3DLIA

Crystal structure of a sam dependent methyltransferase from archaeoglobus fulgidus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
221
structure length
221
Chain Sequence
b'DYYFLFEEKFRGSRELVKARLRRYIPYFKGCRRVLDIGCGRGEFLELCKEEGIESIGVDINEDMIKFCEGKFNVVKSDAIEYLKSLPDKYLDGVMISHFVEHLDPERLFELLSLCYSKMKYSSYIVIESPNPTSLYSLINFYIDPTHKKPVHPETLKFILEYLGFRDVKIEFFEECEELTKLAKIDSNTVSEEVIRVINENIEKLNRILFGPQDYAIIAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords methyltransferase
publication title Crystal structure of a SAM dependent methyltransferase from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
total genus 71
structure length 221
sequence length 221
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dliA00
5GINE 5HEKA 3MQ2A 3TOSA 2CKDA 2EJTA 1EQAA 3GGDA 3SVZA 3KQMA 1NBIA 3G2QA 5EG5A 3MB5A 4RVGA 5HIKA 4PIMA 3TR6A 3CJTA 3PFHA 5EQJB 5FWAA 1QYRA 4PINA 1YF3A 1NW8A 3ORHA 2ZULA 3HCCA 2NXJA 3GRVA 2NXEA 5T67A 4BP3A 2ZZNA 3QOWA 5CVUA 4ZTBA 1UIRA 4QVGA 3P2KA 3FYCA 3LBFA 2PX2A 3DMGA 4IV8A 4F86A 3C0KA 4U7PB 1JG3A 5CCXA 3AWIA 2VP3A 3SSMA 3KQWA 2YR0A 2IDJA 4RTNA 3UBTA 2JH8A 3LDGA 5DX0A 2GPYA 1XDUA 5EMMA 4ER7A 4OX9Y 3C3YA 5DM1A 1G55A 2JHAA 5CD1A 4RTLA 1JQ3A 4RYLA 4RTSA 4YUWA 1RJGA 3O31A 3ELWA 2YXDA 4FT2A 4KW7A 2OZVA 3DLCA 4CWAA 5GWXA 4YUYA 1NBHA 3DULA 1D2CA 3GU3A 4HTFB 5EGSA 3RIEA 4M37A 3REOA 4ISCA 2F8LA 5FQNA 3CKKA 4YMGA 5FQOA 3ELYA 1D2GA 1QZZA 1JG1A 5EMLA 3SXJA 5CVDA 5BXYA 5CVJA 2IH2A 3FPEA 4F84A 3OU7A 3P9NA 1FP1D 5BP7A 3ME5A 3Q87B 1NE2A 2P7IA 2HTEA 3OE4A 4R6WA 2ZIGA 5EEGA 4BY9E 3V8VA 3NWEA 5DTRA 1ORIA 3HA5A 1AQIA 2EX4A 3PS9A 3TKAA 2V74B 2EFJA 2NP7A 2I9KA 2FPOA 5K8VA 4MQ4A 1IXKA 1KYWA 2O05A 2KW5A 3DMHA 3HVIA 3FRHA 3JWIA 5K0BA 3EVEA 2G71A 4OA5A 3B3FA 5GIOE 5ICFA 2ZWAA 5HFJA 3KPUA 1RI4A 2G72A 1AF7A 1SKMA 4ER3A 1FP2A 4RX1A 3NVKI 2WA1A 1R74A 5EOVA 5E8JA 2JG3A 1ZKDA 5EZQA 1FJXA 4M7RA 3C6MA 1PJZA 1U2ZA 3LBYA 1FPQA 1ORHA 1YB2A 2G1PA 2YQZA 3G2PA 1R8YA 5JR3A 3HEMA 3GXOA 2K4MA 5EIFA 4R8SA 4RSRA 4EMSA 2VDWA 2BM8A 2FRXA 2PX4A 3A7EA 2IH5A 5C1IA 5KQSA 5DSXA 4PYOA 4E2YA 1QAOA 2IBSA 2XYVA 2Y1XA 1WY7A 3K6RA 5IH3A 4PCAA 5CUQA 1VBFA 2PGXA 4AZSA 4AUKA 5C9ZA 2VDVE 3KQQA 4YV1A 3BGIA 4DF3A 3GWZA 4KDCA 4RWZA 3MAGA 5GM1A 1R00A 2FHPA 4GOND 3TPZA 3KQTA 4KIFA 5K0NA 3E7PA 2AN5A 2P3LA 4NECA 3G88A 3BXOA 3EVDA 3OE5A 4RTKA 2B9EA 2NYUA 3EVAA 2I7CA 2A14A 2FCAA 3TLJA 2IPXA 2GAFA 4P58A 1JQEA 3CGGA 3E05A 4PYKA 3M6VA 3THSA 4IWNA 3OZRA 7MHTA 2UYOA 3TM4A 4AZWA 2ZZMA 4WVLA 1VP3A 5K0GA 4RVFA 4JXJA 3KHKA 2PWYA 3SX0A 1RI2A 4CKEA 2O07A 1P1CA 2FYTA 3DP7A 3MCTA 1HMYA 2YXLA 3FUWA 3NDJA 1XTPA 4DKJA 4MWZA 3O4FA 3SM3A 4EKGA 5DXJA 3FTEA 3B7PA 1NW7A 3SR4A 2XYRA 2PBFA 3OU2A 2ADMA 1NW3A 3HNRA 3CJQA 3G5TA 5JUWA 1NV8A 3C6KA 3DUWA 4P7GA 1M0EA 5LQKA 4DCMA 4ER6A 3UJBA 3LECA 1D2HA 4PGGA 4RTJA 3GDHA 2JJQA 3BKXA 5DSTA 2R6ZA 5ICEA 5GM2A 1VLMA 3BZBA 3KKZA 5KYGA 2B78A 4DQ0A 4E2WA 1QAQA 2JH9A 4HSGA 4PGHA 4GC9A 1KIAA 4V0RA 4CTJA 3HCBA 2GLUA 3NJRA 3G2MA 3PX2A 5DRTA 2UZ4A 2C7OA 2HV9A 5HIMA 1KPHA 3A7DA 3KU1A 4PYNA 5EZSA 5FHRA 4E31A 1M6EX 4MIKA 2PT6A 1EIZA 2ORED 5F2KA 4C04A 1VE3A 4XUCA 3TRKA 2ZBQA 3P9KA 4AZVA 4XUDA 4GC5A 5LR6A 5DT2A 3TM5A 5HILA 3P71T 3E8SA 3QOXA 5EIWA 4X41A 2OPBA 2P1DA 2OB2A 4EKIA 5CCBA 4CXMA 3VYWA 2NXNA 3CVOA 3OCJA 3EGIA 4X63A 2BR5A 3TFWA 1R18A 3KR1A 4R8RA 2AOXA 3AXSA 4GQBA 1XXLA 3GRRA 3MCZA 1P1BA 2OXTA 5BW4A 3R6TA 3FTFA 1HNNA 1WS6A 1XDSA 4IV0A 4X60A 2ZW9A 2ZBPA 2C7RA 1IM8A 3GIWA 2AR0A 2NP6A 3P2IA 3SMQA 1FBNA 5K03A 1KP9A 3OFKA 5GIPE 3AJDA 1RJDA 1YUBA 1RJEA 3X0DA 3B3GA 4FR0A 4E2XA 2FK7A 3ER8A 3V97A 4AZTA 2ZFUA 5LQCA 2AN3A 3LKZA 2PLWA 4HGZA 2AOUA 3BWCA 3UWPA 4QPPA 3JWHA 2BR3A 3D2LA 4HG2A 2O0LA 3VC2A 4GF5A 1SVUA 4A6EA 1G6Q1 5K0CA 1SUIA 2PSSA 2PV0A 1XCLA 4PYMA 3TMAA 3A27A 3KQYA 3P9IA 1I1NA 2VDUE 2AOTB 2CMGA 4QQKA 4U7TB 2OB1A 3ID6C 4P7FA 5D1HA 5EHIA 3EGEA 5F2NA 2B2CA 4QVKA 2IGTA 4FGZA 2BH2A 3BWMA 5FA8A 4FSDA 2G8NA 2PY6A 3FPJA 5EKXA 1YFJA 4Y2HA 1X1AA 5HOQA 2PXXA 3NW9A 1WZNA 2ONYA 3G2OA 1ZGAA 1G8AA 4R6XA 5KQRA 1R6AA 2V7EA 4PYJA 2AVNA 2O06A 4H0NA 4AX8A 2VS1A 3GRYA 1XJ5A 4YV0A 3DLIA 1KPGA 3UJ8A 2UYHA 2OO3A 2CMHA 2GA9A 3TQSA 2Z6QA 3HCDA 3M33A 1PRYA 5F2OA 3CCFA 2YTZA 3GNLA 2ZCJA 1F38A 3O7WA 3U81A 1ZG3A 3I53A 3LDFA 3FTDA 3OFJA 5E9JA 1IY9A 5E1BA 3DTNA 3B89A 1X19A 4MHTA 5FADA 1L3BA 1O9HA 3T7RA 4DCGA 3H2BA 3ANXA 3HP7A 3HCAA 3R3HA 2DPMA 1M6YA 3RW9A 3DXYA 1VQ1A 2AOUB 3AY0A 3PFGA 3FZGA 4UOEA 3EVGA 1O9GA 1NW6A 5E1DA 5EHGA 2E5WA 4E33A 4YV2A 3BGDA 3G8BA 3B5IA 3K0BA 5T64A 3KPVA 4CTKA 1TW3A 2XVMA 4KIGA 1INLA 4K6MA 2I6GA 1N7IA 3PX3A 2H11A 2JHPA 3ELDA 3EGVA 1NW5A 2EG5A 1VIDA 3FTCA 3KPJA 4PONA 2Z6UA 2AZTA 2CL5A 2HR1A 2QE6A 3T7TA 4POOA 5KVAA 1KHHA 4LWOA 2CWWA 3FPHA 5K0FA 1WG8A 1BHJA 3R0QA 4RTQA 2QM3A 1KR5A 1X1BA 3BKWA 5FUBA 3CJRA 1EAMA 1SUSA 2O57A 4MTLA 4V0QA 2P35A 5T6BA 2PWPA 4RTOA 2IH4A 5DWQA 4P7KA 3LL7A 2R3SA 3G5LA 3HVKA 4C4AA 1MJFA 2PKWA 5EEHA 5E2BA 3OU6A 3M6WA 1EJ6A 3KQSA 3MHTA 2YUIA 4L7VA 1SQGA 2GB4A 3LCCA 3UFBA 5ICCA 4OA8A 1L3IA 2IDKA 3HVHA 2GS9A 3UJDA 3R9XB 2ONZA 2ZBRA 3A26A 10MHA 4GBED 3FPGA 3M6UA 2ZSUA 1X1DA 3BGVA 4HC4A 4RVHA 5H02A 4EQZA 