1EGQA

Enhancement of enzyme activity through three-phase partitioning: crystal structure of a modified serine proteinase at 1.5 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE K
publication title Enhancement of enzyme activity through three-phase partitioning: crystal structure of a modified serine proteinase at 1.5 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2000-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1egqA00
1TMGE 3DE0X 1GT91 2Z2XA 1GTG1 1JEAA 1LW6E 2ZWOA 1TO1E 1WVMA 1S2NA 1NDUA 3VV2A 5CW1A 1AV7A 5FAXA 4DJ5X 3LPDA 2B6NA 2ZRQA 2ID4A 4DWWA 5JXGA 1VSBA 1P7VA 1R6VA 4H6VA 3I30X 1ZVKA 3DE2X 4C3VA 3DYBA 1Y34E 1SUDA 5B1DA 5SICE 2PKCA 3QMPA 3DVSX 3AJ8A 1Y9ZA 1YJAA 2W2OA 3I2YX 1T1IA 1Y48E 2W2NA 4MZDA 3L1KA 1Y33E 1BE6A 1TECE 1P8JA 3VSBA 3ZXYA 1GA1A 3PRKE 1GNSA 3WIUA 1MEEA 1AU9A 2PWAA 3QFHA 1SN7A 3DE7X 1Y3CE 1WSDA 1WMFA 3A3OA 1SVNA 3UNXA 5FBZA 4WOBA 5AVKA 1T1GA 1NLUA 1SBNE 2G4VA 5JXHA 1EGQA 4WOCA 2PYZA 3BPSA 1SPBS 2IY9A 3PTLA 2E1PA 2Z30A 4AKSA 1KDYA 4B5LA 3TI7A 2TECE 1ST3A 2XRMA 3HJRA 1WMEA 1KDZA 1DUIA 2SECE 5AMXA 1SUBA 2Z57A 4C3UA 5B1EA 3F49S 1BFUA 3VTAA 1BFKA 1Y4AE 3LPCA 3D9QX 1SIUA 2V8BA 1AF4A 1OYOA 3A3PA 2W2MA 1IC6A 1AK9A 1TK2A 3DE6X 4M1ZA 3DE4X 2PRKA 3EE6A 4KB5A 1GNVA 4GI3A 2ID8A 1V5IA 4DZTA 4HX2A 1BJRE 3AJ9A 3H42B 4J94A 1MPTA 1AH2A 4Z2AA 2WV7A 3WHIA 3DWEX 3DVQX 1SBIA 1R64A 4ZOQI 2ST1A 2HPZA 2PMWB 2QTWB 4OMDA 4NMXB 1IAVA 1UBNA 3DE5X 1SUPA 1SIBE 3CNQS 1YJBA 1AVTA 1THMA 1Y3FE 3Q40A 1SCAA 3A3NA 3I34X 3DVRX 1KE1A 1SCNE 3DW3X 3LPAA 1XF1A 1DBIA 1Y4DE 2WUVA 1SCDA 1HT3A 1SELA 1PFGA 3T41A 2SNIE 2SBTA 1Q5PA 2DQKA 2DUJA 3F7MA 4AKTA 3I37X 1NDQA 3VYVA 1R0RE 2PQ2A 1SIOA 3DE3X 1SUEA 1PJ8A 3GT4A 4LVOA 1SBCA 2Z2ZA 4CFZA 3TI9A 3SQOA 4H6WA 2XTJA 2ZWPA 1YU6A 1SUCA 1SCJA 3VV3A 1GTJ1 3GCWA 1GA6A 3AFGA 4LVNA 1BH6A 3OSZA 3EIFA 1V6CA 3GCXA 1TO2E 2P4EA 5ARBA 4YN3A 1TM3E 4CFYA 1C9NA 2SICE 1TM1E 1Y1KE 1BE8A 1ZVJA 2WUWE 5ARDA 2X8JB 3SICE 2PWBA 5JMOA 3EDYA 3TECE 1P7WA 5ARCA 2W2PA 1KE2A 1TM5E 4HVLA 2Z58A 4KG7A 4K8RB 3GT3A 1GA4A 3VHQA 1T1EA 3BGOS 3DW1X 1SUAA 1GTL1 4CG0A 5I9SA 1TM7E 1Y3DE 1AQNA 1CNMA 1PEKE 1C9MA 3DE1X 1SCBA 5AQEA 2Z56A 1S02A 3CO0S 3DDZX 1OT5A 4NE7A 3P5BA 4H6XA 4I0WB 2Z2YA 1EA7A 4BWGA 2DP4E 1WMDA 5K7SA 1OYVA 1CSEE 2GKOA 3Q5GA 1Y3BE 5AVJA 3QTLA 3BX1A 1C3LA 5JXJA 1KDVA 1ST2A 2X8JA 3D43A 1SH7A 1GCIA 1S01A 1SBTA 2HD4A 1TM4E 1A2QA 2W2QA 2WWTA 4OV6B 3LXUX 1YJCA 4FONA 3ZXXA 3WIVA 3WQBA 4KPGA 1PTKA 4OMCA 1C9JA 5JXIA 2IXTA 4RYDA 3F7OA 5FFNA 4NE9A 1SBHA 4JP8A 4ZARA
chains in the Genus database with same CATH superfamily
3KVNA 5IJAA 1L8AA 1O97D 1VXRA 2WT9A 3OKPA 4OIFA 4KXUA 3KFXA 3QUAA 4JLPA 1GT91 3T54A 3TLBA 3ZHSA 2GAOA 3ZEAA 3LL7A 3B6JA 5KYVA 2Y0DA 5BSFA 3THWA 1SXPA 5HXAA 4DR4B 1VE6A 1LW6E 2ZJ3A 3OWOA 4P4UA 4TWBA 4TV8B 5JWRA 2CNWD 1UMCA 2C2ZA 4Q93A 1ISMA 3V8VA 1QHGA 3GP8A 2WYHA 2NSHA 3GZJA 2BW0A 2VJAA 3QVMA 3R3ZA 5DHTA 3GEBA 1I36A 2C57A 4B7ZA 3KT6A 4L9SA 3UJDA 5ESXA 4JODA 3MJHA 1YIOA 5EMHA 3W7BA 1KIMA 4RSHA 4PLTA 2L19A 4A9AA 3KOUA 5JQGB 2PFSA 1VE9A 4Q3BA 4R9NA 5HQ3B 3KSDO 4YP9A 1Z0UA 4G0XA 2AD5A 2FFRA 4JSRA 4RGYA 1J2YA 1VIVA 3AX6A 3F3SA 4WXMA 4A8TA 1WDWB 3TL2A 3NKLA 4ITUA 3GG9A 3WAGA 3OC0A 4UBJA 3HLYA 2D06A 2D1RA 4QFCA 2MMGA 3BGVA 5T4FA 2N1MA 1QBKC 2ASEA 3AHFA 4QUHA 4YJ3F 1XMPA 3LC7O 4NFSA 5FTJA 3FIJA 1HDIA 1YBHA 2OORC 1MNAA 1RWNA 2ZYVX 1U9JA 2YCLA 4GI2A 1YRLA 3HCOA 1RAAA 3DBRA 3F97A 4CEJB 1TFRA 1RLMA 5CNIA 5L3VA 3OQHA 1Y34E 2WABA 4OP3A 1COWA 2FNAA 3W34A 5DX0A 3IX7A 2WJWA 3ZU3A 1FUEA 2AFHB 1FSFA 4B4OA 5AIBA 5ITZA 2A4MA 3SJUA 5L3SA 2XMQA 3BDAA 1TF7A 3O91A 2A1TS 4O0LA 3T8YA 4YRAA 3TDKA 4LYJA 1UBJS 2BH9A 3FVTA 5AI9A 3WVNA 5HJ5A 1VDMA 1SC4A 1E5LA 1KGSA 1PWYE 2XR1A 2HXGA 6REQB 3KR0A 3ENQA 4I55B 3V4OA 4F8JA 1CQJB 1ODKA 1TGYA 2OENG 1Q0HA 2PSEA 2FOXA 4LSWA 3WYEA 3IV9A 1J07A 3H0EA 3HWSA 4JWTA 2ODAA 3OTOB 1S4QA 2OV4A 3O2SB 1ODIA 1JQ3A 3FJYA 4MO9A 1QGOA 2ODEA 2JH9A 4NBUA 1BE6A 3UHPA 5CXQA 5HM8A 4FOPA 4R2IA 4X85A 1IY1A 1VP9A 3C74A 4WJLA 3PZBA 1XHEA 3VSEA 2ZBEA 1T4CB 1Y1RA 5AKXA 5IK2A 4IINA 4BGIA 2WP0A 2FLKA 4HZUA 5H70A 5LQMA 2GD1O 4K9QA 3KQHA 1P31A 3OLVA 1NBIA 2GZMA 2GWHA 1X7DA 1PBTA 5D3ZA 1L4NA 2H5JA 1XD2A 4LXIA 1BVYF 4BECA 1CKEA 3RVOA 5GWXA 1EAMA 1STOA 4XX0A 4I36A 5EKDA 5C8VA 3KJFA 4DM3A 5C37A 3UWSA 3BH7A 1IIRA 3V8QA 2PR7A 2D5AA 2HQRA 4RU1A 4GBJA 4P80A 2D6FA 2H16A 4FKZA 1SBNE 4WV3A 2I3DA 1FK8A 1HYEA 5HF8A 3TVTA 2IH2A 3OHMA 4ZQFA 3IBCA 4WOCA 3OJEA 1BU5A 5K0SA 1O94A 2X14A 1HL3A 4LRXA 4B81A 4RZUA 3B2EA 3RVPA 1IHDA 1S5PA 4U9UA 4ZPXA 3Q7QA 1WOYA 2W4MA 1NPTO 3SBDA 2HHHB 2Z30A 2ZU6A 1X8JA 2HDNB 2I7TA 3V7NA 3AVQA 1IVYA 2BCGY 1SWVA 4AYXA 4NESA 3SC6A 4NXMB 3DHWC 1SD2A 3IA7A 2VXCA 1EK2A 1TZCA 1UOEA 4MICA 4KRFA 5EA2A 2WD7A 1ESNA 2YVUA 4F9EA 2HSGA 3IPLA 4N3AA 2OZEA 4NZ9A 3G8CA 3DO5A 4CF4A 4J43A 1J9ZA 5J4LA 1NQXA 3PJEA 4MWZA 1F2TB 5A3QA 2NP6A 2Q0QA 2ZJ6A 3DWFA 3HGTA 4U8HA 3A06A 4NH4A 4QPDA 1JEOA 3HC7A 3L1IA 4EBBA 4ER0A 1IU9A 5JIBA 3VISA 1MO4A 2IZZA 4RW0A 4IY1A 4ARSA 4QOHA 5J3JA 2BEUA 3LUPA 4KW7A 1X1CA 1RPNA 3SLGA 3O75A 3AF2A 1FDOA 3QNUA 4MS4A 