1EGQA

Enhancement of enzyme activity through three-phase partitioning: crystal structure of a modified serine proteinase at 1.5 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE K
publication title Enhancement of enzyme activity through three-phase partitioning: crystal structure of a modified serine proteinase at 1.5 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2000-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1egqA00
5CW1A 1AV7A 3EE6A 1DBIA 4JP8A 1SH7A 4DZTA 2XTJA 1SPBS 1R64A 1BH6A 2W2NA 1GCIA 1BFKA 2Z56A 1BJRE 4CFYA 1TM1E 1PFGA 2PMWB 3I30X 3DVSX 1GA4A 3T41A 1V6CA 3QTLA 3TI7A 4KB5A 1JEAA 1GT91 1NDQA 1S01A 4CFZA 1SCDA 3A3PA 3Q40A 1SCBA 1IAVA 1GNSA 5B1EA 3WIVA 4OV6B 2XRMA 2HPZA 1ZVKA 4WOBA 4H6WA 3DVRX 1EA7A 3DE5X 3AFGA 3I37X 3DVQX 1PEKE 1AQNA 1SVNA 1KDZA 4OMCA 1IC6A 4ZARA 1UBNA 3BPSA 1SBHA 1SELA 3CO0S 1WMFA 1T1EA 3GCWA 5B1DA 1S02A 1LW6E 3EDYA 1AH2A 2QTWB 4LVNA 3D9QX 5JXHA 2ZRQA 5ARCA 2X8JB 2W2QA 4MZDA 3TECE 2PWAA 3VTAA 4H6VA 3AJ8A 4AKSA 1YJCA 1R6VA 4C3VA 1BFUA 1SN7A 3DW3X 1SBNE 3WIUA 1DUIA 2G4VA 1CSEE 3DE0X 2ID8A 1C9NA 1PTKA 5FBZA 3VYVA 1Y3BE 3GT4A 3F49S 2WUWE 1AVTA 3TI9A 4HX2A 3LPAA 1S2NA 4GI3A 4KG7A 1TECE 3EIFA 3LPCA 3LXUX 2W2MA 2HD4A 1KE2A 2WUVA 1P7WA 1SUBA 1GNVA 3GCXA 1HT3A 1SCJA 1SBTA 1V5IA 2DP4E 3HJRA 1BE8A 3AJ9A 3DE6X 1Y33E 2PRKA 1MPTA 3H42B 2Z30A 3DW1X 3BX1A 1R0RE 1MEEA 1TO2E 3PTLA 3BGOS 1GA6A 2TECE 3VSBA 2IXTA 1EGQA 1CNMA 4J94A 5AVJA 1T1IA 1OYVA 5AVKA 1Y3DE 1SCNE 1NLUA 1WSDA 1KDYA 5AQEA 1NDUA 3VHQA 1SIOA 2Z2YA 3DE7X 1AU9A 1THMA 5K7SA 1Y3CE 3DE4X 1SCAA 3P5BA 2Z58A 1P7VA 1WMDA 1Y4AE 1SIUA 1SBIA 4NE7A 5I9SA 2W2PA 3LPDA 4K8RB 2E1PA 1TMGE 1KDVA 2Z2ZA 3DWEX 1GTL1 5ARBA 2Z57A 3A3OA 5JMOA 4RYDA 2V8BA 1SUDA 1ST3A 3QFHA 2P4EA 1GTJ1 4NMXB 4FONA 3F7OA 2X8JA 3SQOA 1KE1A 4WOCA 1GTG1 3CNQS 1Y48E 1OT5A 2DUJA 1Y4DE 5JXJA 1A2QA 4B5LA 1ZVJA 3VV2A 2DQKA 3UNXA 4BWGA 1XF1A 1GA1A 4HVLA 3QMPA 1TM7E 3OSZA 2PQ2A 1TM3E 3SICE 2SBTA 4H6XA 1SBCA 2ZWPA 3VV3A 3DE2X 1C3LA 1AF4A 3WHIA 1OYOA 3ZXXA 2WV7A 1PJ8A 1YJAA 5FFNA 3DDZX 1TK2A 3WQBA 3D43A 1SUPA 2W2OA 2SNIE 1VSBA 3DYBA 3I2YX 5JXIA 1C9JA 4C3UA 5FAXA 1SIBE 1Y34E 2WWTA 2SICE 3PRKE 3DE3X 4KPGA 5SICE 2PWBA 1WVMA 2GKOA 1SUEA 4CG0A 4AKTA 1YU6A 2IY9A 3ZXYA 1YJBA 1BE6A 4DJ5X 4ZOQI 1TM5E 1WMEA 3Q5GA 4OMDA 1ST2A 3I34X 4M1ZA 1T1GA 2Z2XA 1AK9A 3DE1X 4LVOA 2ID4A 1C9MA 1P8JA 1TO1E 2ST1A 3L1KA 4Z2AA 1Y9ZA 1Y1KE 4I0WB 2SECE 2B6NA 2ZWOA 3F7MA 2PKCA 2PYZA 1TM4E 1SUCA 5AMXA 5ARDA 5JXGA 3GT3A 1SUAA 3A3NA 4DWWA 4NE9A 4YN3A 1Y3FE 1Q5PA
chains in the Genus database with same CATH superfamily
4Q3EA 3LP6A 3O73A 4HDSB 4J0EA 4WFQA 5KYVA 2P68A 2XB6A 1HC7A 3DSRA 1T0IA 2IJGX 1DIBA 4FDMA 1E5XA 3MTDA 4KYIB 3RVOA 4AJ1A 5JSQA 1DHTA 2GX6A 1JHMA 1JVBA 1VXOA 3E5MA 3EVDA 1KQOA 2D8AA 4LQ4A 4PHCA 5L4LA 2IODA 1J0DA 1ILWA 5AKYA 4TWAA 4B34A 1YDWA 1NP3A 4G5FA 1R64A 4DWVA 3LK6A 4HGZA 4EVIA 1JHZA 1EFVA 2W2NA 2ZJZA 4GI7A 4BMCA 4Y2PA 3KL2A 4IY1A 3VH1A 4Z54A 5LOVA 4QT4A 2Q6VA 2XMGA 3E9CA 4QDKA 4TLLB 5L3RA 1XA4A 1QGOA 4TLBA 1DG9A 1K66A 3T99A 2M1ZA 1ZD1A 3Q8WA 4N0DA 2POCA 1PQUA 4UU8A 4EZBA 2GAOA 4IHJA 2CNDA 3A1TA 1V6CA 4WFKA 1I7QB 2BV3A 1US8B 3KWMA 4X94A 1CY8A 3GFBA 2X5OA 3I9KA 2OUIA 4MUKA 2HIAA 3E9MA 4KB5A 1UC5B 3BILA 4FFRA 3UTDA 5BURA 5HUHA 1DRJA 1N8NA 1L4YA 2ZSJA 1EM8A 3HEAA 4IOJA 2GYVA 3HADA 2VT3A 4OX9Y 5DPMA 4MPJA 2DH5A 1U9ZA 4RKYA 4GOKA 4KP7A 4R5HA 2AYXA 4WXYB 4PLGA 5EE3A 4JI8B 2UYCA 2A7QA 1U7DA 3BHJA 4RVDA 2BF7A 3ZBTA 4FNMA 2D3TA 4B44A 1EGVB 1XR3A 3DBRA 4FYMA 3VOSA 3MJ4A 4P93A 2AEJA 4D8UA 4YAEA 3DBOB 1K8ZB 3IODA 3DCIA 3AUAA 1NI4B 4MHTA 3SVZA 4BJ3A 4L9SA 3Q3IA 3VOBA 3KSBC 2JAHA 3KUXA 1RAIA 1DAPA 2H57A 3L4BC 2V4MA 1YRYE 4YRBA 1D2GA 2YWEA 4XGIA 1RXVA 2B6HA 1FDRA 2HBRA 2ZPTX 4M8IA 4QPZA 3QPBA 1TEZA 5AW7A 3DMGA 3H4MA 3UN1A 4NOMA 1XZGA 2R6CA 4LG1A 1EIWA 3IUPA 2HNAA 3ZWBA 2YVQA 5A3VA 3MWEA 3HI4A 3RC9A 3ZI7A 5K05A 3KZNA 1E3WB 1G2OA 1UBUS 3DVRX 4KQFA 4RXMA 5CYFA 4KITB 1E7WA 1S8AA 5CFOA 3DV0B 4E1BA 3RS5A 2WWWA 3QY9A 1DBWA 3EGDB 1E94E 4GI5A 4ZHQF 4YQZA 3RIEA 1NURA 1QHSA 2Z1MA 4L1KA 1KZ1A 2AKYA 2WSYB 3K05A 3S1LA 3ZBQA 5AYVA 1KMQA 1SVNA 2UYQA 5FLXA 2FG7C 3WRYA 4Y6PA 4BX9A 4XH9B 3PXEA 2DHCA 2LIPA 1UBNA 1MQSA 3DD1A 2Q5IA 1J8QA 1SELA 3IC5A 1B23P 3D81A 1XMOB 1XRSB 3EIWA 3GBSA 3F5DA 1GP2A 4GYYA 1UFVA 3HP7A 3ETNA 4B6RA 4DHEA 5EZSA 3WLQA 2HF7A 2XB9A 3BWDD 1NQUA 2RB4A 5LPNA 3NGMA 3BK1A 4N12A 2FWIA 5KHAA 4PR0A 5IJXA 3KE8A 4IJUA 1B6GA 2FW7A 1HUQA 1SD5A 2WM8A 4NMMA 2HA2A 3V2GA 2GAIA 4C1BA 3VKGA 4TRNA 4L15A 4A8JA 2BEVB 5JAPA 4PX2A 3L8MA 1MDFA 3AV3A 1ESDA 4B4DA 2FG6C 3RDPA 3S1AB 5H5JA 5EHXA 4TZKA 1Q2XA 2F3RA 2R60A 1RE0A 1M6WA 5BMVF 6NULA 3DW3X 1WXQA 3RK0A 5HE9A 2C8LA 2WG1A 2X0FA 2DPHA 4BNVA 3FMPB 1K89A 4I4TF 3UATA 4YUZA 1C3EA 1AT1A 1LLCA 4UTRA 1G8KA 1GEEA 3UB4A 1KS2A 1NBOA 4WXHA 3HVKA 2CL5A 2R7NA 1KJIA 4HT3B 3MQFA 1MFPA 5DTIA 5HF5A 4JFRA 1W4RA 3VR6D 3ZIAD 4CM8A 4DBZA 3TPCA 4U9UA 2IS6A 2WIBA 2IZZA 4MQBA 1IJKA 3HKEB 2H18A 1QO7A 1GQOA 1XAJA 3E05A 4NOJA 1PUXA 1QAMA 4PYLA 4QOIA 4HGPA 3TL3A 1E1CB 1RWVA 3IHKA 1Z4PX 2XGJA 3LWDA 2P11A 4GQIA 4Z7JA 