3NHMA

Crystal structure of a response regulator from myxococcus xanthus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
115
Chain Sequence
b'PKVLIVENSWTMRETLRLLLSGEFDCTTAADGASGLQQALAHPPDVLISDVNMDGMDGYALCGHFRSEPTLKHIPVIFVSGYAPADQPVPDAYLVKPVKPPVLIAQLHALLARAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Crystal structure of a response regulator from Myxococcus xanthus
rcsb
source organism Myxococcus xanthus
molecule tags Signaling protein
total genus 35
structure length 115
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nhmA00
1NXPA 4KPYA 3CNBA 5DGCA 2JVJA 1BDIA 2WMYA 3C3WA 4FE4A 1RZRD 3E3MA 2PUDA 3HEBA 4N0QA 4YWHA 1MB3A 3MIZA 3EAFA 3NHZA 2JRLA 4L4UA 2V0NA 3I09A 3HJFA 1NTRA 3NNNA 4F8JA 4PZ0A 3OLVA 4RKRA 4MQEA 4D6XA 1GLGA 4E7OA 5B3JC 1ZH2A 1H9CA 1DC8A 3CS3A 1W25A 1GUDA 1F51E 1T34A 2DRIA 3FGZA 4G0OA 4YO7A 2J48A 3H5WA 2NZUG 4ZMSA 4XAQA 5C5CA 1K66A 4RDCA 4LRQA 1VRVA 3NBMA 2MYTA 1P2FA 4B09A 4Z4IA 4H3KB 4MRMB 2FN9A 1R8JA 1L5ZA 3MYYA 3CG4A 2PUGA 5CNKA 5C5EA 4F06A 2E4XA 4W5NA 4P98A 3OQMA 1E2BA 2FEPA 2QVGA 5JNSA 5EWMB 2NZVG 3IP5A 3A10A 3QEMB 4Z0NA 8ABPA 4GPAA 4ZJPA 4KQ9A 3GL9A 5TPWA 5I4CA 3DLHA 1ZGGA 3MF4A 2LP4Y 5IUJC 5BRJA 1JHZA 4WT7A 4LDAA 5BRAA 1UDRA 4FE7A 1BVHA 4MS3B 3Q7SA 2PE5A 4LZLA 4EUKA 4RZSA 3IDOA 1J56A 4JP1A 2VUIB 1Z2EA 3LUFA 5TQ2B 6CHYA 1YMUA 2MYPA 1EFAA 2O20A 2IDMA 1M5TA 3CKMA 2FQXA 4KQCA 3BBLA 5IEBA 4ETNA 4KNYA 2QZJA 4RK0A 2FLWA 3A0UA 4Y9TA 4DQDA 4PICA 1DJMA 4N76A 2MSKA 4XFKA 1W9HA 1Z12A 9ABPA 4NV3A 1TM2A 4EVSA 1CHNA 4KV7A 2R48A 3CZ5A 4MGEA 3OMXA 3CLKA 2B4AA 3BREA 4KREA 4EYGA 1LJLA 1JFVA 1D5WA 1BAPA 5JNWA 1U0SY 4MLCA 1QP4A 5CNMA 4KK3A 5KI6A 4KFCA 1SXIA 3FMVA 1KRWA 1TLFA 4MR8A 2FN8A 2GWRA 3H6GA 4WXMA 2PAFA 3HXMA 4LDZA 3FFTA 1YK0A 4YS6A 4ZMRA 1VKRA 1EAYA 3ROFA 3HDGA 1U2PA 1DG9A 4YRZA 3N8IA 2IPNA 2IKSA 2FQWA 2VUHB 1JDNA 3SG0A 2QW1A 4MQFB 1QNLA 2A9RA 1DC7A 4TLMB 3Q7TA 3KTOA 1Z16A 4N47A 1I3CA 2E4WA 4UHJA 1JBEA 5T7BA 1C4WA 5HM6A 2GKGA 4XXHA 3HVRA 2MYNA 4MLDA 1YK1A 3D02A 3VNBA 2FEWB 4S05A 1CEYA 1JH9A 2FMKA 3N0RA 4D6YA 1D4ZA 4MR7A 3NHMA 2QVCA 1KGSA 3SNKA 2WJAA 1DRKA 2JBAB 1DCKA 1D1QA 1YIOA 3O1HB 5IC5A 4N03A 3RVRA 5HKOA 3FFXA 4H3HB 3O1IC 1USIA 3TB6A 4Z9AA 3CZCA 1ABEA 1B00A 3KLNA 1DBWA 3S99A 4E7PA 2LIVA 3RQIA 3O1JC 1YS6A 4MS4A 3OM1A 1RNLA 5TE9A 4DADA 4OLBA 2FMFA 1PHRA 5JNTA 4JA2A 4TN5A 1NXWA 3QELA 3HM9A 5EWLA 4EYKA 5DLEA 1EHCA 1XHFA 5FWYB 2I6FA 3G1WA 2QXYA 3EODA 1JDPA 3O2JA 4LX8A 1Z15A 1ZHHA 3OMWA 3KJXA 5DKFA 2JVIA 2HQRA 4YLEA 3KSMA 2WB4A 4EGSA 2JVKA 4QYMA 4P1ZA 3JY6A 1JYEA 5JNVA 1P8AA 2A9QA 5FBKA 4WXEA 1Z26A 4MPTA 2JB9A 1YMVA 4RK7A 1F4VA 1JFTA 3HUTA 3HSYA 2NUBA 5KQPA 5IUNC 1JWLA 2LUOA 3L6UA 4LE1A 1GCAA 3TD9A 1IIBA 2E4UA 4OG2A 3VNAA 1APBA 3UKJA 3CU5A 4Q6BA 3N0XA 2X7XA 3A0RB 3O74A 1QO0D 4QPJC 3RVNA 5DTEA 3LKVA 2IOYA 3GBVA 3H5OA 3HDVA 3QLUA 3IP9A 2F8TA 1P6QA 4WZZA 3QLVA 4HNSA 3G85A 4YV7A 1LBIA 2QV0A 5TPZD 2GBPA 5GOTA 3A3KA 2FQYA 4MS1B 4IF4A 2VYCA 4YR7A 3FFWA 3HUUA 4HNRA 4Q6WA 1QP0A 1NXOA 1Z13A 3H6HA 4RXUA 2E4VA 2VK2A 3SM9A 1KMIY 3B2NA 4OTZA 1WETA 1RZRA 3H5VA 3T6KA 1NY5A 3HCWA 1SXGA 4IILA 3KG2A 1S8NA 3K9CA 4F12A 1GCGA 3H5TA 4CBVA 4EVQA 4NICA 1ISRA 1M2FA 3H1FA 3LTEA 4G0ZA 1ZDMA 3O75A 4NCAA 1ZAYA 3OQOA 1TMYA 2FMHA 1ZVVA 1PEAA 1PNTA 3M9XA 1CYEA 3OLYA 4RKQA 2L2QA 4O5AA 1A0OA 1K68A 3HV2A 3IPCA 3RVKA 2BGGA 5KQMA 2FW0A 4G0MA 4MRMA 1USKA 3OM0A 3P9YA 3CRNA 5BQ3A 1MB0A 5KC9A 2R25B 4IMIB 4MR9B 4Z4FA 3T8YA 4EYOA 5JNUA 2YHAA 2ZWMA 1ZN2A 2RJNA 3DBIA 5EWMA 2WY2D 3O2QB 4RK5A 4TLLB 3QEMA 3LUCA 1TJYA 2PUBA 1JF8A 1C0EA 1AB5A 3OLZA 1XHEA 2FEKA 3OO1A 1VLZA 1U2QA 2IPMA 2MSWA 3RVJA 2NT4A 3E61A 2OENG 1SRRA 5B3JA 4MS3A 4RS3A 3LKBA 4EVRA 5TQ0B 5ED4A 2WRZA 5TQ2A 5ABPA 2FVYA 3N6VA 3GA5A 2GI4A 3N0WA 2FKAA 1EWVA 2TMYA 1QKKA 2PL9A 4MS4B 3GT7A 3OLXA 1DZ3A 5FWXB 1NXVA 5IX8A 1QPZA 1SXHA 2L19A 3DLBA 3KS9A 1DCFA 1JYFA 2H3HA 3MM4A 2E4ZA 2PJUA 5EWLB 4W5OA 1MIHA 1JFSA 4JOQA 1OXKB 2PUFA 4LE2A 2AYZA 1LK0A 2L18A 2NT3A 3JVDA 3LUGA 3EGCA 3DGFC 3IPAA 2PUCA 2A9OA 3KYJB 1QP7A 1VPWA 1Z18A 3L49A 3UK0A 1PNRA 1FQWA 1DBQA 4O1HA 5JNRA 3Q41A 3O2SB 3RVQA 4MQEB 3LUKA 1HEYA 1EWKA 2PMCA 4W5RA 2PLNA 2A9PA 2FXIA 1DP4A 4RWEA 3C97A 4G0XA 4KRFA 1Y1LA 1MAVA 5E3JA 4XLTA 3TX6A 3KHTA 5HSGA 2IYNA 5IBQA 3I5AA 3SQNA 5BR1A 4Z4GA 1USGA 4HNQA 4D74A 3OQNA 4WUTA 4W5QA 2AYXA 2L17A 1ZGZA 3KCNA 3LUAA 4MQFA 4KZKA 3RVMA 5EWJA 3O21A 4RY8A 3RVPA 4ETMA 2E4YA 3H5LA 3ILYA 3EULA 4F3TA 2IPAB 3LUDA 2ID7A 4KMRA 1BDHA 4ETIA 2WJWA 5TPWB 4YP9A 1NXSA 2MYUA 1U8TA 2QR3A 3C6QA 4ZYLA 6ABPA 2HSGA 1QMPA 3KKEA 4GNRA 3LOPA 2JBAA 4RY9A 1FFSA 3TO5A 4ZPJA 3KLOA 1OXBB 3EQ2A 4RK6A 5DCLA 1L5YA 1ZITA 4LE0A 1M5UA 4RK4A 3SY8A 2CHEA 1SD5A 3Q9SA 5GQSA 3KYIB 1DRJA 3BRSA 5CHYA 4UHKA 1QQAA 2MSLA 1NATA 4N0PA 1ISSA 2FSPA 3QX8A 1NXXA 4MYRA 1ZH4A 4JAVC 4DN6A 3CTPA 4Z4CA 1Z17A 4RXMA 3H1EA 4FB4A 2QSJA 4IRXA 3H5IA 1XWWA 2FLKA 2IPLA 3I45A 3LUHA 4JB0A 4PEVA 2CD7A 2H0AA 3GBPA 4ML3A 3CHYA 5F64A 3RVSA 4RU1A 2HPHA 5FWYA 1YTUA 3JTEA 5TQJA 4NQRA 3GV0A 1A04A 3Q15C 5KWSA 1FFWA 3FDFA 2PUEA 4G0PA 4IMJB 1DCMA 3F6PA 3LMKA 2WWVD 2PUAA 4M88A 3BRQA 4OBBA 7ABPA 