3NHMA

Crystal structure of a response regulator from myxococcus xanthus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
115
Chain Sequence
b'PKVLIVENSWTMRETLRLLLSGEFDCTTAADGASGLQQALAHPPDVLISDVNMDGMDGYALCGHFRSEPTLKHIPVIFVSGYAPADQPVPDAYLVKPVKPPVLIAQLHALLARAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
molecule tags Signaling protein
source organism Myxococcus xanthus
publication title Crystal structure of a response regulator from Myxococcus xanthus
rcsb
total genus 35
structure length 115
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nhmA00
4NQRA 3OLYA 3OM0A 1MVOA 3DLHA 3E3MA 4S04A 5IEJA 3CHYA 3N0XA 3O2SB 3HDVA 3QELB 1JFTA 3I42A 3BBLA 1URPA 2FTKE 4WXMA 4B09A 2E4VA 3G85A 2A9RA 3KYJB 1EWKA 5JNUA 1L5YA 4D74A 5BQ3A 1M2FA 3NNNA 2QW1A 3GV0A 1BDHA 3QX9A 5ED4A 1D2AA 2E4YA 3IPAA 1U2PA 1Z15A 1RZRA 3K9CA 3G1WA 2IDMA 4TLMB 2B1JA 4EYQA 2LPMA 1KRXA 4WXEA 2NT3A 3RQIA 4F8JA 1PNTA 1UDRA 4MR8B 3LOPA 1JFSA 1KRWA 1YS7A 4FB4A 2HQOA 1ZH4A 1A0OA 4MQEB 3DLBA 5C5CA 1DRJA 2NT4A 3CLKA 1VRVA 1YK0A 2WRZA 3CU5A 3Q15C 3RVMA 1NXPA 5JNSA 2E4WA 1A04A 4EVSA 4H3KB 5B3JA 3CG4A 4ZYLA 1OXBB 2GWRA 5T7BA 4RZSA 4YLEA 4EY3A 5TPWB 1E6LA 3OQOA 3EODA 3KYIB 3M9XA 4LRQA 1CEYA 1I3CA 2FMFA 2JVJA 3TD9A 5KQGA 3OLXA 5HKOA 4IF4A 4MS4A 3UK0A 1NY5A 2FMIA 5EWJA 2WY2D 1DJMA 4W5TA 4LDZA 3RVOA 2HQRA 3Q9SA 1FFSA 3FDFA 1GCGA 1YK1A 1YVUA 1RZRD 3LUJA 1L5ZA 3A0UA 4RK0A 1JHZA 2JB9A 1QNLA 3O2QB 4G0PA 4HNRA 4W5NA 1DC7A 4G97A 3Q41A 2PUDA 4N76A 9ABPA 3JS5A 2FSPA 4Z4GA 3H5OA 2PUGA 3JTEA 4Z4IA 4HNSA 2E4XA 2HSGA 3M6MD 3NNDA 1Z16A 3A3KA 4WUTA 5KQPA 4RU1A 2ID9A 3O1HB 2H3HA 1SRRA 3MYYA 4O1IA 4LDAA 4DADA 1JWLA 3B2NA 5DCLA 5IBQA 1APBA 1F4VA 4S05A 4MR9A 1PHRA 2PAFA 1ISSA 5KC8A 4OATA 2JRLA 4MPTA 1ABEA 3IDOA 3ROTA 1Z17A 1FFWA 2QR3A 2FVYA 1PEYA 1JYFA 4Z99A 4Z9AA 1MB0A 3JPYA 4XAQA 3Q7RA 3EGCA 1JDNA 1DCFA 1ZY2A 2GX6A 3DBIA 4MS4B 3LUFA 1TM2A 4JOQA 4UHKA 5KQLA 4Q6WA 4P1ZA 4KZKA 3MF4A 3LKVA 4RV5A 1MIHA 4Y9TA 5KQMA 4RKRA 2VUIB 4JAVC 4JP1A 3ILHA 3JVIA 4XXHA 2XDYA 1QP0A 2M98A 2FQWA 2FN9A 3FMVA 1W25A 4E7PA 3O75A 2RGYA 4RY8A 1U2QA 4MQFB 5F64A 1RXEA 2VK2A 3KKEA 5JNRA 2R47A 1E6KA 3GL9A 2X7XA 2JVKA 2JK1A 1A2OA 3C3MA 2FXIA 2P4UA 4IMJB 5HQJA 3R0JA 4LE0A 4WWHA 5FWXA 3SY8A 4TLLB 4ZJPA 4NCAA 4DQDA 1VPWA 1GCAA 2HJ9A 1JLKA 3F6CA 2FMHA 1LK0A 1SXIA 3HEBA 1NXXA 3EQ2A 5DKFA 2V0NA 4Q7EA 1VLZA 4YWHA 2FEPA 4IGAA 1GUBA 4KK4A 2MYUA 1DZ3A 3BRSA 3JPWA 2QV0A 3N0WA 1QP7A 1ZHHA 4PE5B 2QU7A 1DC8A 2IPAB 3I09A 3IPCA 3KCNA 3GWGA 2LP4Y 1Z18A 1KMIY 1XHFA 3H75A 1C4WA 2N9UA 1YMUA 2HPHA 1YTUA 2WWVD 3UKJA 4KVFA 1USGA 4NICA 3H5LA 5IUJC 3KHTA 1P6QA 3W9SA 4N41A 3OMXA 1VKRA 3E61A 5PNTA 4G0OA 2I6FA 3HZHA 4ML3A 3T6KA 4QYMA 2BGGA 3IP6A 1ZH2A 3RVJA 2B4AA 4JA2A 2L17A 2LBPA 3LUAA 2F8TA 5HSGA 1FQWA 3LUCA 3N75A 3OO0A 1IIBA 1U8TA 3HCWA 3HM9A 3OO1A 5JNVA 1NATA 2MYNA 3HV2A 1Z13A 4W5QA 4YR7A 1D5WA 1NTRA 1LJLA 4N03A 1TJYA 1JBEA 1F51E 5CNIA 2YHBA 4E7OA 3OQMA 5C5EA 1XWWA 4XLTA 2GKGA 3LTEA 2L19A 1DG9A 1JF8A 3QLUC 5EWMA 4EGSA 1NXTA 4PEVA 2R4QA 5TPZA 4MRMB 3FFWA 5TQ0A 2QZJA 1JH9A 2NZVG 3K4HA 2WJAA 3QLTA 4ETIA 2WMYA 3CG0A 2E4ZA 3SNKA 4L4UA 3CZCA 4N47A 2QSJA 3F6PA 2R48A 3EAFA 4EUKA 4F11A 4EYOA 4CBVA 5BRAA 2FMKA 4NV3A 4TMYA 3L6UA 2AYZA 5FBKA 4HYEA 1OXKB 1TLFA 4MS3A 2DRIA 4EYKA 5IUKC 3D02A 1LBIA 4KK3A 4NCBA 3UUGA 2Q5CA 4MR8A 1TMYA 1GUDA 2RJOA 2ZAYA 4KQCA 3S99A 3TMYA 1M5UA 1QO0A 4MR7A 4DN6A 2FLWA 3OLWA 2FN8A 3N0RA 3T38A 4XARA 3OMWA 2QVGA 4G0YA 4RSMA 5TQ2B 4JB0A 3TO5A 1XHEA 2WJWA 3QLVA 1ZESA 3KG2A 4F12A 2O20A 1RXIA 4MAAA 3QLUA 3OQNA 1J56A 4RK5A 1JYEA 5TPZD 4LE1A 3H1GA 4F06A 4P98A 4G0XA 3I45A 3MM4A 2IYNA 4Q6BA 2FEWB 3QX8A 5CHYA 2VUHB 4HNQA 3NBMA 3O1IC 5FWXB 2OENG 3SG0A 1AB6A 3HS3A 1TVMA 5BR1A 1Y1LA 2J48A 4WZZA 4JB2A 4ZMSA 2WB4A 4MS1A 1D1PA 3LUHA 1EHCA 2TMYA 3JVDA 4JASB 4RK1A 3F73A 1FSPA 2PUCA 2A9QA 3O21A 4D6YA 2PE5A 3MIZA 3QEMB 4YGXB 3C3KA 2FEKA 2MYPA 3OLZA 2LIVA 1RNLA 3SAJA 5GOTA 4O5AA 1NXOA 2IKSA 3LUGA 1YS6A 4MGEA 3QLVC 2JVIA 3H6GA 2PUAA 1ZGZA 2L18A 5DLEA 2R25B 1U04A 3HDGA 3OLVA 1P8AA 3GBVA 4KQ9A 5CNJA 5KI6A 4FE7A 3T95A 2QVCA 4RY9A 4EVRA 3H1EA 5D2CA 5IX8A 3TX6A 4MR9B 1JL3A 5FBHA 1E6MA 4PICA 5TPWA 3RVKA 3QEMA 2GBPA 4PYRA 2CWDA 1W9HA 3BRQA 4G0MA 4GNRA 4W5RA 1CHNA 1LBHA 3CNBA 1DBWA 3H5IA 3H5TA 5IC5A 5FWYA 3CKMA 5CNMA 8ABPA 4Z0NA 3N53A 3FFTA 2JCGA 2A9OA 4KRFA 3N8IA 3M9WA 4UHJA 1EFAA 3A10A 4LX8A 3CZ5A 4XASA 2IPLA 4Z9BA 3FGZA 4RXTA 3QK7A 5EWLB 3H5WA 1MAVA 1H9CA 3HO1A 2JBAA 5JNTA 1ABFA 3O1JC 4KFCA 3NNSA 4QYWA 5I4CA 4PZ0A 5IUNC 2RJNA 4ZMRA 1S8NA 2E4UA 1K68A 1JDPA 3RVSA 4MLCA 3O2JA 4OLAA 4KPYA 1Z2EA 3VNAA 4RK7A 5BRJA 3GA5A 5JNWA 5IEBA 2GI4A 3RVQA 1QKKA 1NXSA 2PJUA 5EWMB 3DGEC 4YV7A 3LKBA 2PMCA 3CFYA 3H5VA 3RVPA 4RWEA 2MSLA 1USIA 3RVRA 4RK6A 5JS2A 1SD5A 4LE2A 1BDIA 4H60A 4RS3A 4G86A 1SXHA 3N6VA 3HUUA 1ZGGA 2OQRA 3P9YA 4YP9A 1NXWA 3HSYA 1DCMA 1KGSA 4IILA 1EWVA 2KYRA 4IRXA 3RVNA 3HXMA 1QP4A 3GYBA 4ETMA 3DGFC 1NXVA 3ROFA 4EVQA 1MB3A 1JFVA 2FQXA 4KNYA 1QPZA 4OLBA 1QQAA 4M88A 3CTPA 3SQNA 4MYRA 3MA0A 4N0PA 4YS6A 3JY6A 3GT7A 4TN5A 2QXYA 4QICA 3Q7SA 5EWJB 5DTEA 4YO7A 3F7NA 5IULC 