2PU7A

Crystal structure of s112a/h265a double mutant of a c-c hydrolase, bphd, from burkholderia xenovorans lb400
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
283
structure length
283
Chain Sequence
LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNAMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGAWAQWEHADEFNRLVIDFLRHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
publication title The Tautomeric Half-reaction of BphD, a C-C Bond Hydrolase: KINETIC AND STRUCTURAL EVIDENCE SUPPORTING A KEY ROLE FOR HISTIDINE 265 OF THE CATALYTIC TRIAD.
pubmed doi rcsb
source organism Burkholderia xenovorans
total genus 107
structure length 283
sequence length 283
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pu7A00
3KD2A 3VISA 1BRTA 5AK6A 2JGKA 1MU0A 1CIJA 5F4ZA 2CMFA 4Q1VA 2WUGA 1VE7A 3NWOA 2H7CA 1YAHA 3S2ZA 2O7VA 5CH3A 1UWCA 1YS2X 1YS1X 1CLEA 3G0CA 5BV7A 3FLAA 3I2FA 3I1YA 4G1FA 5IVDA 2XUOA 1A8QA 1ORWA 3DDUA 2OCKA 2FUKA 4OCZA 4OYYA 3ZI7A 1HPLA 4P92A 2Z8ZA 1TIBA 2E3JA 4C88A 1THGA 1E8DA 4P93A 2WM2A 4F21A 2X8BA 3VJMA 1P0PA 3D2AA 3D5EA 2FX5A 3QVMA 3VXKA 3OTQA 5JALA 3DKRA 4NMWA 2RHTA 2AJDA 3QMWA 2I03A 1Q84A 1EVQA 4J0DA 1IUPA 1MN6A 5LZ4A 1L7RA 1SOMA 5AKXA 1CUBA 3ESAA 2RAUA 3WZMA 3G8YA 3A2MA 3I6ZA 2BUAA 4UBOA 4D9JA 1N5RA 3MVEA 5FV4A 3DJYA 1GKLA 3OPMA 5EI5A 3G9TA 1VA5A 2DQZA 1XZLA 2AXEA 1BEEA 1XZKA 2O2IA 3DOHA 2JIDA 3GA7A 4BC0A 2CUTA 2RGUA 5ESRA 2WG0A 1UOOA 2XUKA 2DHCA 1QIFA 5CT4A 3GZJA 2BGNA 1LPSA 3OC0A 3C43A 4C87A 5DNUA 1IUNA 3G9ZA 3L1JA 4MEAA 4H18A 5K3FB 4EZIA 1B6GA 3AINA 5A2GA 4OSEA 5K3AA 4AX4A 4W63A 1YA4A 3IA2A 3FYUC 2WTMA 2Z8XA 5J3JA 1G42A 5ALOA 5DLPA 4WDQA 3R3UA 2WIDA 4LYDA 2ECFA 4Q82A 3VJLA 4ZWNA 5C7YA 2WU4A 1H23A 3I6MA 1ISPA 3HJUA 4DNPA 1UFOA 3H1BA 2PVSA 5HKBA 2QS9A 3OURA 5DTJA 4ZRDA 2X76A 3DS8A 3D59A 3QM1A 4N8SA 2QT9A 2VJAA 2WG2A 1RYYA 1DX6A 3FSGA 3WYDA 3RARA 4QZVA 1CFJA 4FBLA 1ZI6A 4AMYA 2YH2A 3RK4A 1CVLA 1QO9A 2XB6A 1ORVA 3WL8A 2VATA 3PI6A 4I19A 5LIPA 2I3ZA 1ODSA 2AJBA 3WIBA 2Z3ZA 1E8NA 2YASA 5BWCA 1CR6A 3OM8A 4X7BA 2PPLA 1MX5A 4LXGA 1PJAA 1TQHA 5AI9A 1XQXA 2ZSIA 2LIPA 3WMRA 1YA8A 4FKBA 4QDXA 4K2AA 4X97A 2OQVA 3ESDA 4CG1A 1EDEA 5SYNA 4RE6A 4UUQA 1E3QA 3OG9A 3WKBA 1R88A 4G4JA 3H19A 1P0QA 5ALUA 3HSSA 4GHWA 4UBKA 5JAUA 3IB3A 5EIAA 2H9YA 4HRXA 3ZWQA 3AFIA 4I4CA 3V9AA 2QXTA 3WK6A 4L0CA 1YASA 1NU8A 3MGAA 3WL6A 4ITVA 4AO7A 3EQ8A 2VT7A 2HM7A 5K3DA 4OB6A 4ZGBA 1WB5A 1MJ5A 1XKLA 3DL4A 3ZLVA 3LLCA 2DCMA 3H2IA 1WB4A 1ZJ4A 4Z49A 3A6ZA 3CCCA 1AQLA 2DHDA 5I7UA 3UUEA 1JJFA 1Q0RA 1EK2A 2QM0A 3T4UA 1IZ8A 2BUCA 4BB0A 4UHFA 4WFIA 1ZD5A 1N5MA 1J07A 5C8XA 3FVTA 1C4XA 2XUPA 3C5WP 1W1IA 1UKAA 3E1GA 1WPRA 2B20A 2W6CX 1XZCA 5ALEA 4J0GA 5CH5A 4U2GA 5AKGA 2XMZA 3C6XA 4LXHA 2Z5GA 1CQWA 4GBGA 4GECA 1BROA 4W9RA 2HHAA 5CRIA 1S8OA 3BDVA 1QIMA 2ORYA 5JATA 3W2TA 5CBKA 7YASA 1QO7A 1YCDA 3ANSA 3V1MA 2OAGA 2WIGA 2VJBA 5ALVA 1A7UA 1Z68A 1J1IA 4BAZA 2QJRA 3BL8A 2WIJA 3IBTA 4MQMA 4C4YA 2WIKA 1IMJA 3ANTA 2J4CA 3G9XA 1LNSA 6YASA 4UBMA 3BE8A 4ZXFA 5LLSA 5JD6A 2XMBA 1DWQA 2WFZA 1JMKC 3STXA 3IURA 1M33A 2XQGA 1YB7A 1J2EA 4NZZA 1D07A 1X70A 4KE6A 3I6YA 3BF7A 1EHYA 3FAKA 5ALGA 3R3ZA 1ODTC 5BWBA 2C5FA 4Y2RA 3RKSA 5ALZA 2XMQA 4BATA 5KBYA 2P8SA 3AZPA 3D2BA 3H2HA 4AQDA 5IVKA 4G5XA 2PSEA 4QA9A 2IIVA 3I2JA 3C8HA 2AJLI 4INZA 5ALTA 1VJ5A 4H7JA 5KWJA 5CT6A 2EDAA 2X5XA 5C8VA 3D3NA 5ISMA 1IUOA 2QJWA 5AI5A 4FLFA 3D4LA 4FBMA 2WHRA 4AO6A 1ACJA 2VA9A 1GT6A 4G8CA 5ALRA 1LPAB 2WG1A 3H1AA 5AKIA 4A16A 2XQJA 2XUAA 2DSNA 1AGYA 5AM4A 4TGLA 3DOIA 3BIXA 1F0PA 4OB7A 3O4GA 1W4LA 5KWIA 2OAEA 4Q3KA 5LZ7A 2GZRA 4DNQA 4B0OA 4X91A 5K3EA 5CH8A 3F67A 1K4YA 1LPOA 4E14A 1QLWA 4KJXA 4BE4A 2XLBA 5D3KA 4MEBA 3EBLA 1BN6A 3FWHA 1XZMA 4HXFB 4BVJA 1QZ3A 1FFDA 2ACKA 3X3HA 2WUFA 2OXEA 1VZ2A 5A62A 4XX1A 3WIOA 4C4XA 1QFMA 3KWJA 3HYSA 3EQ7A 1ZD3A 2VJCA 1WHSA 2HA7A 4BAGA 3GUUA 4MYSA 2JGIA 2XMGA 1CEXA 1AKNA 5ALXA 5ALQA 5D7BA 5AJHA 4MQLA 5AM1A 5D3ZA 3EIOA 1BCSA 1CUUA 4ZI5A 4XWGA 1QTIA 3H2KA 3WA6A 3M83A 3FYUB 4J0HA 4V2IA 5AICA 5E4JA 4Q3OA 3R3VA 3FLBA 1XZHA 2BGRA 3NGMA 4UPDA 2CB9A 4KACA 3STUA 5CT8A 5JD4A 2AJ8A 4HS9A 2CKMA 4AXBA 4OD0A 4QE3A 2OGTA 4UFPA 4G8BA 3N2ZB 1GQSA 4H7KA 1XRLA 5HF9A 5AOCA 1K8QA 3WA7A 3WL7A 3WK9A 1XZDA 4QDTA 4DMKA 1PFQA 4X92A 3Q8WA 2QUBA 1ODCA 1VE6A 2NW6A 1SCKA 1AURA 3WKDA 5ALPA 3AIKA 2Z3WA 3PUIA 3M3DA 3ZLUA 4H7DA 4W1PA 5KREA 2C4HA 3I2HA 4Y2JA 1H2XA 3WK4A 4B82A 3SK0A 4B81A 3F8SA 4LIPD 3NUZA 1VOTA 4F60A 2OCIA 1EVEA 1XKTA 5A6VA 1QFSA 1XLVA 3BF8A 1R3DA 3PUHA 2RONA 4QDZA 5JD5A 1CUVA 1L7AA 2CBGA 5FP0A 1VZ3A 3BDIA 1CV2A 1CUAA 4P9NA 4FOLA 4EBBA 4CIBA 4HZGA 4WY5A 5C81A 4BTVA 2GYUA 2PKYX 4EB0A 1MX9A 1UOPA 4B85A 3F97A 1QIIA 4C4ZA 3A2LA 1H22A 3FCYA 3HLKA 4K6HA 5JANA 4U2DA 3STTA 4BE9A 2VEOA 3IVMA 4Q05A 2G4LA 2WHQA 5JYCA 1N8SA 4Y2PA 3Q0TA 1BN7A 2WFLB 3PFBA 3UMJA 3V1NA 2XUQA 1T2NA 1E89A 4PO3X 3U0VA 5JZSA 4J7AA 4RGYA 1DT3A 1KU0A 5FPPA 4Y2TA 1XQYA 1PV1A 3JYHA 4H7FA 4BZZA 5LZ5A 1SFRA 3AZOA 2WU3A 4FMPA 1XZBA 4B6GA 3WZLA 3KXPA 4FTWA 3FYUA 2HFJA 1T4MA 2FJPA 2HFKA 4QWWA 2QUAA 1WM1A 1GPNA 1JT2A 1BS9A 2XI4A 4DNOA 3O95A 4G9GA 4DSZA 