4RXTA 5CNJA 4RY0A 2LPMA 4PE5B 4MR8B 4NCBA 1JLKA 3C3KA 3CFYA 1M2EA 3DGEC 3CG0A 1RPJA 3TMYA 4TMYA 1MVOA 2Q5CA 5IUKC 2CHFA 4JB2A 2CWDA 4N41A 2HJ9A 4Z99A 3GRCA 1BA2A 1GUBA 5JS2A 3F73A 3F7NA 1AB6A 2B1JA 3DZDA 3UUGA 3JPYA 2QU7A 4RK1A 4XASA 3I42A 3F6CA 1A2OA 1LBHA 1QO0A 3QX9A 4RSMA 1LJUA 4RV5A 1PEYA 1EWTA 2PL1A 1PUXA 3RVLA 1ABFA 3LFTA 3LUJA 2RGYA 2ID9A 2JK1A 3HS3A 4G86A 3JVIA 4MR7B 3R0JA 3HO1A 1D2AA 2W42A 5KQGA 3N53A 4MS1A 1JL3A 3OO0A 5TPZA 3K4HA 1ZESA 1RXEA 5D2CA 1RXIA 1D1PA 4G0YA 2GX6A 2HQBA 1DBPA 4YGXB 3D8UA 2N9UA 1Z25A 5CNIA 3QLTA 3ILHA 4W5TA 2P9HA 4Q7EA 1YS7A 3JPWA 4OLAA 4O1IA 3T95A 3H1GA 3SAJA 3JS5A 1E6MA 3IP6A 3T38A 2HQOA 1NXTA 4QICA 2RJOA 3MMNA 1U04A 3QELB 3EDCA 4WWHA 5JS1A 2R47A 2RDMA 3GWGA 3QK7A 3QLUC 1FFGA 1URPA 4KVFA 4XARA 1E6LA 5FBHA 2KYRA 3QLVC 5T3YA 4EYQA 5EWJB 3RVOA 1YVUA 3Q7RA 4Z9BA 5KQLA 4EY3A 3OLWA 4MR9A 3URMA 3EJWA 2R4QA 3IP7A 2PKXA 3GYBA 5PNTA 3M6MD 2XDYA 4F11A 3HZHA 2FTKE 3EQZA 1JX6A 4PYRA 3ROTA 1QQBA 3HK2A 4KK4A 2OQRA 4S04A 4G0QA 1ZY2A 4MAAA 1Z2DA 4G97A 3M9WA 5IEJA 1TVMA 2M1ZA 2JCGA 4H60A 3NNDA 1P6UA 3MA0A 4YCSA 4OATA 5TQ0A 4HYEA 1KRXA 2FMIA 5IULC 3N75A 1BDJA 3QEKA 2F8SA 4IGAA 2P4UA 2YHBA 5HQJA 3W9SA 4Z4HA 1FSPA 5KC8A 2M98A 3BILA 5FWXA 4QYWA 2LBPA 4Z4EA 3RH0A 4L85A 3MQ4A 3NNSA 3H75A 1E6KA 3C3MA 2ZAYA 4JASB
chains in the Genus database with same CATH superfamily
5LBIA 1X3SA 3CNBA 1HLPA 2Q1UA 3AR3A 3IT1A 3JQ9C 3LQYA 4LK2A 1DGQA 4HZGA 4I9GA 3GJ0A 4J0KA 5KHOC 4DNQA 3PUZA 1T9KA 4KRGA 2FUKA 3RYIB 4UXJA 1KAHA 2I6GA 2TMGA 4FFOA 4JB3A 1AF4A 5J23A 3NDBB 4IX9A 4FGSA 1Y8QB 1QRRA 3HCOA 3LOUA 4OB8A 4NECA 2B5WA 4FOOA 3VU0A 1LGYA 2YYYA 4TRRA 3RFVA 3BD6A 3ULKA 1XEWX 2IGBA 4KPGA 3KELA 2FOXA 2QT9A 2UXDB 4US0R 5C0OE 3HU1A 1MC1A 4L8GA 1DC8A 1JHOA 1E18A 1BXRA 1R0KA 2GF2A 1BROA 1ZRNA 2NZUG 3TG8A 2YOGA 5EZ6B 1YF3A 1XC7A 4II3A 3I9FA 2FP4B 1P2FA 2FWMX 4TYQA 5HFAA 3IO3A 3FJOA 3G5MA 4CR8A 2FN9A 4MW7A 4DMHA 4ZTUB 3BYZA 1RACA 1C1DA 3ICWA 2FZ4A 5DI3B 3WIOA 4GM0A 4QODA 5F12A 3MELA 4F06A 1IBLB 3OPVA 2JEOA 4J2HA 4P98A 2EP5A 3NALA 3E81A 5IT5A 1R4MB 3V1MA 3H18A 4JVLA 1I9GA 2HY7A 3O8QA 4QNMA 3QBVA 1GNLA 4U6NA 5A5DA 4RPCA 3JASA 3KQMA 1FU8A 1Q16A 3L79A 3JQPA 1I80A 3N5CA 4H1TA 1SM4A 3F2IA 2VXBA 3U0BA 2VYVA 4H15A 1U2GA 3M6WA 4M1SA 5GZ6A 3QXJA 1NC3A 1KU6A 2CDRA 1ZA1A 5EUCA 3C3EA 3TCNA 1DWPA 3B6ZA 1QIDA 3G0DA 4DFDA 4ARCA 1BVHA 1DO2A 4DIFA 5EKUA 2YWGA 4EUKA 1A72A 3PRYA 5GGYA 1EUYA 5CCEA 4ZT4A 4KOAA 3NPAA 4ZOBA 4NU0A 1EP2B 1U2EA 1RYHA 2NN3C 2Q6IA 3RARA 3RS8A 3TIGA 2BH2A 2AUNA 3A9UA 1A69A 2MU1A 5EMMA 1SQ6A 2GM4A 4GLJA 3EVAA 4LZWA 2ZSKA 4HPWA 1T3HA 5IKPA 2GARA 1GTSA 3AVWA 1UQTA 1KDVA 4B2LA 4UM9B 3V32A 3R8XA 5DBHX 1QGUB 3U7IA 4DLWA 2RGEA 1Z12A 5G3ZA 4FFWA 2Q7DA 1YR8A 3L6RA 4KWHA 1G6Q1 3C8ZA 4Q4DA 5AM0A 1G9TA 1AT1A 1EFVB 5CD1A 3N2KB 3BCSA 4K8RB 4WJKB 2CSXA 1K6XA 1ORIA 3KZ1E 1RLMA 2H9YA 2V7UA 3CIOA 4BKQA 1W0KD 3FFAA 4KQ1A 1M54A 3FYSA 1MDBA 2QP9X 3ZE8A 2F3UA 2XCTB 2ZI9A 4Q3OA 3WY9A 2ORIA 3KOZA 1CZRA 3M7IA 1KRWA 3N0TA 1XTQA 1NVKA 2CDCA 1QH0A 4MR8A 1F6WA 5K4GA 2J0EA 1JMYA 1OLUB 3H9BA 3HRIA 3OZ7A 3PXBA 4UUQA 4RPGA 5FBQB 1N7GA 3REGA 3VZBA 3OFKA 2YQ5A 4O8CA 4BZPA 4YT8A 1KY3A 1GQFA 1PJ3A 1RRFA 2QOEA 5CXSA 3ROFA 4D79A 3D2CA 5B7QA 5KYWA 1QVVA 1FYVA 2WKQA 2IPNA 1JG1A 4GP6A 4CCYA 4NYIR 1FDWA 4AN4A 4L74A 1X6VA 2ZROA 5J5CA 3UENA 4DBLE 4DV0B 4U6SA 3KTOA 3UN1A 1A2KC 2E4WA 2QD5A 2C8VA 2IYFA 2RHLA 4DUGD 3MWKA 2AF4C 1A4IA 1HT2E 1JA1A 2IFTA 2HI0A 2MYNA 3FH0A 4PXAA 5IBCA 1LC0A 2VH1A 3L8EA 3WBFA 5DOVA 3TLGA 2WJZB 4L3OA 2JA1A 1UR5A 2ZT7A 3R0VA 1CJBA 3BMOA 4KQIA 3X1YA 4RHCA 1RKVA 4Y0NA 1XZJA 1ZXXA 2UKDA 3WFJA 3MRSA 1RC0A 4GMKA 1DCKA 1VMIA 3DL2A 4QDOA 5AOVA 1V41E 2PWZA 2ZTUA 4LXUA 4EGFA 4FYMA 5A3JA 5EJ4A 3OT1B 4HH4A 1USIA 1HKHA 4JNCA 5K4AA 3T7RA 2GHQA 1EGQA 2HBYA 4PFSA 4BFCA 4KTTE 3RWOA 4D8YA 1UXOA 4YASA 2ECOA 3RQIA 3V1NA 3ZD6A 3I2HA 2NU8A 5B1HA 3SC2B 1V8BA 1DRVA 3O95A 2WA2A 3KP1A 3RO7A 1M74A 1NSTA 1NULA 4OLBA 3PHBE 3AVUA 5AKYA 4WN9A 2HLDD 1T6BY 5LBTA 1RBQA 1HK7A 2ETXA 1EHCA 2E7ZA 4MYSA 4CKYA 2I6FA 4JI3B 2ES4A 2WWIA 1RLOA 2AIRA 1WHTA 2EGUA 5E1MA 3V6MA 4EW6A 3E5HA 2PGAA 1FRZA 2WZQA 2YOHA 2V5UA 1W0JA 4YLEA 1PX0A 3AINA 4QSMA 1FRFS 3UV3A 2FQ1A 1CNFA 3JY6A 1SBNE 4WA8A 2DUMA 2A9QA 1Q0ZA 3VU9A 4BNGA 1V45E 3NOOA 1MEOA 1LLDA 2F4NA 2HJSA 3CXUA 2YYZA 2B25A 3DVRX 3WTBA 2H52A 1PYDA 4KQKA 4WOKA 4NU8X 4XGNA 3DEAA 4A0SA 4ARZB 1FFEA 1WIWA 2EX4A 1HYEA 1WXDA 4FXOA 4RL4A 3SLKA 4NKRA 2ZIVB 2PWAA 4YUXA 4Q6BA 2X1VA 1BE1A 2ZSEA 4FS8A 4JLDA 3LNCA 5H3HA 4BRZA 2IDZA 2FPIB 1UBHS 3OESA 3FSJX 4BWVA 1S2DA 3G1TA 4C30A 4H4EA 3RIGA 3MXTA 4LTMA 2C59A 5BYBA 3GRYA 4KJZA 5COQA 3ZE6A 4CTOA 2AYYA 2IV7A 5EUBA 1GU0A 3A9WA 5DBIA 4E1AA 4YV7A 1MX1A 3HBMA 3PJEA 3RIMA 5ILOA 3MEQA 2AHRA 3RBZA 2IUUA 3URKA 3AI3A 3CLTC 1WQ4A 3KJNA 4DRYA 4LQCA 3W8DA 4FGUA 2H5EA 4Q6WA 2J46A 2GYWA 2JHAA 3VR4H 1IN5A 4FI3F 2B37A 3BICA 3LT0A 2QM8A 3C3XA 2H16A 4LMPA 1RFGE 2FN7A 3IPLA 4JHLA 4AJPA 3ZDDA 2GEJA 2XT9A 1VPLA 4FGJA 4RTJA 1JDSA 2F43B 3K73O 3E5RA 3CN7A 1SXGA 3NDIA 4B4KA 5IYZA 2IEGA 2ZI7A 2QXTA 3S6JA 1Y98A 2ZJOA 4KR0A 3BGOS 4YMIA 3VR2A 1M2FA 1KOGA 4F9FA 