2PU7A

Crystal structure of s112a/h265a double mutant of a c-c hydrolase, bphd, from burkholderia xenovorans lb400
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
283
structure length
283
Chain Sequence
b'LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNAMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGAWAQWEHADEFNRLVIDFLRHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
molecule tags Hydrolase
source organism Burkholderia xenovorans
publication title The Tautomeric Half-reaction of BphD, a C-C Bond Hydrolase: KINETIC AND STRUCTURAL EVIDENCE SUPPORTING A KEY ROLE FOR HISTIDINE 265 OF THE CATALYTIC TRIAD.
pubmed doi rcsb
total genus 107
structure length 283
sequence length 283
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pu7A00
4DLNA 3AZQA 5LYYA 5AKHA 2RI6A 2G4LA 4PV7A 1LGYA 3STTA 4Q82A 3DKRA 5AOAA 4FHZA 4AMYA 3WL5A 3W9BA 1XRRA 2RIPA 3HACA 4KRYA 3V1MA 4QWWA 1H2ZA 1VA4A 1QZ3A 1ZD4A 3BE8A 5AKKA 3FYTA 4AN1A 1C7IA 2PUJA 3H04A 1XZGA 1DT3A 3NWOA 4F60A 2XMBA 3ZLTA 4EY7A 2DHCA 4X93A 2WIJA 4FDMA 4MXDA 3FOBA 4DMFA 2QKYA 2HADA 1TRHA 5F4ZA 4B82A 3OURA 2V97A 4U2BA 4X6XA 2XUOA 5JATA 4C4XA 2G5TA 3RARA 1XZLA 2QR5A 2YXPX 5C7YA 3U0VA 5I9IA 1P0PA 5AI5A 5H3HA 1PJAA 2C5FA 1OCEA 5EFZA 1P0MA 1ODTC 1RWQA 1ZJ5A 4QE3A 2WTNA 5I8PA 1VE7A 2JGIA 3WL8A 4G4JA 3QVMA 4QDXA 2H1IA 2K2QB 1QO9A 4XJVA 4BAGA 3AZPA 4X3CA 2PSEA 4RGYA 1EVEA 1U2EA 3F67A 3KDAA 4CFSA 5ALKA 3ZI7A 1H23A 2QTBA 5K3FB 4Q34A 5D3KA 3QM1A 3C45A 3JW8A 4JUIA 5BWBA 1JJBA 2C0PA 2XMRA 5JYCA 3FSGA 2Y6VA 2G5PA 2QMQA 5K3DA 3IURA 1XLVA 1EI9A 1XZKA 4JYMA 2OCKA 4XVCA 2BJHA 4MYDA 4L72A 1R1DA 3VISA 5JZSA 1QIDA 1BCRA 3IUMA 2PVSA 3R3UA 4QEKA 5EHXA 1Y7HA 1H2XA 1CUBA 3W05A 3KWFA 2HA2A 2ROQA 1FFCA 1RP1A 3G0GA 4B84A 5ALXA 3WKDA 4K6HA 5AKIA 4DM7A 1R50A 3WWOA 2XQJA 1DWOA 3HABA 3C6XA 1EDBA 4BDTA 1SFRA 1LBSA 1WOMA 3T4UA 5T4EA 5AK6A 2FJPA 4FTWA 1Q0ZA 1CFJA 2GZSA 3EQ8A 1CPYA 1ACLA 1C4XA 2J3DA 5CRIA 1CVLA 5E2IA 2J3QA 1TCAA 3MVEA 2VAVA 3QH4A 4XIIA 1VOTA 4AO6A 5DTIA 5AKEA 1BE0A 1EK2A 3YASA 4QZVA 4KR0A 1QIEA 3WJ1A 4EA6A 1Q83A 1FJ2A 4J0CA 5CMLA 2OGSA 4DIUA 5EIHA 4HTAA 2B20A 4KAFA 3I6MA 5K3AA 1YAJA 4CCYA 4X6UA 5ALLA 3BL8A 1DU4A 2VEOA 3BF7A 3D7RA 3MGAA 4BTVA 2HU7A 4A23A 5HQ3A 1DQYA 2GBGA 4EZIA 4LXHA 2C0QA 4Q3KA 5JD4A 1EVQA 2WG2A 2ACKA 4GI1A 2C7BA 4H7JA 2CEKA 3DD5A 1DWPA 3ZV7A 2XDWA 3HRHA 3H1BA 2VTVA 2D5LA 3FLBA 1R4ZA 2VSQA 1CUIA 3R40A 2HA4A 3JWEA 1AC5A 1HBJA 1W75A 5DNUA 4S0XA 1LBTA 3MUNA 3QYJA 1EB9A 4RE5A 4Y7DA 3PFBA 4P92A 2AJCA 1LNSA 4BCDA 4C4YA 1HQDA 3SX4A 1E3QA 1J07A 3DOIA 3H18A 4OUKX 4GECA 3G9TA 1IZ8A 5C8VA 3C43A 2HA0A 5LZ8A 3RK4A 2W6CX 5ISMA 3KXPA 4FOLA 4J0GA 1CUSA 2WSLA 1BS9A 1N5MA 4FWBA 3WMRA 1BROA 4FNMA 4UPDA 5AK5A 2WUFA 1UK9A 4BBZA 3DEAA 1CLEA 4M0FA 1YASA 4G1FA 2XUPA 3FNBA 4INZA 4UBNA 1G4HA 4EHBA 4LKOA 1ACJA 4BP9A 1JMKC 5EHNA 1QIJA 1J06A 4ZREA 3U1TA 4Y2SA 2H7YA 2OGZA 3K2IA 2WFMA 4U2GA 4X71A 5KWIA 2OCLA 4YX9A 4E15A 4L9AA 2OPHA 3R41A 1VA5A 2LIPA 2WHPB 4QLAA 4H7DA 2O2IA 3GZJA 4N5IX 4A16A 4UHBA 1HLGA 3D2BA 1CUHA 4FFWA 5CTAA 1IUPA 4D9JA 2QVBA 1LPPA 1UKBA 4ZGBA 4BAZA 4QWMA 4KACA 4DYHA 5AH0A 2JGKA 3B5EA 1XFDA 1SCQA 4CI9A 5T4BA 3LS2A 1O6FA 3ZWQA 1WB4A 1L7AA 4XX1A 5SYNA 1CUUA 2HU8A 1I6WA 2Z8ZA 3NGMA 3I2JA 2XB6A 1F0PA 1ZICA 1CUJA 2HA3A 1GKKA 1YR2A 2WFZA 2JGLA 1EINA 5ALPA 1E89A 3ESCA 2V98A 3O4JA 2DHEA 5HF6A 4P9NA 4K2AA 3FLEA 3G0BA 5JZBA 3STWA 1HDEA 1N8SA 1EH5A 3IUNA 4OU4A 4K6GA 2VJCA 5ALWA 4OPMA 2FX5A 1RYYA 1NU8A 5K5EA 1W52X 4Y2XA 4U2EA 3I2IA 1THTA 1F0NA 2WUGA 1ZI6A 5T4FA 3ZLUA 4FLFA 5LZ5A 5ALRA 3QPDA 3EQ9A 4BVKA 4V2IA 1CUYA 4N8SA 1GXSA 4B9AA 2H9YA 1VLQA 1K5PA 1YB7A 3EBLA 5A7GA 1UOOA 4UFNA 4C4ZA 4BRSA 2ZJFA 5HFAA 4MWSA 2H7XA 3DYVA 2HM7A 1AX9A 4CG3A 1PV1A 2RHWA 1CIJA 1GKLA 3X3HA 4F21A 1A8QA 3C6YA 1LPMA 2RHTA 4UFOA 4RPCA 1EHYA 4J0IA 4OB8A 3M3DA 2HDWA 3BIWA 2OCGA 5ALNA 1ODSA 5BOVA 3WKCA 1LPAB 2XQIA 3FYUA 2JEYA 2QXTA 2HA7A 4NS4A 2O2HA 3ESBA 3W06A 3B3QA 1YS2X 1ZD5A 5AOBA 4M0EA 4OSEA 2VF2A 3H2IA 4CG1A 2XMDA 5ALHA 1XKLA 4L0CA 1QIKA 2V9ZA 4UHEA 3RKSA 2WJ6A 3M82A 3PDCA 1X2EA 2EEPA 1E66A 2XMCA 1ZI8A 4ZV7A 5JAPA 1OILA 4GHWA 1MNQA 2JIDA 2R11A 3DLTA 3W9UA 1YB6A 5ALSA 5AOCA 2XUHA 3O9MA 5CBKA 4NVRA 4PF1A 1FFBA 2IX9A 1A88A 2JGMA 1U8EA 3G7NA 5AM1A 4MQMA 5HK8A 1EDDA 5AJHA 1ZGBA 2JGEA 2V96A 4CIAA 1BN7A 3V1NA 3FYUB 1TQHA 2O7VA 1JU4A 4HVTA 2XE4A 3DNMA 3F9CA 2PKYX 5JASA 4HXEB 4U2FA 3L1JA 2ZSIA 3I2FA 5AKXA 2QRUA 2VJDA 2WUDA 3B12A 3DS8A 4AO7A 5SYMA 2VA9A 3V9AA 4Q1VA 4Z49A 4EY6A 1U4NA 2OAGA 2X76A 4N8EA 4PW0A 1ZIYA 4DSZA 4KJXA 2WILA 2XUDA 1AMNA 1DINA 5CT9A 1QJ4A 4MEBA 1XZBA 3A6ZA 4KE6A 1VXRA 5AP9A 3G8YA 5AHXA 1TCCA 1QFMA 1MAHA 1H2WA 3BF8A 3F97A 5A62A 4OD0A 2PPLA 5FRDA 3H1AA 3KD2A 3IVMA 2ZYSA 2DR0A 1DTEA 5C8XA 3WL6A 3FVTA 4JYPA 3ZLVA 4UUQA 1Z68A 4Y2JA 5AI8A 1IVYA 3FBWA 3S8YA 4H7FA 3Q0TA 1CUDA 5CXXA 2W22A 4AZ3A 3AILA 3GELA 1GQRA 1BRTA 1D07A 2GYVA 5AI9A 3CCBA 2PSDA 4Q3OA 5AKLA 1UK8A 2BAGA 5JAUA 1K8QA 4FLEA 4AX4A 3O4IA 5CT6A 3C8HA 2IITA 4X7BA 4KAJA 3KSRA 3ANSA 2DSNA 1H2YA 3VJMA 5AI0A 2XMGA 5AM3A 3PICA 2RGUA 4KE7A 3OG9A 3OM8A 4WFKA 3C6ZA 1EXWA 5ESRA 3HXKA 4H35A 