2GBFA 1EXWA 1FJ2A 5HFNA 2HA2A 1YSCA 3LCRA 5A71A 3WWPA 4RNCA 3QBJA 4OUKX 1XROA 3ICVA 3DKKA 1EINA 4WFKA 1JU3A 5AKLA 3W06A 4BDTA 4GW3A 1OXMA 2XMRA 2YXPX 1UKCA 3B3QA 2CEKA 4G4GA 5BOVA 4BVLA 2OG1A 5EIHA 4MWTA 5DNWA 3WK8A 2Y6VA 4F5ZA 1W6RA 1P0IA 3WL5A 2G5PA 1DTEA 1QTRA 1AUOA 3O0DA 3AILA 1ZGBA 1E5TA 2XUDA 4KR0A 4EY6A 2HADA 2XQIA 2C58A 1P0MA 3WWEA 5FKJA 4PSDA 4YX9A 4X94A 3K6KA 3DYIA 3ICWA 5DYWA 1WOMA 4J03A 5E4YA 3VKFA 3WJ2A 5FLKA 3TGLA 3STVA 4QDUA 4W1RA 5ALDA 5K5EA 3BXPA 5HQ3B 1FFAA 1ZIYA 3FVRA 4PW0A 2QMQA 2QKYA 3DCNA 2JEYA 5CXUA 1CQZA 3AJAA 1HDEA 5IH7A 3W05A 3C6BA 1LBTA 4HXEB 1EI9A 1EA5A 4E15A 5EHNA 4CCYB 4BTLA 5LYYA 1E8MA 2JGMA 1XZAA 1EB9A 4DLNA 2V9ZA 3QPDA 4Y2VA 5AP9A 4DMCA 5FDFA 4FWBA 2QOEA 4X95A 5DTIA 4AZ0A 2DQYA 2O2GA 2VAVA 4A5SA 4J3JA 1RWQA 2GYWA 4UBNA 4UHCA 1Y7HA 3O4IA 1MNQA 1Y7IA 5FUMA 4WDRA 5ALSA 1I6WA 1MX1A 5AM3A 3V1LA 4FFVA 1XZGA 1MT3A 4BZWA 1AZWA 5ALWA 5LZ2A 3L1HA 4W1QA 4RE5A 4PV7A 4ZV7A 1TCBA 1Y37A 2AJCA 2JBWA 1H2YA 5CT9A 4JNCA 3KDAA 4NVRA 1W52X 5K3FA 5CXXA 3GBSA 4RPCA 2HA6A 3H2GA 5DJ5A 2C7BA 2WHPB 5LP1A 2JGEA 5HKAA 2XDWA 4PNZA 2OCLA 4F0JA 3M81A 3P2MA 3ZLTA 3HRHA 1QIEA 5T4BA 1H2WA 1TRHA 1ZD4A 2DFPA 3CXUA 4L9AA 3TRDA 2XUIA 1YB6A 3VJKA 4DSAA 1XZFA 1B41A 3HXKA 3I2IA 3WQHA 5K3BA 3GFFA 1ETHA 1KEZA 4X6XA 1YAJA 2PL5A 3GELA 1DT5A 4EA6A 2BAGA 3I2KA 1TCCA 3BWXA 1CUSA 3PFCA 1MAAA 1A8UA 1TCAA 5AIAA 2WQZA 2WTNA 5JASA 4DM7A 4IO0A 4H77A 4CFSA 2CZQA 5ALKA 2Y6UA 1NU6A 4QLOA 3PDCA 1R50A 4C6HA 4EHBA 1DWPA 5SYMA 1UXOA 5JAOA 5AI0A 5LKAA 1U8EA 2IX9A 4FLMA 5AM5A 5FRDA 3WWOA 1JI3A 4KRXA 4X85A 4FNGA 4GWLA 1CUYA 3ESCA 4KE7A 4AN0A 4M0EA 4HAIA 4TVKA 3R3WA 4W1SA 1GKKA 1UK7A 5AOBA 4Y7DA 4Y2SA 2RIPA 2B61A 4U2BA 1LPPA 1ZOIA 1ZICA 1OILA 5AK3A 3DEAA 3E3AA 5EGNA 3QZUA 3G0GA 4JYMA 4KAJA 2XUHA 2RI6A 2Y2UA 4KAFA 2V96A 2I78A 1OCEA 1QJ4A 2H7XA 4AZ3A 2XUGA 3F98A 3BJMA 3DLTA 2WJ3A 3DD5A 4AMZA 1LPNA 1MNAA 4H7IA 5FPQA 3E0XA 1O6GA 1ZI9A 1CUWA 3R3XA 5E4TA 3UUFA 3AIOA 3O4JA 1N1MA 5AK5A 4L72A 4PF1A 3F96A 2WHPA 4B83A 2HU5A 4BBZA 1XRNA 3SWWA 3OOSA 1QIKA 3I28A 1LZLA 1HL7A 4J0CA 3WYNA 1BEZA 5JAHA 2XE4A 3G0IA 1XRRA 3ED1A 5AK4A 1H2ZA 3C87A 3H17A 5K3CA 5IVIA 4S0XA 4X3CA 4KEAA 1GQRA 3U1TA 3R3YA 2Y2VA 2HL6A 1L7QA 1UT6A 4XJVA 1AC5A 3SX4A 1ZJ5A 2OCGA 4ARAA 5ALFA 4GXNA 1K6EA 4QDOA 3C45A 3HZOA 4HXGA 1EB8A 2CJPA 2WJ6A 1JKMA 2GZSA 3NOXA 2ZYHA 1XRQA 4UFOA 1MTZA 2JF0A 3QITA 5AKYA 2PM8A 2OPHA 3HI4A 5AKKA 5AO9A 2QZPA 3D0KA 1GZ7A 4QWMA 1BU8A 5ALLA 5DYYA 3W04A 3E4DA 3LS2A 2JGFA 1U65A 1LZKA 3C6YA 4WJLA 1LPBB 4KRYA 1LBSA 2GBGA 5FOQA 2OGZA 4H0CA 2PSFA 2I3DA 1VXRA 3I2GA 3H2JA 2QRUA 2G5TA 1LPMA 1O6FA 1CUGA 4UHDA 3O9MA 4JYPA 4UFNA 1G5FA 2V97A 2ZJFA 3FSGD 5CMLA 3AIMA 2ZJ7A 4NS4A 4BAUA 2ZSHA 3M82A 1ZD2P 3O9VA 4J0JA 4HVTA 4N5HX 5AH0A 5HZGA 4UHEA 4J0KA 3IUNA 2ONCA 4OYLA 2BCEA 2QR5A 1QIGA 1YR2A 2WKWA 3H0CA 1JFRA 4E46A 1XZJA 2K2QB 3DQZA 1GGVA 1A8SA 3W9BA 5HCUA 1TKRA 2G63A 1C7JA 5T4EA 2HA3A 2ZYRA 5EIEA 3C8DA 4OU4A 4JEIA 4EY4A 3ILSA 2R8BA 4UBJA 5ALHA 5T4FA 3N0TA 3D2CA 2OQIA 2PSHA 5HF8A 2B4KA 3BIWA 1DQZA 3IUQA 3QMVA 4B7ZA 4B9AA 4YPVA 1GXSA 2HDWA 1QIJA 3PF9A 5CT5A 5IVHA 1RP1A 1UOQA 4DGQA 1LLFA 2PSDA 1LGYA 3QPCA 3HEAA 1CRLA 4BCCA 2VJDA 2ZJ6A 3HC7A 2XMCA 3DYVA 5JZ9A 1UK6A 2B9VA 4H35A 4FDMA 4G4IA 3HABA 5A7FA 3A70A 5H3HA 1FSSA 1Q83A 4LHEA 1DX4A 5AKJA 5AKEA 4CI9A 4X71A 4DNFA 1JJBA 2QVBA 2FJ0A 3DL7A 3FYTA 4B0PA 1G66A 1XRPA 2XUJA 4X6YA 5DYTA 2XT0A 5A7GA 4CG2A 1THTA 4XVCA 2IITA 4X6UA 4EUSA 1CUDA 4KYVA 1UK9A 3TJMA 1JJIA 2HA4A 2XMDA 3KOOA 1CUCA 1G4HA 3K9BA 4OB8A 3RM3A 4GEGA 2HRRA 3H04A 2PU5A 4KE9A 2GBCA 3V48A 2O2HA 5JIBA 3V1KA 4WY8A 3WK7A 4K6GA 4Q3LA 1HBJA 1QIHA 2PSJA 2DHEA 4KE8A 3JW8A 4Y2XA 2XQFA 4A23A 1QONA 4EY7A 2Q0XA 3F9CA 4P08A 5LZ9A 4BP8A 4M0FA 2D5LA 5EFZA 4FFWA 5E2IA 4AB1A 2BKLA 4O08A 1JU4A 2VTVA 3VVLA 3K2IA 1F8UA 1ZGCA 1BCRA 2UZ0A 1MO2A 3I1IA 2OLEA 3IULA 4DTCA 1TK3A 4WFJA 4B9EA 4IH9A 1J06A 4Y9SA 4KAAA 2H1IA 3PF8A 3O4HA 2EEPA 4PQEA 4GDMA 3S8YA 2R11A 4PSCA 1U2EA 4ZREA 3WKCA 1XRMA 4FLEA 1R9MA 2HU8A 1WPXA 1VKHA 4ZV9A 3CCBA 4M0MA 4JUIA 2XQKA 2GYVA 2ZVDA 1CUHA 1DWOA 3R40A 1JMYA 3G0DA 2QXUA 5IKXA 1X2EA 2XLCA 3PICA 5I8PA 1EDDA 2WFLA 3B12A 1MAHA 4FHZA 1SCQA 4DIUA 1FFBA 3FNBA 5AI8A 1Q0ZA 3L1IA 1W76A 5JAPA 1GPLA 2PU7A 4FNMA 1CUIA 4ETWA 3WWCA 1IVYA 4YASA 4AN1A 4C01A 1SC9A 3R41A 5AI6A 1ACLA 1FFEA 1QGED 3EF3A 2EDCA 5DNVA 4DMFA 1R9NA 4BDSA 5CW2A 1R4ZA 1CUXA 1AX9A 3D7RA 1X2BA 4LYEA 5JADA 1CUJA 3YASA 3QH4A 4BYMA 3VVMA 4K5QA 3WK5A 5AOAA 4EY5A 4CG3A 4Y2UA 1EH5A 1EDBA 1QIDA 2PBLA 4UHHA 5EHXA 1AMNA 3HACA 3KWFA 3C6ZA 5ALMA 1E66A 4H7EA 4LKOA 4QEKA 1USWA 4BP9A 1R1DA 5AM0A 2WJ4A 3JWEA 3QMMA 4GI1A 4BC1A 1K63A 4X90A 2GBIA 1WHTA 4B80A 5ALNA 4PSUA 4BRZA 4I3FA 4JH0A 2C0PA 3IUJA 1F6WA 2ACEA 1EK1A 3STWA 2HA5A 5ALYA 1DU4A 2J3QA 1WB6A 5AKHA 1CPYA 2ES4A 4IH4A 2VAXA 1U4NA 4G8DA 4G9EA 2WUDA 2WLSA 4XIIA 2C5GA 2Y1KA 1QOZA 5HQ3A 2W22A 2J4FA 4MYDA 4X00A 4BVKA 4CIAA 2YYSA 4IHAA 4QNNA 3VDXA 5HK8A 4BCDA 4DYHA 1XZIA 1EX9A 4CCYA 3FBWA 1DINA 4U2EA 2V98A 3CN7A 3QYJA 5T4HA 1VLQA 2O7RA 4H7HA 2WFMA 3R0VA 4GLBA 2HA0A 5JARA 1C7IA 3MUNA 4U2FA 3KSRA 3RLIA 5ALIA 5YASA 2WILA 3SC2A 1XZEA 