3DE6X

Proteinase k by classical hanging drop method after the third step of high x-ray dose on esrf id23-1 beamline
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation stability of proteinase K crystals grown by LB nanotemplate method
pubmed doi rcsb
molecule tags Hydrolase
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3de6X00
3WIVA 3BX1A 3P5BA 2PKCA 4YN3A 1MEEA 5B1EA 4B5LA 5JXIA 1SCJA 2PWBA 1SUEA 3AJ8A 4MZDA 1BFUA 3F7OA 1T1GA 1SPBS 3DW3X 1PFGA 5JXJA 1AH2A 3GT3A 2SNIE 1SELA 2HPZA 1Y3DE 2Z30A 1S02A 4BWGA 4H6WA 3VSBA 1BJRE 3TI7A 3CNQS 2W2QA 3QTLA 2PYZA 1TMGE 2WUVA 4OMDA 1NLUA 1C9JA 1NDUA 2P4EA 4CFYA 2IXTA 1KE2A 1BE8A 3I37X 5AVJA 1BFKA 3VHQA 5JXHA 1S01A 3DE4X 1TM5E 4HVLA 3EDYA 2PQ2A 1ZVJA 3Q5GA 1AV7A 1YJBA 1KDZA 4AKTA 1EGQA 3GCWA 1Y33E 3EIFA 2QTWB 1WMEA 5I9SA 3VV3A 1PEKE 3AJ9A 1OT5A 2Z2XA 2W2PA 2ZRQA 1HT3A 1SCNE 3UNXA 1AVTA 4C3UA 4AKSA 2Z2ZA 2X8JA 4WOCA 2Z57A 5FBZA 1PTKA 2ZWPA 1WSDA 1R6VA 1TM3E 3DVSX 1TM4E 4RYDA 1YU6A 1Y3FE 2WV7A 2TECE 3VYVA 3F7MA 2GKOA 3DE5X 4C3VA 1BE6A 3D43A 3WHIA 5FAXA 1BH6A 4OV6B 3CO0S 1SCBA 1IC6A 2XRMA 1Y34E 1SUDA 1C9NA 2ID4A 1SCAA 1TK2A 3DWEX 1Y4AE 4KPGA 5ARBA 3DYBA 1SBNE 1GTG1 2DQKA 2IY9A 4GI3A 1KE1A 1MPTA 2Z2YA 3EE6A 2E1PA 4NE7A 2DP4E 3LPDA 3LPCA 4DWWA 3BPSA 1GA1A 5K7SA 3A3NA 4JP8A 3SICE 3QFHA 1P7WA 1R0RE 3ZXXA 1XF1A 3PTLA 1YJCA 1DBIA 4J94A 3A3PA 5JMOA 2SECE 1SBIA 5ARDA 1SIBE 1CNMA 3SQOA 4I0WB 3A3OA 1Q5PA 5AMXA 4ZOQI 1GCIA 1GNVA 5FFNA 3LPAA 1WMDA 2PWAA 1SIOA 3D9QX 1GT91 2SICE 5AVKA 3GCXA 3I30X 1T1IA 3DE1X 1SUPA 2W2OA 1PJ8A 1CSEE 2Z58A 1YJAA 2HD4A 3H42B 1JEAA 3QMPA 1Y48E 3DW1X 4ZARA 1P7VA 1Y9ZA 3VV2A 3LXUX 2Z56A 1WVMA 1GTL1 1SCDA 2ZWOA 4H6XA 2DUJA 1SUBA 4HX2A 1Y4DE 1Y3CE 2XTJA 1VSBA 3DDZX 4K8RB 3DE7X 3HJRA 1KDVA 1A2QA 3OSZA 3I2YX 1SN7A 1OYVA 2B6NA 1AU9A 1C3LA 5JXGA 4DZTA 4FONA 3T41A 1TM1E 1P8JA 4WOBA 1KDYA 1AQNA 1GA6A 2V8BA 1TO1E 1NDQA 3Q40A 3I34X 1V6CA 4DJ5X 3DE0X 4H6VA 3VTAA 2ST1A 1R64A 2WWTA 2ID8A 3AFGA 1V5IA 1DUIA 2PMWB 1LW6E 1THMA 1WMFA 3TI9A 1Y1KE 1TECE 3DE3X 3GT4A 4LVNA 1SUCA 5B1DA 4CG0A 2X8JB 4OMCA 2W2NA 4Z2AA 4CFZA 4M1ZA 1ST2A 1SBCA 2PRKA 3BGOS 3WQBA 1AK9A 3DE6X 1SIUA 3PRKE 1SUAA 2G4VA 1SH7A 1IAVA 1GTJ1 4NE9A 3TECE 3ZXYA 1ST3A 4NMXB 5ARCA 1SVNA 1SBTA 1AF4A 5AQEA 3L1KA 1ZVKA 1TM7E 3DE2X 4KG7A 1TO2E 3DVRX 4LVOA 1EA7A 5CW1A 1Y3BE 2WUWE 1GA4A 1T1EA 1GNSA 1OYOA 1SBHA 5SICE 3F49S 3WIUA 1C9MA 1S2NA 1UBNA 3DVQX 4KB5A 2W2MA 2SBTA
chains in the Genus database with same CATH superfamily
