1I30A

E. coli enoyl reductase +nad+sb385826
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
256
structure length
248
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitors of bacterial enoyl acyl carrier protein reductase (FabI): 2,9-disubstituted 1,2,3,4-tetrahydropyrido[3,4-b]indoles as potential antibacterial agents.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
total genus 89
structure length 248
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2001-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i30A00
5TX7A 3PQFA 3STHA 4YB8A 1YVEI 2IZZA 3ETGA 1PJQA 4KUEA 4L73A 1PQUA 4IMPA 1ISFA 4BMSA 4OH1A 3WGHA 4FOSA 2IE0A 3GEMA 4QECA 3D3WB 2NU9A 4OL9A 4FFMA 2Y05A 3D5TA 4TVOA 4XX0A 4PLGA 4IMRA 4WOKA 2HMUA 1FDUA 1T2FA 4WGGA 7MDHA 1T25A 4DGSA 1ZK4A 4OQYA 1W4ZA 3S2IA 2CZCA 4IJVA 1HYGA 3IL2A 1YJ8A 4P4GA 3EW7A 1ADFA 4RVHA 1HE4A 1PTJA 3GGOA 3SJ7A 4BGUA 2JKVA 1ENPA 3BHIA 5EQFA 1LLQA 5GZ3A 2OBYA 4AJ2A 2W8ZA 4MDHA 4WLFA 1HZZA 4L4XA 1HEUA 1PIWA 2GN6A 2HO5A 5TT1A 3ZN2A 3L9WA 1BW9B 3PJGA 5JE8A 3E9MA 3JQFC 4PVDA 3GVCA 3INTA 3GG9A 4NDNE 4WEQA 3PHGA 2I3GA 4CV0A 2VWHA 2C07A 1GAEO 3UN1A 3A9WA 1T4BA 5DBFA 2H9IA 3PPIA 5I7EA 1E1KA 2ZYDA 2OORA 4MVJH 1QV7A 4BO3A 1BSVA 4FDAA 2YHUA 4IDDA 2WWRA 3GRKA 4JJIA 1ENYA 3GGPA 1A9ZA 1EFKA 2JJYA 3QA9A 5JAQA 2WM3A 4XJTA 1LLUA 1SAYA 5FFFA 4NPCA 4RDHA 4WUVA 3WR5A 4CMIB 5C3MA 1QLJA 1V35A 5COBA 4U0KA 4O0LA 4WLOA 1UZMA 3JSAA 1EVIA 4MJLA 2NM0A 5JY6A 4E33A 2Y99A 3GK3A 5TF4A 4GKBA 2DC1A 3I3OA 5EINA 4PLYA 4DLLA 1QLHA 4INAA 4R1SA 4FFRA 3ASUA 5L7WA 4R9RA 3DBLB 5JAZA 4FFOA 1A27A 4GSKA 1LLDA 4BNWA 3NX4A 1SEVA 1E7RA 1HZJA 3VH3A 4DQUA 3PHIA 4MKZA 2NQ8A 2HCTA 4HUJA 5DOVA 3OM9A 4C4OA 2X1HA 1GU7A 2UVDA 4CM8B 3TFQA 4FC6A 4CUJA 3GZNA 3ANMA 2Y1CA 3N7UA 3NT5A 4KWIA 3GUCA 3K92A 1Y6JA 4L0QA 1KVRA 1MGOA 1J0XO 2DAPA 5CDGA 1ADGA 1NPTO 5KJFA 1ZH8A 4ZRNA 4YR9A 4TQGA 3Q9UA 4Q9NA 5JSFA 4N54A 3VDRA 1DHTA 2VRCD 1YB1A 1GV0A 5K6AA 1WVGA 4OAQA 4TSKA 3CTMA 2JCXA 1F8FA 2JD0A 1NHGA 3DBRA 1X13A 1EEHA 3CPSA 1NWHA 2GN9A 4J1NA 4CM8A 2AQHA 4I08A 2B0JA 1ZK2A 4DVJA 3KYDB 3ZV3A 3OEWA 1TI7A 2P4HX 1O95A 3HDYA 1R4MA 3DWFA 1QXSA 4PLZA 4GLLA 1PWZA 3FR7A 3DBLA 1G6KA 4ZRMA 4NU5A 2VOEA 2VYVA 1DIBA 1EMDA 5U9CA 3U9LA 3TWOA 2VHYA 2B4TO 2H63A 1YL5A 4BO5A 1U1IA 3ANLA 2IYPA 1D7OA 1XGKA 2P5YA 1F12A 2YV1A 3ETEA 1HE3A 2AA3A 3MJEA 1BVRA 2W2KB 4IS3A 4O1MA 4XCVA 4XGKA 4R1TA 4YVFA 3UW3A 1HKUA 3IOYA 4BNTA 2VHWA 4FS3A 3TOZA 4XGNA 3QWBA 3ZW9A 5KTKA 1VKOA 3ZH2A 3M2PA 2VZ0A 2ET6A 2BLLA 3K8ZA 2AE1A 1MLDA 1GTMA 4Z6KA 1OFGA 3KUXA 2VWQA 2GLXA 1H9AA 1HDOA 1UAYA 2VQ3A 2C7VA 2HU2A 4IBOA 4TZKA 2AEJA 2HMSA 3QHAA 3NT2A 2D1YA 3RSHA 4EJMA 5JAIA 1KBZA 1YQGA 3G3EA 4WLVA 1NQTA 4NK4A 4NFHA 3WMWA 3ZV5A 4RV9A 2PWZA 1A7AA 4UVIA 4KZPA 4LVUA 3JQAB 4ZHSA 4CM5A 1YH3A 3U4HA 2NV6A 1SO8A 4UUNA 4P4NA 5L95A 4NI5A 5AXCA 2OL4A 3GLQA 2JD2A 2O3SA 4XIYA 3GVIA 1IY8A 3OSUA 3KSDO 3H2SA 4CMEC 5TQVA 1LRJA 4NR0A 4QUKA 1HE5A 5T64A 2Y0CA 1IHYA 3UFXA 3DHYA 5F5NA 4TKLA 1DB3A 2ZYAA 4AJ1A 3RC7A 2EWMA 4CQLA 1LSOA 4MVJD 1A71A 3PXXA 3QJ5A 2PKRA 5BNFA 5L4SA 3HG7A 1RYEA 1SZJG 1KVQA 2WE7A 3L4BC 2QG4A 2J3IA 4I5EA 1Y8QA 1CETA 2V6FA 2GRAA 4RDIA 1LDMA 2J8ZA 1U7TA 5H82A 3ZWCA 4PLTA 1YOVA 5DOZA 5T8KA 2DPHA 1LBEA 5ER6A 1XG5A 4Y6RA 1U2DA 5JY1A 5JDIA 5KJ6A 3NTRA 1Y5MA 1M75A 3COSA 1FDWA 3DZBA 1UXHA 5A03A 4M54A 2VHVA 4PGFA 4AJEA 3BXXA 5B4TA 2I65A 3ZWWA 1X15A 1YWGO 4PLWA 1SB8A 2HSDA 5I9MA 3Q2KA 2C7GA 1XA0A 1EUCA 4K26A 1AXEA 1E92A 4YA6A 3RIHA 3VOSA 4BVAA 1FXSA 4CM4A 4W7HA 3OIGA 3WDSA 3RBVA 4L4RA 1H6CA 2Y1FA 3JV7A 4N7RA 3ZU4A 4P38A 5IDYA 3DTTA 2B69A 2C2XA 4J7XA 3PEFA 3W4JA 3QSGA 3QWHA 1ZK0A 4RPHA 4E5NA 5A04A 5I7SA 1L7EA 1QRRA 1Z7EA 3LC7O 4YQZA 2NU8A 4J2HA 3MJTA 1DFHA 1ULUA 4ND5A 1BDMA 1TA4A 3G0OA 3LU1A 3WGYA 5L4LA 1MG0A 1X7HA 4BMVA 4RJTA 4M87A 3E1KA 1E3WA 4BO0A 3KEQA 3JQ8A 3AU9A 4ONEA 4BGEA 1VPDA 1LTHR 4AVYA 4E0BA 3KYBA 2QQ5A 3PFWO 4IJKA 4NFSA 3AU8A 3MJVA 5EERA 1P1IA 1WAMA 3DHEA 3RAJA 2D5AA 3PK0A 2JFGA 2WE8A 3INGA 4P8RA 3DZJA 1QR6A 2EF1A 1OAAA 2VNAA 3JQ9A 1B26A 3IUSA 4I5DA 4UUMA 4B8WA 1DXYA 3H5AA 4GMGA 4I5GA 4JLWA 4HV4A 2EKPA 4MIOA 3SLKA 2WMDA 4L9RA 3L4SO 3M1AA 4RQTA 3S2GA 3GFBA 3Q11A 3QVWA 1P1JA 1LU9A 3NJ8A 3PIDA 2Q2VA 1E7SA 2J5RA 4IDBA 1KY5A 2A94A 2OFPA 2Y68A 4JK3A 1H2HA 3DAGA 3TZ6A 1VI2A 1M6WA 5KCZA 5L45A 1KOLA 1VLLA 2G0TA 5T8KC 1R0SA 3K73O 4YJFB 4Z9FA 4N5MA 4DQVA 3IKVA 3MEQA 3OQ6A 2YDXA 1EK5A 1BXKA 1PS9A 3JD2A 3JQ6A 1U8XX 2B4QA 1I33A 5CEEA 1PJ2A 3FTNA 5L7TA 4RF3A 3WQSB 1MFZA 1JW9B 3EZLA 1XEAA 4YJGA 2AE2A 4ALLA 1P1FA 1HSOA 3D3WA 4J16A 3HE3A 3ZGYA 2WSBA 4J1TA 4PCVA 3H5RA 4JJFA 4EYEA 3OJ0A 5A1TA 9LDBA 5ILOA 4MKRA 1U9JA 4CM7A 1Z45A 5JMPA 4D79A 1QG6A 4AG3A 1E3IA 4WLUA 3WMXA 4IGEA 2AEFA 4IDAA 1Z7BA 4DLAA 4WCFC 4NJMA 2QZ9A 3IS3A 3P2YA 3ZDFA 5B4UA 2ZCUA 3OJFA 4M49A 5G0TA 4YXFA 5JMWA 1ZIDA 5K6AC 5JC8A 3NEPX 4G2NA 4WECA 3ADOA 3OHSX 3F3SA 4DC1A 4TVBA 4DBVO 4AJNA 5TLSA 2O50A 4R4JA 1HDXA 4CUKA 3KLPX 2ZTMA 1YGYA 1H93A 5COQA 1C3VA 3D64A 1QMGA 2CUKA 4Q3NA 2CVQA 2P9CA 1R6DA 1KIFA 3GR6A 5MGBA 3I52A 2O7QA 4FFLA 1DHRA 4FW8A 3JQBA 5FYDA 4IDFA 4JNKA 