2PU7A

Crystal structure of s112a/h265a double mutant of a c-c hydrolase, bphd, from burkholderia xenovorans lb400
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
283
structure length
283
Chain Sequence
LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNAMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGAWAQWEHADEFNRLVIDFLRHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
publication title The Tautomeric Half-reaction of BphD, a C-C Bond Hydrolase: KINETIC AND STRUCTURAL EVIDENCE SUPPORTING A KEY ROLE FOR HISTIDINE 265 OF THE CATALYTIC TRIAD.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Hydrolase
total genus 107
structure length 283
sequence length 283
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pu7A00
4J03A 4W9RA 4CCYB 5EHNA 3BF8A 3EQ9A 1XFDA 1DQZA 1RYYA 1VE6A 3WK6A 4K5QA 2WFZA 1XZFA 2RI6A 1LGYA 2HIHA 2Z8ZA 1TK3A 1G4HA 3F97A 4BATA 1AURA 1R88A 2WIGA 4Y2YA 4MWSA 3FBWA 1CUVA 2OAGA 3ZI7A 1CQWA 2PVSA 4BC0A 1P0PA 2PU5A 4MYDA 3F8SA 2CB9A 2GBCA 4DIUA 2FUKA 3DQZA 2WQZA 5AKZA 4BE4A 1UKAA 2WILA 4BTVA 3D2AA 2DHDA 1N8SA 3O9VA 3M3DA 5EIEA 2ZJ6A 3WI7A 1VXOA 5K3FA 4DNPA 2DHCA 2CJPA 3R40A 1MX1A 3C43A 1E8NA 1JMYA 3C5VA 4QNNA 4YASA 5C8XA 3IIIA 4RE5A 2GBGA 2ECFA 1JJIA 1HQDA 1H22A 3WK5A 1JI3A 4N8EA 1USWA 5AK5A 4BBZA 4A5SA 3HLKA 3I2GA 5I7UA 1FJ2A 4KAJA 3I1YA 2HU7A 4C6HA 1XRQA 3BL8A 3RARA 2O2IA 3WA6A 5AM4A 2X8BA 2XB6A 5E4YA 5BWCA 3D4LA 1BS9A 4E46A 4QEKA 5HFNA 4OU5A 3H18A 3GFFA 1ZOIA 2GZRA 4K6GA 3WL7A 2ZVDA 2DSNA 3KWFA 2C0PA 5LP1A 3FVRA 4XX1A 2XDWA 1R9MA 2RAUA 3UUEA 3EIOA 4RNCA 5HFAA 4EA6A 5FXMA 4DMFA 4B80A 5E4TA 2Y1KA 2QUBA 3I6MA 2XUDA 1AGYA 2G4LA 2GBIA 5JIBA 3KD2A 4DNOA 2XI4A 3G0IA 4FNMA 3DKRA 4L9AA 1NU6A 3ZLVA 1Q83A 3ANSA 5ALZA 4K6HA 4BP9A 4JNCA 1TCBA 4S0XA 3QITA 4Y2JA 5ALDA 3HYSA 5LZ8A 4DNFA 3A70A 5CT6A 3IVMA 4UHBA 4CFSA 4BDSA 3STUA 2CEKA 1AKNA 3RM3A 1VXRA 4HS9A 4FWBA 3RLIA 3BDVA 3H2IA 3STYA 2VTVA 1A8SA 1EH5A 4BP8A 3FSGA 5HF5A 5JD4A 3G0CA 4C87A 4Q82A 4Q1VA 4CG1A 3AIOA 1CUWA 4UBKA 2C58A 1EDDA 4JEIA 4AB1A 4X97A 3WWEA 4Y2QA 4X3CA 3G0DA 1AC5A 2JEZA 3X3HA 4KRXA 3WKBA 3WWDA 1JJBA 5AJHA 3HZOA 4Y2PA 3O4JA 3VVMA 1DINA 1QIGA 2HL6A 3L1JA 1QE3A 3MGAA 1EDEA 4M0MA 3DOIA 1GXSA 2W22A 5T4EA 5FP0A 3S8YA 4FOLA 5ALWA 3SWWA 1GPNA 4ZREA 3AJAA 2ORYA 4H7IA 5JARA 1A8UA 4B84A 4FHZA 2Y6VA 1LPNA 3C8DA 2HHAA 3O9MA 4EB0A 2VT6A 4EY6A 2WFMA 1JMKC 3STVA 1HKHA 5CRIA 4U2DA 2WKWA 1L7AA 3I1IA 2XQFA 1VA5A 2WJ6A 3DNMA 1YAJA 2AJLI 5ALUA 3V48A 2WLSA 1H2WA 2Z3ZA 5IVDA 4Y2UA 1BCSA 1G42A 2OG1A 4X92A 3FLEA 1WOMA 4PSCA 4M0FA 4YPVA 2RGUA 3LLCA 1N5MA 1EA5A 4DYHA 1W76A 2JGMA 5H3HA 4WCVA 3AZOA 2XUOA 3IURA 3DKKA 4L0CA 3NOXA 5JD5A 4IHAA 1QOZA 4BCCA 5ALJA 4GDMA 3AFIA 3A2MA 4P92A 5ALGA 5JASA 4LYEA 1F0NA 2VA9A 4QZVA 4BE9A 2BUBA 1HL7A 2ZSIA 4FBLA 1JKMA 3C70A 1XZDA 2PPLA 4OPMA 1GKLA 2H7CA 4LIPD 3QPDA 5EGNA 2QZPA 5I9IA 5LKRA 2XMBA 3H04A 3F96A 1XQWA 1O6FA 3PUHA 3BXPA 4BZWA 2OXEA 4Q3LA 5K3DA 1XZHA 4O08A 1ZGCA 2WTMA 4E14A 1ISPA 3KDAA 2ACKA 4ZV7A 3BIWA 1VOTA 4HXFB 4MYSA 2XQGA 3IUNA 4JH0A 5JALA 3LCRA 2EEPA 3QMWA 1ZIXA 3DYIA 5AKYA 1BCRA 2VJCA 3OG9A 1CIJA 5HF9A 3I2IA 3T4UA 3CCBA 5CT8A 1QFMA 4UPDA 2XUPA 5EHXA 2B61A 1R1DA 4G5XA 1AMNA 3WKCA 3E0XA 1DU4A 5CT5A 4EY4A 4DTCA 3GZJA 4IH4A 1VKHA 2X76A 3ILSA 4X85A 5LIPA 4G4IA 2XQKA 3CCCA 1CPYA 5BV7A 1EHYA 5AM3A 2YXPX 5JYCA 4KAAA 5AH0A 4FMPA 3D3NA 4AO7A 2YH2A 5AICA 4G8DA 2WTNA 4HZGA 4GXNA 2QM0A 3D59A 7YASA 1ODCA 3G9XA 3W2TA 1WHTA 1XRPA 1GQSA 3DD5A 1EB9A 1XROA 5K3EA 3GROA 1MNQA 5HF6A 1DTEA 1CVLA 3WQHA 3TEJA 3ICVA 1XZGA 4G9EA 1Y7HA 1JFRA 1MX5A 5AKGA 3SK0A 3W9BA 4OUKX 2ZYRA 5AKJA 2BJHA 3QZUA 3N2ZB 4ETWA 2DFPA 5IKXA 4MWTA 1HLGA 2CMFA 1RP1A 4B83A 2WUEA 4ROTA 1F0PA 1MN6A 5FOQA 4G4JA 1XQYA 1EVQA 2V98A 4U2EA 1LBTA 1XQXA 3G0GA 1X70A 3R3YA 4B82A 3V1KA 5D6OA 3VISA 4MXDA 4UBJA 1CUCA 5CXXA 5FDFA 3STWA 2YYSA 5FUMA 5AKXA 3PE6A 2O7RA 3HI4A 5ALSA 3I6YA 1XKLA 1R3DA 1GPLA 5LZ4A 1WCYA 1Y37A 3QH4A 1DQYA 4XJVA 1E8DA 4QLOA 2QJWA 1QIKA 1QFSA 2WFLB 2Y6UA 3ESAA 5ALEA 4B7ZA 4UHHA 5JZ9A 2HU5A 5HK9A 3VXKA 4C89A 4QDXA 1IZ7A 2DQYA 1XZKA 5EI5A 1XRRA 2OGZA 1K5PA 1CLEA 3ESBA 5JAPA 3G7NA 2W6CX 3H17A 3D2CA 1P0IA 2JGJA 2WHQA 5AOAA 4KJXA 5ALOA 3M82A 2GZSA 4OB8A 1XZLA 3HEAA 1CUBA 3QM1A 4J0GA 3R41A 1UOPA 2OCKA 2I03A 3B12A 1C4XA 1U4NA 5AI9A 1CUZA 2WM2A 4PSDA 1UK9A 3JW8A 2O2HA 3R3XA 5K3BA 3C87A 3C6BA 2WIJA 1MTZA 5AKLA 2O2GA 3I2JA 4QWWA 1YCDA 3FYUC 2VEOA 4UHFA 2HA5A 2BFNA 2VF2A 4AZ3A 1UK7A 1RWQA 1BEEA 2B20A 4PW0A 4MEAA 5CBKA 1FFEA 2E3JA 3R3VA 5SYMA 4DMCA 1MJ5A 3FAKA 4OYYA 1QIJA 2WUDA 2OGTA 5EFZA 3VJMA 5AKKA 5CTAA 4C4YA 2V97A 4Y2TA 4BVKA 3D5EA 1BN7A 5EIHA 1Y7IA 5ESRA 2JGEA 5AI5A 4X7BA 1VE7A 2BKLA 3WK8A 2GYUA 4J3JA 4WFIA 2PSJA 3UMJA 2WG2A 1LBSA 3PUIA 5DNWA 4OD0A 1CQZA 4RGYA 4C4ZA 3AIKA 3EQ7A 5EHQA 1THTA 3M81A 5AKEA 3WK9A 4QE3A 3I28A 5T4HA 2HA2A 5JADA 2BGNA 2WHPB 1T4MA 1LNSA 2RIPA 3HSSA 5CXUA 2JGFA 1UKBA 1ZJ4A 2JBWA 4J0JA 1VZ2A 1XZIA 3BIXA 1QIHA 4EHBA 2JIDA 4IH9A 3FLBA 3DDUA 1B41A 5DLPA 2PKYX 4KRYA 1BE0A 4JUIA 2J4FA 4PF1A 2OGSA 4WFKA 5D7BA 1CR6A 3JYHA 2ONCA 1LZLA 4UFPA 1NX9A 4H77A 4F21A 3NUZA 1UK8A 1WPXA 4H7JA 