUA 3GF4A 4YRBA 2PGJA 1EUDA 4DTIA 1U7HA 4O0LA 1Q0QA 4L0QA 1DEHA 2YFQA 4P8RA 4JP2A 3VAZA 1DO8A 3LZ6A 2PGDA 3WWYA 3RUIA 3KUXA 3TL3A 4MO2A 1P1IA 5IAAA 4FIZA 1F14A 1ZBQA 2B37A 2Y1DA 4ROSA 2VZ8A 2DQ4A 1SB8A 2XXJA 4KWIA 1BDBA 3WTCA 3PJGA 5DBIA 3G1UA 1PR3A 3UW3A 1O9BA 2P4HX 2GLXA 3CE6A 3E9QA 4GVXA 1N1EA 1MXFA 6LDHA 3LK7A 3OJEA 2I9PA 4TWRA 2B0JA 1VL0A 2YQ5A 1LEHA 2O2YA 1I0ZA 1VL8A 1T4DA 2VT2A 3C1TA 3KEQA 4YAJA 1IYZA 3ZWWA 5C7LO 4CR6A 2CDCA 5LDHA 1B16A 1P0FA 4K6FA 5CG2A 2C0CA 3HG7A 2YY7A 1IPEA 2VYNA 3F1LA 3PIIA 1W8DA 4KDFA 3R3JA 1ENZA 1GAEO 2PKRA 4F6LA 4G5HA 3U4CA 4GPD1 3BMOB 1E7QA 2V6BA 2NU8A 5CEEA 1DRWA 2PD3A 5JAQA 4CLOA 3K30A 5JMPA 2GZ3A 1LC0A 3GLQA 3HHPA 3GGOA 1PJLA 3NGXA 4NQZA 3RFVA 3ZV3A 4TVBA 4BNZA 1EUCA 3D1LA 4J1TA 2WYWA 3BTOA 3DAGA 1E0DA 5EINA 3GEDA 4P4GA 2VRBA 1QLHA 3DBRB 3NYWA 3M2TA 3TOXA 1YDWA 3LT1A 4LCEA 4GX0A 2GASA 1PSDA 5BNTA 5BSHA 4BGVA 1TT5B 3EVNA 3WBBA 3LF1A 1R4NA 4ID9A 4DQXA 4M89A 1EBUA 2PZJA 5TIIA 2GO1A 3RUCA 3BIOA 3ROPA 1C0LA 4O6VA 2W2LD 3ZGYA 1BVUA 4WUVA 2R6JA 3MJ4A 4UUMA 4OIMA 3S1LA 1QORA 2B5WA 2BI8A 2ZJ0A 4LMPA 2PH3A 3VZPA 4CV1A 3MEQA 1A4IA 1MX3A 1HYHA 1R4MA 4AJPA 1AUPA 1E3WB 3ETGA 3OF2A 5DCYA 4DVJA 5ITVA 1HDOA 1Q0HA 4JP3A 1GZ4A 4IDAA 4S1VA 2H9IA 3TSCA 4ALJA 3GZNA 4NFYA 4TRRA 3K2BA 4XB1A 3WX0A 3WIDA 2D3TA 1J0XO 2O48X 5H82A 3U49A 5KNLA 4J0FA 4XZ3A 3BXXA 1YL6A 1P0CA 3I9MA 3E9NA 2D0IA 4JBIA 2JFHA 4D79A 4IJWA 1HDRA 4BO2A 4ZGWA 3RUHA 3RVDA 3P19A 2DAPA 1WWKA 4EBFA 3VPFA 1Y5RA 3OIDA 4OMUA 3DFUA 1A9ZA 3VKUA 2C5AA 1LC3A 4FOOA 5EN4A 3ZHBA 4IJKA 4XYEA 4QFDA 4UUNA 1XLTA 1XU7A 3VHRA 3JQFC 2DPHA 5GZ6A 4IS2A 3GA0A 1GEGA 2AHRA 2HAEA 4WNIA 4YJDA 4AJOA 4LSWA 2NVUA 3H65A 3QWIA 4KTVE 2D2IA 4RQUA 1IHYA 3GUCA 3JD4A 4XYGA 3KOUA 2Q4BA 1E3EA 2FY8A 1YB5A 3CZMA 4CM7A 4GSLA 1BW9A 4LSMA 1QV6A 2BGLA 1PS0A 1AE1A 5A3JA 3RFTA 2YUTA 1LBEA 3ZHYA 1VRWA 5FWNA 2OBYA 3KSUA 2P9GA 1A7AA 1I3LA 3SJ7A 1YQGA 2GN8A 5JXWA 3R0IA 1V3VA 5CFZA 3NDRA 2HMWA 3UFXA 3B6ZA 1F0YA 1BWSA 4NNJA 1DAOA 2A92A 1C1DB 2BFAA 3K5PA 4AL4A 3T4EA 3OH8A 4PG7A 2YQ4A 3RROA 1AHHA 1L7EA 4YRDA 3F46A 2Y66A 3O38A 3BA1A 4R5HA 1AN9A 4WCDA 1WZIA 3ZW9A 3D3WA 1V6AA 4R68A 4FS3A 2ZQYA 3QSGA 4J9UE 1DXYA 2EP7A 4MIEA 4PLPA 1PGJA 1YB1A 3GVXA 3EHEA 1N7GA 5EERA 3TZCA 4EUFA 1NXQA 3BZUA 1JKFA 5LC1A 1KVQA 4BV8A 4Q3CA 4FD3A 1WDMA 3ROMA 3ABIA 1ZK3A 3WYCA 3PEFA 1QRRA 5K0ZA 2NVBA 1PL6A 1LSSA 2FR0A 3ITKA 3H6KA 2ZB3A 3S2GA 1N8KA 2HKIA 2RIRA 3GY0A 1NQOA 2W90A 4B3JA 2NU9A 3INRA 5L95A 1LDGA 5EPOA 3ADPA 1HE2A 4YPOA 4BO5A 2GUGA 2FZEA 5CEJA 1S6YA 3JYPA 1YB4A 1HRDA 5GMOA 3WLEA 4I5DA 1ZEMA 4WECA 2EIHA 2AE1A 3HB5X 1GL3A 3JSAA 1UP6A 4TKMA 3WGOA 4DIBA 4IGEA 4YT2A 2IYOA 2IXBA 4MVJI 2NQ8A 4LVCA 3ZNOA 3CMCO 5TNXA 3F47A 4C7JA 1EVZA 2JHFA 4KTTE 2FSSA 3SX2A 4XD2A 4ZHSA 5JDIC 2EF1A 3F4LA 1QYVA 4MINA 1T25A 3WGTA 4YJFA 2AE2A 2D4AA 4PG8A 3HADA 1H93A 3ANMA 3E1KA 4WEOA 1I3KA 4RCVA 4UVEA 1EVIA 1E1MA 2Y99A 1PQWA 5EIOA 5F21A 1SCUA 5ES3A 5MDHA 1PGQA 1Y5MA 2EKPA 4JGBA 1YQXA 3FHLA 4L8VA 1VC2A 2JD2A 5A05A 2UDPA 3STHA 1UXIA 1NX6A 3QE3A 1MP0A 4L4XA 1OAAA 4K6CA 4J4BA 1BG6A 4OKNA 2Q4EA 3ONFA 2EKQA 1JLLA 2R00C 2BGKA 4Z3DA 3KHUA 3AUAA 3RWBA 4J2OA 3MJTA 1QSGA 3WNVA 1O0SA 4MP3A 2X5KO 1RYEA 3QQPA 1XU9A 2DVMA 2XAAA 3ZN2A 3G3EA 1C0PA 4JROA 2NUAA 1T1SA 2CNBA 1U1IA 2WJPA 1CIVA 5DULA 1E5LA 3PHJA 4A26A 4GH5A 3FTPA 1GYPA 3QIVA 4R9SA 4BO4A 4S3MA 4R41A 3GH3A 2J5QA 2CD9A 1LA2A 5JDCA 4URFA 4E30A 4C7KA 3ZNNA 2ZYDA 3AM5A 3G17A 