4J0IA 5HF5A 2PUJA 5AKZA 4K6KA 1W75A 1HKHA 4IQ4A 3AUKA 3MUOA 4YK7A 4MWSA 1HQDA 4AO8A 3ZV7A 1VA4A 3WI7A 3ZPXA 4Y2YA 3GROA 2XUFA 1TAHA 5CURA 1UZAA 1XQWA 4ARBA 5AHXA 4B84A 3WWDA 3G7NA 1MPXA 2ROQA 3PE6A 2ZYSA 3DNMA 2PX6A 3TEJA 3QPAA 4CCWA 4HRYA 1VXOA 4OU5A 1NX9A 4UHBA 4MJ3A 2PUHA 5AM2A 5LZ8A 1F0NA 1XLUA 3G9UA 3G0BA 1XQVA 1HLGA 2VF2A 4C89A 1QE3A 2XMSA 4N8EA 3IDAA 2JGLA 3IUMA 3LIPA 2WSLA 3C70A 2JGJA 3B5EA 4X93A 2RHWA 4Q34A 4MXDA 4LXIA 2WUEA 2BJHA 5EHQA 2VSQA 5LKRA 4WCVA 3EQ9A 1DQYA 3WLAA 3FLEA 2WIFA 2QTBA 3T52A 4UBIA 1ZIXA 3STYA 2J3DA 2VQ6A 1CUZA 4E11A 1CUFA 3WKAA 3WJ1A 3LIIA 1GPKA 4HTAA 5D6OA 1CUEA 3WKEA 4BCBA 2HU7A 5C8ZA 1FFCA 2C0QA 2D0DA 1K5PA 2H7YA 5CTAA 2HRQA 3FOBA 1IZ7A 1UK8A 5HFAA 4DMHA 3BJRA 4ROTA 3W9UA 3FCXA 5AIBA 4UBLA 2VT6A 3CN9A 1ZI8A 1XLWA 4BRSA 5A7HA 2BFNA 3H18A 2OGSA 1SCIA 2JEZA 1A88A 2ZYIA 4IH1A 1WCYA 1KU6A 5HF6A 5I9IA 5AI4A 3LP5A 4N8DA 4EY8A 1UKBA 4U2CA 5EHZA 4QLAA 4OPMA 2DR0A 4Y2QA 2BUBA 2HIHA 3A2NA 3C5VA 4L3WA 3AZQA 4N5IX 1BE0A 5ALJA 4TPKA 3ESBA 5HK9A 1XFDA 3G02A 5JZBA 5FXMA 3IIIA 5DWDA
chains in the Genus database with same CATH superfamily
1ZUWA 3BS4A 3KD2A 3SS9X 3LDAA 3G2MA 2JGKA 2HCBA 2VT2A 3EVAA 4MVJD 4PLHA 2VPWA 4S1OA 3WGLA 1KDOA 5F4ZA 5CLJA 1DJMA 4QJ5A 1KZHA 2HF2A 4JOCA 1AVTA 1ZS9A 3WGJA 1TK9A 1Y89A 2IV3A 1JYEA 4MPDA 1NMYA 2GCIA 4E30A 2JCSA 4NOJA 2JFGA 3L5KA 2O7VA 3P9NA 4FDUA 4PX2A 1AZLA 3O1HB 1UWCA 1HFJA 3THRA 2I8AA 4RD6A 5IKEA 4YT4A 4ETNA 1GQQA 3WLFA 5HQTA 3FLAA 3OJEA 3ZWXA 1WB9A 4BO7A 2BFMA 4IXNA 1NYTA 3BWDD 4NBUA 2A3RA 4G1FA 4I6EA 5LYJB 5F12A 4Q1EA 1ORWA 2BFDA 2HO5A 3O7WA 4MI6A 5FTMA 3RK0A 2X1MA 5KWEA 1H5UA 4LHZA 5DNCA 1NKVA 1Q1ZA 4F4HA 3W3AD 3CLRD 4I5FA 1N5OX 1Q3TA 2I8LA 1GKUB 3BYZA 4X66B 3V7WA 4AYWA 2XAAA 3HYTA 3S2YA 2OCKA 4OYYA 4LTDA 3K9CA 3QBTA 2QUIA 4KSCA 1PX0A 2FEWB 4S24A 2NYAA 4R2MA 1UBJS 2RHOA 2Z8ZA 1WUHS 4C88A 5BNWA 1GN9A 2GM4A 3SE7A 1CYDA 1O94A 3PLAE 4TVOA 3RS2A 1ISRA 1L9KA 2MYUA 1SY7A 3DTNA 3V00A 5H68A 2X0FA 4MDEA 3D2LA 4P93A 1V5FA 5BUQA 2X86A 4MX8A 2I99A 3E82A 3B7GA 3R7LA 2PH5A 1TGYA 2Z56A 3E3LA 1U31A 4OKIA 1HTWA 1V4VA 4CXMA 1AUQA 1L8QA 1JX6A 1OYYA 3NC0C 2W2KB 2RJ3A 1DZIA 2WNSA 5IAKA 5B1YA 5HM6A 3AVOA 1NBEA 3NGLA 3P96A 1ODKA 4U7FA 4EHAA 1QZZA 2NTEA 2RHTA 4LE2A 1DRJA 3B1FA 5KINB 1CRZA 2CXTA 1ID8A 4LMBA 5DLYA 3F4LA 4JB0A 4WCDA 1KEVA 5BUZA 2NSJA 1BOOA 3MCUA 2QVLA 1C81A 4NFHA 1GD1O 3LO5A 2RG7A 4P8RA 1FTGA 1T24A 3ROMA 5KKNB 5CFPA 2DTXA 3BB1A 5IKMA 1QBKC 1FMFA 1OBVA 1V8ZA 2YC4C 5DMXA 3QPUA 1BX0A 3DR3A 3QVTA 1R7RA 1A50B 1RVDA 1PWYE 4K9QA 4GGMX 2ZE5A 2JIPA 3PJDA 3NHBA 1A1VA 3A2MA 3FPSA 2BUAA 1JSLA 3HNOA 2JZOA 4QFBA 2G0AA 3DJYA 3OPMA 5CNJA 2G4CA 2DLDA 1UZLA 5A0VA 1MEEA 4ZAZA 3CLUD 4QHYA 1SGWA 2YY5A 3PUYA 4GBMA 4D44A 4OI2A 3JAKA 1SIUA 3N07A 4FDLA 4I46A 3TZBA 1XHLA 2FWPA 1AXGA 3FR8A 2RJNA 4RC9A 3OMLA 1XPJA 2OBXA 1Q0PA 1Y1LA 5L3SB 1U0EA 2A78A 3RJTA 2O8FB 4RKRA 3WE7A 3P0RA 2C2HA 4RA6B 1D9ZA 5E6SB 1I6MA 4ZEWA 1DXQA 1BFKA 1U2ZA 1J0EA 2ID4A 2YDYA 4BC0A 2RGUA 1E9RA 4GI5A 3PDJA 2VNAA 2R8OA 2ZE8A 3OIWA 2XUKA 1SQFA 1YQ9A 3DEKA 4AWXA 3FIJA 4UXHA 4V1CA 1BGWA 4MIEA 1KO8A 2IYQA 2G5GX 3T7TA 1QIFA 4CL2A 4RM2A 3ZHOA 3ZCPA 2OGUA 3CKMA 3MAJA 1GLGA 4GGOA 4WLEA 1UJNA 5TVKA 3SQWA 4TL6A 2MINB 5KJ1A 2YXDA 4DSNA 4F5EA 1DCTA 3C43A 3AI3A 1F4PA 4PAOA 1R0SA 3TNLA 5DNUA 1HDIA 4TYMA 1IUNA 3G9ZA 2C1XA 1B73A 2Q1SA 2ZIXA 5A5VA 1GNSA 4HDRB 3KQLA 4MR9B 2QM8A 3HBJA 4H18A 4B3DA 1R0BA 1I1QB 2H57A 3TKAA 2PXHA 5C1OA 5DISB 3AINA 3RVDA 1M8PA 4QXOA 3CWQA 3GFVA 2Q2QA 1SIOA 4EB8A 3PDWA 4NE2A 2Z6VA 1A95A 3F2IA 4JUDX 2XF8A 1B1AA 4MQUA 4O4HB 1W44A 4OQEA 4JC5A 3EIFA 2PZ8A 2Q9AA 2W6MA 5A9SB 5LM3A 2VFAA 3JTMA 3FDZB 1TL7C 5HNKA 1TUGA 1P3Y1 4MVXA 4I66A 4NECA 4AZ0B 5J3JA 3B5IA 1U3VA 1GP2A 1UC8A 4FX2A 4IIDA 1WZUA 1XCJA 1DAOA 3IMEA 2BEWB 2BGJA 4IDDA 1PZGA 1DBQA 3LKDA 2OBYA 2Y1FA 2WWYA 1AZTA 2ERCA 4DY4A 3WGIA 3LCCA 3PIRA 1M5UA 3E1SA 1ST3A 1J0DA 1SK9A 2WIDA 5E2AA 4LFCB 4XSHA 1TKCA 2ECFA 4Q82A 2Z2ZA 5DULA 4ZWNA 3GDFA 1JG1A 2YIVX 3CONA 4QGBA 5G40A 3V8BA 1L8AA 1OVMA 2WU4A 4XVHA 5CG2A 1NMEA 2CUZA 3SJBA 1EWYA 1MC4A 2WA1A 2EZ9A 1ISPA 3I6MA 1DJPA 4IUCS 3ZWVA 3HJUA 3R76A 4FHDA 4B17A 1RRMA 1UFOA 1ECGA 3H1BA 2GN9A 2ZPUA 3SZOA 1XZQA 4L73A 1IATA 4TRMA 4LI3X 2ZRHA 2R6CA 4S12A 4FWTA 2YXNA 1KO5A 1RRGA 4N82A 3EZ9A 3GLFE 4AMUA 3K7EA 3RTDA 4CKCB 4BP1A 1JWAB 1N3YA 3GDGA 4DJ5X 5TRTA 4QUJA 5TGDA 1PS9A 2HBZA 3NIBA 2PS9A 3O6VA 4WE3A 1TD9A 4NABA 2HK9A 4TMVA 3KSUA 1DX6A 2D2EA 2P41A 3AJEA 3NEPX 5BXQC 2I1VB 3NS7A 3REGA 1QK3A 4CKXA 1CFJA 1KJYA 3O2JA 1OPRA 3EBOA 1ZVJA 1BAPA 2AOUB 2QMHA 2FWRA 5J40A 3DOOA 5E9QA 4MW1A 4ME6A 1CVLA 1IXRC 3MINA 4AULA 4L0DA 3EGIA 2FWMX 2JKYA 4I6GA 2A14A 1NI4A 4C76A 1JXQA 2FG5A 1ORVA 2XB6A 3B82A 1CE8A 3GVCA 3WL8A 2GJAA 2ZB2A 4F85A 3NPAA 5TJ9A 2H5EA 1RHKA 4IQ0A 3VR6D 3KQQA 4F7DA 1ODSA 2AJBA 1KOJA 2BM8A 4HDKB 4GS5A 3QNWA 2P2YA 1ONNA 5B6JA 1YQXA 4RV9A 1F7VA 2C04A 3OQPA 5CPBA 1E8NA 5FNVA 1VHJA 2POCA 1Z26A 1E9CA 1EZZA 3WGZA 1YV9A 5I01A 4MYHA 1EXMA 3DL2A 4M88A 2HEGA 4MHTA 1JH8A 4IQGA 4MA0A 4M9SA 3W77A 4XCVA 2O06A 3I4CA 2FUG6 3TQTA 3KQUA 2PPLA 4C0AC 5EFOA 5L8VA 4LXGA 2TMKA 2Z1NA 3MOIA 1JZQA 3PVCA 