1QTRA 4HXGA 2FX5A 3LIIA 3G9UA 3QPCA 2XMRA 5ALLA 5D3ZA 1FFCA 1TCAA 5AM0A 2VJDA 3MVEA 5AI8A 5EHZA 3TJMA 4J0DA 5HKBA 1UXOA 1HDEA 1SC9A 3H2JA 4J0KA 1E8MA 3PFBA 4V2IA 5DYYA 4X95A 3WKAA 2EDAA 4QDOA 4GW3A 2QKYA 2ZJ7A 2ZYSA 1LPSA 1B6GA 3QMVA 4AO6A 4INZA 3D2BA 4PO3X 2G63A 4G1FA 1Q0ZA 1MO2A 1BRTA 1WM1A 2XUJA 3NGMA 1VJ5A 2WIFA 1TQHA 3MUNA 3VVLA 4HVTA 4ARAA 1AUOA 2ZYIA 2HU8A 4HRYA 4BVJA 3KSRA 3OURA 4H7FA 4KAFA 4BTLA 2QXUA 3WYNA 1QIMA 5EIAA 4UFNA 5AI0A 5HK8A 1CUIA 1MPXA 2XUHA 3DOHA 1QIDA 1LPAB 1K6EA 1UOOA 4KE8A 4UBOA 4OU4A 2JGKA 5E4JA 2VATA 3V1NA 5C7YA 3O4HA 1YS1X 4GHWA 5LZ5A 1ZIYA 2QOEA 1XKTA 5ALNA 2BUAA 5JD6A 1EK2A 5JANA 3E3AA 4CIBA 1ZJ5A 3E1GA 5ALVA 2IX9A 2JEYA 5C8ZA 5K5EA 1EDBA 4H7DA 3IUMA 5DNVA 3FOBA 2RONA 2WHRA 4UBNA 3V1LA 4PV7A 3FYUA 5K3FB 3GA7A 4BRSA 4XVCA 1O6GA 1UT6A 2XQJA 1P0QA 3OC0A 4UBMA 3DCNA 4P9NA 1X2BA 5ALFA 4HAIA 2PM8A 4B9EA 4FFWA 4PSUA 1CUFA 4ZV9A 1Q84A 3BE8A 3VKFA 1E66A 1QIFA 2V96A 2BGRA 3WA7A 4Y2SA 2XMQA 2OQIA 1G66A 4JYMA 4BVLA 2VJBA 1DWPA 2BCEA 2I3DA 1YA4A 4IO0A 4EZIA 3IBTA 5A62A 4U2BA 2WUFA 4GECA 3AZPA 3WK7A 1W1IA 3WLAA 5HQ3A 2VQ6A 5CH5A 2C5GA 5IVIA 3ESDA 1QTIA 3G8YA 4C4XA 4XIIA 3SX4A 1XRNA 1DX6A 1A8QA 1UWCA 5K3AA 1XLVA 1QJ4A 3STTA 3F98A 5LLSA 1CUEA 4QLAA 4X71A 1OILA 3ZV7A 4TGLA 3A6ZA 2C4HA 2HA6A 1H2XA 3W04A 2Y2UA 4KEAA 2JGLA 5AKHA 3STXA 1MAHA 4B85A 3ED1A 1LPMA 1K63A 1J2EA 1W75A 4FFVA 1PV1A 4CCWA 2HA4A 3QBJA 4QA9A 4NS4A 1ORWA 5DYTA 4P08A 3HACA 3SC2A 4AZ0A 1F6WA 5IH7A 3AZQA 1ZI8A 3HABA 3NWOA 2RHTA 1XZJA 2EDCA 4WY8A 1BROA 1CEXA 3BWXA 1EXWA 4UBLA 4QDZA 1CUYA 3GUUA 2QXTA 5AK6A 2NW6A 1Z68A 5A6VA 3HJUA 5HZGA 1FFBA 4IQ4A 4N5HX 5AIBA 2G5PA 5KWJA 5F4ZA 5IVHA 2J4CA 4BZZA 1WB6A 4C01A 4DGQA 3VDXA 1M33A 4AO8A 4J0IA 4Q3OA 2XMSA 4CCYA 1L7QA 2WIDA 1EB8A 3G02A 3L1HA 4W1SA 2GYWA 3I2KA 1D07A 1J1IA 2AJCA 2QVBA 4CG3A 2VSQA 4BYMA 2LIPA 4DMKA 3AINA 1IUNA 4D9JA 1E5TA 1XZMA 3V1MA 3LIPA 4A16A 1IVYA 3CXUA 5FPPA 4AN0A 2R11A 2WG1A 1GKKA 2CBGA 1ODSA 1SOMA 4AMZA 5CT4A 3CN9A 2WU3A 1QO9A 1UOQA 5ALYA 1S8OA 1BU8A 5HKAA 4NZZA 1IMJA 3O4IA 4QDTA 4UFOA 4BAGA 4DLNA 1X2EA 5K3CA 1XZBA 3N0TA 4KE6A 3FYTA 3R3ZA 4FTWA 3EF3A 2QS9A 6YASA 3A2LA 1LLFA 1EVEA 3IUQA 5ALXA 1CUUA 2XLCA 1OXMA 2XMDA 1WHSA 3PICA 5CH8A 5CH3A 3R3WA 1U65A 4X90A 4ZGBA 4I4CA 3WWPA 3WK4A 1GQRA 4W63A 4U2GA 1SCIA 1THGA 5A7FA 3I6ZA 5DWDA 1WB5A 3C45A 4EBBA 2ROQA 4DMHA 2QUAA 2HA0A 3DYVA 1CUGA 4F0JA 2ZYHA 1LPBB 1YSCA 4AQDA 3ZLUA 3Q8WA 4Q3KA 2FJPA 5C8VA 3WL5A 2PX6A 3ESCA 2XUKA 3VJLA 2DCMA 1YB7A 1JT2A 5LYYA 1LZKA 3V9AA 3FWHA 3H1BA 4X94A 3L1IA 1CFJA 2PSDA 1P0MA 2RHWA 1T2NA 3WL6A 2I3ZA 3OM8A 4Q05A 1CUXA 2Z8XA 3H2KA 3KXPA 4G4GA 1BN6A 5JAHA 5AM5A 3WZLA 3H2GA 4HRXA 4F5ZA 2O7VA 3PFCA 4IH1A 5FPQA 4LXGA 1TKRA 4AN1A 4I19A 5A71A 4BRZA 2Z5GA 4LXIA 4B81A 2Z3WA 2X5XA 3ANTA 1EK1A 4EUSA 4KR0A 2WIKA 2J3QA 3HXKA 2XE4A 3B3QA 5AOBA 1XZAA 4A23A 3DJYA 1DWOA 2HFJA 3G9ZA 4H7KA 2B9VA 5AK3A 3O95A 1XLWA 4U2FA 4UHCA 4BB0A 5ALIA 2HM7A 4TPKA 4F60A 3MUOA 5ISMA 2XMZA 4FKBA 3PI6A 4UBIA 4AXBA 3C6ZA 1GGVA 4FNGA 5JZSA 4RE6A 1TCCA 4AX4A 1FSSA 5CT9A 3B5EA 4CG2A 3KWJA 4WFJA 2OCIA 2PBLA 2G5TA 1ETHA 4U2CA 4KE9A 4N8SA 2XQIA 1U2EA 3FCYA 3E4DA 5ALKA 3O0DA 3DL7A 1R9NA 4QDUA 3WJ2A 4Q34A 4W1PA 3PDCA 1YASA 1DT5A 2ZJFA 1F8UA 3TGLA 4Y7DA 2WJ4A 3HRHA 2HADA 1DWQA 5KWIA 3U1TA 1H2ZA 5DNUA 4CIAA 2K2QB 3G0BA 1XQVA 4QWMA 1N1MA 5SYNA 5LZ7A 3EBLA 1PFQA 3WZMA 3DLTA 2PSFA 2R8BA 1R50A 3PF8A 5AHXA 5E2IA 4L3WA 3GELA 4BAZA 2H7XA 5ALPA 3IDAA 5D3KA 4UHEA 5YASA 1XZCA 1EI9A 5DTJA 1LPPA 3M83A 2XUGA 3K6KA 5J3JA 2V9ZA 2CZQA 4BCDA 1AZWA 3P2MA 4H0CA 1R4ZA 5AP9A 5CMLA 1MX9A 1KEZA 2VJAA 3TRDA 3WWCA 1BEZA 4KE7A 2HA3A 3F9CA 5LKAA 2I78A 3RK4A 1VLQA 2B4KA 3BJRA 3FCXA 4I3FA 4X93A 3WKDA 2CUTA 5AKIA 3LP5A 2P8SA 3I2FA 4G8BA 3FSGD 4EY5A 5AOCA 1GT6A 4PQEA 5HF8A 1ACJA 1I6WA 1NU8A 2AXEA 1PJAA 1IUOA 4B6GA 5JZBA 3H0CA 3LS2A 2XUFA 5T4BA 4Y2VA 3IUJA 4MJ3A 3C8HA 2BUCA 4MQLA 2XMGA 1DX4A 1JU3A 2GYVA 4Y2XA 4CI9A 4WDRA 2D0DA 2QT9A 1XZEA 1MNAA 4YK7A 1YS2X 4BCBA 1QIIA 3WMRA 2QTBA 1MU0A 2WUGA 4J0HA 1ZD5A 4NMWA 3IB3A 3FVTA 1J06A 5ALMA 4UUQA 4Y2RA 3A2NA 4OYLA 4EY7A 1J07A 4K6KA 2XT0A 5FRDA 2OQVA 3G9TA 2PL5A 5BOVA 1N5RA 5AIAA 1VA4A 4J0CA 2FJ0A 3C6YA 2PUHA 4OSEA 1C7JA 1AX9A 2WJ3A 3R0VA 3IA2A 2HRRA 1AQLA 1SFRA 1W6RA 4W1QA 3K9BA 4GBGA 1GZ7A 1QLWA 4DNQA 3T52A 1XLUA 2XUQA 1SCKA 5LZ2A 1MAAA 1FFDA 1ZD2P 5BWBA 5A7GA 2IIVA 5FLKA 3WL8A 2XUAA 2H7YA 5HCUA 4LKOA 3ICWA 4H35A 2OAEA 4FLEA 1ZD4A 3W06A 2VT7A 4H7HA 4ITVA 4ZXFA 3QVMA 4ARBA 3DS8A 5ALQA 1CV2A 1UFOA 4GEGA 2J3DA 1K8QA 4P93A 5ALTA 1Q0RA 1ZI9A 4WY5A 5ALRA 3WKEA 1IZ8A 3QYJA 4BC1A 4JYPA 1A7UA 3WYDA 4TVKA 4X6XA 4LYDA 5LZ9A 5FKJA 4C88A 4G9GA 3AIMA 3WWOA 2PSEA 3OPMA 1K4YA 4LXHA 2AJBA 4PNZA 3EQ8A 3UUFA 2AJ8A 3BJMA 2Y2VA 4UHDA 4MQMA 1W52X 3U0VA 3H1AA 2H9YA 2AJDA 3PF9A 2WFLA 3YASA 1HBJA 4Z49A 4HXEB 4XWGA 2H1IA 2XLBA 5A2GA 2GBFA 4OCZA 3WJ1A 1KU6A 1ZI6A 1G5FA 3W05A 5DTIA 4N5IX 2C5FA 1JU4A 4FBMA 1CUSA 4E11A 2ES4A 4GLBA 1ACLA 1W4LA 4YX9A 4EY8A 4L72A 4N8DA 2VAVA 1QONA 4GWLA 4WDQA 3QMMA 2JGIA 1ZGBA 4B0OA 2PSHA 1SCQA 1YB6A 1FFAA 4KYVA 3ZWQA 2ACEA 2UZ0A 1LPOA 2DQZA 4X6YA 4OB7A 4HTAA 1XRMA 1HPLA 2C7BA 3K2IA 