3DLIA

Crystal structure of a sam dependent methyltransferase from archaeoglobus fulgidus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
221
structure length
221
Chain Sequence
DYYFLFEEKFRGSRELVKARLRRYIPYFKGCRRVLDIGCGRGEFLELCKEEGIESIGVDINEDMIKFCEGKFNVVKSDAIEYLKSLPDKYLDGVMISHFVEHLDPERLFELLSLCYSKMKYSSYIVIESPNPTSLYSLINFYIDPTHKKPVHPETLKFILEYLGFRDVKIEFFEECEELTKLAKIDSNTVSEEVIRVINENIEKLNRILFGPQDYAIIAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords methyltransferase
publication title Crystal structure of a SAM dependent methyltransferase from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
total genus 71
structure length 221
sequence length 221
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dliA00
2FCAA 1R74A 4OX9Y 3GIWA 3VSEA 4PYOA 3GCZA 2UYHA 1NE2A 5DM4A 4AZTA 2OBFA 3DH0A 3U81A 5EEHA 3G88A 3SMQA 5EC8A 5KQRA 4G56A 3KR0A 3P8ZA 1FBNA 1HMYA 4PYNA 4ATNA 2H1RA 3GRYA 2BR4A 3HEMA 5DLYA 3KU1A 4PYIA 1G8AA 2P3LA 5DX8A 2Y1WA 4E30A 5HOQA 1G38A 1RJEA 5CD1A 3PVCA 2WA2A 3TR6A 3KKZA 4RTJA 4PWYA 2PXXA 5T64A 2NNWB 1JQ3A 3UJ7A 2GPYA 3CJRA 4KIFA 4OQEA 2XBMA 1INLA 5K0LA 1XCLA 3DULA 5DXJA 1HNNA 3KPJA 5GP1A 3FTFA 4PCAA 2WA1A 1SG9A 7MHTA 5EIWA 3EEYA 3EVDA 3OU6A 5GIOE 5E2BA 2B25A 5IKMA 2GS9A 3LDUA 2ESRA 3PX2A 1IM8A 1JTFA 1NW5A 3P97A 3UJCA 4ER3A 4PYMA 1SVUA 3FTCA 4JXJA 4E2YA 2HTEA 4YV0A 4HRAA 4DA4A 2FPOA 2JHAA 1P1BA 1SQFA 5FWAA 4EKGA 3FPEA 2IP2A 5FADA 4GUAA 3I9FA 2NXNA 3UWPA 2P1DA 3S68A 1XVAA 2V74B 4RVGA 3TLJA 3PFHA 2Y1XA 3ELDA 4RVDA 3UJ8A 4CXMA 5P8WA 3FUVA 3NTVA 5HILA 3HA7A 3V8VA 4EVIA 1BC5A 2FHPA 3ORHA 4GOMD 4POOA 2P7IA 2PX4A 1YF3A 3E7PA 4QQNA 3HVKA 1RJDA 3ERCA 3BGDA 2VP3A 4FT2A 4X1OA 5GIPE 2F8LA 2ZWAA 1IY9A 1NBHA 2C7PA 1DCTA 1XDUA 2G71A 2ZLBA 3DLIA 3M6UA 4LG1A 4BY9E 2YVLA 3GNLA 5FQOA 2N47A 3A25A 1QZZA 3EVZA 4ER7A 2G8NA 2PSSA 3R6TA 3GXOA 5BW5A 3QV2A 2IPXA 1VIDA 5T6BA 4RX1A 1KIAA 2PWYA 3KR9A 3I5UA 4YV2A 1XTPA 3HCBA 3SX0A 4RTSA 1RI5A 3GDHA 1KHHA 3VYWA 1XJ5A 3P2EA 3PFGA 3PT9A 4FS8A 3WSTA 2PBFA 4KDRA 1F3LA 3CJTA 3NWBA 3OZSA 4AZWA 3B5IA 3JWIA 3TM4A 4C07A 2FK7A 3LHDA 2PLWA 2ZSUA 4GEKA 5K0CA 5DTQA 3PLAE 3IEIA 4C05A 4U7PB 2ADMA 3LKZA 2PGXA 5LQRA 4EKIA 4HH4A 3SSNA 2GA9A 4RTMA 1UWVA 4PYLA 2P35A 4DZRA 3LECA 4RTPA 4BLWA 4P7KA 1AF7A 5K8VA 1JTEA 1R00A 4HSGA 4NECA 4QQKA 3CCFA 2E5WA 3ANXA 5C9ZA 1X1DA 3BWMA 3BKXA 4ZTBA 2NXCA 1U2ZA 4GC9A 1KYWA 4L7VA 4M37A 2AOTB 5KVAA 5FHQA 4R6WA 4KDCA 1RJGA 2IGTA 4XUEA 2HWKA 2YX1A 2PWPA 2ZZNA 4DM3A 3TOSA 5T67A 1KR5A 3OFJA 3DOUA 3KQYA 1OR8A 2ERCA 2PXAA 4V0RA 1N2XA 2I6GA 2ZBRA 3AXSA 5ICEA 3FTDA 2YQZA 2OXTA 5FA5A 3LL7A 3LPMA 3I64A 3G7UA 3NJRA 3QOWA 4M7RA 3EVFA 3LCVB 4YV1A 4YUYA 3LBYA 2CL5A 2IFTA 4KW7A 2EJTA 4X61A 4FSDA 2CMHA 4V0QA 1EJ0A 2AN4A 4PCLA 3TQSA 3O7WA 2QYOA 2PKWA 1JQDA 3P9KA 4FZVA 3P2KA 4FSXA 4LWPA 3MGGA 3BUSA 4O29A 5G02A 2ZBQA 1WXWA 2AOUA 3Q87B 4E32A 1UIRA 2FRXA 4E70A 4EMSA 2ZFUA 3G89A 3H2BA 1Y8CA 2I62A 3PX3A 1JR4A 3T0IA 2ONZA 5HZMA 2O57A 2YXDA 3KQVA 2P7HA 5E9QA 1R18A 4YMHA 2Z6QA 4RWZA 1WXXA 1WS6A 3B3GA 2CKDA 3BWCA 5EMMA 1X1AA 3NDIA 3PB3A 1JG3A 4RTLA 3SXJA 3SR4A 4MWZA 5EKUA 4C4AA 1D2HA 2HNKA 3M4XA 1ZGAA 2VDUE 1KP9A 1X19A 5KS2A 1JSZA 4PYJA 2JH9A 3PS9A 3PTAA 4ISCA 3DTNA 3BT7A 4LWOA 3F4KA 5JUWA 2VS1A 3EVEA 3CC8A 3KPYA 2H00A 3KPWA 5E8RA 5FTWA 5GOZA 2NXEA 5GM2A 3AJDA 3EGEA 1B42A 5EZQA 3GRUA 1XXLA 1T43A 2AS0A 1PRYA 3GJYA 3SSMA 1QAQA 4BP3A 3ER9A 2ZIGA 5CVUA 5CIYA 3KR2A 1BOOA 3G2PA 1I4WA 1R8XA 2JJQA 3FUTA 3UZUA 3DP7A 2G70A 3KQQA 4OA8A 2BM9A 5EGSA 4QPNA 2B78A 3LCUA 1JG2A 2EFJA 1SKMA 2ZZMA 3M6XA 4XUDA 5E1OA 4YUXA 3DR5A 3SM3A 3THRA 1ORHA 2PV0A 2IIPA 5LQNA 3CGGA 2K4MA 1XDSA 1KPHA 3HCEA 2XVMA 5CCBA 2GLUA 3HCCA 3G8BA 4MQ4A 3EEOA 3HVIA 2IH4A 4HC4A 1WG8A 5F2OA 3NWEA 5CUQA 3D2LA 4IKPA 5DX0A 2OYRA 4E2ZA 3G5LA 1FJXA 2VZ9A 4RVHA 5F2KA 3FYDA 4HG2A 3EVAA 2JHCA 3DXYA 3KQWA 3EVGA 5CCXA 10MHA 1KXZA 5GWXA 3RODA 5K0JA 5K01A 2C7QA 4RSRA 2BH2A 5CVJA 3P9IA 2B9EA 4WXHA 3UA3A 5FWDA 5D1NA 1L9KA 5HIIA 2A14A 3EPPA 2PT9A 1MHTA 3L8DA 1NKVA 2R6ZA 1TW3A 4PONA 4RTNA 2NP7A 1YUBA 4OQDA 4YUWA 3LCCA 5E1MA 1M0EA 3BGVA 4QTTB 1I9GA 3TFWA 1VQ1A 2QM3A 3CKKA 3OU7A 4GBED 1RI2A 1FP2A 5LQKA 4MIKA 2XYVA 3LGAA 3MCZA 1L1EA 1QANA 4AX8A 1EQAA 2P40A 2WK1A 2QRVB 1XCJA 2NYUA 1NW3A 3SSOA 2ZWVA 5IH3A 4GOLD 1R8YA 4XUCA 3R9XB 1SUSA 4PYQA 2P8JA 5M5BA 2PY6A 5GM1A 1O9HA 1Z3CA 5E1BA 2AN3A 3M6VA 1G8SA 4C04A 3TPZA 2ZW9A 2QY6A 3UJDA 2B2CA 5DT2A 4RV9A 4GOND 2OB1A 5E9WA 3UJAA 5JR3A 4FGZA 1Q0TA 5C1IA 1JG4A 4ER5A 1SUIA 1R6AA 2OZVA 3HCAA 4RTRA 1QAMA 1EAMA 1VLMA 5EZSA 1JG1A 1RI1A 5BXYA 5K05A 2O07A 5HIKA 3ELYA 2C7OA 3B89A 5C0OE 2Z6UA 1NW6A 4R05A 5CVVA 5D1HA 3MHTA 4RTOA 4X41A 2I9KA 1D2CA 2P3OA 3K6RA 1EIZA 3P71T 3KHKA 3KQOA 2YR0A 3P9NA 1NT2A 3FZGA 3T7TA 3HTXA 2NP6A 4CKBA 2GAFA 3JWGA 2Q41A 3FPGA 3M33A 3E05A 3GRZA 3HCDA 5DX1A 3JWJA 2HMYB 3EGIA 5FCDA 1AQJA 3HNRA 2UYQA 1TW2A 3HA5A 3KR1A 3OZTA 4Z2YA 1V39A 5LQJA 3FUXA 3B3FA 5EQJB 3B3JA 4PGHA 5HIMA 5KQSA 2B3TA 5DRYA 3ELWA 5EIFA 4ER6A 4F85A 2PT6A 3G2QA 2YUIA 2ZVJA 3BXOA 5BP7A 3A7DA 1WZNA 3NDJA 4E2WA 3LDFA 3KQPA 3LBFA 4RTKA 1JQEA 3R24A 4MTLA 4P7FA 3K0BA 5E8JA 1PJZA 3FYCA 5K0NA 1DL5A 