2H9IA 4HI0E 5LLDA 2OK8A 2CNNA 3AR8A 2YZNA 1Y3CE 2IE8A 3H5WA 5IVPA 3U4HA 4UXIA 3AF4A 4HX5A 4X0EA 4RZHA 4HC4A 2MIIA 1W4AA 2XYQA 3GGPA 1AXRA 2ZTHA 3WMRA 2Q1UA 1AOXA 1DIOB 1TPYA 3TUZC 1LWOA 3ESDA 4V39A 1EVZA 2FQQA 2I4MA 2PX4A 4PHHA 2BLLA 1BYUA 1B6RA 2I71A 2YVUA 3I6IA 4CG1A 3QI2A 4C20A 4GMXA 4ZOEA 3FHJA 4RHCA 5G1NA 2EZTA 5HPYB 4EUEA 5HUJA 4LWZA 2PAAA 7GPBA 1R88A 2NUPB 2DR2A 4TV9B 1G5TA 1LF5A 1JBEA 4TYPA 3CA8A 1LU9A 3IBFA 1UJMA 3ZKAA 1J09A 1XTSA 2FFBA 3H19A 4FZJA 4ZJZA 2LV8A 5AXCA 2EFGA 2XGMA 3OFJA 4WBNF 1XNHA 2E49A 1Q50A 2WHXA 4GHWA 5JAUA 5JC1A 3QKTA 1WMAA 1CJTC 2H9YA 3N8GA 2WAMA 1H66A 1HLDA 2PRSA 1E94E 2X4LA 1E4EB 4PFKA 4US1R 3ZWQA 3Q72A 4R5MA 4ERNA 1JS1X 1T5BA 2EEZA 4NV0A 3WFIA 4ZMSA 2VZ8A 3RCBA 3WMXA 1YF3A 1L4LA 1HYBA 1KSHA 1TW3A 3KAPA 2QM3A 4U3JA 1DGQA 1U7WA 2O6LA 4NCXA 1SC3A 2I4OA 5FQOA 3WK6A 4L0CA 4H6XA 3Q1LA 3ACCA 4LQCA 4YDSA 3REOA 3HKDB 3AF5A 3MGAA 3M3HA 4MCJA 1F14A 3KJHA 2BONA 2OFPA 2CXPA 2HT6A 3I0ZA 1DRVA 3W8DA 1Z0FA 4AMVA 4HWKA 2BHTA 4JZYA 1FNSA 2C5AA 2OSVA 3HDVA 3L4BC 2R6FA 2VA8A 4TT3A 2YWBA 5E6RB 3DL4A 1L1QA 2PUTA 2WJJA 5GIOE 3IL2A 1FJXA 4Y2HA 1T2EA 3MJEA 3VUFA 2XCRB 1I0IA 5EPOA 1C3OA 4FFBB 2DCMA 5E9WA 4FPXA 1EDZA 2JLRA 2XYPA 1FS5A 3RFFA 3CUEF 3WYCA 2N0SA 5B7GA 1BD4A 4OKSA 1EU1A 3DQQA 3QXCA 1VIMA 1SRQA 5B37A 1KZYC 3CCCA 2DHDA 4MP8A 4UDXX 2Q28A 1N0IA 3HN7A 1XTZA 1LV7A 2PRZA 3CZPA 3IKLA 4GOMD 5I7UA 3THWB 2SKDA 3BTOA 4TSFD 1JJFA 4FD3A 3K0CA 1X92A 1FJGB 2R79A 4I50F 1QC5B 3N7UA 3MJHA 1PEKE 3QJGA 5DOZA 5KVQA 4DRXA 2IHZA 9ABPA 5HJEA 2PX8A 2YMQA 5F23A 1NJFA 4UHFA 5IDVA 5F4BA 4Q1DA 4WFIA 5IU6A 1T3HA 1J07A 5B4VA 1NXWA 3ROEA 1P81A 2OD9A 1UQUA 4PX5A 5F2OA 4BNXA 2VN8A 4OTZA 4QULA 1CHNA 4GG1A 2HMYB 3SYLA 4D43A 1P4SA 3EPKA 3C5WP 4ZDWA 3E1GA 4O4JF 2PMWB 1Z82A 5JBQA 5ALEA 4J0GA 3D8RA 3AIIA 4IYJA 1TEVA 4L4YA 2LDXA 2ZAGA 2GZ2A 1Z6PA 1XV5A 4FQ7A 3OZWA 4KTVE 5FPTA 2JFYA 2V7QD 4KQGA 3T9EA 1OI2A 1LJ8A 2XYGA 1CQWA 5TX7A 4BV8A 5FOVA 3TX2A 4U6QA 2R2GA 1ZZGA 1K2VN 2CLKB 2ZI6A 3NOVA 1J2RA 3DC2A 4FB4A 4YJFB 1GZ4A 3OLXA 1SHKA 2LR0A 1C29B 3P1JA 5FT9A 3BDVA 1IWOA 3RIGA 3T3IA 4JC4A 2ODAA 2V4UA 4HUQA 4OP1A 4WKNA 4O1MA 1G2PA 4LMAA 2E87A 3VTKA 1E6WA 7YASA 3OUUA 2AI3A 4QPDA 2X5OA 5FWYB 1VBKA 2PR7A 1SG6A 4HBZA 1J6UA 1QGYA 1YCDA 3A7DA 3DE6X 2RGDA 1BXZA 4QRDA 1X74A 4R8RA 4B4OA 4LSWA 1MC1A 2B98A 3E7PA 4JYCA 2XDQB 3AVYA 3AXTA 3QWIA 4RJ2A 3LOUA 2MT9A 3KVYA 2AXPA 1J1IA 2I55A 4JT9A 4YHBA 2RHRA 1ESNA 2JFUA 3FH0A 1PWXA 4OHMA 1JBQA 4E5NA 2IUSA 2PEZA 2QVYX 4C4YA 4QPZA 4FEEA 4E5SA 2QRNA 2WIKA 5K0CA 4YJ3F 1KJQA 1NVTA 1IMJA 3G1WA 5KQPA 2J4CA 2HR1A 4WUVA 4HNHA 2OCXA 2RARA 3K9NA 1N2XA 3W8RA 6YASA 3U6BA 1I4EB 1TEXA 3GA0A 4P3PA 3JQ6A 1KY4A 2XMBA 3EC7A 1A04A 4UBMA 4UU0A 2NP7A 1WLYA 2H0RA 3UKOA 3X2EA 3IVGA 4QOHA 2JVKA 4I81A 3KAJA 2QE6A 2EJTA 4QQRA 4RNDB 1JIQA 4ETIA 4F8YA 1J9GA 2P6RA 2A7XA 2QVCA 1A9PA 2R00A 1LDNA 1NP6A 1GCIA 2G25A 1M33A 2VCYA 3IURA 3TW8B 3UC9A 1PSDA 2Q6TA 1J2EA 2AVDA 1X70A 1SKQA 3O8LA 3OZIA 1AKUA 3Q3HA 4ITRC 2H2WA 4KE6A 3I6YA 4NEGA 4CGYA 2CZCA 1Y34E 2BGUA 2EWMA 3P9RA 1VHTA 3M1IA 4FE3A 4UVDA 1O7JA 3RKSA 3W0LB 3N7AA 1A3CA 5B2EA 4ALIA 2O0JA 1J99A 1SVOA 3RAGA 1C3VA 1E2PA 5JXIA 4BATA 3AEYA 2PQMA 3CPEA 5FOTA 3S1AB 2M2IA 3JWPA 3ZXSA 4HO1X 3H65A 1KPHA 1RQRA 3G6WA 3H2HA 3TBFA 3ZE0B 4AQDA 1WW8A 1JA1A 2BV3A 2QTWB 5KNDH 2WYOA 3QWBA 5KOHB 1O94D 3FPCA 5TPWB 3SYNA 3IRUA 1UEXC 2GXSA 4KXYA 1RIIA 1T9GS 4INZA 3JQ7A 4F3CA 2VXCA 1S02A 4H7JA 3AKDA 5AXAA 2DCUA 2QAGA 1R6AA 3LL4A 4RFSB 3VSBA 5C8VA 4DBVO 1OFTA 4LYGA 2CHGA 4H59A 3NTXA 4I9NA 4S1WA 1IUOA 2O3RA 3EZYA 1ADCA 1ZGZA 2EERA 1LA2A 2QHXA 4YRMA 1NDHA 3KR9A 3NBUA 2YQZA 4LZPA 5AI5A 3SE0A 3D4LA 1Q2XA 3FZYA 4FBMA 5BSRA 2Z9CA 3N6VA 3CVWA 1L7PA 2YVQA 4KLCA 4AO6A 1EESA 2I29A 2X42A 3HXPA 1PBTA 4XWOA 2BD0A 4AZVA 1W5BA 2ZUUA 3ZX5A 1LK0A 1GTL1 2B1RA 4F2GA 1JEDA 1UFVA 2G6TA 4M38A 3GQBA 2XUAA 1P2TA 4FT2A 4KDEA 5JLJA 4DUZB 1JG2A 4Q5IA 1N4AA 3NYQA 5AM4A 4HWRA 5IYZB 3HKEA 3TFOA 3BIXA 2XCSB 4LDQA 2OHOA 1TB4A 1HT0A 2FFJA 4K46A 3O4GA 4MVJI 3F5FA 2DWPA 1VIYA 1BG6A 2Z57A 3C4QA 5KWIA 5EIXA 1Q57A 4GPIB 5DHRA 3HUTA 3LO8A 4PC7A 3EXEA 4R54A 1Z3CA 2WZQA 2OAEA 3EDQA 4H6VA 4KP7A 1S1MA 5LZ7A 5DX8A 3B9PA 4EQZA 2XWJI 3QWFA 1MHPA 2E5LB 2P65A 1WABA 5CH8A 2OVBA 4C6TA 1CS4C 1BHQ1 1DKRA 1LPOA 4D97A 3JQAA 3KC2A 1WXFA 4BE4A 4COKA 3K4HA 2IYSA 3UV7A 2X9LA 3NXSA 1JPUA 3A3OA 4FIZA 3GCDA 1BN6A 2C99A 1C9JA 1I9CA 5TIIA 3U7GA 2OC4A 1OT3A 1D1SA 4F93B 2JI7A 1FFDA 3X3HA 2C57A 5AVWA 4IHKA 4FYXA 3ZS8A 2PLFA 1ZMBA 4M99A 1NIJA 3OLVA 3WGOA 1PBNA 3PTAA 2NU6A 1J1ZA 1K92A 2QM7A 2QTGA 2ETVA 2PX0A 3I1JA 3VVBA 1ZIPA 3BCUA 4LRTB 4KQMA 4RF3A 2E1RA 4Q9NA 3CRVA 2ZIEA 5I3CA 4B3MB 4DR4B 5TS3A 4RY8A 2Y76A 2O2ZA 3EQ7A 3R77A 1ZW1A 1JECA 1G6HA 1PLLA 3E2IA 3IELA 5B2ZA 3WR5A 3WMGA 4NJMB 4G0WA 1P33A 2VSYA 2BTQA 4HDNA 1PVOA 2H1OA 2ZRNA 1BMQA 3EIQA 3WGKA 1G3UA 1WHSA 3ZE6A 5K6TA 3PC8A 3UUWA 2HA7A 1AA6A 3DONA 1ULZA 3GUUA 3PCXA 1KVUA 5J63A 3RS4A 3S5JA 1GQFA 3QJ5A 5EJFA 1YCHA 5I9BA 4C4RA 3AFNA 3DJFA 4GLOA 2PMFA 1CEXA 4WK2B 4RF2A 1AKNA 2QVGA 1HXHA 3WIDA 2YMPA 1E7YA 3PEWA 3UAZA 4OQZA 5AJHA 4C4OA 1DFGA 2QSUA 5HOEA 1M10A 4J94A 4MQLA 4Q6BA 