4B3JA 1CDOA 2EV9A 2I99A 2FPPA 3UCEA 2HK9A 3O26A 1YB4A 1LI4A 2IZ0A 1AHIA 3ULKA 4ALIA 4UVGA 4FFPA 5L53A 1T2EA 4NBRA 2HAEA 5CPBA 2OO5A 2ZKLA 2OZPA 1EVJA 2GASA 2VN8A 5I7VA 2QIOA 1WDLA 2IODA 5EESA 2VRCA 3C3XA 2GO1A 4IM7A 1OI7A 4E5YA 1XU7A 4IUYA 1IZ0A 4NJMB 4F6CA 5U1PA 3BTOA 3GF4A 3E9NA 3DB2A 3HN2A 4MP3A 5C37A 4QXMA 3HQ4O 4BKQA 5A9SA 1KY4A 1JKIA 3ROMA 1UXIA 1YS4A 4Y6PA 1YKFA 1RM3A 3HSKA 5DP1A 3R3JA 2HRBA 2VYND 1QP8A 2FZEA 2O23A 3I9JA 4MVJF 1LDBA 2O3QA 3PQDA 3HDJA 1P1KA 5DBGA 3RU7A 1BXGA 5F1OA 4Z0PA 3PVZA 4D0RA 1AXGA 1B3RA 4DBZA 2E37A 4D0SA 3K5PA 1DEHA 3CXRA 3D4OA 4QFDA 1O0SA 5JLAA 1R66A 3VVBA 1FDVA 3MJSA 1LSSA 3RUHA 1WWKA 4WPGA 4J2OA 1V3UA 1U3UA 1CQIA 3IIEA 4FC7A 4U6SA 2JCVA 3SX2A 3DBVO 3F1LA 4BO2A 1PWXA 3H3FA 4OXKA 4U0JA 3RC2A 4OXYA 2CNBA 1X1EA 3WSVA 5IN4A 3LF2A 4FBGA 3ZHBA 3FCOA 4YAIA 2IRWA 2ZB7A 2I67A 3FSRA 3GA0A 4S3MA 1SBYA 3RWBA 3KXDA 4UEKA 3QWFA 1PX0A 1MP0A 4OKIA 1LA2A 3PGXA 1UJMA 2VT2A 5A06A 3UXYA 4A7PA 1XQ1A 4G81A 3I9KA 5CHEA 4ZQBA 3W8FA 4PG7A 1EUZA 1UP7A 1VSVA 4E31A 2EIHA 2PR2A 5IZCA 1IPEA 1I3LA 1LNQA 2I3AA 1P3DA 1B8UA 5AXDA 3EK2A 4E2WA 4TKMA 2BGKA 1I3KA 2CSUA 1KETA 2BELA 3PYMA 1K5HA 3GUYA 4D3SA 1UH5A 4RGBA 4BNIA 1LRLA 3FRJA 5AXBA 2NU7A 3OF2A 5KWEA 4QO8A 1S6YA 1IPFA 3ZWNA 1PJ3A 4ZICA 5JDCA 3DBHA 4J1SA 1GUZA 1MA0A 4KP7A 3HHPA 5L40A 3DO5A 3FPCA 2Q1UA 3QVSA 3KTDA 4IZIA 4BNNA 1PZFA 4D44A 1HXHA 3LSYA 1YDWA 3E03A 2W4QA 3P5SA 1N1GA 2ZQZA 3NAQA 1EK6A 4DLBA 2HQ1A 3H9GA 4G65A 3KSUA 2X23A 4A5OA 4FD3A 3K2EA 1E7WA 1H6BA 3GZNB 1LXCA 4TRRA 2BD0A 3AI3A 3KBOA 3TPCA 5ES3A 2J3JA 1CQJA 3DONA 3QIVA 3DR3A 4CLRB 4DPLA 4XYLA 1H9BA 4J7CA 4BNKA 1WPQA 2B37A 3EY4A 1HE2A 4KTTE 1KVUA 1C1XB 3HADA 1HDRA 2C59A 2VUTA 1XU9A 2FPGA 2EP7A 4I8XA 5TS3A 2VYNA 3I9MA 4W4TA 2BH9A 2X5OA 5FI3A 5JXWA 3PHHA 3K6JA 4OGWA 1N7HA 3DZGA 1ENZA 3LK7A 4AJLA 4PG8A 1GQYA 1D8AA 1HLDA 4FPXA 4FSHA 4Z0HO 3PYLA 5AVOA 4J7UA 5IZ4A 2AW5A 1X0XA 3ADPA 4AICA 1S7CA 5AXAA 1E7YA 4WJZA 3OETA 4B7UA 4EW6A 3L0DA 4M89A 3ZU2A 4CMKA 2ZJ0A 2AQIA 2BKAA 2PLAA 4EITA 3F4BA 1PZGA 2Q1TA 4EZBA 4LRTB 4AJHA 4YAKA 1VKNA 1I2ZA 4RVGA 3ZWPA 4PFJA 5JBIA 4CLXA 3JD3A 2H6EA 4E2YA 2TMDA 4ND2A 3HDQA 4JROA 2AG8A 2RH4A 2QHXA 2YY7A 3BMQB 4RZIA 1GQ2A 3KSZO 4E3ZA 1KS9A 4AL4A 4E2XA 4CQMB 1V3TA 5JFOA 1KVTA 1JVSA 3PTZA 1YBVA 3AOEA 1WMAA 1D3AA 2HJRA 3ON5A 3JQAD 1YXMA 2IXBA 5FI5A 3AJRA 4RO0A 4DRYA 3L6DA 1K0UA 3PHJA 3A4VA 4JP2A 4JXKA 3WGTA 2ZJ1A 1PR3A 3GNSA 3GNQA 4PLCA 3VH2A 3IC5A 3GOHA 1ZK3A 3LC1O 4CL8A 3UOGA 5THKA 3O03A 4CLOA 3RKRA 1HRDA 1SEPA 1KC3A 3AWDA 5T6BA 3FNFA 4KQXA 3IKTA 4HNHA 1LQUA 4OSPA 1JWBB 3W8DA 4YTEA 1PL6A 4TMFA 3ZWVA 5DZSA 3RFTA 3WGQA 1GQQA 3C7CB 2V6MA 5ER9A 5IF3A 2BGLA 2O2SA 3JD0A 1NR7A 4IDGA 2W90A 4DMLA 4ALMA 1WMBA 4J9VA 5L51A 1M6HA 3DZKA 2A92A 3PJDA 1GEEA 3D3EA 5CDYA 4QFCA 1C1DA 1I5RA 3KZVA 4R9SA 3PZBA 1GEGA 1UXJA 1Y81A 2J3HA 1PZHA 4IQ0A 3TNLA 3B1FA 4WCFA 3TOXA 3FNEA 4XB1A 3VPXA 1LX6A 4YT5A 2ILTA 3PRJA 4GGPA 4A73A 8LDHA 4BKUA 4AJOA 1GYPA 4JBGA 3DFZA 3AFNA 4IINA 4AJ4A 3MWEB 4J4HA 4ND4A 4O59O 4GMFA 3O8QB 1NAIA 3VKUA 4XDZA 2AXQA 4J6FA 1DJQA 5DULA 1K89A 3OA2A 2Z95A 2VUSA 3A28A 4K1LA 4RZHA 2DTXA 1OOEA 3FTPA 4ZU3A 4JP3A 3ZW8A 1PL7A 4CLEA 4OMUA 5CP8A 5BNTA 4RL6A 2TMGA 5BR7A 1J5PA 1XLTA 2WYVA 2OP1A 1ZSNA 3AW9A 2Q3EA 1YRLA 1U7HA 3T4XA 4YAGA 4TROA 4Y98A 4CLDA 2Q1WA 4MVJM 1Z74A 2B83A 3KVOA 4R5MA 4R51A 4E13A 3S55A 1JAXA 3EVTA 1BGVA 5EN4A 3WS7A 1NQAO 3E82A 4GPD1 1Y7TA 5ADHA 3MTJA 1EZ4A 2EGGA 4ND3A 2W98A 3ITDA 1E6WA 4GH5A 5I9NA 3NUGA 3AI1A 4FIZA 4GX1A 2HMTA 3SBOA 4BNHA 3I4FA 2QZZA 4RLHA 3Q9NA 3JQ7A 2AHRA 5HS6A 2NVUB 1Q7CA 3OJOA 2FZWA 5JS6A 1PJBA 2FR0A 2YV3A 3CEAA 3U09A 3ZHXA 4AFNA 4DPKA 4ITUA 3W1VA 3NTOA 3TL2A 4RVFA 3V2GA 4XGIA 5KVQA 1QYVA 2R6JA 4PVCA 4RLSA 1LLCA 2P5UA 3H65A 3L6EA 1T1RA 3B6ZA 5G0WA 4EEXA 5IJZA 3AM4A 2CY0A 1PR9A 3PDUA 4IDCA 3PZRA 1EFLA 2XF8A 2Q50A 2ZCVA 2OP0A 1R0LA 3AI2A 1WNTA 3RC1A 3F1KA 4J91A 3W4KA 5IZCC 1CF2O 4CM6A 1O8CA 1Y8QB 5L9AA 1A5ZA 2BFAA 1XKQA 2UUOA 2ZTLA 4NFYA 1A7KA 2AEMA 4R54A 1RYDA 2E48A 4I5FA 1ZUD1 3VKVA 1ISGA 4MVJI 1AHHA 3Q3CA 4CL3A 4W82A 2B4RO 1Q1NA 1OC4A 1M2WA 2X7HA 3U5TA 1R4MB 4K6CA 1NFRA 2EJVA 1V3VA 4XDYA 4ALNA 1L1FA 3DZHA 2A9FA 4YWJA 3WBFA 4PG4A 3GN2A 3NDRA 4BNFA 1ISIA 2A35A 1ORRA 2JHGA 5CPFA 4HX5A 1UDBA 2YQ5A 3WFJA 2H5LA 3IQDB 4B3HA 2DBQA 2UYYA 3GG2A 4L8VA 2ZB3A 4W99A 3FF4A 2EG9A 4Y8VA 4PZEA 3VZQA 2EJWA 3I4CA 3X2EA 1ZSYA 3B1JA 4BS9A 3CZRA 3F46A 4R68A 1BDBA 1I01A 4CMBA 1ZJYA 1VJTA 4QO7A 4DUPA 4CLRA 1ISJA 3PDJA 3WFIA 2I5PO 4WNIA 4WKGA 1YJQA 3RFXA 5HM8A 1P0CA 3IJRA 4RCVA 5H83A 4OKNA 5L3ZA 1SB9A 2Y1EA 3JQGA 1ZO8A 1H5QA 4NBUA 3OFSA 1BRMA 3ITKA 4LMRA 4EUEA 4GVLA 3KV3O 3H2ZA 3H9QA 3QE3A 4N5LA 2GN4A 3V8BA 4JIGA 3GN1A 3TF5A 1I32A 2PZJA 2X6TA 2RHCA 4PRKA 2GPTA 1OC2A 1DJNA 3VVCA 4HP8A 4D3FA 1DDOA 3JYLA 2CDAA 3EUWA 4YT8A 5FWNA 1E3WB 4CV3A 4GI2A 2JFHA 3EHEA 4GGOA 1DAOA 2RCYA 4D43A 4YDRA 4CMGA 1CRWG 3GRPA 3LT0A 4BQPA 5ICMA 7ADHA 1B0AA 1XR3A 2GERA 3JQGB 3VZSA 3UCFA 3A1NA 2NLOA 3WX0A 2WYUA 5U4QA 1KC1A 4CPDA 4WK6A 1MC4A 4K9DA 4XR4A 4XWYA 4JBHA 3HUDA 1JA9A 1U28A 1Z82A 5TJHA 2Y66A 5CDSA 2DLDA 4NIMA 3FWNA 