1SKAA 2AJTA 3DDUA 3EC1A 3EGDB 4M89A 4JI1B 1RYMA 3WB1A 4CM5A 4KH0A 1V8PA 1Z9BA 3OVMA 1Y9ZA 3RVDA 4R54A 1VE5A 2BTQA 3V46A 1CD5A 4R01A 4JENA 3RVKA 5L3VA 3BWBA 1Y5NA 2OCAA 1JQBA 1USKA 1NFQA 4MZXA 4MSUA 3GG9A 5BQ3A 4BJ1A 2HH9A 3TLCA 2I7TA 1GG8A 3HH8A 3FMIA 4HAIA 3SDSA 1XLWA 2B35A 2WABA 3T8YA 1Y4SA 1QIHA 3AEZA 3DBIA 1ENPA 4WLUA 2WY2D 1F4PA 5MFPA 1F20A 3VNUA 4I55B 5FQNA 1UXIA 1G2QA 1ZWLA 1FFXA 2ZRFA 3A27A 4B8ZA 3FE2A 4G4GA 2J0SA 3LK6A 4LOLA 5EJ7A 3I28A 2ZU6A 5A9TA 1HTBA 2QNRA 3B1KA 3DT8A 4E15A 1E66A 1ZNXA 1SRRA 1DCTA 1ND5A 4LF6B 2EFGA 2XB2A 4EYEA 3ICPA 4MJ7A 3DJFA 3AT1A 3GRZA 4X61A 4FHCA 3V8RA 5ED4A 4FGZA 4ZU6X 1YONA 2Q50A 1PHPA 4QXRA 3SC4A 4YN3A 1W2WB 4L2IA 1LFAA 3IQDB 1Z22A 1G8FA 5FAXA 1IUNA 1NKVA 2RJ3A 2HWWA 3P26A 4RPHA 4UNQA 1ULTA 1L7XA 1RRMA 5SV2A 2Q6LA 4B6PA 1JYFA 1M73E 1ZC3A 4AF7A 4DMRA 1MN6A 1IQRA 3MM4A 4TS4A 4JOQA 3ROEA 1HKUA 3B3FA 3T52A 4EMTA 1WP9A 3U4DA 4AZTA 3EJ6A 1O96A 4RF3A 1OUMA 2A9OA 5IVPA 3K70C 1N6PA 3AF1A 3D5EA 1E9BA 4H3SA 3IEPA 4TGLA 5ALKA 3DFIA 2UXCB 1IZ8A 2DWQA 3WIEA 2L82A 4BVJA 4F9GA 2ZUBA 1RQRA 5IJZA 1NQWA 2Q49A 4BUJA 3W79A 1BW9A 1HLFA 1PJ2A 3M70A 1T0HB 4GX5A 4YJFA 5AJZA 1BXRB 2OZLA 2PAAA 5T8KA 3UJCA 3H3JA 1UK7A 1AGNA 2Y1WA 4JLSA 3D4LA 3IEKA 4ESEA 5BN4A 2SBTA 3C3JA 3JQRA 5CP8A 1E2MA 3K0CA 3SQNA 2GZAA 5CCBA 4P83A 4W5QA 2X3UA 3KR9A 1G18A 4MQFA 3MWJA 5LUBA 5E6UB 1UXGA 3BXZA 1DTWA 2BR3A 1PZHA 4UXIA 4WK2B 5HXAA 1I30A 2EWVA 5TEWA 3KJGA 4WH0A 1D7OA 4WINA 2RBGA 1XBTA 1HE8B 3O8QB 1YOVA 3ZY5A 1DNPA 1QLHA 1YQEA 2IU4A 1UEXC 3JASB 3P9SA 1M9NA 4G5SA 1IHOA 2OXRA 3CO5A 3IIIA 1OXUA 4LYYA 5IASA 1NVVQ 4FIZA 3VHXA 2XXBA 4LQ4A 2ZBRA 2BCEA 4OHMA 1TCUA 1ZSYA 3DWFA 3HJBA 3R6DA 3ASUA 1TJ4A 1M6NA 5KTPA 1G2PA 2A5JA 4GGPA 3VTZA 3ZNQA 4HGOA 4TZ6A 1IJKA 1RRPA 3H1AA 4RDHA 2YCLA 5GQSA 1BEEA 2OD7A 3QEOA 3HI4A 1QHSA 4MLZA 4JOSA 2MSLA 3P2OA 3KAJA 4BX2A 1EJ6A 2QPLA 3H9QA 2FDCA 4TYYA 2VJQA 4JLAA 3UO8B 1E4VA 1R27A 2C5FA 3IOCA 3IP3A 3L6DA 1E6WA 2E82A 5ER9A 3RJMA 4FB4A 4QBHA 2OE2A 5AOAA 5JALA 2OWEA 1AG9A 2Q9CA 5AM3A 2V03A 3EDMA 3RFXA 5TT0A 1MB4A 1YUNA 1T8TA 1ZH0A 2ZXEA 4R2WA 3I8OA 1IDN1 2W2KA 2I7VA 3E5MA 4L07A 5FOTA 1XO1A 2NTYC 1NN5A 1DQYA 1YA8A 2QUBA 4G0NA 2CHQA 4J1NA 4ZVMA 4DY4A 5IT0A 1JWBB 2C5EA 1JXAA 1UM8A 2XYGA 4BRUA 1Q1QA 3L7OA 3PHHA 4PTYA 3ZE0B 5LOVF 4G07A 3UBTA 2Q5LA 4O02B 1MMFB 2I1QA 2ZIEA 4MR8B 3VDQA 4L7VA 5JPDA 1DAPA 4ZO9A 1U3VA 2R9VA 1RPJA 4NYJQ 2WVJA 1EP9A 1R0ZA 3NHBA 1X7HA 5KYWB 3MWEA 5DNDA 2BM8A 1JHVA 2JA2A 2YVLA 1GL6A 1SQSA 1Z73A 5DGHA 2MR5A 3KSZO 2FPMA 3EBOA 4TLAA 2LCFA 1U1GA 1UPUA 2XNJA 3ANNA 4N7BA 4ZCQA 5ILGA 5P21A 4CCYB 5L7WA 3JXEA 4JUFA 3UY4A 1N3YA 1NKTA 2W0MA 4OMCA 5DBFA 5GIPE 4F3NA 5I9SA 1W96A 2R751 4M0KA 2GN9A 1VLQA 4E4RA 4JS0A 4ZGBA 1DJQA 1YULA 2C0QA 1XNJA 3ABOB 4BNZA 2GM5A 3ZQ4A 1A9TA 1EWTA 1KZ9A 2PD4A 4GEKA 3TLGB 1L5MA 1G8SA 4EJSC 5HR5A 3AFIA 1EEXB 1HM5A 3X1ZA 3TEMA 3JVIA 4NPCA 4XI9A 1EDDA 1ODIA 2ZULA 1D2AA 1RS0A 3EIWA 3N53A 4KN8A 4EZBA 5CCXA 3WYEA 2QSZA 3MJ4A 5TC4A 3NWOA 2CXOA 1SKYB 4YAFA 3VNVA 3Q8WA 4F4HA 3IOEA 4HB0A 1IOZA 1JXMA 1A4XA 2RGNC 3HLYA 2PXXA 2PL5A 2OSVA 3QLTA 1LEHA 5FFMA 1UXHA 4B81A 5K3EA 1NIJA 4FD3A 2ODTX 4LJ4A 3T7EA 4RHFA 1DHTA 1M2GA 1TLLA 1WSBA 3OPYB 1RLTA 3G8AA 1H2EA 4MV8A 5H3CA 3QJYA 1SJ9A 4BO3A 4UBJA 3PTLA 4IXWA 3VMFA 3M81A 2RJOA 3MMNA 2NTVA 4W8OA 4LHVA 4HI0E 4UAGA 1KYZA 2G25A 1GA6A 1ADCA 2EJUA 6PFKA 2G9QA 3GPCA 4I4TB 3VDRA 5EJEA 1WHTB 2M6SA 2DM6A 1KF0A 1LVGA 1U02A 1R0YA 3F71A 3AHHA 4KR3A 4MP6A 5IF3A 2OD9A 4EY3A 4RLHA 4PU0A 3EJWA 1JYSA 3IP7A 3EZLA 4HWRA 3MCWA 3VU9B 3QG1A 2WU3A 2RH9B 2Q2NA 2HRQA 2VBFA 1NF3A 3T1VA 1T4BA 3V34A 2H57A 2H4FA 2Y05A 4TV9A 5KWEA 2QTCA 1O9BA 3FWNA 3HLKA 4NFSA 1STOA 3LC0A 3EF1A 1TVMA 4JT4A 1N2ZA 1MU0A 2X2OA 3REQB 3PVZA 3AM5A 2KBEA 1UKZA 2P0EA 4H60A 1VA5A 3PFGA 3R3JA 4GZ5A 4XUGB 4UM7A 2AR9A 2C3YA 2TRSB 2VAMA 5K3DA 4MEJA 2DZDA 1LPSA 1QP8A 2BN4A 3VKVA 4G5GA 2CF6A 3JQFC 1Z2AA 2WVAA 4DIUA 4CM6A 3C5HA 3T0GA 1F12A 3KQTA 3LU1A 4EHNA 2LBPA 1Z2PX 3HA2A 2FG7C 3HB0A 4Q1CA 3VR4D 4DIBA 4PYJA 3H75A 1PWZA 1E6KA 1T2UA 4Y6RA 4DDVA 3LPLA 1HV8A 1NXPA 2PDAA 3DULA 2ZJ1A 4KDFA 4MVCA 5DGCA 3STWA 2H2HA 4PRYA 3TNJA 3U37A 3GAFA 1J00A 3LGXA 3FRIA 3JATB 4JBGA 2R8EA 4P4NA 3RC1A 5LLDA 3FROA 4XWYA 3FCYA 4OL9A 4YT5A 1L4LA 4OBEA 3EEQA 4PSUA 3P2EA 4JOBA 3AB3A 4Y2UA 5K3AA 4YV1A 5CAEA 3FMGA 1SHTX 2ZGVA 1LPPA 5IYZB 1XEFA 4XOIA 4ENVA 3LZDA 5A0TA 2CKDA 1C7ZA 4PSVA 2ZYSA 2HWKA 4D6XA 4HGNA 3LYAA 1IG0A 1BDBA 4UNIA 4CQJA 3J80A 4CT4B 3BD8A 1JIQA 3G9ZA 4ND7A 4ZOLF 3RRNA 2JAWA 3T7CA 3EGXA 1IYZA 5SZHB 2BPOA 3OQ1A 5KTKA 1G7TA 2XCLA 3COYA 5JIBA 3ON5A 3LSTA 1XVVA 2XKKA 3ANSA 5CDYA 3MLEA 1U63A 1JSCA 3GJ3A 2NGRA 5FUYA 1CZNA 3OHPA 3C7CB 2ZYDA 2R1TB 4D4MA 3OQMA 1Z2NX 1DIOB 1JTFA 1H9BA 2I6TA 4MGIR 3UH1A 3I04M 4GYKA 4HLUC 2XQJA 1GPJA 3VC1A 4HLCA 5FULA 4MIYA 1Z8HA 1KO4A 3HB1A 4DQVA 3HGMA 1JHMA 5CVJA 5I7AA 2W6QA 4HNTA 2R87A 3D8RA 2AFIA 3REOA 1CS4C 5HA5A 5HHTA 2P67A 3TE6A 2YWEA 2IS6A 3L8YA 1E92A 3SFVA 4LYFA 3MWLA 1EX9A 3PXAA 3HMKA 3FCAA 2DU8A 2NSDA 3FMPB 4UM9D 4L2IB 4RK0A 2DPMA 2WWWA 1DWUA 2OHXA 4ABTA 2JZCA 1ST2A 2QW0X 3SHTA 1KXJA 4ZODA 4BLQA 2O5EA 