3DLIA

Crystal structure of a sam dependent methyltransferase from archaeoglobus fulgidus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
221
structure length
221
Chain Sequence
DYYFLFEEKFRGSRELVKARLRRYIPYFKGCRRVLDIGCGRGEFLELCKEEGIESIGVDINEDMIKFCEGKFNVVKSDAIEYLKSLPDKYLDGVMISHFVEHLDPERLFELLSLCYSKMKYSSYIVIESPNPTSLYSLINFYIDPTHKKPVHPETLKFILEYLGFRDVKIEFFEECEELTKLAKIDSNTVSEEVIRVINENIEKLNRILFGPQDYAIIAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords methyltransferase
publication title Crystal structure of a SAM dependent methyltransferase from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
total genus 71
structure length 221
sequence length 221
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dliA00
2N47A 2BR3A 3KR1A 3T7SA 4EKIA 1BC5A 2PY6A 4KDRA 2QE6A 2PT9A 3LPMA 3T0IA 4ER5A 4HH4A 4K6MA 5HZMA 1BKYA 4YUZA 1SKMA 2NXCA 2PSSA 4AZWA 5EEHA 1ORIA 1YB2A 1RI2A 2P3LA 2YVLA 4PONA 4PGHA 3TQSA 3P9KA 4KVZA 4FS8A 1M6EX 3GNLA 1R00A 1XDZA 2ADMA 3BWMA 4L7VA 5EC8A 3UJBA 3A7EA 3UA4A 1XCJA 1WY7A 4RTLA 5K0JA 3PTAA 2AVNA 2EJTA 3P71T 4DCGA 3Q7EA 5P8WA 2IP2A 3BZBA 5BW4A 3MB5A 4MTLA 2QM3A 1EJ6A 4C05A 5C9ZA 3JWJA 1EG2A 1L9KA 2ORED 2P40A 3D2LA 1I9GA 3CKKA 3JWHA 5IKMA 5K0GA 2XYQA 1VLMA 2JHAA 4C4AA 3DLIA 5K03A 1FP2A 3MQ2A 1TPYA 2PXAA 2XVAA 2PKWA 3CC8A 5CVDA 1RJDA 4YMGA 2IBTA 4E2XA 2VDUE 3T7RA 1DUSA 3AXSA 3FPHA 3ME5A 1XVAA 1L1EA 1JG1A 5ERGB 1NV9A 3IV6A 5GIOE 3B5IA 3DMHA 3PS9A 3JWIA 1F3LA 1AQJA 3A25A 3HM2A 3G2PA 4HTFA 1SVUA 2OZVA 4QQKA 5DX1A 3IHTA 1JQ3A 3B3JA 1Y8CA 3E23A 1KR5A 3TM5A 2P7HA 2WA1A 2NP7A 1YZ3A 4XUDA 3P97A 3FUXA 4KWCA 2PXXA 3EGVA 2VP3A 2VS1A 3KQVA 2AN5A 4M38A 3X0DA 4AZTA 1XXLA 3HCAA 4CWAA 2JJQA 2UYOA 2NP6A 4RVDA 2NYUA 5K0FA 4E33A 4EKGA 3G2MA 1JSZA 2PWYA 3THRA 1BOOA 5JR3A 1H1DA 2OB1A 4RVFA 1UIRA 2FK7A 2UYHA 3EPPA 1JQDA 3M70A 4ER7A 2IPXA 5LQRA 4OBXA 2JH8A 3HP7A 2ZTHA 3CJTA 3OE5A 4V0RA 3ANXA 4GEKA 1VPTA 2KW5A 3I58A 1SG9A 4GUAA 4PGGA 4HG2A 5BP7A 4RTRA 1FP1D 2BH2A 5LQCA 3DLCA 1G8SA 4CTKA 2EJUA 3P9IA 4HGZA 5LQNA 3IYLW 3FZGA 4M7RA 2ZVJA 1NBHA 4ER0A 2ZIGA 1G55A 3I64A 2AS0A 2JHCA 3U81A 3RIEA 4BLUA 3EVCA 4FSXA 3BWYA 2ONZA 3G88A 3GU3A 1G8AA 3OFJA 4RYLA 3EEYA 3OZTA 5HEKA 5ICEA 5LSAA 3R6TA 3UJAA 4XUCA 4AZVA 4RV9A 2IDKA 2I9KA 4QVKA 4GOOD 3DXYA 2I7CA 4B17A 5K01A 3RODA 3EGEA 3WSTA 4CKEA 3CJQA 5FA8A 1IM8A 3KQYA 4QTUB 2QYOA 3TMAA 2WA2A 5EKXA 2QY6A 2ZIEA 3LDGA 2YR0A 3UWPA 3KQMA 4C06A 4JXJA 2ZCJA 1X1CA 5FCDA 5GIPE 3LHDA 2I62A 2K4MA 5U4XA 4MHTA 2AOVA 3HCEA 3MCZA 2VDVE 3NDIA 4U7PB 4Y30A 5E1DA 1WXXA 5JUWA 3UJ8A 2CKDA 2AVDA 3KQTA 3FUUA 4MQ4A 3MGGA 4BLVA 1WS6A 2Y1WA 1EIZA 3OU6A 3NVKI 5HILA 2H00A 3FRHA 3LDUA 3OCJA 3SSMA 4BP3A 3LBYA 1XDUA 4XUEA 4ER6A 2CL5A 4E32A 5FA5A 3DR5A 3LECA 3MTEA 4LG1A 2YQZA 2G1PA 1JTFA 1Q0TA 1UWVA 2AOWA 3G8BA 3BWBA 3LX6A 5GP1A 3TKAA 2ZBQA 2ZSUA 4C08A 4KDCA 4E30A 2OXTA 4RVGA 4EK9A 4PIPA 2P41A 5D1NA 3HVHA 5D1HA 5GWXA 3SMQA 1DL5A 5HIIA 3FTCA 1NT2A 4R8RA 3LCVB 2C7QA 1RI5A 3ID6C 3KPWA 5EQJB 3O4FA 3NWBA 4RTPA 1IY9A 5HFJA 1RI4A 2Z6AA 3KR0A 4ZTBA 3OU2A 3NTVA 3ELDA 4KRGA 5DSTA 2OBFA 4FGZA 1JQEA 4F84A 3AY0A 3SM3A 1QYRA 1VP3A 3M6WA 3EGIA 5CM2Z 5EOVA 3G5LA 5DTQA 1XTPA 1NW5A 3UJ9A 3OE4A 1G60A 2GA9A 4H0NA 2YUIA 3LKDA 2O0LA 1O9GA 1VQ1A 4OQDA 2XYVA 1P91A 1M6YA 2VDWA 4NECA 1QANA 3EMBA 2ZWAA 5GM2A 5DX0A 3AJDA 2AN4A 4QDKA 2IBSA 5E9QA 3BT7A 3TM4A 3KQSA 3ER8A 3EVDA 5FQNA 3TRKA 2GLUA 5CCXA 5EIFA 3C3YA 4QQNA 4C03A 2GH1A 3KQWA 4R05A 3LSTA 1L3BA 5CVJA 5E8RA 1XJ5A 1JR4A 3DOUA 5EMKA 1RI3A 3EMDA 1G6Q1 1WZNA 3FPGA 1KYZA 3VSEA 4RTOA 2VZ9A 1P1CA 4GOND 4PYKA 3ER9A 2EFJA 2P1DA 3C6MA 3QV2A 4WVLA 3MHTA 3FTFA 5KVAA 1TW2A 3CGGA 3HNRA 3I5UA 4X61A 5CVEA 5E1OA 1F38A 2NXJA 4QPPA 3SGLA 3PVCA 4E31A 3DULA 3C0KA 3EVZA 5DTMA 5KYGA 1SQGA 3HVKA 5ICFA 2BM9A 5LQKA 2P3OA 4DM3A 1RJFA 3MTIA 1P1BA 3BXOA 3FPEA 2P3QA 3B3FA 2Z6QA 4LWOA 1R8YA 2IH4A 1M0EA 4IV0A 1HMYA 2G71A 3DXZA 1ZKDA 2HWKA 2GAFA 2ZZKA 3G8AA 3HCBA 1YFJA 3M6VA 5T67A 2IIPA 5DX8A 3UBTA 4P58A 2B9EA 3DMGA 2NNWB 2OY0A 2ZLBA 4U7TB 2PX5A 2YXDA 5DRYA 1KYWA 3GO4A 2UYQA 5FHQA 4YMHA 3P2EA 4LWPA 3DH0A 4R6XA 2HR1A 5DM1A 3UZUA 1SUIA 3NWEA 3TR6A 3EEOA 2B3TA 2O07A 2V7EA 4CKBA 3EVGA 5HIMA 4A6EA 1NBIA 4Z2YA 5C1IA 4YUXA 2EX4A 1N7IA 1RI1A 3BGVA 3GIWA 4GC5A 4XCXA 1X19A 3OZRA 3FUWA 4P7FA 3FPFA 5DM4A 3M6UA 1DCTA 2C7OA 3PLAE 2BZGA 1OR8A 3SXJA 1EQAA 5K0LA 5MHTA 1R74A 5EPEA 5GOZA 4V0QA 5F2KA 4KW7A 5E2AA 2R6ZA 3BGIA 2CMHA 2PT6A 2R3SA 3GRYA 1AV6A 1Q0SA 4DQ0A 5FWDA 3G2OA 3SR4A 1D2HA 1KPGA 3FTDA 4QPNA 5FWAA 3E7PA 3VC1A 4E2ZA 1QAMA 4X41A 3VC2A 4POOA 1TW3A 3FTEA 1KIAA 1KXZA 4PYOA 5FQOA 3KPYA 3A27A 5BXYA 2AOUA 4YUVA 2ERCA 2AOXA 4GOMD 4DA4A 1G38A 5EEGA 1VIDA 1JSXA 2PBFA 3DUWA 1R6AA 1VE3A 3ERCA 2CMGA 3M33A 3PFGA 5LQAA 1KPHA 3B3GA 5K09A 1JG2A 4EVIA 2GPYA 3IEIA 1ORHA 3THSA 3GJYA 2AOUB 5EGSA 5B1SA 4GBED 3HEMA 3GGDA 3R24A 1NKVA 3KR9A 3O7WA 5HIJA 1QZZA 2FYTA 4ATNA 3CVOA 3R3HA 3OU7A 4CXMA 2I6GA 2IH2A 3OPNA 3CCFA 2B25A 1N7JA 1JTEA 1AQIA 2FCAA 2OPBA 5CIYA 1UFKA 2FK8A 4YV1A 2UYCA 2YXLA 4YUYA 3B89A 1N2XA 3SSNA 2AZTA 3PX2A 2XVMA 3P9NA 1HNNA 4FT4A 1WG8A 3EVBA 1JG3A 3LCCA 3MCTA 5EKUA 4ER3A 2HNKA 5CD1A 2P8JA 