4HH4A 1Q0TA 2ZTHA 1QAMA 3HA7A 5K05A 2AS0A 5GOZA 1YZHA 1WXWA 2P7HA 1JTFA 2PXAA 5ICGA 2OKCA 2JHCA 1DCTA 3EVBA 3FUUA 4KRGA 3DOUA 4P7JA 1KXZA 4XCXA 5DPMA 5G02A 5LSAA 4HTFA 1SQFA 3BWYA 1L9KA 4PIPA 2ZWVA 1UWVA 1V39A 1Y8CA 4QPNA 5K0EA 3R24A 3F4KA 1DL5A 3LDUA 1Q0SA 3FUVA 4C08A 4PWYA 1XDZA 4G56A 2PVCA 3FUTA 2C7QA 3I58A 1KYZA 2XBMA 5U4XA 3I9FA 3LKDA 3VC1A 2IBTA 3EMBA 5HZMA 4GEKA 3PTAA 4QQNA 3UJ7A 4KDRA 5BW5A 2ESRA 2Y1WA 5K0JA 3G89A 3LX6A 3LCUA 3OZTA 4YUXA 5E8RA 4LECA 3E23A 3QV2A 9MHTA 4PYQA 2FK8A 3LPMA 3KR2A 3KQVA 5HIIA 4X1OA 3G8AA 1YFLA 5E9QA 3FYDA 4ATNA 2AN4A 1JSZA 3EMDA 2BZGA 4M38A 5CM2Z 3UJCA 3JWJA 1JSXA 5LQAA 2WA2A 3KQPA 5KS2A 3GCZA 2YVLA 2IFTA 5MHTA 2P40A 1RJFA 2ZVJA 1EJ0A 3FRIA 3CBGA 1RI5A 3LHDA 5P8WA 5D1NA 4Y30A 1B42A 3THRA 2OBFA 2YXEA 1SG9A 4PYLA 4F85A 3HM2A 1H1DA 4ER0A 3KR0A 2ZZKA 1P91A 3MTEA 4BLUA 1NT2A 4E70A 3EEOA 1RI3A 3NWBA 3IV6A 3UJ9A 4DM3A 2LD4A 4XUEA 3S68A 4X61A 4YUVA 3ERCA 5EMKA 4FSXA 4DZRA 3SSOA 5CVVA 3P8ZA 3UA3A 3LSTA 1ZHFA 2PT9A 3G7UA 5DTQA 5CIYA 3DMFA 3IYLW 3HCFA 4GOLD 4KWCA 4C06A 2AOVA 4FT4A 4E30A 1L1EA 2BR4A 5DM0A 3PLAE 4BP1A 2ZIFA 4RTRA 1ZQ9A 1G38A 3KR9A 4DA4A 2QRVA 3GJYA 5EPEA 5FWDA 2C7PA 3BT7A 3VSEA 2HNKA 3PT9A 4C03A 1ZGJA 3M6XA 4C07A 4EK9A 3ELUA 2ZLBA 5K01A 5EVJA 5DM4A 3BUSA 4CKCA 3NDIA 4ER5A 3GO4A 1R8XA 1QANA 5EMJA 1NV9A 5E1OA 1O54A 3A25A 3HCEA 3MGGA 3C3PA 1XCJA 3AXTA 5K09A 3P9CA 3ER9A 4OBXA 4WXHA 3EVCA 1G60A 3HTXA 1AV6A 4OBWA 3GRZA 2VZ9A 2P3QA 2PJDA 3FPFA 3T0IA 3HVJA 4RV9A 3L8DA 2NXCA 3UJ6A 2AOWA 4M36A 2BM9A 2GH1A 3OPNA 2PX8A 3MTIA 3EPPA 1F3LA 4O29A 5LQNA 3BWBA 4B17A 5LQRA 3NMUF 2XYQA 3M70A 3CC8A 1DUSA 3KQOA 1AQJA 1VL5A 2EJUA 5EC8A 4YUZA 5E1MA 8MHTA 3A4TA 5FHQA 2UYQA 3IHTA 5DX1A 2Q41A 3LGAA 4OQEA 3NVMB 2DULA 2QY6A 3IEIA 2HMYB 4GOOD 5M5BA 3NTVA 3UA4A 1X1CA 1L3CA 3JWGA 3P2EA 2IP2A 2G70A 4HRAA 2I62A 5DRYA 2B3TA 5FCDA 4E32A 5DTMA 1MHTA 3KPWA 5IKMA 4EVIA 2AVDA 2YX1A 5FA5A 3UZUA 5EKUA 1UFKA 3EVFA 4A6DA 3Q7EA 2UYCA 4PCLA 1KPIA 2HWKA 3DH0A 4IKPA 2NNWB 4LG1A 4BLVA 3LCVB 2Z6AA 3PVCA 4LWPA 4PYIA 5DXAA 1BKYA 5E9WA 2QRVB 4QDJA 3P97A 3SGLA 5FULA 3SSNA 5K0LA 4DMGA 1N2XA 3T7SA 1RI1A 2ZIEA 1G8SA 2PXCA 2XVAA 3WSTA 4FZVA 3I64A 3KPYA 3DR5A 5C0OE 4E2ZA 4GOMD 3EEYA 2P41A 1XVAA 3UJAA 4RVDA 3HA3A 2H00A 2PX5A 1VP9A 1I4WA 3EVZA 1NKVA 3M4XA 5CVEA 5LQUA 3OZSA 5ERGB 5DLYA 4RTPA 1JR4A 1BOOA 1TW2A 4KVZA 4CKBA 2B25A 4BLWA 1BC5A 3I5UA 4YMHA 2ERCA 5GP1A 4Z2YA 2P3OA 4QTTB 4FS8A 2OYRA 1OR8A 1WXXA 2IIPA 1I9GA 1EG2A 5B1SA 3RODA 3MERA 4C05A 5LQJA 3DXXA 1Z3CA 2H1RA 3DXZA 5DX8A 1JQDA 2QYOA 4QDKA 3TKYA 5FTWA 2P8JA 4FP9A 3FUXA 4GUAA 1T43A 1VPTA 4OQDA 5HIJA 1YZ3A 1JG2A 3PB3A 4R05A 4PNEA 1P39A 5DM2A 4RTMA 3B3JA 4HGYA 5E2AA 2WK1A 2N47A 1TPYA 1N7JA 2OY0A 3GRUA 2AOTA 1JTEA 1JG4A 4QTUB
chains in the Genus database with same CATH superfamily
1X7GA 3V8EA 4LXUA 3CEJA 5K8CA 1L1RA 2O2EA 3JYPA 4N8EA 5AVVA 4OX9B 3KAJA 4QM7A 3G2QA 2NU9B 3SNHA 2GM4A 5IC6A 4CM5A 4O25A 3BTVA 5K3OA 1QX3A 3UB4A 5I3CA 2KS6A 2VIIA 1W34A 3UTCA 1N8KA 2PQ0A 2ZB2A 4QUBA 4Y2YA 3QOWA 3G2KA 4M8SA 4OI0A 4ZTBA 1SC9A 5IAGA 1OIVA 3RVLA 5C8ZA 4RDCA 5JAPA 3LBFA 4QOGA 1MO2A 2PEYA 1UOQA 5ECDA 6LDHA 3QE9Y 1PVVA 1W1WA 2YL2A 4IOKA 4JP8A 2A5LA 5A03A 2X7HA 1H6CA 1R15A 4ZDIA 4GH5A 4HEJA 1GRNA 4LA4A 1XMJA 4KXUA 1U5BB 2YMQA 5HX7A 4N41A 1ZIPA 4CKBB 2BD0A 1G55A 2HTFA 5KPJA 2PV7A 1QGUA 4MUXA 4L08A 4ZT5A 1Z68A 1T9HA 3DLBA 3PUWA 4LYDA 7REQA 4IUCS 3VPGA 4FEYA 1H66A 1KYQA 1NBHA 1NQVA 4GLJA 4K46A 5ITWA 3UIEA 1MBZA 2D6FA 4PNHA 3REOA 1UP4A 1WV1A 3GOQA 4QEKA 3SEFA 1D2GA 2VHVA 5LUAA 5BXYA 4B3SB 3OZBA 2M9MA 2C5EA 4ITVA 4XASA 5D01A 1P19A 4JYZA 2F3PA 3T5GA 4QYIB 1G3QA 3ANLA 2YY6A 2ZSJA 2FX5A 1XMIA 3HMQA 3OE4A 1E2DA 1YOVB 1D0SA 4WX2B 1XU9A 3ZNNA 2FEMA 4MCAA 3F2VA 1JE1A 2VP6A 1U1DA 5LYJF 3IKMB 4RF4A 3ROXA 2NP7A 1YJ8A 1ID8A 2WWHA 5JARA 2F8MA 1KYWA 4NNOA 4GBGA 1RHQA 2C2OA 4TM7A 2IYQA 3R3JA 1VYVA 3JVVA 4KE6A 3KXPA 3FFAA 1SCBA 3OMWA 3P4YA 3QPAA 4MQFA 1IBSA 3TBHA 1E8MA 4H7PA 1CEQA 1P5RA 4PG4A 4FFPA 4IHKA 3KYIB 3R74A 3DYVA 1SURA 2HIHA 1PYGA 1Y3FE 2WIAA 1CW2B 1EP9A 1GG9A 3C3DA 1NWHA 1UC8A 1D2MA 1WF3A 1U2ZA 2UYGA 3A70A 4ZARA 3TWOA 1ZH4A 4UDOA 4DLZA 3JQGB 1WTAA 3IQIX 1KI7A 2ZTSA 3FDJA 2O2XA 4MA0A 2HK7A 2CXHA 3QM1A 5HR5A 2QUHA 2DT8A 4B82A 1JDVA 4JK3A 4DLSA 2GNAA 3CMMA 1XVLA 3FGOA 3ITNA 3LUFA 3MJCA 3AUFA 3Q5EA 4LYGA 3SQLA 4BAZA 3BN3A 2C5LA 3RU9A 4ZP1A 4YV1A 4QC2A 4EB8A 2E5LB 4X20A 4J1QA 3IMEA 1GQ2A 5DW3A 1DNPA 2ES4A 3DA8A 5F33A 5JDCC 1XT6A 3VDNB 3ICWA 4NECA 5CLFA 3KFLA 2B9EA 1CUWA 1MH9A 2IRWA 3EVAA 3GUHA 4XVQA 2BPOA 2EEPA 5IAJA 5KYYB 5GVRA 1QYDA 3QI7A 2GAFA 4JR1A 4PYKA 1YRWA 1RRPA 3DEYX 3IIEA 3MWGA 2QRPA 3H84A 4DCJA 5LWQA 2G9VA 3LK7A 2W2MA 3OCYA 4D6PA 5F35A 4AXXA 3CCBA 3BFVA 3KHKA 4BDSA 3ZHVA 3E3OA 1XEWY 4NI5A 2PWBA 2QJWA 13PKA 4MVJH 3KT3A 1GKYA 3OUTA 1M34A 3BQNB 1XTPA 5FFFA 3ZQJA 1GKKA 3O4RA 1PZHA 3WL7A 2E37A 3DMNA 2PKQP 3PGVA 1IZYA 4IHJF 5KX5B 4I4TA 1KA9H 5DISB 5SZIA 2BGNA 1VPLA 2GJ8A 5FI3A 1VSBA 3A3NA 3JALA 5D3QA 5JLAA 1QGAA 3HKEB 5JEDA 5ICEA 2R6ZA 4R3NA 4JP2A 3VU1A 3ZY5A 1PG5A 3ROZA 2QQEA 3PZBA 5CLIA 4I1PA 4RZ3A 4V0OA 2AG6A 4BB5A 5J2TB 4L85A 1ESZA 4KQXA 4HVCA 1GSOA 