1EGQA

Enhancement of enzyme activity through three-phase partitioning: crystal structure of a modified serine proteinase at 1.5 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEINASE K
publication title Enhancement of enzyme activity through three-phase partitioning: crystal structure of a modified serine proteinase at 1.5 A resolution.
pubmed doi rcsb
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2000-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1egqA00
1R0RE 4BWGA 1PJ8A 1AQNA 4KB5A 3VV2A 3GT3A 1DBIA 1NDUA 4OV6B 3WIVA 1HT3A 4NMXB 1VSBA 1DUIA 1GTL1 4J94A 5FBZA 1YJAA 1Y4DE 1S02A 3BGOS 5ARCA 1SBHA 1CNMA 1BFUA 2Z56A 1SVNA 2ID8A 1R6VA 3DW1X 1GA6A 3I34X 1AVTA 1TM1E 1SIUA 5AQEA 2DUJA 3LPCA 5JXIA 5SICE 4HVLA 1YJCA 5B1DA 3T41A 3DE5X 1MPTA 1GT91 3DE0X 2IXTA 3TECE 1WMFA 4WOCA 4OMDA 5AVKA 1SUEA 3CNQS 1BE6A 1SIBE 3WHIA 1PFGA 3F7OA 4AKSA 2B6NA 1TM4E 3UNXA 1XF1A 3VV3A 1BH6A 4B5LA 1ST2A 1SBNE 2W2MA 4MZDA 2E1PA 2SECE 1SBCA 1OT5A 4CFZA 2HD4A 3EIFA 1EA7A 1AK9A 1T1IA 3VTAA 2X8JA 3LPDA 3PTLA 1ZVJA 3BPSA 1AH2A 3SQOA 1YJBA 2Z2YA 1TECE 5CW1A 2DQKA 1SCNE 2ZWOA 1T1EA 1TM7E 3DE4X 1S01A 1THMA 3WQBA 4LVOA 1KDYA 1Y3BE 1Y3FE 5JXGA 3GCXA 1A2QA 1C9MA 1SUPA 4GI3A 1JEAA 1TMGE 4NE9A 1SCBA 5JMOA 1SCJA 3F49S 2W2OA 4ZOQI 1SUBA 3ZXYA 1OYOA 3DVRX 4HX2A 3QFHA 1GCIA 5FFNA 1GNVA 3PRKE 1WMEA 1KE1A 5JXJA 1SPBS 4AKTA 1KDZA 3TI7A 2PYZA 1Y48E 3DVQX 2PMWB 3DE1X 3EDYA 4YN3A 1TM5E 1PTKA 2PKCA 2W2NA 1KDVA 1WVMA 2WWTA 1AV7A 2XRMA 2Z30A 1TO2E 3Q5GA 1TO1E 2XTJA 1ST3A 1GNSA 1BE8A 2SNIE 3QMPA 3A3NA 3HJRA 3Q40A 2P4EA 2PWAA 3AJ8A 1GA1A 1TM3E 4CFYA 1KE2A 2PQ2A 1SUDA 2DP4E 1IC6A 1IAVA 1SIOA 1SUCA 5B1EA 3VYVA 1WSDA 2W2QA 3I2YX 1Y3CE 1R64A 3DE7X 4CG0A 4OMCA 3I37X 1GA4A 4JP8A 3F7MA 2TECE 5FAXA 3H42B 3ZXXA 2Z58A 4C3UA 2SBTA 4RYDA 2X8JB 1AF4A 1NDQA 4WOBA 1MEEA 3A3OA 2HPZA 4DJ5X 1SCAA 4ZARA 5ARDA 2ID4A 1WMDA 1P8JA 1SUAA 3LXUX 1Y4AE 3AFGA 1AU9A 2V8BA 1GTG1 2WUVA 1BFKA 5AMXA 3LPAA 1C9JA 1Y34E 3D43A 4M1ZA 2QTWB 1EGQA 1Y33E 1SBIA 1P7VA 5AVJA 3VSBA 1Q5PA 3D9QX 2Z2XA 3DYBA 3TI9A 2G4VA 1SELA 2WV7A 1T1GA 3DE2X 2ZWPA 1V5IA 5ARBA 1SBTA 3L1KA 1LW6E 1OYVA 3BX1A 1SCDA 4LVNA 1CSEE 1SN7A 3DDZX 2PRKA 1P7WA 4DWWA 1ZVKA 4C3VA 1BJRE 3DE3X 4NE7A 1TK2A 2Z2ZA 2PWBA 3VHQA 3GCWA 3GT4A 4KPGA 3DW3X 4I0WB 1Y3DE 2IY9A 3QTLA 4FONA 1UBNA 1SH7A 2GKOA 3AJ9A 3DE6X 2Z57A 2ST1A 1V6CA 3I30X 2WUWE 2SICE 4Z2AA 1C3LA 1YU6A 4H6XA 5K7SA 3DWEX 3OSZA 1Y9ZA 5JXHA 5I9SA 1C9NA 3CO0S 3DVSX 3P5BA 1Y1KE 3WIUA 2ZRQA 3EE6A 4H6VA 1PEKE 1GTJ1 1NLUA 4DZTA 2W2PA 4KG7A 1S2NA 4H6WA 3A3PA 4K8RB 3SICE
chains in the Genus database with same CATH superfamily
2IK8A 1AXRA 1JHUA 1U3CA 3DEFA 3RUFA 5KNDD 1WPXA 4JYCA 3WLJA 4AXXA 3IT0A 3BRWD 3H84A 4YMTA 3RODA 1XQVA 5G4LA 4RHTA 2O7RA 3RT7A 4ISCA 5IX8A 4DIDA 1K5HA 3PQ4A 2YFYA 5E6SA 3G0BA 4L0QA 1DRKA 1WF3A 5H4HA 3PENA 5TQJA 4BQPA 5KQPA 4INJA 4HB4A 3MM4A 3OZIA 1JNXX 4X61A 3U7QB 4BZXA 1OH8A 2P2GA 3CCCA 1JXQA 2WM2A 4HGYA 1A04A 1YXMA 2TMDA 3AJRA 2IUUA 5JG7A 3V97A 4YYEA 3R8FA 2JFWA 5J58A 3PEFA 1NP6A 1H3NA 2ADFA 1V8DA 2JGFA 3H5TA 4LRXA 4NMXB 3X1MA 2H65A 1DQYA 5ALEA 3JVDA 3U80A 4YAJA 2JK1A 2CJFA 3S0JA 2GA8A 2PX6A 1H66A 4ZCLA 4DILA 4OFWA 2BSXA 1EWTA 3M82A 3A3KA 1RACA 2XF8A 3LW7A 3QA9A 1W96A 3OAAA 3RRMA 5J23A 3NU1A 3MHPA 1JDTA 4Q4HB 2D1TA 3DHVA 1OLSA 2ZRPA 4ZO6A 2H92A 4RD2A 3H18A 1B3RA 1XD8A 2XY4A 3GCZA 4OI4A 4NOKA 4UCFA 1W2GA 1EA5A 5DHUA 2IYRA 1FDTA 4W6QA 3OZXA 1FX0B 1KEUA 1M2GA 3HJCA 3KEOA 3NWOA 2ZOSA 2PT6A 1V6AA 2OB1A 2WJ4A 1O6GA 1XP5A 4HBZA 4D9MA 1PLKA 2Y1LA 3HP1A 3IAM6 1WTCA 2WMOB 4XCQA 4XB2A 2RAUA 1QK3A 3INRA 3ND5A 2ZIVB 4Z4IA 3GUUA 4P7KA 4JWTA 2AD1A 4XPIB 3LX6A 4YI5A 5AR1A 1US8B 2HA6A 2UUOA 5DHAA 2NTEA 4ESHA 2VPTA 3L7IA 1DWQA 1BO6A 2VUIB 1UANA 3QKRB 3EIHA 2Q1SA 3O2JA 1TI7A 1V5FA 1GU0A 3FGNA 2Q0SA 3DE0X 1MC5A 3NIBA 4UUMA 5IP5A 1ARZA 3AQIA 2CV0A 3N6XA 2OHXA 2OYRA 4FZRA 5K4GA 1NYRA 1O6FA 4DZZA 1H22A 3UO8B 4NCIA 1OA0A 4DAOA 1AS2A 2FOXA 2WAMA 4RNCA 4BJ3A 1P29A 1QFMA 1AUQA 3NC1C 2F3UA 2PRIA 2RG7A 4OJNA 1SOUA 3H17A 2OXEA 4QIHA 4PR0A 3FSGA 1YONA 4JLAA 3DUFA 1NXQA 3WRYC 4BVHA 3GDWA 4A9AA 2YHBA 5A6VA 5C5CA 3PVZA 4XFJA 3HA7A 4GE0A 5AW9A 5HKKD 3F7OA 5TV2A 2C5SA 4ASUA 3RYFA 3A04A 3EQ7A 5TIIA 2J5RA 3DBLA 3LECA 1MTZA 1JP7A 2OV8A 3QELB 4IKEA 3QHPA 1NBWB 4X8LA 3C1OA 1IZ9A 4JK3A 3IXLA 4B2PA 3VV3A 3RSHA 1PJAA 3HJFA 4TLBA 1AD2A 1S4MA 2P75A 1QG2A 2TRSB 1GPDG 4PCLA 4UHEA 5CXUA 2VYFA 2Q2QA 1XZJA 2SKEA 3NJ8A 2FXIA 2DH5A 1DEXA 3U1BA 1C7IA 4TKZA 5TGTA 4FQ5A 1U1GA 1YDHA 2BDUA 1G7RA 2HGZA 1BW9A 3LCJA 1Q21A 5BN4B 1G8YA 2ZPUA 1QQAA 2QRUA 4UM7A 4M98A 3S1AB 4V03A 4INOA 2QB5A 4CFSA 3TMAA 2YJ4A 2UKDA 4UM9D 3TAXA 1BHQ1 1MA3A 1ORHA 3MWJA 3EUFA 3BKXA 3QBTA 2YBDA 5AVTA 2JH3A 2VAWA 4RIFA 5IH3A 3ZK7A 4WESB 3KZVA 3OPVA 3UMBA 1DOAA 2AFRA 4LX8A 3A6JA 2NW6A 3BPSA 4Q9AA 1NL3A 3WIEA 1PRYA 2YHIB 5FEMA 1VG1A 1VLHA 3CZAA 4MVJE 3QOXA 5FXMA 4A0GA 3UA3A 1M72A 2AFHA 5L3ZA 4BKPA 1V37A 3A4LA 5K0FA 2DQKA 3NW9A 2WHQA 1SK8A 3L8YA 3LUFA 1PR6A 4GRIA 5GIPE 1TCVA 2WM8A 2ATIA 4RHXA 5WRFA 5IF9A 1X8LA 1P2TA 4H6PA 2HYDA 4DADA 4PGFA 3A1TA 3QVOA 3WQBA 3B1WA 