2JHPA 4P7JA 3TLJA 5EZQA 3DXXA 4RTQA 1XDSA 1NW7A 4R8SA 1YF3A 4OX9Y 3HVIA 1PJZA 3GRZA 5F2OA 4RTKA 2YX1A 3GWZA 2XBMA 3TKYA 4M36A 1L3CA 3DMFA 3GRRA 1YZHA 2IFTA 4RX1A 2FPOA 2JH9A 3HA5A 4GC9A 3E8SA 5DXJA 5G02A 4PYLA 3RW9A 5EMMA 3GRUA 3KQPA 4PWYA 3NVMB 3VYWA 4CTJA 1ZQ9A 2OB2A 1VP9A 3FYDA 3I53A 4E2YA 4PYJA 2BR5A 4YV2A 2F8LA 3BGDA 4RWZA 2G8NA 5FTWA 2IGTA 3S68A 1WXWA 5EMJA 2B78A 3KQOA 3HA7A 1JG4A 1R18A 1NE2A 3DTNA 4GQBA 4A6DA 4BP1A 1O9HA 3GDHA 1NW8A 2PGXA 3UA3A 4UOEA 1FPQA 2DULA 4HSGA 2ZIFA 1R8XA 3KPVA 2BR4A 1D2GA 1X1DA 2ONYA 3ELUA 3FYCA 3ORHA 1ZGJA 4HRAA 4R6WA 5DPMA 3UJ6A 5HOQA 3M6XA 1ZHFA 5E1BA 2H11A 2O57A 3MAGA 1FBNA 5DM2A 3UJCA 1PRYA 1I4WA 4F86A 2H1RA 3O31A 5E1MA 4OBWA 4PIMA 3HA3A 1U2ZA 4PYNA 1L3IA 2IDJA 5K0NA 4C07A 4CKCA 5DSXA 3F4KA 4PINA 3R9XB 2PWPA 2NXEA 4FR0A 1KPIA 3P8ZA 5FHRA 3TPZA 5EHIA 5ICGA 4HGYA 4QTTB 4BY9E 2ZZNA 4PYMA 3K0BA 4RVHA 3HCDA 5LQUA 2YTZA 5GM1A 2GB4A 2WK1A 2G70A 3FPJA 2C7PA 2NXNA 3KHKA 2UZ4A 2FRXA 4IV8A 4PCAA 3KPJA 3KQQA 3G5TA 3SVZA 5DTRA 2GS9A 5K0BA 3LCUA 2P7IA 3SX0A 2BM8A 4E2WA 5DM0A 5E2BA 2AOTA 5E9JA 4YUWA 3C3PA 3KU1A 4QVGA 3HTXA 4OA8A 4MIKA 4AZSA 2ZULA 2ZW9A 4LECA 1NW6A 5T64A 1VBFA 2O06A 2PXCA 3CBGA 1SQFA 3MERA 2CWWA 3LL7A 2DPMA 3CJRA 3ELWA 10MHA 1RJEA 1AF7A 1FJXA 2ZWVA 3EVFA 3K6RA 2AOTB 2ZFUA 5H02A 1VL5A 3M4XA 3P9CA 5EZSA 3EVAA 2P35A 3HVJA 1SUSA 2IH5A 3EVEA 3P2KA 3NW9A 5LR6A 4IWNA 4FSDA 1NV8A 1IXKA 4FZVA 4HTFB 3A4TA 4PYIA 4PNEA 3GRVA 3HCFA 4X63A 5E8JA 3LKZA 2ZBPA 4DKJA 1MHTA 3BKXA 3G89A 4EQZA 4KIGA 5K8VA 1D2CA 1X1BA 2YXEA 5DT2A 5FUBA 3REOA 4EMSA 4ISCA 4RTMA 4C04A 1P39A 5EIWA 5CCBA 2E5WA 3A26A 4P7GA 1EJ0A 3P2IA 3KPUA 3V97A 3GCZA 2B2CA 3PX3A 1YFLA 4HC4A 5T6BA 3LDFA 4RTNA 2Y1XA 4O29A 3TFWA 2Z6UA 4P7KA 5CVUA 1XCLA 4AX8A 3TOSA 4PYQA 4DCMA 5EVJA 3ELYA 3FUVA 2HV9A 3PFHA 1NW3A 1O54A 2HMYB 4DZRA 4YV0A 1Z3CA 3FUTA 3UJDA 4FP9A 3Q87B 5K0CA 5FULA 2A14A 5ICCA 4RTJA 2ESRA 1BHJA 3OFKA 3QOWA 4X60A 3LGAA 1YUBA 2AN3A 5EMLA 4X1OA 4M37A 3A7DA 5GINE 5DXAA 4GF5A 3AXTA 5CUQA 2QRVA 3KR2A 1T43A 1X1AA 5FADA 3R0QA 2AR0A 2EG5A 7MHTA 8MHTA 3B7PA 4G56A 2PX2A 4FT2A 3E05A 1I1NA 3H2BA 3I9FA 4OA5A 3BKWA 3UJ7A 1QAQA 3QOXA 4IKPA 2QRVB 3L8DA 3C6KA 3NJRA 4WXHA 4F85A 4DMGA 3DP7A 2PV0A 3PB3A 2ZZMA 1MJFA 4RSRA 2HTEA 5C0OE 5IH3A 5CVVA 4OQEA 5K05A 3SSOA 1KHHA 5EG5A 3G7UA 5E9WA 5BW5A 2PLWA 2FHPA 2PX8A 5K0EA 3UFBA 1ZGAA 2G72A 5KQSA 1QAOA 4AUKA 1KP9A 3JWGA 3V8VA 1INLA 5LQJA 5DLYA 3AWIA 3NDJA 5DRTA 5KS2A 2JG3A 3OZSA 5M5BA 1V39A 3GXOA 1EAMA 1ZG3A 2OO3A 2PX4A 4KIFA 4DF3A 4E70A 5HIKA 2C7RA 3FRIA 3NMUF 3HCCA 3G2QA 1B42A 5KQRA 2ZBRA 4PCLA 2Q41A 2XYRA 2O05A 3PT9A 5EHGA 2OYRA 3KKZA 3BWCA 2PVCA 1RJGA 2PJDA 3LBFA 3T7TA 2V74B 2LD4A 4Y2HA 4MWZA 3BUSA 4GOLD 5DWQA 5F2NA 2OKCA 4QDJA 9MHTA 4BLWA 4RTSA
chains in the Genus database with same CATH superfamily
3A9VA 2VJKA 3N7TA 2B99A 5JADA 1MB9A 1SZDA 1BC5A 1PJLA 4Y6OA 5DHAA 3WGMA 5C81A 2BLNA 2XOKD 2VJPA 3INGA 1CXZA 3A05A 1JALA 1EA5A 5EEHA 3B53X 2C94A 3KOMA 3TQSA 3E81A 5DNYB 4KVZA 5JS8A 1DQYA 1DBSA 4FS8A 1HE5A 3N87A 1M10A 1M6EX 1H8EA 1RJWA 1R00A 1GUDA 1TMKA 1TQDA 2W6IA 3GMTA 1FQKA 4KWEA 3PD0A 3PTAA 2FN9A 9LDTA 4TV8F 4EB6B 3KQUA 4GLLA 4DCGA 1SQ0A 4OLJA 1R12A 4LE2A 1LBHA 2L82A 4MTLA 2ATVA 2AXQA 1CDDA 3AK4A 1JU9A 1R8SA 2P40A 3D2LA 3WGTA 5IVKA 4HNSA 1OPRA 3AONB 4L4UA 4B6EA 2B8TA 3WWCA 3G8YA 4HDQB 3OCZA 4AJPA 3C3DA 2QIOA 2RGNA 1LPNA 4MI3A 3PTLA 5THXA 4UD2A 4GVXA 3RJ5A 3G0CA 4ZVVA 1Z5UA 3H04A 2IDMA 3IV6A 5GIOE 4C87A 2CD7A 4ZZ0A 2RDMA 1G5FA 1X7ZA 5LQDA 2B8JA 1R64A 3IOYA 2WJ3A 4JOCA 1KYVA 1YCGA 2HZBA 3PRYA 1Q50A 2OYCA 1JQ3A 3B3JA 5T7BA 4HBGA 3D3EA 1RQRA 5CVCA 3RWOA 2R5WA 1P75A 4LSMA 1L5WA 4WBNB 4FPXA 1GAJA 3SJUA 4DIUA 2CYCA 2WWIA 7ADHA 3P97A 2JD2A 4R2HA 3VHRA 3KXLA 1VJRA 4PHHA 4AZ3B 3HCAA 2GF0A 3EGDB 3CEAA 2I2AA 3KELA 4QC2A 2VO1A 4P5PA 1U31A 1U3CA 3AOGA 3KHUA 4E33A 2VQFB 3IT1A 2B4KA 3D1JA 4JIMA 1UBTS 2ZT8A 2G82A 2H1WA 1L5SA 3DFFA 5GGXA 2OFFA 2XZTA 1RRGA 2MMGA 2YJ5A 2IPXA 4IKEA 2IYRA 2ZRBA 4C7BA 1DOAA 1OXSC 2HDHA 4XTRA 2JJ1D 4WSOA 2DE0X 4E5MA 1U6IA 2WD9A 3KVNA 2H5LA 4ZU1X 3DLCA 3VYSB 4Z4FA 1NMQA 3T4UA 1ISIA 2GFQA 2PWAA 1BJKA 2VIIA 1K8QA 2QUJA 4QSHA 3A2KA 3HO8A 2AZMA 2AC4A 3JASB 1RDFA 3G1UA 4AN0A 3GDOA 1Y6FA 2CYAA 1SXHA 4KRYA 4ZHQF 2R62A 3EVCA 5KOJA 1SZJG 4DLBA 3RLIA 3NOXA 2CCGA 5H82A 3QU4A 4B43A 4J0GA 4H7IA 2AX4A 4MYRA 2BGTA 4WJZA 1RS0A 3JTMA 1LRKA 3ZBUA 2B82A 5KHLB 1P5RA 3HACA 4O4HA 1GYPA 3LH5A 3RQIA 3FCAA 4OFZA 2YWHA 1OD6A 1GWNA 4GU5A 5CEEA 5TPWA 5FA8A 1FP7A 1E3IA 2O2SA 4D3DA 1A5TA 1ENYA 1OIVA 2NO0A 2WWFA 3KZ1E 2C57A 4KO4S 2XLCA 4ARBA 1BGWA 2AB0A 2WP0A 4M86A 1GPUA 1P8AA 5E1DA 1SVLA 1ZI6A 3NDIA 2M6LA 1FLVA 1B8PA 2XBLA 3FUUA 1X87A 2A1UB 2WSSD 2JFOA 3CNEA 4RF4A 1E1QD 4MQUA 2TMYA 1CYEA 1BHSA 1EIZA 3GDFA 1AKEA 5FB3A 4R16A 1XDUA 3QSGA 4MGZR 4WKBA 2WIFA 2M1XA 4P31A 3AKDA 1CUJA 9ABPA 3SWWA 3WYDA 2IIBA 2B2XA 2QJRA 4FX5A 1T2VA 4WTOA 1ZD3A 2PNFA 5MF6A 1EEHA 3GCXA 4WMLA 2XA2A 3HB7A 3H4TA 3I32A 3NCTA 1ZU5A 1JR3D 1LPBB 3LGXA 4W1QA 1SKBA 3I34X 1PBNA 2R8EA 4M0EA 2P41A 3IOCA 3NOOA 4PR3A 1D9ZA 1MB3A 4G0ZA 4PPQA 1XP5A 4P3PA 4BO8A 1CUXA 4DCTA 2OCKA 1JH8A 1ZSVA 4C43A 5IABA 2EZ9A 2FDCA 