2PU7A

Crystal structure of s112a/h265a double mutant of a c-c hydrolase, bphd, from burkholderia xenovorans lb400
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
283
structure length
283
Chain Sequence
b'LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNAMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGAWAQWEHADEFNRLVIDFLRHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
publication title The Tautomeric Half-reaction of BphD, a C-C Bond Hydrolase: KINETIC AND STRUCTURAL EVIDENCE SUPPORTING A KEY ROLE FOR HISTIDINE 265 OF THE CATALYTIC TRIAD.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Hydrolase
total genus 107
structure length 283
sequence length 283
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pu7A00
1XQYA 3ZPXA 5AKEA 4DMKA 3FYTA 3WMRA 1CUZA 1VJ5A 4OYYA 4B0PA 3C6YA 1JJFA 2Y1KA 3GBSA 3G9XA 2BJHA 1I6WA 1ZJ4A 5ALSA 5ALOA 4AZ0A 1ZI8A 1UOPA 4L9AA 5DYYA 1CUCA 5AJHA 4F21A 3EQ8A 5IVHA 2O7VA 5EIHA 4QWMA 3S2ZA 3C6ZA 3DD5A 3O4JA 1WM1A 3C8DA 5HQ3A 1MT3A 4H35A 4PSUA 3H04A 1MX5A 5LYYA 2C0PA 1AMNA 5I7UA 4UFOA 5HZGA 2WFZA 3OM8A 5AKIA 4OB7A 4C4XA 2ORYA 2HFKA 3O0DA 3BF7A 1CR6A 1P0PA 5AKXA 2G5TA 1QFMA 2OG1A 2WFLB 1B41A 1ZD5A 2H7CA 2HRQA 3R3ZA 2R8BA 3R3UA 1QTIA 2JGJA 5EHQA 5F4ZA 5HF8A 1WPXA 4L3WA 3R41A 1RWQA 2BUBA 3NGMA 1VA4A 1WHTA 4DTCA 3LLCA 3DKRA 2ZJ6A 2DQYA 1B6GA 2QJRA 1HPLA 4U2BA 1USWA 2ACKA 1CUEA 5JAPA 4RE5A 1JU4A 2QRUA 1LPMA 3BF8A 3GUUA 4X85A 2OAEA 1CUDA 1L7AA 3R3XA 1CUJA 3FYUC 5JZBA 2HRRA 4W1PA 3MGAA 4BVJA 1Y7HA 3RKSA 1LLFA 3X3HA 3E1GA 2WJ3A 4WCVA 2XI4A 3FOBA 3P2MA 1XRMA 2G4LA 3OG9A 1CUVA 2Z5GA 2QTBA 1SCQA 3BXPA 4BE4A 1EINA 2VT7A 5JANA 2HHAA 3R0VA 1MU0A 4X6UA 5HK8A 2WG2A 4H18A 5K3DA 1IUOA 1XZJA 4NMWA 2BGRA 2VJCA 3WWOA 3K6KA 5AM5A 1ZD2P 4C4ZA 4HAIA 4XWGA 1EVQA 4AO8A 1MTZA 1IMJA 3F96A 1XZKA 1E8NA 2RI6A 4BDSA 4HTAA 1CVLA 1MJ5A 1VXRA 3JWEA 4CI9A 3I28A 1GZ7A 4H77A 2W22A 5T4BA 3WWCA 1YA8A 1FFAA 4GBGA 2Y6UA 3Q0TA 5ALNA 4CG1A 1XRPA 5EIAA 2WUDA 5T4EA 2C5GA 3D0KA 4OD0A 1YASA 1UT6A 3HZOA 2BGNA 5FKJA 4YPVA 5JD6A 1DT3A 3FCXA 3WZLA 4BTVA 3WL5A 1OCEA 3M82A 2VATA 1YAHA 3T52A 1DWPA 4PQEA 5LKAA 5ALFA 4DIUA 1MX9A 2QXUA 3ESDA 2ZVDA 1ODSA 3GFFA 5CMLA 4ZGBA 3BIWA 5LLSA 1DQYA 4GWLA 4K5QA 3BWXA 5YASA 4HXEB 2OXEA 2XUDA 3QYJA 4KRYA 4HVTA 4X71A 1G42A 5IVDA 5DJ5A 1ACJA 2X5XA 3C5WP 2DHEA 4DM7A 1BE0A 5A7GA 5ALRA 3PFBA 2XUGA 4GXNA 5SYMA 3SWWA 2VAXA 3ANTA 1QZ3A 4OSEA 5EHZA 4OU5A 1WCYA 1MNQA 3LIPA 4MQLA 4QZVA 3KD2A 5HF6A 5HKBA 1U65A 1ZOIA 2XUIA 4KE7A 5LZ4A 4BYMA 3I2HA 5FXMA 1GT6A 4EB0A 1UZAA 4Y2YA 1G5FA 4J0CA 1ZIXA 2XUAA 2PKYX 4HRXA 1GPKA 5D7BA 3C87A 2XMGA 2D0DA 2Z8ZA 2QKYA 4MWSA 5E4JA 4BAZA 4FFWA 2BFNA 4K6GA 5DYTA 5ESRA 1ORVA 3WYDA 2Y2UA 3W06A 2PSDA 1LPPA 2O2IA 5JIBA 3E3AA 2FJ0A 4WFIA 4TVKA 1LPNA 2IITA 1FFEA 1DT5A 1MAAA 4Y7DA 1UKCA 5ALYA 1YSCA 2QJWA 5CURA 5JZ9A 1R4ZA 4DSZA 3WKBA 2XMRA 2CB9A 1XZMA 1XRQA 1ZGBA 4L72A 4C01A 5KWJA 3AJAA 2H9YA 4J0KA 1IZ7A 1T4MA 3KXPA 2I3ZA 4B83A 2J3QA 5EI5A 3ICVA 3EIOA 2J3DA 4ZREA 3FWHA 1BCRA 2AJ8A 3WI7A 3LP5A 4BCDA 1QFSA 3TEJA 4PW0A 3STWA 2XUQA 1H2YA 3DOIA 2WJ6A 4MJ3A 1R3DA 3WLAA 3IIIA 1RP1A 1J07A 2QVBA 4GDMA 1TCAA 3OTQA 5K5EA 1VE7A 3DDUA 1C7JA 1LPSA 1W1IA 3FLEA 3ESBA 2YH2A 3ANSA 3O95A 3IUJA 4G4GA 5AOAA 4EY6A 1F6WA 5ALIA 4X3CA 5HFNA 1SFRA 5HF5A 2PSJA 5ALMA 2PSHA 5D6OA 1P0IA 3HJUA 4LXIA 1XZFA 1L7QA 4M0EA 3C70A 3W2TA 2WIKA 3ICWA 4RGYA 1XQXA 2HA6A 3FBWA 4UHEA 3NUZA 4W1SA 3BL8A 4N5IX 5K3EA 5T4FA 1WB5A 3LS2A 1A8UA 4XJVA 1ODTC 1YAJA 2DHDA 4EA6A 4I4CA 3C8HA 4FTWA 2GBGA 3DOHA 5AI0A 4IQ4A 2GBIA 1CQZA 3R3WA 1RYYA 3AZQA 3DCNA 4DMHA 3ED1A 1R88A 7YASA 1CUIA 2I03A 3IBTA 5CH8A 2DSNA 5ALHA 3A6ZA 3AZOA 1G4HA 4AN0A 3R3YA 1YR2A 4C6HA 1UK6A 3I2IA 4P93A 3UMJA 2OPHA 2WIJA 5A7HA 2WG0A 4MYSA 4LKOA 3WWEA 2QOEA 2PBLA 3ESCA 2WHPB 4X90A 3QH4A 4Y2UA 1A8QA 3H2JA 4D9JA 5KREA 3WWPA 1GKKA 2PX6A 3G0GA 4AXBA 2C58A 4Y2SA 2QS9A 1Y37A 3HSSA 2CMFA 1THGA 2VJBA 1QOZA 2CJPA 1HQDA 3UUEA 1DX6A 5KWIA 4CFSA 2HA0A 2YYSA 3HRHA 3CCCA 4CCYA 1SC9A 3ILSA 2I3DA 1EDDA 2C4HA 4X95A 4B0OA 3KWFA 4E15A 1THTA 2WHQA 4BAGA 2B9VA 4Q1VA 3G0BA 3U0VA 4EY4A 4UUQA 3IDAA 3VJMA 4ZRDA 3K9BA 2PUHA 3HABA 4B82A 4MXDA 2WUFA 3D3NA 4AN1A 3C43A 1EK1A 4QDTA 2ZYHA 1K6EA 4IH4A 4FFVA 5CT5A 4MWTA 4FLEA 2CKMA 3STTA 2IX9A 4OYLA 3L1IA 3S8YA 2DHCA 2JGKA 1DWOA 3G8YA 3HYSA 2XLCA 3MUNA 2R11A 5C81A 4J0JA 4WY8A 1W75A 3IURA 1M33A 3V9AA 5CXXA 4OPMA 3F67A 5D3ZA 1XZCA 2JF0A 1EHYA 1D07A 1UFOA 3IUQA 2XQIA 5LZ9A 3C6BA 4DMCA 2GBCA 3H2IA 2XQKA 3WIOA 4FDMA 1AURA 4BP8A 1CUUA 2YASA 2GBFA 2XUJA 5K3FB 3I1YA 3ZLTA 4GW3A 4EUSA 5ALWA 3PUIA 5AI9A 4HRYA 4ZWNA 1T2NA 2HA7A 1F0NA 3DLTA 4G1FA 4HXGA 4X6YA 1O6GA 4GECA 3I2GA 4F0JA 4H7EA 1AGYA 4UBKA 3I6MA 4XVCA 3DQZA 1XZBA 3DKKA 4O08A 2O2HA 4K6KA 4BZWA 5JARA 3QMVA 4H0CA 4ROTA 1QLWA 3HEAA 1IUNA 4C87A 3VVLA 1A7UA 4E11A 4C88A 3WA6A 3M83A 3O9MA 1JJBA 2DFPA 1J2EA 4G4JA 3F8SA 4A5SA 3FNBA 2HM7A 1W6RA 2OCLA 1HLGA 4H7IA 1BEEA 2VA9A 5ALQA 3O9VA 4GLBA 3IA2A 2XQFA 4Y2RA 1JJIA 4FWBA 1PV1A 2WUGA 1VKHA 3PI6A 3JW8A 4OU4A 2VT6A 4ZV9A 5E2IA 5AK3A 5FLKA 2Z8XA 3AZPA 3QITA 4QDZA 3RM3A 5ALPA 2QUAA 3QPDA 2C7BA 3VISA 