2VEDA 2H63A 3MCZA 1JKMA 3SXUA 2H4WA 3WAKA 1T36B 3A58B 3VQTA 4D4HA 4EVSA 5GINE 3CZQA 4CLEA 3I4LA 3CLKA 2XWJI 1H8HA 1IWPB 1D5WA 1MXHA 1QCYA 2O7QA 2FN4A 2XQGA 3WZ2A 3R3SA 4MCJA 3VXKA 4XUDA 4PNEA 2WTAA 1XMVA 4J43A 3T7KA 4BGUA 1TLFA 3ZWKA 3U62A 2J08A 3JQCA 1I4OA 4U4AA 4DR6B 1YQTA 2BGTA 2ASEA 4YJFB 1G3RA 2HQ1A 3KWLA 4YUAA 2A84A 2JFGA 3NHPA 4P3XA 4DYHA 1E32A 1VKRA 4Q3BA 3TWOA 4ZMRA 4LYJA 5BN4B 3DTTA 4ZEOA 3WC4A 4R5HA 1JKIA 2NZ8A 4F4FA 3DBHA 5IRCD 4MQFB 3ZHVA 3QVLA 3KEFA 4D57A 1I3CA 2AHOA 1GZSA 2ZDGA 1Y8RA 1NLFA 3OZCA 4QD3A 5LN1A 1FMFA 3ZWPA 3HNOA 1KL7A 3G7SA 3M6AA 2GAOA 4D8XA 1DAMA 2HJVA 3BEOA 1M2NA 4DDHA 5JXWA 5DYTA 4ERNA 4X1KA 4C4XA 4R6XA 2Q41A 3CUYA 3EA0A 4DLBA 4YRTA 2CCKA 5AVXA 5EA2A 2Q0XA 3M1AA 4XDGA 4GXRA 4BNKA 5A02A 5JJ5A 1RW4A 3MMZA 1OWLA 2I3BA 5AKJA 2IVFA 2EKLA 2N46A 5BRNA 1C9NA 4GWLA 3JZAA 4K6OA 4UCWA 2LR0A 3RVRA 1J70A 3IA7A 3SMQA 4IR7A 2C7GA 1GZVA 1YKGA 1SUDA 2IXAA 3EW7A 1I4EB 3LJKA 1ABEA 4RVOA 1Q6ZA 1MVNA 1JHUA 4KDRA 2GT1A 5BN5A 1EBBA 2QX7A 1OW3B 3FUWA 2BMWA 2BF7A 1Y5LA 4C76A 4WBNB 1ULAA 5K05A 2VWQA 2XMPA 3KZVA 5IAJA 4G1FA 2DCMA 4TTJA 1P5ZB 1C3OA 5JC1A 1FTYA 3Q5EA 1A4UA 1L5OA 3LXRA 4XPIA 3FPCA 3HM9A 1ORVA 4P0QB 5DLEA 2X76A 2BFNA 2W2KB 3QE3A 4DGQA 5MF6A 3G1WA 1Z15A 1ZEMA 3ZNNA 1VB3A 5AESA 1AK1A 4LDPA 2P35A 1BS2A 4G3XA 4EI7A 1IBSA 1QUFA 1KI2A 1YBMA 4PCLA 1MKYA 1MUUA 4E5VA 1T8YA 5JCOA 1VL2A 3EQ9A 3NKLA 2B34A 3GZNA 2ZDQA 5FOWA 3TAXA 4DIOA 3DONA 3AETA 3PUHA 3MWEB 3NCHA 5FLKA 3N28A 2WT4A 3KM0A 1KJQA 3UMJA 4A6XA 2ERYA 1IIBA 2MSNA 1LDBA 4EJMA 2KI5A 2OCBA 4EDHA 4EGCB 5IC4A 1ZZEA 3QU9A 5FL7A 4Z49A 7YASA 1SCKA 1ICIA 2HV8A 2Z8YM 2PL3A 3UB3A 4BZWA 4QTZA 5JZMA 4GYJA 5IN4A 4NBVA 2MT9A 3SEQA 1TEXA 3IMFA 4GW3A 1HQCA 3A2MA 2VZ0A 4QFBA 4XB1A 4MUBA 3TQCA 3UV7A 2I54A 3AI2A 1GTRA 9MHTA 1MAWA 3IUBA 1PBNA 4ZQFA 5GV7A 3GGCA 4DF3A 5A3QA 2QLBA 1OVGA 5JFOA 1DFGA 4DBZA 1P29A 1GIAA 1Z75A 3I1JA 2GA8A 4YMGA 4I66A 3NW9A 4US2R 1XP5A 3DJYA 3PWTA 2GPTA 3PR1A 4OJNA 4RXUA 5F7JA 5REQA 3GLQA 2EIHA 1FUIA 2YJ3A 1CUDA 1ESCA 3PGVA 2DECA 5B4VA 3DBVO 3FBGA 4D1YA 2YRFA 2W4MA 4DZRA 1ZD8A 1F0YA 1I4TD 2AXEA 2JFUA 3AUJB 4EVQA 1CU1A 3HY6A 5BN3A 1N8NA 4XOUA 1GJRA 1LWOA 4NCAA 1F6BA 1KIMA 2DY0A 3K8YA 5EJ6A 3DD1A 2OQVA 2ACVA 2GUGA 4JC0A 4JYMA 4I55F 1FNDA 4FWIB 1FLDA 5BSTA 1VMAA 1A0OA 1OSNA 2OLKA 3PUIA 3RYHA 2BGGA 3E7DA 4HX9A 1T5SA 1D2HA 1SKYE 2WG2A 1NBWB 1Z68A 3AVOA 2QLJA 3FDXA 3K1ZA 1QIIA 5F23A 3IV6A 4UVIA 4DR3B 5JU6A 4CGZA 1TO2E 5TLSA 1SC3A 1Z56C 2HU5A 2WNSA 4D81A 2J0QA 1X70A 2GJ8A 4CXMA 1WXGA 4PLZA 3WOVA 3GHYA 5T64A 3D3JA 3QUTA 1ACMA 1MNQA 1VG1A 3QEMA 2WF7A 4MVXA 2IXDA 4TLLB 3MWFA 5G4KB 4FQ8A 1MT3A 3ND8A 4N5NA 2I78A 2PUBA 3Q72A 4KO2S 3FCEA 1EFCA 1M0EA 4AMUA 4AY2A 1I13A 4TV9B 4LZPA 2XMCA 1QGDA 2IPOA 4F92B 4MKIA 1UFQA 2IWRA 2OENG 4YRLA 3Q0EA 1VMEA 3DDNA 1CZOA 3F3YA 1MG0A 4NCNA 4CL3A 1VIAA 1IFXA 1XRLA 3D8HA 1AKUA 3GD5A 1A50B 4HB2A 4ARSA 4Z1MD 5JZ9A 2QMHA 4GS5A 2NU9A 3B9PA 5TQ2A 3H9UA 4B44A 3WQHA 4MUXA 1SEVA 3MGCA 4GPEA 4JMLA 4RZHA 1X74A 4Z0HO 1IVYA 5EQDA 1UOOA 1DOAA 2Y4OA 1NXVA 1A76A 1N9GA 2OTCA 1OBOA 1W5FA 5B1EA 1P44A 1ZAKA 3ABRB 1XTJA 1P91A 2K7ZA 2V6FA 4MCAA 3ZGOA 3RFUA 1L7AA 2PJUA 2PLRA 1J7KA 1H94A 3O0TA 4BMOB 2AYZA 4LZNA 2PQ2A 2OCYC 3IKMB 3QMWA 1YQDA 3CSUA 1GPWB 3PSHA 4LWOA 1U0HC 4OVKA 3RAFC 2ZUEA 5ALFA 3NHYA 4GKKB 1R8XA 4PF1A 4L73A 521PA 3VUFA 5CAEB 1YZUA 2JIDA 2QGZA 3MUNA 1QP7A 3QVWA 3W4IA 1U9CA 1A8PA 5DP1A 1AZSC 1BJTA 3I37X 3WIDA 1TF5A 2H1FA 4HMOA 5BSGA 2M6LA 4Q7JB 2G72A 1ZOSA 1CY8A 1KJ8A 4PO9A 4UDOA 4I1PA 2XMQA 1IBMB 1W5BA 3W9BA 4G0XA 1GUZA 2B8WA 3ET4A 4DSUA 3SWWA 1RPAA 5I7OA 3QYPA 5AM4A 2DOKA 2IYNA 2NADA 3OX2A 3VVBA 5IG2A 3EGXB 3I5AA 1CQIA 4CCAA 5BR1A 4OQYA 4TSRA 2IYOA 3A9CA 3DO6A 3ELBA 4QHTA 4QXMA 3I8SA 2YVAA 3I58A 5BYKA 1DKOA 1KDYA 1JIIA 2DQKA 3EVNA 3X2SA 3OPNA 4YPOA 5HF8A 2VYVD 1ULBA 3AR4A 1ZVJA 1AO0A 3DE4X 2IEYA 1JA0A 4RQBA 4KMRA 4KV9A 2C03A 4XSHA 2F59A 1J24A 1PL7A 3MMXA 3AR6A 4OQNA 4TL9A 4DCCA 4EPRA 2OBYA 3UMCA 3K20A 1PFWA 4E6PA 5KSPA 5CMLA 3T3OA 4LJYA 2EWMA 4B6SA 3IP1A 4ZTZB 1THMA 2HSGA 3KR1A 4A16A 1P3DA 2JJMA 5KB3A 2HCJB 2JBAA 3PCXA 3KR0A 2AFIB 4MI6A 2AS0A 4YLGA 3HZZA 4ZVKA 4WEQA 4IS3A 3STVA 1ZN9A 5G1PA 3BJMA 2VO1A 3PT9A 4EW2A 1U9IA 2AZMA 5CT6A 1TCBA 1EKXA 1YZKA 5EESA 3LY7A 5CT5A 1Q14A 5JDIA 4M9ZA 2R44A 1QTQA 1P9OA 1E60A 2D4AA 2RIRA 1ZH4A 2A0WA 3DEKA 2EW8A 2P6RA 2P7IA 2VTKA 3Q2OA 3RSHA 4RLFA 3K16A 1TE2A 4Q9KA 3KOMA 2PKCA 2AB0A 3BM5A 1IMOA 2XCOA 3SXUB 3GEHA 4X6LA 5AVWA 3GFBA 2YN2A 4LQLA 4FM9A 2C2YA 3V7UA 2VT7A 2M32A 4BQSA 4RFSA 4R1NA 1GZ3A 4LJ5A 2XE6A 4YJKA 5TY0A 2YIJA 3VPSA 2XZTA 2XX3A 4FFRA 1QANA 3HUEA 5AM5A 4F56A 4M9CA 4E51A 4UEQA 1IY0A 2QVLA 2AN1A 2QYTA 3CY6A 3BJZA 5I6DA 4O4HA 4QYTA 2R8OA 3U1VA 1K5GA 1G38A 1EBUA 1Q7GA 2E4AA 4FQ7A 1XRQA 2H06A 1XN1A 4FK8A 5HIIA 3JZIA 4ND8A 1KTVA 1S89A 3K35A 1G8AA 1H8EA 2CVPA 3HCBA 4NH4A 1C7QA 4AAYA 1O95C 1ZO8A 5CM9C 2HNBA 2PN1A 3MTGA 4NS4A 4OGFA 1I8TA 1ZUNB 2AE1A 1R0CA 2M2IA 3F73A 1NOIA 2WE7A 3DZDA 1Y8RB 2QP4A 4OGLA 4TXMA 1KE2A 5H9VA 3ESZA 4DKXA 3FTFA 5ES4B 2VN8A 4DSAA 1N2HA 1RM3A 1Z33A 3UAOA 2Q21A 2O8BA 5HZMA 2QL5A 5D86A 2DFDA 