5DLEA 3KPWA 3HSSA 4RTPA 3OLYA 2UKDA 5HFJA 5ED0A 4ZAFA 4QLOA 3PYLA 2O4UX 4ABYA 1CZLA 3DE2X 2X86A 3GUVA 3K2EA 1YD7A 4BZXA 1JQEA 1FUKA 2OESA 5B30A 4RVOA 2OD7A 4HNTA 2YUTA 1O95C 3M6WA 3W3AA 2IZ7A 3ZV7A 4QICA 5IF9A 5LYJF 1GG5A 2VN8A 1ANKA 4L15A 1VHLA 4P3YA 4U0JA 4RPCA 1Z63A 2Q49A 3CWZA 1IG3A 3QK7A 4O08A 5EJ2A 3TVDA 1Z6YA 5BPHA 3DT9A 3ADBA 2Y1GA 1QJ4A 4J0KA 3RVBA 1Y0BA 2ZWAA 4I4TB 1U9ZA 4M2LA 4MP8A 4EHAA 1MC8A 1VCOA 4X24A 4DCOA 3BL8A 3KQSA 5SZIA 2IYVA 1CRWG 4PXYA 1DXOA 3W2EA 3IUYA 3NRJA 3DLHA 2BEJA 1I14A 2VZEA 3C6BA 5CVJA 3RVDA 4DE5A 3TNDA 1EEXB 4DDKA 4N6OA 2K7ZA 4RACA 1WX1A 5ALLA 1TQ8A 2LDBA 5EJMA 5IF3A 1ZJZA 2VZ9A 3DG9A 4YJ2F 1U0GA 2AQHA 1RFLA 1G5PA 1KY2A 1NSYA 3DBIA 3HKBB 3DFIA 5C1BA 2F48A 3MYRA 1X80B 3BJEA 3SGLA 2PBRA 1RHKA 2ZSBA 3QVKA 1Z0FA 4HAUA 4UPDA 2DB3A 2ZJAA 2IPOA 3ESZA 1JKMA 1J22A 1ZM4A 2PH7A 2ZXFA 4HDSB 1BXZA 2Z57A 1RZ3A 2BFMA 1XK6A 3BJMA 5B1EA 1ZH2A 7REQA 3EFHA 3TBHA 4OSOA 1IU9A 1YXMA 1ZM7A 4MR9B 3OQ6A 3Q6IA 5DWDA 3UYLA 4C0KA 1AXGA 4KBGA 3V4SA 4AY2A 1S7CA 3QVGA 5A6SB 3M7IA 1EX7A 1SUWA 1TF2A 2WJYA 3QG1A 3QUCA 4BO2A 1V1JA 3EIXA 2QTVB 5DYWA 4UTPA 3WDLA 3LUDA 2ZYAA 2Z3ZA 1ISMA 2OY0A 3KOOA 4CQJA 2H17A 4DXAA 4KQCA 4QXQA 3DH0A 1W9HA 4MS1B 4ZOBA 5L6LB 2HSJA 2N46A 3TR6A 2DHDA 2D7JA 5IT4A 1W94A 2PE5A 1K8XB 3GARA 1UXHA 1AGNA 1KRHA 1LSOA 4X71A 4DARA 8LDHA 5BSGA 4TKUA 1WNTA 2Y0DA 4H6VA 3NGLA 5DM4A 2I2CA 3O8QB 4C0JA 2PKQP 1H2WA 3MJSA 4ES6A 1N75A 1TB4A 3U5TA 1LFDB 3QUSA 4F5EA 4NU6A 4OMUA 3G49A 3SS7X 4WNIA 3H4MA 3M89A 3F7TA 1MW8X 4DJTA 3PXAA 3BGIA 1Z0IA 3AHIA 1H69A 3TRDA 5A3JA 5JCZA 1CQPA 3IMCA 5FWDA 3P2OA 1D5CA 3H86A 5AK4A 5FWAA 3W5VA 3FNEA 3O74A 2WW8A 3W5HA 5KNBH 2GAIA 2W2TA 3ZHYA 3DMDA 3D0OA 2X1LA 4E0BA 3A27A 5U9CA 5LYYA 4DSZA 1M3SA 5CFLA 2QW1A 1VIDA 5BN5B 2J0UB 3LYLA 4JH0A 4NBNA 1KOGA 1V1RB 3UGKA 2FSVA 3NONA 1JDNA 4NESA 1CE8B 4M1WA 1AT1A 2A0YA 2OA0A 4OB6A 3V2GA 5ER9A 2HMUA 3UJPA 3P2MA 5K09A 2A4MA 4QNMA 2B61A 3VGJA 2J5QA 1HYEA 2QK4A 4U3JB 2D1QA 3AZQA 3GC6A 4QL3A 3GGDA 4YP5A 4DBZA 2SCUA 1WQ4A 5K3FA 5EJ4A 3JYNA 3L4BA 2Q9CA 4ATNA 1NWCA 1ZR4A 5SY4A 1T1JA 3ANMA 1JT2A 3N86A 1OB5A 5K3EA 1DWPA 3B89A 2GBIA 3K96A 2XVMA 1KZ7B 1T8WA 2DM6A 4A2PA 3T3OA 1CVLA 2PS9A 4WZBA 3DAHA 3I2KA 4OKSA 5AUPB 1N2SA 3S8EA 1OCEA 5AOCA 2YHUA 2ZT6A 2XCSB 4RTKA 1SJ9A 4QLBA 4LF5B 5F76A 3KT3A 4IMRA 4N65A 5E6UA 4YX9A 2FPOA 4H3SA 4U02A 3U4GA 1PWXA 3HRIA 4IEIA 3SI7A 1KBQA 5KYNA 1VJ1A 3KJFA 1UANA 1OFHA 3H16A 4RSMA 4TVSA 1M8JA 1OI3A 3F49S 1E3JA 2A1TR 1ZJWA 4IOJA 4EO9A 3QI7A 1GG2A 4QZVA 4QO7A 3KVVA 1OBCA 2ABWA 1OMOA 3T3IA 3BCSA 3ZGXA 2G09A 3IEVA 2Q3EA 4GDMA 3B3QA 4N0QA 4ZOAA 1P29A 1HETA 5KOHA 1R37A 3GJ5A 1I2CA 4ETMA 1U0EA 3JQ9A 2OCLA 3HXKA 4YMIA 1QTQA 4ZCTA 4HRAA 4JLWA 4HDMB 2SICE 8MHTA 1N57A 1UM8A 2AFIA 3NM5A 2Q4OA 1U02A 1EHIA 1PK7A 3TOXA 4F7WA 3WV5A 3RYHA 3GT0A 1K0FA 4CGZA 4F86A 1CF4A 4N8EA 1U8FO 2RHOA 3AVXA 2O0HA 1UK9A 2G1AA 4MAMA 2JJYA 5J2UB 4FR0A 2ZIXA 4GDFA 1I4DD 1Y3HA 1IN7A 1DJLA 1Z17A 1Z6ZA 3OIVA 3UB2A 4E08A 4CKWA 4ZK2A 2VT3A 2GN6A 1B41A 1N1EA 2CJXA 2J4CA 3FR7A 2J3EA 4LZAA 1TKCA 4Q9JA 3OCXA 3WYGA 4E1BA 1UR5A 2JATA 4UPVA 4PO8A 1IEQA 5FI0B 3HPQA 3COYA 1JXOA 3E8MA 3G17A 2O7NA 3TCKA 4NKRA 5DHRA 5I7UA 4YXWA 1YOVB 2F3QA 5EIEA 1MGOA 2OORC 3GLRA 3TRHA 5IJ9B 3SQXA 4EIWA 2G28A 3F7NA 2VDPB 4F8YA 2WAOA 2HV8A 4YAUA 3F1KA 3BS4A 4MRRA 4H59A 5AJTA 2ZUBA 1UJ4A 2X6QA 4NMHA 4QAJA 4Z9AA 5LLDA 1WMDA 1E2EA 1YFKA 2WF7A 3RAJA 4GBMA 3C16C 3LF2A 3ODPA 4C2TA 3PU6A 4AZSA 3K05A 2HT1A 3GPIA 1NKTA 2NT3A 3ND7A 2AYXA 4ZQEA 5EIXA 1K89A 4MKFA 5J4VA 2ZVDA 4JU8A 2UXDB 4KR9A 4DPMA 4F3TA 4I9FA 5CITA 2VATA 3AIMA 4F45A 4ZGWA 2BP7B 1NXXA 1DX6A 1ODTC 2WB4A 3QHQA 4XM0A 1DDIA 2OAP1 2ZI7A 5CJJA 1A9YA 3SYMA 3TZ6A 3R7DA 4MRPA 2P9ZA 5EZSA 4C2BA 1H4QA 2JI6A 2V5AA 3SDBA 4U00A 3PUZA 4OLHA 4O63O 4DQUA 4HWTA 4W5WA 2IKSA 1XE3A 3RM3A 3ZWAA 2UZAA 3UK7A 2DLCX 2Z8ZA 3VU9B 1UPCA 2J07A 2ZIVB 1GP2A 1DEHA 3PX7A 1DIAA 1OFGA 1CPYA 4OGKA 5A1TA 1X1BA 5JVDB 4L9RA 5K1ZA 3SLGA 3A6KA 4IFBA 2B8WA 2BJVA 5EN4A 2XA9A 2QY9A 5JNLA 5JSZB 1HZJA 3V97A 1MFPA 2ZJYA 1RE0A 4CQMD 4KRFA 2ARKA 3OFND 4F6LA 4KK3A 2W6ZA 1E9SA 4N3AA 3PNSA 4DCMA 5BWOA 3H9CA 4UVHA 1KJQA 2DAPA 3FAKA 4WVFA 1IJBA 1SBZA 3QJYA 4MCIA 3W04A 2AQKA 4RKRA 2Q27A 3BCHA 2D00A 3WMRA 1E2JA 2CLDX 3A3PA 3HU5A 1QPBA 3MQFA 1WCYA 4YMSA 5EMLA 4J16C 5K8JB 3KYCB 5I7OA 2PKEA 3CSUA 1Z3IX 1CP2A 1ONSA 1T43A 2YV3A 5I9TA 3WQRA 3VOAA 5CA1B 3WMFA 1W1IA 3TMKA 1A5SB 1KYIA 1MAUA 1WSWA 2OKGA 3D4BA 4BLQA 1VCIA 3ADOA 3EIHA 4CIXA 3FOWA 4P4NA 2IDZA 3C6KA 3NJRA 4R9NA 1RPTA 3C3EA 3FNGA 3U4IA 1GPKA 4OJQA 2P9HA 4RL6A 1F8YA 3E27A 2ZUSA 2OTCA 2K7FA 4RF5A 3STXA 1Y89A 3PGA1 4NNJA 2V7QD 1KKLA 1QJCA 4NCNA 4C2UA 4O2BA 1ITZA 4NL4H 1WBDA 4GGOA 3AJ9A 3C7AA 1LI5A 4Q4CA 3HI6A 1SCJA 3C2QA 5IBPA 2XMBA 1E0SA 1C3VA 1H8HD 4E1AA 5KS2A 3OFVA 5E7IA 1T35A 3S29A 1DOHA 4J0CA 3C7CB 4LC0A 3O3CA 1HA3A 1TVEA 3UQYS 2WYHA 1EP3B 3PNMA 3W34A 2ZBFA 4Y8VA 3A04A 4IIJB 1BWSA 3EQ2A 2MSLA 1CHDA 2IHJA 2OOKA 2XYRA 4NCJA 3D7NA 5JO9A 4EITA 2VPYA 4JVNA 4NOJA 3VOBA 2JPDA 3LWNA 4NFSA 1BW9A 5FNVA 3FR8A 1ISPA 2VNSA 1L5LA 3MXOA 3UGQA 3PE3A 3BB4A 4KQFA 4QDJA 1FFXB 1JDPA 1JQKA 1TLFA 1Q1QA 2MSDB 3UTDA 