1MX1A 4MYDA 3W9UA 2PPLA 5BWBA 2HL6A 4E46A 5EIEA 1HDEA 1ZJ5A 2P8SA 3CN9A 2XMSA 4E14A 1F0PA 5AI8A 1JU3A 2JGFA 1ZD3A 4GHWA 3W04A 2GZSA 2XUFA 2HFJA 1TK3A 4I3FA 1LPBB 4LXGA 1K5PA 3TRDA 4UBLA 2AJCA 1UKAA 1CLEA 2ZSIA 5AKJA 1E66A 1LZKA 5AOBA 4BAUA 4KE8A 2XUOA 3BJMA 2W6CX 1J1IA 4FBMA 3A2NA 3TGLA 3H19A 4J0DA 1SCIA 2CBGA 3AINA 3I6YA 2CUTA 4BRZA 4Y9SA 1N1MA 4INZA 5AI6A 5ALJA 4X00A 1BN7A 2GYUA 5DNUA 4U2FA 4W1QA 4H7KA 3STXA 2XLBA 4K2AA 3HC7A 3DL7A 2VJDA 4J7AA 4B7ZA 4G8DA 5ALEA 2DCMA 4KR0A 5DTIA 1QIFA 1XKLA 2Y6VA 2ROQA 4EHBA 3WZMA 1QIKA 4P92A 3WKCA 1QIEA 2OCGA 5AOCA 3G9TA 4IO0A 3WWDA 3RK4A 3DYIA 2WFLA 3D5EA 1EI9A 1QIDA 1CUSA 1XZEA 2OLEA 5JALA 1ZIYA 4AO6A 2RIPA 3H2HA 4WDQA 1XRRA 5SYNA 4EY7A 4QWWA 2G63A 3WL7A 3VDXA 3AUKA 2ECFA 4UBNA 2QXTA 2ONCA 4GEGA 2WLSA 4ARBA 4L0CA 1GPNA 2WQZA 4WJLA 2PU5A 3M3DA 2ZJ7A 2WUEA 4ZXFA 4UHBA 4YK7A 1WPRA 3I2FA 1KU0A 3FLAA 3ZLVA 4YASA 2QZPA 4OCZA 5AP9A 3BJRA 2HADA 4Y2QA 1DINA 1UWCA 4HZGA 2QT9A 1E3QA 4QDUA 1UK8A 5J3JA 3QPAA 4QLOA 1U2EA 1X2BA 2GZRA 3IVMA 3WQHA 3L1HA 1IVYA 1YS1X 3E0XA 4H7HA 3U1TA 2XB6A 4KYVA 1DX4A 1XZHA 1E89A 1VZ3A 4BE9A 2WSLA 2OQIA 5ALGA 4BCCA 3PDCA 1Y7IA 4N8DA 2J4CA 2BAGA 3BIXA 1Q0RA 1HBJA 3RLIA 1W52X 1EA5A 4ETWA 3HACA 4BZZA 1C7IA 1CUXA 2EEPA 5BV7A 1IUPA 3D2AA 4F5ZA 3WKDA 1Q83A 4NVRA 4W9RA 1TCCA 4KJXA 1QIHA 5CT6A 2Q0XA 1WB4A 3MUOA 3H2GA 1XRNA 1FSSA 2XUPA 5C8ZA 1JI3A 2VEOA 1ZICA 2JEZA 4A16A 4B80A 2WIFA 4FHZA 4FBLA 2QR5A 2PU7A 2WM2A 5CT8A 1R9NA 5EHXA 2DQZA 5JAUA 3NWOA 1LPAB 2RAUA 4BVLA 3C6XA 1Q84A 5DWDA 4YX9A 4JYMA 2OGZA 4UHDA 1OILA 5IKXA 1G66A 3HXKA 1QO9A 5AM0A 3AFIA 4IHAA 3RARA 2QM0A 3BDIA 5LKRA 2FJPA 4KEAA 1ZI6A 1KEZA 4DSAA 3WK4A 1Q0ZA 3D2BA 3QMWA 1CUAA 1QGED 3FYUB 2O2GA 3IB3A 4WFKA 3O4IA 3G02A 4CCWA 2XMQA 4EY5A 1CUWA 3H1BA 4DNFA 1C4XA 5AHXA 4Y2PA 3YASA 3CCBA 5LP1A 4PF1A 5JD4A 5AKYA 1BS9A 1AC5A 4Q3OA 2WHRA 4EBBA 5AKHA 4G5XA 3H17A 4BB0A 3WK9A 1QIMA 4AZ3A 1VXOA 3FLBA 1Z68A 3WIBA 3SK0A 3V1NA 4FMPA 4CG2A 3VJLA 1E8DA 4RNCA 1UXOA 5CW2A 4QLAA 4H7DA 4Q34A 3FCYA 5AO9A 5HQ3B 2OGTA 3LIIA 3WKEA 4Y2JA 4FKBA 4I19A 4K6HA 4WDRA 4TPKA 2HU8A 2OQVA 4Y2XA 5HK9A 1LPOA 1UK7A 2RGUA 2NW6A 1JMKC 2ZYIA 1WB6A 4QDXA 2QUBA 1EDEA 3KOOA 1TAHA 4CG3A 4NS4A 5FV4A 1UKBA 1VE6A 4V2IA 2HIHA 2FUKA 4JEIA 4LYEA 5FUMA 5AM2A 3WJ1A 1CUBA 5FOQA 4BRSA 1ETHA 4DNPA 1CPYA 3FVTA 1CIJA 1ISPA 1XZAA 2XMZA 4HXFB 4UPDA 5AKZA 2XDWA 1XZLA 3QZUA 1WOMA 1UOOA 5C8VA 2RHWA 3H0CA 3H2KA 1DWQA 3ZI7A 1DQZA 5AIAA 3PF9A 3DJYA 4BATA 1XKTA 3OOSA 1XQVA 1ZD4A 1CFJA 3WKAA 3SX4A 4Y2VA 4DNQA 3D4LA 1AQLA 5ALZA 3V1MA 2VSQA 4FLMA 1SOMA 5LZ2A 5DTJA 1EH5A 3DYVA 4P08A 4Y2TA 1XZGA 3FAKA 3FVRA 5ALTA 2HA5A 2PVSA 2GYVA 1LZLA 1K63A 2O7RA 2Y2VA 2VTVA 4H7FA 5AKLA 2C5FA 4PSDA 1XLUA 3I2KA 4U2GA 3SC2A 3FSGD 5A2GA 3IUMA 5AKGA 1R9MA 4U2EA 3O4HA 3ESAA 4DGQA 4LIPD 4AMYA 4F60A 3STUA 3QVMA 1K4YA 5CXUA 1FFCA 1AZWA 2AXEA 1YB6A 1BRTA 1VOTA 5K3AA 5AM1A 5LZ8A 1CRLA 3FSGA 1TCBA 4AX4A 5D3KA 4UHCA 2WHPA 4DLNA 1CUYA 3AILA 4OB8A 3STYA 4X6XA 4J0HA 1UOQA 4S0XA 2G5PA 1GKLA 4XX1A 4FNMA 3G0IA 4G9EA 2YXPX 2X76A 4X94A 3G7NA 4W1RA 3VVMA 3KWJA 1QJ4A 4EZIA 3BDVA 5JAHA 4BC1A 5DYWA 2UZ0A 5A7FA 1QONA 3B12A 4AO7A 1P0MA 5LZ7A 3GROA 3K2IA 2B61A 4B81A 4M0FA 3UUFA 1DTEA 4Q3LA 4WFJA 2QMQA 4HS9A 1JFRA 4KACA 5E4YA 1VA5A 2WILA 1O6FA 5CH5A 2H7XA 5AICA 5LZ5A 2B20A 4A23A 2WTNA 4EY8A 2VF2A 2VQ6A 1BROA 2V96A 4B9EA 4ZV7A 1HL7A 4M0MA 4JNCA 5AM3A 4N8SA 5E4TA 5JATA 1BU8A 2C0QA 4BC0A 2E3JA 3WK5A 4KAJA 1GPLA 5K3CA 5HKAA 2BKLA 2ZYRA 1W4LA 1XZDA 4AMZA 1FJ2A 3LCRA 4IH1A 4NZZA 2K2QB 2LIPA 2RHTA 2HA2A 1EB8A 5C7YA 1EXWA 4BDTA 5HF9A 3WK8A 1BN6A 4N8EA 2HU7A 4ARAA 2J4FA 2JGMA 1X2EA 2Z3ZA 3ZV7A 4JH0A 5K3FA 4UBJA 5AK5A 2WJ4A 2BCEA 5HCUA 1AX9A 3WL8A 2WIGA 2JGEA 4DMFA 1KU6A 1GXSA 5CBKA 4B85A 4PV7A 3D59A 1E5TA 1R1DA 5JASA 1F8UA 4UFPA 1JKMA 2Z3WA 4Q05A 3D7RA 1BEZA 4UBMA 5ISMA 2ACEA 3I1IA 3H1AA 3HI4A 3N2ZB 3DEAA 1YS2X 2V9ZA 4Q3KA 3WYNA 3M81A 4H7JA 1LBTA 5FRDA 5ALUA 3TJMA 3A2MA 4UBOA 3G0CA 3B5EA 4W63A 5AK4A 5KBYA 3AIKA 2I78A 3ZWQA 2H7YA 2BUCA 4P9NA 2D5LA 5BOVA 1CV2A 4G8BA 3WL6A 2XUKA 3PFCA 5CT4A 5HFAA 2HA3A 4B9AA 4RE6A 4GI1A 4OUKX 4QNNA 5CRIA 3JYHA 3CXUA 3IUNA 4OB6A 4LHEA 2CZQA 4U2DA 5JADA 5FDFA 3KDAA 2JIDA 5JAOA 2WKWA 1P0QA 1FFDA 1AUOA 1MPXA 1XFDA 4RPCA 1WHSA 4PNZA 3STVA 5C8XA 3IULA 3G9ZA 4TGLA 2AJDA 4C4YA 1GQSA 2V98A 1SCKA 4X91A 4FLFA 1U8EA 4MEBA 3L1JA 5AK6A 3OC0A 5FP0A 5ALLA 1IZ8A 1TQHA 4KAFA 3WA7A 4C89A 4J0IA 4KE9A 2XT0A 4WY5A 1XLVA 1K8QA 1ODCA 4B84A 2ZJFA 3V48A 2XMCA 1YA4A 2ZYSA 2PSFA 3I6ZA 5AKKA 2EDCA 3QPCA 5AIBA 3T4UA 2DR0A 3A2LA 4X92A 4N5HX 3W9BA 4QA9A 1X70A 3G0DA 2EDAA 3QMMA 4BVKA 4BCBA 3PICA 3F97A 2JGLA 5JD5A 2RONA 3WK7A 1CQWA 5DNVA 5H3HA 2XE4A 5IVKA 4DYHA 1PJAA 4UHHA 4IH9A 3C5VA 2H1IA 3CN7A 4ITVA 4BTLA 1QTRA 3HLKA 2PM8A 3OURA 1U4NA 2V97A 2OCIA 2JEYA 2CEKA 5CTAA 3F98A 2XQJA 1LNSA 3WK6A 4AB1A 3H18A 4X93A 4MQMA 1CUFA 2XUHA 3ZLUA 1N5MA 3Q8WA 2HU5A 4ZI5A 1UK9A 1QIIA 4CCYB 1QO7A 5AI5A 3R3VA 5LIPA 5JYCA 1W76A 5CH3A 4FNGA 3DNMA 3E4DA 1JT2A 1ZGCA 5ALXA 1A8SA 3GA7A 2VAVA 5DLPA 2HA4A 5EHNA 5AI4A 3W05A 4J0GA 1LGYA 3PF8A 4UHFA 2WG1A 1H2WA 5A6VA 1GQRA 4J03A 1QIGA 2XMDA 4UBIA 3EBLA 2PSEA 