1WHSA 5AM2A 2J4FA 2BUAA 5LKRA 1ZIXA 5C81A 5EIAA 2WQZA 3DCNA 3WIOA 3OC0A 1HKHA 4QDUA 2Y1KA 1XZDA 3SWWA 3I6YA 1MX1A 4AB1A 2WIKA 3GROA 1EDEA 3BJRA 1WHTA 5AK4A 3QZUA 3G9XA 2PBLA 1Y37A 3E0XA 1A8SA 1XRPA 4BE4A 4KEAA 1MX9A 4UBIA 1QOZA 3GA7A 3QMWA 1R9NA 5FUMA 5FOQA 2XT0A 3AIMA 4EB0A 4IQ4A 1TAHA 2WG1A 5FP0A 3BWXA 1QTRA 3L1IA 4W1RA 5D3ZA 3WKBA 1T4MA 1XZMA 5HF8A 2QM0A 5HQ3B 3D2AA 1XRLA 3F8SA 3CXUA 3E4DA 3RLIA 3WL7A 1IUOA 1L7RA 1AUOA 1E8MA 2BUBA 4BC0A 3H2GA 3O9VA 4AQDA 5CT4A 1ZD3A 4UBOA 5HFNA 4G4IA 4I4CA 5K3CA 1ORVA 5DNVA 1W76A 5CT8A 3DOHA 5I7UA 1UZAA 3STYA 1NU6A 1WB5A 2X8BA 4H7KA 1XRMA 4WFJA 1CUAA 1UWCA 3STUA 3C70A 3I2HA 3G0DA 5IVIA 3WWPA 4WDRA 2DCMA 3F98A 1MN6A 3BDVA 3FWHA 4W1QA 1UXOA 2HIHA 3D3NA 1LPNA 3Q8WA 1K63A 2WHRA 3W2TA 3FCXA 4LIPD 3WJ2A 3VJKA 3FAKA 4BATA 4X97A 4Y2TA 4UHFA 4J0KA 1UK6A 2Z5GA 3AUKA 3V1LA 5A6VA 5JALA 5DYYA 1XLUA 5AM4A 3FYUC 1R88A 3P2MA 2AJBA 4LXGA 4W9RA 1SCKA 4Y2RA 5A71A 2ORYA 1XZAA 3OTQA 5DJ5A 2ZJ7A 5EHQA 3HEAA 3BJMA 4TPKA 4QLOA 5FXMA 2WJ3A 3FSGD 5IVHA 3D5EA 1AGYA 4PSUA 2VAXA 2ZYHA 4QDTA 5KREA 2NW6A 4H7HA 3VVLA 1MJ5A 4DGQA 4TGLA 3WK4A 4LYEA 4CCYB 3WQHA 4BC1A 4OU5A 5T4HA 2ZJ6A 3V48A 4HRXA 4BAUA 5CW2A 1YA8A 1FSSA 4BYMA 4KRXA 4FKBA 1F8UA 5CH8A 5HF5A 2WU3A 3SC2A 1R3DA 1VJ5A 4Y2QA 1BEEA 2B61A 3O0DA 5HKBA 4JNCA 1W1IA 2I03A 4E14A 3C6BA 4J3JA 1M33A 3G9UA 3I2KA 2EDAA 2AJDA 4CCWA 5LP1A 2ZYRA 5JARA 5KBYA 3HC7A 2GBFA 5AI6A 1U65A 1TIBA 4Y2VA 2PM8A 1CUCA 2WKWA 3E3AA 1QIHA 5J3JA 3UUEA 1QO7A 2UZ0A 3BXPA 5EI5A 4X85A 5IH7A 4FNGA 2XUFA 5ALUA 1K4YA 3O4GA 3WIBA 2PSJA 3C8DA 2VJBA 3DKKA 3QMVA 3H2KA 4EY8A 4UHCA 5AO9A 4K5QA 2QXUA 1UOQA 4OB7A 3WK9A 1EB8A 2XQKA 3HZOA 2DFPA 4FFVA 2JBWA 4BZZA 1DT5A 7YASA 4E46A 1P0QA 1JT2A 5LLSA 2C58A 5ALFA 2ZYIA 5A2GA 1J2EA 2CUTA 2QOEA 5ALOA 2BUCA 3KOOA 3T52A 3WZMA 1AZWA 1GQSA 1XLWA 4ITVA 3R3YA 2X5XA 4PQEA 3K6KA 4OYYA 1MTZA 2WU4A 2XLBA 4GXNA 1ZOIA 3QPAA 4X94A 2WHPA 3H2HA 5ALGA 2I3ZA 1G66A 1CUWA 4F5ZA 1CRLA 4WDQA 5AKZA 1QFSA 3R3ZA 3WYDA 3I1IA 3WZLA 1KU6A 4X90A 5LZ4A 3OPMA 1EX9A 4RNCA 1Q0RA 2Z3ZA 2RONA 1H22A 3WA7A 4DNPA 2YASA 2PL5A 5AICA 2XMSA 5ALDA 3RM3A 4RE6A 1F6WA 4B0OA 1XQWA 1A7UA 4GDMA 1ZI9A 5DWDA 2EDCA 2WLSA 2JF0A 1YAHA 3WWDA 5A7HA 1QGED 3H2JA 4KE9A 4BCBA 3M81A 1N1MA 4EBBA 2R8BA 3EF3A 2G63A 3TGLA 2YYSA 3C5WP 1CUZA 3WKAA 1JU3A 3O4HA 4UHHA 4UHDA 2OQVA 2WM2A 2J4CA 4B81A 1PFQA 3C87A 4W63A 2HHAA 3PUIA 5ALZA 4Q3LA 1MO2A 2HA5A 2PSFA 4KAAA 2OLEA 2OAEA 4L3WA 3G0IA 4UBKA 2HRQA 2QZPA 5AIAA 3L1HA 1XQVA 2XQGA 3QMMA 1ISPA 4U2DA 4Y2PA 5CURA 1LPSA 5ALMA 5C8ZA 4MEAA 2GYWA 1W6RA 1UKAA 2HRRA 3TJMA 4YASA 4H7EA 3H0CA 4NZZA 3VVMA 1ZGCA 4BVLA 5K3EA 1JKMA 1JI3A 3PE6A 4A5SA 1XZHA 2HU5A 5JIBA 3LIIA 2HFKA 3D59A 3QPCA 4MYSA 3WK6A 3AZOA 4LHEA 2AJ8A 2VJAA 4F0JA 3DYIA 5AKGA 5AK3A 1EK1A 1BCSA 4W1PA 1VZ3A 1QIIA 1JFRA 1IUNA 4X6YA 4ZXFA 5ALEA 3CCCA 2XUQA 1UKCA 4B85A 4CIBA 3PFCA 1E5TA 4Y2UA 3R3WA 5HF9A 4B0PA 1ORWA 4G9GA 5FPPA 1TK3A 3LCRA 5HZGA 2QS9A 2WFLA 3I28A 4NMWA 2I3DA 2DQYA 5CT5A 4LXIA 4BRZA 1BU8A 3LIPA 2WG0A 4B80A 3NUZA 4PSDA 1IZ7A 2XUKA 3IUJA 5LZ7A 5DLPA 1X70A 3WLAA 4X95A 2JGJA 1QIGA 4AXBA 1XZCA 4DMCA 2VATA 4YPVA 1MX5A 4FBLA 1IMJA 1GPNA 1DX6A 1HPLA 1CQWA 4I19A 3IBTA 1A8UA 3A2LA 5A7FA 1FFEA 3PF8A 3MUOA 4N5HX 3ANTA 3HLKA 3HSSA 2E3JA 1VE6A 1MPXA 4BDSA 4K6KA 3WI7A 5LIPA 3DL7A 5DTJA 1VZ2A 4JEIA 2FUKA 3QITA 4DMHA 2XMZA 1X2BA 3ICWA 3WKEA 4Y2YA 1R9MA 1XZEA 2BKLA 4HRYA 1WB6A 2BGRA 2Y2UA 1E8DA 1GZ7A 4GWLA 4QDOA 5FV4A 1SC9A 4M0MA 3GBSA 5ALYA 1OXMA 1DWQA 4P08A 5LKAA 4B83A 1MNAA 4G9EA 2GBIA 4WJLA 1E8NA 2XLCA 2WJ4A 4IH1A 5JD5A 5ALQA 5AKJA 3AFIA 1VKHA 3ESDA 3A2NA 5AM5A 1XZIA 2H7CA 1QTIA 5IVDA 3D4LA 3HYSA 2OCIA 3ILSA 3ICVA 2I78A 5ALIA 1AKNA 3V1KA 5E4YA 1B6GA 3STXA 2VT7A 4H18A 3TEJA 5FDFA 4Q05A 1ODCA 3AIOA 3NOXA 1GPKA 3WWCA 4EY5A 5JZ9A 1EA5A 2CB9A 1KEZA 4H0CA 1USWA 4FMPA 5HKAA 4QA9A 5K3FA 2OGTA 1QIFA 5FKJA 4UFPA 2ES4A 4IH4A 3AIKA 4DSAA 4KYVA 1T2NA 1DX4A 3O95A 3E1GA 3GFFA 4G4GA 1LPOA 1WM1A 4ZI5A 3R0VA 3D0KA 3AJAA 1JJIA 3CN9A 3D2CA 2CJPA 3STVA 4ZV9A 5D7BA 1ZD2P 2QUBA 5K3BA 3BIXA 3FCYA 1XROA 5DYWA 4PNZA 4FBMA 4EUSA 1P0IA 4DTCA 3G9ZA 4C01A 3I6ZA 4J03A 1THGA 4H77A 4ARAA 4AN0A 3EIOA 3QBJA 3IIIA 2DQZA 2HL6A 3A70A 1XQXA 2ONCA 5CH5A 2VT6A 2PUHA 6YASA 2QJRA 3SK0A 1FFDA 2CKMA 4WY5A 2ECFA 3JYHA 3F96A 5CXUA 2OXEA 3HI4A 4J0HA 1QIMA 4BCCA 3R3VA 1CUXA 3DL4A 1JJFA 5YASA 2XUJA 2GBCA 5HCUA 4X92A 1TKRA 1BEZA 3IA2A 1AURA 4B6GA 3I2GA 1YS1X 5AKYA 1MU0A 2IIVA 2O7RA 2WFLB 2Y6UA 4N8DA 1XRQA 3WK5A 1LZLA 2ACEA 3AINA 4MWTA 1Y7IA 2XMQA 4KE8A 1DQZA 3DDUA 5KWJA 3R3XA 1CUEA 4B7ZA 4FLMA 2YH2A 5LZ9A 4OCZA 3DQZA 2QT9A 4U2CA 5JAHA 1W4LA 2JGFA 2BGNA 4GEGA 1CV2A 3WK7A 5BV7A 1LLFA 3S2ZA 4HS9A 4G8BA 1ZJ4A 3I1YA 4ROTA 2B9VA 4WCVA 1S8OA 4WY8A 1JMYA 2WHQA 3WWEA 3ED1A 4GW3A 2FJ0A 2P8SA 3WYNA 1TCBA 3H17A 5IKXA 1WPRA 4GLBA 4J0DA 5ALVA 4C87A 1UFOA 2BFNA 1CEXA 2AJLI 3LLCA 1QE3A 1CQZA 3IDAA 2CMFA 5D6OA 3IUQA 4QDZA 4G8CA 4BTLA 2ZSHA 2AXEA 2PSHA 1G42A 5FPQA 1SOMA 4OYLA 2C4HA 1UK7A 4C89A 4X91A 4DNQA 2OQIA 1GT6A 3N0TA 3LP5A 1ETHA 2OG1A 2CZQA 3CN7A 4TVKA 4HXFB 2C5GA 2Y2VA 4UBLA 3BDIA 4BE9A 3C5VA 1CUFA 3TRDA 1BN6A 1XRNA 2PU7A 2QUAA 