1DIGA 1NASA 2B4TO 2WMDA 4IMRA 4PIVA 1DC6A 5KVQA 4IIUA 1MLDA 3O26A 1T2EA 2ZCVA 4GMFA 1FF9A 2W4QA 1PZEA 2C2YA 4F45A 3O03A 5CG1A 1YJQA 1YDEA 4ZQBA 3HFSA 4BB6A 1I10A 4NR0A 2UUOA 5AOVA 4RQTA 3WG9A 4EJ0A 4KOAA 2Q2WA 2G17A 3ZCXA 4WE3A 3X2FA 2VHYA 2CDBA 2DTEA 3OQ1A 3U9LA 1DJNA 1H94A 4FGWA 3B20A 2GR9A 1TEHA 2C54A 5A9SB 3MOIA 4O59O 1E7MA 5JPIA 3WGYA 1KVRA 1PJ3A 1X1TA 5HWSA 4IXWA 1HXHA 4PG6A 4Y6RA 1E3SA 2H6EA 2PK3A 1KIFA 3RBVA 1EDZA 1N2SA 2W2LA 2Q1WA 1QP8A 4LW8A 4ALNA 4NMHA 3ST7A 4TRJA 4A27A 3SXPA 3NT5A 4XYBA 4PLHA 2YV2A 4DBZA 1LDBA 2QYTA 4JIGA 5COQA 5CPFA 4EITA 1NQ5A 4M1QA 1MUUA 2YFHA 3MTJA 4BQPA 3QLJA 1ZZEA 1ZXLA 1N9GA 1ZEJA 4RF5A 1ENOA 3AOEA 5KVVA 5B4TA 3RUDA 4NU6A 2O7QA 1GUZA 2J3HA 3NUGA 4WJZA 1Y7TA 4KP7A 1Q7CA 3TWOA 2AG8A 4AJLA 3KLPX 5DZSA 4B4WA 4YACA 4FB5A 1YGYA 5GZ3A 1KEVA 2OL4A 3R3SA 5L7YA 3BMCA 3NRCA 3H5AA 3FNFA 3PK0A 1U5CA 5T57A 4CMJA 5IF3A 5KOIA 1W0CA 3CEAA 1T24A 2IXAA 3ZNPA 2O3TA 5DT9A 3K96A 3KM0A 4FC7A 4MKXA 3ZV5A 4XDYA 3N58A 3NGLA 2GDZA 2IZ0A 3PYMA 4KZPA 2WDZA 4UVIA 3D7LA 5G0SA 4OOEA 3SLKA 1VSUA 3I9NA 3GN1A 3OSUA 2ZATA 3AFMA 3FSRA 2HSDA 1R0SA 1M75A 3KTDA 1ISGA 5GZ1A 1YWGO 1UJMA 5LCXA 5DP1A 4BMSA 1UDCA 2HRZA 4OXNA 1UXJA 4D46A 3L0DA 4UUOA 1PZGA 2UUPA 5I8WA 5ILGA 1E6UA 4CM8B 1T2CA 1U2DA 4G81A 5HS6A 1DDOA 2X22A 2W2KA 2G5CA 3NJ8A 4GGPA 1H6AA 3VVBA 3Q3CA 3TPCA 4TRNA 2J3KA 1P1KA 4R3NA 3WYEA 5G0VA 1CYDA 2X5OA 1I32A 1YBAA 2D1YA 3OJ0A 4IBOA 4RDHA 4TSKA 4YEDA 4RORA 5EL0A 5AYVA 1E1LA 4RZIA 3FWZA 2HU2A 3GNSA 3JQ6A 1BMDA 1EQ2A 2ET6A 1Z7BA 3EZLA 1GPDG 3OQ6A 1QYWA 4CV3A 2Q99A 1LLUA 1R4NB 2PFGA 5GY7A 4RVDA 1VJ0A 1WP4A 3SEFA 1HTBA 2BELA 3I9LA 4FFRA 1IL0A 4PLGA 3W8DA 2Y0DA 2YHIA 4YDRA 4B7XA 4HUJA 4A03A 2X9VA 5A3VA 4KMSA 4EEZA 4P4LA 2ZJ1A 4XIJA 4TVOA 1HYEA 4YJGA 1I2ZA 4CQLA 3VDQA 3DBLB 3WMWA 1RYDA 1ZVMA 4FOSA 4RF4A 2BMAA 3CPSA 4EYEA 4CLDA 4II2A 4FBGA 5T5QA 3RKRA 3RBZA 1LRJA 5LDGA 3TRIA 4M55A 3VH3A 1G6KA 2WM3A 4YRAA 3F3SA 3PZBA 2A94A 1FDWA 3DHEA 4MP6A 4AJEA 4DRYA 3D4OA 3M1AA 4HY3A 1A72A 4R69A 2Q49A 1DB3A 2R2GA 3ZU4A 1U8XX 3FNHA 1DIRA 1DOHA 5KJCA 2VYVA 4HBGA 3UUWA 1PJ4A 4E5MA 3DFZA 3HDYA 3NTOA 4J43A 2DBZA 4A10A 1R4MB 1K89A 1VJ1A 4BOYA 4WGGA 1G0NA 3FTNA 2Q45A 3RKUA 3NTRA 4IQ0A 5JC8A 1HLPA 3K73O 4NK5A 3GFBA 2CVZA 2O3JA 4CLRB 4PN3A 5L53A 3WFIA 5ER9A 1VE9A 4PLFA 1D7OA 3PIDA 4DIOA 3CIFA 4DREA 4DQVA 4IIVA 4EZBA 4UVGA 4G2NA 3H2ZA 5A9RA 3V2HA 3C85A 4Y9DA 1TT7A 1XR3A 2AMFA 3JV7A 5DCWA 4EUEA 4MOWA 1GUFA 4U0JA 4BNTA 2OGUA 3UHAA 1ARZA 2O3SA 1QLJA 5JCJD 4WCFB 1E7SA 2C07A 5TC4A 1BVRA 2RHCA 1MFZA 2QHXA 3ZU2A 3NT2A 1PWZA 3IL2A 3JQGB 3HN2A 1P74A 2V65A 2GD1O 4LRTB 4R1NA 2I5PO 1U4OA 4YR9A 3PRJA 4GI2A 1Q1NA 1M6HA 4OHUA 5AXBA 4Q3AA 5C3MA 1NAIA 1NVTA 3JQBA 3RU7A 2JJYA 3C7CB 5TSDA 4F6CA 3QW2A 3DMTA 1CF2O 5MGBA 1PJSA 4RL6A 2VYVD 4RVGA 1EBFA 1M2WA 2J5RA 1LQTA 3GEGA 4WLVA 3MTGA 1WMBA 4BKOA 5JYDA 4IMPA 2BFOA 1A7KA 3AI2A 1CEQA 3BMOA 4IJVA 4H15A 3QV1A 3KZVA 1PL7A 2TMDA 3BTSA 3JYLA 1SNYA 3VPXA 4CM6A 4RO0A 2VN8A 2BH9A 4W99A 4R51A 1DRUA 3D5QA 3GNTA 3FR8A 4Y98A 1LSOA 2VNAA 4CUJA 2C29D 1PR9A 1DRVA 4ZA2A 1U5AA 2V6FA 1PJBA 4PLCA 5DBGA 3VDRA 4DPLA 3DZIA 4MVJE 2EGHA 1YH3A 1U4SA 1JVBA 3D3WB 3R6DA 4D3DA 4YAKA 3PP8A 4E5PA 1P31A 4WKGA 3GPDG 1B8UA 4BV9A 1PQUA 3CXRA 5KJFA 3G49A 3SVTA 4E2WA 1WNTA 1DIBA 2E6UX 2D5CA 2Y68A 4YAGA 2X8LA 5BQFA 1UZLA 1OBFO 2VQ3A 1X0VA 1ZNQO 3WMXA 2I6TA 1A4UA 1KC1A 4J1SA 5JDCC 5TGDA 3SBOA 3DXFA 1PJ2A 3JQBC 4MKRA 2Q50A 2VOEA 