3FRIA 5DM0A 2O06A 3GO4A 2IBSA 3UA4A 1P91A 4R8RA 3KQTA 1M6EX 1TPYA 3A7EA 3BWYA 3GRVA 4QVGA 4AZVA 2YTZA 2FK8A 1KPGA 3OE5A 2ZIEA 4AZSA 2ONYA 3C3YA 2ZBPA 1ZGJA 5EMKA 3AXTA 3GGDA 1L3IA 4QVKA 4EQZA 5LQCA 2YXLA 3DLCA 1JSXA 3IV6A 2IDKA 2IDJA 3HM2A 1AQIA 5DWQA 5LR6A 4C06A 5CVDA 3FUUA 1QAOA 1FPQA 1ORIA 1KPIA 2PXCA 3OU2A 2QE6A 4HTFA 2AOTA 3LDGA 3P2IA 5DSTA 3RW9A 4DKJA 4B17A 1NV8A 5HIJA 3G5TA 3C3PA 2ORED 3G2OA 1FP1D 4IV0A 2PVCA 5K0EA 2EJUA 2LD4A 5DXAA 5DM2A 5E2AA 1M6YA 3G8AA 1VE3A 4QTUB 1G6Q1 5EHGA 3FUWA 3BGIA 4HGZA 4PINA 1SQGA 2XYQA 3EVCA 4Y30A 5E1DA 3REOA 3TKYA 2AVDA 3UJ9A 4M38A 1KYZA 1EJ6A 5BW4A 5FULA 3G2MA 3CBGA 4P7GA 4QPPA 3DUWA 3GU3A 2AR0A 2AVNA 2XYRA 1UFKA 3MERA 4E2XA 3KQSA 2P3QA 4H0NA 5K0FA 5ERGB 5B1SA 5K0BA 4P7JA 1H1DA 3TRKA 3VC2A 3A4TA 3OFKA 2AZTA 1YFLA 2GH1A 4IV8A 2AOXA 4OBWA 1YZHA 3C6MA 2UZ4A 1VPTA 2ZCJA 5K0GA 5LSAA 2OPBA 2UYOA 5EVJA 1XDZA 3CVOA 3ELUA 3GRRA 4RYLA 3AWIA 3ID6C 4IWNA 3FPJA 3A27A 3EMDA 2V7EA 4Y2HA 5ICGA 4A6DA 1EG2A 1P1CA 2OO3A 3NMUF 3BZBA 1O54A 3HCFA 4U7TB 3IYLW 4R8SA 3THSA 2VDWA 1ZKDA 3HP7A 5DSXA 5LQUA 3TKAA 1X1BA 4YUZA 1ZQ9A 4QDJA 4CKCA 3TMAA 4PNEA 3X0DA 4F86A 3FTEA 5EG5A 2DPMA 2XVAA 4MHTA 5EOVA 3O31A 5FHRA 5EHIA 4GC5A 4A6EA 5K03A 1I1NA 3HVJA 1O9GA 2ZULA 3UJBA 3AY0A 2JH8A 3R3HA 9MHTA 4DCMA 1NBIA 3V97A 3MCTA 5DTRA 2DULA 5U4XA 3QOXA 4GQBA 5KYGA 1N7IA 3A26A 3Q7EA 3UFBA 3ME5A 4OBXA 2C7RA 3DXXA 2IH5A 1VL5A 1BKYA 4KRGA 3SVZA 5EEGA 3OE4A 3FPHA 1RJFA 4C03A 3C0KA 1QYRA 2PJDA 5H02A 4PYKA 3SGLA 3UJ6A 5ICCA 2EG5A 3UBTA 2PX8A 2AOVA 2NXJA 2P41A 2JG3A 2BZGA 8MHTA 5DTMA 1NW7A 2AOUB 2EX4A 4RVFA 4DCGA 3GWZA 2R3SA 3HVHA 5EPEA 4R6XA 5FQNA 5HFJA 5CM2Z 4E33A 2BR5A 3VC1A 5K09A 2JHPA 4AUKA 5EKXA 3FRHA 4YUVA 2BR3A 4K6MA 5EMLA 2FYTA 4M36A 5DRTA 1NV9A 4DMGA 2G1PA 4GOOD 1ZG3A 3DMFA 4DF3A 3M6WA 4OA5A 4E31A 4KIGA 2OB2A 1F38A 1IXKA 4X60A 4YMGA 4KWCA 1RI4A 1DUSA 3OPNA 3LSTA 4RTQA 3E8SA 3DMGA 3I58A 3OCJA 4HGYA 3P9CA 3DXZA 1L3BA 4BP1A 3E23A 4WVLA 2BM8A 3I53A 2I7CA 4CTKA 4CKEA 4XCXA 5GINE 3FPFA 1RI3A 2PX5A 2YXEA 2ZZKA 3CJQA 5EMJA 1YFJA 3C6KA 3IHTA 4LECA 2CMGA 1D2GA 1G55A 4HTFB 5E9JA 3EMBA 4X63A 4F84A 4PGGA 2AOWA 2G72A 2ZIFA 3MB5A 3NVMB 1P39A 3R0QA 4P58A 2Z6AA 3LX6A 3T7RA 3KQMA 3DMHA 5CVEA 1N7JA 3KPVA 1Q0SA 5MHTA 2CWWA 3ER8A 1X1CA 1VP9A 1BHJA 3M70A 2OY0A 4FP9A 5FA8A 4BLVA 2HR1A 3MQ2A 3B7PA 2QRVA 3BKWA 1WY7A 3KPUA 2O05A 3MTEA 2AN5A 1YZ3A 3EGVA 3NVKI 2O0LA 3OZRA 5LQAA 4FT4A 3MAGA 4DQ0A 1NW8A 4EK9A 2HV9A 1AV6A 5DPMA 1G60A 5FUBA 1ZHFA 3O4FA 5HEKA 4CWAA 1YB2A 1MJFA 3BWBA 3EVBA 4KVZA 5F2NA 2H11A 2IH2A 1VP3A 4UOEA 2VDVE 3NW9A 4BLUA 4GF5A 3JWHA 3T7SA 3TM5A 5ICFA 2KW5A 3LKDA 4PIPA 4ER0A 2PX2A 4FR0A 3HA3A 1VBFA 4C08A 2ZTHA 2UYCA 3MTIA 5DM1A 1L3CA 3RIEA 4CTJA 2GB4A 2IBTA 4PIMA 4QDKA 2OKCA
chains in the Genus database with same CATH superfamily
5LVAA 2GCPA 2P91A 2VAVA 2OBBA 2E7ZA 1COZA 1QR2A 3AZQA 3GIWA 4FBMA 2HMTA 3VSEA 5JIBA 5JROA 1EJBA 4II3A 1K3UB 1Y4AE 2Q5QA 3F5DA 1MJHA 4LYYA 1WW3A 5TY0A 3SJZA 1VMAA 1VSBA 2J3MA 1HMYA 4HAYA 1CF2O 5FPQA 1V8DA 3WZLA 1NU8A 2WMNB 3DM5A 3QYAA 5DLYA 2GNPA 4A91A 5DULA 4CKCB 5HOQA 5J2UA 4Q4AB 4UDXX 3CGWA 3ZG6A 4B48A 4GS5A 1PLKA 4UHBA 3G0IA 3EZ9A 1SOUA 2B92A 3WGTA 1E5QA 4ZGBA 5SZKB 2Q21A 3DO6A 3LWBA 1ZD1A 3OA0A 3ROMA 5AW4A 2NYAA 2ZSAA 3R76A 2JBWA 3ZDYB 1PWZA 3CX6A 4RIFA 4AS3A 1FFEA 1H6CA 2O2DA 1VMKA 3KL4A 2YOFA 5F7JA 3BWEA 3UAYA 4F1WA 1PUXA 1U0HC 2GCIA 1Z6ZA 4XD2A 4CLEA 5JYBA 4FKZA 3KKPA 2ZE7A 1JR6A 1BX0A 4A23A 4D9BA 3CX7A 3KAKA 5LQDA 1L5YA 2P4EA 4LZPA 2HLDD 4YYEA 4ZI7B 3KZCA 1JKJA 3VI3B 4QO7A 4U63A 1EESA 3AJAA 4Q01A 1I7LA 2X42A 4HRAA 2AL7A 4CLDA 1C1DB 1E1NA 1U8YA 2YN0A 3C5VA 5FADA 4QUDA 4LC0A 3FWKA 4YWHA 4CR8A 4HOYA 3UENA 1Q74A 5HZGA 4KGDA 2WOOA 3DAHA 1T5LA 3STVA 3DCNA 3UK2A 2AFIB 3AF2A 1H1LA 2Z5LA 5T4BA 1KKMA 4B4UA 4LYGA 3OZVA 3VO8A 2WU0A 5JXIA 5KCMA 3CPEA 4KBYA 4EX7A 2ACKA 3PRYA 5CR9A 1SCAA 2ZRKA 3KTAB 1K3FA 1QPGA 3JAWB 4QGFA 2RAVA 4LY6A 2C4TA 2L19A 5ALLA 4X66B 4CF6A 3GXBA 3HYCA 1GCUA 3DKIA 2F3UA 3H2GA 4J07A 1HY3A 4NABA 3KWMA 4B33A 2IU0A 3AI1A 3HKDA 3L5KA 4FYVA 2C2ZA 3VPBA 3W79A 2EQAA 5LXTA 2QSYA 5G1PA 1CYEA 3O4GA 1TMKA 3DL4A 6CHYA 1RHQA 3L02A 3TD2A 5DB4A 1XVLA 3AM4A 2VUSA 1KHTA 1PYGA 1O7JA 5A4MS 2WW8A 4F3TA 1CEXA 4MI1A 3SC2A 1PFKA 4KDRA 3KHSA 3KE9A 3LO5A 1VDZA 4MGYR 2EKQA 4I3GA 3LT2A 1NF9A 1KTVA 1KJ9A 1UQTA 3BRWA 3K05A 4CLRB 2PGAA 3SKYA 1GPMA 2XXAB 2ODBA 3QTBA 1JQAA 2O7NA 4FBGA 1HXHA 1QHSA 1UF9A 1ZIXA 4IYJA 4EIWA 3FYTA 1QRUA 5GZ1A 1OY1A 2PGOA 3GAZA 4PAMA 3WGHA 3B1FA 3HS3A 1P8JA 4K9RA 1UBTS 1UBSB 3WLFA 4ZTBA 4A7PA 1RJWA 4AZ3B 3GELA 2X8WA 3PC3A 1YQDA 3H8VA 1Q83A 2J9GA 2QIOA 2C5EA 3OZDA 3HWWA 4R2XA 4TKUA 4UBIA 3NDBB 1SC3A 1ZMOA 1RJGA 2I2DA 1QV9A 2QL5A 3H4IA 3QU7A 4K6HA 4Q0MA 3TSZA 1GQ2A 2O2YA 5BWNA 2H7XA 4TL9A 4KSBA 5TC4A 3GQBB 3PC6A 1LLFA 2XDWA 5IC4A 4JNKA 2BTEA 1N2XA 1Y5LA 3R6LA 1J5EB 3KXKA 1D1TA 3R3VA 3VKWA 5C5IA 2YQZA 1QFYA 1NVMB 1R9NA 5JXJA 1WSDA 3ENWA 2Z8YM 3MD9A 4NDNE 4DV3B 2K7FA 5AK5A 1RYMA 2XT6A 1EZ4A 2SCUB 3GRPA 2G07A 5C5DA 1M7GA 3H3XA 3LBYA 3QYFA 3KQNA 1VFNA 3SYTA 4TYPA 4IZIA 1EJ0A 2ZYRA 1HG1A 4YK7A 1COWA 1NQ5A 5BQ5A 4ESEA 2AMFA 4FFLA 2FRVA 3Q4GA 3GLVA 