2DR3A 3ZHBA 1BFKA 2AN9A 1Y4AE 4KUHA 1Z5VA 4DIKA 2C82A 5KCMA 3U4MA 3U13A 4C4ZA 3H5VA 3UC5A 2W2MA 1KK1A 3ZTWA 2H8GA 1DSSG 1IC6A 2JH8A 5A5VA 2XBUA 2VLBA 3RK1A 2HCBA 4FFBA 4HI0E 2OO7A 4TM8A 5DN6A 3GLIE 4CEIA 2OCYC 4Z9AA 4ZAFA 1P6QA 2W37A 4JASB 1H4QA 2HKIA 5I4IA 2V59A 2O7RA 2WFLA 2YZ7A 2A7QA 3QVLA 4U9IS 5DPMA 3UWOA 1AO3A 1E5VA 4YJGB 4BNNA 3IBYA 3N0RA 4UDXX 1NQWA 4MXDA 3K35A 4GGOA 3S2UA 2J4FA 4WTOA 5IBQA 1VIDA 4BIMA 3IL2A 4I6JA 3GMSA 3ILYA 4MEAA 2FJ0A 3ANNA 2HMYB 4J0EA 1NLZA 1TQ8A 1T2CA 4C29A 5IS2A 3T1YB 3SP1A 3N28A 2QN2A 3KWFA 5ALEA 1TTPB 3VR4A 2HPZA 3U3XA 5K05A 1RWBA 4OMDA 5IBPA 3WB9A 1LNSA 3K70C 5HOQA 2J9YB 4MS1A 4UAGA 4Y30A 3DUFB 2Z5LA 4RA9A 1P0QA 3DEZA 5EKXA 3FX2A 5CD9A 1J0XO 4JR0A 4M7RA 1E2BA 4U0KA 5BSHA 3ZVLA 2ONYA 4MEBA 2GRUA 1DBSA 4M9CA 3WLLA 2BBWA 1WCIA 1SUPA 1UZUA 3ZGYA 4MW5A 1V9SA 1EKXA 2B4YA 2G9ZA 4DQXA 5CJJA 4RAOA 3IQEA 3VNQA 1R12A 1M1YE 3C39A 1S3IA 2I3BA 3WJ7A 3TOXA 3WFIA 4TSFD 1V25A 2H51A 4PHGA 3Q10A 2DQZA 4JGGA 2PTGA 5M34A 2BFCB 1VBFA 4IQ0A 3COVA 1UXHA 1GU1A 3IAEA 1YZUA 1VPLA 2OKCA 3FF4A 4NCJA 2WIBA 1DAIA 1I0IA 1KNXA 1MO2A 2DPXA 2VZ0A 1ZZEA 4B3GA 2O4CA 3CLTD 3L0YA 3QE4A 3DZDA 1N5MA 1KP2A 2YC4C 1C3XA 3LPAA 1AKVA 3H1EA 1IXRC 3SHVA 4G9EA 1JYEA 4U02A 3IQXA 2XUOA 3LCJA 1DKOA 4IIXA 5DTQA 3SYTA 2OKGA 4LV8B 4NSNA 4O1IA 1JWBB 3EAGA 4L22A 4BNYA 3I2GA 2WQZA 4D6PA 4FDAA 1I1HA 5BYJA 2BT4A 4L5CA 1MVNA 2O5CA 3AHCA 2GSWA 5EIBC 1KERA 4G4SO 4MRRA 5ALXA 2X3YA 5ECDA 2EU8A 3EVFA 3WKAA 5CIYA 3IQDB 7MDHA 2IYPA 2R7KA 3RUFA 4YV2A 4JJZA 3F2IA 4MWSA 3C2QA 4DQDA 5JAUA 5IVDA 4PZEA 4IIUA 1AD2A 3NNNA 4HL6A 5DEIA 1QK3A 3WKDA 4KO8A 5BT8A 3QVJA 3QX3A 4YIKA 5ILOA 1T5BA 1YWGO 3P9ZA 3SBXA 4FW8A 4CIYA 5AJVB 1Q0LA 2PRIA 5ALDA 5EHQA 3YASA 2HHCA 1JKJB 1QFXA 3NYRA 3VJLA 4ZMRA 1EEXB 1W0KD 3RNOA 4B6PA 4I4TF 1ZVQA 3DOCA 1UZAA 1KVUA 1YFZA 1Z0ZA 3FPFA 2G7ZA 1EDEA 1O6GA 4G4IA 1VYUA 1LDEA 2H1VA 3M6FA 4M0DA 2ZP1A 2HWKA 4WHMA 4BV3A 4NZZA 1JV2B 4R0NA 1G5IA 4YMTA 5E6SA 1RI4A 2CYBA 4B3BA 1W0JA 2HV8A 4O2AB 3RH0A 5B6PA 4L1KA 1ZM2A 5DTIA 3TBKA 3CY6A 1EPUA 1BGWA 2CFTA 2ZJYA 3ELBA 3O8NA 4P84A 3WK9A 4LHWA 4AICA 4H6WA 1KY3A 1WX1A 3UAXA 1DOAA 1H69A 1TE2A 1S7GA 1MF7A 1U2RA 1Z37A 1PQYA 1Z7GA 3IUYA 3V1UA 4ZGWA 1W1IA 3H4VA 4GDFA 2WJ6A 4BMVA 1QX3A 4DVGA 3O7MA 5I8PA 2HA2A 4UCQA 1S3SA 4XRRA 2FRDC 4MQLA 4XWOA 3GCWA 4Q7LA 3O7WA 2FFBA 3JZAA 4GLLA 4PRKA 4JLDA 2QD2A 3WLKX 2VZEA 1QFSA 4K6CA 4OXXA 5L9AA 2HI0A 5EFOA 5CVCA 4W1SA 4FEEA 3B9QA 4L73A 4B3CA 2RJNA 1F51E 1D09A 2Q1YA 1JW9B 2G8LA 1K86A 2QTLA 1RJDA 3RHZA 4G1MB 2VT7A 1Z56C 2B4KA 2HDWA 4OH7A 2I7XA 2ZTMA 1FSGA 3RRXA 1NSFA 1EX9A 1C9NA 5C52B 3WGMA 1C8BA 4LQDA 2R84A 4C4TA 4RY9A 2WWGA 3ILSA 1V43A 2BAGA 4LJ9A 5CT9A 5AR1A 1OA0A 5FOUA 1TA0A 3AQIA 2PWPA 1Z4PX 4TRMA 1SWWA 3LVQE 4YBRA 5ARDA 2AGVA 4ZVMA 4WACA 5HIMA 3WGNA 1QZUA 2FPOA 5JVDA 1MG5A 2YOHA 3CVXA 3RADC 1A7JA 5M3BA 3PCXA 3VYRB 3I62A 2J1LA 4NTZA 3GPDG 4CUZA 1U8YA 1FYDA 3KD3A 1PZFA 1XTIA 4QUKA 1KE2A 4Z8XA 1JU9A 3KELA 2QYOA 4M8IA 5THQA 2CMHA 4AF8A 3THYA 1L6RA 4DR7B 4YJ2A 1QUEA 2BEJA 3A1FA 3I1IA 1WLYA 1ISRA 4OQQA 1E2NA 3OU2A 3PC6A 1PJCA 3KSRA 5EIXA 3JQ8A 1UDXA 4XVUA 3BGOS 2H2GA 1DG3A 5JYBA 2LZ0A 2I8CA 4IF6A 4ISBA 1SUAA 1FS5A 1ONNA 3CSSA 1OA1A 3N8GA 1QF7A 4HR7A 3WP1B 1JALA 5KNBD 1XQ1A 2HSZA 5MFZA 4L5AA 1QF9A 2ICAA 1EVZA 2ZDQA 4MS3A 1OOEA 4KI7A 2IYUA 1H8ED 3QVTA 5IANA 5ICCA 2EEPA 1X7GA 2O2SA 3N58A 3Q4GA 4KL8S 1LPPA 5DBFA 5FPYA 3QEAZ 1AQLA 1HA3A 1ZISA 2BTOA 3P2KA 1AKRA 5CK4A 5CYOA 3R9XA 3PF8A 5JAHA 1JKFA 1C9MA 2QLBA 5G1PA 4YP0A 1ZR4A 2I03A 2QROA 1FYWA 3GFVA 3I0MA 3G9UA 3SZRA 3L01A 3UVEA 4ZANA 3HB1A 3NATA 1CUCA 4NCNA 4OYLA 3KFLA 3L07A 1NJ2A 2EWWA 3MJ4A 2ZUFA 1QIEA 1J2JA 1FDUA 2O2JA 4IKOA 4AO6A 3PNVA 2NO1A 1G5RA 4QJ5A 4ZJUA 1F4LA 3SKYA 3VPXA 2FX5A 4LG1A 3FBGA 4BNIA 2Q9AA 1Y98A 4X3OA 4BN5A 1PVDA 1Q1AA 3Q6NA 3GARA 2D13A 1AOXA 3KRTA 4A16A 4HAIA 1O95D 4NULA 2R60A 3LP5A 2R8ZA 4XOIA 5FPSA 4FP9A 1YULA 3NVKI 1M5UA 4EFKA 3FTFA 1JHDA 2BEWA 1AB5A 2X13A 3FVWA 3I1YA 1MEJA 4DILA 3G23A 4IDPA 4L07A 1VMIA 2DWCA 5AVJA 2B8NA 5IDQA 3MGKA 1J0CA 1J8FA 2XDAA 2P1ZA 3DAOA 4K9MA 1XYVA 2FUNB 4TSKA 4YRFA 1BWSA 2JFZA 2EX1A 3ZWWA 4BKMA 5B4UA 4WVLA 4K81B 3HM9A 2JGFA 1CVRA 3BJIC 3I0NA 1XAJA 4HVAA 3ONDA 5A6SB 4ENWA 5MN5A 2JGDB 2IPAB 3TD6A 3ETDA 4IKPA 4BP9A 4V0ME 3IAM1 3L1UA 1ZIYA 1NQ5A 5G0VA 2R97A 3T5TA 3O8QA 2JI6A 4S05A 2XLBA 3PNMA 1KJWA 1NF9A 4L3OA 3RVMA 3GVCA 1N2EA 1QIIA 1CR6A 2VNAA 3ASYA 3GLSA 3LDHA 1JIVA 4GYKA 3FTNA 5HK8A 5HRUA 4LJRA 1LWNA 3IEMA 3OIFA 1XMOB 2BKAA 1VRCA 1F5NA 3GJSA 2NZUG 2J85A 4DE5A 4I50A 4M2LA 1XRRA 2BPOA 4JVOA 3T7AA 2CL6X 5DX8A 1L8OA 2O52A 3M1LA 1BJKA 4HXFB 4YFVA 3H3FA 3R9KA 3RRYA 4B6FA 5EIEA 3ER8A 3BJMA 1T91A 4I1OA 4KPUB 4P58A 5CTJA 3AEKB 4Y9SA 2HSDA 2VYFA 1NXTA 5GOTA 3MVEA 3LNCA 1RQNA 4CKCB 1F8XA 3HSKA 1J5PA 3E3NA 3SIRA 4YYEA 2Q28A 4AD8A 1QH1A 4FDVA 5JXIA 4W9MC 5TX7A 4ARAA 2O0LA 3LY8A 1W8DA 1XSEA 2GAAA 2I9KA 5CYPA 1Y8AA 1NHWA 4JHLA 1JHAA 4QL3A 2B0JA 2I78A 1UOQA 3VDQA 3QG1A 1ZH0A 2FN9A 3M5DA 2R2AA 5J58A 4WZ6A 2B2XA 4GE0A 1HLGA 2I99A 2XQVA 2GBCA 4EF5A 1IM5A 1A77A 3L7LA 2H1IA 4RIEA 3HGMA 3S8YA 1JRLA 