4HADA 3U4CA 2Q46A 4TWRA 1C1DB 4I9HA 1XHLA 2I6TA 1WZEA 3WNVA 5KJ1A 3DOOA 5I8WA 5JCJD 4J1QA 4ALKA 2I76A 3BIOA 5THQA 1NR1A 1N5DA 4RF4A 4LSWA 1PGJA 1JU9A 2XPCA 3QVTA 5JAMA 4BO9A 3C1AA 4LRSB 1Q7GA 1IULA 5EMHA 2JFFA 2ZK7A 4R3NA 4AJIA 4DPMA 4YACA 1TLTA 3MOIA 1E1NA 3WQRA 1B7GO 3IP1A 3H5NA 3R1IA 3GDGA 2HDHA 3I83A 1NFFA 1TT5B 4E5MA 4U6QA 1JVBA 3UGKA 3EZYA 4YBZA 3EVNA 3LLVA 3WIEA 3QV1A 3MTGA 4GWGA 2VTEA 1IZ9A 3GNTA 1YQXA 4RVUA 1SOVA 4UEOA 1XSEA 4PG5A 4WCFB 3ZWAA 4BL5A 2G1UA 4B4VA 3P19A 4CMJA 4U8GA 2UDPA 3JQCA 1JN0A 3GQVA 2DTEA 4J90A 6ADHA 3RU9A 3A06A 3B20A 3L07A 2PD4A 4E5PA 1YO6A 1SCUA 1LDGA 3WWYA 3KB6A 1W8DA 4DIOA 3PJEA 3WBBA 4LGVA 2DVMA 4J0FA 3JTMA 3V2UA 2E49A 3ZWMA 5IFLA 2JD1A 5MDHA 5F3RA 3ZCXA 3EMKA 1E0DA 3NGLA 4FJ2A 4XZ3A 5GY7A 1XQ6A 3ZV4A 1GDHA 4GWKA 5BSGA 3MOGA 3DEYX 3RUIA 5KKCA 1UXKA 2C54A 3E8XA 2ZTUA 5DCYA 3AOEC 1D4FA 3PGJA 4PN3A 3GFGA 3HJAA 1N1EA 4BO1A 1DRUA 2RAFA 1DO8A 5COAA 4Q3AA 4RPKA 2NADA 2NVBA 1LSUA 3C8MA 1C0KA 1ZSVA 1OZAA 2BI8A 5BSHA 3JCZA 3W4IA 4Q3EA 1MFPA 3FNGA 4FJ0A 3R0IA 2NQTA 1TB4A 1G0NA 4UAGA 2UV8A 3UVEA 1ML3A 2WDZA 4FGSA 1I2CA 1B15A 1CEQA 3TZHA 1V9LA 3ZHZA 3IAHA 4DC0A 5JNLA 2Y1GA 5JC1A 2X58A 2JL1A 2DFVA 5I8ZA 3O9ZA 1I24A 4UVDA 1MV8A 4PLPA 4BNGA 5A4DA 3ST7A 1R0KA 1CIVA 1Y8RA 1PSDA 2O3JA 1CWUA 1ISMA 4FOOA 2V7PA 4YQYA 2PGDA 5ENDA 2PZKA 3AOGA 1ZNQO 2PV7A 4DWVA 1XDWA 4DA9A 1KYQA 1PZEA 1MXHA 4YYZA 3IP3A 1E3LA 3BTSA 2X9NA 4MOWA 1B16A 2O7SA 2EP5A 1MUUA 1U5AA 3KYCB 3WYCA 1JQBA 1QSGA 3F5SA 4BKPA 2O4UX 3I23A 2P9EA 2VOJA 2YQ4A 2DTDA 3ZHYA 1F17A 3LVFO 3FHLA 1EE2A 4TRNA 3JQFA 3NT4A 1X0VA 1N92A 4MP6A 4XYGA 1NBOA 4FN4A 5EPOA 4DYDA 4PLHA 3RFVA 1E6UA 3DDNA 5G0VA 1J6UA 1ZJZA 2GSDA 2GD1O 1DFIA 2Q2QA 4GKVA 1ZEJA 1NNUA 1FF9A 3FBGA 3PI7A 4E5KA 4BGVA 4XRGA 2CVZA 2OXIA 4AJJA 1P9LA 3JYPA 1U4SA 4GVXA 4W6ZA 2O3RA 3KYCA 5A02A 3TN7A 3RVDA 2Q1SA 1N7GA 2DPGA 2G17A 2C0CA 1K6JA 4BO8A 1FDSA 1O89A 2A4KA 5G4KA 2HKIA 4EUFA 1LSJA 1IL0A 1XIVA 1IB6A 4NBTA 5CEFA 4W9NC 4Y9DA 5BT9A 3WTBA 2Q49A 4JQCA 1T2AA 1BW9A 2XXJA 3WNQA 3JQ8B 5TIIA 4YAJA 4XEHA 3GAFA 1LUAA 3RQSA 3PYXA 4KOAA 4CR6A 4NU6A 5ENVA 3OJLA 3OJEA 4Q3DA 2X22A 2DUUA 3RD5A 3DZFA 3WG9A 1PL8A 4Z0TA 3TFOA 3GVHA 1NVTA 4YRBA 1DRVA 3KO8A 1HDGO 4BHTA 1H0KA 2D0IA 2D2IA 4R5HA 5G0SA 4DYVA 1I10A 1ZMTA 4ZJUA 2CDBA 5BSFA 2VCYA 1YQDA 4JBIA 4DMMA 5A3JA 3PHLA 2P4QA 2Z1MA 4FJ1A 4CLHA 5KNLA 1PGQA 3D1LA 1KERA 4PLFA 1ZBQA 3LQFA 3F6YA 1O6ZA 2ZQYA 3PLNA 1ISHA 4PLVA 2ZTVA 4OJNA 5EQDA 5IDXA 2XOXA 2GGSA 1DBVO 2W2LD 1HYHA 1DAPA 1Q7BA 5IDWA 1H2BA 1O9BA 1HSZA 4O5OA 4GLOA 3TZCA 2G5CA 3OQBA 3QRWA 1ID1A 1AN9A 1GFSA 1VL6A 2ZB8A 1WLYA 3TZKA 5A5FA 4Q3CA 4GX0A 3CINA 3FD8A 4K6FA 3BTVA 4J4BA 3JQ9C 3ROKA 2I66A 4RPJA 2VHXA 1BXGB 1E7MA 1WZIA 3MJCA 3SXPA 1ARZA 2QRKA 3WGGA 3ZZNA 1T2CA 1LJ8A 3ZNOA 1M66A 4II3A 4MO2A 1GUFA 3LT2A 3FR8A 2GYYA 3M6IA 1LRKA 3VPSA 4NJOA 3UICA 3RROA 3AY7A 3IDSA 4WASA 5HWSA 4JCOA 2OUIA 1PU2A 1BVUA 2Y93A 4J49A 4A03A 2IXAA 5A9RA 3K9QO 1CYDA 4KUHA 3BHMA 4HBGA 4B7XA 1E7QA 2D3TA 4HFNA 3OICA 1LDNA 1TT7A 2POQX 4D3DA 4RVDA 3I1JA 4IIVA 3GPDG 3W6UA 4WE3A 5L7YA 3H4VA 4JJGA 1ADBA 4OOEA 4R69A 4Z3DA 3PWSA 1Y9EA 5KOIA 2B5WA 2C5EA 1J4AA 3ABIA 4KQWA 3GDFA 2AQ8A 3OA0A 4CM9D 1TEHA 4DIFA 1DC4A 2NU6A 2B5VA 1X14A 2OHXA 4NBWA 4ZQHA 4MVJG 3RI3A 1ZMOA 4CODB 1IHXA 1M67A 1G0OA 1MC5A 4IPTA 1XYGA 1PQWA 1GZ4A 4S1VA 3I9NA 1YL7A 3ICPA 2VZ9A 3H7AA 1GUYA 3ZNNA 3TRIA 2IEDA 3RJ5A 2GN8A 3FNHA 1E1MA 2VWGA 3AUSA 4D7AA 2BI7A 2HUNA 4E12A 1TT5A 2R00C 2X0NA 1RWBA 2PK3A 5G4LA 2NSDA 1E3SA 2I9PA 5F1PA 3Q1LA 4MVJP 4ZN6A 2Y0EA 4BB5A 1P33A 2WD7A 5CEJA 1HETA 2OOSA 1E5QA 3C7DB 4CR7A 3EC7A 3BMNB 5A9TA 4YPOA 3E9QA 1NP3A 3HB5X 1RJWA 1QYXA 5KKAA 2FR1A 4XRRA 2EXXA 3H9JA 2PY6A 4HFRA 4P4LA 2D59A 4U7WA 1AE1A 2YUTA 3F47A 1MG5A 4EDFA 3NRCA 2O2YA 3QLJA 4DREA 1T2DA 1BWSA 2RHRA 3BMCB 3H9UA 1EDZA 3QW2A 4IXWA 2DU8A 4L4SA 1JKFA 3K2BA 5KJCA 3AUUA 5KVSA 4GQAA 2PKQO 4BNYA 1QYDA 2Y67A 3GAZA 3D4NA 2BF7A 1CJCA 1HLPA 1RM0A 2Y0DA 4BNXA 1R15A 4MIYA 1I3NA 1P74A 1WDKA 5JYEA 1N2SA 3L9XA 5B12A 3VC7A 5FF9A 4Z9XA 4HKTA 3VH4A 3VPFA 3F5QA 3WQQA 2YHIA 5IDQA 4WLNA 1ZCJA 5B4VA 1GL3A 2GZ2A 1B2LA 3JYQA 3DOJA 1PQPA 1GV1A 4XJSA 3VTFA 4BO4A 2UUPA 1YDEA 3C1TA 3UKOA 1DIAA 2YFHA 4NH4A 4CM4B 4F3YA 3SVTA 2NNLD 1QYCA 4YJHA 5TSDA 4QTZA 5IXYA 2IEBA 3L77A 5DN9A 2PNFA 3PIIA 5TRTA 3DC2A 1UP6A 3H9EO 1A9YA 3CKYA 2DM6A 3IJPA 1H6DA 1L7DA 4PIVA 3KHUA 1D1TA 4JX8A 1XWFA 3OECA 2O4CA 4RQUA 3OIFA 8ADHA 1Z73A 1PGOA 2X5KO 2J3KA 3PJFA 1P44A 3C7AA 1HDZA 4CM1A 3DMTC 1R4NB 4KTVE 1MXFA 4F46A 1VSUA 1WDMA 3S2FA 2G82A 3CH6A 4Y67A 1W0CA 4O63O 3HDHA 4Y6SA 2JCYA 3GEGA 3HWRA 1ZXBA 3Q2IA 5DF1A 4XA8A 2YZ7A 1OBFO 3ONFA 1HT0A 5C5IA 1LQTA 5TT0A 5IG2A 5A9SB 3M1LA 4I9UA 1YB5A 4LN1A 3RJ9A 5BSEA 1EQUA 4P22A 4ZA2A 3RKUA 5C7IO 3E18A 2DT5A 3GT0A 1ZK1A 3CUKA 5LCXA 1I0ZA 3QWIA 2DBVO 3RBXA 1I30A 1DRWA 4BB6A 1X7GA 4BNZA 1N9GA 3I5MA 2P68A 2QYSA 2QRJA 3G17A 1P77A 1C14A 2PGLA 4H15A 1VE9A 3WJAA 3KETA 2PZLA 4EJ0A 1GY8A 1EDOA 4OYRA 4RPGA 4BQRA 4JN6B 2X4GA 2Z1NA 4UREA 1T26A 3RC9A 3G49A 5KIAA 4LMPA 1JKJA 2X0RA 3D4PA 4UEJA 3ASVA 3KOUA 3N58A 3O4RA 3M2TA 5TC4A 1X7DA 4B8ZA 