2FX5A 3WIVA 1FDVA 1GL9B 5ERXA 5A6VA 2PSSA 4AZ0B 2PZBA 4WERA 2XBMA 2JIDA 4OL0A 3BBLA 4OSPA 1PCXA 5A0FA 3ND8A 2Q1XA 1QO0D 2R8ZA 1TNDA 2IA5A 1CPYA 1W4RA 1W36B 1RYNA 2YV3A 4GRAA 2E48A 4WNYA 3I92A 1X6VA 1R4AA 2QZ4A 3T54A 3W5VA 4B6JA 4OX9Y 1EI9A 1I8TA 2I8LA 2NM0A 4HEA6 4H4CA 1MR3F 2CL6X 4E6EA 5K3FB 4QJ5A 4WJKB 1QQ6A 4CV3A 2ILTA 1XMXA 3AJEA 4YUZA 5A7FA 4WXYB 5JXIA 1YRAA 4AWAA 4KHZA 3MMPA 3HS3A 2PWBA 4YAGA 3C15C 3KWMA 2O48X 1P2VA 4NH0A 2XY4A 1M74A 1FRZA 3GZNA 3I0ZA 5GVRA 3ILHA 2G08A 5C8ZA 2J9FB 5F7OA 1SG9A 2G9RA 3IYLW 4BKQA 4BMDA 4CKYA 5L4SA 3BE8A 1PFVA 4W5TA 5FBVB 3RS4A 4OH1A 1VPTA 2XLCA 3PJEA 3PUKA 4GVPA 2Q3CA 5E4TA 2JD1A 1O7JA 4XLLA 1PAUA 2EFDB 1R0LA 3QLTA 4UZSA 4J3FA 2UXCB 4CEJA 3MS2A 4ZVOA 4EGAA 3VPFA 3PITA 1C1HA 1I6MA 1OXTA 1S3FA 2A0WA 2HV9A 2WLTA 5AW9A 3T0IA 4BGIA 1M33A 5KYWA 2QSYA 3EPJA 5EZYA 3RIXA 2IYVA 3KBBA 1IXZA 5B1SA 4E22A 2FHSA 1D5WA 2IYRA 4RQUA 2NTVA 1XZ8A 1JKMA 2OXCA 5CVDA 3IB6A 4YRZA 3EDRA 5TY0A 1JDJA 1SK9A 3DHVA 1DIOB 4CKEB 1IULA 4K6FA 1V48A 1WDMA 3L01A 1M8KA 4HR7A 3UHOA 3I3SR 4DLWA 5JD3A 4GUAA 3PDUA 2IEAA 1C9JA 1PX0A 1UM9B 2A2ZA 3WWCA 3BRQA 4ZJZA 1A9XB 1D6SA 1YZHA 4GEKA 3K0FB 2RG7A 1E1YA 1P1JA 4GO1A 1EJ6A 2PLRA 2YS7A 3O8RA 1Z75A 4XLTA 1NLYA 5E7IA 5CLFA 1FX0A 1IN4A 4H7EA 1OHHA 1TU0A 2WJJA 1CZNA 4EF4A 4ETWA 5JD6A 4NRDA 3AH8A 1RHJA 1TFUA 4UPDA 5ICMA 2GD6A 1HQYE 1O96A 1AUVA 4V2UA 5AVJA 1NFRA 2IZOA 3CNEA 2QU7A 1C8VB 2WR8A 4N65A 3ZJ5A 3RAEC 1PDVA 3ROFA 4Z0NA 1NSYA 5E9AA 1XPUA 1QCYA 2HIGA 4UASA 4Z8YA 3ZTYA 1KNXA 5KJEA 3DZBA 4A6EA 3H8JA 3LF2A 5CB4B 1M2WA 3SLRA 2PRJA 3L4EA 2CB0A 1T6BY 4E5SA 2XW6A 1ZD3A 1OGYA 3LCRA 3VSDA 2PUEA 2FPUA 4LC1A 4GPAA 4PHGA 1RIIA 2YBDA 3A70A 3FOWA 4LFAB 1ZVJA 1OX5A 1ZN2A 3PQ4A 3VJMA 1GL6A 1BJTA 3U1VA 1QC5A 1ODCA 5IARA 3VDXA 1CIVA 1SXJE 4MYTA 1QQAA 4LZWA 2XWPA 3IL2A 5H8WA 4F7DA 5IX8A 1JECA 4WZBE 1XNQB 4EMSA 1PLJA 1D8TA 2YQ4A 3G9UA 4HWTA 4II3A 4LJRA 3ZD8A 3ZX5A 2EKQA 2D54A 1KKUA 4QU0A 2Q9AA 5E6UA 2RH4A 4YAKA 3PSAA 1U9CA 1WS6A 1JFVA 3JWHA 1E2PA 3AF0A 3QELB 2Z3WA 1R88A 3NNNA 1DMRA 5B7GA 1EFLA 1LC0A 3VV3A 4DJTA 4EG5A 2ZJ7A 4BMSA 2CFRA 1QFZA 5ELXA 1W4LA 3GOQA 3MELA 1NBOA 3NYQA 4LS3A 5KKNB 3QMWA 4QAQA 5K0EA 4H7JA 5FOUA 1NOIA 2H1RA 1MVOA 1C50A 3K9NA 4MWTA 4EUSA 3FWNA 2XBLA 4AS1A 2O4UX 2VDRB 4LK3A 4RENA 1L8AA 1CV2A 3Q88A 4FN5A 1II8B 3ZU6A 4ZKDA 3PZBA 4M60A 2QX6A 4KQMA 3VDRA 4Z7QB 1S6YA 3I1YA 5AKYA 1Y1PA 2RHGB 1KVUA 2ODQA 3KUCA 3LRTA 1CWUA 5FB3A 2WWVD 4CODB 3HN7A 2DFNA 3IV7A 2HX1A 5CK5A 4CM3A 3K8QA 4TSRA 5B1YA 1O6GA 4R69A 2CJFA 4RELA 3S7TA 3VNAA 1Q7BA 1ISHA 5DYTA 1TM3E 5JI2E 2AMVA 1FUKA 