3VNBA 3OM1A 6CHYA 2CD7A 1YMVA 2PL1A 3EQZA 3BREA 4L85A 3T8YA 3KSMA 3MMNA 4MS1B 2PLNA 4O1HA 1K66A 3TB6A 1C0EA 3RVLA 1DP4A 2IOYA 4KMRA 1SXGA 3H6HA 5JS1A 2RDMA 3KJXA 3KLNA 4RXUA 2IPMA 1DBQA 2FQYA 4QPJC 1D1QA 4XFKA 2CHFA 4MR7B 1YIOA 2CHEA 3EULA 3URMA 2MSWA 4OG2A 2NZUG 3H1FA 3QEKA 3I5AA 1Z12A 4ZPJA 5GQSA 1U0SY 3FFXA 1BAPA 5T3YA 3LUKA 3KTOA 4LZLA 4N0QA 4MQFA 2L2QA 2P9HA 4Z4HA 1HEYA 1BVHA 3GBPA 3NHZA 2H0AA 3C6QA 4MLDA 2F8SA 3C3WA 5TE9A 4GPAA 1FFGA 5CNKA 2ID7A 2FKAA 3IP7A 3D8UA 2IPNA 3KS9A 3EDCA 1EAYA 1ZVVA 1QQBA 2FLKA 2FW0A 4D6XA 1ZITA 2PKXA 3HUTA 1PNRA 1ZDMA 4IMIB 3A0RB 4ETNA 4Z4EA 1USKA 1WETA 1ISRA 2AYXA 3IP5A 5TQ2A 3CRNA 3IP9A 5DGCA 3HJFA 3RH0A 7ABPA 2ZWMA 1M2EA 3ILYA 3DZDA 1DRKA 1D4ZA 4MS3B 4RK4A 1BDJA 4H3HB 4WT7A 3LMKA 4RKQA 1RPJA 4YRZA 4W5OA 1M5TA 4OBBA 2A9PA 2PUBA 2HQBA 3LUDA 3GRCA 4F3TA 4RDCA 1T34A 4MQEA 5EWLA 4Z4CA 3NHMA 1DBPA 1PUXA 2PUEA 1EWTA 4G0QA 1B00A 2JBAB 1PEAA 1Z2DA 2NUBA 4KV7A 1AB5A 3HVRA 1GLGA 5ABPA 4KREA 3BILA 2VYCA 1P2FA 3KLOA 3O74A 3SM9A 1ZAYA 3QELA 2W42A 4RY0A 3LFTA 5HM6A 1P6UA 1QMPA 4FE4A 5FWYB 5E3JA 5KWSA 1QO0D 1LJUA 2PL9A 3EJWA 6ABPA 2M1ZA 4MRMA 5TQ0B 3HK2A 1CYEA 4RXMA 3CS3A 1R8JA 5B3JC 5TQJA 1ZN2A 2YHAA 1Z26A 2LUOA 1JX6A 5KC9A 3L49A 1Z25A 2MYTA 4OTZA 4Z4FA 1DCKA 3C97A 1BA2A 2MSKA 3MQ4A 4EYGA 4G0ZA 4YCSA 2PUFA 3Q7TA 1E2BA
chains in the Genus database with same CATH superfamily
3T35A 3ZZNA 5IEJA 3EVNA 4EUNA 3J7AC 3S2IA 3PT9A 4YJ2A 3SQDA 3BXZA 2Z5GA 4DMCA 1E98A 4P4UA 2DY1A 4KBYA 4EEZA 1CULC 5E6RB 2H5IA 1OKKD 3OUUA 2PKEA 2JIOA 1A2BA 3CBGA 1EUCB 1T5SA 2GHIA 1T2NA 4UM9B 1WLYA 4AQ7A 2HD4A 2OAQ1 3LY7A 1ZIXA 2A33A 3IPAA 3K35A 1KY5A 1N5IA 1YBHA 4JJGA 3DA8A 3TRFA 1K3TA 4JR2A 2IXEA 5GJCA 3AVVA 1PNVA 4UNPA 4W6ZA 3W77A 4EB0A 3VC3A 2PSDA 4DLRA 4OSEA 4DC9A 4XGKA 2WSSA 4K6CA 3CURA 1YVDA 2ETXA 4XCQA 2NZYA 2YL2A 2I3BA 5DYWA 2IZ1A 4C0HA 2QU8A 1DX6A 4EDFA 1P4HA 4ZK2A 1N2JA 1T6XA 1V2HE 1YRHA 2B1RA 5TSDA 4E1VA 3OZEA 4G37A 3NALA 2HQOA 1G8YA 3I01M 1DOAA 1DRJA 1E1QA 4O4JF 4ABTA 1LBEA 3QVXA 1HSZA 2EFGA 3IAS6 4KRGA 4NU5A 2BEJA 4I5IA 4YASA 2B4QA 3NONA 4IKPA 1G6KA 3FPKA 3UFBA 5KSOA 3R9WA 3TQOA 4EI7A 1YCHA 4QDZA 3UAGA 2YW2A 4J91A 4EWLA 1IM5A 4N3GA 2G9UA 1O95A 4HN4B 4Q9JA 4YR9A 5K05A 3HY4A 1E9VA 3EC2A 2QSYA 2QL6A 1XZQA 2O14A 2JGEA 2X86A 3E53A 3L0ZA 1XNHA 3G2LA 1PFQA 2H16A 1K6EA 5BNWA 1NE7A 3OQ6A 2PGLA 4GR4A 2WJ3A 2GPBA 3E05A 4XUEA 3V3TA 5F7ZA 4A27A 4GE0A 5HKOA 2JFZA 3MC1A 3UEOA 3E9RA 1NI4B 3SMQA 1BH6A 3DJFA 4BIMA 2QW0X 5JD3A 4TKMA 1N2CA 4F21A 3HU5A 1V6CA 3W3ZB 1OC4A 1RZRD 3TTTA 1FIUA 4OI4A 2JCBA 1OGYA 4NH0A 2X9QA 5K4GA 4Z51A 1QNLA 1DWPA 3PC6A 3U19A 4UTXA 4QGGA 4JOCA 1EKXA 2RKBA 4TWJA 4W1PA 4MOWA 2OBFA 2W6QA 3KUKA 1MPTA 1P60A 1E7YA 1RQNA 3L6EA 4N6NA 1Z28A 1P4GA 4QPPA 2DB3A 1YQTA 3UK6A 1KPHA 3ETHA 1RPNA 1UZNA 1SRRA 3MYYA 4QYIB 2IHTA 5C1OA 3VKHA 1BCRA 4Y67A 4DCOA 1EK2A 1ODCA 3JALA 4GLFA 1J25A 5F2OA 1JSLA 3H0CA 5CDTA 3ZDYB 1IZZA 1VCHA 4AF7A 3LBYA 3B1XA 5E9WA 4AJJA 4CDMA 1IULA 1ZVKA 3HI4A 1YJCA 1OASA 3G2IA 4IWXA 1UKBA 3FZQA 4CHTA 4FNGA 3X43A 5E7QA 3INYA 3SGLA 3AUXA 4KITB 1W6UA 2DG2A 1FS4A 1FBNA 3AVQA 3HB9A 4J1SA 4L8WB 4MMYB 4N7RA 4XYEA 4JOQA 1GCUA 1X1DA 1ZM9A 1JXMA 3LKVA 1RKUA 4BKQA 5B3LA 4BN0A 2ZYIA 2O1EA 2ZAIA 2CLDX 5J1TB 4B6OA 1ZNZA 2NYRA 1G5RA 5IF3A 1CEQA 3L5KA 4HXYA 5DYYA 1DIGA 2OWEA 1FK8A 1H6CA 2B78A 1TQ6A 2H0QA 5I7FA 4KDEA 4Y3UA 1SXJD 4CWAA 2P67A 1SU8A 1UFKA 1KIMA 3AT1A 1V2GA 4DJDC 2I03A 2PGXA 2C57A 3GCGA 3NOVA 4KAXA 1JPUA 2FPIB 4JLJA 1B0UA 4WWHA 3QUBA 4WK6A 4DQDA 5LQUA 2CE7A 1ZU5A 3KPUA 5IDVA 4F8YA 1NI4A 5AKHA 2DLCX 2C9CA 1IEWA 1XD9A 3OAAD 2J9XB 3HEBA 2HA0A 1B93A 3EZNA 1HYEA 4KIFA 4BE7B 5AVTA 1T2FA 4I1PA 1J2TA 1ONBA 2DOKA 4FBMA 1DZ3A 2BTQA 2R62A 4D0RA 3IDAA 1ENZA 4PE5B 2HXSA 4OMCA 2ATIA 4UU1A 3RV4A 4M1OA 5CDFA 3GUHA 1U0RA 3WQRA 3GVIA 3UQZA 2AJ8A 1QYIA 2JFUA 1XWIA 3THWB 1AHNA 4MUKA 5DN6A 3TQRA 2ZB8A 1C4WA 1BJKA 1PD1A 2DPHA 3LX6A 3AKDA 5BYKA 2XT6A 1BVYF 3B5JA 3S68A 2C9YA 1LNQA 2D1FA 2NO4A 1G1AA 4RCYA 3EPJA 2JLWA 2ZROA 1T9ZA 1Q7TA 4KQXA 3MNFA 1N2GA 3PE6A 3U4CA 3RUEA 5HRUA 2WJJA 2QAGC 1BCRB 2WUFA 4KRXA 4MW2A 5L7YA 5KX5F 1RQ7A 1KI8A 2BMWA 2AA3A 2LRHA 2NTNA 2ORVA 1VKHA 2VJNA 2Q9AA 5KOJA 4HPJB 1PJAA 1A8QA 1E2HA 1VL5A 1ZH2A 3BWEA 3IP6A 2R87A 4TQAA 1DJPA 2WQ6A 2ZUCA 1X7DA 3OSUA 3VC1A 1Z82A 1RI3A 2C5FA 2JGNA 1FQWA 1DDGA 4FDTA 1GP2A 5C4MA 1U8TA 3VOAA 3GEHA 3IMKA 4RVNA 1RYDA 5HILA 3HM9A 1AKEA 2OWDA 1E8DA 2I91A 1QIHA 4MP8A 1UBKS 4KLZA 4TXHA 4E08A 2CF5A 3GD7A 1V6SA 1ZC4A 2XQKA 2AOXA 4U2GA 4QBGB 1CEEA 1Q12A 1TA9A 5JSHA 3I01A 1F51E 1MX9A 2MJLA 3IP1A 3TG8A 1F8GA 1J0BA 3O1LA 1L4EA 4UTZA 4FX5A 4R3WA 4MTCA 3SQLA 4M6WA 3BHNA 3GHHA 2B1QA 2TS1A 2XRZA 2VWPA 4Q1EA 2C4WA 4K1XA 5EJEA 3DOCA 4Q3DA 3VJRA 1DMRA 4H7FA 3PR3A 4DDMA 4H7IA 4IGEA 4UUOA 3D7LA 4NPCA 3AB7A 3HA3A 2OZEA 3ZIDA 4D44A 4HDMB 3IV7A 5A4JA 3TKYA 4XWYA 4TL7A 1KY3A 5I9NA 5KO2A 1V95A 4J0QA 2OLKA 2QIPA 3PEEA 2FPKA 4JI1B 4D1YA 4RQUA 1XJ0A 2II6A 4M76B 1AO0A 2ZRJA 4AZ0A 2CXHA 4W99A 2J3HA 3BB4A 1N25A 3PEWA 3VZQA 4YMIA 1WCIB 2FUKA 2AQKA 4NCBA 5LXTF 5KYYA 2FPIA 2IZOA 3LT2A 3RFTA 2HW8A 4MCIA 4KQCA 1LLFA 4HL6A 4LRXA 1Z8NA 