4WA8A 1U8TA 5H83A 1VMKA 2BH9A 1DAMA 1WMSA 121PA 5C18A 2EL9A 5AHKA 4PYQA 5B4TA 3AEUB 4AZSA 1CUUA 1C7EA 3I9LA 1Y8QB 3CSUA 1NP7A 3OQHA 4M0DA 3AF2A 1RYNA 4DWOA 1H9AA 4NU6A 1D7OA 3PTLA 2GSDA 1PFKA 1RQ2A 1HY3A 3H2KA 5F73A 3TTSA 3VSCA 3WA6A 2ZE6A 2NZYA 3TSOA 1S2GA 2XE8A 2DETA 2JZNA 4C2AA 1KWGA 4PY2A 2C2KA 2WWTA 3VYTB 5ER6A 5HCNA 1EUCB 1GPMA 2A9PA 1KNQA 3TX6A 1KEPA 1XZHA 1UXIA 3OTHA 1IQPA 2H29A 4NENA 4NXNB 2WJAA 3JVEA 1QCYA 4R0NA 4G36A 4YQZA 1DOAA 5HRUA 5HTOA 4BFTA 2X6TA 4FYYA 3KJEA 4FS3A 2CLLB 4GYJA 4Y6LA 4N0MA 4NYMQ 3SKYA 4CQMA 5BN1A 1AJEA 3PRHA 2ZTMA 2XKBA 2EQBA 1Y1RA 1FQOA 2AC4A 1M2OB 2H4WA 4L6IA 5DRYA 4ZAGA 5L3QB 3SHFA 4RPGA 1MLDA 2W58A 4HS9A 4LNAA 5PNTA 3DLHA 1GQSA 2VUIB 3O2SB 4QXRA 4YB8A 1UBMS 1CJUC 3L7AA 4FU0A 4FS8A 3OJLA 4JI8B 1N0HA 1GCAA 5AOCA 1K8QA 2FGKA 4RHUA 1RYHA 3KT6A 2ODQA 1OWPA 4M83A 1PR1A 3QFTA 4HPXB 4QDTA 1PJ4A 2I4RA 4UATA 4X92A 3T7IA 3AFHA 4UW9A 4K05A 3TLAA 4EENA 1U94A 3NATA 4EP1A 5JCPA 2WLTA 1II0A 4ZVQA 1ODCA 1EGHA 5IAAA 1BC5A 1VE6A 4PGFA 4D81A 1C4KA 3A25A 1SCKA 4M60A 1AURA 1CQIB 3DTYA 2J0UA 2VPTA 5JMPA 1HL3A 1GZUA 3AIKA 5DOVA 4OYRA 3UG6A 2FUEA 3PSAA 3M3DA 4D8VA 4PFQA 5M3BA 4WXPA 3EZ2A 3KSBC 4HFNA 3RFCA 5HKLA 4BQPA 2QSYA 1C7ZA 1QHYA 4HLUC 1A2KC 4B43A 3LPDA 4M1YA 5LWHA 2GAFA 1G63A 3A1WA 1WUKS 4R9RA 1AQ6A 3EMBA 3DLBA 1EDOA 1UAYA 2RAFA 5GMOA 2N9UA 3FNGA 2ISCA 4LNUB 2GEBA 1X42A 2IEGA 1P45A 2VHYA 3B9BA 3EE6A 4MQ6A 1KMHA 4IDPA 4F4DA 1Z06A 1QKKA 1S0UA 2H2HA 1EVEA 1XKTA 1XC7A 2YCLA 4LOAA 1U7XA 3RIYA 3T5CA 4C43A 1QFSA 1RRKA 1XLVA 4DIEA 4F84A 1F2DA 5FAKA 4MP3A 4DQLA 3T5AA 1T4CA 4IJ6A 3OJ0A 4PYOA 5E4FA 5GONA 3GLGA 1YS6A 2QN9A 2RONA 5C4MA 4ZO7A 4F6CA 3KQMA 2XJ9A 2Y1OA 3GEBA 5A3VA 5HEKA 2GM9A 2CBGA 1GFSA 3IQIX 3NYRA 1FOEB 3VNRA 3O03A 4A4DA 5I7VA 1N1EA 3TTYA 1XJWA 4QHTA 3EHDA 2MSKA 4QYTA 3G23A 4BO9A 3N70A 4LJKA 1XR3A 3AOGA 2G80A 4HNSA 4KTTE 1YVUA 2NU9B 3WHPA 5C81A 4GBJA 4RVFA 4Y2GA 1DKLA 1TFUA 2GYUA 2YWDA 3HDJA 5DTQA 3RUCA 3ZY5A 2HEIA 4KAXA 3FX2A 3JQGA 3ZIDA 3EFOA 2BFFA 2V9CA 1UOPA 1ECLA 4ZPXA 5IC6A 4LXYA 2CYCA 2ECOA 1QIIA 3F97A 2EYUA 5U9CA 3WLHA 3N2KA 1QRUA 1GEEA 1T3LA 3HLKA 4ZP1A 4EUFA 3EPHA 1FA9A 4XJXA 1E1DA 4JDPA 4AX8A 4EJSC 2YHUA 2JHPA 2OCBA 2RHDA 2VEOA 2W2XA 1U9JA 4HMOA 1KYTA 3CO0S 4KW7A 1AXEA 1NNI1 3GG2A 4DADA 2J33A 5IDXA 4RSMA 1FYXA 3WRXA 4YP1A 4BQNA 2WFLB 4J6EA 4BWFB 4EI9A 3DFIA 4DLSA 3ZEAA 2M98A 3TEFA 3NHUA 4M1TA 3KWMA 3MCAA 1KIMA 1NX6A 4AF6A 3G89A 5D3MA 3ZV4A 1SBIA 2OECA 4UNQA 1UF9A 3EYAA 4GPAA 3P4XA 1K7XB 4WOKA 1N5IA 1YVPA 1T2NA 1U1GA 5H7XA 3FRHA 1AKWA 2GLXA 3ZDXB 2HWWA 2PZAA 4NR0A 2H1CA 2R68A 3EMKA 4J7AA 4CKEB 1B15A 4OGFA 3GT0A 4ZCLA 2NVUA 4UUNA 1J49A 3BK2A 1P4GA 1R64A 1KBZA 1XQYA 1Z2EA 1JJAA 1ZL2A 2CXOA 3IOEA 4ZT6A 2C0CA 2ZTLA 4D9BA 1GDHA 4H7FA 3JXEA 4BZZA 3TQIA 3MRSA 3TVDA 3PQ6A 4LF4B 2WU3A 4Q9LA 3ZWCA 1Z83A 1ZD8A 3ISJA 2W4QA 1XZBA 3VYVA 1UKVY 1NW3A 1XMPA 3ZQ4A 4B6GA 3MCTA 4N0DA 1K8RA 5JT1A 1C5KA 3FYUA 4C3OB 4IILA 3OA2A 2AE1A 4QWWA 1V45E 3B13B 4IIXA 4AJHA 2FLWA 3CB2A 3DH0A 1YGPA 4HV4A 4KN8A 4NBWA 1H85A 1JT2A 1RC1A 3ND9A 4WZBA 5JY1A 3G2PA 3VH1A 1R9GA 1GTZA 1XD9A 1UJ4A 1M1YB 2B99A 3D3KA 1JAIA 4NBKA 5CNIA 1RMTA 2QZSA 2PL1A 5FAXA 4GNKA 5FUQA 3BIJA 3FIUA 4F11A 4BV2A 2VZEA 1MG0A 4RK4A 3PVSA 1WKCA 1RHQA 1YE5A 4BNIA 3ZH2A 4D0LB 4OBBA 3LCRA 3UUGA 3ABOB 5A71A 3D81A 1Y8RB 3CGGA 1OTXA 3NBMA 3OCZA 1EWQA 2J3MA 2J07A 4DCUA 4G5QA 2GAAA 3PQEA 1PNOA 3MTIA 1VSVA 5DK6A 5CTJA 3CRRA 1N77A 4JLJA 1F4VA 1P3JA 4QD3A 3L8HA 3HDGA 3IEVA 1AS0A 4IZIA 4V0KA 4DLVA 5A6SA 5B5SA 4B48A 4KGXA 2TS1A 4GLFA 4KVZA 4BNMA 4D0RA 4BB9A 4MIKA 2VSOA 3SZGA 1GKYA 1YR8A 3OQIA 4WASA 5J58A 2CEKA 1XJ5A 4G4GA 5KOJB 1VL5A 2H1SA 4QBFA 4D98A 1NV8A 5T57A 3GZNA 4QODA 4B1FA 4DE5A 5BOVA 1MFPA 2FSFA 4QPJC 1D9XA 3ON5A 2FEOA 5KYNA 1JIKA 1E62A 1I5RA 1THZA 2WF5A 4HATA 4Z0TA 2OR3A 1TQ8A 4MWTA 5JYBA 1SUSA 1NXXA 3ZV5A 3ORYA 4EHHA 1P0IA 3G49A 5DXAA 3WL5A 3LH5A 4TV8A 4CM8A 3BM5A 1JTVA 3E9QA 3N0XA 3O0DA 4QFDA 4U5XA 4WZAB 5IJ9A 1OLXB 2RGRA 1PL8A 3UMCA 1FFHA 1XIVA 1JALA 1WG8A 3ZDAA 4KR0A 5MN6A 1PR3A 1FLNA 2BFPA 3I34X 4WESB 3TSWA 4HPWA 4EW2A 2X5NA 4TWRA 3HXOA 1AF4A 1XCLA 3D6HA 4NCHA 4ZMBA 1P62B 4UUPA 3EG9B 2VQSA 1C1XA 4X94A 4Z99A 1EFPA 3K6KA 2DUNA 3TIFA 2HJSA 1FW8A 4HGRA 3ZGVA 1NUSA 4BFXA 3AEKB 1U3DA 3IQHX 1R0CA 1TAUA 4I9HA 4O2AF 1DP4A 1MXFA 2OTCA 4X8HA 5E4YA 1ZKDA 3SLKA 5FNZA 3WJ2A 4P35A 3UK1A 4V24A 4RQUA 4DA7A 2DYKA 3E22A 3NHSA 4XD7D 3PC6A 3ZE9A 4W1RA 5ALDA 4LDJA 3NUQA 5CIWA 3BXPA 1VC2A 4F9FA 5KQRA 2FPIB 4RTRA 5EMNA 2HMTA 4ZRNA 5K8VA 2AYXA 3KRTA 4PYIA 2L19A 1EUDA 4GNRA 1Y6ZA 3A3NA 5HQ3B 3TZCA 2FR8C 1EBFA 4WOPA 4CPDA 4L4SA 4OJTA 3QELB 1WTAA 4WBNB 4JYAB 1SKYE 1EK0A 1GA1A 1UXHA 2B5WA 3N76A 2G7ZA 3KX2A 4QDJA 4ARUA 3BWBA 5JSZA 1XPRA 4U9UA 2JEYA 3BMOA 3G5AA 2XVYA 3AJAA 5LQSA 3WLSA 2NZJA 2OO3A 1URPA 4NL4H 3W05A 2O6HA 1DWUA 1Q19A 2BWJA 4MDYA 5K0NA 4D80A 4WOBA 1EI9A 5IANA 5L51A 3K8ZA 2F3PA 2QMUA 3AHIA 4E15A 5BRAA 5EHNA 1SG9A 3EYWA 3GO4A 2JHGA 1RQGA 2BC9A 3TBKA 1RQXA 1SUCA 5TSDA 2OB2A 5JHHB 1GRRA 4EECA 1WUYA 2V9ZA 3PGJA 4Y2VA 5FDFA 1I01A 4FWBA 5K05A 5BR1A 1OUMA 4D9KA 1RZ3A 4FFNA 4NATA 4HQNA 1T5IA 2QJTA 3D7MA 1PYDA 4TTVA 