4FZJA 4JODA 3N2GB 4LVOA 4XA8A 5FWNA 3MJCA 4RIEA 3H1PA 3QUCA 4MZXA 4ZYWA 5JUWA 4JSTA 2V1XA 1G9SA 1KDYA 3VDMA 3IOMA 4MS4B 2P4HX 3O9VA 1Y3FE 1V48A 4BBZA 4Z7OB 1VG0B 2NGRA 3CX6A 5JMTA 3I6IA 1KRXA 2OHJA 2W2TA 3OP4A 1IL0A 3PUVA 2YVAA 1WDMA 4NNPA 3RSLA 4C2BA 4ARZA 1RXCA 2A94A 2VT3A 4ZEWA 4LMPA 4KSYA 2L2QA 4Q47A 4RGYA 1KQNA 3K6SB 2QP9X 2X0DA 3CNHA 1LPPA 3I9KA 5FQOA 3RH0A 2PUHA 4RGVA 2WAOA 3LK7A 3L6CA 2UVQA 2Q3FA 2A9KA 1U0OC 3MYYA 4N1AA 4ZAYA 1ZUNB 4I7EA 4RD6A 1I2MA 3B1XA 3C43A 3OVMA 1PJQA 5EIBC 3ROEA 1F48A 3DGFC 2JKZA 3FAKA 4NL4H 4B4DA 1QX4A 4WY5A 5EKUA 1BS9A 2QVZX 5C7IO 2XUAA 3RF6A 5KYTA 1BYUA 1IBSA 1JQJC 4M87A 3NVMB 1LBHA 4KFSA 4PC1A 5T4HA 3TLMA 2OQRA 3OCUA 1J56A 2HQOA 3AHCA 5ALWA 1A9OA 1NFQA 4IDOA 3NAMA 5LUBA 3V1TC 3ZYCA 1R12A 1ZWKA 3JQ9A 1TKCA 3L0OA 3OQ1A 4HB0A 2FR8C 5K05A 1M1YE 1YO6A 4WKGA 2I2AA 2VF4X 1XIVA 16PKA 3WQHA 1Q50A 3K6JA 2CW5A 3SBOA 5LQSA 4LMBA 5BUQA 2XSZD 1ML4A 3A9TA 4O0MA 3MELA 4R6WA 1A2OA 4OHKA 3BRSA 3DVQX 5CCDA 4UUOA 4CM1A 3PHIA 2HU8A 3PGMA 5EJ4A 2P6PA 3TAUA 2REQB 2EC5A 2GYUA 2RGBA 3Q9NA 1PV2A 4YMVA 4I6JA 3OOSA 3QE9Y 2IC5A 3D3JA 3T5AA 3TTVA 2D0PB 1N2ZA 4KXYA 1JZSA 5DXAA 2FXVA 2P2DA 1FJHA 2FPIB 1Y8RA 4GYKA 4OQPA 4A7PA 2IPLA 1YBHA 4K86A 3PXCX 2Q29A 2YOFA 2WJ3A 2WILA 4ZMBA 5B36A 5BWLA 3C8ZA 2CD9A 1QHEA 3G2PA 3QHQA 4J0IA 1GQRA 2JFZA 2OYSA 2G5GX 4OHBA 3RJTA 5JI3E 3ZIAA 4AFNA 3CVUA 5GZ6A 1DZIA 2OWEA 2GN4A 1Y4UA 1V26A 4BC1A 1P9WA 2C2GA 3C8DA 3BB4A 4A10A 1L8XA 3BOSA 2P7IA 3AESA 3U1TA 3TG8A 4K03A 4AIIA 1DLJA 3P9CA 1CR1A 2LDBA 1E2EA 3A1CA 1XZDA 3B6EA 3KO8A 4WBSA 4KDEA 5J5CA 1J2RA 2ZJBA 3KVNA 3CRVA 1DQRA 3KJIA 2GTPA 3T3EA 1E8NA 1RWOA 1SPXA 4C4RA 2BN4A 1IN7A 3HJRA 4UREA 5FRDA 4BFSA 3BD9A 1OLUB 1RYBA 3K9GA 5CYFA 3SZRA 2R47A 2TMKA 3VSDA 3EGXA 4PQRA 3TQCA 4BNXA 4FDUA 5CD9A 5BN4A 3RHFA 3H2JA 3WAKA 1BMDA 1BS2A 4IQ0A 2V0NA 4WLNA 3CF4G 3BHNA 5HFAA 1TEZA 1CDZA 5E0KB 3BSYA 4BAUA 1FSZA 3OFND 2YMPA 4PIVA 2IPAB 2V4UA 1X38A 2X14A 2DFLA 3FHJA 4KIWA 1GIAA 4B4UA 3L0BA 2J6HA 4JJ4A 4ZYUA 2QN6A 2VEDA 4RHFA 1JYSA 3C1TA 1YT5A 1THTA 2C04A 2P9ZA 1KEZA 4N6OA 2C8LA 2LCIA 2Q0HA 2Q4OA 4ML3A 4BKRA 1E2JA 3A2MA 3K20A 1UXGA 3OJEA 4QUGA 2P9CA 2F55A 1AZWA 2AN9A 5IK2A 3SEZA 3PG5A 1GPAA 1ZD2P 3D3EA 1RIFA 3EW7A 4EG8A 4FW8A 4KMOA 3GLRA 2HDOA 5CDFE 3EOBI 3UK0A 5LQUA 4WKNA 3GPDG 1JL3A 2GI4A 1G3MA 2LBPA 2V7PA 2W4IA 4PPGA 3NEAA 4QUHA 5TXGA 1D0VA 1ZD4A 3NCHA 4E09A 3MGBA 3GG2A 4Q1VA 3IAHA 4FW9A 1R00A 3D54D 2PKQP 4YXFA 3GT7A 1A9SA 2YINC 1P91A 4NBNA 3WLSA 5HP4A 1YZVA 5B3JC 2ZIXB 3FIJA 3IDSA 3U3ZA 1X1SA 1OREA 3NVDA 4D26A 1QDUA 4BE7B 4LYFA 5BOSB 5BSHA 4P7GA 3U44B 2Z58A 3RU9A 3MS7A 3DZKA 2R85A 1C7RA 3IJEB 2JJ8A 3JQAB 4KU4A 1KSHA 2HRZA 4BB0A 1BS1A 3HNRA 1QIKA 4S1OA 4X5OA 4A16A 4KNVA 1HC7A 2W5UA 3ZDQA 2LKDA 1FOEB 4IIJA 3K6SA 3PHJA 4GKAA 5SYNA 1KAOA 4UTPA 4AQ7A 4HRYA 5T3UA 1JQKA 2J0EA 4UAVA 5KU7A 3C5VA 2ZRJA 3O8NA 2G71A 2QLJA 3K94A 1PQ4A 3WB2A 5A5DA 3MCWA 1TJ4A 2XKKA 3RWMB 1ECGA 3FPFA 1EFRA 2QA5A 2ZTSA 4CLOB 2WFLB 2FWRA 1TJYA 4N6GA 1GTG1 1W1UA 2WUVA 3M89A 2O1EA 2V5VA 5JLJA 4GOMD 2IHKA 3C7TA 2ZSFA 3EY4A 3PXGA 3HS3A 1PSDA 5E6RA 4LV6A 5L4NA 4U6NA 1MMFB 2ZAYA 1Z4PX 5E38A 2FF7A 1VL8A 4GMGA 5D5HA 5IM5A 3A06A 4FYWA 5FI3A 5J4KA 5JAUA 1QE3A 5KYNA 1P9NA 3HVHA 4PYIA 2CVFA 1ZVQA 2HO4A 3HK2A 2KX7A 2XIJA 4Q3OA 1UJBA 3B2QA 5J4VA 1CUAA 3NX4A 3QMVA 2QTGA 1CQXA 4MV0A 1OUMA 2ATVA 2H5EA 4D81A 5DWDA 1FY2A 4W5TA 3IILA 2ZRNA 4KHZA 4ZQBA 1N5OX 5CEFA 2DQSA 4PQYA 3KUKA 1XV5A 1PCXA 1IB6A 4GYYA 3B1YA 4EELA 1N5DA 4GO1A 4HAVA 2A4MA 3BCUA 3KEFA 5LYJB 4JOQA 4Q16A 2YV1A 3WLIA 4AJJA 2XADA 4FQ8A 4ZI7A 1I3LA 2ALJA 5EE9A 3C6XA 4QO7A 1J5PA 1V4NA 2HSDA 1W88B 2A30A 2O05A 4G5YA 4PFJA 1GYRA 4M1TA 5FL7A 3SC2B 3UWDA 5LL6P 1OGJA 3QEAZ 1E18A 1CLUA 4X66B 3BH7A 1PYGA 3SZMA 3UV6A 4O4IB 4CKXA 3AK4A 2GM4A 3E3AA 4RKRA 3W5IA 3MSXA 5IUKC 2CHGA 4AF8A 3PFHA 4U9UA 1J0CA 4PAOA 5BV2P 3FMIA 2YBEA 4CTOA 1W0KD 2VYNA 3RKRA 2VDNB 2IYWA 1HZJA 2QMOA 4GT1A 1ZGZA 4B3DA 4DQVA 1HFWA 5HKBA 4QM7A 1FTYA 1W47A 5DYYA 3QX3A 3CX4A 1B8NA 2WDPA 4BP8A 2JDIA 2B20A 1RHUA 2P79A 1BNCA 1M0WA 4Q9NA 5F73A 2Y27A 4CQLB 2LNDA 4ZT7A 3GJSA 3RUCA 4ETNA 3THWA 2R1TB 5L95A 1WKVA 3GC6A 2MR5A 5E3HA 4QC2A 3DTNA 3Q10A 2F1HA 4X1IA 2HIGA 1UODA 3HFGA 3R3WA 1YZYA 3RROA 1BDMA 3NKFA 5FULA 3V42A 1G38A 1EUDB 4LDAA 3TTSA 1E9EA 2C2HA 2QX4A 3I1JA 4J2TA 2HXYA 4MGKR 4D3DA 1SC1A 5BSKA 4HGRA 2R2GA 5A03A 3DBRB 1UPUA 5KSYA 3SHQA 4EJ0A 1N0WA 1N2HA 1OH7A 3EQ6A 1QORA 3ER8A 3WFJA 1ZWLA 3FPHA 1P2SA 5HQJA 3KTFA 3WGKA 3N0VA 5B4VA 3H6KA 1N9KA 1IOVA 2EDCA 1ONPA 5AK0A 2A0XA 1X70A 3MPUA 1KJQA 1RMTA 1T43A 2HJRA 1E3WB 2XGOA 3K5HA 2UYCA 4C2TA 4C05A 1E5LA 2QTVA 1PT7A 1T2UA 1WOYA 4MPTA 4ZVQA 3KKPA 4EY5A 4J4HA 2AC4A 5CHEA 2SICE 3SYRA 4ZTZB 4Z2AA 1C3LA 2HGSA 1JLRA 1OIVA 3EODA 3OU6A 4I2VA 5CURA 5EJGA 1Y1LA 2IZ7A 3WX0A 1RYZA 1WA5A 3EMVA 4ER6A 1HR0B 2HQBA 4M37A 1R5JA 3WHLA 2DZDA 4QE3A 2APJA 3RUIA 2DTXA 5I5EA 3LVRE 2RHGB 1QG0A 3QXSA 1Y9ZA 1USGA 4ND8B 1DKNA 1YI0A 1WTAA 3HP7A 5C8YA 4FHGA 1E9VA 3ONNA 3CEAA 5F7ZA 1NMQA 3IP5A 4BMCA 4CUZA 2XXAB 4IIEA 1RBYA 3EC7A 4S12A 1J42A 1IHXA 1YQXA 2RJ3A 1R6XA 3EXAA 4FFWA 1R4MB 