1UK6A 4OB6A 2WU4A 2DR0A 3WIOA 2WSLA 3Q0TA 2HFKA 5KBYA 3FLAA 5JATA 3H2HA 3OTQA 3AILA 4J7AA 5DYWA 2OCGA 4B0PA 2OCLA 3FYUB 3C6XA 4Y9SA 5AO9A 1VZ3A 5AK4A 4ZWNA 2QJRA 1U8EA 5KREA 2D5LA 1QO7A 1EINA 2Q0XA 1E3QA 4FLFA 5CURA 2XUIA 1UZAA 5T4FA 1DT3A 4G8CA 1UKCA 3HC7A 1QGED 1CUHA 4W1RA 1CRLA 4RPCA 1ZD3A 4B9AA 3O4GA 2HDWA 1CUAA 4H18A 3BDIA 4WJLA 5AM2A 5JAOA 2DHEA 5CW2A 4H7EA 1ODTC 3H19A 5FV4A 3D7RA 5HQ3B 2YASA 1YAHA 1A88A 2BAGA 1TAHA 2PUJA 2VAXA 4LHEA 5AI4A 2WHPA 5A7HA 2WG0A 1L7RA 1TIBA 2PU7A 4FLMA 3DL4A 2JF0A 1H23A 5IVKA 2CKMA 4NVRA 1WB4A 1IUPA 3WIBA 4X00A 4FDMA 1CUDA 3FNBA 3W9UA 1ZICA 1QZ3A 4GI1A 4DM7A 4E15A 5I8PA 3D0KA 3KOOA 2IITA 3CN7A 4X6UA 5C81A 1OCEA 1GPKA 1QIEA 3OOSA 2QMQA 2QR5A 4ZI5A 1MT3A 5AI6A 1YR2A 2OPHA 4BDTA 1ORVA 1EX9A 3C5WP 5AM1A 3DEAA 1WPRA 2OLEA 1XRLA 3VJKA 3R3UA 4M0EA 4K2AA 1YA8A 3JWEA 4X91A 3ZLTA 5DJ5A 4MEBA 1CUJA 3IULA 4KACA 5JAUA 1TRHA 3I2HA 4ZRDA 2C0QA 4DSAA 1KU0A 3F67A 1H2YA 3ZPXA 4AMYA 3AUKA 5ALHA 2QRUA 2XMCA 1C7IA 1E89A 4DSZA 1JJFA 4BAUA 3RKSA 2ZSHA 3BF7A 3S2ZA 3GBSA 3QPAA 2HRQA 2HA7A
chains in the Genus database with same CATH superfamily
2ZTUA 4RQUA 2JPDA 3TZHA 4IWXA 4CMEC 5KKNB 1TJYA 4K0RA 3U4QA 3I58A 3RAFC 3I5MA 3HJRA 3K09A 4KZKA 3EQ9A 1T1GA 2ESRA 2P2DA 1VJ0A 3RIEA 1U2GA 1F9AA 3MRXA 4AX8A 1T5OA 2O05A 4BQIA 4GWGA 2E4YA 1DE0A 3V7WA 1FTWA 1PW7A 3I5XA 3P96A 2Y0BA 3ZU5A 3OT1B 3ET4A 2OYCA 1OTXA 1YOVB 1H6AA 2CSUA 1KI8A 1NN3A 4ZMBA 5LMNB 1D9XA 2PS1A 1B2LA 1Q74A 4AY6A 1TW2A 2HIHA 1QK3A 2Z8ZA 2R6HA 3BL6A 1OZHA 4OMDA 1UBFA 3IE2A 1G4HA 4URUR 4BATA 4F9GA 2GD1O 2WIGA 2R8ZA 1M6WA 3CTPA 2AOVA 2N1MA 3EGCA 4GD3Q 2HF8A 4G1CA 3TIVA 3QG1A 1N7HA 1NURA 2QPOA 3EWSA 4OQLA 1E99A 4URYR 1E3EA 4H6PA 4Z9AA 3FBWA 5JSUA 2IEBA 2XNDA 4JI7B 3ZJYA 4JJ4A 2O3SA 1Z0IA 2PVSA 4DIMA 5AQ1A 2CLFB 2ZQYA 3KYCB 1L7NA 3TCXB 5AW2A 4R9VA 2GEFA 2ZYWX 1LSUA 2DF8A 3F8SA 3NFYA 3LWDA 3NAGA 4N39A 1BU5A 5IC6A 4AWAA 5MGNA 1H4VB 3K32A 4PAWA 3DQZA 4PR3A 1L4BA 4AMUA 3QWHA 4YGYA 2WQZA 3UGQA 3DTVD 1XU4A 1ACMA 2IPAB 3DC2A 3IA7A 1QKJA 1IN5A 3EXHA 4G0MA 1Y6QA 1NBIA 1RAEA 4QXPA 1RYZA 1SUBA 2WILA 2XZTA 3NX4A 3C8MA 3V8QA 2JFOA 2ANBA 1A9YA 3MD0A 2ZSKA 3D2AA 1N92A 2ZULA 4NH0A 4CM6A 1NI4A 3ZYZA 4S0ZA 2XHEA 4BVHA 3PXBA 1PVDA 5TT0A 4QELA 2PGJA 3ORRA 4OFZA 3EHDA 3EN0A 1RQRA 1ZQ9A 3KSMA 3PQEA 4UM9D 5LBTA 1IN6A 4X20B 3A9WA 3EQ6A 4JZKA 1FLAA 1XCOA 3R40A 4XSGA 4I6GA 1NP3A 2COEA 1G5IA 2HDOA 3C43A 3OY2A 4EW1A 4Z7QB 5KNDA 4JBLA 2CXQA 2JCXA 2YWHA 3HP7A 2QU7A 2ERCA 1T0PA 2VZ0A 3NIDB 3O1LA 4HNUA 1LKZA 2BGWA 2FVYA 3HB7A 2QL5A 3ZGLA 2CFIA 1TMOA 4LJYA 4ALLA 1VLVA 4GYWA 5GTDA 4YRGA 2GBGA 5IF9A 1JJIA 4R2LA 5TPZA 5KVSA 4ZOLF 2AR9A 2GLTA 4KXYA 2I3GA 2POCA 4YMLA 2RGAA 4C20A 3CUKA 1GM5A 1X7XB 1JI3A 1XXLA 2AJTA 1NI5A 3DBRB 1LC3A 5AK5A 2CBZA 5A4FS 2HKIA 3JQ6A 1DC4A 1H0SA 1WMEA 4UMDA 3I1YA 1QBGA 2ALJA 1M75A 1UJ2A 3R0IA 4C30A 2NPFA 1JW9B 1XRQA 2OGWA 3H5IA 3RARA 2JFWA 2W2MA 4F4IA 4ENSA 2QEQA 2VL7A 2IY7A 4PYOA 2XB6A 5E4YA 2HNBA 2CV1A 1XRSB 4E46A 5BR7A 1QB8A 5KHOC 3DDNA 1C9KA 4QEKA 3NBKA 3ZW9A 2VRNA 1ZBDA 3H18A 1EGMB 4KMMA 4K6GA 4LK2A 5BSGA 1KI2A 2IYRA 1IEVA 2BTOA 2VSFA 4X24A 3KWFA 4GRDA 1M5TA 3IO3A 4IPTA 1K7FB 3D6NB 1D6MA 4EG0A 2J0SA 2LR0A 2BMJA 4ZO8A 5LP1A 5IXJA 3E58A 1LY1A 5A3JA 2F2TA 2RHHA 1JFFA 3AEUB 5DU2A 1H0HA 1B8UA 2W8BA 4TROA 4AY3A 2X9QA 3EIOA 2JATA 2QY9A 4IIEA 2YX1A 2WWFA 4BB9A 2NVUA 2PGDA 3LM8A 2FLVA 1S2DA 4MKGA 2IIQA 5FXMA 3SYNA 3UB4A 4DMFA 5DFAA 1EKXA 2BHLA 4GICA 1DDOA 2ZT8A 4XWWA 2A92A 1UUFA 1LWNA 1KJIA 3L8CA 2I6UA 1MOSA 3L40A 1W46A 3Q7IA 4WCDA 4M36A 3UY4A 3UUWA 2J7PA 5DN6A 3SC4A 2X1VA 2R1UA 2XUDA 1JGTA 1EX7A 1QG0A 2DLNA 1FSGA 1QHGA 5JVDA 3BXOA 1J8DA 2IXDA 4YMSA 1SVIA 2FPMA 3BQNB 2Y1CA 2J3EA 3SF8A 4C7BA 3CH5A 4XM1A 1HLPA 1FCJA 3SE7A 3UT5A 2CL7X 2ZI4A 3T5AA 1SXQA 1XC7A 3DKRA 4L9AA 4NLLA 4YPFA 5HIIA 1NU6A 5JDCC 4CJXA 3QLVC 2VTKA 4ENUA 4L0DA 4NAVA 2ZE8A 3ANSA 1GY8A 5ALZA 4FGZA 2HBZA 4K6HA 5LBIA 2ZUBA 2P4HX 2AD1A 1FUYB 2ID7A 3PJDA 4PLCA 4BYGA 2V6MA 4J07A 2XKKA 1RJDA 4BP9A 1MRZA 2FGKA 3P9SA 1DQRA 4FKMA 5EIOA 3ZC3A 5JS2A 5DHFA 3ONVA 2ZCVA 2ORED 3HUDA 4NHEA 1E2IA 4RTRA 2HJ9A 2FEMA 3LBIA 1JVSA 4ID3A 1RTTA 1NX6A 4EGJA 5DEIA 3LFUA 3VDMA 2M98A 4B74A 4RWZA 2C3PA 1FP6A 2CMHA 3CZCA 2DFKB 3AHCA 3NUQA 4UHBA 4X41A 3IEIA 1X6VA 2GTHA 1I2CA 2H63A 3BMNA 1MO5A 3UC9A 4BDSA 1MOZA 4QXRA 1XL0A 5L7TA 3QUAA 5IASA 1SPBS 3AJRA 1XYVA 1Z26A 4MICA 4WLEA 2R47A 3ZE8A 1L8XA 2YTZA 4M54A 1C9JA 1YDEA 4DVGA 4Q3DA 4LW8A 2HWYA 2PRIA 3UOGA 1SA0A 3H2IA 4RD2A 5TMDA 4DCVA 5B6JA 4RD3A 3UA3A 2NXEA 1HM5A 4F93B 3OESA 3L43A 3NEPX 3N2GA 1XNQB 3R9XB 4OQMA 4HLNA 3EQZA 1JIVA 2BI7A 3C41J 3CCFA 3FSGA 4Q19A 5BVGB 2BGGA 3AR3A 2OHXA 5JD4A 3X1WA 3IESA 4MARA 1R8XA 2Y71A 4XYMA 5EZQA 5EZYA 3INYA 4Q1VA 2I7TA 4OGFA 3WJ7A 3EVEA 4GP7A 2PCJA 3AIOA 1FFXA 4HCJA 4URXR 4UBKA 3L4KA 2J3MA 4PZAA 2C58A 1XMQB 5EVJA 2ZFUA 3DO5A 3I01M 3IOEA 3TTXA 3WWEA 5LFAA 2WJPA 1RI5A 3JQCA 1JG2A 3PDJA 4JX8A 4MO2A 2CDCA 4KRXA 1NA5A 2HIGA 1JJBA 3QKUA 2X1LA 3A6EA 421PA 3PFWO 5BRNA 4IHJF 1FBTA 4DV5B 4BQOA 1TZKA 2B6NA 3G79A 1GTG1 1QIGA 1ORHA 3JQGA 1Y4SA 3PR2B 1NVBA 2HCRA 3MGAA 3QIVA 2MSDB 4IF4A 1Y1RA 4M0MA 5DNDA 4D9NA 