1Y1QA 3GP3A 1XAJA 3U7FB 5CU7A 3WISA 4ZHQF 4QRIA 1R5OA 4RIFA 3R9WA 4NBSA 2DKOA 4L4XA 3MBIA 5AJXA 1XNJA 1G3RA 2DPGA 5ANRB 3WBBA 1SIBE 4TLLB 4EPYA 3CTPA 3V2GA 3TG2A 2ST1A 3KXIA 1MNQA 1Y7IA 1ZCFA 1FX0A 4QT0A 3ZJVA 3WOHA 3GIDA 4HOYA 4E2ZA 3A1TA 2QX8A 3LKVA 5KC9A 3AJ9A 2AOTA 4FFVA 3TRKA 2RE8A 3BEDA 1MT3A 1NR7A 2HLHA 1RCFA 1W85B 3FFXA 1NASA 4I5GA 4I50B 3QRWA 1V5GA 4KIWA 3MRTA 5ALWA 3COWA 5KJEA 1WDLA 2EJBA 4A82A 4F4FA 4J9VA 4WXMA 3OQOA 3C7KA 4RE5A 5DNEA 1TCBA 4G5FA 1Y37A 1SEPA 2EX0A 1NBIA 1WP9A 3PZBA 4RK1A 3V4LA 5KS2A 3EJ6A 3D5TA 2HF8A 1PFVA 1TU0A 3M6IA 3V4FA 1GNRA 3KXLA 1X80B 1T2FA 2D3TA 5J2UB 1DJOA 2GPAA 4ZAVA 2W6ZA 4KH0A 4AJOA 3RYTC 5LLTA 4NVRA 1TVEA 4G0MA 1CRPA 3MWJA 5K3FA 2DFVA 4O4JB 3WNDA 1WR8A 1YCFA 1Z7YA 5T6MA 3RRNA 1GVNB 5JNVA 3GBSA 3GUZA 1AMOA 3COPA 4Z3OA 1K3UB 4AN4A 2MSCB 3OZDA 4PRZA 1JDPA 4EUKA 1TZBA 1XD2B 1Z12A 2XKAA 3TCKA 3TTWA 4D46A 4LJRA 1G3QA 1OX6A 2CJFA 2RGBA 3IR5A 4IICA 2MSWA 2WHPB 5EEHA 3KEFA 2AB0A 1O87A 5CA1A 1DO8A 1V1MA 3C4VA 5LP1A 1B0AA 1CCWA 4CMEC 2JGEA 1IG0A 3RU3A 5JPCA 4PNHA 3GGJA 4BN5A 4ZEVA 1DADA 1HDCA 5IG2A 3VZBA 1JXAA 3SKVA 4F0JA 4WFQA 4M8NE 4EYOA 3BCSA 1RR6A 2WP0A 3B70A 4ZOLB 4A15A 2AI2A 3HRHA 4EABA 3FCCA 1QIEA 1H1LA 9LDTA 5LNK6 1N36B 3A0UA 1WSBA 4OHXA 2RBEA 4MYCA 1H2WA 3P4YA 4D4JA 1ZD4A 3TRDA 5CX4A 2G1JA 1ATZA 4D1YA 1Z13A 2VZ0A 3M9XA 5LNK1 4OXYA 4PM4A 4Q1CA 3C7AA 1U5BA 2I4LA 2P2NA 3KEMA 3OZAA 5CB4F 2CLCX 2PZGA 1C30A 2WZBA 1MW8X 1MG5A 1I3LA 2HMAA 5EWJB 2AK3A 4U8HA 5F1YA 1JL3A 5B58C 3JCZA 1K0FA 3HWX1 4OK3A 1RZRD 3GFFA 1IK4A 3VDQA 4YJ3B 2BHSA 2IXFA 2BMAA 3HU2A 3DEIA 1K7EB 1I5EA 4CLOB 4BFZA 4DG5A 3OO0A 2JGDB 4XUEA 3FWPA 3DMDA 5BW8A 5FWNA 1Y3HA 5B6PA 4ND1A 2BAGA 2ANCA 4FX5A 3C6MA 1TCAA 4YUAA 4DUGD 2WTNA 2WE7A 5JASA 1SHJA 4OUDB 4HB4A 1U3FA 3W5HA 2X7XA 3IEIA 4CM5A 3PHJA 2CZQA 1XLTC 2Y6UA 1KDRA 1D6JA 5AJUA 1G18A 2VBFA 1CRWG 2JIRA 4YCMA 5DYNA 4QLOA 1RXVA 4V1CI 1FUUA 5DWVA 3DXXA 4ZOBA 5U4XA 1R50A 4B45A 2OHJA 3LCVB 4HK4A 5SYMA 2C7GA 3RU2A 4NYMR 5CAEB 2J48A 2CVHA 5CVEA 3T4EA 2XZLA 4PG6A 1U8EA 2V5UA 3D4OA 3L2OB 2UZ1A 1W47A 2ZWOA 1RFLA 2NO9A 4HY3A 4Z0NA 1MJGA 4AJ9A 2IH5A 3GJSA 2PWAA 3L7NA 1ECCA 4O4LF 5FRDA 1SXGA 4Z9YA 3QHAA 2ZI4A 3W9YA 3WWOA 1OV6A 4X9XA 2O3QA 4U9HS 1JPNA 3ESXA 1YO6A 5CDFA 3AB7A 1IHDA 2ATXA 5IEJA 1U6IA 7AT1A 2Z58A 3WXBA 1CUYA 1Z8HA 3ESCA 3PUXA 4NESA 5EXEA 4MCAA 2FPLA 4ON9A 4AN0A 1VI5A 2W6JA 3GLIA 4W1SA 2FLKA 2ILTA 4Y9DA 1ZK1A 1E9FA 1S2DA 2N1BA 1FP7A 2PD3A 4G0UA 4P86A 4FEYA 1KJIA 3R0XA 2R84A 2AMVA 1TMOA 3NLLA 3AP3A 1ZH6A 3T7SA 2CD7A 2EKPA 1KP2A 4LHWA 1MQAA 2P90A 4MYRA 3DEHA 1UOEA 2VYVD 3EASA 3GFOA 3J80A 5E0KB 1UKEA 1KJWA 2B61A 3JATA 5DMHA 1Z5GA 1OI7A 3I01A 3UOAB 4DV1B 1MABB 4H08A 4LY9A 1WMDA 1NV9A 3HUDA 2MSNA 4OBXA 4EPWA 5BSKA 1OILA 5DT2A 3EOBI 3KFXA 3HBNA 3LBHA 4PYNA 3WDSA 3PFKA 4D41A 1NBWB 4IIUA 1MC8A 3FMGA 3QZUA 1X7ZA 4HNGA 1H65A 1RI4A 1XDSA 2Q3JA 4JYMA 4DDVA 2R1TA 2RI6A 5KNBH 4YY3B 2Y2UA 2IPOA 1ORHA 1W88A 4GYWA 1RYFA 4R05A 1WD7A 1H8ED 2D59A 2IF0A 1V3TA 1BMFA 2PZFA 2I78A 1OZAA 1OCEA 1X1SA 2P79A 2XRMA 2QY6A 3QXHA 3CT4A 2DXIA 3FHOA 1Z5VA 2YFKA 3USZA 1CEYA 3VDRA 1QJ4A 3RFVA 2ON6A 4BIIA 4AICA 4XQ0A 5DM0A 2BEVB 2P6UA 5B1IA 3QKSB 1MOZA 4AZ3A 5GJWC 1XELA 1QGOA 3N2GB 2XUGA 1RTTA 4DVGA 2C7OA 3JWHA 2Q9CA 2OV2A 3UM9A 3A9WA 2EGGA 4HHEA 1MNAA 4LJ9A 1Q7EA 1KQPA 3E0XA 1GNQA 2J09A 4FGZA 5FPQA 3SM9A 5DXJA 1TIPA 5FI3A 3OJCA 1YRYE 4FCTA 1HORA 1WVIA 5H80A 3AIOA 5CYGA 1UADA 3D8HA 5BMVA 2YKGA 3NTVA 4PN7A 1Z0ZA 1N1MA 5IVIA 4C7OB 5JJ5A 4O8CA 3HO6A 3JVUA 1F5NA 1E7SA 2QT0A 2ZETA 2H18A 4FEGA 3WLKX 1DRUA 4PF1A 6GPBA 4BX9A 5KWSA 2FQYA 4JVOA 3RRYA 3T0FA 4Z6KA 3G1TA 2VJOA 5H59A 1I3OA 1P9WA 1ZOLA 4FC7A 5TS2A 3RSZA 4DGSA 4UUAA 1HV8A 1M3SA 2I34A 2OXFA 4HAZA 5E1BA 5C51B 1ZK2A 4C0SA 4OHYA 4BBZA 4W5WA 3LRPA 2FAXA 1SUIA 2PBZA 2V5AA 3DCYA 3LUFA 3QG1A 4L15A 1JHPA 4M36A 4CBVA 1E2MA 3LFTA 2OHFA 1C7QA 1Y3IA 5I7SA 2EQ5A 2VK8A 4OJQA 2G76A 1UZNA 4X8LA 5F98A 1T34A 1KK0A 2NT4A 2CXXA 2H52A 4LZAA 1KSJA 4HF7A 5FOXA 2A57A 1Z25A 1U2PA 1LZLA 2FWIA 3WRYA 3WYNA 1ZHOA 4WKPA 3RTBA 2BFCB 2PH7A 1UBEA 2QX9A 3UPDA 4B3TB 2BF4A 3S4YA 1S89A 3HSYA 5FWXB 3I83A 1XRRA 1U8UA 3EDMA 3CKLA 3AT1A 2CW5A 2Q8PA 1FNNA 3O74A 1L8XA 4MRRA 1NJSA 3H8WA 4WZBE 1QRAA 3DB2A 4X3CA 3OFSA 2RSLA 3H3XA 4UNRA 3PC4A 1GQRA 1P73A 2BM1A 3R3YA 1Z6QA 3OE4A 2Y2VA 2HL6A 4HAUA 4Y18A 1ZGGA 2O5EA 2QN1A 1L7QA 3HH8A 4CDRA 2JFFA 1ZJ5A 3ICPA 5ITZA 3T9AA 4ARAA 4X1YA 4G5GA 4B75A 1GU0A 2EP5A 2IODA 1V48A 3DFUA 3EAQA 3LZDA 4RCVA 1RWOA 2HTEA 2R5FA 2W6ID 5IABA 2BHNA 1M73E 1HE4A 2W43A 2FPUA 5I9MA 5K8TA 1BW9A 3AP1A 2RGYA 1HM5A 4UVIA 2GXUA 3E7FA 4L3OA 2WVGA 4GVLA 3IV7A 1N2CB 4NDNE 4H17A 2OMEA 3ZDBA 2ZYHA 3OD1A 1VKZA 5F1PA 4E08A 2VKTA 3QE0A 2JF0A 3MWDA 3S70A 3E9NA 4M55A 1T1GA 2PSSA 1W19A 2BSAA 2PM8A 3GRRA 4FFRA 5AKYA 3VR0A 2ZRLA 2J6IA 1OWLA 2QZPA 4UE3S 4LCBA 2IUUA 1W0KA 2PVCA 4FBGA 1J7JA 4EARA 3A05A 4MGIR 3N74A 4IJMA 4Q7KA 4PZPA 4YQYA 1IB6A 3WMEA 1OZ0A 4BGEA 2IBTA 1IMOA 2C9YA 2GERA 5JFOA 1ABBA 5DYYA 1BQ3A 3AEZA 3W04A 3FETA 4QJ4A 4BO1A 3IT3A 1PSZA 3LS2A 4ZQBA 1A8HA 4KQHA 4PZ9A 3VAZA 3Q1KA 3EODA 4R2LA 3UVEA 4PONA 1J5XA 5JRDS 2RMKA 3IJEB 4GPTA 