5IJ9B 2JLZA 1C0PA 2VQSA 1QUFA 1ZZGA 2G06A 4N41A 2LW7A 2O3TA 4NC9A 2FRDA 2R6JA 3OHMA 5BWCA 4D4MA 2GKOA 3CZQA 5CG1A 5BQ5A 2R1ZA 1R3UA 3FFXA 1KIFA 3AG5A 4LC9A 5ALOA 3HO1A 1IN7A 3IJEB 3LBAA 3FY4A 3UWKA 2PS9A 3H2IA 3WOHA 4TVSA 4O1IA 3QSGA 4J7CA 3MGAA 4IQGA 2O20A 4EUNA 1M34A 2EJBA 2G9VA 3LKBA 1R18A 1H0KA 1U0OC 5DT2A 3SSMA 3T1VA 4LFBB 3U3JA 1MRZA 4KMSA 1VIVA 1YJ8A 4A0FA 4WN3A 4QU5A 5DM70 3LC7O 4QO8A 4TT3D 1RPNA 2DHEA 1OILA 5TARA 3M1IA 4FNAA 3L6OO 2ZIZA 5FA5A 2P3SA 3DKIA 5KTSA 1JT2A 4MMZB 4Y1RB 2I4OA 1M54A 4Q3CA 1WHTA 4N12A 2N1BA 4HN4B 1DTWA 2R7LA 2HXGA 2JCYA 3K1AB 3U48A 1RI3A 2JBAA 4Z0TA 2DBRA 3ZWBA 4M4SA 3TQTA 4A9AA 4EHDA 1NRIA 3WL5A 4BB9A 2IPAB 1XL1A 2H1VA 2Q5JA 2Q50A 3HGTA 2RHWA 1E98A 4OHBA 5JSHA 3NFRA 1FVFA 2QUBA 3A1TA 4Y7CA 1E9SA 5K45A 1P7PA 5AVSA 5FUQA 4I5DA 4J0HA 4UEQA 4QTXA 4X54A 3OAAD 3OQBA 4AW9A 4DMGA 5IZ4A 4TYMA 1LPOA 3RS7A 1NI4A 1BCRB 5DXFA 5ESDA 4NXMB 1FFBA 2J32A 2MYUA 5EJIA 2PUFA 3ZXXA 2DVMA 3ED1A 3UT6A 3WHKA 3IKTA 2PAAA 4G8JA 2YZ7A 2PVCA 2QLTA 3W5HA 1LK7A 2A14A 1VXOA 3O90A 4G37A 4PFKA 5F1OA 1UPAA 5B58C 1QVZA 2RHJA 5A0VA 2FPKA 3WNQA 4IGAA 2ECKA 4JYZA 2FZGA 1F6DA 2BCJQ 2IIBA 1GR1A 3RTEA 1HDXA 4ZT5A 5BYJA 2ZPAA 3C6QA 1FFAA 2OZPA 4QPCA 4Z2YA 3VYSB 1JEYA 2FEKA 3K3PA 2WWFA 1N36B 1K63A 3VU8A 2G4LA 3K0AB 3SQOA 3TSCA 5JC1A 2E4UA 4H6PA 3ZU5A 2HRZA 4CWAA 3I73A 1Z0IA 3E8XA 5HS4A 1O3YA 3K0HA 1WWKA 2YY7A 2W42A 3KQQA 1QAQA 2YWBA 3RG2A 2YC2C 1BN6A 1N6IA 1LBEA 3C98A 1BGVA 4OFXA 1R0XA 1OT3A 1SHKA 2UVPA 1CIJA 3K9QO 3FI0A 3GGCA 1JEDA 3CVVA 5AK0A 2EBHX 3JD4A 3NGLA 4KAFA 4S1VA 1E6MA 5BVGA 1Z2CA 2PZFA 1J9ZA 2H9IA 5J3JA 3LHKA 2HCTA 2P2ZA 2C8LA 2W83A 4FDTA 4YAWA 1P1BA 3M7IA 2BEVB 1B4DA 2MMGA 4TKVA 1B76A 1FMFA 1XVUA 3DUWA 4LJSA 2NTNA 2P5YA 3L7DA 3GI1A 3H9GA 3TM5A 3AHEA 3T0FA 1BMTA 2PMFA 1UDXA 4XOIA 2ZUCA 2LCQA 1QH1A 5IG2A 3L07A 2SCUA 2W0MA 3BFKA 5CX4A 1DV1A 3RPEA 4DWJA 5CK4A 1AF7A 2RARA 1PFKA 3EVFA 3RRBA 5HZHA 1D6JA 4ZARA 1WCXA 1P2GA 3M0EA 5CDUA 5HRUA 4KR7A 1RPAA 3WNCA 3HYTA 1KYWA 3V2UA 5JV5A 2G6BA 2VT7A 2CVZA 1PFYA 1Q0PA 2A5DA 2O2EA 1PZHA 1ZEJA 3PXAA 3ZGVA 1MOSA 2R6FA 4MQ5A 4NEQA 1T4GA 1U8ZA 5LM3A 1ZRNA 3L2OB 2ANCA 3OOEA 4UBMA 5DXAA 3RK1A 3G9ZA 4HQ0A 4M7OA 4RL4A 4YH1A 1T10A 2ASEA 3EC7A 4FINA 4ZGGA 4JFAA 1WZCA 1Z4PX 4NNJA 4ZT3A 4JI2B 2FRDC 3PDCA 3ABRB 5BN5A 3H1BA 1T6NA 1XTZA 3KVRA 3W6OA 2LCFA 1PFWA 1VJGA 2XV1A 3DE7X 4R2XA 2IW1A 4YVFA 3BGIA 3S1LA 1JIIA 1IBKB 1JLKA 2Y68A 3DS8A 3K9BA 1IOVA 1P91A 3A0UA 3DMDA 1FXUA 2ZAMA 5FBRB 3U3RA 4HDKB 3RJ5A 3UFBA 3DZIA 1A8QA 4XYEA 5DYGA 1QRUA 1H9AA 