3DLIA

Crystal structure of a sam dependent methyltransferase from archaeoglobus fulgidus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
221
structure length
221
Chain Sequence
DYYFLFEEKFRGSRELVKARLRRYIPYFKGCRRVLDIGCGRGEFLELCKEEGIESIGVDINEDMIKFCEGKFNVVKSDAIEYLKSLPDKYLDGVMISHFVEHLDPERLFELLSLCYSKMKYSSYIVIESPNPTSLYSLINFYIDPTHKKPVHPETLKFILEYLGFRDVKIEFFEECEELTKLAKIDSNTVSEEVIRVINENIEKLNRILFGPQDYAIIAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a SAM dependent methyltransferase from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
molecule keywords methyltransferase
total genus 71
structure length 221
sequence length 221
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dliA00
4E32A 3JWHA 4FS8A 5P8WA 4R6WA 4GC5A 3LCVB 3AJDA 3LKDA 3P2KA 4GC9A 5FQNA 5DM2A 4PIMA 3DP7A 5FWAA 3HCBA 1KYZA 1YZ3A 1VQ1A 3LBYA 5EMMA 2AN4A 1L3BA 3FTCA 1TW3A 1R8YA 3OZTA 4HC4A 5FUBA 2OXTA 3BT7A 1O54A 3ELUA 5BP7A 1R6AA 3I53A 2EFJA 5LQCA 2QYOA 2VP3A 2IDKA 4ISCA 3H2BA 3EVGA 3Q87B 1F38A 5K0GA 1SKMA 3DH0A 3G89A 3FRHA 2BR5A 3NWBA 3FPJA 2AOUA 1YFJA 5F2KA 5HFJA 4CXMA 3KR2A 1FJXA 4BLWA 1SVUA 2R6ZA 3GDHA 3OZRA 2XBMA 4YUZA 4ER3A 3PVCA 1N7JA 2BR3A 5EIWA 2IFTA 3M6XA 4ER7A 5KQSA 2NP7A 1ZQ9A 1R00A 1UWVA 3HVHA 5EIFA 2UYHA 1XCLA 4CTJA 2FK7A 3KHKA 3GRYA 1JG2A 2F8LA 4DMGA 3VC1A 3MTIA 2EJTA 3OU7A 1X19A 5CCBA 3RIEA 2JG3A 1NW3A 1WY7A 3GJYA 5K05A 2B2CA 2ERCA 3EGEA 1QAOA 4FT4A 1EAMA 4YUYA 4FZVA 4HSGA 2I9KA 3DLIA 3EGIA 3C0KA 3AXSA 1G8SA 4LECA 2P3OA 4P7GA 4BP3A 2UYCA 1JTFA 2C7RA 2JH8A 5ICGA 3TM4A 1SQGA 4AX8A 3THSA 3ID6C 3FYDA 4KWCA 3M6WA 3C3YA 2BR4A 4AZTA 5LQUA 1WS6A 1Z3CA 5EEGA 5GP1A 2PGXA 5C0OE 3UJ8A 2C7QA 1YFLA 2PSSA 2ZIFA 3KQYA 2ZZNA 5E9QA 2P41A 5DRYA 2HWKA 4OA5A 4YUVA 4CWAA 5BW5A 2Z6UA 3KQWA 4X61A 4GOLD 3FUWA 1KXZA 2CMHA 3CCFA 3SSNA 4E30A 4PGGA 3FRIA 3P2IA 3FPHA 3UJAA 3R6TA 1IXKA 4ER0A 1QAMA 2NNWB 1ORIA 4IWNA 1G38A 1JQ3A 4E2YA 4RTQA 4RTMA 1JSZA 1L1EA 5HIIA 3HTXA 5GM1A 3QOWA 3JWIA 2H00A 1JQDA 1EG2A 2P40A 4X63A 4XUCA 5DX8A 3I9FA 5FQOA 4DKJA 1SG9A 5K0BA 1MJFA 3AWIA 3JWGA 3LX6A 2JHAA 3NTVA 5MHTA 4GF5A 4AZVA 2NYUA 3B5IA 4XUDA 3KQPA 3R24A 4QQKA 1WXWA 1BC5A 2ZULA 2ZIEA 3EMDA 1L3CA 2AOTB 1YB2A 2GLUA 2IH5A 4HG2A 3FPGA 2AN5A 1XXLA 3LKZA 3G2QA 1V39A 2GA9A 3DXZA 3OFJA 3ANXA 3P8ZA 2Z6QA 2QM3A 2XYVA 1O9HA 3B89A 3LECA 3BWYA 3CJRA 5BW4A 5K0CA 3OZSA 5GINE 5DTQA 2B9EA 2CL5A 3BKWA 3UJ9A 1XCJA 1I4WA 3MQ2A 5DM0A 3KPWA 4R8SA 3UWPA 4KIFA 4POOA 5CVJA 3B3JA 4RTLA 4QVGA 1QANA 1XJ5A 3A7DA 2NP6A 4AZWA 3PT9A 1KIAA 4B17A 5FADA 3FUXA 3OFKA 5DXAA 1NW6A 2IP2A 5EMJA 3KPVA 2P7IA 4DF3A 1VPTA 5FA5A 1X1BA 1PJZA 1RJGA 1AF7A 2A14A 2JHCA 3QV2A 3G2PA 3BWCA 5DTRA 5DX1A 2PX4A 1AV6A 5GIOE 3C6MA 4CKBA 3KPYA 4R6XA 3UJDA 3HCEA 3BKXA 3HP7A 2IBTA 1RI2A 3IYLW 5LQKA 2P3QA 1FBNA 3ER9A 5FHQA 3U81A 5DT2A 4PYQA 5FA8A 3TM5A 4GQBA 4AUKA 4LWOA 5E1OA 3ELYA 4KVZA 4MWZA 3ORHA 5CVVA 2AOXA 5JR3A 2XYRA 2OO3A 2YTZA 3KR9A 1N2XA 3MGGA 2ZBQA 1SUSA 3B7PA 4C03A 2AN3A 2R3SA 5EQJB 3F4KA 1L3IA 1EIZA 4R8RA 2AOTA 2V74B 3HA5A 2ZVJA 2GAFA 2QRVB 3IEIA 4ER5A 5BXYA 2E5WA 4ER6A 3DMHA 2OPBA 3HVIA 2PX2A 2QE6A 4IV0A 3TFWA 2YX1A 1YF3A 5LQAA 3PTAA 3ERCA 5K0LA 3I5UA 1L9KA 4RTPA 2O06A 5HILA 3FUUA 1F3LA 5M5BA 4HRAA 4L7VA 1N7IA 2HTEA 3BGDA 2ZZKA 4PONA 4KRGA 4X41A 5LQRA 3FTDA 2ZBPA 3JWJA 3P2EA 5EG5A 3CKKA 3MCTA 3E05A 3NDJA 3A27A 3O4FA 5EHGA 1SQFA 3UA4A 2G8NA 3UA3A 1QYRA 2O57A 2P3LA 5DRTA 5FCDA 2FYTA 3DLCA 3IV6A 3E8SA 5GWXA 5K8VA 2C7OA 3C6KA 5FULA 1KHHA 3KQSA 3V97A 3M33A 4PIPA 4R05A 3C3PA 2YR0A 4RTSA 3EVEA 1AQIA 4QTTB 5K09A 4OA8A 4QDJA 2ZLBA 5CCXA 4JXJA 2GB4A 3KQVA 5EMLA 3G5TA 3VSEA 3PFHA 4G56A 3LDGA 1BHJA 3UZUA 2VDUE 1BKYA 1DUSA 2Q41A 1I9GA 4PYMA 4C08A 4DZRA 3PX2A 3TRKA 1R74A 5D1NA 1X1AA 5EMKA 3TKYA 3KU1A 3RW9A 3L8DA 1JTEA 2P1DA 2BZGA 5DXJA 3LSTA 3HA3A 4FT2A 2XVMA 3DTNA 4FSDA 2ORED 5ERGB 3KQMA 1P91A 2IH4A 3O7WA 2OB2A 3OU6A 2P7HA 5GM2A 3M70A 5K0EA 4OX9Y 3BGIA 3EPPA 4M7RA 3MB5A 5CUQA 5EHIA 3UBTA 4BY9E 3FUVA 4DA4A 3PLAE 4P7FA 3OE5A 4P58A 4V0QA 4YMGA 3FPEA 1FP1D 1I1NA 5DLYA 1VP9A 1KP9A 2ZWVA 3B3GA 2YXEA 2H1RA 3DOUA 3GCZA 3E23A 3X0DA 5LQNA 4EMSA 5E1BA 4OQEA 2AVDA 2WA1A 2HMYB 3QOXA 2GPYA 1ZGAA 3FTEA 2B78A 1JSXA 2KW5A 5IKMA 3ER8A 1MHTA 1HMYA 2ZWAA 4E33A 3P9KA 4HTFB 5E1DA 1XDZA 3NMUF 1ZGJA 3DMGA 5LR6A 5HIMA 2AOVA 2ZIGA 1NW5A 3EGVA 3A4TA 3NWEA 5IH3A 4RYLA 2VDVE 3HM2A 4MTLA 4FGZA 3T7RA 3TKAA 2PV0A 1XDUA 3SX0A 1X1CA 1P39A 4HGYA 3TLJA 1VE3A 4X1OA 3OU2A 2FHPA 2PT6A 5C1IA 5E2BA 2JJQA 5EZSA 4PYLA 2IBSA 2BH2A 3THRA 4FP9A 3IHTA 4RVFA 4RX1A 3GRRA 2PWPA 5HIKA 3A7EA 3G5LA 1G55A 2PWYA 5EPEA 3MERA 2FK8A 5B1SA 4M38A 4PYOA 1UFKA 4DCGA 3FPFA 1ZHFA 1YZHA 5C9ZA 1RI1A 5T67A 3SMQA 4EK9A 3EEOA 1G60A 5K03A 3I64A 1DL5A 2VZ9A 2C7PA 3P9CA 4C06A 2JHPA 2ESRA 4GEKA 4RTOA 2YXLA 5KYGA 3M6VA 5T64A 1PRYA 3HCFA 1B42A 2CWWA 1RI4A 4MIKA 3GIWA 2BM9A 3UJ6A 3UFBA 2EJUA 3GO4A 4PCAA 3G7UA 4HTFA 2BM8A 4DM3A 2IDJA 1VP3A 2CMGA 3GU3A 2B25A 2PT9A 2O07A 3FZGA 4NECA 4FR0A 4A6DA 4KDRA 1OR8A 3EVBA 5EKUA 2OZVA 2PVCA 4C4AA 3HCCA 3KQOA 3SSMA 3B3FA 2PX5A 3NVKI 3HCAA 4E2ZA 1RI3A 5EZQA 1IM8A 4XUEA 4Z2YA 3EVDA 4QPNA 3KPJA 5LQJA 1NW7A 3T0IA 4RTNA 5E1MA 