3C7AA 3PJFA 4Z6KA 5I7VA 3MWEB 4YJHA 2YW9A 3UCFA 3A14A 4IY1A 4AG3A 3IUSA 1KETA 1L7DA 4I9NA 5K6AA 2IZZA 4E5NA 4YT4A 1NPYA 3DOOA 2FZWA 4BKUA 3R1IA 3H9JA 4YT8A 3C7DB 4BNFA 3G79A 2B83A 3H7AA 1TB4A 2CVOA 3JD0A 3OETA 3WR5A 4DPMA 1LNQA 2BGMA 1WVGA 5HRUA 2RCYA 2Y93A 1VKNA 2I66A 3UCEA 4FR5A 5JDIA 1OOEA 2E37A 3GQVA 5ILOA 2NLOA 3AWDA 2YHUA 2DFDA 1VL6A 2VWQA 2Z5LA 2ZTUA 5BNIA 4K26A 3PWZA 3W4JA 1QYXA 5JCJA 4D0SA 1RPNA 1MB4A 4D3FA 4LVUA 1ONNA 4DBVO 1PS8A 2P9CA 3IP3A 3KSDO 2VUUA 4QECA 1EZ4A 4PFJA 4NJMB 2FWMX 2X0JA 3F5SA 1ZK2A 3WQRA 2P2SA 5IDYA 1XELA 2HUNA 2OXIA 2DUUA 3FF4A 3ZU3A 5ADHA 2NV6A 4GKVA 1V9LA 2W2KB 4N18A 1EK5A 3S8MA 3AUUA 3ZWNA 1FMCA 4RDIA 4TZKA 1UDAA 2JL1A 1FK8A 5TS3A 2VHXA 4CV0A 4U6QA 3ZDFA 4J49A 4ZVVA 3SC6A 3X2EA 1ULSA 2F00A 3PJDA 5COAA 3I23A 1D8AA 1MG0A 3GNQA 2ZB7A 4Z3KA 3ZWMA 4NK4A 1ZK4A 1I01A 1LI4A 3FR7A 4IDFA 4BKPA 1PS9A 3GGGA 4CMKA 3A4VA 1EMDA 2X86A 4RPKA 1R12A 4GQAA 2GERA 3UGKA 5A9TA 1HSOA 1HZJA 4AFNA 2G1UA 4BO1A 4DLBA 5C7IO 3PYXA 2UYYA 1LDYA 1ENYA 4YTEA 4CMBA 1NQTA 2QZ9A 1HE4A 4R9RA 5TT1A 2PGLA 2VTEA 3UKOA 2HK7A 1AXEA 4RV9A 2EV9A 3GG2A 4BHTA 1MG5A 2YYYA 1JAXA 1UAGA 3GUYA 3PQFA 4JJIA 3KRTA 1U8FO 4RVUA 3K31A 4WCFA 2H1SA 1JW9B 2VUTA 3W4IA 3FNGA 4DYVA 2Y1GA 2FPGA 5JAIA 4NBTA 3HDHA
chains in the Genus database with same CATH superfamily
3SBEA 2D0DA 3NV7A 4H6PA 3HVIA 2H52A 3UGJA 5JJLA 2O0LA 5GOZA 4P83A 1J7KA 1FMLA 5KYYB 5EHNA 5ENDA 1I94B 5T8KC 4A91A 3OQBA 2N46A 1YRBA 1P62B 1ZJ6A 3IILA 3UATA 2P9TA 1AS0A 2H8GA 1B6RA 5EWJA 2B25A 3OBBA 4NULA 4AS3A 2CJPA 4P54A 3SLRA 2QL5A 3A7EA 1FX0B 1TCCA 5HKLA 1U0BB 3LYAA 5IF9A 1J8QA 1W36D 1GILA 1M1UA 1H6CA 2FR8A 2FWAA 2H65A 2EIXA 2Z3WA 4K9KA 4ACAA 4E51A 5LQKA 2DLCX 1O2DA 4IP0A 2VZ9A 4PQEA 2XI4A 2YFKA 4U8GA 1CQXA 4YV1A 3FCSB 4L0CA 2PKWA 1AUQA 3IKTA 1T2VA 4JYPA 1ZJYA 2G25A 3DEYX 3ZDDA 5DH9A 5IJXA 1XPJA 2Z98A 4OO3A 3DC2A 4KK3A 4FFDA 4KO8A 4MQLA 5BQXA 2XUPA 2R8OA 3O90A 1CKEA 3I3OA 1IQ0A 3ICEA 4KW7A 5IJWA 5CM9C 3QNUA 3DEFA 1GQQA 3SHFA 1YOVA 3G7SA 1AF4A 4DJEC 2ZM5A 2WYIA 4MJ7A 4NMLA 2O2DA 2FP4A 2DUMA 2ODAA 3H2JA 4MVJF 4M7WA 5HCUA 2C4TA 1FQOA 4B32A 1NSFA 4ETMA 2OK8A 1NBHA 5T67A 1ND6A 3QOWA 3SC2A 4UHDA 2HMSA 2RH8A 4Y1GA 3KU4A 2XCUA 5LQMA 1RVDA 1HSZA 3LRTA 2A9FA 3OZXA 4JC5A 1MPXA 1TJYA 4ARVA 5IUNC 3ZU6A 2PBFA 1CR6A 3CINA 2CE2X 4ND2A 3O75A 2FW9A 1ULAA 5E7MA 4TTQA 1HOXA 3TQFA 5A03A 5JY6A 1AO0A 1XP8A 1Q7BA 3CLTC 1VKHA 4RC9A 4DGQA 1M66A 2REXB 2YHIB 5IM5A 3AUYA 3QENA 4OGWA 2D8AA 5IYZA 4L27A 2P4SA 4RMHA 1CDDA 2NO6A 3WOHA 2GJ9A 2QTFA 4URUR 5JQGB 2X0NA 3CZRA 4FJ0A 1BKDR 3I09A 2FA9A 3JWEA 5HJ2A 4CMEC 5CCXA 4TQ9A 1J5XA 5JS6A 3R7NA 2HCFA 3PCRB 1G3IA 3MLEA 4BNLA 1YASA 1JLLB 5IJ9A 3ZYCA 2PMCA 3SE7A 3ICOA 5F52A 2GA9A 3LTNC 3QM1A 2D1QA 4EKIA 4DA8A 1FW8A 4QT0A 4BPBA 3NMUF 4IXDA 4P58A 1MT3A 3TNYA 1U04A 1RLIA 3UN1A 1IB0A 4W5QA 3UXYA 1X6VA 4HWSA 1PE0A 1Q1QA 5K0TA 4HOYA 4P4TA 1P4RA 2ADMA 3DP7A 3IGFA 2YBDA 2YFYA 2HEGA 3KHSA 3KYJB 3O8QA 5LOVF 1EWQA 1OXBB 2CLOB 2KBFA 4KXLA 2ZYGA 1CXZA 3VHXB 4N6GA 1XAHA 3KWLA 4E2ZA 3OT1B 1QOZA 4G0XA 3EMKA 3HJCA 3H3JA 1IN6A 3LZDA 4BMVA 4MR7A 2OM6A 1E60A 4Q7KA 4FSDA 1VE6A 2FU5C 1YE5A 4RKQA 1W9MA 3LXUX 1OHHD 1SHJA 1UC8A 3D64A 2JI8A 2O3RA 3VM6A 1IN8A 1GTJ1 2E48A 1JKMA 2PKEA 3CO0S 1UZNA 2JDIA 3SIRA 5IWCA 5ALRA 1SUIA 4DNXA 1SZDA 6REQB 3B53X 3BL8A 3DEZA 4IF6A 1K2VN 1KJ9A 2DERA 3BXZA 1OSNA 2V7UA 2GEDA 3ESYA 3SZOA 2V7PA 2DPXA 4BNIA 4RH3A 3OEED 1A69A 3JQ9C 3LUPA 