1T4CA 1I36A 1IEWA 3CLSD 3UJ8A 3ZHSA 1ACLA 1O9HA 3KCQA 3AERA 4IIEA 4Y2TA 1L3BA 2OP1A 4BPBA 2ID9A 2GMWA 3V4OA 4DREA 3JYHA 5JO0A 2Q9UA 1N3BA 3CH7A 1JKJA 2Q8PA 3KT8A 4X1YA 4URVR 1GFIA 2I2DA 3QA3E 4MJLA 3R7BA 4D2IA 5KWIA 2O3RA 3DDCA 1RLUA 4DEYA 3I1IA 1GG5A 4Q39A 4B3MB 3D2AA 1IN4A 4I4TF 3C1TA 1GO2A 2H1LA 2C20A 1YA4A 3LXMA 4IBOA 4ALLA 2H92A 2HLNA 4UTRA 2Q2OA 3IDAA 2J7KA 2QJFA 2RGXA 1M1NA 4FS3A 4FW8A 3SAJA 5BV8A 5JANA 1NOKA 4IDPA 3KFVA 4XZ3A 5FBRB 3GRRA 4M7OA 4DMUB 1KP3A 2XGMA 1AMNA 2EBUA 1C3OB 2PUHA 2FU5C 4XPIB 2UYYA 1NIPA 1NPTO 4AKSA 2X23A 3FNEA 3GCXA 1UDWA 4JIMA 3R7AA 1LD3A 3FHTA 1RXCA 2GKOA 3MTJA 2VQ6A 4KVFA 1Y0BA 3DQQA 3W3AA 1GTL1 4XARA 1ZGCA 4YP6A 4EG4A 4RCYA 2YMMA 5HKBA 4M37A 3NIWA 4J8PA 3BK7A 3C8UA 4LQDA 2QUHA 3VPGA 1P2TA 2EVWX 3OLWA 2BBWA 4FOTA 4PN7A 2R4QA 3VMMA 1CQJA 4D8UA 4BRWA 1YL6A 3MJVA 1G0OA 5GVSA 3EQZA 1NW9B 2QUZA 1NF9A 2AN3A 2Q9AA 5E0OA 2J1LA 2VDWA 3TBKA 4I19A 1WXXA 3PPXA 4UZEA 2ENUA 1PSDA 2PD6A 2G5PA 1JEDA 2PRZA 3O4JA 3P94A 3GLHB 4YHHB 2FZWA 2G1PA 4UMDA 4OHYA 4JSTA 3AHCA 1JGTA 3NCTA 5JAOA 2H7XA 4GPZA 5CYPA 5IVIA 3OP1A 3M3HA 1NM5C 3TOVA 2WP0A 4LMBA 2MCFA 4D98A 2FSVA 1UMDA 4YUVA 2VP2A 4XCQA 3UHJA 3V7FA 4JELA 4O4IB 5AXBA 4TM7A 1MR3F 2RBEA 3JWIA 3LOQA 2JFPA 4Z4HA 4DDUA 3FOEC 1M2OA 8OHMA 5IYZF 3HFGA 1UFRA 2O3QA 1NUQA 3HDYA 4TMFA 3RH0A 3RRXA 1NL3A 4F2DA 3CVVA 2XE8A 1EFPA 6GPBA 1EFRD 2C95A 1UKYA 1KOLA 4UBMA 5DDIP 1GRCA 3KC2A 5G4LA 2ZAOA 3EK2A 4EJFA 1EA7A 1XNGA 4G85A 1KIFA 3TR0A 3VI4B 3ZVLA 5G0VA 4RH0A 3B3JA 3MIZA 3NHZA 3VR2D 1P2UA 5REQB 4L4UA 5LNK6 1A98A 1F9AA 3EG9A 4J03A 1BKDR 2FXVA 4PM4A 4EHBA 4DW8A 4AMZA 3GUZA 4LBVA 4PZ0A 3GXBA 4R68A 3TKYA 3KJFA 2CLOB 5BN3B 1BFUA 5I7HA 2OEPA 3PYXA 5LU8A 1JR3A 1SUSA 2OFPA 3KE9A 1TRKA 5DULA 2J85A 5IKEA 4WOCA 2VP3A 5TXGA 4ZZIA 3LHSA 2VWHA 1HE5A 1VPTA 3RYHB 4ZDIA 5KPDA 1KBQA 5I5GA 1YUBA 3AP3A 5KJ6A 2C2WA 4BP1A 3Q2KA 5CT9A 5I4KA 1SBIA 3L5KA 3QZUA 4DR5B 3G02A 4BCCA 1S2MA 5I8PA 4CQLA 1UC8A 3F6SA 4KIJA 3KKNA 2ZYRA 4QZVA 2F1JA 1T0JB 4AJKA 4KACA 4HQKA 4AP6A 1U8FO 2FFBA 4FZRA 2FX3A 3QEMB 3MNFA 4X3CA 3U4MA 3GL9A 4F2PA 1CG6A 1N2CA 1ZSVA 1YZFA 5IWAB 3MF4A 5HKAA 2ZRNA 5ELMA 1J1UA 2PSDA 3OCUA 4RMGA 2QLTA 4MWSA 2VKQA 3ZXYA 4Z2YA 4RGQA 3TVTA 1Q7CA 4DDWA 4N7JA 4CLDA 4B3GA 4FCVA 4GUDA 1KQPA 2J5KA 2NO6A 4UU8A 3BB4A 3CR3C 5TQ2B 5FHRA 2NU9B 2ALJA 1L4EA 4ZEWA 1N2BA 3I8XA 1YMUA 1H23A 1EFAA 4B1FA 2Y27A 4B3IA 1QMGA 2YL2A 1A77A 2WLTA 4RPLA 4ETNA 1O5IA 3H17A 1SVKA 1N34B 3COSA 2YTZA 3OQVA 2ACEA 2MINA 5BYJA 3CEHA 4JJ7A 4ZI3A 2VNHA 4LJRA 2W0SA 1O8CA 2WZDA 4J76A 1TTPB 4PAGA 4BV9A 4CNBA 2ZJ3A 4K9SA 2QD1A 4HDMA 4A4DA 1W9HA 1RIIA 2QRPA 1R6BX 2VPTA 1A9YA 1FEZA 1GNPA 4P33A 4LJ6A 1W76A 3T5PA 2B4AA 3RJ9A 4XYGA 4CODB 4R8LA 1AQJA 1XCPA 1ODKA 1U0SY 3P2YA 1MC4A 2WJPA 4RTOA 3EPLA 1Y37A 5B6JA 2DBZA 2RE8A 1CUUA 1TPZA 1Q95A 1UANA 4H7EA 3NKFA 1HX7A 1BXKA 3GNTA 3IR7A 5EZ5A 4OAQA 1TK3A 2A3NA 4CV1A 3PXGA 2BFFB 2H4ZA 3HDGA 4HK4A 5H7XA 2GTPA 2HDOA 4N40A 2OGZA 5D5HA 4UXHA 4BLWA 2RARA 1CQIB 4KDEA 2X2PA 2W37A 4JJ8A 5ERXA 1FSZA 2WUEA 2Z3VA 4BJHB 3FNQA 1H1DA 5DZSA 2QM0A 3Q7TA 3F5MA 3EH2A 3OD5A 5KKNB 1AHHA 1O94C 4UHJA 5IP5A 4A27A 3IQZA 3M4YA 4HG2A 4IOKA 3V9PA 2O8EA 3QGMA 2GPNA 2OCDA 4I5EA 3FA2A 4QJIA 1UUFA 2BKLA 2CBXA 4RTQA 5ICGA 2V3VA 3VNBA 1J0DA 2NMVA 4QELA 1Y81A 1NVEA 1FIUA 1U1CA 3CNNA 3HEMA 3N0RA 1P7ZA 4OSEA 5JSUA 1P3Y1 4LDJA 1JHDA 3NYWA 4ZJZA 1QOQB 4WBNF 1E9RA 2ZRDA 1U3FA 1S0UA 2GJSA 2JBAB 1V6SA 3KKOA 1D0VA 3PDWA 2IQ5A 1NU8A 2X42A 3RFCA 4L0DA 4ZZ1A 1QRUA 2QTVA 3IJRA 4NBRA 3UV6A 3BFXA 1EINA 1YASA 1MABA 1UBMS 1ZKMA 1BFKA 2AW3A 5EMHA 4R2XA 1WVMA 4D42A 3DLAA 2FG5A 3S99A 1DKLA 1XVLA 3WGVA 4C2TA 4HS4A 2NV0A 1RD4A 3HEAA 4JFAA 1T9DA 2PGJA 3K2QA 2KB0A 2DR2A 5K0CA 3OQJA 1EVKA 1GZUA 1XTRA 3RUHA 3OWHA 2O50A 5EJ9A 4JA2A 3KO8A 4TN5A 3M3PA 4BJ6A 2K2WA 2O2YA 1NV8A 5EWLA 1CY1A 5LA6B 3EB9A 4QLOA 3DAGA 3NX4A 4B3BA 1ZGJA 2WK1A 1OI7A 1JDPA 2AFIE 2D0IA 1JPUA 1PEKE 4NZMA 1NQOA 2JGJA 2OAP1 4RFSB 1ZHHA 1JQ3A 4WKGA 3N8GA 2VJCA 4S1VA 2WJYA 1WXIA 4JLNA 2WB4A 1ZG3A 5E1OA 1N6KA 2VTDA 3H9CA 3ZHBA 3WL8A 1PL0A 4H7KA 3CM0A 3G82C 5A1TA 2YW9A 4FZVA 1KAGA 1IXYA 1P5FA 3IUPA 2DWPA 1FDSA 3KL4A 2X6RA 3A6EA 5KX5A 1NP3A 3HKEA 4K86A 4ND8B 4QUJA 3TD9A 7MHTA 2QAGA 1CY0A 1APBA 4WVFA 1RRGA 1LK5A 3IQIX 4KFRA 5L3QB 4JBXA 4XDHA 2NZWA 5K6TA 2WHPA 4KXNA 1Z35A 3S5UA 3H5OA 2H2FA 3G2OA 4P6VF 4B4WA 3DB2A 1CR4A 4AKIA 4K9KA 3IP9A 4OV6B 5K3OA 2WT9A 5JDCC 4W1QA 2REQA 4WZZA 4XR9A 4D96A 3DZGA 5B58C 1T4CB 1KJZA 2ZITA 3LI2A 4N9WA 3VKWA 1XDZA 1Y5RA 3AERB 2HYDA 3GVPA 4NULA 5DTIA 3RB8A 3O9MA 2GBPA 2MR6A 2N0SA 2Q8NA 2WWGA 2RSLA 1GSIA 3I52A 3C4JA 5AHRA 4FW9A 4Y2GA 2QWXA 2HDWA 2B4QA 5BWMA 4X1YB 5HQTA 5JFTA 1K3UB 1KOJA 2CMDA 1FW8A 4YAJA 3PICA 3H6HA 5AVSA 4ES6A 1RI3A 1R10A 5DYYA 3ZBQA 4PXYA 3JAKB 2A1UA 3SS7X 3IKLA 2O2DA 4A8PA 5JJIA 1ZU5A 1NTOA 3HCWA 3NBKA 4WTOA 4MVJG 5K8CA 2GBLA 3M83A 3VSBA 5ELXA 1R9JA 4GM1A 1PO7A 4PC7A 5CH3A 4CM3A 3JR3A 1E9AA 3PUJA 5CG1A 2QRHA 4XJVA 3WGYA 5L53A 1UJMA 3QJ5A 5KSYA 1H3EA 3VZPA 4C0BA 5KTNA 2ZRIA 2W70A 1XTKA 3TE7A 4TV9F 3QFCA 2JFBA 2NG1A 4ZAFA 3DFKA 2AG0A 4MRMA 3FPGA 1O0CA 3QFFA 1YL7A 4D99A 