1P17A 2OV1A 3EDCA 1TQDA 3OUZA 1TEZA 3AL0C 1E2BA 4C7OA 1Q20A 1GXSA 4RYLA 4YCSA 4JNKA 1GNSA 4W7IA 1VGVA 4RLSA 4BGEA 1WPQA 2GEBA 2W22A 3LUHA 4L02A 4WMLA 4FOLA 2WDZA 5ALWA 2VSXA 1FNCA 4ZREA 2IH5A 4RHEA 4LWQA 3VM6A 4AJLA 2DUMA 2VUSA 3KWLA 5G4KA 5C4IA 1Z0JA 4NARA 3L92A 2JBHA 1SXIA 2NG1A 1MJGA 3FKQA 3OJEA 3PRKE 4QGHA 4IX1A 1A77A 2P4UA 2W8ZA 3PUJA 2FX3A 3MTAA 4F1KA 1RTKA 1SHTX 1A8UA 2XNCA 1U0RA 1FMLA 2JFFA 1ZD1A 4EECA 2FW0A 1ZESA 5LXTA 1B15A 2JA1A 2WY2D 3TQHA 5J4LA 3O9MA 3DDHA 1NW3A 2B4AA 1KMIY 2B0CA 3PNYA 3GDFA 1RZRD 3HXTA 5FJJA 3HJFA 4AMGA 1RQLA 2P9CA 1P18A 3OCWA 2P2NA 3CVOA 4TXMA 2GTPA 2I6GA 3WDMA 2J3KA 4DUZB 1JMKC 3KHTA 1QQBA 1RI4A 4YQZA 1PX2A 3N8HA 1RLJA 2W37A 4YJHA 1XTTA 5ARCA 3B6MA 4L76A 3NWEA 2LTAA 4P54A 4NNJA 2FOLA 5DIFA 4E5NA 1ZCJA 2XWSA 3Q8MA 5EJ5A 1I3CA 3ETNA 2FXVA 2HC9A 1O96B 1D1SA 4I1IA 5ARDA 1RXWA 5BOSA 1O97C 4L5CA 2YMQA 1IM2A 3F6BX 1OF1A 3NPAA 4GFDA 5KC9A 1YRQA 2QL6A 4RHCA 5A6SA 1ZGAA 4DQKA 1ZC4A 2YV1A 2OG2A 3ZKWA 2PH3A 2VP6A 2XUZA 1YAJA 3BMOB 2XYQA 3DNMA 3H5NA 3QLTA 2GXAA 1W47A 2WLSA 1PG5A 5LQMA 3FSEA 4MV1A 5IVDA 2AEEA 3JAKB 2W5UA 1KOLA 3RWMB 2OG1A 4D9HA 4UHJA 2BW0A 3RD5A 5EJ9A 2NUAA 1KFJB 4JMLA 4DTIA 1MTOA 5J5AA 4PSCA 3FIUA 2QVGA 2R7LA 3AG5A 2EBWA 2FSIA 2JHGA 4M0FA 4ZI7A 1U8YA 1V4NA 2BMDA 3ZD6A 3G89A 1S8FA 4H08A 1OFTA 3ERCA 1RRGA 4ENVA 1V8DA 5FT9A 1N5MA 3MIIA 2D54A 2D3TA 4DYHA 4AKEA 2AF3C 4CCSA 4QO8A 1G5TA 3LSYA 1ZVMA 5H3HA 1ADYA 3AZOA 1MEJA 4UMFA 2AC4A 4BJ1A 4QUEA 3GG9A 3H9JA 3PD7A 1EBUA 3IURA 3WLOA 4L0CA 3AEKA 3NOXA 4NEHB 4MGEA 3PEEA 3L8ZA 3R9IA 1CP2A 5ALJA 3GFBA 5FBKA 1DPGA 4KBGA 4ZDIA 1XMXA 3EC2A 2HWWA 1WXQA 4J90A 4XB1A 1E6CA 2WK1A 4G97A 4U7WA 1WX1A 4YRPA 1SBNE 2OFPA 1TAQA 3SVLA 2XDYA 2AN5A 1KMCA 4BMXA 5EKDA 3TDMA 5ECYA 1RT9A 1QMPA 1SNYA 3L9WA 3JQEA 3RFVA 2E82A 1QH1A 1DBSA 1W0JA 3A0RB 5H16A 3RS2A 1EIZA 3ND8A 3C70A 1XZDA 2CF6A 4OPMA 2D3WA 1NJ6A 2DY1A 3GZNA 4I1SA 4M9UA 3W5DA 4NXMB 1T8SA 3BB4A 5H81A 1C29B 1BXGB 1NLYA 2R87A 4LIPD 4OHKA 5EGNA 1WZ2A 2QZPA 3IPCA 3H04A 4O2LA 4TVBA 1SD5A 1BNCA 2BKAA 2IP2A 2Y1EA 4INPA 1ZGHA 3IMFA 3GIDA 1GWNA 3PFGA 3RFFA 4MI1A 4BZWA 4BNZA 3CNQS 3F5SA 2VDWB 3NZEA 1XZHA 2IEYA 1BW9B 1WF6A 2A86A 1WAMA 4OGKA 4REQB 5TVGA 5E7QA 4Z0HO 2BDTA 1GGNA 3QNWA 1B74A 5FLEX 2P4EA 2UKDA 3BIWA 4N6GA 3U9LA 1QQ7A 3HU2A 3V4LA 2AFIA 1HETA 3GRUA 1UPAA 3LO5A 3VPGA 1JAXA 4MYSA 2XQGA 1JR6A 5EHIA 4YDQA 2PGXA 4KN6A 3HB9A 1XD2A 4C05A 1VIYA 4KWTA 3BIOA 2I4RA 3MOSA 2EGHA 2EEPA 3L6EA 4Q12A 4HJRA 5A4DA 3RYHB 3HA5A 5GOTA 3DAHA 3DE0X 1FP4A 3BA6A 4CF4A 1D2CA 3EGXB 3VZQA 5AVXA 2VJCA 3GGPA 4HH3C 3RABA 2YWGA 4MA5A 4TYPA 1LX6A 3I2IA 5CT8A 4LJAA 4BASA 5JBNA 2FPPA 3DHVA 3LL7A 3I6BA 3NIGB 4MVJH 3Q7PA 5JJLA 1Z5NA 5CIYA 3SJAA 1CETA 3COWA 5EHXA 2AOTB 2PJZA 3BIJA 3FI0A 3ML1A 3Q3JB 1X8KA 1UFRA 2E49A 1M1UA 5AJYA 3REQB 1DAHA 3URMA 3V7UA 1Z17A 2EHJA 4XQGA 4ICIA 1K06A 1U8UA 4D0RA 1SBZA 3E0XA 2ECKA 3TWOA 1FSPA 3D8TA 4QOJA 4O0MA 3ELYA 2HBYA 4MMXB 2A1TR 3GQBA 4DTCA 2ZVPX 4OMCA 4YCNA 4TV9A 4RL4A 1JS1X 4W99A 4LXUA 3RSSA 1UDWA 4PYQA 3UJ8A 4BBAA 2D8AA 4UHKA 3SVZA 1W96A 4ZCMA 1C1DB 4WXYB 4YRMA 3TM5A 4Q03A 5BSEA 4IJQA 4WESB 4PNHA 1JKFA 1EHYA 1N3BA 4JXJA 1PR6A 1G6KA 1P5HA 2GEUA 5LN1A 4PC3A 5LOVA 3IL2A 2BBSA 5EIFA 4K87A 2HOQA 2HT6A 4ZI2A 2PZBA 3AP3A 4QSMA 5C7IO 5JYCA 4DC1A 5AH0A 4BGUA 3K1YA 1F4LA 3D3NA 1PTKA 2HWKA 3PCTA 4JBIA 5IM4F 1O4WA 3M4NA 3ZDZB 3UO8B 1HDYA 2I1WA 5AHKA 1PV4A 4HGRA 4IOKA 2SKDA 1U0JA 1BE1A 1O54A 5FFMA 1T8YA 1E79D 1B73A 3AH8A 3CRQA 1O2DA 2GAJA 3HJBA 3ZZTA 1PF7E 4GXNA 2RJOA 1P7PA 3N74A 4IWYA 2HMAA 5EJEA 2UVPA 1XK7A 1BKYA 1M34B 2W6ZA 2QM0A 3QBEA 1EWVA 1JDBB 4TQUS 4O1HA 2WJWA 7YASA 1Q77A 3UMVA 4UPEA 4QATA 3C39A 3U7GA 4B3SB 1OPRA 2AG5A 5KSZA 1LFAA 1WZUA 2HUNA 3EDMA 1GPH1 3GHYA 4E6EA 1ESNA 1PEKE 2OPBA 3PDHA 4TMKA 5DULA 4OK6A 3K5WA 2P9HA 3DD5A 1EUQA 4RHXA 1QORA 1P61B 3ZGNA 2PR7A 4ATNA 1EB9A 2YY6A 1V11A 2J9FB 1BMTA 4LBWA 2B98A 2X23A 3ADOA 4J4HA 3GPCA 3X44A 4ZKDA 1I7LA 2EWWA 1DTEA 1CVLA 3DO6A 4Q1CA 2Z56A 5IAJA 2Q5CA 1J8YF 3WNVA 5BNWA 3T3NA 3U4DA 3ZZ0A 1Y8QA 4E07A 1ZM2A 5GONA 2O3TA 3LH5A 4OHWA 1XZGA 2QJOA 4G9EA 1P31A 2W6IA 1T3HA 5C34B 4FJ2A 3UJDA 5AKGA 3KSUA 3OM0A 2QG4A 3DTYA 3SK0A 1MBZA 4MCAA 3W9BA 2FB9A 4YMWA 1O6ZA 3TNLA 4F85A 5AKJA 5CFOA 1RWOA 1T8WA 4BRUA 4MVJM 2BJHA 1M2NA 3A10A 2H92A 3HFRA 4TLBA 4AS3A 5C37A 5IKXA 3PFKA 2XB9A 1EFPA 2O7NA 4XAQA 3C7CB 2OA0A 4UVIA 5JEDA 1RP1A 3A1VA 5A5VA 2HQBA 2FSVC 3KQNA 2GEJA 2IUFA 1CC1S 5KNCH 3H8SA 4JVMA 3GI1A 1F0PA 3W6PA 1JEOA 1JJAA 2I2FA 3J7TA 1X87A 3R2JA 2W6QA 1KAHA 5DHQA 3K1JA 4UE2A 2EJUA 4G4JA 4ARIA 2IX3A 4D98A 3W1WA 1XQYA 3D3EA 3H2YA 1NF8A 1EVQA 1ZUWA 2ZDGA 1XNJA 3K1TA 3KJGA 3MXTA 4R1QA 3U80A 5C46F 2G1UA 4M83A 4PQYA 2PAFA 3V1KA 1JHRA 4JI0B 5ULLA 5F5NA 1RKBA 4GR4A 4JSYA 2IBMA 3VISA 1AHHA 1NI3A 5CM8B 4V1CA 4LYJA 2Z1MA 4X1YA 4UBJA 4DT1A 2GCEA 3ST7A 1NVEA 1EIWA 3NBMA 1G8HA 1WXGA 5DP1A 1H2EA 3UG7A 1O08A 3GLGE 2NO0A 4YLYA 1T9GS 1S1MA 4TTTS 4H6VA 5DI3A 1AKEA 1FPQA 1CU1A 2JFVA 4JT9A 2XOEA 5E2BA 3STWA 3W3AH 1CEQA 3WMGA 3K6SA 2F43B 2Q21A 4O1MA 2QV0A 1H5UA 2AWNA 3TRIA 5AKXA 4M6WB 7MDHA 1M1YB 4GAEA 4UCQA 2VR1A 3DYBA 1V7PC 2AXNA 1L5GB 5IW8A 