4GAEA 2FOIA 5K9ZA 1U3TA 3JQAA 3WGOA 4LK3A 4C7JA 3F4LA 3BYZA 1EBUA 5HBRA 1LDYA 5H81A 2NTJA 2GF2A 1P0FA 2V6GA 4D42A 5JDCC 4WEOA 1DOHA 3N74A 3OEYA 4W9NA 3JQEA 4R01A 4B4UA 2LDBA 5C7OO 3UH1A 3WB9A 3ZI0A 3GDOA 2GR9A 4BV9A 2PKQP 1HDCA 1K6XA 4H16A 3TL3A 1QKIA 4KDFA 2FPIA 2C2YA 1A4UA 3JYNA 5DCWA 2GNAA 4I9NA 5T57A 3SC6A 2J6IA 5F1KA 1GCUA 4H3VA 1GD1O 2YW9A 3QWAA 4ID9A 3K31A 4OSOA 1DLIA 1NFQA 3RUFA 3LT4A 4BV8A 2DFDA 4XQCA 4HWKA 1V0JA 1Y9AA 4IXTA 4GL4A 3HFSA 1I36A 2O3TA 1NVMB 6LDHA 5IAAA 2VT3A 4IJWA 3ZNPA 1SC6A 5B37A 4MP8A 3EAGA 4YRDA 3VH1A 2FSVA 3D7LA 1PEDA 4E4YA 4L75A 1Z6ZA 4XD2A 3WGIA 1K3TA 1C1XA 4ILKA 4NG5A 3GZ4A 3VHRA 3WXBA 1DC3A 3BA1A 4URFA 1ZKMA 3ENKA 3UCXA 3JQBC 5ITWA 1JDJA 4M8SA 4M1QA 2BRUA 2WEKA 1YBAA 3MCVA 3KEOA 5CG1A 4YT2A 4ALJA 2G76A 3DMYA 2YFQA 4GX2A 3W8EA 3WOHA 3CSDA 5LC1A 1DFGA 4CM3A 1GZ6A 5B1YA 1SMKA 2FSSA 3FWZA 3ORFA 1VJ0A 5C7LO 4L74A 4KMSA 4OM8A 4F45A 1Q0QA 4H7PA 4UUOA 1GZ3A 2AG5A 2Y1DA 4M55A 4BNLA 3LYLA 1UDAA 2ZYGA 1O5IA 1E3JA 2D5CA 1JLLA 3R3SA 5HTOA 3ZU3A 2YV2A 3U3XA 3GVPA 1F0YA 1XELA 1SNYA 3R6DA 4J0EA 3QQPA 5A3VA 3CIFA 2V6BA 4MIEA 3BAZA 3DAPA 3I9OA 1YL6A 3L6OO 4CJXA 1U3VA 5I9LA 3QY9A 1FK8A 2EEZA 4KWHA 4BNVA 4MVJE 5TJ9A 4B79A 1VJ1A 1UXGA 1ZXLA 2C82A 2P9GA 1SOWA 3C24A 2X5JO 3LZ6A 3TSCA 3GHHA 4A10A 4KUGA 3ZWBA 4R41A 3G1TA 1NWCA 4LVCA 4YJHB 3GC6A 1NX6A 3VPGA 2EHDA 2PA3A 4IQGA 3AM3A 4N18A 3RBZA 4TRMA 3SEFA 1Z75A 2RBEA 5G0UA 2WD7B 2EW8A 3EDMA 2BFPA 3U0BA 2VTDA 3PFFA 3GPIA 2EW2A 5ICSA 1P1HA 2DBZA 3RUAA 3K96A 3NDJA 1KVSA 1UAGA 2VZ8A 4HNGA 3NYWA 1YBMA 3PWZA 2OBNA 4A27A 1H94A 3TDKA 1P1RA 3DQPA 1W73A 2JAHA 2X0IA 4G5HA 4OO3A 4WOJA 5GZ1A 1DC5A 2VUUA 1KEWA 1H6AA 2DBRA 3CE6A 4NHEA 3WICA 4EUHA 1GR0A 4BNJA 4CQLB 4RF2A 4UVHA 4FFNA 1CERA 2CVOA 1N9GB 3VAZA 3DHNA 4O6VA 3B1KA 2FWMX 1C0PA 4QQRA 1ADCA 1PJCA 1E6EA 3WYBA 4Q3BA 1EVZA 4YRAA 1NASA 1VC2A 4MKXA 4NMHA 4IS2A 5GZ6A 2XXBA 3PWKA 3T4EA 2ZATA 5JO0A 2YHIB 1Q0HA 3FN4A 4DL9A 1NQOA 4BGIA 3UUWA 1U8FO 3LT1A 4IIUA 4CUZA 3VDQA 1HL3A 3KM0A 4N5NA 5JPIA 3OP4A 1LDEA 1TXGA 3Q0EA 2GZ3A 3V1TC 3UHAA 4RPLA 5G2OA 2GDZA 5BNIA 3NJ4A 4YAEA 2PH5A 5KVCA 3V2HA 3ONDA 3BMQA 2ZB4A 2FY8A 4B3IA 3G1UA 3H3JA 4B4WA 1K2WA 2O3UA 2GUGA 3PP8A 2NUAA 2WD8A 4HY3A 5DCUA 5BQFA 2CMDA 4GSLA 5T67A 3LDHA 5JO9A 4CV2A 1BMDA 2HLPA 2NVUA 3SJUA 2D4AA 4QSMA 2XAAA 1HWYA 2EERA 1PJ4A 1QV6A 2DUWA 4AJKA 1C0IA 3DMTA 2FRDA 2QW8A 3EGOA 4Q39A 2R00A 4BNUA 2W2KA 4R3WA 1PJLA 1NTOA 1ZFNA 1I3MA 2B35A 2HK7A 5JCJA 1E1LA 3SC4A 1DLJA 1EBFA 1RPNA 5EL0A 2FN7A 3RUCA 5ILGA 2E4AA 1NHWA 1GCOA 1ZW1A 4NZ9A 4E30A 4B7CA 3WTCA 2X0JA 3GMSA 3WSWA 3JD1A 3ZWOA 1Q2XA 3MJ4A 1IE3A 1DPGA 3ZWXA 4XYBA 3I6IA 5DP2A 4IQ8A 1Q0LA 3C85A 4IY1A 2DKNA 3JYOA 1YONA 4PRLA 2VWPA 1GYRA 4J43A 1PGPA 1RM4A 1KEPA 1F14A 3ICCA 1IYZA 1UDCA 3BZUA 3Q6IA 4PZCA 1PS0A 1U5CA 5EIOA 1E3EA 3OIDA 4EGFA 4XQGA 4RF5A 4LCEA 2Q4BA 4EBFA 2RIRA 4BO7A 1R12A 1EUDA 3KYDA 3DFUA 2WTBA 4CQMD 1T1SA 4YCAA 2J5QA 2FP4A 3DTYA 5AQ1A 4YJFA 3ANNA 1UZLA 3ETDA 3O8QA 1NXQA 1UP4A 4LW8A 3GGGA 3CMCO 4KDEA 4II2A 2NTVA 3HNPA 3W6ZA 2CDCA 4LISA 2Q2WA 4R1NA 3BHJA 3LF1A 4FQ8A 4J9UE 3U62A 1I2BA 3AY3A 2WYWA 1A4IA 1I8TA 2CF6A 2GCGA 4XIJA 1NPDA 5IN5A 3U4DA 1A72A 2AQKA 2J5KA 2VHZA 3ZV6A 1RM5A 1ZEMA 3WLEA 1F8GA 1UZNA 3A14A 4OQZA 1VRWA 3HB4X 1KEVA 2HK8A 3GH3A 1HF3A 5HS4A 1DC6A 2GZ1A 3ONEA 5EJ2A 4A2CA 4HFJA 4IZHA 1LEHA 4DTIA 4A26A 5CDTA 4UULA 1EVYA 3G79A 1U2GA 1UR5A 3RCBA 3T7CA 2Q4EA 4YJGB 3D0OA 1W6UA 4D46A 4RORA 4QT0A 1G1AA 1B8VA 1ZVMA 4XB2A 3S8MA 4CLOB 4CMIA 3V1UA 3NGXA 2CD9A 3WLFA 3VTZA 3BMNA 3IMFA 5DDIP 4TRJA 3OQ1A 3DBHB 5F21A 4LSMA 4QEDA 3LC2O 1RKXA 4EI2A 1NPYA 1MB4A 3BMOB 4IGFA 3SLGA 1ENOA 3CMMA 4J3FA 1NVGA 2NTNA 3BMCA 4YJDA 3V5NA 4CMEA 3GMDA 5L4NA 4HFMA 3DZIA 3RASA 4BIIA 9LDTA 2C5AA 3P7MA 3WWZA 4A0SA 3U4IA 5DNAA 1YE3A 4JGBA 3ROPA 2HRZA 2BGMA 1X1TA 4MINA 4ND1A 4K28A 4ZQGA 3DOCA 4R1UA 3NTQA 4XR9A 2YDYA 3ZNQA 4F6LA 3UAGA 1GPDG 3T7EA 1EQ2A 1FDTA 5CG2A 3K30A 1ONOA 5AYVA 1HYEA 5FEUA 4B4OA 4XKJA 3H8VA 2EKLA 3D5QA 5TNXA 4XYEA 5AOVA 3DL2A 3OBBA 3WIDA 2FMUA 2EKQA 4QX6A 1M76A 4NNJA 4C7KA 4E32A 3WGZA 2BMAA 1XCBA 5HRUA 1U3WA 4CMAA 1NM5A 3AUAA 3P2OA 3QVOA 5KVVA 3HFGA 3F9IA 4M86A 5JYDA 3X2FA 3S1LA 1NQ5A 4OXNA 2Z5LA 5JCXA 1ONNA 3AUTA 5A05A 5IXSA 2YYYA 2PZMA 4YT4A 3TZQA 4TZTA 4XYMA 2C20A 2B36A 4BKRA 4IDEA 3H6KA 3JQDA 3PLRA 3AM5A 4E2ZA 5ITVA 1R4NA 4UUPA 2BFMA 1BHSA 2Y1OA 2E82A 4PZDA 1VM6A 1WP4A 1BTOA 3AY6A 4ZGWA 4E6PA 4FGWA 3VZPA 3GHYA 4MVJA 4DIBA 4CM9A 4CMCA 1DIRA 2X86A 1DSSG 1T24A 2H1SA 3E48A 3QP9A 5HA5A 2YJZA 4ZVVA 4MPDA 4R16A 4CR8A 1ONPA 2PGJA 3FI9A 3O38A 4OIMA 3WYEA 3HZZA 1TVEA 2X9GA 2BHLA 1JWAB 2QRLA 2NACA 1PGNA 2NWQA 4ESOA 1V6AA 2LDXA 3ZU5A 4Z3KA 4GX5A 4WNCA 3CZMA 2QYTA 3I6QA 4RVSA 4HXYA 3C1OA 4D45A 3NKLA 2QX7A 4D41A 5JW6A 1C0LA 1PS8A 1K6IA 1LC0A 1GPJA 1HDYA 4I1IA 5DT9A 3TQHA 4DXHA 5LDGA 3KRTA 4LCJA 3V1YA 4ZQEA 2UAGA 1R16A 4BOYA 2C29D 4WCDA 4U5QA 2PTGA 1E5LA 4J4TA 1AGNA 4PG6A 4BKOA 3I9LA 2E6UX 1KEUA 2SCUA 3AK4A 2RH8A 3HN7A 1ZZEA 1J49A 1Y5RA 4E21A 1UUFA 2W2LA 2VRBA 1VL0A 4CQMA 3RUEA 2BFOA 4EJ6A 1OMOA 5F5LA 1DIHA 3GEDA 2IDZA 4BO6A 3FPLA 3DXFA 4BNMA 