1ONPA 3K0HA 3OOHA 1AS0A 4ARVA 2L18A 3EX7C 4IY1A 3QUSA 3RC2A 4WBNF 5KYWB 3AL2A 4HNGA 4KK3A 4IVQA 2O0MA 1SIBE 4XD7A 5JFGA 3P0FA 2GZ3A 2O5VA 2PS9A 2CLIB 3KYDA 4D57A 4UOZA 5JQWA 4HLNA 4KXUA 3SZGA 4EI8A 2ZWMA 2EWVA 3L6RA 1L1RA 4FFDA 3WGKA 3WOHA 5FF9A 1RLJA 2DF8A 1X1AA 2WHYA 3BMOA 3NDIA 4MJ3A 4MVJD 4M1MA 4C43A 4R7ZA 2R97A 3SR4A 1SHJA 4RK1A 4UZSA 1XD2B 2FFRA 4FDAA 1D2AA 1JPNA 5HFAA 3HKEA 3MK31 2QNIA 4FR2A 1I0IA 1NW9B 2BI4A 2BEWB 4IDBA 4CQLB 2TYSB 4UFPA 3EZ7A 3FZYA 3DBIA 2ISQA 2OSVA 2VDJA 4IOJA 4KO4S 4Q3LA 2QUAA 2VS1A 2ZYSA 1W8DA 1QIEA 2P30A 3M7IA 3MJ4A 2Y0PA 3GLHA 4PQRA 5JANA 2F3QA 2DQ4A 2J0UA 4GXRA 4ZJPA 5AK4A 3I8OA 5AI6A 3WLHA 5F3WB 2E0IA 2X6RA 1WZEA 2ZRAA 2ZTLA 4FMPA 5EZQA 1IB0A 5DYIA 2HM7A 3DT9A 1M8JA 1XRNA 3OZ7A 3O8QA 4LNUB 1ULUA 2JAPA 1NDUA 1WDTA 3RJMA 3AT1A 3L8FA 3W7AA 4CDGA 4ZMBA 2BI7A 2C1EA 3R5SA 3TQTA 1EZZA 3S3TA 1SXJC 2VFAA 3PUVA 2PYIA 1IPEA 1KJJA 1DLIA 2KBFA 3KZVA 2ZJ8A 4TM7A 1FS6A 4CJXA 1G4HA 4XUDA 3S2YA 3RE1A 4YUXA 1B8UA 2PV0A 4DM4A 2NG1A 4B7UA 3NPMA 4B80A 1TAUA 3DFFA 5JNSA 2ANCA 5E9AA 2GZ1A 3NIFB 3R3JA 3LO8A 4V38A 3U61B 3KFVA 2QTAA 4JJ4A 1B1CA 2CD9A 2JKVA 2QN8A 5BRNA 2IH4A 1WG8A 5DX0A 2OV8A 3D2LA 3JVDA 2OAQ1 2VSNA 3BFPA 3HB0A 3P9PA 4GFDA 4P98A 3SZ3A 3CO0S 1BWPA 4R31A 5TMPA 2CV0A 3NXKA 3ZCQA 1JN0A 3ICOA 2FEWB 3TOXA 4DC0A 2NUPB 3MOSA 4OJNA 3THWA 5AXAA 4GVPA 3AF1A 5C8YB 3DLBA 5JASA 5JMOA 2UVPB 3HDVA 1O96A 3IMCA 1M1ZA 4LCBA 5HIIA 4UQPA 3P32A 1J07A 2PT9A 4NS4A 5DNYB 1H42A 2NQ2C 2B82A 2Y1LA 2WNIA 3EXAA 4OQDA 1Q22A 2PS0A 3K72B 3V8RA 2A0XA 1JHMA 2OGUA 3B1WA 4WCDA 5BSKA 5L51A 3A1SA 3OIDA 5BV1A 3WK7A 1CUXA 4HNVA 4IGAA 3LY7A 3IAHA 3M6FA 1YNOA 3GP5A 4BN0A 1NQOA 3CZ4A 3VDNB 5KI6A 4QBTA 2PKRA 1OKKA 3PGXA 5ECWA 5JWRA 2P9YA 2YWJA 5I9SA 2XW6A 1CZLA 1U3TA 1TO6A 1T34A 4GOLD 4Y2RA 5CCDA 1BU8A 2A9PA 1EM6A 4Q9JA 4G4SP 4OJMX 1O9HA 2R25B 4GO1A 4H1WA 3D3NA 2X7HA 1CUBA 5LBIA 2ZW9A 4BBAA 4MRNA 4F1KA 3OIFA 2Y92A 1W48A 4N9QA 1GQQA 4CNBA 1A5ZA 1V16A 4AY2A 2XZLA 3FMIA 2IPMA 2NMVA 3EZNA 4ER5A 5IF9A 4G67A 1AKMA 3SIWA 3FOZA 2OXFA 4PE5B 4W7HA 4R81A 2IQIA 3GAMA 3RYFB 1NOIA 1UAYA 4HYQA 1EB9A 3OECA 1QX4A 4ZPJA 1MO5A 1NMXA 1TDJA 4PNZA 3G2HA 4TT3D 4BGIA 4YXWD 2C7OA 4DR4B 2I9KA 2P4HX 4W5OA 4HDCA 2NP6A 4RADA 1W4ZA 3IQWA 4X8LA 1JDTA 4US0R 3VR5H 3ROTA 1R4MA 4MS4A 1NGSA 1H2AS 3HFGA 4TMFA 3RREA 4QQRA 2IHUA 3HADA 4CCYB 4B3JA 1O57A 3CB2A 2R4UA 3LT5A 3MRVA 3B52X 4WESB 3T06B 3UT5B 4C3ZA 2ZTUA 5F64A 5H83A 2XLCA 1UXKA 3Q5GA 5EQJB 2TMGA 1Q92A 2VDLB 1ECLA 2FA9A 4MGIR 1O6BA 5IJAA 2A9JA 4WN3A 1CKEA 2NYRA 4NBKA 2C99A 5I5EA 2OM6A 2NO9A 2RI1A 3KQPA 3LBFA 4J3FA 1V35A 1PVDA 2VK2A 2ZB8A 2HN9A 3FDJA 2Z3ZA 3P4XA 4UD6A 1N78A 4LE2A 4WLNA 5BSRA 3SZUA 5F2KA 4BX0A 2UXCB 4PSDA 2PQ0A 1TK9A 3L6DA 1SUCA 5LA6B 4M49A 4ZHQB 4LMRA 4DUGA 4AZVA 2CYAA 4JLWA 1ZA2A 1KY5A 2GVZC 4TPKA 3ZZ0A 2GJAA 1ZGJA 3TR0A 3GGDA 4RJJA 1IN6A 5EMHA 3GLGA 4XLLA 4OMCA 5LQCA 2WAXA 3IV6A 5HPYB 3BL5A 1N2HA 2ZIXB 1Q1GA 3VYTB 2AG5A 4DR1B 1OHHD 3WJ2A 2XGMA 1Z88A 1VE9A 3HG7A 4B3TB 5AIAA 4PTYA 4JLUA 1JHZA 3LDGA 3O0DA 5G1NA 3PF8A 5HIJA 3THYB 3DTVA 2ORED 3ZR4B 1FP1D 3FSRA 2VBGA 4TRJA 2EGHA 4CR7A 1UMBA 2JHFA 2GAJA 1W25A 4M0FA 3JVUA 1M6YA 4Q9NA 2HH9A 2WJZB 2PTGA 3R8FA 3I09A 3O93A 4FCVA 1XZCA 2FDRA 2GCOB 1JR3D 1WIWA 5K7SA 2CJPA 1U3UA 4LXYA 4PG8A 2RMKA 2GVDC 3AR4A 3R5FA 3VNQA 3TLGA 3M1YA 3ZDZB 3KUXA 4MHSA 2I6FA 4WNAB 3T7AA 5KVVA 3LX8A 4D0NA 3V33A 3PFKA 1X0VA 2P3QA 2QF7A 3CTMA 5AO9A 2Q45A 1X8XA 3FCXA 4FZRA 3FCAA 5DHRA 4BMNA 2RCNA 3W6UA 4NG5A 3VZCA 1CUAA 1Q95A 4DR5B 4U4AA 1UDWA 4UFNA 5KEIA 3OT1B 4IQFA 4BBJA 1GGHA 4P86A 1GRRA 1A88A 1MOPA 4R9RA 3ID6C 1J20A 4YRBA 1NF3A 4M9XA 1GUBA 4A6DA 4JQCA 3DWGA 1F9AA 3BZBA 1P7ZA 4JLSA 2P27A 3BZWA 521PA 5G0WA 4QJ3A 3IOYA 4JEHA 5KJ6A 3TLYA 3RHZA 2QL6A 3GCDA 3RYHA 3TTUA 1OYYA 1H5NA 2WRZA 2QTHA 3FTEA 1AX9A 1X70A 2GN6A 3CIFA 3O31A 2SKCA 5EE9A 1JPJA 3EDMA 4H77A 4HUQB 4XH9B 3ZVKA 2ZULA 3E1SA 1XJCA 4WUVA 2JH8A 4A1FA 1VJGA 1Y8QB 2G7MC 1KIFA 2XOKA 3KLNA 3EAFA 1KMNA 1F60A 3Q9UA 2IYRA 4GOKA 1N6RA 4NJMB 5DTRA 1L4FA 3CZMA 2NIPA 2XI4A 1JRLA 3OIUA 3IJRA 3QJGA 2IL1A 3L7MA 2X15A 5HCIA 5JJLA 1MB0A 5COQA 5CDYA 4XFKA 2NT4A 5ICCA 1LVHA 4YRJA 5EIEA 2P9ZA 1J1ZA 1LV7A 3GJ5A 4XX0B 1DU4A 1VLHA 1PGQA 4LXGA 2CEKA 3GFOA 3HVHA 3RSQA 1IBLB 1J0CA 1R12A 5K3CA 4E33A 3BMNB 4F6RA 2JCXA 4D81A 1M0SA 5EKXA 3FRHA 3DFIA 3KZNA 3UW1A 2ZI9A 4IGEA 3LLVA 2JLVA 4CG0A 1LDBA 4OLJA 3HR7A 3SZLA 2B1IA 3E8XA 2QTVB 3VNRA 3WWDA 4DF3A 4JV5B 1U1FA 1A5AB 5TVKA 5EPUA 1PZFA 4E4YA 3KCQA 3UMJA 5LMUB 2Z9BA 2FJPA 4RPJA 3N7UA 2IS4A 1KYIA 1TF7A 1C1XA 4MROA 5AW8A 4FQ5A 3KAJA 4R2MA 3QX9A 3A6PC 2ZXEA 2V54A 1QF9A 3GG2A 4O2BB 5FWXB 1T1GA 1GOTA 1CIVA 2EX1A 1JHXA 3LLCA 2DUUA 4LECA 1F2TA 4HTFB 1TCUA 1VYHA 3N2GB 4MI6A 4RAOA 3EA5A 2J5QA 3RHFA 3ZEAA 1P39A 3OCXA 2PUFA 3A31A 4KLCA 4DLAA 1WXIA 2ZKLA 4TSRA 1I1HA 4LX8A 2I3GA 5E4TA 2J0VA 3WFJA 1ZK1A 5F4ZA 1AE1A 2PZEA 4QYWA 2CWWA 4E7PA 2A0UA 5IG2A 2ACWA 2P3SA 1K3TA 5HZKA 2IYFA 3EFHA 4TKMA 4DDWA 5LP6B 3ZV7A 2DPHA 3ETCA 4RKFA 5AVOA 1E2DA 3DWEX 4Q21A 4FYYA 4GP7A 1EDZA 2XVYA 3QVMA 4L8VA 2P4SA 3SEFA 1IU9A 4S1OA 2XUJA 3IEXA 3OFNA 2G25A 2XZPA 3Q3JB 1XNQB 4OAOA 3QEMB 4GF5A 5LBTA 