3P71T 3VR5D 3O47A 1P9OA 1QYXA 1M5UA 3JZMA 4II7A 2QMQA 3EXEB 2G0TA 4Q4HB 2Q5OA 3R40A 1G8HA 3N0RA 1HF3A 3FCEA 3H99A 3R5KA 1V8OA 2QVGA 4F6RA 1E2FA 1G4HA 4JB0A 3TZHA 1BMDA 4KR0A 4U7PB 3ENKA 4XM1A 5JH7F 1JUDA 2E0IA 2P9CA 1LF5A 3D8HA 3HCOA 2D4AA 4K8OA 4CDGA 2F48A 4PZYA 4QFDA 3R7WB 5KOIA 3S5UA 1CU1A 2JARA 1HDIA 4PQEA 5FHQA 1E4YA 1QV7A 2ZJYA 1JU3A 3RT7A 3WLQA 3CB4A 1QFSA 3LLUA 3ESDA 4FBGA 5IJWA 4LQCA 2BW0A 3A9SA 4MSUA 4DAOA 4OX9Y 1KETA 4J07A 4CLOB 2I33A 3SJUA 2YY6A 3OPVA 2CEKA 4PANA 4BQQA 4UCXA 1P5FA 2FEWB 4O33A 4WJLA 3AH8A 1KKLA 2WWTA 4GP7A 4WRRA 1SVKA 2L82A 4ZYZA 3AIKA 1ACMA 3HB4X 3ASZA 5DWQA 3F6SA 4GOKA 4JUFA 3UTDA 2R6GA 4XCVA 2JBHA 2QGZA 2WB4A 3GFSA 2W71A 4EKIA 1GNQA 2LR0A 4FEEA 1N5MA 3SZMA 3OX1A 4RK1A 5DI3A 5FFFA 1XQWA 2E5WA 3DAOA 3NDRA 1F14A 2QG4A 3S5JA 2JG3A 2I1LA 2MYPA 1DLJA 2P2YA 4RF5A 1RNLA 3Q9LA 3R8FA 4YIHA 2AG6A 1N5DA 1L7PA 5IT0A 2XWJI 4GOLD 5JFTA 5AVOA 1D6JA 2D59A 4AUNA 3MD9A 5IXJA 2AB0A 4IJ6A 2JVIA 5IVKA 4GH5A 1YZ3A 1PJZA 4G25A 2XWQA 5U4XA 3FNRA 4YCCA 3RAEC 4LJRA 2ZRKA 3PFBA 2G76A 3NKLA 1CEXA 1XF9A 3GGPA 3KVVA 3KQNA 2RG1A 1UOPA 5BOSA 1EM6A 3FY4A 3KOWA 2D2XA 1GHTA 4D57A 1B8PA 2WJGA 3ORFA 3OJCA 3DO5A 5IAKA 1N32B 2AEFA 1S02A 4LOHA 4B84A 1Q77A 4MV4A 1BMTA 4BASA 4JVSB 4LJLA 2R6R1 2YV5A 1AMNA 4GYYA 4DLZA 3BXPA 3R6WA 1XPRA 1WF3A 5CCDA 2DFLA 1B4DA 2Q8PA 4IUCS 1ZKMA 2FZ5A 2XCLA 2HMYB 1I36A 3BK2A 3CNBA 1JFFA 3ZDQA 1ZK0A 2XVXA 5KNCA 3WK6A 5IT5A 2OR3A 3RUIA 1RC1A 1VFPA 1FFXA 3G8DA 1QB7A 3I34X 4BZPA 3HJNA 3NTUA 4M0MA 8ABPA 1TZBA 1W48A 4WOJA 4EG4A 1ESCA 4FS8A 4GLOA 4Q3LA 1WUHS 1Q0HA 4EBFA 3RK1A 3ZKWA 4OHFA 3C5EA 4CG0A 3SQOA 2MDTA 3KVRA 4OI1A 2HU8A 2CCGA 1ZZGA 3D6TB 2B20A 3BDVA 2AF4C 1LPAB 3OOHA 4QYWA 2C88A 1ZGCA 1PWHA 4PZ0A 1QTIA 3FPBA 1ZGHA 4LZZA 4QULA 5LP6C 4CGYA 4ZCRA 4AP6A 3IEKA 4YPOA 4CQNA 1SUBA 5C7LO 3U1BA 2BEVB 3LDAA 4QVKA 3W5HA 4CUKA 2G1PA 3C7TA 2JHPA 3QVGA 2VQ3A 4YFYA 4LF5B 1UKZA 2WWXA 1BA3A 4TT8A 1CETA 1QRAA 3E58A 4AY2A 1XT6A 1RWMA 2QSZA 2X76A 2E2WA 2HYIC 3PA8A 5CFOA 1ZM4A 5C1IA 2WU0A 3SHTA 1JEYB 4OLFA 3G0CA 3WVNA 5IKEA 2V7UA 3PJEA 3ZJ5A 1TF2A 2JGJA 3MQFA 3NIGB 4O08A 1H65A 2IA5A 4ZOLF 2EHDA 4NZZA 4PIPA 4OQDA 3L1VA 2XMSA 1XVVA 1GVHA 2J45A 1UMBB 4L5IA 1E1RA 2Q5FA 5EG5A 2W8BA 3WLFA 3UA3A 2PRZA 3WNCA 3N2YA 3HUFA 4G9BA 3KM0A 5DNYB 3NRCA 1N5JA 1ILWA 5K5EA 1Q1AA 4X00A 4X91A 3CE9A 3X1XA 3VTKA 4EG5A 4W5HA 4HUTA 2QP4A 5FBLB 3Q6IA 4Q4CA 3PEUA 4PNPA 4L15A 4M0LA 2ZJ0A 5TS2A 3OCZA 5DW0A 3S8EA 1JW9B 2Z2JA 4EA9A 1CQJA 1B8VA 1T4MA 3MS4A 2CD7A 2QNRA 3JYOA 2I2DA 2COKA 2Y93A 5ITSA 5AW4A 2QT1A 3GGSA 2I2CA 2Q4BA 1P61B 4MS1B 4GICA 4MI3A 1G20B 1R8SA 2F3PA 3HDYA 3FZEA 3FNHA 3D2CA 5JZBA 2JGRA 3DE4X 4BMDA 3FLBA 4HTFB 1U0FA 5E0KB 3PGLA 1B23P 4V38A 5EXEA 5DISB 2CHEA 3KQYA 3KT8A 4YXFA 2OO7A 5KS2A 1QYWA 3DHEA 5I5GA 1PFUA 4OA5A 1EGVB 1L5HB 1MVNA 2ZUDA 4JSTA 1JG4A 1U0SY 1X8KA 3AXSA 2JKZA 4DRXA 3A04A 1AO3A 2XITA 2VO1A 4PO1A 3L0BA 4V0NA 2QTLA 2EBFX 4DUGD 5JSZA 2VHZA 3PUYA 1C1YA 1MLDA 4IX1A 1U8ZA 3KTOA 4LVCA 4N40A 1FFHA 1A8IA 3BGDA 4Z4HA 4Q19A 1PNOA 2WJ6A 3F96A 3CJRA 3FLAA 1V6AA 3ZEAA 4MHSA 4E12A 1AKMA 3R5TA 5HF9A 3AOEC 3BQNB 2IPNA 3KS9A 4QSHA 4M7PA 3BD7A 5HEKA 3BC1A 1BYIA 4LJKA 4URUR 2BDUA 1V41E 2QZPA 4KDRA 4LZPA 4YY3B 2PTGA 3JWEA 3OURA 1OOEA 3CH7A 4WW0A 1AHIA 2AYXA 3MWLA 3KQVA 2FWBA 2WIAA 3ETEA 2WQZA 2PZKA 3O84A 3QBDA 4NAHA 1HO3A 1ZK3A 1FYFA 2VAVA 5CH5A 3SJBA 2UYHA 2RI0A 3RFUA 3BH6A 4NI5A 3AHEA 3LMKA 5EAIA 3DE3X 3OVMA 1XF1A 3C5VA 2CLHB 2X2OA 3LQKA 1QZXA 3TZBA 5DBOA 5K8LA 1JVNA 4MRNA 2D2EA 3OIVA 3EIOA 3GT3A 2EEPA 3V1TC 4ZIRA 4RDCA 2JGFA 4RMIA 3MYRA 2QZ9A 1R9JA 2WD7B 4YXWD 3BAZA 4KTTE 3E81A 3BTSA 3S2UA 3SE0A 2Z56A 2R8PA 4LHXA 2B0JA 4EHFA 2ZSJA 4GOND 1OFUA 4BS9A 1D4AA 3G7NA 1KC1A 3H04A 1ESNA 3R41A 4EELA 4RVSA 5KINB 1W75A 4YCNA 2ORWA 2VYCA 5AJHA 3VHQA 5I4IA 2XXAB 2DFNA 1OYWA 1OGJA 1NRWA 1V8PA 3OOWA 1Y1TA 1H6AA 2Q2WA 3EVCA 5E3JA 2Q1UA 5KYWA 4JJKA 5HCIA 5HFAA 1R50A 4OD0A 4P4SA 2H7CA 4MQ6A 1HZZA 2FPGA 2ZIAA 3M89A 1FSSA 1XU9A 1DFHA 4R81A 1QAOA 3LPCA 3TDNA 4ENPA 4QJ3A 1O87A 5IVDA 3RI3A 4A0HA 1ZN8A 4YUXA 3UT5B 4EG1A 4I4TA 3PK0A 3EAGA 4DF3A 3N2NA 2P2NA 2WZDA 5EZ5A 2O8EB 3E18A 4QA9A 1BA2A 4YMHA 1GXSA 3IQDB 3QMVA 4YCSA 1U2SA 4OFXA 4Q48A 5EIBC 4I3HA 1G20A 4G4SP 1OZFA 2DHRA 3O8BA 2EZ9A 5EC8A 4NIMA 3O8QA 3PBKA 2CVZA 3HBMA 4K9NA 1ZVMA 1ZH0A 1CY6A 3U61B 4DV7B 2AGVA 3W5AA 4QDOA 2BN4A 4RE5A 5AHWA 4GE3A 5CM9C 2A9RA 4ZT6A 3F1KA 3T1OA 4DIOA 3ZCVA 1TT5B 5IHXA 3PFIA 5D51S 4L5BA 1BU8A 4MUFA 3QYAA 1FVFA 2QW1A 1UOOA 3QX9A 4A0SA 4WTOA 1LDBA 4NBTA 4Z8YA 1ORWA 5LM3A 2OQVA 2NG1A 3DMTA 3PUIA 1Y5MA 1JNXX 2XUFA 1T5OA 1QG2A 2P6NA 1IBCA 5K3BA 3O8DA 3WK7A 2H11A 1C9EA 221PA 4C4TA 2VSOA 3TLMA 4EW2A 1U65A 1OT5A 2C3OA 2JFFA 4QUHA 4OI2A 1MP0A 3O4VA 4YRRA 1RLJA 4P4NA 5HDQA 4WY2A 3LGAA 2ZCJA 4PLHA 2Q3JA 1RJ9B 1Q17A 5LSAA 2B69A 4HV4A 1FDRA 2P5SA 3DH0A 1RW4A 2X0DA 1XOIA 2PA0A 3TLKA 3CLKA 4F56A 3DZIA 5FO0A 3VAAA 2HGZA 4JXKA 2VHXA 3AL3A 4MUYA 3Q15C 4U00A 3CBQA 5DHTA 4X20A 2OM2A 3K53A 3NJ8A 5CDHA 4DGQA 1ULUA 5AXCA 4DV2B 1YDFA 2D8MA 4PRLA 1B6GA 1NJGA 1TQ2A 1Z33A 3K5PA 1RWBA 3AHFA 4YJHB 3JQAA 1EXDA 2XB2A 3HCEA 3R6TA 