1LC3A 1FMCA 2EGHA 3IUPA 2ZIZA 3OH8A 1MX3A 5G4KB 1DIGA 1BXZA 2HJSA 4FR5A 4GBJA 4ZQFA 3VPHA 1AUPA 4OHUA 3VZRA 4CMHA 5KJEA 5K0ZA 2AMFA 3TJRA 3AFMA 1NAHA 1HTBA 1GYQA 4Z9YA 1B14A 1V8BA 1ULSA 5LDHA 4W7IA 2VYVD 5CFZA 1GADO 3PQEA 5J23A 3JD4A 2WJPA 4BMNA 1F06A 3MWDB 4WLEA 1PJSA 1WXDA 2OMEA 3BMOA 3E6AA 3QVXA 4IJUA 5CAEA 4CV1A 1Y1PA 1FJHA 4NK5A 1B8PA 3JQ7B 5T5QA 1P31A 1U4OA 4ROSA 4BUCA 5I7FA 3EYWA 1B3BA 1NYTA 1VL8A 4NQZA 4YEDA 1YOVB 3ZWYA 5CDUA 1R37A 4X54A 4FB5A 2OGUA 4UVEA 4ZD6A 3INRA 3B70A 3BTUA 3L4BA 3NDIA 3GVXA 2FR8A 2O48X 2F1KA 1JAYA 2P2SA 1O94A 1PJTA 2NVWA 1QORA 1N8KA 2HMVA 4AJPA 1EE9A 5TGDA 4DQXA 1SPXA 4EEZA 2VNSA 3E5RA 3ENNA 2F00A 1P45A 2JHFA 3MZ0A 3RUDA 3FBTA 1QYWA 4FCCA 3KLMX 2DQ4A 5A5EA 2D8AA 2X9VA 3DBRB 5GMOA 3WJ7A 2HMWA 1IUKA 1Y8RB 2PH3A 3ROQA 3UF0A 1JTVA 1D1SA 2CFCA 2IZ1A 1BG6A 2CF5A 2R2GA 2V65A 4XQ9A 2PFGA 1T4DA 3U49A 3LLSA 3E5MA 2FHSA 2PD6A 5DBIA 3DAFA 1WW8A 3S2EA 2X8LA 2Q99A 4OOFA 2PD3A 3GY0A 5JDIC 3OMLA 2IYOA 4XQEA 2P91A 1E77A 2JAPA 1IOLA 2Q45A 4NBVA 3NV9A 4L76A
chains in the Genus database with same CATH superfamily
1JU4A 3PQFA 1ACJA 3ND7A 1YVEI 1FYEA 3ETGA 5ALYA 4YJKA 1GPLA 4XCQA 3A6FA 1YZHA 5EGSA 5KNDD 2XGSA 2IE0A 3GEMA 4HAVA 4QECA 3RFFA 1FLDA 4KX5A 2KB0A 2NU9A 4OL9A 3V1NA 3GZJA 4N1AA 3RHFA 3H99A 4NVRA 4TVOA 2BEUB 4IMRA 2A5FA 3ROQA 3HVRA 2HMUA 1T2FA 4WGGA 3R7DA 1X8LA 1V41E 3R3YA 5LMUB 2GEVA 2FU5C 4NWIA 1EWTA 1ZK4A 2YTZA 4TUYF 5CJ2A 4U7GA 4G2TA 3AIOA 3H9BA 3S2IA 5EG5A 3W3AD 3X1KA 4W5OA 1HYGA 1BRTA 1YJ8A 2ORWA 1SG0A 4P4GA 5I51A 2B2XA 2RC6A 2ZYIA 1E4VA 3NM4A 3U13A 4F96A 3SJ7A 1BEUB 1ENPA 1ECFA 1P5HA 1U9IC 4G6ZA 2G9UA 1G66A 2OBYA 4I2NA 4M8IA 2J08A 1U7XA 1Z4QA 4C4XA 2JLZA 1H2EA 4L4XA 1L5ZA 1T5IA 4C22A 5J3JA 4MQBA 4QU5A 2HO5A 4ZC8A 3ZN2A 1BW9B 1HRKA 3E9MA 1DX9A 1U2TA 1XKXA 3JQFC 5D5HA 2FPXA 4KOEC 1E9RA 2VZEA 3GG9A 3H11B 2E4WA 2DLNA 3FY4A 3HDGA 3INTA 3GBVA 3RRZA 2WT9A 3WK5A 5I47A 2I3GA 4G1UC 2JZNA 1X80B 2XLBA 3HPRA 4BP1A 3PPYA 1NVVR 4QWMA 2OV6A 2PGXA 2E18A 2IPAB 1V48A 3OURA 3MCZA 2AYXA 1EYZA 3KQOA 2HV9A 3PFCA 1QV7A 2BW0A 1BSVA 4MVJH 2J3EA 4M9SA 1Q1AA 4HLNA 2ZRDA 3TW0A 1M1XB 2Q6TA 3GRKA 1TK9A 2VNHA 1CDDA 4QU8A 1NLZA 1A9ZA 3B82A 4KK3A 1M0TA 1PKXA 4TUYB 5D6NA 4GXNA 3NANA 3QA9A 2GOYA 4AUNA 4H1TA 2WM3A 1LLUA 1SAYA 3HY3A 5FFFA 3L0BA 1EAMA 2F1RA 3PDHA 4QM6A 3UHOA 4U0KA 4GE3A 4WLOA 4IOJA 1NT2A 4GOOD 4XWKA 1GM5A 3L92A 1W9HA 2DR0A 1PYOA 4NSNA 4D8TA 1K2VN 1QOQB 2WVGA 2NM0A 1ND5A 2HQOA 3EPRA 4E33A 2Y99A 3DGEC 1PFQA 4GKBA 1E64A 4BVLA 2DC1A 1QNLA 1KYYA 3H5TA 3I9V6 2UXCB 3AH8A 4IXDA 3KV1A 2QD3A 3R5TA 1YMQA 3O9VA 4FFRA 3ASUA 5D5PA 4BMOB 5A4FS 3DBLB 1A27A 1LI7A 1LLDA 1Y1RA 3COYA 1E7RA 3OCYA 4ARAA 2VUHB 5F5XA 1U3FA 4BIMA 1W87A 3N7TA 1A8IA 1G3UA 4C0SA 1HUQA 2J3MA 2XUQA 3Q3GE 4C20A 3OM9A 1XTKA 1NQWA 3PDIA 2GVZC 4DSOA 2IIBA 3TFQA 3KZCA 4FC6A 4CUJA 3H7IA 3THXB 3GUCA 1Y6JA 1KVRA 1MGOA 3BK2A 2GLTA 1J0XO 1QHHB 3M4YA 3Q98A 4JLMA 3K72B 1NC1A 1NPTO 1EIWA 4RTLA 3UJNA 3OIVA 2ES4A 3LGXA 1SCNE 1Q16A 2P27A 1XZDA 2PANA 4Q1EA 4V0LA 4Y9TA 3W2GA 2NU6B 4N54A 3II6X 2QVLA 1XFAA 1PT7A 1P80A 2VRCD 3LKVA 2VEDA 3M82A 3B9RA 3JPYA 5K3DA 3IX7A 4MGKR 4TS4A 1NGSA 3HA2A 3LCRA 2JCXA 2J46A 1F8FA 4G63A 4TSKA 3DBRA 3PQ3A 3GOQA 1EEHA 4HLCA 4HQNA 3CPSA 5AVTA 4Z8XA 1NWHA 1XROA 5EJ5A 2X1MA 4CM8A 4MVXA 4LC0A 1GNTA 1A9TA 2C78A 4NYJR 5FPPA 1PNOA 4CIVA 1VLJA 2WR8A 5EWLB 4N41A 4HXGA 4MB2A 1XNHA 4CKCA 3DWFA 5AVUA 5DFAA 1E8MA 4GLLA 3ZBQA 1PWZA 4IKOA 3RS3A 4EHLA 4QZVA 2AF4C 1FC0A 1UXOA 3MT9A 4OQMA 5E1DA 1DIBA 1EMDA 4RGVA 2WTXA 3TWOA 3KJEA 3SJBA 2B4AA 4NU8X 1U1IA 3ANLA 4K8OA 2IYPA 3FROA 1D7OA 3BD8A 3SJAA 4BDSA 1H8HD 1SQ5A 3OP1A 1XTZA 3I92A 3M81A 2HSEA 2C7PA 2Z3WA 5TQJA 3Q8KA 3SZLA 5EMLA 1EHCA 5KTKA 4JYMA 3ZH2A 4XD7D 1TW2A 3WL6A 2VZ0A 2ET6A 2HN9A 3HXKA 3K8ZA 3GX1A 1J1UA 4LY0A 4WXRA 4ZYVA 4XLZA 5JH7B 4G9GA 1BOOA 1MIOA 2A2ZA 2F59A 1GTMA 2FSGA 1XT6A 5T3UA 2ISQA 4YIKA 4DE5A 5JEEA 3KUXA 3QTTA 2VWQA 2AMYA 1HDOA 1MX1A 4LXQA 2QDKA 4MEAA 3CVWA 2HU2A 4IBOA 4D9KA 1AY0A 4NONA 2AD1A 5JAIA 1NATA 3H5IA 4WOCA 5KYWA 4RXMA 5EE1A 1T5HX 5MN6A 2W2PA 2R751 1KTVA 3WMWA 4KE9A 3ZV5A 3PD0A 3FPBA 5IEBA 1A1VA 3N59A 3S27A 3EIEA 3F67A 1JHOA 4CM5A 4PZUA 4AN0A 4N3GA 2NV6A 4KSYA 2QVCA 3DL4A 1G7SA 4JFRA 3E3NA 1YJAA 2HBRA 2QVYX 2WLSA 4MHSA 1K98A 3AIMA 5FLEX 2JGNA 4P4NA 5L95A 3OLXA 3HV2A 4B1FA 1VKJA 3FYDA 4MV8A 3V1KA 3THYB 4X1YB 5ALFA 4M46A 1C8KA 1AK1A 5EHZA 4DDUA 3T6KA 2VNKA 3IA2A 5FV7A 1XJCA 4FEAA 4A91A 3KSDO 2P1ZA 1QGYA 4NR0A 5B58T 3L8EA 2IVFA 2FFHA 1HV8A 1JEQB 1KEEB 1VMIA 3UFXA 3PL5A 3DHYA 5F5NA 4ZK2A 3LPCA 3G0HA 2ZYAA 3TO5A 2ORED 2C7OA 4EA7A 4AJ1A 5KYYB 1KZ9A 1NRWA 5J4HA 2EWMA 4AMUA 4ZYYA 2Z3ZA 5REQB 1N8TA 3KVYA 2HHHB 3V46A 2Z2KA 2HHJA 4FHDA 3BXOA 4X97A 5EWMB 4YRIA 3ORYA 5ALZA 2HADA 5EE0A 4F11A 3P2JA 2ZCJA 4YV2A 3TKAA 1NVVQ 3AJAA 2N0SA 5J2UF 3S2YA 5ALDA 3SM3A 2C97A 2GRAA 4GKKB 3QE0A 2GNOA 4RDIA 1LDMA 5EQTA 1U7TA 3VAYA 1VIAA 2VHEA 3IR6A 1FFGA 3RKSA 3U3OA 1YOVA 2PZEA 3KOYA 1I6LA 5DOZA 4BEBA 2Y27A 2YIVX 1OPXA 3UPDA 2FV8A 5JY1A 1QVZA 2XQJA 2XTJA 1Y5MA 4RYDA 1IRIA 3K9HA 2R5WA 1X3SA 3AETB 5I7AA 5C34B 5AESA 1UXHA 2P78A 3MWEA 