4UEQA 3X2SA 2XGOA 3G6KA 3KU1A 1Z22A 2CNLA 2PT6A 3QFCA 3EXAA 2H3EA 3ILXA 4OFWA 2E4UA 1UPCA 3IXLA 3E5NA 5E4FA 3R1IA 2O2YA 2OGZA 1ILEA 1UOEA 4K9OA 5LZ8A 2L69A 3V4OA 4YALA 7GPBA 4UBIA 4X41A 2Q6TA 2QZ4A 1JWBB 2B1QA 4KEAA 1L4UA 1U7ZA 2YJ6A 1UWCA 1WHTB 1GTSA 1E89A 3NHZA 3AR9A 4KN9S 1AO0A 2Q1XA 3I8XA 3H04A 1NBMA 3NBFA 1O95D 1BE6A 4DARA 1KZ7B 3UWSA 3IEMA 1Z6PA 2E85A 2CXTA 3FCYA 4PLHA 1M5UA 1A8UA 1N2CA 3VHRA 4EGFA 2O54A 1Z07A 2X23A 4IF6A 4OUDA 1CR1A 3LK6A 4D8VA 3WBFA 4C01A 4QG3A 4R68A 3WVNA 2ZIWB 1UPFA 5CDTA 1CYEA 1YH3A 1NDQA 3VX3A 1OFTA 5BT9A 4D98A 5LQCA 3A9CA 4MUEA 3KUXA 4QATA 4FYHA 5KWVA 3A36A 3D3KA 2G0NA 3GVCA 2H4JA 4IJWA 4YTEA 3AF2A 3VXKA 1AKMA 1KVQA 1RKBA 4A26A 5JDCA 2ZQ5A 2O0LA 3OWHA 5EJ4A 1FYFA 3H86A 1XROA 1O96A 4WCFC 1V5IA 5M3BA 5AKKA 1I1NA 2FX2A 5DNYB 1XYVA 2WJYA 3JY6A 3TJRA 3EGEA 4LCBA 4HGRA 2IGTA 3BWMA 1OD6A 1SBQA 4BCDA 1Z5VA 2I8AA 3W6UA 3B53X 5EIHA 4B5LA 1KI6A 2D5CA 1YFJA 3NXSA 2QPTA 1KAQA 3NW9A 5H80A 2HA5A 3GLUA 2R8OA 3HDGA 4YJFA 2VDKB 3OFVA 3NT5A 3JAKB 4DV1B 4EHNA 3QVVA 4AX8A 3K9QO 4BJ3A 2VT7A 4Y2RA 5JMWA 1U90A 4AMGA 5HUQA 1ZVKA 1L2TA 1QK3A 1ZUNA 2R60A 4NCHA 3CCFA 2XV1A 3TTWA 1NJ1A 1RHKA 3KUDA 3I05A 3A1CA 4LXGA 4NTZA 4FC6A 3S5JA 5FORA 3LGSA 1TF2A 3QFFA 2Q7OE 3TTSA 2J5KA 1VL6A 3DZFA 5I01A 5IPFA 5IT4A 1AGYA 5CP8A 3G13A 2GCIA 3HWRA 1ZVQA 4ZOQI 1L3BA 5KHAA 2REQA 3K92A 2PR2A 3E2MA 2KHZA 4MX8A 2ZI7A 3E9ZA 5LBIA 3S8MA 1QF9A 1TDJA 4EB6A 4EPYA 4LEIA 1VQ1A 4NY1A 3DOIA 1WVIA 1AURA 3GAFA 3IH5A 3PR3A 1RM5A 3BWVA 1CB7A 2RFLA 1AN9A 3OBBA 4MAAA 4PZ0A 4Y6OA 1RXSA 5EJMA 4JLBA 2CNOA 4N03A 2F1KA 1NR7A 3KFXA 3T7IA 2IPNA 2PK3A 5JZSA 2DERA 2PBZA 4KIGA 4K6MA 4F5ZA 1CVIA 1F06A 1SC6A 3AONB 3BXGA 3L93A 3PXUA 3AR2A 4H1VA 4G25A 1J49A 4OP3A 2XOXA 1VIDA 1E1NA 1XU4A 2B5WA 4PONA 4X7RA 5AK4A 2HJVA 2XSZD 3BDVA 4NK5A 4YJHB 3SFTA 4CM1A 4POOA 1NMZA 1WR8A 2K6GA 3D3EA 4LC9A 3BJRA 2B69A 4IHAA 3QMMA 4OOFA 1QB7A 2QTNA 2YN2A 3DOJA 5DYTA 2RAFA 2JIPA 4C88A 2II6A 3NPMA 1IVNA 1PR0A 2HSWA 4LWQA 2O3QA 2JI8A 3ZJ5A 1ZD1A 2BFEA 3Q7IA 4UTZA 1G5TA 4BJ5A 2R0QC 4DMKA 3H2HA 3MEQA 3PEYA 2R79A 4WRRA 1SVMA 4FNOA 3WLJA 4QU9A 2G0TA 1O58A 1MAAA 1YQ9A 1A7UA 4I0WB 5EP1A 3UJDA 1SVLA 1ZUWA 3A26A 3SBOA 3KTAB 3EQ6A 1PZMA 4I1RA 4WCFA 2VJBA 3PQCA 3UK6A 4V2UA 3BD8A 4MEAA 5FTNA 3MUFA 1DJQA 2ECQA 1QVVA 4FC7A 2FLWA 4PO3X 1EEHA 2HLDA 4ZV9A 4UTXA 4EEXA 1EWQA 5HHTA 1JFLA 421PA 4LHWA 3C3CA 3MOSA 2VBIA 4N1AA 1AQYA 4J07A 4J7CA 5AI4A 1I32A 1G4AE 3RRFA 4P3OA 2WPNA 1G8YA 1NVVQ 4UHDA 5KJEA 1XPOA 3L6BA 2V58A 2O4UX 3LSYA 1ZNXA 1FTQA 3AI1A 1GN9A 4JDUA 3OZGA 4DTCA 2ATEA 1GG8A 3OJOA 4XGKA 3ICVA 4MUFA 4X92A 1XP8A 3P2MA 1XDZA 4FNMA 4UVDA 4LSZA 2W70A 3D6VA 2P78A 1PQWA 2YZGA 4ZAWA 5F7ZA 1UJ5A 2A33A 4F8JA 2LNDA 4GX5A 5LYJA 3MAAC 1CUIA 2XJ4A 4WA7A 2C42A 4KMRA 1Z4MA 4CF7A 4AQYB 1JR3E 1N2IA 2X4GA 4N47A 1PS8A 4PG7A 3LA8A 4XSVA 2M2IA 4IM7A 1NN5A 4NBWA 1DB3A 1W46A 1RFGE 1KAOA 4CKWA 1CJVC 1B15A 4AG6A 1UWKA 5GTDA 4RJ2A 1EM6A 1H2YA 3AF0A 1E3IA 1ELOA 3FTNA 4MRVA 3EISA 3DP9A 2FR8C 5SYMA 2WA2A 4J4HA 1DJMA 2WG2A 3HI6A 4CCYA 3UV7A 2X9VA 1SXIA 1KMHB 4IEFB 2YYYA 1EJ0A 4NMHA 4IIJB 4ACAA 2OBFA 1OE0A 3UG7A 5TLSA 4F85A 1Z8DA 2IOFA 4J6EA 1P91A 1H5QA 3H5IA 3S5UA 5BVHB 3KE8A 3A9UA 2AEMA 4HQ0A 5LLTA 3FM9A 3A1WA 2PU5A 4DSAA 4LAFA 4BU0A 4WEOA 4FYYA 1PR3A 2BMDA 4IDOA 4LISA 5HE9A 2LD4A 4NPAA 4MV4A 3ASZA 2I0FA 4YAGA 2CLEB 3R3XA 3IUJA 3W6NA 1DC5A 1KY3A 3LSTA 4EFNA 1DSSG 1NVDA 3GMSA 3NP7A 5K3EA 1P2SA 1Y6ZA 5ECGC 3CUWA 1L1EA 2JFHA 2AYZA 1DJLA 1PW7A 4IUBS 4IQ4A 5JPDA 1NG9A 4I99A 4JX8A 1MX5A 5DZSA 3AX6A 4JOBA 4K28A 1ESEA 3K4HA 3ZU3A 3RS8A 3PT9A 1BFUA 3DZJA 5COAA 1U0OC 1PSDA 3CEHA 3ELUA 3BHNA 3QHAA 4OGLA 1AOXA 2VDRB 1H22A 1NURA 2VF2A 2X5JO 2PMBA 2GM3A 3NFYA 1YB6A 3AEKB 1WLSA 1P3DA 1BFDA 2RHJA 1QOQB 1K5DA 3OAAD 3IQXA 4PLWA 3QQ5A 3BFKA 4WESB 3RYTC 4E22A 3LQ1A 4UCQA 4C7KA 4Q0MA 4QGHA 1DC3A 2F43B 3VGPA 1G7CA 2YIDA 3HYSA 2NXCA 1HE1C 3CNEA 2JJ2A 4QG7A 1Z34A 2HF7A 2RDMA 3ANMA 2VWGA 1C4WA 2B0CA 1PJAA 1ZBQA 1SG6A 1JLLA 1SVWA 3BBPA 3EPPA 2JZNA 4GHWA 1OV4A 4D97A 2XYQA 3LC7O 5TVGA 1GPYA 4H4CA 1E94E 1AQJA 2BEKA 1UP7A 2QTWB 2A5YB 2VYQA 2WUGA 3EFOB 5FHQA 5KTSA 2A7QA 2QR2A 4LC0A 4U2BA 5FLEX 3KQUA 5JWRA 3K1AA 5M5BA 2JGDB 5FI5A 4Z3OA 2WWRA 1U4NA 1HDOA 1ZY2A 4GKKB 5LP6B 2B0JA 4HRAA 2AXEA 1QWOA 1XDDA 1JDSA 3O92A 4O0MA 2AVDA 1GA1A 3WHIA 1GN8A 3EOAI 3ISJA 3HYNA 3AY6A 1U7PA 3NWPA 5K4HA 3V5NA 1D03A 1KPIA 1NMQA 4CIYA 2NNWB 3AF1A 3GFPA 1YQTA 2HQRA 3JQAA 2ZPUA 4WOPA 4BUZA 4DIOA 4HH0A 1BKYA 1D4FA 4QL3A 5FKJA 3V8QA 1A7AA 1DG3A 2HF2A 2OHIA 3AUAA 4OG2A 1W0KA 3I83A 1MEJA 2D5AA 3GGJA 2P2LA 4OKNA 4RC9A 3T7SA 5BR1A 2FR8A 4OIFA 1QYCA 2FZ4A 2Q5JA 1UBFA 3I64A 3GLFA 2ZUUA 4GOMD 1NNI1 2QDKA 3OP1A 1LLUA 5LZ7A 3EUEA 3OZEA 4L4XA 1TKBA 1MHPA 4Y2UA 4EB0A 1OZFA 2CXNA 4JROA 4QOJA 2R62A 3L02A 4OJMX 4EYGA 4Y1GA 5ARDA 5BNIA 4BLWA 5L3VA 4BNNA 4OSEA 4HAVA 1N7HA 1SC4A 4XOUA 3L7JA 1C9YA 1H42A 1KL7A 2AH5A 2YN0A 4GLOA 2HNBA 4UNSA 4E1VA 1EG2A 2UVPB 3E2PA 3MERA 1IY0A 1M8GA 1ZRSA 5B3AA 3CW8X 4HX9A 1S9DA 3L0PA 5NULA 2EXXA 3TIIA 5B36A 3C2QA 2XMCA 1JBKA 2HGZA 3E70C 3TW8A 3WG9A 4D6XA 3KJXA 5A5EA 5CFNA 1LH0A 3M6MD 1CPYA 1WMFA 4R1OA 3MTGA 5I3ZA 3TRFA 