5FYQA 1CUBA 1GA4A 1AGYA 4OU5A 3S5UA 3T7SA 4N40A 3USES 3VZRA 3UK6A 4PTZA 2V6GA 3GD7A 5JD6A 4IQGA 5A9SB 4JQSA 1G63A 3PI7A 2W4MA 4TYQA 1UMDA 2CXQA 1SKMA 2JZOA 2EV9A 2EZ8A 4QUJA 4LXQA 5BOSB 4MUAA 2PEZA 3GLFA 2GUWA 3HFJA 2M1ZA 1R6TA 4GSKA 1HL7A 1IULA 1WY7A 4BQPA 3FOBA 1SHJA 3VAYA 4BBAA 1W2WB 4I0WB 1COWD 1G5RA 5BW4A 4B3TB 4DR2B 1DFHA 1PYDA 3AKCA 3GN2A 3QEOA 4HOYA 2RC6A 5A1JA 2V3VA 1IPFA 4GMDA 5IXSA 1EFRD 2R44A 4XQ9A 3RSLA 2ZAGA 4O4HF 4UHJA 1FP2A 1MV8A 3PNVA 4PO9A 3F6RA 2XXAB 2YZGA 2XRZA 2QNBA 1BS9A 2GF2A 3Q85A 2BLLA 3IKMB 3FPHA 4FGJA 2XCTB 4XJTA 2C42A 3DDUA 2G7MC 5JXGA 1NULA 1Q11A 4WT7A 1C1XA 5M3BA 2M9MA 3KD2A 4PC3A 5I7RA 3E5MA 3D6AA 1AQJA 2E18A 3CT6A 5A05A 1E7WA 4N0MA 3HDHA 4HD8A 4AM8A 1U28A 1YDMA 2OV4A 3THXB 5DX1A 2FDXA 2FY8A 2VG8A 3FCOA 3O95A 5DBFA 3ET5A 1EFPB 1OASA 4NFLA 4E46A 3RSQA 4K3UA 1O3YA 4JJZA 4RORA 2P7HA 3D1LA 3AEYA 4LSWA 1ML3A 1HDRA 4RIHA 5LU9A 1DV1A 4DADA 4FFPA 2QLFA 1TDJA 1AU9A 2Q2QA 2ZJ5A 1XUOA 2BTQB 4YCCA 2QSYA 1YQXA 3LQ2A 4V0NA 4WKCA 2PBZA 4EKGA 2EERA 5ADUS 1L4NA 3I5MA 1TEVA 1DJNA 2VL7A 2YH2A 4FFSA 4QA9A 1FDIA 4RIEA 5IWCA 5CTAA 2CHVA 4P0QB 3I05A 2VF8A 3BE6A 3RWBA 1FS4A 3ILYA 5AM0A 2QB5A 3RGWS 2JH8A 4M1ZA 4X95A 3IPCA 4B0PA 2HBZA 3E7FA 4RTRA 1YVRA 4L9WA 1ZS9A 1P0FA 1Z2NX 2Q1YA 2X5JO 4PHTA 3VGPA 4DDTA 1WQ1R 1O7JA 2VSQA 4URFA 5FF9A 3RAGA 1U90A 3GBSA 1A9RA 2ZVJA 4HUQA 2HJGA 5FPTA 2WHPB 3RRJA 4OYYA 2WYOA 2TSYB 2OE2A 4G5HA 2J8ZA 4L8WB 1QMPA 2JANA 2NVUA 2XA1A 1XMIA 1NRXA 3VPAA 1U9CA 3VDXA 5FPHA 5HEKA 2ZSAA 1J00A 5AYVA 4E5UA 2YY5A 1OHHA 2ZRJA 4JOBA 3DNFA 4AZVA 4EENA 3KT0A 5B2ZA 4L8FA 3LUKA 1N36B 1YS2X 1ZCZA 2WILA 2Z43A 4EQ6B 2J6CA 2V3WA 1N2BA 1U3UA 1XLWA 1EUCA 2AK3A 3ZWPA 3K1JA 1V43A 3QLVA 1N0HA 3P5BA 5E2IA 5U4QA 2IHYA 3LOQA 2JFPA 5EKXA 1YL5A 2MSWA 4E14A 1PFQA 4JXJA 4E13A 1E1CB 5FCDA 4YRTA 3H2GA 3K72B 2KS6A 3E22B 2O5CA 7MDHA 4DY6A 1VZ2A 5EJFA 1Z07A 1GHTA 2C20A 1I4LD 1E3WB 4MQ4A 3MGGA 4LF8B 2P1RA 3TQHA 3TI7A 3BFJA 3R7NA 4G1FA 1N34B 3OU6A 1ZNYA 3DE3X 2BHTA 2JVJA 1LKZA 3LDUA 3PZRA 2BYTA 4C5BA 4XUEA 1FXWA 1GIAA 2PLRA 4EMUA 3ACCA 3M1IA 1UJ6A 1M8PA 3OF2A 3U9LA 5TGZA 2GZRA 4LRYA 2QP3A 3K35A 3LX6A 3ZQJA 1TUEA 4HMOA 3UW1A 4TRNA 4EK9A 1TA0A 2DGDA 2GAAA 3GPCA 4OSEA 5GWXA 5JJBA 4ENUA 1MFZA 2F67A 3KL2A 3ESXA 3D8BA 4X94A 2LE0A 3NWBA 3E3OA 4A36A 1MQSA 1ADFA 4FFVA 2R25B 3V3TA 1G6KA 3LP5A 2F9FA 3REQA 1N5MA 2PQ2A 4KRGA 5JQWA 1WE2A 3CUSA 3U7QA 1L7RA 2WM2A 2A1IA 2WABA 1VKZA 5DTQA 3IBGA 1BCRB 2FF7A 2FRVA 2J45A 1OGJA 4Q19A 4LNUA 5IRCD 3LKDA 5J2TA 5EIAA 3U37A 2P77A 2HEGA 3SJZA 3JQ7B 3EHDA 2R4QA 3ORSA 2D2VA 3BT7A 4G9GA 2GLTA 3RVQA 2NO9A 4GI1A 5I8WA 2V7WA 3LPAA 4J29A 1Z6AA 1Z74A 3AY3A 4F3KA 1B8VA 1YZFA 3LCMA 4DMRA 2EKLA 1APBA 1L3BA 4M7OA 3B8EA 4R1OA 2C4KA 3ODGA 3WWDA 5I8PA 5JASA 3THWB 1G3QA 4LDNA 1J8FA 5AJZA 4M1EA 1Q0HA 3LUHA 4BASA 2XRFA 2RBEA 4FFDA 1GTZA 3EAGA 1D8TA 3U3KA 3VDNB 4L5IA 5EXTA 1J06A 3O3NB 2AFIE 5E1OA 4E6EA 3B1KA 1PIWA 3C0KA 4BHTA 1GPMA 4FFBA 2XGGA 4TOIA 4OKIA 4FC6A 4WNCA 1M0SA 2CT8A 1J0EA 3GZJA 4B9EA 4H1VA 2MR6A 3TFOA 2BD0A 4JJAA 4IV0A 5FI3A 5LDGA 3RC2A 5AJXA 3ZQKA 3NJ4A 3FOAA 2HRDA 2QD2A 4G2TA 5EMNA 4BN0A 3HCBA 4B47A 5AK3A 3UBTA 3HUUA 2SKCA 4L3WA 4CDNA 1VHTA 2H9YA 2B21A 4QUKA 3V4VB 1Y3AA 5LP6B 4EF5A 1MVNA 2VT2A 2JLVA 3K9HA 3GI1A 1E2UA 3HYRA 1J8VA 4YJGA 1CR1A 4S2UA 3GLVA 3VYTB 4I7EA 1N92A 2EU8A 3GZTB 5DRYA 3LC1O 4DAOA 1KEWA 1KYWA 3GO4A 4UTZA 3LXRA 2WJPA 3G7SA 4RHEA 3NHWA 2R1TB 1YI0A 1N2JA 4M8LA 4R6XA 5DJ5A 5P8WA 4P5DA 1YB6A 2DUMA 5BNZA 3V1LA 4FYVA 2D3WA 3CUTA 3G2NA 2RSLA 1GTJ1 4HRYA 1NBIA 2JIRA 1LSJA 3VZCA 2Z04A 3FSRA 3GIWA 4IVRA 4XCXA 3PEYA 5KNDA 1VPDA 3PYMA 4F12A 3N3AC 1NW9B 1Z29A 3E53A 2OPHA 4YHBA 2C7OA 4CIBA 1TUGA 3HRKA 4A1OA 3CYFA 4EH1A 4EG7A 5MHTA 1NUSA 4MGKR 4ZEOA 4UVIA 2ZB8A 4BQSA 3LO5A 5ERYA 2Z08A 3IQXA 5BSKA 2QMZA 3RSFA 2XGSA 2H0QA 1I4TD 3B1XA 3VSBA 1J49A 2HCRA 4LGMA 4G5QA 4EF6A 2PGAA 2PRKA 3E1KA 3SQLA 2OHJA 1L8LA 1Q15A 1W5TA 4LXXA 4KVFA 1XN4A 1KI7A 2HJRA 2B8EA 4UHKA 4UUOA 3ZHRA 1XA4A 2O2JA 5B4VA 4TT3D 1I7DA 1PZXA 3VPXA 1AK1A 2IS6A 1NXSA 2CHGA 4G1MB 3UOGA 2B1QA 1NBWB 1IUKA 3NG1A 4NPHA 2P4HX 2Q46A 3AEQB 5CNJA 4ETNA 3G2HA 3I30X 5AI5A 3GJYA 1Q1EA 5AHWA 3MJRA 3NBMA 4DEVA 3T12A 4BIIA 3B1VA 3NC4A 2HBQA 3DFZA 2ZAMA 5B3LA 2I6GA 3ZBPA 2Q1UA 2NU8B 1LBTA 4GQIA 3JD4A 6REQA 2HF9A 3VKWA 1PYGA 4MINA 1RAEA 1V0JA 2FN7A 2BEVA 5HSGA 4C7OA 1UFKA 1KWKA 4AS2A 5AKKA 1YI1A 2JD0A 5BR4A 4HQLA 3K2IA 3O83A 3ECSA 3H5WA 1CZOA 3WK9A 1XRMA 4BPRA 4LFCB 3QTTA 2Q9UA 2DBRA 4IO0A 4JYCA 5BSTA 4WFKA 3E2IA 3DXXA 4H3KB 1KDTA 1XDSA 4AO7A 4NG4A 1SHKA 2JIQA 1D03A 3HVIA 3U3JA 1JKJB 1K7XB 4BATA 4RH3A 1KH3A 2IK8A 1G2QA 3W9UA 1XZEA 4C4ZA 5IZCA 1UKEA 2PKCA 2IRWA 2O8FB 1A4UA 1LZLA 3OCVA 2C03A 4EEXA 5EWLA 1PCXA 3QW2A 1GSHA 5KTYA 2C8LA 1JFLA 2QLMA 1MOSA 3ANSA 1N3LA 2UUPA 8GPBA 2D5LA 3A4YA 4RE5A 2PX6A 4GQBA 1OLSB 4BLOA 2HK9A 2XE6A 5AM2A 1SKYB 2BDTA 2HY7A 5T8KC 4X0EA 5AKXA 2GEBA 3WSVA 3RUPA 3PC4A 1FNDA 5DEIA 1V2HE 1Z5OA 3PHJA 2K6GA 1Z4PX 5ALFA 3TLXA 1Z7YA 3W6NA 1NVKA 3HJBA 3DKIA 4RPKA 3COSA 3BTUA 4KK4A 3SHOA 4MYTA 3E1GA 4UEOA 5G1NA 3TEJA 2I3AA 3Q88A 3VHLB 4NQZA 3QX9A 3E7XA 2H1RA 4MA0A 5L7TA 1VMKA 1Z8FA 3DWEX 2XUIA 