2CKMA 2F1OA 2ZR9A 4YFYA 2VHVA 3O74A 5B4TA 3BXXA 4DG5A 3TQRA 2C8LA 2GQ0A 5IHPA 4CW7A 1Q2UA 4X24A 4ND8B 5AKXA 3CZ4A 4PLWA 7AT1A 2XY4A 2AFIA 3T12A 4M8NE 1OFUA 2ZFUA 4DNFA 2EX1A 3B6JA 5I9MA 3VV3A 2C7GA 1TEVA 2X4DA 3ORRA 2QL7A 4G0PA 4YUWA 4PHGA 2KHZA 4O4HB 2IYNA 2XZDA 1AXEA 3VFDA 4YA6A 4BVAA 3LUFA 4K03A 4W7HA 2QX8A 1F2DA 1K7CA 3HVKA 1KU0A 3PSAA 3QE2A 5J5AA 2JF0A 3C3WA 4N7RA 3U9TA 2YVKA 3PEVA 5IDYA 3OQNA 1WMFA 2B69A 2C2XA 2X6QA 3IQWA 5GP1A 3IIIA 3W4JA 4NMMA 1YBFA 5EP3A 1L7EA 1RHJA 4UMEA 4YQZA 1IDN1 3P0IA 2FW9A 4XXHA 4C89A 2NU8A 2NUBA 4J2HA 3IO5A 5JQWA 4ZT2A 2FZKA 1TA4A 5L4LA 1OUMA 3ZI7A 1FSZA 1MG0A 4BMVA 3R7WB 2DR3A 4RJTA 3R3HA 1FFHA 2XRMA 1RXWA 2XMPA 1CSEE 3BXGA 2GXUA 3REFA 4TYQA 3VSBA 1W5TA 2HPZA 4BGEA 3L1VA 1VPDA 2H2IA 1E2FA 3OZAA 4P3KA 2EHJA 1XZQA 1KZGB 4NFSA 3MJVA 1BXRB 1SQSA 1YVPA 5FXMA 4JLAA 3RAJA 3AZQA 4IIJB 5I7HA 4DV0B 4DQLA 1OREA 5GADl 2F3QA 2FQYA 4IRXA 5LQSA 3UYKA 4P8RA 5I9BA 4DSNA 3MLBA 1QR6A 4RA9B 1OAAA 2B82A 4P3OA 1DUIA 3IUSA 3SG0A 4UUMA 4CIXA 3LUKA 4P3NA 1Z38A 4UZSA 2EKPA 2WMDA 3R9IA 3ILVA 1EFTA 1K1EA 1L4MA 3EARA 3L4SO 2OESA 3T8YA 5K4GA 2G06A 1XO1A 3Q11A 5CJJA 5DNWA 2XCTB 1IZYA 3PC7A 3WKAA 1QONA 1XP8A 2R1ZA 4FM9A 3KZMA 1D0IA 4G24A 4FGLA 1E7SA 3LT5A 4IDOA 3LY5A 4M99A 1T3HA 2FF5A 4JH0A 1JQ5A 3PUVA 3RYTC 2YJNA 3M6MD 3DAGA 5FUVA 1VI2A 5L45A 1KOLA 3HB9A 5DSTA 1VLLA 2ZT8A 1JPVA 4H6XA 4Z9FA 4LNUB 4DQVA 3S8YA 1NMQA 2OXCA 4ZAWA 2YINC 4XX1A 1K5DA 1X7WA 2DPXA 5D8DA 5JH7A 4KPYA 5KYTA 2O1SA 2IWRA 3VC3A 4WN9B 1D2HA 1QHIA 1VB5A 1N0VC 2OENG 2VJAA 1G18A 1U8XX 2PG3A 3EWAA 1HEYA 5CEEA 3RSFA 3FTNA 3AEQA 3VC2A 3S0JA 5CGQB 3EZLA 4QC2A 5ETJA 4EH1A 1VBKA 1X9GA 5JZMA 1P1FA 3Q12A 1EXDA 1Z6YA 4REQA 2WSBA 1T8YA 4EYEA 5A1TA 1SK9A 1Z45A 3DR5A 3L5OA 5JMPA 1JSCA 1QG6A 1N6LA 3ZY6A 4D79A 3L7IA 3VZCA 1TVKA 3WMXA 2E55A 1VOTA 3KEMA 1OD6A 1QP7A 1I9GA 3KWMA 2AVDA 4LXYA 5EKDA 1U0RA 1YJBA 1Z8FA 3BUSA 3P2YA 4F1WA 4BE7B 2ZCUA 4H1UA 1ODSA 2X8WA 3GLFA 5G1NA 5LM3A 1R00A 2XGGA 4DCCA 3VM6A 5JMWA 3BWBA 4G8BA 2DUMA 4ZVOA 4G2NA 4WECA 4IFTA 3F3SA 3BE4A 4WERA 1PLKA 1FTSA 1H8HA 2PMEA 4KQMA 4AJNA 8OHMA 5IT9A 4A8HA 1HDXA 2VQ6A 1L6RA 5MHTA 4YY3B 3ICOA 3TRFA 5COQA 1RQPA 3MPOA 3OT5A 1V5GA 2CUKA 3STTA 3PGLA 1E89A 1XCMA 3HXMA 2CVQA 1HDIA 2ZUSA 1HI9A 1R6DA 1KIFA 2OGSA 3C3EA 3NHLA 3IO3A 1C4XA 3I52A 2BUAA 5J2TF 1VIDA 3G9UA 1QZXA 2MYNA 4Y2QA 2X77A 5LMCA 1FE8A 2EV9A 3GJ6A 3GL9A 3MUOA 4ZT6A 4LSZA 4QKQA 1N6IA 4WESA 1G8AA 2LP4Y 3LWDA 2IT1A 1Q0TA 4JJEA 3ZY3A 3M8KA 1WD7A 3ULKA 4YMWA 3KFVA 4B31A 4YRPA 3LX4A 5L53A 3C5CA 4NBRA 2HAEA 3OTWA 3FYUC 2ZAIA 2VN8A 1T0HB 2GASA 3JS5A 4OGKA 3KZ1E 4RY0A 2QIOA 1WDLA 2IODA 4X93A 2DY1A 3D3KA 2XZLA 4HN9A 2GO1A 3WO1A 1CF4A 2IPOA 1IZ0A 5CYGA 2PGOA 2BMJA 3BTOA 2EJUA 3DB2A 3E9NA 4RA6B 1XCJA 3HN2A 2BGTA 4B76A 3IXMA 1N33B 4IZOA 3HQ4O 4BKQA 1EH5A 5A9SA 4IX9A 1CUBA 1KY4A 1RI5A 2VPYA 4FGZA 2CL5A 3R0QA 4PF1A 5HIIA 1YS4A 3IILA 4OIFA 5HF9A 3KSAC 1T1GA 4ED9A 1M2KA 5DW3A 4TTTS 2AHOA 3Q8MA 2ECOA 2HRBA 3BGVA 1QP8A 4LDRA 4IGAA 3O8OA 4ZEWA 3USCS 2BIFA 3K6SB 3HDJA 5I9TA 3STXA 1P1KA 4HQLA 2GFIA 5GV8A 3F97A 4EFNA 3PVZA 5ALGA 5CNMA 1NNSA 1B3RA 1KOFA 2PX4A 3KJZA 1DBSA 2HA6A 3CXRA 1NBEA 4BJ5A 1U0JA 3U44B 3VVBA 1AH2A 4EGAA 3G9QA 3USES 4R9NA 4J2OA 4Q6WA 3NP7A 4U6SA 1Q95A 3IIEA 3PCTA 3FB1A 3MCAA 3DL7A 1LPOA 1BD3A 4U0JA 3JRWA 4OXYA 4Z99A 5BW6B 1PTJC 4Z53A 1AMUA 7REQB 1VCHA 3TTUA 1W29A 1VRVA 1PK9A 3LF2A 1RRVA 4L4UA 2YWRA 4DLYA 2NSJA 2O52A 2IRWA 4L5JA 1PR5A 2H8KA 2I67A 3GDWA 2WIGA 4S3MA 4UEKA 1ETUA 4QTXA 4QOFA 1PX0A 3LV8A 4R9VA 1H3EA 2Z0MA 3TBFA 2ZXFA 3I05A 4H59A 3ZIAD 2FMIA 3ESRA 3UXYA 1CP2A 5F9HA 3U6KA 1IUPA 4QYMA 3H4TA 4WX2B 5CHEA 1SU6A 2QTCA 1Z5NA 2OV2A 2EIHA 4MWEA 1RADA 1JYSA 1PG2A 2I3AA 2WJ4A 3P4UA 4WFJA 2FPIB 5I7UA 1YUMA 3HJBA 1XRRA 3EK2A 5AFSA 2Q3FA 1THGA 5D3KA 2YV4A 1Z2NX 2HA5A 2JGKA 1I51A 2ZI3A 1KETA 3FM9A 3KSRA 3DE4X 3QJYA 5TPWB 3GUYA 4D3SA 1OSNA 3KDPA 1OGYA 2VEOA 1T4MA 3L0CA 4NLLA 2BSXA 5LOVB 3UUEA 2NU7A 4UC0A 2BCJQ 4ZOBA 3OF2A 5LWHA 3FVRA 3L6BA 4QO8A 2W2MA 3DD1A 5GTDA 3ZI4A 2D54A 1T9BA 4DMUB 4ZICA 3NH6A 3E3MA 3AVWA 2VAXA 3FPCA 2PKEA 3T34A 2OO7A 5LXTF 4Q7QA 1KEKA 3EGIA 3KTDA 4G5YA 4IZIA 3K9CA 1OZHA 1YRQA 5AW1A 1Q21A 5KWVA 2AS0A 1HXHA 4XPZA 4HATA 1B73A 1P6UA 2XDYA 3ROZA 1N1GA 2ZQZA 3TD6A 1Q1BA 4NG4A 1BCRA 1NULA 1Q6ZA 4G65A 4GBGA 3SSOA 2X23A 1SJ9A 4A5OA 5L3QB 5L8VA 3KB1A 5FBWB 1P8JA 3EXHA 4CT4B 3P9QA 4Y6OA 3PXDA 1QJ4A 3ZYCA 5FWAA 3DKRA 4DLTA 1LXCA 4MLPA 1NUSA 3NM5A 1JSLA 2JKYA 3KBOA 1W1WA 5KU7A 3FHTA 1GSIA 2NO9A 2OCXA 2J3JA 2RHTA 1CQJA 1JEAA 3DONA 3EZ6A 3LA6A 2V7WA 4S2UA 1N78A 3VGJA 1H9BA 4P5EA 3NOOA 2GPBA 4J7CA 4UAUA 2VBIA 4MULA 4H60A 2JAQA 1R0ZA 1C1XB 1GU0A 3HADA 4MGZR 3LQRA 3GU3A 3FZNA 1XMXA 3U80A 1VP9A 3AINA 1L0BA 3FKJA 4UNPA 3SR0A 1A5SB 5BR8B 4E4RA 4NS4A 2HC9A 4RY9A 1XZJA 5TS3A 4W4TA 1QS0A 1BEZA 3IPAA 1VHQA 1IOVA 4FR2A 5LXTB 4BYMA 1KIAA 3UKJA 3VNAA 1N7HA 1ZD3A 3FTQA 4PFQA 3VI3B 4DRZA 2MJLA 3U7HB 4NQRA 4IJQA 1P4AA 4FPXA 3B89A 3KLNA 3EB9A 3PYLA 4G67A 2N3ZA 4UM8B 2WYOA 3MTDA 3R2JA 4PYLA 4XASA 3V9PA 3ADPA 4M8KA 1M2OB 1Y0BA 4B7UA 4YQFA 4G0WA 2YZMA 4ZYUA 4YJ2A 3DL0A 1LK0A 4Y1EA 