5TPWB 1OD6A 3LUPA 4DCMA 4YT2A 2GZMA 3RSSA 5T8KA 2IGTA 3KE9A 3TD9A 2H2AA 2Q1TA 3PF8A 1HT3A 1T0IA 4Q3KA 4MS4A 1FRZA 2IY8A 1AXEA 1X7WB 3KBOA 4C6TA 1JLLB 3HJCA 3HDJA 3RYFB 3FDFA 4MI1A 2HR1A 3IT3A 2FWMX 3IDZA 4CT5A 1KYXA 2IOQA 1GUYA 2G25A 2OHVA 2V4UA 3FWHA 3L0DA 1XQYA 3BWBA 4I4LA 4RA9A 3VV2A 2C8KA 3D1JA 4IP0A 5DP1A 4HWGA 5A05A 4ZTBA 4BNTA 3H2JA 2HPZA 3IPXA 3PDIA 4OHBA 2Y1FA 3Q0TA 1N4AA 2PUDA 2AQ8A 1F06A 4JC0A 5ILQA 4YP5A 4OKNA 2VPTA 1JG2A 4OXRA 4K6KA 3L7YA 1SWWA 3T7IA 1JDBB 1YZNA 4Q9HA 3SS9X 4BWYA 4TZ0A 4YPVA 4ZGGA 5EZSA 5AVZA 1ICEA 2BWJA 2Y05A 3CLHA 4B4OA 2P62A 3B2NA 1I4WA 2PUVA 5EJFA 1INLA 5EIWA 4DLBA 1RACA 1SHLA 1SCJA 3L7CA 3GLFB 2JRLA 3D8NA 1COZA 4GU5A 4QBKA 2PZAA 3IDOA 1W8DA 3AR7A 4M3NA 4L8GA 1DKQA 2QR3A 3C43A 3QX7A 3OJEA 1NUUA 2Q1WA 4D9EA 1IU9A 2V6JA 1FP1D 2ZG6A 3FMPB 2C77A 2DSTA 1CNFA 5ECWA 1Z8HA 1UBOS 2GX6A 3A2NA 1EFAA 4RFVA 3ZHUA 2FDCA 4OUKX 1QVAA 1P7PA 1J00A 2Q0SA 5SY9A 4DIEA 3QVSA 4U8GA 3L4SO 5JRZA 2Q5HA 5L3RA 3I04A 3OFJA 3UW1A 5EESA 2RC6A 1A96A 2ZS7A 2GOYA 3I8SA 3FE2A 2NYVA 1NBHA 1CFJA 3DULA 2G6BA 3AHHA 4KXLA 3A3PA 4UEWA 2A0WA 2NO6A 3WL5A 1JTVA 4B5KA 3SYMA 5JADA 4ENRA 4Z53A 1N3LA 2VK2A 3IT1A 3WLHA 3KEQA 2R47A 4B81A 2CDCA 4V0ME 4E5SA 3R4VA 1Q83A 1YASA 3IQXA 1XVIA 1A2OA 2FXIA 4BB0A 4KN8A 1LI4A 4ECEA 2O6HA 1S8OA 5ETJA 2AFVA 4QDTA 5FWXA 4KLAA 3ROQA 4E15A 2J9FB 4B83A 1TCUA 2O5CA 1T4DA 1PVVA 2IYLD 4US0R 3QVOA 3KUUA 4KUGA 1YHYA 7MHTA 1EP2B 3KEGA 2ZWAA 3OOJA 2Y6VA 4M9SA 4TSFD 1UQRA 2BTQB 1U6IA 3BRSA 4AY4A 3ROKA 3LQ2A 2IPAB 3I09A 3AKEA 1UR5A 5HJEA 2QD2A 4JN6B 4F9EA 3V97A 4AS1A 2YN0A 3GX1A 4LHZA 4DT1B 4I5FA 1UWKA 5DTIA 3BXEA 1J24A 1MG5A 3INTA 4Y18A 2PS0A 3H5LA 1K7EB 1FDIA 2WIGA 3QU9A 2HT1A 1E4VA 3I73A 5BSKA 3CVVA 3EDRA 3G2PA 1KOLA 1WPXA 5JG7A 5LP6F 1V16A 3W9SA 4X0EA 3EE6A 5DNVA 1KFCB 3EEFA 3PYXA 1JR3E 4MEAA 5DH9A 1AGXA 3WK5A 3AGQA 5A4FS 1G8SA 1WS6A 2YCLA 2H1VA 4DHEA 1AZWA 1MDFA 1N3YA 1T4CB 2XNCA 3EF1A 4HAZA 2B3TA 2B82A 4J3JA 3LUCA 3RKRA 2GILA 3OO0A 5HSGA 1E92A 2AV6A 4H16A 1BJRE 1E2IA 1T6ZA 3NGMA 3WYEA 2MR6A 1SKQA 2X22A 3ZGOA 1R8XA 3AR4A 1D5WA 1NTRA 4WADA 2ZRMA 1LK7A 3MCUA 3WIDA 1L4NA 2JHGA 4XWOA 5CNIA 4IJVA 3USZA 4DG9A 4ALMA 2VYND 5C5EA 2Z3VA 3CYFA 3TTWA 4QATA 5HZGA 3DTNA 4R2JA 1QFMA 4AJ2A 1OREA 4YQEA 5CAEB 1BWRA 3ZH2A 4PR0A 2VJMA 4DV6B 1XV5A 1Z47A 3IPRA 2F1JA 1RHRA 3A28A 2B2NA 5LBTA 2ID4A 3ADDA 1RYYA 2NZJA 3IVCA 3JQFC 1U8FO 2PO5A 1NHWA 5JVDF 5FBRB 2O52A 5K9ZA 4LJ7A 3BF8A 3FM9A 4ZXFA 1EGHA 2C58A 4FMDF 5IAEA 1NRXA 3BXHA 3FI0A 3F8SA 3HHPA 3PNPA 3HGTA 4I55F 4D9HA 4EB6A 5C5DA 1Z7GA 4UAVA 4MX8A 4E5VA 4CFSA 1C0LA 4B6QA 1OF1A 1ATIA 3MBOA 3A6PC 4Y6OA 1M6YA 3IRUA 2QPLA 3FYSA 1G21E 2PJDA 1E62A 3SCZA 4DIDA 2IYFA 2V7QD 1X92A 2HJWA 2UDPA 1MGPA 2VJYA 3BZBA 2J9FA 3P9IA 3FOEC 3PRJA 2VRWA 1ZMXA 3KKNA 1Q1BA 5F9MA 2O4CA 4D96A 1E1YA 3E7PA 3EAQA 4RSMA 3MFYA 5ERXA 2GR9A 3D7MA 5EOVA 3ZTWA 1KEPA 1RM4A 4I8XA 4KWIA 2WJWA 5AOCA 4QUBA 4D9CA 1WZIA 1ZH6A 1PFKA 2RBGA 4YRFA 1BJTA 4JGBA 2GN6A 5C8DA 2RKWA 4DB4A 2P75A 4K9SA 5L4SA 1XE3A 4KAFA 2VWGA 4O2BB 3OZBA 3TI7A 2VRBA 2VHWA 1BGVA 3AUSA 3LP8A 4I81A 4WBNA 3KQWA 2FFRA 1UBRS 2W4MA 2G0AA 3GDFA 1B6TA 3TZQA 2YUIA 3DKKA 3P0HA 3ZNNA 1Y3HA 4AXXA 4PLFA 1H42A 4YT8A 1GWNA 4FFBA 2ZSFA 4V2IA 1Q1ZA 4BCBA 3E9EA 2VNIA 3G9UA 1C7EA 2EX4A 2GYUA 1UPAA 4NNOA 5TR9A 3B82A 4LBZA 4FOTA 4ZZ0A 2VP6A 3ACDA 1A5ZA 2R68A 3M1YA 4D4MA 1JIJA 2Y76A 3CNLA 1ISPA 5F35A 2FEKA 2CVQA 1KNQA 2LIVA 3SAJA 2W6CX 5CAEA 2GCPA 2VJCA 2ZSDA 1QG6A 5EIAA 3VYVA 4DDKA 2AR9A 3QNWA 3ANLA 5C8ZA 5IN4A 1W73A 1W9MA 5H0IA 1YB6A 3N8HA 4NFYA 2XMRA 4PGAA 4HB4A 2TSYB 1S3FA 4IICA 4DSAA 3AHCA 4KI7A 1RQPA 4ESVA 3ZGYA 1UIRA 3W6OA 5CNJA 3GGOA 4D0NA 2PN1A 1IHOA 1I6KA 1IB0A 5B57C 1NQAO 1Q5PA 4Y2JA 1Z4NA 3RFCA 3PL1A 3OC6A 1NLFA 2GPWA 4I1UA 4FN5A 2CSUA 2B4YA 2EGHA 3HB0A 1YMQA 2EFYA 2P5YA 4P3KA 2I1VB 3CVYA 3LOQA 3PXAA 1E1CA 4N48A 1E2JA 3TLYA 2OL4A 2ZRIA 2C1EA 1E69A 1YBMA 3LX4A 1ZM3A 3OWOA 4HATA 4IOJA 3ZHVA 5CEEA 1SIOA 2V74B 1DQSA 4TL9A 4I50A 4D8TA 1J90A 1Y0BA 4RADA 5CIYA 1PG5A 5GM2A 2EFJA 1FFXB 1O6CA 3CKMA 3T4UA 4R2HA 1G3RA 3VVBA 5K8VA 1SUSA 4JSRA 2NYAA 4PYLA 1PIWA 1XSEA 5JT1A 4UUQA 3IESA 1A9OA 5EE1A 5JMPA 2BBWA 2DR3A 2IPLA 1E0JA 1W1IA 1R2QA 2BI4A 3EFBA 3MTEA 2WSBA 3I1FA 4QEDA 2C3UA 4BNYA 5I7SA 5IANA 3OE4A 5ENZA 3WKAA 1ABFA 5LLSA 2AQIA 2MSCB 5CVVA 4C05A 1XN1A 3NM6B 1KZGB 4KXQA 4HLUC 2ZI3A 3LWNA 3F71A 3OD1A 4DCUA 2XDQB 1NW6A 2Q4RA 2P3LA 3RVSA 2G9QA 3ZLUA 4EO4A 3O2JA 1K7SN 3COSA 3QVGB 1DQYA 2WM9B 4KLRA 3BX1A 4RH0A 3GA5A 1TDJA 1C7FA 1R8YA 4KTVE 5KYXB 1XX6A 1NVXQ 5AJXA 2PMCA 4MH0R 3O95A 4RKEA 2WOOA 4LYDA 3RSHA 4RGQA 4C4ZA 5BVHB 1EIWA 3FSJX 1OZAA 3A1VA 3BH0A 4B74A 1T8PA 3U3MA 4IDFA 4EH1A 1ZGGA 1XA3A 2LXNA 2QUJA 3VNRA 1TADA 2V6FA 3C74A 5JANA 3BZUA 2BFPA 4DVGA 2RARA 4GSKA 1N2XA 2JJQA 4INJA 5JYCA 5BW5A 3GJTA 4Q4JA 4JS0A 4BE9A 3KQKA 5FUMA 4MJ7A 4L74A 3NWOA 2Z1DA 2QDXA 4XYMA 1BEUB 4IJWA 1IATA 4IIDA 4ZAFA 1MT3A 7GPBA 3GRAA 1J2EA 3T3GA 2IY9A 4B75A 3JY6A 2C84A 1JG1A 1L7MA 2REQB 3OAAA 4QDKA 2OO5A 3B52X 3J81A 1CQJB 3HCDA 1MABA 3KTDA 4JJ8A 2HMTA 3LBAA 2JDID 3FHCB 2IDJA 3ABOB 2C61A 3CWQA 1L3IA 3MWDA 4LHEA 3OTOB 