4DZTA 2RGYA 2VDMB 2YNMA 2C3YA 4F5EA 3R9WA 1E9EA 1X74A 3ONDA 3LL7A 4IXNA 1OFUA 3SR4A 2R87A 2B5VA 4MVXA 3A1WA 1YBVA 2QM8A 4BTVA 4G9BA 3V5NA 5DYNA 2HIGA 2RDMA 4R1TA 5JJCA 2FPUA 1KK0A 1VPDA 1Q0SA 1NN1A 4DMMA 4CMHA 2CXXA 4L1KA 3V9PA 4ENVA 1XBTA 1QUFA 2XKJE 2ZBVA 1YE8A 1LKZA 3VHLB 2QP9X 3A1NA 1GPUA 1LF0A 3RAJA 3WLKX 2OM2A 2CKMA 1Z0JA 1OB2A 1B73A 1XEXB 1ZJJA 2R6AA 3BOSA 4LOAA 2BM0A 3NASA 3VYUB 1XWFA 3D7KA 1HNZB 3C87A 2VJQA 4O5OA 5BW4A 3HKBB 3IR5A 3OLZA 3T5AA 2LDXA 2OXFA 4A23A 2CGEA 1IZ8A 3PNPA 3WGNA 4WBNB 5KYXB 3O6VA 5GV7A 3PI7A 4HK4A 4NPHA 3V8BA 2PRKA 3CCBA 2P6OA 3QFHA 4OHYA 4DQKA 1RRCA 1UWKA 4LXXA 5JASA 3QVOA 1RYBA 1N2HA 5JYCA 4JSYA 5EP2A 5EXEA 1X19A 4QYWA 4F6RB 1Y6RA 2IOFK 3WSWA 1I9CA 3Q87B 4TWZA 1CS4C 2IIQA 4ER0A 1EWKA 1ETHA 4U02A 5K9ZA 3I2YX 2UYGA 1FU7A 5FBLB 5JJKA 5JFOA 2RBGA 2YXLA 4JQCA 3DNPA 2QLJA 3DQPA 1Z8NA 5IDQA 2VL7A 4W8GA 4N65A 4BMPB 4G36A 2FWPA 2GESA 4HQFA 2Y1FA 3M0EA 5J4VA 1O03A 1N6RA 1N34B 3DS8A 1A2OA 2GF2A 2QZZA 4I2VA 5GP1A 3DBRA 4MGEA 1X1CA 1JEQB 3L5OA 2V7TA 4QPZA 5HILA 1GZ6A 3ZBPA 1V35A 5LNK6 1ONSA 2IYTA 1IONA 1O95C 2DZDA 3GFRA 3JAWB 4ZQGA 5CA1F 5CYFA 3LQQA 1DKPA 1ESEA 3P71T 1PLKA 4V0ME 2PX3A 4YRCA 1Z6TA 3MWEA 3QPAA 4YJHB 4DMGA 4ZMSA 3T7CA 3VBEA 2RG1A 4L5IA 2PL9A 1T9KA 2VCYA 3IP9A 4NY1A 1SQ5A 4PGMA 5HFJA 2DBRA 3TBKA 1RWXA 1UK6A 2CFIA 2FE1A 1Q7TA 3B70A 4YI3A 2V4UA 1OROA 5C31A 1VPVA 2B6HA 4EO9A 1W4RA 3EZNA 4NONA 1OZHA 4JA2A 4R4JA 3GXOA 1S2LA 2I1QA 1PQPA 5G4KA 3T9EA 1FPQA 2VTBA 2O14A 2GSWA 1GYRA 3IUMA 2HNKA 1D8TA 4OY3A 2M6RA 4AN4A 2O07A 1L5MA 1JJVA 1UK8A 1R74A 3A3OA 3Q7EA 4JI3B 1KMHA 1EJ2A 1M2VB 2N1BA 3V8MA 1ZN9A 1OILA 3WDSA 3LYLA 3V8EA 5ABPA 3CRMA 3HB0A 1S7GA 1AZSC 5AH0A 5HR5A 3NALA 2OCLA 2FLKA 1WY7A 1TCBA 2WPDA 2QG6A 3EHDA 5DM4A 4DE5A 4E11A 5CLHA 1PZHA 1GWNA 2BMVA 2QVLA 4U6SA 3WICA 3FOCA 4BP1A 3N2EA 1NHWA 2VXBA 1N5DA 3ANLA 3G85A 3KLNA 3W3AA 2R44A 4EHJA 4LJLA 1FMTA 1GZUA 4IWYA 1U0EA 4LA4A 2FB9A 5LZ2A 2JI9A 1Z88A 2BRUA 3H6GA 2BFBA 5BNWA 3RLFA 2P5YA 1M7GA 1ESZA 2H11A 1D2HA 1Z0UA 4CUKA 2VS1A 3R40A 2RAFA 3V2IA 4S35A 5F5NA 1U3DA 3L02A 2WTEA 3V1KA 2B35A 5KNCA 1RE0A 2CCKA 3GUUA 4P7JA 3I72A 3NFYA 3WJ7A 4RA9B 3THXA 1UFKA 3T9DA 1MZPA 2X9GA 3U3XA 4KYVA 4FFBA 4MLDA 4CKEB 1EAYA 1MC4A 1Z29A 3CUWA 3ND5A 3L77A 3HKCA 1V16B 3JQAA 1Y1LA 4OI2A 5J2TA 3T3OA 1BEZA 1P5FA 2D06A 2HSZA 4C7OB 4RW0A 4CEIA 3WGHA 2R00A 3E8XA 5LKAA 1B3RA 4AW9A 2Q5OA 4DLLA 5I4BA 4YMLA 2W98A 4ZI5A 2O2JA 8LDHA 2O52A 4LOIA 4PYQA 3QKWA 1HG0A 3IRVA 4NU5A 3W6NA 5C81A 3EAGA 2VT7A 3N0VA 2Q8NA 2HUPA 3B6EA 3I2GA 4RVCA 4Y6OA 2OCYC 5B1HA 2VCHA 3W05A 4ZQIA 1PNQA 3UJPA 4DG8A 4AX4A 5L7TA 1T1GA 3TE6A 3D6NB 1XG5A 3CZ9A 3PXDA 1QPGA 3KFLA 4EATA 4YB8A 2Y2UA 2O2EA 1M76A 4TKLA 4DGSA 1YZUA 5AJYA 3OQJA 1Y8ZA 3RREA 3D4IA 3R3YA 1VI2A 3CW2A 2J5KA 3ANNA 2Q21A 1EHIA 1H1TA 4JB3A 2ZU6A 5ELMA 3N0TA 1G291 4A1FA 3LECA 2FSPA 3N05A 3QVMA 4TYQA 5HQTA 3ABZA 4IG4A 2CNWD 3TKAA 3ELYA 3QWBA 4WZAB 1J7JA 2N0SA 4L5CA 1NI5A 4PY2A 3SPXA 1G1AA 3H5WA 1EUYA 3QYJA 1L5HB 2UZIR 4OP3A 2RAVA 3KEOA 4B3XA 1RTTA 2CF6A 4EL0A 5AM3A 1GQYA 2NIPA 1DBQA 1NNUA 2DP4E 5ALVA 3LKDA 8ABPA 4CMIA 1X9IA 2XNDA 2IXGA 5CAEA 4HMQA 4REQB 4M0EA 3IPCA 1WSBA 3H5TA 3TPFA 4XGNA 5A5EA 4QPDA 4QOJA 2NADA 4U5QA 1L4UA 2I2XB 3PGJA 4IXTA 4EW6A 1FDVA 4HPXB 1E2MA 3D2CA 1YDHA 4BECA 2CUTA 1DGQA 1WQ4A 1JDPA 4H08A 1YJBA 5CTJA 1P5HA 3S2UA 1BXKA 2H51A 2PSJA 3KQUA 1PR1A 4P82A 3KVVA 5IG2A 2XQIA 1OLUA 2P35A 3GV0A 5EHGA 1TZJA 