1NU6A 2X8BA 4QDOA 4DNOA 5FPQA 1H22A 3PE6A 4KAAA 5K3BA 4KRXA 5T4HA 4PSCA 2AJBA 5ALKA 5I8PA 2IIVA 3AIOA 3B3QA 1MAHA 1EB9A 1MNAA 3OPMA 4G8CA 1XLWA 3QBJA 1VLQA 1XROA 1BCSA 2ZSHA 3KSRA 5JZSA 3QM1A 5EFZA 5BWCA 2VJAA 1TIBA 4FOLA 3EQ7A 3EQ9A 3PUHA 3D2CA 1ORWA 2B4KA 1QE3A 1ACLA 4JUIA 1PFQA 2WFMA 1E8MA 1HKHA 5ALDA 1N5RA 1XRLA 1DU4A 3VJKA 2HDWA 3F9CA 3NOXA 1ZI9A 1MN6A 4B6GA 1VZ2A 1FFBA 4LXHA 3BE8A 1EVEA 2JBWA 5IVIA 2OGSA 2WU3A 4JYPA 2XQGA 2ES4A 2FX5A 1A88A 1XQWA 5DNWA 4BP9A 3V1KA 3O4GA 1N8SA 3G9UA 2PUJA 2OAGA 5AM4A 2XMBA 1JMYA 1YCDA 3C45A 3VKFA 3EF3A 3WJ2A 1H23A 3GZJA 5AH0A 5FPPA 5EGNA 6YASA 4QE3A 4QEKA 4G4IA 1H2XA 3R40A 3GELA 1GGVA 4CIBA 2BUAA 2PL5A 4U2CA 4UFNA 4X7BA 3VXKA 1S8OA 1R50A 1CUHA 3N0TA 1LBSA 1MO2A 1XZIA 3DL4A 4KE6A 1EK2A 2WTMA 1CUGA 2JGIA 1TKRA 5A62A 3AIMA 2WU4A 1CEXA 1EDBA 1EX9A 4CIAA 1H2ZA 2WIDA 2OCKA 4G9GA 4MEAA 4Z49A 1YB7A 1J06A 5ALVA 1NU8A 4XIIA 1QIJA 5CT9A 1TRHA 1AKNA 4X97A 3FYUA 5I9IA 4Q82A 4PO3X 5A71A 4BBZA 3DS8A 3V1LA 2AJLI 2GYWA 4LYDA 1NX9A 3A70A 4AQDA 3MVEA 5IH7A 3I2JA 1L7RA 4J3JA 1OXMA
chains in the Genus database with same CATH superfamily
3A9UA 3UXEA 3OPXA 5C35A 1SOVA 1RWOA 3P9ZA 4C78A 4EKYA 1Q0QA 1CF9A 5H02A 4MKRA 4PLPA 1KH2A 4P4SA 2A6PA 2OYSA 2PKXA 4Z6KA 3GFBA 4DMKA 3NIFB 1RC0A 2H2WA 3FYTA 3JZFA 2SKCA 1CUZA 3FPCA 4DXAA 2PYIA 3P9PA 4JAVC 1XF9A 1FQKA 2H5IA 4K9KA 2GN9A 2OXIA 4B0PA 1W29A 1PRYA 4HYQA 2B25A 4QT0A 4XWTA 4BNUA 1JJFA 3GBSA 3RTAA 3RRFA 3A6PC 5AT1A 1S2OA 3NR2A 5JJIA 2AFHA 4D8UA 1GZUA 4LOAA 3JD4A 4RF3A 3WRYC 3WNBA 3WGTA 1PW5A 2ZI7A 4R1LA 3FM9A 3LT5A 3NCTA 1BWSA 3OKCA 1KJZA 5ALSA 3SDBA 4MTCA 1FYFA 1MD9A 2YJTD 3GT3A 4AZ0A 3ZXSA 2AW3A 2J9GA 2NO6A 5KINB 1T5HX 1CUCA 3LAWA 3T4XA 5KIAA 5AJHA 2AKEA 3U7RA 5T57A 3HK2A 5CXSA 3FIJA 1YIAA 4B6QA 2YWJA 2ZKLA 1L5HB 4G86A 5IVHA 5CM2Z 1AXGA 2O7VA 1SAYA 1JN0A 2QYSA 3OM1A 2VYVD 4U2KA 2V3VA 3RYTC 1RRKA 2C61A 3A05A 4E2YA 3FJOA 2D1YA 2ARKA 3I0NA 3W9SA 4FD2A 2X1VA 3H8WA 2BEWB 4LECA 2ZULA 1X8KA 3AMVA 5DCWA 3MSCA 3R7SA 1Z3CA 3GEBA 3D3WB 4WK6A 5EJ6A 1G38A 2KBEA 3O8QA 1ZSVA 2FKAA 2J4DA 4G56A 5E4FA 4DF3A 1CY1A 3FW1A 3G6WA 1UPAA 4XM0A 1J1UA 1SZJG 5K0NA 4O3MA 1XMVA 1COWD 5LYYA 4CMIB 3QOYA 4NMLA 3C4QA 5FAKA 4IG4A 4JXXA 1ECGA 4ND1A 4RZUA 5FI1B 1V6AA 5I7FA 5I7UA 1R0XA 2PCLA 1Z22A 1N5DA 1U9YA 3U3DA 3CRNA 1QB8A 2I1WA 2AH5A 4LV8B 3R7BA 3OZ7A 1NDQA 3KEQA 1QP4A 2DJ5A 4I0WB 3ZJ5A 4JI8B 2R2GA 2C29D 3VVCA 2O8NA 4TUYA 4PXAA 1TMOA 1CR6A 4IRUB 4MLDA 1P0PA 3QX8A 1IZYA 2X0JA 1JA9A 2X8AA 3P9KA 1BXZA 3PQ8A 2G5TA 1JLRA 2WM8A 3OM0A 4N5MA 4BMOB 3EY4A 1CR4A 4UNQA 1TU0A 3UW1A 5BT8A 3DDZX 2H7CA 1JEAA 1MENA 1XI2A 2QPTA 2X7JA 3RQSA 1ZHOA 1U3VA 3RROA 4OGKA 2NQ2C 1X6VA 4IEIA 2A0WA 3WYAA 1XTVA 3HVKA 3I76A 1GGMA 3DPIA 3IKJA 2H4WA 2GCIA 1TTPB 5D5QA 1U9CA 1QVVA 3FI0A 1IH8A 1O8CA 1YQGA 4RK0A 1XMXA 2GX6A 4BX0A 4BWGA 4UM9B 4L6CA 3P4YA 4BVBA 4M7OA 3QKRB 4NYJQ 4MVWA 3RT1A 3FPGA 1H0KA 1W8DA 1R15A 2PLWA 3AWDA 1U02A 1P3DA 4K9RA 1RWQA 5JNVA 3NGMA 4Y3UA 4DR2B 1VA4A 5JBNA 4KFTA 2EKDA 3LDHA 1WHTA 4EF4A 3LLCA 4LRQA 1A1SA 5KNCA 3TTTA 1R6BX 3DE6X 1V1RB 3FDZA 3Q2KA 5E9JA 3OLWA 4RE5A 4DEVA 5FWYA 1KQFA 2R6FA 4HQRA 4BNTA 1K8ZB 1GCUA 3EC2A 3FBGA 2QPOA 1SC6A 2BE7A 3EIHA 1RLJA 3C14C 2H1FA 3BF8A 4HWGA 4GPTA 1JQLB 1RFLA 2PRZA 3GUUA 2R7LA 1ESDA 2FF7A 4R05A 1GOTA 3EHDA 1CUDA 4HDKA 2ZSFA 3R3XA 1CUJA 3NX4A 3UNXA 2JLUA 2A9JA 3HVJA 1XSEA 3OU6A 5EP3A 5GVSA 4MI1A 1UODA 3AOGA 1C9NA 1T5SA 2IYAA 2YOGA 3E82A 3MGCA 4QUGA 5M5BA 4LY9A 3MGAA 1XPJA 2FHSA 1HQCA 3ENKA 4U63A 2CJXA 4ZK2A 2J41A 4J16C 3RKSA 2JKVA 1N6RA 3TINA 1I4LD 3BK7A 1WG8A 2WJ3A 2VXCA 5EJFA 4CMAA 4WCVA 3V7WA 3FOBA 3JAWB 3UJ8A 4DTCA 4J8PA 4MUGA 3TLKA 2E89A 2G4LA 5L8VA 3PC4A 2YVLA 1WDMA 2RGDA 2IEBA 3KXKA 2II6A 1XVUA 1PJQA 3FDFA 5ED4A 1XAHA 1SCQA 1JSZA 3BXPA 1EINA 4IJ5A 4FSHA 2IXTA 4K9QA 5DLQC 4E32A 2QTCA 1MU0A 4EHNA 5FIUA 1T4BA 4H18A 2IYTA 4MPPA 1EX1A 3QIVA 4QXQA 3EXAA 3I04M 3TQIA 4DUPA 1RYHA 3WDLA 1V0JA 1P1CA 1ISFA 3EWIA 2BGRA 5CFNA 3GNSA 3WLTA 3EDRA 2YS6A 2XE7A 3K6KA 3WWOA 2UZ4A 3F6CA 3W78A 5A05A 7GPBA 3CNHA 3DAGA 5G0WA 5D8DA 4Q4AB 3C3KA 2O8DA 4MZXA 1LWOA 3SZMA 3NBKA 1SA0A 3BYZA 1TUEA 1DV1A 1E3DA 1G2PA 3NAQA 5CR9A 1E8NA 4Q7MB 3UHOA 2JAQA 1DKLA 4BDSA 2GD1O 3UUWA 4W9NA 4MVJE 1JDUA 1CVLA 4LJYA 4MK4A 1VXRA 1KQNA 4CTJA 4CI9A 3FF4A 3L7LA 5I9BA 1GZ7A 1CZKA 4IFBA 2YIVX 2Q2WA 3VZBA 2C8LA 3ETHA 1P2DA 4ZVMA 2VKQA 4I5IA 1JIIA 1T2EA 1YA8A 3I4FA 4ZAFA 1QKKA 2ZYDA 1P6XA 3MRXA 3NTXA 3P2YA 3Q0TA 4P33A 5CLJA 1Q0TA 3CR8A 4MW2A 1FX1A 3A9VA 2F8LA 3PFNA 4IOMA 5EIAA 5T4EA 4YP7A 2I8AA 2W4QA 4FPXA 1Y4SA 1L5WA 1UPBA 3D0KA 1G6KA 3C97A 2O3SA 4OD0A 5AHRA 1Y9DA 3E9ZA 3EFOA 1EAYA 1U9IA 1S2LA 2FB9A 3W8DA 2VOJA 3AETA 3F5FA 3SZLA 1N6KA 1BKSB 5B30A 3KG2A 4GWGA 1EX7A 2OZLA 1U0EA 1E6LA 1EE1A 2RAVA 3KSUA 5HJ7A 5KO2A 2OOKA 3D8RA 4YPVA 4BBPA 3I1FA 3KBBA 1EZZA 2H52A 3DT9A 4IXWA 4DV7B 3U3OA 2Z9DA 1YDMA 3CF4A 4MINA 4D46A 2J0SA 1N92A 3I32A 3UKOA 1DEHA 3WLFA 3FNFA 1MO3A 3SBDA 3ZE8A 2IL1A 2H2FA 3KM0A 1G6Q1 4D6YA 2ZWMA 1AO0A 2GD2A 1UKEA 1FFHA 3IP1A 2VATA 5D1NA 4TRJA 4BVAA 1Z0IA 4QOJA 2ZS9A 3CW8X 4YLGA 3JVDA 5ALFA 3SF8A 4M3NA 5AJWA 1XN1A 2QXUA 1ZL2A 1DFIA 3EQ6A 