4G01B 5K0NA 4CKCA 3L9WA 5A2QA 3SIRA 2PWPA 3OJFA 2O7QA 1IATA 4WN9B 1PAUA 5EHIA 3DFMA 1UPAA 4MP3A 1DPGA 1IN6A 1T0PA 2JGFA 1K9VF 2C4WA 2QUHA 1K8ZB 4C3ZA 2JLRA 4B44A 4DBLC 1YC2A 3P96A 3HZHA 2R97A 2OK8A 3FHLA 3S2YA 2G70A 3VUEA 4K6FA 4D9EA 1PS9A 1RWOA 3C4QA 2FRXA 2X14A 1VIVA 4RFSB 2BFCB 1NSTA 3WYEA 1I2ZA 1K5HA 2Q8PA 3UXHA 4F2HA 3BK2A 3BK7A 3O8BA 3OUTA 4BNXA 1YCFA 3G5TA 4CL2A 1HE4A 1VE7A 2FJUA 2QTFA 3GLHA 2YNMA 3SZGA 2X8LA 1NLUA 2A3RA 3SZRA 1TJ3A 1W581 5KBYA 2O3UA 3C3PA 2XD9A 4M3NA 4UBOA 1JDZA 1T1RA 2X9GA 5HDBB 1I0IA 1SQFA 1SVKA 1VFPA 4HDKA 3K4PA 3KUXA 1UC9A 4WNYA 3GQBB 4MLPA 5KU1A 3H8WA 3OZIA 5JQGA 4JL6A 1IAQA 4FYIA 5JSQA 4O2BF 4JT2A 3INNA 1VE1A 1NPTO 1TQ6A 4EJFA 1O0CA 1SZCA 4U6QA 3VJKA 3OZEA 2ID4A 3Q7RA 3P2KA 3ISVA 3A10A 3ZWXA 1RHMA 3NW9A 4Y9RA 3RWMB 5JBQA 1NV8A 1PV4A 3RV4A 3KLPX 3AHEA 5BQOA 4HTFB 3DMPA 2BMWA 3ZWCA 4XD2A 4KOAA 1PQ4A 4TZ6A 4JGIA 1B16A 5SYNA 4D5GA 5AW7A 4DUZB 1BEUB 1ZHOA 1QGUB 1V7ZA 1MO4A 1ZGZA 4URYR 5F7JA 1H42A 1NBEA 1GQFA 2OD9A 5FL7A 5FNVF 3WLNA 4RQAA 1V4VA 3HZOA 2X77A 2NAFA 2HMSA 4PZEA 5AXBA 5DU2A 4HC4A 3ORYA 3EXHA 3HY6A 4NATA 1SKUA 2BIFA 3LO8A 4PRZA 4IQFA 4F21A 1NDUA 1UPTA 2F4NA 1KIFA 3GELA 2J7KA 3UMJA 2V7BA 2Y1CA 3E03A 3EYWA 1EFUA 4EKYA 3MT7A 2H1IA 1E9BA 1Y5MA 2EWMA 2FUNB 3EA4A 4IDNA 4K0RA 4MP6A 4UBNA 5H5JA 3GGOA 5KVCA 4YPFA 1U3GA 4U39A 2ST1A 2Q4BA 1AA6A 5GINE 4Q3EA 2AYZA 2ZE8A 4EY6A 1X1AA 3USCS 1DJPA 3FJOA 3R0QA 4PZLA 2AR0A 3T5AA 1NVVQ 4FBGA 3B7PA 3CLSC 3H8JA 3OOYA 4UHEA 4LJKA 1I1NA 1DFGA 2YHIA 1ZKMA 4OA5A 2RB5A 4MS4A 3I4FA 2ZB4A 1QAQA 4Q15A 1OBVA 3BA1A 2DXIA 1DG1G 5JXIA 1NM5A 1AQNA 5C0OE 5FBQB 3ROEA 1IY8A 3ABZA 2E5FA 1VBMA 1UBKS 3L43A 3GFVA 5E38A 1M34E 4RADA 3HBAA 3GRCA 4FONA 2WU4A 3LT4A 4M88A 4OXXA 3WFZA 3GPBA 4ZK6A 2FB9A 2OM2A 5JANA 1ZW6A 4ILEA 5JT1A 5FLXA 3URMA 4G24A 1W5BA 1JEYB 2ZRGA 3NDJA 4X92A 1JFSA 2BMAA 4AZ0A 4I1YA 1C0KA 1BA3A 5CGQB 1QVAA 3DUFB 4YRCA 1ODKA 5BOVA 4A6PA 1RHQA 3HCCA 4LS3A 3Q15C 4UHDA 2VCYA 1ZN8A 3P9PA 5JSKA 3B2EA 3VU0A 4O2AF 4DC0A 4ZVLA 1UOPA 2CLOB 1LLDA 2JGAA 4RZIA 5P21A 3UFXA 4YRQA 5IHPA 4FS3A 4MS3B 1MPTA 4IIHA 5F2NA 1G16A 3Q7IA 3W5SA 4BLWA 1FRZA 3P9SA 1XZNA 3TTYA 4C22A 4KWIA 4TVBA 5TQ0B 2X4DA 4OK6A 3UNXA 1GPWB 5JZVA 3P0IA 2QE6A 1UBNA 3LPMA 1Z0ZA 2AA3A 1V16A 3FPLA 4P53A 4TLMB 4P82A 4HH4A 4Y6LA 4KE9A 3ZNNA 1VI5A 4ZU6X 2PSSA 3DYIA 4H3HB 4BBJA 5TSDA 1RI2A 1ISSA 1NC1A 5BV8A 1UEXC 4B3HA 1GKIA 4J4TA 3BIXA 1R50A 4M87A 4INOA 3UA4A 6PFKA 1ZK1A 2YZ2A 4QYXA 1AUQA 4R1SA 3VVMA 1XZGA 4YTEA 1XRSB 2VJDA 2F55A 3LKBA 1XP8A 1WZEA 3EIUA 2WE8A 2GR9A 2OHGA 1T29A 3MMPA 3LJKA 2PG3A 3MTBA 4KAJA 2PPVA 3ZZTA 1SB9A 2HUNA 2XYQA 3KG2A 4L4ZA 4TV9B 3J81k 4F8JA 2H48A 3ENWA 3EULA 3KOWA 2HZ7A 4R3UC 4A5OA 4L16A 3W8EA 3C14C 1LX7A 2HA6A 3DOJA 3BOSA 3NORA 4BUCA 2CFSA 4ZIRA 1Y5IA 2QOEA 2F8MA 4XUGB 4HN9A 5I9LA 4ZO8A 2FP4A 4HNUA 1VRWA 3F97A 1E2GA 3MC1A 3UMFA 1EJBA 1LDNA 2OZVA 3I04M 4P3XA 4PV7A 4RGVA 3ZXXA 4BQRA 4EVRA 3IULA 2VAMA 4Q1VA 3LVBA 3GT7A 4Y1RA 3SP1A 1FIUA 1PVOA 1C8VB 1G18A 2BMEA 1MX5A 1UZMA 1DCKA 1F3OA 3H8SA 4GMHA 3TTXA 1FXWF 3FDXA 1C7JA 3LPLA 4XUDA 2PU7A 2VH2A 4I81A 4CMJA 4YAOA 5AOAA 1VE6A 5C7OO 2F4VB 1NI4A 1KDPA 2TS1A 1EWKA 2WHXA 2WM9B 3KAPA 4C4PA 3ZDYB 3CE9A 4KFUA 4A23A 4PLZA 5GY7A 3U7FB 1M1NA 1N5KA 1H1DA 2V8OA 4KR6A 2FK7A 1TLLA 5BO5A 3KAKA 1EDOA 3T3DA 4BFYA 5D01A 1M74A 2ZB3A 2HD4A 5BVHA 1S3SA 2ORWA 2ZRMA 4C76A 3DBHB 3Q40A 5BXQC 1YBVA 2ECQA 4U6SA 4DLVA 1SG9A 1K7SN 2FDRA 1MEJA 3DBOB 4JLKA 4X1YA 4BMDA 4I8DA 1ADJA 3G02A 3OKFA 4JCOA 5BMVB 5JY1A 3FWNA 1T3HA 2LDXA 2LGJA 4HXFB 5AM4A 5EIBC 4DXDA 3OPQA 2H4YA 2FTKE 4KO8A 2AS0A 1HYQA 3L7LA 2C2WA 1C3OA 4I50B 4JNKA 3WI7A 2BJWA 2P1ZA 2XTNA 3N39C 4ASUA 4BL5A 1LTHR 3TQCA 3L01A 1SUDA 1TQHA 3N2NA 1MPXA 1X8LA 2C83A 1AK9A 1L5FA 3BQ9A 4GSYA 1L5GB 1F06A 3WYNA 3QVMA 4B3XA 4CMAA 1SVMA 5LWQA 4KQGA 3QKSB 1YULA 1P1RA 1TK9A 1GSIA 1CR0A 3MUFA 3CJQA 2W8BB 3ZCVA 4F56A 4B3BA 1J8DA 2QYOA 4IIYA 4KX5A 1S1MA 3NH6A 4I1SA 5EYPB 3VI4B 5EJ9A 4LNHA 4D4MA 2QTAA 3CIOA 4WXPA 3BMQB 1JXMA 1PGOA 3Q11A 3TF5A 2Z3WA 2K4MA 2B4QA 4LJ7A 5AIAA 4P4SB 3QPCA 5LCXA 3SQOA 4MHTA 3MCZA 1IWOA 3UANA 3FOCA 1T5OA 3IHWA 2EDCA 1M1YB 1LRJA 1WPRA 3H8VA 1Z5PA 3HZZA 1A96A 3DWIA 3I45A 1E7YA 2FQYA 3GCGA 1U2SA 2QYTA 2HB6A 3LQRA 5ARBA 1P19A 2P2GA 1DEXA 1DG3A 2L0XA 3FNIA 4WGGA 5LLSA 2D62A 1S6YA 2XADA 1Q0TA 4RIIA 4W5JA 4R7GA 2P4UA 3VR3D 1ZD9A 4OFWA 5D3MA 4C08A 3D8RA 4NJEB 4NH0A 1IZ8A 3RD5A 4XCQA 3JZFA 4URVR 3CW8X 2OO5A 4JXKA 5BV1A 3I5AA 4FM9A 4D57A 3TLGB 5T5QA 3ID6C 3IUQA 4HBZA 4XKJA 5EQJB 1EE9A 1POXA 1YASA 2AF3C 4FYXA 4XW2A 4YROA 2SHKA 3CNNA 3QUTA 3QVUA 4KQKA 1TU4A 3USZA 2Z5GA 4GEGA 5J9FA 3RUEA 1C8LA 4B3SB 4EATA 3NGMA 1XFDA 2PUEA 5CM2Z 2ETVA 3D6NB 3FYUA 4DG5A 4IDAA 2BCGY 1NVGA 2ETXA 4FMDF 1GDDA 1X0XA 5TDHA 4MJ7A 1M6YA 3PQEA 3KQHA 2GTIA 3S1AB 3GX1A 4ZN6A 1F9AA 2X3UA 2H8GA 4OHRA 3PQ5A 2P2NA 2YXNA 1HO3A 2PTHA 3QGMA 4IOKA 5ABPA 1JH9A 4YRSA 5PGMA 3NHBA 4TMKA 5ALZA 2CUKA 5A3SA 3RIHA 2DY1A 4RYDA 3DHWC 3RK1A 1JQLB 3LSTA 5CCDA 2GXSA 3BCRA 1XSEA 1SCKA 4D45A 1YTUA 1CFZA 4AO6A 1FFHA 4UASA 4BGIA 4DIOA 1E1KA 1QNLA 3OSZA 4M8SA 4MCJA 4PYKA 3ER9A 3A1CA 2Y0CA 3C6MA 1OW3B 4JGBA 4XDGA 1EX6A 3CGGA 