4LOJA 4AKIA 3A70A 1QO9A 1A2BA 2R6FA 3KB8A 3Q85A 2AFVA 2PLAA 1KO5A 3MAGA 4PPQA 2HBZA 2CCJA 4EITA 1YKSA 2W6OA 4AJHA 1BJRE 3FDXA 4WV3A 4YAKA 3QMPA 1WCIA 4GPTA 5IJ0B 3WIBA 4KFUA 1SXGA 1A5BB 2ZAYA 5AM1A 1LVUA 4PFJA 2D13A 2MYUA 2A5YB 4FXPA 2PRSA 2H6EA 5BR1A 5JNWA 4EQ6B 2TMDA 1EJ6A 1G5TA 1SXIA 2RH4A 2ZAMA 2KQUA 3CEJA 1GQ2A 3BXEA 3HYLA 4E3ZA 4OX9B 2W71A 3UT6A 4RK1A 3B3GA 1LK7A 1V3TA 2WVJA 4F91B 4HX9A 4IQ4A 4YCNA 1YHNA 1WMAA 2IYQA 3KQKA 3SZOA 3TMKA 2J7PA 2MIIA 4A0HA 5LD2B 2HT1A 1XF9A 1VFNA 3IP9A 3JQAD 1YXMA 2IXBA 1RSZA 2PL1A 3AJRA 1M1YE 3C6QA 2YL2A 1Z9BA 5BOSB 1K0UA 1I1OA 2EDCA 4JP2A 5HUHA 1UQUA 2OBFA 1EFUA 1I4LD 5FR2A 5TGTA 3UATA 1PR3A 1SVOA 3PF8A 4F06A 4YLYA 1MB9A 3IC5A 4O4IF 3D7NA 1JHRA 1BFDA 1AZTA 2H1FA 5THKA 4B7AA 2PJRA 3O03A 4TT3A 1V8FA 2ZGVA 5HK8A 1UPCA 2ZUWA 4PQGA 2KLBA 2P9FA 4BMYA 1RVDA 1ZQ1A 2QLNA 3AWDA 1WBDA 1G59A 2PCLA 2Q4RA 2P30A 3GFQA 3UC9A 4A23A 4X92A 2QMQA 5DZSA 3RFTA 2G6BA 2Q3CA 1Q14A 4M88A 5ARCA 5D3ZA 3WGQA 4DFDA 4J8PA 3JD0A 3DTVD 3JX9A 1JAHA 1GG5A 1SIUA 1WMBA 2ONKA 2BT4A 2QV7A 3NKFA 4FR0A 5L51A 3I2GA 4AULA 3W5AA 1GEEA 2M6RA 1VGRA 3CVJA 4R9SA 1JHUA 2OAEA 2NXNA 1S2DA 1GRRA 2OCGA 2CL6X 1R9GA 1EVEA 1UK7A 2V55B 5KDLA 1V1MB 4G85A 4WCFA 2PLWA 3WGMA 3PEWA 2IZ6A 1JHVA 1WD5A 2DQYA 3TTTA 2DG2A 1E1CA 4GGPA 1DMRA 5KI6A 1Z8NA 4JBGA 1DQSA 4JVOA 1SCBA 4ODIA 2ZXUA 5CDFA 3WLIA 3H8JA 2G09A 3VKFA 3GLFE 4M6WA 3LBNA 4J4HA 4ND4A 4O59O 1JHDA 4GMFA 4DQDA 1ZD4A 1ZYUA 1ZLXA 2B4YA 2GPYA 3CZ9A 1NAIA 1RWXA 1D2MA 4XDZA 5EIEA 2PXAA 1DJQA 1TKBA 3WLSA 3ONNA 5E2AA 1JR3D 4O2BF 2EATA 4ZHQA 1XNGA 2VUSA 3A28A 3KKMA 4JBNA 4TXNA 4Y7CA 1YTLA 2OZLA 3VYWA 4KRYA 4M60A 4CLEA 2NO4A 4OMUA 4HTFB 1QRAA 4H4CA 1GZ7A 1QAMA 2CYAA 3B3FA 1XLTA 4ZVQA 2ZUCA 4EG7A 1V1JA 2GPNA 3N0XA 5BQOA 2YMQA 1MR3F 1YRLA 2F3UA 3T4XA 4BFYA 4V3CA 3G9XA 4GMDA 3REGA 4O4HF 2DZDA 2AG6A 3O4HA 2Q1WA 3RVSA 4HWGA 4R5MA 3RIXA 4HJRA 1JAXA 1PJRA 1IBKB 4LYAA 2ZRFA 3T1TA 2ZJYA 5J4LA 3M33A 2JIRA 3E82A 4KXLA 5L6MB 1NYRA 1Q15A 1WKBA 4KU4A 4WXHA 3O4JA 2WNSA 4P7JA 2G9NA 5CM9C 3HBFA 1GPNA 4D9BA 1EZ4A 4RSMA 2VJQA 3N2EA 3ETHA 4ND3A 4B80A 2W98A 2VHJA 1V8PA 5JSZB 2OILA 5B1SA 1BHQ1 1US8B 3DKKA 3P4YA 2XUHA 4FXOA 1FXUA 2PAAA 4QT4A 3AI1A 5C80A 2X0KA 2H4JA 2VBFA 2NV2B 3EPLA 4BNHA 3I4FA 5CA0F 1ZHFA 2REOA 1UC4B 1VYHA 4RLHA 3Q9NA 3JQ7A 5FWXB 3WWEA 2Z83A 5HS6A 2C4VA 2Q5JA 2BSQA 1OB5A 5JFGA 3L7AA 5JS6A 2FR0A 3CEAA 1HURA 3T5PA 4L4ZA 4AFNA 3SGLA 4ITUA 5ICFA 5JFTA 3NTOA 4GEKA 3V2GA 3ZVKA 1FB5A 2GXSA 2PYZA 1DQZA 2GA9A 1K92A 2R6JA 1FMTA 2R8PA 5CLJA 1S89A 2FWBA 4YCJA 1R74A 1OLXA 2WT4A 4JUIA 1D1QA 3B6ZA 4FYYA 4WTOA 1WX1A 5REQA 1BAPA 2UZ1B 3QZUA 5ALUA 5BO5A 4AKTA 5JTUA 2JK1A 1HYQA 4IDCA 3PZRA 1EFLA 4JLOA 4PHTA 2CFIA 3NW9A 4M0EA 4PSVA 3ZBUA 4BZQA 5B6IA 5BVGB 3ECAA 1XUOA 1C2YA 2BONA 2OD7A 4YJ2B 3RC1A 3W4KA 5IZCC 3G2MA 1YGPA 1O8CA 5CW1A 1EJ0A 3MK31 4UNQA 2AIRA 2WJ3A 5CIQA 5CVDA 3W9YA 4X66B 1A5ZA 2UUOA 1F4PA 2ZTLA 1DX6A 3OKPA 3HSYA 5BWOA 4N3AA 1ZUD1 4B09A 2XCLA 3CF4G 3RT1A 2XYVA 4EECA 1G63A 4TMYA 3SQNA 2OZVA 1E1RA 2WF7A 3ZQ4A 4G1BA 1K6EA 1TU0A 4CL3A 1EGVB 4EHBA 2ZT5A 4P0TA 4F9GA 2B4RO 1Q1NA 4M7PA 1YZQA 3LL7A 3UK6A 4A8JC 2ATIA 2EJVA 5GAJA 3FCCA 1V3VA 4QRIA 5CVJA 1XMSA 1DL5A 3WBFA 1NG1A 1HE8B 4NS1A 1AN0A 2GZHA 2UVPB 2ZT6A 3FCXA 2CHUA 2XECA 1THMA 3K0AB 1R0XA 4GPBA 4I7EA 4C29A 4HVLA 4POOA 4LZLA 1KZ7B 2BM9A 3QTLA 4LQCA 5HKKA 1ZMBA 3CJTA 4F3TA 4O08A 3IESA 1JHYA 5JO0A 1DAKA 1JT9A 2W9XA 4Z49A 3C6XA 3VO1A 4B3HA 1Z15A 1PVVA 3WDKA 1IZ8A 1NMYA 1KPGA 4KFCA 4XAQA 3ED1A 4MUFA 3FMFA 3PGVA 3GI1A 4MCJA 4TL9A 1B8OA 1C7RA 3TI7A 4BEVA 5HIAA 3VR3D 4WRRA 3X2EA 1ZI6A 1Q7RA 5J2UA 3VHXA 1G20E 1UINA 2VF5X 4DUGA 1Y98A 1AG9A 3VR0A 3ZVRA 1FYVA 4KAXA 4RKFA 4PW0A 1K7EB 4CLRA 1O9GA 4Q9AA 4YJ3A 3PDJA 3PUJA 3WFIA 2Q4DA 4QTYA 2I5PO 1R5JA 1YJQA 1JTFA 2A67A 1P0CA 2YUIA 1TD9A 4KC0A 1JEYB 2JAXA 4QVGA 3ZD6A 4K0KB 1DXQA 1EM8B 1CC1S 2EYUA 3A2NA 5LZ4A 3TEMA 5BUSA 3K2QA 4CRWB 3ERCA 1JDBC 3VNQA 2ZBFA 3ENZA 4PEVA 5ES4B 4NBUA 1H5QA 1B0PA 3OFSA 1BRMA 2DKOA 1X8KA 4G5QA 1YS1X 2B3DA 3E9EA 3KV3O 3EGVA 5ADUS 3QE3A 2I1WA 4JI5B 3F6RA 3WL8A 4L5IA 4PCUA 3IAAA 4CDNA 1KI1A 3OQMA 4V0OA 4PRKA 2IY9A 1DJNA 1IOWA 3OX3A 2ZWAA 3T52A 4DR1B 4HP8A 1Z5GA 1M2EA 1GN8A 1KWKA 1DDOA 1NXWA 3E9DA 5FP0A 2BP7B 5FWNA 4QIHA 3WGKA 4YT8A 2I7DA 4GI2A 4DCJA 2ZRAA 4YDRA 2F8TA 4RKQA 3LT0A 1CHNA 3NWPA 1L7AA 3NC1C 5ITSA 3MINB 7ADHA 2IC5A 3THWA 1YUBA 1U6KA 3JQGB 3V3TA 4HRVA 4JI6B 1Y3DE 1MRNA 1XQVA 2NTYC 1E5TA 2JAUA 2XUAA 1UMCA 4HDKB 4AROA 4DMHA 4EAAA 3GGDA 1Q5PA 3VHXB 1ZH2A 2PZ8A 3FLMA 4CPDA 4ZGBA 5TQ2B 1MC4A 1NVXQ 3FOEC 2PX0A 1P19A 3NHUA 4XR4A 2GBLC 4JBHA 1JA9A 1Z82A 4PTLA 3HCNA 5CDSA 4D9IA 5IHXA 4P08A 1PAUA 3CZ5A 3H04A 1C7FA 4P4SB 3UMBA 5C18A 1PEYA 2P11A 3JZFA 3I5UA 4HADA 2O8CB 2WSSD 4IHKA 4AECA 4O29A 1XHLA 1XPUA 1FRNA 1SC1A 1M8GA 1SFRA 3AKDA 2NAPA 2ZE8A 1ZD1A 3EIFA 4JYAB 1IU9A 2H2FA 5DI3A 5IAGA 1N5DA 4F2DA 3CPEA 3MT8A 4MYTA 5AJYA 2MCFA 3CLSC 4QDKA 5JWHA 4YCLA 4I99A 2VYQA 5ED0A 4ESHA 5JAMA 3PNPA 3PITA 5DB4A 5DHSA 2WTUA 1P2UA 4JQYA 4M3NA 1WBJB 4TMVA 4BDTA 2ZI9A 1FTWA 2XSZD 2QLBA 2DSNA 4MVYA 4RFSA 1CUUA 2YVUA 1CRLA 1G5RA 