4KYIB 1KU0A 1WZIA 4RTQA 1O6FA 4C9BA 1I4TD 4MQUA 4JUBA 4O4IF 2CUKA 3HB0A 4BO9A 4YJFA 2JPDA 1QIFA 2CD7A 1HDRA 2PS1A 4I9NA 4E5YA 5JXGA 1ZK1A 1G2QA 1AO3A 4RVSA 2FDXA 4AMUA 4PPGA 4KHPB 2GKSA 2ZYVX 1CXZA 4HK4A 3U0BA 1PJLA 3AEKA 5EERA 5KSYA 3KRTA 1Z28A 4Q3OA 1R0KA 4QVGA 5BSHA 2VSFA 1UKVY 1YDHA 1TIBA 3MJTA 4HDAA 4BDSA 2D1FA 3HZOA 1DARA 1US8A 2C96A 2VBFA 5HBRA 5I5GA 1ZJ5A 1KY3A 1PEYA 5KNCD 4M99A 3ROPA 1NL3A 1USIA 3VZRA 5LQAA 2G71A 4CMCA 1AHPA 2G80A 1G59A 4JR2A 1Z6GA 3T7IA 3O74A 2OCAA 3MINA 2ZCVA 2B1IA 4FFMA 2RFLA 4OHUA 2J0UA 1U7PA 2XWQA 2ZUWA 1G3IA 2XWSA 1T8SA 3C7DB 1QH8A 4MVJH 2CBZA 3SSOA 5HUHA 3KJZA 4EJ0A 3UT5A 4P5EA 1V7PC 2LP4Y 2DHCA 4JENA 4MVJG 3RUIA 4P31A 4BVJA 3CCFA 3QEMB 4HBZA 5AVXA 3NATA 4QELA 4L3OA 3HKCA 2HRBA 5ES3A 2CL7X 2H08A 3TO5A 4CKXA 1TZCA 2XB2A 1DXQA 3ML1A 3AY0A 4RXMA 3H1EA 3GH1A 5COBA 4GMFA 5JSYA 3U4AA 1M1YA 1DKRA 3FM9A 3VC3A 3PF9A 5B12A 2X7JA 1PWYE 1Q95A 1EESA 2O3UA 1FVHA 1BEUB 5FUVA 2FF5A 1CJCA 3QVWA 4FCWA 4BKRA 1I9CA 4KJZA 2CC2A 5DW3A 3DDUA 1GYPA 4F06A 3UW3A 2QAGA 3E7DA 5TQ2A 1ECJA 1XKXA 1UP6A 3Q6IA 1MXHA 2F48A 3B6KA 4G1MB 1KS9A 5CT9A 2FSHA 2C2BA 1GFIA 1H2XA 1NR1A 2CB9A 2ZI6A 3D8UA 1N2BA 5I7AA 1DUVG 4AZTA 3P2JA 4QYIB 4PGGA 2EP7A 3V3TA 4E94A 1JHVA 3IT2A 3O8OA 4RS4A 3UMGA 1C3OB 2WF8A 3QG5A 3U7GA 1QP0A 3CH6A 4G0XA 3F46A 2OPBA 2ZJBA 1WCIA 3EF3A 2BGKA 1TAGA 4M1SA 1UBKS 1QO9A 4DEXA 1NVUQ 4YA6A 3BDVA 1HBJA 1NBMD 2WKQA 3JQ6A 3L7YA 4UM9D 3ON5A 3FUVA 2FN3A 2Z5GA 3AVTA 1R3DA 3FLAA 1E6LA 3IODA 4IUYA 4Q3LA 3NO4A 1G41A 3OZSA 2JJQA 3NU1A 4CQLB 4CR6A 1Z6YA 3UJBA 1W87A 2JAQA 3EDCA 3BJRA 4ALLA 2D1YA 5MGBA 4EO7A 1RW4A 2WD7B 4IJMA 4RCYA 4WKCA 3V7FA 4MR8B 3DWIA 1TRKA 2GJ4A 3LOUA 4ZQEA 4NE9A 3B7PA 5EKXA 4DCTA 4B3RB 3TZLA 1KI6A 1U0SY 4F3KA 4KYVA 3W5AA 4EB6B 3NEYA 4KPEC 4RZIA 2IYWA 3C74A 1G2IA 4CKWB 5I9NA 3T7RA 1WTAA 3TTTA 1SBTA 1ZH6A 3WKAA 2H52A 3H5TA 1PTJA 2R66A 3L1KA 4UPVA 5FA6A 2BV3A 1NIPA 1TM7E 3VQTA 4NARA 1FNCA 1H5QA 1U5CA 1AT1A 1T9ZA 3D4IA 4C78A 4C7MA 1LBTA 2BFPA 2NTEA 3DR5A 5A4DA 1JE0A 1VMDA 2GD2A 2DT8A 1YE5A 5DEIA 1C4WA 2FHPA 2I4RA 3B8HA 5CW1A 2DPHA 3ABIA 1IJKA 3GQVA 2VLBA 1GGVA 2V1XA 1GA4A 2JB9A 1BA3A 2IODA 3AIMA 4OLHA 5A71A 2G88A 1T3GA 2V55B 1FEZA 2JK0A 5AM2A 5DTQA 3CW9A 3GDGA 3A6KA 4X7PA 2FMTA 2VA9A 1Z22A 2VNHA 3G1TA 3LVRE 2WPDA 1K9VF 3AVWA 2P68A 2PA0A 3HVJA 2W0SA 3AERA 1DRKA 2WOOA 1VLLA 5G4LA 1W5TA 4AURA 4DPMA 4E2ZA 2A57A 3HDTA 4J8PA 4XPIB 3E82A 4IIXA 2NYAA 2JFQA 5TJ9A 3OZVA 1E1MA 4QLAA 1DG1G 2QRHA 4WFKA 3DVQX 2EHDA 4URHA 4YJGB 1IEQA 4QHTA 3GAAA 3HJHA 4TQAA 4ARVA 