5KQGA 3H9CA 4FFLA 1RBQA 3QOYA 1DDGA 5FPPA 1R3DA 4W5WA 3SY8A 1DFGA 1TJPB 2QAIA 3VU0A 4DREA 1SKMA 3GC6A 3L8FA 4BXOA 4IMIB 3VHLB 2XGJA 3PHIA 4XJVA 2FWJA 3VBEA 3GEIA 4ZK2A 1DO0A 2IUUA 2Z95A 2JI4A 4PC1A 2LD4A 3FPFA 4RHTA 3GRYA 1QIKA 5LJLA 3ABSB 5BV1A 2H5JA 1MV5A 2E9SA 1N2XA 3PXCX 4JKOA 3BD9A 3I92A 3NORA 4I9FA 1ZMOA 2YJ6A 3JWGA 4FHCA 4O4IA 2FZCA 3GEBA 4Y6SA 4LF6B 3BD7A 3RSOA 1W5AA 1YA6A 3WMFA 3LXXA 2IHBA 5DHSA 2A9RA 2QI9C 3V8MA 2HU5A 4EPVA 4KQXA 4PLFA 5JZ9A 3GEPA 3QKTA 2TMKA 3DZGA 1AXRA 4OXQA 2VFAA 1MPTA 2O14A 3M6MD 1U7XA 2NXNA 1U0FA 2AHOA 4HGPA 1SJ9A 2GA8A 4XYLA 5JW6A 2CXXA 4DWWA 1IZ7A 1NZDA 2I7XA 2A57A 4TTJA 1XZKA 2I1QA 1V4BA 1AY0A 4INAA 2FWRA 3VGJA 2NSJA 3DL2A 3TXXA 4GLJA 4BLOA 4YUXA 1K92A 2PZGA 2JHFA 3UM9A 1I7NA 1K5PA 1VJDA 3AI1A 5BT8A 3ESBA 3DAYA 2OV2A 3CH4B 2JFZA 3KK0A 3MBKA 5HSGA 2GAFA 1N77A 4RMJA 2J67A 3A25A 3QF4A 3OCXA 2FCRA 2YWXA 2I54A 5KDDA 3ACBA 1OV6A 3H17A 4BNWA 1JKIA 2BCJQ 3D2CA 3L7KA 4P5DA 4EGQA 3FAZA 3W6NA 3B3AA 4IIJA 5AOAA 4KJXA 2PUWA 1BOOA 4IXWA 1D04A 2IIBA 2C2GA 3KU1A 1ZOSA 4H2DA 2ZT7A 5D85A 1CUBA 3TD2A 3TNDA 4AJJA 1YHNA 3L41A 3LV8A 3QM1A 4J0GA 2IYUA 4TUYB 4CQLA 4Z3KA 4HFRA 3KOMA 2MMGA 4EZBA 2I03A 3X1MA 5AVKA 4C0QC 4DC0A 1BEUB 3GQVA 3IR5A 3Q9SA 4WZBE 2FYTA 4HDKB 3T4XA 3UKJA 3E5NA 2PZ8A 1U4NA 2HI0A 4BP3A 3Q8KA 2FR1A 1G291 2C5LA 3M8KA 4IIXA 1CUZA 4FB5A 1YQGA 3JW8A 4NBRA 5CUQA 1UP7A 3U3KA 1OYVA 2NT3A 1YQ9A 3C87A 2WIJA 1MTZA 1I4LD 3AUFA 5AKLA 4A15A 2AI2A 1RYFA 16PKA 3RVJA 5EQTA 4CL8A 5HOEA 4QWWA 4UM7A 1V37A 2IZZA 3QENA 4RCVA 1KH2A 4ZQGA 4F9EA 3AKYA 1T0IA 1E7MA 1YHYA 3L7CA 3FYUC 5BNZA 1UMDB 4MS3B 1VHDA 2P9YA 3K8ZA 2GWRA 2YWFA 4CM1A 4DLZA 5ADUS 2OQ2A 2VCHA 3WGTA 1DKMA 1T1IA 2B4YA 2A9QA 1K7CA 2OCBA 1CR0A 1OX6A 3HDVA 4I46A 2ONJA 1GZ5A 2FCAA 5DM0A 1PJTA 4F04A 2R44A 1CYDA 2ZJOA 3G5UA 1FFEA 4I14A 4UJ5A 4CEIA 4YYZA 1C4OA 1YR7A 2GF9A 2FPGB 3O75A 4F4HA 3LE8A 4GQIA 4HYEA 4P0PB 5SYMA 1QP4A 4CVNA 4GZLA 1NPTO 4PU0A 1MJ5A 1UIMA 3AX6A 3NTVA 5FWXB 2QT0A 4GO1A 2YBEA 1C3JA 3GLHA 1IAVA 3KLBA 2OGTA 4L51A 4I1PA 2X6QA 3ZDFA 4CNQA 1FTNA 1FLNA 5THXA 1NOIA 4YMGA 4RXTA 4HNVA 1ZXLA 2PL9A 4C4YA 2V97A 3OVMA 4X66B 4D3DA 4Y2TA 4I3GA 1Z7WA 2P0AA 5KOIA 1KQPA 1VI2A 3ROPA 3VRHA 3D5EA 1R0WA 5CFPA 1Y7IA 4NK5A 3UV7A 1MW8X 1G8MA 5ESRA 4C76A 1ADJA 1P44A 5K8IA 4WI1A 4N9QA 1WB9A 1DQSA 3TPFA 1JQEA 2JGEA 1T0JB 4X8HA 4BLSA 4Q4CA 2VYND 4D82A 4L0QA 3RNLA 4EJSB 3ECAA 1Z6QA 3WDSA 2I2DA 4B43A 2P40A 2KI5A 3V4OA 1BX0A 1N3LA 3AFHA 1HTBA 1L9XA 2ZUUA 3H1PA 3ZDXB 3B53X 4O6VA 4OX9Y 3MG9A 3DKIA 3HJNA 4RK4A 3VPXA 1D2MA 1LK0A 3T1TA 2HBRA 2OOKA 3DV2A 3PC8C 2WG2A 5FTLA 1ZO8A 3C4VA 4PFQA 4C4OA 4OD0A 3L77A 1YACA 4TL9A 3P5BA 3CLTC 5KUTA 4K6OA 4MIKA 3LHSA 3UMCA 4WVLA 2A1TS 5EHQA 1J9ZA 2ZE6A 3N8IA 1KI7A 1XSEA 1YR3A 3G2PA 3KVNA 5AKEA 4QGSA 3I28A 3PWSA 2XADA 1KEUA 1O77A 1D2HA 3KTAA 1G63A 1IATA 3O94A 5T4HA 3X0DA 4ETNA 1GA1A 4ZZ3A 2FSSA 2BGNA 3ZTWA 5AW5A 3NIWA 1WUJS 1IBKB 1EM8A 2HSEA 4B2LA 1LNSA 1RE0A 4RFSA 3RCBA 4AD8A 5A4KA 4M7OA 5KYTA 3ANLA 3COJA 5DLQC 2FPRA 4JS0A 1Z5UA 3WB1A 2ZUFA 1ZJ4A 3EZXA 4GR9A 5CVJA 5ECWA 1XZIA 2RC6A 1OBOA 2R8OA 1F3OA 4Y98A 1LDNA 1Q95A 1LEHA 1AS3A 2JIDA 3H99A 3LQ4A 1OBVA 1V16B 4KDFA 2EHDA 3NAQA 1ZZEA 2SCUB 3RUAA 3GJ5A 2GN9A 3DDUA 3JQ7A 1M6YA 4ZZ1A 4DPLA 1Z08A 2W2NA 2PKYX 2Q3MA 4O33A 1DV1A 4JUIA 2Y4OA 3JD3A 4I2NA 3AY6A 3EGEA 1YK0A 4MTCA 1GVNB 5LQSA 2OGSA 2AC2A 4FE7A 1IY1A 1KMQA 1VKOA 3GCGA 4L73A 1SG9A 3FVQA 1CR6A 4NYJQ 4PZ0A 3K70C 1W59A 4RA6B 3IKMB 3L7YA 1LZLA 2NXJA 3R9WA 4DQDA 1L5HA 5TB5A 2I33A 3I8OA 2CJWB 1L7EA 3NUZA 4H7JA 2CY0A 3RRJA 3WTCA 3U61B 1W7AA 2H4JA 2WYVA 4HQ0A 4HXGA 4C4TA 4Q02A 5GVRA 3MMPA 2NPOA 3EEIA 4RVDA 4U00A 1AKMA 4NE2A 3TSYA 4KPYA 5CG2A 1OZFA 4L27A 3QPCA 4C0JA 4U9IS 4CW7A 1IXKA 3CUTA 2H7VA 2Z1NA 1WW3A 4X1OA 1F2TB 2WM9B 4BO3A 3GRAA 2YC4C 5HRAA 4DA0A 4Q7KA 5AM0A 2VJDA 3A2KA 3OEEA 5EHZA 5JLJA 5AW6A 2EJTA 4M60A 3TJMA 4J0DA 3B9BA 4NS1A 3TGPA 4KODA 4PZLA 4DPMA 4F5WA 3OCZA 4WEQA 1BYUA 1XCMA 2XTJA 3R4CA 3SS7X 2EZUA 4MWOA 1IOVA 1QH8A 4CMIB 1DC7A 2FZKA 4V2IA 1ZN8A 4X95A 4JDUA 1JR3A 3OC6A 2EDAA 5EZSA 4GW3A 1GKYA 2P5TB 2FEXA 2QKYA 4N6OA 3VI4B 4NBTA 1Z4OA 3JVEA 1LPSA 2G5CA 721PA 2JKZA 4M76B 4INZA 3D2BA 1QLHA 1MB0A 1Z5OA 1JILA 2GZMA 2PHZA 4G01B 7AT1A 4HAXA 4Y1FA 4B09A 1PFKA 4YV7A 2ZI3A 4JA2A 4LSGA 4CR7A 2JNWA 1T9BA 3N9IA 4C0HA 1G20B 2AXPA 1WXFA 4P8RA 1KNXA 3PI7A 3PPWA 5HG0A 4M1QA 4OLJA 4W8HA 4XVHA 3K71B 2XUJA 1PK8A 4Q16A 3WSVA 3PL1A 4CKWA 1VJ5A 1VMKA 1JU9A 1CX9B 1V7ZA 3MUNA 1W88B 3AM4A 3VVLA 3TG2A 4AT1A 4RSRA 3UHAA 4HVTA 1H5NA 1XD8A 4RTSA 1AUOA 4J0QA 5BR4A 3PC7A 4DABA 3M3HA 4W6ZA 3UGJA 1F1BA 4I55B 2P9JA 1YRAA 5AQEA 2C1ZA 2P27A 3CZ5A 2CT8A 2WWXA 3GRZA 3KSRA 1CRQA 3CX7A 4PHCA 1PQYA 1QV9A 2RBKA 2VDVE 3I42A 3LX8A 5T8KA 4BU1A 4FS8A 5SV2A 1T2CA 3SYKA 4DCCA 3R1IA 4CTOA 5JJ5A 4KFCA 4KAFA 2C9DA 2D0IA 4MS4A 3U4QB 3FRIA 2FA9A 3FY4A 2G1KA 2VTBA 3MS4A 3WYNA 2LKDA 4KHZA 3ONDA 5EIAA 5AI0A 2HQSA 3MWEA 1U1CA 3MHTA 4MPJA 2FOXA 3CLHA 3LDUA 4N3CA 2C9OA 4EB3A 2FZEA 1WUKS 2O0LA 3C3KA 3NRCA 4OXNA 4AJ1A 5JJKA 1LJ8A 2PD6A 3HBLA 5HJ7A 2PUEA 3DEYX 1GJRA 2OBBA 1P4JA 3DGEC 4LJ6A 2ZRKA 4CN9A 1GTZA 2E87A 3B5IA 3ZU3A 