5I48A 4BO4A 3OLQA 5KYUA 2P41A 1SY7A 4L5JA 3Q5EA 3D7LA 3PGMA 3WO1A 1EX7A 4Z4FA 3UENA 2W0MA 3C7DB 4KH1A 1HMPA 1RCFA 2O20A 4CKZA 1E9EA 2JANA 1GNPA 3NAZA 1QHHA 1U99A 4MVJP 4ZGWA 3VMMA 1DIOB 3KYDB 3WY9A 2QSZA 4YJ3A 3T3OA 1T9GS 2BKVA 1VPLA 1FTGA 2FPLA 2M2IA 3L3BA 4PYKA 4Q66C 4IKEA 1ZR4A 3CLUC 3NALA 4C0HA 1HT3A 5B1YA 2I34A 1TTTA 2B61A 4M7PA 2OV2A 1D6NA 3ADKA 3FGOA 3VSDA 4ZZ1A 4CDRA 3DHEA 1ZIOA 4C04A 2XWQA 4G65A 4JKOA 2O7NA 3NYWA 1Y33E 2QRLA 3MYRA 3DAPA 1IXKA 1EFUA 2CYAA 3MRTA 3T3EA 4PSKA 1HDGO 4NJMB 3RVRA 4CLDA 1CIJA 2DSTA 4I8IA 1Q44A 3ME5A 3BD7A 4JYCA 1U2TA 5BV0A 3CNEA 3Q6MA 3B5EA 4Q7KA 4ZT5A 3ZHCA 2OBNA 2QL6A 3R3SA 3AKCA 5GZ3A 1OBCA 2UVDA 5LYJF 1TUBB 2O06A 4GOMD 4TRMA 2ZWIA 5IEJA 3JCZA 4MI9A 2FWBA 4BASA 4M46A 2AS0A 2EW2A 4ICIA 3COVA 4I1RA 5CEJA 3WRVA 3MQ2A 2QBYA 4JXZA 3QEMA 4OX9B 4TV9A 4G5XA 3B3JA 5JADA 1E62A 2X9LA 3BGOS 2WZQA 3R2JA 5E6SB 1QIMA 3ZE1B 4L4ZA 5CT5A 3VSBA 1FTNA 3UXEA 3V1LA 4IIJB 5CURA 1BHO1 2IXTA 2WHPB 2R5NA 3T1OA 1ILEA 1O0SA 3PDIB 2CB0A 5JPDA 4TMWA 1UXKA 3DPIA 2PQ6A 1IOZA 1ZEJA 4RPKA 4EJ6A 4HS4A 5AVJA 3BD6A 4CTJA 2CFTA 3OESA 1FMCA 1R88A 3OFJA 4BDTA 4QYWA 2PT7A 1CJKC 1YONA 3PA8A 2XHEA 5FJIA 5M3BA 5IDVA 4K6CA 4EIWA 3IKLA 5CR9A 4OA8A 2XA9A 4KIGA 4B75A 2PH5A 4WWHA 1K68A 3TDKA 1X1TA 4AJ4A 2WMYA 1T9KA 4CODB 1QNFA 4N6NA 3KVYA 3FOAA 4ER5A 4BRZA 1VFNA 2AMJA 4LNHA 1XZAA 3OU6A 4MXDA 3CUSA 1VC2A 2JIRA 2P9EA 3JYLA 2V7BA 1FFDA 3SK0A 2QGFA 1YWGO 2HPVA 3RTAA 1S2LA 2UUAB 4OK3A 4YR9A 4R9SA 2V6BA 4UDYX 1PIWA 4II7A 3GRVA 1SUIA 4D9CA 4DYHA 5KSOA 4MJXA 1WB6A 2V5AA 3PR2B 1TMKA 4KUGA 1XKLA 3G2KA 4UHEA 4IMJB 1CUEA 3NHZA 1MAAA 1ORDA 4CQLA 5IANA 3D5TA 4NJEB 4W7SA 3K0EA 5IT9A 4JI0B 2XBMA 4KBFA 3AG5A 2J41A 2B8JA 2JKYA 1Z0UA 2WK1A 4FWTA 3W5CA 2H4ZA 1P7VA 2CNOA 2G9RA 2UUPA 4R9RA 2XYVA 1HFJA 3A4VA 1P0IA 2JD2A 4OAOA 2FHPA 4C6HA 3LKBA 4HVLA 2VJCA 4UULA 1RZ3A 2D0OB 2V03A 3HR7A 3TJRA 3LW8A 3H5WA 4ZVVA 3CLUD 2WICA 2Y1GA 1R8YA 1XLTA 3WDKA 2Y0DA 3OHPA 2W9XA 2PVCA 5KJ6A 3JU3A 2V0CA 1N2ZA 2J31A 5I7VA 3RPEA 3HABA 4X97A 3FF4A 1KDVA 3K9WA 1K8QA 1YL7A 4CEJA 3KB6A 3N8HA 4HUQA 1D2MA 5JXWA 1RFGE 2H85A 3WADA 4K0RA 1TTPB 2R66A 1DLJA 2Y0PA 4C4ZA 4KGVA 1MJFA 4X44A 4HUTA 5LBIA 2VTBB 1XJWA 2YY7A 3QF4A 3BGVA 1GCAA 1ORWA 3S27A 3HC7A 4RCZA 4EKYA 1SUDA 1FSZA 1MAUA 1ST3A 1SG0A 2YJTD 4IM7A 1HOTA 3DCJA 4UUBA 5EQDA 1QPZA 1Q0SA 1OH5A 5B3KA 5JSHA 2XQVA 1K5DA 5LP6B 1P81A 4IDBA 2O7QA 2J3MA 2CD7A 3SQOA 3FOFC 4Q9LA 1HDRA 2FSVC 2IYLD 3I1YA 1T4CB 3M6FA 2UDPA 1UWLA 2WJGA 2XDAA 4JEUA 3SX4A 3V4VB 4LXXA 3W6NA 2GZDA 1CUJA 4EAQA 2R1UA 2ZRHA 1DJNA 3E7FA 1I1OA 3VU0A 3I53A 1ZQ1A 2D5LA 3DDWA 4R40A 4G5SA 2BM0A 2DWOA 2W2LD 4OOFA 2CMDA 2DQKA 2E4XA 4GZLA 1XK7A 5JEDA 3A28A 4Z4IA 2IE0A 3FNRA 2FPRA 1U9IC 4MUXA 2QTRA 4BFTA 5JVDA 1E58A 3ZI4A 4Q3OA 3C24A 1T4GA 3O1JC 1SXGA 2QLNA 4BWGA 3IOMA 1M7GA 1XF1A 3COJA 1IG0A 3P8ZA 4LWPA 1CETA 1KMHB 1L5WA 2ZZMA 1V96A 4HQKA 4EG6A 3AJAA 3TE6A 3NUGA 3FTEA 3AU9A 3TR0A 1KY2A 4QGFA 3PQ8A 1UK8A 4PFSA 5EE9A 3UJPA 1XG5A 2EJBA 1NTOA 1S2OA 2HY7A 2P4UA 2GN8A 3OJWA 1SB8A 2ZWPA 3Q7PA 1CY7A 4NG4A 1KARA 1YOVB 1W46A 3LAWA 3LRXA 5D84A 4DLZA 5FBWB 3ILXA 1XRRA 4DSNA 4XB1A 3DXFA 4ROTA 4EY6A 3U60B 1NZJA 2JI8A 2Q3DA 3KTAA 3SOZA 4YJGA 3DB2A 4BO0A 2IIPA 5JNUA 2OG2A 3HKDA 5ADUS 2JFZA 5L3VA 2EAUA 1E1RA 1KEZA 4NICA 2HRZA 4IHKA 3KBBA 1W73A 1Y6JA 3AL0C 2NXWA 1GWNA 2E89A 2F1KA 2ODTX 1K27A 2OP0A 4MRRA 4Y6GB 3WQBA 3I9V6 1EKXA 1ZW6A 5IYZA 2OHFA 4EHAA 1S89A 3L7BA 1SIWA 1IOVA 4UVGA 3DLTA 4F6CA 4I9GA 1XJ5A 4TMXA 2P9HA 4BMZA 3FCAA 4B71A 3AP3A 3H4IA 1CERA 5JSYA 1LFAA 3H83A 5DV9A 3ZYZA 4EG7A 3I2YX 1P29A 1QQBA 4OHBA 3RIHA 1SOVA 4OHFA 1E9DA 1FTWA 2RC6A 4ZVTA 1IUOA 1N2JA 4OJTA 3ZHBA 3QFRA 1II8A 1Z35A 4LE2A 1TT5B 4K9PA 4V2IA 1PHRA 3GF4A 4DQXA 4IRMA 2GM3A 2R1TA 3E3NA 3GP8A 2VSNA 4QA9A 5GM2A 4DIFA 2ZGVA 5KKNB 3UMMA 3GDOA 4FGWA 4PSDA 2L18A 1X9HA 4JENA 1ZRMA 4TL6A 5JNVA 5FULA 2AW3A 2Q4DA 4PRYA 2RSLA 3L7IA 3FFBA 4XSGA 2GJ8A 1Q3KA 3QBDA 3W1WA 3ZWYA 3WK4A 1N7IA 4MWBA 3QH4A 1YCGA 2DVMA 1Z06A 3C2QA 1EK1A 3B60A 4HDMA 1A7UA 4PPYA 2RJOA 1OGYA 3WGTA 2V55B 3KSRA 1CUFA 4EDFA 2CE7A 3ODPA 2HA5A 5IZCA 5CMLA 5BW8A 2ZUVA 5TLSA 4F2HA 4BVAA 4LCEA 5A0VA 1CUXA 1I3LA 1NRIA 2LR0A 4EFKA 5DCWA 2EP7A 4PPFA 5EWMB 3SOPA 4PO8A 3L1IA 5E1OA 5C18A 1TO1E 4C7OA 5GIPE 2WAXA 2OAEA 3QLVA 1XA0A 3CKYA 4N39A 1L1FA 1IBMB 2JFVA 1BCSA 4FDVA 3IOEA 2IFTA 3CRQA 4L2IB 4Y0VA 2SKEA 3HU2A 4DCUA 2HFKA 2H8KA 3M5PA 4XJTA 5DCYA 1NVEA 2PJZA 3ZWDA 2R2GA 1AX9A 2XNHA 4LGYA 1RHMA 3TOZA 2GVNA 3IXLA 5C52B 3BZBA 1G2QA 1NUUA 3CZPA 1OXKB 2EFCB 1MZVA 3AEZA 1RCTE 1XMVA 1C1DB 1WX1A 3ONEA 3QVXA 4XOUA 4PTYA 1I4OA 1YQWA 1OMOA 2C1EA 1Q5PA 3ZZ1A 3GAZA 3FYTA 2P4SA 3RVLA 4OM7A 5CW1A 4L28A 2IP2A 3N8GA 1JH8A 4EPVA 1NUSA 1NW4A 4CM5A 2EW1A 4Q34A 3WKCA 1G6OA 1MIHA 2AL7A 1V8BA 3IQGX 2JCGA 5FL3A 4JXKA 5L3QB 2ZPUA 5C80A 1T5IA 3C3YA 3T5DA 2C2GA 4PANA 2RGWA 3PGA1 4WOJA 1ODSA 4HTFA 1PNRA 1KF0A 1V4NA 4FM9A 2DTXA 3KQVA 4PLWA 2D00A 3U3KA 2FPGB 2JGKA 4OI1A 3RYTC 1B8UA 1RWXA 1D2EA 3FXAA 3LBYA 2AYZA 2F1OA 1BFKA 4K2AA 4M36A 1BJRE 1LRLA 1ZXXA 2C2ZA 2F90A 2HDHA 4KGDA 1ZM7A 2J85A 4XVQA 4CYMA 1JX6A 