1HF3A 3ONDA 4MCIA 3VMFA 4OQZA 4Q9AA 4S1VA 1QQ7A 5HEKA 4IF4A 4XVCA 3UEOA 4HEA6 2IL1A 4FGJA 1KGSA 5G1PA 1KY4A 4FCTA 4ZT6A 4DZZA 1T4BA 1L6IA 4KRYA 3B12A 4BEJA 1QYRA 3HCCA 3PHHA 5HF6A 3RANA 5EHXA 3AIIA 5AW8A 1SZJG 5GAJA 3R7BA 2PSDA 3RVJA 4AICA 4HF7A 1JW9B 2VZLA 4PHHA 1VSQA 1YV9A 2ZB8A 2F3RA 1JG3A 2ODAA 1OX5A 2OFWA 3F3KA 4RGYA 4A1FA 1IM5A 2YR0A 3HBLA 1SB8A 2Y1EA 1E18A 3QWBA 4DCNA 1T3GA 4RTNA 5A0VA 4AUEA 2GPYA 1S2IA 1L5HA 1Y0BA 2I2WA 3TZHA 2UKDA 3M81A 4KNVA 4RTSA 1XZIA 3FCSB 3IKVA 1PEYA 1KC3A 3RE1A 2LUOA 5AKJA 4UHEA 4M1SA 1GRRA 4DHWA 2Y05A 1IEQA 3U44B 4HTFB 5DI9A 3GU3A 3EARA 5EGSA 4JLNA 3RIEA 3VR4A 3MWDA 4JC8A 3F78A 1BTOA 3VPDA 5FQOA 3ELYA 4WADA 3H5RA 1XTBA 2XB6A 2WU0A 3P9NA 5AHKA 5ILQA 1TK2A 1E2MA 1V3UA 2GCPA 2PL5A 4HDCA 3I6MA 2EZ9A 2J08A 2Q5FA 2AG8A 2G07A 5BNTA 5FTLA 2XHZA 3TIVA 1JFFA 5MFZA 3CLSD 3C43A 5HTOA 3WMRA 1J2EA 3D8UA 1CJMA 1UDWA 2DPYA 2KW5A 2OR3A 3F8WA 2EP8A 1WQ3A 3SKXA 4KGDA 3GK3A 4IJKA 4I3FA 1CJTC 5A3RA 3MD9A 1LRKA 1RADA 3OIWA 3IP9A 3BA1A 1HEYA 2CVHA 4QUKA 4RAOA 3IPAA 1YQDA 1AS2A 1ZSYA 3TKLA 4EIWA 1T26A 1RPJA 1MXHA 3ZDAA 1FXWA 1G3UA 1H2EA 1HTTA 3C6MA 3HXOA 4WAUA 4NYJQ 1W5SA 4YASA 1ZGBA 5EIFA 2DWUA 4G0VA 3A3OA 1SY7A 1KMQA 2O8NA 4G8CA 5C1IA 4XZ3A 4LZZA 5DHRA 4OFZA 4WINA 3N2KA 5KC8A 1QAOA 2FWJA 2JK0A 2QORA 1OF1A 1RRVA 1XQ9A 2WG1A 1QV7A 2VUIB 1PT9A 2CV0A 2PGXA 4AZSA 5M34A 3CU5A 4H3HB 4GYYA 5EIBC 3WIDA 2PQMA 4A2QA 3H5OA 4FK8A 3L1HA 1B26A 5A4AA 2C0CA 1C7FA 2C0PA 1MVOA 2YVUA 4R5HA 1P72A 1EX6A 2FPGB 3WNDA 1HA3A 1EK0A 4EMUA 3OE5A 1BS9A 1UZLA 3VU3A 4G1VA 2PCLA 3IJEB 1COWA 3I1YA 3TLJA 1SUFA 1E1CB 2PWAA 1Z6ZA 1IOWA 1U7UA 1ZLYA 2IPXA 2REOA 3WMWA 3WX0A 5AUNB 2ARKA 1FVXA 3E1KA 2GILA 3WJAA 3KYBA 3BJZA 4CMEA 3X1KA 3H2SA 3IQHX 3W7AA 1QH8B 1GL9B 2ZAGA 3JD4A 3IVMA 1OFHA 2O07A 3SX0A 4P22A 4CKEA 1IEWA 2BTQB 1C1XB 1TKCA 5G2OA 4OI1A 1IATA 1XTKA 3LF1A 5IBQA 1O77A 3PXDA 5IDYA 1GXSB 3ZY2A 4LBZA 2H65A 1Z5OA 4MWZA 2WV7A 2NZWA 2NO6A 4FMCF 2QG6A 4R0VA 2X77A 4URHA 4B47A 2BBWA 3O8CA 2FQQA 4DNPA 3QNWA 1Z6YA 4CQMA 3RU2A 4G97A 2WJJA 2ZIZA 2Y76A 4FFNA 4ER6A 3U62A 1L7VC 1BS1A 4RMJA 4JLVA 1HYEA 2Q5QA 4NP6A 1GPH1 4DV7B 1II0A 5G4KB 3UMBA 3ILSA 1NX6A 3OJ0A 3D3NA 2B78A 2W6CX 1GQSA 3UMSA 1RYDA 3U4CA 2WSIA 2Z0MA 3ESCA 3Q5DA 3BMXA 4NU5A 3NEYA 4V0RA 5BOSB 2VYVD 3GCGA 4KPYA 3HCBA 1VYUA 4GQAA 4MARA 1K6EA 1W1IA 4KMSA 2IQIA 5DRTA 4EG6A 3ZGYA 2RGXA 4A0HA 1M66A 4TXHA 1Z0SA 4PYNA 4BMDA 1DUIA 1HE5A 1MPXA 4LJ8A 3O3NB 5DHTA 2O8FA 3W2FA 1R64A 4KNWA 3RQIA 2XMSA 4XUCA 3TRKA 1RC8A 3AIOA 1T25A 1QG0A 3T61A 3U3DA 5BR7A 3LUHA 3P71T 3PFNA 5IJZA 1YB4A 2AX3A 3QVUA 3QWIA 2QRHA 4DS3A 4KP7A 4BRSA 1U11A 4G0YA 4NJEB 4NJMB 2BOVA 3EGIA 3R5KA 2BF4A 5KKAA 5I4KA 5KYTA 3GEMA 2AOXA 4UBOA 4G2NA 3NHYA 4AS1A 2X15A 1P1BA 3PITA 1PNTA 2DFVA 4GZ5A 3QBTA 5F73A 4G81A 3JQ7A 5SYNA 1JHUA 2ZJ1A 3CF6R 3G0IA 4JR0A 4KQHA 5FL7D 2O2JA 1T8TA 2ZBPA 2C99A 3QIAA 2DSTA 1QRSA 4QU5A 2XI4A 1Y63A 2BSXA 3E3LA 3K9WA 5H5JA 2GYVA 2OHHA 3B3GA 3HACA 3O1LA 4MMYB 3ER8A 2CHGA 5AK0A 4B3CA 4DA9A 2EKDA 3TUZC 1M5TA 2D1RA 2GPNA 3AZOA 3WRWA 1U28A 5A9SB 1KAHA 4V0MA 2F4VB 2Q5OA 3QSGA 1E7RA 2A58A 5BXQC 2VT6A 4ZYTA 1NOJA 4DV0B 1JHRA 1SVUA 1T36A 1ZCFA 2PMKA 2ZE5A 4N8DA 2JGRA 2ET6A 2PSSA 2LZ0A 1XCLA 2QD2A 3NO4A 4PYMA 4RHEA 4QUDA 3P9IA 3QKTA 3N5CA 2F1IA 3RUPA 3OTQA 4U7TB 3U7EB 4UTNA 2I8LA 3GJ6A 2P8SA 2FI1A 5FA8A 2YVAA 4QU0A 4KBGA 4FSDA 1JKIA 3EG9B 2IHYA 3GJ4A 4IGAA 4MITA 4BX3A 4MV5A 3GLGA 1G64A 1X7XA 3O4GA 4OCZA 1T6BY 4BWYA 2BMWA 3FJYA 1HETA 2EFYA 5BSUA 2QUBA 3S0JA 3W5SA 3ZW7A 4NZOA 2GCGA 1KKMA 5EIXA 4MQLA 2DLDA 3SS9X 1EHYA 5TJ9A 2AMYA 4D0SA 5MN6A 3RVNA 1E58A 3RIXA 4D5GA 2VHQA 4XDYA 2PNFA 2EQAA 4HUTA 1G2IA 1C7IA 1CK4A 2YV1A 3DCYA 4XD7A 4YI5A 2UYHA 1UBCA 1KEKA 1U94A 4AZ3B 1LF0A 1OTHA 2ZGVA 1DLJA 3GNLA 3K71B 2FR0A 2RHLA 3PQ2A 1JUDA 1KZ4A 5T7BA 4A4DA 1H2HA 1ZMOA 3IQZA 5AI0A 3WGKA 3FE2A 3GELA 3QV1A 5GZ1A 1UC4B 1FSSA 3UFXB 5JSYA 4C5CA 4L22A 2UXBB 1OBCA 1CEEA 3H2BA 4Q9JA 1W36D 4XQ9A 1QGZA 1T6NA 4JSTA 4LC1A 4ENPA 2YQ5A 5CB4B 3G7SA 5CDUA 3WNBA 3CSUA 2IY8A 3KT0A 4YRKA 1G16A 4X6UA 4GXQA 1RXCA 3MHPA 3PJGA 3QI2A 5JAZA 1GZ7A 5C8XA 5ESXA 4FKBA 1E3MA 3R3UA 1HZZC 4FOLA 5IK2A 1ZD9A 3ZWAA 1RXVA 2P4QA 2HSEA 3QX8A 4RK1A 3WYCA 1DC4A 4CKXA 1TD1A 5F9HA 3F96A 4CT5A 2I7DA 4QT0A 1G9XA 2HL6A 4IIUA 1NQ5A 1UKZA 2QPAA 5L3QA 4I50B 2VWHA 4PQGA 3D31A 1TMKA 1U0FA 1Q6YA 3IAHA 3INNA 3LV8A 4RPIA 2NX2A 5AKIA 3TRHA 5KNCD 3H11B 2I3ZA 5CW1A 5EJ2A 1MRZA 1ZNZA 2PKCA 4EGJA 4QGSA 5EZYB 4V0QA 1E79D 5LB4A 2I6TA 5EPUA 3S8EA 3QU9A 5EYPA 3ESQA 4Q5IA 4AK9A 4GT1A 2QSJA 3E0XA 1S3IA 1FP6A 1E4EA 1LY1A 4KBFA 3ZV5A 2GLTA 2PYZA 1X3SA 3SLRA 2Q28A 3C7CB 1PYOA 1Z0IA 4L7VA 3FCEA 4D92A 1GNQA 4WL0A 4JGGA 1XOIA 4BTEA 1E98A 1PUIA 2W2LA 4TKVA 1FYDA 1ZVMA 3LDAA 3T1NA 4GZLA 4C20A 5JZ9A 3IBYA 2JGNA 3E27A 3SN6A 4O4IF 4XARA 4AULA 3DOCA 3GBVA 1Q0TA 2PPLA 2FDCA 2Q27A 2O2DA 1ZFNA 2WAOA 3D4OA 5DGDA 4COOA 3PQ7A 1QIJA 3O1IC 5E3IA 5CEFA 4NQZA 2DY0A 4WW0A 1JB1A 2HO4A 3B2QA 4Q02A 3KWFA 1L5SA 1OH8A 3HPRA 1T9KA 1WOMA 5DP1A 3QUQA 1EAYA 4YT4A 1GYPA 5A7GA 5FBRB 2VWQA 2AN1A 1GTL1 1C30A 3BWYA 2CK3A 4LZLA 2Z08A 4Q7JB 4WOBA 1M0SA 1J0AA 1UWVA 3PSHA 3SXPA 4F7DA 4Z9FA 4EY5A 