2ZXFA 4ME6A 4PY2A 4ZDKA 4Z4FA 2C2YA 1CULC 2ENUA 2FCRA 4M76B 8ATCA 1HSZA 2E6UX 5JW6A 3HTXA 4IH4A 4ZYYA 1XEFA 1ZK2A 2O7VA 3JQRA 2G9RA 2Y4NA 3BT7A 1ZS9A 4QTXA 1JR4A 4UFPA 1FNDA 4OXKA 3I1YA 3SNKA 2WFLA 3S8MA 2MMCA 1KZ9A 3OX4A 4MHTA 1X13A 2NOAA 4H6WA 3S2FA 1ZAYA 4GX1A 1KDTA 2QX8A 4M86A 2B2NA 4GWKA 5FTNA 1TEVA 3N6RA 2Z6QA 3LXXA 4PG7A 1UBUS 4U2GA 4YROA 1KYXA 2B8JA 4OFXA 4C21A 4HNQA 4JDUA 2ZG6A 1H2BA 2ZJ3A 2VSOA 5G0TA 2QE6A 4WKPA 1PL0A 3W9BA 3RJZA 4R05A 4OLBA 2WU1A 5F2KA 2RAPA 1T4GA 1BWPA 3N3AC 3VR3D 5JH7B 3ADPA 1K89A 1ZAKA 1T4BA 4HXEB 2PGXA 2PHZA 1REQB 4J9UE 2B5OA 2EL7A 1C9EA 5MN6A 1PNQA 3WYDA 1UC5B 1SXQA 2OKCA 3UWMA 1E6LA 2EKLA 4EHHA 2FX3A 2R5FA 1Y80A 5ENZA 1FFBA 1Z9BA 1HSOA 1ZP6A 2JVJA 4HEJA 5E3JA 5TMDA 2HLDA 1IEXA 3VR0A 2PX0A 1OFUX 1IRIA 1VG9B 2I4RA 4GKBA 4WRRA 3VJLA 3SLKA 1M34E 2IEBA 3C70A 3OM0A 4NH4A 4E4RA 3BL8A 3ZU6A 1KXJA 3W5BA 2IT1A 2B0JA 2XDQA 2XGSA 4L8FA 4UTOA 3QPAA 1GZ3A 2PZJA 1M66A 1GTMA 5F21A 2JANA 3S5JA 5A7FA 4S35A 2VBGA 4A92A 3WXBA 3IUMA 4BPBA 2ZJ8A 2A0UA 4L3OA 1P7YA 1VRWA 3GFVA 1LEHA 1QHFA 2V7QD 3NPMA 4YFVA 5AJUA 4A4DA 4EGAA 1SGWA 1ZMXA 2XT0A 2R1TA 1MDBA 3OZBA 4ESVA 1OI4A 5BRJA 2PZLA 5FOWA 3I09A 2H85A 2FZ5A 1Q0UA 3EWNA 4YFYA 4JELA 1KHHA 4NOJA 1OPXA 1EHYA 2YJTD 3INNA 3K2BA 1XDDA 3T4EA 4BQRA 4P81A 4B4VA 5IKEA 1I10A 3ICEA 3KQLA 3HYNA 1VIVA 2GILA 2OQ2A 5BR1A 2O8DA 5IYZA 1E4EA 3DBRA 4GR4A 3USZA 2VAMA 3BWBA 2ZRIA 1AMOA 1I2AA 3WWCA 3Q2IA 3ZR4B 3KKOA 3KKEA 2J46A 4EAQA 2ZETA 5C9ZA 1CF2O 3L4KA 3TL3A 2XE7A 2ZUDA 1DO8A 5CLGA 3SX4A 5FUMA 3HCDA 3N87A 1QYWA 1Y3AA 4MV1A 3RVLA 3MTAA 4H17A 3CRRA 3V4SA 1E3WA 5HM8A 1IM2A 1SIBE 4KDCA 1Y9AA 5DIZA 2OCIA 4KWEA 4HLNA 3T35A 3D64A 3DLIA 5ADUS 5JZVA 1FW8A 3WLKX 1A7AA 1TM4E 2NZ8A 4F21A 3O4HA 4MVJA 3R3YA 4UBOA 5FO1A 4R2XA 1A8UA 2Z3ZA 4HDMA 3F3KA 4WWHA 3CE6A 1ORTA 3JYHA 1N6OA 4L1KA 4A91A 4J8PA 1NVTA 4OX9Y 1WY7A 4FHZA 3K9NA 2WWFA 1CEQA 3C41J 3EIEA 1UQRA 1TK3A 5FX2A 5KSOA 4IIJF 1Z3CA 4CV2A 1JBQA 4NAVA 1I0IA 2PZMA 2FPUA 3WGYA 2ZVPX 4CFZA 3ZQUA 3OPYB 4R4JA 3CT6A 4FDMA 4NMHA 2O0JA 3EUEA 3CZQA 1NI4B 2CLCX 4MDYA 4YWJA 2D8MA 3O91A 1CJVC 4C0XA 4B6GA 3BDVA 5AOVA 4BGIA 3AR7A 4Q3AA 3DTVA 2ZYRA 1ZD3A 1NOJA 3HVUA 4V3BA 3GZ4A 5AM3A 1W4ZA 2G04A 3PFFA 4WN9B 1QG4A 2VKQA 1WULS 4UOQA 2E85A 2RH9B 4GQBA 3T06B 5LLDA 1Z22A 3BE4A 5TEVA 1TECE 4DMHA 5EE3A 3IVGA 1FSGA 3R5HA 3SJAA 1DARA 1SCNE 4U6QA 1T8SA 5CG1A 2I80A 2CXQA 3D6JA 1DO2A 2DT5A 2QAGA 3OHPA 1A7JA 2A4KA 4MA4A 1W93A 2JLCA 3JALA 4UU7A 4OQDA 5ED4A 4N0EA 4NU0A 1I13A 4QRIA 4OG2A 8LDHA 4QOFA 1EAYA 2Y1CA 4ZO7A 5AKEA 4CCSA 5JAQA 3R5FA 5B30A 2BONA 2ZRDA 1TLLA 4W6ZA 2NPFA 3FOZA 2B8TA 2H3HA 2R1VA 2CFOA 2QTNA 3A28A 4G0YA 5ECWA 1UDRA 1Z2OX 1U8FO 1Z2DA 2J48A 3C3YA 4QICA 4TT3A 3TVTA 1HEUA 3UAVA 4ARBA 3M4YA 3PR2B 4MKHA 3EX7C 1M1YA 3AUAA 3HXLA 4CLXA 1F6WA 4NRDA 1IRXA 2GMWA 2ZT5A 3K16A 4WDRA 5EE0A 1QH9A 2RARA 2X5XA 3KSMA 5JQGA 3LNTA 1YR9A 4JB3A 3UMSA 2XODA 2NN3C 2FFAA 4HH0A 2O2HA 2GPNA 5AUQA 3EGVA 2EKQA 4RVCA 4NMWA 3BGWA 3UOAB 3PE6A 3EEBA 3ZHXA 1V8BA 3L7YA 4PSVA 3AM5A 3W5VA 3WTCA 1KU6A 5FWYA 5REQB 1C1HA 4H7PA 1YB1A 3RS8A 2QRVA 1FYWA 1SKAA 2BI8A 1IPFA 1TKAA 2DWOA 1ZM3A 1XRJA 1X1QA 3FSRA 2N46A 4HNTA 2B4QA 3CXRA 2OGUA 4ZJPA 2O2IA 3H04A 1AKUA 2VJMA 3QMWA 2CHVA 2RGUA 3WGNA 5AFSA 5DBGA 4JI1B 4PCUA 2PTHA 3T1YB 2J87A 1GZUA 4JQZA 5JD4A 4Y6QA 4IGKA 4R40A 1W94A 3AIKA 3AF1A 3VNQA 1JJVA 1XF9A 3LYHA 4D2IA 1IUNA 1Q77A 2QTHA 3KJXA 1YR2A 4BDSA 4MVWA 2XV1A 1AM4D 1Y4ZA 2UXDB 1IZ0A 3KSUA 4W9NC 5HUHA 1X7YB 1L0BA 4IQ4A 1AHHA 3W6NA 2V1UA 5CR9A 3D4OA 1XDZA 3JZIA 4D92A 1MGOA 2PUAA 1VMDA 3R6TA 1NVXQ 4R9SA 5D3MA 5FWAA 1I3MA 1H69A 1RRGA 1TM5E 2G70A 1LXCA 4WY2A 3MLEA 1VJ0A 4XFKA 2RGCA 4TL7A 1GLVA 1KI4A 2W2NA 4MGEA 1NYQA 3VM6A 5BW8A 1F4LA 3P2EA 4IDBA 1WVMA 5DEOA 5DSZA 1JRLA 5KI6A 3IAAA 4UUPA 4X85A 4PNEA 3QXCA 4YDRA 1BXRA 4BBJA 1OXMA 4PYLA 1UINA 4JL5A 5DCYA 1GITA 3KYBA 1TO2E 2B0CA 2ILTA 2PRJA 3FCCA 2OHGA 3O1IC 3UKJA 1OX4B 3G8BA 1VMIA 2YXPX 5A04A 4G0MA 1XX6A 3DPIA 3H9CA 3EDCA 4GS5A 4K26A 5DP2A 4C4SA 4O4LA 4IHJB 5DLDA 1G3QA 1N5IA 5AVOA 2ODEA 2B9VA 5EA2A 4G4GA 4Q3KA 1PHPA 5C8YF 2CL5A 2WAAA 2ZTHA 5E7MA 3L8HA 2ACVA 1J20A 2ZAMA 4OQXA 1ZJ6A 2I66A 2X9NA 5CDFA 1NBOA 1GUFA 3A4IA 1YS9A 1HE1C 3VSEA 4Z4CA 1NP7A 3TIXB 3PNSA 4D44A 2G6TA 1LSSA 2WQ7A 3TW4A 4EGJA 2ODBA 4M99A 3L7NA 2ZI9A 3GLGB 3UFXA 2VK1A 3TZCA 2P78A 2VLIA 4TVKA 3UBTA 4DBLC 2QRPA 3EEOA 1UEIA 1P0FA 2C07A 3FWZA 3HV0A 1SEVA 3H8JA 1H2HA 1UJ4A 3QVTA 1LB1B 1VSQA 2E4UA 2ZIAA 3E7XA 3MQ2A 5CIQA 4URFA 1TVKB 3QLJA 4U7PB 2XVXA 1J5EB 1L7AA 4QHTA 4E5VA 4CV1A 1PAUA 3QGMA 1Q0PA 5CA1A 1SIOA 4XDHA 5ITZB 2O54A 3LO5A 3V8BA 4LYJA 1RC8A 4MVJP 2OC4A 1L5NA 3WGTA 4ZOCA 4HEA1 3MWFA 1RS0A 1BSVA 2WUGA 5KBYA 1LNZA 3KWLA 3SE0A 4BWVA 4JIMA 2Y0EA 1X19A 4S04A 3WS7A 2OLKA 1N32B 2RC5A 4OMCA 2PZAA 4IWNA 2FRVA 4DR5B 3I83A 4WZAE 3K8OE 4R6XA 1Z2CA 1OU4A 3QXHA 1L8QA 3IIJA 3ZGNA 1EXVA 3K9QO 3WL8A 5GINE 2ZLBA 2X2FA 4MKZA 4U7TB 4MX8A 5LYJF 3HR8A 3T9EA 4GE3A 1JDSA 2QD2A 3IYLW 4GLBA 2A0KA 1C0PA 3DEYX 3PF8A 4BJ5A 1UBFA 4UEOA 2W37A 3QVSA 4TUYA 2C98A 1V0JA 2I2WA 3EIXA 3PT5A 2JKVA 4YH1A 3WMRA 4CHTA 1I0ZA 1Z18A 