2G4CA 2IIQA 1AXGA 2PKQP 3GXBA 4M1TA 3GYGA 4NHOA 4PZLA 4NI5A 2NUTB 1MGPA 1OFIA 3P0FA 4S0XA 5G02A 4N76A 1ZMXA 3WIDA 5EQTA 4KVGA 3QTLA 1W581 2NP7A 2HHHB 3NHFA 4YCMA 1Z5UA 4F2GA 1EPUA 3BJRA 4W5WA 5CA1A 1Z63A 5EUBA 4KWIA 3PUHA 4H0CA 1S01A 1QG2A 4CIXA 5CPBA 1XTVA 2QM8A 2IYPA 4TS9A 3TKYA 5J43A 5LZ5A 1JQ5A 1UZAA 1VL2A 4D0RA 3D6AA 1XE3A 2RGAA 3H17A 5BSFA 1V26A 3N1UA 1I10A 1BS2A 2JS7A 2R7MA 3DOCA 3KYCB 2BFCB 4YMVA 3PBKA 4XJVA 2QIOA 4RJLA 5BP7A 4GNRA 2EX1A 1UWCA 3BVPA 2EF0A 3SIWA 2WM3A 2E4UA 2HIGA 1XDGA 4OJQA 3CNHA 5TQJA 4PNEA 4Q6WA 2WHYA 3GJ0A 3HYSA 4ZU6X 4A2PA 3W5SA 4KIJA 4EYQA 2XRYA 1NXSA 2GM5A 5FORA 4D57A 4WJLA 3ZEIA 4EUKA 2K87A 3PNQA 3VTKA 2ZDGA 2C3YA 5CAEB 2AB0A 2QMQA 1OBVA 2V6IA 1TCVA 2VDQB 4QBTA 4WW0A 2CL6X 2VC2B 3O2NA 4DMHA 4EKIA 4HAZA 3BMQB 2P3LA 1TAUA 3KR1A 5HE8A 5DYGA 2VF8A 3UPUA 4L5IA 3GVHA 3RGGA 1JEDA 3EZYA 1IATA 4X24A 2AQ8A 4XLLA 5ES3A 1FK8A 2O2EA 1YE5A 1Q7TA 4B6PA 1JKIA 3P71T 3M6AA 1QFJA 4ZAGA 1EUQA 1JZTA 3ZDEA 2JHGA 8ATCA 3R3UA 4XIGS 1RC8A 2H5LA 1D09A 1RXUA 3EMDA 3FWYA 2OV1A 2GARA 3OT4A 5ETJA 3OIYA 1JDTA 3C0KA 3WRYC 1GYRA 5JI3E 1FX0A 2J6HA 1QP4A 1JR4A 3EA5A 4IOKA 3H97A 4N40A 4CR8A 5CA0B 4MB2A 1G21E 4GM1A 2VNAA 4Q1FA 4XA8A 5I7FA 3UWPA 5HF9A 1RDFA 4H7HA 1Q21A 5ESRA 2GSWA 3EF0A 5KQGA 4M0LA 3V32A 4AD8A 2OC4A 4BWFB 3M3PA 3NB0A 2IYFA 3ABZA 4MTLA 5G0TA 2GHRA 3GDWA 4LZWA 1NPTO 2HLDA 1UL1X 2OCPA 2ZIVB 3CMMA 3GA7A 3HR8A 5MFZA 4MUIA 2NTJA 1KI6A 2IITA 1OHHD 4M21A 2HWUA 3PX3A 1O6FA 2E55A 1D04A 1K6JA 4YGYA 4NPAA 2JH3A 3D9QX 1YRQA 4OA5A 3VPBA 4OCZA 1NQOA 3L0DA 4FT4A 4A8JC 2I7XA 3LT1A 4N49A 4PZ9A 4V0MA 4AXBA 4R8LA 2F4NA 1RQPA 4UMFA 4CI0B 1PF7E 5IASA 3KD3A 4B87A 1J0CA 1H0RA 4DUPA 2GDZA 2IHKA 1B00A 4QPPA 4RO0A 3RHTA 4E15A 3UK0A 2JEZA 3U7QA 1J0EA 3BXPA 3KQPA 2XF8A 3HA5A 1IBLB 4G97A 3QV2A 2XXBA 4JJ4A 5K03A 4P31A 3E84A 1OXSC 2QNBA 2WG0A 3AX6A 4KQHA 1JT2A 4N0QA 4CM4B 1MC8A 5IHXA 3ADDA 2GBIA 4EW2A 4JLSA 2LCFA 2OVBA 3TAXA 4QSHA 5F9MA 3T52A 2YVLA 3IKVA 2WB2A 3OBIA 2GRAA 3O74A 2BFEA 5K8TA 1USIA 4TTSA 3GJ3A 4R0MA 2CDAA 1E96A 3TIXB 5DM0A 4NEHB 4DA6A 5EAIA 1R50A 2HSWA 4PLZA 1RQGA 3ER6A 1U0BB 3OIVA 3D4OA 1ORRA 1B15A 3LLMA 1QHYA 1X7XB 2PBZA 3QUAA 4YPOA 1NN5A 4BCCA 1ACMA 3NTVA 1Q7GA 1C8BA 1RU3A 1QQ5A 1S8OA 4UFOA 2JA2A 1PQPA 3UAZA 4DSZA 1JLKA 3HG7A 1CDEA 1O95A 2WUWE 1L8AA 4DR1B 2GF2A 1G7TA 1V1MB 2H54A 4BRWA 2QW1A 2OOSA 2XNSA 3CLTD 1DAOA 2ORWA 1BWSA 3PD1A 3T34A 3A10A 1NXVA 2NV2B 5JLAA 3VR5A 1BRMA 4AY4A 1DHRA 1PK8A 1E0SA 5AI8A 3PA6A 1UQTA 1IUKA 1USGA 5H3HA 4ZQBA 3TD2A 3LPCA 1Z4MA 1GILA 2VHXA 5TIIA 3E2PA 2J0SA 2PUTA 3FGZA 4NFSA 4QJ5A 5GONA 1V5EA 2WKPA 3P32A 4AAYA 2XXAA 4LXGA 1SOUA 4TLEA 3UAOA 4MW2A 2G40A 3T3HA 1SUBA 5LQAA 8MHTA 3G02A 2OB2A 3V6MA 2GPSA 4NCAA 1Q0ZA 4TWBA 1U7UA 2MSCB 2NPFA 1PU2A 1YQGA 3O8NA 1N1EA 4HDSA 4YJ2A 1KSFX 2AEMA 3HJRA 1B43A 4HQFA 4NESA 1N34B 3R8XA 3VFDA 1LPSA 2WU4A 1YUNA 2H17A 5KWJA 4UE2A 2K7FA 1O6CA 3CKLA 1OB5A 3SQNA 1A0OA 3QGMA 1X8XA 2MR6A 3IXQA 4H1TA 1N32B 3ACDA 4C5AA 4CU5A 2CB9A 3QX9A 1CHNA 1EFPB 4JX9A 3VKVA 5IVDA 3KWLA 3MOSA 5DXJA 4PBSA 3WSVA 2DQYA 2PXXA 2QEQA 4NX2A 5ERGB 4ZVKA 5BSHA 2PT6A 4NCNA 3RQSA 3GEPA 2XKJE 1VYVA 1F51E 2CLIB 1HRKA 1BQEA 1REQA 3JZDA 4P84A 2OV8A 3RI3A 2BHRA 2PV0A 1P7ZA 3RVPA 4BNLA 2YS6A 2QXTA 3WBJA 3LQYA 5IPFA 1CY0A 3CMCO 1US8A 2K7ZA 3QNUA 2QGNA 4R0VA 3EIEA 5BNFA 1BU8A 2JJ2D 3HA7A 4RYLA 3PPYA 4JT2A 1RHKA 2FEWB 4BQIA 4V0OA 5JNTA 3QI2A 3ZDAA 1K08A 3BWBA 1TLTA 2IX9A 3BE4A 4E5MA 4AJKA 1KJJA 3KK0A 1Y63A 3GGDA 2W2TA 1IY1A 2PL3A 3FI0A 3HKCB 3L6EA 1OQAA 1P62B 3COYA 3QY0A 4HQNA 4HZIA 4KN8A 4P33A 3REFA 3SNHA 4BGDA 4IXTA 4EHHA 5FOQA 3MGGA 1I1QB 2XB4A 4D9JA 1NI4A 3EEYA 2Z2YA 3IUQA 3OQIB 4IYJA 4K26A 3Q5DA 2EGGA 3SEZA 5K7SA 3IKTA 1D5WA 5IWAB 4ILEA 4K6MA 2Q6TA 3WDSA 3H2SA 3Q0TA 4JAVC 4AF7A 3Q9UA 1RTKA 3OP1A 1ZRNA 3RSQA 1E7QA 5JCPA 1NM5A 5F73A 3RTEA 3O8OB 2XVYA 4KXFB 3ZDZB 2W90A 4R2JA 2Y27A 3RS4A 2ZR8A 2YHAA 3SWWA 3AP2A 3WYCA 1MEJA 1WMBA 4PLCA 1JLMA 2PD6A 4AP9A 1C30B 3HHPA 1N6IA 5HJ5A 5KNCH 3JTEA 1U0SY 1ARZA 4M0FA 1E3WA 1SG9A 2F9LA 3HB5X 3KUDA 4WLFA 4BKRA 3BF8A 1ZM3A 1GG5A 2I6TA 1NR5A 2B30A 2DPMA 2D54A 2GWHA 2YXLA 3QWBA 5LZ8A 1QGDA 2VO1A 3KPVA 3EGDA 1KFKB 3K70D 2X9VA 2HI0A 2EFGA 2ZVPX 2ATVA 4K8RB 2IZ1A 1YKFA 2CFCA 3H05A 3MFQA 4IGFA 1E5VA 3TWOA 4ZT4A 1XFDA 4C29A 4NNJA 5JZVA 5LN1A 5IKXA 3ZWNA 3ZNPA 1YB1A 2H2GA 4ZYUA 3LHIA 2YJ6A 1KAOA 2QW8A 2QVYX 4PSVA 4D4KA 4KLRA 1RD4A 1A4XA 1Z3CA 2ECPA 3RUHA 2H1OA 1ZOPA 1U1DA 5EKXA 2GRJA 1QONA 3H8SA 2AA3A 1NX6A 3LC2O 2NU8B 3GEIA 1XAHA 3PF9A 1OAOA 4WZBE 4DDHA 4KPFC 3ZTYA 2BR4A 1VKOA 1TPYA 5FI0B 3KQUA 3I9OA 4DCPA 2Q5LA 2RIPA 4MRVA 3F7OA 1U6IA 3GJXC 3DBVO 2VQDA 3ICVA 4YLEA 3R5FA 3BMXA 4ESOA 5KTMA 3SG0A 3F5QA 2C58A 3KXPA 4P7GA 2CLHB 1RYFA 2PLRA 3PYXA 5DMXA 2B7LA 3HACA 2EJUA 5AW9A 1Y7HA 2ORVA 3MYYA 4YYZA 3RUDA 4I4IA 2LWIA 2X1VA 3CZ5A 1UJBA 1HDXA 1T8UA 1M6EX 1A2QA 1MB3A 2J5XA 3DFKA 2ZT5A 4WK4B 2GLTA 5DI3B 3S1AA 4TX1A 3ZWPA 5FPKA 1YZ3A 4HGYA 5IP5A 3K9FC 1WB5A 4MUFA 4PPQA 4TS1A 4C22A 1P9WA 3B3FA 1IWBB 3GEHA 3WSTA 1RYBA 5L8VA 3OLXA 4H16A 3WWEA 1C4KA 1TVKA 3VPHA 4GBGA 3RUPA 4B48A 5HS6A 1E1NA 