4RTKA 3KQQA 2AVNA 1XVAA 4M36A 1ORHA 4YMHA 4EQZA 2GS9A 1P1CA 5E8RA 2QRVA 2NXJA 3HNRA 1P1BA 2OYRA 2I62A 4KW7A 2CKDA 4KDCA 3R9XB 3BXOA 2O0LA 5HZMA 2AOUB 5DM1A 4E70A 1BOOA 3ME5A 3LL7A 2OB1A 1JG1A 2VDWA 4ZTBA 1NBIA 2I7CA 2K4MA 5DSXA 3BZBA 3DULA 4E2XA 5GIPE 4GUAA 4WXHA 5CVEA 3MHTA 1IY9A 3SXJA 4F84A 2JH9A 1INLA 2I6GA 2ZW9A 3CJQA 8MHTA 4C04A 4QDKA 5DX0A 1VBFA 2PLWA 4AZSA 3OCJA 5K01A 2IH2A 2ZCJA 3FYCA 1G6Q1 2P8JA 4YUXA 2PJDA 2WA2A 4RVDA 4IKPA 4HGZA 1R18A 4O29A 3CVOA 3MAGA 4YV0A 5D1HA 3OE4A 4QPPA 2G72A 3REOA 1M6YA 2GH1A 1Q0SA 2AR0A 5U4XA 3KR0A 1ZG3A 3S68A 2IGTA 3LCUA 3K0BA 3P9NA 4H0NA 4QVKA 1NBHA 1KPHA 2YUIA 4QQNA 1EQAA 5FWDA 3T7SA 3TPZA 2PKWA 3HVJA 2OKCA 1WXXA 3UJBA 3P97A 2P35A 3BWBA 1G8AA 3Q7EA 3TMAA 5K0FA 4PYNA 4YV1A 3PX3A 1XTPA 3HVKA 1EJ0A 1NE2A 2EX4A 1HNNA 2HNKA 4FSXA 1NKVA 3GGDA 4PCLA 5T6BA 4PNEA 1NT2A 2Z6AA 5HOQA 2Y1WA 4RTRA 1XDSA 3SSOA 1DCTA 2G1PA 1VIDA 3M4XA 3SGLA 3P9IA 4C05A 7MHTA 3BGVA 1QZZA 5K0NA 3E7PA 3LHDA 3G8AA 4X60A 5DWQA 5E9WA 3RODA 2UYQA 3UJ7A 5EEHA 2B3TA 2OBFA 3G8BA 4Y2HA 1T43A 4GOOD 2AS0A 4XCXA 3P71T 3HA7A 3BWMA 4WVLA 1H1DA 3SM3A 1D2HA 3DMFA 3I58A 2ZTHA 2VS1A 1X1DA 5K0JA 1WZNA 3HEMA 4E31A 4RVHA 1SUIA 3KKZA 2G71A 3D2LA 3NW9A 3EEYA 4F85A 3VYWA 2ZSUA 2WK1A 3DXXA 1UIRA 2Y1XA 2NXEA 3PS9A 1FPQA 2XYQA 4LG1A 4YV2A 5E9JA 5KVAA 4K6MA 3MCZA 5CM2Z 5ICFA 5DM4A 3WSTA 3G2MA 1KPGA 4M37A 3G88A 3BUSA 3SR4A 4EKIA 2HR1A 3GNLA 3DXYA 1M0EA 3GRVA 2LD4A 1NV9A 4RV9A 4MQ4A 1TPYA 4U7TB 3NJRA 2FRXA 2NXCA 2N47A 3R0QA 3V8VA 4C07A 3DUWA 4PGHA 4RVGA 5E8JA 1ZKDA 5CIYA 9MHTA 1VL5A 1KPIA 1KYWA 2G70A 2PXAA 2YQZA 5CVDA 1QAQA 2UYOA 3DR5A 1KR5A 2EG5A 3GRZA 3K6RA 3LPMA 5E2AA 3A25A 5EC8A 2YXDA 3LDFA 4P7JA 1JQEA 3HCDA 3KR1A 5FHRA 1R8XA 3CC8A 4ATNA 4BLUA 1Y8CA 3MTEA 2H11A 4CTKA 3AY0A 3PB3A 2PY6A 4OBWA 2AOWA 2HV9A 2PBFA 4P7KA 3EMBA 4PINA 1O9GA 2XVAA 4RSRA 5EGSA 3LCCA 3TQSA 4EKGA 4KIGA 3TOSA 2IIPA 5LSAA 2V7EA 2ZZMA 4GOND 1RJDA 1YUBA 5EVJA 5HIJA 3OPNA 1JR4A 3VC2A 4BP1A 5HEKA 2FCAA 4PYKA 5F2OA 4UOEA 1VLMA 5FTWA 2UZ4A 3A26A 2FPOA 3CGGA 3LGAA 2PXCA 4OQDA 4PWYA 3UJCA 3FUTA 4RTJA 3GXOA 2IPXA 4RWZA 5CVUA 3EVAA 4IV8A 4Y30A 5EKXA 4QTUB 5G02A 4EVIA 3CJTA 5KQRA 1D2GA 5DSTA 3NVMB 4MHTA 4GOMD 3FTFA 1NV8A 2OY0A 4YUWA 4DCMA 1Q0TA 1TW2A 4V0RA 5DPMA 4U7PB 3NDIA 4BLVA 5CD1A 3ELDA 1M6EX 2PXXA 1WG8A 2ONYA 3R3HA 1U2ZA 2PX8A 4CKCA 5F2NA 3EVZA 1RI5A 4HH4A 1AQJA 1FP2A 5ICCA 3SVZA 4E2WA 3T7TA 3LBFA 4OBXA 3O31A 4PYJA 3GRUA 5EOVA 4F86A 1JG4A 2NXNA 4A6EA 4LWPA 3EVCA 2ONZA 1D2CA 10MHA 3KPUA 5GOZA 4PYIA 2ADMA 1RJEA 5H02A 4GBED 1RJFA 5ICEA 5JUWA 3KQTA 5DTMA 3EVFA 2ZFUA 3TR6A 2O05A 1NW8A 2AZTA 2DULA 4CKEA 2QY6A 2YVLA 1JG3A 3CBGA 3M6UA 3AXTA 1EJ6A 3LDUA 3PFGA 2DPMA 4DQ0A 5KS2A 3GWZA 3ELWA 2ZBRA 3G2OA
chains in the Genus database with same CATH superfamily
3QVLA 2WNHA 3B5JA 1GZ4A 1XZEA 2L19A 4PM4A 5F73A 1FY2A 4EJMA 3ZIDA 3DLHA 5KJEA 1IBLB 1CDZA 1U0EA 4LISA 3A14A 4JEHA 4PPQA 5SY4A 5D86A 1M1XB 1VQ1A 4Y1RB 4Y7CA 3WYDA 4BC1A 4IJQA 4OUDA 4MYTA 1K5GA 3I3OA 1Z2DA 2I91A 2FNAA 2WU3A 1TX4B 3MINA 4BAGA 2BTOA 1SUFA 1E18A 5JAUA 4YWJA 3CT6A 4Q4CA 5ELLA 1BYIA 3ESQA 1I33A 3A2NA 3FTEA 3U09A 2VUHB 4DAEA 4KXFB 1G8PA 4YFVA 4EDHA 1JSCA 3W78A 4D42A 1AU9A 1Q0HA 3ZOKA 2JARA 2ZKIA 1HT3A 4MUEA 3ZVMA 3TZCA 4MKXA 4RXMA 3EPRA 5A02A 3D6HA 4Q7MB 4ER3A 4RK0A 5K99A 2W0MA 3R76A 1QHSA 2I29A 3CKYA 5FUXA 1OYVA 1GKKA 3R6GA 3TFQA 2BL4A 1GL9B 4C6TA 4YP5A 1JG2A 1TA0A 4KGVA 4B7UA 3M4YA 4MW5A 1TYCA 2WKSA 4JQZA 2G76A 1HEYA 4K3UA 1GQYA 3RV3A 2QP3A 4F3NA 1QH1A 2ZB8A 4DCOA 4UBJA 4ZZ3A 4NPHA 5CCBA 2J0EA 4H18A 4Y9UA 5IXJA 3D6MA 2ERCA 3Q12A 4FT4A 3M3DA 2AJBA 3OEHA 3TW0A 3VO1A 3WVNA 4EG0A 2IQIA 1YR2A 1B0ZA 1LBQA 3CMCO 3L7JA 1QQ7A 5KVQA 3VHRA 621PA 5DW0A 3IAXA 3TM4A 4PBSA 1JR2A 3D7KA 2J09A 2LPMA 4NU8X 2NG1A 1D4ZA 3NBQA 5D84A 5FOUA 4TXMA 1OZ0A 2C82A 3D6UA 3PDWA 1HWYA 1Z25A 5FP0A 4B71A 3VX3A 5KYYB 1SOWA 2WSSA 4EG3A 1R8JA 4G37A 2J1LA 3PITA 1W8IA 4FJ1A 3SHWA 1MV5A 3D2CA 1NMQA 3BL8A 2Q4BA 4LMPA 3UYKA 4RIFA 1S3GA 2CHUA 4QFMA 1E9AA 4FI3C 4ER0A 3L0BA 3U3KA 4KITB 2HHHB 1NR1A 4IJWA 3HKEA 3HYRA 4IWNA 4CRWB 3FPAA 2WWXA 4I1PA 5JSUA 1D7AA 1YBVA 4FMCF 4F4IA 1JSZA 5HIIA 2IITA 2A84A 3AR4A 4EF4A 4TM7A 1IJFA 2QJRA 3VKVA 1ZN9A 2R1ZA 4RKYA 3C24A 4MKZA 3T1VA 2JFWA 3ZGYA 1C9YA 3E58A 2OE2A 2YNMD 3EHEA 4UHDA 5KU1A 1DJQA 3WRVA 2XUAA 4C4RA 3AUFA 1H2YA 1R6DA 3MTQA 5JFOA 4L0QA 5BOVA 1ZC4A 3WSWA 2XUDA 3C7KA 4HDKA 1EA5A 4HADA 1TUEA 1ULHA 4FN4A 1L4YA 1VHDA 3L7AA 4U7JA 1RE1A 1Y8QB 3UHPA 3KOUA 1TIBA 2PRYA 3KM0A 4BRUA 1FTWA 2NO6A 3E3LA 4G65A 3OESA 4KSYA 2BHTA 1Y5RA 2GA9A 3DXZA 3MWLA 2TMYA 2C9ZA 2B2XA 3QNWA 3K9FC 1NBWB 1VA5A 5CCDA 5GINE 5TF0A 1Y7IA 3SX2A 2Z2KA 1SU6A 3QEMA 5BWLA 1KQGA 5DYWA 2XB8A 1IUKA 4QQRA 2FWPA 2IE8A 2OXCA 2JIBA 1BWSA 3WAGA 3GMTA 2PGDA 2VF2A 1JAXA 3SZOA 1E1CB 2C1XA 2GPJA 3H5LA 3O47A 4GL4A 2QEQA 1DAFA 4B17A 5AVVA 1JB1A 1CW2B 3PNOA 4FZ3A 1LZKA 4LMAA 2CLOB 4JVLA 2VRCA 1GQRA 5LD2C 1PJZA 1RJGA 3LQ1A 3UUFA 2GX6A 2ZDHA 3HJCA 3JQAA 4AT1A 1OKKD 2O2SA 3PUVA 3NNSA 3VX4A 4D4IA 3IDFA 4ND2A 4EJ6A 1ZJJA 2W48A 5J3JA 5DBOA 1N0VC 1GZSA 2R00A 3OTHA 1LC3A 3BS4A 3NEYA 3IYLW 3FG9A 1QHEA 1RJWA 3EAFA 4Y6RA 3QPBA 2QXTA 