1XZHA 1W2WB 1J0BA 1UBHS 1AZTA 3LCCA 2ADMA 4IWYA 5ELLA 3MXTA 3T61A 1WW3A 3QVMA 5BOVA 3VTKA 3AF5A 4JXZA 1YL5A 4TROA 3PVCA 2BIFA 2BTEA 3QWIA 1TK9A 1TW3A 2SKDA 1EUCA 1GG8A 3JQCA 1D3AA 1VG9B 2QMUA 1F8XA 4FX5A 4UHHA 5TT1A 1MEEA 4G4JA 2RSLA 1K4MA 1LI7A 2Q4EA 6GPBA 1EMDA 2VYVA 1RRVA 2GN0A 3F8WA 1JDBC 5BNWA 5AW8A 2E4VA 3RS3A 2OXEA 1E3SA 1LPBB 4YAOA 3U7JA 1ZY2A 2Q8NA 4K9SA 3ZQKA 2AN9A 2H9YA 3IR6A 1F60A 3OM8A 1B1CA 1YQWA 1ZXLA 2GD1O 2UZ0A 1JR3D 1BEEA 4HNUA 4I1UA 2Z8ZA 1N33B 1YKFA 4FSDA 4ZIRA 1IXSB 1KHTA 1KJ9A 2VSYA 3AYZB 3RREA 3ZDDA 2IF2A 4GLBA 4AF8A 4CMEA 3DEYX 4RSMA 4K87A 1CS0A 3HSKA 4G8DA 5AW5A 4X41A 1DC5A 2XH8A 3IAAA 3TJZA 1OHHD 4BBAA 5BV1A 3EGDA 2WJHA 3VC2A 1ZCBA 4LDJA 3UOAB 3KZKA 4UE3S 3TLGB 2JZOA 2ASVA 2QRGA 3CN7A 3KHUA 3O92A 4C07A 3E7FA 3U61B 1OJ7A 3ZEIA 2PBFA 1E5DA 2QAGC 5JRZA 1PUXA 1I32A 1S02A 5GP1A 3RIEA 5K3SA 3ETEA 4PR3A 5TMEA 1HE2A 4B09A 4WDQA 2CV2A 2CLFB 2MSCB 3CSUA 4Q3EA 5DZSA 2B2XA 4GECA 1BH2A 2ORVA 3A2NA 4H60A 4IFIA 4NCHA 4S2EA 4UHJA 2PX2A 4EA9A 1KP3A 2BJHA 3NC4A 2W2QA 2ZIWB 4BV3A 2PYZA 4DJAA 1NBME 3HH8A 4TMYA 3KE8A 1IRXA 1VFPA 4LJAA 3A32A 5F7JA 4FE4A 2BLLA 1NDUA 3SM3A 4O25A 3Q8XB 3P8ZA 3PLRA 1CCWA 3I5UA 3ZV7A 2NPFA 4RTRA 3QIAA 1GWNA 5K03A 1TCUA 1KAGA 2C03A 3CINA 2H2IA 3EZLA 3HA5A 1LB1B 3I04A 3JWIA 1Z5GA 2IH5A 1WXHA 5LB2A 5G3ZA 3SLKA 1AMNA 4QQ8A 3AR4A 3I01A 3Q9LA 4JLVA 4RWZA 3QWAA 1ZLXA 5AJYA 3V8PA 4B80A 4IDOA 4G67A 1E3WB 4JIMA 3K0BA 3U4QB 1DJMA 4JFRA 2Q4DA 4RLFA 1YNOA 2FWAA 3H4MA 4C4RA 1KL7A 3TW6A 1IDOA 4WLFA 1P2TA 2YUTA 3JPYA 3QKTA 5IC4A 2W98A 1FBNA 3T1OA 4PN7A 1M6EX 2I2DA 3DT9A 4ILEA 3P9NA 1C7ZA 3BIFA 4JT8A 2FQQA 1PTJC 2FEXA 1P9LA 2QR2A 5CIQA 2EFJA 4Q4LA 5DH9A 5A3VA 3IMFA 1YH3A 5ALXA 3P9KA 4KITB 1DFGA 1W4AA 3ZV4A 2G8NA 1G18A 3I5MA 1DSSG 3R2JA 4OAPA 5LZ7A 2ENWA 1M9NA 2YIVX 1PJSA 2W58A 3C4JA 3TZCA 3TRFA 4QQRA 4WSOA 3PHLA 3H2KA 4QO7A 5FX2A 1AV7A 3ET5A 3OUUA 3IEXA 4FWBA 2WT4A 1D8AA 2VYQA 1W5AA 2D5CA 3GLFB 1NP3A 3LQYA 5AKHA 5E7MA 4EHKA 4BNDA 1A27A 2HHAA 3LS2A 2Z83A 1VG8A 1H93A 2ZKLA 3QPUA 4NBVA 5EXDA 4D79A 1OWOA 1UZNA 4X9XA 1KC1A 3EIFA 1YMVA 2PX5A 4BVEA 1KGDA 1IHPA 2X2PA 1GKUB 2B8JA 5AKKA 3ZUPA 3CIFA 3NDJA 3PR3A 2DHDA 4CXMA 1U2ZA 4Q7LA 1FNBA 1XZBA 1ZNYA 2OZVA 1J56A 1Z5UA 1L4KA 1XD2B 2VQDA 3A4NA 4KXUA 2XF2A 1B43A 2B0JA 4GGPA 5CJ2A 5F73A 2GHIA 1SVLA 1XTUA 3S99A 3CG0A 4O2AA 4JOSA 3TXYA 1Z7EA 5MN4A 2XZTA 3PJFA 3TAXA 4DDWA 1YSCA 3A04A 2AKYA 3WYEA 1IWBB 1L8XA 3GLUA 3UNXA 3VJKA 4MIOA 4D3YA 1O97C 5ER6A 5KO2A 1FFXB 2YY6A 4UZFA 1TW2A 4JVMA 3VKVA 3R7DA 2X4IA 4F72A 4LTDA 