3BWXA 1HNWB 4CM3A 2O2ZA 5TMEA 1U80A 4ZICA 2X42A 4RGBA 4XX0B 3MTBA 1NY5A 2GHQA 3GNSA 4G9EA 1X7GA 2ONCA 5EJ4A 3CUUA 1ZIPA 2WUFA 3NC4A 4RWEA 2KLHA 3ADCA 3B8HA 3HKEA 1AGNA 3LLSA 4L4UA 4EG8A 2H2HA 1JT9A 4CZ2A 3N39C 2FNAA 1TD9A 2VPQA 2X86A 2VUHB 3TW0A 2O3TA 1FFGA 4A5OA 1J23A 1G4HA 4GX2A 5JAUA 2R96A 3MJSA 2VDNB 1T3LA 1YUMA 3PL5A 3OJEA 3OKCA 1UKCA 5KYTA 1VL0A 5EIWA 3F6EX 1JQLB 3V8BA 3VPAA 5IWCA 1R18A 5CFNA 2WHRA 4JJ7A 4D46A 3WXMA 4RK5A 2C83A 2SCUB 2WR8A 3KSZO 1FQOA 1G18A 3FNFA 3KJIA 3QNWA 3EXAA 4WV3A 1PJ8A 1ZUNA 1OYWA 3KYDA 3QVLA 5TJ9A 2OG1A 4B6GA 4BFYA 5C1PA 1SKQA 1UC9A 1A7JA 2IW3A 3OJOA 3ZJ5A 1P2DA 3DDZX 3T7IA 1Q0HA 3Q7QA 5CB4B 3MILA 2I8LA 3MCVA 4DIUA 2WYOA 4IIDA 1COZA 3IPRA 4UXHA 3U6KA 3AHCA 3K0AA 3QKIA 4C3ZA 2OZLB 1R6XA 3GP5A 4TMTA 1Q84A 3L8EA 2FPMA 2SNIE 4CE6A 4EB0A 3QYPA 1LY1A 1B73A 1NVTA 1U8ZA 4DCSA 1G0OA 4MV0A 3ELUA 1MX1A 1Y34E 4NJMA 2WD7B 4KRXA 3X2FA 2ZI3A 4F7WA 2QUHA 4RK4A 4RL6A 1PV4A 1WD7A 3I6IA 4BO8A 1YTLA 3KQTA 1PJCA 3TOXA 3HL0A 1J00A 2F3UA 1EP3B 2O6LA 1CRZA 2GKOA 4PICA 1HQYE 3RCBA 1TCUA 4H0FA 4G2TA 1TUBA 4DQ0A 2Q6LA 3HM2A 3KJZA 4HNRA 3LA8A 4DR4B 1PT7A 5IXJA 4GI2A 3IVMA 3MEQA 1HOXA 4PLYA 5CBPB 5KREA 5KVVA 1MH1A 1RJWA 4ZT2A 3T8YA 3GI1A 4HLUA 3G2LA 4L75A 4R2KA 5K4AA 4NU5A 4JUDX 2NU6B 3B9QA 1H2FA 3DC2A 5DXAA 5KNCD 5E6SA 3UJ8A 3DT8A 1R1DA 2QRPA 1JA1A 1MB2A 2IU6A 1GVNB 2ZVQX 4IIJA 4ZKEA 2WHPA 5IZCC 1Q0TA 4ZQHA 1E0KA 2I0FA 5B7NA 5LA6A 2B4YA 3PDIA 3H1GA 4N41A 2MSWA 1XRPA 2P3SA 3H9JA 3ASUA 5CNKA 5JY6A 3VA7A 4FYYA 2QX4A 2OYRA 3QLVC 3WKAA 4DLUA 1QU2A 2F55A 3VX4A 2DOKA 1C7FA 1TM2A 2VRNA 1V8DA 2WAAA 1N6LA 4L8FA 5KYKA 1AKRA 1GNRA 1CHDA 1U8XX 2FJ0A 1T2FA 3P2KA 1M2WA 1N6KA 1NF8A 4KQKA 1WTAA 3NM5A 1DX9A 1SWWA 1WXEA 1BKDR 2GOYA 3O3NB 4O4IB 4X1YB 5E8JA 1R8QA 2OXIA 4N82A 3U3ZA 4XOIA 5IF3A 3OEYA 3A3KA 4IV0A 4AO7A 1A72A 1RHRA 3I92A 2ID9A 1F14A 3L8FA 4PNZA 5DSZA 5CYPA 1QIFA 5H70A 4C7VA 3BDAA 4H3VA 2H07A 4KNWA 4ZI5A 1JKJB 3ZYCA 4QULA 1XD2B 4FDLA 2RGUA 3KJFA 4HB0A 1KWKA 3IH5A 5DLEA 1Q20A 3DUFB 1XEXB 3HWRA 4NJEA 5AUQA 2HXSA 5LB2A 1TJ3A 4F46A 1JR3E 1DXHA 1X7YB 3EXFB 2HWYA 2Z2KA 3BZWA 3EBLA 3RNLA 1J7JA 2IPNA 4BEJA 4YV0A 1BX1A 2H06A 2XCOA 1PLLA 2XPCA 3G7SA 5DBOA 3CGWA 4YMHA 3HLTA 3OD1A 4GI1A 2BEJA 4YMUA 3RAFC 1JPNA 1VMAA 2Z98A 5CGZA 4ABYA 1A7KA 1YAHA 3IUBA 3MN1A 5JW6A 2NQTA 1MENA 1KYVA 1Z5ZA 3NTQA 3NIBA 4QOJA 5FPYA 1EVEA 3RYIB 1JE1A 1HLDA 1T6NA 1SR8A 2IDJA 4N7JA 4ZEMA 3L8CA 3MG9A 4INOA 4NBLA 4XCQA 4OQFA 3CTPA 2Q6KA 2QD5A 4GPBA 4MJ3A 1HTBA 2JLWA 1LPAB 4GO1A 3ZGYA 2H4YA 2CCJA 2HJWA 3E3OA 4Y2QA 4FFBB 1K63A 4C9BA 5LNK1 3LU1A 2ADOA 3HCRA 2GN2A 4JKYA 3S7TA 2CZGA 3B52X 3P97A 3GR6A 1C1HA 2VTBA 4JLBA 2DWQA 2EKLA 1PG5A 5D1NA 5FOWA 4AP6A 4OLAA 2QS9A 1VPDA 4J9VA 3NIFB 2LNDA 1NONA 4YI3A 5KC9A 2J3IA 5L6MB 4KBGA 4BV3A 1ATIA 1KQ3A 1KK2A 2KW5A 4F84A 5LP6A 5CG2A 1YDFA 1EG2A 2I3GA 2PAAA 2EP8A 3KM0A 4G37A 4X54A 5TPZA 3W7VA 2JAOA 3Q9SA 2UUOA 3DYVA 1A88A 3OFNA 3H75A 2QTHA 1NVVR 2VHQA 1RLTA 4GH5A 5LLSA 4RSRA 1T4CA 4P4TA 4UQOA 1NTRA 3ORFA 3NOXA 2WYVA 2Q9UA 4MZXA 1WR8A 4YMTA 5JSZA 1IG3A 3G5AA 1IAVA 3EGEA 3PC7A 4PC3A 4RF5A 2OHOA 4W5RA 2AG8A 3OZAA 3KQLA 5JT1A 1JMYA 4YWHA 2HF2A 4IR7A 2DLDA 3QPAA 3T3DA 3I8SA 4MWTA 4QEZA 2R5WA 3AQIA 1VCIA 3HP1A 4ZODA 1NSYA 3TRKA 1QHXA 3DEAA 3JAWA 5AKJA 3ZJUA 2QHXA 1KRXA 1GAEO 1N3LA 1P77A 2VH5R 3DKRA 4JBNA 2E3JA 1RMYA 4K9MA 1D1QA 2JJ8A 3GPBA 1RM0A 3Q8XB 4B82A 5BUSA 4D82A 3DB1A 3C6KA 3UQZA 1CUZA 1PWYE 2VXCA 4ESHA 4GGMX 1KMHA 4WOBA 3NHYA 1ZD9A 1T9CA 1FVHA 1K8XB 1WDWB 2FF7A 2P69A 1O2DA 1TO6A 4HXYA 1LBHA 4OU5A 5FR2A 5C9ZA 1FU7A 3EGCA 1HYQA 2GPBA 1C0IA 3E48A 2CLKB 1FFHA 1NG9A 2ORED 3L7JA 5DYTA 2Y1DA 3WMRA 1Z8DA 2O4UX 4D0GA 1YOVA 1NWCA 2GZRA 4WZAB 2PKWA 1FVFA 5J2UF 3I37X 4NP6A 1Z7BA 4AX4A 4EYGA 2OBLA 4QEDA 4B5KA 5B6IA 4BVGA 3HCAA 1PEAA 1UWVA 1PR3A 3UH0A 3RSOA 3S2ZA 4ACBA 1F17A 1NVDA 2BGUA 3DJYA 4KQEA 1TKCA 1JDBB 2W93A 1UBEA 3TJZA 2IEIA 3Q3JB 3CONA 1IM2A 4XTRA 1EA5A 3T5TA 3PEWA 2WZBA 2JFGA 3A4IA 4BU1A 5TSDA 3C43A 4XAQA 4BNYA 3ZY6A 2XHZA 3AIOA 3G79A 4L6CA 5AKHA 5AUNB 2IEAA 3VR5H 1S2DA 1MX5A 3JZMA 2B4KA 3EUFA 2Y1OA 4ME6A 1YCDA 4U63A 2AIRA 3T5PA 1RFLA 4DCGA 3OCJA 5DYNA 3X1MA 1P8AA 3K5WA 1VQ1A 3Q41A 3GLFB 3OF3A 4EF4A 2D1QA 2C0QA 1H2XA 4MX8A 5ELXA 4DCJA 2QLLA 3FPGA 1YHZA 1QDLB 4BNIA 2R47A 1UPUA 1P60A 2Q0QA 4JBLA 4EQ6B 2Y9PB 1SBNE 3N3BC 5FOVA 4N1AA 3WLAA 1WY7A 4G5YA 1IY2A 4KO1S 1GTRA 4U4AA 1Q1QA 3FNQA 5IK2A 1WIWA 1U0NA 2G4VA 1CW2B 1E2MA 4RVUA 5A0TA 2QRVB 4URUR 1XZLA 3P52A 3LQKA 3AM1A 1Q3HA 1S96A 1YS7A 4J7CA 4Q9NA 4Z7OB 1U7ZA 2CNWA 1SD2A 1EYZA 1X70A 4M7RA 4KUHA 2E4YA 3UB2A 1I80A 5FNVA 1ZVQA 2Z5GA 1JXQA 1KP2A 1R0ZA 2QT1A 2QSUA 4PNHA 1IUNA 2BY4A 2FZKA 3BD9A 1KDOA 3EAQA 1O95C 1J22A 3DHNA 1V9CA 5JU6A 1SXJE 1WCV1 5EWMA 1J49A 2Z09A 3BERA 3QQ5A 4OYLA 2HIMA 2PJDA 1UJ5A 2ATEA 2XRFA 4BQNA 1AHHA 4TRJA 3SCZA 1K7CA 1XSEA 1LEHA 1YZFA 2N1MA 2QTCA 3FF1A 4L2IA 5A6SB 3S2SA 5C1DA 3C7CB 4DEVA 1ENZA 3ZHZA 4MVJG 3ZZMA 1V48A 1ZFNA 2C61A 4YP6A 2R3SA 2HA0A 5G2OA 3SLGA 2RKWA 1IOWA 1ECJA 1KPGA 3V8MA 4QOHA 1BN6A 4G5GA 1P7WA 3HXMA 1D4FA 1QB7A 1C1DA 3EAFA 4NIMA 3UMBA 2BISA 3WIOA 1BGWA 