4IH9A 4YK7A 4ZWNA 4ZRDA 5FLKA 5EIEA 1XQYA 1YSCA 4HZGA 4JH0A 5LZ2A 2Q0XA 2WTMA 3HJUA 2HFJA 1J1IA 5E4JA 1L7QA 4AZ0A 2GYUA 2PX6A 4UBMA 1LZKA 3IB3A 4WFIA 4Y9SA 5ALJA 1WCYA 4AMZA 3A2MA 2PU5A 2WUEA 1UT6A 5JD6A 5HK9A 4OB6A 1UOPA 1MAAA 5JAOA 4G5XA 4AO8A 3G02A 1G5FA 4B9EA 3UMJA 5AIBA 3KWJA 4G8DA 1YA4A 4MJ3A 4J0JA 1N5RA 4O08A 1GPLA 4LYDA 1KU0A 2WIGA 4CG2A 2XUAA 4BVJA 3K9BA 2XQFA 1C7JA 2VQ6A 3EQ7A 2DHDA 4ETWA 4P93A 1K6EA 3PUHA 5JADA 1XZJA 5AI4A 5CH3A 4IHAA 4BP8A 1SCIA 3DJYA 2RAUA 3N2ZB 2JEZA 2CBGA 4HAIA 4XWGA 5EHZA 4DNOA 1XKTA 5ALTA 3ESAA 3M83A 3WA6A 1QONA 1CUGA 4C6HA 2Z8XA 1VXOA 4ARBA 4E11A 2Z3WA 5DYTA 1MT3A 3VDXA 4DNFA 3PI6A 4UBJA 1YCDA 1O6GA 3VKFA 1AQLA 4J7AA 5JANA 3W04A 2XI4A 3UUFA 3OOSA 4HXGA 4DMKA 3H19A 1Q84A 2B4KA 4PSCA 3G0CA 2XUIA 3VJLA 2QJWA 2WIDA 2GZRA 5E4TA 4BZWA 1QLWA 3GUUA 4MQLA 5AM0A 5EGNA 3FVRA 1CR6A 2BCEA 3VXKA 1HL7A 2D0DA 1FFAA 4QNNA 4BB0A 5IVKA 2WIFA 1WPXA 4H7IA 3WK8A 1XZFA 3IULA 3PF9A 3FLAA 1LPBB 4C88A 1NX9A 4X00A 4I3FA 5DNWA 1CUVA 2XUGA 3ZPXA 2O2GA 5BWCA 2HA6A 2ZVDA 4PO3X 1B41A 1GGVA 4GBGA 4IO0A 4EY4A 4W1SA
chains in the Genus database with same CATH superfamily
4LVNA 3I01M 4BIIA 3LAWA 4JELA 4KMOA 4AT1A 5LR6A 4KO1S 3MXTA 4A0FA 2PS1A 1VLMA 4IIYA 5K0NA 2QR2A 3SU8A 5C1PA 3STHA 4LMBA 1PJZA 3OD1A 1O6BA 1JDTA 3PBKA 4FB4A 2E49A 4JBNA 1GU1A 2E5WA 4YJ3F 2MR6A 4EI9A 5DHFA 3N70A 4YS6A 1H3NA 4HDMA 2C4MA 5COBA 4RMJA 3R5KA 4HJXA 3JD3A 3DKRA 1U9CA 2ODEA 3ELWA 3UFBA 1XVLA 1RZVA 3GFBA 3HV0A 1GCIA 4L7QA 3RSLA 1BX1A 2GGSA 3VC1A 2HWKA 3VR6H 1OAKA 4HH0A 3TK1A 3T8YA 4N7JA 4Z9BA 4P82A 1M6NA 4JMLA 2RIPA 4F97A 1TU0A 3FI9A 2ZT7A 5BVHB 4IV8A 1U2DC 3BMNB 3CPJB 3HACA 4JXJA 3X43A 2J0UB 2GVNA 2R6HA 4PPFA 3V1MA 3QWIA 5IAEA 4ZT6A 3BK7A 2XGMA 4P22A 1THZA 3KHSA 1VA4A 3N0VA 6ADHA 2R66A 4YV0A 2ZWOA 4QJBA 5KUTA 2AZTA 1FU7A 3SG0A 3NTVA 3AI7A 2A7XA 1R0LA 2ZPUA 3UXHA 2NUPB 5K1ZA 4TKUA 1NVVR 1NI4A 1ZGJA 5DGTA 5FADA 1LTQA 2PLFA 2GFIA 4TKVB 3RIGA 5FBVB 4NYIQ 3CR8A 5KAPA 3KQOA 3MYRA 2PUJA 2RG1A 3A0UA 3L6RA 3GGDA 4JBLA 2WV7A 4IAOA 4MWZA 4Z7OB 4JHLA 2A9RA 4D9EA 2C4KA 1G0OA 1CY2A 1XD9A 2CL6X 3EODA 3K09A 4F60A 2EW8A 3ZXXA 3IQWA 2DXIA 4LV5B 3ZLTA 2ZBFA 2DHCA 1P5RA 3HDVA 3GUHA 4YP9A 3NTQA 3UTCA 3MRXA 1CULC 4FDMA 3S6JA 2BJVA 3RKUA 3B6EA 1U8UA 5JTTA 2C2KA 2OAP1 5IJZA 2YBDA 1LSOA 3VYRB 3OZ7A 3G6KA 4PQFA 1Z13A 3OQOA 2MINB 4OP1A 1DIRA 1SR8A 3N87A 1EG2A 2HADA 1WETA 2FVYA 1X0VA 5CLGA 2ZE7A 1FDVA 3WVNA 2F90A 5B4TA 3P7MA 1PVDA 3HB4X 4GZ6A 3W6UA 4C6RA 2GZMA 3CRNA 5INTA 8ABPA 4D3FA 4B82A 5LL6P 2VZEA 3HCOA 2EQ5A 3OURA 3OCXA 2P6PA 1XDWA 3CLUD 4KZKA 2MWMA 3OE7A 2NNWB 1T29A 3WB2A 5C4IA 3FPFA 1NVUQ 2V7VA 3PUKA 4ZICA 1WXGA 3NRBA 4W8HA 2BM0A 5DK6A 4G26A 5EHIA 4Y9UA 1LTKA 1VPVA 2R48A 1O4VA 2Q41A 3CJQA 4RDIA 4CMEC 5KSZA 4DUZB 1C9KA 2VSFA 1W0JD 2DHRA 4KG7A 2TMDA 3C3XA 1F0KA 2C5BA 2G28A 5CVDA 4LJSA 5FTWA 5C7YA 4GBJA 3M70A 3SFTA 3O8BA 1X14A 2AD5A 4XYMA 1YH3A 2VPXA 4G37A 3RRXA 2CZGA 5H3HA 1X1DA 5GIPE 2C5FA 2QAGA 3A4YA 1QP0A 5EFZA 3TNFA 4EEKA 1QV9A 1DFIA 4MB2A 1C14A 1E7MA 2BMDA 4C05A 2WTNA 1JA9A 1L3IA 1NW8A 4OEHA 4RPLA 4DJTA 2PHZA 3MJSA 1UBTS 3ZC3A 3WAJA 3EZYA 1E7RA 3DDCA 4A8JA 4FIDA 1J39A 3D4NA 1OX4A 4HS4A 1Q22A 1XG5A 2I2DA 4JJ6A 5IZCC 3W90A 2J0UA 1O94C 2JFGA 1EX7A 4DKXA 1E0KA 1T24A 2B8NA 4IOJA 3DMTC 4L28A 3WLRA 3ZI7A 3DBHA 1R0BA 2Q4RA 4LHSA 5I8ZA 1H23A 1RP7A 1SIBE 1DDIA 3D3WB 1OFUX 1I4EB 3DFKA 3H5IA 2HF2A 3ZJUA 4WZZA 5E7JA 3FKJA 1F2DA 4N6OA 3I0ZA 2ZM6B 5HJ7A 1PQUA 1VGQA 5IBQA 2Q2VA 1H4QA 2ZJAA 5CPBA 4HAXA 3H2SA 2VP4A 4HNSA 2H57A 2O1XA 2DJ5A 1ZM2A 1KEVA 4W6QA 4WOBA 5HPYB 3GG2A 4MP3A 5LIRA 2NYUA 2IYWA 2G5PA 2QMQA 5AVTA 3NHUA 4UQPA 3PGKA 4JK3A 1SQ5A 2IZ5A 1SIUA 2BD0A 1ZC3A 3HCAA 1YCHA 3DD1A 3HP1A 4JVMA 5FLEX 2PZAA 4UM8B 4YTEA 3ZK8A 4CUJA 4XVCA 5BYAA 5JECA 1AH2A 1E2PA 5JNLA 1BCRB 1K5HA 2PVSA 3I92A 2XSZD 3PJFA 1NMQA 3R3UA 5CLLA 1PW7A 2VPPA 3SJAA 3MXOA 3L1VA 1CUBA 1LC0A 2PLRA 1MC4A 4DCSA 5LVAA 3H13A 1ZUNB 4EY3A 3EEQA 4RFLA 5LBTA 1E3WB 3TI7A 4CQMD 1AMOA 3IAAA 2CHGA 2RGRA 3RAPR 1P9NA 4Z9XA 4UTPA 4FYMA 4DLAA 5J4KA 1I2ZA 3IAS6 4MW5A 1I13A 4GL2A 3GRFA 1U2DA 1RP1A 1ES9A 4GX1A 2H92A 1D2AA 2BWJA 4JL5A 4EPXA 3A14A 4IJWA 3RYHB 5JWRA 5G0SA 3CVUA 2GD1O 3LF1A 2XKKA 4EUKA 5CCXA 3KSZO 3SBOA 3ZUGA 4Q00A 3NOOA 5K3OA 4BKMA 1QH8A 3KTAB 3NCHA 1YJAA 3VO9A 4AWBA 1FP7A 5LD2B 1Z5UA 4I36A 1AE1A 1X3SA 3C6XA 1EAMA 4RA9A 5CXSA 2RHGB 4CU2A 3JR3A 4PO1A 3CUTA 1B93A 1NW7A 2AFVA 1LBSA 4Z5XA 2VRWA 4HLDA 4PSKA 1XCLA 3ZD8A 2FJPA 2ARKA 4IOKA 1IWOA 1TYDE 3SIXA 2OPBA 3KBOA 4OGKA 4ECAA 2VSOA 3AR6A 3ETGA 1T6NA 1RPTA 1L1QA 1YDWA 4G4SP 2CB0A 3BPSA 3OPNA 1VDZA 4H3KB 1JHXA 4ZOCA 1SPBS 2JGNA 2G09A 1S0UA 4H1HA 1Q3TA 2CD7A 1C4XA 1XFAA 2ZAOA 1E9CA 5L8VA 2RHOA 3BMXA 4QRIA 4Q5IA 2HGSA 8OHMA 1QRRA 2Z2ZA 3LUCA 1CJBA 1EMDA 4BO3A 5A3VA 3MVEA 3RNLA 1NW5A 3PTLA 1WZUA 3MJRA 3MSCA 4FK8A 4HN2A 2VAVA 1WQ4A 2X4IA 3QEJA 3G49A 3NHMA 4B3FX 3IHKA 2OBMA 3RK1A 4AO6A 3CVYA 3DAHA 1DNPA 3N58A 2VYVD 1TKAA 5LJLA 4RXUA 3YASA 4OLBA 1Z6TA 5I5EA 3DTYA 4EYGA 3TLKA 4H60A 2YFHA 3AHIA 3LOQA 3N8KA 3EMKA 3OJLA 3QEMA 4ISBA 3L07A 1KO8A 1I14A 4FN5A 2YMPA 4CKXA 4EECA 2G9VA 4MGIR 4OTZA 3HY4A 3GRCA 1FDOA 4D9KA 2UVDA 