3FIUA 4BP3A 3EIUA 4OU5A 4B6JA 2CMGA 5AT1A 1N8TA 2CFSA 2OLJA 4C0WA 2R1VB 2VPZA 4KACA 4FYVA 1G1MA 2JJ2A 2EARA 1AQJA 4PHGA 3VVMA 2PT9A 1GGMA 1X7YB 1LBSA 1XCGB 2A0YA 1JIVA 3L8FA 4JR1A 2OP0A 3WDLA 3WLLA 3AESB 1Y81A 3HJTA 2DXIA 4DSNA 4EK9A 3ZCUA 2HJVA 3GCDA 1M6NA 2FMUA 1UCFA 3DHYA 3EDQA 3GFVA 3HCFA 1RM3A 3EN0A 1DG1G 1AQYA 1N5OX 1P33A 1B3RA 1BAPA 1M66A 1VIYA 2FQ1A 3PXUA 4FHFA 4V02A 5EQFA 5AW0A 4YRQA 1WOYA 1EINA 1EB9A 4DCTA 4QTYA 5EJ7A 2W7TA 1EVLA 2FEOA 3GBPA 2I4RA 1TEVA 4R5MA 1KERA 2IPXA 2FWAA 3C3WA 5KYXA 1BRMA 3ZCQA 2IEYA 5KTOA 1O8CA 2G1JA 3KSRA 1NY6A 2NQTA 1KI9A 1VBKA 3V4SA 4CV0A 1U2ZA 2HLHA 4X84A 5DYNA 1RWVA 4TS1A 4CEIA 4BV2A 2P2CA 1M2VA 4GG1A 2HZBA 4IXNA 4M8LA 1TJ5A 1O77A 1SKYB 1HYHA 2O1SA 2DKFA 1TD9A 4YLGA 4E4YA 4MS3B 1JHPA 2XYHA 1RP1A 3L6DA 4D7AA 5BW8A 5JPDA 3ICQB 1RIIA 3DEYX 3R4CA 3RC9A 3U6KA 3ZJTA 3IHLA 1S9DA 1UXOA 4WLEA 3A4TA 4D79A 4IH4A 3WYNA 3OX3A 4Y30A 1MA3A 2PR7A 1JDZA 2HQBA 1V9LA 4C22A 3L8DA 2EVWX 2YQZA 3NG1A 4NL4H 3OX4A 2UUPA 2R6ZA 4RVCA 2OB1A 5U4QA 5CA0B 1B74A 1QVVA 3QPUA 1B00A 4FKMA 4J2TA 1KI6B 4URHA 4GXRA 3SJZA 2WDZA 2EEZA 3BJEA 4OHVA 2Q0HA 2VEDA 3NEPX 5ABPA 5EJ6A 2FA9A 1ETUA 1GA1A 1R12A 4OO3A 3TUIC 2NZXA 3ZY2A 4KREA 1OGIA 4N6OA 5C8YB 1CV2A 1BWPA 5AQEA 1GU0A 1LY1A 3D7NA 5E1DA 1O7JA 1T8SA 4CL0A 5HIKA 5HM6A 1Z63A 2DF8A 3KZCA 3OZVA 1C0KA 3WQBA 3BPSA 3RASA 1L4FA 3A9TA 3EJWA 3I9KA 4JLVA 4L16A 4OFZA 3S2ZA 3WLSA 5DTMA 1BKDR 2A14A 2HXYA 3HA7A 4K86A 3RRBA 1O6ZA 3PX7A 2Q4TA 3L49A 4RL4A 3KK0A 1EHIA 3DTTA 2OO3A 5JC8A 3UICA 5EFOA 1HEIA 2G07A 2VT2A 3U26A 4FUQA 1WTCA 4G0ZA 4ERXA 1MC8A 3Q7TA 4F4UA 1OZHA 2C7BA 1A8HA 1JDJA 2JH9A 3KFLA 3OLYA 4GX1A 3HBAA 4QD3A 1JECA 4Q15A 3VR5H 4RTKA 4TLBA 3OT1B 4XSGA 4ZVRA 5LNK1 4Z3OA 4KI0A 4GUAA 4D42A 4RZIA 3WQHA 3L8CA 3ND7A 5EKSA 3P8ZA 3DT6A 2E4VA 2QLBA 4HWSA 4F46A 4LHYA 2OP1A 3FMIA 1KHHA 2X6TA 1XJCA 4KFTA 1XU4A 3O3OB 4L0QA 4NMHA 5A5GA 3F5FA 1KMHB 3HCRA 5GP1A 3VHLB 2W0MA 1JR6A 3DPUA 5SYMA 1THTA 3AEKB 1NF8A 3ZHCA 5J58A 4MZXA 4XQ0A 3K9QO 1W94A 4TTQA 4MB0A 4MVYA 3SLKA 3WWEA 1N57A 1Z5NA 2J3LA 2A5YB 1J2RA 3NHPA 2QJOA 3PXGA 4MCHA 3D5EA 1P77A 2W8BB 4F8JA 3ZV5A 1CSEE 4E6PA 3CUVA 3LOPA 1GAEO 1UJNA 1JPVA 4NEGA 5TGZA 5AW7A 3T15A 3Q3EA 1O3YA 1KRWA 4TVKA 3TOSA 4JT8A 3I9NA 1H1DA 1RMYA 3CLSD 4DS3A 3V7WA 5FUYA 3CU5A 1ZH8A 4QRIA 2JI4A 1DC6A 1T8TA 1WCV1 3PKIA 3GRUA 5BNTA 5AKYA 4AFNA 3H97A 2EKBA 1GTL1 2OE2A 2QMZA 1V7QA 3UJ7A 1QPBA 3NKFA 1ZUWA 4ZOCA 4OGKA 2W6JA 3E3OA 3FVWA 3IOEA 1FXWF 3PZRA 1NFRA 4M4SA 4BHTA 2GWRA 3KQLA 3ICOA 5A6SA 1SZJG 1V5GA 3C3AA 3ZUPA 2H0RA 2ENWA 4MB6A 2CKDA 1JDVA 1F48A 3K9NA 4OQYA 4QYSA 1ZQ1A 4ALLA 4IEFB 2C2WA 3B2QA 2OQ2A 3TINA 2B9EA 1W2HA 3SFZA 1HYBA 4F9FA 1DJMA 2GZ2A 2XGMA 1BD4A 3CNQS 1BXRA 2WUEA 3GA0A 4N7JA 3WGMA 5ITVA 3PC3A 3ZH9B 4E31A 3LQ4A 4L6CA 3P27A 1L5HA 1T35A 1HRKA 2ZR7A 3BWVA 1D2HA 5BMVF 5FPKA 4P32A 4RK0A 2R60A 2CNWD 3A6LA 1RBQA 5ELMA 4BBAA 5JD5A 1HE4A 1TUBB 3O2QB 2NN3C 3U2QA 3EEQA 2EZ8A 4KVAA 4E32A 5E6UA 3AI7A 2EKLA 1CW2B 4G56A 3VZDA 4CDNA 1JV2B 2E9SA 2RHLA 1Y9JA 1XDUA 4YA6A 5JDCC 1KYQA 1S4QA 1YJ8A 2FSPA 3RPEA 3V3KA 2PUGA 4YI3A 3JTEA 3U6BA 2WT8A 4FXOA 3SZ3A 3WJ1A 3GN1A 5KQPA 3BN3A 2GBLC 4LHSA 4RU1A 2OMEA 1A7AA 2N46A 2PZLA 2P6PA 5KPJA 1Q3HA 4YDQA 2IITA 3G17A 3P7MA 2DFTA 3L1HA 1RAFA 2QUBA 3I1YA 3LF1A 3H0KA 1NIPA 5IF9A 4WZBA 3PUVA 4IIHA 2F3SA 3OWHA 1SULA 1XVLA 4I5EA 3THXB 1G9SA 3A1FA 5ITZA 2IX3A 5FH9A 2R85A 3MTGA 4Z9AA 1MB0A 1LSUA 4ENQA 1JN0A 1SBQA 1KKUA 1XTZA 3VKVA 2JLXA 5JYEA 5SZKB 4ND7A 3HC7A 4BNUA 1E0AA 2AZXA 5B4VA 4JUIA 2QNBA 1MF7A 5AJVB 1R6BX 2GSWA 5JTTA 3MFQA 2Q45A 1ZM7A 2ISCA 2ZRHA 3MOSA 3KIPA 1J9GA 3CF6R 3PC2A 3HXPA 1C80A 2Y1DA 4PG4A 1H0KA 1VRWA 5EEGA 4B1FA 3IL2A 3EJ6A 1R3DA 3OCXA 3VR1A 2REBA 1T9BA 1WU7A 2KW5A 2G17A 3CLUC 3VR4D 3KKEA 3IB3A 1XR3A 2R1ZA 4AJNA 5JNRA 1LD3A 1XN4A 4LBWA 4P34A 4HVLA 2ZJAA 3HWRA 4Q4DA 3L02A 3WJ2A 3OQHA 2QTBA 1O58A 2X8JB 4HZIA 5IMSA 3S1AA 5JZVA 4N7BA 3G9ZA 3NIDB 5K0TA 5H5JA 3QG5A 3HKDA 3QXXA 1Z39A 3A1DA 4OHMA 3RARA 4DMMA 3CN7A 3WLNA 1PX2A 1M0EA 2MYUA 1NVTA 2ZBDA 3KU4A 1RYBA 4DDWA 5CXQA 1HNZB 3QUCA 1GVNB 2GHQA 3FWNA 1NYQA 5L7TA 3GDWA 4UPEA 2EOAA 3N28A 1G6Q1 1M1ZA 3FAKA 3ERCA 4MW5A 4BRZA 3N3AC 1VMEA 3C5WP 3WHKA 3HBNA 4L6AA 4RPJA 1HNXB 1QHHB 1XGKA 1KH1A 3EXAA 3EW9A 2WWVD 3WLKX 1FMLA 1QIGA 1KJ8A 3PWSA 4B3IA 4FI3F 5YASA 1POWA 4N5DA 4DOMA 3T1HB 1E3QA 5AKIA 3RWBA 3HKCB 5GZ3A 2VHYA 1SHUX 2PGIA 1SUAA 2O2JA 2VNKA 3NV7A 3VHXA 2ZUWA 1HE5A 4UM8B 4YX9A 5J1SB 2RGRA 3CRQA 3T9DA 3HM2A 4U63A 4XRRA 1C14A 1YRWA 3S2FA 4EPRA 2QXUA 3GJ3A 1XDWA 3HCWA 3IHTA 5EE5B 3MOGA 3OY2A 3WLTA 1IZ9A 2WP0A 5GPBA 2B8EA 1YQEA 3OE5A 5KNBH 2OPBA 1L1EA 1Y7PA 3R5HA 1JBEA 3S8YA 2E3JA 1HPLA 2ZIUB 1OXSC 2PUJA 2D5LA 4ZT5A 5BSRA 4OU4A 3TPFA 3FWKA 2EYQA 2OQIA 1FNBA 1GL7A 2W5UA 2FPSA 4TTJA 4WJZA 3FFWA 4D5EA 1R27A 1Q2XA 1IY8A 2OV3A 2GF2A 4R5HA 5F98A 5JCPA 1LWOA 2PSSA 2H1HA 4LF7B 2D2VA 4RZ2A 4WV3A 1MO2A 2DPXA 3EUAA 2JGMA 5BWCA 1XMPA 4ZVOA 3PUWA 3W2TA 4F11A 3K20A 4CBVA 4TZ6A 1BRTA 2W37A 3ESCA 3Q7PA 2H1WA 2QTHA 3F46A 1U0HC 4W6QA 4UUNA 4PZCA 4D9IA 4B3SB 1U11A 2GAAA 4ZEVA 2BE7A 3DLAA 4FYPA 4ZANA 3AONB 1RWWA 4KXWA 3A2KA 