2ZOSA 3GBVA 3LKDA 4QNRA 3GA5A 2DFTA 4L9SA 4C5BA 4Z3KA 2QX9A 2P6RA 5DM1A 1Y1KE 3AF6A 2Y68A 2N9UA 4LJ5A 3VVMA 3CVJA 1WTAA 3QH4A 3ICWA 4ZHQF 1GPH1 4RFLA 2Z5FA 4CMJA 2B94A 4ZVQA 4TXNA 1P0MA 3G88A 4FYIA 1IZZA 4PZEA 3DC7A 3UEOA 4DLRA 1PK7A 3CLVA 4PHHA 4OIFA 3PWSA 2VHWA 1E58A 1LUAA 1OBOA 3W1WA 1RFGE 2GFIA 2R8YA 2R47A 3M5PA 2IHTA 3BAZA 9LDTA 1J49A 4DZTA 4IXNA 3LCMA 3CJRA 2CN1A 2DFLA 1MCZA 2Q1SA 3IT1A 5FNVF 1J5PA 4M8KA 4MVJM 2G9VA 1XZQA 4FQ8A 4IIEA 5D84A 1BXZA 1ZY2A 4PCAA 4Y2JA 5M34A 3IEVA 2ZM5A 4YDHB 3EE6A 5EIWA 4V0SA 3RT9A 3OQNA 4L3WA 5KNCD 2NT3A 2OMEA 3AO0B 4PZ9A 1R0KA 4QOFA 5KKAA 5L8VA 3EQ8A 3H9GA 3AR9A 4G5HA 5EQDA 4PYMA 3FTCA 1DO8A 4LFCB 3FROA 4B84A 2TMDA 3WLAA 2DJ5A 4DN6A 2H5IA 4MLPA 1VYTA 3VO1A 2NXNA 4O1IA 1JEQA 4YAUA 1RZRD 1CUGA 2OORA 1OGIA 5FO0A 2O54A 1LQUA 4IRXA 4RVGA 3QU2A 1M73E 4PM4A 1QWSA 3DR3A 1QLHA 2HSJA 3NRJA 1TAHA 4FEEA 4PQFA 4DDHA 5DM60 1WBJB 4OO3A 1IZ9A 3EZ2A 5B3LA 1GXSB 3D6FA 5KTMA 4LVOA 1XF1A 5B30A 3ORHA 1E6EA 3UMMA 4YROA 1YF3A 3FOFC 3ER6A 3DXFA 5L7YA 4OQMA 2VZLA 1GDDA 2AN1A 4JUIA 3RFCA 3SR0A 3W6OA 3I01A 4EW1A 3LPDA 4KR2A 2Y1GA 1UMCA 4KYUA 2FRDC 4O08A 4P81A 4L5IA 1NLYA 1Z7YA 4J2OA 4LQLA 4EY6A 2V7UA 2GNOA 3PK0A 4G8BA 4LHXA 4BB0A 3OWXA 3L3BA 5IW8A 3GGGA 4MVJA 3FWNA 4MLCA 1B23P 2O9JA 2V55B 1IVYA 2OQ2A 4OF4A 1AGYA 4CN8A 5IDWA 1YJQA 2DWCA 3K70C 1RI5A 2ASEA 2PEYA 4HGRA 4WBXC 2HRBA 4DQLA 5AW0A 1UK6A 3ZXXA 3TPCA 2ST1A 4D9KA 3K4QA 4LWQA 2FE1A 2Q3LA 1D04A 3OM1A 1L5NA 2PZFA 2XX3A 4AZWA 3JWIA 1W46A 2FK7A 3LUBA 1R6UA 4GEKA 4O63O 1E2EA 1D6MA 1SG0A 2BN4A 1C7IA 1SUPA 1P2FA 1ZEMA 1AD2A 3NBXX 4R1OA 5DTEA 5HR5A 4U7PB 1EWRA 3EGDB 3ZGNA 5HK9A 4L78A 1IN8A 1N2EA 1RCTE 1TVCA 1V4BA 4HH4A 1B00A 5AYVA 4BN5A 4F71A 4RTMA 5E6RB 1AMOA 3M1AA 5JQGA 3P0IA 1JJVA 3QE2A 2X6QA 4BLWA 2RGCA 2IYWA 3WIDA 2XJ9A 1R00A 3HRKA 1HE3A 1X8JA 2XOXA 3RG2A 3TZBA 4TQ9A 3CCFA 4BMXA 5LP6C 3C43A 2WUGA 2Z83A 1N3LA 1E69A 1NVVQ 1QQ7A 4TL6A 4NCNA 1U0BB 4DDVA 4FNAA 3DV2A 5JSZB 1TK2A 2CNWD 2P11A 5AW2A 1IVSA 5AJUA 2JI8A 2BCEA 4ZOBA 1SURA 3R8XA 3TF5A 4DM3A 1WR8A 4FX5A 4QLAA 3B5EA 2GM4A 5IXSA 4I36A 1KEWA 3QEKA 2APJA 2CW5A 3OLVA 4F5YA 5E3HA 5L40A 4B3RB 3UYKA 3S7ZA 4EA6A 1PF7E 3F49S 2F1RA 2M6LA 1KMIY 3B1YA 3IDZA 2DUJA 4ALLA 3ES9A 3NJRA 1IQ0A 4FKBA 2A78A 4X6YA 3JVVA 1NVEA 4DG5A 3L8GA 1BXKA 5FIUA 1EUQA 3F5MA 5CA0A 1R6XA 4LZWA 4DANA 5A0VA 2YZNA 4KTTE 2H1FA 3JQEA 4PCLA 3O1JC 2QYOA 2WWIA 3QLUC 1JQDA 1E9EA 1SA0A 2QX6A 2WLTA 3P9KA 1CYDA 4LWPA 4BQOA 4ZZ3A 5AVUA 1U0NA 2Z57A 3CF4A 3Q7RA 5H81A 5DGTA 3PSHA 3WA6A 5J43A 5EJ9A 1GYQA 3MM4A 4A15A 2OBYA 4IR7A 3VNVA 2FSVA 1L7NA 1RLOA 3E35A 4UAGA 4XIYA 1EUDA 1WLSA 2YHUA 4ACBA 3W8EA 5L3VA 5DI3B 1USKA 5I51A 3OF3A 1HEIA 5CX4A 5FT9A 1H3FA 4F9GA 2HRQA 4NENA 2ZK7A 3ND8A 4CKZA 3J80A 1OT3A 1T3HA 3B3GA 4AJIA 4BJ1A 1T36B 4KRFA 1X1SA 2VDRB 1U0FA 3JYPA 4IOMA 4LYAA 4J0EA 2YW2A 3D02A 5F7XA 1MZPA 4U2EA 5AWFC 3D64A 3M1IA 3WADA 1U4OA 4FYJA 1FS5A 4LPKA 2Q9CA 2O0KA 4OLAA 5DLPA 1SQ6A 1EX1A 1TUGA 5EA2A 1PFGA 2HCBA 2PWBA 3VNBA 1JSZA 1L8XA 1NP7A 1WQ4A 4XYEA 3BD7A 2F1IA 3MQ4A 4OUKX 1ZK0A 3HKBB 3RI3A 4BX2A 4DHWA 5T4EA 4NZOA 4W1PA 1WUIS 3QIAA 3VI4B 3PEYA 2ANBA 4DLPA 1NMEA 4G07A 2EP5A 3OSZA 2I2FA 1EUCB 3LGXA 4TT3A 1LA2A 3G59A 5HTKA 4YXWA 4Z4QA 2JFWA 1YQQA 2XUGA 1ZESA 1KI9A 3N0VA 4NMWA 2ZRCA 2YV1A 2AS0A 2PRKA 4E88A 1QAQA 2JCVA 2G04A 1VI5A 3PC2A 3B82A 5G3ZA 2FETA 3CEJA 3T1TA 1R8XA 2FAXA 2JJQA 2Y1DA 2ZBGA 3IKLA 2GN0A 5I7EA 4QOEA 1DV2A 1QFSA 3PEEA 4RULA 1WCXA 3KSRA 2Q8PA 1UBFA 3M6XA 3ZGZA 3DR5A 4OQZA 2ZQZA 2ZBUA 5CBPB 3TW6A 4I1SA 1ZD3A 1LLUA 3QU4A 1FS4A 3NLLA 2GLUA 1AUXA 1DIGA 1RACA 4PVCA 5DNAA 1KL7A 3D7SA 3O8CA 4R7GA 1FRNA 2C4KA 3K3PA 4R2LA 4WD3A 2C84A 2QHXA 4NTZA 4N39A 4YDRA 3RSOA 2NUBA 4ALNA 3VPSA 1UQUA 5IU6A 2GZMA 5AJWA 1IJEA 3B20A 3FAKA 3GN1A 3RODA 1IOZA 1N2OA 1LNSA 1RLMA 4G2TA 4RSRA 5CVJA 5DE3A 2FSUA 3HBAA 5ECDA 4ZCIA 4ML3A 2ZITA 2PR2A 2CDCA 3A28A 2H2IA 4O2LA 3K5PA 4K9LA 5FXMA 3H1EA 1IVNA 3UXYA 1Q57A 2ODEA 5KTKA 3EG9A 3TLZA 3WRWA 1CETA 4GBED 3ND6A 3A1DA 4JR1A 3D6AA 4I66A 1RJ9A 4MIKA 5KNBH 6ADHA 5K0SA 1NVVR 1X1TA 2GD2A 5KINB 5FFNA 5KJCA 2AFHE 4AG3A 4V3BA 2P6OA 3DVLA 4BIMA 5BNWA 3HY4A 1T0HB 2M6RA 3ZGYA 1QDEA 1CQJA 2J3IA 3RRFA 1JFSA 1OLUB 1EMDA 1XDWA 2NZYA 3BEOA 3K6JA 2Q7XA 4UTRA 1M34B 4G85A 2UUOA 1MVLA 3I8XA 1LPPA 3IUQA 1KVSA 4QX6A 5BSUA 3ZXSA 4Q1EA 1JU9A 2H5JA 1T5DX 2FSSA 1I2DA 5F1YA 4D79A 1TZJA 1I6KA 1LSOA 3L0DA 1ADBA 1RHRA 4X24A 4NFHA 3QZUA 3LX4A 3CR7A 2AEEA 1YS2X 4HWGA 1CJSA 1NVFA 3BFXA 3EQZA 2A94A 3I2KA 4MUJA 4UFOA 5DI9A 1UWKA 3T4UA 1TM1E 4OFWA 4RTRA 4QUHA 3JQDA 1XO1A 3FKQA 5JECA 4YECA 4HN9A 3PL5A 3LKVA 1B8OA 1NNUA 2Q3CA 5CH8A 2EFEB 5A04A 1KOFA 3B89A 1AKVA 2DH5A 1FQOA 3LHKA 1Q3TA 4Q1DA 1KARA 1U1IA 1X2EA 4UD2A 5GINE 1KQ3A 4AY6A 5A06A 2YYYA 2DOKA 3JWGA 3K1TA 3RIGA 5GZ3A 5U9CA 2XGJA 4DA0A 2XZDA 5ADWA 3KVNA 1RAIA 3DEFA 2D7CA 3SXUA 2JDID 3EXIA 4DCPA 4ZO4A 4DLZA 3PRKE 3WGGA 3WLEA 5BURA 1L5WA 1SUBA 3FGNA 3R7AA 2E85A 4IKOA 2P68A 2VIIA 1DTWA 3NBKA 2DSNA 3LQQA 3NYIA 5EIFA 2PWZA 1T9BA 1NJSA 2ZVJA 1R0YA 5ERYA 4JCOA 1IBSA 3E48A 1J21A 3WXBA 3SLKA 4RKWA 3BXGA 1O08A 1VC2A 4RTKA 3K0BA 3RIXA 4C6RA 4CM8B 3QY0A 3RTDA 2X0KA 2P9QA 