2BJWA 1XPOA 2HCJB 4UBOA 4HDSA 5DTQA 3WMXA 3U81A 2IHUA 3G49A 3ZCSA 6PFKA 4D9FA 2JAWA 5SZHB 3LBHA 4I1VA 3CX6A 4IINA 3SEAA 3SIRA 1LJUA 4YT5A 3NJRA 4Q01A 1WUTA 3ABQB 5C7YA 1GSOA 1URPA 2F3PA 1YR6A 3MZ0A 3WWZA 1U9YA 1M73E 1VFNA 2QYHA 3UWMA 1M6HA 1QNLA 2ZWOA 2GHIA 1G41A 1SXHA 1OLXA 2YOGA 3W6ZA 2WB2A 1A7KA 3WRWA 3AVUA 3LOPA 1GZVA 1T43A 2H4WA 2QOEA 2PQMA 2RIRA 3IAEA 4LOHA 2C5AA 5ALNA 3L5KA 2BUAA 4AU1A 3TUZC 3Q40A 4R9RA 1N9GA 3W6UA 3LRXA 5E9WA 1U7HA 5JD6A 4M1EA 3K05A 1OH5A 4KXLA 2I0FA 4LE0A 2JI7A 3U6KA 1Q2UA 4Q7JB 1RXIA 1YF3A 4CIBA 4JQSA 3EXHB 4MGKR 2DFNA 5ALVA 1AQYA 4P0QB 1HUQA 2C8LA 5C8ZA 2H5IA 2Y66A 3PFHA 2A5FA 5FJIA 3TNYA 2HHJA 1UM9A 4XIJA 1TTPB 3UVEA 3IUMA 3JVVA 5JFGA 1KYTA 1N7JA 1Z63A 4DM4A 1NI4B 5TGZA 3HG7A 4LRYA 4R84A 2QE6A 2WV7A 4UBNA 2Z2ZA 1O58A 1NVTA 3IJPA 4RETA 3C1TA 2QMYA 3GA7A 3L0OA 1OTHA 3DMTC 1I9GA 2TRSB 2BZGA 2PDAA 1JBKA 4DBVO 3AQ4A 1B42A 1O6GA 1N2EA 2QVLA 4MR8A 1S9DA 3HUEA 4P22A 2J9YB 2X14A 1QV6A 3VGPA 1P0QA 3KJNA 4C6TA 3VKHA 4C22A 3JPWA 3O73A 1JB9A 4XB6B 1B7GO 1ECLA 3JZIA 1YVUA 2X3FA 5ALFA 5EJ4A 5E1MA 4HAIA 2YNMC 1F8YA 3JY6A 3BXZA 3AHFA 2QAJA 1KYZA 5K0TA 3VNVA 1L7XA 1TYBE 1HEIA 1YJ5A 3BE8A 1MH1A 1XE3A 1XTBA 3LRTA 1KY4A 4LDPA 4R05A 3TE6A 1UF9A 3ZV6A 4ARVA 3THXA 5TGTA 1QIFA 2E4VA 1OH6A 1DCFA 2BGRA 2X9NA 1S4MA 3K0BA 3LD9A 2FU5C 2OHIA 4GPAA 4EF6A 3HM9A 3HBAA 4LJ8A 4CMAA 1Q1NA 3S2GA 4J7UA 1XQ9A 1XXHE 3EK2A 5G0VA 2QTRA 3WLMA 2CNOA 2A9PA 1TE2A 3IT1A 3KZCA 5CLHA 1BHO1 1TU0A 4IG4A 1EA7A 1UBGA 2CWWA 3AY3A 3F47A 4EZIA 1I6KA 1Q22A 3ZX5A 5A62A 3TD9A 4Y67A 1QH0A 1RLOA 1SZCA 2WHXA 4LAFA 1N0VC 2C77A 2WUFA 5AWFC 4ZCIA 1ZPDA 4L8GA 4NNOA 3NUGA 2QUKA 2WJJA 3WK7A 3S1LA 3WLAA 5HQ3A 1H3EA 1DL5A 5CNKA 4TN5A 5WRFA 2O1WA 3C3WA 1MH9A 2W0SA 5CH5A 4KLZA 4NBUA 1MZPA 3QUTA 3W5SA 2PFGA 4C9BA 4PX3A 4C07A 5DLEA 3OJ0A 2FMXA 2FWIA 1YS6A 1C9MA 2XGMA 1JFFB 3FDZA 4P2BA 4BUZA 2P3QA 4TT3D 4XIIA 2Q9CA 3KB2A 1ESCA 1Z0SA 2O2EA 4EHNA 1E59A 2W8BB 2WJIA 4DUYB 3BRQA 1PL0A 4F97A 1QTQA 1TJNA 1XDZA 1A8QA 1UWCA 1U6KA 4OF4A 2NVUB 7REQA 5AT1A 4P36A 4FYWA 5ABPA 2XWQA 4J1TC 3STTA 1RAGA 1QB7A 521PA 4U7DA 3AP2A 1CUEA 5DRTA 2PNJA 3IDQA 3B1XA 3CUSA 4RIHA 1OILA 1LFDB 4LXXA 4PRYA 5H1YA 3TH5A 4TGLA 1Z29A 1IM5A 3ZV7A 3U56A 1M6EX 1CEEA 1VGRA 4CT0A 1H2XA 3UK1A 5JVDB 3LCUA 1GR0A 1NW8A 1F6BA 4KPGA 3SF8B 5EJ2A 3D54D 1J25A 4LDJA 3LWNA 2V65A 4NYMR 5AKHA 5LVAA 3FCAA 3OZEA 4HB3A 3UT5B 1FDOA 3E23A 3STXA 4BQPA 3VX3A 5FUBA 1MAHA 3DFKA 3TVYA 3C3CA 1E58A 4LV6A 2PA3A 3TZKA 4B85A 3BK1A 3ED1A 3EMDA 1A4IA 5DH9A 4TT8A 5C3MA 3LVFO 1J2EA 2ADMA 1ISSA 3LRPA 3F7OA 1N5KA 1PV1A 5B37A 3OF5A 1FNDA 2HA4A 3TZLA 2A9JA 1GFIA 4CCWA 3QBJA 2Y93A 3KETA 4I50F 3VA7A 3MFQA 2X13A 2CZCA 3MMNA 3MK31 1OA0A 4KO8A 1KMHA 1TLFA 4LHXA 3SC2A 2OCAA 5LD2C 3BMNB 1OSNA 4ZT3A 2GM3A 3CF2A 3RRNA 5CA0A 5JUWA 4WOCA 1HLFA 1ZI8A 1ODFA 2Y77A 2PJRA 2C2ZA 2H2AA 4OKIA 4LJ5A 2AUNA 2XJ9A 2JK0A 1FP2A 3NM5A 4WY8A 4ZVMA 5FUYA 4KHPB 1BROA 3RSQA 3UJAA 4QBHA 1SA0B 1ZM9A 3ANXA 4GOOD 4UBLA 821PA 5JY6A 2Z6AA 2Q0SA 3GUUA 1QYCA 2Y1XA 4P5EA 3N2GB 4M9CA 4IGEA 3SC6A 4M1ZA 3W1EA 4DA9A 3T7RA 3PUZA 4HSGA 5EZYB 3ZWPA 1CY8A 1JXAA 1NVMB 1NHWA 4FM9A 3OLWA 3H6KA 3EARA 1JAZA 1FFXB 2RGNA 5DTMA 4FFDA 1FFBA 2XA2A 3E9RA 2ZATA 1J2JA 1T8RA 2G5PA 5KWJA 1E4EA 2P91A 3VNBA 3DA8A 5CA1F 5F4ZA 1A2QA 3TLZA 4DCOA 2RKBA 3VBCA 2BE9A 4BX2A 2J4CA 2EQAA 4YRZA 1YL6A 4Z7JA 3JQGB 3GFPA 4NFHA 3UICA 3SJUA 5B5SA 2VO1A 2QRPA 2J3LA 1U02A 4B2YA 3GZ4A 3MGKA 3A9UA 4Q3OA 5K0BA 1GXSB 4HQ6A 3SBXA 2BR5A 5FLXA 2VKTA 1L7QA 2J3IA 4HZUA 3BD8A 4LOLA 2EW1A 4E2XA 4JD5A 1N5DA 1QFXA 2GYWA 3OZGA 5ARBA 3DWEX 3N87A 5CNJA 3GLFA 5G4KB 1J1IA 1ULSA 3THSA 1AM4D 1CZLA 2FPXA 3F3KA 1CY7A 3IUYA 3KJFA 4NK4A 1RXVA 2PZJA 1FS6A 1NTOA 2F1OA 5KNLA 5ADVA 2VSQA 1LK5A 1V5IA 1N4DA 4OJQA 4EHHA 1KR2A 4WA7A 3PHLA 3CKMA 1E3WA 1FUEA 1WOYA 2ZCUA 4YAOA 3R20A 2IXGA 3WYEA 3ZCRA 3N8DA 2EL9A 3LYAA 2AOUB 5LXTB 3CWQA 1UPFA 4I1OA 2HHHB 3S3TA 3DXZA 4X7RA 3PRJA 5AYVA 5JRJA 4KMRA 5JNVA 3ZVMA 1YJ8A 3HKBA 4BMSA 4YDSA 1SOWA 4G24A 2Y68A 2FUCA 1GCUA 5DI9A 3CX4A 4LECA 2GPAA 5DXFA 3W1VA 4DSUA 2R11A 1DG1G 1OZ0A 4EY3A 3LYHA 3RVDA 1SHKA 1I80A 2P90A 3G1WA 1JAHA 4II3A 2OT3B 4Q3CA 4U6SA 4AJIA 1TEHA 4KK3A 4UUMA 3TNJA 1WY5A 2W93A 2C61A 5J40A 1JI0A 2C3OA 5K0ZA 2QPLA 3Q3CA 1SOAA 5BOSB 3BC1A 4H4DA 3JRNA 1PJRA 3RC1A 1QOQB 3GX1A 2WU3A 3SZMA 3HR7A 4C0XA 1JQLB 5A6SB 5A5FA 1RQ2A 4XCQA 3OT5A 5HUJA 1PJ2A 4J2OA 4B6PA 4B7AA 1OR8A 3ZKWB 4UJ3A 1P7CA 3KZXA 4MV5A 1EBBA 1SCBA 1YZ3A 2Q28A 2TYSB 1EGHA 1ULUA 3C7TA 3O4IA 4U5QA 1EJ2A 3RVRA 3T3MB 3VNUA 2F3UA 2NUAB 2OXTA 2VP9A 3MT0A 4EW6A 3F7MA 5ENZA 6NULA 3BEDA 1BZYA 4B3RB 4FE3A 5L9AA 5JPDA 3QEJA 4ZI7B 1XZBA 2V1UA 1K6IA 2YRWA 4BNKA 1Z22A 1IIRA 1CF9A 2I7VA 5C31A 1UFQA 4HQFA 2MYNA 2QBYB 3DHNA 1XVVA 1DCMA 5IAAA 3QVGA 3MEQA 4CIWA 2QS9A 1G1AA 4I6JA 1TZBA 3LT4A 4AJKA 3CLUD 1GCGA 1VBMA 1U2QA 1SWWA 2IUYA 5DBIA 2LKCA 3OFKA 5CEFA 1KWKA 1XT6A 1EVEA 3OQIA 4YMHA 4JDPA 2OV4A 3L93A 3M7IA 5ALXA 5HEKA 5C9ZA 1BFDA 1KI3A 2V7EA 4A92A 4QQRA 4E1BA 4CLRA 2BKUA 3IKJA 3WOVA 1WHSA 1XDBA 5MGBA 4LFBB 4QGBA 5CH8A 3SBEA 2VP3A 1BX1A 2QP9X 4X90A 2X6RA 3EOBI 4KQJA 3NDIA 4UVGA 3TBFA 4ZGBA 5LLTA 