2VJMA 2OSVA 3C3BA 5EZYF 5EXPA 5BY2A 4FLMA 3K2IA 4C7MA 3HN6A 3GLFB 3BRWA 4YACA 3MOIA 1FFYA 3C1UA 1MEEA 4GUDA 3IP1A 4BFXA 4E5SA 1NSTA 2PRJA 3R1IA 2BR5A 3L0OA 2OK8A 3AUXA 2HDHA 2QI9C 2YASA 4MPPA 3NAGA 1TT5B 1XI2A 2Z2IA 3BGDA 3A1WA 4FOPA 3WGNA 1ESZA 3D02A 1XRLA 1QZTA 3TEJA 1ICIA 2JIZD 1EVKA 2A9RA 3EVCA 2QAGA 2VTEA 2Z3VA 4B83A 1YQXA 5JH7F 1HOXA 4X0EA 1W19A 4B4VA 4B43A 3P19A 4UU1A 5F78A 5AI0A 5H4GA 1AX9A 4L1KA 2BY4A 3JQCA 1TPZA 1SCAA 2QY9A 5ESXA 6ADHA 4QHTA 3C4VA 1G21A 5E9QA 4RADA 3CXUA 1P3Y1 1RAIA 2PD4A 3KD3A 1HFWA 3ZOKA 2VTVA 2V0GA 3KG2A 1IK6A 1G19A 1Q6YA 2GRUA 2ZTHA 3A1CA 2G5GX 3FNQA 1W8DA 4M0MA 4RABA 4UXIA 4DIOA 1XWIA 4OP1A 4RH1A 3T3NA 4LGVA 4X1KB 2DVMA 3X43A 3SQDA 3U19A 2RAVA 4GKAA 4Z6KA 3S81A 2YOFA 2NZ2A 4WW0A 5K0NA 3ZWMA 2J0SA 4L8GA 4UDNA 1ZD5A 5CDFE 5IFLA 1X7ZB 1E0DA 4GO1A 5WRFA 3ZWDA 4FONA 1XQ6A 1G4UR 4J0HA 2PMKA 3ZV4A 1TQHA 4DIDA 3NBXX 3QMMA 3L8ZA 1G8GA 3RUIA 2C9MA 1L5HB 2C54A 4P3YA 5DRYA 4BMZA 3O9MA 2W6NA 2BHRA 3AOEC 2HF9A 3RYIB 3GFGA 2H7YA 3EGXB 3B5EA 3I76A 4CZ2A 3SNHA 5A5DA 1CR0A 1WCXA 3DFFA 4BFTA 3LUBA 2FZ5A 4KG7A 4RPKA 4XTRA 2NADA 2JEYA 1DADA 4LKOA 4I1PA 2L19A 1RZ3A 2H29A 2BI8A 1E0KA 2FPUA 2ZIFA 3FXAA 2N42A 4G1EB 1JALA 4MLDA 1PT9A 2IW3A 2ZYTX 1O6FA 2F1IA 3LNTA 4ETIA 3UYLA 2IIQA 4TKVA 2NQTA 4EGCB 4QBGB 3WK4A 3KCNA 1N2GA 3EA0A 4JQZA 2Q7OE 3D2LA 3Q2OA 1ML3A 1N3BA 2TRSB 1G8KA 4FGSA 1I2CA 3R23A 2OGWA 1J2YA 2NU8B 4JI0B 2JLYA 1TMOA 5FL7D 4MS3A 3VHQA 3ZHZA 2QVXX 4U6NA 4URVR 1ONBA 5JC1A 2HA3A 4OQEA 4OYLA 1BYIA 2JL1A 3TMYA 2X9QA 5I8ZA 5A7HA 3QE4A 1A5AB 3LGAA 3LX5A 1FNBA 3O9ZA 4PLPA 1RMYA 1SQ0A 2X4IA 3F3MA 3QFFA 1T0PA 1I3OA 4KQGA 1Y8RA 2RHWA 2O3JA 1SU8A 4ZIRA 1ZNYA 1P60A 2IY8A 3DAOA 2CL7X 3H1AA 2G40A 3N76A 4UPVA 4DA9A 3LCMA 2YR0A 2QZSA 2AMVA 1OVGA 3O8LA 4YYZA 1GDTA 1BMTA 3D6VA 4LF4B 3FDZB 2IUYA 4N8DA 5KVAA 1JE0A 4BWGA 2JFPA 2IEZA 5T41A 4MV9A 5H5JA 4B6QA 3WYCA 3W0LB 1QSGA 1B0ZA 4BKPA 2O4UX 2IH4A 4OB8A 2VOJA 3PB3A 5ALSA 3AO0B 1F17A 3ZHVA 3WMGA 2DETA 2ZSFA 3HUUA 4Q15A 2BZSA 1X0VA 2QP4A 2Y71A 5B57C 1CJUC 4MP6A 5CH5A 4HLDA 1NBOA 4PHCA 3AHHA 1RLUA 2B7LA 4JI4B 1KE1A 1O08A 1XEXA 4GT1A 2YC2C 1YCFA 2D62A 5EJ7A 2A0UA 3LZDA 4GPEA 4U2FA 1E6UA 1LPAB 4G4SO 1R88A 1FMLA 1DFIA 5EZSA 3VR5D 1M2NA 1ZESA 2H7VA 4E5KA 4Q4AB 4V0KA 4Z4HA 3V8QA 2PXHA 5AHOA 4M4SA 3OAAD 3JYPA 5JJIA 1U4SA 4JLVA 2AGVA 2FW8A 5C4MA 1QKKA 2WB4A 3WL5A 1E0SA 2QTTA 3KYCA 3D6UA 5A02A 4CL2A 4LF5B 1CR4A 2DPGA 2EFJA 4ARIA 1O94D 1X7WB 4LXHA 5DHQA 4CCWA 4EMSA 1K6JA 2RB5A 2JNWA 3BK1A 2JZCA 4QPNA 4AMZA 3FVQA 1O89A 2A4KA 5IDWA 5CEFA 2HJGA 1JVNA 4PRZA 3EPJA 5BT9A 1OV6A 4JLUA 3GUHA 3PHBE 1HNWB 1QO0A 3JQ8B 3AHCA 1AZWA 1KFEB 1V37A 4EAQA 4PSAA 1PNVA 1YR6A 3PYXA 4KOAA 3QX3A 4X1IA 1GWNA 3HU2A 3DUFB 4YRQA 3A1UA 3ZKWA 3OJEA 4WHMA 1BKYA 2XKJE 1U0FA 3IUEA 1XMJA 5A0FA 1AUXA 1MJGA 1N6RA 5FTNA 3ZVNA 2GARA 1YVDA 4X6YA 3QF7A 1X3LA 5J63A 3W2HA 5JRZA 2DE0X 4EYQA 4ENWA 4RZ2A 1Z68A 4I1SA 1ORHA 1H0KA 2D2IA 2HO4A 2X7XA 4R5HA 1WXHA 3OHMA 4WDQA 1FFSA 2CK3A 1Q0PA 1FPQA 4RZUA 4DYVA 1X7YB 4JI8B 4TMZA 1ZMTA 4X7BA 3FSGA 4H3SA 3KQPA 7MHTA 3MCWA 5ALQA 2FETA 2P4QA 2HQRA 4A2WA 1W34A 3FTDA 1XEWY 2ZAGA 1R5OA 4GC5A 3F6YA 1BC5A 1O6ZA 3FCUB 3PLNA 5K4HA 1YVRA 4PLVA 4PSCA 2C92A 3T4UA 3VA7A 4EGQA 1JH9A 2I9KA 3ASZA 5ECGC 5LQNA 1F60A 2I8LA 4C6TB 1ZRMA 2C9ZA 2OWDA 3QELB 1I1QB 1DBVO 2C96A 3QPDA 4YLEA 4V1CB 1DAPA 2B6NA 1Z07A 1H2BA 1O9BA 2L17A 1RLMA 3DFKA 1E1QA 5E2BA 1HSZA 1XALA 3MD0A 2UZIR 3E9RA 4KACA 1XLUA 2G5CA 3CRMA 4DSTA 2BJWA 2Q9BA 3K35A 1ID1A 1AN9A 1EXMA 4L0MA 5FOTA 3TZKA 3A6EA 5A5FA 1NVDA 1S9DA 3D6TB 1AKWA 1NDQA 2Y1KA 4K6FA 4TM7A 2WHQA 3IEXA 5C52B 1LS1A 2MHCA 4N8EA 1QTIA 2VIIA 3JQ9C 4UCQA 1RLJA 2C8KA 4R7ZA 1UEIA 1U8UA 2VJCA 3B85A 3N53A 4KNVA 3BDIA 4RPJA 2RMKA 4LV6A 1ZZGA 3WHIA 5DIFA 4Q1BA 1HLGA 2ZJAA 2JHAA 4QG3A 3IQHX 2QRKA 4BVEA 4DM3A 3C3JA 4L3OA 5FPHA 1G8SA 2GXQA 2HCBA 2P4EA 1COZA 1WHTA 3LT2A 2J0UA 1LRKA 1UKEA 1L5HA 3W1EA 4NJOA 4XLLA 3UICA 3ICEA 4UTOA 2TS1A 2C00A 3T5DA 5F3DA 1XRMA 3KQLA 4WASA 2QK4A 3DE2X 4L8FA 1FA9A 1GO2A 2OUIA 2VATA 3BIXA 4JCOA 4FFSA 1CY2A 1CS0A 1KSJA 1XTQA 1CYDA 1L4GA 3DMNA 3BHMA 1JV2B 4KUHA 3ZK9A 4D74A 1E7QA 5HRAA 1CDZA 1Z2AA 4D3DA 4H0NA 2QEQA 1COWD 1W30A 4LY3A 3VSDA 3GPDG 4O4JF 1EK0A 1K6MA 1CRZA 1A2OA 1IWOA 2PL3A 1H3FA 2CMKA 3CW8X 4M1SA 2A1TS 1TIBA 3H4VA 4OOEA 4YP5A 4DCVA 1ZOOA 2O2DA 3SXJA 4NEQA 4RTPA 4KO1S 4N9QA 4Q21A 3OA0A 3DV2A 4CM9D 1TEHA 4EM6A 3OTOB 4HJXA 2GHRA 5CCDA 1DC4A 2NU6A 4RANA 3IQXA 1SBZA 5E7MA 1XP5A 3IDFA 3E05A 2GPWA 3K6RA 4MVJG 3RI3A 1IHXA 1G0OA 1J20A 1SXQA 1KQFA 1AV7A 3IBGA 4QOHA 3I9NA 3ICPA 4KXFB 4ENUA 2WP8J 1UPBA 2IDMA 1TC1A 3TRIA 2ODBA 3E58A 3FPSA 3FNHA 1J8VA 1E1MA 4D7AA 4UHCA 3LFUA 1D7AA 4L7QA 4KKXB 3TKLA 3OKAA 3UB4A 1FXWA 1Z8HA 4MW4A 5JLJA 4G4GA 4PO3X 4Q93A 1U94A 1E3SA 2I9PA 4E15A 5LD2C 4XVCA 1CUDA 2G07A 4QVIA 4L78A 3BORA 4LZAA 5CEJA 1HETA 4Q18A 4YAUA 2IOQA 3KT3A 1R6AA 2HCJB 5A9TA 2CXPA 3DD5A 3IQZA 4IZ6A 4UATA 4BUJA 4DYHA 5EOVA 1RJWA 3K53A 3KQMA 2AZTA 3ZR4B 3EG9A 3NRBA 3QBDA 3BF8A 2Q6OA 1E4YA 3FFTA 2EXXA 1P9WA 2BFNA 1UOOA 3H9JA 2PY6A 1KAMA 2O07A 3A1TA 2YIDA 5FUBA 5G41A 2C2BA 3T3EA 4ZZ1A