2QLBA 3KQTA 4GPTA 3FMPB 1L5RA 1M2WA 1MORA 4XYBA 4WZAB 3A6JA 1VSQA 3DLTA 1F2UB 5IM4A 3QK7A 3ZLUA 1YCGA 1BCRA 3L77A 1K8ZB 2XUKA 4Q7LA 5EZYB 3RFTA 2O8DB 1YUMA 3G3EA 3UAVA 4NKRA 1WHSA 4CFZA 4EQZA 1FFGA 1ZCJA 2VKQA 3LFHA 4E4TA 1FUUA 2PTHA 4WOBA 2VR1A 1QB8A 5BMVA 1U80A 1DOZA 5GY7A 4DKXA 4RZQA 1O97D 4AKEA 1UM8A 4X1IB 3NC0C 3DCYA 3QELB 5F78A 2DVMA 2QT0A 2F64A 4IV0A 3O6VA 2LR0A 4P3OA 5JZSA 1K9VF 2EJUA 2WF9A 2KYRA 3BFKA 2BFCA 1Z5NA 4J0QA 2ZANA 2VPTA 4RV4A 3JASB 4WINA 4NBTA 2OXEA 2AYXA 3GT7A 1WU7A 2BC9A 1XP8A 1ZOOA 1BRMA 2I1VB 5ELMA 4YAIA 4LV6A 3WAGA 1MAVA 4AWBA 2ODQA 3QWHA 4RVUA 4DRYA 3WB9A 2J3HA 1TF5A 1UFKA 2FR8C 2GHRA 4DQXA 4KSCA 3SHQA 1BKDR 1BHQ1 4X91A 4R68A 7REQB 1WEKA 4N6OA 4IIXA 2RC6A 3UBMA 2CV2A 2OESA 4C7MA 1XN4A 1FQJA 1I5EA 4NL4H 2VYVD 4EHNA 2ZCJA 1R15A 3ANLA 4F85A 4ZOAA 2WYIA 5HNKA 2DHEA 3I1FA 4P4SB 4CM6A 1Q1BA 2B1JA 2WIAA 5KDLA 3FVQA 4BPBA 4RYLA 3CX4A 3HV0A 4XYMA 3KSZO 3EMDA 3JYQA 4Y2HA 5CURA 4YP6A 4X64B 4MQFA 3IO5A 3IMFA 5KX5F 3W2GA 1DJQA 2PUTA 3DZFA 4RF2A 3MINA 1K5PA 1Z3IX 3FNRA 3PFIA 5DSXA 5FHQA 3TGLA 1DAPA 1ISRA 1Z8HA 3V42A 5I9IA 3L1VA 3LWDA 4G5GA 1RT9A 1LB1B 4HJXA 4PWZA 4QDJA 1GUAA 1VKZA 1QIHA 1YFZA 2CEAA 5IN5A 4YAOA 3W2IA 1NBAA 5AVSA 1G291 4MPJA 2PO5A 1MP0A 5JCJD 3K0FA 1LNQA 3LGSA 3M81A 4MVYA 4UXIA 1GA6A 2EWWA 4GC5A 1YC2A 4QUAA 3WX0A 5DNWA 4W5QA 2W2TA 1X3LA 4DCMA 4LPSA 1A7JA 1BD3A 4Y6OA 1YJBA 2CJXA 2BEVB 4GQBA 4NESA 2MU1A 1B2LA 2LZ0A 5CXSA 3C14C 3UFBA 3WLSA 1VPEA 4WFKA 4RDHA 4KRGA 1NJ2A 1I3LA 2R7KA 3BMCB 3KOZA 3SVZA 3BXHA 1S9DA 3O1HB 1DKPA 3EDQA 4MULA 3UV3A 4ZK2A 5FEUA 5HZHA 5KJFA 1ST2A 1N1MA 1TTQB 2Z5VA 5DF1A 3TIFA 4ZVRA 3MPUA 4FMBB 4BAZA 4EJ0A 1ACLA 2AOUB 5BYAA 1CNEA 2O8EB 5EPEA 4B31A 2H2HA 4MZXA 1HORA 1T3GA 4RMHA 3E8MA 1OU0A 3KEQA 3UGQA 3AUKA 1ZA1A 5LOVF 1T3SA 2FYTA 1PNOA 3LYLA 4OL0A 4ZANA 4MV1A 3W1VA 3W5IA 3GLIE 3DMYA 4YPVA 1IY1A 1BDBA 3BH6A 3D59A 1JA9A 2H31A 2PL1A 1JHYA 3G9TA 1LD3A 2OBNA 2HYIC 3FJOA 4X60A 3WHKA 4DOMA 4DSNA 4ZOLB 4EI9A 1Z73A 4HGYA 4C6TB 6GPBA 3LBNA 2P1RA 3IIIA 1F06A 1LKZA 2C5BA 3MS2A 1RZVA 3GJ6A 3I53A 4YAFA 2D1FA 2HC9A 3CUWA 2WVAA 4NMMA 5E7JA 4NNOA 3E5MA 3Q8LA 1JX6A 1SVMA 1TUBB 3GFVA 5BQXA 2VT2A 4MUKA 2BH9A 4B1FA 1P1IA 3WMWA 2E1RA 4K05A 4X63A 1C4WA 1EDOA 2J6CA 1QC5B 4KXQA 4A5OA 1ZRMA 4KQMA 4D4MA 4YAGA 4GT1A 1Z0KA 3FF4A 3HB4X 5FBQB 4DSAA 2ILVA 4GX1A 5TF4A 2DZDA 4LF6B 5E6SB 1E3LA 4GKVA 4RH0A 4AVYA 1H0KA 3O38A 4P35A 3W9YA 1V48A 2OY0A 2JK0A 4FP9A 4CL0A 4CM5A 3CVXA 3PQ2A 5BYBA 4L28A 1M67A 5IUNC 3GJ0A 1WKVA 3I9V6 4MS3A 1ECGA 3EGVA 4XJTA 5CXXA 1CR4A 4U2DA 1JLMA 2AZ4A 3SHFA 4AJLA 4EHFA 2YVAA 1ZC4A 2Z2IA 5C2JB 5IC5A 5CVTA 2B69A 4N6GA 3U40A 5K3FB 1GKIA 3NW9A 2JLSA 4BVKA 2BHRA 4IMJB 1CEQA 2GYUA 1BYUA 2JA2A 3FXAA 2DFDA 3AERB 3QIVA 1L8AA 4JVLA 3SU8A 5LZ4A 4ZP1A 1FZTA 1OB2A 5C34B 2YYZA 2RH4A 3G6WA 3HXTA 2UDPA 2JPDA 4O4JF 4A2WA 2IBTA 4UEWA 4PIMA 3FZNA 1P1RA 3T3HA 5JSKA 3SS8A 2B30A 4L0MA 3RV4A 4QBIA 4C0AC 1PDVA 3QYPA 4LF7B 2C77A 1FLAA 1NE2A 4RCVA 4BO1A 1OBCA 4XWKA 4L85A 2CJFA 2IBSA 4U9HS 4KQFA 3Q88A 4DJTA 4NS1A 3HABA 1TX4B 5EP3A 4FFVA 3ROXA 4Y7CA 1Y3DE 1J8FA 3MTAA 3I04A 3OTGA 4LJLA 1D1PA 1HE4A 1AO3A 3I9KA 2WA2A 3UT6A 13PKA 2NUTA 4RTJA 3UATA 4OQEA 1T5OA 1DUIA 1NBME 3RHTA 5KMGA 3EPJA 2BFPA 2WA1A 3U39A 2J4FA 4IXMA 1RAEA 3EEYA 3OU6A 4N49A 3T94A 1U0RA 4R2HA 2B25A 4Q1VA 3ROQA 4OMDA 3H8JA 3LDUA 2IS2A 1OZAA 2RGEA 3SVTA 1TTHA 2VUUA 1PSWA 3P97A 2WWVD 5H0IA 5BR8B 4K6GA 4DMKA 1WB6A 3EXFA 3OESA 5IM4F 2ZJZA 5BXQC 2HBZA 4F97A 1BD4A 2CCGA 2FDCA 3FPEA 3KKLA 3MHPA 3KELA 2XZOA 2IP4A 2QVYX 4JX9A 2P1DA 5ALQA 4BWVA 3W9UA 1J23A 1FVHA 2C31A 1E5LA 2D2XA 5J40A 3WO1A 3EASA 4RVDA 2QAGB 4URVR 2ZIWB 2Q9BA 3AH8A 3FUVA 1Z6TA 2X2EA 2GXQA 1SCKA 2CNKA 3I39X 4N48A 5CT5A 4E1AA 2P7IA 3SS7X 5B4UA 4NCIA 1HZJA 2HCTA 1NN1A 4GMKA 4X1OA 4C7VA 1DCTA 1CP2A 2CFOA 3BIJA 4WNCA 2G71A 4B3BA 3ZHRA 3EOBI 2JC3A 5AKXA 1U2GC 3QWAA 4Q9AA 5HIAA 1Z47A 1PNRA 2YNMD 3E7DA 1NXWA 2YHAA 3H9EO 3JTEA 5CIWA 2RIRA 1D7OA 1UXOA 4FZJA 4XI9A 1OXBB 1QDUA 3VYWA 3JRWA 3ZGOA 2DB3A 1WV1A 2YZ2A 3CURA 1CIJA 5CYOA 2A92A 8LDHA 3WSTA 3S81A 5AKLA 1U5CA 3MWFA 3CHYA 1NBEA 4WLEA 4QHYA 1V2GA 2JNWA 3DKKA 4OJKA 4B46A 1R0ZA 3EEIA 3VHLB 3TSCA 3VJLA 5JCPA 4TLEA 1DRKA 2AEMA 4MRPA 5DTQA 1LJ8A 1EGAA 1XZPA 1SJ9A 2GKSA 3K0AB 4NF2A 2N42A 3U4GA 1O5TA 2HRRA 2O6LA 2BKVA 1IHOA 4L8WB 3PLNA 4C9BA 1BX1A 3IRVA 3BDAA 4WK4B 5D6NA 4YQFA 3EEFA 4RQTA 1VYVA 4XWOA 4NECA 1RRVA 9LDBA 4PN3A 5BV7A 2RHTA 1IJBA 2FZEA 3KBBA 1JT2A 4HUTA 1TA4A 4KFTA 4HDNB 1RBZA 4BFVA 4ZAZA 1W581 3IELA 3CLTC 4U7GA 4X7MA 3FJ1A 1PR1A 3SICE 1QTQA 4DV0B 4W8GA 1XNGA 4DUYB 4QECA 3ROGA 2G0AA 1ETHA 1UBJS 2ZBRA 5LDGA 4TXLA 1V43A 2QVXX 5BV0A 4ENQA 3IKVA 4IIDA 1NOJA 5KOJB 1NASA 3I64A 3KTDA 4KO3S 1F5SA 3TYXA 1IY0A 2ZTSA 2ZYIA 1Q7RA 3EVFA 3IDSA 4WFIA 3SDZA 1AJEA 1AV7A 1MVOA 1JQKA 3ENKA 4O4IB 2FFAA 5ULLA 1T9DA 3R77A 2LBPA 1N9GB 2FZ5A 2HUPA 4TZKA 4B75A 1XYGA 3JYNA 3WB2A 3DLHA 1F7VA 2BT4A 4OGGA 1UOOA 1X39A 5TGDA 2A7XA 1W36D 1C8BA 4WXEA 3O95A 3UOGA 3AIIA 4B6EA 2YXNA 4PLHA 4EF4A 2WTUA 5ELXA 2OAP1 3ICEA 3GPBA 2RGBA 3G49A 4GBMA 1Y8CA 3KSDO 1YCDA 8ATCA 2I6XA 2FOXA 3Q6IA 4N8DA 1SY7A 1RU3A 1T6XA 2GUWA 2G63A 4W7SA 