2ZPUA 1WW2A 4UFPA 3TM5A 4A8JB 4JKYA 4HXGA 4KX3A 1XNGA 1J0XO 2DFLA 4M76B 1LTQA 1U2DC 4E15A 2XGJA 2OO3A 3GLVA 3TK1A 3T3NA 1XLUA 5H80A 4EFMA 3RUEA 2QF7A 4BHTA 4EG6A 1PI3A 1EHYA 3ZWVA 2HPVA 4RABA 1F7UA 3CLUD 2HY7A 3AKYA 4M53A 4ZAVA 3KZCA 2HV8A 1YQQA 3P9XA 3FJYA 1P62B 4QWMA 5EYPA 1CNFA 2BHRA 3QK7A 1GRNA 4BX2A 1ZM3A 1QB8A 3SPXA 5LQAA 1P5JA 4G4GA 2G6TA 4NCHA 4C0LA 5HE8A 3LCMA 1UP7A 3QXSA 1BCRB 3ECAA 3AHHA 3FNGA 1RE0A 1GZ6A 5TB5A 4ZI2A 5CDTA 4HRAA 3NIWA 3LPLA 4YQEA 3ZV7A 4LY3A 1ACLA 4GMXA 1P4GA 2ENWA 3FTDA 1TMOA 2PXHA 5IKOA 3DMTC 5D3ZA 2FRDC 4QHTA 4HWGA 4N9WA 1NP3A 3I2FA 1CP2A 1XO1A 1P5RA 4H59A 4HATA 4J4BA 1SY7A 1A9YA 2Q45A 4JWKA 4QGAA 3R7LA 2BZ1A 4D41A 2X2PA 3ACBA 4LBWA 1M2NA 3PRKE 3H2GA 4Z54A 1KDPA 2HA0A 1FLDA 1JIQA 1DRVA 1FYDA 2P4UA 3AZQA 4XAQA 3G59A 5DFAA 4R71A 4KFCA 1A76A 1MO5A 1P9RA 2GN4A 1Z5UA 3CUYA 3TZQA 2CCKA 4KV9A 5CCXA 4F9TA 1RBZA 3DBOB 3GJQA 5F35A 3VPHA 3EFOA 4D5EA 1A71A 2HSEA 1Z63A 4BQEA 3OAAD 3RRMA 1TZMA 4BNTA 1LUAA 1JJAA 3F5SA 2PUCA 1DCMA 1Q2XA 3FM9A 5BSVA 1RZUA 1X0VA 3DE6X 1K63A 3QVOA 2PR2A 3KZNA 4PTYA 1E8MA 2H5IA 5D1NA 1OASA 3AM5A 3C3WA 3OCCA 4Q1FA 5AOCA 4V1CB 2R4UA 4Q3BA 3MG9A 4XWAA 4JYMA 3JPWA 4EAAA 1YA8A 2PUDA 3RUPA 1ZGCA 4P35A 3M70A 4YONB 1POXA 1RM5A 4FFBA 2DU8A 4MPTA 1XTVA 1OPRA 4Y6OA 1XK6A 3RPEA 4MDEA 3G2NA 1MOQA 4ZMRA 2W6QA 1SCJA 3C8DA 3E9YA 3F6PA 3KEOA 5L4LA 4JI2B 3H87A 3SHVA 4BJ1A 3QVMA 3TQRA 1WF6A 2X3FA 3FFBA 1UC4B 1CJUC 2ZWVA 3ZHBA 3OM9A 3QU2A 2CXTA 2W11A 5E1BA 3IVCA 1KBQA 3D4PA 2BT4A 1E1LA 4G23A 2ZRKA 4IJ5A 3P96A 1PBNA 2XAAA 1P4RA 3H2HA 4G1UC 3FFWA 4WNIA 4X7RA 3VSAA 2Q3LA 1L4UA 3CA8A 2B78A 5SY9A 1T0UA 4JCCA 2RH5A 2H1IA 5JCJA 1HMYA 4QLBA 1N75A 2IOYA 2ZWAA 3KUDA 3RKSA 4IX9A 2O3TA 3C41J 5LR6A 2XQVA 1DBWA 1MGPA 5LKRA 1B8UA 1QVVA 3COPA 1PV1A 5EGNA 3EPJA 3JD2A 3PFWO 4HDRA 5KAMA 4MTLA 3RCBA 4KR2A 1PWYE 2XCTB 4GGPA 5CT8A 2P3SA 1QCDA 3KEQA 4EJ2A 4AJPA 4K9NA 3MELA 2DKNA 3UAYA 2HH9A 3DL2A 4M60A 2G9ZA 3F2IA 1UBTS 2XUHA 2QZZA 1XGKA 1EXWA 3DNMA 3O0DA 5AUQA 1MT3A 1LRLA 3SNKA 4PLTA 1JU4A 4UUBA 5E4TA 4P2BA 6ABPA 3K6JA 1J1ZA 3EN0A 2B1QA 1U9IA 3GD7A 2DQZA 2PG3A 3O8BA 4F2HA 1F4PA 2IYRA 2VNHA 3QXJA 1A9XB 1RPAA 3AFIA 3X1YA 4KRYA 2ZJ7A 1S4QA 1OROA 3FHLA 4KYUA 4M21A 4LZJA 4XIJA 2QBYA 2JK0A 1FRVA 2C1ZA 4LDRA 5EQFA 4EK9A 1NJGA 1OFUA 1UDXA 2GSWA 1EWKA 2CFIA 2KYRA 2P4EA 3TB4A 3TQIA 3WMEA 4BAZA 5AW4A 1UXJA 5ALPA 3H2ZA 2PS0A 2DP4E 3AG6A 3KHUA 2MCFA 4B0OA 1ZK4A 3IAS1 3C6XA 2NO5A 1CX9B 3L1VA 5LA6A 5P21A 1DBVO 2VNJA 4QXQA 3ZHCA 4M6WB 5DDIP 1U5CA 4CL0A 1OH5A 2VSNA 1W5TA 3B6EA 5JH7A 1H5UA 4LJKA 2WTMA 3OE1A 4HO1X 2INGX 2PVCA 3EUWA 5MF6A 1NY6A 3QG1A 3AKEA 3U9SA 3RV4A 5CJJA 4HXYA 5HS6A 4HQOA 4CVNA 3NBKA 2PSFA 4P84A 5L53A 1S3IA 1NJ8A 2XF8A 2ZWIA 3SYNA 1SO8A 5JJCA 4F04A 3QFCA 4I6GA 3UGJA 4ZYTA 5A3JA 4AMUA 3W2EA 1P0IA 3QBEA 5GONB 1UH5A 1X74A 1R3UA 1VDMA 2ZRIA 2QV7A 3C5VA 4G97A 1V35A 3OA0A 5E8RA 4BQQA 2CJPA 2X9GA 4HZUB 3DHWC 1RD4A 3CPHA 1LPMA 1O77A 2HMTA 3FSRA 4M0CA 1QH9A 4PFSA 2IVFA 3CH5A 3NHYA 3RT7A 2Q9BA 4CM4B 4ZO6A 4PSKA 1FFAA 1UPCA 4R9UC 3DZJA 3HE3A 4ZVLA 4EFLA 1E3MA 1EG7A 3OG9A 3PYMA 3SXJA 1N9ZA 1OVMA 3OQIA 4LXTA 4EHJA 2VJCA 1CZNA 1DX9A 3DBLA 4HH0A 5AW0A 3CNOA 1KDTA 1P6UA 3R2JA 3T54A 1TMKA 3IVRA 3NPMA 3U61B 2C9CA 3MAAC 3BFPA 1JKFA 1XRJA 3NV9A 3R7DA 3BZWA 3TOXA 3TEMA 1K98A 4QT4A 1CTQA 1R4NB 2IJGX 3Q9NA 4JYBA 1GZDA 4XQ9A 3B1KA 1QFSA 3F49S 4NTZA 4PAOA 2VWPA 3T9FA 4B6JA 2VSXA 1L7DA 2WJ4A 3RC7A 5G41A 4ROTA 4RTOA 1GTG1 1M2FA 3IQGX 3KXPA 2OR3A 2IXEA 4JT8A 5EZYA 3EGXB 1KPHA 5J63A 1GGJA 1P2TA 2IZ0A 5AKGA 1RMTA 4WY5A 1QMPA 4WXEA 1XEWX 2BH9A 2OVBA 2R8OA 1PWHA 4YFYA 4AMYA 5CDGA 3C15C 1KJZA 3OX2A 3PV0A 2FSIA 1E3QA 1PU2A 5EXSA 3SKVA 2O4UX 2WMYA 4G25A 5EWLB 2JVJA 3TJZA 3K09C 4BDSA 5JYCA 3PL1A 1HNNA 1Z73A 3LUBA 3R5SA 3JW8A 4GWKA 4PNEA 1OX4B 1YD7A 3OQNA 1VL2A 1IZ0A 1QG0A 2Y1WA 3H1BA 3I0NA 3ZVKA 2HHAA 2PRIA 4YC7A 1H4TA 1QCCA 1II8A 5HDBB 4JBGA 4WLVA 4PRLA 1GCOA 5TF4A 1NLMA 2G1PA 4QGHA 1LKZA 3KLPX 2QGZA 3ST7A 4G0WA 1F9AA 2EKZA 3OLVA 4H7PA 1O9BA 1L5SA 3GBPA 2FP4A 2UKDA 4NCJA 4W9NC 2W70A 4FEYA 5A0FA 4EQ6A 4FMPA 2FEWB 2QG9A 2WU0A 1H66A 1PR6A 3ICOA 4KFSA 4NAHA 4BWVA 1GTVA 5BN3A 4UVIA 1JQAA 3CRW1 1SIBE 4RXUA 1V45E 2H4FA 1VSTA 2HIMA 2PAFA 4I1SA 4MYDA 3ICWA 3KP1A 1ZI8A 3HDGA 5A6SA 1AE1A 2J6CA 4KQMA 2CUNA 5FDFA 1YAHA 4LA4A 4MKGA 1IUPA 1NXTA 2AX4A 3EUEA 4U6SA 4RE5A 1TJNA 4PFQA 4U2FA 4XLZA 2GQ0A 1WE2A 4RULA 2YVUA 1JAZA 1ZONA 2C78A 3PF8A 4F5ZA 1KAOA 2R7AA 4ENRA 1GZ3A 3T34A 4DQDA 3SJBA 4UCFA 3ISJA 5ALWA 3Q8WA 2PH3A 4Q1EA 3G88A 5LYJB 3PL5A 4NH4A 4N7RA 2O7NA 1KEEB 5B4TA 1QTRA 1M1UA 2Q2QA 4ND1A 4MQ4A 4QYXA 3R09A 1NI4B 4ITVA 4WXRA 5JWOA 1PEDA 4HX9A 5E8JA 5H59A 4B3JA 1ZKDA 2C0QA 1TFRA 1DEAA 1YZVA 4QX6A 2YQZA 3HJRA 4OATA 4TUYF 2Q4EA 4A7PA 3NYIA 5F4ZA 5B36A 1LPOA 2C3UA 1ZK1A 3LRPA 4KXUA 3T7IA 2IS1A 3NG1A 1K3TA 4BE7B 2AMJA 4RANA 4QEKA 2ZSKA 3EMBA 5AHWA 5LZ7A 3S40A 2WM9B 1UK9A 4RHCA 4XSVA 3GA0A 4F3RA 1R4ZA 3GRKA 4KIGA 4DARA 3RVNA 5AUPB 3QE4A 3WGJA 5BYJA 5I5GA 3FPKA 4HPWA 2RK6A 4R8VA 4XQ0A 4Z51A 2M2IA 3KK0A 4PYKA 5KTOA 5KYUA 3VPGA 2FPOA 1SVLA 4NAUA 3R5KA 1ISHA 3DHVA 4LXXA 4PG4A 4WFQA 3AR7A 4BFUA 1Z12A 2B1IA 1Z06A 