1QRRA 3AHIA 4OXXA 1CJKC 1G41A 1XLUA 3LO5A 3GVHA 2BMJA 2JGLA 4YJ3B 3AVOA 1E2LA 1RLMA 2AJTA 2OK7A 1NC3A 2XNSA 4AY6A 1YR3A 5SZHB 3GPIA 4NOJA 3RADC 2IOFK 4FVTA 5B30A 2FLWA 3FETA 1AH2A 2Q3FA 4YPFA 3AVUA 3UCEA 3HA2A 5BQXA 3N6XA 4ZO4A 1BO6A 5K09A 4LYAA 1XTQA 4PQYA 3HE3A 1LKZA 2J41A 4LI0A 3FNQA 1AN0A 2CYAA 1SXJB 4A03A 4BGUA 1R9NA 3WNVA 1QG4A 3JRNA 4O59O 2RC5A 5D7BA 3W78A 1OTXA 2H7YA 3L7NA 3FFBA 1N5LA 4N5IX 1V1MB 1TEHA 2NXWA 1UQUA 4PAGA 1ST3A 3C8MA 1R4MA 4PWYA 3JQGB 1R74A 1AXGA 2K6GA 4I99A 1H5UA 2BISA 1ZJ6A 3MCTA 2J4FA 3ITNA 4QEKA 3SIWA 3LTNC 2KLHA 1FLVA 4O8CA 2C5BA 1AB6A 3I83A 1OKKA 5IFKA 4M7OA 2WZBA 3CISA 4FZ5A 1SOAA 3LQRA 3RBAA 4R2XA 3PS9A 5E4FA 7ADHA 3QQ5A 3ZQUA 3TD2A 4ZMSA 3T3IA 2GK7A 1P2TA 3NP9A 4P3OA 1QZUA 4Z7OB 3PQCA 2XA9A 1FSPA 3E03A 3GQBA 4M6WB 3KKKA 1SUIA 1DPFA 4NU0A 3I3SR 3GAZA 5AYVA 1L5RA 5BN3B 3MERA 1FTQA 1UC8A 2HL6A 2YW9A 3HRIA 1QKJA 4MA4A 3PLNA 2Z8XA 4MGEA 3H0EA 3S3TA 4B32A 3ZD8A 3KXIA 3CZRA 3OIFA 5JS8A 2YVAA 1L7XA 1R64A 3HUEA 5COQA 3VU0A 4AVYA 1Q11A 1R6DA 4OY3A 2J6CA 3HDGA 3WAGA 4EF4A 1G16A 1KBOA 3RSLA 4WLVA 3U3RA 4YQFA 3GLGE 1CE8A 1EZZA 4C29A 3ROPA 3FCOA 4AMZA 4R2KA 4PN7A 1C7IA 1L4GA 2Q9UA 4J0HA 2KJQA 2Q6LA 4NONA 5EIBD 2V7BA 3GC6A 4UHBA 3TQSA 5FPQA 2EQBA 3SVTA 3EFEA 1NUHA 2ZSEA 3KJGA 4M86A 4X64B 3EEOA 2GFHA 4R2IA 1OW3B 1DAHA 2Y77A 4HMOA 4MVJI 2YVLA 3AV0B 1FSFA 2HMSA 4G0MA 3HABA 4E13A 4PNEA 3P94A 1XZPA 4BNVA 1TQ4A 5BSWA 4CL2A 1L8XA 1ZR4A 2C2ZA 5B1SA 1CX9B 2O8DA 1IRXA 2ALJA 4KHPB 2JI6A 1SXJA 3D6FA 2HDHA 4RPHA 1KR2A 1MX1A 2Z98A 1SIBE 2PEZA 1EX9A 2O0JA 3GFQA 3M9WA 5HKKD 1DEOA 1JPNA 3O26A 5T4HA 1P0QA 2WYIA 2EF0A 2F90A 3F9IA 1OB2A 3PI7A 1M2NA 1DRWA 1XQXA 3OCUA 5ALSA 5DK4A 2QUZA 3O1JC 3CVXA 5SZJA 4OVKA 1BFKA 3IXMA 1I1OA 1US8B 3W8RA 2ZWVA 1ECCA 3PE3A 2NPIA 3G89A 1EG7A 3TFQA 4MZDA 1L5SA 4QUKA 1FU8A 2FZVA 5IJ0B 1N1GA 2XGSA 3CUSA 5J2UA 3WGTA 4FCCA 3F3KA 4K3UA 3MELA 4FMBB 4PC1A 5BRJA 1CUAA 5IEBA 3RVQA 1HX7A 3KZMA 4M99A 4FOSA 4EI9A 1TX4B 4RKFA 3RK4A 2CY0A 2RK3A 5DN6D 3OF2A 3FUUA 1VPTA 1RJGA 4RS3A 3D31A 5JE8A 3H2KA 3CVWA 1EGMB 5DHAA 1SOUA 1OXVA 1H1TA 3MHPA 2Y2UA 1G98A 3H19A 3VDNB 3TSCA 3A11A 5L4LA 2ERYA 4BO3A 3RVNA 1YKSA 2RIRA 5SY6A 1U9CA 1WD5A 3EVBA 3B1VA 4GBMA 1N2EA 3ND9A 4ZO7A 3THOA 4B5LA 1GQQA 5BN4B 1RWOA 2NGRA 1QIKA 1E2NA 4RF2A 3A32A 4EVQA 3U60B 3G0DA 1RXSA 4FHGA 3RS5A 2JGIA 1LXCA 1NVMB 4HWOA 1ORTA 2ACEA 4RAOA 4RSRA 3TDKA 3UMBA 1TLLA 1YE5A 2V7EA 3BSYA 3LPLA 4KFSA 4RYLA 4ZU3A 4TWZA 1G21B 3BQMB 1UK9A 4KPEC 2QQFA 1Y3DE 2HT6A 4ILEA 4ZRDA 1UBMS 2CVHA 2OCBA 2VYQA 5ALXA 4UAJA 1ZPDA 4UBKA 1O0CA 5TY0A 3NOOA 1X9HA 5CLJA 2MHCA 3BG5A 2K7FA 2CFIA 3T1NA 3BMNA 5TT0A 3AI1A 4WOPA 1MKYA 1NW8A 1T8YA 1Z0DA 2QTGA 3GLRA 4R9NA 3OFKA 4H6WA 4K9RA 2XUJA 1DBVO 3I2JA 3LW8A 1MG0A 4O4IB 2YX1A 1FNDA 1Y7IA 1U2DA 4DDUA 2YYZA 4OYHA 1QCYA 1KYWA 2QQ0A 4FZVA 2C4UA 3QVKA 3B6IA 4WBNB 5EXTA 4GR5A 3EA4A 2DJ5A 1PVDA 1TJ3A 2QORA 1GQYA 5LPNA 4H1VA 3FPAA 1E9AA 1NLMA 2ZRDA 3ACCA 4IDPA 4R9RA 4FW8A 3TQIA 2PNJA 2R1TB 2EZUA 1HFWA 1E7QA 1U0TA 2PA3A 5CGQB 5JZSA 5LZ4A 2VDWB 4MARA 3AJ9A 2QD5A 2EAUA 2GGSA 1E0DA 1KSJA 1M6WA 3PE4A 4LZLA 5C18A 3KQHA 3OP4A 2H57A 4M53A 2VDQB 3TEMA 2J1LA 3T1VA 4HQRA 1IMJA 3RSZA 1UBEA 3SICE 3IP7A 4L8VA 1T25A 5MGBA 5KNCH 3G6WA 4DXAA 2FW0A 2QXTA 4TTPA 4Z7JA 1QQBA 1RAEA 1RHQA 1PNRA 1YZQA 5LOVA 3KV3O 3PKZA 3MGAA 4LJAA 4HUJA 1MIOA 1XEAA 3IIEA 2PVCA 3AF4A 3CT4A 4XSHA 5EIOA 1IY2A 2A3RA 1CVLA 2BLNA 2QIOA 3ONFA 3H4IA 2VJQA 4G4JA 4RDXA 1DRKA 1RE0A 3IO3A 1BDJA 4H3HB 1KXJA 1P3Y1 2PQ2A 4XE5A 2YN4A 1ORIA 1PTJC 3T1YB 2YWGA 1PJ3A 2WPNA 2AOUB 2PUBA 1A1SA 1J49A 4RZUA 3JQ9A 2L0XA 1VL0A 3LUDA 1CKEA 1UXIA 3JR7A 2QVLA 5BYAA 4FS3A 2VPQA 5AVJA 4S35A 1T5DX 3LYUA 3F4BA 1ORVA 4L5YA 3B3GA 5FTJA 2HK7A 4OX9B 1HL3A 5JAOA 3D3WB 1GPKA 1NDHA 3FCXA 3KYBA 3NC0C 3BILA 5JXJA 2OCYC 2VOJA 1SC3A 4FBLA 4HAUA 2ZQ5A 5C34B 3JSAA 4RY0A 2QRGA 3RODA 1P6UA 2IEZA 1QMPA 3K05A 4FE4A 3WK9A 4E2WA 2AN4A 3UWDA 4I4NA 5C51B 5TGDA 3QPBA 1BQEA 2VXCA 3P45A 4MQUA 2C2GA 3O0TA 4B2PA 2VHCA 1NVDA 4FLFA 3C6YA 4RFLA 2X0JA 3JWJA 5B1IA 3ZG6A 4OTZA 1JQBA 3CZ4A 2WWYA 1MX3A 2FF5A 3CO5A 1KDPA 5ALMA 2AXPA 4F72A 1M83A 4X3CA 3SC3A 4GOJA 1NBMA 5FAKA 1IJFA 4CLDA 1E89A 4ZAWA 4KPGA 3R7AA 2LTAA 3KT3A 4UMVA 1ES9A 6ADHA 2AN3A 2M9MA 4GLBA 4HPXB 2BE9A 2Z3WA 4GVPA 2ODBA 3HQ4O 4G09A 1WB4A 2D1TA 2JAWA 1CS4C 1II0A 3EHDA 4P08A 1K0FA 4S0ZA 3W0LB 2XLBA 5JALA 5LOVB 4Q4LA 4BO2A 4QPZA 1U2PA 4KOEC 1IG3A 2O8CB 2C9ZA 3ABIA 3TL2A 3EH1A 4H1TA 2B61A 5DI9A 4KR9A 2C03A 1RBMA 4E5PA 4H0CA 2UZ3A 1NKVA 3WMFA 3AWDA 3ENZA 5C46F 3IPLA 3A1CA 3KL4A 4MR8B 1Q57A 3MJ4A 2JJ1D 5KSWB 3DAGA 5C1DA 3PLRA 2HO5A 5EE3A 2ZUTA 1XL1A 2AD1A 4FB4A 2P77A 3EFOB 2NT4A 3AR6A 3GNSA 4RWZA 2O07A 2AXEA 3O4HA 1AA6A 2PYIA 2DTDA 4X8LA 2LD4A 4DIMA 4ND3A 2BL4A 2CNNA 3WKCA 1EU1A 1M7BA 2CMDA 2P1RA 3HU1A 3WYCA 4OHPA 3F7MA 4EL0A 4K0RA 2I1QA 3AFOA 5DTQA 1EVEA 2VS1A 3EODA 4NQZA 1THZA 5JLJA 1NQOA 4FTWA 3FDIA 1EFHA 3NYIA 1PFGA 1MABB 1ZIOA 3AESA 3ZBUA 5KJ1A 3A1UA 2VSFA 2XTNA 1D2EA 2HK6A 1VCNA 1JE0A 1FFSA 2ABWA 3GN2A 4OGGA 4WCFC 5AUQA 2B34A 4J3NA 1OA0A 1U90A 3TSYA 1DTEA 3ZI7A 1Y6FA 9GPBA 2IXFA 4Q3EA 1VB5A 4BGEA 