1YHNA 3KEMA 1O54A 5DI3A 1K8XB 5SYNA 1BXZA 3R6DA 4HY3A 2RK6A 4M1TA 4BN4A 4ZEOA 3RJTA 4MIKA 5ER6A 1GTG1 4N0MA 2O8EA 5LUAA 5K8IA 3SVTA 2O4UX 3CJRA 4DLZA 2D0IA 2EZUA 5LL6P 5IJ0A 3IBFA 1PR6A 2IDMA 5BN1A 4FE4A 2EAUA 5CH3A 4RF4A 1HEUA 3HKDA 4V0OA 1PIWA 3V8NA 3GLGB 3S1LA 4Y2UA 3LT1A 5BVHA 3LQ1A 4M9ZA 1FX0A 2IHKA 2RB5A 3EGXB 5BNTA 1YK0A 4U6SA 1LNQA 1VL1A 4DWWA 4Y67A 4NECA 1J33A 1Y5IA 1F4PA 2EF0A 3BD8A 3IJPA 1VMKA 1Y89A 2CNBA 3C4VA 4HGYA 4LYFA 1UT5A 5A05A 4DLRA 4PAMA 4LI0A 4LF8B 1RQGA 3MJRA 1R6VA 1PL7A 1XZNA 3DL7A 4H7FA 4MYCA 3L0SA 5DFAA 1PR2A 1USUA 5HZMA 5EPUA 4RKWA 2BJVA 3LX8A 3EIEA 4RGVA 1PSWA 5LBIA 3B1JA 3UBMA 3KP1A 2JC3A 1KBOA 1TJ3A 2A1TR 4NOKA 2LDBA 3DYBA 4PG8A 1IEWA 3CNOA 5C9ZA 4JI0B 3QLJA 4ILEA 2EG5A 4GOMD 4YC7A 2IV3A 2WSLA 1FUYB 2HHJA 3W6UA 2TYSB 3CNBA 1O0SA 1ZW1A 3MT7A 1BGVA 4L02A 4D45A 1GM5A 4S04A 2PMKA 4F3YA 2JVJA 3RU7A 3WV4A 1FRNA 3OKFA 4RSGA 1ZLXA 2WR8A 3CH6A 5SICE 2B9VA 1OGJA 2CLLB 3DWGA 3E5NA 3U7QA 4D74A 1A9XA 1IWPB 1RACA 4BGUA 5HSGA 2QX4A 2A7XA 3ZJUA 4UPVA 4NDNE 2FPKA 1NFQA 4M9SA 2P6RA 3JV7A 3NHZA 4MHSA 4UCFA 4ZP1A 1S96A 3HE3A 4PAWA 1T1IA 4O1MA 4AS2A 421PA 1NM5A 2A5LA 3R1IA 4L2IB 3HH8A 2V9CA 2VYQA 4UJ5A 5K0BA 1PNRA 3ICEA 2V96A 3PPYA 5LP6B 5KO2A 3URKA 1DGQA 4PCAA 4BRSA 5DK4A 2IV7A 3ZV5A 1XG5A 1YVEI 2XNDA 2Q07A 3EFEA 3JALB 5A1TA 2O2GA 1E96A 1CY4A 3NO4A 1KY4A 1O5OA 3INYA 2Z4RA 1MA3A 3IC5A 2IF0A 2PGNA 1EGHA 3CH7A 3FFXA 4MYSA 1RIIA 5CB6A 3KWJA 4ARZB 5B7NA 3AEUA 3O8CA 4IIHA 4A4DA 5AVUA 4JI8B 1PFVA 1EFPA 2EXXA 1Z0DA 3H13A 2VDRB 2VQSA 1NIJA 3W5AA 4JQSA 3ZDEA 2C5FA 1H5UA 2EKLA 4ZJYA 1QV9A 3TZQA 2IT1A 5KX5F 4PG6A 4RQTA 5AVKA 4UOEA 4ITRC 2I3GA 3GUCA 3R6TA 3O1IC 1Y6FA 1NUQA 1YVUA 5ESRA 3FKSA 5F4ZA 4JXKA 4LX0A 1MG0A 4R2JA 1OROA 1EXWA 2IY9A 4UVEA 8GPBA 2YFQA 1B2LA 2ZJ0A 4P1ZA 1E8MA 4KXVA 3BD9A 1ZJWA 1FW8A 4MP6A 4EI8A 3D5TA 2X8BA 4N0DA 5TQJA 2PKRA 5KQLA 2I2WA 1F20A 3PCRB 1DPGA 1H0SA 4XB2A 1MVOA 1BMFD 1ECPA 1PFUA 3JTMA 5JYEA 5EJMA 1YVDA 3ZHTA 3KE9A 4D9EA 1B0ZA 2KBEA 1VG8A 3LT4A 1TOAA 3MINA 4NQRA 1DUIA 1M6HA 3L43A 4URFA 3AM1A 1O5IA 2F9MA 3AERA 2RHRA 3VJMA 3OCYA 3OIWA 2XCTB 5AMXA 1K4KA 1NHGA 2WE7A 3PG5A 3LBFA 4NP6A 1KEPA 1JT9A 1DHTA 2JLAA 4RVNA 1YR7A 3SOZA 5GJBA 1VDZA 3QYPA 4DCNA 4XQGA 4FMCF 3T3GA 4E4RA 1MJ5A 2C4VA 3KKZA 2GM9A 4LNHA 1VBKA 1G20B 2OORA 2V1XA 4RC9A 3UAOA 4GRIA 3SSAA 1K7YA 1MOPA 2JFGA 3PXBA 3PFFA 4F4UA 2PG3A 3CLRD 3C4JA 1Q0PA 5G02A 3FOEC 4ZOLF 3CJTA 2LRHA 3CH5A 4EJFA 5B55A 3UPUA 1YRQA 1UDCA 1FQKA 3KQQA 3TR5A 1T9AA 2PXHA 3AH8A 2CXTA 3ETEA 3IJEB 4KGDA 3JTEA 1V5WA 2VN8A 4ERNA 1VIMA 1NUPA 3AFNA 3HU5A 2W6NA 2FW6A 4OJNA 1V5IA 2V5UA 5IH3A 1KORA 1RWWA 3RYFA 1WNTA 5TT0A 5DNDA 3MW8A 1JA9A 4CMAA 2GKSA 3HCPA 3EPKA 2PBZA 2ZJ1A 3ES9A 3VMMA 3WLIA 2CMFA 2JCXA 4D5EA 3PENA 3QUCA 4I81A 4BC1A 4MJXA 5DGHA 5LCXA 3LCVB 3DWEX 4Z2AA 1SBIA 5DRYA 2O0MA 3QXXA 4YP6A 3C48A 4L50A 5A4IS 5CLIA 5C8XA 3PIRA 2HT1A 3TRKA 1Y8QB 2QZ9A 4I9GA 3TW4A 2CKMA 3PB3A 2P6MA 3OZIA 1CIJA 2O7QA 3BBLA 4I1VA 4OHYA 3O2JA 4Q21A 1VI5A 1GP2A 3SKVA 5H59A 3ESDA 1RWOA 1K2WA 4PZYA 1WTCA 4CFSA 4W5JA 1AMNA 3OEED 4RVHA 1GAJA 7GPBA 2O8BA 5DBHX 1LW7A 2CL7X 3OT4A 4CM5A 1W6RA 1ZC3A 1VP3A 3EVGA 3WDMA 2ZLBA 3OJ0A 4BLTA 4E5VA 3DE5X 5EMLA 3SX2A 4E1AA 4KO4S 2I91A 1PYGA 4EYQA 2YHAA 3PX3A 4ZI3A 1RCFA 2X5NA 4QXQA 5HWSA 4NU6A 2CLEB 2P6NA 4CKWB 2FZLA 3WGKA 3WMGA 3MCWA 4D9KA 5E1BA 4YUWA 3EG5A 1I3KA 2O2HA 3MIIA 1E1LA 2F64A 1Y3FE 3ESYA 4MLDA 5EZYB 1XTSA 4IPTA 2Q5EA 3Q40A 4E51A 4JBNA 1UWKA 3A0UA 2IPLA 1Q7EA 2J6BA 5DLEA 3VR5H 4URVR 1UKBA 2UYGA 3CPSA 5BR4A 2E2WA 3THXA 1HKHA 3BE4A 3I58A 3K1TA 4N5DA 4WAUA 2VTVA 2PUJA 3I9JA 1OIWA 4EHKA 5AKKA 2O2YA 4KWEA 5JHHB 4B6GA 1G3MA 1O96A 3R0JA 4FIZA 1PLKA 4J29A 4ZOCA 5JPIA 1HQDA 3ZLVA 5ADHA 4UHKA 2WUVA 1VPDA 2QL5A 3A9UA 5E4YA 4LF5B 1ZK0A 2EWVA 1CFZA 2I6FA 2OY0A 3IT1A 3PU6A 3WKEA 4Q01A 4Y1RB 2QVGA 3G6KA 4MA4A 2YR0A 4HRXA 4RMJA 3PL1A 3AVVA 1QWOA 2FFAA 2HSWA 3QFTA 4AUKA 1ISSA 4MQ6A 4B80A 3C1TA 1Y1SA 5KVVA 1Z0JA 4GX0A 3SE7A 2Q27A 2WJPA 3HJNA 3RV4A 2YJ4A 2PLFA 3V48A 1DAOA 4IDGA 3X44A 4KIJA 1J9GA 2XE4A 4J3NA 2W2KB 2CDNA 3HZOA 5A3JA 4MHTA 1Q77A 3PHIA 5E1DA 1C30A 2J7PD 2C29D 3WX0A 1DEKA 1QGUA 4I1RA 2H57A 1PG5A 1U7TA 1PZGA 2YXLA 3B3QA 3QBTA 3EZGA 5KKAA 3FE2A 1F0YA 4FYPA 1XA3A 3H9EO 4TLCA 2X0DA 3QKTA 4K8OA 3SQDA 5KWEA 3ZLUA 2CVQA 4CV0A 4NRDA 1MT3A 1U7WA 2GLTA 1YVRA 3O93A 3FPHA 2W4QA 1CT9A 2CXXA 1XWIA 3W8RA 1GRNA 1NVXQ 1JDBB 4JXXA 2EQAA 5BSUA 5HIJA 1R2QA 4LRUA 2CUTA 4QWWA 1G6OA 2YHSA 2ZB8A 1U2DC 2OYSA 4D4IA 4ZTUB 3SQOA 3VZDA 1R3UA 4WK2B 3HU2A 2NZ8A 3D7SA 2XB8A 1G19A 3BSWA 1W19A 2XTJA 3HP4A 3PNPA 3C5VA 3OLWA 4OQYA 4QO8A 4DV3B 1CQIA 3AVYA 4LE0A 3GC6A 3ZW7A 1MIOA 1Z82A 4G97A 3ELDA 4N6GA 1K4MA 4CMGA 1JGTA 1U63A 4YRSA 4EITA 3RRFA 2CB0A 1R9MA 1E92A 1Z4MA 3IUBA 4FYJA 4HJRA 4Q3DA 1CJMA 3PUYA 5B36A 1XTJA 1BDJA 2NVBA 1EDBA 3AFGA 3ZWAA 3O9ZA 2IUSA 2PXXA 4C0WA 4KOAA 4DM4A 2EFDB 2AVDA 5ISMA 1N78A 2BGWA 3U4IA 2R1VB 4E08A 1P73A 2NSDA 3HYSA 3WA7A 4E5UA 5I9IA 3UK2A 4LDNA 4UMVA 2PVPA 2P4EA 5ARBA 1Y1LA 4P4LA 3VNAA 3Q87B 4TS4A 4DA6A 2EFGA 4WY2A 2F8LA 1DV1A 3A4YA 1S9DA 2FE1A 3IS3A 2GYUA 1RPAA 