2ZBDA 4WLUA 2H85A 4LV8B 4LGYA 3WWEA 1M6WA 3PK0A 1L8OA 3I9V6 1WVMA 3KWJA 2AFHE 5E6SB 3HJFA 1LQUA 3SZMA 3T5AA 1T1IA 2ECQA 3QLUC 4EA8A 1VIMA 3PHJA 3IDOA 2IYNA 4JJIA 1OA1A 1R6UA 4OJKA 4YAWA 1NXOA 1NQXA 1N25A 1RQ7A 1Q0TA 3LQKA 1L5GB 1AO3A 2HO5A 3LCRA 2PXXA 4N54A 1P4HA 1HTTA 3WX0A 1M34B 1PP4A 4ZK6A 1A8UA 1U2ZA 4ARZB 4NSNA 3UWDA 2BKUA 4FHDA 2FDXA 4H7IA 3LBFA 4OBXA 1KC1A 2RI1A 2VRCD 4YAJA 3P9ZA 1DUVG 3LMKA 3ZIAD 2W9XA 5CDSA 4GFDA 2FVXA 1U0BB 2YOGA 1D03A 3JSAA 1VG0B 2AT1A 2X9QA 1CULC 3O5AA 4URXR 3EBOA 2F7SA 5DTMA 2XMQA 3ZD9A 3GGCA 1M1YE 2CHVA 1NW8A 3B9BA 3K4HA 4GM1A 1E1QD 1ZGGA 2V5AA 2HC9A 2QDKA 3U31A 2VTKA 1KVRA 1YQDA 3O8CA 1UJ2A 3FLAA 4H35A 2YHUA 2I4LA 1FQWA 1DIHA 2ECOA 3TL3A 3ZH2A 3RYIA 2FN3A 1USIA 2WWTA 3JWHA 4DLBA 1NZFA 4LHEA 4IH9A 3QYJA 2VQSA 4YECA 4I5DA 5JATA 1J0EA 3EEBA 3ZWCA 4D80A 4F46A 4PIMA 3DP7A 4I81A 3TF5A 1RRPA 2WFAA 1M1YA 3JYHA 1DMSA 3O21A 4IHJB 3UO8B 3Q3VA 1XLVA 1XKXA 2H1WA 2YMLA 4IVRA 1QK4A 2M9MA 3H9BA 4ZZ2A 5JZMA 1CYDA 1GLVA 4N65A 4O4IB 4HAIA 3HFRA 3PNPA 4H31A 1EVEA 2KHZA 4Q4AB 3W5HA 3ZJYA 4UMFA 2BF7A 1XXHB 2B5VA 5EWMB 4CHTA 3ZZ1A 4G36A 2JJ8A 3D2BA 3N53A 3SE7A 5FPQA 4B6RA 3OZFA 1YVDA 4COKA 2VSQA 2JC3A 4OHKA 3CF4A 2IYSA 3TVYA 1QZTA 3M3PA 4UXJA 2C31A 1JH9A 4R1QA 2CHQA 2R6JA 3NTOA 4GX2A 1CJKC 5EJ5A 4I9GA 4P3OA 3NWJA 1J2TA 1C3OB 1Z68A 5B7PA 4CCAA 1TQ2A 1NW3A 1OX5A 2H9IA 3KZMA 3OT4A 1PK9A 3ZCQA 4P5DA 3L79A 2VRBA 3LBNA 3OI7A 2P2ZA 4FI3F 4EW6A 3UT5B 1Y8RB 3D3WA 4CLOB 2Q4RA 1KY4A 3AG5A 4KDEA 5ICGA 4FDTA 3ID6C 4U1RA 2EKQA 2V9PA 1FPMA 1BQ4A 4B2PA 1NTOA 2EV9A 1D2MA 1MQAA 3LUJA 3GJSA 4MIYA 3VPCA 3ZNQA 4DMCA 2OCIA 1E9EA 3MTBA 1CUDA 2OUIA 5IC4A 4I50F 5BMVA 2WEKA 4GKJB 4KYTA 2DUWA 3EAGA 2VUUA 3OTQA 2QTRA 2VEOA 1KXZA 3BIOA 3OEED 6NULA 3O1JC 4MRNA 3GPLA 4CLOA 4ALIA 5I7EA 2OORA 2J4FA 2Z4SA 4QFCA 3IOCA 3IE2A 3PSHA 2EHDA 3KZKA 1KZGB 5LFAA 1HT0A 4WESB 4KLCA 3L7DA 1I3KA 4NICA 3PDUA 1G38A 2W2KA 3VAYA 4JOSA 2H1SA 2HJWA 5AIBA 3UGQA 3GGGA 3HTXA 2IS2A 2GK6A 3SG0A 4BMSA 4HNAB 2FOXA 3AF5A 1MJFA 3INYA 3DBRA 3JWGA 1MQ9A 4LNHA 1HYBA 2ANCA 3FSEA 5FI3A 4XYLA 2UVPB 3RSLA 4JI7B 4M1KA 5D8DA 4BZXA 3I8SA 5AK5A 1N6PA 1L3CA 2GPWA 4MEJA 1W4LA 3HZZA 3WC4A 4EKDA 3GZTB 1H2HA 3B36A 4MS3A 3SLKA 3TX2A 1HH4A 2GPSA 4MYHA 4YV7A 4ND4A 1FX0A 1Y1TA 4R69A 5CYPA 1VJRA 2O8DA 3ZY6A 2HJHA 1O9HA 2P78A 5ISMA 3VRHA 5K3DA 4YO8A 3UJ9A 2H29A 3BDIA 5BV1A 4FZJA 4KIFA 3HY6A 1T3GA 1QANA 1QP0A 1F20A 2ASVA 2H18A 1C9MA 3GUYA 1YFJA 1R0SA 3MQ4A 4WD3A 3PT9A 1AS0A 1AS2A 2CFTA 1ZXLA 1AN9A 4JR1A 4LTNA 5GZ6A 4H1WA 3C3EA 3ADPA 2D1QA 2QYHA 5WRFA 1VPDA 5GV8A 1GLNA 4G0YA 4Q03A 4S0ZA 3GEEA 5FPPA 1D8TA 4YHBA 3TEJA 2ARKA 1W48A 1UT8A 1VI5A 1WLYA 5K8UA 4U2EA 4JP1A 1AV6A 4NCIA 1W30A 3OWOA 2CMFA 3C5EA 4I2NA 1TM3E 4XGKA 5DEOA 5EWLA 4P3NA 3H6GA 1Y9DA 1KIFA 4PYQA 1PJAA 4GH5A 3CNBA 3S5UA 5C53B 3JTEA 2KPOA 3CSDA 3HFSA 1IMJA 2PRZA 4UXHA 4MDHA 2VDWB 2CXOA 1XRPA 1PGOA 2CBXA 3I8OA 1WP9A 3HB5X 4CL2A 3F8TA 1TZCA 2AN3A 4HDKB 2XGOA 3OFNA 2QYTA 3K70D 2NZ2A 1VCHA 4XDYA 2QRVB 4LDPA 2RHLA 3L2OB 3X3HA 2NPOA 4GQAA 2ISSD 2R6AA 3W8RA 3FHTA 1CP3A 1TUBB 1ECPA 4IGAA 5A7HA 4FK8A 5FOQA 4EKNB 4PO9A 3LYUA 2J9FA 3TOVA 5H5JA 3WTBA 3AI7A 3RRZA 2CNNA 3FF4A 1KE2A 3K8ZA 4H0FA 4L7VA 5DBGA 3HKDB 3UAZA 1X38A 2NU8B 1ZSNA 5K0SA 3JZMA 2VIIA 2GDJA 3HO1A 3C14C 2J6BA 3A27A 3FVTA 5LLSA 1LPBB 3QPCA 5KKAA 3ZXXA 5D6NA 2AFIE 3DMNA 3QE2A 1AMUA 3QSYA 2QD5A 2X15A 4HFNA 4W5QA 2PX6A 4NXMB 3A4YA 1WETA 3QP9A 2V3VA 3TIFA 3QA3E 1PZXA 1UBSB 5L3SB 1Z0SA 2JCGA 5IKPA 4RTSA 1T6ZA 1PZMA 4D81A 2XNJA 4ZANA 2QTAA 3FYUB 4I4TA 3K9QO 3E61A 3SHFA 3GJXC 4BEWA 1OFHA 4IH4A 2BP7B 3KALA 1KOGA 1YJ8A 6LDHA 4AZ0B 4LRTB 4W5WA 3WGKA 2WYUA 4FFRA 5C31A 1YRWA 2HKIA 4OAQA 2EDCA 2F3UA 3ZWWA 2XNDA 1C7IA 1RRVA 4DUZB 2G5TA 3LVFO 4O2BB 5TPWB 3J81k 4D2IA 4E5UA 2ZI6A 3IP9A 2ATCA 4NFYA 3AEQA 2DPLA 2O0KA 1GVHA 3IP6A 4JOQA 2XRZA 2ORED 1TK3A 4XYGA 3N2GB 4LJAA 4MQ6A 1OC2A 2R47A 4J3NA 3U3RA 1A1VA 3MB5A 5CUQA 2HSZA 3AP3A 4U4AA 5DCLA 1EZZA 3PUZA 4M9SA 4AP6A 5BW8A 4DY4A 3RS5A 3PHIA 4JOBA 4MYRA 4ZHQB 5LDHA 4ERXA 1P31A 1LQTA 4WOKA 3QE9Y 4RNDB 3LF1A 3DMRA 2WSSD 4R1MA 4RA9A 4E13A 5JEEA 2QBYB 4Q6BA 2YDYA 2D5AA 3MMSA 3L4EA 3ICEA 3SI7A 4EMSA 5KYNA 2B69A 3VC7A 3VO8A 1DO2A 1M34E 3QKSB 4H60A 4ESEA 1NT4A 4Z5XA 1ZGZA 1JLLB 3BMOB 3G23A 3UMGA 3RS8A 3RNLA 4E33A 3EXAA 4EFDA 2PH7A 2POCA 2QTLA 3LH5A 3ECCA 5DF1A 3NWEA 2IY8A 4S05A 4PZ9A 1CDOA 5H82A 3TKAA 3WLRA 3EGDB 5LNK6 2Y4OA 2XLCA 5GZ1A 2FF5A 4D9HA 1YVUA 2EGHA 4ALKA 1GFIA 4IH1A 1GKUB 3EZYA 2GFQA 2ZU0C 2PT6A 3S8YA 3QQPA 4BQRA 1W73A 1YKGA 5CM8B 3SC2B 1VXRA 3Q6IA 1Q92A 4Q3NA 2BH2A 3LQ4A 4JKIA 5TY0A 1ZEMA 1NC3A 3ZZNA 2UUCB 1UJBA 2FPGA 4NZMA 3KT3A 2HA4A 1KVQA 5MFZA 4ZD6A 1MH9A 4KE7A 5AHKA 4OIMA 4UCXA 2X0IA 4PYOA 3PQEA 1X2BA 2JRCA 3FPFA 2HLDD 1GARA 3FA2A 2X41A 5AYVA 5JE8A 3TLGA 5B6JA 1UXIA 4M1MA 1C9EA 3HVUA 3WL4A 2W8BB 1M33A 3GLSA 2H7VA 3ROZA 1TB4A 2GBLC 3DPIA 3AFGA 4OP1A 1QO7A 2YXLA 1UBGA 5TGDA 5KQLA 1P0QA 3TJMA 2JLXA 2RGNA 4JT4A 4Q4JB 4BMNA 5B55A 2I71A 2XEDA 7REQB 1ZJZA 4JCOA 3BTOA 3R3SA 1U7TA 4HDSA 3G7UA 4MWBA 2VHJA 5F77A 3OZGA 1E1YA 1U5BB 4RQUA 3NYQA 3W8NA 4QUJA 2BEKA 3CZMA 3ZKWA 3BILA 4P32A 2B82A 2X9NA 