3SEZA 2B7CA 1G8YA 4HUQA 1C81A 1Z4OA 1UT5A 1MC5A 1NG1A 4QOEA 4G9EA 3SIWA 4AY4A 3LVRE 1HQDA 2RJNA 1PSZA 5AK5A 2OFFA 3T7SA 5K20A 5C8YA 3K7EA 1SCQA 4RHEA 1A9OA 1F1BA 4PQFA 3OLZA 5IDVA 2VDWB 4G89A 1V25A 3RVJA 1UWCA 3ADDA 4QASA 2IYUA 3RV4A 4NYMQ 4X7MA 3CN9A 5JV5A 1ORWA 5HZGA 5DBOA 1B6GA 1L1QA 3LBHA 2IIQA 4L9SA 721PA 4NRDA 2FSIA 1J25A 1E2LA 1T6YA 1NQAO 2GKSA 3AG5A 3CINA 2IF2A 3GYGA 3ITDA 5E1DA 5IJ0A 4DV2B 3TX2A 3RS0A 2AL7A 1TFRA 2NACA 5IX8A 1G5TA 2ZR7A 2QM7A 4Q01A 1P9LA 2GYUA 1EFPB 1N6OA 4IJMA 4PHCA 1N7IA 2R65A 2GD2A 1CYDA 1OKKA 1NBHA 2WFLA 5EP2A 2Q46A 3HRHA 2IEDA 3JU3A 3BWCA 2IZ7A 3T99A 5C5DA 3GLIA 3IR5A 2Q3HA 2CT8A 1D2GA 2MOKA 4Z53A 1J09A 2O3UA 1Y3FE 5B57C 3ZWAA 1RYNA 2WU4A 3RSGA 4ZJYA 1R12A 3IPAA 3DMTA 3I6YA 4U2CA 2XTZA 3EG9B 1Z0AA 4OHWA 1V48A 1ZD1A 3EEBA 1OU0A 4Q4HA 5ECYA 4AUKA 4DV5B 5LIPA 4ALNA 1BVUA 3D6FA 1EQAA 2OCGA 1PFKA 1VJRA 5EJFA 2MMCA 4BZXA 2ILVA 1HOTA 1M8PA 5IT4A 4E3ZA 1LSJA 2RGWA 4O6VA 2FXIA 2I76A 4EP1A 1JDZA 4G56A 4EUFA 4MV0A 3PHGA 5A9RA 1Y1LA 4I5DA 4U7JA 2A6PA 1VL1A 2D4HA 3SZGA 1EDBA 4J0FA 3TIFA 1FJGB 1WDKA 1W6RA 3UJDA 1B8UA 3INRA 4WUTA 1OGYA 1T2EA 3BDIA 3BFKA 1OV6A 3T4XA 4BX8A 2ZQ5A 3NVMB 3LD9A 3DFZA 3SR4A 4EGAA 3WSTA 4EPXA 2BFBA 4KN9S 1PR2A 4MX8A 3UMVA 2D0OB 2YMPA 1OILA 1P33A 3O3CA 4I0WB 1L7PA 2HHJA 1OOEA 4LZZA 1BDHA 4OLHA 8LDHA 3VKFA 2BISA 3EAGA 4M8IA 3DUWA 4QDJA 4Q3DA 4AUMA 4QG3A 3BT7A 3IERA 1GRQA 2YBEA 1UT6A 3QWBA 4HZIA 2PMWB 3GDHA 2HHCA 3WKAA 6ABPA 4LVUA 2W6JA 1UADA 1PG2A 2NSHA 3CKLA 1E1KA 2FOLA 2O14A 2WFMA 3E22A 3KLOA 3S2SA 2C98A 3QH4A 2B36A 3G79A 4C03A 1IOVA 1H3NA 2FZGA 2WM2A 3S2YA 2F3RA 4UBIA 3CLUC 1HR0B 2XA9A 2GAAA 5CIWA 2W6NA 1ULZA 2P5UA 1SCUA 1QYDA 1S96A 3QX8A 1R0SA 2MINB 3DAFA 5GAJA 3TQHA 3ZW7A 4AY5A 2IZ6A 1MX9A 1NA5A 2P11A 4RV4A 4RXMA 4Z4CA 3JVEA 4BKRA 2FLKA 3C7KA 2H59A 1R88A 4GOXA 3PIRA 1UFKA 4HDMB 4IF6A 3TRDA 1GVHA 1FFBA 2AC7A 1BHQ1 4TZTA 1H8HD 4NK4A 2R6GA 4JSYA 3ZV7A 1KPGA 5JPCA 1SHZA 3HO1A 1C1YA 2MJLA 3BAFA 1WDLA 3B36A 5F9FA 2P2YA 3NB0A 1SK8A 2HEIA 5ALMA 4GL2A 4ZRNA 2MTBA 4EJ2A 5C53B 4E08A 2ATEA 3RUEA 5K09A 2PUAA 1QYWA 1UK6A 2GLUA 3PRJA 4J0QA 3RTCA 4PC1A 5ALSA 3DV0A 4LSWA 3JWPA 3K0SA 1LSUA 3B3QA 2H1CA 4QFDA 4RY0A 2OBXA 1IZ9A 2R8ZA 4RMNA 1RJGA 4IHAA 4KQGA 2P77A 4GDFA 4OUKX 5CK4A 2Q5OA 4B8WA 5JC8A 2FPXA 2QP3A 1PU2A 4UOZA 4KN6A 5HRAA 2D13A 3WWDA 1WZNA 1BA2A 3GRCA 3QSGA 1E7SA 5AKIA 4DIKA 5CFNA 1WR8A 1KYIA 1AB6A 4EKGA 5JNLA 1CK4A 1HRKA 3EFEA 3CF4G 2QTHA 4MB0A 4Y2JA 5T67A 5T4BA 1G1MA 1RWMA 2YYSA 3EWSA 2EZ4A 5F52A 2O8EB 4UMFA 4KO8A 5D87A 2RB5A 3KUKA 3PQ5A 5AW3A 2W2XA 3DVAA 1V5WA 1QX4A 1P1CA 4BV2A 2NPIA 1L5RA 3D7NA 1NURA 1ODCA 1PGOA 1J99A 2V58A 3EUWA 3PVSA 2VRBA 3HLTA 3SVLA 1C8KA 3UCXA 3JZMA 1SVSA 5TPZA 3ZW8A 2HKIA 1IQ0A 3GR6A 2QTVB 2C7PA 5GIOE 3T5CA 1XMJA 2V9PA 5EPUA 4ZO7A 3AVXA 1MABB 1R0BA 2ZB3A 2IW1A 3GJZA 4P84A 2Y2UA 3E1KA 3W6NA 3QX3A 3TPCA 5IAEA 5A7FA 1JQKA 1Z62A 5D5PA 2VDNB 1BNCA 3H2HA 5TDHA 4W82A 5TQVA 2AXQA 2JGEA 3G7NA 3V8BA 4E2FA 5CFPA 5I7RA 5JMWA 4ZT6A 3L4JA 4K6KA 5JRZA 1FS5A 1VXRA 4M1QA 5BWNA 2HRRA 3O2NA 1UBFA 1TUGA 3SSAA 1Z06A 4MUGA 4CCWA 2IBSA 1WKVA 1U28C 2B0CA 2R5WA 2R6AA 2PYIA 1Z4PX 1MXFA 3KU4A 4QRIA 4RD0A 4YAOA 4KODA 3V4RA 5KNLA 4TYWA 3KTDA 1C7EA 2Y92A 3OKFA 3AR9A 5CVTA 1FZTA 3VC7A 1LBTA 3LP8A 4NLLA 3PXDA 5EWJB 3A1TA 4FC7A 2FY8A 4JYAB 2QAIA 1N1MA 3T1QA 1UXJA 2VEOA 3EVGA 3GYBA 4ZI7A 1YBAA 2C29D 3SC3A 4DPMA 2QUJA 3H2IA 2VTVA 1DI0A 4F11A 2EHJA 2JGDA 1JX6A 1Z63A 1WM1A 4OI2A 4KK4A 1CZKA 5FL7D 1U9ZA 3MJHA 2C4VA 2XPCA 3HKEB 5CB4A 3EZ7A 3RU3A 2GHIA 3JD3A 2LKCA 3C1OA 3VU1A 3R7NA 2PLAA 1LTKA 4XGKA 1Q5PA 2YX1A 1W85A 3CYFA 1JG3A 2ICAA 4HDNA 4LOIA 5CGQB 1R00A 4CV0A 2DPXA 4IHKA 2WHPB 1WMFA 4D56A 4DYDA 4GH5A 5HRUA 1QU2A 1U7HA 2Q3JA 5IH3A 2AFHA 4R1UA 1NRJB 1UBGA 4AG5A 2GLXA 1FSPA 2YVQA 2VQEB 1DFIA 4WCFA 1MOPA 1XJCA 2J4DA 3VZRA 3KQPA 4URXR 2HMYB 2NWQA 3UWDA 4PG8A 5C8ZA 4OM7A 1Q7RA 3IAS6 4L76A 3T4UA 1C9DB 1NHGA 2P65A 4ZCIA 5JADA 2R00A 5F77A 4EITA 2Z6QA 1MO5A 1VKZA 4JJKA 3L1KA 2FUG1 2PT7A 4ZREA 1ZM2A 2Q1TA 4LBZA 2A1UB 3O4GA 3F67A 2NSLA 4EFMA 3NNNA 2FR1A 3BEDA 4Q3CA 2PSSA 4RZ2A 5AI8A 5FKJA 4D9IA 1FW6A 3X2FA 4BHTA 3QKUA 3RM3A 3TJMA 4RVUA 1VPEA 4XUEA 4DJDC 3BZBA 4JI7B 1MORA 1RAFA 1RHJA 2YJNA 3H1TA 3N2NA 2WU1A 4LXXA 4X3OA 5HKKA 1FMLA 1EVEA 2QX6A 2DBVO 1VPVA 2Z8ZA 3A1DA 5J2TA 1J33A 5DF1A 2GK3A 3PQDA 4D8TA 2BFOA 4H3KB 4MRMB 1Z3CA 3A3PA 1R8JA 4FT4A 3DDOA 4LSZA 5A9SA 2I9KA 1YVPA 3QNUA 4CG3A 3RE1A 3PFCA 3NDJA 3SHWA 3PZBA 1XKQA 1PZEA 2PZKA 4QT4A 1IXZA 3G5UA 5C8YB 2IYVA 3KB8A 8ABPA 2AJDA 3N07A 2JAOA 3H2ZA 3OU6A 2FF5A 2G6BA 3CX4A 5JBIA 2P9TA 2PHZA 4FE7A 3TTXA 3OTIA 4EG7A 2AMJA 4XWWA 1PQYA 3KYDA 3NG1A 4LZLA 2ZANA 2VPXA 4YFYA 1NG9A 4GP7A 4TRNA 3HO8A 2FPWA 2OGTA 5IXYA 3GJTA 5JBQA 5KNCH 4HOYA 1M5TA 4NTZA 1ID8A 4O2AA 3NIFB 4ZRDA 3B2EA 2R6JA 3NDPA 3I6ZA 2OCPA 3FRJA 3HSKA 4DQDA 2WMDA 2R97A 3TM4A 1K2VN 3K5HA 3V6LA 3WK4A 2NUAB 4R3NA 4GLLA 4V0LA 4A2QA 4DA0A 4GP9A 5EOVA 3T94A 2JI4A 1DEXA 4G36A 3G59A 4NV3A 1TM2A 4RSRA 3VFDA 3S8YA 2VIIA 3CRZA 1EP1B 1W1UA 2ZJYA 4HYYA 1LA2A 2J45A 1YI1A 3R41A 7GPBA 2C3PA 4HFMA 1FYWA 2BCJQ 1AOXA 1NLYA 4Q4HB 