4FMDF 3RASA 8AT1A 4DV6B 4J6FA 1J21A 4MRMB 4ZIRA 3UBTA 1DLIA 3LCCA 3M5DA 2JIPA 4K6KA 2C88A 5I7FA 5JSFA 4LWPA 1Z06A 2BKAA 3UHFA 2GX6A 1XKQA 3AG6A 4Z1MA 4AJ1A 2YC2C 3BDAA 4B6OA 1A76A 3OUZA 3NIWA 2ZIWB 2IVZA 4GW3A 1L1QA 1YZQA 3KYCA 1FRNA 2FQ1A 2QQ0A 3ZI0A 3VSAA 3WWZA 4AKSA 5A4JA 2CV0A 4H27A 3DMPA 5AM4A 3ZK8A 1U7ZA 4LY0A 5AI4A 2B8TA 3RK4A 5IFKA 2ZRDA 3A9TA 4N54A 3L7OA 2CB0A 2VDQB 4ISCA 1CUVA 4EHFA 2WB4A 4HNAA 4OL9A 3IDZA 3KKQA 1N0WA 3ORHA 3B1VA 1GD1O 2CLDX 1UDBA 2C77A 3T7TA 2QX7A 3DPUA 4PX9A 1WPQA 3H4MA 4Q24A 4TM8A 4CMIB 3QKSA 4B46A 3DZKA 4XJXA 1P73A 1X9HA 3DLHA 4OUDB 3G0IA 2IOHA 1JFVA 1NOJA 2B1QA 2XB9A 1Q77A 2OXRA 4HR7A 3RANA 5JD3A 5DM0A 1Q22A 1RKXA 3DL0A 4Q4LA 5IZ4A 1QE5A 1U98A 1KAMA 5F5XA 3V8RA 5JSZA 4X6LA 3FVWA 3THWB 1AZLA 2Q3JA 3NNNA 1LGYA 2Q6IA 3DSRA 4C04A 5JADA 3N70A 3DV9A 5TF0A 1EX9A 2PJZA 1CLEA 3G6WA 4TGLA 1T29A 5K0FA 3BWDD 1JDJA 3W2EA 2X4LA 3LQFA 3WSVA 2FGJA 2E55A 4I55F 4MHOA 3IP6A 3PI6A 2DXIA 2AW5A 4IXMA 3WZ2A 1WEHA 1Z62A 4OHVA 4UBNA 1BJKA 2G6BA 4H1HA 3Q7SA 1P29A 3Q0EA 4U7FA 1HYGA 1KPIA 5F76A 4MEBA 3KETA 1NZJA 1V16A 4Y6SA 1LNSA 2WWWA 4QXMA 1PEDA 6YASA 1P3DA 1WSDA 2I7TA 3M70A 3I52A 3L79A 4KH0A 4RUKA 4V0KA 2ORED 4DSTA 5A2QA 5CDFE 3DCIA 4D43A 3C4QA 1TZCA 1TA4A 2XCRB 1Y6GA 4IYJA 2XDYA 5C18A 4ND1A 1S4MA 1EDOA 3MA0A 2AI3A 1J0AA 4LQDA 3LWZA 2VPWA 3UAYA 3ASZA 3IEPA 3ZU5A 2FMTA 2BUAA 5K3DA 3O21A 3OVMA 4DDVA 1DT5A 3OZTA 2CHVA 1DTWA 3ZQUA 1MQ9A 4I5FA 5EZ5A 5LQSA 1VFPA 3WC4A 4CKBA 3SC3A 1WW8A 5F9MA 5DW0A 2GCPA 4UZFA 1HX7A 1KI4A 2X4GA 3PQ7A 1MVNA 4P3NA 1MR3F 5JS2A 4XSGA 5TE9A 1J9GA 5G2OA 2EBWA 2CUZA 5IJZA 3E22A 1J49A 5LQUA 1PBTA 4CKXA 1OI3A 2REQB 3NHPA 2DH6A 1RM4A 4EG4A 1KZ1A 5B58T 4QTYA 4OH1A 5ICMA 2K6GA 3Q3GE 3S2EA 3ZZTA 4B09A 3EGDB 1LUAA 1E6EA 4OHFA 2Z1NA 2ZBFA 1WP9A 2XUOA 5KVCA 3TF5A 2HK6A 5JMTA 4XJSA 4BFSA 3M6IA 5LPNA 2PKQO 1XHLA 3FOEC 3A6PC 1Y89A 4Z4CA 3TIXB 1T2NA 1YR9A 3F4BA 3AERA 3REOA 4AAYA 3GT0A 4I5GA 1YT5A 3M6XA 3DO8A 2J9RA 1XMXA 1KMQA 3CNQS 3VU1A 2X3FA 4YJ2A 3P2YA 3UUFA 3EULA 2G88A 3KV1A 2J3JA 1LK5A 3O1HB 3SQDA 3CXUA 5JSQA 5CA0F 3JYHA 2HJWA 4ICIA 3GJXC 4Y7DA 1WQ1R 2MTBA 4J90A 4HAIA 4X1KA 2CXOA 4PC3A 4YDSA 1KY3A 5K8UA 2VHEA 4HXEB 2O7SA 1I7LA 4MGYR 3ZE2B 4HXGA 3LT4A 4FFMA 5EUBA 1KFKB 3EDMA 3GZTB 1OFGA 4LX0A 1OGIA 3EC2A 3H4IA 4KQXA 5JEEA 1RI3A 4KWCA 1YS2X 1O8CA 3VYTB 4IZHA 2CT8A 4UBMA 3O73A 5SYAA 1NVXQ 2XYHA 4Z9BA 3TZEA 3TLMA 4C05A 1ADBA 1P7ZA 3G9ZA 3DWIA 3NYQA 4P2BA 4URVR 1JWAB 1PNTA 1UT8A 1Q0UA 2ZB8A 4WXPA 4F84A 5M29A 4BE9A 4GS5A 5CTAA 3NWPA 2AUTA 2YV4A 5C5IA 2KB0A 3C8DA 3E5MA 3B8EA 3B82A 4K5QA 4U0KA 2P9BA 1MENA 2P78A 2XCOA 4LK3A 4YJKA 3WRWA 3ZQ4A 1NTOA 1PYGA 3BYZA 3OLWA 4EW3A 3DFFA 1I24A 1VM6A 1ZJZA 2ZWAA 3PGVA 2ZGVA 1WKVA 3KYDA 2BEKA 2NXJA 4FQ7A 4K28A 1IHXA 4TZ6A 4B76A 4GMDA 4XYMA 1OMOA 2O6LA 5IS2A 1E1YA 2EBHX 1LPOA 3OX1A 2IF2A 4YUVA 3W90A 3EMBA 4HB4A 5G4LA 1E3MA 4NRDA 1BA3A 2CD7A 4D9FA 2FN8A 4M54A 3DJYA 4B3TB 3HACA 1T8TA 2BCEA 2R9VA 2CJYA 1PD0A 1XJQA 2QMYA 3X1DA 4IDCA 1PTKA 1JR3E 2Q9AA 2VWGA 2HLPA 3HCRA 2WSLA 1SD2A 1I7NA 1C3LA 3B9QA 5ALOA 1WUTA 5JQGF 4LG1A 4RM2A 5GVRA 2VHTA 3W8EA 4LYEA 1SMKA 1GUYA 1ATIA 2D2FA 2JAWA 4M0MA 3WFJA 1XD9A 3TFWA 1Y34E 3LFTA 3W6PA 3S8YA 3ZW7A 4C1NA 2PH1A 4GZLA 1A5ZA 1RI1A 1FTSA 1U2PA 2II6A 2LWIA 3WDMA 3KB8A 4J3FA 1PSZA 3C3XA 1AGRA 3EIHA 1TW2A 4YP9A 4O4HF 3GRFA 4B6JA 1K97A 1NYQA 5F2OA 1FLVA 5ALDA 3T3DA 1DWOA 4XM1A 2LIVA 5LZ7A 3ZS8A 1ULHA 4K40A 4ESVA 1V3TA 2ZYWX 