1OXVA 4OO3A 4CDGA 4R01A 4BPBA 3SZUA 4JLNA 4BL5A 5C8DA 2ZR0A 1H3NA 2XE6A 4TKZA 4YJ3F 4YMUA 1SQ0A 3K7EA 1I1HA 4CZ2A 2I4NA 3A1EA 4NP6A 2GRUA 4E5KA 3JATB 1QH1B 4JP5A 1JH9A 4KNVA 1B0AA 2FW7A 4BFLA 1RPZA 4HB0A 5C53B 5KQSA 4A2PA 1F8GA 2C84A 3GZNB 4U63A 1COWA 1MA3A 4Q18A 4WSOA 1KDYA 2PEYA 2XZPA 1Q57A 1DC5A 1IZ9A 2HA0A 1QAOA 3LKVA 4RYDA 1QF7A 2PKQP 2J0QA 3FKSA 3DYVA 4CIXA 1QDUA 5C35A 3HA7A 3WGGA 2M6KA 3K73O 3MRTA 2DKOA 1GUYA 1I94B 4AQDA 3GVPA 5B57C 1YBVA 5FA6A 1QVWA 2B2NA 4N3GA 3ZLUA 4H1WA 3Q8WA 4Q3KA 1OI4A 1TM7E 2FJPA 1IXZA 2IELA 4GM4A 3K92A 4C1BA 1ELOA 4XFDA 2XUKA 3H1TA 4MCJA 1JEYA 2V74B 5AXAA 2AFIB 3VJLA 3EXEA 5EJFA 4QBFA 1I4DD 1N9ZA 2I4TA 5BSUA 3PWKA 2JIRA 2WQ6A 3RTBA 4OXIA 1NTRA 1YVRA 1XD2B 2C4UA 2C0CA 2MYTA 2E2WA 4MRMA 4Q66C 4BO2A 1O8CA 2FUG6 5KX5F 3GU3A 2B4RO 1C50A 3K72B 4MVJA 4X94A 3TZ6A 2ZZMA 3UMMA 1PS0A 3DNFA 4TLDA 4F1JA 2AI3A 2VPYA 4QOHA 3I9LA 1FP4B 1QGYA 5BQXA 1Q1BA 1U4SA 3QEMA 1PQ4A 3NXSA 5FCDA 5LJIA 1XDGA 1R64A 2I3ZA 3LC0A 4RV4A 2H2GA 3OM8A 3K0HA 1H69A 1CUXA 1F48A 3FJ1A 5KCMA 4AZ0B 3ZHQA 5CB0A 1XPRA 3KXPA 3PUVA 1QJCA 3QWBA 3AK4A 4PZ9A 2CHQA 2ZIXA 4ER3A 4UNPA 2FPPB 3P94A 2FQWA 2Y27A 3NVKI 1GP2A 4BJHB 4YJGB 2Z3VA 2IDZA 5D1NA 5LA6F 3SR4A 4R2MA 5HXAA 2JLXA 4BNGA 1Q11A 2F4VB 5NLLA 3GJTA 1EBFA 2O6LA 3MJRA 3BCSA 4BFWA 3RJZA 1X1CA 4YFYA 1JWBB 4FOPA 2AK3A 3VO1A 4D6PA 2O5VA 3GQBB 2YHBA 3AL3A 4IH1A 3TPCA 3PX3A 3PTLA 2Q3LA 4IDOA 4TV9B 2F48A 1PQWA 4LXGA 1TKRA 5KNBD 2BWJA 3NU1A 2C7QA 1Z6GA 4PBTA 2FR0A 3BB1A 1NMYA 8ADHA 3TRKA 4XRRA 2QLJA 3FMIA 3NANA 3ANTA 5E3IA 1EK1A 4E5UA 3RC8A 2YN0A 1IOLA 3ENVA 1TGVA 4AS2A 4NCKA 5LOVB 1KEEA 1QVRA 1E2LA 4UQLA 1R10A 4GXTA 3A6LA 5T6MA 4O4JF 4OP1A 5E3HA 3FF1A 2VZ8A 1FQKA 3T41A 3EIXA 1XZAA 2PMFA 2YXBA 1MF7A 1JDBC 3DJYA 3TKLA 2JFXA 4GPBA 4N5NA 4JR2A 5E7IA 3U4HA 2HHLA 4JYZA 4OLBA 2HFJA 3HCOA 5CFLA 3ITEA 2GRAA 4W5HA 4TQ9A 1UBKS 1NJ5A 3EY4A 1CY4A 3JR3A 4H60A 5FD8A 3GRPA 4U2FA 4EPWA 2XXBA 3MUEA 4CTJA 4FFPA 1NQ5A 2UVPB 4POAA 3U9SA 2WKPA 4DJTA 4UUNA 3D8NA 1XAGA 3ND5A 2YCLA 1IN7A 3MUOA 3K9HA 4LHZA 3OCVA 4MYRA 3V7FA 4B4DA 4C21A 4BO9A 2HDHA 4U7HA 4D0GA 2DFLA 2GPJA 4PPQA 4MPRA 1N0IA 2QYOA 3KPJA 1QRDA 3GJRA 2I55A 3ZEIA 2HZBA 2OGUA 1PG0A 3IAM6 4AF8A 3ZJUA 1JRLA 4H4EA 5GPBA 4FNGA 1C5KA 4RAOA 1RLMA 5B64A 4N0QA 2YHSA 4XLZA 4AUNA 4DJDC 5JZSA 1NBAA 1V11B 2FGJA 2GAIA 5CT9A 4LMRA 1LRJA 3WGKA 4G5OA 3KWJA 1G60A 2QENA 3QMPA 4H0FA 1DXQA 2AF4C 2WIAA 2NVWA 3E8MA 1D4OA 2CDBA 4ZAZA 3TW8A 5B3JC 1KK2A 3FTNA 4ZHQA 1GCIA 1DIAA 1Y89A 1U8TA 1Y8QB 3IAFA 4BO6A 2NGRA 5GONB 5K51A 1SUCA 1ZH8A 4P4NA 3UJ7A 3V4RA 4IXDA 4JXKA 1N7IA 2O4CA 2QF7A 4ZICA 2BKXA 2Z58A 2EGUA 3ILYA 4N8SA 4MQBA 3SCZA 3FCYA 5KNCA 4NXNB 1LLQA 1KYQA 4LVNA 1ZH2A 5AXBA 4KYTA 2OWDA 4P32A 3K6JA 3IP7A 3R3HA 3WY9A 1R9NA 4HGYA 3GRKA 3K16A 4RSHA 4WOKA 4MP8A 1EFPB 2Z6UA 3DWFA 1XTJA 4CBVA 3ROFA 3HWSA 3QV1A 3UAZA 2YC2C 3E84A 5JD3A 1R6TA 4BBPA 1AVTA 4R9NA 4TL7A 1DT5A 2ZJFA 1F8UA 3PEWA 3A26A 4JLOA 2DOKA 1RAIA 1G8GA 3J80A 4G56A 3HRHA 4C4AA 3ZV3A 3QY9A 1YGPA 4PAQA 1GO2A 4TMYA 1OI2A 1RABA 4MCIA 1FRZA 1T5HX 3GUYA 1T36A 2P68A 4M1TA 2VYNA 2ZB2A 1Q6ZA 3UCFA 4RADA 1XN4A 4NZMA 1VHTA 3E3NA 3P27A 5DNUA 3HY4A 2Y0EA 4NC9A 4U7TB 3MPOA 3W3AA 3M1LA 2Q7DA 1F6DA 5EXXA 4CM4A 4V1CB 4LF4B 1YTUA 2OK8A 1N2BA 1GYRA 3ELBA 2Q6OA 2Q3FA 4X1YB 4R98A 4DT1B 5DT2A 1NJ8A 3E4CA 4V0LA 1N2GA 3S2YA 2PZAA 5JDIA 3KEGA 5FPYA 5SYNA 5H4GA 4WFQA 4LK3A 3V3TA 3G85A 2W11A 1W34A 3ZXUB 1WBDA 5ECDA 3PLAE 1DO2A 2VCEA 2YDYA 3EBLA 5DI3B 5GAJA 1PFQA 1NJSA 3FTPA 4D45A 1ZMTA 3QHPA 3K6SB 5HILA 1F2VA 1LX7A 3DLTA 3PSAA 4MRAA 5H5JA 1RBMA 5C2JB 2EKQA 4JA0A 1IM8A 1RR6A 2Q46A 1W581 1J0CA 2MHCA 4K6FA 4R8KA 3IBGA 5FEMA 4KR9A 4M99A 2WV9A 5AHXA 2W2PA 4R1NA 2QR2A 2Z08A 3B7WA 1PJ3A 1ZS9A 3AF1A 3D7SA 1SVSA 3N2YA 1VP3A 4FQ8A 4OHFA 4BXOB 2N47A 2OZVA 3SG0A 2H7XA 3HGTA 1RWXA 2GM4A 2YRXA 1ZY2A 5ALPA 3T5MA 1CR1A 1UDCA 4B4VA 4MUHA 1EFKA 3FUVA 4PRZA 2DLCX 1NXOA 1AGNA 4IUBS 1NW5A 3N2KA 3QK7A 4O4IB 4AQ7A 1FMJA 4JWKA 1RI2A 3M83A 2C9MA 3W79A 1IHXA 3OQOA 3IJ5A 4ILKA 1U81A 1AZLA 2FKAA 2GAOA 4RANA 4QUKA 2R1VA 2WMYA 1G98A 1V3QE 4QULA 1GAWA 4F3CA 2XF8A 4YJ2F 2FFQA 3FWNA 4HB2A 4KPUA 4NYIQ 2ZQ5A 2ZJ0A 1IHDA 3QNMA 4FYVA 4B71A 5KJ1A 2XCLA 4GLLA 2VK2A 3P2MA 1ZA1A 4H0CA 4KCGA 2B7BA 5CMLA 5DBGA 5AP9A 2LRHA 3OKAA 4BKRA 1KEZA 2O4UX 1BOFA 2ADFA 2IS1A 5F9FA 1OROA 3WWCA 3NT5A 1AKUA 4KUGA 2P0EA 4ZARA 4HS4A 2ZRBA 3CU5A 1WUIS 3QF4B 3SLKA 1RCFA 4IR7A 1C0PA 2FNAA 3B1VA 4KOEC 2VHZA 2G3YA 4WK0B 5TIIA 4II7A 2XVAA 2YY5A 2I4OA 2WC1A 3RYCA 2P8SA 4HHEA 1EG7A 5HIJA 1GT91 1W0KA 3AJ8A 3DV9A 2Y1LA 4G8BA 1YB4A 4WVFA 3HA2A 4FYMA 2OO7A 4K9DA 4CQLB 2AUTA 1I5RA 3DT6A 4BJ5A 4CKEA 5E6UA 3SIPA 3WLNA 4DXAA 4MS1A 5AOCA 1L3IA 1P1JA 3RSHA 2R96A 2X5OA 2VHEA 3PUYA 5JWOA 2P4SA 1U9IC 3PK0A 2PZKA 1MA0A 5CPBA 3HXQA 4GZ5A 3ZDAA 1GEGA 1L4LA 1I13A 2QE7D 1BWSA 1KR5A 2CXSA 1KO5A 1U28A 2AZDA 2FPIA 2JLCA 4Z99A 3C98A 1P2VA 3M2PA 4FMDB 3IVAA 1OYOA 1OI7A 4JP2A 4Z54A 6LDHA 3PX7A 4ZOLA 1YZLA 3JPYA 4L22A 4CFZA 1G38A 2ZXFA 4R2KA 3DF9A 2W83A 4MINA 1SD2A 3SFZA 2CLOB 3D6TB 4FZ3A 1GZ6A 5EMKA 4MJ3A 2OD9A 3H2BA 2ZJYA 3QFRA 1EG2A 2AI1A 3QQ5A 5B4TA 5LYJF 5K2OA 2PUCA 2A9FA 