4CM4A 1FTWA 2ZM5A 3ANTA 3VR6A 1EVYA 2UYGA 5JARA 2HZ7A 4CMHA 4KFCA 3TIVA 1TLTA 1NVGA 4ARVA 4NARA 4FZJA 3MT7A 3AVPA 3D31A 1KQFA 4MRSA 1OZHA 1LSOA 3NUZA 4ROSA 1DG9A 2PEZA 3F2VA 1X8LA 1LC3A 1NWHA 4KXUA 3EIFA 4NJMA 5LD2C 4D4JA 3UXYA 1KS9A 5FTJA 1R2QA 3MT0A 5T41A 1IM2A 3LL7A 1LXCA 2GESA 4BWFB 5K0LA 5JYEA 1O4WA 4IHJA 2BFBB 3PK0A 3VV3A 1I4WA 4MAMA 3GOHA 2R7MA 1C4WA 1G66A 1Q20A 3RSZA 4UU7A 1SNYA 3ZV6A 1BXZA 1R6XA 5FBVB 2NTEA 4XKJA 3UW3A 3QHAA 3WP0A 3ZS9A 1JR3E 5DSTA 4R2LA 3T9CA 1U6KA 1V1MA 1WMAA 2B83A 2I33A 3HNRA 3NFRA 4JMPA 3NJ8A 3OQIA 4LZOA 4MWCA 2ZWVA 4ZOEA 3SYLA 3ESXA 4NE7A 5A4DA 5K8UA 4FFPA 3UGJA 1PJ4A 3E22B 2BDTA 5LSAA 5GPBA 1DIAA 2G0NA 5GADl 3WYAA 4JK3A 3MB5A 5HKOA 1NDUA 1VSVA 1ZIPA 2H4JA 2HIMA 2B8TA 2JAPA 3Q3HA 2YQZA 4RFVA 5DV9A 5IM4A 1OF1A 1PLLA 3CZCA 3L6CA 4S0ZA 4I3FA 5KAMA 2LWIA 1YDEA 2JG3A 3DA8A 3OA0A 2V98A 1B8PA 4CKEA 5IAGA 2CJFA 2P9ZA 4F2HA 3KUDA 2F62A 3H05A 3QUBA 1S2OA 4MJ3A 1CLEA 2FVXA 2Q3LA 1B73A 3V8NA 1N2CE 2ZM6B 1NYQA 1RYFA 1S8AA 4O4HF 1A95A 1UKAA 1NXWA 1XAIA 3BTSA 3BE8A 3I30X 3Q8LA 3EEYA 4KIWA 2XJ4A 4X84A 3OH8A 1VGQA 2Q5IA 3EODA 4CDNA 1SAYA 1C1XA 3ZPXA 1W4RA 1VGVA 2D5IA 2DFLA 2WTMA 3DTNA 2PCLA 5C35A 3MZ0A 1SVMA 5A4IS 4LF7B 2WG0A 1Z0KA 3SF8B 2W2NA 4NV0A 3DV0B 1LS1A 3VX3A 4I9NA 4P1ZA 4YCCA 1H8ED 4PG6A 4NNJA 2QS9A 4OEHA 4BNFA 4E33A 3UANA 3FNGA 2BI8A 2YH2A 3DWEX 3L6UA 3IKTA 3AF4A 3WNZA 5BW4A 2DKOA 3A1CA 4DJEC 3UHFA 4OG2A 3E82A 4HNUA 4XB6B 2Q4BA 4B71A 4JLUA 2V7VA 1X7XA 4IQ0A 1EE1A 1M3SA 1X9GA 2HWXA 3PC8A 3RYCA 1GHTA 2EFDB 2ZEJA 3AXSA 4G1EB 4HP8A 4RZQA 4EF5A 1RPNA 2UZIR 1DFHA 1GARA 4L8VA 13PKA 1DC4A 1E59A 1U7PA 2ECPA 1Y4UA 3GUHA 3GMSA 3JALA 2J0UA 3B52X 4UAUA 1AS0A 4C4SA 4DEXA 3ADBA 3DVAB 1QNFA 3OEHA 2B4TO 2JZOA 2KMLA 2X0RA 3PNSA 2PRSA 2DSTA 1LBIA 3ZK9A 3HJAA 4QREA 4R31A 1BDMA 4FGKA 5GOTA 3ZQKA 3L1UA 4ENRA 1PR1A 3A05A 2MSDB 1VB5A 3E1GA 1KQOA 3EVDA 2PSJA 4S35A 5TGDA 4Z8YA 4GOJA 1AVTA 1NW6A 2PA3A 5CVVA 4C5BA 1WW8A 1HPLA 4BO8A 1KZ4A 4GGOA 4B75A 4HN9A 1FSFA 1EK6A 5F7OA 1ESMA 1GA4A 1QZUA 2Y71A 3T3GA 4B2YA 4F04A 5ADVA 5I9IA 3KXDA 5DHTA 3UMBA 1OLXA 1E9CA 2QRGA 4MW9A 1T2VA 1DL5A 1M0TA 3O3NB 1NVVR 2BOVA 4US1R 4X54A 3O26A 4CDGA 1VQ1A 1ZVVA 2INGX 3VTAA 5M04A 3OHSX 3OBIA 2H4HA 1IQPA 1XKTA 2WICA 2C5GA 2QRKA 2X2EA 4TXLA 5H16A 5JXIA 3B6KA 4FMBB 3SR3A 1Q83A 2ZE7A 4AO7A 3WL4A 1FC0A 4V2UA 3P9YA 2C2KA 2FDXA 3CRNA 1L7VC 3CUEF 2NNLD 1MB0A 3DTVB 1YS2X 3KOUA 5L3SA 4EVIA 5CM2Z 1WSAA 4HSEA 4I1OA 4EUNA 4AP5A 4EYOA 3WMXA 2L0XA 4AI6A 4MGHA 1NR7A 2JGDB 1NI5A 5KBYA 2GD1O 4BO5A 4ZHQA 1UINA 1AB5A 3EDQA 3IAAA 4M83A 4V0NA 5D3ZA 4TTVA 1EXNA 5BSRA 2QX4A 2NT4A 3BB3A 3SIXA 2C7QA 3IUSA 1E4EB 4GO1A 3GHHA 1NKSA 2EKPA 4GVPA 2WINI 1Q3HA 1W85B 4HDNB 3PI6A 4L6CA 4C6TA 3JD1A 3DVQX 4BBJA 2XNHA 4N8EA 4AZ0A 2CLHB 5FP0A 1FFCA 1X0XA 4ND4A 2V6JA 2AFHB 1EWVA 1GSAA 4POAA 1NE2A 4RMIA 2OG2A 4X8LA 2R6DA 1O9GA 4YDSA 3PPYA 4ZAZA 4CKBA 2ZLBA 3FMOB 1OFUA 3OKPA 4WASA 1H2HA 1ML4A 3HHPA 1WHSA 3A37A 3EGWA 4XQCA 1CX9B 4XVQA 3AB7A 5E8RA 1NFRA 1E1RD 2AXNA 1WUYA 1OT3A 2H3HA 2P40A 1BYUA 4OXXA 4Y0AA 3E9EA 1HI9A 4EWLA 6LDHA 5KTTA 3FKJA 1JFSA 1N7JA 3FHCB 4LE2A 4EFNA 1EFHA 2R0QC 4FC6A 1HDRA 3KQQA 2F3PA 1P18A 5D6OA 1BMQA 1G5IA 1NW5A 4KLAA 3O8OA 2HW8A 1Y9JA 1OT5A 3K96A 2QW8A 1FF9A 5SY4A 1SXQA 5JJBA 3K6KA 1AKNA 1G7SA 1N4DA 2HU7A 2XUQA 1JR3D 4GI2A 4URFA 5HW0A 1PNRA 1L6RA 2VDUE 4RTNA 3CZ4A 3UM9A 5ALDA 3ISTA 2ORED 1UOEA 2OK7A 3K5PA 1LSSA 2XNDD 1D1TA 4AECA 4QOFA 2FRDC 4WI1A 3ELUA 3QOFA 4C0LA 4M0EA 1GADO 1FP4A 2CD9A 3RGWS 5J2TB 1ZINA 2CJWA 3ZNOA 2HTFA 1RWQA 2JGMA 2V5VA 5AI0A 3EUAA 2VS1A 5E6SA 1BHJA 1ZGHA 4C4TA 5B6IA 2FZKA 1H4VB 2ODNA 4G65A 2L17A 5A9SB 4CW7A 1QHEA 2H1SA 2CXHA 2JLAA 4JROA 4WFKA 2CNNA 1NNUA 4K6HA 4EF6A 5JS7A 4RY8A 2WI8A 2ZRLA 1IATA 5JE8A 4U39A 3EXHC 4FYHA 4UVDA 2E4YA 1RSZA 4MWEA 2ECKA 4HDQB 2IPAB 2XKBA 4NXNB 2B82A 3AVYA 3S70A 4KQXA 5LDDC 3TOXA 2RAUA 1K27A 3HA7A 4UEJA 1XVTA 1U4NA 4Z0PA 1N6NA 1U1EA 3DMNA 4XD7D 1OB5A 2QR3A 5IJXA 2H1OA 1CJUC 4MNTA 5K0JA 1M2JA 1KVUA 1V26A 2VXCA 2NU7A 1FU7A 1DG1G 1XCMA 3OM9A 3VSEA 2PQMA 5DCLA 1AUPA 3NTQA 1H6DA 3ZLJA 1EVQA 5BUQA 5BW6B 1QFXA 4QATA 1PR6A 3EXG1 3R9KA 1ZUWA 4A1FA 4BQRA 3DE5X 1BA3A 1SC9A 4O2LA 1X14A 1DELA 2V7EA 4AMGA 4LEIA 3ZWWA 3MK31 4WNYA 2F00A 2IEAA 4UNPA 2OA0A 1T2FA 1X2BA 3ZHYA 4Z9XA 2ZREA 3P19A 5HUHA 1THZA 4MKFA 4B3CA 2NU6A 4KNVA 3PEFA 3HDHA 4ISBA 4JVNA 4MUFA 1TPYA 1RJWA 1V8DA 1WBJB 1NLUA 4C7BA 4C7OA 3C45A 1SUEA 3JTEA 4JJ6A 3A9VA 1YTUA 1CUHA 2NXCA 1RHKA 2Q7OE 1FFWA 1GFZA 5AHKA 3MAGA 4CM4B 3I9LA 2QRQA 3ZHXA 2BKAA 1MO3A 5EVCA 5KKCA 3F6YA 4CN9A 7ABPA 4GWGA 2PGLA 4YK7A 2VYQA 2YZ7A 2IYXA 1XYVA 2PVSA 4GKAA 3S2GA 2H17A 3OOJA 1E3EA 2ZKLA 3UC9A 2F7SA 1KFCB 4G9BA 3H2BA 4WAUA 1GNTA 4PLTA 4MW1A 4C6SA 3BERA 1N75A 2A4MA 3GLIE 4F4CA 2Q28A 5HJ5A 2HJ9A 1O7JA 5TVGA 1TRHA 3IVXA 4TS3A 1PR4A 3F8SA 2OWDA 1E1LA 2WAMA 4YMHA 3MT8A 3UUGA 4P32A 4IHJB 3JPYA 3CA8A 1BXGB 3AF0A 1BOFA 2C77A 4BX3A 1HDXA 4C07A 1ZW6A 1PEYA 3PFBA 5LYJA 5M3BA 1YC5A 2JIQA 5E4YA 3UCEA 3WB0A 3S8EA 1V1MB 4EHJA 5L40A 1L5QA 3OQIB 4DMLA 3ESBA 3HDQA 1W4BA 2BFCA 1DVRA 4Y30A 3WJ2A 2I80A 1FDIA 3WKDA 1C9KA 1FQKA 3A3OA 