4TLCA 3K31A 5FBZA 4RAQA 5JE8A 1YUMA 4I8XA 4R7GA 3A31A 4GQAA 1S2IA 3ABSB 4JGGA 3ENWA 3KT0A 4NCXA 5DO9A 4D9CA 5A6SB 1IAQA 1NYLA 3S28A 3WDMA 4HAYA 5BPFA 1NLZA 2HA0A 3CT4A 1L4UA 1SHLA 4H3KB 3G6KA 2V0CA 4QDXA 3LUKA 3VM6A 1F2UA 1W2GA 2Z8YM 1OD6A 3SYKA 2X42A 4ZN6A 7YASA 4HDSA 1V1MA 2AR9A 3A6LA 2TECE 3O3OB 3TLJA 2ESRA 4DMHA 1UXKA 5DF1A 4ARSA 4CMEC 4E6PA 3MF4A 3OURA 3T9BA 5I45A 5JRJA 4IIHA 4JC4A 4F56A 3KLMX 2WNSA 4YUWA 4OOEA 2GTIA 1YTUA 4BUJA 1AB6A 3K0SA 3TIXB 3BQMB 2L2QA 3ESXA 3BJEA 4JB2A 4LJ8A 3L6RA 5AVZA 1EK5A 1QCCA 5IHPA 1O0SA 4E14A 3CZ4A 1T3HA 2FN9A 4RD2A 4C30A 4B3FX 1G21A 1IC6A 1N2XA 2ZE7A 2ZI4A 3E9NA 3O8QA 4CCYB 3QVGA 5KMGA 3PI7A 4WK4B 2XCUA 1C9NA 1XIVA 5I9BA 4L5AA 4ZHQF 1Z73A 3EIEA 5KAMA 2F3UA 3T9DA 5C35A 2QTRA 3C1TA 3V2GA 1E6KA 5AIBA 3USZA 1R1DA 1GTG1 2AUTA 3J81A 2NYVA 3FHJA 4F85A 2HMAA 1QGYA 2ZSAA 2QUJA 1MF7A 1UDRA 4OATA 4L51A 3D3QA 1J97A 1E0KA 2M1XA 2ZSDA 4P9NA 3VU9B 4F9TA 5AVRA 4RULA 2NZ8A 1O94A 2FJUA 2HUNA 2VP2A 3Q7IA 4NE7A 4DR6B 3HJUA 3JVIA 2YCLA 3QP9A 4ZV7A 1KJYA 3S7ZA 2Y77A 2HMTA 1A5TA 2VTKA 4I55F 4LF5B 5C7OO 1P5FA 2F17A 2FWRA 2H2WA 4BCBA 4YCCA 2WA2A 2ZYSA 1VCHA 4YQZA 1JB1A 1ZGGA 3FSRA 2HA2A 3LBIA 3T06B 1P7WA 2IU3A 2CK3A 4GMGA 3WKBA 3AF6A 1AS3A 2L69A 2I66A 3M3HA 5CNMA 3OTGA 2MYPA 4BMOB 3RS8A 2ZRLA 4JK3A 3E18A 2ACKA 3DFZA 3PE6A 5CVJA 3ZZTA 4S05A 3AM3A 4UQOA 1X14A 4G0QA 5FEUA 1JQBA 1YD7A 2FPPA 1T1RA 3KHSA 3M4ZA 4FGKA 4MA5A 4MKGA 5EHGA 3DBRB 1Q3KA 3EGXB 4P3NA 1BKDR 1JV2B 4FNOA 1JLHA 3TRDA 3E70C 4F2DA 2RHDA 4CL2A 3A3OA 2CYCA 1X7ZB 2QWXA 4B76A 3I62A 1QHHA 3SFTA 2EKLA 4KUHA 1EJBA 1UBJS 2CDBA 3GJ8A 3HYRA 2QR3A 4ITUA 4J43A 4O2BF 2OBLA 4REQA 3PENA 2B0CA 2EFCB 4XIIA 1VSQA 4FSHA 3LGSA 3L0CA 1MLDA 3P4XA 3EVAA 3RUHA 1ZD4A 1BX0A 1KYIA 1HZJA 1ZPDA 3EMKA 3FHCB 3HG7A 5FFNA 5FOWA 4O4IB 4XAQA 1GT91 4MKHA 1VIMA 2O50A 4FW9A 4KU4A 3I6YA 4WN9A 3B70A 1QYRA 3TRIA 4MI3A 3ANTA 5FF9A 4UEJA 1V96A 1W73A 3HJCA 3U26A 2X5XA 4V0RA 3K8OE 3TLMA 4TZ0A 1RXIA 1RWQA 3SBOA 2O5CA 2O2YA 5DHAA 2CCGA 1JEEA 1KAEA 2FLWA 2G28A 1M34E 3GJ4A 2ZUFA 5KINB 2PIDA 5EE3A 4MUJA 3F7NA 4YWJA 1ODKA 2MSKA 1P2FA 5KCMA 2VNAA 5ITVA 4WTOA 1KYVA 1EK6A 4PFQA 5G1OA 4CTJA 4DC9A 4JCCA 1EUZA 1ML4A 3R3YA 2DLNA 4F5WA 3EIQA 1GTRA 2OORA 2GYVA 3IAHA 2HJRA 2P69A 2P9BA 4AJNA 3O2NA 3O82A 1QU3A 3FNIA 2JDIA 2ZUUA 2V6FA 4RYLA 4F5ZA 4PAGA 4ATNA 1GFSA 1QWSA 4B40A 1G5TA 3CGGA 3KVYA 3I9OA 4ERXA 3NKVA 5AK5A 4KPYA 1TEHA 4M0CA 3IJ5A 4DV2B 2AFRA 3VAAA 4LV5B 1D04A 1RWBA 1E7RA 3GFPA 3UENA 4E4RA 1BDHA 4QKQA 1RPJA 1VB3A 1TZBA 4MV3A 2F00A 5AOVA 2JANA 