1CKEA 1EAMA 1SK9A 4FI3F 2V7BA 4MQLA 4NPCA 2GA9A 2GCNA 5KYKA 1KGDA 1KPIA 1JT9A 1XMJA 2D0DA 4CEIB 1I30A 4UDNA 3UWPA 3CKKA 5F78A 1I2MA 3UB3A 3JSXA 3MTQA 1LH0A 3I30X 4IIUA 4QEDA 1ICIA 5E8RA 2PKCA 2XIQA 2WWGA 3GLHB 1IK6A 1KO4A 1YS2X 1IWPB 1O4VA 1NL3A 1CJTC 1KFBB 2OORA 2VSNA 2WUGA 1U7ZA 1ZVVA 1CQIA 2PMCA 1T10A 1GPAA 2G72A 2P5YA 3BWBA 3ETCA 3H0EA 5BO5A 4XVUA 4D3YA 1E7QA 5KKAA 1I1OA 3W2EA 3IB3A 1A4XA 1HE5A 2D5BA 3FVTA 3QPVA 4FT2A 4UUQA 4ZVOA 4EF4A 3KELA 1PR9A 1U2DA 4PGGA 5EIXA 1PG2A 5HJ5A 2F8SA 4YIKA 3CONA 2ZUSA 2OV8A 4O2BA 3EWAA 5ER9A 4MV4A 5JSYA 2VBFA 3ZHRA 1VJ1A 4RS4A 2X0NA 3GNTA 2ZT5A 3PIIA 1J07A 5K0CA 3ZWDA 1G7TA 3NRJA 4P7FA 4QU8A 4FK8A 1QHXA 5KWVA 3I73A 4FOSA 3FTCA 2QVXX 4MUYA 1HDZA 1RHQA 2PL5A 2GT1A 3DP9A 3ID6C 4MR9A 5BOVA 4W5OA 1JB1A 4LRUA 2F1HA 4YLEA 3C6YA 3MJ4A 2YS6A 3HP4A 4BGDA 1C7JA 3D1LA 3E2IA 3JZFA 1W4ZA 5K0FA 4G0VA 1Z18A 5L6LB 1X1RA 1GKIA 2C5EA 3QW2A 4L57A 1Y34E 3UBMA 2JCSA 5A0TA 3TMKA 2V4MA 4ZCQA 3UJ9A 4D0SA 2BI4A 1GV1A 1USGA 2ZRNA 5E9JA 1PFWA 4V0NA 3U7RA 2IPMA 1W6RA 5UKDA 3FB1A 3KTAB 4LV5B 5KQPA 4GBGA 3OX4A 3S40A 1QLWA 1M2WA 4DNQA 3T52A 2VK4A 1KAQA 1B0ZA 1EM8B 1II0A 4RFSB 3TOVA 2J6BA 3A4VA 3OQBA 4IDHA 1J70A 2ZAIA 2H1HA 1EDOA 4WASA 4DBZA 5A5EA 5FR1A 4X60A 4BMDA 3G1UA 5D3QA 4MDFA 3PPYA 1CP3A 1SCAA 3GOHA 4PHHA 4DKJA 3WHIA 4UM9B 1KZGB 1VB3A 1J49A 4GE0A 4J16A 3TJRA 4R54A 2DJ5A 3HCFA 3PZBA 2J33A 3CF6R 2B21A 3MJVA 1K5DA 2BFDA 4R6WA 4E6PA 1I7QB 3JQ7B 3COPA 2RHLA 3TR0A 4UTNA 3W5JA 3MINA 4NMHA 4D8TA 1ZZGA 5MDHA 5HCUA 1KY3A 5I5GA 2B4TO 4LKOA 3ICWA 3WIEA 4AJPA 2HZ7A 4JBGA 2RI0A 2YVKA 1KJZA 2AIRA 2PH7A 4FLEA 1XLTC 2I1VB 1OAOC 3FGPA 1C3XA 4C7OB 2Q1YA 3DFUA 4ZXFA 4ARBA 1UBUS 3QVMA 1L5HB 221PA 4D9CA 4C14A 1P74A 1UKYA 1LW7A 3A05A 4OGLA 2IH4A 4AC9A 1P29A 3AF4A 1YK1A 2ECQA 2B1QA 2H2FA 2R1TA 1RW4A 4M8NE 4EI2A 2HGSA 3LVRE 4EI8A 1NRXA 2CL6X 1X38A 2G4CA 2ZRHA 1JSZA 4KC0A 2JKYA 4ZAXA 4IFEA 3DMGA 3QYJA 3HK2A 1EP1B 1A7UA 2N42A 1NMQA 3IVCA 3MTEA 3L8YA 3IT2A 3MTJA 3Q7TA 3OIDA 4IHJA 2V8OA 4LYDA 4TVKA 1WETA 3KQUA 2OBLA 3DHWC 1JIIA 3RS5A 2H06A 1RLIA 1J2YA 4FGWA 4AJNA 4D99A 2H16A 4IDEA 3OPMA 1JDSA 1L5MA 2WF6A 1K4YA 4LXHA 5IXYA 1QH8B 2QDKA 1I4EB 1JDPA 2J5KA 3D6AA 4PNZA 4JI3B 1LSSA 4EHAA 4YAWA 1NULA 4WXEA 2O8NA 2OBMA 3HMKA 4QUDA 5TF0A 1ECFA 4HLUA 5FLYA 2OFFA 1O94A 3S2UA 1TO1E 3HYLA 4IG9A 1XEXA 1YCHA 1YDGA 4V39A 5HNKA 4LJLA 1SIWA 4UHDA 2MCFA 5MHTA 3ZHYA 1HG1A 1W52X 3D1JA 1IFXA 2FTKE 4MCHA 1H85A 1UQTA 4QFCA 3AIIA 1P9WA 3H1AA 5H3LA 3FM9A 4LA4A 2H9YA 3UCEA 1PRYA 1L4FA 2BSXA 2Q1TA 1QDLB 3AYXB 5FBHA 2OXRA 3MAGA 2HV8A 4F1WA 4JI1B 2GBLC 1V1JA 2IEGA 1KETA 2R25B 3HI6A 3HNPA 1S89A 4ZKEA 1OX4A 1DRUA 4CKWB 1OBHA 3NWBA 5K8LA 4JGBA 2Q1SA 2XLBA 3WDKA 1UWVA 1AZTA 4IZIA 2OUIA 4WN3A 1KJNA 2VYFA 5KOHB 5BN1A 4KL8S 4QT4A 1S5PA 2XITA 2LGJA 3EB9A 1TAGA 1JTEA 4KQKA 4QHSA 4FUQA 1AHNA 1ZI6A 3DZIA 3GD5A 4L5AA 5BPHA 4TZ6A 3THYA 2ZAMA 1O0CA 2H4YA 1T8TA 2O8DA 1O03A 4MS4B 4WTOA 4DA8A 1H8ED 3I53A 4KI7A 3WAJA 3BX1A 1B8VA 2VTBB 5T5QA 4E11A 4HNAA 3O3MB 2CW5A 2ES4A 5G0WA 3MXOA 4ZQIA 2P3SA 2XDQA 3SZOA 2JJMA 3AY0A 1W4LA 3MWEB 4YX9A 3R5FA 4EYOA 2F3RA 3D0RA 1VQ1A 1LLUA 2C83A 3A37A 4O2RA 5CGQB 1Z16A 1PUJA 5FIUA 4WX2B 3FHLA 3V2HA 4M0LA 3DDWA 4NU5A 3WMWA 2P69A 1QONA 2PTHA 4KLCA 1ISHA 3PJGA 4JYBA 3JQ9A 4PFKA 5IDVA 2H48A 1RQPA 2JGIA 4HDSB 5K6AC 3KOUA 1ZGBA 1A9ZA 1DBWA 1NVDA 1SCQA 4ZVSA 4HQRA 2C8JA 3U17A 4K6CA 3AUXA 3ZWQA 3VDQA 3D3QA 3VR5H 2CMKA 2ACEA 2ZITA 5E3JA 2ZJ8A 4TTAA 2UZ0A 3ZQJA 5BWLA 4HN2A 4IV0A 4ZVPA 4X6YA 2ID8A 5KOJA 3OMXA 3NP9A 3M4XA 1TT5A 4DY4A 2QBYA 3FD8A 1PN3A 1RAAA 1OLXB 1PE0A 1PNTA 2IY9A 3USCS 2VAMA 4KIUA 1U3FA 1GNTA 1SOVA 4DZZA 2M6LA 5T7BA 1MX3A 5CFRA 2FX2A 2VPQA 3KDPA 1UK6A 1OFHA 1QGOA 4GG1A 1N9GB 2YZMA 3KM0A 4OB6A 4ZYWA 1UZNA 4Y6LA 3OF3A 4ISCA 1OZGA 5LQCA 4L7VA 3WIOA 1QM5A 4M8IA 1ONSA 4PINA 2RGDA 2ZGVA 4QRHA 1SHLA 2OVBA 3GJZA 1K4MA 4L2IA 1TYDE 4ZQCB 1CNEA 4R4JA 4J7AA 4XTCS 5DYWA 2QTZA 3IB6A 3VKWA 2FZ4A 2OCGA 5JCOC 1XNRB 2NOAA 2WWHA 4GOJA 2C94A 4HUJA 4KGZA 2YJ5A 5LQKA 4KN8A 2GO1A 4EFMA 4UAUA 1RIIA 2IZ6A 4N7RA 4EELA 3T9CA 2JJQA 1EVYA 1NVGA 1Z8HA 4MR8B 4EITA 2QJRA 3BHMA 3EF0A 1L2TA 3IS3A 2QMUA 3HV2A 1G64A 1U8EA 3GLTA 1USIA 1BD4A 4C6TB 1LDEA 4DV4B 2ZZNA 1LF5A 3KZMA 5F3RA 4FR5A 4TVSA 5K0JA 4O8ZA 1OWPA 4DUGD 5J23A 3CNLA 2PGLA 4DUPA 1CF2O 5LNK6 2JLVA 1RFLA 5KVAA 4FLFA 2GK7A 1B1AA 1F7UA 3G8AA 3TLGA 5KYWA 1UZAA 1DT3A 1EEHA 3EW9A 5AD1A 5AUPB 3NKFA 3PR3A 4IRXA 1L5SA 5HGJA 1UKCA 3AB3A 4JBWA 1FVHA 5E7JA 3WX0A 4HMQA 4BEJA 3THXB 1OFVA 2WJAA 5DGDA 6AT1A 3EUWA 4UPVA 1S9HA 4J1SA 3UPTA 1NFQA 4CMGA 3P4YA 4ZVUA 1N0WA 4LVOA 2Q0QA 2FFHA 4QYIA 5FOWA 5BN3A 2VIIA 3FOWA 3F3YA 3QU7A 3L4SO 3O4GA 1M34E 1Y80A 3ZDEA 3BDIA 5SZIA 1JEDA 1KSFX 1G8KA 2XWJI 4L07A 1FNSA 1NQTA 2CHFA 1LVHA 5C5IA 2CWDA 1V1RA 2NUTB 3GN2A 1Z2CA 4ECAA 4WERA 2VDJA 3H19A 3L8DA 3WB2A 4Q47A 2R6JA 2WRZA 1QRSA 3D7RA 3QV2A 3ZY4A 5HQ3B 4PFSA 3UPUA 4RACA 3W78A 1ABEA 1UC9A 3U60B 5KYNA 2LW7A 3ND6A 1UC8A 1YH3A 2NZXA 5EESA 1TAHA 1XMIA 3COSA 3DEZA 4V0OA 4OYHA 3VR4H 3M6IA 3M6AA 4EJFA 1KMNA 1VG0B 2WG0A 2AEFA 3OF2A 1GZUA 1DLJA 1POWA 4YRSA 4FQ7A 1QCDA 1W4RA 2PU7A 2AYZA 5HW0A 3NKLA