3HY6A 1ONBA 1T9ZA 3ESDA 3MT8A 4E07A 3ADBA 2NX2A 3GFFA 3GVCA 3S70A 1Y1RA 4BB5A 4EVIA 5ELXA 1EGMB 2KE5A 3EYWA 3IVXA 3MN1A 5BRAA 1ZCAA 4LCBA 4UHKA 3WGQA 1SQ6A 2D1RA 1DQYA 1Z9BA 1Q15A 3GRRA 3N2NA 3GX1A 4K5QA 1HSOA 2P9CA 1M0EA 4BVFA 2EWVA 2QAGA 1LRLA 3DMDA 2EP7A 1E1CB 5LBTA 3STHA 1G6HA 3HXTA 3T61A 2J0UB 1T13A 1N9GB 1WPQA 3ANNA 3C3YA 4U1RA 4DY6A 4EY8A 1MUUA 3QYJA 2PKEA 3OQ6A 4KXUA 4EHDA 2HPAA 3OLVA 3U80A 4F86A 2QGFA 4KRYA 1IXYA 4X71A 1IONA 3ZVRA 3A7EA 1YDFA 2AYXA 3G8CA 3SDZA 1GDTA 4G0UA 1JVNA 1SELA 2CLDX 5IVDA 5DJ5A 1R0LA 5E1MA 4B32A 3LX8A 5A9SB 5JXIA 1BE0A 4G26A 4KR2A 2DY1A 4R0VA 3AR6A 3L40A 4D2IA 2XXAA 1KRXA 5DT9A 3U16A 1ITZA 5NLLA 1FQOA 5KJFA 1PJTA 3ABQB 4GFDA 1NW4A 5CPFA 5SYMA 2VAXA 5BNTA 4X62B 4NCBA 1HYGA 3BGIA 3DHEA 1BTOA 4FWIB 4C7MA 3KYDA 4OU5A 1EBBA 4F4CA 1FOEB 5KOIA 2IYWA 5K6AC 4ZEWA 3DCJA 4X44A 5DBOA 3NTVA 2G70A 3BZBA 4RQAA 1CQJB 3B8HA 5IC5A 1YQQA 3THYB 2C3YA 3W5CA 3DFMA 3RO7A 4RO0A 5CXQA 1V3VA 4R68A 3RAPR 1SXGA 5HF6A 3KJIA 5HKBA 4TYPA 4YUYA 4ZGWA 3LK7A 5EY5B 1UDRA 2REBA 3ELWA 3IDFA 1ZOPA 4QGGA 2OVFA 1LDEA 1T34A 1EFHA 2B6HA 1GAWA 1J49A 2X9GA 3E3OA 4HGZA 1R0ZA 3MGKA 2H6EA 2OG2A 4E3ZA 3MYRA 5B12A 4ZYUA 3QI2A 1XE3A 4EB0A 1E9FA 4K9OA 2VQ3A 3VPXA 4E70A 1Y5NA 3A37A 3R6LA 1OLXB 1SHJA 2PKYX 2YJNA 3BXEA 4HRXA 1GPKA 4YXFA 4HG2A 5TMDA 1I1NA 2ZS8A 3KKMA 2H3EA 1NOKA 2M6KA 3MTDA 1I7QB 1P2FA 3C87A 5D7BA 3S27A 5HKOA 2GTHA 5F9HA 1QDUA 2O2SA 4JOQA 5B6JA 4YMIA 1W85B 2DBVO 3RRYA 1ZM7A 2FI1A 1JHPA 1PWHA 1H2BA 2Z8ZA 4H3KB 3H87A 1JE1A 3ZWBA 2NVWA 4GOLD 3IT2A 2WVJA 3MS7A 4OQYA 3SZUA 1Q0LA 1DARA 4W5OA 3WOVA 1OA0A 3OQ1A 5DKFA 4EFNA 3OUTA 1LTQA 2Q4OA 2ENUA 3RK0A 1ZJZA 1VJTA 5BSRA 4PR0A 1KY4A 2X0EA 4XH9B 5B3JA 2RGRA 2O5EA 5ESRA 4C3ZA 1GU0A 4HSEA 5FWNA 1T4GA 4OFXA 1FQJA 4FOOA 2O2IA 1ZCJA 2CLFB 3KJHA 5BPFA 4Q4HB 1O5IA 4PX2A 2IITA 4A6DA 3I9V1 1ZR4A 1EEHA 2XEDA 2RGNA 3OZIA 3LKZA 4ZU6X 3RS0A 4LOJA 1YSCA 1N2IA 3H2YA 3OOWA 3B6MA 4WASA 1R4ZA 1H1TA 4O1IA 3RDPA 2EZUA 2FW6A 3OX4A 4HSGA 1TLLA 4BNYA 2WSIA 4HMOA 3D3EA 1GTG1 1X13A 4JUCA 3SSOA 1ZGBA 2SCUB 4C01A 1A9PA 3AHHA 3MK31 1U3GA 3M3PA 4H3VA 3RSCA 3OKAA 4AX8A 2IF0A 1KHHA 3HFSA 3MJFA 5BYKA 2PBFA 2F1HA 4ZZ3A 2GM5A 4DFDA 2LRHA 2ZT8A 1MHTA 2R6CA 3E05A 3KXPA 1RYMA 1G21B 2I3ZA 3B6EA 4B83A 2WOOA 4A2WA 3FPEA 4WKCA 4U6NA 4B4UA 3DMPA 3EIOA 4QG3A 3PPXA 1JIUA 4ZREA 5JNWA 3LHSA 3FGPA 1JZTA 2HRBA 5EZ6B 5L45A 1OVGA 4O5OA 1M2FA 2PFGA 4EG5A 4TTQA 3GH3A 4BCDA 5AW4A 1TKBA 3DPUA 1KMMA 2V5AA 1Y1SA 5BQOA 2W2VA 1LDYA 4H59A 1CWUA 4Q15A 3H1GA 1CS4C 1PKEA 3KXIA 1NULA 2YC4C 3N2YA 1WMSA 4O63O 3N2LA 1OXTA 1KDZA 4V03A 2XUQA 4YMUA 2J08A 2RHGB 5KYTA 5FHRA 3U9TA 1H2YA 3W3AA 1V7PC 4DM4A 4FYXA 2WJ6A 1MOQA 2CMGA 4PPFA 2KMLA 1SD2A 2B2CA 3DVAB 5FR2A 1D5WA 3L6CA 2JLQA 3GNTA 1R3DA 4DJEC 4PYLA 3OJWA 3WLAA 4BECA 3WHLA 3TS1A 1UMCA 3ANYB 3DOOA 1RWBA 1A9XB 1VBKA 4HD8A 2W8BA 4DV4B 4ENVA 1YWGO 3ROQA 1T0UA 4MITA 5EWMA 3PGLA 4Q3DA 3VPFA 3V4LA 1NMYA 1EVJA 4PHHA 4MTLA 2HF7A 4MAAA 3K94A 1VPLA 3PFGA 1CB0A 2WWXA 1UBTS 3IUJA 1PUXA 3AESB 3IVRA 4KDRA 2O0JA 5FOVA 2F1OA 4D4IA 3L4JA 4ZI7F 1NJGA 4TS3A 3SG0A 1W73A 1BOFA 1GN9A 1HE8B 3NONA 3DQPA 4GXQA 3GZNA 5CCEA 2YKGA 1FX0B 3MTGA 4GP6A 1TJYA 5DBFA 3HDQA 5DHRA 5AOAA 3GPDG 1F6WA 4UQPA 3HKEA 3VDRA 3OCCA 3GRKA 3MTBA 3OTIA 1SFRA 3ANLA 4KGDA 5HF5A 5BQ5A 3RPEA 3TCNA 4MA5A 1J7KA 3AWIA 2IPAB 2PSHA 1EPUA 4ZVKA 5HXAA 4QU5A 4JVOA 3EMBA 4LVCA 3KPYA 4G5RA 1DC5A 1RAIA 4XGNA 3HB1A 3WTBA 2AZTA 4R0MA 1KJ9A 2IZ0A 4KG7A 4LJ6A 3T9FA 3M5WA 1KMHA 3DEJA 4D3XA 5KCZA 4TMKA 3T3NA 2CFSA 2V8BA 2WIKA 1Z37A 3ICWA 3WGGA 3ELDA 2ST1A 2PL9A 3DDSA 1ZIPA 4FOSA 3BL8A 5JWRA 1M8PA 2SBTA 3HADA 3RTEA 4K1LA 3WQRA 1ARZA 1U3UA 2WE7A 5BVGB 2WB4A 1GQ2A 4YRBA 2C8VA 4IQFA 1QQ6A 4EA6A 3C8HA 1X1AA 5B2EA 3GAAA 1ZH2A 3BERA 4NAVA 4IQ4A 3WRVA 1DB3A 2B3TA 2R6GA 2VBCA 3NGLA 2YZ7A 4X7RA 5CLFA 2JKYA 4HT3B 3MINB 2CL7X 1TO1E 2PEYA 1W30A 4WE3A 5CFZA 3DCNA 3NNSA 5KNCH 1IY8A 1YRYE 2DT5A 4GX5A 2JZNA 4PU0A 1E5XA 5K6TA 4BPRA 1ZJJA 1MLDA 4KAXA 3W90A 1C3VA 1NMXA 1W0CA 3REQA 3Q9LA 3SVTA 2G9VA 4FZVA 1Z36A 3MOIA 3A11A 4A8JA 1M2VB 1W5AA 3LNCA 3A6ZA 3VOBA 2B37A 3GY0A 3ZLJA 1XOIA 1Y3HA 4DWJA 3M9LA 3DULA 2NT3A 4Z9YA 2P2DA 2WSSD 5AW1A 1RE0A 4OQDA 2O8VA 1DKNA 4F7WA 3NRBA 4HLQB 3GPBA 4RANA 4WEOA 4OX9Y 2QGNA 5EMJA 2XWPA 3PGMA 3ADDA 3LUGA 4MQEB 3FFAA 3DHNA 2WHPB 3OWXA 4B8WA 2IOYA 2CVPA 4ZJZA 4PZLA 3UOAB 1I01A 2C3MA 3KFVA 5DI9A 3L0DA 5UKDA 3I9V6 1KQGA 4PNEA 2YWBA 5K0SA 1IRIA 1Q91A 2VPPA 3H2JA 5GOZA 2AQ8A 4EY7A 2HR1A 3U4AA 3ZWPA 1KJYA 1NXTA 1XTJA 2FN8A 2JAXA 1WV1A 2PX6A 2ZPAA 4WKOA 4XB1A 3T9BA 3UJBA 2QV7A 2QS9A 2B4AA 1IOVA 2VEDA 4HJRA 4IGKA 1HC7A 1P4JA 3IQGX 4JWTA 4UU1A 3AF4A 1MO5A 4GUAA 3BVPA 1WDWB 2F6RA 2BKUA 3CWCA 2TSYB 2X8WA 3UUEA 1MDBA 2HF9A 3OQHA 4N39A 3MMZA 4AJIA 3K9HA 4AW9A 3EGCA 1U28A 2AMFA 4I36A 2HA0A 4MKFA 4RXUA 1VB3A 4CQLA 3UJCA 3HRHA 4DPMA 3CCCA 3CLRC 3GIDA 5FI0B 2V3WA 3ILSA 3V6MA 4WNAA 2GESA 2I3DA 3L77A 1L7OA 3QU5A 4KQ6A 1DTWA 4NDAA 1RQPA 1EDDA 4WZBA 3ZWWA 1ZM4A 5B5SA 1SKQA 2C94A 2ZKIA 3KWFA 5LNK1 2NZJA 4LHYA 3UT0A 1E64A 1YBVA 5F52A 1UDWA 2H1VA 2V4ZA 2X2PA 1Y1KE 2O3UA 3A9SA 3G0BA 3MUEA 4FR2A 1L4KA 4EY4A 5I4BA 5KVAA 3L0OA 