3VOSA 3RC3A 1BO6A 2I6SA 3DTVB 1MX1A 1RIFA 1DQNA 4LNAA 3U0VA 3K8QA 3ZE8A 3TRIA 4AY2A 1O7JA 4JLMA 2GN6A 5MN4A 4KQXA 4LI0A 4CI0B 5U9CA 5IAJA 1WV0A 4C3OB 4FCVA 1W6UA 2MIIA 1LSOA 3AINA 4ZVNA 5LMZA 3E9MA 3BE4A 3BHIA 4UM9B 1CERA 3WIDA 1EESA 3IO3A 2IUEA 2VJMB 3AEXA 1V5EA 1JEYB 4EVSA 3UTCA 1JVNA 2C83A 2FF7A 3LIIA 1SXJB 4ZQIA 3ZLVA 1LPAB 1X42A 4X54A 4OKIA 1FTSA 3TW8B 1PV2A 1F14A 4I19A 3MD0A 3X2FA 3ZDZB 4UDXX 1J39A 1EK0A 4Q3AA 4R2LA 1XYVA 3K5IA 2OB1A 2XTJA 2ZXFA 2A1IA 3WLLA 1ISSA 2FN8A 3FPBA 1FS6A 1T2UA 3SQMA 3TLYA 2GCOA 1ZVKA 2X8LA 4M1QA 4WXHA 4XA8A 5DKFA 2WY2D 5JSZB 2RGXA 4EY5A 4C21A 5JXWA 4HAXA 5G4KA 3SZ3A 3T3PB 3ZGXA 1DC3A 1A8QA 4QPJC 1U8AA 1Y5NA 2QTCA 1YMUA 3ZKAA 3KEGA 3KEFA 3VNVA 2KBEA 3OCJA 4FHEA 3REQA 3OKFA 1T5TA 1A5AB 3NVDA 1CQZA 2O1SA 2XNDD 4YCAA 1EM8B 1DRKA 2X2EA 3MAGA 5KHAA 4KNYA 2E48A 6YASA 3D0QA 1D0SA 4Q3DA 4A82A 2QAGA 5D01A 5FLEX 1MAHA 1USGA 1NBHA 1WSAA 1Z4IA 2CHFA 2FN4A 2RHMA 2RKOA 4P92A 3HNOA 5FOWA 3GBSA 4PZLA 2PCJA 4Q7JB 5BSWA 5FAKA 5A1JA 3QOFA 1EFCA 1CHNA 2LCIA 1ZN2A 5C37A 2G1AA 4PYNA 1KS2A 4CR6A 3PC2A 2ODWA 4ECEA 1DG1G 5HRCA 4FSXA 1T29A 5FV4A 5HP4A 5BRNA 3HB4X 2GAJA 1P2BA 1VLVA 4EYOA 4WCFB 3DVRX 2XLBA 3RC2A 3VYRB 1J33A 1U2GA 1TEZA 4BQFA 1UT6A 1OOEA 1UMDA 1AQ6A 3P9IA 4JUDX 4OAPA 4X65B 5KU7A 3T94A 3SBEA 4WNYA 4A1OA 1YXMA 3LC0A 1XDDA 4IDBA 1W5AA 2BFEB 3FTPA 1A96A 4ERNA 4GOOD 1QYWA 2D5LA 1AGXA 2PX0A 3ADOA 4C5BA 5IKXA 1V71A 3Q7SA 3QVSA 2GBCA 3PFBA 3DMFA 3WGUA 5K0JA 1KL7A 4M8IA 1Y80A 1SUIA 2FE1A 4C5CA 3HV2A 1HLDA 5KKNB 2RONA 2D2IA 3GW8A 4J29A 3ND6A 1E2HA 1I1QB 1NUTA 2ZJ3A 5JECA 1FUKA 2HU8A 4G07A 1PJSA 1RHJA 3B1ZA 4OJYA 1SG0A 2A1TS 1Z9BA 4FKZA 6REQA 1LF5A 4MGZR 1YRQA 3DSRA 2I8AA 2YVKA 2QLNA 2C9BA 3K2EA 3KKKA 1G63A 3M7IA 4IQFA 4JLKA 4O2RA 4R40A 2X0RA 4URVR 3BUSA 3K9BA 3E48A 3UANA 5B1HA 4BGIA 1SVNA 3UW3A 3LT0A 2W2XA 1NV9A 3P9RA 5AR1A 3DTTA 2JLYA 1J21A 3EG9A 4NL4H 4ID3A 3UCXA 4C7KA 1ABFA 2OILA 2XEXA 3LQRA 2WAYA 3I1FA 4QUAA 5I01A 4D25A 4EGCB 2G70A 1WPQA 2G1JA 3AF3A 4K6KA 2K5UA 1MIOB 4N0MA 2IGBA 5LOVA 2EG5A 5FUVA 4CE6A 1DAKA 4M9QA 5CNIA 1R0RE 2QGNA 3CC8A 1Y8CA 1DG3A 2WUGA 3D6NB 1KDVA 3T5TA 4RD3A 4BNHA 1FMLA 5CW2A 4D8UA 1L7NA 1X70A 2H4ZA 3PPYA 5JLAA 1YIDA 2B4KA 1L5QA 3N70A 1ZJYA 3Q7PA 4G85A 5KWEA 2R86A 1T4GA 1Q1ZA 4XRRA 4C29A 1UP4A 2YMPA 4NMXB 1VPWA 1PD0A 2WIAA 3DWEX 5F2OA 1ISIA 1P3JA 5FF9A 7MDHA 3JQPA 3LOQA 3QH4A 3QRWA 4E0BA 3I3SR 3MS4A 1MBZA 3GCGA 1T9CA 3KB2A 3ADKA 4KGZA 1NOKA 4PCVA 4Y30A 5COAA 3CLKA 4LZZA 3VI4B 4DC9A 3CJTA 1T6YA 4LKOA 4RE6A 4TLDA 4DJAA 2BE7A 4NZ9A 3C5HA 4ZCMA 2FUG6 4KE8A 4F2DA 3TTUA 5CH3A 5U1PA 1PJQA 3JQGA 3GMDA 4B09A 3S1SA 1AXEA 2HA5A 3ELDA 2ZTVA 1WG8A 2VYQA 4QUDA 1ECCA 1RVDA 1W7AA 1M83A 1EGVB 3MPOA 4FOLA 1XDWA 3CB2A 3EC2A 3H17A 4LRXA 2FSPA 2CL0X 2EFYA 3OCXA 1WIWA 3QPVA 4UBLA 5L6MB 3AOEC 1S1CA 3L0YA 3NOOA 2C2XA 1JG4A 2H2GA 2PUVA 4PSAA 4KVGA 3NETA 4Z7OB 3FWKA 1A5ZA 5JOQA 1DXHA 3L93A 3WE7A 5GOZA 2HTFA 4RPJA 1OWOA 2Z83A 3MYYA 5ICEA 3TBFA 4XCVA 4YRTA 4YRJA 3HNPA 4MB6A 3CBGA 3NFYA 4C6SA 1MR3F 3AKZA 1Z0ZA 5HKAA 2IYOA 2HLNA 2VH2A 5K20A 4QOSA 2XQFA 4H08A 4OXIA 4URYR 1NKTA 4FS8A 4CIDA 1YONA 2XZOA 4LGCA 4RVUA 4CTNA 5LLTA 1D0VA 3T15A 3NBFA 1PBTA 2DLNA 4L75A 4XB2A 2JIMA 3HCBA 2ZRBA 1LA2A 2Y1EA 4RZ3A 1HL3A 1K6EA 5KJFA 2ZIWB 2PQ6A 3GJTA 5EWMA 4KPEC 4J49A 1K8YB 4EYKA 2JLZA 3MBKA 4ZAZA 2J5KA 2GZMA 3JD0A 1NFQA 1G4HA 5ALSA 3W6NA 1DDGA 1ESEA 4NYMQ 2JGJA 4O5AA 2GLTA 2CYAA 4ANFA 2BR5A 2MYNA 4K8OA 4JJ8A 4RY0A 2YIJA 3U80A 1O3YA 4C0HA 1H4QA 2X22A 2DYKA 2OENG 3MOIA 3NANA 3OZRA 3KJXA 2B83A 1D4AA 2Q3BA 5DK4A 1U1FA 1BKDR 5BOSA 3G2IA 2Q3MA 4ER7A 2J3DA 4BMZA 1UF9A 4DXDA 2I7VA 1UPAA 1SNYA 3E9DA 5KYXA 1Y5MA 4MGKR 1CU1A 1ZA1A 1V9SA 2JFHA 4L4YA 1Z0AA 1GKLA 1RHRA 1UFVA 1Z7EA 2FZ5A 2VC2B 2PAAA 1JHXA 3RIEA 3IERA 2TYSB 2Y77A 3O4VA 3PUKA 4JA2A 4M9RA 5KMGA 3OTIA 3F5QA 1JAYA 1RBMA 1QAOA 1EAMA 4NESA 4BLOA 3B2QA 4HSGA 3HJHA 4CEIA 1DZIA 4N49A 1J70A 2CEKA 4RD4A 4Q9DA 4V39A 4ACAA 1XTIA 3FFTA 2BBTA 3BXHA 4G9EA 1JTFA 4D3SA 4OHVA 2ZRDA 2QVGA 3OZ7A 1W5FA 1KMIY 1AKNA 5HKKD 1I4OA 3CLTD 4C87A 3PRJA 3LBAA 4OU4A 3LY8A 2CDCA 4Y2JA 1UKYA 4X1YB 2P41A 3VR5A 5K3FB 3ZD7A 2XNKA 3IIKA 3LZ6A 2IU6A 2VTEA 4ZDIA 6REQB 2WW8A 2CNLA 3MOGA 4LCJA 4X61A 1MFPA 3M6FA 1J2EA 3CCFA 4JELA 3U5TA 1ZAYA 4TSFD 4UREA 1PN3A 4PO1A 2QUZA 4P36A 5E4JA 2H1OA 3MMNA 3UHAA 1ONOA 3MHPA 4P4TA 4XWKA 4XIFA 1JPNA 3PTLA 4KC0A 2OV2A 2AN1A 2PQ0A 4E2YA 4XZ3A 2ACVA 2FV8A 3NH6A 2YFKA 2X5KO 2AXPA 2C2YA 2QMOA 3KKLA 2H00A 1JQDA 2JAWA 1KZ1A 2P40A 3QOWA 4XUCA 1K66A 5K0BA 3W0LB 2QAIA 3RR2A 1XQXA 1TYBE 4RAOA 2SCUB 4JVSB 4Y6QA 2XYPA 4NOJA 1YE5A 3A32A 1OHHD 1PNOA 2NYUA 4IOMA 1LB1B 4I99A 3QUQA 3R24A 3ZXIA 4LW8A 1NBME 1YOBA 1AURA 5EE0A 2B30A 2IT1A 3MF4A 1BQ3A 4GICA 2IEZA 3ZJUA 2AJCA 4JQYA 1EEXB 5LOVB 1T0IA 1IBCA 1V39A 3ABSB 2P27A 2OHJA 1KRXA 2Z6QA 3BTSA 5CA0B 3B89A 1UZAA 3C1AA 1UQTA 3MCAA 4DV3B 1SR8A 4O25A 1KVUA 3EG9B 5AK4A 4FHFA 1YBAA 3M4ZA 3V4ZA 3IAM1 4CQNA 1SELA 4WERA 4EPXA 1RC8A 1JIUA 2QZJA 1ODJA 2PQ2A 3F9CA 3EOZA 3I76A 3OPMA 3V46A 1WM1A 4EGSA 1Z29A 5EHXA 5HCNA 4KBYA 2O3RA 1AXGA 2F48A 3E82A 5AI8A 3CBQA 3ZGNA 2RAUA 1CDEA 2JBAA 2WKWA 1GT91 1YVEI 4FDMA 