1PDWA 4CCWA 3M9XA 3SSAA 5M5BA 2QN2A 2ZUWA 3GFOA 4DC0A 1V3UA 3KQQA 4RZ3A 1R9GA 1TCAA 5TGZA 3DOJA 4JR2A 4B3XA 2FEMA 2REXB 3CC8A 4NEQA 3FYUA 1KAEA 3UKDA 1FLNA 2FFHA 4R5MA 5A06A 1VCOA 3IIMA 3NTXA 4H08A 4X1OA 3VO8A 3LY7A 3QLUA 2OG2A 1WX1A 3QX7A 5REQA 4CMEC 1E1CA 2IH2A 3NALA 3DMRA 5B1HA 1PX2A 1MH1A 4ZYXA 1QF7A 1S3GA 1X77A 2BRUA 2VWPA 3IA2A 1E59A 4YAWA 5E3IA 1GQOA 3DLTA 5FTMA 4PYKA 3TQOA 1KERA 1O97D 4GICA 1GTZA 5DFAA 4FOSA 3KTAB 5F23A 4JFRA 1GEEA 1OXXK 3TCXB 3UH1A 3VNBA 4JI7B 2GJKA 3VDXA 3FW1A 1ZJYA 3D8SA 5AI0A 3EQ8A 1NUUA 3OCZA 4X8MA 5FOUA 1YHZA 2ZE6A 3C4JA 3KQOA 4JLDA 1FUUA 4OP1A 4D9HA 4GPBA 4B74A 4L4SA 2NQ8A 4BAGA 1VE5A 1KDPA 3M5WA 3JQ8A 4MYSA 4XI9A 3HRKA 1I1HA 3AONB 2CUTA 3KB8A 2Y4OA 3IQEA 4AY5A 1J7JA 4ZEMA 4UTZA 1D2GA 2M6RA 2YDYA 2PVSA 5EYPA 4FUTA 5K3CA 1QO0A 2LTAA 3NG1A 4XSGA 5E7QA 4DJTA 1JU9A 4QAQA 5FPKA 5K0SA 4KR3A 1QFZA 1AN0A 2VYQA 1E9SA 3HBMA 4OKNA 3V9AA 3WNQA 4RTSA 2FZGA 1NNLA 2P6UA 1MF7A 2XT6A 5CPFA 3PT9A 4Z8YA 2INGX 4EQ6B 4YCMA 2ZBEA 2BM9A 5EIXA 1EK2A 2AV6A 4I2NA 4K1LA 4MXDA 4LFCB 2B6HA 3H9JA 1PE0A 1P2BA 3ECAA 5LQJA 1CUGA 1WE2A 4QTZA 5A7GA 3SXUA 4POOA 3BK2A 4PNHA 3MXTA 2I2CA 3VMMA 1GDTA 5IEJA 1TZ2A 1YRWA 1NQXA 1T3SA 2G3YA 2MDTA 3LT0A 3MFYA 2RKWA 3RRXA 2B82A 3U4CA 5I7UA 4KR2A 1AOXA 4TTJA 2IRWA 1SCDA 1YQUA 2BZGA 3KHSA 2WWHA 1C0EA 4KPUA 3CWQA 1LPMA 2W22A 4MUNA 4EYGA 3LF2A 2NO7A 3L40A 5EI5A 1I4DD 1ANKA 1L8OA 3N6VA 1KI6A 3DFKA 3IPYA 1HGXA 4OJMX 5EAIA 3VDRA 4DWWA 2PU7A 2IP4A 1EUCA 3LHFA 4K9KA 1W5AA 4ZPXA 4GBED 1UL1X 4A2PA 4ONEA 4ER0A 2NX2A 1R0WA 4LPSA 1DUSA 2Q4DA 3PQ2A 3IO3A 4QA9A 4EHDA 2P2NA 3P20A 3DHEA 4HQLA 5KJ1A 1VA4A 3N05A 5CAEA 4LJ6A 4O08A 1ZMOA 3EFEA 4AUEA 3WL3A 1V95A 2B34A 4DCVA 1Z39A 5JDCA 3VU0A 5C3MA 5ALYA 2ZYHA 2VDRB 5FBLB 1U7PA 3CHYA 1FNSA 1WV1A 3TNLA 3JARA 2ADOA 2XHEA 2C5LA 2YWCA 4M54A 1YK0A 3ISVA 5EXEA 3AJ9A 2CD7A 2E82A 2OR3A 4MK4A 3PJFA 4OH1A 3WBFA 1GXSA 4MVCA 5IKMA 3PC4A 1JHPA 4WXHA 1FL9A 5FQNA 3T1HB 1IQ0A 4OPMA 2ZYSA 5EWLA 2YRFA 3O9MA 3ON5A 2PA0A 1NJ1A 5JD3A 3OTQA 4M4SA 2NTJA 4GWGA 1M5RA 1ACLA 3M4XA 4GGPA 3VKFA 3IURA 2D0IA 2HLHA 5FDFA 5BWBA 1QLHA 1N9GB 2ZSHA 3RV3A 4CKWB 3Q3IA 3KJEA 3FZEA 4WDQA 3RFXA 2ON6A 4F4CA 1YKGA 2H6EA 1XLTC 3RI3A 2QD3A 1M75A 2H06A 1IN5A 1EQ2A 2WIFA 3TZ6A 5HZGA 2PFGA 3DTTA 1H5NA 3R3ZA 1J70A 1YQTA 4IZHA 4E13A 1FFAA 1Y37A 5JQGF 3RYTC 3CH5A 3I4CA 2G5PA 3P26A 4FFVA 3EWAA 1CS0A 1SC4A 4EHKA 4PS0A 5FH9A 3OOHA 4HZGA 2HN9A 1GDDA 2RK3A 5L3VA 2XVYA 1RWXA 1QVZA 4W7SA 5DW0A 4FN5A 3ZLUA 1UOQA 2HFKA 5AJVB 4O1IA 1SU6A 3BCSA 2P5TB 5IZCA 4C43A 1UQTA 1I9GA 3L0ZA 3OKAA 4UUBA 4BS9A 5B1YA 4FLMA 3OZGA 1T2CA 2WU0A 4WFJA 1QPBA 5JFGA 4K9RA 3S6JA 2IGBA 2XE6A 3JPYA 1CLEA 3E7PA 3HCPA 4EG0A 1KP9A 1F5NA 2ODQA 4HY3A 3SZUA 1ZJZA 3CLKA 4BB6A 5DXJA 1M34A 1U5BB 4LZWA 4MAAA 2QVXX 2IE8A 1NMXA 3DDSA 4BE4A 2FPXA 4YGYA 2IOYA 3O8DA 1DWPA 5JRJA 1Q12A 1G8GA 4BWGA 3E5MA 1GZHB 3IP9A 1U3FA 2O3SA 2XNJA 2JFHA 2PDAA 2XWBF 3EIOA 4NARA 3VV2A 2KJQA 3BAFA 5DCLA 5BXQC 1X6VA 3HYSA 5EKTA 1YVPA 2W6IA 2H2IA 5TT1A 1XNHA 4C22A 3BJIC 1RWPA 4F38A 1EEXB 1KAHA 1ULAA 2NUBA 3V6MA 3EGIA 1ZMRA 3UUGA 1CQIA 1QKJA 1T4CA 1XCOA 3LVFO 4J1SA 5T41A 4F06A 5IULC 4J76A 1G8PA 3J81k 2XUDA 4OB7A 4OYLA 4OQMA 3E1GA 3WBBA 2GPYA 3Q4GA 4BLTA 1XHLA 1IY1A 2QP3A 3DYIA 5GOTA 1A9ZA 5JS2A 4EUFA 4XD7D 1V6SA 1N9ZA 3L6EA 5MF6A 3DC2A 4DDHA 2W42A 2ACKA 1Y3HA 4HNUA 3FUUA 5DCUA 3Q0TA 1XA0A 3QFSA 2QZZA 3OHMA 2Q41A 3ABIA 3WP1B 3V2HA 4F8YA 1E7MA 5CW2A 4C9BA 1N8NA 4D9IA 4H0NA 2WTEA 2EFHB 1NN3A 4NFSA 2OFWA 2ZI4A 3B3QA 3CPEA 3OJCA 4RGBA 4CKZA 1I94B 1OWLA 2D2XA 3L1JA 4I1IA 1U5AA 4C2UA 1NI3A 1E0SA 3AFNA 4AROA 3W6OA 4DMCA 3PICA 2FPWA 3DHNA 1O6BA 2H9AA 2OBMA 3QVGA 2R6HA 4YACA 3WRWA 3H5AA 2DUJA 5JOQA 3EXIA 2DUUA 3L06A 4JFAA 3RSOA 3SM3A 2C61A 3AERA 3NBYC 2W11A 1T10A 3K5IA 1EVIA 3I42A 3C3PA 1EB8A 1NF2A 5ELMA 2A9QA 4CIVA 4TVSA 5KTNA 3EVFA 5SICE 3CH6A 4HI0E 1O4WA 1JWAB 3N2YA 1XU4A 1JPUA 2PRZA 1DOZA 2IHTA 4KKVA 1KZ6A 1Q16A 5BQOA 4AMBA 2AE1A 2XCOA 3D5EA 3LLCA 4FYJA 5CA1F 3DXZA 4W82A 4HN4B 2WJZB 3ABQB 4C5BA 3PXEA 4ENRA 4WVFA 1XNQB 4XX0B 4RADA 3WI7A 3DOOA 3F5SA 4GZLA 4QGHA 4ZXFA 1QAQA 1U9IA 1U7TA 3G6WA 2HZBA 2AG0A 1PQUA 2CWWA 1LX7A 1P77A 2WHPB 4K88A 4H35A 4L9WA 2R8RA 1G64A 3B5IA 1RM3A 2FEKA 2JCXA 1PYOA 1G20B 3DNFA 1IY0A 3ND8A 3UQZA 4UVGA 2QV0A 3DYVA 3RNLA 1ILEA 1BE6A 3AHFA 4RSRA 1XQ6A 1USUA 3GJ7A 1RAAA 2QGFA 2VNSA 1YBVA 2JVIA 2P9YA 2YWXA 3OQBA 3PUXA 5CT5A 4B4OA 4EABA 4RQUA 4DLVA 2VK4A 4U2CA 3C14C 2ROQA 3HBAA 1Y8AA 2FG7C 1JF8A 5AQ1A 5DK6A 3NWPA 1MO5A 1LGYA 4K9MA 4Q1DA 4Z54A 3URKA 2D2VA 2O8EB 2QV7A 1T8UA 3U9TA 2YVKA 3KTOA 3EC1A 2KE5A 4MH0R 3L4BA 1ZK3A 1Z26A 5BQFA 1U2TA 5SYMA 2DMRA 3DTYA 5IN5A 2DWPA 4W8HA 4RORA 1MIOB 1PFWA 3HM2A 3V8MA 5LKAA 2BMEA 1CZKA 1NR5A 3E05A 1JG1A 2HF7A 1G8JA 3BMXA 4RFLA 5DPMA 1DKRA 2X5KO 1OXBB 3EFOA 3OO1A 5K3AA 3RS0A 3WLOA 4QU9A 1AA6A 2NZJA 1V4BA 5I5GA 3RG2A 4K0KB 3GX1A 3NHKA 4WGFA 1R0XA 5JATA 4N3AA 3R7WA 3VPDA 1TPYA 4D02A 4EHJA 4DUGA 5G3YA 2OBXA 1YJBA 4DAEA 2R1ZA 3UTCA 1TQ4A 1KMQA 5CW1A 4NZNA 2XUKA 3H6GA 2EG5A 2OECA 4Q37A 5CU7A 2WKRA 2XE4A 3WLFA 2G08A 5BNTA 4JXJA 2ZJFA 3QTBA 4RY0A 