2H0AA 4X61A 1F38A 2OCDA 4FU0A 1N2CE 1JU3A 5KYGA 1WHTB 5CXXA 1MXFA 2XI4A 3DOHA 3GH3A 3NAMA 4JKIA 4O25A 1TADA 3O6VA 4RZSA 3V9AA 1G1AA 1ESZA 2YQ5A 1LU9A 3B3FA 3EGDA 2FPLA 2CZGA 2PGJA 1Q16A 1QFYA 3O2JA 3IP8A 1WUIS 2WWGA 3DHEA 5CNKA 3KWLA 2E0IA 4R9VA 5KNCH 1N77A 1TTQB 1X7YA 4KMSA 3RE1A 2I0FA 5I45A 1FEZA 5C8YB 1XQWA 5T67A 2QG6A 4PX2A 2XKBA 2GI4A 2Z5LA 3QVSA 1NMEA 4CM4B 4NHEA 4D9MA 1O6BA 3QPWA 3CVVA 1JHAA 1RKUA 4OL9A 4BX9A 3CBQA 3KCNA 4LCBA 2NNWB 1QWOA 1VSVA 1X39A 4KTVE 1I80A 4H77A 1M2JA 2AG1A 2PUVA 4IDQA 1A4XA 3KKEA 5JS7A 3HB5X 3EG5A 1AVTA 4L85A 1XEWX 4W5QA 2SBTA 4U5XA 3IC5A 4L9SA 5ECYA 3JASA 3EEOA 3TRJA 4N3GA 5GGYA 4POAA 4YUXA 3PSHA 1QH1B 4Z2YA 3ZCPA 2JEOA 5FBLB 1YRQA 1WAMA 2V54A 4GC5A 4RZ2A 2CXTA 2IYUA 1OXVA 1P3Y1 4P7FA 2IS1A 2NZXA 4J75A 4V1CI 4RAOA 2NTVA 5EE1A 1EXWA 1QMGA 2BZGA 3OO1A 1CNFA 4MRMA 4C4SA 5IHXA 5GOZA 5IWAB 1WPGA 2W11A 4IICA 1WY5A 1XEWY 4F60A 2XOKA 4M60A 4MUNA 4LOHA 3GRYA 1WVGA 4NNOA 4A2QA 1D1SA 2FHSA 2WKWA 4ND6A 5A4FS 3U3DA 4E2ZA 4MUKA 3SC6A 2BBOA 1OIWA 1VLLA 5AUQA 4K6OA 2YZMA 4D5EA 4KWTA 4QDUA 2EW1A 3N6RA 3H9QA 3U7GA 2ZPAA 4TTVA 2CMGA 3CMMA 5LQAA 1IEWA 5CT8A 2HA3A 1J97A 1ORHA 3NUGA 3GY0A 5YASA 1BFKA 2FLVA 1Q5PA 3KZMA 2ZDQA 1W2HA 2B30A 3U6KA 3BB3A 3DV0B 1AZSC 5ALMA 2HNAA 4JASB 4OXRA 4WCFC 2B25A 2WYUA 1JJBA 3FSGD 4HAOA 4R01A 5KVQA 3TZQA 2I7DA 2JS7A 2AGVA 3RRBA 2FK8A 1U9IC 3BD6A 1FZTA 3KV3O 3V8MA 2AZTA 1W59A 5MGNA 3GNTA 4HAZA 1WQ3A 3ZWNA 5KYUB 3EY4A 5EMHA 4EHJA 1JVSA 3ZCSA 3O82A 3TLJA 1JMVA 3U39A 3C5EA 3FGPA 3I23A 4OXYA 1MJHA 5AJUA 4C3OB 1OWMA 1N3YA 2AR7A 1GA1A 3AM5A 3IHLA 4HO1X 4ARAA 4UFOA 2SNIE 3L7KA 5KPJA 1CJKC 3FYHA 3QPVA 4JZKA 4ZI7B 2CSUA 3AJ8A 4TYMA 1FTWA 1WCXA 5BQ5A 5C31A 4NCBA 5EXPA 2WFAA 2C8KA 3NHUA 4TLAA 2LCQA 4QUAA 2A5FA 1OAOA 1QCDA 4Z0NA 3ZS9A 3P45A 1YS1X 4DUYB 5C7LO 4KQMA 1O97D 4E1VA 3BGDA 1JSLA 1T8TA 3NTQA 3WHIA 4RO0A 5FTWA 3K0FB 2A7XA 1UJ5A 2YXPX 1JG4A 5FTLA 3RHTA 2C3PA 3N9IA 4E21A 5KVVA 2R2AA 2JJ1A 4Q18A 1EXMA 2VDLB 3L8HA 1N9KA 2R7KA 1NYTA 2WTAA 4HSGA 3EWSA 1QQBA 1LWOA 3GCWA 3UMCA 1QK5A 1UBSB 1ZGJA 2I29A 3AKYA 4YACA 3HKBA 5JLJA 5DM2A 3T3MB 2CD9A 1EUDB 4HS9A 1JLLB 1JWAB 1SD2A 2R00A 1NVUQ 3IFSA 4EGQA 2F3TA 2VYQA 3F6BX 1CB0A 3C7DB 4PSCA 4Q4LA 4D46A 2UZ0A 4HDSA 3P8ZA 2FQWA 4D8TA 1YR2A 4K81B 1UWKA 4ENRA 3H1GA 3G0HA 3NALA 4CM8B 4DA8A 4FMPA 1SM4A 5IJZA 5LQUA 1OXUA 1Y9ZA 2QN8A 1XHFA 3P9XA 4NK4A 3WX0A 1O94D 2GB4A 2FPXA 4Z0HO 2C4VA 2N75A 2JLSA 4LXUA 2NSYA 4PGMA 5CA0B 4JU9A 4DV6B 4EFLA 1I7PA 4NU5A 1Y3BE 1IHPA 4UOQA 2FZ5A 3NFRA 3LY7A 4DDMA 2HQ1A 4HPWA 3KQQA 2Z6VA 3JZDA 2HLHA 4FI3C 4WKNA 2VHYA 1HE8B 3K92A 2P7IA 1L7NA 2WSSA 4FNGA 4GM0A 2O50A 4OHXA 1E1QA 4MS1A 4WY8A 2I1VB 1ZQ1A 3PQ7A 3A2LA 5DM0A 2LRHA 4OA8A 1E4EB 2ZULA 3SC2A 4CL0A 4ZAGA 4JKYA 5EHNA 4GMFA 4YYZA 4LXIA 2Y1LA 1YL6A 3CJRA 1X15A 4Z3KA 3WTCA 3SZMA 2JF0A 1RBQA 1USGA 3I9LA 4J7XA 4ZQHA 4XGNA 5C80A 4LXHA 1T36A 3X2FA 1ODCA 4UU7A 1VL5A 4G6ZA 4MNTA 1JR3A 1GNRA 5JTUA 3JQRA 4XASA 3T0FA 4BS9A 3LX8A 2IH5A 1PDWA 1PD0A 1DEAA 1LQ2A 2JI9A 1JQAA 3K30A 3LLMA 1W1UA 1KVRA 1L5NA 4YC7A 4DW8A 1Y6GA 3QF7A 2P68A 4PQFA 5CM8B 4IX9A 2WQZA 2HHCA 1CRLA 3FLMA 3LKZA 1KOFA 5ULLA 5TARA 3KD3A 2QPOA 4IIGA 3UHOA 5CBKA 2R6R1 5CB6A 3INTA 2AMYA 3I9NA 2NXWA 5BN5A 2JFZA 3G2LA 5EIWA 2E5WA 2A0UA 2YJ6A 4ID3A 4ZQGA 3RSOA 2YY6A 1XXHA 4PXAA 5BYJA 1CE8A 3FOZA 3SG0A 2D7CA 1MU0A 5T6BA 1YZLA 3LDFA 4RTNA 4O29A 2R2GA 4MVJA 5F5XA 3VR5H 1UKVY 3MTGA 4X6UA 1ZMOA 2G5GX 2ACEA 5AKHA 1OF1A 3BEOA 4U3JA 5IYZB 3TOSA 5I9NA 2KM1A 3B1FA 4DXHA 5H3HA 5CT4A 1LPMA 2XMRA 5FYDA 1YI8A 5ES3A 2FVYA 1KQFA 2OG2A 2W6PA 4WJKB 1N0VC 1Y63A 3OFKA 3WO0A 2AN3A 1R6BX 1F0PA 2QJFA 3AF2A 3EIOA 3BJIC 5H9WA 5JH7A 4UNIA 4GF5A 3AXTA 1X6VA 4PBSA 4TMZA 121PA 5KQLA 4ALMA 4CEHB 3F78A 2X4LA 4ZRMA 1X7WA 2FOXA 3R5FA 1U7TA 3FCSB 4YRPA 3IR5A 3ZYZA 3MSXA 4G56A 3KLNA 4BGEA 1AHIA 4ZVKA 3EFOA 3KJIA 3ESYA 1T0HB 3BKWA 1M5RA 2CJYA 4MLCA 5CYFA 3QWHA 2NX2A 3N0WA 2GCEA 4YECA 4FOOA 2H5EA 4M0LA 1U1IA 3OLVA 1JEAA 3KHTA 3UGTA 1VKJA 2IQ5A 3M4NA 2JZNA 5DNAA 2VNKA 4KAXA 2QHXA 2XAAA 3ZDAA 2WD7A 1OROA 3B2QA 3R0IA 4L4YA 3RC1A 3UKOA 2FHPA 4FDMA 4KHZA 4NWIA 3UFBA 1KGSA 1ZGAA 5CDUA 4HN4B 1E7MA 2Z58A 1JIXA 3WA7A 2YV1A 1HFWA 4MQ5A 2BSQA 4HZGA 3AWIA 4PC7A 2X2OA 1ZM9A 4MMZB 4QG7A 3AW8A 4LWZA 1IZYA 1FRVA 1DTSA 1IFXA 2PX4A 1B15A 1F14A 1M5UA 4HDMA 3IPAA 3ZWVA 1WHSA 1XVTA 5DM60 5IKPA 3QBDA 5CH3A 4ZPJA 5EHGA 4HLNA 3AT1A 5G40A 1YB1A 3HCOA 2Q4TA 2YZNA 5KHOC 2BFOA 3BXGA 4NZOA 2V74B 2X8JB 1XTSA 2Z56A 3R09A 4YPOA 5JZ9A 5L3SB 2OKCA 3PKJA 3N0VA 5JARA 2YW9A 3KEFA 3MJ4A 3SJAA 1IPEA 1GFZA 1YKFA 2IXGA 5FOSA 4CRWB 2PT9A 4GR5A 3U6BA 1GILA 2P5SA 3ZCTA 3TZLA 4DUPA 4ESHA 4TMXA 2IOQA 1BEZA 1MOZA 2BRUC 2WHEA 4FGWA 3SJ7A 2E1RA 1FYVA 1NLFA 4H17A 3V2IA 4YUZA 2V0GA 4IDHA 1C3LA 2A78A 2WSIA 1XHLA 2QVBA 4I3GA 4YRMA 2OCBA 3U4QA 4B76A 3QLEA 4UC0A 2Q3LA 2IZ5A 4PVCA 3KLMX 2Y2UA 3DVSX 5B2FA 2QVCA 4YT5A 4F6CA 3T1QA 3LA6A 1TAQA 4IXNA 1L5ZA 2XE8A 4REQB 1H3EA 3IB3A 1EMDA 1MOQA 1Q84A 3R20A 2ZSIA 2PLFA 1JQ5A 1I9GA 1TJ5A 1V2GA 4C9BA 1ZRNA 2OXCA 2JHAA 3MVEA 1L7DA 4MJ3A 4YNBA 2ZTMA 3G13A 3T7JA 2IS2A 2BP7A 2ZANA 2D5AA 4GKVA 1WF6A 4ADSG 3OAAD 5CLJA 1FCJA 3MS2A 