4EPRA 3DLBA 3Q3IA 4M0KA 3ZQ4A 5C37A 4UUQA 2DQKA 3VJMA 4ZRDA 1TF5A 3EARA 1ZW6A 2UZIR 2BEJA 3G1TA 3HABA 5E6UA 1MC1A 1D7AA 3D3NA 3INNA 1KEKA 2B1IA 5MGBA 1LI4A 1J21A 1EK1A 2HRDA 3JRNA 2QN8A 1K6EA 2A1TS 2LCFA 4OF4A 1W0KD 3KTOA 4LXQA 4YAEA 3DBHA 1CVRA 2CUNA 4JX8A 4MWTA 1MIOA 1XXHA 4MV4A 2CKMA 4MRMB 3AUAA 2IX9A 1A82A 4OYLA 1VPWA 3AW8A 3QEMB 4LSMA 4MUNA 4QC2A 1IN7A 3S8YA 1EWTA 1EIWA 1SBIA 1M6EX 3C3EA 2ZVPX 4CYMA 3U40A 4Q7QA 2HAEA 2VLIA 2QRZA 1DWOA 1F1BA 2P41A 2R97A 2V7VA 3IVCA 2JI4A 3KYJB 4B5LA 3E58A 3GJ3A 5TQ0B 4IDQA 2G76A 5E9AA 5IJ0A 3PC3A 1E2QA 3DV0A 3V4FA 2E6KA 2PKQP 4NHOA 4EVSA 4J0JA 5FL3A 3DGEC 1MO6A 1MXHA 2V1UA 1W48A 3UJPA 2F4NA 1W75A 1ZEJA 4XAQA 3NVKI 1QWOA 4O3FA 4XYLA 4YRTA 3I04A 1IEQA 3R4VA 4YUWA 1P61B 3CZ4A 1YGPA 3F67A 5KYWB 2FZGA 5D3ZA 1KEPA 5IXJA 2PFKA 3A14A 1DS6A 2GASA 4OK3A 3OZGA 4EA7A 2FZWA 4UTRA 5JS7A 1UFOA 1TJ4A 4MRPA 1FXWF 4XGRA 4ZVRA 4B3XA 2C98A 1JAYA 3LOUA 2VKTA 2EF1A 4I14A 4LZOA 2PGIA 3CG4A 2XQIA 2VP5A 3C5EA 1YCHA 1T0IA 3TSZA 1XZ8A 4XEUA 2R84A 3C6BA 3KVRA 4IEFB 1T8SA 1AKYA 2I4NA 1P5ZB 3OA2A 1AA9A 1JR6A 2XQKA 4RF2A 3OTWA 1G4UR 4RS4A 2P67A 2ZUBA 3RVLA 2AX4A 3SDSA 2X8JA 3RODA 3GLHE 1UMDB 4BP8A 2CW5A 2UVDA 1UADA 3JVEA 2XUJA 5K3FB 3AUYA 3D8TA 1UJCA 3NXSA 1LDBA 4OATA 4DCOA 1IK6A 2XOXA 3ZI4A 1X3LA 3FHJA 5BVHA 2NG1A 3MJVA 4I55B 1KSFX 1T9GR 2J5KA 2QXYA 3PUIA 3HNRA 2O50A 5EHGA 4F5DA 4AKGA 1ZCZA 3TBKA 1XZQA 5FPYA 3E7FA 4ETMA 3X1KA 4HDRB 1PZXA 4HVAA 4JJKA 2X9VA 1X87A 3ONVA 5C8YF 2IJGX 3OZCA 4OKIA 3DLTA 4ZYXA 1AZLA 5U4XA 1NVTA 4G1FA 1XV5A 1C7FA 5AW6A 3QA9A 1C7EA 3EZ9A 1J97A 4XOIA 2QG6A 5K0TA 4PNPA 4C05A 3J81k 1M66A 1XZPA 1ZIDA 1X1TA 2HKIA 3IMEA 2IEGA 4ATNA 2HJVA 3Q8LA 3VHXA 1KI7A 3PNQA 4UBKA 1TO6A 1CW2B 1XZBA 3C15C 4DIOA 4EG6A 2Y8EA 5HA5A 1ULUA 4M60A 1X92A 2OFXA 5ABPA 2J31A 3ZHRA 3GQBA 1PT6A 3L04A 3DMHA 2PWYA 4HDMA 3TZHA 3W5UA 4BZWA 1ONSA 1UXJA 4BJ6A 2MDTA 1XRJA 3RNOA 1KI9A 2XNCA 1XCOA 3O31A 4AWBA 4W8HA 1IG3A 2AR7A 4GBJA 5SY6A 1QLWA 5DGDA 3HEAA 1IUNA 4ZIRA 5JQGA 4E11A 2ZTHA 1ECFA 3CH4B 3WA6A 2YQ4A 4ZCIA 1NFFA 3JQPA 1JJBA 2DFPA 4L4YA 4FHDA 3VDQA 2VDKB 3VR5A 5FWXA 1J2EA 3V8EA 3HLTA 1Z6PA 3M4ZA 3LKBA 4TTIA 3WLEA 2XW6A 4WA7A 4MS4A 4UQLA 3MGBA 1WV0A 3PSAA 3V2IA 1I5OA 1Z4LA 1U0JA 4E7OA 5BQFA 2B92A 2D74A 4NMHA 3HYLA 4DBLE 4QUBA 5ALQA 1NKSA 1EFRA 1K9SA 5MDHA 3OLCX 3P2EA 1WXGA 1QRAA 3IAM1 4HO1X 3TLZA 3FDJA 4Z2YA 1NQTA 2X7XA 4IIDA 5AXBA 2OCYC 4M88A 3T7IA 2IVFA 5CDSA 5GV8A 1NHGA 1TQ2A 1PV1A 1WEKA 1UT8A 3G5LA 3INYA 4MVCA 3O2JA 4TKVB 3W5BA 3JW8A 3UWDA 2VT6A 1YFZA 1U2DA 1F0YA 1N1EA 2RCNA 4AC9A 1QGUA 2ADMA 1G3IA 1U2GC 2NUPA 4D57A 1IAVA 5DHFA 4BVEA 2A14A 1P74A 2Z8XA 4KOEC 5HR5A 4KFRA 3QITA 3AH8A 3PK0A 5D51S 3S1AB 3R7DA 4AURA 1D2AA 2NAPA 3PT5A 3UPTA 1CF4A 1IJEA 3TIGA 4YLYA 3GLGB 4IZ6A 4R83A 1ECBA 5KJCA 3A26A 2IYZA 2NXNA 5IC4A 4JQZA 3PNOA 2FTKE 2Y92A 4IGAA 4LJ7A 3KLPX 2HYDA 4XOUA 3RC1A 1S7CA 4LXXA 2P8SA 4CM8A 3EIWA 1IY0A 1Q6YA 1VSBA 1QCZA 3CINA 4NZNA 5FI3A 3RHFA 3WBJA 4WOKA 4HI0E 1H0RA 2I6XA 3OQBA 4C0SA 1E1NA 1H1LB 3AG5A 3GJZA 5AI8A 2PYZA 1TTHA 5MN4A 1JAIA 1PT5A 3WISA 2YRXA 3W04A 3AY6A 4N7RA 4PWZA 4QQRA 1HTBA 3FOCA 3RUAA 4S0ZA 1TK3A 4M1YA 4AZTA 2VP6A 1LLUA 3G2QA 5J47A 3ZWYA 4J4BA 1K5PA 3AM3A 4UBLA 1C29B 3ULKA 5EFOA 2QIOA 1G5PA 4IX9A 2G04A 3GD5A 3N75A 2Y0PA 1UQUA 3NP7A 1W4RA 1E66A 1LZKA 2QLFA 1T91A 2NTNA 2HCBA 1FVOA 3KCNA 3OT4A 5CHYA 1QCDA 1W2WB 4RKFA 3C7CB 3V97A 2YMPA 2I3AA 1YZTA 4RV4A 3WGVA 2B5VA 3DOEA 4F6CA 4BAUA 2GNPA 1FYDA 4EBFA 1CJCA 1O9BA 2IELA 4IDOA 1CP3A 1EGVB 1BVHA 3TTYA 2BLLA 2O23A 4Z7JA 1XJ0A 1T36B 4G1EB 4IS3A 5E9QA 5ITVA 3IODA 3A25A 2WE8A 1T5BA 5CVJA 1GEEA 1RWWA 5IFLA 3DMGA 1ZQ9A 4PBRA 2E2WA 4RHUA 3JS5A 3W3AH 4E7PA 3W77A 4ZCMA 3MJCA 1UFRA 3BHJA 1SCIA 3EDCA 3SS7X 1FE8A 5ITSA 5JBIA 1XX6A 2YUIA 3LP6A 4XDHA 3TGPA 1OMOA 2G8LA 3FCUB 4MKGA 1KMQA 1L5SA 4EI7A 3WIUA 1J8FA 2OV6A 4UREA 4WBNA 1EU1A 1T9HA 4TKUA 4WXEA 3RYFB 2OXTA 3EXHA 4RIHA 3D0QA 4C0WA 3B6IA 4IICA 1HDXA 4BB6A 1ODJA 1NG1A 2VCYA 3C3MA 3WADA 3THXB 5AI6A 4JU9A 3GLQA 5K8VA 4L9RA 4X00A 5DNUA 1NR5A 3TRIA 4O29A 4E30A 1D4OA 1OY1A 2P77A 3EULA 4J1TA 4W1QA 1U6KA 3CEMA 3ZXIA 2YZMA 4H7KA 2YC2C 3OZAA 5HSGA 3STXA 5JJLA 3GJ5A 1JZSA 1KMIY 3OP1A 4NE2A 4MDFA 3HC7A 1EUDB 1H94A 2DPMA 3G5MA 1YJ8A 2XVMA 2AEJA 3DL7A 2YJZA 2XVZA 3DWGA 2HF2A 2YYZA 3N8NA 3OFVA 5IC6A 5IKOA 1KYZA 4MX8A 1ZJYA 5EG5A 2FEOA 1N2OA 2OWEA 5K99A 3FYDA 4G8DA 3RVOA 4Z9XA 1IQPA 2DM6A 1E98A 2ZJZA 4Y2GA 5TGZA 1MJGM 2MYTA 2ZUSA 4U5XA 4HGYA 1JL3A 3AI3A 1YS7A 3C3AA 5DTIA 5A0FA 3FHOA 1QIFA 4OHXA 1H9BA 4PYJA 1SN7A 4PQYA 4KHPB 4BKMA 5LQKA 1L5LA 4EHBA 1JKFA 3WZMA 2PUDA 1QIKA 4WXRA 3QV2A 5LP6B 4URYR 3UO8B 1QYDA 3JZMA 3EN0A 1E9DA 3UYKA 2Q4BA 3DBRB 4KV7A 1R00A 2DG2A 3KZMA 5FTKA 3B1YA 3TLXA 3LLUA 5HILA 4AF6A 2R8RA 2I1VB 1T3SA 4ENRA 3IAHA 1PQPA 1QIDA 3IPRA 4X63A 1K68A 2FW9A 4AO6A 2V6BA 4FB5A 1DL5A 2A58A 1UQRA 4GE3A 1IWPB 4IL5A 3H2HA 1Z88A 4WOCA 3A04A 3SEQA 4OBBA 5JFGA 4BQQA 3IAM6 4MCAA 1FW8A 2Z43A 3RYIA 5SY4A 4ALKA 2UZ3A 4K3VA 2VPZA 4EFLA 2HPHA 1XQ9A 3IP3A 4U6QA 2DHQA 4GEGA 2P2SA 2WLSA 2ZB8A 2O3QA 2ISQA 3GYBA 5CM8B 3DXYA 4Z8YA 3UQYS 3CRW1 2A2ZA 2AWOA 4L0CA 2PWZA 2PU5A 1O89A 