2X6TA 4ZIRA 3MMXA 1WKVA 4KSBA 5HK9A 3MOIA 1RKVA 1F8UA 4LYFA 1I32A 4BP8A 3ZH2A 2PGIA 3E9DA 1PNOA 1JWBB 1WLYA 3AIMA 3F4BA 5CHEA 3VUFA 2RD2A 4F45A 1IK6A 3P4YA 4IF6A 3PITA 5FF9A 4IRUB 1KEVA 2J5BA 3H42B 4H7FA 4JHXA 4JLMA 5HRCA 3TS1A 1CUWA 3KQNA 4BN0A 3TM4A 1LDYA 1P5ZB 5KOJB 3NBQA 2A0XA 4UUOA 1H2AS 4AU1A 2ONKA 1L5MA 3VKFA 5EJFA 2H9YA 2PT9A 4P92A 4QEKA 1RPNA 1UPTA 2FPGA 4Q3KA 2HBYA 3BFPA 2AW5A 2V7GA 2DBYA 1U2EA 3A6GA 3I1JA 4V39A 4ON9A 1R4MB 3CXRA 4JU8A 3K9HA 4OJYA 2BKAA 2WKQA 3N7UA 5EGNA 1BFDA 3H2YA 5IJ0B 3QEOA 2NUTA 4BGVA 3IEMA 1DL5A 4ES6A 2V5VA 4R69A 5HP4A 2ZJ8A 1Q7CA 1U0OC 2Z5VA 1NLYA 2NYVA 621PA 1MRSA 9GPBA 4BLVA 1SCIA 1T0UA 1JYFA 1MFZA 3KWFA 4EG5A 2ZSAA 1Y9AA 2RHWA 5JH7B 5EWJB 4DV2B 3LK7A 4FNAA 2HGSA 3E5HA 3H5LA 3PFHA 4QUGA 2P67A 4OP2A 2OPHA 1KIFA 5FPQA 1WMSA 1DQZA 2BT4A 5H83A 3RLFA 4TKMA 2ZOSA 1DT3A 4D8XA 3RC8A 3KYCA 5J63A 2BFCA 2EBFX 2Y92A 4FOLA 4OBBA 4AY2A 4XEHA 3A8TA 5IU6A 2C0CA 5K45A 4TL8A 1KDTA 3N5KA 3OKFA 1JIQA 4KXVA 2QTMA 1YZUA 4Q82A 5BV2P 3BDVA 1X1EA 1XQ9A 3BBLA 1GFSA 3K8YA 2BFNA 3T4UA 5CDFE 2C4KA 5ALMA 1DBRA 3QKUA 3C3PA 4KDCA 4C7JA 1NBHA 1PSWA 3L6BA 4OQNA 2PKYX 4MQFB 3EH1A 2V1XA 3H1TA 4PV7A 3DE4X 3PICA 2RHBA 4TPKA 5SYMA 1J1IA 5AKZA 5CAEA 1DAGA 1HZZA 2G6TA 1KYXA 1TVCA 2GK7A 1YOBA 3UMCA 4M3NA 4ONEA 1L7PA 2FN9A 3FB1A 2VS1A 5IAJA 3TSWA 1GUBA 1WJGA 2RH8A 4RA9B 3L7NA 2JKZA 3ROGA 4G85A 1W8DA 4EY5A 2IYUA 1ZI9A 2IUYA 4DMKA 2BBTA 5EFZA 4EFNA 4KFCA 5KKCA 3AHJA 2J30A 2LW7A 1NFRA 2V98A 3SR3A 1YA6A 4G0XA 3GLHB 1F1BA 3OOWA 3EW7A 2OZEA 3PGXA 2J4FA 5THQA 1B42A 5C5IA 2HLNA 4XDZA 5I7WA 3OLZA 3EVBA 3K16A 3VO8A 1T5SA 3K32A 3PUJA 2WKWA 4MS3B 1M54A 5LJIA 5CA0A 1OWPA 3AOGA 1M2VB 3UKDA 2I3ZA 2X22A 4TLAA 821PA 4AF6A 2G0TA 1WP9A 4JB2A 3AOEA 1BXZA 2G8LA 2AUMA 3ZUGA 2CF5A 1EQAA 4FLMA 2O1WA 3IVAA 1EFHA 1NZDA 3E5NA 3LT4A 3CX7A 3WRXA 1OWOA 5KX5A 2QORA 5E2IA 3RBVA 4BAUA 2ARKA 2KI5A 1A9ZA 3MGCA 4BWVA 1OAOC 4V02A 2G4LA 1H2ZA 3B8EA 4JI7B 3LMKA 1Z16A 3PWSA 2Z9DA 3WQHA 2HK8A 1HETA 2HJ9A 2P4EA 1O0BA 1TCAA 1N25A 3I9LA 5KYYB 3ZD8A 4IXNA 2SKDA 1EWVA 2ZB8A 4N3GA 4M88A 3RBAA 2C8VA 2WJZB 5K4GA 5KQLA 4AWBA 3RVJA 4M54A 2ECOA 3H65A 1I94B 1E8NA 4FGKA 4WOCA 2DUNA 4EA9A 3U49A 1ZMBA 4X90A 4DCCA 1G4UR 1Y48E 2DHEA 3ZBUA 1CY1A 4AG3A 2JL1A 3L6RA 4UHDA 3B36A 4OFWA 4OYRA 4B5LA 1SFRA 3DZJA 1ZG3A 1E0AA 3Q7TA 4JJEA 4QYIB 3TQCA 1U5CA 4CM4A 4FYIA 5KCZA 2VYNA 2FRVA 2XQFA 2YHUA 3CF2A 3F47A 3NI2A 4Q01A 3VDRA 4M0PA 3WZ2A 3I28A 4HPJB 4YMLA 2W6JA 2AUNA 4JBWA 5FLEX 3L7KA 3NR2A 4HB4A 1Z2DA 2UVPB 3MNFA 4HR7A 1PT5A 1VPWA 3CN7A 1J25A 1ECLA 3JZFA 4GLBA 2H7CA 5ELLA 5AD1A 2NTVA 1V16B 2NSLA 3UTCA 1VHLA 3CEAA 1YRAA 2Q1YA 3TCNA 3Q7IA 4FFVA 1DAHA 5IAKA 1AQJA 4CQNA 1V3UA 2NPOA 3O7MA 4Y2GA 1X7XA 2YN4A 3DP7A 1NUQA 3L7LA 3R9IA 1CYEA 1G2PA 3P0JA 1N2OA 4TKVB 4L9AA 1JJBA 2UZ0A 1NF9A 1UZMA 4EYOA 2IZOA 2AN4A 2PX5A 1GDDA 3G2PA 3Q8LA 4J3NA 1SVUA 1YBVA 3WHIA 7YASA 1U7TA 1SD1A 2GZ1A 1M2OB 1PWZA 3PXDA 3IIIA 2VH2A 4IWXA 5K09A 2PGNA 3FUXA 3HY6A 3I4CA 4GOND 4M8SA 2QE6A 3KETA 4LZNA 3R4VA 2A4MA 3ZV3A 1Y7PA 4Z3DA 3TTYA 1UXGA 1VE5A 1Y0BA 2RIRA 4U6QA 4DDWA 1EXVA 4MUBA 1XRNA 3E53A 4WOPA 1ZSVA 4IVNA 4EZIA 4EKEA 5DBFA 3V1YA 1FYDA 1JQJC 4R1LA 5BWBA 2I33A 3DMTA 5HW0A 3TSOA 1Y1LA 3VNQA 3KAKA 3LUBA 1EMDA 1DI0A 3HO8A 1GUAA 1Y9DA 2BMEA 1E3LA 3LY9A 4S12A 4RPJA 1G7RA 5JLJA 3JRNA 3U0BA 1EFRD 2R44A 3CPHA 4GC9A 4P86A 2X2EA 4B2YA 3TSCA 1XZ8A 3EHDA 3L92A 2ZBEA 4JEMA 1W2HA 2HHJA 2FGKA 4XLZA 3GB9A 3T3MB 2GVZC 3I6MA 3B1XA 4HH0A 4PO3X 1ZN8A 1T29A 3MAAC 3PRKE 5EJAA 1L5OA 1O54A 2DPLA 3WK9A 5KHOC 1EFPA 1SULA 3TLEA 4RFLA 3VSAA 1VJCA 2R4QA 5IKEA 1JR6A 4HLUC 4E46A 4OU4A 4K8OA 3I6ZA 5HYVA 1YQQA 3D6UA 5CT6A 5K4HA 3JQPA 5KTSA 2PX3A 2QN7A 4MV8A 5JNWA 5LMCA 3JSAA 5TF0A 5KSYA 1BJKA 1VBNA 3D6VA 3UBMA 5ABPA 3MRSA 3PKIA 3QWAA 1MBZA 4QX6A 1NVUQ 2OGTA 4JBXA 5K3FB 2DB3A 1TM5E 2ECQA 4RD2A 4D0NA 1V7PC 3D64A 1YGYA 3BA1A 3R77A 3RUAA 3SC6A 1BHQ1 3P9IA 1PWXA 4YCAA 1N7JA 1YJ5A 2L0XA 1X7WB 2PWYA 1PSDA 1MJ5A 3CWCA 3DE1X 4K9NA 4NQRA 2X13A 3RKSA 3PQ6A 4CKBB 4QPCA 3RM3A 4AULA 4DUGA 5B64A 3RAEC 1L8QA 1XTSA 1QSGA 2AFVA 1E3TA 4Q3NA 1BXGB 3W6UA 3PFFA 5F7XA 1YJ8A 2HZ7A 2O19A 3HCEA 4ZJYA 2N75A 2O8NA 3DZFA 3LOUA 3QUQA 5CHYA 5DCLA 3D3JA 1XRQA 5BSWA 2WILA 1PCXA 3B3AA 1MTZA 1I1NA 1LC0A 2B6NA 3R3VA 3IEVA 4QHTA 3QOYA 3AVXA 1DOAA 2PYZA 1ZK1A 5ARDA 3MUEA 5JCJD 2TYSB 1H3FA 2AN5A 3FPCA 1CZUA 2FKNA 2QF7A 3KFLA 5HFNA 1YVUA 4K28A 5BT9A 1FP6A 5KDOA 5AHOA 2ZYDA 4L0MA 4M8NE 2YJ4A 5LM3A 5J23A 3BGIA 2CVPA 4F4UA 3O8OA 3WYNA 1Z0ZA 5AVTA 3PWTA 2ADFA 3U4HA 5U9CA 3R7BA 1P2BA 1XMIA 2W6ID 3S2IA 1SVKA 4P80A 3IV7A 4HB2A 3FWPA 4D3SA 4ZVPA 2VSQA 1A8SA 4K87A 4PCUA 4RJJA 5F9HA 3W8EA 4GZ5A 1UFRA 3MLEA 1AQLA 3BXOA 3EXIB 4D81A 1QE5A 5CYGA 4HWSA 3C14C 3LY5A 4LHEA 2GXAA 3OCCA 3UC9A 1B26A 1QOPB 2FHSA 4DCTA 1J9ZA 1XJCA 2HF9A 1XZJA 5JJKA 5J2TB 3GBPA 1VP3A 5HJ2A 2G1AA 1J6UA 5TY0A 3JD1A 3KE9A 2EW8A 2MWMA 4LDQA 2WYUA 4BEWA 3EZ2A 3O1HB 1ULSA 2BEKA 4G41A 2ZIWB 1NJFA 2Z9BA 3RBXA 1AGPA 2Y0EA 4DA0A 2W37A 5KYWB 4DR7B 1L4FA 3Q10A 1ML4A 3CY6A 2C2WA 1QZ3A 3KDAA 3T41A 2Q9CA 1YS6A 2NU8A 3H8JA 1EK2A 5LP6C 3O2QB 2R62A 