3IPRA 2OCIA 4H6XA 2Q5FA 1NM5A 3PVSA 2FYTA 4HAXA 5AOBA 5EA2A 1Q1ZA 1KPIA 2V7TA 2NZJA 2OV2A 1A1VA 1ATZA 3ZI0A 4YP0A 4Y1FA 1RLMA 3V8VA 1NMEA 2BRUA 3ENNA 1NTRA 2D5AA 2WMOB 3LLVA 5IUJC 4BC1A 2QBYA 3DZJA 3GEBA 3ZXUB 1E2QA 2AFHA 3NLLA 4G5OA 5FOTA 4B6GA 5CIWA 2IHZA 2JHCA 3HYNA 3ZCTA 4HYTA 3CH5A 4GWGA 2GFHA 2HSJA 2II6A 4DCOA 3B6ZA 2V5VA 1XI2A 3F90A 4JVLA 1W9HA 4KV7A 4YRRA 3R1IA 3OSZA 4MO9A 3Q9SA 1WDLA 4NPHA 4UTPA 3ZD6A 3OTHA 4Q48A 2HV8A 2GLTA 2F4VB 3WLMA 1NP6A 2AZMA 2YYZA 3O91A 3PUYA 3GXOA 4PZDA 2O2HA 4DZTA 1ZAYA 2R7AA 2VZ8A 3V1YA 2XKJE 4TN5A 1KF0A 1TM1E 2GA9A 2JHPA 1MO5A 4MP3A 3OPYA 4U2BA 4X64B 2GAJA 1A8IA 4W5QA 4AY6A 3D0OA 3STXA 4BRSA 1G42A 5EL0A 1NFFA 4KUGA 4NCNA 3W5JA 4D9FA 5A4AA 4KXMA 3T95A 3GLHB 4RZHA 3KZOA 1O94C 3Q40A 1SU8A 4PCAA 3TSZA 2OSVA 4Q03A 1PK8A 3G8YA 5DNWA 3G13A 3I9V1 1VPWA 1ARZA 1LNSA 2R6CA 3DO5A 5CCDA 5ITZB 3R5JA 4G24A 4BQSA 3QM1A 3EEBA 3IVGA 2R47A 1YBMA 2JJ1A 3F2IA 2LD4A 2OO5A 2C00A 4BKPA 4PIPA 5IN4A 4PYJA 3EG9B 1U7UA 1H2YA 2X5KO 4CLOA 3I2JA 5BURA 2P9TA 1XWFA 1YCFA 5K8VA 1T13A 4E5UA 4YRJA 3KYBA 1RHRA 1PHPA 5HQTA 1CR1A 2PGXA 1GGMA 3DBLB 4RCZA 4EARA 3KPYA 5JW6A 1JNXX 1U1FA 1L8LA 3WLEA 2VS1A 1EVEA 3UW1A 2PJUA 4RFSA 4HRVA 3RVRA 3MT9A 4A26A 3LIIA 4F11A 4XFJA 4NENB 1WMFA 1J00A 1YS7A 5IAAA 3TBKA 3U39A 3K9FC 5JUWA 3KB2A 4WIAA 2A67A 4WH0A 3F4KA 2IZ0A 3F6RA 2D2FA 1Y1KE 3U31A 4EL5A 4FFWA 2NAPA 4LVNA 4F2PA 4YNBA 3T5BA 3WO1A 1KRHA 3REGA 4A92A 4H1UA 5AP9A 3G49A 2W2NA 1DTEA 1O95A 1Y3HA 2ZR9A 4ID9A 1UDWA 4UE2A 5ALHA 1NV8A 5DGDA 2VF5X 2WJ4A 1KVQA 5IVIA 1SKYE 2OK8A 3N53A 3INYA 4NOKA 4XVRA 1DZIA 2R62A 1IBMB 2EXXA 4G9GA 2PUGA 1A0OA 2JRCA 2VAXA 3D6JA 3FCAA 4DKXA 3UHJA 4L73A 3KTDA 2IXGA 3COJA 4Q1EA 4N82A 2I6TA 2RHMA 3DOHA 4FYPA 2IP4A 5DCWA 3ZJ4A 4CRWB 1I13A 2OQRA 2YC4C 3PHGA 1CB7A 4BFVA 1DLJA 1N0UA 1VL2A 1Z3IX 3ZHZA 4CHGA 4JXXA 2EZ4A 1VA4A 2QE7A 3RWOA 3UWPA 4C4AA 1IB6A 3OX2A 5GY7A 5HGXA 2OORC 4HB0A 4V0NA 3VOTA 5DNUA 3GFFA 2WPDD 2AN3A 2F67A 2OMEA 2NUAB 1H5UA 2HLPA 4KQWA 3WVNA 3DMTA 2JFNA 1I5OA 1RJWA 5JTTA 3UGKA 2D0DA 4YJ2F 1C7EA 2C9BA 3B6EA 4FBMA 3PDJA 3KU1A 5AKIA 1D2MA 1GCOA 1ST3A 2JIBA 3KV3O 1XJCA 4OJQA 4C2TA 2R8PA 2P4HX 1A9YA 3WJ2A 1CJUC 3LVFO 1PR4A 3QF4B 3ORHA 3MD9A 1NM5C 2OG2A 4PHHA 5FTNA 1XYVA 3RS5A 2JIOA 1W1UA 2VFAA 4ZAYA 4GL2A 3D4BA 4FDAA 4MWZA 2OAP1 4PLYA 4YI5A 4DSUA 3GUVA 4ZJPA 5F7XA 5J2TA 1D2NA 3RT1A 2F90A 2BRUC 1EA7A 1O97D 1HRKA 4QOGA 2XYQA 5A2QA 3BGVA 3ASZA 1Q14A 3HU1A 2VYVD 2CHEA 2FEOA 5SY4A 4BZWA 4R1MA 4QU8A 1E59A 1R6UA 5CA1A 3QUCA 4H7FA 4J2HA 4M7RA 2IYSA 3GUUA 