2AJCA 1WDMA 1KYVA 4Y1GA 4LXYA 3BMOA 2QAGB 1QU3A 4UZEA 1GL3A 3VZCA 5BVGB 4UEKA 3I2YX 1E58A 3EMDA 1S89A 3D3KA 2E4XA 1W5TA 1PJQA 5KVQA 3UM9A 2IS4A 5K3FA 1JMYA 1WEKA 4FD2A 1CRWG 1OSNA 3X1KA 4R1OA 3WAKA 2CD9A 5JPCA 1XYGA 5JY6A 1EUYA 2XZLA 2N75A 3PHBE 4RAQA 1SH7A 2C2YA 4HDOB 3RB8A 2ONZA 4QPCA 5FTMA 1APBA 1AURA 2CXSA 1N6NA 2AWNA 4YCLA 5AVQA 1SUFA 4DARA 2AOTB 2EGUA 4H7EA 3QKTA 1DI0A 4NDZA 3DEAA 2PY6A 2ANCA 4MW6A 3AO0B 5GY7A 2I4MA 2IIVA 3EXFA 1PZXA 5JOQA 4V0LA 3TQQA 3UAXA 1QU2A 2VZEA 4ARBA 4EKDA 4BVAA 2X8LA 3EWIA 4Y2HA 4KQFA 4AZ3A 2BDTA 1E59A 4HMQA 2Q4OA 4P1ZA 1BZYA 2ZE5A 2KE5A 1K06A 2IODA 2RHWA 3MF4A 3I4CA 4M49A 2HSZA 1UMKA 1SU4A 1O9GA 4MQ4A 5AK5A 3KETA 5TMPA 1GZDA 4O1MA 2FQWA 4HZGA 3RHSA 3MTAA 4YMVA 4AM8A 4BNFA 3JVUA 3BXOA 4K6GA 3R7SA 3ZIAD 3ESXA 4C3OB 4MQFB 3DOOA 4X6YA 3T9BA 1S7CA 3PF9A 1IRIA 3N87A 2FZKA 1LA2A 2E18A 2GPYA 2IYTA 3EFOA 3MLEA 1PQWA 1D2MA 3QTTA 4DIBA 4DG5A 1CF4A 1B6SA 4BNHA 4OOFA 2CCJA 1IZ0A 3ZLJA 2O5EA 2WU1A 4YRKA 1L3BA 1H8ED 3GRPA 5JZ9A 3OQPA 3F78A 4FEAA 2R7KA 2JFOA 3DF9A 4QTUB 4JVLA 4YCDA 1LK0A 3PDCA 2BELA 3BCSA 3P9RA 8ATCA 3T3OA 3PFGA 3EQ2A 4FIZA 2H4WA 3GEPA 3IBCA 3QXCA 1K97A 4KK4A 1TVKB 1EFCA 1KBQA 1ORDA 1G17A 2PZFA 5DJ5A 4BTLA 5DULA 2NXEA 5FQNA 1AK2A 1H0RA 2BR3A 2IIBA 2WTAA 2E5FA 2UVPB 1U1CA 1YZUA 1S5PA 4OQFA 3QA3E 3NAZA 1ML3A 4QASA 1U2GA 1ONPA 2PZGA 4HS9A 1Y8RA 2I2FA 1G3QA 1II8B 3PYMA 5SYAA 3LX5A 1BTOA 2F62A 5EE0A 2O3UA 1V43A 2CVOA 3RIYA 1KMHA 1GIAA 3K70C 3T7TA 3FDZB 3U7EB 3N2ZB 1KYTA 3UJBA 4BJ1A 4DLWA 4Q7KA 2EWMA 3OMXA 3P19A 1VKRA 4MLPA 4MKGA 1MFZA 2IK8A 3VR6D 4EUEA 4QYMA 2QZZA 2G0NA 5B3KA 4UVDA 1Z3CA 4ZCTA 4O4JA 3ZHRA 1PEKE 1QIDA 3ZV4A 1FYVA 2I4TA 1PK8A 2BONA 2K2QB 1J06A 1T5BA 2X13A 3KR9A 4GSYA 3HNPA 4IHJA 4JZKA 4RKWA 4AZ3B 3K1TA 3B1KA 4AAYA 3PICA 1DEKA 3BGSA 2QYOA 4C6HA 2WHXA 4LHVA 2YJZA 4ODIA 4WEQA 3B3JA 1NMSA 1K63A 2GM9A 1NQXA 2QB5A 2VPXA 3AF2A 2GKGA 2H2IA 3HUDA 3DOHA 3PXDA 4LPSA 2IV2X 3AEYA 4WLNA 4PEVA 4X1IB 5AIBA 1M2GA 2X3YA 3UPTA 4QOJA 5A6SB 4U9IS 4R3UC 1JAZA 2G36A 4F3NA 1F2TA 3PNVA 2VP4A 2O8VA 1OTHA 3P5SA 4J6EA 1R6TA 3RU2A 3VOSA 5CEJA 2G4VA 3UJ6A 2QVBA 3TNLA 1VOTA 4EHIA 4WN9B 1XJQA 5AW5A 2ZVDA 3VRHA 4HYEA 1UXJA 2WVAA 1CT9A 4BJHB 5TQVA 1BFUA 1QHFA 1T2UA 4AU1A 4KK3A 5BWLA 2FW1A 1V25A 2ZAMA 3AZOA 4DQUA 1UJ6A 1QYDA 4TRJA 4DT1A 1PBTA 5DE3A 2W83A 1EX1A 3KXKA 3DCJA 4LKRA 3OC0A 3BL6A 3BM5A 1YHZA 4NMXB 2LCQA 1AZSC 3T3EA 2C9BA 4M9CA 1XCPA 2C4KA 2H1CA 4MW7A 3OCVA 5CA1A 2H17A 4AULA 5CPBA 1OUMA 2XB4A 3N2KA 4F12A 2O20A 1KL7A 3VAYA 5A2GA 3W5CA 2O0LA 3K9FC 5EP1A 2PBRA 3KOOA 2JZCA 2Y6UA 3U7IA 4EPYA 1L1FA 3NTVA 3WDSA 1NM5A 2O2ZA 4N18A 3AF0A 5C9ZA 4FMPA 2BLLA 1ULAA 2UYOA 3SOZA 3UAYA 1RXCA 3UK1A 2AK3A 3AJ8A 1C5KA 1XLTC 3ANXA 3K94A 3QMWA 4FDLA 4K46A 3GJ6A 2JIDA 3NHBA 4FFSA 3ZZUA 1TVEA 5CIWA 1TUEA 1WLSA 3FVQA 3NLLA 5CHYA 1IWBB 3C8ZA 3O1IC 3V4PB 3HXLA 3L2OB 2XB6A 3DEKA 4IHJB 1KVSA 1ZP6A 3RUPA 1WXDA 3K09C 2Z2KA 4C6RA 4AN1A 1NX6A 1YBAA 2PVPA 4WZZA 2W2QA 3UT6A 1JSXA 4EFNA 1U8UA 2GJ4A 3LUHA 3T06B 3F73A 3DE0X 4JASB 2XF8A 4ZN6A 1EVJA 1XCMA 2LE0A 3WP1B 5AVWA 2YYSA 3QEMB 3I61A 1ZNQO 3DONA 3QOXA 1B8UA 1EXNA 2FX3A 4J16A 1G4UR 3AVWA 4DM7A 4MULA 1NMEA 1JZQA 2G88A 1NUSA 3EXHA 4HX5A 1F3OA 4UHDA 2FPLA 2B4TO 4X7BA 3E5NA 1FLDA 3QSYA 1G38A 1U04A 4UQOA 1A8SA 4LXHA 3F8TA 2VF4X 2HCBA 5ADVA 1OFGA 4KQ9A 1KGDA 1T15A 2WWWA 4HMPA 3VV3A 1Q14A 3GH1A 4YYEA 3WSTA 2BUBA 3B8HA 4B17A 2GNOA 2CXXA 4MV1A 5B4TA 5TVKA 3MPUA 5TPWA 3ADCA 1DEXA 2YHIA 3M2PA 4NJEB 3FKSD 5K0GA 3ZE9A 2PKQO 3RYIB 4AUMA 4GL2A 3Q3VA 3WL7A 5KNDH 2C0PA 2P3QA 1Z6YA 2IHVA 4LWPA 3GH3A 1EVZA 4BMZA 3FZNA 4JLWA 1SEVA 3FCUB 1OH5A 1XTRA 2W58A 1TU3A 4GBGA 4Y2VA 3RKSA 1OYOA 2G77B 3H5TA 4K9PA 3R3YA 1M76A 1NJFA 4IXMA 3T5AA 1KAHA 2HADA 3PEFA 2FEAA 4Z0NA 3WWPA 4JC4A 3HCPA 4KRFA 4B71A 1UBSB 2E82A 3YASA 1M0SA 4KXVA 1VYHA 3I8XA 4QWMA 4RXTA 3VHXB 4EMBA 2GF0A 5EWLB 2GXQA 4ZAXA 4GC9A 1TD1A 2EKQA 2B9VA 2XAUA 3IUNA 3NNSA 5IDYA 5BO5A 4LK3A 5EGSA 3D6UA 1YKGA 4L9SA 3TK1A 3CNHA 3IIIA 2X3UA 1YQWA 1FQJA 3EIHA 4IWYA 5LQJA 2BUAA 1WUTA 1SELA 2CKMA 1VE5A 3DV0B 4UBLA 5LVAA 4NENB 1PWEA 3EXHC 2YVUA 4EMSA 2QRVA 2GI4A 2FP3A 2C2KA 2BMFA 2H00A 1E3JA 1NXSA 1X7HA 3OPXA 1Q2UA 4MWZA 4Q3AA 3BWXA 4ACAA 1NVAA 4Q16A 3GA7A 3EQ9A 1W35A 1JQ3A 1A9ZA 2ZRPA 4NP6A 1TPZA 3FOWA 1PCXA 2EL7A 3HRHA 4OIFA 4PYKA 4YIKA 3N6VA 1N8KA 1YJQA 3RC2A 1QCDA 5K4AA 4YECA 1Z7WA 4NZNA 1GPBA 5JSQA 3JTMA 2GSDA 1JPJA 3GJQA 4QRHA 4ASUD 3H87A 4D2IA 4MYUA 1G6OA 2O2DA 5BQFA 1AQLA 1NXVA 4I46A 2GA9A 2VA9A 3UQYS 2BGMA 4B47A 4U0KA 1VG0B 1RYNA 5DNWA 2EFEB 3IUSA 1NN5A 2W6OA 1BFDA 1F0YA 2O0HA 3I28A 4MYRA 3PEYA 2ZT8A 3PJDA 1YB2A 3KVYA 3PRYA 1V3UA 5G1PA 3S2EA 5M34A 3DOIA 4AJKA 1ZAKA 5ILGA 5SV2A 5AKKA 1X1EA 4YO7A 3IKVA 3LGSA 3QLEA 4C21A 3A31A 4FLMA 1XRLA 5HOQA 1GRRA 1UKVY 1A7KA 2WSLA 4ONEA 1IDN1 4EW6A 4J3FA 1K89A 1KEZA 1PN3A 1T2CA 1EFLA 1K66A 3T9FA 3ESRA 1MO3A 1B43A 3DC2A 4KMRA 4DDVA 3NXSA 2RDMA 2R5FA 4RXUA 2QM3A 4K1LA 1E3MA 1RD4A 1QH9A 3N8DA 5EPUA 4IVPA 3U4QA 5FULA 1K3FA 4G5FA 3LHIA 4C43A 5BQPA 5BYJA 3H1FA 1M34E 1RTTA 2FRDC 3PC8A 5HTKA 1UXHA 2P9GA 2WLSA 3FFXA 2NADA 1PGNA 4QYIA 3MTDA 