5L53A 3DMTC 2PDAA 4AJHA 3L9WA 1XX6A 1E2QA 3RF6A 1TFUA 3FVVA 4PHGA 3ZHBA 1VLHA 4C08A 4LWZA 2L2QA 2NQTA 3MGKA 4Y2SA 3IJRA 5KQMA 4LRYA 2NVUA 1RQ2A 3GVXA 1YFKA 4UASA 4ENRA 4OO3A 3M5CA 1BEUB 1LWOA 1EMDA 4P3YA 3RSGA 3MLAA 3NUZA 3UJ7A 4MAFA 4PZLA 3IVGA 2V1XA 3RBZA 1BWRA 1U99A 2MYTA 3RVOA 3DDHA 1Z73A 1OC4A 3D2BA 1NXSA 3RRMA 1GGNA 1KZYC 1U8EA 1F2DA 3H4VA 3P0FA 4UUPA 2PJRA 2JW5A 4H77A 4PRKA 3T7AA 1ZJJA 3WRYC 3G8AA 4YJ2A 2ZS8A 1KJYA 2ZUBA 2RGCA 4BN0A 1IHXA 3M83A 1J8MF 3AU9A 3ANYB 3DQPA 3VYUB 5KOYA 2FY8A 3U39A 3PCXA 2QTAA 1QB8A 2QM8A 5KS2A 3NB0A 4GX2A 2GWHA 5D6NA 2HX1A 5IULC 3CH5A 1RI5A 4H9GA 3KP1A 1Y1TA 4YH1A 2FSVC 4GPTA 2Q3CA 4Q4HA 1U7XA 2NXWA 5EWMA 1NPDA 1PFGA 3EXEB 1VG0B 2EKPA 3A11A 4NFHA 3OICA 4ZK6A 3QLUC 2FSFA 4XEUA 3FLAA 4GVPA 3WWZA 4E70A 4PXSA 1EJBA 1TO1E 3CF4G 1EE2A 5FF9A 1WNTA 1ZN9A 4RVSA 5C34B 1OI7A 1CJSA 2P9JA 1J8YF 3I37X 5IMSA 2PT9A 2JCBA 1XQWA 1Z2DA 3SC4A 1CRQA 4FT4A 5HTKA 5L6LB 1BQ4A 1IZ9A 1YQGA 3NAMA 1YQQA 3KVNA 3TB6A 1IMJA 1AQ6A 1K66A 5A1TA 1YL7A 1OZHA 3DZHA 4ZT4A 1WO8A 1CC1S 1P6XA 1J7KA 2HNKA 2R44A 1DBWA 2FZGA 2YUTA 3IA2A 2GD1O 3QEMA 4C07A 4WFIA 2HY7A 2JKZA 1P9NA 1GGFA 4V2IA 1GR0A 4J29A 4LKOA 3WV4A 5FOXA 5E4YA 4FDVA 3T34A 1PTJC 5JCXA 2GK3A 4X6YA 3QE0A 2FZLA 4PO8A 4BZPA 1U2SA 1SBHA 2BFWA 2YWXA 4I1IA 4D0NA 5M29A 4N0PA 4D4IA 1AZWA 3FPFA 3FWHA 3W2GA 2PO7A 5K4GA 1QPGA 4NABA 1QNLA 1O5OA 3ZQUA 3IODA 1GY8A 2DWOA 4CEJB 1GRCA 1NBWB 3ASUA 3T9BA 3HBMA 4J7UA 4C29A 4GMGA 1IXRC 1E1KA 4JLAA 3AV0B 4BGIA 2L17A 4YDQA 3H9BA 4C87A 5TGTA 4W8OA 1T0UA 2DG2A 4IKOA 4GM1A 3AC0A 1PT8A 2IEBA 2OILA 4OQEA 3LM8A 4LRUA 2Q50A 2DULA 2QY6A 1MTZA 1E69A 2BJWA 2COKA 1F5NA 1XZBA 1VCHA 1B43A 4N0QA 3EZXA 3NUQA 4C43A 1Q6ZA 1L3CA 2AFRA 4B09A 4D0LB 5AKXA 1D8AA 1GNPA 5JD4A 2J7PA 2AJLI 3LY9A 3CRVA 4B85A 1FSPA 1UZMA 4DBZA 1B14A 4LJSA 4C21A 1KJ9A 2G3YA 4A6DA 1IXYA 3ECSA 3F5QA 1K0FA 1QUFA 4WHMA 3WRYA 3OZ7A 1M5RA 3IMFA 1GTJ1 4LWPA 2ZK7A 4ZEOA 2YWBA 4MRMA 4DPKA 5LDHA 2IQ5A 3IB3A 4IDFA 4F2PA 4XWKA 3TL6A 1FXUA 1Z4PX 4K8RB 2XKBA 4R2HA 1E0JA 1SJ9A 3BWEA 4KN5A 2GD6A 2OBXA 1VG8A 4M22A 2VXBA 2ZATA 4C4TA 4ZXFA 4IIVA 5C18A 4YDHB 3SEAA 3UGQA 5AM1A 1XDBA 2Y99A 1VXOA 1N57A 4J90A 1XA4A 4YRGA 4EJMA 3QLUA 5HCUA 5GP1A 1U2DC 2RGNA 3B1ZA 4FUQA 1JJBA 1TZ2A 4QTTB 5F21A 3SZ3A 3ZDEA 4NYIR 1IYZA 3OTOB 4X94A 2XNSA 4HB0A 5TRTA 2H18A 4MKFA 4WKNA 1QX4A 3BXEA 1LBSA 2QVXX 4BNZA 5JI3E 2IZ5A 4DSNA 5J23A 2P5SA 3WYGA 2PYDA 3JZFA 4OHWA 1CERA 1TJ3A 4L8GA 3TTUA 4F3RA 2W43A 1K5PA 3VPBA 2RSLA 2C4TA 1P39A 3C6XA 1Y1PA 1NJFA 1XNJA 4HGYA 5D3MA 2XDQA 3OFNA 4NCNA 3GRKA 4QGBA 3CQ9A 4WZAA 1N7JA 3OIGA 3PJEA 4J4TA 4XX1A 1SUAA 4F06A 2GZDA 4OSPA 2E48A 4O4JA 1U8ZA 1VGVA 2IY7A 4IXDA 4QTUB 1RIIA 3Q1KA 5DOZA 1XHEA 2X7JA 4FMPA 1P9OA 1EZ4A 2XLBA 2YYZA 4O6VA 4U9UA 3T3OA 3K70D 1U8UA 4BJHB 1V4BA 5HQ3B 1TYAE 1PTJA 5KCMA 1AKEA 1OHHD 4QNMA 2CLFB 3PWTA 1PL6A 2B9VA 3JCZA 3ACCA 1L7AA 2GARA 2XMPA 1L5LA 1Y8RA 5JAHA 4D26A 2D1QA 3IOMA 3DG9A 4PQFA 1I4LD 2QF7A 3JZIA 4Q4JA 2R86A 5ARCA 1K6XA 2QRGA 3QU5A 5CCXA 3FGNA 1XGKA 2HIMA 2IDJA 2XNCA 1L7DA 1P7YA 2IDZA 1G21B 2Q1TA 3LUPA 5LCXA 5E2IA 4MJ3A 2GBPA 2ZTUA 1VKRA 5JAOA 4RYLA 4FFSA 3LT1A 1RJGA 1S0UA 1X9GA 2FTKE 3AVOA 3ELWA 2E2WA 3G2NA 3KTOA 4RKWA 1XRPA 1N0HA 3HYLA 4GP9A 5DJ5A 5G1NA 3URMA 1E3WA 3Q9SA 4R8LA 4KAAA 4NJOA 3W5AA 3SZUA 1Y7PA 4M37A 4XX0B 1DJNA 5I48A 3DLPX 1BWPA 4YMGA 4M98A 5D5HA 3B5EA 4JP1A 3S55A 1Z9BA 2O6LA 3E84A 4O2BB 4FR5A 1F20A 2CXRA 2WJAA 3K2BA 4OLAA 3NKLA 4B3IA 3KQKA 4WBSA 3H5VA 1N9GB 1CD5A 2CDBA 4FLFA 4PWZA 4V3CA 3KQNA 3FOWA 2B37A 2J7KA 4LYFA 1WBJB 1JHMA 1AQIA 4A1OA 1TLTA 3BQMB 3EWNA 3IOEA 3VZCA 3O84A 3IPYA 4RY9A 1WZIA 1Q92A 4D9FA 2Z3VA 2X9NA 4AKIA 2J3EA 2VUSA 1Z28A 3OPYB 3DPUA 3IDZA 4Y2QA 2YV2A 1BVHA 1GTVA 3ETJA 3RLFA 1Z4KA 1NBAA 2NUTA 1H0KA 2JAPA 4ITRC 3NNDA 4MDYA 1FNSA 4LQDA 4URXR 3GJRA 3N1UA 4LDJA 2V5VA 2O20A 2V7BA 2AZDA 3ABQB 2BUAA 4RPGA 1N6NA 1K7XB 4B6RA 1YB2A 2E89A 1DWUA 3QPWA 1AUOA 4YK7A 3G2PA 1R8YA 3OX3A 4WE3A 5NLLA 1D0VA 3RC2A 4K9KA 4LJ9A 4MW7A 4NU6A 4R8SA 5B4VA 2PGNA 5EESA 1U0NA 5HJ2A 3ADBA 3L92A 4URFA 3ZE8A 2P0AA 4O0LA 3I9JA 1GU7A 4NVRA 4NMXB 1Z4QA 4KV9A 4F6LA 3N0RA 2E4YA 4ZVRA 5DNAA 5IYZA 4X8LA 4DQKA 1KK1A 2BHLA 1XTZA 1O5TA 1DQNA 5EKTA 4ZI5A 1JDNA 2PEZA 2RB4A 3STUA 3HADA 1W5FA 3FNQA 3NVAA 2PL9A 4U7JA 3QVWA 3BXZA 4P93A 4DF3A 5B4TA 3AL3A 1OWOA 1GU0A 5IFKA 2WTAA 4L9SA 3OEHA 2X1MA 4C4XA 2DBRA 1SC1A 2AV6A 4RSHA 1GUFA 4RM3A 3KEMA 3SI7A 3OQJA 2LE0A 3AVVA 4CMHA 1CR2A 2O3UA 4BFTA 3UAYA 4YMLA 1I24A 1LFDB 3V8BA 5ALDA 4DLLA 1YL6A 3UOGA 1NVFA 4TZ6A 1GGEA 4QECA 3PQDA 3GZNA 3B3QA 3O73A 4I55F 1OBVA 3LLCA 3HUUA 1VJDA 3N6RA 3TE7A 1TM2A 4EUFA 3NDJA 1L7EA 3GG9A 2WB2A 1IWOA 3OETA 1UEIA 1VJTA 4BKOA 3ROMA 2AJ8A 2V65A 3B7PA 3ZCRA 4BFZA 1GL3A 4R2LA 2LKDA 4CUJA 2WIFA 3OU2A 3OM9A 1M33A 1J9GA 3OOYA 2ZPAA 1CV2A 4TT8A 4RACA 3REGA 4X90A 4DCMA 1R5BA 1QVRA 1SUDA 4YCCA 2B1JA 3LECA 3AL0C 2GYUA 2H1HA 1HQCA 1W4RA 3EBLA 5LU8A 4D0GA 5JZVA 3LPNA 3RTDA 5DSTA 4RZXA 2V7QD 4Z8XA 2GEFA 2R7KA 4F3KA 5FV4A 3JD3A 5KWEA 5KYGA 1E1QA 1ZRNA 2ROQA 1P62B 2PXHA 1LWNA 1WMBA 1L8AA 4MCJA 4MKRA 1P5HA 4G5RA 3PX2A 4JP5A 1LI4A 4NXNB 1WW2A 2R6GA 4J43A 2YJ4A 4D9GA 