4KWTA 1RI5A 2IE0A 5EUMA 1TYAE 4JHLA 2OXIA 5FOQA 4QU0A 1ESEA 1OOEA 3OZ7A 4L5YA 2OZEA 1JWBB 4ZCPA 3RUEA 4BO0A 1GV0A 3DLIA 4X1KB 4U1RA 3EAFA 2INGX 2QRUA 3N5CA 1KQFA 2G5TA 2SHKA 3M2PA 4Z4EA 3SOPA 4BMSA 4DF3A 4NNJA 1CUGA 2QRZA 3ACBA 3KB2A 3LRXA 5EXPA 3H9UA 1LNZA 1ZLXA 3R6DA 1T3ZA 4YFYA 1A27A 1K9SA 4FW9A 4YONB 4DDWA 1M34B 1NVXQ 2B8NA 2V97A 3ROGA 2FE4A 4IGKA 2QSZA 1DIBA 3RVOA 3C3XA 1QQ7A 1SHUX 5EOVA 2QX4A 1EG7A 2F8LA 4LGMA 3K0AA 1QH1A 3ZCQA 1B76A 1VIVA 2AOVA 1V8BA 3N2LA 3PKIA 5C5EA 3IP7A 2H2IA 1TUBA 3RD5A 4MRAA 4P2BA 1G8PA 3M82A 3Q7SA 4LTMA 4MAFA 5J1SB 3SVLA 1ZD2P 4J0JA 1AH2A 4HVTA 2NO4A 4FE7A 4N5HX 1EP3B 4IEIA 3LDHA 1NL3A 2FV8A 1MA0A 1WTCA 3LPCA 3G6KA 3D02A 4PWYA 4AKSA 3V6MA 1KOFA 1DAEA 4HB2A 4TXLA 1ZD9A 3ROZA 3ZUGA 2QR5A 1AK1A 3RVBA 6NULA 4RTKA 2UXCB 2JC3A 3RLFA 4IZOA 1BS2A 4UUMA 4D9EA 5BSUA 5A4DA 1T9BA 3JRNA 1U81A 3WTBA 4KXVA 3SR0A 4WBXC 1YR2A 2WKWA 3H0CA 1FRNA 3N2NA 2ZJAA 2XOKD 4E46A 3FKQA 4DJFC 1BE8A 1XZJA 2G17A 4X20B 1U2SA 4BPRA 3ZQJA 1QHXA 3DQZA 4EKNB 1YJQA 2VTEA 5EZYA 3H86A 1G1MA 2Q3MA 3CW9A 3NWJA 4TTSA 5TMDA 3VR3A 3QU9A 4CN9A 1QRSA 1L6IA 5HCUA 2UZAA 3T99A 3LT4A 1TKRA 5DYGA 4ZJPA 1FNCA 1Q21A 3S2IA 2BY4A 1JEQA 2HA3A 5T4EA 3QF4B 1JZSA 3D54D 1KFJB 3LQYA 4A27A 1KH1A 4YT8A 1HWYA 2YWHA 4YRGA 4RQBA 5IW8A 3PPVA 2QXYA 2YN0A 4MRVA 3P0FA 2HQRA 4YRDA 1M72A 3TAHA 3I05A 1R10A 5JCZA 4Q7EA 3K9FC 2BL4A 5ARCA 3BJEA 2V59A 1H2EA 3H16A 4XVQA 4LC0A 4LRWA 5HIJA 1TDJA 3FTQA 3JD0A 4P32A 4PRYA 1U2TA 1QKIA 3BSFA 3CF6R 2B4KA 2CB0A 4PLTA 3GJ7A 1K66A 1P61B 4K9RA 4O5OA 1MR3F 4S05A 2G06A 1U7ZA 3LDUA 3QMVA 1NW6A 4A8HA 4B7ZA 5L6MB 2HDWA 1JAZA 1U7UA 2NU7A 4LJ7A 4QO8A 4B5LA 2DBVO 1NOJA 3A3YA 3K73O 4TZ0A 2LP4Y 2HYDA 4RMNA 3FUXA 3VKWA 2J41A 1IY9A 1UOQA 4OL9A 4QASA 1T8RA 3K6JA 1Q77A 4DGQA 1UINA 3UPTA 1N3BA 3MA0A 4X8MA 2PGDA 3DVAB 1MH9A 2B25A 1X7XB 3EARA 4MWEA 1MDFA 2GEFA 2A7QA 4A91A 1JHUA 1R2QA 4Q4AB 1T0UA 4CU5A 1M0SA 1WXEA 5BT8A 2CT8A 3RW9A 1J5PA 2UUBB 2GBPA 3HC7A 4LXQA 1W5TA 2ZIUB 2P5UA 4IDNA 3TDKA 4BKQA 3B8HA 1TAQA 1JFFB 1R5BA 3KV3O 3U7HB 3T1OA 3E27A 1GT91 4P7BA 1UK6A 2B9VA 4MPRA 4REMA 2PTGA 4IPTA 4JCCA 1ICEA 1TJYA 2J3KA 1WBDA 3HGQA 4OX9Y 4I1YA 3UGQA 3IOMA 5KTYA 4ZCIA 5A7FA 2NXNA 2KM1A 3IAUA 4M0UA 3A70A 1JQAA 5KPDA 1Q83A 2QGFA 4W8OA 4PZUA 4X3PA 1JGTA 1KVQA 1SC1A 2CMDA 2FUNB 1YRLA 1PT5A 4ARZA 2A1TS 3DZ8A 1K6IA 1ELOA 1UM9B 2GUGA 2JFOA 3HFGA 5DV9A 4N12A 3ZBPA 6CHYA 2V45A 2PWYA 2A2ZA 5FFFA 4LX0A 3C3MA 3P7MA 1XTKA 5JDCA 3RFUA 2XT0A 1RWNA 3QLVA 4FQ5A 1CR2A 4CG2A 2QQEA 5IBCA 1ORDA 1HTTA 3QOYA 3ZDRA 3DDNA 2C9MA 2D5IA 2LXNA 4NCNA 4IJKA 2PUCA 3EGCA 4JSYA 1WNTA 2OD2A 2AR7A 4RD2A 4LDAA 4BPBA 4X6UA 2N47A 1LVUA 1Q7BA 1ZEJA 3B3AA 1CUDA 4G65A 4KYVA 5KZMB 1AKQA 1UK9A 1RI3A 2J85A 2JLUA 5MHTA 4KKXB 4RV5A 4AQ7A 3GVHA 1CUCA 4HVLA 1L4FA 3C41J 4M46A 3IJRA 1NW8A 1G4HA 1LQ2A 2WYVA 4JA2A 2EBWA 4G24A 3C5HA 4Y0AA 1LBIA 4OQMA 5E1OA 4DQVA 4WPGA 1FXWA 4EL0A 2CDAA 3TINA 2XXAB 1GZSA 2PU5A 4V0OA 1DLIA 3A31A 1OHHA 5JVDA 4IGEA 2NIPA 1R6XA 1DAFA 1VG1A 3IKVA 1KS9A 1QXSA 2IZ1A 4CKBB 4EKEA 4MI1A 5JG7A 5JS1A 3OECA 3L9WA 3EIEA 3EZLA 3PV0A 1KRWA 4FHGA 1QLHA 1QIHA 3ND8A 3SP1A 4UAUA 1CIPA 4DPMA 1HE5A 2PT9A 4JN6B 3BWYA 5DCYA 2EQAA 1XP5A 3A06A 3F3MA 4ZZIA 3D0OA 2V58A 4TSKA 5CLIA 3VNAA 1YOVA 4B3IA 3CLHA 4JVNA 1SOUA 2ZBRA 2AMFA 3VSDA 1H3FA 4Q9KA 4ZTBA 1X1TA 4JR1A 3TMYA 2QK4A 4N3NA 1WHTB 1KAOA 3E61A 2QMYA 3P0EA 3PRJA 3JW8A 4QBIA 4TTRA 4XWAA 4Y9UA 1R6TA 4BY9E 3MILA 2PRKA 5KI6A 3VH2A 1UKYA 1CS0A 1RWWA 3L04A 3AUJB 3PDUA 4MK4A 3VMMA 4EY7A 1QNLA 2WWWA 3BXEA 3F9CA 3I9MA 4F46A 5LZ9A 1T1JA 3DMTA 3HVJA 3LKZA 1Y33E 3IO5A 2QW1A 2DF8A 2D5LA 4CETA 5FLXA 5FR1A 4CNBA 2NQ2C 3BHMA 1I3KA 3RYIA 1A97A 1QV9A 1IVSA 4AB1A 1QVWA 2REOA 2BKLA 2WU1A 3U5ZB 2CJYA 1JIVA 3DV2A 5TQ0B 2P9ZA 4CU2A 1F06A 1JWLA 2R1ZA 3B78A 5I7RA 3F3SA 3VVLA 2X14A 4KSBA 1ZGCA 2GA8A 5KYGA 3QI7A 4QOSA 5EP1A 4LJ4A 1MO2A 2PD4A 3LC7O 1A9RA 1O95A 3JZIA 2WRZA 3IULA 3TB6A 5FHRA 4DTCA 5CJPA 2F1HA 2CVFA 5JBNA 1N5KA 1WQ3A 3IV6A 4HR7A 3NHRA 5T3YA 3RAFC 2ECPA 3S2EA 3PXCX 4K2HA 1OYVA 1FTNA 5D85A 1N2OA 5J47A 1CU1A 2H3EA 1I10A 2MSEB 1FP4A 4PTZA 2PJUA 1LWNA 3FCSB 2FN9A 2W6QA 3ZY3A 2EEPA 4ZVPA 3WGMA 2DBQA 4DLXA 4CTMA 721PA 5AMXA 4NAHA 1R4MA 4FZ3A 1D09A 4OXIA 1QCDA 3S8YA 2DPMA 3ZHRA 3EXFA 1U2EA 3JSXA 5B58T 4EZEA 4YLYA 3WKCA 3GFBA 1XRMA 3BERA 3GRAA 3WGTA 4ZHQB 2C2WA 1IE3A 4GZ6A 4Q4LA 3OJFA 3AW8A 4CLOA 3GRCA 3VR4D 1E6EA 1ML4A 3I72A 3OHMA 4ZV9A 5CCDA 1RKBA 3CCBA 1ADGA 4GQAA 2GHIA 4BJ6A 4KIGA 3TZ6A 5CG1A 2CD9A 1EWTA 2XQKA 5CVUA 1KP3A 3G5TA 2E9SA 4NJEA 5FO0A 3E9YA 5IUJC 3WJAA 2PGNA 3RS7A 4AZTA 1CEQA 2W93A 5AVRA 1CUHA 2C61A 2G3YA 2VQ3A 4WKOA 4DABA 1DHTA 1DWOA 2P9TA 2QDXA 2I9PA 1X1RA 2H1FA 3TSAA 3UWPA 3G0DA 4ZEOA 1RP7A 2FXIA 2QXUA 3B6MA 3W5SA 1QZUA 5K8CA 5EZ5A 3NBZC 3PICA 3O8OB 2ID8A 5CB6A 4BLWA 3B12A 1EUYA 4NDZA 4XVUA 4AAYA 2A5GA 2YVKA 2KW5A 2IYFA 1YONA 4FHZA 4IKPA 2OZKA 5LBUA 1CZHA 4E5VA 4GAEA 3CZQA 4ZYVA 5AI8A 5CGZA 1QTQA 1NJ8A 3ILHA 4C06A 3VA7A 1FJHA 2W2VA 3GN2A 1ZN9A 2O9JA 4FSHA 2WF8A 4E4YA 4DYDA 2PU7A 1U0HC 3Q41A 2YN4A 1CUIA 3E9ZA 3TIIA 3WWCA 1W4BA 3KL4A 2BF7A 2W70A 3SC2B 4TQGA 4BLRA 4DCNA 3C3AA 3B2NA 4GEKA 4R1NA 