3O4IA 1SZJG 1JIIA 1K88A 4NBLA 1DX6A 3IOCA 4MYUA 1YJ8A 1WXDA 3DD5A 1RXEA 5KWEA 9LDTA 4BP8A 5KTNA 2GYYA 4MW9A 3HQ4O 3SS7X 1R8XA 3HTXA 2JHGA 4UAGA 3S81A 1K3TA 4OB7A 1CFJA 1LQUA 1ZC3A 3OMWA 5BN3B 2ECFA 4GXQA 1YQEA 1Z2PX 1IN5A 3T3GA 3TVTA 5K01A 1JI3A 1R6XA 2QW1A 3TJMA 4TUYA 3EQ9A 3HNPA 2JFGA 3MGCA 2ZW9A 4GE0A 1Z4OA 4PAOA 4P3OA 2OD9A 4YV0A 3AOEC 2IXEA 3DUFA 3IDFA 5DTQA 5ALTA 1TPZA 3SDBA 3RM3A 3TZHA 3IUJA 1RHJA 4X20B 3GRRA 4CI0B 2BVNA 4BWVA 3JALA 3L6EA 1K5HA 3OMXA 2FDCA 2WSSA 3UH1A 1KKMA 5EQDA 1KEKA 2JIRA 3KC2A 2IY9A 4Q02A 2ZIAA 4DV5B 1TM4E 3LPNA 2FXVA 3U7RA 3LC1O 3RYCA 5CLLA 1QP7A 4XWWA 3TTWA 1RAAA 2BRUC 3NM4A 4YWHA 5WRFA 1IHUA 2AMJA 1R66A 4P86A 4EHAA 4MVJG 2ZQZA 2D2EA 2GEBA 1ZAKA 3V6LA 3WYDA 3U2QA 4EOGA 2PRJA 3C24A 1C1DA 3KV3O 5K4HA 4E3WA 5DU2A 2IHUA 4AMZA 1OZFA 3OZSA 3C14C 1TU4A 3CFYA 3Q12A 4R16A 4Z51A 4OBEA 3RYTC 4KPUB 5KWSA 5JQGA 5AK4A 1DKQA 2QVGA 3NNSA 3QX8A 5ED0A 2VUSA 1E6WA 1NW8A 4N0DA 3PEYA 5C1OA 1DCKA 4MIKA 3RI3A 3VR4A 3FBTA 4P2GA 4AULA 3AKDA 1Q6YA 2R5WA 1JIQA 1U81A 5JU6A 2OG1A 2OQVA 4CKWB 3WMEA 3JR7A 2YY6A 2OG2A 4ZVMA 4BX9A 1CQJB 3QBEA 1LFDB 1U8TA 2P6NA 2QROA 4U2GA 3ASUA 4XEHA 4D2IA 5JNUA 4B3GA 4DQLA 1N92A 5BSRA 4YRIA 1L7BA 3N2GB 2FPPB 1C3VA 1SVSA 4TX1A 1EZ1A 3D6VA 1ZR4A 3PWSA 3A05A 1BE8A 1NKSA 4KO1S 1M1YE 4QTZA 4FS8A 1PD1A 4F4HA 1DC3A 4Z99A 1T1RA 2PX8A 5KKCA 4BFVA 3FCCA 1TQ4A 4QYIB 1C7ZA 1EB9A 4Z53A 5AKLA 1B2LA 1RWWA 1FJHA 1WXWA 3NTQA 4GAEA 3HDVA 1F5SA 3HBFA 1E1QA 2PZEA 2ZIFA 4E0BA 3EISA 4OLFA 4ZDKA 3ADDA 1P44A 1RKQA 3N2KB 3TVYA 5D5QA 1EINA 2GETA 5AW8A 2J09A 1NDQA 3GHYA 4MRPA 4XYLA 3AX6A 2BBOA 2V1XA 3EXG2 3R6TA 4F3RA 2B4AA 3TGPA 2CYAA 2WJ6A 1O6CA 3QMMA 1G5PA 1CRLA 1ESMA 1YBHA 1BNCA 1YVEI 3BB1A 3FZYA 3H0CA 2Y0BA 3U4IA 4X63A 2W9XA 3BKXA 2P3QA 5J1SB 2UXBB 1W0JA 2RGAA 3FJ1A 3ADCA 4GPAA 4EYQA 4U6NA 3RC7A 3I6YA 1II9A 5I9TA 2J3LA 2QG9A 1P4SA 4K8OA 5KNDD 4RDXA 1P2TA 1IUNA 1KYQA 1OI7A 1YMUA 4UEJA 1QVRA 4S1WA 4Z0TA 2WHQA 1VLLA 3TCXB 4A0GA 3U3RA 1ETUA 3WGMA 5AM2A 5EHXA 4MVWA 1H42A 5E4FA 1SCUB 3CBQA 4R05A 3P7MA 3VR2A 3DZDA 4O33A 4RMIA 2GEUA 3VR5A 1CSEE 1WUKS 4WCFC 3HGTA 4YO7A 4EECA 4CMGA 3D6FA 4G0ZA 3FVVA 3ZYZA 1G0OA 3E9MA 3PXXA 4JMLA 3R8XA 3V3TA 4ZWNA 1O96A 2QR5A 3BTVA 3DB2A 1QBKC 1L5GB 1NV8A 4UM5A 4UNRA 4C29A 1WMAA 2GZMA 5TLSA 2I62A 2R8EA 4X8HA 2WJ3A 3F6YA 1QAQA 2BZGA 4MVJH 1O94C 3GA5A 4MQ6A 5BR7A 2MYNA 3R76A 2HRQA 4DUPA 3VPGA 2I67A 3G59A 3N2ZB 3OUTA 1E6KA 1MA0A 5SZKB 3AJDA 1EFUA 2Q6LA 4R71A 3PD1A 1MHTA 3KZKA 2FRDC 4BNDB 4QBTA 2JG3A 5KNCD 3LWBA 5ERGB 3OE1A 2RB5A 4KN8A 2UZ3A 5AKJA 3REQA 4UUPA 4Z3OA 1YGPA 3WNZA 1XHEA 3ZZUA 1NNSA 4FMCB 1T35A 4H3SA 1W1UA 1KXZA 3ENVA 3G2MA 3ZEAA 1E9CA 3HB7A 4MDEA 3H16A 2VRCD 1NVKA 4N0EA 1QGUB 2JLYA 3BJZA 1IRXA 1CJVC 2QA5A 1JHOA 4TTJA 2ZBUA 4BLQA 1UMDA 2BGUA 1U9JA 1J22A 4DMHA 5DV9A 2YV1A 5AUQA 1M6YA 3QK7A 1Y5LA 4XD7D 2GN2A 2RFLA 3D0OA 3JRXA 4MQEB 3MYYA 3BMQA 1KBZA 1DOZA 1KI3A 3DT6A 3D31A 2HQRA 3KFXA 4HWOA 2LCQA 9LDBA 3K0AB 2OXEA 1RQPA 2FW7A 4UBKA 4MVJD 5BYBA 3THSA 4NZPA 3ZK9A 1X94A 1JNYA 1JKJA 1HC7A 2JJ1A 2QAGA 3KE8A 4KX3A 2M98A 1EFPB 4OMFG 5LZ8A 4Q1CA 2A86A 4JAVC 1SVMA 1E4VA 2FFJA 3T1HB 5AK0A 1IEQA 1N2EA 2DPMA 1CWUA 1HT1E 2V7BA 3D8BA 5HBRA 3IIIA 2YNMD 3N0WA 2WFAA 2FWBA 2C20A 3DZ8A 2NXEA 4ZN6A 3LLUA 2O2CA 1LFAA 1S2DA 1EJ6A 2K4MA 2WUGA 2UV8A 4HYYA 4JBGA 1SQGA 4Y1RB 5HEKA 3YASA 2KLHA 3AVWA 1ORRA 3E03A 1ZOSA 3E8MA 3DONA 1VJ5A 5HRAA 1B0AA 3FOAA 3L4EA 2C7GA 4EX7A 4NKRA 