4C0WA 4CDRA 3A3YA 3M1YA 2OP0A 3SKXA 3BE8A 4E5KA 3ZDAA 1K7XB 3UG7A 2YKGA 4G0OA 1G2QA 2GWHA 1QV6A 3BTUA 3ML1A 4KWCA 4QT0A 3NYIA 5TARA 3WBKA 3O3CA 4QRHA 4O2AB 3RVRA 3I9NA 3QIVA 2O06A 3JWGA 1BKDR 2E89A 2XMCA 1XXLA 4R84A 4C7KA 4EW1A 2BBTA 1YMQA 2NTVA 3QBJA 2PJZA 1MORA 1PEYA 2RCNA 5AW5A 3WA7A 4NCBA 3DUWA 1AQYA 4KXFB 4FE7A 3RFCA 2P5YA 1P1IA 3LBIA 3MK31 3OZDA 4LOAA 2P4UA 1HLDA 1ZLYA 2IV7A 3PLAE 2FHPA 4L6CA 2A0WA 2PO5A 1T5BA 2V55B 5BUCA 1FC0A 1B8PA 2I6SA 1M0TA 1U8EA 3OIUA 4XYBA 2AG6A 3MILA 3VKHA 3IVAA 4OHOA 1YQWA 1DDIA 4M0FA 4G0VA 4JLKA 4YRTA 2P9BA 1LLDA 1G2PA 3PITA 2AG8A 1YOVB 4K40A 1VLLA 3NBMA 4LJ9A 3UUEA 4Z7NB 4TL6A 3P2MA 4B3RB 1T6YA 2VJAA 4J1NA 2PGDA 4LXIA 4UBIA 3Q9UA 3EPRA 1JPJA 4ZAZA 1ZOLA 5HM6A 3SVTA 1N0IA 4U39A 4H3HB 4RYLA 4F0JA 5AUNB 2X4LA 3G9XA 3AYZB 1RJFA 3FNRA 3TW8A 1M54A 1HXHA 2POQX 3A26A 4OXNA 4YI3A 2A9JA 4DGQA 3VZCA 5DV9A 5JSYA 1ZHHA 4HGPA 3PHHA 4MI9A 5ES3A 1MJGM 5F2OA 3UT5B 2I29A 2YX1A 4JAVC 4LZJA 2NWQA 1QHHA 2OBFA 2H7VA 3LC7O 1MB0A 3M83A 1QP7A 4IIFA 4TOIA 5IF3A 1F9AA 1HLFA 5B58T 4CGZA 3AB3A 3CG4A 3PCRB 4G5OA 1T36B 3VNRA 1FVFA 4F60A 1YA6A 3EH2A 5DBFA 1Z36A 4Z0PA 2PMWB 3BKWA 1RPAA 4ZQIA 3TB4A 4DCPA 2GPBA 4TMYA 1K6IA 3K2IA 3IDOA 4ZVNA 4YMGA 2BMJA 5A1JA 4WASA 4QOHA 1XEXA 3JWHA 1NUAA 2X7JA 2EG9A 3QPBA 3H1AA 4CM4A 5KNDH 3KZNA 3QE2A 2YV3A 5L3RA 4B76A 2E37A 2ZS7A 2IXAA 2E3JA 4DZRA 1V7QA 2IODA 1XL0A 2R00C 3P0EA 4I1RA 3E1KA 5CX1B 3K9LA 3BTSA 1NBME 3AHEA 4Q4LA 5D1NA 3E3NA 2MSEB 1MG0A 1HTBA 2NTYC 3FTPA 3MG9A 4CQMA 2WUEA 3FX2A 3IIIA 4ZV4A 3FYCA 2HCBA 3CNBA 4PR3A 4JQCA 2DAPA 4DQKA 3F67A 1I3CA 3O2QB 3NHFA 3STVA 1GNSA 2VP5A 3D2BA 2QU8A 2ZIGA 4IJ5A 1IBRA 4L8LA 1H2RS 3ANNA 3ZZMA 2UZ1B 4MUJA 1G19A 5DIFA 4TZ0A 2RHRA 3W3AH 1HBJA 1ZCFA 1JIQA 3EVGA 1UBCA 3QPDA 3QPWA 3CRW1 4FGSA 4CEHB 4HFNA 3Q8XB 2VRWA 2XECA 4X6XA 2R6ZA 1M2JA 1NWCA 1FX1A 1VCMA 2VR1A 3Q40A 1VL6A 2PT5A 4O1HA 3QKSA 4X24A 3SHVA 5I01A 1DMRA 3GFSA 4OFBA 1ESCA 4WZAA 4FR0A 5D86A 3ZE7A 3OTHA 5KYGA 1YE8A 2G76A 5CVEA 5EJEA 5KIAA 4KVZA 4YP6A 1KY4A 1SKBA 5HCUA 4X94A 5BY2A 4LTDA 1SUIA 1L7EA 1C50A 1E4OA 5C8ZA 3PEYA 1E79A 1YMUA 1NNUA 3BIWA 4FZ5A 3ZY5A 1ESEA 1NG9A 1IN6A 1OAKA 1UXKA 2IZ1A 2P27A 1XK6A 1LTKA 1HY3A 4XWOA 3C85A 3RRNA 1IAVA 3NANA 3TPFA 4CIWA 5K8LA 1ULBA 5KQLA 1QH1A 5KSWB 1AKQA 1JQLB 3E8XA 3ZY4A 1ZPDA 4U1RA 4ZAGA 3RYIB 3E03A 4MR8B 1UK7A 3ZJ5A 1NIJA 4MEJA 1Y3CE 1WRBA 4CIBA 2HIMA 2UU9B 3E6AA 3MW8A 1GLNA 1KK1A 2DUMA 3NTVA 3NP9A 1EDBA 2DR3A 3ZV6A 4D42A 1ODIA 5EERA 3A8TA 2AZMA 1T5TA 1PR5A 2QN7A 1P4HA 1Z5PA 5BOVA 5J63A 5K45A 3P97A 5EE1A 5KPJA 1OV6A 2CV1A 1KYWA 3NONA 2QGNA 1V5EA 4YRLA 5LMZA 5SZIA 1KZGB 1UM9A 5EMKA 1PVDA 4MRVA 2OLEA 3BG5A 3PJDA 4G84A 4V2IA 2FUEA 3PFCA 2RFLA 2F90A 1H5UA 2M98A 2X8JB 3JWIA 5HILA 1D6JA 1DC6A 1WHSB 2JAQA 3EXHB 4MHSA 3D8BA 1YB5A 1AE1A 2NU6A 3DBHA 3A2LA 3ND6A 3P2IA 3PSAA 3PUJA 5A9TA 3S44A 4EVSA 2RH8A 3ETNA 1ZEMA 4UEKA 3T9CA 3T61A 3G0GA 3TD2A 3OCVA 4GYJA 3EEYA 4AP6A 4BZPA 1IVNA 4GPD1 3RARA 4JKOA 1SUAA 4A2QA 3AEQA 3AFGA 3FRJA 3WLQA 5IUJC 4RK6A 4JR0A 3PQFA 1E3LA 2C20A 1MAHA 2BHRA 3OKFA 1MRNA 4QOSA 3GDOA 4BTLA 5ALSA 5F5LA 3IEKA 1JEDA 4DC9A 1C9JA 1CY2A 1Y34E 3FUTA 1EGQA 4LXTA 3WKEA 1LDEA 3W3ZB 3B1KA 2ZITA 3RTAA 3M1IA 3QY0A 1M2EA 5HRUA 1M2FA 4X41A 1E62A 4BEWA 3FCEA 2HCFA 2HWKA 2AZ4A 3EW9A 1DU4A 4WUTA 3NM5A 2FCAA 2PUJA 3SBEA 1E1QD 4NJEB 3QU7A 4PFQA 4UTXA 4F1JA 3I2IA 4MUBA 4DRXB 2BIFA 1PL6A 4R3NA 3F6EX 3LOUA 1Z62A 4E46A 5DM60 3H5NA 1FRQA 1KNQA 2GEFA 2VO1A 5JE8A 1L5ZA 4BRWA 2WJJA 1N7HA 3IQHX 1J39A 3Q6IA 5CITA 2P0YA 3EDQA 3MCVA 4GPEA 2LXNA 3I4LA 3Q6NA 1M8JA 3LC1O 1ZRMA 4G9EA 2DWQA 1BQEA 5KMGB 4S05A 3C5EA 4N01A 2RHJA 2HMWA 4H1VA 5G2OA 5J43A 4QDTA 3B36A 4U63A 2F64A 2ONZA 3FNBA 3HWWA 2O8CB 1B76A 1EFTA 3FWHA 2ECQA 2PD3A 2XRZA 1A9RA 5LLTA 5T6BA 2O5EA 2VT6A 2ODWA 4RA9A 2B35A 4TVOA 4BO6A 4WFIA 2FVYA 1G5IA 3L04A 3B9PA 1Y6GA 5ALTA 1JSRA 1XKQA 3IUPA 3QIAA 5EXSA 3UT0A 3ZDZB 4EI2A 2FLVA 5ALGA 3GRKA 3II6X 4JYPA 4QGBA 4C08A 4H15A 4PCVA 1H9CA 2DKOA 2XUPA 5CT6A 3U0VA 2XVMA 2V3VA 3PQ6A 4JKYA 4TMXA 5AW4A 1L4YA 2EZ4A 2OGWA 4EHNA 3R9IA 1WXFA 3D5QA 2VQFB 1R88A 1P80A 1XEWY 1XZMA 1VFNA 1CSEE 4QJ4A 5ESDA 2QN1A 5CNJA 5KOHA 1Q57A 2FMFA 3IMFA 3QP9A 3EG9B 3WMWA 3COPA 4AZ0B 5JAPA 3W5UA 2H5LA 4QDXA 3ZDXB 5BSGA 4B3FX 5K9ZA 4A0HA 3DVLA 3GQVA 4ETIA 4QUKA 3B9RA 5JCOA 3DDUA 3OEEA 3H11B 1X1CA 2GCNA 4OYHA 4C14A 2NSYA 2XBUA 4OX9B 1YCHA 4DJDC 3HKEA 1CY1A 3LIIA 4JQYA 2YNMC 3R23A 2HEIA 3B5EA 1HDZA 3HE3A 9MHTA 4DRZA 2YDXA 3LMKA 1M3SA 4Q34A 4X1YB 1N78A 3IV7A 3A6LA 3H2SA 5HCNA 4BE9A 1MEJA 3CVVA 4I9HA 5DASA 1H2AS 5MFZA 3TUJC 3S2ZA 1SCQA 2CLEB 1OZGA 4ZJUA 5LU9A 2X4GA 2Z8XA 5D87A 1B43A 3WSWA 1CE8A 5DJ5A 3RGGA 4X7MA 3AFMA 3W7VA 3ACCA 1R6AA 4M0PA 4YMHA 2JGEA 1J09A 2XB8A 2VA9A 4AY3A 3GGDA 2F3RA 3CB2A 1IMJA 2FAXA 2VZEA 4DA4A 3ROXA 1SUSA 1SHJA 1XJ5A 5ADVA 1R66A 2R2AA 4P3XA 1E7YA 1XZQA 4LE1A 2VSXA 4YHBA 1UKCA 1WHTA 3WWOA 1W1WA 2OBNA 3JD2A 1JHDA 3GNSA 5J1TB 5G0SA 3RJ5A 3WJAA 4NQRA 1XHEA 2E87A 3UPDA 1JDZA 1F12A 3TKLA 1VZ3A 2P9HA 3F98A 1VKRA 3PPIA 4NC9A 1JJAA 3P9XA 5A62A 1R0KA 1JPNA 2DTEA 3M6VA 1S9HA 4U8HA 5CJPA 2FW0A 2PJDA 