1F51E 3KPVA 4WI1A 5ALYA 3VMMA 4NCXA 1QK5A 2ACEA 3ZXUB 2MR6A 2W00A 3QMWA 3QV2A 5ES3A 4ENVA 2XW6A 3DB1A 5EFOA 2NVUB 1H2BA 1RPZA 1Z8NA 4B4VA 3TSAA 5LQKA 1E7SA 1PHRA 2OZPA 3H2IA 1VGQA 4DCSA 5JVDF 2PL1A 3G8YA 1OU0A 4UPVA 1DV1A 2C3OA 2NO0A 4P3YA 1IWPB 3ELYA 3KS9A 4AJ1A 3KVVA 5K2MA 2YTZA 3PRYA 1FEZA 4R7ZA 5KTRA 3EVNA 3ROPA 5F12A 4ESOA 3H04A 3I28A 5DYTA 2GEVA 4BCCA 4WA8A 1DXOA 3RAPR 3ZHTA 2HSWA 4DDVA 1T36B 3KJZA 3D31A 1I1OA 2BEJA 1TFUA 5CAEB 3BRSA 1PVVA 1QGUA 1KYYA 2WD7A 4UTZA 1ULZA 3RSZA 1EDOA 4WBNB 1H9AA 2FOIA 2VAPA 1E2KA 3BWDD 4QTZA 5E6UB 4BCBA 3U7FB 4DJEC 2J5QA 2O5CA 1F17A 2XWPA 2F90A 4JJ7A 4A6PA 3I5UA 2BMJA 3GDWA 4BMCA 2P65A 2CLFB 3VM6A 2O06A 3L6BA 3HK2A 1E63A 3DV9A 5CFOA 4MUKA 4OHCA 1D8AA 2OOKA 4II2A 4KXVA 2DC1A 2DTEA 4GI2A 3WISA 3VHXA 1H23A 1BCSB 2WJGA 5LQRA 4HV4A 3LGXA 3COJA 1J7JA 4PQGA 3CKKA 4D92A 4DLUA 4JLVA 3S0JA 2EYQA 2WP0A 3MRVA 2FXVA 1GPJA 1X7GA 4N5DA 3UA4A 3AVTA 1QHNA 3G17A 3GVPA 3QNUA 4A8JC 2V7XA 4IGEA 2FMXA 1VBNA 4NYJR 3IQZA 2IU3A 3MIZA 3C6KA 4HDSB 5CLLA 1O94D 1LX7A 3A37A 4F4JA 2B8WA 3OCUA 3RBVA 3WOHA 1W4ZA 4DC0A 3NDRA 2O2EA 2FZVA 3CNQS 2C94A 1EWRA 3MS2A 3KJHA 1XTQA 2ZLBA 5HXAA 1PWXA 3UV3A 2BKXA 1T2EA 3LNTA 3AM1A 4MROA 5D7BA 3VAZA 1RCTE 4Q9JA 2P5SA 3PEYA 2FW1A 2RCYA 2I1LA 2IYZA 2JFUA 3HXPA 3UZUA 2XKBA 4NMLA 1XA3A 1WTAA 3MOSA 4Y9RA 1PJCA 1TK2A 4AD8A 4AKTA 1YR3A 4YCNA 1I2AA 2HWYA 4JROA 4R9NA 2VHCA 1XD2A 1X1AA 3EWSA 3HP4A 2XE6A 3GT0A 1OGIA 2WHPA 2XTAA 5CX1B 3WLOA 5A4AA 3RFUA 1QE3A 2HRRA 2WAAA 4L8GA 2IH4A 1W75A 1XTTA 3O7WA 5D85A 5BOSB 1UDBA 1WDKA 3DKVA 2X8JA 4EHNA 5AW6A 4AY3A 4OLBA 1YVRA 1KSGA 3I2JA 5CBKA 2R84A 1QSGA 3LOPA 2CFCA 1QU2A 1KGDA 1NGSA 3FMOB 2PO7A 5DIFA 2WFZA 5AVRA 5KTKA 4ZV7A 1KJWA 2KI5A 3GCZA 4PVCA 1EFAA 3R5HA 4YJFA 1ZOSA 2OLJA 3E7WA 1P0PA 3X0DA 1UBKS 4PG8A 4TZ0A 3OM1A 3N05A 2I1QA 3GP8A 1DTWB 3E4DA 1TPZA 5KDDA 1WUKS 1EFPA 1YB6A 2GM9A 1NQWA 1E2PA 2E37A 1NG9A 4G1FA 4IDCA 5JH7B 3LPDA 5IW8A 1RRMA 2JLCA 3QHAA 2UAGA 4WAUA 5IJWA 3T61A 4YO7A 2HPAA 3M1LA 4KKXB 4UEWA 1KE1A 1VIAA 2AOVA 2W6JA 2OXEA 1B8PA 5JTUA 3PNYA 4DUGD 2WIBA 2Y6VA 2ZI7A 2XT6A 3BFJA 3PR1A 3SX0A 3L8ZA 4K6OA 3VZCA 1XMQB 3QMMA 4IUBS 3ROGA 1KH3A 1PS9A 2W0SA 4MGYR 4MUGA 2AJLI 4P9NA 5BW6B 3DL0A 4U6NA 1QZ3A 4CW7A 4J4TA 3QKRB 1JXAA 1RR6A 3GH3A 4PYLA 2CCJA 5LIRA 5A3SA 1ZVQA 2CV2A 1XFDA 1JWBB 1X1RA 3TMKA 2TECE 1P80A 1ISGA 1Y9ZA 2XAUA 3ETNA 3G5LA 5DI3B 4LF4B 2Z5GA 3I2YX 1K6IA 5B1SA 4YCBA 3V5NA 2O54A 1FMTA 5KDOA 1M8PA 2B4YA 4B87A 4QUBA 4TPKA 2YUTA 1RI1A 3M5DA 3D3EA 1V96A 1NIPA 3I64A 3O2JA 1M10A 1M1NA 2EKBA 2VHQA 4UTRA 5LWHA 2EVWX 3ZY4A 3ZWQA 5C35A 3TR5A 1RHQA 5EVCA 1XEFA 1XK7A 2FEAA 4F4FA 1UFRA 2PGAA 3ZHVA 4H3SA 1W93A 1VP3A 1KRWA 4R1TA 4IDOA 5I7FA 1K06A 3GUHA 2C00A 3SN6A 4A6DA 5FORA 1GZUA 4XD7D 2ZXUA 1C7EA 4JC4A 1ADCA 1V2HE 3WXBA 4FS3A 5L95A 2EOAA 4QLAA 3SSMA 4BU1A 2Q0QA 3Q7IA 3HGQA 4YTEA 1HUQA 5HM8A 4NQRA 5CPFA 3BRQA 5JCOC 4XJXA 3VTAA 3JQQA 2XXJA 4PZPA 3GVXA 1PL6A 2BE9A 2C20A 3ZU6A 5DGCA 1YI0A 4R0NA 2JVIA 3DMYA 1PL0A 4MUNA 4TV8F 4FD2A 3ED1A 4KQJA 1N6HA 3ROFA 2DWUA 3T5CA 4EJSB 2O2IA 2MOKA 4Q7KA 2DB3A 2I62A 4KDCA 4M7WA 4ARIA 2QLJA 4W9MC 2AOUB 5DM1A 3MTGA 2D2VA 5KBYA 3FNRA 2QG4A 1DQZA 1HOTA 1NBIA 3CZ4A 1M6HA 3EISA 3GG2A 4CLHA 3ENVA 3NS7A 2IHJA 3WGTA 1EK2A 2C4UA 3GUCA 4MJXA 4RM2A 4C7OA 3E3AA 1PG0A 3THOA 5JBQA 2C5FA 4AG3A 3RLFA 4DANA 4EIWA 2IUYA 2XT0A 3K05A 3Q41A 4B2LA 1SQ5A 3LLCA 2A6PA 4W5OA 1KJNA 3ASVA 3I9V1 3GLHB 2ID8A 4INAA 4OXNA 2PJDA 4YRLA 4ZOLA 3U40A 1UL1X 2ZT8A 3RFCA 3USZA 3RQIA 3CF6R 3LGSA 5D1HA 5TNXA 4YV0A 1SURA 2IW3A 3S68A 1IMOA 1D4FA 5ALFA 2BMVA 3H4MA 4MO2A 1YQEA 2NUPA 4B6QA 5BV7A 3WQRA 2WNSA 3T7SA 3E9EA 3U48A 2B4RO 1ZRSA 2YMMA 5SY6A 4B32A 1G3UA 3C74A 3TOZA 1CFJA 5KDLA 1YOVB 5NLLA 4U0KA 1NHWA 3T6KA 4R1UA 3NWPA 2Y9PB 4TQ9A 2A78A 2PUHA 3KXDA 3B1WA 2CDNA 1N2BA 2GGSA 4GI1A 3TZLA 1AKRA 4WK6A 5TMBA 5EKDA 4GPIB 1PV4A 2DY0A 5AJYA 4ZXFA 4Z1MD 1I7QB 3BGVA 4OFZA 1X7HA 1VHWA 4JA0A 2H2IA 2HYDA 3SQWA 1H9BA 5AXDA 2ZYAA 2R4QA 1DOHA 3JQ8B 1KORA 3CEMA 2F1HA 4XCXA 4NEQA 2NTVA 4N7MA 3KYCA 1E6LA 3AEZA 3W6OA 1I94B 4X71A 1D2HA 2B36A 2QUBA 5ALUA 1L5VA 4IF4A 4X95A 1PR3A 4JQOA 3V8MA 4OHBA 4BP8A 4EWLA 2ZSUA 3K5HA 2XMRA 2I76A 4L3OA 2EWWA 4RF4A 3K6KA 4CQLA 4RMNA 3R44A 3R7FA 1DEHA 1X1TA 4HI0E 5FL7A 4F38A 1XZ8A 2I99A 4UVGA 2OGTA 3TAUA 5DM4A 1PJ8A 2P6MA 2RGGA 2E1RA 3BL6A 3M1YA 2CJWA 3BJMA 4TMXA 4HJXA 4AJKA 4YAKA 4L85A 2W6NA 3VH2A 3ZYZA 5HKKA 3DPUA 3KYDA 4NNPA 1QIGA 4RCYA 3HMQA 4WZBA 3PEWA 3ROKA 1Q0PA 2N47A 1GQSA 2FLWA 2BDEA 1ZRMA 4NG4A 3SR0A 3TTXA 4RL6A 2FPRA 3QY9A 1J1UA 1IK4A 2NTYC 2HDWA 2Q9UA 3L1JA 3ZQUA 2A33A 5DGHA 3TLMA 8ADHA 1Y4AE 1ZK0A 3I6YA 1PD1A 1WXFA 3VMFA 3OOYA 2IHNA 1E0AA 1NN1A 3UVEA 5G1NA 1CUJA 1Z4NA 4KRFA 3CRNA 2XVAA 4WN9B 2VVTA 4AKIA 4KO2S 3LZCA 4EKGA 1MDBA 4J6EA 2IIPA 4R2XA 3DHNA 5HJ5A 1RJDA 1XWWA 4GQIA 3O8RA 1E9VA 1X7YA 3VDQA 2EW8A 1ZMRA 5HEKA 3ZDYB 2MSWA 3ND9A 2A1UA 3T9CA 3FUTA 4ND3A 3RBAA 2PUBA 5U4QA 1XALA 3IS3A 1CJMA 3VH4A 1EGMB 2Q2VA 2WMDA 3LX5A 1PW7A 4JH0A 1L5YA 1USUA 1Z82A 4TTAA 3NBYC 1K3FA 4XSHA 4O4IA 1JMVA 1GADO 4YRNA 1G9TA 2B2NA 1ZNXA 3R23A 1HRKA 2XMDA 3QBJA 1YZYA 4V0RA 2C3PA 1T5HX 3LTEA 1Q19A 