4IIJB 4FGSA 4ZVTA 3B3GA 2XGGA 2ZB7A 2O2IA 4FD2A 1Y1KE 5JVDF 2XJ4A 2A94A 3VC3A 2X3FA 3X43A 3GDHA 1A95A 3TUIC 4GXRA 3BWDD 2YNMD 2FWIA 3AF4A 1YL5A 1VB5A 3KHSA 3QW2A 1J09A 4PQYA 4WZBB 4DYDA 3NETA 4QREA 4MKFA 5J2TA 1RHMA 3SSOA 1RLUA 4RSMA 4BLVA 3AB3A 1L5HA 1CJTC 3IAHA 4PSVA 3SU8A 3FLAA 4DUPA 4L7VA 1X1BA 3HB4X 5ESWA 3A1EA 5GM2A 4RKQA 5LUBA 1JFVA 4RORA 2QG6A 3A14A 3QEMB 2DHRA 5C0OE 2H2HA 1KK3A 4TTJA 2VR1A 4TXNA 5D3QA 1D1PA 4W7SA 4CUKA 1NKVA 1PW5A 3HR8A 2G4LA 4TTIA 4NPCA 3SF8A 2HRBA 4D26A 4Q4HB 1FSPA 1Z12A 3MPUA 4U6NA 3S1SA 2ORVA 2PANA 5LQNA 4RZSA 3OF3A 4LJ6A 3DW1X 1RRCA 2BHSA 4M8KA 4L0DA 5ECWA 4RDCA 4JROA 1V6SA 4EF6A 1T8SA 3WIBA 2HMVA 1U99A 3F6CA 2DFLA 5HP4A 1G3IA 4FHZA 3PYXA 1PR4A 1Q6YA 3A6ZA 1AKQA 3E7DA 1V48A 3DVAA 3I32A 3C3DA 4HNTA 3LWDA 4BXOA 4DNXA 4YB8A 3IAUA 4N4AA 1U3TA 1VJ5A 5B1IA 1V8ZA 3UBTA 1SQ0A 3EMBA 3OBBA 1BE0A 4B44A 4OOEA 2RGDA 3S81A 1KKLA 4D9JA 3KEQA 1I4LD 3NANA 2C94A 2G82A 2JIZA 2VPWA 4PYRA 4ZAGA 3V34A 5A5DA 3AESB 3RM3A 1XV5A 3WYGA 2GN4A 3VZRA 1DXOA 2XCLA 2E4WA 3BH0A 5JE8A 3MRXA 5FLYA 2Y68A 3RTEA 4HSEA 3UYKA 4OX9B 4ZDWA 3CT6A 3U31A 4AK9A 1I94B 4J6EA 3KT8A 3PEUA 2WHPA 2H4HA 1M0SA 1TIKA 3KD2A 3QUQA 3V1TC 3UXHA 2HCTA 2NXEA 3PQ2A 2W2LA 4OBXA 2OE2A 2PO7A 1NV9A 1SD1A 1ORWA 1V7ZA 1VHDA 3DR5A 2ZBVA 3ZCRA 2GKOA 2FMTA 3I2IA 4Y7DA 3B2QA 3BRWA 3H84A 3UTDA 4U39A 2ZYWX 1BMDA 1C7FA 1I1QB 1E58A 1XF9A 1Y3BE 2FSSA 4D97A 1G0NA 2REQA 3KJQA 3CA8A 3C3KA 4LJYA 3FNFA 3RU3A 2OBXA 3OMXA 3ZNNA 1WBBA 1R50A 1ZU5A 4L8GA 1KDVA 1G4HA 1UH5A 4DNQA 1SU7A 3U4HA 1NUUA 1E89A 3ZD6A 3OG9A 2FRDA 4NENA 3BIWA 4AFNA 4PE5B 3WYFA 1CNEA 3SMQA 3NGXA 3TCXB 3VX3A 1E5DA 2EKPA 4RK6A 1QTIA 2VAWA 1H23A 4Z54A 1CF2O 4EPWA 1RRGA 2P3SA 2BFEB 5DDIP 4B3XA 5I01A 3ADOA 2WVAA 3B20A 4I50F 4R9SA 1XZGA 3F3MA 3KS9A 1PQPA 1T3SA 2JS7A 4ZRDA 6GPBA 5JH7A 4EF4A 4NBWA 4A7PA 2CHQA 2EBHX 2GCEA 4ZIRB 2RK3A 5B3LA 1BDIA 2BTEA 3IP3A 1FMJA 2DYKA 4Y2YA 5SY9A 1L8QA 2NO5A 3U9SA 4PVCA 2ZRCA 3KTFA 2NYAA 4BDTA 2IYEA 4EFMA 1JHMA 3PGMA 2E5LB 4UVIA 5FI1B 4E7OA 2LNDA 2PX8A 2VSOA 3JR7A 4I8DA 3UXMA 1PS9A 3D31A 3K2IA 3QUSA 5FIUA 4KAAA 5KQMA 2LTAA 3D3QA 4Q19A 3ZWOA 1C9JA 4TZTA 3DNPA 2QDKA 4QU5A 1N8SA 1B8PA 4JYZA 3VOAA 2AFIE 2BEVB 4U1RA 4B3IA 5JZSA 3VTFA 4GP6A 1ISJA 5DGIA 4OLBA 4YJHB 3K0FA 1A2KC 3AY6A 1LVGA 1QR2A 4ZVSA 4KYVA 1G16A 3C7KA 3HL0A 3MFYA 1ZJ4A 3TTUA 4DMFA 5MGNA 1E79D 4KDCA 5AJXA 5FXMA 4M37A 3WA6A 3VR3D 3CRW1 1ZGCA 3EXFA 4F6RA 1T5SA 2JLXA 3R5FA 4R9RA 3KTAA 3FHOA 3TX2A 2QW1A 2FMXA 2JFVA 2ORYA 4QJIA 2J9FB 1X2EA 2W71A 3KJIA 5EMNA 1F5SA 1T8WA 5T5QA 1OX4A 2ETVA 4L72A 4MVJH 3UMFA 4EQZA 1UJ4A 2C4KA 1BQEA 2G5PA 1G9SA 1XEXA 2N47A 3AKDA 3IIKA 4FWBA 1FC0A 1CJBA 5DK6A 3THRA 1LBIA 4C4SA 4DY6A 2BDTA 4DCJA 4RE5A 1BH2A 4B32A 2WJYA 1WTAA 5KQSA 3ZH9B 4DZRA 4DJ5X 4DREA 3O4FA 3WWPA 3PKZA 3DF9A 4Z4IA 2ZRQA 4TL8A 2ZSDA 4C6TA 4OA5A 3U19A 4QXRA 2HJHA 4J0JA 3AUFA 1GRRA 3UWPA 2AZ4A 5DM60 4Y6LA 3ELUA 1ULTA 4ZVPA 3THOA 2QNRA 5COBA 4MGEA 4AZ3A 2ACKA 4TUYA 3K92A 5I7FA 5AYVA 1F9EA 3ZE9A 1IK6A 2GERA 1EK6A 4N18A 1YDFA 4OGGA 1CUIA 2P9QA 1S89A 1XHLA 4RXTA 3IXLA 1XZAA 2VQ6A 4E21A 2Z3ZA 3GEEA 1NOJA 4C7XA 3K96A 3SYLA 2EIHA 1ZD5A 5GJWC 1FS4A 2B4QA 4YHHB 4KMMA 3H4IA 5ALFA 2C7GA 3GA5A 4YXWA 3WK8A 3WRVA 3WMFA 2QM3A 1L5NA 4LI3X 1Z36A 2OAP1 1FFBA 3CNHA 3A6DA 3QBJA 3B6EA 3FVQA 4RH3A 4AG3A 4DLAA 5CNJA 5I9MA 1YZYA 1D6MA 1EFCA 2ZUWA 3HPRA 1NVDA 4OGLA 5MF6A 1N3LA 1U3VA 1UMKA 2JK1A 3DVSX 1SHTX 2GUWA 1YR3A 3IRUA 2ZJFA 2MSKA 1JHZA 1LH0A 1YJAA 3SZMA 4EG8A 1E3LA 4UTNA 5F33A 3CS3A 1PI3A 5BR8B 2IS4A 3H5IA 5CLHA 1ZAYA 5BW8A 4DGSA 1EFHA 2P2CA 3CX3A 2VDOB 3LCMA 4B4WA 1TEZA 1I1OA 3B12A 3ZIAD 4P98A 1HE4A 2X86A 1AM4D 1C7JA 3BL8A 2HUNA 2JANA 1L3CA 1TIPA 2B82A 3F5QA 2C9MA 4BP3A 2P1RA 3LHKA 2GRJA 1E0AA 5IPFA 1JP7A 4PRZA 5HZHA 4BCCA 1SZJG 3RTAA 1APBA 4S24A 2IW1A 2OBBA 1D0SA 1G3UA 1P4HA 4OB7A 4V02A 2AFRA 3OICA 5DIZA 3NHSA 3RWBA 5DOZA 1GA1A 2ZREA 5TQ0B 1P81A 1D6JA 1J22A 3K0HA 1CY2A 2JGJA 4HN2A 5JRDS 1P2DA 4EYSA 1O0BA 4N47A 1F0NA 2A0XA 3AILA 5JSZB 1IAQA 1GDDA 1R8JA 2QSJA 2VK1A 4HDOB 4TZ0A 2D0DA 3BILA 2Q5LA 4DLUA 2WE8A 1A8QA 2GMWA 3JVUA 3IQFA 3QSGA 1Y9DA 4JA0A 5AP9A 2KLHA 2CLIB 5F3DA 1QORA 4TKLA 1ZKDA 2VEOA 5KVCA 1MB2A 2G08A 1X1QA 4M83A 1GKUB 2ANBA 4HFJA 4J0CA 4IEEA 2ZM5A 4IX1A 1FUUA 1UFQA 2NYVA 4JBYA 1KEUA 4PY2A 4WOBA 4LRYA 3RVBA 1MXHA 4J6FA 4DRXB 3QU5A 3TLZA 1E3QA 1ZUNA 4YJ3B 1UK7A 5BQ5A 3SFTA 3L7YA 2ZTUA 5JALA 4P35A 3V6MA 4BTEA 5TV2A 3P9CA 1BDBA 4PXYA 1G98A 2Q1UA 4JITA 4TKMA 3UAVA 3ZBQA 2DBYA 3TEJA 3HNRA 5ITWA 2ZQZA 4EJSB 3M9XA 4F3TA 3GB9A 1KDYA 5BQ3A 2IYYA 1KMHA 3PHCA 4MEJA 1YZKA 4ABYA 2O3TA 2XTAA 4EB3A 3N2IA 4EKEA 1WW8A 2J59A 5GVRA 1I5RA 1VIAA 3EY9A 1OC4A 4WDQA 3TI7A 1E0KA 2PRYA 4HNHA 2W2XA 4NYJQ 1QSGA 3LIIA 4GZ6A 1P2FA 4KVAA 2J67A 5A1JA 1SBQA 1YACA 1YZHA 4E30A 5JY1A 1SVIA 2H06A 4ZEXA 4OKSA 4XVQA 4FX2A 1RKVA 2WJJA 3FR8A 2HOQA 1T9BA 2J3LA 2CXRA 4RGBA 4X6YA 2CUNA 3FWYA 4XEHA 3EQ7A 5KAPA 4WKPA 4AZSA 4P31A 3C6XA 3GLHA 4Y2RA 4DV1B 2NSJA 3B3FA 5CA1A 4M8LA 4CM1A 4C01A 5KDOA 4MUHA 2IHZA 1D0IA 4IDFA 3QVOA 4HGOA 1GGNA 4S12A 1AQYA 2XOEA 2Q50A 1BGXT 3NHKA 4IS3A 2GN1A 3I6ZA 