4MR7A 2RK6A 1M2KA 2PNJA 1NW9B 2BOVA 5AD1A 1MFZA 1P2BA 2BZGA 2CE7A 2EG5A 2C96A 2EDCA 3V8VA 5I7HA 4C4SA 5IXJA 3ZNPA 1EZ1A 3A6DA 2PLNA 4X61A 1EWKA 1P1CA 1T5DX 2X8JA 1X77A 4Q4HB 1QFYA 5CDYA 2Q6OA 4TLEA 5HGJA 1CY2A 3PXGA 4AC9A 4RFVA 5E1MA 2HPVA 4R8LA 5FWAA 2BKXA 4H27A 3ZU5A 4BVGA 2FW0A 4D3FA 1EK6A 3KTFA 1GUDA 3RPEA 9MHTA 1CUJA 4F2DA 5TMPA 3WLEA 1HDRA 3NTOA 5EE3A 5BV1A 4YJGA 3AESA 2NU8A 3ZGOA 4IFIA 1Y6QA 3DG9A 4MPPA 3UJDA 1N33B 1USKA 5LA6B 3K0HA 2X1LA 3PA6A 5C52B 2RC6A 3DZGA 2O8BA 4TMWA 3DT8A 3FM9A 1COZA 1PHRA 1SZJG 4OQFA 3D0RA 4WVLA 5AOAA 1LBQA 2Q4BA 1C3LA 2E85A 4RGBA 4ZEXA 5A5FA 4ARIA 4IAOA 4X8OA 4OGLA 1KXJA 3LDFA 5I7FA 1RVV1 4UHHA 1YE8A 4EB6B 4DJAA 1H8HA 3EXG2 4JXJA 4EO4A 2F9LA 5FOSA 4JBHA 4WJZA 3FYSA 3QVKA 2YWGA 1UUFA 1CBUA 1Z5NA 1A4UA 2ET6A 2WIBA 5B3JC 4NZ9A 1IAQA 4QUAA 1HDGO 2VXOA 3ZVKA 1N3LA 1R9JA 5FPSA 5F9FA 5C7IO 4II3A 1E66A 1DKMA 4A9AA 1QQ6A 3LCUA 1HG0A 3LM8A 5BW5A 3PR2B 3UFXB 3DW3X 2GEDA 3MSXA 4PBTA 4CT5A 3W34A 1N2GA 2XJ4A 3WNBA 1USWA 3CVOA 3P9PA 2O2EA 3CY6A 4M6WB 1MB9A 2BGKA 3L4JA 1IH8A 4MS3B 2IXAA 4JLDA 5FEUA 1G21A 3OOWA 3UPUA 5COAA 3BCHA 1DBWA 4Q16A 4CGZA 1W5SA 1YDGA 1ML3A 1GUZA 2Y27A 3MQ4A 4JASB 4BQFA 1EFCA 5GP1A 5ALNA 4B80A 3EVFA 4IOLA 4UXJA 5EVJA 3RT1A 5AXDA 1W2WB 1LBHA 2ZR0A 2AN3A 3DB1A 5I8WA 4L9WA 5KJ6A 3FPJA 1YUBA 3LSTA 1HA3A 1TMYA 3TMKA 3ZZ0A 3WWZA 3BK1A 1FC0A 1UIRA 4DV3B 1VPWA 2V74B 1RHUA 2UAGA 3IUJA 1F6WA 1Z63A 5AVSA 5AXBA 3UW1A 2WJVA 3NNDA 4F45A 1GHTA 3T61A 4O4LB 1PGPA 3GEHA 5ALYA 4D0NA 4BGDA 4JFAA 3QKRB 4JB2A 2XCTB 1FDOA 1QUFA 1W8DA 1YDMA 2GWRA 1Z45A 2YWEA 2VHTA 3HJTA 4P4LA 3GJTA 1R8YA 1KPGA 5CX1B 5FI5A 1SMKA 1WKVA 2BFWA 5AKHA 4M7WA 1BXGA 1CPYA 3CT6A 4IZ6A 4IQFA 5EAIA 3GUVA 3UWDA 3FYDA 3GXBA 2VAXA 4JLKA 1CT9A 1U4NA 3QMPA 1TTHA 1DQRA 1SCUB 4LS3A 3U48A 4N0PA 1IQ0A 3DZDA 1TZMA 4G8DA 1PR9A 4G9EA 4EK9A 3KPUA 1OC2A 5B4UA 4HQRA 4TQ9A 4RV4A 4AWBA 2WUDA 3UANA 2KSQA 3TR6A 1UMDA 3GLVA 1B0ZA 1CEEA 3H5RA 4ZQFA 1CR1A 3WC4A 4BKUA 5HGXA 4GPZA 2C5GA 4XX0A 1ZA1A 4MB0A 1CZLA 2Y1KA 3ABQB 4C5AA 4BECA 4AT1A 4GQIA 4D79A 3EAGA 4B6JA 4XM2A 1M1NA 5DSXA 2BGTA 4X00A 3HSKA 5H81A 1CQPA 4MQFB 4M8SA 2R65A 1W9MA 2FP4B 4BVKA 2G77B 4B71A 2YQ5A 1BCSB 1X1AA 3NKLA 1RPTA 2XZDA 2FG6C 4OM8A 3VU3A 2H4FA 4BQSA 3FTEA 2HY7A 1YJBA 1U2GC 3LX6A 2WWHA 3H5NA 5HK8A 3TLZA 4DYHA 3GLQA 3JR7A 3LPAA 1EXNA 2V65A 3F46A 1Q22A 3HPQA 1M83A 1V8OA 3F7NA 4JJFA 2AN9A 2O2CA 5F76A 1YBHA 1X39A 5J5VA 4AFNA 5JDIA 1DINA 4JK3A 4U2EA 1G98A 3B2QA 2ZQ5A 3TLXA 1JF8A 3CN7A 3DBOB 3LX4A 3M6UA 2UYCA 4K9LA 5FR2A 5JLAA 2YJTD 3AU9A 4UMEA 2GRJA 1M6NA 5T4HA 4P4SA 2VPYA 3F5SA 3RI3A 1PGQA 4EJFA 1JLLA 5HRAA 3SXPA 3UJ3X 2JFNA 1WSWA 4S35A 1C7IA 2XB9A 1O3YA 2ZRAA 4IEEA 1F8FA 4DSTA 1E3SA 4L85A 4ZI2A 5HSGA 4I4TB 2WILA 4ONEA 1CWUA 2YNMA 4B3XA 4MUXA 3MJFA 3PL5A 1PEDA 3BZBA 4L8FA 3FPHA 1W94A 4IIJF 4PCVA 3TW0A 4JI7B 4K6KA 4MVJH 1NVUQ 1U8AA 3RBAA 2C2XA 3QKUA 3DFZA 2IXBA 4TKVB 4I3HA 5IM4A 1XP8A 4XDZA 2H5JA 4IM7A 3KPWA 3GU3A 1O4WA 4FR5A 4A0QA 4FC6A 1QU2A 4KRFA 2UYYA 1GRNA 3MGCA 3OU7A 3HRKA 3Q6NA 1UC4B 3TDMA 4L8GA 4A3SA 1IN5A 1HQDA 2I2FA 4AO8A 2WYIA 1VYVA 2EZ4A 4FQ8A 1R12A 3ZPXA 1S3SA 4Y2YA 4ASUA 1DC5A 2E7ZA 3GROA 3P9YA 2XUFA 3RRXA 4L4ZA 2MMCA 3G2NA 4KU4A 4RWEA 4N9QA 2QTAA 4J91A 3U9TA 5AHXA 3BJIC 1WW3A 3II6X 4B84A 5MGBA 3EZNA 2QLTA 1MPXA 1KH2A 1JQEA 1E58A 2IXTA 2ROQA 1TQ4A 2RBKA 1KI6B 1GR1A 4H1TA 4LV6A 3P71T 1ENPA 4QXMA 4E6EA 2JS7A 4MRMA 4E5YA 3KDPA 4MVJG 1VDZA 2X9QA 4G89A 2P69A 1UAGA 3M5DA 4PC3A 3RNOA 4Y3UA 3WMFA 1VXOA 4WRRA 4W8GA 2GK7A 5C7OO 1XDGA 2ALJA 1ZRSA 1NX9A 2JLCA 2OCDA 3NASA 4ZO6A 1KH3A 1RQNA 2B69A 4U7PB 1Z22A 2P40A 2PAFA 1E7QA 2IKSA 4EVSA 3BMQA 4UZSA 3U3XA 4LPSA 1OH8A 3G0BA 3CLSC 2YR0A 4BVHA 1ENOA 2Q6VA 2WHEA 1QE3A 4MV7A 4DYVA 1Y8ZA 3T5GA 3CRW1 1FPQA 1N1GA 2R0QC 1P19A 2PKRA 1U6KA 4GX0A 3GD5A 4D6PA 1H4VB 2HRZA 3SSNA 3FXAA 1PKXA 1Z4LA 4WUTA 4J8PA 2GRAA 4BMNA 1KETA 3I32A 3B5EA 4OG2A 4XSVA 2AKAB 2VTDA 5FBRB 1X7HA 2AVNA 1NSTA 4LXIA 4MXDA 1O0CA 1RXIA 4K03A 3OZGA 5BT9A 5DN6D 5EHQA 5D6NA 2I7DA 1SPXA 4B6OA 3AW9A 4PGHA 5REQB 1B3BA 1YJ8A 1LW7A 4QJ3A 4X44A 1QH9A 3UTCA 4DR1B 2JIOA 1DQYA 1NUAA 3QW2A 1YDFA 2MR6A 4MWGA 2IEAA 5C5CA 3DPUA 3WB2A 2QTBA 1ZVVA 3EZGA 4IDOA 3SD7A 3AVWA 3WY9A 5IEBA 1QHNA 3FA2A 2HCRA 1ZIXA 3SM3A 3STYA 3HCWA 3L8FA 1GNTA 4CNQA 1P9RA 1CUZA 2VLBA 3THYA 2NACA 2TYSB 3PKJA 4NPHA 3ZNOA 1NUTA 4CMJA 3A1DA 2WTBA 4KMRA 2CN1A 2DBRA 5CA0A 2ORED 2VR1A 3QW4B 5AVQA 1EMDA 3K32A 1WCIA 3EA4A 4Q21A 1U1CA 2XGSA 4LUCA 1MRZA 1IBCA 1GNPA 3IDQA 1EX6A 2VK4A 3P27A 4G25A 4JJEA 2R6ZA 2X2EA 1E1CB 4UASA 4YCAA 2XB2A 2UYOA 1R8SA 3SEZA 4KXNA 5HE8A 2H7YA 5IXYA 4E51A 3QVGA 5CGQB 2HRQA 2YV5A 1UK8A 2VJMA 3AY7A 1HOTA 2B8JA 4FGSA 4ERXA 4ZOQI 5A03A 2CJWA 3E05A 1GFWA 4ZQIA 4JC0A 3GA5A 3LX8A 3K9LA 2H2DA 3IOCA 1DOZA 4NU5A 3W9UA 1COWD 2WTEA 2FEMA 3H4MA 2OT3B 4WLVA 3WV5A 2YV4A 1CQJB 1MRNA 3CN9A 3OCVA 1LRJA 3BMNA 4UVGA 1N2IA 4P54A 1XLWA 2QTRA 4RBNA 2DSTA 2HQOA 4JT4A 4XD2A 4BL5A 3DO5A 1SBYA 5A7HA 1UC9A 4JEMA 5EPEA 3VH3A 3IAHA 1MW9X 4ARSA 1G17A 3TBHA 3CPSA 4GMHA 5KO2A 1EX1A 1GL6A 2LDBA 2OGSA 1SCIA 4AYTA 1TPZA 4R8MA 3VDMA 3BSYA 3U13A 2JGAA 2QP3A 4KHZA 4LJSA 4UM9