2YVUA 3OZWA 3RS8A 1FJ2A 2G1UA 2CYCA 1VIDA 4DIUA 3C8ZA 1G3MA 2B20A 4HTAA 4KAFA 3I6MA 5DSTA 5K3AA 3TOVA 2ZBPA 4BJ3A 1EFDN 3RU3A 3U3DA 3OPYA 4URWR 1WU7A 1UBLS 2GS9A 5ALLA 2FK8A 3KLBA 1ZU5A 2UYYA 5FFMA 3ZJ4A 4PO9A 3FSRA 2PUFA 1AK2A 4MIOA 4FDUA 2VEOA 4GUDA 2AYYA 3KT6A 4EVSA 3OQJA 4R7GA 5EJMA 5JAQA 5CM8B 1AQYA 2CNOA 3VTAA 3IUPA 4PYKA 2VF5X 4C0BA 2QIPA 4M7RA 3RYHA 2WT4A 1CY8A 1Y3CE 3I9V1 3I04M 1JIQA 1PR9A 4EFNA 2Q3EA 2FOXA 2QTAA 3PQCA 3LD9A 4MAMA 4PHGA 4P4GA 4ALJA 5HQ3A 2BFCB 1ORRA 1DQYA 2GBGA 3Q9UA 3CWZA 4LXHA 4ARCA 2C0QA 2H7VA 1PL8A 4AJEA 2QYTA 4LZJA 3T4PA 3GWGA 4NJEB 5JD4A 4AECA 4RYDA 1II9A 5B6PA 3IB6A 1NY5A 1TB4A 4V0LA 3WP1B 4UU1A 1DWPA 4G5HA 4EITA 2WYWA 4O33A 3S29A 4XAQA 4GQIA 1V2HE 3E8SA 3HRHA 1ZK2A 3T7IA 4DMUB 1GDDA 2CF5A 2J41A 4MR8A 5AW0A 1NC1A 2H9AA 1CUIA 1OWLA 3D7KA 3KIPA 3SR0A 3JQFA 1ZL2A 1II0A 1XCGB 2HA4A 3AM5A 4EDFA 1JB9A 2I80A 1E9SA 1R0CA 2IODA 3IIJA 3GEBA 1NUPA 5KPDA 1BZYA 3S7TA 3H2BA 3KCNA 1AF4A 2VTBB 5EKUA 5BQ3A 1WXHA 2IBMA 4RCZA 1JR3A 3LFHA 3ET4A 1W75A 3BRWA 3D6JA 1EAYA 3KUXA 4NBTA 3QYJA 4KSCA 1EB9A 3K70C 1CZOA 3HWWA 4JYCA 2M6SA 3OOEA 4OUDA 4Y7DA 5KAMA 2G70A 5IAOA 3IP6A 4AKGA 1V41E 1XNGA 2QRPA 4P92A 1ZCAA 4B6JA 2PX5A 1SK8A 3V7YA 3TCNA 4C4YA 3RSHA 5TGZA 4DB2A 1N3LA 2DFKB 3LXXA 5U1PA 4AY2A 2NNLD 4PZLA 3RIMA 3T94A 3ND9A 1V5EA 1AHHA 3PQ6A 1E4VA 5KNDD 4TMFA 1JE1A 2VDQB 4JL8A 4FOLA 2HZ7A 1IAQA 3CU5A 5F5LA 3WGUA 4YMIA 2IYEA 4FFLA 5IM5A 1JXOA 1YO6A 4YJDA 3E4CA 4D8UA 5GTDA 4J07A 2WSLA 3E9ZA 1SOWA 2H4XA 3D81A 1IDN1 2C2XA 1J0DA 5ADHA 4RTSA 2JI7A 1N9GA 3AQ4A 5F35A 2A5FA 1DIOB 3N8HA 5LCXA 2FAXA 1MX3A 4FNMA 4NYMQ 3ZQUA 3PJRA 4MCHA 3M89A 2Q8QA 3TSOA 3H42B 4HQKA 3VH2A 3NWPA 3OHSX 1AN9A 2WUFA 3KCQA 3UB3A 4BLOA 4KXMA 4Z4QA 1IK4A 1W2WB 2CYBA 1VJGA 1G21E 2V9PA 1NW3A 5JPIA 4J6EA 2JKVA 1C8BA 1QB7A 3DEAA 2SCUA 2IPLA 4PC1A 4BNJA 4IEEA 3RARA 3D4BA 2QTGA 4KOEC 1NUSA 5IMSA 1DXYA 1YASA 5JSZB 3U1BA 1OX4B 5IBPA 3OY2A 3BTUA 3OCZA 4INZA 4NU6A 4HYEA 5FFNA 4KIJA 4U7TB 4MIEA 5IAKA 1ZN2A 3GCZA 4BYGA 4DBVO 4V1CI 4LKOA 4ANFA 3N2IA 3VAZA 4BNKA 4Q24A 2WNHA 2FWBA 1QIJA 2HTEA 5IANA 2AG6A 1E1DA 5CYOA 2R4TA 3IEUA 2OGZA 3LUGA 4ESEA 4PNEA 1BHQ1 1QZTA 1VBKA 2BOVA 4PZAA 3K2IA 4DUGA 2WRZA 3MQ4A 2WFMA 4X71A 4UNNA 4V02A 4HFMA 1GADO 3T41A 5IC5A 4O4HB 2SICE 5MDHA 2O8EB 3CW8X 3MWJA 4YJGA 3KZMA 4W82A 2YV2A 3RVQA 1V3TA 1QK4A 2W2MA 2QD1A 3T06B 3BB1A 3BFJA 3ZCXA 4L74A 3KE9A 3BMCB 5COQA 2OPHA 1Q6YA 4A5OA 4CUZA 2LIPA 4CM8A 2OFWA 3PTZA 1TO2E 3T9FA 2REBA 3G7UA 5B5SA 1Z75A 1RMYA 5A0TA 2QVXX 3NHLA 2BSQA 4R40A 1PGJA 1VM6A 2X1MA 3LKVA 2ZRHA 1N5LA 2Y1OA 5FL3A 3AV0B 3HNRA 2QVBA 1LPPA 3GVCA 4JNKA 3E22A 4LJLA 3WGYA 1UKBA 4QICA 2E82A 3C3EA 4V3CA 3E48A 1PQWA 2F64A 1NYQA 3KKLA 4FYYA 4DYHA 5CHYA 1QVRA 3CNBA 1D6SA 2JGKA 4KLAA 5HDQA 1PW5A 4DZZA 5J58A 2IZZA 3JS5A 3JYPA 1SCQA 5DLDA 3UY4A 3W6NA 2B1IA 4Q4JB 4IIEA 1Z06A 2FW6A 3GJTA 4M9SA 3PC2A 1C7ZA 4MUNA 3IL2A 1O96A 1A5TA 1WB4A 4OOFA 3EVDA 2ZBVA 3ONNA 3ZBTA 2D5BA 2JFFA 3B70A 5KS2A 4MVYA 1U0BB 2IP1A 1AGXA 2XCTB 2FKNA 5DP1A 1S96A 3GGCA 4P5DA 3TRJA 1YS6A 5DDIP 4YJ2A 2BONA 5DCYA 1OPRA 2XY4A 3C3DA 1NDQA 4MVXA 3AUAA 4PPQA 4MTCA 2HSZA 3NGMA 4C0SA 4CUKA 4QGSA 2FFBA 1F0PA 1HYEA 2JARA 4DC1A 1ZICA 1GCUA 1FDTA 2ZYGA 4M1TA 1GZHB 3T7EA 1Y8RA 2VNHA 1TFUA 3PNMA 3WICA 4TQGA 1N2IA 3IQXA 2CUZA 1Y8CA 3EWSA 2RAFA 3P8ZA 4IF6A 4KLRA 2WFZA 4JIMA 1EINA 2DYKA 4M0LA 1JEYB 5ALPA 1ID8A 1E89A 3LHDA 3KQYA 3L3BA 1TPZA 4R2LA 3D5QA 2DHEA 3O4JA 5HF6A 5ILGA 2E4AA 4TXJA 3MUEA 4ESHA 2IEGA 4ZKDA 1AG9A 1FC0A 2H1WA 9LDTA 1I5EA 3KHUA 5BN1A 3FM9A 1JG4A 1NYLA 2EW1A 2JBAB 2NVUA 3K0BA 3G0BA 1P1CA 3TCXB 3KAQA 2UYHA 2ZQYA 4UOEA 4OU4A 1RJ9B 1WTCA 4TWJA 4NJMA 3TN7A 4A8HA 2I65A 1Y6JA 3PWSA 4FSDA 3U2QA 4QBTA 3U5ZB 3AVOA 2FX5A 2C8KA 2OBLA 2OD2A 2EJVA 2CDAA 2P90A 5K5EA 4GKJB 1TE2A 4N41A 4TYWA 3RIYA 4PINA 1RAFA 5HMLA 2CK3A 1K6MA 3NBMA 2QIOA 4L8WB 5IPFA 2GHTA 3BGSA 1IJKA 2FZGA 4UVHA 4P31A 4MUMA 4QRDA 1QRTA 1IEQA 3RNOA 1IG0A 1P7VA 5THQA 2C57A 4FLFA 3SX2A 1Z8DA 1O77A 2AX3A 5EVCA 1X80A 3AEQB 4ZT7A 4C0AC 3AF6A 3NHFA 1OI4A 2V7PA 3IESA 4QU5A 2ZBUA 2J5QA 3M5CA 2ZRBA 2EATA 4V2IA 3CVXA 5T41A 3PHJA 4DR7B 4FHDA 3O73A 2H9YA 3CYFA 3RBVA 4G5SA 4QTYA 2XX3A 2VSNA 4LI3X 3TTWA 5CB4A 4AY4A 4D0GA 2I2AA 2D2IA 1N5KA 1PGPA 3EW9A 4PYIA 1IVNA 2FMTA 2C7RA 1NVTA 3L41A 1QRSA 4HX2A 2IHNA 3QF7A 4C4ZA 4OXIA 5I5GA 3I05A 4BRSA 1ZUHA 5HFAA 1ID1A 3DAYA 4MW9A 3EK2A 3IEKA 1R27A 5AW2A 1EGMB 3KUCA 5G02A 3CMCO 4CMEA 4IHJF 1UXHA 3DW3X 4TT8A 2NO9A 5E6UA 5HTKA 5C8YA 2ZIFA 4MVJF 5AW5A 3QU5A 2YMLA 3LGSA 3IP9A 1E9AA 3H8JA 4LF7B 3EA5A 5C3UA 5F7XA 3UZUA 4KIFA 4DV7B 4JEHA 1HL3A 1VSQA 2GKOA 4IMIB 5CEJA 2Z2YA 1CR4A 4MWEA 4C7MA 1E6LA 3EZFA 5A9SB 1TECE 2Q5JA 2VLBA 1EHYA 4N9QA 1KA9H 1HDRA 2IZ0A 5P8WA 5JSZA 1UDAA 2XGJA 4IDOA 2B1GA 2CUNA 1VKNA 1UWKA 2HDWA 2R62A 4CEHA 2GNOA 3UMMA 2OCGA 5B6IA 221PA 3R2JA 1A7AA 1U8ZA 4FQ8A 1R4NB 3A3YA 3I5UA 4IKPA 1ZZEA 2YVKA 3EC2A 3PD7A 1MORA 1WMAA 2LNDA 3RUHA 4GX5A 2H1FA 4JB8A 4OSPA 3U17A 4AWAA 3RYIB 4BNDB 4LOLA 4QUGA 4AY3A 1XPJA 2Z1MA 3HR8A 4J49A 3G2MA 4S35A 4TL8A 3EY9A 2RHJA 4LZPA 4URVR 1U5AA 2Q3CA 4MDHA 4YP5A 1Z4KA 1X74A 4CJXA 2YCBA 3AHJA 1KZ9A 