1R18A 5TT0A 4I5FA 5A03A 3ZWCA 5B58C 5TLSA 1W87A 1WXXA 1WS6A 1U90A 4GE0A 2NTYC 2BFFB 3NRBA 3BWCA 1U7WA 2JH3A 3B36A 4CIBA 1S1CA 4O1HA 1ZM7A 4S0ZA 2ENUA 1SRRA 4EW3A 5AVVA 2BMWA 3U3OA 3OQIA 3LNCA 1L4GA 2Q4RA 3R5KA 2CBZA 1W0JA 1NVKA 3LYHA 3CLUD 1ZJWA 4GLBA 2VZ0A 1USUA 4Y18A 4I9UA 3N8DA 5ELLA 1UOEA 1I6LA 3KJQA 2IYUA 1DRJA 4I1OA 4B3CA 3OX3A 1FPMA 5I7WA 3GJ8A 3MCUA 3O3MB 1ICEA 1Y89A 4ZO6A 2IYZA 1G4UR 5J4YA 2QAGC 1MOZA 1E9CA 3AVTA 4HQNA 4ZMRA 5D86A 3WMFA 1UZNA 2HHLA 4IZ6A 4RGQA 4L95C 4EGJA 5AUPB 2X19A 2XITA 2OLJA 2JGKA 1NATA 1QIJA 3Q3VA 3NHSA 3ZH9B 3AFGA 1FL9A 1Q0UA 1BXRB 3SSAA 1E62A 2M2IA 1IJFA 1MX9A 1P73A 3EISA 1BS1A 1MEOA 1O03A 2AFIE 4OREX 1E1CA 4YCAA 4MJ7A 2IUUA 4HGOA 3SFVA 2I4NA 4F4FA 1UPCA 3JR7A 3PDHA 1ZDMA 1SULA 1E2GA 3AF4A 4D8UA 3VYVA 1J06A 3WNDA 3RS2A 5AESA 3NOQA 4FFBB 5CNIA 2JLYA 4OQXA 3U4QB 2C04A 1DKQA 3HCCA 3AY7A 4QU0A 1XJQA 5JCXA 2CD7A 4HZUB 4YWJA 3FYHA 4G1VA 3ZWNA 5BN3B 4OATA 1YR6A 1VHLA 3ABIA 1OBHA 3LUPA 3TQRA 1JSLA 1LFAA 3DXYA 4XB2A 1GU7A 5CCXA 2H0RA 2QRPA 3M5WA 4LNAA 4MITA 4TYNA 2NZXA 1VRWA 4JI2B 3RK4A 1O4VA 1A2KC 1BSVA 3VO9A 5AW3A 2C20A 4Y9TA 4U5XA 3L79A 4EJSC 4P1ZA 5E4YA 1A8UA 3CNLA 5JXWA 1NURA 3L8DA 3OI7A 1TW3A 5AICA 4IWXA 5E1MA 1V8PA 2QM3A 3L93A 4GH5A 4M88A 4ND5A 4QO8A 5KREA 1RTKA 2NO7A 4XW2A 3CN7A 1J9GA 1BEZA 2XQIA 4GOJA 1XCJA 4MVWA 2QQGA 4RK6A 1NDHA 1TIBA 5FKJA 1CY6A 2P9TA 3T0FA 2WI8A 4HQ0A 1BQ3A 2WICA 3A0RB 4IILA 2BKXA 3N5CA 5CAEB 4Q37A 5KYYB 1PR2A 5M5BA 3HDQA 2GFHA 1VBNA 2VUIB 4LYHA 4IHQA 1UBUS 4V0MA 4W9NC 2ZRMA 2XNDD 2AN3A 2X5XA 2Q6TA 3HJRA 4UUNA 2JI7A 4UDOA 4LF5B 4PLCA 2Y1KA 2I7TA 2ZPAA 1O95C 2ZYUX 3AHIA 3CEMA 3B8HA 4YONB 2VJYA 3B9BA 4AS2A 1JG4A 3OEHD 3Q98A 4OI0A 4ARIA 4KN9S 5TQJA 4PRKA 3UUWA 3BFVA 2UXBB 2EVWX 4EKDA 3NFRA 3H75A 1QCDA 4KPUA 3ZV5A 1CJUC 2VYVA 5DKFA 1NPTO 4FCTA 1VMIA 2X86A 3ZCXA 3LRPA 1RYDA 4IJ6A 4MRMA 4CM7A 3PJRA 1T6ZA 2OHXA 3S6JA 1UKAA 5G4KA 3MOIA 5GJVC 5LIRA 1ONNA 4HRXA 4QE3A 2W8ZA 3W04A 4TQUS 3IQIX 1JZQA 2DHDA 2H5LA 3RYIB 3SZRA 1NG1A 3MCWA 5F5LA 3W3ZB 4EAQA 3RAGA 4ZYUA 1D5CA 3NT5A 4HZIA 2VH5R 3HNRA 4JC4A 4OHBA 1C30B 3GL9A 1K0UA 1EXMA 2Q2NA 1QE3A 2OP0A 1V4VA 4FIDA 2FZKA 1T3ZA 4LV5B 3TTYA 3FUXA 1RM5A 5JCOA 2GF0A 2RGYA 4EHHA 3C3DA 5KQSA 1H5QA 4ER6A 3IBSA 3HCWA 1TA0A 2R62A 3EZYA 5JCJA 4A0GA 1UBRS 3AFIA 5KUTA 4E2WA 1PG0A 1O94C 1JWAB 3BK2A 2X1MA 5HFNA 5KYXA 4H9GA 1TRKA 2A3NA 4JI6B 2NO4A 5WRFA 2OFPA 3ZU5A 2UUPA 5EKSA 4TTVA 1DNPA 3G2NA 2PCJA 3GBSA 1FLNA 3IS3A 4PSCA 2BMVA 2GBIA 4R8RA 4RKQA 5DT9A 3NHYA 1LV8A 3EIXA 1I6WA 3MFYA 4LJYA 4N3CA 5CPFA 4JI8B 2AZXA 1ZC3A 2WJ3A 4TVOA 1IN5A 3ZHUA 4Z8XA 3O84A 1IFXA 2ZROA 3MNFA 5EMKA 2QUJA 2XUQA 1JUDA 1KNXA 1L3IA 2E55A 3U0BA 1HEUA 2YXLA 2HMAA 3HM2A 6REQA 1MAWA 2R6HA 2YASA 4F2DA 3EXEA 3GF4A 1VMEA 1XDBA 1QOPB 3W05A 4DA7A 4F96A 1AHIA 4R83A 1Y3HA 4Q12A 1L5SA 2PVCA 4JAVC 1N5DA 4NPHA 4I7EA 5BNIA 2AJDA 2YC4C 1LH0A 5E2AA 2B20A 4AYTA 5JDCA 1DKRA 1UIMA 2C78A 1P6UA 4N76A 3B6EA 3Q3EA 2I2XB 3REOA 1D09A 3VH1A 1NN5A 4PRYA 3RKRA 3WBBA 1TQ4A 1U2QA 4RETA 4O4HA 2AXQA 1T0PA 3A10A 4YLGA 3E9YA 1W4RA 2CB9A 3ESBA 4IQ4A 3GUZA 3A1EA 4Q4JB 1X7WA 1SHZA 1Z12A 1FJHA 3CRNA 1ZGGA 4I5GA 3L0IB 1RW4A 2AK3A 4MWOA 2R0QC 1J8YF 5SZIA 1I13A 1TUIA 2IHBA 2QGZA 3K9WA 4N65A 4RVCA 4WCVA 3THOA 4B8ZA 1GGKA 1OLSB 1MENA 2AUMA 4XUGB 2ATVA 3OFKA 4DR3B 3GVCA 2X8BA 1QOZA 1YH3A 1HYEA 1FYXA 3AHGA 2VSOA 4KGXA 4X6UA 4AZ0A 5LSAA 1SKAA 4E7OA 4NI5A 3HQ4O 4X45A 3UPDA 4KH0A 4L8FA 4OP2A 3AWIA 3HKCB 5HK8A 2QLTA 4NOKA 3H1PA 1SXJD 2Q4EA 4RZIA 1OLXA 4ND2A 3AETB 4I4TA 1NMZA 3BC1A 2X5JO 1XZ8A 3HCFA 4QJ4A 4X97A 2VDWA 3RSGA 3FTNA 3TW8A 4MEAA 3JCZA 4DABA 2QR2A 2IODA 2Y9MB 1CDZA 3CISA 1Y6FA 1X1BA 5LLTA 1V8FA 3DVAA 5KSPA 4UJ5A 1NYLA 1M1NB 3NHUA 4OMFG 2ORWA 3VZDA 3PCTA 1GQFA 1II8B 4FEYA 1Z29A 4DLVA 3DPUA 3KS9A 1Y1QA 4A8PA 3CPJB 2EIXA 3ZW9A 4GUDA 2UXDB 4REOA 2V9PA 3L40A 3CB4A 4NQZA 5C1OA 2IH5A 3A2LA 2AW3A 2BM0A 3NYWA 3RRJA 4PPFA 3VU8A 1Z35A 4NBLA 3PNLA 3R20A 1G59A 3DCJA 4YX9A 5IF3A 5ESXA 4DJEC 2WSSA 4C2BA 3MJRA 3SX4A 1AT1A 2MSLA 3VBCA 5B55A 5KHOC 2WLSA 5FQNA 4R6XA 1CEYA 1WPRA 4JB8A 3K0SA 1BWSA 1ICIA 1YIOA 2Y1CA 1ZOIA 4Z0PA 5EMLA 3KKEA 3QA9A 3T15A 4QYSA 3AUYA 2I6TA 3TAXA 2OB2A 3DEAA 1LS1A 4FIZA 2A5DA 1U3CA 1LX7A 2VRNA 3C6XA 4I50A 4N7BA 4YMGA 2G83A 2I22A 3OPNA 4XB6B 4PF1A 4BLOA 2OXIA 2WVJA 1SD2A 3W1EA 4HBZA 3PJFA 4LRXA 2ECKA 4M7PA 3IQFA 4D3DA 1FUEA 1XRQA 3R41A 4ROSA 2PX5A 2C4HA 2RHHA 5EMJA 5BVHA 1YB4A 1F4LA 2NYVA 3EWNA 3VVBA 2AMYA 4QTYA 1ZMRA 1B73A 1XPRA 3NVMB 5GONF 1E0KA 3CBQA 3RYTC 4X65B 1E2MA 4DREA 3DEIA 5I9TA 2Z6AA 4QL3A 4MKIA 3PYXA 1YB1A 4DBLE 3KQMA 3FCUB 2HW8A 4BCCA 1OTHA 1ULZA 2FN4A 3W3AA 3B51X 1TEHA 2A6PA 2GHQA 2OM2A 2V3WA 3IODA 1EK6A 4YJFA 1VHTA 2BF7A 4RDXA 3ZN2A 5TNXA 4ZN6A 2R6FA 4D3YA 1STOA 4TMVA 4QTZA 3ZPXA 1M76A 5FFMA 1OZFA 2I6SA 2QRVA 2VK8A 1PR5A 4DYHA 4B4DA 3VYUB 3IKTA 2W6PA 4B4WA 5FR1A 3KUKA 3NZEA 3UIEA 1EA7A 3QEBZ 3HZOA 2CE2X 4JNCA 3RU3A 4ZAWA 2H1WA 2I7VA 2WD7A 5ALMA 5TE9A 1LPSA 1MQ8B 3EFOB 5CD9A 5ALGA 3I28A 2F17A 1YQGA 3ZE6A 4C5CA 1XLWA 1IIBA 3IE1A 1UZMA 3K8OE 4LF4B 1SOAA 3DL0A 1Y5IA 2I87A 4GQIA 4MO2A 3KSUA 4NNJA 4ZQHA 1SCUA 4DT1A 5JWOA 2NUAA 4X0EA 4GWGA 