1ACJA 1GDHA 3DEHA 4HFJA 4PQRA 2QD3A 5ITZB 2HBQA 4QBKA 4TS3A 5UKDA 4CKCA 1E96A 4C4ZA 2BRUC 4DLTA 3V1NA 3L6UA 5AKJA 1JZQA 3ZGLA 2EKPA 3JQBC 4HDMB 1SWVA 1WY5A 4L9AA 4BJ5A 1F8YA 3SZUA 4D96A 4ND8A 1Z26A 2E5LB 2WQ6A 1ZK3A 3AZPA 3VYSB 4LGMA 1G17A 1QZUA 3MWDA 3WGLA 3V55A 1P8AA 2P4SA 3K0CA 3KG2A 2W6MA 4IDGA 4JASB 5EJIA 2IHZA 2DULA 4CKEA 3PUJA 5FI1B 3IR6A 5FNVA 1JG3A 3RRBA 4LZNA 1VLQA 3GL9A 2C7BA 4FC6A 5JV5A 3C4VA 4DQ0A 3FE2A 4UZSA 4IY1A 3WLAA 1I6WA 2RIPA 3EIWA 3RTEA 3N9IA 1VRCA 2R11A 5KX5A 3KTAA 1XG5A 5AI4A 2BONA 3PE4A 2ERYA 4YBZA 2R66A 1L7QA 2WF9A 4MEAA 5AHRA 1GPKA 2LCQA 3V1YA 5GVSA 2AC7A 5A6SB 3WBJA 2KSQA 2NN3C 2RHGB 1Z6ZA 3B1YA 4PSUA 3BCRA 1X80B 3C6YA 3RYHA 4WUVA 2PFGA 3A04A 3T06B 2CJFA 3M6IA 4YCDA 1CUCA 3SKYA 3UPTA 3LHSA 3KKPA 1B76A 4E5DA 5JD4A 1C3JA 4PEVA 5JG7A 3DMPA 3FDZB 3AVQA 1PIWA 3G49A 1MFZA 1ORWA 3NHPA 5A5VA 2E5FA 2CLSA 1J07A 3M9LA 5ECYA 4IW3B 5E6RA 4CCYB 1J06A 1Y3BE 1V1MB 3OJEA 1AXRA 2I4IA 1E77A 3EDCA 1P2GA 3AUKA 2A0XA 3M6XA 3M83A 3TW4A 4Y8VA 2DMRA 4ZQCB 3F6SA 4PNPA 3V9PA 4WXPA 4YJGB 2D8MA 3VR3A 3LUKA 5JBNA 2AG0A 1MJ5A 3NHWA 3TZ6A 4L5YA 3RVKA 3P19A 1NDQA 3TQFA 1BDHA 2BGUA 4NY1A 1ID1A 4F3KA 4LEIA 3WA7A 4R83A 1EB8A 1RXWA 1RTTA 2OZLA 1F2TA 2HUPA 3DBHA 1PG5A 4DFDA 2OXFA 4NMHA 2CZCA 2QZPA 3HO8A 3CVXA 2W2LD 2C4HA 4TROA 5BR4A 4QNMA 3QVJA 4A1FA 2CXQA 1FFHA 3A1UA 3E15A 5J47A 4RCVA 2PL5A 2QTFA 4PR3A 3HCNA 4X6LA 2GN0A 3H9CA 2FN9A 4LRSB 2XD4A 1YS1X 2YZMA 4PG7A 1ST3A 4JI6B 1A69A 1RQRA 2GN8A 2YRXA 5HCUA 4DM4A 4BE9A 4I1RA 3D3NA 521PA 5LP1A 2WFMA 1D1PA 1BJRE 2DBQA 1ZZGA 2CGEA 2DFKB 2D5BA 2GWHA 4RXTA 3SLRA 4BYGA 4Z7JA 2OUKA 5C8YB 1A2KC 4TWRA 4PV7A 4CF4A 4DN6A 3U9LA 1E9BA 1DBRA 4QOGA 4HLCA 2C2MA 4GZMA 2V7QD 2P9HA 2PKYX 2J9FB 4ZRMA 5EI5A 1FMFA 4Q66C 1A2QA 5EZ6B 3GVHA 4JUCA 3UOAB 2QLMA 4AFNA 2VHZA 3IPYA 3JWIA 4IDPA 1OFGA 4IUCS 3DEAA 2OWDA 3I9FA 3MMPA 5DOZA 2IV2X 2VYFA 5BRAA 4M1EA 4I3HA 1CJCA 1YV9A 2FMUA 3NEPX 1WOYA 4OMDA 4YJGA 4I8IA 4GRDA 3TMYA 3DL4A 1UBMS 3VR4D 4F5YA 4LF8B 3ESZA 2H9AA 4J1TC 3AL2A 4QQKA 4EPVA 3HACA 3LSYA 1RKVA 2HMVA 2B7BA 4JQSA 4WNAB 2EP8A 1C0EA 3PD0A 4HN9A 1DT5A 3AUTA 5F78A 5JD3A 3PGVA 5TGTA 3K2BA 2Q6OA 3ITEA 4LQ4A 4XM1A 3TSCA 2DPXA 1E4EA 5JZSA 3KVYA 3F2VA 1UANA 2JF0A 4WKNA 3LI2A 3OTWA 4P98A 5BW4A 1M9NA 1T5DX 3QNMA 4TSFA 1BX1A 1GYPA 1XCJA 2OAQ1 3V7UA 3ZYCA 1YUMA 5IAGA 1P8JA 3HGMA 5ALKA 3KIPA 2HMWA 5CYOA 1L6IA 1Z4QA 1CPYA 1Z33A 3EH1A 4K7JA 5EJ2A 1DKNA 1DMRA 3TQTA 3H9QA 4OMFG 3FUXA 4UQPA 3WYBA 5GAJA 3UWMA 2PT5A 4BJ3A 1F48A 1ZJ5A 2QL7A 1PZGA 3IHLA 5AJHA 1FDVA 1XU7A 3FNFA 5DTRA 1M7HA 3L7IA 4EZEA 5CVTA 3U56A 4LXGA 3THXA 3C6MA 5CBPA 3E5RA 3WRXC 4Q4HA 3UN1A 1C1YA 2SICE 3H0EA 5KNBH 3WGYA 1HBJA 1A9RA 1HZZA 5B1YA 5JJKA 2IWHA 1K1EA 3IMEA 5LLDA 1E59A 1PFQA 4ZIRA 1IRXA 1YRLA 1SC9A 2EKLA 2Q1WA 3LUDA 3DV0B 2JAPA 4RELA 4H7EA 2E2WA 3JQ9C 2QXYA 1LDNA 3M5WA 3TQQA 4R1LA 4R8RA 2ZSBA 5JSQA 3R8FA 3OZBA 4LMRA 1FUUA 5BYAA 4O2BF 2OPBA 3FDIA 2ES4A 1FXUA 2C2WA 1ZCJA 3TFWA 3WB9A 1VL6A 2ATEA 1YF3A 1PT5A 3EZ2A 1UBJS 4RTPA 2AYXA 2Q2WA 4KV7A 2WZDA 1F3LA 2FQWA 4UE2A 4WY2A 5M5BA 1K97A 4MO9A 4XXHA 1LI7A 4LDAA 2HREA 1RXEA 3SKXA 3WB1A 5EJEA 1YFKA 3FPSA 3IVGA 5EG5A 3AVVA 5AQEA 3D8BA 3MILA 3QJ5A 2OC4A 1AKWA 2QRLA 4ZEVA 5K7SA 2Q5FA 3Q3GE 4WINA 4AKEA 1LV7A 4F7DA 5KX5B 1CR4A 2OMEA 1K8ZB 4PIPA 3VYUB 4OI2A 2LGJA 1F6DA 4PQEA 2FQXA 1R0WA 2IX9A 1AQIA 2Q5EA 1L7OA 3I73A 2GCPA 4MQFA 4OA8A 4CKXA 4MPDA 3VU0A 5BWOA 4UE3S 4RU1A 5EMLA 3UT5A 4JYAB 3VVBA 5AJWA 4B6SA 2FGKA 3DCIA 3D1JA 1P73A 4IEEA 4KI7A 2ZI3A 4G56A 4DVGA 3UMJA 3K0SA 1PNRA 1N0HA 4N5IX 5BNTA 3ABRB 3LWDA 1JQLB 2PVPA 1CQIA 2BHLA 5JS2A 3F97A 3OCZA 3QLEA 1YU6A 4UBNA 3FCSB 3I34X 4BFYA 3KKQA 1GIAA 1JYSA 4RH0A 2XB2A 4YRDA 1EVIA 1TO1E 4ZQBA 3DTNA 2Y1FA 3U7RA 2P6UA 1PR0A 5ILOA 4QO8A 2WHYA 1JT2A 3E1GA 4M8LA 3G9TA 2DG2A 1IEQA 5B1DA 2CNWA 3BSSA 2QMEA 1RYMA 3W9YA 1JKJB 3KU4A 1D6NA 4AI6A 1ZI9A 1T5BA 4C5AA 2GF0A 1V8DA 3IURA 1IJBA 2WYHA 1VP9A 2P2GA 3K53A 1N8SA 1VE9A 1A82A 3KSDO 5HFNA 5G0WA 1C2TA 3RBZA 1FDRA 2OA0A 4OCZA 5CLGA 1H6BA 2HMYB 1GA6A 3QOXA 5A71A 3SDSA 1KSJA 1E3WB 2JEOA 1FK8A 1LU9A 1H0KA 2KW5A 2R5FA 1MHTA 1FSSA 2PX3A 2QN9A 3DBVO 4RK5A 1TMGE 3P9KA 3ET5A 4FHGA 4IZ6A 1XDZA 4MV8A 2W71A 5CX4A 3QWAA 4YRMA 4TXJA 5HIMA 4HWPA 3A4TA 3PJRA 2Z5LA 2W58A 1BE0A 1FVHA 3M1AA 2AX3A 1DTSA 2O0MA 4RA6A 5EUQB 3ZEAA 3FMIA 2Z4RA 3K0KA 3OBIA 5E7QA 2JGDA 4CG1A 2ZBUA 3FNBA 3OU2A 1QE5A 3RVQA 4DM7A 1T9HA 4EHLA 5HYVA 2OO5A 4NDNE 1V11B 2AE1A 1JHZA 4DWWA 3D6AA 3ZS8A 3IHTA 3NP9A 1I4DD 3TZEA 3GRRA 3DO8A 4D74A 1TLFA 1V37A 1U3WA 1GNRA 2AF3C 1RLIA 2VPTA 3IAEA 1KZYC 9ABPA 5IAAA 2YN0A 5HF5A 3IPRA 4NEHB 1HC7A 2I22A 3Q72A 4HDMA 5KSOA 3C8HA 2FXIA 3ASYA 3IALA 2X5JO 1A9ZA 2GJSA 2IPMA 4NYIQ 3QV1A 5FPSA 2EFDB 4PQYA 5D6OA 3K0EA 4XASA 3H5OA 5I9TA 2AG6A 4IIXA 3IJEB 5B57C 1F9EA 4K03A 2A1TR 3CNHA 4FFMA 1RWVA 3ETCA 3LPAA 2VA8A 1TZBA 3UFBA 5CFPA 2Q4OA 3WLFA 4MZDA 2ZP1A 4YT2A 1UDWA 2EZTA 4FOSA 2H07A 4OFBA 2BM8A 1O96A 4ENPA 2GJ8A 1TO6A 4L9RA 3HJTA 1TT7A 2B25A 1QNLA 1IN4A 1XHEA 2PKRA 3SE0A 1C5KA 4PAMA 3LT2A 2GO7A 1Y8QA 1DJNA 1AQYA 1Z6TA 3A6FA 1B0PA 3IPCA 1WXDA 4FGKA 3OZWA 1NNLA 4XFDA 1G3MA 4KZPA 4DPMA 2BAGA 4UOQA 2ORVA 