3KG2A 1WVGA 4PHCA 4IS2A 2ZGVA 1GCOA 3VR6A 2AZXA 4QOSA 1ZNXA 4X7PA 5IW8A 3R75A 1RYDA 1SHUX 4IHQA 3B8EA 3T3MB 1U9IA 4CM3A 3PLNA 2FRVA 4YLGA 2GHRA 1CQJB 1JA0A 3ZBUA 5KOJB 1N0HA 1Q11A 4ENRA 3A9UA 2A84A 3O92A 1JH8A 4RLFA 3HCRA 2BGGA 4DV1B 1IM8A 1G3UA 1KI6B 4JYBA 4FGLA 5ALHA 5GVRA 3U3JA 1QIKA 3A1NA 1FRQA 1TT7A 2RHMA 3W7BA 4LCJA 4UHEA 3RBZA 4I55F 4EKGA 1ESDA 2WJ6A 1PWYE 1Z6PA 3OQ1A 4B09A 3PDCA 2Q1TA 2EEPA 3L5KA 4HDRA 2GXQA 2Q3HA 4FDTA 4LPSA 5IS2A 4QXQA 2COEA 3I45A 4F4UA 4M54A 4JFRA 4ZV7A 1XN4A 1T2EA 3HXTA 4IWYA 5HYVA 2Q5LA 3HL0A 3K0EA 2EJUA 3DLTA 3T4EA 4CQNA 5ALSA 4F7WA 3REQB 5HM6A 1N75A 2G25A 2IELA 4RK4A 4M22A 1YE8A 2FPWA 1DBPA 3CVJA 3AUJB 3PITA 3TPZA 3W9SA 1FNBA 2WHYA 4BB9A 1R5JA 2J45A 4B3JA 2IX9A 2ACVA 3KVRA 1AU9A 5JNVA 3A9CA 1ZVKA 3HSKA 3IS3A 4QG7A 1YR6A 3LSYA 3SMVA 4PG6A 4DIBA 1NF2A 2YIVX 3T4XA 3UG7A 1TPYA 2QE7D 2LTAA 1BX3A 3PQ8A 4WA8A 4XM0A 5AJHA 4CIAA 1NP6A 2V96A 3QKSB 3VKVA 4YRKA 1FUKA 4TS9A 4AJOA 3DSRA 1A97A 1HE3A 4PC6A 3HNOA 3SQMA 3UJCA 4HCJA 4M9QA 5C5DA 2MMCA 2O7VA 3NJ4A 3NX4A 1NN5A 3FROA 4QSMA 4BLQA 1DAPA 2AI3A 3QGMA 2IY7A 3GLHB 2PBRA 3FVWA 1KIMA 3OICA 3NEPX 2VZLA 3FWKA 4XOIA 3L1JA 2XNSA 3IE2A 4YV1A 3AVUA 1E2LA 2F9FA 1NR5A 2P79A 2LD4A 3I2FA 3K9GA 3TUIC 4D26A 4TT3A 3DO6A 1KAEA 1ZJZA 2WZDA 1KEPA 4HNAA 2C4NA 4ZT2A 4HQRA 4F1KA 4M9CA 4ZDWA 3P9YA 2VJDA 1VB3A 3MGKA 3ZJVA 3VR0A 1FL9A 1GP2A 2VRCA 3QEAZ 5SYMA 1OKKA 2VA9A 1OPXA 4CFZA 4PX3A 1F51E 2CLEB 2G80A 4J1NA 3BL6A 2X4DA 2L17A 4NAUA 2ECKA 4WADA 1ZIYA 3CNNA 3M0EA 1Z4JA 2R44A 2GK4A 2HBRA 1G2OA 2WILA 5CEFA 5DVZA 4M6WB 1H9AA 2Q1XA 2R7KA 3AY3A 3P71T 1S9DA 2BM9A 1QJ4A 5FEUA 2XA2A 4X5OA 3DAGA 1DJLA 1KMMA 3E58A 4HH4A 1GA1A 4YECA 4M9RA 4R2KA 1Q1NA 2YWCA 1PR6A 4TXHA 3FG9A 5G2OA 5J9FA 3A6ZA 4RV4A 3SHQA 3T5GA 3JVUA 3LK6A 1U2RA 3G8YA 4IIBA 1AO0A 1UJMA 1W85A 3NLLA 5HE8A 1G6OA 1UFKA 3FOCA 4B3HA 3O0TA 4M8IA 1RAHA 4OA8A 1JKXA 3RS7A 2ID8A 1QFMA 3OAAD 1LF0A 2I6SA 3BF8A 3F97A 2R1VB 4MQFB 4YNBA 1UM8A 2PPLA 2WZQA 3PUJA 5DI3A 1G7CA 2YS6A 5ENZA 2A9VA 1P9OA 3DE5X 3GT3A 3TLBA 3UMRA 1NG9A 2FN8A 3N3AC 3OZDA 2DR0A 2QGNA 2P62A 1DTEA 3AI2A 3R6LA 3SQOA 1ZD8A 4DQUA 2Y1WA 1OHHD 2IV3A 3HA2A 3RJMA 5K4GA 3X1ZA 2IHJA 3K5PA 2GN4A 3NALA 2JJ8A 4K03A 4UUQA 1C3JA 3RTCA 1ISRA 1J5XA 4Y2JA 1ZO8A 2C84A 1A82A 3C3KA 4DZRA 1EIWA 5AI8A 4BNZA 1CS4C 1CNFA 1VB5A 3ZCUA 4C3OB 4ZJYA 4JLSA 1QYXA 3WB0A 4Z4FA 3OIFA 5H16A 4UZFA 5FO1A 4HMQA 1T0HB 3RFTA 5EMLA 4HVAA 3IT0A 2W7TA 1R6VA 2PMWB 2HPHA 2PWPA 3TXYA 4RMNA 3EZ6A 3AEZA 3L8ZA 1RM3A 1E1CB 3K0HA 3MGCA 4QXAA 5J5VA 1SC1A 4ZZ0A 2G72A 1BRTA 3K9WA 3SXPA 4RABA 1VI5A 3OQPA 1S1MA 4EYKA 5A5DA 1JA1A 5T3UA 7MDHA 4WW0A 1FTGA 2ON6A 4AFNA 1RWPA 1XBTA 2ZT5A 4A1FA 1K8QA 2B5OA 2WJPA 3DEFA 2IYQA 4FLEA 5AJWA 4AX4A 3UT5B 4G2TA 2QLLA 1WQ3A 5F2NA 1TEVA 5JXWA 5K0FA 1JFLA 1KJJA 2YW9A 5CT6A 2IYRA 5K05A 1PQ4A 3OPVA 1CY4A 2K4MA 1AA6A 3ANSA 4WIAA 4MRSA 3CPHA 2D13A 4TOIA 3A4LA 1IH8A 5AI0A 1M2HA 3VJMA 1IQ0A 3KQUA 3PICA 4IQ0A 4F91B 4L51A 2RGUA 4PFQA 3DEIA 3O5AA 5GONB 4CLOB 4LHZA 4EL0A 1Z36A 4D46A 2QN1A 3O8OB 3KKZA 3L2OB 3GFGA 5JJIA 4QDJA 5ESRA 1Y8QB 5KNDA 4ESVA 1B0PA 2FWMX 3HXKA 1WHSA 1OX5A 2BGLA 3DPSA 3M4JA 5TPZA 5JNWA 2J4FA 5HKOA 5KNBA 5KU7A 4LK3A 3ZD7A 2L42A 1OREA 1U04A 2YYYA 4URZR 3N07A 1GYPA 4QULA 4EF4A 3DFZA 5C81A 5K8TA 2YWJA 1T1SA 4Z99A 4MV9A 1LC3A 1LSUA 5FLXA 1RI2A 4M8LA 1VHJA 3HPQA 1WUJS 5AHOA 4BQQA 1HKHA 1A4XA 1GGJA 1PGNA 1XA3A 2Q5IA 2R87A 2F1IA 3GW8A 1VRCA 4JOSA 1Z2EA 2IXBA 4W5WA 3EFHA 4D9IA 4WL0A 4G1VA 3MCAA 3ZNPA 4IL5A 2WI8A 2WIKA 3GAFA 3ECAA 4L02A 2H0RA 1AQUA 2ZEJA 1G8AA 4ZPXA 2H51A 5D87A 1VRWA 1EHCA 1C1YA 1WHTA 5AK4A 3TMKA 2B36A 2PBLA 3CNHA 1O8CA 4M1ZA 5L3RA 5EAIA 1G8MA 2XT6A 4UDXX 4XGIA 1NYRA 3SE0A 4LHVA 3WSWA 3OO1A 1EJ0A 3UWOA 1FLNA 1MX9A 3KOMA 1N5OX 4CMGA 4UBIA 4JOCA 1A4IA 1PJLA 2G7ZA 3QRWA 1JAIA 1E5LA 4ZOEA 2CLFB 1T91A 1T15A 5LPNA 1QGYA 2CMKA 4YFYA 3WGJA 3TL2A 1KOGA 4QJ3A 5BXYA 1VE3A 3HU2A 5LUBA 1DUVG 2VDMB 3WBJA 1HEUA 4JSRA 4EB0A 3H9EO 4PICA 2YWEA 1EFPB 1M0TA 4IQ4A 2ZUDA 3H7IA 4BQEA 1R4NA 2WG1A 5IRCD 4Q93A 4EQZA 1N2OA 5FP0A 2CFTA 3G68A 3N7TA 1E3WA 4GF5A 1REQA 2OD9A 2X5JO 5DN6A 4EP1A 4LF6B 1SVKA 1Y3HA 5HILA 1CVIA 1UKVY 3QPWA 4RHCA 3QX7A 4INAA 3HCEA 2QLJA 3H0EA 3URKA 1E61A 2QX4A 1D6JA 2RKWA 3QMPA 2QVZX 5G0WA 3TVDA 5JOQA 1LVHA 1H4VB 3GMTA 2ZI6A 3OMXA 5CLIA 1FRZA 2QM0A 5T8KC 4NARA 3TLZA 1MO5A 4J4HA 2FZKA 3D2AA 2B0CA 5JNTA 3JAMA 1HV8A 2AMLA 1A71A 3C16C 1PZNA 3F8SA 4K81B 3E4DA 1EVIA 3L7BA 5TVGA 1KFEB 4B3CA 3BT7A 3LHIA 4HF7A 2P5TB 3RUIA 5GONA 1NUHA 5BQXA 4MUGA 1TTTA 1DVRA 4LE1A 4MICA 1F7UA 1Z74A 2BUBA 3OPQA 1S6YA 2AQHA 2XYRA 4AQDA 4QVGA 1SQSA 1CIPA 3W4KA 7GPBA 1BQ4A 1EBUA 3EXG1 3K0CC 4LQDA 4UBOA 1DELA 1QG2A 4DIMA 2C9OA 1K4KA 1UQTA 4DJJA 2R3SA 3ZBQA 3T7CA 1A72A 1ZN8A 2D1RA 4D4IA 4I4TF 1W94A 3V8MA 1JJVA 4AXXA 3GBPA 3REQA 1R8XA 4I4CA 1HLDA 1BKDR 2IS1A 3FA2A 3F6YA 2XCSB 1YBHA 3HYNA 3B1FA 2EX4A 2D1YA 2OZPA 4ZO4A 1W76A 1A69A 4MR7A 1B14A 4M9ZA 3RWOA 3WB1A 2A94A 3V8VA 1J70A 4AG5A 4K6MA 3DOHA 2A2ZA 4M0PA 1CB7A 1QFJA 1TYEB 1UZAA 3BXZA 1KMHA 1WDKA 3HDYA 5DM2A 5KC9A 4NBWA 2H4HA 2HEGA 3TW8B 2XEXA 3I01A 4WZBB 4C4SA 1GPWB 4IDAA 1YDGA 5EOVA 2D2FA 3QE3A 