4Q1FA 2ACEA 2WIJA 3HYLA 5BR8B 1GTJ1 4HFRA 4O4JA 3QNMA 2CZCA 2EXXA 2GQ0A 4ISBA 4E5YA 2FE4A 2C4WA 1NUQA 4C0JA 2XYRA 3KVVA 2FV8A 1Z7BA 2ICAA 4XIFA 1MT0A 4QG3A 1ZBDA 1OHHA 1Z68A 2HNKA 4FJ2A 4NS1A 3WLLA 1Q20A 2JFUA 3L9WA 1J6UA 1BG6A 3BHMA 1H1LB 4FFBB 3JQGB 2UAGA 4RPLA 4XIJA 1RE1A 5DKFA 3SFTA 1X1TA 1BJKA 4P5DA 4GZ5A 4IM7A 4TWIA 3TLCA 3HGMA 2H4WA 4JQSA 4BL5A 1ISFA 1AKEA 3L7AA 5CFLA 4KB5A 4YDQA 2Q7DA 2O2SA 2QUIA 2IVFA 3O94A 3FDFA 3C3DA 5J2UB 1SQ0A 4RK4A 4IJWA 4DJFC 1H9AA 1P0CA 4R1MA 4HTFA 3WIVA 4Y6RA 1C4XA 3NXKA 5K2MA 4D3YA 3IBYA 3UA4A 3V1KA 1W35A 1MJNA 1B26A 1GPJA 1VI2A 1VSBA 2FWNA 2WKWA 2XZTA 5EEHA 4F2GA 1ZI8A 5ALIA 4MITA 5IVKA 4ZVKA 1C3OB 4MVYA 4BX9A 2R751 2C1EA 2GZSA 4ZRDA 1U9CA 2ZUSA 3IO5A 4KL8S 4W5WA 5BWNA 3CINA 2GFHA 1MQSA 3HZOA 3JATB 4F6RA 3WKDA 1L5RA 1E63A 1ZJJA 3F96A 1G0OA 3TW0A 4ACBA 2JBHA 1WQ1R 4LOIA 4HV4A 1GQSA 1SHKA 2GVDC 4JLVA 3SXJA 3UG6A 4E1AA 3VO9A 2Z8YA 2NT3A 1J2TA 1EPUA 4TXMA 1ORRA 4EPVA 3I5YA 3FR8A 4PLCA 4F1WA 3I45A 3DWIA 4GR9A 4PHHA 1JUDA 1C1DB 1DZ3A 1FTWA 1DP4A 3AHJA 4ZVOA 2GT1A 4EUKA 4DPLA 2OOKA 4E31A 1C7ZA 1YR7A 2GVNA 5LUAA 4EW3A 4R83A 3BRQA 2HOQA 5BSMA 2OM2A 1JKMA 2YIDA 4JP5A 3UKOA 2I4OA 3FGZA 5B57C 2WAYA 4G97A 4LBZA 4E15A 3ESYA 1N1DA 3CBQA 4EG5A 4YAFA 2X9QA 4V1CB 3L8DA 4RQTA 3GRVA 3GQBB 3LH5A 4GG1A 4A73A 4KIJA 4UBMA 5AVXA 2Q9UA 1IIBA 1SOAA 2WYVA 2OHVA 2CFCA 5C31A 4CBVA 4US0R 2ZTUA 1I1NA 3VU9B 2W48A 1YRBA 3CW2A 4OSPA 3N8GA 1K97A 1V43A 4EO7A 5LQDA 4LRQA 2DSTA 1UBHS 3EPPA 5BWCA 1W7AA 4AKHA 3V2GA 2A3RA 2PX8A 4DEXA 1UBTS 3ZKWA 4AO6A 1EFUA 4GF5A 5HF6A 1XR3A 4BB9A 2FW8A 1CRZA 5AVKA 5JR3A 3FBGA 3JRWA 4MUAA 2O3QA 3OQOA 4RABA 4IMIB 4Q24A 1XRQA 2J5BA 3BGDA 1QC5B 1XO1A 2Q3EA 3FOAA 1TCBA 4FXPA 5JSKA 3WL4A 3O7WA 3UGTA 4BDTA 4DQLA 4RMGA 4ARAA 4YRAA 2XA1A 2UV8A 3N58A 1MQ9A 1O58A 3MCUA 4LHXA 2I2FA 3JQCA 5ANRB 3LHDA 3QE0A 2V6BA 3AKYA 4O2AF 2BHTA 1BX3A 3VUFA 3BBLA 4YT4A 1X3LA 1T0IA 3AUUA 2O1XA 4O4HB 5H0IA 4CIAA 4UQLA 3PA8A 4IL5A 3WNZA 3DF9A 2EAUA 4JYZA 1UC4B 2W2MA 3K9HA 3O9ZA 4KJXA 3AXSA 2FH5B 3N8HA 4G8DA 3WLNA 1IM8A 4XWKA 3FI0A 3HL4A 1N1EA 1XMSA 2QKYA 2VEOA 4NVRA 2P6RA 1PQWA 3HY6A 1HO3A 3I23A 1P3JA 3HJBA 4FHEA 1EA7A 5LB4A 3IMKA 2JLRA 3F6RA 1ISGA 2PVPA 2CLHB 1G7TA 3P0JA 4Y0AA 3V7WA 2XWPA 3JWPA 3NHJA 5FBQB 1Z5NA 2FY8A 2DM6A 4A82A 1P6XA 1YB6A 2E4WA 2BKXA 5TPWB 4HYQA 3FHLA 3MNFA 1J33A 1EVJA 2VK2A 4BGUA 1R7RA 2YFQA 3AF4A 2QD5A 2XYHA 3X2EA 2Q6LA 1KQ3A 2ZKIA 2ZDGA 5C3UA 2PUWA 2ZWOA 4NNOA 1N3IA 2PSSA 4JJ6A 4TYPA 5BT8A 5FTLA 4Z5XA 1U0LA 3M5CA 4KLAA 3H2BA 3OZSA 4WFQA 2HAEA 3PQ5A 1RQXA 2AE2A 4FM9A 1YCGA 3JQGA 4FEEA 1AX9A 1SZCA 3W7BA 3GAFA 1RHMA 1U5CA 5FLXA 2AD5A 4KN8A 5CJJA 3VAAA 2ESRA 1K5PA 4KUHA 2VH2A 4LGVA 5HE9A 5ALDA 2X0FA 2QW0X 2C9BA 1PZXA 2QOEA 3L0CA 4MP3A 5JISA 5J2UA 3PX7A 4OGLA 1KQOA 3FMFA 5HS6A 3UOGA 5ISMA 4JLBA 3VVBA 5AJTA 1LV7A 3KKKA 4XIIA 1XPOA 5HFNA 3NUQA 1RC0A 1YVRA 3V4FA 3TL2A 4OI1A 2AH5A 3LYAA 2X0JA 3I2FA 3RJMA 1DBQA 2WA1A 3GLQA 4MJLA 3SQLA 3TR5A 3ZCVA 3ITDA 4X90A 4G0XA 3SFVA 2JAPA 2HB6A 1UM8A 2CMHA 3KJFA 3PXBA 2F7SA 4I9FA 4QQFA 2XTNA 1SK9A 1I4WA 3EJWA 4D0NA 3HWSA 3HU1A 1Y9JA 4W9RA 3R7NA 3JD3A 4UMDA 2WEKA 3UGKA 4AN4A 2OTCA 2VTVA 1WD7A 2AMLA 3F6YA 2R8ZA 4XVHA 1V45E 1OFVA 1ZH8A 2B7CA 1U2RA 2PT9A 1JEQB 2ZBDA 3ZVLA 2Y1WA 1MB2A 4M0EA 5ERGB 4KXUA 5JALA 7GPBA 3N2KB 1TM2A 2A6PA 4E6PA 1NBMA 4ZHQB 4L95C 1JA1A 2H7CA 4CZ2A 2D4AA 3H4IA 4JX8A 3OTGA 4WKCA 3CB4A 3TRJA 3VR1A 1YRQA 1PG5A 4V1CA 1NXXA 5CFNA 4NAUA 1OAOC 4BX3A 3S2UA 2O5VA 2B7BA 3K53A 3R41A 4JHXA 4DRYA 3AEKB 4WN3A 3RSFA 2J45A 5BUZA 2J07A 1EFPA 3R5JA 4DNQA 2BLNA 3GLKA 2AHOA 2VHEA 4IBOA 2IU6A 1IFXA 1GKYA 1KI2A 1GKLA 1I2BA 1P8AA 1RU3A 4IVPA 1UP4A 1OWMA 3IBFA 3QI7A 4FGKA 4JBNA 2Y76A 1G3IA 1R27A 2PXCA 3KZXA 2CHQA 2BFMA 3ONEA 5FR1A 3VVCA 1X7WA 2FN8A 3GUYA 4LWZA 2FZLA 4YQZA 3WSVA 4ZJYA 1C41A 1QJCA 2G5CA 3K0CA 4JLUA 1KL7A 1PJRA 2AVDA 1GCAA 2W98A 4RHEA 5KVCA 3M1AA 2ORVA 1J97A 3MF4A 1B6TA 1MQ8B 3RFTA 4ARVA 3NAQA 1NIPA 1PBNA 4YR7A 3FNGA 5BVHB 5JAHA 2WTNA 1WKCA 3T1VA 4NQZA 1SHTX 1I0LA 1DDOA 1W59A 3JCZA 1T5DX 2BT4A 1EK6A 3VTKA 2IF0A 1NAIA 5LJLA 4HWTA 1HT0A 1JU4A 1ST3A 3NHWA 1IN4A 4R2MA 2Z43A 1E1MA 4TRMA 1V39A 5A5FA 1SXHA 2VAXA 4OHPA 1XEAA 4RJKA 2BZ0A 3COYA 3MB8A 3QMPA 2J3HA 2ORIA 3IBCA 2CB9A 1E32A 3R0QA 3NFRA 4RFSA 1M0EA 2F8MA 4RKFA 4GXNA 1DX6A 2WWIA 3PXAA 1YZLA 1DAKA 1Y7TA 5CTAA 4O4JF 1P6UA 4KAXA 1NVAA 3W8DA 4J0EA 3F3SA 5J2TA 3IUSA 2QS9A 3N0XA 4XOUA 3G49A 2CK3A 4HG2A 1P0QA 4TS3A 5I7AA 1HQYE 4LEIA 2BFDA 4OVKA 3GAMA 5GAJA 2DFDA 4QPCA 5TPWA 2D0OB 1EGVB 2PBRA 2DHEA 4GNRA 4AZVA 3GIDA 4E3WA 1PGPA 4RAQA 4AJEA 5LQRA 2W2QA 3HSSA 3W04A 1G59A 4M1SA 3FIUA 3K0BA 2CEAA 5DOVA 4XRRA 1R64A 3GGCA 1PFKA 4J07A 4I4TB 4JI6B 3ZD7A 5BR4A 1CQZA 1GNRA 1OBHA 5G02A 2QUJA 5HDBB 4LOLA 4MB6A 5C1DA 3SE7A 1BN6A 4TMWA 2HKIA 1HZZA 4G56A 4CMBA 1L9XA 1Q6YA 3KHTA 1F5SA 1QMGA 1IOLA 1CUDA 4NOMA 4RA6A 4RD3A 1WPGA 1JIJA 1GA4A 5HF8A 5L6LB 1GNLA 1XTUA 2FMUA 2IYTA 2TECE 4GBJA 2XI4A 4MVJM 1C7EA 1Q1QA 3A05A 1LBIA 3QKWA 4R7GA 5ALNA 2C3YA 1MLDA 1UBGA 2R8BA 1M6VB 1K3TA 4G5HA 1DWOA 4C3UA 5CJ2A 1A9XA 1ZMTA 3PLNA 2NZWA 2IWRA 4U7DA 3T1OA 