5C8DA 3WZLA 3PTLA 2MMCA 1XK6A 3RIYA 4G1EB 1E58A 4K1LA 3CJQA 2IUYA 5KQSA 5TQ2A 1B42A 2C98A 3O9VA 1KMIY 3SS8A 1R0LA 2XA1A 5TARA 4LYJA 1G64A 3IV6A 4B44A 4ALLA 1DE0A 2G8NA 2IE8A 3AG5A 4MUMA 4YMWA 3AR7A 5E3JA 4AICA 4M86A 5I9MA 4QM7A 1SFRA 3ZJ5A 1B76A 2G08A 4IV8A 3VV3A 2ZSFA 4TV9F 5C32A 4KV9A 3RG8A 2X76A 1QVZA 1UKZA 4RHTA 4ES6A 4ZYZA 4BGEA 3H9CA 1JBEA 1VBMA 5IULC 4AJHA 3U0VA 4MHTA 1QONA 1S89A 1ZISA 3DV0B 3HU1A 3BHNA 3UYKA 4BYMA 1M1YA 1TJNA 3ZZ1A 3WKDA 4CKYA 4N5NA 1JXMA 4QPCA 3A2KA 3ICQB 3DDNA 2H0AA 4ENUA 4GI5A 2H4YA 4XCVA 1T4BA 4YCDA 3HJNA 3LT2A 1KS2A 3NV9A 1J1IA 2DU8A 4YP0A 3WRXA 1CY2A 4QVGA 4DN6A 3Q8LA 1NMXA 1SHTX 4NICA 3W7VA 2GEVA 3MAAC 1T9AA 4G5FA 4C1BA 5BP7A 2JRCA 4ZC1A 3MMPA 4MRNA 3USZA 4PWZA 2H5IA 3GHHA 1GZ7A 4GXNA 4E03A 3DBHB 4M49A 4Z5XA 3DXXA 2A84A 3FVQA 3P0FA 1J8MF 3L8MA 4AF7A 3EG9A 4CQJA 2E2WA 2FK8A 3SC4A 2PD6A 1JR3D 4Q05A 4CL8A 4BKQA 4INPA 2O50A 2XX3A 1HGXA 3SHQA 2P4EA 2Z57A 1EFRA 1G8GA 2GNOA 5CXQA 4V1CI 4BVKA 5D1HA 4LV5B 3ETHA 3H2YA 1R0BA 3RCBA 2G9ZA 3HVRA 2DQKA 2R4QA 1Y4DE 1TMGE 2CNOA 2W6IA 3WBJA 4YCCA 1BFKA 1FA9A 1WB6A 1WZUA 2I4RA 4CDRA 3MZ0A 3UWMA 1P6UA 2GT1A 3NDJA 1SKYB 3HJAA 3G0DA 1W88B 3HCEA 1QZTA 1IIRA 4S04A 2JJ8A 2VP0A 2ODNA 4R3WA 5EZSA 1LZLA 4P3XA 4DCJA 4YUAA 2A1IA 1MRSA 1ZUNA 4RH0A 4D5GA 1LPAB 5LN1A 2D1RA 5TV2A 2V9CA 3WB2A 1X2EA 2VWPA 3ELBA 4MP8A 3P9IA 3NANA 3WLPA 4B6QA 3HA5A 3GP5A 3OPYI 5TY0A 5AW5A 1CX9B 1L4KA 3CZCA 3NOOA 4WACA 5DTJA 4DM7A 4W5TA 1OU4A 2Q1YA 4UOQA 2Q7DA 3SQXA 1SU6A 3CHYA 2O5VA 1YUNA 2JAHA 1KYIA 4MX8A 3ILYA 1WCWA 3V55A 4YYZA 3BXEA 4KPYA 1V11B 4XLTA 1EM6A 3RHFA 1I7PA 3TTYA 4BRZA 5B36A 1DCTA 2GTHA 3T5BA 5AW4A 2OO5A 3E4DA 4FOLA 1P8AA 4L08A 3HLKA 4F46A 3LC7O 1E3WA 2DPGA 3DJFA 2EKLA 2ZCUA 2PJRA 1AS2A 1YXMA 2V97A 3GFFA 4GPBA 3DMDA 4L0MA 1M2OA 1DEOA 1CRWG 2WJJA 2I4OA 3AL3A 4HQ6A 3VZDA 1WZCA 1HKHA 2ZRQA 2C3MA 1A8HA 2AA3A 2WLSA 3CF6R 1ODCA 3FCUB 4B79A 3PWKA 3CW9A 3RSFA 3V1TC 3W5IA 1FP4B 1OC2A 1X1BA 3UIEA 3ZW8A 1EI9A 1U8AA 3AUSA 4OX9B 1YC5A 1O89A 2A9PA 2H08A 1ENPA 3BWCA 4UMVA 2XNJA 3BHJA 5DK4A 5B4UA 1MAHA 3E48A 1EUZA 1F8GA 2LV8A 1JYEA 4W63A 2JCGA 3GRPA 1Z83A 3EZ6A 1TAQA 4J76A 1V43A 2Z9BA 2GZRA 3ZWBA 1ZU5A 1WPRA 1UAAA 5AVOA 3B6MA 3CPJB 1MO6A 1UADA 4MDYA 1Z15A 2C9CA 2RHGB 2D5AA 3GB9A 4DDTA 3TB4A 1Q50A 1YONA 2IEDA 2QI9F 4PFSA 1OA1A 3G9XA 4QFCA 1TKRA 4AJIA 4ZHQA 4G6ZA 4BO3A 5EIXA 4EGCB 1W34A 4M88A 1L5KA 1R4AA 2E4XA 4XX0A 2CVFA 2OHJA 2TS1A 1PU2A 3EYWA 5KMGA 2FPLA 1TK2A 1U7TA 2HA7A 1I2BA 3S1AA 3F6EX 2XF2A 5A9SA 3B3JA 2Q2QA 2DJIA 3GLIA 1JSLA 2B1GA 2O8CB 1XSEA 1FYEA 3A6ZA 3A6JA 3VO2A 2FEKA 3CM0A 4BFTA 3OA2A 1KRHA 3ZHQA 3BZBA 4KB5A 2X4DA 4BS9A 3H2GA 4UEOA 1BXGA 4FFNA 4OL0A 1FFWA 2PLRA 5JNTA 5T8KA 5LU8A 1THGA 2GPBA 3NHBA 4OK5A 3AHCA 3U7GA 5LDDC 4YCAA 4Z0PA 3O3NB 2QQEA 1JHVA 3HDTA 5EKXA 4D45A 2RGDA 2TSYB 2FN7A 3EBLA 3LQ2A 4AMYA 3FWNA 3L7KA 4AP9A 3GDHA 3KEMA 1WW3A 1WHTA 4G5QA 4KIWA 3TECE 1LWOA 2NU6B 1PTJA 2WUFA 2ZR7A 3KJGA 4I4TF 1ZICA 4A0RA 1UWLA 1U6KA 3PGA1 3TCKA 1UBSB 1Z3IX 4LGMA 4I5IA 4WEQA 1L4BA 3Q2OA 3PKZA 4CPDA 5L4LA 3AKYA 3W6ZA 1ZQ9A 2EJWA 4RJIA 4W9NA 4RKWA 3VMMA 1K6XA 1TF5A 3O83A 4CUZA 2OAGA 2GZAA 2I3AA 1H05A 4GF5A 5DYGA 2DBVO 3CONA 4N3BA 4RY0A 4UCFA 4PO1A 5JCOC 2XYPA 1CQIA 4H4EA 1R15A 4F9FA 2ZTLA 2HSJA 2QD5A 2XUHA 3CRVA 5L3ZA 2JGDB 4E5KA 2IVFA 3ISTA 5H3CA 4EYGA 2J7PD 4IX1A 2PGNA 2HBRA 4FMPA 4MPDA 1ZGGA 5L3SA 3K1JA 1V7PC 4U00A 1W73A 1QJCA 3A9WA 2E82A 4UFPA 1TJ3A 3CR8A 