3EOBI 5FOWA 3S2UA 1Z17A 3VVBA 3SN6A 4LVUA 1SM4A 3WWPA 5KVQA 1PAUA 5DH9A 5HZMA 2DCMA 3VKWA 4I7EA 3C1UA 1MN6A 2UUBB 1IXKA 2B4YA 1ZVJA 4GRDA 2HXYA 3FWHA 3R6DA 4HAWA 1SJ9A 1O9HA 3D3NA 3G1WA 4GOJA 1E9EA 3ST7A 1N6LA 1WIWA 2BPOA 3Q8WA 3SJBA 5LN1A 3Q87B 5TIIA 1K63A 1B76A 3NI2A 4PHFA 3WHLA 2ZSBA 5MGNA 4X7RA 1XWFA 1X8LA 4EVIA 2GK6A 4RHFA 5KWSA 2AIRA 4QFCA 2CDNA 4XYBA 5DWVA 2D00A 1D2GA 4IJQA 4O2LA 3M2TA 4FFPA 5LYJF 2KLBA 4U3JA 2XNJA 4A0GA 1WD5A 4I1UA 4FSHA 2JLWA 5AR1A 2XZDA 1D6MA 1NY6A 2PS0A 2RC5A 2VJLA 3MCTA 4HWKA 1C5KA 3AUKA 3NB0A 4XRRA 3V1LA 2DERA 4K8OA 1KDPA 1NT2A 3A4VA 2I29A 1XAGA 3GVXA 5HG0A 3WSTA 1YDFA 4Q4CA 2XDYA 1TM7E 2FSSA 3FGPA 5AM4A 3TSZA 4DQKA 4F4FA 5KIAA 3O91A 5IDXA 2P2SA 3V1TC 1PK8A 1DV2A 3A1WA 4RJIA 3BRSA 3QK7A 3KU4A 4D9GA 5BY2A 4YCAA 1SCKA 3SSOA 1V8FA 1TA0A 1I4OA 1J8FA 3B1YA 4A0HA 1KJNA 3B6MA 1WRBA 2PQ0A 1PP4A 4MULA 1TQ6A 4NDAA 5EL0A 3ZWWA 4JC0A 2W43A 3GJSA 4UKDA 3K4PA 4ATNA 4DCMA 3EIXA 2ZJ7A 2A7QA 2GCOA 3ZWDA 4H15A 1QOQB 4RVHA 1E9VA 1MQSA 1O7JA 1RHUA 1JSXA 1BU5A 2YOGA 4RANA 4TPKA 5KJFA 2XODA 3AKYA 2REQB 2C9BA 4UXIA 5FXMA 3WNQA 3W5BA 1WXQA 3FPGA 4ZAFA 2WYHA 3D8SA 3MPUA 4Z6KA 3BMOA 3P1JA 3PSHA 3UMBA 2QRKA 3PJDA 3JXEA 2CL7X 1H0RA 2I8CA 1TZKA 2YIJA 2E4VA 1N4DA 1NQVA 2VRBA 3NHZA 5EXPA 4BUCA 1E32A 1HDYA 5KREA 1MVLA 5F98A 2ODBA 2FWNA 3IXQA 4H7HA 4IIGA 4V0RA 4LQLA 2C03A 1J09A 1JG3A 2H0AA 1PEKE 3KTFA 3SC4A 1WXWA 3CEJA 1KZ1A 2ZTHA 1N3YA 3HCPA 1SG6A 2FPPA 3OFND 4CCYB 1DG1G 2I62A 2QTCA 4KWTA 2NYVA 5LA6B 4EEXA 2ZRLA 2X8WA 2V9CA 3KHTA 1Q17A 4YDHB 4OG2A 1NWCA 3ME5A 4QBGB 3VC7A 2BEWB 2DUWA 2P2ZA 3LCUA 4HRXA 4XCXA 4ND1A 4BO9A 2C7VA 1IPEA 3AHDA 4BAUA 4CMBA 1N1EA 4OLFA 4JENA 2IP2A 2J3KA 5EZ6B 2DAPA 4EHNA 3FHTA 3ZDRA 1FW6A 3ZGNA 1HZZC 1IRXA 4ZOBA 5CH8A 5FA5A 4CR8A 4E4YA 4LFCB 2C95A 3W79A 5JVDB 5JXJA 1VJCA 2GN9A 4GI7A 4NMMA 3SPXA 1UDCA 4HB3A 4PC7A 1R3DA 2QT1A 4DL9A 4ZEMA 1KAHA 4B8WA 3MSXA 4J0FA 5GADl 1E1QD 2Q3BA 3FDZB 4DEXA 1WOYA 5E1OA 1S3GA 1BEEA 4GPAA 1RAAA 3UFXA 1WMDA 3V97A 3CNEA 2NVBA 1YB5A 3W2HA 2I03A 1FYXA 3F6CA 3P19A 4GL4A 2HH9A 3EUFA 4JCCA 5E38A 3T5MA 3GJZA 5FWXB 1N78A 2XTNA 3NBAA 3T9CA 2VRNA 3LGAA 4E14A 2A33A 4M3NA 5LFAA 4YIHA 3LPAA 3G9UA 4GPEA 5IVPA 2NXJA 2AJDA 3LQFA 3CX8A 4C0JA 5CFLA 3TNLA 2BFWA 3RG2A 5CEEA 3GLGB 4LJ5A 1FJGB 1U28A 4PPGA 2PA3A 5IFKA 2I9KA 4FMDB 3BQMB 3LT5A 5U4QA 2GBFA 3WGKA 3UN1A 2CVPA 1KI9A 3GRYA 4NSNA 4PHTA 4DRXB 1Y4SA 3ROXA 4JBHA 1K4MA 3ET5A 4XGNA 4FS3A 3A04A 4HEQA 5CTJA 5B1HA 1TJYA 4B71A 3CLUC 3ITEA 1N2JA 3KB2A 1QIHA 4KREA 1I3MA 1E1MA 4Q47A 3WISA 2NQTA 4D9CA 3DZCA 4FDAA 4U9IS 1KI6A 4MAFA 5FWYB 4FNGA 4WEQA 2PZGA 2XUFA 3MJEA 3MOIA 4TX1A 5ALUA 3UAOA 4YYZA 2KHZA 4HR7A 5FR2A 3C24A 2BGTA 4OOEA 3WIBA 2PGAA 2PSJA 2V6BA 3QLUA 1J20A 1J0XO 4LV6A 2E18A 3PXDA 3SHFA 4DR3B 3QVVA 2WM9B 1P1JA 3NYIA 3HJFA 2FQ1A 3RAEC 1YBVA 1TLFA 4UNQA 3SKYA 3CZ5A 3DO8A 3MLAA 4LJ9A 1B15A 3IFSA 4WMLA 3I5XA 5GV8A 1KOJA 3JZFA 4U7WA 4YAOA 3TMAA 4EVRA 5ITZA 3ZGLA 1U90A 1M2OB 4YFVA 5BR7A 5AO9A 4CTMA 1OH5A 2G5GX 3A4IA 1UOQA 1SXJB 4H6XA 3RHZA 1DSSG 1EFPA 3C97A 4DCGA 2VNJA 2YY6A 1ATIA 3GNLA 1EB8A 1DKOA 4OGGA 4QYWA 1X1BA 2VJYA 3ZW8A 4OMCA 3CHYA 2X9LA 5EWJA 4WK6A 1OI2A 3P94A 3FDXA 1QFYA 3GWZA 1B8NA 3UC5A 3O7MA 3GLFB 4MS1A 2P2YA 3EDQA 3TGWA 4JUCA 2Z30A 3HXPA 1O4WA 3RDPA 2N1BA 4E46A 1LH0A 4UREA 1JG6A 4PLFA 5CNMA 4V03A 3T0GA 1P0QA 3HPRA 5JJ5A 1JT2A 1G55A 5CFZA 2Y4NA 3X1XA 3W5IA 2Q49A 1V35A 2MIIA 3I9V6 1QYWA 2OECA 3AGQA 2Y93A 2IPOA 3VNAA 2RD2A 2O3UA 5KCZA 1KE1A 1JNYA 2I33A 4PAMA 2ZS8A 2QOEA 5EXTA 3ZXIA 1Y8RB 2ISQA 2G06A 5BORA 3WE7A 2BUCA 2EJCA 3FZGA 1H5QA 2ZZNA 2IW1A 1FXSA 2PUWA 3W3AA 1N57A 3WZMA 4AS3A 1J7JA 3L1UA 1EP1B 1HTBA 1NR1A 3OBIA 1YQTA 3DKIA 1VFPA 4DADA 1L9XA 2X7JA 1ENPA 3UA4A 1RI1A 3DZ8A 5HM8A 4FOTA 4BNWA 4DWOA 4OO3A 1P73A 1DBWA 5D7NA 5FX2A 1G3RA 3KSMA 3PXXA 2X41A 4PQEA 3K6KA 3ZHYA 3IQDB 4NMXB 5JNSA 1EUQA 4HN9A 3PXUA 4C14A 1XQ1A 5BP7A 3IDOA 2ECQA 2WHPA 3RRMA 1GRVA 4BV8A 3HRIA 1DWUA 5ALGA 3ZWBA 4R3NA 1G7SA 3JTEA 3FYDA 2I3ZA 3DTNA 5FPKA 5CDUA 1GY8A 1CUWA 2NO6A 1KZ7B 3VR4H 2MSDB 3ZK9A 3I4LA 1FUIA 2ZTVA 3WLQA 4A6EA 3DEZA 5CAEA 1A5SB 1JVNA 1XXHB 1Z15A 2AQIA 2DM6A 1W85B 3WZLA 3LT2A 5FWYA 3U61B 1EWTA 1N6PA 2DFDA 1ZH6A 2BFAA 3V3KA 3ZQ4A 4BRUA 4DA6A 4RH0A 2EL9A 4KKXB 4X90A 3VH1A 4I08A 1GSIA 4CMKA 2XAUA 1N8KA 1Q0RA 1UJBA 2JBHA 2NXEA 4E5KA 4P1ZA 3W8RA 5A03A 2H1OA 5B3AA 3J80A 5HNKA 4IUDS 4JN6B 3NKLA 2OXRA 2ANBA 1G41A 1XQWA 1A7UA 1JDZA 2UZ1A 2X1VA 1ZI9A 3SQWA 3FMIA 2ZCVA 2WJHA 3PGLA 2WLSA 4D9NA 3E5HA 4ZT5A 1PZMA 1Z5NA 1LY1A 1QGED 2W9XA 2ZZKA 3AJ8A 3TRIA 2E4YA 4KE9A 2P0EA 1YOVB 4PX2A 4QYIA 3IO5A 3MIIA 4MVJI 1N1MA 1YZUA 4RLHA 4DMRA 5M5BA 4EB8A 3NDPA 1SKYE 2HLDD 2F1JA 3AUFA 5T64A 3TGLA 4RELA 2ZRFA 4MS1B 4M88A 4DIDA 4D6YA 2B2NA 1B6RA 2JJ1D 1JU3A 3FHOA 4JD5A 5AHRA 4TYQA 3KEFA 2DP4E 3ID6C 4KWCA 4BO4A 3K9HA 3OLXA 3V46A 2B0JA 1WD7A 1Y9AA 5CA1A 1MEOA 2OTCA 2ZE8A 3BXGA 2WWFA 1H4TA 2J4CA 1PFQA 3KOWA 1PJBA 4AQYB 2G76A 1EVJA 1QYCA 3UMGA 4B43A 1Z37A 2PBFA 1BKSB 1Q7RA 3NXKA 5DFAA 2G9UA 3QVGA 2D5IA 2OM6A 4WE3A 3OU7A 4EQ6A 4CPDA 3AL2A 3OCVA 4QBIA 4EKEA 1XEWY 2JFBA 3VX3A 3DMDA 2I3AA 2HQSA 1XRJA 1N7HA 2HA5A 2CY0A 