1ZSNA 2R4TA 2XR1A 3QHAA 5B3KA 5BPFA 1SKQA 5F12A 3ROPA 3HU3A 4GOXA 4R2IA 2BLNA 4R3WA 2QM8A 4I5DA 2FX5A 2C4WA 4KBGA 5JXHA 3GLIA 5E6UB 4F2WA 3GMIA 4TS1A 4B0PA 3C41J 2XUDA 4JGBA 4NE7A 4O02B 2OFWA 3RQSA 1HDIA 4UCFA 4D5EA 3AOEA 1V9CA 2HOQA 3E15A 3IP1A 1JDNA 4PYIA 3TQFA 3VZRA 3E0QA 2CLKB 1GZ7A 3PE6A 1QTNA 2VDOB 3Q6NA 3RM3A 2GVNA 4HXGA 4J49A 4KIFA 4GECA 2DC1A 4M86A 2BMAA 4IKEA 4QFMA 3TNDA 1WB5A 3NB0A 4EG4A 5BYKA 4OKIA 3SE0A 3UXEA 3AZOA 1Z39A 3GHHA 4FONA 2C8JA 3COWA 4RAQA 3S0JA 4GZMA 2IDZA 3ZE0B 3LHSA 4CEIA 2VTVA 3L8EA 3I5XA 3TUZC 2Y0DA 4RC9A 2AMVA 4CKYA 5F3RA 4OLBA 4PR3A 3CEHA 3I3SR 3AUTA 2NU7B 1YU6A 3W6ZA 1P4SA 3ZVNA 4DLUA 1PFVA 1DC5A 2HTEA 1VL2A 3FLEA 3LW7A 1PZXA 2HYDA 4JXKA 4JUAA 4OHVA 5BQ3A 2EGUA 3HU5A 5F1PA 4ASUD 2H3EA 3KCNA 4G24A 5H4GA 1BAPA 4LK2A 3CWQA 5HTOA 1GA4A 2OLKA 2V74B 3D2AA 4FLMA 5TARA 4AO6A 2GO1A 1OYOA 1P3JA 5ARCA 1J0AA 3ELDA 2XWPA 1RXSA 1X15A 2HCJB 3TB4A 3TIGA 4P4GA 2C3MA 5IJ0B 1U2TA 1DELA 3GG9A 1HH4A 1ZM9A 4UUOA 2BFBA 3CF2A 4N12A 5FPTA 1HK7A 3BGDA 1YZTA 1DEHA 1AURA 3AVYA 3O82A 3S2FA 1R4AA 1YMVA 2VUTA 3FD8A 3GPCA 2JEZA 5CU7A 1QZZA 1E66A 1PNVA 1UBHS 4P5EA 1TD9A 4BNLA 4NG4A 3VZQA 5BV2P 4HNAA 2PSFA 3OC0A 3ZE7A 3T3DA 1KIAA 2PVPA 3KK0A 3O91A 5DTJA 1Y6GA 2NZJA 5J4VA 2FWRA 5AT1A 1JXMA 3MWDB 3STTA 1RXEA 4UAUA 4I9HA 1DEKA 3PFGA 2JAUA 3KLPX 4LHYA 5IARA 5DHUA 1SHUX 2PAAA 3GD7A 4FTWA 1G7RA 1QCCA 2VSQA 2OBXA 1UDBA 3LHDA 4OGWA 1V96A 1BFKA 1DWPA 1UOPA 1I3KA 4K7JA 4S2EA 5K0CA 1K66A 1KJQA 4B3SB 2ADMA 2ZU6A 3VOAA 1WE2A 3EXHA 4B17A 3BJIC 2FFJA 1KDVA 5AMXA 3GYBA 4MVCA 1RC1A 4QXQA 2CYCA 4XDYA 4DZRA 4MKXA 4P7KA 1JTEA 4HSGA 4N7MA 3IQZA 2WIDA 2I4RA 4I4LA 3B5JA 5A5VA 1JEYA 3SKVA 4XWYA 2NXCA 4PXSA 2QTBA 1C0KA 2PZGA 3FSEA 4KL8S 4TS4A 1XTIA 5B3AA 1E2QA 3TSWA 2R751 4FHFA 4UXHA 1FTSA 4LXUA 2OE2A 4FB5A 1QKIA 5KCZA 4HEHA 4IINA 3PCXA 1TM7E 3GUUA 4KYVA 5FFFA 2HWUA 4R1LA 1K97A 4U1RA 1VKOA 3GVIA 2IEDA 2VHTA 4JFAA 4PZZA 4AP9A 1EVLA 5JQGF 5J2UB 2C82A 1V1MB 3JRXA 3T52A 5EERA 5TB5A 3C6QA 1YI0A 2BZ1A 4X92A 4YV1A 4YUYA 3IIKA 2VRBA 2FGKA 2J41A 4OYHA 3R9IA 3RUAA 3WXMA 1GGVA 3ZBUA 4K40A 3DAYA 2EZUA 3NOVA 4ZVPA 3VR2A 1SUEA 3DV9A 1XWIA 2VUHB 3CY6A 4DAOA 2Z5GA 2O7QA 2X9VA 1WXWA 1KY2A 4J0IA 4L02A 4E32A 4I1UA 4Y2SA 1C1HA 4D99A 4E70A 1REQB 2A35A 3QFTA 3GZTB 4NV3A 4GMHA 1SB9A 1WCYA 4B83A 2WWYA 1I9CA 2WHPB 2VYNA 2Z43A 3FFXA 4UHDA 2P7HA 2Z2JA 5AI0A 5EJ5A 1Q50A 2AQIA 2IXEA 2J7KA 3D3EA 3I42A 2QV7A 3SJCA 1KEKA 3V5NA 1NNI1 2HQRA 4M2LA 1P9WA 2OXCA 3F90A 1U7XA 2XYHA 3F6EX 4Z0TA 5CG1A 2OP1A 2G28A 3B38A 3CX3A 3VKHA 1Q0PA 2OV4A 5DU2A 2WF8A 3B48A 4UU7A 4MEBA 5L6LB 1NXTA 2XNDA 1YS1X 3M4XA 3RO7A 2J32A 1IMOA 2WF7A 4UXJA 2J7PD 1BHSA 3FYUC 3TSOA 4BGEA 3VH4A 1XV5A 1JJ7A 1PFUA 4HQ6A 2LGJA 4HS9A 4JJ8A 4MOWA 5E4FA 4L9RA 1NONA 3WIBA 3OEHA 5IC6A 3OEED 3P27A 3NX4A 3CC8A 1GT91 2X8LA 1TU4A 2GEBA 2XMGA 3AW8A 3JQ7A 5LLDA 3A14A 4ZK6A 1SQSA 2GM3A 1WUTA 5IABA 2E4ZA 3VR0A 3WICA 1YC5A 5JYEA 5IZCA 1NX9A 3SSMA 5IJXA 5DBOA 2QBYB 1DQNA 2XQKA 2B7CA 1TEXA 3MW8A 3ZY5A 1ESNA 4K5QA 2QZSA 5BSWA 4L6CA 2E9SA 2C2MA 3SVLA 2CXQA 2FWNA 1HTTA 1D1QA 4M8LA 3RVOA 3OMXA 4N5LA 2OO5C 5FNZA 3RVLA 4BECA 2V4ZA 3BQMB 3K6SB 1B6TA 2QJFA 5M04A 1NC3A 1OBVA 4U7WA 5E1OA 5I5GA 1TADA 2VJDA 4QRDA 4CM4B 1OXVA 3JQGA 1L7EA 2BCJQ 3PFBA 5KVQA 4EW2A 3AFMA 3PUJA 5CFLA 4KRYA 1IEXA 2UZ1A 5IT9A 2R65A 3G0BA 3SQNA 3TOVA 4MGZR 3KJIA 1LSSA 4RD0A 3U0VA 1Z37A 1QK4A 3NHFA 4YT8A 5BVGA 4CKEB 3AU9A 4KX3A 1NX6A 2WIGA 4N3AA 1EDEA 3PICA 4JQZA 3ILVA 1ORTA 4RVHA 3V8EA 7ADHA 1R5BA 4KP7A 3L7AA 4O2AF 4B44A 1CK4A 1Z45A 1GTMA 3B85A 3H2ZA 5GWXA 1IM2A 4ZZ0A 1B74A 1MXFA 2X2FA 3LVRE 3DF9A 1O8CA 1RBQA 2WD8A 3NUGA 5H1YA 1P18A 5D1NA 3UA3A 1L9KA 4AG5A 2XAUA 4B6SA 5CCEA 1W5BA 1L7QA 4FLFA 3GP3A 2CLMB 4Q4AA 2NVUB 1YUBA 4EYKA 2XPCA 3ITDA 1VQ1A 3CKKA 3MIIA 4HX5A 2VEDA 1FP2A 2BEJA 3EF1A 1P2UA 4W5JA 1NVWQ 1NOKA 3B9QA 4P4LA 4Z51A 3FW1A 4QA9A 3NJ4A 1EQAA 2BHSA 5ILGA 3GQVA 1W30A 1W73A 3IOMA 4MW5A 4UHHA 4EHIA 3TAHA 4AD8A 3ZJTA 4I3HA 5IH3A 1M2KA 4Q16A 4Q66C 1IOWA 3KO8A 4LDZA 5B2EA 5UKDA 2QTNA 5ALOA 3K70D 4ZVOA 1DE0A 1JWBB 1QG2A 4ZI7A 1JI0A 1CBUA 3EXG2 2E4XA 4AK9A 1NAIA 1P17A 4C04A 4ZA2A 2QN7A 2WWHA 4WE3A 1C1DA 1R3DA 1RWQA 4Z7NB 3AU8A 1C3OB 1V7CA 3DFMA 2IF0A 1A5TA 3SYNA 1WMDA 4NATA 2X7XA 2H2AA 3I1YA 4Z3DA 3T99A 3AY3A 3KYDB 1EAMA 1PUIA 1K6EA 3EAQA 3IP9A 2AFIA 3C1OA 2CMDA 1T0BA 4L1KA 1NSYA 4G5XA 3VXKA 3OPYI 2W2NA 1RWMA 1XMIA 2RGXA 2ZSHA 3KHKA 3NR2A 1KE1A 2WMYA 3F67A 3O8BA 4X20A 3N2ZB 5BSFA 2VAPA 3ORRA 2GTIA 2B1QA 1NNLA 3C3AA 3HKEB 2JD0A 3OOYA 4QGGA 3ZWPA 4CL3A 1BVUA 4F06A 1M1UA 4GKJB 1MB4A 1GKKA 1D9ZA 3AP2A 3MJHA 4R5HA 1WMSA 1QTIA 1SAYA 3CSSA 4XTCS 5I4IA 4BFWA 4HK4A 1E60A 4NZ9A 4UM9D 4B76A 2WQ7A 1OGYA 3CYFA 1U02A 5A6SB 3AGPA 1TVEA 2ZYDA 3OZXA 3OZCA 3WHPA 1FDRA 1N0UA 2HMWA 2PGIA 2QG4A 2HJRA 3AHDA 3I1JA 4DMHA 4F9EA 1U2PA 5BP7A 5DHQA 5REQB 4B3IA 1CDOA 5AIBA 3VTFA 2FZLA 1ZEJA 3ANTA 4KI7A 1Y4UA 2IIQA 4L5YA 1AHPA 4Y2YA 4BU0A 1NKTA 1K0FA 1QE5A 3NANA 4EP1A 1A7AA 4MQ6A 4CLRA 4I0WB 2JZNA 4X1KA 4L8LA 2EWMA 5G40A 2XXAA 2V7TA 3R1IA 4QAJA 1Y37A 5AH0A 2P0YA 1SEVA 4AZSA 1P80A 4DNQA 1JHUA 3N2YA 4FCCA 1J2EA 4A73A 4K88A 5JVDF 1WV0A 2VHUA 2QUKA 