2VF2A 5I7HA 1KQPA 1UOPA 1WHSB 2MWMA 3G1TA 2VIIA 1KJQA 3K05A 4LVOA 5C80A 4G0UA 2FMXA 4NEHB 4N5MA 1TVKB 5EP1A 2IYNA 1QUEA 5ALPA 2AYXA 1Z0SA 1GHTA 2HV8A 1OUMA 3RSQA 3NP7A 1B14A 1JHXA 4QBGB 4XJVA 1J33A 4B9EA 4RANA 5BR8B 5EZ6B 3BMNA 4XIYA 1U2EA 2QZSA 1G2IA 1QWSA 3EDYA 3IA2A 4WLUA 3RT9A 1LNZA 3ZIUA 4EFDA 5K8TA 1ZJWA 3RV3A 3WOVA 1Q5PA 3FPCA 3ZDAA 2YHSA 3KO8A 1VSTA 2QIPA 3H87A 4TQGA 3PBKA 1SKAA 3NC4A 5KNBA 2TYSB 1N8TA 1LTKA 2JFXA 5M34A 3ICPA 2R65A 4J7CA 1L7VC 2FF5A 4Y0VA 3ZZNA 4A73A 2WIJA 5FCDA 1NBAA 4GMKA 5EIFA 2Q5LA 1CQPA 3DM9B 1RIIA 3UTDA 1GSOA 3ZDBA 2I80A 4QUEA 2YWXA 4UM8B 3WK8A 1RHKA 2GTPA 4Z4EA 1RXVA 2JGAA 4M9QA 3BTUA 4OU4A 3GJ5A 4MS3B 4TLEA 4Q5IA 4LBZA 3QJ5A 1JFSA 2AJBA 1NIPA 2A5DA 8ATCA 1OI4A 4NYJR 1G1MA 1X1SA 4UQPA 1DBWA 2XH8A 1QIMA 1WX1A 4I1YA 3ZD9A 2QOEA 4TMZA 5FBQB 5IXJA 3P9XA 1ADGA 1JFFB 2P40A 4QWMA 3P0RA 5GWXA 3O9ZA 1N2CE 4RSHA 3LRPA 1H6BA 5ECWA 4C03A 1PGPA 1OWMA 3FPGA 4NS1A 3VYRB 1EGQA 1WJGA 2OILA 1JLKA 5HZGA 2Q46A 1TXGA 1Z07A 3VFDA 2MSKA 3EBPA 4BJ3A 3CO5A 1JV2B 4PGAA 1P19A 4R9UC 2H2WA 3T1OA 3NQ41 2R47A 4U5XA 4MK4A 5EQTA 5I8ZA 1TX4B 1JWLA 4RAOA 4ZO4A 4OHCA 2WA2A 3DO6A 2VQDA 4DJAA 2CK3D 2GA8A 4NBSA 3VR6D 2ZRNA 4GLLA 2HF8A 4KO2S 3TLGB 3D5TA 2RE8A 5CCBA 3H8VA 1F2TB 2HQSA 3ROZA 1U2GA 4FHFA 2JCYA 3ZNQA 1XQ6A 2OBMA 2YXDA 3BMNB 3QVSA 1YFLA 4ZEVA 1GVHA 3MCUA 4J7XA 1N5IA 1W8IA 1TZBA 2QENA 3FBGA 5JO9A 4L85A 2OYRA 3ZDZB 4EL5A 5DLPA 4OXKA 1BD4A 4O4LB 5IT5A 4P0QB 4P98A 1QH9A 1I1QB 4MH0R 3PHIA 4B8WA 4D6PA 5IN4A 2JGJA 4X9XA 5G53C 1YRYE 2UZ1B 1YVPA 3ZEIA 4TOIA 3OE5A 2G4VA 1Z9BA 5BSFA 1JR6A 4PS1A 4CM8A 2O8DA 3O4RA 1KZYC 2DM6A 4OQPA 5U9CA 2AUNA 2A9RA 2JAQA 3AQ4A 2OWEA 3D8UA 1OHHA 2J41A 4IHKA 1USUA 4NV1A 4QOFA 4TMVA 5AVUA 5M04A 2Y9MB 1WULS 3CZPA 1XZLA 1UMCA 3LP6A 1XTKA 4RPHA 3H2BA 2AX3A 3O84A 1A4RA 3RUEA 2WD8A 5EWMA 1P45A 4RZSA 1G60A 5THKA 1BW9B 5KU1A 3LBNA 3H0KA 3WY9A 4V38A 3AI1A 3VSCA 2ZKLA 4G5SA 1DG1G 1V41E 1Z74A 4MMXB 5CRIA 3SN6A 3D3QA 1L5NA 3JWIA 1Z6AA 2VAWA 4QTXA 3WJAA 2AZMA 3FTQA 5KX5A 1GG2A 1HETA 3EPLA 3FUVA 3LPLA 1PV1A 2C84A 2PGJA 3OM0A 4MR7B 4JP8A 3UJNA 4L0QA 3OLQA 3K0KA 3THXB 4PSKA 3SX0A 4ESHA 2VP9A 4JP2A 3VAZA 1IJEA 1DO8A 5E0OA 3STTA 4WOBA 5ITSA 2HBZA 1W4BA 2PGDA 2WWYA 2WMOB 2XDQB 3OZAA 5FAKA 1QX4A 1ZOPA 4MO2A 4FIZA 2FPWA 5EWLB 4DR3B 2EFEB 3NUQA 2CYBA 4C3ZA 2SHKA 4H59A 5KSPA 1SB8A 3ZBUA 1EG7A 2DR3A 1X7XB 3LLCA 3BF7A 4Q9IA 1C3OA 4N40A 5DBIA 3C70A 3SQMA 3VVLA 3GNLA 1QR2A 1RHMA 5HCNA 1SG9A 3AL0C 5DXJA 3R3ZA 1DT3A 1VSBA 3CE6A 3MGKA 1N1EA 3OJEA 5BSWA 5KHAA 2FEOA 5DWVA 2B0JA 1KQFA 4XPZA 1BVHA 3OCZA 3L7BA 4NC9A 1HO3A 4K2HA 1DEKA 1T4DA 3C1TA 1KDPA 3Q72A 3ZWWA 1FJXA 4LJ7A 3C3CA 4IH9A 4KE7A 5JAHA 3EEYA 2HWYA 2UVQA 4K6FA 4N3AA 3FDZA 5LQNA 1S2IA 4IHQA 1B0UA 3HG7A 4WRRA 1Y1TA 1RAEA 2IYSA 3VTKA 2YY7A 5CG2A 3F1LA 2VYNA 2ZT8A 5JANA 3G2NA 2FN9A 1ENZA 1FFXB 2C9MA 3A6HA 4IIJF 4F6LA 2YIMA 3QOYA 1FJ2A 4RK5A 3U4CA 1EWVA 3EGCA 1ZG3A 4YIHA 4RV4A 2JFPA 1FB5A 4F8JA 1DOAA 3AV3A 1OKKA 5JAQA 2Z5GA 2Q9CA 4Q7MB 4MAFA 5JMPA 3RFVA 4E15A 3DYVA 1N0UA 3ETLA 1CJSA 3ZV3A 3P1JA 2QGNA 1EUCA 5FHQA 1TMKA 1R1DA 1SUPA 1QANA 1IAQA 1NF8A 4I1UA 2ZE5A 4DARA 3FMOB 4KXUA 4A8JC 4P4GA 2VRBA 3ORSA 3L8GA 4RE5A 3EAFA 4XSVA 1QLHA 1IWOA 3DBRB 1NLUA 4N1AA 3HVUA 3V32A 5IK2D 5JZ9A 4DNFA 2NUPA 4EMBA 4O2BF 3LT1A 4FE7A 3WSTA 4RMGA 2C9ZA 2GASA 4ENPA 3JXEA 3PRKE 1M2OB 4IFTA 1R4NA 2H7XA 5E1BA 1N8SA 5FLYA 1QKKA 5KNDH 1YIDA 4DQXA 2B82A 2GAOA 3GPCA 3RUCA