3QIAA 3EUWA 4IIJB 1T8RA 4XGQA 4L3WA 4M7PA 3RREA 1JTEA 1PR3A 4RF4A 4GSLA 4NG5A 2QL9A 4YXWD 1OFTA 2DPMA 4MCAA 5JXHA 1KJYA 3LUFA 1O03A 1E4OA 1E2JA 2YJZA 4XPZA 2RGWA 3WADA 3HJBA 3HCDA 4BNFA 2IXEA 4DHWA 3WGHA 1J8QA 4GPD1 2V5VA 4XYEA 3S55A 4F5DA 4WUVA 1ZK3A 1EUCA 3EZNA 2BY4A 3Q5EA 1W5SA 4I5GA 4Y2PA 3NIDB 5CURA 2FXIA 1NN1A 1BGWA 2ZRGA 2VEDA 3KYCB 4BMYA 4ZYVA 4P5EA 2WR8A 3EVFA 1CRZA 3PHHA 3KQVA 1BH6A 5DHQA 3C3YA 2P69A 4PANA 1PEAA 4RVOA 2RGNC 3MINB 2M6LA 1QK3A 2ZE6A 4ES6A 3K71B 4HBZA 4BXOB 3ZWAA 2PO5A 4HQFA 4EPVA 1UZUA 4ZHQB 1JYFA 2WZCA 3N2GB 4XIJA 3OZXA 4BVLA 2IHZA 4UCWA 4EG8A 5FPYA 1A50B 1YDHA 1MUUA 2I55A 4HFRA 4A5SA 1U02A 1T26A 1BDJA 3ZHUA 5ED0A 4C0HA 5JBIA 1LRLA 3FCEA 1PFVA 4OATA 4M1YA 3S81A 1R4MB 1SHJA 3EIWA 1SVMA 3IDQA 2W2KA 3QPCA 4WOKA 2WTEA 2HU2A 1Q50A 1U2SA 1P44A 3B7WA 1QKJA 3LOPA 1E3SA 3OZAA 4JZKA 5E9QA 4S1TA 4LHEA 2WZBA 3G9QA 1N6OA 5IJAA 3GMDA 3HDHA 3HWX1 5CIQA 2R8EA 1N2CB 1NXQA 4G3XA 1UH5A 2HJSA 1WPGA 4MK4A 3SOZA 5KTKA 1N6IA 1PD1A 2IJGX 4F93B 5JBNA 1AXGA 4W1PA 3ZHQA 1E77A 4Z3KA 4JWTA 4E1BA 5B1DA 4HFNA 4P3PA 4P3NA 2VQFB 1X77A 3Q1LA 3Q5DA 4RJLA 4X6YA 5A2QA 1NBHA 1NXSA 2JBAA 1RPJA 1G21B 3PRJA 1A2QA 2WYOA 3O3NB 4R9NA 3KX2A 3LI2A 5ALEA 3P32A 5KYXA 2P3OA 1ODJA 2XUQA 3R7WA 3PQEA 2NO7A 3A6LA 1RJ9A 1TCVA 3RVJA 4MV0A 1I6LA 5HF9A 2JIQA 1FS5A 1VPLA 1MF7A 1DS6A 1SCJA 5FPPA 3DP9A 1OZ0A 1RKXA 5AQEA 2YQZA 2NXWA 2PKWA 4KHPB 4CI0B 3T3IA 4CF7A 2WFLA 4YAFA 3I28A 1FJHA 1TCUA 5G1NA 2E89A 1LS6A 4XSHA 1YMUA 1K06A 4GYKA 1DXHA 3T7TA 4N7BA 5D5HA 3SQDA 1EZ4A 4MGYR 3UK2A 4BRZA 1RW4A 5FNVA 1R74A 4B80A 2R84A 1MBZA 3UJDA 1EP3B 2J5KA 4FE3A 2DR2A 4AY5A 2JI4A 4DSTA 3MMNA 1ZVQA 3PT9A 1NF9A 4RV5A 5C51B 1DCTA 3I30X 4BFLA 3QSGA 3OM0A 4WESA 2C99A 5TS2A 3CLTC 1TQDA 1X70A 1O87A 5BUQA 1XQ9A 2Q9AA 2EG5A 2VF8A 3ETDA 2EIHA 3LRPA 3PWKA 4A73A 4E7PA 2VHCA 3QLJA 2EYQA 1IULA 2GN6A 4GC9A 1HNXB 4B32A 4CMIA 1T9GS 1KE2A 4R2JA 3GJ4A 3ZE2B 2GM4A 3REOA 2NOAA 2VATA 4S3MA 1YULA 1IHPA 1VMEA 3M6LA 1IMJA 1G17A 2AV6A 1PWZA 1GPNA 1Y33E 1EFVA 2AK2A 3PLRA 4M1SA 5TQJA 3SICE 5B58C 4K9PA 4EGQA 1JEOA 1W5AA 1YRAA 2BDUA 2W2PA 3MLEA 3HEBA 2OCPA 2O3JA 2GOYA 3PF8A 3RFXA 4DAOA 5AK0A 3IBSA 3V8BA 3KALA 1G16A 5DISB 1P62B 4H9GA 4NFYA 4WXMA 3WFZA 3T5AA 4YPOA 1HWYA 3ANTA 1POWA 3HLKA 3U31A 1MAUA 3I8OA 3CINA 3TWOA 5C1OA 4WBXC 2ZSJA 3KR2A 4ENTA 2YWBA 5JDCC 2ESRA 2CWWA 3AKCA 1PUIA 5CX4A 3RB8A 3ZY4A 5A4JA 2TMYA 1P2UA 5B55A 5MN6A 5DTJA 1MXHA 2AE2A 4N12A 3TUZC 2FUKA 3Q85A 4ZO6A 2GXSA 3QITA 1M7HA 4MMZB 4DXAA 5KHOC 5HQTA 2JKYA 4XASA 2PG3A 5L40A 3ICWA 3WKEA 2XPCA 2GD0A 3UWMA 5B1EA 1XZEA 4FWIB 3VPSA 4EELA 2G04A 4RZUA 4EFDA 5B7NA 4QUAA 2BKLA 2C29D 1PV2A 2WF5A 1BRMA 4V24A 2XB9A 3VZBA 1OBHA 3L7CA 4GYJA 2XD9A 3UHAA 3DMTA 5K4HA 4F9TA 2W6QA 4BV9A 3NANA 2C2YA 5FV4A 1N7GA 1XA0A 2IUEA 3UHPA 4M0MA 3HCBA 2IUFA 4G1MB 4JCOA 1BDMA 3C41J 4WTOA 3PXEA 3S2EA 1DWQA 1H2AS 3LUJA 3TR5A 4RIFA 1D2EA 5LOVA 1TYAE 1AUPA 5KTOA 2DH6A 4G0PA 4GRAA 4KUEA 4QQ8A 1PS8A 2GBIA 3NIWA 2DWQA 3EVCA 3FNRA 2ZTMA 3B53X 4D41A 3LJKA 3THXA 1L7MA 3IGFA 3SQNA 3HN7A 5JD5A 1I1QB 1NXXA 2ZUSA 3CV3A 3EAGA 1QXSA 2ZT8A 3ESDA 3R7AA 3A2NA 1P7PA 3K09C 1XZIA 4X3PA 4MP8A 1DAIA 2QRQA 2XWPA 5IVDA 5CNIA 2PX8A 1GIAA 2VIIA 3ILSA 2XBMA 1GTJ1 3BJEA 3EXEA 3VKHA 1ZLXA 4AJPA 1CY0A 1R0KA 2N47A 1CP3A 1MKYA 1Y8AA 5ALIA 5AD1A 4O2RA 1KFKB 1RLOA 4ZODA 4F04A 1B6GA 2OBFA 2H2GA 4BP3A 4KWHA 4CN8A 5JWOA 2GZ3A 2EHJA 2VT7A 3K7EA 3JYOA 2Q3FA 2VJKA 2IEDA 3I9LA 3CX4A 3PVCA 4TTIA 4BKRA 3FH0A 5JAMA 2IZOA 4I1RA 4JL6A 2H08A 4DYVA 3UC9A 4YR9A 3AIOA 3M6WA 5BMVF 2O05A 5ERXA 4CGZA 3NOXA 4FMCB 5BUSA 1ZJWA 3VYSB 3ZEIA 2DWCA 2VVTA 5MF6A 1N34B 3NBZC 1Z29A 1EA5A 4PHHA 4NH0A 2I6UA 4RM2A 4V0OA 1JLRA 3GFRA 4TTJA 1MZVA 5HUJA 4W7SA 3FDIA 4UD2A 2NU6A 5IAJA 4JLAA 3PU6A 1QNFA 4HYQA 1VGRA 3A6KA 1QFXA 4R98A 1GV1A 3OT1B 3WIEA 3DEKA 3ZXUB 3ZU4A 4FMPA 3E7WA 4G6ZA 3U7GA 2HHLA 4D9HA 3ITKA 1XTSA 4V0KA 3NXSA 3GCWA 4BB6A 4AICA 4ILEA 1H93A 3AM4A 2P9EA 1RVDA 2ZJ8A 1ND5A 1N8TA 1OIVA 2ZR8A 1PG0A 2FMKA 3A3KA 1YKGA 4K3VA 4ZGWA 4IH4A 3CVOA 4DSAA 2HMUA 1I2BA 3GGJA 1EVZA 1MJFA 2FPOA 3A28A 4S04A 3W2EA 1ADBA 1UFRA 4YGXB 4Z0HO 1QGUA 4DABA 4CNQA 3K8QA 5FWXA 4G4GA 4EUEA 1PFKA 4ZI5A 1JWBB 1W4AA 3BEDA 1Z4QA 5FV7A 3HVIA 4DA0A 3M1IA 2QTZA 4AJ4A 4DIEA 3I83A 1XTKA 3UEOA 2ILVA 3K92A 4OXYA 1Z45A 4MGKR 3HBJA 3G2LA 3A9RA 1Y3FE 3KEGA 3PDJA 2PGNA 2EFHB 3D2CA 4KZPA 2IOFA 4QQNA 5ULLA 2FY8A 5F7JA 1F2VA 4XCVA 1RRFA 2Y0BA 3FUXA 3VTKA 5ES4B 2X2PA 1PSDA 1ZD2P 1X7WA 2Y0PA 3THWA 2O8FB 3MWLA 1BCSB 1ZDMA 5DYWA 2F8TA 3HUUA 3LC2O 4DFDA 4DJDC 5I01A 5A5FA 1W87A 1KJQA 3OQMA 4DEYA 2HAEA 5GJWC 1GSHA 4N0DA 1G5PA 1P0IA 3G9ZA 4WGFA 1BHJA 5IUNC 2BMAA 5C7LO 1PT6A 1ZUIA 3I6ZA 5EJ7A 2EX0A 4J03A 4FYXA 4DR2B 1VCIA 1THGA 2C5SA 4ARAA 3EIOA 4MV3A 3RS4A 3QBJA 1TM2A 4CQLB 3LBHA 5EKSA 1P5HA 1SKMA 1N2GA 1KMQA 5DHPA 3SIRA 4BLWA 2IH5A 2YWFA 1L8AA 2WKPA 3VI4B 3MLBA 3O8RA 1T3HA 3TF5A 4TMZA 2ONCA 3N53A 5CH5A 3E3MA 4AQ7A 4E3WA 5HKKA 5ITZB 2ZUVA 2QJRA 1HLPA 1GDTA 5TS3A 2CKMA 2YJNA 3WJ7A 2ECFA 2GVZC 2QNBA 3ZIAD 2FA9A 3NIGB 4JGGA 2JAQA 1U4OA 3KLPX 1Y3IA 4HUJA 3TZLA 5CXUA 4CL2A 4W5NA 4YO8A 4DDUA 3HI4A 3WP0A 2ZG6A 4J0HA 2DQKA 