2DQSA 4LKOA 4QYMA 5E6RA 4F5YA 5DXFA 4K9LA 1Z6ZA 4YDRA 5AHOA 4TYQA 5D3MB 2VJQA 5ALGA 2BGNA 3RRMA 2GZAA 2P75A 3MC1A 4IH9A 5C80A 4BMZA 5JAOA 1EUDB 4IWYA 5DCUA 1CZNA 2RGEA 1W5FA 4WWHA 2OESA 5AO9A 3DE4X 2XMRA 5DYGA 1ILWA 3WAJA 2HU2A 3NWPA 4J9UE 1H1DA 2QTMA 2ZPUA 4JXJA 3VR0A 3GNSA 4Y2SA 1OVMA 3DEHA 3W3AA 4PIMA 3TQFA 4DLLA 5AKIA 4J9VA 1MAWA 2J41A 4AS3A 3PGJA 1P7ZA 4Z9YA 3BHNA 4PSUA 1WQ1R 1IPHA 3CLUD 1YJ8A 5LSAA 5C7OO 2WJZB 5U4QA 1HDXA 4V0LA 1S2DA 5E7JA 2RHBA 3CC8A 1GU7A 1XTZA 2ZSEA 4C5BA 3A6KA 3JYLA 3NAGA 2E82A 4N7MA 2YXDA 4DUYB 1A98A 3R44A 5ETJA 1PVVA 3B7GA 2XKBA 4UEKA 3ROEA 1HNZB 1ND6A 5B57C 2BMEA 3EWIA 4U5XA 4HQNA 5DWQA 4ZALA 3J80A 4LBYA 1NPDA 2HX1A 2NAFA 2R0QC 4K46A 5KTRA 2VTEA 2K2WA 1TX4B 2ZJ2A 2QPOA 5IT4A 4G1BA 4Y6QA 4ZV9A 1E1QA 2ZGVA 4LC0A 4DMMA 1QGAA 3B9PA 3ZBTA 2RG7A 3DB2A 3ZZUA 2C3OA 2YJZA 2Y1KA 1X7WB 3D8RA 1F60A 4H7HA 3UB4A 4B43A 1ISFA 5I48A 1THMA 5TMBA 3RARA 3C8UA 1UWCA 3RO7A 2J31A 2HLNA 2O2DA 3X1YA 4EA7A 2A5DA 3BB4A 3FMPB 5CBKA 1W4RA 1SCAA 3G0GA 2IKSA 1FYEA 1MO3A 1N2CA 3HNOA 2OMKA 2R11A 3CG4A 3KYDA 4NBLA 5CJ2A 1G3RA 2G83A 2RARA 1GSHA 2BR5A 4EKGA 1C1YA 3WISA 3CZ9A 2OXFA 2Y6VA 3G2QA 5AJHA 3FTQA 2JGNA 3LVRE 3ANTA 3GAZA 4I9FA 2WPDA 4QNNA 1T29A 3W5IA 4D92A 2OZLA 4O5AA 2OO3A 4YRRA 1HTBA 4BO0A 4CVNA 4RTLA 5IABA 2O7NA 2D5CA 1B74A 4CPDA 1HQCA 2CT8A 4DR1B 2PL3A 3KLBA 1ULHA 1RCUA 1W47A 3R3JA 1RWVA 1J2TA 1T1RA 2WM3A 3FJ1A 4NV1A 5J5CA 3K5WA 2QAJA 4JOCA 3H3JA 4LTMA 1E2PA 4HLUC 3L8DA 4KH1A 3T38A 5AM1A 2V74B 2RI0A 1WB5A 2G1AA 2Y76A 2AF3C 4FFSA 3TQQA 4KAXA 2XB2A 5K6AC 1LFDB 7AT1A 4IIYA 4AKTA 4UQLA 1XO1A 3THSA 2GZSA 1MABA 1K4YA 3PT5A 4EECA 3C5WP 2JZOA 1R4AA 3LLUA 1RLIA 4TYPA 3REQB 3EXG2 3A58B 3WK4A 3WWOA 2OBNA 3Q5DA 1H2YA 4G01B 1LUAA 2AUTA 2VBFA 1ZD9A 3BVPA 1OHHD 2TMYA 3EOAI 2EG9A 2NVWA 3LJKA 1DX6A 2BVNA 2IHUA 2VRCD 3HJTA 2ZR0A 2CCJA 1PJSA 1U5CA 3LOPA 3QSYA 3TTYA 2C5HA 4KMSA 4RHTA 1VGVA 5HIAA 4EY4A 3B6IA 1EFRD 2W90A 16PKA 1HEIA 1SCQA 3PF9A 4P83A 3L0PA 4DT1B 3WGIA 1BHQ1 4GH5A 4BNMA 3R3WA 1TK9A 3TI9A 4DC0A 5CAEA 1LRLA 1USVA 4M7OA 5IFLA 5DU2A 4O2BA 3CINA 4F6CA 4Q5IA 3MRVA 1NNUA 3IIMA 4KUEA 1Z6GA 3CF4G 1BN6A 3F67A 5KNCH 4WKOA 1PYOA 5EWLA 1K75A 2AMVA 2P90A 4JYCA 1GTJ1 1H1LB 2QYHA 3G59A 2ZRAA 2X9NA 5GPBA 4BNHA 1SXHA 2EHDA 2O6LA 4WA7A 1J1UA 1U0NA 4QOFA 3NOOA 3DD5A 1GKLA 2X4DA 3BK2A 2FFQA 3DONA 1J8VA 4KAJA 1U0LA 1H2AS 3ZDAA 2VHXA 1ZM4A 1UQRA 2XXBA 3FCSB 4IQ8A 4N7JA 2HA0A 4L8VA 4NPHA 1EINA 3MUFA 3I53A 4HNAB 1HY3A 2X15A 2WLSA 3DXFA 1ZNWA 1RE0A 2PA3A 3HCFA 3MGBA 4WLUA 4A8JB 3AVXA 4CI9A 4H0FA 2C4WA 3NH6A 4Y1GA 4EEXA 3M4XA 5JS6A 1YAHA 2HF2A 3PKJA 3FPEA 3A1WA 2DR2A 2G5TA 4QGHA 2YWRA 1Z28A 5EIWA 1DQZA 2Z5GA 3TOSA 3UMCA 1XTRA 2JVKA 5KC8A 4KR3A 4IRXA 5J2TF 2O1XA 1YC2A 2Q5IA 1YA4A 5EYPB 3C7DB 4PTYA 3R8CA 3L7KA 3VO8A 1MLDA 4MCJA 1NWHA 4OHFA 1XMSA 3NDBB 3PVCA 1L7EA 1I7NA 4KRYA 1Z74A 1MZPA 1DJPA 3D2AA 3SICE 2F8SA 1LY1A 1YUMA 3A37A 3NFYA 3B5JA 4L3WA 5AKHA 3AKEA 1EWYA 1F0KA 2A14A 1V11B 1OF1A 3ELWA 2OVBA 4QBKA 3BRSA 2D2XA 5F51A 2CFCA 3RKRA 2POQX 4ABTA 3QJ5A 4C88A 1T0IA 1KYZA 3G2MA 3I42A 1BX1A 1NV8A 5GM1A 5J40A 2C4UA 3Q12A 5C5EA 3JD0A 2V5AA 3K6RA 4I4TB 3GJ8A 4D98A 4RIGA 4AURA 3QPUA 5K51A 1DEHA 4QUJA 1AQ6A 2FPGB 4BO3A 1TFUA 4R2HA 3WK7A 5LNK1 4F6LA 2PZKA 4EYOA 4D5GA 2KI5A 4GBMA 4PZ0A 4IJQA 3AKCA 1COZA 4GKBA 4NZYA 2C2GA 4AIRA 3ND9A 3U40A 2FG6C 4L0MA 4NL4H 5CFOA 4QNMA 4C6HA 1OI2A 1BROA 1EK5A 2I7CA 2D54A 5AJZA 1X0VA 3UA3A 4FTWA 4Y1FA 4JLVA 1LI5A 2W70A 2PJRA 4DPLA 4HQFA 3FRHA 2HNKA 2R4QA 2BMAA 4DSOA 2ZIAA 1OX5A 1KU0A 3TSCA 1U7XA 2XB4A 4G1EB 4IFBA 2X0RA 3GBPA 4GKVA 3O8DA 1G7RA 4MQMA 4WCFC 1W35A 5KNDA 1RYEA 4HH3C 1XJ5A 2M32A 4IMJB 1Q1QA 1W5EA 3L84A 4YCMA 1ZGBA 5E3HA 1SJ9A 4DV6B 2GRAA 3ZQJA 4XSGA 7ABPA 3BFPA 2Q4RA 4H7EA 3FGNA 3LYHA 4AMGA 3DDZX 4ME6A 3ICPA 2PZFA 3IUJA 3VI4B 1IHYA 3GAMA 4HEJA 3QW4B 2QMZA 2BGIA 2YFHA 2ONJA 1T9CA 4AI6A 2E85A 3MELA 3ENZA 1QIFA 4WA8A 5IAOA 1EA7A 2FWBA 3KSZO 4MUIA 4MV6A 4CU2A 4WECA 1GPMA 2E4VA 2O2ZA 2Y1OA 3ICVA 5IMSA 4MA0A 4D02A 4RL6A 2IPMA 1A4UA 1VL6A 1GAQA 3Q5GA 1TQHA 1VLVA 2ODQA 1IZ0A 3F90A 3LFHA 4Z4GA 4BUCA 2Y0BA 1U2DA 1F1BA 1L5SA 1JG4A 1KS2A 5F73A 4PO1A 5CYFA 4IDEA 3EDQA 3LQ4A 3TRDA 4FKMA 1KFEB 2BTQB 2BGMA 3L82B 3TRIA 1A5ZA 3OBIA 2OAQ1 3E3OA 1J2RA 4DUGD 4PLHA 2D0OB 2CKDA 1YR6A 2H7VA 3Q3VA 2XMSA 4PIVA 3LC2O 4JC0A 2CXOA 2LXNA 3QG5A 4MZXA 1NN0A 2W0SA 1EZ4A 3D43A 1NP6A 1NY5A 3TH5A 1S01A 1XE3A 4GX5A 3NRJA 2CLCX 1LFAA 1O89A 1AKUA 3Q9UA 4D9IA 5CG2A 3CW2A 4ZT5A 3U26A 1CJUC 1QG4A 5C7YA 3PD0A 5JH7F 1UMBB 3D4IA 3W2TA 4OYRA 3L8HA 1RE1A 4LY6A 2QA5A 1K06A 5M29A 3K4PA 3EK2A 2QVLA 3ZPXA 1K0FA 3HA3A 3DH0A 5FWXB 5K01A 5DZSA 4BLPA 4RTJA 1QK5A 1DU4A 2VNHA 4JI6B 3TBFA 2I8AA 5J5VA 3LUKA 1DV2A 2YXNA 3LZCA 3SJ7A 3G89A 3W9YA 4OHKA 1DIHA 3BGSA 1E62A 4D56A 3C3MA 3K1AB 2KMLA 5AKZA 1DKQA 3DSRA 1B16A 2BMJA 4JA2A 1WUJS 1XTTA 3DPIA 5KEIA 3HFGA 1BVHA 3RUEA 2I87A 3CM0A 1HOTA 1S7CA 2GS9A 4KXLA 5E2AA 3VTZA 2CVHA 1E5QA 4H08A 4O8CA 3LT5A 2EJCA 2REBA 2VRNA 1PR1A 4YV7A 3U56A 3E9YA 4EHDA 1R5JA 1BEEA 1VZ2A 1YFKA 2XA1A 3KALA 1CHDA 4PZZA 1ACJA 1ULSA 4Z3KA 1XCOA 1TZJA 1SBHA 