1A0OA 2XJ4A 2PR2A 1LLCA 2ZAIA 3ON5A 1JG1A 2AC2A 4FE4A 4H6PA 1RCFA 1UJCA 2EFCB 3CZ4A 4WEQA 1OXBB 3R3YA 1GAQA 2CB0A 3CS3A 2X6RA 3W5IA 3WYAA 4TVKA 1Z7GA 2FMTA 3LBHA 1MF7A 1FUEA 1M67A 2WAAA 1Y3FE 2WA1A 3B82A 4GI3A 4HEHA 1G7SA 3FZYA 4O1MA 4B34A 1LQTA 5JSZA 2PXXA 2ZVQX 3CH6A 4BQQA 5JNUA 1LLQA 3FMGA 3KT6A 1HNXB 1CP3A 1OXXK 2A5GA 4N54A 1H5QA 4EW6A 1EZ1A 3G2MA 1YUMA 2CFOA 3ZVNA 2AIRA 2BONA 5J5AA 2C92A 2ZAOA 4N8SA 2OB1A 2FF5A 4PLYA 3DCIA 1L0BA 3CNBA 3PC6A 1K1EA 4M0DA 2YHSA 3ZD6A 1KNXA 4OBXA 3QLTA 1MN6A 4EI8A 1BDBA 5FD8A 3ZIAD 1NUQA 3MYYA 2OMEA 5FWXB 3P4UA 3PD7A 1D6SA 4E51A 1D04A 4Q37A 4D9HA 1SXJD 3KXDA 3GAZA 3F73A 3ETEA 4NXNB 4J0JA 2Q7DA 2H3EA 3UOWA 1ZCBA 2ODNA 4I4CA 3TK1A 2DFDA 1A4RA 2FSFA 1W76A 3L1KA 5CLHA 3CLUD 2XT6A 4RZQA 1L8QA 4BLUA 4JAVC 4JR1A 4RPGA 3OFJA 5C35A 4RU1A 2G88A 2FKAA 3FH0A 3UW3A 5KPDA 3A36A 3ZDQA 3WGQA 4HGPA 1A9XB 1EI9A 4LYFA 4BE9A 2HPAA 1EWYA 4GVPA 3ZH2A 4W82A 4WD3A 3DXYA 1M76A 2QRJA 2WKSA 4I1VA 5G3ZA 2F6RA 5G0UA 3OLWA 3SN6A 1TTTA 1VMDA 2GPAA 3WLEA 1H9AA 3BFXA 3IQFA 1K68A 2PH5A 4UTVA 1QHEA 2YRWA 3JAWB 1G2IA 4C06A 4ZV9A 1G66A 2Y67A 1HDIA 1T15A 4WPGA 5TMDA 2AG0A 2E2WA 3CPEA 1SWWA 4EP1A 2NN3C 4TMTA 4FR2A 3K20A 2FN4A 2WTBA 2ZCUA 3T34A 2N42A 5HBRA 4C7KA 3NVKI 3UICA 2X0RA 4IIJA 1SBIA 1VPLA 4ZYVA 1KSJA 1U98A 4UHCA 3PQ4A 4TTTS 4P93A 2ZU0C 4X66B 2GN0A 6CHYA 3CRZA 4L08A 3S99A 1RPZA 2XGJA 2CW5A 3BWBA 3G2KA 4PZZA 5GP1A 3TKAA 4R9RA 3Q98A 4KDFA 4BN4A 3L41A 3PF8A 1CQJA 3FNBA 3QUQA 5D1NA 1PN3A 2PSJA 3KLBA 3TQTA 4ALLA 1CERA 5AWFC 5A9SA 3W6PA 1YH3A 4R8MA 3T7IA 4R68A 5EKDA 2QRMA 2NUTB 4KMMA 4RBNA 2QQFA 4KQHA 4RXMA 3F7OA 4INJA 1R7RA 3R8XA 3U49A 1MQ8B 3LDHA 3LD9A 1VI2A 3HJHA 1FRNA 4QUBA 1QYRA 1AHNA 2GK4A 4FHEA 1BE0A 1KF0A 2FXIA 3AO0B 2OQIA 3HS3A 3GFRA 1F60A 1T91A 2REQB 3O0DA 1XTUA 3L0SA 4BUZA 4N5HX 1TLTA 1L5VA 4P81A 1VQ1A 4CLXA 5HM8A 4CQMA 1DBQA 1P0IA 1YKSA 3OFNA 3FTNA 4ZT2A 5EXDA 1WOYA 3GG9A 3SS8A 4HB3A 3IQDB 3IVCA 4OQFA 3VNAA 2BI7A 4E22A 4HK4A 3H9GA 3K5PA 3ER8A 1U0HC 3C85A 1FFYA 1KZ9A 1DUIA 2IYXA 3H0CA 4XSHA 1J33A 2NUPA 3QTLA 3LTNC 1SIBE 1CJVC 3JD2A 3QJ5A 3R7WA 3U62A 2BEKA 3RTCA 2Q8QA 2ONKA 4FX2A 5IM5A 3WB2A 1PFWA 2NYAA 4Q12A 1KYZA 4RTOA 1EP2B 2QDXA 4RJKA 5IT9A 4OX9B 2HIMA 3TGWA 1DO2A 3THXA 1TF7A 2CLEB 3GZ4A 4WXYB 4ZDWA 5JMOA 2CK3D 1EFPA 2VA9A 1W46A 3BWXA 4JC0A 2Q2OA 1GTG1 3LLSA 4HDRB 5D6OA 1NFRA 2H2IA 3ZE2B 4M7WA 4AJLA 1RXVA 4PLWA 2R65A 3GGJA 4ZQFA 4KXMA 4O33A 4IV5A 1GVNB 3M6LA 2BTQA 2QQEA 4DCPA 3IT2A 2Z1NA 4IS2A 4QRIA 3UCEA 2RCNA 1HMYA 5FXMA 3ITNA 1T8SA 2V7QA 2GSWA 3G8AA 2QXUA 1DRKA 3LX4A 2JK0A 1B7GO 2W43A 1Z75A 3PUKA 2WIJA 3SXUB 4JT8A 4LF4B 2HRZA 1Y4UA 3O75A 1OIXA 4KLCA 4DJEC 3S27A 4S0XA 2V7TA 2EAUA 3T35A 5CFNA 1HDOA 3DOEA 3GD5A 1H8HA 3FKSD 3NDRA 2CXSA 1GCGA 3HCWA 3R0ZA 3ROQA 3UXMA 1U8XX 3M34A 3N28A 1W30A 4D42A 2EIXA 3NWEA 5L3ZA 4PFKA 2HYIC 3DBRA 1PTJA 4G4SO 1USIA 4F9FA 5KYKA 3UMMA 1ZN2A 3TG8A 1NP6A 2YWCA 3SNKA 1ZCFA 3BE4A 5IFLA 3UOAB 1A95A 3D0RA 3OI7A 5AW9A 1DCTA 1OR8A 3H11B 1EQAA 2OWEA 3NHSA 4A27A 1BD4A 4TLEA 4B7UA 1J0BA 2P0YA 1QO7A 3VX3A 5C32A 4B6JA 3LBAA 3K31A 4OKNA 1XYGA 3D7KA 3I4LA 3RFUA 3M3DA 4YRJA 1WMEA 2KBFA 5JXHA 1U9YA 1TJYA 1YS4A 4YFVA 1O08A 1E1CA 3RRNA 2RG7A 1QIHA 4MUXA 5FQOA 4B7CA 4EEKA 3I9KA 4BTEA 2VTBB 4IVNA 3SCZA 3L4JA 4RA6B 2OEPA 4BO7A 4UXIA 1WUKS 1TTHA 1I94B 1E3WA 3N1UA 1VE3A 4PG6A 1GCIA 3WYFA 3M33A 1COWA 2O2EA 4WZAB 2JLZA 4GKKB 3QNWA 4GRAA 2EFDB 4ON9A 2P2SA 1OLXA 3GR6A 3ZKAA 3IEIA 4AJEA 1EFRA 3RS9A 5B1SA 1LX6A 2WU0A 3BMOB 4HH0A 3CUKA 4OH1A 4CG0A 4CMEC 5CH5A 1NKVA 2H2AA 4MVJE 2KE5A 2QTHA 1MX3A 1D8AA 4DLWA 3R3HA 1E5VA 2AV6A 4FN5A 5L3QA 1NWHA 3PDHA 1NT4A 4QOGA 1T0UA 4QXOA 2XNDD 3IIJA 1ULHA 2FCAA 2W2OA 4K9KA 4OJMX 3ZN2A 5AKGA 5KJ1A 2I4RA 2IYFA 1X94A 3GHHA 5CEJA 5JAIA 1EBBA 1UZLA 3NU1A 3WKEA 5KNLA 4NULA 1GFWA 2FFJA 3P9NA 2EP5A 4KXQA 5DYNA 4DJFC 2YKGA 1CRPA 2DYKA 2PL3A 3H6GA 3OPMA 5F9MA 3F47A 2PMFA 2H5JA 2PHZA 3SBOA 1XIVA 4OX9Y 3UV7A 1GKLA 2PCLA 1S8OA 1NVTA 2CF5A 2FSUA 2QLNA 4YRFA 3S28A 4B6GA 1BCRA 4BYGA 4DZZA 4ZICA 2XIJA 3ZLBA 1U11A 4LGVA 4ALKA 1R5BA 2A9RA 1D1TA 1IE3A 3J81A 4O4LA 4U7HA 4D7AA 1N2EA 4Q4HA 3I83A 3JQ7A 3NVMB 3HFGA 2IPMA 3C4VA 4YV2A 2TRSB 2VTDA 1EB8A 1ZC4A 3BH7A 1XELA 1UAGA 2H31A 4QYWA 5FPQA 4ZVQA 2XZLA 5KC9A 4PNPA 3LF1A 1UXIA 3DZ8A 4PZCA 3WY9A 3M49A 1LI4A 3WJAA 3HMQA 1O9HA 1VJTA 4QX6A 2E7ZA 4MWSA 5KYWB 3G0IA 5F78A 3QJGA 1CQIB 1R2QA 2O7RA 1DXHA 2NSHA 2ODWA 2QMQA 4MYUA 4R6WA 3X1JA 2HW8A 1ZESA 2ILTA 3M6XA 3ZHQA 1WMSA 1O8BA 1RBZA 3MAGA 3OFSA 2Q07A 3GUYA 3TDNA 4D9BA 1CZHA 3HWRA 3QFTA 4DT1B 4X91A 4UU1A 5KJFA 1J9ZA 3SLKA 2D6FA 4C07A 4IDOA 3I9V6 3GUHA 3IUSA 2QG9A 4ZT7A 3CF4G 4X9XA 1IBMB 1DADA 1XCMA 4LC9A 1C80A 5IANA 3PD1A 5H68A 1FF9A 3MINB 1UK7A 2GJ9A 4C1NA 3DOCA 4MVJP 2G77B 3IUNA 2X40A 2GTPA 5JH7F 1ND6A 1EVZA 2XPCA 3RI3A 1XVUA 1Z8HA 2H2WA 1XJ0A 4GPD1 2GHIA 5LP6A 1LJ8A 2ZGVA 2FZVA 4QFDA 4QGHA 4Y0VA 2FR8A 4XGKA 2NTYC 1NXOA 1W29A 2AX3A 1O94C 3IKJA 4PCAA 5CJ2A 3RFTA 1Z2DA 5C8VA 1CQZA 3HV0A 2GJ4A 1G5QA 2WIKA 4AYWA 2Z9DA 4QVGA 5AW3A 3FBTA 3HTXA 3NV9A 3E2PA 5KAPA 2FN8A 2H1HA 4W6QA 4XZ3A 1VBFA 3KSDO 3ZQ6A 3ZWQA 5K8CA 1F12A 2CJPA 4ESOA 4KYIB 3WP0A 1CZUA 1GD1O 