4L0CA 1TFRA 1IONA 3NV7A 3G5UA 3R23A 3ST7A 2XMBA 4XYLA 2QAJA 3ASYA 2IF0A 5CCEA 2ZROA 4BBJA 1A71A 1L9XA 3AHEA 3FHCB 2ZBGA 5CRIA 4B7XA 4CV0A 5A4AA 1ZGCA 1QTQA 3QLUA 2BGLA 1PNQA 3HVIA 4ENPA 2A92A 1G20E 2B1RA 3ZDDA 2AI1A 3Q40A 2RKOA 3ZDRA 4JFAA 3OE7A 3DDCA 4KWHA 4E88A 5LD2C 4YECA 1GNSA 1ZWKA 2G76A 4EVSA 3BRWD 4HRAA 5CLLA 5DI3A 3WLFA 4BECA 5ALRA 3MAGA 1YJQA 2B9EA 2D7JA 3D5QA 1E5LA 4G4SO 4MUGA 4R83A 3WLPA 4EMTA 3DQQA 2JHPA 3KOMA 4IMRA 3T4PA 1HFEL 1JJVA 2DR2A 4F1KA 1GKIA 1U81A 1UINA 2X3FA 3GELA 5CB6A 4TMKA 5HWSA 1RAHA 4XIIA 1L7RA 5JTUA 4R9NA 1T5BA 1EJ0A 2XRMA 2PXHA 3HU1A 3O84A 4XCVA 4COKA 1XBTA 5CFLA 4PZUA 1QZTA 1YE8A 4NABA 3UC5A 2GXUA 2G0AA 3R9XB 1DINA 1DC4A 3M2TA 1HQDA 2O8FB 2NO0A 3KB1A 1JP7A 3MM4A 3I1IA 4XX0A 3VZDA 4I8DA 1HLPA 2ZG6A 4MKHA 2XQJA 4E5UA 5HRUA 2FOLA 3AR8A 4IIVA 5BNWA 2BCEA 2QL9A 3L43A 3D0OA 1Z25A 1SBZA 4JKIA 1MCZA 1PHPA 2PIAA 2YINC 4Z5XA 3ZE0B 2O6HA 3KV1A 4IZ6A 1H05A 1XALA 3TIGA 5JDIA 3M3HA 3DE5X 1P33A 3MUFA 1HM5A 4YTEA 1T2UA 2JFUA 5CUQA 4F0JA 4D7AA 3FJ1A 2WTNA 3A4YA 4I50F 2ZVJA 4N5IX 4LPSA 4X7BA 1AQNA 2O50A 1NR7A 3T7TA 4CEHB 2XOKD 5AI9A 3KYBA 4CU2A 3PGVA 1SHZA 1U8TA 3V46A 2SCUA 3BPSA 3TTUA 5A7HA 5JI2E 1FYWA 2BAGA 4JVMA 1X9GA 3KIPA 2YN2A 1WVIA 3H9CA 2HMYB 3HJTA 3I6QA 2RFLA 2VYQA 4P83A 3JD0A 4BNTA 1K8RA 2I2FA 5KQSA 1ECPA 2BOVA 2FDCA 4ZEOA 3ER8A 2JLYA 5I9NA 4PAOA 3C1TA 4GBED 4OH1A 2BFFB 2YYYA 2YIJA 1LLFA 5IBRA 1ETUA 4B6QA 2EWMA 1T8TA 1KZ7B 3W2GA 1EUZA 3R5KA 2OZLA 4KW7A 2ZRQA 1UKYA 5KQMA 4GPTA 1RP7A 2XCRB 1EK5A 1Q7EA 3NBXX 1VI2A 4XVCA 1MTOA 4WTOA 5TMDA 1UBMS 1VRVA 2LPMA 1MA3A 2A0UA 2EFDB 3VAYA 4QATA 5J40A 3C48A 3FKJA 2WD7A 4QARA 5CD1A 3L46A 4GWLA 3O21A 4EO7A 2ERYA 1BGXT 2D2VA 1YF3A 4LV8B 1HBJA 1SHUX 2ZU6A 4NMLA 1GSIA 2PSJA 1WKBA 4YPFA 1U98A 2VK4A 2XGGA 2QXYA 3DTVD 4NRDA 3CZRA 2OV6A 3G0GA 3NBYC 4MGIR 1D8TA 4EP1A 1YS4A 2ZSKA 2PUBA 1L7NA 2H5EA 3C8DA 2AXEA 2FMXA 5DVZA 2FFJA 2D5BA 2NU6A 3V48A 2I7TA 3AIIA 1CSEE 1KHTA 2WTAA 3IP1A 2H51A 1MV8A 1JB1A 3W3AD 4PG8A 4IICA 4LNUB 5A71A 4YLYA 4HGQA 1XL1A 1EXWA 2XMRA 4OJMX 2DUMA 2I91A 1WAMA 2X8LA 4KU4A 4OFXA 4PYQA 4TLCA 5TE9A 2JHCA 3RFTA 5BW5A 3UOGA 1LDGA 1CULC 2R8BA 4X41A 1H2WA 1MRZA 4G3XA 3B13B 4ENUA 3GARA 1NP6A 1L4KA 3ED5A 1NSTA 3MCAA 1WUTA 2XCQA 3URMA 3O3CA 3DL7A 4ARAA 2HCJB 3AUYA 1A7AA 1U7PA 4O4IA 1TECE 2JFWA 1Z13A 4TTTS 4X1YA 5DEOA 1DJOA 4XWGA 3RO7A 3BN3A 4RHFA 1R8XA 4NDNE 4Y2TA 3L5OA 2PS3A 1IBRA 3RYCB 1G5IA 1QYVA 2WSBA 5AI4A 5FEMA 3W06A 1EBFA 3JYPA 3F6CA 2PA0A 3HB0A 4KJXA 5DNAA 1SCUB 2H4HA 1JKJA 4HBGA 2GEUA 3GCXA 2C5AA 3NHRA 1XD2A 1L5HB 4HVTA 4MITA 2WSLA 5H82A 2QXUA 4RW0A 1RAGA 4QFMA 2ZSUA 3DUFA 1XEXA 3KFXA 4L6IA 2IQIA 3WYFA 4MPDA 4RMNA 1X7YA 3EXFA 4U6SA 4N3CA 3B6JA 2WJ4A 5FLYA 3H1EA 2Q4BA 4Q4DA 3G89A 3LUPA 4FGJA 2QENA 2FN7A 4HXFB 3SXUA 1P3JA 2ANBA 3LCVB 3A6EA 4D9KA 4D9EA 4EUNA 3EWSA 1V47A 5F64A 4TGLA 2C5GA 4HAOA 3PC4A 2X14A 1OFHA 1R8SA 3DW1X 3AF0A 4I55B 3HUUA 3RYIA 3R74A 3ZE8A 1SXQA 1DKPA 3ND6A 4PFQA 2B2CA 5C4GB 2XCUA 4MQEB 4UEJA 3ZIUA 3S8YA 3A9CA 2HF8A 2W6OA 4O5OA 4KDEA 3OKPA 3ZWQA 4DABA 4O2BF 5GM1A 1L4LA 2BM9A 4NZOA 2WHXA 4QOFA 1OKKA 2HSZA 3FWZA 3QLEA 3H8WA 3QOWA 1IN8A 1QC5A 1JFLA 3TUZC 1NMSA 1QZXA 3FCXA 1X3SA 2VHEA 1A9QA 4GQBA 2H1LA 2W0SA 1IU9A 4WASA 3U9LA 2AN9A 1R0BA 3K9BA 2CMHA 4DMFA 3LLVA 4J1SA 1U6KA 5NULA 3VC1A 4LZZA 2I6GA 2BGRA 5CTJA 1ZBQA 3LFUA 3LT2A 1T1IA 2XQKA 4FKZA 3A4NA 3K73O 4HEA6 4JLKA 4OQ4A 1ENYA 3HSYA 3PQEA 4IOMA 7ADHA 1H8EA 1QTIA 3PNKA 4RXTA 1Z47A 3H5VA 4UVDA 4EJSA 5K0GA 3FPSA 4HWKA 4YRCA 4A8HA 2CMKA 2F3SA 4EUEA 4O2AF 1BRTA 5KSPA 4ERNA 4IO0A 4PXYA 3VI3B 2FOIA 1UM8A 3IS3A 4X8OA 3ZU6A 3FN4A 1X13A 3KXDA 4OTZA 1K1EA 5BRNA 6REQA 1QNLA 3C6MA 5IEBA 3M83A 4H3SA 4MAMA 1SIOA 1G21B 3DEFA 4LF4B 4GPZA 1KO5A 2HRQA 2OFPA 1EWKA 3M4YA 5CFPA 4C7KA 1HZZC 1THMA 2IXDA 1GITA 4N5NA 4Y6LA 2ODNA 4H4DA 4E2ZA 3LRTA 4P54A 2WYWA 5KC8A 1QXSA 1SKAA 1AKNA 1C50A 1ZOLA 4HEHA 3BTSA 4AG5A 1LFDB 1U2QA 1ZMRA 2QRNA 3FKSA 4CHGA 3JQBC 3EWAA 4I5EA 4AXXA 5JASA 2HFJA 1CLUA 3CUTA 5H1YA 1Z26A 3RSCA 1N6RA 1LBSA 1X38A 2Y68A 4Z0HO 2VUIB 3AUKA 3KCQA 4QECA 1R4AA 3PSHA 1NSFA 1PE0A 1Z07A 4EECA 5BQFA 4LQCA 4X61A 1SC6A 2NU7B 4W6QA 5ESXA 2OENG 5H16A 2GPAA 4WZAA 3ECAA 4URVR 4ZT3A 1CKEA 4RMIA 4ZO9A 3AOEC 3G59A 4LZAA 3FGNA 4JT8A 4DPLA 5FWXB 3HR4A 1UDBA 2FPIB 3F3SA 3ISTA 4YMIA 3F3YA 4E03A 3IAS1 3RAGA 4XYMA 3H0CA 5DLQC 5BSMA 1SURA 1T9AA 2IEGA 3D3WB 3SGLA 1YV9A 2IHTA 2DBVO 2VTKA 5FBQB 1J33A 5IVIA 4EUHA 2FK7A 3WYBA 1KOFA 4L07A 4ZA2A 5IVHA 3PC8C 3I39X 1WXFA 1Z3IX 3GFTA 3D1JA 3FZQA 3DLIA 1OVMA 1C29B 1H6CA 2D5CA 1LTKA 5I7OA 4Y0NA 2JH9A 2GPJA 3R6WA 4KKXB 4I9FA 1F4LA 4IDDA 5HCUA 4JY7A 1K86A 4KSYA 4CCAA 1VPVA 4B2LA 2XMCA 3PFBA 4M9SA 3GPLA 4DDMA 4LDRA 3FOZA 1WB4A 3T4XA 3U4MA 5AESA 3CVVA 5DNCA 3ND9A 4MB6A 2RAUA 4ZHQB 2PUWA 3GLFA 1K7XB 3G0BA 4LOAA 4X8MA 1PL6A 2R85A 2PZBA 3AUUA 4DMLA 5JSUA 3DAOA 4FHFA 1TAGA 1VPTA 4E5YA 3S44A 3VV2A 5HPYB 1PRYA 3A1SA 3O9MA 1XV5A 3P20A 4EQ6A 2Z08A 1CUHA 1MV5A 1XLVA 3IVXA 3JALB 4RTQA 3NMUF 5F1KA 1TVMA 2FFBA 2GO1A 3DFIA 1RWKA 4HN2A 2KBFA 2IVZA 5FUBA 3WS7A 2V58A 2M1XA 2YWRA 5IK2D 3IMEA 2QRVA 2JEYA 