3KG2A 4EG0A 1UBTS 1BMTA 1W46A 3F5SA 3STUA 1OLSA 1BZYA 2JHCA 4M76B 2QGZA 1SRRA 4YO8A 4QLAA 5LP1A 3C1AA 5HCUA 2CMGA 2OD7A 4YASA 1WVIA 2CJPA 2X7JA 3G1UA 2Z2XA 3KDAA 3V7FA 2JJ1A 1K89A 4N9WA 5EWJA 1ZN2A 4GKKB 2WMYA 1GNLA 3UOWA 4DA0A 1Z5OA 2ZWOA 4HX9A 2VCEA 3JQ6A 3OZSA 4LSMA 5EHZA 1C29B 5DE3A 1KNQA 2QMUA 2FSPA 2AG6A 2N42A 2ILVA 2WVHA 4N8SA 4ZCRA 3KEFA 1C1XA 2PGOA 1K7SN 2AFHE 3FW1A 4M89A 4KV7A 4B40A 2PD4A 3A9RA 4YX9A 1TEHA 3BMCB 4Z0HO 5F98A 1A96A 5FAXA 4N41A 2ZOSA 4KIGA 1XWFA 1DS6A 2IIVA 4TUYF 2F4VB 1YTUA 4OHWA 5JCJA 5EE0A 2O8CB 1NATA 3KUUA 2ZJOA 3OAAD 1VMAA 4ZV4A 3ABIA 1X42A 3DEJA 4N3NA 2PVSA 2XVMA 5KDDA 4YAGA 1A9PA 2WM8A 2AWNA 1F1JA 4R40A 2VSXA 3B36A 4A6EA 1BD4A 4OL9A 1PG2A 1YQQA 2FAXA 1HDZA 2I71A 1T2VA 2UVPA 4BQFA 4MROA 1WUTA 2IHTA 2YH2A 3K30A 5GONF 3BWVA 5ALMA 2ZXEA 4YI3A 3HMKA 4Q1AA 5KTMA 5C51B 5BW6B 1YB2A 1WF6A 2QTVA 3LRTA 4P92A 1XNGA 1HC7A 2REOA 1GL9B 3TB4A 1ZK4A 1CDOA 3L06A 1IN8A 1W76A 3OFKA 3O26A 3ZQUA 1WXHA 2AI3A 4LV5B 2WWFA 4XFKA 4CL0A 1QZTA 1C5KA 4OK3A 4QPNA 4ZI7F 3T6KA 1CB0A 3ECCA 5KJ1A 1KOGA 2WB2A 2Z2KA 5EE3A 1EFVB 3JWGA 4FLMA 5LQSA 1XMIA 1UPFA 3I2YX 5BV8A 1LWOA 1WWKA 3HY4A 1E3IA 1ECBA 1SCKA 4R69A 4WN3A 3VYSB 3WOVA 1Y48E 1YJXA 2QTNA 3FNRA 3MLEA 4H2DA 4EUSA 2UXDB 2CL0X 3GLQA 3O38A 5FWNA 5IN4A 1UMCB 1UWVA 3O9VA 3L1KA 4KBGA 1PFKA 4DG9A 1M2NA 1P72A 3BTVA 4QXMA 2WHXA 3RSHA 3ZZ0A 3D7KA 4P5PA 5K0NA 4X5OA 3A1DA 4G5YA 3VR6A 4Q4JB 1SVOA 4KQ9A 2Z95A 1E1RA 1A4IA 4TLAA 4WZAA 5JFGA 1LJUA 3KZOA 4OSOA 4RZ3A 2IGBA 4LDRA 3GFQA 5H02A 1FNCA 2W2LD 3W79A 3AJDA 4D42A 2WKSA 3ABSB 4EZIA 2NP7A 2NO7A 4QUDA 2JIBA 2LV8A 2OV8A 2XV1A 1RQRA 2XSZD 4XDGA 4MDFA 2QMQA 2FN8A 4KK3A 4IDHA 5E9JA 1M66A 3LUHA 1N0VC 3ROFA 2RGRA 3TXXA 4CR8A 3DBRB 3R5JA 5HF9A 4IJ6A 1T1GA 3AB8A 2QRVA 1KAGA 2BGGA 2R68A 3SR0A 1C1HA 2LCFA 1M72A 3QWBA 3T5DA 1RFLA 3ZJ5A 3PVZA 5HRAA 1BMQA 1IQ0A 3PHHA 2CHEA 3VR2A 5KQGA 3F6PA 1QRTA 1TYCA 1CJVC 8AT1A 5L3SB 2HWYA 1SPBS 2P2NA 4L5BA 3W8DA 1OFHA 1QDLB 2GESA 2AX3A 2YWDA 4KWTA 1ID8A 4F12A 2B34A 3F6EX 4NAUA 1QO7A 5JSYA 4CG2A 3G2KA 2C7OA 1HYHA 4PX3A 4NMLA 1PWHA 1QB8A 2DBQA 4XLTA 3K1YA 3BF8A 2XEXA 4BHTA 4JWKA 4ZK6A 3VRHA 4BDSA 3AEQB 4IOKA 1ZGJA 4MPDA 4QO7A 4AN4A 5K99A 5IDWA 2JAHA 4CV2A 1K7FB 1E3SA 4DMKA 1IXZA 5EXSA 2F3QA 1L4FA 4FQ7A 4OI2A 5ITSA 4CLOB 1WMEA 4B3JA 3CEJA 4NARA 1AX9A 2GN9A 5CA1F 4K1XA 4LHSA 1D2GA 2NZYA 4DB4A 1F14A 2Q4BA 1VBNA 4TL6A 3WICA 1A69A 1UCFA 4YAFA 3UKDA 3U4QB 3W1WA 4MK4A 1L7QA 4WD3A 2JZNA 3AY0A 4HZUB 1I51A 4RQUA 1E20A 1NKTA 4WASA 4XVHA 1OWLA 2GZ2A 3MSCA 2VZLA 4GG1A 4NFYA 3AHHA 1OAKA 1UZLA 3P2YA 4RVGA 4Y2GA 5FUMA 1AKYA 4LBZA 3T3DA 3OPXA 1XD2B 3T9EA 4EGCB 1QHEA 4RJIA 3UJ8A 3QY0A 3UT0A 5K5EA 4GR4A 4Q16A 1E2UA 3TG8A 2C3MA 1KAOA 1ZN8A 5DM2A 3S2GA 4B35A 4UW9A 1OIVA 1TK2A 1P9RA 5KHOC 4JLUA 1FTQA 4WJZA 1UXOA 1HG1A 1K7EB 2OGSA 1AKMA 4RVOA 2QWXA 1WKVA 3OD5A 1QHSA 4RHCA 5ILGA 3TLYA 3UHFA 5DCWA 2WW8A 4A2PA 3NWOA 4LZPA 4PW0A 4H3HB 1S2LA 3NWBA 5KX5B 2CY0A 1Z6PA 3V8BA 1AF7A 4DDWA 2XKKA 1EDOA 2J3EA 2XOKD 2Q46A 3QLEA 5A9TA 1BJRE 1X7HA 5TGZA 3ZWYA 4DBZA 3RSZA 1V9LA 3GRFA 3QEKA 5KCZA 4GI1A 1WG8A 1XGKA 1P2BA 3OX2A 1CUDA 5DJ5A 1VLHA 4YCDA 3L8YA 5ALRA 1L7XA 3I5XA 1N2BA 4LJLA 3DVQX 3KR9A 1DHRA 1M83A 2ZUCA 1DBPA 3EXEB 4AP9A 2VJMA 2QUKA 3W05A 2QF7A 4EUHA 4PZAA 3EQZA 2WD7B 3PYMA 1KZHA 1C0PA 1T2EA 4CQMD 4OXIA 3DO8A 1ITZA 3IILA 2FG7C 3U61B 5EJ8A 4LXUA 3DZIA 1A5SB 3PXUA 4MQEB 3CZAA 4C0JA 2VYVD 1R74A 4JOQA 4ZXPA 3RC9A 4AIIA 2ZB2A 3L40A 4N1AA 5AOAA 5KQRA 4RMGA 1B14A 4WK6A 3AL3A 4C14A 5HS6A 1LI7A 2TMGA 1QIDA 4KWIA 1OTHA 3CWCA 3AJAA 1E3TA 5DM4A 1YJBA 2EL7A 2FW0A 2GCNA 2YXPX 1XTUA 4OI4A 1LRKA 3TIVA 3EXHA 1W75A 5JO0A 3O90A 5A0VA 1E4VA 4KN9S 3A3NA 3QYAA 2ZSFA 2QXUA 1F6WA 2Y1DA 5CBPA 1SHUX 1ZI6A 1G5FA 1V1RB 3BB1A 4QQFA 1WY7A 4D8UA 5IM4A 2BM9A 2I3ZA 3SYNA 4FFBB 2VOEA 4WOJA 1RXUA 2X0EA 1JNXX 4DV7B 1C80A 1PK9A 1BXGB 4CN9A 5ES4B 4JUAA 2O8DA 2C7RA 3COPA 3OJWA 3L7OA 1XF1A 4PU0A 4HDQB 4AZ0B 2PGLA 3FDZA 4ZOLB 4DLPA 5CEJA 1R0ZA 3DT8A 1YA6A 2HWUA 2RJOA 4ROSA 1Y4DE 2HU7A 2BEKA 1HZZC 3U7RA 1TEVA 1G7SA 4BVEA 5A4AA 3CEAA 1DIBA 1LRJA 2VF7A 2FPLA 4U7PB 3TMYA 2IP4A 4WXEA 1AHPA 2VDUE 2CHFA 3JZDA 3B3AA 2MSNA 3IH5A 4PG5A 3U1BA 3BCSA 4UU0A 3ROGA 4PHCA 4HMPA 1J8DA 1CUAA 2Z0MA 4E07A 1MQSA 1UBKS 1XZIA 2HMAA 4HAVA 2F59A 2FE4A 4D0LB 5JHGB 1XZEA 5J2UA 1HDOA 1JR6A 3HY6A 3OOJA 4MOWA 4E3WA 1E8DA 5KOHA 5KWSA 3QE9Y 1HETA 3U09A 1JIKA 5CLJA 1W36D 4IDQA 1MC1A 3E2MA 4GMKA 4ZOBA 4KQMA 1N6IA 1NF3A 2BZGA 3GOQA 3PL5A 4A27A 4F04A 3HACA 1XTQA 3RYCB 4JZKA 4W9NC 2P62A 4I14A 3SDSA 3G7SA 3UK7A 2RE8A 2A92A 1MCZA 3E9DA 1EFDN 4BZXA 3WWEA 3LT2A 1R16A 4YEDA 5EERA 5K8UA 4ZZ0A 4O2BF 3W5JA 4MVJE 3NT4A 5DM0A 3WLAA 4AZVA 4R84A 3ZV7A 1K3FA 1ZNQO 1TCAA 2ORWA 2ZS9A 3OZWA 5DYNA 4M1OA 1DEAA 5U1PA 4S1NA 3WJ1A 1A5BB 4C7BA 4CE6A 2JZCA 2P91A 3TDMA 2OUIA 5KJ6A 1LZLA 1OCEA 1Q92A 3EZYA 2HCFA 1SUCA 4GR9A 2VWHA 4JQOA 2BKLA 3MD9A 3NG1A 4E14A 1H65A 1JWAB 1CS4C 3QPDA 5AICA 1JEYB 1FDRA 3LZDA 1QVVA 3FWKA 4OHCA 4YVFA 1V96A 4LF4B 3R76A 4CKXA 2VP0A 3GNTA 2E0IA 2KS6A 4MX8A 5LXTA 3PIDA 4ZQCB 4R1TA 3DKKA 3SSMA 1JL3A 2XI4A 1SCUA 1NUAA 