3UCFA 1RZUA 3O3MB 3QYFA 1CUSA 2R4TA 5DCYA 1DWOA 1ZOOA 3IIEA 2UYGA 5GONF 1E89A 1MB4A 1YSCA 1SC9A 4DV5B 4BYMA 1ONBA 1W88B 2DUJA 3DVAB 3IAHA 5E9AA 2WQ6A 2XY4A 4M0MA 1VYUA 3R23A 1BD3A 2A9FA 1TU3A 3PF9A 4A2WA 4BVHA 4BVKA 1Z0SA 1J07A 3R7BA 2JGLA 2V6MA 5I4BA 3PVSA 3NHRA 5E8JA 3PPXA 4YAEA 1GPNA 4Z4IA 1HT3A 3VR6D 3D02A 1J90A 2VLBA 5B7QA 3CZ9A 2HREA 4QPDA 2FUCA 1PGJA 5EJ6A 1PHRA 4CEIA 2IY9A 2C1EA 3RUDA 1XNJA 1PQYA 3ZEAA 3T1HB 4Y2GA 1KEPA 1Z4NA 2FMIA 5CCBA 2H7YA 3UC9A 4LRWA 5AMXA 4Q66C 4ACAA 4QEZA 3K4HA 1X8XA 1U5CA 4FFWA 1ISRA 2HPHA 3THOA 3CF4A 2VKQA 2CLCX 5BY2A 2XTMA 3ABOB 2UZ1A 4TTRA 4AJHA 3RSGA 3OE7D 4R2KA 2HDNB 3NRBA 5EVJA 4UFPA 1UKCA 5ENDA 1B6RA 3OZAA 5F5LA 1GAWA 3GMIA 4JL5A 1TMGE 5G4LA 3T9AA 5K0CA 2I4OA 5E6SB 1QBGA 1XKLA 4JZYA 1HF3A 4MUIA 2WVAA 4RGBA 1LSSA 1H6CA 3M9LA 3L82B 1K6XA 3WKDA 5J4YA 5ARCA 3A7DA 3QP9A 1FJGB 2A86A 1U63A 1UUFA 2F1OA 1NQXA 4DIKA 1BE8A 1RBYA 2QRHA 3F98A 4QARA 1TZCA 5HF9A 1JV2B 4X3OA 3VRHA 3F5FA 4PZAA 2R8ZA 4KPEC 3HH8A 2BEUB 2XVYA 1NBOA 3FNFA 1HYGA 1MAAA 1VMIA 2OT3B 1G64A 2VYND 2WIAA 4L27A 5D3KA 3WLHA 1NVXQ 4BNFA 1T10A 1K66A 3NBKA 4CE6A 1E1RD 2PWZA 2VHTA 4DLYA 1U2DA 1D3AA 5GQSA 3VDMA 4BNWA 4YXFA 1K06A 1GRQA 2K87A 5DF1A 2D06A 5B3KA 2WFLB 1C30A 2ZYHA 5E9WA 1RFGE 1Q7CA 4E94A 3U16A 1NF8A 2RAFA 3DLBA 1B26A 5F3DA 3R3VA 3BSFA 3F0TA 1E4YA 1KEZA 1KP9A 3L79A 1OLSA 2QI9C 4BMVA 1XK7A 4YGXB 4LQCA 1ZL0A 3UHJA 3TE6A 1Q7RA 1ZLYA 4EHHA 3D0QA 3NO4A 3Q9SA 3W9SA 1GQRA 2OFPA 4RVCA 5DVZA 4X6LA 3CEPB 5CM9C 1I32A 3E5NA 4G0NA 5BWMA 4FD2A 1OH8A 2B4AA 5HCIA 2YJTD 2PVCA 1V5GA 3WL8A 4C7MA 2FW7A 4RHTA 1Q19A 4R1UA 4GR9A 1PNTA 5F1PA 4TX1A 1YDEA 5DKFA 4WN9A 2BFFB 3KR1A 4L2IB 4KJZA 3DDHA 4IJWA 1K7FB 1SQ5A 4IDCA 4L1KA 2NUAB 1KY5A 2WJZB 1ISFA 2BGUA 4YQYA 1JN0A 1CUIA 2DJ5A 3HCPA 1DKLA 5KJ6A 5DK4A 3OZFA 4LGCA 3KJZA 4MYHA 1C1YA 1ORIA 2A4KA 2CBXA 2HQSA 4IDFA 2HXYA 3AU8A 1ZISA 5B53A 1VJCA 3ST7A 3K0CA 3U1VA 2BFCA 2QYSA 3F71A 3C6YA 3LU1A 3NV7A 4TWAA 5H70A 4AJ1A 4LMBA 1XCJA 2EXXA 4FZJA 4HDOB 4TT3A 3ZDDA 3P71T 3EX7C 3CMCO 3NHLA 1BMTA 2QTGA 4LHVA 3FSJX 2F90A 1KI6A 2RIRA 3F9IA 2JGIA 3WIOA 1F8GA 4C7JA 2QZ9A 1P9RA 1RXEA 2ZRDA 4WE3A 5AW5A 2BEWB 1WP9A 2G4LA 3LLVA 3NH9A 2XF8A 3GQBA 3H3XA 3NM4A 3OZXA 3IH5A 5EJIA 4J4BA 1TPZA 4YMGA 1FY2A 2EG9A 1U3DA 1I2DA 3ILVA 3S3TA 2PRYA 1DAHA 3TMYA 3ZVLA 3J7TA 4A8JA 3ME5A 4C2AA 4CL8A 4EF4A 5LP1A 4KLAA 5LBTA 1D09A 4OHFA 3D3NA 4HP8A 4RKEA 4XR9A 1GRRA 2Q3MA 3PEFA 2QN6A 4HTFA 1CD5A 2EJBA 4FMCB 3QFRA 1G5IA 3UPTA 3N74A 2OVFA 5AR1A 4XJXA 1ZD8A 3MMZA 3W0LB 1Y8CA 2EGHA 2OZEA 4UM8B 4IIJF 1QHGA 3O8RA 4Z5XA 2B7BA 1T9CA 3JR7A 1IVNA 1VOTA 4P08A 4TRRA 4QRHA 2VWGA 3AQ4A 1OFTA 4W4TA 5K8TA 2PAFA 2JJQA 3A37A 3H2ZA 4OQQA 1VL8A 4UBLA 1IONA 2RH8A 3BAZA 3H5TA 4P22A 2VDNB 3WG9A 5CCEA 5AW2A 4RQBA 3CF0A 4B40A 4PLGA 1WJGA 1UIRA 4TQGA 3U26A 1HBJA 2M6RA 3KKLA 2PJRA 3BTOA 4ITRC 3IKTA 1NVDA 4YYEA 4KSCA 3M1LA 1FTQA 2FPGB 3B6ZA 4WY2A 4V3CA 5ALUA 1L5YA 3FM9A 1BXGA 1N6NA 1OWOA 1ZOSA 2PQ6A 2VBCA 3AUJB 3HBNA 1HSZA 1PR0A 4QLAA 4M1YA 5J59A 2B94A 3C5CA 4G0OA 3T7CA 1BN6A 4L50A 5EL0A 3G3EA 2AZ4A 2CXXA 1HH4A 4OOFA 2APJA 1KK3A 4BGVA 3MOSA 1C0PA 1CUDA 4LYYA 3PUWA 4M7RA 4PXSA 5EP2A 4TPKA 3SLRA 1HFKA 4QXAA 4ER0A 4LGYA 2AT1A 2K2QB 1TECE 2R60A 3OP1A 4KFRA 4XWAA 3ZZMA 3P1JA 1AMOA 4MPRA 4ER3A 3WV4A 4CV2A 1O0BA 2WPNA 3AR7A 1VXRA 3GJXC 4HRXA 3OPYI 5B1DA 3H84A 1TM3E 4UDNA 1TZMA 1YR3A 1XRQA 3OQ1A 4BC1A 5CDHA 1TVCA 2G67A 1SWVA 5F1KA 3G0OA 3CLUC 2SKDA 4JLUA 4RF2A 4XH9B 1JMYA 2I7CA 2JL1A 4AROA 4EG3A 4UMVA 3UMGA 5F9HA 2D0OB 4NYMQ 3R3XA 3VFDA 3H2HA 5DCUA 2XNKA 1LTQA 3CNHA 4DM7A 5BW8A 3PYXA 3DNMA 2QY6A 4NQRA 2I1QA 2ISCA 1Q0UA 4IIVA 4PSAA 4W1RA 5IC6A 5LMNB 1JFFB 1EZ4A 2HWYA 3W8FA 1GPJA 4WNAB 1IZ9A 1GGMA 5M7EA 4YCAA 2GESA 2N3ZA 4IJMA 1NVMB 2QRZA 3X2SA 4GPBA 4YJHB 3UAGA 1HC7A 4OXNA 1LPOA 3NKFA 4JR0A 1HNZB 5KINB 4W5NA 1QCZA 4AJIA 4LOJA 2VK1A 4U9UA 1ZSNA 1KC1A 2WWHA 2O5EA 1W34A 2FH5B 1KMHB 3PPWA 3GJRA 1GJRA 3D3QA 4LG1A 5HTOA 5FAXA 1U4NA 2XKKA 5D00A 4QD3A 4TRMA 4EVQA 1H85A 2RHMA 3PVZA 1ZINA 3FYTA 1XG5A 3AR6A 2CXNA 1DI0A 3DEZA 2YQ4A 3HDTA 3Q5EA 4LBYA 4LJ6A 1YK0A 2BFEA 2X0EA 5CB4B 5TQ0A 1PFVA 4RVGA 2QD4A 3C4JA 1WD7A 3SMQA 1BJTA 3GDWA 3JYPA 4UZEA 5HIIA 4D8YA 4UAUA 3BSYA 4DTIA 3NLLA 2WMDA 4EB0A 4OTZA 4LK3A 4O4JA 1V11A 4C5AA 3OZUA 3DLTA 5I9MA 1JEQB 3OU2A 1OX4A 5DSTA 2I65A 2LIPA 3RPEA 2FSIA 4NOLA 1XDBA 3PRHA 1YJCA 4YDRA 4FSHA 2Q7XA 4IYRA 3C6QA 1NAIA 1VB5A 3SQMA 1Q0ZA 5CX1B 3MTAA 3H17A 1G60A 2GA9A 1L9XA 4TT8A 5E4JA 5F64A 1ZZGA 4YP9A 2O0LA 4GD3Q 1JJAA 3W7BA 4K6KA 3IKVA 5CLLA 1U8EA 2C29D 4CDMA 2PSFA 1QH9A 4IQ0A 1XDDA 2OHFA 2GYVA 2PRSA 3AJDA 3HEAA 4TV9A 3K9GA 5FTJA 4ZXPA 4BNYA 2I4IA 3VHXB 2RH9B 4AI6A 2OLJA 3F6SA 5EQDA 3AFMA 2A0FA 4LOAA 3OLQA 5EIFA 5MN5A 1KDVA 4XIIA 3C3YA 2CN1A 2PR7A 1YVEI 2JARA 1EAYA 4ENTA 5NLLA 1JS1X 4MUEA 5CLQA 1U6KA 4OF4A 3A1SA 1T3TA 5T3YA 2JFUA 3DEYX 1L8OA 4CF3A 1K3UB 3GMDA 1Z6XA 4WLUA 5CBPA 2J4FA 4EEZA 4G37A 4EY5A 3DT6A 3HE3A 4WVLA 1F2VA 1MZVA 1MO5A 1P7ZA 4B3IA 1HTBA 3PVCA 4LI0A 4OQXA 2DWOA 4HFNA 2JCYA 2V59A 4R2IA 3ZWBA 2WVJA 1DPFA 3EOAI 4F5ZA 4MUBA 2P3QA 1LUAA 2DUWA 3EH2A 3QLUA 4RA9A 1KJJA 4KIUA 1N6RA 2P9QA 3W2IA 1ZNZA