2A1IA 2QQFA 3A36A 1AQIA 4W1QA 4I8DA 3E9MA 4M87A 2JFXA 4WUTA 4KLZA 1T8YA 1YR2A 2BBWA 2QRJA 4WKGA 3ZTWA 4BASA 1U8CB 2VA9A 1UPXA 2WMOB 4DCJA 5F98A 4UARA 4QG3A 5JH7F 1EWYA 2IXDA 2PMWB 2QRLA 2WYWA 3C3PA 2ZT7A 3G5TA 3R5TA 3TMKA 2BV3A 4DLXA 4C87A 1NUTA 3S8YA 3O0TA 4XZ3A 1UC5B 3PDCA 1PSZA 4H17A 5DM2A 3ZKAA 1IK4A 1ESEA 4AKTA 5LJLA 4ZQFA 2I2WA 1SQGA 3V00A 2Q0QA 3TKYA 2FN8A 3DQQA 3U19A 1BNCA 1WB4A 2PAFA 3ZVMA 3MTJA 3MTDA 4V0OA 3IE2A 2DLCX 3DUWA 3GU3A 4UMEA 4YT5A 2OENG 4D74A 1CCWA 1M0WA 4E2XA 3BICA 2PLRA 4UEQA 3DCIA 4GDMA 3MT7A 1CQIA 4IO1A 1XVVA 3OEWA 2BDEA 1UPFA 4XM1A 3E7WA 1Y5MA 2AZTA 1B6RA 2J5RA 2HA5A 2Q49A 3ZEIA 5E7MA 1YFLA 3Q2KA 3SZMA 1YVRA 5I7UA 1PV2A 2BGKA 4XYGA 3HWSA 4OHWA 5KYWA 2BDUA 2KM1A 3GLTA 3H4VA 3QNWA 2PMCA 4J1QA 4Q1FA 5J4HA 1QQAA 1T29A 2QZZA 4MAMA 1CRQA 5H16A 5L3ZA 3CEAA 3BL6A 3WQSB 4H60A 1ZGHA 4NNPA 3RAPR 3T54A 1B14A 3ZCUA 1V16B 3NS7A 4BNWA 3N7TA 2W9XA 2DCMA 4HDMB 3WP0A 5JTTA 4EF5A 3U7HB 1E5DA 1MJ5A 4HAWA 3Q72A 1L6RA 1NSTA 2GJ9A 2G1JA 2HRDA 1C50A 1XD2A 2VF7A 3F3YA 3OH8A 3PD1A 4JQOA 5H70A 1CZOA 2IYXA 5B2ZA 1DCKA 2Z9CA 1P1FA 4FHCA 4BPRA 4ZYXA 2UKDA 1G3MA 3QKTA 3Q9SA 1QHNA 3NIDB 2BEWA 2HNBA 1G5IA 4I81A 5FUYA 4CQLA 1U1GA 2JA1A 1CLUA 2QNRA 4EWLA 1JJBA 4ZTUB 4IH9A 2B9VA 3AM5A 5JFTA 1KC3A 5EFOA 4B3GA 4HO1X 3A26A 3HDJA 3IP5A 2WWRA 4IP0A 1OFUX 1K88A 1M34E 1Y9AA 2H0QA 2Y0BA 3RUDA 5B1EA 2W71A 4JL6A 3SQLA 1R88A 3QPBA 4JHLA 1GJRA 2ETXA 2PX8A 2NXJA 1NMYA 3O4HA 4R1QA 2VZEA 2VI5A 4G0VA 3DHWC 1ZJJA 3QG1A 4CIYA 2R8XA 2GLXA 3MXTA 2NV2B 2ATEA 1ISFA 4XIFA 2Q2QA 2XADA 1R66A 1XRRA 3UANA 2WKRA 4H7KA 4YT4A 1ZINA 3IEUA 3L04A 2RI6A 1IIRA 1QQBA 1XWFA 5F9FA 1BEEA 5DVZA 1BU5A 5FBLB 3HP1A 1XTVA 3TINA 2YY5A 4KIGA 4CT0A 5JADA 2XCSB 2WBLC 1UJNA 1OFVA 3UV6A 4C7OA 5EZ5A 1Y8ZA 1AK9A 4RTQA 5CB8A 2V7XA 2AE2A 1N77A 5ERXA 2EF0A 2PV7A 2C7RA 1VYUA 3U3MA 4WOPA 2O2IA 3NCTA 4PX2A 2QVZX 1XLUA 2IA5A 1IHYA 3LWNA 4GMFA 4MCIA 2OCBA 3UF0A 5BOSA 4UHEA 3LTNC 3GLGB 1PGNA 1U0EA 4OHKA 1FYVA 3CJQA 3EFEA 3A11A 2NUPA 4I19A 4C5AA 4E5DA 3F6YA 4FXPA 4CF7A 2B7LA 1JEDA 4Q39A 2I54A 4LUCA 4Y9SA 5D85A 4QPCA 2AOWA 3UWSA 4F84A 3DTVB 1X9GA 1M83A 4ZGWA 3KQHA 3MZ0A 1CB0A 2QORA 1C81A 2R6DA 1T3LA 1UMBB 2MSNA 3JD2A 4D4JA 5CVEA 2IDMA 3LPAA 5A5GA 5K0TA 1UFVA 1JDJA 3E7XA 3D6MA 2YQ4A 3T3GA 1QV6A 2AJLI 2ZKIA 3CSDA 3LOUA 3RRZA 5KZMB 1YO6A 3KVYA 1KSHA 2IYPA 3IEPA 3IP6A 4HNSA 1NRWA 3MQ2A 3IUEA 2AUNA 4LXQA 2GTPA 3BKWA 5SYNA 1LI5A 1EVIA 2J48A 3TLGB 5A5EA 1Z13A 4WZAE 3NVKI 3L4SO 3Q10A 1QG0A 4UBOA 3HUFA 1RXWA 3LQ4A 1FK8A 1KOJA 5IULC 3AHJA 5F2NA 1AZSC 4KVZA 4CKWB 2GEKA 3F7NA 4C4PA 1SHKA 3P9ZA 1W47A 1T2NA 5HUHA 4W99A 2BTQA 1ZI8A 1ZH8A 3GDFA 4G0XA 4GMDA 1SPXA 1P5FA 1BGWA 3G9ZA 3KEFA 4GNRA 4M1WA 4AFNA 1U8AA 2CUKA 2CMFA 1URPA 2XIQA 3MTIA 4CV2A 4OGLA 1Z82A 1QHIA 4M8NE 1QJCA 4EYSA 1X42A 4HAUA 4RK7A 3RYFA 3SLGA 3ZK9A 3TIIA 3PNQA 3JQBC 4CL8A 2Q3MA 3F1LA 5DM4A 2M6KA 3DH0A 3D0KA 4AZTA 3JAKA 1ULSA 2A9KA 4F11A 4ZI2A 3SMQA 2FJ0A 2W6CX 2BFWA 5KQRA 4H1UA 1ILEA 4MWEA 2P3LA 4ZKEA 1UADA 5AI4A 2M9MA 1SFRA 5TQ0A 3BVPA 3B8EA 2PXXA 4KVAA 2QPOA 2DBZA 2NNWB 3OD1A 3QNUA 4GZ5A 5E0OA 3RRYA 4B43A 4CCYA 4F4DA 5AM4A 1QP7A 1H6DA 3UT5A 4WESA 5EUBA 5HOEA 2V7BA 4AJNA 3HJHA 5HDBB 3W5SA 4LXXA 2HK9A 4ARZB 3PVZA 1Q1QA 1QWOA 5ADUS 3EVDA 1VGVA 4PEVA 1UK8A 1TQ8A 1U6JA 2GS9A 4QARA 3RASA 2AUTA 5KWJA 1CZKA 3ZWOA 1NW5A 1B43A 3JZFA 1TEVA 3COPA 5ALTA 1QPBA 4RMNA 3FKJA 4NARA 3E3OA 1ZN2A 3I0NA 3WQQA 3JAMA 1PT5A 3MRXA 3II6X 1SQFA 3KYIB 5A5FA 1Q6ZA 3EIFA 3T5BA 5DGCA 5LA6A 5JXGA 4ZHQA 4J3JA 4MUXA 1NNSA 1NMQA 2ZB7A 3QWFA 3GRKA 1P9NA 4G25A 1RHKA 4GPAA 3V6MA 5BNZA 2G3YA 3F9IA 2OHJA 4RMGA 4KAXA 2C3UA 2RE8A 3HA7A 3QP9A 4CG1A 3HR8A 3IT3A 1NWHA 1C1XB 1GRNA 4BNFA 4WBNB 4YMUA 4TZ6A 2F3SA 2IKSA 2X0JA 1J42A 4L76A 2J08A 3FPCA 4B71A 4HB2A 1UK7A 2GWHA 1K2VN 3WLPA 4ER7A 4IIVA 4MQLA 2G8NA 4JLOA 4JMLA 3ZWBA 1ZOLA 2WTAA 1IWBB 4UNRA 2WP0A 4NMHA 2XA9A 5JD4A 1Z6AA 3DA8A 1WX1A 2Q5JA 1R4NB 2HHAA 3H2KA 4ON9A 1GCGA 2H17A 2J7PA 3STHA 5T3YA 1C4XA 2Y77A 4AAYA 4F5EA 5FOSA 2ZBVA 1IAQA 4R98A 4YJDA 3VVCA 4ED9A 2VLBA 3M6AA 5FDFA 3D8NA 1E3IA 3EB9A 1ZD8A 3QPUA 5DCWA 3UUEA 3ZX4A 1S8NA 3DO8A 3G79A 4BUZA 1EPUA 1A98A 3OEEA 4EMUA 3D81A 2WP8J 1Q21A 2RHWA 1PV4A 2ZSUA 1G6KA 2BPOA 4LS3A 2X3YA 4AKHA 3U49A 1QHXA 1AGNA 4FVTA 5FPKA 2PGXA 3I6ZA 3RQIA 3H04A 1NRXA 3OT1A 4GP6A 2LKDA 3NIBA 4HLCA 3W5UA 4D9MA 4CV3A 2GKOA 3LP5A 1NI4B 1RRKA 4MWTA 5TMDA 1SBZA 3STYA 2FUG1 4DG9A 1UT5A 4ZRNA 3G2IA 1L1FA 4RE5A 2H1LA 4M8IA 1M8KA 4F56A 4KQXA 2IKQA 1UKEA 3F6SA 2QMQA 4RHUA 5F21A 4UVHA 1OI7A 1E6KA 1PJ8A 2JGLA 2VHXA 4XQGA 1RXCA 1UKVY 2IGTA 1R27A 3KAPA 4Y67A 4YPOA 3WK4A 3EY4A 3ZNNA 4EYOA 2XYGA 3IAS1 2Z2YA 1E20A 1F5NA 2PRJA 3UTDA 2EQBA 4N3NA 4QD3A 4TLDA 4U7JA 4DXHA 1OR8A 1T1SA 4EY5A 2GPNA 4MDYA 4Z4GA 4MW4A 4H7EA 5KYNA 5L6MB 2QRNA 4JBLA 5CGZA 1JBKA 1Y8QA 5A2GA 1MMFB 1GZUA 1Y98A 1ZIOA 3U26A 1QF7A 1P1KA 1JVBA 4NJMA 3Q5DA 4R0MA 1RAFA 1QO7A 4NBWA 1KJNA 1OA1A 4DLTA 2EDCA 2H1HA 3PQCA 2UVQA 4XE5A 4KV7A 4EO4A 3W8NA 1O8BA 1ZKMA 4J43A 2NPOA 2REBA 3LAWA 5CFQA 3O7WA 5FBVB 2PUAA 1H94A 2NU9B 3EBPA 4M89A 1RKBA 4DXAA 1A9PA 5JS8A 2ICAA 2GJ8A 1OWMA 1DPFA 1GCOA 4XX0A 1KZYC 5ALKA 5IDXA