1Z5NA 1GWNA 4G1VA 3SXJA 4L78A 1ESZA 4DCPA 4IHJA 1P7PA 4FBGA 4Q9DA 3T1QA 4BASA 1YZHA 3ZYZA 5CVUA 4KTVE 4DLPA 3E1SA 1CF2O 2EJWA 2AOUA 3H4IA 2Q6LA 3CR7A 2WUEA 3EVFA 4ZXFA 4BFYA 4UHBA 4YK7A 1VSVA 4MV1A 2EARA 3I2FA 3MPOA 2OR3A 1JDSA 4P34A 4YP0A 1F9AA 4U4AA 1PWEA 4HDOB 4YASA 3OUZA 1QZUA 4PAGA 5FFFA 4F45A 5BUQA 1ZUHA 4EI2A 1JHAA 4G1BA 1U5AA 1BCSB 1DINA 2NU7B 4PLHA 1UWCA 2PMEA 3EOZA 3IKVA 1KYIA 4ZICA 2DZDA 3OLXA 4GM4A 3HN7A 4MCIA 1EUQA 1U2PA 1WF6A 3TNLA 4LJKA 1KI1A 4Q00A 5J3JA 1SCUB 4ZQCB 3DUWA 1GFSA 2GZRA 2O2JA 3DO6A 4G5OA 5FBKA 2RKWA 4S1VA 4TZKA 1ORHA 1KDYA 4ML3A 4KMRA 4S1PA 3RSSA 4DGSA 2ON6A 2B83A 3GFQA 3IVMA 1Y9ZA 3LUHA 2O6HA 1GITA 2CNOA 3TZBA 1YS1X 4JB3A 1PQUA 2VJKA 4XYEA 2FX3A 3E0XA 2D1SA 2GRUA 1YO6A 3EVZA 4IJMA 3ZGLA 1E3WA 3ZVLA 1BGXT 3REGA 4E08A 2BDUA 4EG7A 4G0OA 5LWHA 1PQYA 3CSSA 3PKJA 3Q72A 4RHTA 4GI7A 5FI5A 5ALGA 5JS8A 2QLJA 4BCCA 1L0BA 2OECA 1Y7IA 2ZJ5A 1JQDA 2FAXA 3PDCA 3M5CA 4CNBA 5BPHA 3CB4A 3OSUA 1Z0FA 2J4CA 3BIXA 1QJCA 1UEXC 3GLFE 2HHLA 1HNNA 2V7QA 1HBJA 3T4PA 3V5NA 3JZIA 3RS3A 3SVLA 2ANBA 3NH6A 1LQ2A 1A7KA 2V0CA 3OAAA 5ADUS 5IBCA 5H70A 4HGPA 1EA5A 1R0SA 3HYRA 4BNDB 4MW0A 2EFCB 5IJZA 1SK9A 1DEAA 3ZUPA 5FBVB 2G9UA 2J5QA 2VK4A 3EDYA 3LQFA 1QAMA 4V24A 2Q3CA 3H97A 4CT0A 5LP6F 4A5OA 2EEPA 4Q9AA 1YHNA 5KSWB 3EISA 4TROA 3U4QB 3USES 4HBGA 1J00A 3DDNA 4LNAA 3VH4A 3HUDA 4NZ9A 2PUAA 2XJ4A 1IUPA 3FTNA 4AL4A 1NLZA 1XEXB 1KAMA 4YROA 3EVEA 4HRAA 4UM5A 1BWRA 4KYUA 1R5JA 1U9IC 2FWPA 3DKPA 4TN1A 1TCCA 1YZUA 2Y3IA 4OIMA 2YJ4A 4JUFA 1SXJA 3TD2A 3CLRD 1J22A 1XO1A 2OCXA 5GONA 3KPVA 3QX7A 2DPGA 3HUUA 1BA3A 3L01A 4KCGA 2CFCA 1GQOA 3F9RA 3MUOA 4UQOA 5HW0A 1T8PA 1FSSA 1VM6A 3PS9A 4PIMA 4RHFA 3FGZA 1DAHA 1U2TA 4DB2A 3ZU6A 2GAJA 4MZDA 5C8ZA 1G6OA 2Z2JA 2PANA 3IKLA 3CZ5A 3LPAA 1JQ5A 2H4FA 4JGIA 2FFRA 4NCXA 1ZICA 1OH5A 3W5VA 3ZGYA 4XGKA 4A16A 5BV0A 2PK3A 1Z62A 4DR5B 4BNGA 5LMZA 1UBHS 4MH0R 3R6TA 2EWMA 2RK4A 2RH9B 2ZYGA 2GN8A 4GMHA 4H31A 4MIYA 2CNKA 3RCBA 3M5PA 1PYGA 1NUPA 4GGOA 3HKDB 4FBLA 2JFUA 2JLBA 2WM2A 5C34B 1KTIA 1ZNYA 1KFKB 1LX6A 5T5QA 3I09A 5ES3A 3KUUA 4BZPA 3C6XA 1Q84A 4JI6B 3C3PA 2WVHA 1BYIA 4YX9A 4BV2A 1BDIA 1J9EA 1NT4A 1D2MA 1YRBA 2OV3A 2X0KA 3UATA 1Q92A 4II2A 2G80A 3K9QO 2WF7A 3T9AA 2ERYA 2Y77A 5JAMA 3BMNB 1S7GA 3QXXA 1AH2A 4WADA 4Q37A 1TUGA 2NU6B 4FILA 5JMWA 2E1PA 2IXGA 4X60A 2I6FA 3OOYA 4XQ9A 4KQHA 1IHPA 1AKEA 4FYYA 4GZMA 2QM0A 1FFYA 2A4MA 4YUAA 4JSTA 2QVCA 4YRPA 1KOFA 2ZUVA 1M1NA 3SQOA 3V2UA 3NQ41 1F9EA 4G5FA 1KEZA 2R7KA 3WK4A 1YACA 3LUDA 4YI3A 1HLFA 3L4EA 3LWBA 3QMWA 4PZ0A 2ZAMA 4G4SO 1VCNA 4IIYA 4YP9A 3IB3A 3KVNA 1ML3A 5DEOA 1LDMA 1A4UA 1YRWA 2PQ0A 5IVPA 2GEDA 3ETEA 3KK0A 2NTYC 4PY2A 4H3HB 4RC9A 2O5VA 3CW2A 1IBMB 3ABRB 1FMLA 3A9WA 3VPGA 3ZDFA 1OB5A 1A04A 4EY5A 2CXOA 4KIUA 3L0CA 1DP4A 3PD7A 1AS3A 1M8KA 3RVNA 2BMEA 3U4HA 2HJWA 4DNFA 5J2UA 3PP8A 3TOSA 3TQQA 1GTRA 5AHXA 1MR3F 2CL0X 521PA 4MGZR 3MCUA 1AU9A 3NBYC 3T5TA 3IV7A 3CCBA 1U99A 3USCS 3VR5H 4D3YA 5LDHA 2AN4A 4AJEA 4IMRA 4D5GA 5BN5A 2ONKA 1NI4B 1RVDA 3OZTA 4PVCA 2R1VA 4GC5A 4US0R 4YONB 1WXQA 2HF8A 2J1LA 4I4TB 4BEVA 1HYBA 4EGCB 2QRLA 4Z4QA 3K0FA 3C16C 1W2GA 5AKYA 1BS9A 3UH1A 1AC5A 1Q16A 1B1CA 3A1VA 2WHRA 1RXEA 3HBAA 1CRWG 2PRYA 2V65A 2HJSA 4R8KA 4MMZB 2PXHA 3H17A 4PLCA 1Z7YA 4N48A 4FHEA 2Z30A 4BB0A 3WB9A 1EESA 3DKVA 3DVSX 4MW7A 4HNVA 1DJMA 3SHVA 1YQEA 1QIMA 2EGHA 4AZ3A 3WZLA 1ZINA 1VDMA 3KQVA 3MIIA 2G1AA 2P5SA 3WIBA 3PLAE 1Z38A 3EYAA 1KP2A 3UC9A 1RSZA 2P65A 5JCXA 3P19A 2DLDA 2OFFA 4NHEA 2X15A 1WUHS 3VJLA 2BBOA 3PRYA 5B3JC 1NVWQ 4M8KA 3UT6A 1NVUQ 2XZTA 2NZ2A 5A04A 5HQTA 2FMHA 2NO9A 5CW2A 2BGWA 1TL7C 2LD4A 1NKTA 1EWVA 2X0RA 1FK8A 3COYA 4P7JA 4QLAA 3TI9A 3O82A 3TOVA 4Q34A 2A7XA 3K05A 4YRKA 2X1MA 5CBPA 2MSCB 3LHIA 4LDAA 1G7TA 2DFKB 4D9HA 5C46F 3GLUA 1PZNA 4M8IA 2Z5LA 4KIJA 421PA 1GUDA 3BRCA 3RT9A 3SSNA 3UAZA 5AD1A 4G0NA 2V74B 3LW7A 4EITA 5LMNB 1QHNA 4DQVA 2IEDA 2FMIA 2VDOB 3LLVA 3Q6IA 4B09A 4F7DA 5MFZA 1TVEA 3BFXA 3VSBA 4MVJM 3PRHA 3VYTB 3VOAA 1F1JA 2YV3A 2REOA 2ZIAA 4CDNA 1XAJA 3DOCA 5LYJA 3EGDA 5FWDA 3UMRA 5IDWA 1EDEA 3KOOA 4LF9B 4KV9A 5JNSA 5L51A 5C1DA 2GHIA 3OE1A 1ZYUA 1WVGA 3D0RA 1IB6A 3EF1A 3JASB 5A5DA 1IU9A 1UL1X 5FV4A 4B48A 4IGIA 1CB7A 2ZIFA 3A3YA 1MRZA 1UKBA 3T1NA 5BW4A 2NUAA 3G59A 1NI5A 2QTTA 2HIHA 2FUKA 2PG3A 3EW9A 1VE1A 4LWZA 4NBSA 2BKVA 1N2HA 4GKBA 3RS9A 1DCTA 5E3IA 4B4WA 4KO8A 1OI2A 1VKOA 3E8SA 5DBHX 2B2XA 3PEEA 4PZUA 3GDGA 4FGUA 2AQHA 2ZXEA 1YZGA 4P2GA 4QYIB 4PN3A 1WUKS 3ZG6A 4XD2A 5FUMA 2ECOA 3BREA 3WJ1A 1CUBA 2W2MA 3SY8A 2ZUTA 4ZARA 2XNHA 1ETHA 4NDZA 4PO1A 4QPJC 2V7XA 2ZRAA 3FPKA 4DNPA 2ZPTX 1CPYA 1IN4A 1ZGZA 1FNDA 1NURA 3GHYA 3OESA 3Q3CA 1W47A 5HGXA 1AV7A 2Z4TA 3NKLA 3S6JA 3WQQA 4LPSA 1D8AA 1JFVA 1DTSA 5KVQA 4PCUA 3ZDZB 2GZAA 3ZTYA 2PGDA 5KYUA 4X8MA 2VBIA 4JA2A 5AKZA 3IV9A 4PHTA 3PGJA 1UC9A 1R4AA 3TLGB 1XZLA 1N75A 1WOMA 5LU8A 1E5QA 2V9PA 3HGMA 4NFYA 4V39A 4MA0A 4NL4H 1I4EB 1PD1A 3NHUA 4F3RA 1LK5A 1Q0PA 1Q7BA 3EB9A 4NBLA 3KB1A 4P6VF 5CVTA 5JAZA 3I5UA 3BFVA 1BDJA 3WJAA 1GUZA 3JQDA 1YULA 2YN0A 4IIJF 2GD0A 3O5AA 4BQRA 4KPEC 5LA6A 3OFSA 1ZRNA 1XUOA 1M2JA 1Z83A 1DWQA 2WVAA 1QV7A 3W8EA 2GGSA 3FUUA 