3PFBA 4OEHA 5TVGA 2JCBA 3T9CA 4GS5A 4IO1A 3EIFA 4HADA 3PRJA 4QECA 4B7XA 1MEOA 4QA9A 3ZCVA 5IT0A 2IV2X 5HQTA 2AZDA 3EWAA 3RRJA 3P9YA 4IXDA 5JMPA 2QMYA 1E6KA 2GCPA 4HTFA 1ODLA 5ILQA 4GIBA 4JJ4A 1FP2A 5IUJC 2YHBA 3LA6A 4L76A 2PN1A 1EVQA 3KBOA 1YFLA 1EM8A 1DBWA 1JMKC 1Q2XA 3M6LA 4Y9RA 3TQRA 4BFXA 3E1GA 4BGDA 1ES9A 3SQXA 2FPMA 1OB5A 1I3NA 1A71A 3KJXA 1BE8A 3JWJA 1TVEA 3NEYA 1E2FA 2F1KA 2X9VA 3O1JC 4WCVA 2CV2A 4DDMA 2X8JB 4G0WA 1GFIA 6YASA 3KTOA 3N75A 4JX8A 4JR1A 1L1QA 1VE7A 4FFWA 5DNAA 2YASA 4TWRA 4ND5A 3NUGA 5KB3A 3AUJB 3QKUA 4MW4A 5JMOA 2BFBA 3EDYA 1KA9H 4K5QA 2DWQA 1L1EA 1V41E 2O8NA 5ALJA 3BS4A 3KAQA 5E6SB 3TFQA 2A86A 4FHDA 5HR5A 1TKBA 3X2SA 4FEGA 4HF7A 2CE2X 3LS2A 3TJRA 4V2UA 4EBFA 4J0HA 5COAA 4GMDA 5ENVA 3MTBA 8OHMA 3U3DA 1BXRA 2DPHA 3GT3A 3BM5A 4YS6A 3VHQA 1DC6A 3FPCA 1G5HA 3Q1KA 5C46F 3K32A 2JLQA 4B83A 4UFNA 4YA6A 2FWMX 1AN9A 2ZE8A 2XYQA 4QQKA 3KB2A 4ZDIA 4Z7JA 1N57A 2AQKA 1ZCFA 1DFGA 1TQ6A 3DA8A 1NQUA 4TTRA 3AK4A 2V03A 3D2BA 4HLUA 1PEKE 1YMUA 4PTLA 4WMLA 2HUPA 2G5GX 5GV7A 1Y8RA 1OKKD 1EWVA 2FWJA 821PA 5B53A 1SCBA 4JBIA 4LWPA 2XUQA 4M36A 2NU9A 3BA6A 3DFIA 5K6AA 4OQZA 1OBHA 1Y5NA 4B7UA 621PA 1HFJA 1BVRA 4TTQA 2FG5A 4HDNA 4IF4A 3L9WA 1XVTA 3WGOA 1T26A 3H2JA 4BEJA 1FFCA 5HVNA 1J42A 1Z5WA 2B2NA 3FR7A 2I29A 3V8EA 2VP5A 2BGLA 2P0YA 3AY3A 1G5TA 4JC5A 4LJSA 5K7SA 3IURA 5JVDB 3E3MA 1W8IA 3VAZA 3K0KA 1GLVA 4IDNA 1ODSA 2Y1GA 3G2NA 3SNKA 2XT0A 3T3PB 1QGDA 3SHFA 1T25A 1JKIA 1XRNA 2J3JA 3BDVA 1MB4A 3CUEF 4TTTS 5ERXA 2JCYA 3NTLA 4LYAA 5B2FA 3IOEA 3P52A 2J3IA 1BCSA 2LIVA 3THYB 3INRA 4TZKA 1U3DA 4F4IA 4M99A 3AL0C 3WL4A 1IB6A 3TSWA 2HCJB 1BYUA 3A4TA 3KXDA 3D4NA 2LGJA 5CJPA 2G88A 3JQ8B 4GI5A 3FFTA 1GCIA 3AXTA 1X1TA 1YQTA 4MV1A 5DLPA 1RAEA 5HKOA 4GUAA 5AFSA 2YWFA 2H1CA 3GD7A 2VPQA 5G3YA 3M4YA 1IG3A 4G09A 1PO7A 4MS3B 4DLKA 3URMA 3LYUA 3MWDA 4K1LA 4M0PA 3SHTA 1Z22A 3KQLA 1N3YA 2A9KA 3NDPA 2HTEA 3L8EA 2RKBA 3F3YA 1IN5A 3KXLA 4NBNA 4CQJA 5F2OA 1IQUA 4EL5A 3R9XB 3EDOA 1UBSB 2QTCA 2NUPA 1CY7A 5K3AA 4DOMA 3BEOA 1NQTA 1FSSA 1HORA 3P0JA 1M0TA 2QJFA 1QMGA 2WKQA 3I4LA 2VXYA 3CUWA 2OXEA 3E6AA 5EIOA 2VZ8A 4JUBA 4JP2A 4MQUA 1ZHHA 1U4NA 2QD3A 4KPGA 3DZGA 1KOLA 3ZS8A 4EP1A 3K3PA 2ZE5A 3B5IA 5DBEX 1QANA 2AUMA 1W4LA 3MILA 1XKQA 2NTYC 1KJ8A 4FS8A 4JI1B 2XQJA 4U0JA 4JH0A 1ZD2P 3RS9A 2OHOA 3WYCA 5JSQA 4YH1A 1EE9A 3FETA 2Q8NA 3GMIA 4OOFA 3ZVMA 1H85A 3ZI7A 2ATCA 4FBGA 1QZXA 2E1RA 2QJWA 4LUCA 4YBZA 3TZEA 3LV8A 4OU4A 3M5PA 4TXJA 3GRUA 2WF6A 5CTAA 3W9BA 2O3QA 1IM8A 2QW0X 1DTWB 3Q3EA 2GF2A 2BEWB 3K0AA 5FOQA 1Z5GA 2P8SA 3F9IA 3HKBB 4OFZA 1S1MA 1GRCA 4GLOA 5I45A 5J47A 4URZR 4X1IA 2NTNA 2QIOA 2CF6A 3WQRA 1KH1A 3ZQKA 1IPFA 3CQ9A 5B1YA 3VPDA 1RQ7A 2BSAA 3GGJA 1U8EA 3ET5A 1IBCA 3FRIA 4EGJA 4YMUA 3VHXB 3ZNPA 4CCYA 5IMBA 2CLSA 4F72A 2WTUA 4R8VA 5ADWA 1I6MA 5AJYA 3WFZA 2WBLC 1VKOA 1C41A 2C8VA 3JD4A 2OHHA 5IJ9A 1GNTA 1Z75A 1T24A 1J1ZA 1W25A 1EG7A 1Z2OX 2XMBA 2WSBA 3LW7A 4IIEA 4LN1A 2VHVA 3WLNA 3ZKAA 4CM8B 3LPMA 3AETB 4UDYX 2QRHA 1NN5A 2IZ1A 4G89A 4KLAA 1RI1A 1FTSA 3CLHA 5EJIA 1GVNB 1I32A 5KC9A 4WCFA 1SA0A 1G8KA 3EBPA 2HTFA 2Y2UA 2SKEA 3K6JA 4R2WA 1VLJA 2PCLA 1O4WA 1XDZA 1MD9A 2QQGA 3D5QA 3R23A 2Y9PB 4H0NA 4QSMA 3VUEA 3ZCPA 3R20A 3TZLA 4UUMA 5M7EA 4I50B 4XEUA 4B4DA 3DHNA 4C7KA 3DV9A 3VU0A 1E4EB 3U7FB 1PNQA 1A3CA 4MP3A 1P7VA 1IY0A 2NADA 2V3VA 1DLJA 2YMPA 4G5XA 4D4HA 3SWWA 4FN4A 1VG0B 3FB1A 1KY5A 3LQQA 2O50A 4GAEA 5HKKA 2NMVA 5AT1A 2E87A 5H83A 1WXEA 2JVIA 2HW8A 1MHPA 2D4AA 3ZDZB 3ONEA 4YRCA 4CMJA 3LW8A 1ILEA 4MYDA 4TM7A 3PI7A 1PKXA 2XQKA 1XFDA 1E6UA 3U37A 4C0KA 1U6KA 3SC4A 1GG8A 2PKCA 3PPWA 1A4RA 1IK4A 3FWZA 3KDPA 4M9UA 4M8SA 4PQEA 3T34A 3QMPA 1IBRA 2GA9A 3GLIB 1Z5PA 2IU6A 3TDNA 1VKRA 3VVMA 1MV8A 2JAQA 3D2CA 2C2MA 2EDCA 1B3BA 2WUEA 1PEYA 4PAQA 2YJ6A 3GW8A 4AJJA 2O8EB 1QYVA 3D4OA 2GPNA 3NB0A 1ZONA 3JXEA 4QDXA 5DN9A 3NW9A 5JARA 1KVSA 4CMHA 3C6MA 1LF5A 2FPIA 2QVCA 3BC1A 1F8GA 1ABFA 2QOEA 4D41A 3HKDB 3VNVA 1P8JA 2F3RA 1UFRA 5FPTA 4XIFA 1W4CA 1P0PA 3OZFA 1P2TA 4HRAA 3ZW8A 1FX0B 3L4JA 4UFOA 2O54A 3H2YA 2CMKA 2CDCA 1B1CA 3OP1A 3SE0A 4KRXA 3HNPA 2R66A 2DHDA 2PKEA 3W04A 1F6BA 1ZY2A 3ZY6A 2FPUA 2P9CA 5L51A 2VDKB 1E0DA 3QRWA 4G4GA 4Q39A 2LVBA 2VYND 5CDFA 3ZR4B 4WH0A 1WXDA 2MJLA 3R4CA 2J7KA 3FLEA 3PFWO 3Q0EA 4JLBA 4NZNA 1Q74A 3F4BA 5KJCA 4P36A 2XBMA 3FSJX 3RD5A 4KITB 3U7HB 1UKVY 2AWOA 2ZVDA 4DDVA 1VSUA 3NVAA 4FFOA 2GFIA 3NZEA 1SEVA 4UPEA 4C3ZA 3GN1A 4KSYA 2PSHA 4GPIB 4QBHA 5F2NA 4PXAA 5J59A 4FNOA 4ZVOA 3UPDA 1MKYA 3MOSA 3HL4A 4KE6A 3R2JA 4LRWA 4JYBA 3U44A 1CF9A 2C5BA 3K9BA 3OFNA 1G20E 2GJ9A 1TJ5A 4ETWA 4CIDA 3P4UA 1X7XA 3OE4A 2D5LA 3HEAA 4NU8X 5H3CA 3AYZB 4XASA 3VPBA 1PZMA 3I09A 3GJTA 3OZXA 1MENA 1KF0A 4WKNA 3TUJC 3O2NA 4DY4A 4DLBA 1AQJA 1PJ3A 1PD0A 1KSGA 4E2XA 3QY9A 4BX3A 5K0GA 1KEKA 1N6LA 4YDQA 2PK3A 2R6CA 5HX7A 1VM6A 2QORA 1EB8A 3EHEA 4PWYA 5FKJA 4HLCA 1RTTA 5F9MA 4A0RA 2AUNA 3RBVA 5DP2A 1V7QA 4I5DA 3CPHA 4AP6A 1UC9A 3KHTA 2JFUA 4W5OA 4EY8A 4EVSA 4JX9A 2RHOA 5DF1A 2C1ZA 1YI1A 3JQEA 4H4CA 5B1EA 1AKWA 2GILA 2QMOA 3GEIA 3QA9A 5EP2A 3W4IA 4ASUD 2POCA 3SAJA 3OFVA 4P86A 1G8AA 2Z2IA 3I2JA 3AEUB 