3A7DA 3WHKA 2W4IA 4WXMA 3D7MA 2XXAB 4INAA 4LHZA 4D8TA 3U7QB 1YK1A 5A7FA 4BXOB 1LU9A 4PRZA 1UPBA 2CLMB 5EP4A 4G4JA 1P2BA 2VDQB 3Q12A 2HRQA 4BB0A 2W2PA 4EYOA 3OPXA 4GYJA 4Z4EA 2YC2C 1K27A 5DNVA 4GWKA 4CXMA 3K5PA 4Y7DA 4Q21A 2CW5A 4JGIA 4F4FA 4F97A 1W4CA 2BR5A 3K9BA 2R6FA 3LUDA 3I3OA 4NONA 4DJDC 5DT9A 2WTBA 3FYUB 5ER6A 3MRSA 3GGPA 1ADJA 3NJ8A 3X44A 2XUGA 4MV1A 5BWBA 1H4TA 4AKTA 4LW8A 5B7GA 4I6JA 2DF8A 4ZJZA 3QX3A 3D8HA 1G21E 2FETA 3W5HA 3GDOA 3KELA 2YNMA 2IZ6A 2JI4A 3X0DA 2PFGA 1QUEA 1NXVA 3IIKA 2FK7A 3EDMA 5CA1A 1CHNA 1YZLA 2A88A 2C94A 3QUCA 3PD7A 1DEOA 1XTJA 4G26A 2HIGA 3B78A 5CM8B 2G83A 1FJHA 1Z2CA 2WABA 3JWHA 1E6CA 3GJ0A 4KYUA 4RLHA 4DY6A 1KYIA 2C8JA 4HG2A 4WCDA 3SAJA 5DWDA 1MF7A 2BSAA 3LY5A 2OT3B 1LTHR 1EWRA 1TYDE 4P92A 3H13A 2XYGA 1XA0A 2R8ZA 3AHHA 3OLCX 1U9JA 4HATA 4UUMA 5FT9A 5JVDB 2COEA 3BBLA 1GCOA 1XRSB 3CIOA 4DYHA 1U02A 3NHWA 3AKYA 1EUDA 1ZA1A 1Z0AA 2VHJA 3EIXA 3MGAA 4JFAA 2REXB 1E6UA 5C1BA 5JJKA 3WWEA 3T9FA 2XTNA 4AU1A 3DKRA 3NBYC 4U3JA 5DF1A 1X1AA 4Q7EA 1H85A 4ZK2A 5BV7A 4LZOA 3VV3A 2H17A 3RYFB 2AW5A 3L7IA 1QTNA 3ZXYA 2BELA 2C20A 3ROQA 3M5WA 1RMYA 1C0LA 4N3BA 1H8HA 1JH8A 1MR3F 4KE9A 3D7LA 4XTRA 1HL3A 2NSJA 1PFVA 3RIGA 3CS3A 2ZBVA 3BOSA 2OZKA 4Q1EA 5F2OA 1RC1A 1U0HC 1U3CA 1WDWB 1F38A 1Q0QA 2YY5A 4NAUA 3WYAA 1HG0A 1ZM7A 3NYIA 1YE8A 2NN3C 1OLXB 4F8EA 1LSUA 3OQIA 1IY9A 3BDIA 3DTNA 1KI4A 1XB2A 1RWOA 4BQNA 1I6WA 1CUSA 2Q2OA 1K89A 2YHAA 4OHYA 4DCGA 4AMUA 2DPMA 1G8GA 1CUCA 5K6RA 3K9CA 4HDRB 3FZGA 3AB8A 1M9NA 4HQNA 2ZM5A 4YMWA 4KQWA 2HRDA 2K7ZA 1NOKA 4L9RA 2I65A 3HKBA 3BJEA 4YV2A 2XTMA 5EZ5A 4QWMA 2NTNA 1TW3A 2AW3A 3JVUA 4JELA 1WB9A 1PV1A 2GBIA 3E3MA 4W6ZA 2BGKA 3F9CA 4AY6A 2M1ZA 2AUNA 2RHGB 4RLQA 2CEKA 2EERA 3BCUA 1RJWA 2PS0A 4Z7JA 2Z6UA 4MLDA 1DEXA 1N2SA 1IUNA 1H1LA 1G7SA 2JA2A 4TQ9A 1X1BA 3P7MA 5KTNA 2C84A 3I6YA 2FPPA 2QZSA 3C3KA 2WD8A 3FFXA 2X3YA 3GLRA 5T57A 4A8PA 1FIUA 1XKXA 2Q3DA 1UDBA 3VDXA 3ZIDA 4RZ2A 1FQKA 3D3QA 1VIYA 4C4AA 2FSGA 3PDHA 2PX3A 3UHJA 1I9CA 4DYVA 1EJ6A 4AZ0B 2DEUA 1KU0A 1W2WB 5LMNB 4Q3AA 5ICCA 4P81A 1L3IA 3HSSA 4GPAA 3HJUA 3NTRA 3W5VA 3HVHA 1YS1X 1P29A 2GKGA 2J87A 2NZXA 5I8PA 3R9XB 2PH7A 2C9CA 3L0YA 1OLUA 2QXTA 1SHZA 2W6ID 4RPKA 1QQ5A 4DCUA 1YQUA 3D7KA 2H1VA 2WM9B 1JTFA 5BSVA 1NG1A 5ICGA 1F7UA 3C8DA 4IIBA 3SP1A 4DM7A 4AYXA 2XQKA 1L1FA 3LGXA 4G24A 3UT5B 1JG6A 1Z25A 1SQFA 1EHIA 2PU7A 3QLVC 5ALPA 2MINB 3ZS9A 3U7GA 3R24A 1WCIA 1WULS 4YJ3F 3ECCA 1FLDA 4JJAA 3SHWA 1M8JA 2I4IA 1IJKA 2ZI3A 4IL5A 4ZU3A 4W5RA 1F8XA 4MGKR 5CXQA 1XJQA 1DC6A 1EXWA 2X4LA 3NHRA 5LMUB 2WU8A 2JH3A 1N9ZA 2NOAA 2Y0PA 2G1AA 4GEKA 4W5HA 5DTJA 5CFQA 3HZOA 1Z82A 1CJKC 1RWXA 3TNYA 2B8EA 4EFLA 1U3TA 4YUXA 4K9MA 5J2UA 5P21A 3T15A 2FK8A 3MSXA 4GR5A 5EXPA 1UXHA 1DXQA 3WLPA 4KH0A 4X0EA 4LYJA 4EGCB 1GOTA 2YIVX 2KJQA 1T2UA 3UJCA 3TIFA 3JWJA 1ZK0A 2OFFA 1RR6A 3N2LA 1KY5A 4MVJF 5G53C 1Z45A 1IEVA 2MR6A 1RBMA 2B61A 4C7OB 3GRPA 4ZCQA 2IFTA 3MBIA 3GN1A 3THOA 4QXMA 4LF9B 1GCUA 1Z0JA 2PH1A 2WWFA 3E4DA 3IC5A 4Z2AA 4QVIA 1FDUA 1T35A 3P0JA 1PI3A 3EQ2A 2CVOA 3VOTA 1MC5A 2ODQA 4BLUA 2I8CA 3R44A 2D62A 2P9TA 4HX5A 4L28A 2IUEA 3TUIC 4DJAA 1XLTC 1BXRA 4XUEA 5TE9A 3S68A 2OQ2A 4ETMA 2WKRA 3VAZA 2C96A 2Z8YM 1BCSA 3TQHA 1O57A 4B74A 2H48A 2QLBA 1D07A 4C0KA 1SA0B 3T7DA 2AEEA 3GRCA 4E30A 2VDLB 1PHRA 3VZRA 4TYPA 1BYUA 4JZKA 4MV0A 2VL7A 5CNKA 2H4YA 4BFWA 3S1AB 1BWSA 3CSDA 2DUMA 3GJYA 1E8NA 2JL1A 4DIFA 1HDGO 3ZY4A 1S89A 2MSCB 1SD5A 4CIWA 2CHFA 3DEJA 1Z4IA 2WU4A 3T3DA 3DO8A 2J0QA 4GMDA 3KZCA 1FNMA 4YRFA 1KYVA 5I7UA 1DAFA 3KEQA 4KQ1A 2CUKA 3DDUA 2AR7A 1LX7A 5UKDA 3C7DB 1AZTA 3P9PA 3OJFA 2O7SA 3ZVNA 4HNAB 3LT0A 4GU5A 4IUYA 4C0AC 3QX7A 5I45A 3R5TA 3FNBA 4QHYA 3NATA 2HLPA 2GN8A 4E07A 1ND5A 1WP4A 1O8BA 3DEIA 3LHKA 3QBVA 3SYLA 2XUZA 2JLWA 1KVRA 1GZ5A 1SK9A 3U37A 1JJFA 4B17A 1XN4A 2EGHA 2BDUA 1DBRA 4UM9D 5HRUA 3CNHA 1P9WA 1ZN8A 4EECA 1DU4A 1NA5A 4YUZA 1BX1A 1NTRA 3G1TA 2EX1A 3EXFA 4PFJA 4W1SA 5HMMA 4CLOA 2HMYB 3ND8A 2G80A 4W9RA 5EGNA 2EKLA 3WDLA 1T9CA 3TG2A 1QV6A 4D8WA 2ZS7A 2VSOA 1NU8A 1FX0B 1KI9A 1W35A 1JA0A 2G70A 2Q9AA 3SOZA 2IDMA 3BMOB 3CKLA 4M1KA 3NUGA 2A5JA 2RAPA 2YRWA 5E6UA 2EOAA 2WINI 2FMIA 3HPQA 3B60A 2XZLA 4PYIA 3ADCA 2V0GA 1VI6A 1SD1A 3JQEA 4K88A 3ZU6A 4R9VA 1O6BA 2PXCA 4AFNA 2PAFA 1XZQA 1PL0A 1FTWA 1C50A 4N7BA 4R83A 4B6QA 2C1EA 1NI5A 2H00A 3LLUA 4MR8A 2WU1A 3DKPA 2PMFA 4W7HA 5HQTA 5LQUA 5ERGB 2AI3A 3C5CA 1TJYA 2WLSA 1JR4A 2Q1UA 3KLNA 4KK4A 4RK0A 3LBAA 4B7ZA 3I5UA 2EZ8A 2VP9A 3KVOA 2MSDB 4DAOA 5FOTA 3PDIB 4YMHA 2P3OA 1KC1A 1M76A 2PFSA 1E6MA 5EIBD 2IIPA 4M1TA 3GX1A 2PKYX 4HKTA 2B92A 5K8LA 1CIPA 2AMVA 3GCDA 2EYQA 2DECA 4FP9A 1H6BA 3LTNC 3I2FA 4H1TA 3IPLA 4C0HA 1M6VA 1Y4ZA 1A5BB 1TA4A 3VH1A 2ZXFA 1Q2XA 4R1LA 1QP8A 2AXQA 2VYFA 3TSAA 2X8LA 1TPYA 1POWA 1L4FA 1STOA 2B1RA 1OWMA 2B4YA 1SHJA 4P1ZA 1CUJA 3C1UA 1UXGA 1V1MB 1M1ZA 3AEQB 2CCKA 2ZYDA 1U9IA 1R4NB 4X1KA 2IBTA 4BMNA 5I7WA 2GHQA 3IMCA 1OIXA 5ELLA 1K3UB 3MB5A 2WYIA 3ZH9B 2KLHA 4ZOLB 2YHUA 4MYDA 1G1MA 2CFSA 3DXFA 3PENA 3UUGA 1YZKA 3U4MA 5E9AA 2ZZNA 3X2EA 5FTMA 2FA9A 2OV1A 2XHEA 4DQXA 2ORIA 1AKQA 1UPTA 1RQ7A 2HWXA 3JQ6A 4Y2VA 3OE7D 1KQGA 1WSWA 3EEIA 4BO8A 2DPXA 4JVLA 