3LH5A 1C1XA 2I7XA 2CYCA 3PF9A 3TTVA 4E5UA 4S35A 3D1VA 4RJTA 3PFKA 1OH6A 2JRCA 3AEQB 5BSFA 5EP1A 5C7IO 221PA 2IEIA 1VLLA 4NCNA 3WKAA 2QD3A 5AUNB 3WDSA 1JIJA 1V16B 5TVKA 5JO0A 2FN9A 4J4TA 2BDEA 3ZEAA 3CUEF 1LY1A 3SQMA 3GFTA 3D4LA 1KRHA 3OX2A 5H59A 5BORA 1GG5A 2D4HA 2IYLD 2ZYUX 5IM4F 2AEEA 5HYVA 1RKXA 3NKVA 4HZUA 3ICEA 1Q2XA 1YJAA 3UAVA 2WIBA 4C0QC 1RXVA 2Y1FA 2SECE 4O0LA 1TA0A 4WZAA 4YJ2F 3ZVKA 2BBWA 4BV3A 2A7QA 2JFBA 2O05A 1O0CA 5A03A 2H29A 1C8BA 3PJEA 3FI9A 2NOAA 1XZGA 2IDMA 2Q1UA 3FAKA 3FVRA 4R40A 4S1NA 1KOLA 3VR3D 4ZK6A 5EIXA 3RIMA 4O2BB 4B45A 4IQ8A 3C8UA 1PX0A 4GD3Q 4GOMD 1KSHA 4D3DA 4YV7A 2GZHA 4TZTA 4C20A 4QRDA 2YVAA 1XTUA 2FSUA 2Y2VA 4JIGA 3TL2A 1E9EA 2OD9A 1JTEA 1NVFA 1TJ3A 2O2YA 3QNMA 1UKZA 5EIFA 2EP8A 2V5UA 1OI7A 2VZEA 2WU8A 4C3VA 1PGPA 3HVIA 4HH1A 1L5GB 1QGZA 1NZDA 4WOJA 5DMHA 2BFBB 4M9ZA 4RW0A 3ESYA 2XCQA 4CUZA 4YMSA 4XW2A 2XDQB 4A8JC 3S0JA 1P44A 3G1WA 5D84A 1MPTA 4ZO7A 4CKCB 2QP9X 4HB0A 3H13A 1F60A 5G3ZA 4FCTA 2ZJ0A 1RCFA 2J87A 1RADA 4R2LA 3VI3B 2IBMA 3NBUA 4LIPD 4G23A 2Z2XA 4WVFA 4Z0TA 4Y6OA 1H42A 3FB4A 3FMPB 2CV0A 4RMHA 4NPCA 4Z0NA 4J2TA 1H5NA 2HMUA 2D7DA 2WU0A 4LA4A 4LOIA 4L08A 2BKXA 5EZQA 3X43A 1TM1E 1YZNA 3KZ1E 2AXEA 2FMUA 4B3MB 1NONA 1QO0A 2RGAA 3AY7A 4FYVA 5EJGA 4LG1A 3ZW9A 4R2WA 1TK9A 3ZHSA 3O21A 4BNNA 1M54A 4JP8A 3ZZNA 1J5PA 1VOTA 5LZ8A 1MJGA 4LE1A 1ONOA 4LCJA 5AM1A 3V4ZA 2W5UA 1B2LA 1BQ4A 2WWFA 1K7CA 4NONA 2XEXA 3CIFA 4WWHA 1UFKA 2WDPA 3BL6A 3I12A 1XVVA 4GMKA 1ZVJA 3MWLA 5D3KA 5ERXA 1Z56C 4N3AA 1SG6A 4RMIA 4L95C 2J3IA 4X41A 1VJGA 1NX6A 4PS0A 2A5YB 4DLNA 1G0NA 2BD0A 1F2TA 2AKYA 3AI7A 3ZNOA 3RBAA 3N5KA 3WGNA 1ZWKA 2AHRA 2IYRA 2AFRA 2P7HA 3PC6A 4F9FA 2NV2B 3O9ZA 5JPCA 3DTVB 1UOQA 2BT4A 3EXEB 1T6XA 2PRIA 3ISTA 1CSEE 1B74A 1U28C 4NOLA 4K0KB 3HWX1 1ADYA 3M6UA 3Q6MA 2P3SA 1WXIA 1CC1S 4PZYA 4M1MA 1DCKA 2R62A 4G9EA 5IP5A 1KBOA 1B73A 2H4XA 2YXPX 4I1RA 4B3RB 4J4HA 1Q1AA 2PJZA 3G9QA 3BCUA 5BWMA 3A2KA 2IY7A 3RS5A 5AVSA 4IIUA 3PHJA 3WLSA 1RDFA 2XYPA 3A1UA 3OTHA 1GAJA 2CCJA 3JQBC 3KWJA 2YZ2A 3OCWA 4TQGA 2O06A 4ZP1A 1FUYB 5AW8A 4EZIA 3OECA 2FPIA 1G98A 1X39A 5HGJA 1LVUA 3C7DB 3T7EA 2YNMD 1OTYA 2H1LA 5JWOA 1JSXA 3JVUA 3WLQA 5A7FA 1MOSA 1RTKA 1DAIA 1IWOA 4F3CA 2FETA 3P5SA 2VO1A 2HW8A 1H4SA 1CNFA 4LC1A 4DARA 3WRXA 4BLWA 4BXOA 2DYKA 2OBYA 3ZK7A 3VC7A 4FFOA 2BMFA 1HYEA 4RVCA 5B64A 4DCJA 2B61A 5JC8A 1AS2A 3ONDA 2ZIXB 1W35A 4LNHA 4C1NA 4Q3LA 3NJ8A 3Q10A 4HS9A 1GDDA 3HCEA 4GPD1 4MIEA 7MDHA 1QKIA 1ZM2A 4KACA 2ZJ4A 5E4YA 1DUVG 2IBSA 2CLCX 1U2QA 2FUEA 1J8QA 5LMUB 2QN2A 5CH5A 2JJMA 2JJYA 4KL8S 1AZTA 2H7XA 1XU4A 3A4NA 2OESA 3PCXA 4EX7A 4A23A 4BX9A 2VF2A 3A6JA 3E70C 5CLHA 1EFVB 1GGHA 1MC4A 1JHDA 4UOQA 1Z6GA 1P2UA 3RWMB 4MCJA 3CNLA 4M0MA 5IARA 1II8B 4JNCA 4NV0A 3O7MA 1Z6AA 4N8SA 3A3KA 4E31A 1KP9A 1NXOA 2R65A 3AB3A 3SNHA 3DE5X 5A1JA 1V2HE 1C5KA 1IC6A 2C0QA 1R8XA 2J7KA 4CLRB 1E1LA 2PT6A 1MQ9A 3GXOA 4KAJA 2VUUA 5BW6B 5TEVA 3IMCA 3TVTA 4QEZA 4A1OA 4CU5A 2BKLA 1RYEA 3ZKWB 5EMNA 4KIGA 4NABA 5BSTA 2NQTA 4Q0MA 3T5DA 3A9CA 1FJ2A 3CY6A 3ZCPA 5HX7A 1GG9A 2K2QB 4GC9A 1GUBA 1KPGA 1KRWA 2PXAA 3A1FA 2GBPA 2VDVE 3UTDA 5C1OA 5HWSA 1JSRA 1VBMA 2LIPA 2RHTA 4UD6A 2HA2A 4EMTA 1EB8A 2VNIA 3I30X 5CW1A 1SXHA 3GN2A 4AP9A 3ISJA 3NDRA 3WK8A 5A5VA 1NJ6A 2Y0EA 4OA5A 3PFIA 2IP4A 1BGVA 1NTRA 4TMFA 1Z2DA 3VR6D 3VHRA 3HXLA 1NUSA 2QDKA 5EQTA 4D4MA 5K0CA 2E4WA 2R8ZA 1M1YA 4O4HA 5L7TA 4O25A 2BSQA 1BXGB 1OFHA 3BAFA 2MIIA 3C4VA 1ZGAA 3HPRA 1TYCA 2HJ9A 4DY4A 2DB3A 3DXFA 2DOKA 4IIXA 4EB8A 8AT1A 2FPSA 3E7XA 1ICIA 1RXCA 3WLIA 2H2HA 2QJFA 3KAQA 1JMVA 1CP2A 2QRKA 3AERB 2BE9A 5MGNA 1FTWA 1BFUA 3PHHA 5HCUA 1YI1A 4ANFA 1K89A 3AHFA 3U1VA 3WL8A 3CVWA 3CVVA 4WJZA 4KMSA 1YA6A 3H1PA 5G53C 5BW8A 4HNTA 5KYXA 2C31A 3IE0A 3N39C 4OM8A 1K9VF 1R8YA 3C85A 4NU5A 2I55A 2LNDA 5TDHA 1MOPA 4DMFA 3SKXA 1O57A 1TK2A 4NFLA 2QE7A 3P9RA 1JDBB 5JY6A 1CS0B 5CBKA 1X7HA 4PV7A 4BRUA 4XCQA 3T7AA 4KK4A 1NR7A 4RD2A 3SAJA 2P9EA 2IYSA 5MHTA 4FFRA 4KVGA 5CDFE 2XCTB 4A03A 1JKMA 1RHRA 3FTFA 2CHEA 3D43A 1PQWA 2I2FA 2J3MA 3I0MA 3WQSB 2BPOA 1GPDG 3FLMA 3RSHA 3KSAC 1HE3A 2QYHA 4UBMA 4ZCSA 1H2FA 2FCRA 3EC1A 5DMXA 3I1IA 3F9IA 4BKQA 1XFAA 2DBYA 3H1AA 3HI4A 4RJLA 3N2ZB 2XB9A 1KBZA 1M2WA 3DC2A 1EMDA 2BEVB 2D2IA 3D6UA 3DEAA 3UFXA 4P3YA 3WL7A 3M81A 4F6LA 4H7JA 2ZSAA 3X1DA 4ZJYA 5D00A 1FXSA 2GXQA 2P2ZA 2WA1A 3QF7A 4G97A 4OQMA 2HNKA 2X0DA 3ED5A 3R3JA 3BK1A 1K8YB 2FWJA 2P30A 1J0XO 2A88A 5AK4A 5BN3B 5KBYA 3I8OA 1PT9A 4XARA 2HWXA 1PG5A 3PZRA 2ODAA 1GTJ1 2M1XA 3WGJA 5IYZA 5IBPA 4IGEA 1SU6A 3OZDA 3PXEA 3ZU4A 3JAKB 1RR6A 2FVYA 3G89A 4AF8A 5ICSA 3MCZA 4B4KA 4E0BA 5CAEA 4XJSA 2C20A 1ZC4A 4YJFB 3FD8A 1Z2OX 1PK8A 2PVCA 2WP8J 3A3OA 3WJ7A 4DILA 1NATA 2AG8A 2ZYAA 4MVJP 3WL6A 2I29A 3P26A 2PWAA 3QEJA 5J59A 3ILYA 1JEQB 1U2DC 4GVXA 4OMDA 5HFAA 1WTCA 3IOMA 5TJ9A 1PHRA 3CXRA 4GI1A 1JECA 3H7AA 4QYMA 4B47A 3WMFA 1OGJA 1LUAA 3VO8A 2I33A 3IT3A 4D82A 5IUJC 1WMBA 2J46A 1O96B 4W6QA 4GSLA 4N01A 1I2DA 5F51A 3ROTA 1RKQA 4AM8A 4FWTA 2C4VA 3S2IA 3K8QA 3PPVA 2ZJYA 4EO9A 1KAGA 2J5XA 2WKPA 1X19A 1X9IA 3U44B 1GGKA 2DKNA 4F85A 1BHO1 2WKWA 4CT5A 2PQ2A 3B13B 3ZW8A 1KVRA 3G2KA 4OMCA 1GL9B 4YAWA 5NULA 