3GBVA 3UGJA 3CNQS 1H6AA 3H6HA 2BRUA 3H9CA 5WRFA 4BNYA 2QUJA 1X1QA 1JJFA 3OT1A 4GDFA 4JP2A 2GBCA 2VHTA 2AK3A 3J7TA 4Q03A 4RW0A 4UD6A 1XJ5A 4X92A 3NPAA 5BUZA 3IR6A 5DXFA 4Z0TA 1CDEA 3U60B 4B6GA 1X9GA 2EFJA 3LUHA 4LG1A 2R2AA 4O5AA 4RDHA 1U7OA 3ZU5A 1P9RA 4X41A 3Q7RA 4F3YA 1RQPA 2PMFA 2CBXA 1P7CA 2WFLB 3TNJA 2ZRNA 3RHSA 4B87A 5CD1A 4J3FA 1LZLA 4HEHA 1M8FA 2I8LA 1U81A 1MENA 2ACEA 1UZNA 1P4JA 2O2EA 3LWNA 4YCBA 3E9RA 3QX3A 3C4QA 4HGOA 1P1KA 1KDTA 1T36B 2A0FA 5DF1A 4PCVA 1CZRA 3D6HA 1XDSA 4YRQA 4R83A 4O2AA 1DQZA 1OROA 2KW5A 4X84A 5K09A 2WDPA 4OHMA 2BTOA 2QGZA 5C3MA 2V7TA 4RVCA 5EKXA 4UDYX 3L82B 5CA1F 3TAXA 1E7YA 1TC1A 3OP1A 4CG0A 3O2NA 4PGGA 2OXTA 4X1IB 5LZ9A 5M7EA 1QU2A 3PUVA 4UW9A 1AHIA 1FOEB 1RADA 1E5VA 2A9JA 2NZXA 3VBEA 4D82A 1WF3A 3O38A 3LV8A 2QTRA 1CIVA 3PR1A 2MSCB 4U2CA 5TJHA 1P2TA 1Z0JA 4BNNA 4CF6A 4C03A 2BGNA 5DBFA 3RIHA 1C7RA 1CZHA 2MHCA 2PRZA 3WK7A 5CITA 1R3UA 2UKDA 1GTL1 4NU8X 4V39A 7REQB 4EJMA 4F2DA 1UBMS 2JGRA 4ER0A 4DLRA 4OGFA 1X13A 1E6CA 2YWRA 2WMOB 5EPOA 2IL1A 3S2ZA 2AI1A 3BCRA 4JGIA 4MIYA 4DRZA 5AVZA 4K9MA 2FCAA 3GVIA 1ADCA 3QEMB 5DHTA 2HLNA 4KPUA 2L82A 1SN7A 1WB9A 1IIRA 3NP9A 5JG7A 1K0FA 1LRJA 1Z8HA 4G0OA 5K8UA 1IJBA 4MAAA 2NT3A 4MV4A 4BX9A 4ABTA 1E5QA 4P7JA 3FN4A 4QO8A 3RC2A 1R8QA 1T5HX 4DDTA 3VM6A 2B9VA 5FAXA 5A0VA 2P1RA 1MC1A 2ACWA 3OSZA 1IONA 2V6JA 4WY8A 3I0MA 3ZVRA 2FMHA 4E1VA 3OCUA 2PLWA 2I2FA 4NWIA 2P9CA 3OPYB 3ED1A 4BV2A 3LE8A 4EGCB 2BCGY 5EJ9A 3EG9B 1KO5A 3K2QA 4G36A 4HH1A 3SNHA 3TOSA 1G64A 2QM3A 5JQGA 2FJ0A 5CGQB 5ECWA 4NBVA 2P8SA 1UJNA 2VI5A 4N3AA 3H17A 2AFHA 4TYYA 2WM3A 2O2YA 4ZVLA 4F92B 4EMTA 4DR6B 1JRLA 1L5SA 1OGYA 2Z98A 3AW8A 4GXRA 4PZEA 1YQ9A 3K72B 1QE3A 3H9QA 3ED5A 4C2UA 3M4ZA 1CQZA 3IDAA 4KPYA 5CM9C 5EJAA 4QPNA 1L5LA 4MGZR 5FUYA 2FFJA 1WR8A 4K2HA 3R0QA 2M2IA 1CY1A 2PSHA 3EIFA 4MEJA 4MLZA 4DV0B 3D5TA 5SV2A 3DVAB 5FPQA 2FE1A 5CIWA 1Y6GA 4LTDA 4BMVA 3RRNA 2AGVA 4B3IA 3I23A 1SBYA 3EXHA 4JLBA 3DDWA 4OYLA 4EHLA 2HB6A 4F8YA 5EIFA 3IVRA 2HIGA 3NHYA 2YQ5A 2HQOA 2PIAA 3DGEC 1KMNA 1T4GA 5F9MA 4XIGS 3L92A 1R0WA 3EH1A 3R20A 4R9SA 4R5MA 1WV1A 3G3EA 4B8YA 1M75A 4PPYA 4CQJA 2C3PA 1LK5A 3CN7A 2XTAA 2XYGA 3Q10A 4OQ4A 3KQNA 4BWFB 4HP8A 4R16A 4CV2A 5CNJA 4U5XA 2GQ0A 2GBLA 3CR7A 1LVUA 4R0MA 4HDKB 1RE0A 3BDIA 1V37A 4DG5A 3C5VA 2IPXA 4NULA 3TRDA 1JQ5A 3Q40A 5D3MB 1BN6A 2WD9A 5TV2A 5KI6A 1GGFA 4IH9A 4XEUA 4CYMA 1GDHA 5B64A 1JALA 2X22A 1YFJA 4JA0A 1V25A 3PR3A 1IPHA 4B7AA 4NF2A 3T5DA 2JFVA 1Z62A 2JIPA 3IUEA 1L4YA 2WF6A 1XQYA 2JIOA 2X4GA 3D6VA 4UAUA 4XPIB 4ZVOA 1RXUA 3QTLA 5BVGA 3QE9Y 4HDNB 1GG2A 1T1JA 3IQGX 3G0HA 4F46A 3AW9A 3SF0A 3RGGA 3SZ3A 3R7DA 4ZCMA 1NMZA 2NXNA 3LLMA 4MJ7A 3A1VA 5I3ZA 3G2PA 4IDFA 2VCYA 4MS3A 5H70A 4YPVA 4AYWA 1LZKA 1F5NA 1GR0A 2R5FA 5LYJB 3VNUA 2BHLA 3LMKA 2HY7A 3EF1A 3LPDA 3AVVA 1MRNA 5BV1A 3SR4A 3PDIA 2HJGA 3O93A 1N8NA 4QUDA 4B44A 1UEXC 2DMRA 4G1EB 1I6KA 3KPUA 1UT6A 3ABRB 1F2TB 1JP7A 2CFIA 4YQEA 2UYQA 4WEOA 4OX9Y 5A4KA 5JD6A 2OV2A 2HSWA 3D7MA 3EIHA 4FONA 4K7JA 1FY2A 5HIAA 4OB6A 3TKLA 3DW1X 2H1LA 4NH4A 3P9ZA 5E6RA 3WWYA 3FB4A 4RZ2A 2DWUA 3QTBA 1SVLA 3QNWA 4MCJA 1Z4PX 1G63A 5D00A 3T35A 5BSGA 4Z7JA 1K86A 1WDLA 2I6QA 2GA8A 3GUZA 2XCOA 3OUTA 4YRTA 1U3CA 4FZ5A 5AIBA 5AVJA 2VHJA 3GNSA 3DWFA 3KQQA 4K40A 1K08A 1MZPA 2Q6KA 2BR5A 4FE4A 4LDPA 1GPH1 2VHVA 3DFMA 4N3NA 4XFJA 4QGFA 4O08A 3TDMA 3BTOA 4R05A 2IA5A 5GGYA 3RRYA 4WBSA 1FX0B 3BGDA 3IIEA 4FDLA 1D1PA 5DKFA 2WP8J 2X9NA 2J9XB 3F6PA 3QFRA 4OHFA 4U6NA 5DTMA 4WBNB 1G5QA 3ER9A 3UBMA 3ZV3A 1J1ZA 1G9TA 1N7JA 2FXVA 1Y98A 1TNDA 3A27A 4PE5B 2VQEB 1NNSA 3K9BA 1AHNA 3BFXA 4RTPA 4K1XA 3RAGA 4QVIA 4RVGA 1TK2A 2J5BA 4RZSA 4U9HS 3QVKA 1C7JA 3Q7PA 3SS7X 2AN1A 3DPUA 4MJLA 2ZITA 1SG0A 4UUBA 2EBFX 5GOTA 2DHDA 5DOZA 1K3FA 5AVKA 4RLQA 2ONYA 1IDOA 3OE5A 1ZXBA 5BSEA 3F49S 1YBMA 3S1AA 3WFJA 3RABA 3WHIA 4KHZA 4B17A 1SZPA 2EF1A 1PUJA 3R1IA 1QG4A 2JFQA 4J1TC 1U9ZA 4Q1AA 2QRZA 4ZQHA 1SCIA 1C0IA 4G5OA 1ULHA 1OLSA 2RAUA 5C31A 1CC1S 3BIJA 4ZK6A 5IT5A 1SKAA 3KQTA 4HAIA 3EQZA 2AR0A 2CXPA 5LLTA 2HCFA 2E6KA 5D51S 4BGUA 3I5YA 2Q8PA 3MUFA 3CLSC 3UJ3X 3I62A 1VCNA 2YV3A 4YCLA 3G8DA 1XKTA 4IUBS 5HRCA 2C7GA 2EOAA 3K70B 1BOFA 2FEMA 2QZ9A 5JDIC 5EWMB 1IZ0A 2XKJE 3DQQA 3LFUA 3TQFA 5C5EA 1QH0A 4A2QA 5FTLA 1CUGA 2A88A 3AL3A 4UTRA 4N5MA 2NT4A 1JLKA 5DIZA 3ZDXB 4C6HA 1D5WA 2Z8XA 4O4JF 1PGQA 5JE8A 3D3KA 1VXOA 3RIXA 1LI4A 1A0OA 4D81A 2ADMA 3KPYA 3COYA 1L5MA 2P7IA 1Z4NA 3U7JA 5TX7A 3MFYA 3VH3A 3OZRA 1TAQA 3EMVA 2Q1YA 1MT3A 3BQNB 1R5OA 3MB5A 4R1PA 2JLVA 2CXHA 2CCKA 4IWXA 3V6MA 3H2YA 1H0KA 4ZEVA 3UENA 2DETA 4K88A 4NYJR 1O6GA 5FOTA 1AQLA 1MFPA 2FRDA 1Q6ZA 2WJJA 3K9CA 4UZEA 3U81A 5LMCA 4J75A 4HXGA 3P9RA 3PV0A 3AESB 5CK4A 2Y1FA 4KVFA 4PPNA 1YXMA 3DXZA 1V5FA 2FF5A 3ZHRA 5ICEA 1P4RA 4WXRA 2BMJA 4YCJA 3IAM6 4PSCA 3Q88A 3FTPA 3KOYA 3UWSA 1MDFA 3FDJA 4CW7A 3O90A 3JQ6A 3WYEA 4C07A 4F2HA 4ZI7A 5AVXA 1ZH8A 3LLVA 4CTJA 1FLDA 2QJWA 2WIDA 2DTDA 2GEDA 1JEQA 1M76A 2GZRA 2QL5A 5E4TA 1Q0UA 3FPBA 1UBHS 1L0BA 1O94A 4I50B 1JBQA 4I4TB 3K9NA 4MQLA 1L4FA 2XKAA 3KXIA 5ELLA 3FVRA 3RADC 4WNAA 2SKCA 1HF3A 3TD6A 4C5BA 1TTHA 3EXFB 4V1CB 1P77A 4GWKA 1OT5A 1PT9A 2GVDC 2HBYA