4RJKA 3V2UA 1S0UA 2F8MA 3F1LA 3HY6A 4CQMD 1JJFA 5ANRB 1QHYA 1FA9A 1P0FA 2O06A 4PGMA 5CD1A 1UBTS 1P62B 1P39A 2Q6OA 3BE8A 3K6JA 3JWPA 4HYYA 3Q9NA 1W5EA 2OPHA 4BX2A 2XX3A 1R4MB 3GUZA 1YJBA 3K2IA 4Z9XA 5EXSA 4L7QA 2WF5A 1S3SA 2RHBA 2JH3A 1PEDA 4KN6A 5FBVB 4QPNA 1N8SA 1V7PC 1JIQA 3N74A 3GPDG 5L51A 3H5NA 4B34A 2UKDA 4AW9A 2ZJZA 3QOYA 2GM3A 2HA6A 4IMIB 1WZ2A 4DMKA 3Q98A 1WETA 1XB2A 3M3HA 5EHGA 1Y4ZA 4ARIA 1N0UA 4NENA 1KAMA 3QM1A 5ECGC 1Z4OA 3LD9A 1KSGA 4QU8A 4R1QA 2XZDA 2WWRA 3QE3A 4G5XA 5AWFC 4NFSA 1CTQA 1T5LA 5DZSA 1HT2E 2JFNA 4DZZA 1PGPA 2R66A 3NVDA 5AKLA 2WJVA 1YVEI 3LQFA 4PSDA 3U5TA 2BKEA 3PTLA 4QAQA 4QSMA 3RHFA 1YI1A 1JQAA 2GO1A 1YKFA 4QBHA 4BFYA 4DNOA 1BHO1 1PZGA 3LYAA 4AF6A 3RSCA 2OFOA 1YOBA 2UU9B 1CZKA 2IZ6A 3MSCA 2FPUA 1MH1A 3QIVA 3VA7A 1HG0A 3DNFA 3QELA 5IAGA 4GFDA 1XRNA 3H3FA 2ECQA 3UXEA 3KUXA 2PV7A 5ARCA 5KYNA 2D6FA 1GNLA 1MJFA 3B20A 4ZHQF 1JU4A 1C2YA 4MRMA 5TQ0B 1R0ZA 1CYEA 2V7TA 2F9FA 1M72A 4HLDA 1PYGA 4K0KB 1N6OA 2ACVA 5KC9A 4LF8B 4ZYXA 5BUQA 5CXSA 2G1KA 2MYTA 1SM4A 3H9EO 1EZ1A 1WCWA 4M1WA 5B6PA 1NAHA 4JI7B 1U7DA 3PIDA 4OXNA 1CRZA 2DTEA 2C54A 2ORYA 4OQXA 5E1MA 1QYRA 5H82A 3DZGA 2ZPAA 3AMVA 4PAOA 4R98A 3V42A 1G6HA 3HDVA 3TL6A 4TVBA 1QOPB 3AETA 3BBLA 1C9DB 1CR2A 3CN9A 4EHJA 1QBKC 1SN7A 3EBOA 3D54D 4G0UA 1ZO8A 4HFNA 2VQEB 3ZZTA 1U3VA 3MW8A 2ZWPA 3A4YA 3EXIA 4GMXA 4JH0A 3TRJA 1BDHA 3KB8A 4FZJA 3V4FA 3ITDA 1LV8A 2GVZC 2X2PA 2JF0A 4WCFA 5FPYA 4QFBA 1EESA 1FP2A 1K2VN 3QW4B 2ZULA 1ENPA 1X2EA 5LMZA 1K5GA 3PQ4A 3QLJA 3TWOA 3RFXA 5ALNA 4QEZA 1E6EA 2HREA 2Q6IA 3HKEA 3ID6C 2H2FA 5A71A 4AG6A 5L3QB 3G9TA 2GA8A 1EUZA 3SNHA 1OWOA 1RLTA 4R1TA 2BFFB 3OBIA 5I7EA 4MMXB 3ULKA 4CF7A 2A88A 4PBSA 1A0OA 4HGZA 2PXXA 2NVWA 2H4ZA 4OKSA 2CF6A 1AZTA 4PRYA 1KDTA 1XJ5A 4IEIA 3OZSA 4EHHA 3S2SA 3V00A 3I1IA 4QHYA 5AUNB 4NH4A 1VPVA 4OV6B 3DDNA 1OMOA 4IIXA 3TOVA 3COVA 4PPFA 4CIDA 4IZ6A 1UINA 4AI6A 4H3KB 4OGFA 2VWQA 1XA0A 1TA0A 3P96A 1UP6A 3R5FA 4QU0A 1N7HA 3ONVA 1FDSA 4RF3A 3VSAA 4K6OA 3G3EA 1EJBA 3G0BA 2FF7A 4XFDA 1PQYA 3DEFA 4FLEA 1UBCA 1NP6A 3VJKA 2OORC 1UXKA 3ANSA 4NV0A 4ZVSA 3REQB 2YCBA 3MUNA 4EKGA 4NESA 3DLPX 2GVDC 3HGMA 2D62A 2B8NA 4V3BA 1GCGA 5E4TA 1NVKA 1F8XA 1P6XA 1QIFA 3C16C 3E5MA 3WWDA 4HI0E 2EW8A 2HLNA 3LPDA 4FFRA 4LV6A 2W11A 4OH7A 2O05A 4OM7A 3RAGA 1E3DA 4LG1A 2ZIWB 3VPFA 3I30X 4TVSA 5J43A 2QUKA 1E9RA 4HAYA 4CODB 3IJEB 4IQ4A 3RFFA 3VO1A 5ALIA 4XVHA 1O96B 3P4YA 3GT0A 3F9RA 4GX0A 3T1QA 3M6MD 1UC5B 2Q1SA 2QLTA 4A9AA 2H3HA 2NTEA 4D9GA 4ID9A 2VZLA 4H08A 4AMUA 2VDOB 4NBLA 4JB3A 5DCLA 1NN0A 4U7WA 4V39A 4OYLA 2PAFA 2AOTA 3BXXA 5KOYA 2V54A 3S6JA 1NNUA 1X87A 4IDOA 2H5LA 3NWPA 1QLHA 1U3TA 3QHAA 4HRVA 4NRDA 2I2AA 4ZU1X 3LVRE 4F2WA 4NMLA 3K0FB 3W1VA 4XPIB 2IE8A 5DBIA 4JNKA 5AM3A 1Q95A 4BKPA 3FJ1A 3FYUB 3DBIA 4I6JA 4PCUA 5AI8A 4G2TA 3LF2A 2Q9BA 1NG1A 4NYJR 1MIOB 2J08A 1E5XA 4J90A 1N0VC 2RHCA 3BMQB 2FW6A 2P11A 1P5JA 2KM1A 3NXKA 4RV5A 1OJ7A 4WBXC 4B3DA 3P2KA 1NKTA 2BFCB 2HMUA 1JHMA 1BE6A 2VUIB 1J39A 3IV6A 5JECA 1B8OA 1SQ5A 1GEGA 3IULA 2EIXA 2HWUA 3GUUA 1ZVJA 3CEMA 3JAKB 3WX0A 1ZNYA 1HG1A 5BQ5A 2JCSA 2REOA 3PU6A 3ZY6A 1RXEA 4J4TA 4K6FA 4PF1A 1FUYB 1IEVA 3S55A 4KC0A 1DV2A 5FNZA 1Z2PX 4CF5A 1I0LA 1RCFA 4RZXA 3C3MA 4JEUA 4PX5A 3B1ZA 2GEJA 4LE0A 4BUCA 3ZX5A 4ZJPA 3GHYA 3D3QA 5ADUS 4KOAA 5F5XA 4LXQA 1G5QA 1SC6A 2OBYA 2HKIA 2HHAA 2XD4A 4OK6A 4EA7A 5BURA 3A37A 3ELYA 4MP3A 5D5HA 5C1BA 1Q74A 3T1TA 3JQBC 3M4ZA 3MAGA 3Q0EA 3C3JA 2HA2A 4ZI7A 2YXLA 4MRPA 1G3UA 3F0TA 2J5RA 4GPBA 2F67A 4PSCA 5ELLA 2QU7A 1DC8A 3ZI0A 4B40A 5CA0F 2JIBA 1PS9A 4ICIA 4DEXA 2CV0A 5IVHA 4EFKA 5JVDA 1YO6A 2OCKA 2V7GA 2GEDA 2YMMA 3DE1X 3H75A 4QQFA 1YTUA 2JAQA 1MEJA 1J99A 2X4GA 2Q6TA 4IG4A 2CLLB 3FBTA 4E22A 1K7FB 5G1OA 4OL9A 2ZJBA 4QNMA 3WSWA 3O8CA 2HCRA 1A9RA 5JAPA 2DCMA 4PSKA 2ZJ3A 4IDEA 5PNTA 3IDFA 2HCJB 4NBNA 3ZQKA 4WLOA 3T6KA 1HMYA 2P6UA 4WZBB 2BGGA 4MVJM 2I7VA 3KJHA 1KWKA 3LSTA 4HR7A 1E3IA 5F2KA 4JWTA 3IYLW 1NNLA 1IN5A 1XTKA 3JWIA 2Y0PA 1VHDA 3K32A 1KMQA 4PIVA 3UC5A 3Q10A 5AFSA 1G59A 2EJUA 3WGUA 2X1HA 1Z13A 2QN3A 1XZDA 2J0VA 3MEQA 4YBRA 2A1TS 3D8BA 4K9KA 3UV3A 3AY3A 1O54A 2VQ6A 1NNSA 3B12A 5K0BA 2VSNA 1HNWB 3WO0A 1R0LA 3NDJA 4XSVA 4HAXA 1P5ZB 4HNAB 4FP9A 4BMOB 3IKJA 3CH5A 2JCXA 2X40A 4TQUS 1FNMA 5G40A 1QGUB 3T9CA 1UKCA 4QO8A 3PCTA 4N8EA 1PWZA 4BC0A 3I64A 3BH7A 2DUMA 1CNEA 1X14A 2C3PA 2QYSA 2NU8A 5ADHA 2P9ZA 3A06A 2Y0CA 1T1SA 1U1IA 4MJLA 2KS6A 2WZCA 1P1BA 2XPCA 4DC1A 2LVBA 3GJRA 4O2BF 4M1TA 2Q5QA 1B2RA 2B7BA 3P9KA 2JLUA 4WDRA 4RD6A 3ZJUA 3FW1A 4UBMA 1HLPA 1ISIA 3LA8A 5I9TA 4DKJA 1E9CA 1J9ZA 5KMGA 4YMUA 1L7DA 4EYKA 4DPKA 4Z2AA 2OV6A 3UUGA 1E61A 1ZJZA 1YZYA 1TMYA 4EYEA 2FMTA 1VJGA 2G5CA 1UWVA 1GZSA 2RJOA 1CY2A 2D0IA 3AM1A 5HFNA 1ZONA 5E3IA 3EDYA 1C9YA 3IMEA 3X1ZA 4RSHA 1O03A 1NUTA 3G7UA 4QE3A 4D98A 4C07A 4JBGA 5K0ZA 4V1CB 1V45E 3IMGA 2VPIA 4XD2A 1V5IA 3D9QX 4CMHA 4EPWA 4ZI7B 4A8HA 2VBFA 2O2GA 2PWPA 3A7EA 3QNUA 3TLAA 1RAGA 3BMCA 4UZSA 2UZAA 3C7CB 3WNDA 4RVDA 4JYBA 2FE4A 3OE7D 4P35A 1UM9A 2ZSBA 2NVUB 2PGOA 1I6LA 4F06A 4P98A 4B2IA 4XM0A 3UUWA 1JG3A 4FYKA 3EXFB 1PV2A 1SHTX 1WXIA 5TNXA 2ZEJA 1RRMA 1ZINA 1TCCA </