1O9GA 3LYHA 3O91A 4KO1S 2I67A 5CNIA 4JP5A 4X84A 3TQCA 5KZMB 5C8XA 4Q9LA 3H9CA 3NS7A 2BY4A 4XFKA 1QTNA 2PMFA 1KP3A 2I7TA 3LX6A 4RY8A 3V42A 5EJ8A 1SWVA 3GJSA 1GQSA 1ZCBA 1E2KA 4QRHA 4WGFA 4L22A 5K6RA 5FTMA 1B23P 5F98A 2PX4A 1SCKA 4US2R 4FLFA 1U8EA 3KUCA 3E8XA 1Y7LA 3L1JA 3JYNA 3PGXA 5AK6A 4E2WA 3OC0A 2PZKA 1IOLA 1YHZA 2BIFA 5LB4A 4V1CB 4BFWA 1TQHA 3AU9A 5E0OA 4C2TA 2ZJBA 2VYND 4KE9A 1C3OA 4NX2A 3CX3A 1CRQA 3LBYA 4YRQA 3EDMA 3G2OA 4CBVA 4NF2A 1LH0A 5JU6A 1UM8A 5AUOB 2CC2A 1RP7A 3NOQA 1U1GA 3HP4A 3IJEB 5FYQA 1SIWA 2XKAA 3DR5A 2ZYSA 4IOKA 4ZZ0A 1OWNA 1SBHA 4P81A 3GPLA 2IE0A 3CLKA 3GWZA 3QUBA 1FY2A 1Z28A 5G1OA 1REQA 1B8PA 3KTFA 4R8RA 3F4LA 2VPIA 3QPCA 4F71A 4QVIA 1UBKS 1YBFA 2JI8A 4M1WA 3CUWA 3LRTA 2P5YA 3C3XA 4OGLA 5F1OA 4ACAA 4LRXA 1UPUA 4OQEA 1KIFA 1AUPA 3DBOB 4UJ5A 2C0CA 1NSFA 2VYNA 4LHSA 2Q2VA 2INGX 3PICA 3F97A 5KJ6A 5BR4A 4GNKA 2PKCA 4J0EA 3LPNA 4GO1A 3ZTWA 4AMGA 4C6SA 2O8CA 1ZC3A 2MHCA 2IZ5A 4NBWA 2RC6A 1NQUA 4DYHA 3EGXA 4HDNA 1BA2A 4I2VA 3K0AB 4CCAA 2R96A 3FWPA 3KYBA 1L7DA 1BFKA 3QFTA 4MVJA 1ZGGA 2HQBA 3C5VA 4JLDA 4CW7A 4H1WA 4RULA 1KJNA 3EPJA 1Z3IX 2X40A 4CKXA 4U02A 4J1TC 2V6GA 1V5GA 4CMGA 4ITVA 1KQ3A 1W1UA 1NBOA 2EKQA 3A7DA 4QJIA 2PKWA 3JQ9A 2VPXA 4B3JA 4D79A 4JC8A 3U1BA 4BP3A 1BVUA 3FJYA 3HCNA 2AFIB 4DLUA 5J2TF 4JI7B 2PD3A 4L7VA 3R24A 1OWMA 4QYSA 4XEHA 2YXLA 4DW8A 3R9XA 4UASA 5CNJA 1KZGB 3SOPA 3HUTA 1XAIA 2WT9A 3HI6A 4OTZA 2R47A 1O4VA 4HNSA 1JHMA 3MAAC 1LNSA 5J23A 3WLLA 5B1YA 4UATA 1XA3A 1RYBA 1OKKD 2BJWA 4U0JA 4BBJA 5DXAA 4RLHA 2PPVA 4MQMA 1E1YA 1E9VA 3LGXA 3G5AA 3DDHA 2OORC 2IPXA 1CJMA 1GKIA 2WABA 1ZHFA 3LYUA 4NEQA 4RELA 1G63A 1ODKA 1R6XA 2ZE8A 2ZUCA 1XALA 3E5HA 3PFWO 3EODA 4QQKA 2Q5CA 4AY6A 1Z0AA 1G21E 2IZZA 3VPCA 2ZI9A 5A4DA 5CLIA 1L5NA 1UPFA 3AHJA 5JCJA 4YP6A 2OFOA 1XVAA 3Q12A 3ZCRA 4FDAA 5JYCA 5LIPA 1S0UA 3FB1A 3SQDA 4YAFA 4B8YA 3ZY4A 4BO6A 3DDCA 4F1WA 3RJZA 3QG1A 3W0LB 2JIBA 1H2EA 1P2BA 3PDWA 4BTEA 4C6TB 1US8A 5DOZA 3K6SA 1CZHA 3DNMA 4LVOA 4G0VA 1CULC 3CM0A 3JQ8B 1A8SA 4WT7A 1NMZA 3TLAA 2EJCA 4RFLA 1CLUA 1VYHA 2JL1A 2JRLA 1G8FA 3KL4A 4CM5A 5DLPA 2PT5A 3LPMA 2Y1XA 2HA4A 1U1DA 4JQOA 3M2TA 5EHNA 2E18A 2UVQA 1FTSA 4DDUA 4JC5A 4K6FA 2QQGA 1RBYA 1Y42X 4JL6A 1YJQA 2QY9A 1U98A 4JZYA 4ALNA 2WG1A 2PLRA 1GQRA 4OV6B 4AJHA 4DLVA 4DR1B 5DLYA 2G4VA 4P83A 4ZAXA 1F5SA 5ER6A 3N2GA 5HP4A 4C76A 2D2EA 1KI6B 4FW9A 4MUAA 2X8BA 5KKCA 1ADCA 5FPQA 1KO7A 1XTKA 1H22A 2CFOA 3DAFA 1Z5OA 5C5IA 2P9TA 4KAAA 4LUCA 5K3BA 5B3KA 3FFXA 3S8MA 4V0RA 1C14A 4B40A 3ITDA 4KRXA 1AGXA 3NLLA 3BQ9A 4MV6A 2X41A 2E87A 1NF2A 1NJ5A 1ILWA 1Q14A 4CKEA 5IANA 2HIAA 2IIVA 1GA1A 3LA6A 1P77A 3AIOA 2FQ1A 4N3NA 1YOVB 4XTRA 5G2OA 5IM5A 2ODTX 4FYHA 1WCIB 4K9LA 4QREA 1HNWB 4ZAYA 5HS4A 1VMKA 3KZKA 1VLQA 3HKCA 1XROA 2AVDA 3RANA 2WZCA 1PJRA 4OFWA 4UCWA 3UVEA 1NN5A 5JZSA 3BGDA 3QM1A 3ANMA 2PJUA 5DVZA 2VJAA 1J25A 1T6ZA 3N2IA 2ZCJA 4Z51A 2W93A 4TXLA 1TUBA 2JDID 2MINB 2HV9A 5ECGC 3HUEA 2WHXA 3EQ9A 2DR2A 4D9FA 4AYTA 1EZ1A 1J7JA 4M0CA 4R7GA 1RJFA 2YQZA 1DC7A 4H6PA 1FU8A 4QXPA 3RFUA 3TR6A 4JI3B 3WLJA 4YH1A 4LFBB 3PUYA 3R7AA 1QE3A 1EM8A 1QHHB 2OV8A 2EG5A 1PFQA 5EIOA 1L5RA 1KYQA 2VWHA 1PLKA 1SVLA 5H80A 3UK0A 2G7ZA 2JIMA 3QGMA 1TOAA 3TZKA 1LDNA 5ALDA 1C80A 1PNQA 4D9IA 3BAZA 4E3WA 2DT8A 2IP2A 4B3DA 3UEOA 2ETVA 3TIIA 2B8TA 2ATVA 2HDWA 3EFHA 2AT1A 1NAHA 5EVCA 2AUTA 4DJTA 1DHTA 1MN6A 2AX3A 1X7YA 1VZ2A 2Y0DA 3KQWA 2IZ7A 2X6QA 3FUTA 4OAOA 4DZRA 3UT5A 1ZOLA 1EVEA 2XTAA 2BBTA 1M5TA 3LYLA 1KIAA 1QYCA 4F9EA 4I1OA 1ZH0A 2NVUA 1FDIA 1GZ3A 3LHKA 2C04A 4H4EA 4JYPA 4QUKA 4ZKEA 1LB1B 1R66A 4JP3A 1EFCA 2FSVA 2Q99A 2QSYA 1QFZA 5JW6A 3H9QA 2A84A 2VUTA 2FX5A 4JT2A 2OGWA 4L1KA 1XQWA 1N4AA 5DNWA 3NHMA 1WU8A 1OWPA 2NZWA 4TWBA 4DLYA 3EGEA 2QUIA 1SC3A 5CFQA 3COZA 3SCZA 1SXJC 1NN3A 1V35A 5EVJA 2F9FA 4L8WB 4XPIB 3I6QA 5KNBD 4LXTA 1T1RA 1O4WA 3CO5A 3D6JA 3G7UA 2N1MA 2IU6A 1SUDA 3KKEA 3M1LA 4GPZA 1HZZC 4TMZA 2NN3C 4GVLA 2TS1A 2JFOA 2PUJA 2FUNB 3JTEA 5CVCA 1YE3A 5AM4A 1VL1A 1WXXA 1X7GA 1WUTA 3NCHA 4PC2A 5LJIA 5LQUA 3O90A 4K9DA 3ZH2A 1ZH8A 1YCDA 5BV2P 1SD5A 3C45A 3EF3A 8ABPA 3CSDA 1KJJA 2HHHB 2VDUE 3M1YA 3HB0A 3K9CA 3GZJA 1HG0A 2LE0A 3RF6A 5L4SA 5FPPA 2MSWA 1TPZA 1N5LA 2VDPB 2AN5A 4YCNA 4NCAA 2BFEB 2QM7A 4WN9B 5KNBA 3MYYA 3Q5GA 3SYRA 2YJ6A 3ENNA 3KLNA 4FMCB 4JC0A 4PLVA 4IV5A 4JFAA 3R4CA 4PSAA 1W5TA 3VU9B 2ZS7A 1MORA 2PL5A 1NF9A 2ODEA 4L5BA 1S8OA 1P6QA 1SB8A 3CNBA 2NV6A 2CFIA 1YQWA 4E6EA 2YHUA 5IUKC 3IAUA 4EYEA 1SUWA 2IV3A 1Y1PA 4OH1A 1F4VA 1L8AA 1NBME 2A5DA 4EGSA 4D8WA 1EK2A 1VGRA 2KYRA 1CUGA 3SIWA 1Z34A 2FQQA 1QH8A 4OAPA 4C06A 1SHLA 3HJRA 2DQ4A 1D2NA 2ZEJA 4NPAA 3V4RA 5DZSA 1I8TA 1AKQA 4GRIA 4L3WA 2PV0A 1X1EA 2EWWA 2VYCA 4J7UA 4ISCA 4ZEOA 4CN9A 1MTOA 1SBTA 1AUQA 2QN7A 3B60A 2DWCA 3CS3A 1T6BY 4JLOA 4V3BA 5E38A 3VR6H 4D4GA 3DEFA 1H2ZA 1M2EA 2OCKA 1RTTA 3GUZA 4MEJA 3K8OE 4QPPA 4B7CA 4G9GA 3NRCA 4NXNB 1GAEO 1Y8ZA 5AVVA 3RJTA 1TTQB 4GEKA 1H6AA 1ZJ6A 2C96A 2Z8YM 3HMQA 4B6SA 3AXSA 4IMIB 1IXRC 1IOWA 4RK6A 3X44A 5KU1A 1W4CA 4ND4A 4BMDA 4PGGA 4F93B 3H8SA 1QIJA 3FNEA 3HJTA 1YJXA 2RB4A 5L3ZA 4RY0A 4JYCA 1QHEA 1GCIA 2ZATA 4Q18A 4X97A 3BUSA 1ULHA 4O4JB 4Q82A