1SOWA 3FBWA 5PGMA 4OJNA 4DQVA 1BYIA 2ID7A 4HH1A 1GA1A 3BFJA 4HNGA 1YZHA 3PRJA 2VZ8A 3QMPA 1PUJA 2I7VA 3DHWC 5CH8A 2AOVA 1LDEA 1O9HA 5FPSA 3FETA 4JIGA 4MKFA 1JE0A 2AOUA 2HEGA 4ZAYA 5BQOA 4BIIA 4D9HA 4FDTA 1W36C 4QXOA 3RW9A 2PQ2A 2RGRA 3O94A 3ZJ4A 1QGZA 5GZ6A 2IHYA 3GFPA 3PE3A 3KQQA 2QX9A 1XTUA 3QVJA 2E5FA 2F8MA 2X5JO 4XGNA 1RYMA 1MU0A 3Q3CA 4AZWA 4CL0A 2AOWA 3IAHA 1SQ0A 1WW8A 1L4MA 3E2IA 1HTTA 3UV3A 2VLBA 3SVTA 5IVKA 4TSFD 1GAWA 3D8TA 1XZDA 4B81A 2A1UB 3C3JA 3OOJA 1QIGA 1CQWA 2PTGA 1C2YA 2PXAA 3G2MA 5CJ2A 1NJGA 4WH0A 3SEQA 5A6SA 4J1TC 5BMVB 1IFXA 4XM1A 2JAPA 2E21A 4CIBA 1NHGA 1UANA 3QTTA 2G83A 3C5WP 2XJ4A 5EKSA 1BMTA 2QKYA 3OAAA 2OA0A 4E2WA 3H3FA 5EYPB 2CLLB 3IR5A 4IYRA 3W2IA 2Z3VA 1B2RA 1RYDA 1CE8B 4H1WA 1I5EA 1FUKA 2VA8A 2VOEA 3FGPA 4Z51A 1LK7A 4NKRA 5KYXB 5ALQA 3W8RA 1G8AA 3GPCA 4LBVA 2ZSEA 4JR2A 5A4IS 1M2NA 1NW8A 2E2WA 4Z0NA 5L3SB 1PR5A 2O7SA 4WY5A 3ND8A 5CX4A 5FWYB 2H1WA 1H4TA 4C6TA 2GBLC 3HE3A 4G8DA 4NU8X 2F59A 3BICA 3DYBA 3H2KA 3KUKA 4WNAB 3AINA 3HN7A 3O3MB 1RWMA 3TZLA 4N3AA 3IOBA 4Y6QA 4QU0A 1R0SA 4L16A 2VSXA 4QRIA 4ZGBA 4YJDA 4AMUA 4GUDA 2B37A 2IOFK 5LUBA 1AGXA 1QP0A 4FWBA 2WIJA 3A1UA 1GKUB 5DTJA 5KOJA 2PL1A 1P75A 2RHGB 1EFLA 3O2SB 3QBTA 2XUJA 4MSUA 4LY6A 3IPLA 3OM0A 5JRJA 1WDLA 3OIGA 3KPUA 3VO1A 1R4MA 3H5NA 2C9YA 4FXPA 5B58C 1ZJ4A 3I3SR 4DJ5X 3UK2A 5IJ0A 1XJ0A 4PFKA 1XAIA 2CC2A 2IU4A 1TLFA 1XPUA 5EEHA 3HBAA 2FSFA 1OV6A 4ZVLA 5I4KA 1EEHA 5DJ5A 4ER7A 2GK3A 4J4TA 4OQMA 2XB2A 5LL6P 2VOJA 4ZYTA 3PCTA 5EWJA 3E9NA 3BHIA 5FJJA 1M34E 3G85A 4FD3A 4NFYA 3T9EA 4EW1A 5HM8A 2A9PA 1U90A 3MPUA 4I1UA 2COEA 5FQOA 3EZXA 2XWJI 3CO5A 5T8KA 1A69A 1HH4A 2OXRA 4QPJC 3STYA 2H2IA 3UGQA 2GD0A 1G6KA 1UP7A 1W36D 3H5AA 5T64A 5C8ZA 5LYJB 1DKUA 2SECE 4HGNA 5TV2A 2QV0A 1IQUA 5FOTA 4HPXB 1CZKA 2I8AA 2UZAA 3REOA 3UUEA 3F7MA 1VHDA 1AS2A 4WKNA 1TFUA 2B3TA 4KCGA 1ORHA 5ALGA 5AMXA 1HYEA 3Q8KA 3SX0A 5A4JA 4AURA 2Y2VA 1UT8A 4MQFA 1M1YE 2PO5A 5K0JA 2VWPA 2J9YB 1E0JA 3JQGB 2Q5EA 4L8VA 1HTWA 2FZLA 3FAKA 4CJXA 5CFZA 4P7JA 2VJAA 4F4JA 4DR3B 2F62A 3CF6R 1AY0A 2G06A 3ZNOA 4ISBA 2C2OA 1VE6A 2MSDB 2V65A 2ZUSA 3LWBA 1XX6A 5JC8A 1E6LA 4RD1A 4RA9A 4DB2A 1NXTA 1RVV1 2FU5C 4YRKA 4N5DA 4RH0A 1FP2A 4KFUA 2PQ0A 4G36A 1C0KA 2IUUA 4C5CA 1QRUA 1TUGA 1SO8A 3F3KA 1EIZA 4O2RA 5DISB 4HVCA 4WBNF 4OXYA 3U6BA 3EIOA 3IP3A 3DOUA 2XTJA 7AT1A 3F97A 3FTQA 2CXUA 3R7DA 2PL9A 2YYZA 2QU8A 5TGTA 4C0QC 1XNGA 1NP7A 1OASA 4QTXA 2ODAA 2ZXFA 4PLPA 1IM5A 2VPXA 4QZVA 1R00A 3FOEC 4MS3A 1M2VA 5BNZA 2DWUA 2FZGA 3ES9A 3T5CA 2P2YA 2O05A 2ES4A 2PH1A 3B6ZA 1RYYA 3AHIA 3MB5A 1GTSA 3H8VA 1G42A 4Q7JB 1FOEB 4QDJA 4J91A 1C9EA 3ONWA 1I4EB 4PRZA 1Q22A 2JLCA 1LF0A 2H00A 4GVLA 3UMGA 4EWLA 4FU0A 3WYDA 2D2EA 4JB3A 4YRZA 5ADWA 3BWVA 1JEAA 2B9VA 4Q21A 1O03A 2OBXA 4Q0MA 3A4LA 2WUDA 2N9UA 3MCUA 4G5RA 4NVRA 5KYYA 3QLUC 4WDRA 3ZCXA 4OLFA 5HDQA 1XLWA 2ZE6A 1A97A 3GZNA 4D9GA 1Z2AA 2V7QA 4EKNB 1Z4IA 3IE2A 2FPPB 3O03A 4RANA 3UW3A 3VNUA 1MQAA 2A59A 3QEKA 3QJYA 3NVMB 1GN8A 2DLNA 2IYYA 3A32A 2HDOA 2QNRA 1F60A 3EARA 3P2IA 4QGGA 3D7MA 1EWTA 3GYBA 3U3JA 2RI0A 2PYIA 2ZWAA 3DCNA 4KWTA 3ZGLA 2XIQA 4LOIA 1R0LA 4RSHA 3ENVA 4CCYB 2X1LA 1NJSA 3HPRA 4FOOA 1DDGA 4IVQA 4QYIA 5JPIA 2PEYA 3G5MA 1H93A 2W4QA 4KXLA 1KKMA 3AJEA 4DGQA 4LSZA 4POOA 5LWHA 1SA0A 1U4SA 3ZD7A 1D2RA 2H1RA 3ICQB 2AT1A 4PQFA 1QMGA 2C94A 2NVUA 1ZXLA 3RVQA 2UVPA 2NYRA 1SXPA 1DBPA 3IT1A 1M10A 2FKAA 5AFSA 3V8QA 3KFVA 2V9PA 1IBCA 1ZCFA 2EV9A 3QE4A 4MINA 2QVLA 1V16A 3W2FA 5KPJA 1W9MA 1ZHHA 1Y5RA 2FUG6 5J4KA 4X60A 4INJA 2BCGY 5JDIC 1W85B 3L2OB 3N86A 1OBFO 3G9QA 4EH1A 2OKGA 4KLAA 4TKVA 4L8YA 2QUJA 3CZCA 1D6SA 2Y1KA 4HWTA 3CRMA 1PDWA 1GPH1 1XDUA 4DCOA 4EUFA 2V6MA 1GADO 3RRFA 3BMOA 1KS9A 4RE6A 3GJRA 5JS2A 3OC6A 3QBEA 1PR9A 1V4VA 4OB7A 3WGIA 4R7TA 3ENZA 4ND3A 3FM9A 4OHUA 1KDZA 2IXGA 4MCHA 4DG5A 3C3EA 5BV1A 2PSEA 4WINA 3CLSD 4UDNA 1X1CA 3G13A 6ADHA 4F91B 4XEUA 2XBUA 3E82A 3QXCA 2AC2A 3KLBA 1C0PA 5G0WA 2C9ZA 2CNBA 2QR3A 3BH7A 4P7FA 3VZQA 1O77A 5E38A 3UJ9A 2IBSA 1G9XA 4WK2B 4XJXA 1LW6E 1XQ1A 4GEKA 2PZLA 4TYQA 4UREA 4I1OA 1S1MA 1TEVA 2ZRFA 3CZMA 2DFPA 3ONFA 3UAYA 1Z5OA 1QCZA 1R9MA 3CF4G 2JIOA 5KTOA 3FX2A 2BKUA 2JGFA 1KYWA 4K0KB 3TECE 5JEEA 3K0SA 1MQ8B 3F9IA 3ZU5A 1U2GC 1YKGA 3RSFA 2VG8A 4CLEA 4H6VA 5ESDA 2VNKA 1YJCA 2CE2X 2W6ZA 3OQVA 4JQSA 2FZ5A 1F9AA 3KOZA 2GO7A 5FNVF 4LF9B 3MJEA 4JHLA 3KQHA 1QTRA 2J3JA 1SQSA 2HCBA 3PDUA 4G1MB 3ESDA 3LX6A 5K8VA 4RD6A 4LOKA 3ZU2A 4Y2UA 2XR1A 3BH0A 3FZYA 2VAXA 5KHLB 2EZTA 1DRUA 1EVKA 3PDJA 2EFHB 4FZJA 2AOTA 1PFUA 3JVVA 3MWFA 4W5JA 1J5XA 5K3FA 2BE7A 4RD0A 4ZT7A 4B0PA 1GCGA 3NHSA 1MO3A 1W94A 2PSDA 1ESEA 3W5BA 4Z4GA 3RS0A 1A9SA 4KDRA 2RI6A 3NCTA 4LZLA 3MS7A 2IUSA 2CUZA 3VHXB 4CM9D 1ZUWA 5MGBA 1B7GO 1JIXA 4BNDA 5A03A 1X7WA 1QPBA 2XE7A 4CKBA 1IB0A 1KO7A 4GRDA 1RLIA 1RM5A 3VR3A 4Q7EA 4S1WA 1T4MA 2H9AA 1PJ2A 1BXGA 2ICAA 2B20A 3KZXA 4GRAA 2VJLA 1FNNA 1LUAA 4WY8A 3U3MA 1O94D 3S7ZA 4CTOA 2VDJA 5KJEA 1ZONA 1LK0A 3G9XA 1N6OA 1JKMA 3LCRA 4L4YA 4XUEA 1N5OX 4A8TA 1I7LA 1UOQA 3F1LA 4LHWA 2BHSA 4NLLA 4BZQA 2PZKA 4FS3A 5ALVA 5LQDA 1DO0A 9LDTA 3QXXA 1L9KA 4KG7A 5A4KA 3IBYA 