4RNCA 1ZXXA 5KSPA 4G2NA 3UF0A 1CJCA 3KQNA 4EVRA 3ED5A 1CZKA 1KYQA 1SKAA 3A6PC 2OQ2A 1EFPB 2I8LA 4JIMA 2QV7A 4RZIA 5JD5A 2V8BA 2O9JA 1QC5A 3WLQA 1QGZA 4E09A 4RLSA 3W2FA 3FGOA 3WB1A 1UF9A 3F3KA 2JCVA 1HEYA 3SVZA 2RKWA 5CCBA 1QONA 4WUTA 3RT7A 2NZXA 3WSVA 1NMXA 4J0FA 4YTEA 5HKLA 3NHWA 4H7DA 4KB5A 4MAMA 3RUIA 1RTKA 3MJFA 5HMMA 1VI2A 1HDEA 1NUHA 4AJ1A 1DOHA 2WK1A 4TQAA 2I54A 3N76A 3U7IA 3ILXA 3AJ9A 1OXTA 1RAHA 2C31A 4K6MA 3NQ41 4K0KB 2Z4TA 3WLSA 1MAVA 2NUTA 1KVQA 3EYWA 3PYLA 3SYKA 4BB6A 1DIOB 1GN8A 3IP5A 5D51S 4H15A 1X7YA 1ZU4A 2Q49A 5EWMB 2RHGB 2KPOA 2ST1A 3DMHA 4NE2A 4RM3A 2G67A 4ZKEA 3OZ7A 1UBLS 3C5HA 3KWLA 1B15A 3WOHA 2ZJ7A 4EHJA 2A0KA 1YQWA 3M6UA 4XYLA 4IXTA 1EVYA 3MINB 2GGSA 5JNUA 2FY8A 1H6BA 2YYAA 3N59A 3AERB 4ZKDA 5CP8A 5K0JA 4MWOA 3BAZA 2X5JO 3IR7A 4RK7A 5H9WA 4F96A 1DJNA 4G9GA 4MMXB 3TS1A 3VDRA 3A1NA 1M6EX 1P7PA 3NORA 3W90A 4F1KA 3KL4A 2QYSA 3ORQA 4QHTA 4M0FA 1Z5NA 3DPUA 1PQUA 5KYYB 2GVZC 1I8TA 1SPXA 2BC9A 2ISSD 1UBEA 4RK4A 5DBIA 1LS6A 4B8WA 1E2GA 1JFFB 3TW0A 5EUMA 2R85A 3IJ5A 3FXAA 4HEHA 1NAHA 2DSNA 2I6UA 3AZPA 3KOZA 3UCXA 4RZHA 1I6LA 4HUQA 2AI1A 2H00A 2GXAA 3SJBA 4C4AA 5SZJA 1X87A 1DCKA 1P60A 1ESMA 1GCUA 3C5EA 2A57A 3IAAA 4JJFA 1IOVA 1QRDA 2JJ2D 3OJXA 3E22B 1T2FA 1Y9EA 2JGEA 4YR9A 2X6TA 4I5FA 4R41A 5J2UF 2ZT7A 2YFYA 3ZWKA 3MWEA 1MB0A 1N6NA 2Y8EA 4BNLA 5DI9A 5H1YA 4DA7A 1W5BA 2OILA 2A5YB 2X2FA 3AC0A 2IUEA 3KUCA 1XLTC 4B0OA 2PX0A 1J1IA 1NW7A 3IIJA 4CF3A 4I7EA 4EHHA 1S8NA 4HXYA 3OQMA 4AKGA 2CFSA 1PWEA 2CZGA 2UDPA 1YK1A 4KO2S 1EX1A 1HE1C 1RXWA 3T7TA 1A9OA 1LLFA 3ROMA 1DC3A 3TEFA 5HS4A 4XPIA 2PRZA 5J4KA 2GCGA 1J24A 2O8BB 2UZ3A 3K09C 3OCZA 3ON5A 3AHGA 3ZU4A 5TJ9A 4RXMA 2B9EA 1NRIA 2PQ2A 1FW6A 4O4IA 4JI7B 3WWZA 3JASB 3H4MA 5HUJA 4JBWA 1YOVB 4WRRA 2QL7A 3F9RA 4C0HA 3HSYA 1ZLYA 2ZJBA 2GSDA 4KKVA 1V8FA 1P4AA 4IUYA 2G76A 4ND7A 5JSHA 4I66A 1RU3A 5KTTA 2G70A 1D2RA 2QSUA 3F47A 3NYQA 4EK9A 4AS1A 3MTQA 3UICA 5JZBA 2C00A 1G8MA 1KZGB 1ENOA 5LXTF 3BTSA 4WZBE 4OVKA 3LBNA 3ZHVA 4R5MA 1PT5A 4RLHA 3ZDRA 1O96B 4DW8A 4F46A 2R8PA 5I4KA 5LYJB 5K0FA 1X1SA 3AP2A 2BE9A 4RY2A 2MSLA 4J4BA 3RSLA 1I6KA 1TO6A 1W6UA 1PUIA 1W9HA 2BM0A 2EC5A 2XUAA 1VIYA 3EGDB 2O2CA 3QHAA 4P81A 1JJFA 4DPMA 4F5ZA 3E5RA 4BMNA 4KFCA 3WBBA 2F2TA 3QEBZ 2G63A 4OU5A 4Y2HA 3GG2A 3FLMA 3BKWA 5ITVA 4CJXA 1TTHA 4QARA 5B7GA 3WHLA 5G53C 4BFCA 1NLYA 4KIFA 4E5PA 1DIGA 3H99A 1SUIA 3T7IA 5E4TA 3AF0A 1Z35A 5DOVA 1T3TA 1ZIXA 1F12A 2D2VA 4ENTA 1PL8A 4R68A 2AJDA 1YVPA 1T1JA 2ZZNA 3AOEC 1C30B 4FYYA 1GV1A 5D5QA 2R1ZA 2A2ZA 3BCHA 1QH8A 3CN9A 3Q2OA 5CHEA 1FF9A 3RG2A 4BX8A 1PFWA 2VJPA 4U3JA 1AQNA 3BTUA 1V71A 4OQXA 2V0CA 2XITA 5A9SA 1NF2A 2XTMA 1WQ3A 4INAA 1R0LA 1NX9A 3LUBA 5K3EA 1SKYB 1BX3A 3X0DA 5FPQA 4OJQA 3V80A 5ARCA 3KLMX 1JKMA 2YFKA 3ISJA 4UEJA 5JRZA 2IS6A 5A04A 2C98A 4P4GA 5ICGA 4B3MB 3ZXIA 4CKYA 4HP8A 3K2EA 3DMPA 3KT0A 3NV9A 3ZZNA 4HWSA 1AY0A 4XX1A 3SQLA 5A9RA 2WJIA 1T9KA 2ZPAA 5KYUA 1LLCA 1CQIB 5SY4A 3EGVA 3VU8A 2BMFA 2M6RA 1P1JA 3MJVA 1FA9A 2XCQA 1HZZA 1GAXA 1DZ3A 1GFSA 2WTMA 3NX4A 3O1HB 1JIIA 3M3DA 5T41A 1IOLA 1E3WA 5EKTA 3WMEA 1Z73A 1SHJA 3O8OA 1TTTA 1PDOA 2DC1A 2J48A 1FE8A 2MINB 2Q4DA 3CJQA 1ADBA 4X66B 4XYBA 2GYVA 4HB4A 3E82A 2X8WA 4EWLA 1Z38A 1TCBA 4EEKA 5KYXA 4PNPA 1KP9A 5JD3A 1ZRNA 3PP8A 4X84A 3E7FA 1E18A 2X8AA 3W2EA 3VGJA 3RIMA 3SIWA 4ECEA 5EJ6A 3G9QA 1DKLA 2YV5A 1HM5A 2WUDA 2XEDA 4OG2A 2ZT6A 1FQWA 5AVQA 4Q1CA 1UPUA 5FO1A 1E7RA 4FCWA 4JVLA 3IUMA 4F3CA 5HBGA 3K70B 3T5GA 1AZTA 3C0KA 3BF7A 1B6RA 1XROA 3A28A 2FUKA 4GPAA 4MR7B 2XUDA 3GMDA 4EUEA 1U5AA 4RENA 4W9NA 2J6IA 1Z0FA 5I6DA 1D2NA 2DPGA 4I4CA 4DR6B 1J20A 2I3AA 2EX0A 2TSYB 4US1R 1A9ZA 1USKA 2JD2A 1QQTA 4G56A 2FP4A 4KE9A 4QFMA 4UTZA 1CSEE 1NL3A 1L5HB 4H7PA 4TPKA 4W6QA 2OBFA 1GPJA 2PS9A 4GM0A 2PT9A 4UASA 3VPAA 1NFRA 4ZICA 4I46A 9LDBA 3DLHA 3F73A 2E4ZA 4HGRA 5IX8A 1NBMA 2C20A 1ZDMA 5FFFA 5I7AA 1ZA2A 4OX9Y 5FWYB 4MJLA 2YN4A 4UM5A 1I2CA 1L7AA 4KXYA 1U65A 5FL7A 3H3XA 3SF8B 2OECA 3BGIA 1P9NA 2YVQA 1K6JA 4NYIQ 1O6CA 2IOHA 2X3UA 1ST2A 4MDEA 4FYHA 1CPYA 4R2KA 4ID3A 1TCUA 3EIQA 2GQ0A 3PR3A 1KR5A 4LPKA 4ZRNA 5F77A 3VR4H 3L2OB 4MR9B 5JCPA 4JQCA 5NULA 1USWA 2H1FA 2WWTA 4X41A 1Q6ZA 1SXJD 3SDZA 2FDXA 3MMSA 2D59A 3UOGA 2EW1A 2F3TA 4EARA 5KDLA 4Z4HA 3FBWA 1VCNA 5CIQA 3ZWCA 1P0IA 4I1IA 3IKVA 4EG4A 4MUNA 3SHWA 3MGAA 4BXOB 4OQMA 4B6QA 1O7JA 5DHAA 3T99A 2ZQYA 3ZKWA 2C3YA 3U49A 2AHOA 1B0AA 1ZN7A 1P2UA 2HF8A 4OF4A 4TKVA 3VSCA 2C54A 1HE2A 4IMIB 5JZOA 4L0CA 1KO5A 1JG6A 1WDKA 3KJGA 4LHVA 2GN6A 2QE7A 3USCS 4CKBB 2NXWA 1V39A 4RJJA 3PICA 2ATXA 1YUBA 2J3MA 3L7CA 4EKYA 1C0EA 2WIJA 2CF5A 4R6WA 4Z7OB 4QM7A 4KLNA 1YD7A 3FHTA 1TQ4A 4X24A 3NHFA 4EX6A 4BLQA 2WHEA 4OJTA 2MHCA 4LZAA 1O1YA 3FPKA 4ROTA 4KNYA 5FH9A 1J97A 2RGBA 1XN1A 3IODA 3QTTA 5HILA 5ADUS 1XOIA 3O4RA 4BZPA 1KQFA 4HO1X 1TMGE 3R75A 1C0KA 4CU5A 3I2HA 1E2DA 2GEJA 2PX2A 2ZBUA 5FV7A 4YMSA 5IDYA 3ISTA 3WB0A 5K0LA 3R0VA 4GFDA 1CUGA 4CM7A 1A9RA 4LQ4A 1BTOA 1T15A 1TAUA 2M1ZA 1EJBA 2QLTA 4NENB 4EAAA 1JSRA 4F4DA 1KJNA 1M2GA 1QZ3A 3K9FC 4P93A 2P9JA 4LZOA 4BO5A 3RROA 2I4OA 4KQEA 3GVPA 2N0SA 5CW1A 3FOFC 3E7PA 1LU9A <