4F86A 1IWBB 2QTFA 2ZJBA 4DA0A 2K2QB 1XWWA 1CF9A 3AQIA 3SYRA 1S7CA 5REQB 2EFHB 3N86A 1JHOA 5AJWA 2VAVA 3EWSA 2EWWA 1TRKA 3P26A 4IGEA 3TS1A 3VJMA 1JEEA 1LBQA 3C3XA 4NU0A 1JDPA 4ZGWA 3MF4A 4IWYA 3VR3A 1R9MA 4B79A 2X1LA 1W36B 1TF7A 2ZAIA 4J3NA 4DE5A 5JD6A 1RZRD 3PL5A 4C7MA 5TQ0A 2ZBDA 2B2XA 4JEHA 1DCFA 2HFJA 3AH8A 2Y66A 4TZTA 1NUAA 4ED9A 1K8ZB 3CX7A 3GEEA 5EMLA 4MWOA 1U2RA 3FPEA 3I62A 1THTA 4JOCA 3L7DA 4DKXA 1YR7A 4EG7A 4O4HF 2GZRA 4BY9E 1YKFA 2X0DA 1XYGA 2XXJA 3NWEA 1CZKA 3GD5A 1YNOA 4LDZA 5DNWA 5ALNA 5HZKA 5JBQA 5L4LA 2IYVA 3OQIB 2RKBA 3DEZA 1NQXA 4DLRA 2RGYA 3PEUA 3GI1A 1ORVA 1E32A 4RD6A 5DULA 2H1FA 3SQOA 3CTPA 5LLSA 2E18A 1U2GC 3JWEA 2GMWA 2R97A 3EJWA 3FUCA 3B3FA 5I4BA 2M6SA 4C7BA 4D3XA 1J90A 5ICFA 5HFJA 4QBHA 4DMHA 2CHUA 4ZOAA 3I5XA 3P96A 4C2AA 1PF7E 1AKRA 4CLRB 2BE9A 1R74A 1YDFA 1CQJA 2H06A 3K1ZA 2OG1A 1DKNA 1Q1AA 1VFPA 3HFSA 4RHUA 2JGJA 1ES9A 3HGQA 4JLUA 4K26A 4DLAA 4J3JA 2VDWA 2BM8A 2PX4A 4BDTA 4YNBA 1MU0A 2B30A 1X80B 3EY9A 1I7QB 1TAGA 4TTRA 4YAIA 2YDXA 3V55A 2ID8A 3H1TA 3OZVA 3GRAA 2OZLA 3V2GA 3HB1A 1CT9A 3I9KA 2OFPA 1R6TA 2HN9A 3HJNA 4Q00A 3BGIA 3NONA 1F8FA 4YRTA 3P0IA 1A8PA 3W0LB 4QUGA 1U0SY 1YC2A 4R9UC 1E5XA 1CNMA 4J2OA 4BS9A 1LLFA 4KIFA 2J32A 5KOJB 1CULC 2AN5A 3TBFA 4IMJB 4US0R 2GF2A 2NO9A 4UUNA 2PJZA 4ZZIA 2R65A 4CUKA 6CHYA 4PLVA 2A4KA 3PQEA 3W8DA 4AQDA 4CL3A 4AZWA 1P75A 2RCNA 3DWIA 2IEZA 5T4FA 4C14A 3FYSA 1QKJA 4I8XA 4JXJA 5HIAA 1TQHA 1G5HA 5ERXA 3W5BA 1GWNA 4A16A 5J4LA 3VKUA 5JS6A 3UKDA 4JB3A 1HBJA 4DPLA 2D4AA 4XGQA 1K97A 3OMXA 3DFZA 3K09C 4NMMA 1JIVA 1MZVA 4LMAA 2FPIB 2JFYA 2FFAA 1JV2B 4IX1A 4OAPA 3ASVA 4ZAZA 2GZHA 3OKAA 4D42A 2GUGA 5IZ4A 1E6WA 2I9PA 2BGWA 1UBLS 3GHHA 1O3YA 2W6NA 1QG2A 5DN9A 1ADBA 4QBTA 1Y8AA 4Q6WA 3O75A 4U7FA 1DAOA 3TMYA 3A6ZA 4JD5A 1AMUA 4GI7A 5IS2A 4DA6A 4DUGA 1BDHA 3RVSA 3G8YA 3WIEA 2IXEA 1QAQA 4GAEA 3ZD7A 4GC9A 2GTIA 4KH1A 1QPZA 3NJRA 2UZ4A 3LWZA 3MD0A 5A6SA 3BK1A 5AIBA 3WK9A 3VM6A 5KDLA 1N0VC 4I4CA 5JZOA 1LV8A 3INTA 3RNOA 2UUAB 4AF7A 1U2GA 1KARA 1HI9A 2RHCA 3E35A 2BUBA 3LRTA 3LUBA 3M1IA 3M3PA 3MMSA 3RR2A 3SDZA 1OFGA 1Z36A 3UHFA 3UICA 5K8UA 4QE3A 4J0HA 1ZDMA 4OAQA 1DUVG 3PUIA 3UMVA 5HILA 1FDTA 1KKLA 2FSUA 4OK5A 2YBEA 2OB2A 6REQA 1JKJA 1HDEA 1BMDA 4PX3A 3ZJ4A 5LLDA 3NHSA 3W8RA 3JX9A 1OU4A 5A4DA 5BMVA 2JLAA 5FH9A 4XVUA 1MD9A 3R6TA 1JXMA 4Y2XA 1HDZA 1LC3A 3MXTA 2GAJA 3DDWA 3GVHA 3QKWA 3T95A 3ZE1B 1EZ1A 3EEBA 2XE4A 1EA7A 3U5TA 1BZYA 1DIOB 1JXQA 1M34B 4MJLA 4UMFA 3UWDA 1PDOA 3UPUA 5B37A 5I9BA 4F3TA 1G5FA 3WGNA 1YUBA 4PAGA 1SELA 2JJ1D 3K20A 2Q2WA 1IBLB 4G1CA 3HO1A 1VHWA 1U8XX 4OHBA 4UDXX 3USCS 3DE5X 1LRLA 3LKZA 2A0YA 4P6VF 2CJPA 3QMVA 5LJLA 2AGVA 4J9VA 1KOLA 4LF4B 3O3MB 4BV2A 3JALB 3UAVA 3PUZA 1Y7HA 2PH3A 3PP8A 4M21A 4LRTB 5H1YA 1YASA 1WXDA 2JGEA 4A6EA 2EL7A 1X7DA 1A5AB 2QUAA 1KRXA 4KAFA 2PX0A 1VE1A 3IULA 1VMIA 4HH3C 4N7MA 2X1VA 1DI0A 5DNDA 3RAJA 1UBTS 2Q4EA 2FV8A 3ZV3A 5F9MA 4OXQA 5KNBA 1PV4A 1M6WA 1UBMS 3KOXA 2OCKA 4B81A 1C29B 2NWQA 3ZVRA 5CDYA 4PVDA 1Z6XA 1UQUA 2FF5A 3ZDXB 3UC9A 4HR7A 1IE3A 2XRZA 3ADOA 1KI2A 2O1WA 3KKKA 4HEA1 5AYVA 1T9GR 1DQZA 3KIPA 2QE7D 1SBTA 3EQ8A 4G23A 1P1KA 2QDXA 2J9XB 1MXFA 2CMHA 3TRIA 3U7HB 3B9RA 1GVNB 3IBFA 2CFCA 4IH9A 4TL7A 3MFYA 3AETB 3AUSA 4JHXA 3AB7A 4BUCA 1EDDA 2FUG6 2O0MA 3BMQB 4OPMA 2HU5A 4B6OA 2J3DA 4OXNA 1QIGA 3CM0A 4IJVA 3AP3A 1Z6AA 4OUDB 4TTVA 2JJMA 3CE9A 2IU4A 3CNBA 2PZMA 2Z3WA 1H2RS 1ZL2A 2BE7A 1VC2A 3G9UA 5CT5A 2VO1A 3NOXA 4CIBA 3CNOA 3UOAB 4KZPA 2NADA 5BORA 2G6BA 3CUTA 5C1PA 5F1KA 3DXYA 4RELA 4DMCA 1T4GA 2F8SA 2CLLB 3KAQA 3CUVA 2QTZA 3IIIA 3RSFA 3W3AD 3PI7A 4Z0NA 5JQGA 2CXSA 2XE8A 3ODPA 1T5SA 4Z4QA 2XUOA 3TNDA 2HA4A 1TPZA 3KLOA 4M76B 2PSFA 4NZNA 4N5LA 1C1YA 1WUTA 1ABFA 3WIUA 2OV2A 1OU0A 4S1PA 5D6OA 3ZCSA 1QK4A 1ULHA 4C3ZA 1FS5A 4XSHA 1ICIA 2HSJA 4G5SA 3Q6NA 4M54A 1BKDR 4MUGA 5TX7A 2C3MA 4IIDA 4F93B 5A06A 1FYVA 2BCGY 2B5OA 3R0QA 2DHRA 2QM3A 2RAVA 2WYUA 4KUHA 3U31A 2VXOA 1H9AA 1EAMA 1XE3A 2WFLB 3GLQA 4QD3A 1H1TA 3TGPA 1GO2A 3L82B 3ND7A 1EE1A 2QG9A 4CV2A 1G4HA 2NU9A 2PANA 4UTOA 4YJFB 1JPUA 1A72A 4XQEA 4F72A 4B0OA 2AJDA 4LIPD 4DIMA 3HWX1 4E5SA 4FCVA 5AVRA 3E61A 4J16A 1F4PA 2B3DA 3TVTA 2XWBF 3OCCA 4G0QA 4CMBA 3TQOA 4EB3A 2Z43A 1SPBS 2ZB3A 4LDAA 4CQLB 1FUYB 2WQ7A 1XYYA 3MJVA 3U80A 4XRRA 4AI6A 5T8KA 2NQ2C 3R6WA 3S2GA 4X8OA 1DIAA 2YRFA 4JB0A 4ZVPA 1XELA 3KJGA 2EKZA 1O94C 3G0GA 5JEEA 4KQFA 1Y1QA 2QJRA 4U4AA 3WGOA 4YY3B 1XAIA 1EPUA 1GUZA 2XWPA 1ZPDA 2O52A 3EVBA 1LJLA 5COQA 1KXZA 1XCGB 3OLWA 5E4JA 1EVEA 1A9TA 1G5PA 4HXFB 4M1WA 5G02A 5JJCA 2CVPA 2VHWA 1AE1A 4KN6A 3B38A 1GPKA 3ED1A 2GOYA 2IGBA 2IKQA 2VK4A 4JT9A 4X7MA 1RC0A 4JP3A 3KUKA 4MSUA 3FUVA 1FDRA 6ABPA 3KDSE 1NF8A 2WJ6A 3AFIA 3K35A 2R48A 3H4TA 4QYIA 3PK0A 1A3CA 1MOSA 1OXUA 5TF4A 3TG8A 4Z9YA 1Q1ZA 1YOVA 2WHXA 1KWGA 2VBFA 3S1LA 3PTAA 1V43A 5BW5A 1VTKA 3OZTA 4QASA 5KWSA 3GGOA 3IILA 4Z7NB 4KAXA 2ZKIA 4PYQA 1JYEA 1VB3A 2GT1A 4XE5A 1J39A 3W1VA 4PG8A 2AQHA 3AHIA 4AX4A 3L46A 1NAIA 2BFEB 5JNRA 2QX7A 1NIJA 2FWRA 1PNVA 1ZSVA 3H2YA 4IVRA 4NOLA 5E0OA 5BN5B 1NW9B 2BBOA 1M34E 1YRYE 3PJDA 5CM2Z 5J1SB 5JO0A 3K0SA 4R69A 3ESRA 4ISBA 4U6NA 2YV4A 3UAXA 3X2FA 3EZYA 5DMXA 