4MW4A 4H9GA 2RJNA 1L5KA 4URXR 2PKQO 3C98A 4KAJA 2QW0X 3CPSA 4Q9IA 4URYR 4NH4A 2QRMA 3OC0A 2R2AA 2ZUWA 4Y2SA 4Y2JA 2AE2A 1DARA 3A1VA 3MBOA 4EW6A 1N57A 2O57A 3TNJA 4RQAA 1EINA 2SKCA 5C8VA 1U94A 4I5FA 5JBNA 3EQZA 4CMEC 2YZGA 1KEEB 2ZIXB 1DBQA 5IUKC 2IU0A 2DAPA 1LQ2A 2JCXA 2H7YA 2RGYA 3KBOA 5E4YA 3VVCA 2QR5A 1Z34A 2QT9A 4YIHA 1GPNA 2YWXA 4MARA 4DUZB 2ZBFA 1XCMA 1YBAA 1RPJA 1QIEA 2YMQA 3F6RA 2R8YA 1Z0DA 1HE1C 2PRKA 3C5EA 1BKYA 1RI3A 4MV9A 4AN0A 2PXCA 2VT7A 2OHIA 3L0YA 1AKMA 1RKXA 3EXIA 3K2IA 1MC1A 2X7XA 4FEEA 2A5YB 4XQ9A 2VYVD 2OO5A 1BROA 2Q8QA 3EZ7A 3F8TA 3KLPX 5J2TA 1NNI1 3AY0A 1JFFB 3AR9A 1G66A 1RXSA 3FB4A 3H2BA 4D4JA 5JDCA 1KC1A 1P5JA 3LIIA 4YBZA 1KWGA 1NQTA 1MEEA 4EX6A 2NAPA 4F8EA 1F8GA 2DT8A 2FOXA 2RH4A 3CSSA 1EHYA 1MR3F 3QPCA 4FYKA 2MJLA 3V1MA 1MX3A 2VJBA 3C97A 2F8LA 5KYWA 1TUIA 2TECE 2YHIB 3I76A 1Q7BA 3ZHOA 4ZCRA 1YR7A 4Y2VA 1W93A 2PLNA 3U1BA 2ZJYA 2W6CX 3OZRA 2FJUA 1E99A 2IS2A 1U1CA 3PEYA 2JATA 3S5JA 4EJSC 3NKFA 4ZQIA 4H7IA 4LN1A 4IBOA 4U2GA 5G53C 4ZPXA 5AVKA 2BHNA 5D8DA 2NWQA 2BGKA 2CMFA 4LY9A 4CLRB 1V5FA 2R9VA 1XVUA 1WOMA 1CZHA 2GYYA 2QTLA 4JL8A 1T8PA 1G8FA 3K35A 1UC4B 4NU6A 1M2GA 2ZE7A 4JODA 3R0VA 4QQRA 2I6XA 3SHTA 1PG0A 1NLFA 3JQAB 1WNFA 5D3ZA 3DOHA 2YCBA 4KQWA 2Z5LA 5C8XA 3D0KA 2ZYWX 1P44A 1UDWA 2WMNB 3ELDA 4RZUA 1R16A 4TWIA 4XXHA 2WY2D 1DKOA 4OVKA 1E61A 1OLXB 1COWA 1VJ0A 2X4DA 3KHTA 2CXTA 3CLRC 4V03A 5DNEA 5A0FA 4FDAA 5BW6B 2QDKA 1LBIA 2IU3A 2L2QA 2ORYA 2FGJA 5AHRA 5KKAA 1AO3A 2BGJA 2KPOA 4RZ2A 2Q6OA 3VR4A 3WQRA 1ESMA 4BNWA 3EQ6A 4Z9YA 2HRCA 1JPUA 4RMGA 3R9XA 2R1ZA 2Q4OA 1SCAA 2VNJA 1QIHA 3FRHA 2O8FA 2O2IA 1XELA 3BXXA 3K6SB 2G9UA 3NNNA 3IILA 1RXWA 3ZLVA 2VWGA 3IDFA 4XQEA 1WMDA 2CD9A 3HDJA 3J81A 5DF1A 3BFKA 3EVTA 4XFKA 4ZTBA 4RY2A 2JIBA 2FQYA 4GXRA 8ADHA 3AM4A 3PXCX 1GZHB 2FRDA 9ABPA 1HYGA 3BGWA 4BP3A 2WJ6A 1NN1A 1YDGA 2GBCA 1U6JA 5I9SA 3EC1A 2W4MA 1F0YA 1K4MA 3I8OA 4LTNA 2ZCVA 1EESA 1JEQA 4HJXA 1GRVA 4UNNA 4BYGA 3C16C 1HLFA 1OSNA 1JDBC 2NAFA 5HIMA 3TTTA 2DQZA 4CEHA 1YB7A 2HCTA 4FB5A 2PHZA 4LRTB 2HK7A 4ENWA 5EPOA 2EXXA 1OF1A 1IDOA 2V6FA 3FVTA 4BQPA 1K7EB 3GRKA 2O5RA 1OY1A 3GFSA 3EVNA 3O38A 2XI4A 4OXXA 2JIZD 2WU0A 3VC2A 3QM1A 1AKYA 2H5JA 4EY3A 2BFFA 4FHCA 2W70A 4LBZA 2Q3LA 1ANKA 2X8AA 2HPAA 4D44A 1OKKD 2NXNA 4HMOA 5ILGA 5BR1A 1J99A 4FONA 5H80A 5AKXA 3ZHVA 3VH2A 4OIFA 3SYMA 1JHXA 3HCOA 2VHUA 3HFJA 3FUUA 2ACKA 2YWGA 2I54A 5D3QA 1TW3A 1II9A 3VC7A 4LZOA 1DIAA 1Z38A 1Z36A 3OWXA 4BNJA 4QG3A 5HRAA 2IZ7A 3CJQA 2E6KA 3B1ZA 3IHTA 1RIIA 4WKGA 2WC1A 1ZVJA 3RU9A 1S3IA 4GYKA 4UQLA 3T3NA 3CURA 1CZRA 3C8UA 5FYQA 2ZRAA 3RVKA 1UP4A 1I4WA 1VZ3A 3SZ3A 1W49A 1INLA 4JCOA 1GOTA 3IP6A 4ZU1X 5HBRA 3RTGA 5BWNA 3GJYA 4FHDA 1P80A 2Q5CA 4O3FA 1WQ3A 3FWNA 3QWFA 1JLSA 4HDOB 3TXXA 3F9RA 3RC3A 3RVBA 2J45A 1R5BA 4FZ3A 1RLUA 1VKJA 3DZ8A 4FGLA 4GR9A 4LNUA 5KOHB 2HHCA 4WI1A 3GGSA 5G1PA 1AQYA 2AJDA 1PJRA 1FFAA 3SLKA 3BSWA 3FRIA 3KKZA 4LAFA 4MMXB 4YCCA 4I1PA 3PUZA 5F5NA 4FSHA 3ZDQA 2X0IA 2G9QA 4RHYA 2BTQB 3T54A 1ZH0A 2P6OA 3K3PA 3TOSA 3MS4A 3RRNA 1NQ5A 4CW7A 5ADHA 2GZ3A 5DDIP 1OYOA 1S0UA 4KL8S 2B4QA 4JLUA 2W98A 2PX2A 3LOQA 2VT6A 1CR4A 2WWIA 2AC4A 4ZRDA 2IXAA 1CEQA 4DVGA 3RYCA 1GQFA 1GTVA 2GEJA 1D7OA 3VNAA 4LGVA 1QZUA 1QP8A 4LE1A 1RBMA 1V11B 1SCUA 3VNVA 5C51B 2YYAA 3D43A 3HA3A 4H7KA 3O95A 4X9XA 4B33A 1ADCA 4AUMA 3BGSA 4BZZA 1MNAA 1L5HA 4CTMA 4C01A 3OOEA 3IELA 2QQ5A 1J56A 4O8CA 1WXIA 4X7RA 4DAEA 2FFAA 1V9LA 1L7QA 5ALHA 3BZUA 3WIEA 3T5AA 2F2TA 1OLUA 4ED9A 3W2TA 5J4VA 3ZGZA 1JA0A 1ESCA 1KR5A 4MW1A 4P4SB 2HV9A 2DCMA 3V3KA 1E2PA 2FSUA 5INTA 5FA5A 1MORA 3I2JA 1WBJB 3DT9A 1KNXA 2OXCA 1Y4UA 5K2MA 2C3OA 2IYEA 2ZQ5A 1JECA 3GLIB 4TV9F 2CFIA 4WEOA 1GZ7A 1SUEA 2I6SA 3H5IA 3U37A 1ZAKA 4HEJA 4I55A 2I55A 4U7FA 4WHMA 3TSAA 2FA9A 4I5IA 1XTKA 1KZ9A 4L5BA 1NUPA 4MQEA 1PD0A 2L17A 4N5LA 3GLVA 1P4AA 5DU2A 3WHPA 3WFJA 2PV7A 4FX5A 2FW6A 4D41A 1DFGA 4QLAA 4D9FA 3U4DA 3ACCA 3FNEA 2Y9MB 1A9TA 1MEOA 4R68A 5CU7A 4GXQA 3KQKA 3L40A 5ERYA 1JPJA 1SKUA 2CJFA 1GRNA 2E5WA 1JEOA 3A1CA 3R3HA 3G8YA 2W71A 1L7AA 1NA5A 2GMWA 3TQIA 4BUJA 4KAAA 1N78A 2AKEA 3AIKA 2ZTUA 3DC7A 2VP3A 4R9VA 2B4TO 4RJTA 2EZUA 5CLGA 3OO0A 1FC0A 2VDWA 3HJUA 1UOOA 2ZYSA 4KOAA 1KTIA 2QUBA 2QX7A 3N0TA 5AKLA 3FFWA 1IIBA 4BP9A 4YRGA 2YBEA 4MKIA 1KAGA 2JDID 1ZPDA 4TTJA 4X91A 5DGIA 1VBMA 4UM8B 1RWOA 1G21A 4NY1A 1T24A 2IPMA 4GPEA 3T9BA 3WK6A 1YH3A 1ODFA 1RE1A 4OATA 3EPKA 4PHTA 5LVAA 4LIPD 2COKA 4W5NA 5C35A 1KYTA 1VGVA 5C81A 2NV6A 3X43A 2R1VB 2J33A 5E7MA 1T2EA 2ZE8A 4GRIA 4KE9A 2YOGA 2AFHE 2XNKA 1KBQA 3L6OO 3OIUA 3OZGA 3D8UA 3CBQA 4DRXB 8LDHA 1WB9A 3OCXA 4ALKA 4I14A 1DCMA 1G8HA 5AOAA 2Q49A 2IYQA 1RRKA 1KKUA 5CB4F 1DNPA 221PA 3GG2A 2YYSA 4XUGB 2OGSA 4ZI3A 2XYHA 1RRGA 3WE7A 3GN2A 3A0UA 4G1EB 3CG4A 3OPQA 4YO8A 3EODA 4CWAA 5C8DA 5IDYA 2P8JA 1XB2A 4XR4A 4C0BA 5IAAA 2NU7A 1WSBA 3AR7A 4EABA 3MXOA 2YTZA 4HATA 3S2UA 5H9VA 3UJ6A 2VSOA 2A35A 2PANA 3VKHA 4MVJD 5E9WA 5F3DA 1HEUA 1JAXA 3A6FA 3NT2A 4POAA 5FADA 3ZQKA 5FWXA 1N4AA 1CJVC 2YY5A 3D8BA 4B2PA 2FPIA 5TMBA 4ZO4A 2GCEA 3GL9A 2WM2A 3BXFA 4BMYA 1FY2A 5CVTA 3T9FA 1FU8A 1QS0B 2XZTA 2C9OA</