2HM7A 3IV6A 5SZJA 5K03A 2HBYA 4AQDA 4Q66C 2LIPA 3OE5A 1ZUHA 3B82A 3LAWA 1R15A 4FE4A 1D3AA 2OESA 3CN7A 3IEMA 4US2R 4V3CA 2JGMA 5C5DA 1DT5A 4R9RA 4NZZA 1H42A 4ZQHA 1PS9A 1G2IA 3C6YA 3LXUX 1AV6A 1NLFA 3UWKA 1Z82A 2ZBVA 3IT1A 4BP9A 3EVEA 1QH8B 4LCJA 2XXJA 1ISRA 2J85A 3MSCA 3CKKA 2CDNA 2A9VA 4JEIA 4MRSA 1ZHOA 2UUBB 4ZV7A 1L7MA 2CMDA 5EOVA 3CEHA 4EKEA 4J0CA 3D43A 5AVUA 3UCFA 1QIJA 4B1FA 4LFBB 3IHLA 1HG1A 2FUKA 3DOCA 1IXZA 3JAWB 4HOYA 2G9UA 4KQEA 4DB4A 1LLQA 1QNLA 4V38A 4BNWA 3EFHA 3HB7A 1J21A 1C3JA 3KT6A 3L8CA 4YRPA 2W71A 4G1EB 4F3CA 4A23A 2Z0MA 1FUKA 3DHYA 4MLPA 3ZH2A 1L4GA 2YR0A 3GOHA 1CETA 3H6HA 3L8ZA 4ZGWA 2EWVA 3KDPA 1O94C 3PA6A 4LA4A 2W2VA 3P7MA 1XWWA 4YVFA 4QPJC 3IEUA 3B3JA 2RG1A 3NI2A 4UHHA 1EHIA 4ZVUA 1O0SA 1R74A 1IMOA 3AEKA 4GOKA 2G1PA 1UK6A 2DHQA 1RRKA 2OZVA 4W1SA 3P52A 3SSOA 4IUBS 1RYNA 5HDQA 1SELA 3ZLTA 1U0GA 3DR5A 3KWMA 3EMKA 4V0SA 3NBFA 3CVYA 3OPYI 2BKLA 4LHEA 2DE0X 4LS3A 5KNCD 2XNDA 1ZKMA 4L6IA 1B93A 1LTHR 1XRLA 1OYYA 2QI9F 1N8TA 3CLRC 3OJOA 1QOZA 1Z25A 1ULTA 3OOWA 4B6FA 1QHXA 1DG1G 1PEDA 2C7GA 2AXNA 5BVHA 1QIEA 1ECBA 2GD1O 3BXXA 1BVYF 1UMKA 1UPTA 1Z4KA 1FEZA 2WZQA 4PGHA 4ZVLA 1YVDA 1SRRA 4R8LA 4X9XA 4AZ3A 1ZESA 3BIFA 3L6OO 4IIHA 2HX1A 1TD1A 1LW6E 2YVLA 3LPMA 2XMGA 4WI1A 1Y98A 4LGMA 4WEQA 4XUEA 3N0TA 3UXEA 4YBRA 3QG5A 5JZ9A 1M1NA 3OQIB 4LBWA 4QO8A 1SN7A 1L8LA 3BJEA 1T3LA 3NATA 1U4OA 4DLAA 1CJCA 2CLFB 4YRFA 5FA5A 1UFRA 3QWBA 3A4TA 4FDAA 2UUPA 3PC8C 4JJZA 4LHSA 4OP2A 5EHQA 5IDYA 3VX3A 5K8CA 4NE7A 5IHXA 1SKYB 1WVGA 4H3KB 3TSWA 1MV5A 1WBDA 1JSZA 1G5RA 4G1VA 4RC9A 1T34A 3INYA 1DKPA 2FEXA 4F4HA 3CIOA 3PDUA 4F5DA 5K0BA 1Y3DE 5KYUA 1JAYA 3OLYA 1R5OA 3AVYA 4QPZA 4FGUA 2ZYTX 4GQIA 1TB4A 2FWIA 2X9LA 4F3YA 3J81A 1F1JA 2JATA 4LKRA 2ZM6B 3C6KA 1G2OA 3EXFA 2P0EA 3G2KA 2FNAA 3JQDA 4ZRMA 1KIAA 2NO1A 2VDWB 2QRGA 1GFZA 2AWNA 1FYEA 3WK9A 4H1HA 2AG5A 1XD9A 2BEUB 3UQYS 4EM6A 4QFDA 3GJXC 2PGNA 4D56A 2NADA 2W6QA 5J2UF 3BRCA 1JQ3A 3CV3A 3MCTA 1E20A 5DM0A 5JLAA 2YYYA 1UPFA 4JASB 1TX4B 1FXWA 1E5QA 4HLDA 5EIBD 2C1XA 3QW2A 3AJEA 4K9QA 3ZE1B 7REQB 1OTXA 2GTHA 3A1UA 5A2GA 2OCAA 5AOCA 4NJMA 2OY0A 5KYWA 1B0PA 3FJ1A 1YR3A 2A9PA 4L74A 3RVDA 1FSFA 1JSLA 1YWGO 2XGMA 1CUEA 1UCFA 2FZVA 4MUHA 1FU7A 4OB6A 2IOFK 4R2JA 4X3CA 1F2TB 2IIPA 3EAQA 4C7VA 4E33A 3VC3A 2C4KA 1NQVA 1TE2A 4EKDA 8ABPA 3SQDA 1ODJA 5BV8A 5GP1A 3WLTA 3SOZA 2BGIA 3V46A 1P5RA 2XZDA 1FMJA 1XAJA 1KI3A 1S0UA 3NO4A 5COAA 3LCMA 3V80A 4KXVA 3TIGA 1P7PA 4DZTA 2I7DA 4WH0A 4CT0A 4X00A 1RYMA 1O5OA 1W29A 4Q82A 4IDCA 5IARA 1BFDA 4P2BA 3GT0A 4RL4A 4TN5A 2VPXA 2HDNB 2X23A 3D59A 5I7FA 4TWRA 1E89A 2DLDA 4ND5A 2Q1WA 4NMLA 2QNBA 1DQSA 3ODPA 3KU4A 4LN1A 2Z98A 5AQEA 3RVNA 4D9EA 4PYOA 4L3WA 3OBBA 1KHTA 2D5IA 2Q2NA 2YV5A 4BECA 4K2AA 3SDSA 2QRJA 3U9SA 5L51A 5HPYB 4WINA 2JBAB 3BEOA 1PFUA 4MKFA 4GC9A 5EIHA 1W4AA 3C98A 2VT2A 4HPWA 4Y2SA 3TRIA 2Q9BA 5T67A 1QF9A 1FYXA 1SXJD 2B2XA 1CZUA 1KXZA 3HMKA 1LI4A 2IY7A 4I14A 3AR8A 2H1HA 1DAFA 3B1ZA 2EJCA 1ZM9A 3PL5A 1WABA 4KQIA 2CF6A 3A1FA 4YECA 2WI8A 1XSEA 4CJXA 2R6GA 4KVGA 1J8DA 3C6QA 5CT8A 3W3AA 2RHDA 1L7DA 3IQIX 1RTKA 4J9VA 4WIAA 1E3MA 1EFCA 4OGKA 5DT2A 4WEOA 3N28A 1W4CA 4OXQA 2X1MA 2Q4EA 3A6ZA 1RP1A 3DFMA 4OKSA 1KOFA 2AC2A 3WMEA 4JI4B 4BOYA 2OORA 5HCIA 1HQCA 4CT4B 5H3CA 3C48A 4B3SB 4A26A 1Z0DA 1UF9A 2NACA 4H1TA 4E5SA 2JAUA 1U11A 3JYLA 4ZVPA 1HX7A 2GA9A 3SQNA 1YZTA 3THSA 4O4HF 5A5EA 1ECPA 3LDFA 3DT6A 4IWXA 1GJRA 2DJIA 3K0FA 2BKEA 3OFKA 3QYAA 1BKSB 1SB9A 1XU9A 1ZISA 2Z3VA 3NNNA 4ZO8A 3BMNB 3RTCA 3W78A 1ZBQA 4NIMA 2C84A 1XC7A 1R4ZA 2JLVA 4KN9S 4Z6KA 2ZUVA 1Z7EA 4Y1FA 3D02A 3G9QA 2EJUA 1I1OA 1X39A 3G7UA 2NUAA 2H4YA 3O83A 5EC8A 5J2TF 4NXMB 4JSRA 3D6UA 2PUTA 2XMDA 3PGA1 1FYDA 2NTNA 4AG3A 2O2DA 3AP2A 4TT8A 4P7JA 2VPWA 3W77A 5INTA 1MABB 3NVKI 1A97A 4BKOA 1DCMA 1GT91 5F9HA 1NVFA 2C88A 1O8BA 4XR4A 1SWVA 1H94A 1Z5ZA 2PS1A 3A9UA 5CYOA 3KCQA 1U3WA 4DSAA 1NV9A 4RZSA 3PI6A 4R01A 4DSTA 1XJQA 1XZCA 4OQ4A 5L45A 2CFIA 1QRSA 4OYYA 3D2AA 1TTHA 4ZVMA 2QLLA 5C8VA 5TS3A 1PKEA 1VDMA 5K8UA 2JG3A 4X45A 2NO4A 2X15A 3BSFA 5B2EA 3ELWA 3X1XA 5C5EA 1BKYA 3S2SA 3UJ9A 2E0IA 3GROA 4IGFA 4X1KA 4CE6A 1ZYUA 2WAXA 4XGKA 4Y2PA 1MOZA 3F8WA 3KT0A 4F93B 4OI0A 2JGAA 3EASA 2R8YA 4J03A 2J08A 2W0MA 1JLSA 3U26A 5BYJA 1VP3A 3TNDA 4MZDA 2NT4A 3LX5A 3JPWA 1DUVG 3RSCA 1BHJA 5J1SB 1Y8QB 1HEIA 1Y81A 4KBFA 4AT1A 4NI5A 3FLEA 3IVMA 4Q7JB 3PX3A 3C3EA 2FEWB 5GMOA 4ZQCB 4BKMA 2E1RA 4WT7A 4B6OA 1R5BA 2BGNA 3VR2D 1RYEA 1I6MA 1Q0RA 2OHFA 2PZ8A 3G0CA 2RI6A 4GPTA 4QJBA 1V8OA 2GLUA 3F1LA 2OQVA 4DJJA 4R7ZA 1JG4A 1XALA 1M74A 4FEGA 4NCJA 1PX0A 2JA1A 1AXGA 3PE3A 2XA2A 4BO0A 4PO8A 3UAGA 3SZGA 2QRQA 2VHTA 2FF5A 1E60A 1FRVA 2MSKA 1V16B 1GUDA 2RIPA 2H2GA 3HEBA 1MX9A 4JJ7A 5F9MA 3T5PA 3BK1A 1NOKA 3NHLA 4YY3B 4FMPA 3AI1A 2Z2YA 4IIUA 3NV9A 4MA0A 4I3HA 1XE3A 1QBKC 1CJSA 1A5TA 1JB9A 1GQQA 3V8RA 3SVLA 5K3FB 1THMA 2YIJA 3A10A 2V98A 4QOJA 4R2WA 3F47A 5IAJA 1RI3A 2EQAA 2FWMX 3DDOA 5EZYB 2FKAA 4KGXA 1ZVMA 4DMGA 4JOSA 4B48A 4ITVA 2HQSA 2WD7A 4P4UA 1JH9A 1N57A 5DK4A 3E4CA 3RBXA 4FB5A 4RLSA 1JIXA 1ZLXA 1RDFA 2C9DA 5IDVA 1K7EB 1T2VA 1KFKB 2NQTA 1QIGA 2BY4A 