1S3SA 4DCSA 1GZ7A 2HQBA 4UCQA 5D7NA 4UEWA 4REOA 1ZR2A 4C4AA 1WG8A 1DBPA 4YGXB 3M1IA 4RHYA 5C1DA 1Z25A 4ZIRA 3ZIUA 3ILHA 4W5TA 4TTIA 2HNAA 4Q7EA 1N2EA 4CKEB 5K45A 4DGSA 4OLAA 1T10A 4NCKA 1QDUA 2KLBA 2GCNA 3F98A 4OP2A 3G5TA 3L6EA 5DW0A 1I4DD 2R84A 4PXSA 2I8AA 2GZMA 3DM9B 4IP0A 1H65A 2ZIUB 5HF6A 3TQOA 4JN6B 1T3LA 4CG1A 4BRSA 3DBOB 2J0VA 1GR0A 3F46A 4K46A 4A6EA 4D3XA 5KX5F 3QK7A 4DLRA 4FXPA 3IAXA 1NP6A 1KETA 3IEMA 1C1XB 3EY4A 1GYPA 4HQFA 3EZ2A 5EFZA 1YR3A 3ZDRA 1XU9A 4E5MA 1JXQA 1KEVA 2P79A 2D2IA 2CXRA 3HYRA 4RF2A 3KZXA 4YECA 2X58A 1H0RA 3IX7A 3N58A 1CT9A 1F48A 1UMBA 1ICEA 1R3UA 4R40A 4ZV9A 3KAKA 5LQNA 4AY6A 5ALLA 3H4IA 3I9JA 4KR2A 5FV4A 1B74A 5LBUA 1Z6XA 1EGHA 2JS7A 1EIZA 1XMOB 4MP3A 2BFPA 3JQGA 3LBFA 3KHUA 3ASZA 1IONA 4HXYA 1PRYA 4LV6A 1D6SA 2W48A 3ENQA 3I3SR 2HHHB 4E13A 1GAXA 2PX6A 4ZICA 3RREA 3GU3A 1YQ9A 3EWNA 3RYCB 3RHSA 2GZDA 2ZBUA 3AGPA 4K81B 4WMLA 3WLKX 1ZI8A 4Y7DA 1AX9A 3AWIA 4I1RA 4Q4CA 1AH2A 1SN7A 3UJ6A 3JALB 3DKKA 3AUYA 3W9SA 4WOPA 3BF7A 3HBLA 2CBGA 1ZMRA 2XWSA 2FPSA 3BBPA 3NHLA 4I6JA 1TW3A 1L5VA 2ZUUA 4PC3A 4Q24A 5FWXA 2RHRA 5F2OA 2QNBA 1Q15A 4CNQA 3B9RA 3AKDA 4JKOA 3HJUA 4QOIA 3UMMA 1ORDA 1CB7A 1Z4LA 4PZZA 2DE0X 1X77A 3DMDA 5KQSA 3EDRA 1GGHA 1NUSA 1MCZA 3GEDA 1P9NA 1OZAA 1YE5A 1W36C 1CUVA 5K03A 1SCJA 2YWXA 3ZH2A 4AK9A 3BK1A 1TUBB 4N8DA 4D3ZA 4EDFA 3HJFA 3RCBA 1DQSA 1TQ6A 1UKVY 3SBDA 2NXWA 2A67A 3DO8A 3FXAA 2KSQA 4JQZA 1DBRA 4X65B 1U3TA 1K08A 1FUUA 4AO6A 3GGPA 3EQ7A 4PCUA 1OLXB 2GEKA 1T2NA 4JCOA 3IIMA 4RAOA 3ESYA 5JXHA 5C8YF 1ZVQA 3TUZC 1ZP6A 1ZCZA 1DUSA 3H86A 4XM2A 2OLJA 3ER9A 4ZCRA 2I34A 2XYRA 2EERA 4WN3A 1KC3A 4ZDJA 3ITEA 4BFSA 5DSZA 1XL0A 5BXQC 5K99A 4C4YA 3AM3A 1VIVA 4YUYA 1WU7A 5L3SB 1QYCA 1ISGA 2VWGA 4DYVA 1UBSB 2QT1A 1QG6A 2XOXA 1CRZA 1IBRA 3CQ9A 2ABWA 4XGRA 4GYYA 3VPCA 1E2BA 1ZLXA 1O8BA 2XF2A 3BMNB 4KSCA 2EQAA 2ZBFA 4TMTA 5H0IA 5BW8A 1JPNA 1SEPA 3IS3A 4ZHQB 3W5DA 2PXAA 2QG9A 1HXHA 2WYHA 2BDEA 2RMKA 4BIIA 1JHZA 2JPDA 1J39A 4LYAA 4KAJA 1S01A 3WI7A 3N70A 3IE1A 2J5XA 1P0CA 2BGKA 1D2EA 1IDOA 1COWA 2GDJA 2G5TA 3TZLA 1UP6A 2ATXA 3Q7SA 4D4IA 2J3DA 2XGOA 3M6UA 1RYYA 4NYIQ 3CTMA 2P6OA 4UD6A 4AZ0B 1P4JA 4EENA 2JFZA 3LC1O 3RHFA 3BFJA 5DP2A 3G3EA 2I4IA 3CLRD 2VSYA 5JVDB 5FA5A 4KXQA 1HA3A 4RY2A 5LQAA 4PSAA 2H31A 2FJ0A 3OT5A 4QG7A 1OKKD 1QHIA 2Q6KA 4QXPA 3G2QA 1VLHA 1XHLA 1WHSB 2M6KA 3OY2A 1HBJA 4B3JA 2XEDA 4LSMA 5CB6A 1CZUA 1HMPA 3TZHA 4I5IA 4B3SB 2Z2YA 2JHFA 2AJLI 1T3TA 4ENWA 4AKTA 5DWVA 4INAA 3R6LA 4UHDA 5D51S 3IDZA 3O8OB 3G6WA 2CMKA 4IQGA 4NBSA 4YRNA 3EW9A 3SX4A 3T1OA 1ESDA 1VCIA 2AFHE 2QJOA 3VR6H 1Z47A 3OQHA 3UCFA 3IQHX 4D3DA 1J49A 1Q7EA 4H0FA 2CGEA 2GWRA 2HCRA 3PNPA 1ECLA 2PVPA 1FDOA 3QUCA 2IBTA 3CUKA 3DCJA 3FFTA 2AC2A 4I1VA 4OREX 1FP4B 3D6TB 3DTYA 2FPPA 2KE5A 2Q3BA 3LDGA 1JBKA 4XIJA 4CIBA 3OZTA 3CJQA 4LY3A 2J6HA 2ZR9A 3TXXA 2A9RA 1DXQA 5AKHA 1D8TA 2JL1A 2J4FA 2BI4A 1ORHA 2JDID 5FUXA 4X20A 1E3DA 4YP1A 3FNHA 5SICE 3SOZA 5IN5A 1RI4A 3PZRA 1OYWA 1XTBA 2YUIA 2GPWA 5AJVB 4Q3AA 5FPHA 2J31A 3NOQA 2W6JD 2FMKA 2ASVA 4GLFA 4IFBA 3D4NA 4LVOA 3QLEA 4GRAA 3KHKA 4IJQA 1V6AA 3UFXA 4FYWA 1LI7A 1KY4A 1LRKA 2PFKA 1FOEB 1NMSA 3GZTB 3EXIA 2D1TA 2GM3A 2G67A 3BC1A 2NU7B 1RLIA 1Y1SA 3GH3A 3DNPA 4PIPA 1YB5A 3L0CA 4WERA 1ZK3A 3K0AA 4N6NA 1MGPA 5D1HA 4AC9A 3C1UA 4BC0A 4CDMA 5GJCA 1U8CB 4GOOD 3UH0A 3OE4A 1IUOA 3GP8A 3FHOA 1JJBA 1DEKA 1L4MA 1UBRS 4OYYA 2EFYA 1JE1A 3UT5A 4CUZA 4G1BA 1YJAA 2XTNA 1QCDA 3AESA 1XFDA 3QNWA 1G5PA 1KU0A 2VDJA 5AW2A 3QXGA 2H4XA 4IH4A 4ER5A 1ZOOA 3K2IA 1XJ0A 2NU6B 4JLMA 4PG4A 1GZ6A 4S2EA 5G3YA 1N1DA 4ZVTA 1DEOA 4EJSA 4C7OB 4YAWA 1Y42X 1WF6A 4JODA 3V8PA 1YHNA 3BSWA 5DKFA 4RW0A 4KRYA 4NDAA 4QA9A 4D26A 4O33A 4G0UA 4BKPA 3QUQA 1V11A 4QYMA 1PJLA 2IUSA 2XWBF 2JIRA 1N9ZA 3LDUA 4QBGB 1Y3IA 4YMSA 5AVJA 3VU8A 4ARBA 1O89A 2RGNA 1PQPA 5DE3A 2QLMA 3AZQA 3KKQA 4XD2A 5K01A 2IHZA 4DUZB 4ME6A 2P9EA 3TRHA 3R1IA 4KMMA 1I2AA 3VYTB 5CLHA 3PDIB 2RCNA 1PVDA 1Z7GA 2BGJA 3FJYA 4NFYA 1C0IA 3G0CA 2P5YA 4G26A 2X86A 1M1UA 1OCEA 3WL5A 4BMXA 4QPCA 4OHOA 4DLVA 2G4CA 4DVJA 2GASA 5LYJB 2QRZA 3MUEA 3I05A 4U3JA 1J1ZA 2Y1KA 4PSCA 4Y6OA 3U5ZB 5KSZA 2NYUA 3R5FA 3EXEB 2ZBEA 2NUTA 5CXUA 2WQ6A 1RWPA 3H83A 5TPZD 2XZOA 5JWHA 3A2KA 4RC9A 5KOYA 3CCCA 3HCCA 1U8YA 3UPDA 2PXHA 1GGFA 3GJ6A 3SDBA 1H5NA 1Y7IA 2BFCB 3H04A 4YJGA 5A71A 3C8MA 1QP0A 4PRLA 2BONA 3W2IA 1I2MA 1GQYA 5CJJA 5CFOA 2JCVA 4FMPA 2LCQA 4E1BA 4JYPA 3VGPA 2QQFA 2BT4A 4M1ZA 1NUPA 4GE0A 3T7AA 3N87A 4W4TA 1QCZA 2PX8A 3U2QA 4EI2A 3HA3A 3IESA 4I6GA 3CVXA 3G0IA 3LTEA 3P2KA 5K2OA 1L8LA 1ISFA 4ALKA 2AV6A 4YYEA 3I01M 3MS2A 1PNTA 2IEZA 4CIVA 4D92A 1ZNWA 3JQFA 3HCFA 2GLTA 3DV2A 4OSPA 2L2QA 3N59A 3A31A 4XTRA 3TUJC 5BT8A 5AI5A 4RH3A 3LFUA 3Q9UA 1L4HA 4FWBA 2QVXX 4R1SA 3ZLUA 5GWXA 1KVTA 3BK2A 3KXIA 4EI8A 3GUVA 1V5FA 1XPRA 3E8SA 1CCWA 4L16A 4P3NA 5EJIA 3X43A 1NUUA 2CUNA 3LCUA 2JHCA 3CZRA 1QBKC 2VSQA 4MWOA 5EWMA 3WGLA 3ZV3A 1Z5VA 2QEQA 4QEDA 4N01A 3THRA 2P1ZA 3K6SA 1XDUA 2IYWA 2NZJA 4HHEA 2NXJA 1CZLA 4IQ8A 5AIAA 4DA6A 2J41A 3SFTA 4OM8A 2DC1A 2XITA 3WJAA 4CZ2A 1WDTA 1TK2A 3AIMA 4R41A 1KWKA 1BYIA 1JPJA 3THSA 3EIOA 2AX3A 4NZZA </