2VYVD 1RWQA 1SUAA 2XBUA 4XUEA 3SYTA 2J07A 3EVDA 1JL3A 2H9YA 3IEPA 1X0XA 4L8YA 3D4BA 1NW7A 4CEJA 3DT6A 3P9PA 4GPEA 2NVBA 5A03A 1I0LA 4CF3A 1U3GA 1J8VA 5EE1A 1Y81A 2NVOA 3P5SA 2FZ4A 4NXNB 2BGMA 1B00A 2NXJA 1L8AA 5AM0A 1EUDB 5JT1A 3MXTA 5KWVA 4LRYA 3FNQA 3R0JA 2RB4A 1HY3A 4LXIA 4C6RA 4ALJA 5CB4B 1AGRA 1MD9A 1QIEA 1YHYA 3BAZA 3BEOA 1INLA 5HG0A 1SCUA 5KOHA 2TS1A 2Y8EA 4WQMA 3EMVA 3SBXA 4AZSA 1XQVA 4ZKEA 1R3DA 2BGRA 3A11A 3UV6A 4E1BA 4IJUA 3VO9A 5EIXA 4PZZA 2ISQA 3HWSA 2ZIVB 3I42A 3OPVA 1KSFX 3ONEA 4H7HA 4RKEA 1BH6A 2JHGA 4IKPA 5LBUA 1I36A 4UNPA 2E7ZA 4QPPA 2H8KA 2GM4A 4KAXA 1GPDG 4JVNA 3RFFA 1IVSA 1FCJA 3PRHA 2RH8A 2VK8A 1Z3IX 4GHWA 4H0NA 1ZGHA 3NHUA 4KAAA 5I4CA 2KJQA 3REGA 3IPXA 3KFLA 4L6IA 1J5XA 1OI3A 1QH1B 2JI8A 1XHFA 2R6DA 4JU8A 2AYYA 3VVCA 3C7TA 1AJEA 2CDRA 3ZWYA 3Q7EA 5I4KA 2Y9MB 2ANBA 4H6WA 1C9DB 3ENNA 2YFHA 2D4AA 1DAIA 1ESZA 3U4QA 3PQ3A 5H81A 3W34A 4BV2A 1B8OA 3RF7A 2EX0A 2Y1LA 4Z9FA 5LWQA 1QMGA 5FPHA 5KKCA 1CB7A 4MWDA 4NP6A 1ZUNA 3QEJA 4NBSA 4JSRA 4UM7A 4X8OA 3WIEA 4RLHA 2Y0EA 1G98A 3UJ7A 2GPBA 1C4KA 3JARA 2I6QA 1NLZA 4PO3X 4DPKA 4O4HB 2J3EA 3DF7A 4G86A 5B7QA 1A0OA 3G02A 1JQBA 4LKRA 1DU4A 1WZNA 2VPPA 2AEEA 2E18A 1PE0A 1RYHA 1THTA 3UV7A 4Z53A 2FPKA 3CURA 3OLCX 5JAIA 5AVTA 1QK3A 4W1SA 4KE6A 1HDEA 3IELA 4B84A 2GESA 4JR0A 2HJRA 2ZCUA 4N5NA 1PGQA 4UNIA 3N5CA 3M5PA 4D9CA 1KPGA 1OZGA 3KOZA 2QRPA 5TMEA 5EZYF 1YDMA 1P1JA 2PZBA 4Q0MA 1ODIA 3WSVA 3GRVA 5F7OA 1V25A 1EQ2A 1GNVA 1NW9B 3KLOA 3RHTA 3AU9A 2NXCA 1L7VC 2Q6TA 3EH2A 4X94A 5CIYA 4DNQA 1LW6E 2A9JA 3KBOA 3HRKA 4LXHA 1FSPA 1UPBA 2GHRA 4ZI5A 1KR5A 2M32A 3KETA 2OZEA 3T0GA 3MTEA 1WUIS 2H11A 2HW8A 3II6X 2ID4A 1UMBA 1Z6YA 4LQDA 4D43A 3VU9A 4BLQA 1TF7A 4EJSA 3TQSA 2QRNA 1P1RA 3B70A 4JBLA 4UPEA 4YLYA 4W5TA 1Z17A 2OV3A 3C3DA 5HZHA 1NXWA 1OAKA 4QRHA 3M6AA 4OQYA 3KKNA 1IB0A 4A0FA 3TXXA 2CUZA 2C2KA 2N0SA 1MEOA 3WJ1A 3H7AA 4OX9Y 4LTDA 4C88A 1GTRA 3LBIA 5F64A 5F3WB 3ZBQA 1XBTA 2YV5A 3D6FA 3CKMA 2C9DA 2Q50A 5T3UA 3X1MA 4WIAA 5HHTA 4M0MA 4OXQA 3ZIUA 1LK7A 3D2AA 3PUHA 4H6XA 4Q9AA 4EI2A 1JKIA 3JASA 2F3QA 2RFLA 5DSTA 4X8HA 1NV8A 1U31A 2Z2ZA 3IAS6 4GT1A 4H7KA 4FYJA 4U7PB 4AJIA 2QMHA 3B13B 1CSEE 1J2UA 2C04A 1WKBA 3JATB 5FWNA 4CPDA 1M1NB 4AMBA 1F8GA 1PUJA 1PCXA 4E2WA 2R1VA 3UKJA 1L2TA 1P2FA 5I8WA 2VP6A 4WEQA 4AJLA 4A2PA 1H2FA 1YZUA 4L08A 1J2JA 2HQ1A 2I2AA 3I1JA 1VKHA 2PLFA 5LDDC 2XQIA 2NOAA 1RACA 4HAVA 1UOPA 1OFIA 2I4NA 5H02A 4LNUA 3VTZA 2EJVA 3BREA 5PGMA 2QY6A 1YCGA 1MVOA 1VB3A 2OD7A 3W77A 4B74A 2V7VA 1R2QA 1S9DA 1NIJA 3GAZA 3I01A 3M89A 3KQUA 2H0RA 2R00C 5CFZA 4UTPA 2JLSA 3QHPA 1F3OA 4F4CA 5CLHA 5HRUA 4WKGA 4EGJA 3LCVB 5THKA 2PSJA 4WVFA 1XWFA 1ULUA 4X6XA 1W0KA 3ZHOA 2OHGA 1R8YA 4IIHA 4GI5A 4XQCA 3CGWA 3V3KA 4RF2A 3V4OA 3L4SO 2VP3A 1PNQA 3KV1A 5IZCA 3CXUA 3RKUA 4E6PA 4JVOA 5KTNA 2YNMA 3QXGA 4EI8A 2W22A 4ECAA 2G7MC 1XB2A 4KGXA 3QLVC 2GBPA 3WK5A 4ZHQF 3TL2A 3PQ4A 1E1NA 1KEVA 1IOZA 3RYCB 1SHTX 1VHJA 3U7IA 2JGMA 2ZJ1A 3WYAA 4B2IA 4DSOA 1RXVA 2GZ1A 3O9ZA 3FUCA 4DRXA 1T4BA 3VAAA 5K0TA 4PGMA 1PJLA 1H2EA 5J2UB 3RTGA 2VKTA 2BKVA 3QIVA 4RPHA 2HHJA 4CIXA 2B0JA 4L9SA 5A9RA 3NHMA 4CKEB 1T2FA 2EXXA 3EXEB 1P3DA 3KSZO 1WDTA 4D0SA 4I36A 5A5DA 4IGIA 5TVKA 1N5OX 3ETJA 1PL8A 1XPOA 1CY7A 3CF0A 3URMA 2WJAA 3O4JA 4DMLA 2J5XA 4LXQA 3L7NA 2L18A 4P4GA 4UHJA 4Y0AA 1YC5A 3DF9A 1ZICA 4URZR 1XVIA 2EYUA 2PKCA 4B7CA 2ZITA 3RT9A 2GHQA 4B3CA 4P3PA 4YLEA 4IXNA 3WNQA 3JQDA 3DO5A 4TN5A 4PSVA 3NAGA 4LK3A 1JJ7A 3BWXA 1KKLA 2HIHA 5K3FA 3T95A 2H2DA 3KQYA 3ZV3A 1Q7CA 1QWOA 1N34B 3WGNA 1IG3A 2JGKA 2DT5A 1TVKA 3O8NA 4XUGB 2BSXA 1VDZA 1QOPB 4G89A 2Q1XA 4P83A 5FUQA 2J46A 4ISBA 3ZDRA 1D07A 5LL6P 3UW1A 4CHGA 3R6TA 4B4WA 1WCIB 1QAMA 1W2HA 1KYXA 2P11A 4DV5B 3EQ2A 4I5EA 4YDSA 1KJJA 3GN1A 4RZIA 5KCZA 4A2CA 2V6FA 1ZIXA 2APJA 3QEBZ 3EXG2 1Y3CE 5ECGC 2YXNA 2GXQA 3OZXA 3R0VA 4X00A 4LS3A 4IRMA 2Q7DA 3UH1A 1QP4A 4OI0A 4IIVA 1QS0A 4BAUA 4PBTA 2FMIA 5MHTA 4X1KA 4RMHA 2R1TB 3NTQA 3THYB 1QB7A 1S8NA 1BC5A 2WD7B 3GUZA 4QD3A 2B4QA 5CK5A 1E2GA 3W05A 2OK7A 3GEMA 3RK0A 4X97A 5A9SB 2FMTA 3H6HA 2AOTB 4DLSA 1YB1A 1V95A 4EFKA 1OWLA 4MHOA 1NYRA 4DSTA 1Q0ZA 2DKFA 3DQPA 3MJTA 3R40A 3D8SA 1YOVA 1S5PA 2UZ1B 1WPXA 3LECA 1GAEO 3PFKA 4J0QA 4JJZA 2VTBB 3N2LA 4JL8A 4YT5A 2CL5A 1K8RA 4PGAA 1XCBA 4R8SA 3B2NA 4LOKA 2E4UA 4R2HA 5ECWA 3GMIA 4GSLA 3W5DA 1IBMB 1XJ5A 2QX8A 1NJ1A 2W6ZA 3QF4B 3IQEA 4HGRA 4RIEA 4UM5A 4ASUD 4QOHA 4AURA 4DABA 3TECE 1FLAA 3K1AA 2C8VA 2CHEA 3OBBA 2B61A 3OFKA 3TCKA 3ES9A 4QPDA 3ZY3A 4CFZA 1JW9B 5HM6A 2AWOA 1O5TA 2P7IA 4D97A 3AL0C 3R20A 2A14A 3GPIA 2JB9A 2Q6KA 3JD3A 4QOIA 4XIYA 4RD1A 1R37A 1IZZA 2Z1DA 4POAA 3IKJA 1J2YA 1NU6A 4R6XA 1PQYA 3UJDA 1K5HA 2QZSA 4UAGA 3GA7A 5K6TA 1U28C 4RIHA 2QX6A 2P3QA 3GNTA 2WJ6A 5FAXA 4BJHB 5J2TA 1M2VB 1HDIA 4ZYLA 2R6R1 2VYVA 2IYAA 2WWHA 3CXRA 1TJ4A 1XPJA 1OCEA 4ZCQA 3IUSA 3B7PA 3KELA 4NIMA 1DFIA 5FPTA 4UOZA 2XR1A 4XJVA 4TYNA 2O2HA 5E95A 1TCCA 4IDEA 1ZVJA 3LPCA 4P81A 3UT0A 3HA5A 3IEIA 2HGSA 2SKCA 3FKQA 4RWEA 4S1VA 5LKAA 1Q44A 2Z3WA 4Q1AA 3IT1A 3GJZA 3WLEA 2PDAA 2EFGA 1YL5A 1T9BA 3TSOA 1KNXA 1XAIA 3P0FA 4YJ3B 5BR7A 5DHQA 4IO0A 4ICIA 4BUZA 1D0IA 1SXGA 5DYYA 1DARA 2NUPB