4FCWA 5M7EA 3NEPX 4OJKA 1GGNA 4KRFA 1CJBA 3A1DA 2GHIA 3FDZB 1IAQA 4P53A 2GEBA 4XWGA 3CUYA 1GUZA 1V1RB 3G1UA 4P92A 3BZWA 3JQ7B 1A4RA 4IYRA 3DZIA 1JXOA 4N7RA 4BO9A 4NE9A 4RV9A 1E9RA 1QU2A 3ZZTA 1G5HA 2AGVA 3EGDB 4PZLA 4DA0A 5HQ3A 3ABZA 4TLEA 1GL7A 1XCBA 2HNAA 4XX1A 2F4VB 3HCBA 1USIA 3AW9A 4IXMA 1NR1A 2QENA 1X94A 4YPOA 3KXLA 1SHUX 2QZPA 3ETJA 3GGJA 3RASA 3VI3B 3BF8A 3HXTA 1R8JA 4HRVA 2O2EA 4XGQA 3RIXA 4BNTA 4F2HA 2QUAA 3SC3A 4LDZA 1ECJA 4WFKA 1FQOA 4BZWA 1U7OA 3QF4A 4X8HA 5LA6A 3G0IA 2XSZA 2A7XA 4OMUA 4L76A 2Y1DA 3FTQA 2GK3A 3RC1A 1JYFA 2Y71A 3UY4A 1L6IA 3D1JA 4H1UA 1LK0A 4P22A 2GESA 4ZAFA 3O4JA 4PNPA 1ZRNA 2AN5A 2JGDA 3N39C 3ZQ6A 1ZM2A 4RM2A 6PFKA 1RYHA 3Q0IA 1K06A 4BNVA 1ULUA 3CZ9A 4GAEA 2YJZA 2WHYA 5HIAA 2BFCA 2J0UB 4L7VA 1MRSA 2X0NA 3PJGA 2NO5A 3NBXX 3PNMA 4MWSA 5EP1A 2BLLA 3TPCA 3SJ7A 2CDCA 3MTGA 4JOBA 4LC0A 5K0NA 4OHRA 4QYWA 4D8UA 5KJEA 3IAFA 4V0KA 4JD5A 1CQJA 5U4QA 4G4JA 4IRMA 4KNYA 3ZD6A 3FWPA 3LXRA 4L73A 1BEEA 5DTQA 3PD1A 1RHKA 4XYGA 3WYEA 3WWYA 3AZOA 5AHKA 2BR3A 1MEOA 2KQUA 1FXWF 3D7SA 3HXMA 2WPDD 2PVCA 3Q3GE 3GRUA 1LJLA 3MWDB 1QR2A 4TV8A 5KOIA 2CVHA 1EUQA 3HU5A 4EG3A 5IJZA 1EU1A 3LWDA 5KQSA 2VAVA 1KS2A 2SNIE 3FPKA 4JJGA 5EHGA 5A4DA 3M6LA 1F0PA 1R37A 2M2IA 3KPWA 4ER5A 3OLXA 4P32A 5DB4A 2Y8EA 1T9ZA 1ZIPA 4DGSA 4EEXA 4PC7A 2F67A 3BQ9A 1A69A 4QDKA 5BT9A 4DREA 3AJ8A 3K6RA 1N7GA 1LUAA 2AOTB 4FNAA 2HUNA 4GVPA 2XVZA 4X8OA 2QL6A 2J30A 3IBSA 3HG7A 4PO1A 1TNDA 2CHEA 3RADC 5JZMA 5JYDA 3W9UA 5MGBA 4OHXA 2QTCA 1LFDB 2OBBA 1TCUA 3PRJA 2NP6A 4JA2A 4FFDA 1L5OA 1TF2A 2CLDX 4CKEA 3FDXA 5DX1A 4MKGA 5CA0B 3RTGA 2JPDA 2ZJAA 1U1DA 1CRLA 5DI3A 4U7JA 2C0CA 3U3DA 3RC8A 1IOWA 1PSZA 3VPXA 5DNDA 4JUIA 1G18A 4Y1RB 1C29B 1NQUA 2JZCA 4QPPA 1Y82A 4KGVA 1VYVA 5FB3A 2Q7XA 3R3HA 3OC0A 5AKHA 5H80A 3W05A 4AB1A 4C4AA 3AY7A 2CCJA 1KJYA 3QG1A 4JI2B 3GZJA 4Q7MB 3KPJA 3GEIA 2CYCA 3MTEA 4BZQA 5H70A 4JYMA 1Z08A 4P5PA 3O21A 3T7JA 2Q5OA 1ML3A 3OCXA 3I9V6 5CX4A 3VAZA 3KOUA 3I37X 2Q6TA 3L93A 3S1LA 3LZ6A 4RKQA 4JBYA 1WP9A 3GA5A 3ILVA 3OCCA 3V48A 4P9NA 5E7IA 1NBEA 3TXXA 4DCMA 4ECAA 3F6BX 4Z7QB 2G1AA 2PBZA 2QLBA 2ISQA 3QM1A 4HDKB 1PQYA 2B30A 4KYVA 4D79A 4DB2A 3MOSA 5K3DA 4HDNA 4ZO9A 1EX6A 5F1PA 2Z04A 2F62A 3DXFA 2HK7A 3NJ4A 4DV5B 2QHXA 3B48A 4P84A 1SY7A 1NXTA 2P35A 1C2TA 7YASA 1NQTA 3AWDA 1EJ6A 2VPZA 3CQ9A 1DHTA 1QIFA 2BR4A 3HPQA 1QTQA 3T5MA 2RGXA 4H59A 2XOKA 2ZYAA 1NU8A 3ZWMA 1W44A 3R8XA 2YNMD 2UZIR 1SXGA 4D9BA 2YZGA 2XPCA 1HF3A 3F4BA 1Z8NA 1YZFA 1L7RA 1TEXA 2UYGA 3DL4A 4B2YA 3PIIA 2Z1MA 1GPKA 4NCKA 3KFVA 3P0FA 2H0AA 2GF9A 4L8VA 3LPAA 5CVTA 2P91A 3F9RA 3LXMA 4NULA 2F00A 4WLFA 1S5PA 3DV0A 3ZU3A 2VZLA 1G60A 3H4TA 4WZBB 2IYXA 2WNSA 1L5FA 2P4QA 3O4IA 3COVA 2BFBA 3CUSA 3RAPR 1Z0AA 1G8HA 3H3FA 1T15A 1PJ2A 4TV9B 1X74A 3VRHA 4ARUA 3J7TA 4WERA 3NTQA 1ZUWA 3FROA 2FWJA 3IR7A 3ESAA 3N5KA 4IZOA 4J90A 3E22A 2Z2XA 3IUQA 4MUGA 3ECSA 4IUCS 4BFXA 4P4SB 4ZMSA 2QM3A 1MB9A 3LUDA 3RLFA 4URZR 4OLAA 3TRFA 2F59A 1OD6A 5JJLA 3CA8A 2EBWA 4Z53A 1U31A 2FPMA 4Q3DA 4PPNA 2DPYA 1RKBA 2P3OA 4GPZA 3U1VA 4B17A 2FSSA 3S4YA 1Z17A 3CISA 2Y05A 4N5NA 3OESA 1T2FA 2VNHA 2ZT7A 2B4RO 2YZKA 1SD5A 2N75A 4GW3A 3SR4A 3VOBA 5LWHA 3C8UA 1U0HC 4NK4A 2V45A 4UHDA 2J0UA 3HSYA 1Z4QA 3QZUA 4O6VA 5AW6A 4IO0A 1VLVA 3HLYA 3FCAA 1NW4A 1XMOB 1JQAA 1FS5A 1CNFA 4ZFNA 1RQLA 3BFJA 1N7IA 3JYOA 4HDSB 4HGZA 4I3FA 4MR7B 2AOWA 5T4BA 1SO8A 2GN9A 2TMGA 5A71A 1HRDA 1GCGA 3FPBA 4DLYA 1RCUA 3LA6A 4LG1A 3NDPA 5DNEA 5F33A 2CYBA 1KJWA 2BTOA 1T13A 3AC0A 4EB6B 1TAUA 3PNKA 2HU5A 2NO6A 1LDBA 4AKIA 5JV5A 2H16A 2PSDA 3H5RA 4PLYA 5TVGA 3RIEA 1G6Q1 4FT2A 4JJ8A 3C1UA 3SN6A 2JLSA 2QAGC 1CEYA 5DGTA 1XZPA 3GJYA 4EKGA 3A27A 4YT8A 1IHOA 5EJ7A 4S1VA 4NPHA 3L0DA 1UMCA 2E4YA 1P7CA 4OJQA 3W5DA 5KDLA 4XARA 2P0AA 3KJHA 2MINB 6LDHA 4ZVRA 4D9GA 1WLSA 4JY7A 1EVLA 1NN1A 3EEQA 4HN9A 5B53A 3W4IA 3OF5A 1TIBA 1TK2A 3NHPA 4P38A 3ZVMA 1J9ZA 2PWBA 2BMVA 3OICA 4U3JB 1KY2A 1Y6QA 3BHIA 3STWA 5JI2E 3VNSA 2LW7A 2VC2B 1YS6A 1GSHA 2AK3A 2O9JA 3MJSA 4LJYA 1U90A 3JTEA 1CDDA 4RPCA 4YO7A 2IY9A 4ZWNA 4BBPA 4D25A 2PMCA 3H1GA 3UWPA 2QK4A 3TFWA 1WW8A 3B38A 1HDXA 4Q93A 1SKQA 2IWHA 2VZ8A 4JJAA 1RZRD 2C8VA 2ETXA 4B3IA 3BULA 3WKCA 1L7QA 3A70A 5B5SA 4U2BA 4GHWA 3K70D 1E6MA 1BOFA 3A36A 3LBAA 4BQEA 4E14A 1CYDA 2PS9A 3IOBA 3NRBA 4OF4A 3COJA 2Z6VA 2HCRA 2NUPA 1NVVQ 4KIGA 2YL2A 1A8QA 4X84A 1T3GA 3GEGA 4MRMB 4KO1S 1K6XA 3ESRA 1KEKA 3DWEX 3KB2A 2QSJA 1LX6A 5KSPA 2JGNA 2O0HA 4NV3A 1LC0A 2A33A 3HB0A 4KYTA 4URYR 1G66A 4ENTA 3SC6A 1E99A 2YWBA 3SSNA 1NT4A 1JI3A 1G1AA 4PICA 3GN2A 1GQFA 2FEOA 5I9SA 4OKIA 5K51A 1XKXA 3DAFA 4I4NA 1BN7A 5KAMA 1ZSYA 3PFIA 4HWGA 5KOJA 5JWHA 1YL5A 3G89A 4GP9A 4YJ2B 1G6HA 5GGYA 1FXSA 4PGMA 3WZ2A 3MJHA 4L9AA 4MP6A 1UKVY 3IA7A 3IDZA 1XELA 3IP7A 3O03A 4AS1A 3U4DA 2FSGA 2CJWB 3I3SR 1E0JA 1OTYA 2C2KA 3K70C 4LSMA 1TF7A 2O5RA 3KFXA 1PK8A 4ODIA 2WT4A 2XYPA 5IRCD 3FPGA 3OT1B 2NVUA 2OUIA 1N36B 2FP4B 1F38A 4NBKA 1VL5A 1XVLA 4K9PA 3MINB 4X20B 4GMHA 1CP3A 1S2NA 2PIDA 2AW5A 2R5WA 3DZ8A 2PFSA 1RYFA 2GBPA 3IPRA 4FGZA 5BUSA 3IAEA 3LCUA 1N5RA 3N70A 2B78A 2VTEA 4K6FA 4W5JA 2WT9A 5K4HA 1D1TA 2WU3A