4YGYA 5J4HA 1M0TA 1VLJA 1NMYA 3EF1A 4MI3A 3X1YA 2ZVJA 4NQRA 4UBMA 2I1QA 2C8LA 3EZ2A 1QE3A 2NAPA 3JQGA 2CNWD 2W11A 4G8JA 4WCFB 3WL4A 3WSWA 5KJCA 4D8UA 4X85A 1K0UA 5GMOA 1PUXA 2VXYA 1XUOA 1ZMTA 1V3VA 3HJHA 4RZQA 2EP5A 5AVWA 2ACWA 3D2CA 5EE5B 4CR7A 4BUJA 1GQOA 3RAEC 3UJ9A 1E9AA 2QSUA 4F4JA 3PHBE 5EN4A 1OJ7A 2FHSA 2EBHX 5IVIA 4L6CA 4FSXA 3DBLB 4NZYA 4ZVVA 3NIBA 3RREA 1XMQB 1PFQA 2QGFA 4M89A 4L76A 5AHWA 4CEIA 3D7NA 3IOYA 4LX0A 2Y9PB 3V9AA 4RA6B 1HYQA 2XVYA 5AOAA 5DBOA 2ZAMA 5F64A 2IV3A 4NENB 2I2XB 4MVWA 3I23A 1AA6A 4FKMA 3AJRA 1RCUA 2Q1WA 2VOJA 1V8OA 3DQQA 3CURA 4HGPA 1J97A 3WJ2A 1PR9A 2Y93A 2A9OA 2MWMA 5KYYA 2PS1A 5LYJB 1NIPA 1Y6JA 3HO8A 3HCRA 3OD5A 3FNRA 4MIOA 4NPHA 4Q82A 3TPCA 1OZAA 4JCCA 5F7OA 5JH7F 5JAIA 3IHLA 4LJ6A 1FRNA 4BE4A 4CL0A 4L07A 4PR0A 4CKCA 2WPDD 3DMPA 1YZNA 3AKDA 3LOUA 1TJ4A 1KJQA 1UXOA 2WFMA 3BMCA 1NBME 3EE6A 1BHSA 1CY2A 3FH0A 3JWPA 3OWOA 4TSFD 1JU3A 4K1LA 4CKWB 1TADA 1QKKA 2JNWA 4QRIA 5B58T 3S2EA 4A2WA 1PW5A 3SLGA 4C22A 2VZ9A 1EGVB 1NVTA 2H63A 2PJDA 3V00A 2EW1A 3WOHA 2KBFA 3JV7A 3SR3A 1WEHA 2JIMA 1VGQA 5DLPA 1QORA 2X4DA 3AYXB 1VL8A 3WL3A 3WMFA 3SFZA 3QVTA 2IWRA 1P2GA 2CZQA 3RBXA 3ICCA 1PS0A 2Q41A 4QSMA 4GOOD 2G4LA 3KKLA 4YPVA 3ER6A 3QEKA 4LXTA 5ETJA 3W5IA 1APBA 5FI1B 2A0XA 5FIUA 1JQKA 5BV1A 2OLKA 1SWVA 1XRNA 3LL4A 4Q9KA 1XRRA 5EUMA 2BONA 1W581 3D0OA 2QD4A 5IVKA 4G1MB 5IF3A 3CUEF 4XDHA 3NHFA 3FSRA 1XEWX 4YXWA 1TZKA 3BREA 4MOWA 3TLMA 3HBFA 3OQBA 2RH5A 4BLVA 1J20A 4Q03A 5BYJA 3GJZA 1CQIA 3IUYA 3M4JA 4PG5A 1DKLA 2MT9A 4HLCA 3VC7A 4ZKDA 3LA6A 1MIHA 1WE2A 3A6JA 5E6SB 4OBEA 1JR3A 3A1TA 3VYRB 2MJLA 4QRHA 1K68A 4YRBA 1PG0A 1WHTA 4JMLA 1XVAA 3B6MA 4JITA 3UJAA 5FA6A 5HZGA 2BLNA 4E88A 3KEFA 2PX5A 3EEQA 5ICMA 1J0XO 1E9CA 1QZTA 1H94A 3CLKA 3GT4A 4L4ZA 4G84A 4MA4A 4RQBA 2I1LA 1DFIA 2ZYGA 1EP3B 2CSUA 3DB1A 4O1IA 2FWIA 3STVA 2GN1A 1JEQB 4IHJB 4J6FA 3TAUA 5F7JA 3UF0A 1PJLA 4AKSA 4EKYA 3SJZA 5BYKA 3JATA 1RYBA 1ANKA 1MKYA 5L95A 1P18A 1M0WA 1JLLB 2R6JA 5FFMA 2JFGA 3OJXA 4RKRA 1VPEA 3PQ6A 1C8KA 1DLIA 3FUXA 3Q7QA 1DFGA 4YONB 4RL6A 3PNLA 3RSSA 1KIMA 4LF7B 4LJRA 2CUTA 2CDAA 3B3JA 3DZGA 1QYXA 4L72A 3ZS8A 3K1AB 2W6QA 5LN1A 1M2VB 3L4BA 3ZXIA 1W29A 3FF4A 3LNTA 3Q41A 4F92B 5KVVA 5DGXA 3QVKA 2GX6A 3CV3A 2YINC 3DJYA 1JG4A 1ZZEA 1OXXK 1ULUA 2JFFA 3MQ2A 4JBIA 1OXKB 2CKDA 2D5LA 3U4QB 3O8LA 4KO3S 4YP0A 4A91A 1YZGA 4X93A 5EG5A 3ABSB 1SXJC 1Z8FA 3TR6A 1R37A 4O2LA 5DM60 1CE8B 3TPFA 2Q9BA 1GADO 4TQAA 5GADl 2J33A 2KYRA 4TKUA 4KQ6A 4Y9DA 2UV8A 2B5VA 2XD4A 3JAKA 4QVGA 3X1ZA 5KREA 1V7PC 4ETWA 3HUFA 4G8BA 4U7PB 1HYHA 3GLFB 3AVWA 1YZVA 1KERA 3AWIA 3OJLA 3M1AA 4IO0A 1RYMA 2C78A 1HDYA 2DJ5A 5KNDD 4ENQA 1O8CA 5CMLA 3U3ZA 3RABA 3GJQA 4BLQA 5U4QA 3AF3A 5I4CA 3H17A 1PFYA 5SICE 2P9BA 4BV9A 1ICEA 2HRCA 3PNOA 3WQQA 1JZQA 1DDOA 1QGED 1XG5A 2HQ1A 3S6JA 4JBHA 2W6ZA 5JY6A 3PFFA 4N9QA 1CX9B 4MYUA 2OHOA 2G17A 2GN9A 4Q4DA 3TSCA 3QLEA 2YWGA 1AHIA 4C0SA 3AW9A 3SFVA 3KKEA 3C15C 1DFHA 1YUMA 2ONJA 2VF7A 3KS9A 3FAZA 1EE9A 1CJCA 3DTVD 3QEBZ 4JV5B 5JXJA 1CR0A 1PZNA 3OX4A 3JQFA 1BJRE 4L74A 3DOOA 3IEUA 3V8VA 2W2KB 3PC3A 2PGJA 3CKMA 3D3WA 2Q6VA 3RVPA 4NL4H 4AKEA 1AUVA 4TS4A 5CM9C 1ZNYA 2ZRJA 4TRNA 1SIWA 5CCDA 5LD2C 2FPOA 3PHCA 4YJHA 1G7TA 2RCYA 3E15A 3KT8A 2BGMA 1HT2E 2V54A 3G5MA 4AL4A 2FZ5A 1ECGA 2JLVA 1SEVA 3GP8A 2A1TR 2RK4A 3TJZA 2OCGA 1WY5A 2IOFK 3A2MA 4JMPA 5EIOA 4DDMA 1W8IA 1FNDA 1MB9A 3AERA 3VR5A 5DBGA 2JFWA 1CSEE 4UTRA 3E9MA 4GM0A 4J0EA 2BGJA 4U6SA 4BN4A 1FZTA 1NSTA 1X9IA 1XQ6A 1RLTA 3OT5A 2JG3A 3WRXC 5I7OA 1NLUA 3AI3A 4YT2A 1NLYA 3G9ZA 2AZXA 1JPJA 2RBEA 3WJ1A 3I32A 2EFDB 4E14A 4MHOA 4FHGA 1FW8A 1HM5A 2GQ0A 1PGQA 5IHXA 3BIJA 1L5HB 5JWOA 1SBNE 2BFNA 1AU9A 1XALA 5B1DA 2OGUA 2I34A 4IR7A 4PYOA 2YS6A 1HL7A 1NVWQ 4BFSA 1MDBA 2GA8A 4BB9A 4C1BA 3QTLA 3M0EA 4MULA 2QP4A 5DW0A 5C5IA 1CR6A 2O3RA 2VDVE 1JN0A 3MWDB 1J21A 5BUSA 4RDHA 5DHSA 3MAGA 1QQBA 1I0ZA 2G5GX 2E5FA 1KZHA 4X62B 1FU8A 1SXJA 4Z1OA 2P6RA 3L0BA 1ODLA 4QO8A 5F1YA 4LOLA 1JDTA 2HEIA 3NYWA 1X1RA 1UK9A 3ZHRA 2RGDA 2FCAA 4AWXA 2IV7A 4C0BA 1XZJA 1ZM4A 3GL9A 3OC0A 2JFUA 1PVOA 5IANA 4ZZ0A 3CGGA 4KXVA 4N49A 1JFFB 2WYVA 3TK1A 1YKGA 4DRXB 4EA9A 4EX7A 1NHGA 3GA0A 5ALZA 1GUBA 3HLTA 5JO9A 3ILHA 2P9HA 4KGXA 5HCIA 5K99A 3A2NA 1MN6A 3O8RA 3HLYA 1PIWA 2FYTA 3MWJA 1Z0FA 2IW1A 1T2VA 3ORQA 5IASA 1YC5A 4JL5A 4N48A 1GGMA 1USGA 2LTAA 2R8YA 2IC5A 3OJEA 3ZCPA 8OHMA 1QVZA 2WQ6A 1SUPA 5LOVF 5B64A 2DUNA 1NNLA 4TPKA 3R77A 2XQFA 3WLEA 4DLWA 3BS4A 3CJQA 3RGWS 2F9FA 2G8LA 3KRTA 4XFKA 4DIDA 1S6YA 2VPWA 1D2HA 1MB0A 1OA0A 2WUDA 3HK2A 1N6LA 1KMHA 4JLJA 1GNTA 3RKUA 5JRDS 5M04A 3N2KB 2WZBA 3KSDO 3QW4B 1UBSB 1YDGA 1UFRA 3NAZA 5D3ZA 3CZ9A 1ZD2P 2QQGA 4HSGA 3TYXA 1QIIA 2WWGA 3Q88A 4KI0A 1BX3A 2XB8A 4BPRA 1E2GA 5HIMA 1Q7RA 3C3JA 4IV5A 1M7GA 5BPHA 1I80A 4UM5A 2BBSA 5FLYA 4PAOA 4L5CA 4F6CA 2ZBQA 3E81A 4KUGA 1C80A 4C7JA 1UC9A 1O4VA 3PGJA 4GC5A 4AKGA 1AKTA 3IR5A 2VHEA 3FCAA 3KSMA 3NLLA 3OEYA 1JXOA 1GLNA 1HFJA 2RMKA 3GMTA 3C24A 3PU6A 2HZ7A 2C2WA 2B6HA 4MQMA 1KSGA 1F4LA 4KITB 3DAOA 2GAAA 2NPFA 4KR9A 5BQ5A 3TDNA 4KTTE 4PN7A 3L0DA 1FE8A 1G18A 1YVUA 2WU3A 3EZNA 5JH7A 4O8ZA 4CKEB 3T4PA 1Z4JA 1DARA 4E7PA 2G4CA 1HNNA