3CSSA 3CUTA 4FGJA 2J45A 3C3WA 4I50F 2OYSA 4AM8A 2KLHA 2WHPB 3ETHA 2IE8A 3Q5DA 1M1YE 4KMRA 4LOLA 1Y8AA 2TMDA 3JD3A 4MQEB 3N59A 4KH0A 3OQJA 5E3HA 3W4JA 1MJGM 3ZLUA 4RPGA 3MUEA 1YIDA 1ZJYA 1RRCA 3CC8A 3H84A 3ISTA 1TTHA 4JL6A 4OXRA 4QBTA 2SBTA 3I42A 4YPOA 2IEYA 4TWZA 4LNHA 2C0QA 4JLDA 5JVDF 3HM2A 3U1BA 2BKEA 4J3JA 1GGHA 3FAKA 1V25A 4I1IA 4DUZB 2VRNA 2I4NA 1UKBA 4GM4A 4Q9DA 2BF7A 3SQDA 4BU0A 1XPRA 4F86A 1KYQA 4ENSA 2R8EA 5LKRA 4L3VA 1UMDB 1RBQA 1JYEA 3NWPA 4PC2A 5KNDH 3FJOA 3W06A 3UTCA 3MJHA 4YDHB 4U9IS 4TLBA 5FDFA 1TZMA 1GZHB 1WCWA 3F6SA 3PNYA 2OO5C 2CLEB 5CXUA 4QYTA 1WE2A 1G5RA 2QUKA 3PA8A 4JLPA 3LFTA 5D3MA 3TKLA 1W52X 4EYQA 2ZJYA 5F23A 2V0NA 3LXXA 4P4TA 1I7LA 4EX6A 4ZO6A 3A4VA 3ND5A 2JCGA 5ETJA 3HP7A 3EJ6A 4M86A 2WA1A 4MA0A 1GT6A 5D3ZA 4B3HA 4EYGA 5B53A 4GOND 1U4SA 2E49A 5LU9A 1PT5A 2GB4A 2VHVA 4E03A 4ZFNA 3I0MA 5JFGA 3GL9A 1OZHA 4YACA 3U4DA 1XZIA 2P35A 3KE9A 5HCNA 4O29A 1NJFA 3DWGA 3JWGA 3TEJA 3DM9B 4BNWA 3EUFA 1D0SA 1P60A 2HPZA 4HQRA 3VC1A 3ZK9A 2JJ8A 4KN6A 4ZPJA 2LRHA 4L4ZA 3V1TC 4EITA 2V7QA 4ON9A 4QPNA 3D7MA 3OU2A 3C3BA 4UUMA 5HJEA 3EB9A 3IALA 1KU6A 2LKCA 2WKSA 4QEZA 3RFFA 1R5NA 3TR0A 3DZDA 3QSYA 3IH5A 2AFIB 1O95C 3RC8A 1JSXA 2P9ZA 4W63A 4E1AA 4QOJA 1YDWA 4X1YA 2W2LA 3E7WA 1WQ3A 2ORYA 4L2IA 3FUWA 3QENA 2ADOA 3CW2A 4JR1A 3WQHA 3K70D 4MRMA 2ZBDA 3IIMA 2F3PA 3DDCA 2FSGA 5IDQA 5IYZF 2E4XA 1Y5NA 3C41J 2DR3A 4JEMA 4XDZA 2ZYDA 5F76A 3WYCA 3IQXA 4MZXA 2R48A 3JALB 3TOZA 4TV8F 1QP4A 3H18A 4Y0NA 4KX3A 1F3LA 4YLYA 4BZPA 1MEOA 4HNRA 3LY7A 4E70A 5ICGA 5ADUS 3MJCA 4BLRA 4QUDA 5LIPA 2H1OA 4ITVA 1EWRA 3NH9A 3WGZA 4BXOB 2A0KA 3DMTC 5DOZA 3FUTA 2JGKA 4OGKA 1EFKA 5KJFA 4LRSB 5KS2A 5ALDA 1RHQA 3ONEA 1U6IA 1F1BA 3AOEA 3OD5A 4IV0A 4KPUB 4NZOA 1V5GA 4KNYA 1SVMA 5EJGA 3MZ0A 3HJFA 4RD1A 2WVAA 3ZDBA 4OVKA 4HQKA 4NZ9A 1ZIPA 1F6WA 2AOXA 4F4JA 2MINB 4H0NA 3O5AA 4RVGA 2D2VA 3O21A 4AFNA 1SU6A 2H1HA 3CF6R 2FMHA 3ZCVA 3DVLA 1Z83A 2VJBA 2QRMA 3LT0A 5DPMA 1X8XA 2OCBA 2R6DA 4L6IA 2AG1A 4ZOCA 1RMYA 3TE7A 4DUYB 4MLDA 1Y6FA 2WMDA 4EKIA 3O8BA 2DRIA 3PDIA 4BAGA 3DBHB 1WMAA 3UMRA 5KQPA 1NHGA 3HXKA 1VG1A 3M5DA 2Q4BA 3KVVA 4G89A 4FT2A 1VLHA 1XRNA 4CTKA 2C92A 5H59A 1HEIA 2FR0A 1WUHS 2JIMA 3OJWA 4WOJA 1OE0A 4IXMA 3ND9A 5SY6A 3U7EB 1K5GA 3TW0A 4AI6A 2FPIA 4I5IA 4Y18A 1P3JA 4Y9SA 4WJZA 5FT9A 4GPD1 5E38A 4CL0A 4HGYA 2FWNA 4LCBA 4QJBA 3V9PA 4CV1A 3IHLA 5TQ0A 5GPBA 1Z8FA 4HQNA 2CF6A 2DAPA 4KNVA 1GCUA 1K08A 2R1UA 1PWEA 2O2XA 4HFJA 1H85A 6PFKA 3M1AA 4I55B 4YBRA 1Y9DA 4OA8A 2CZGA 2PWYA 3MMZA 2D7DA 3KNZA 1BDBA 5LDHA 2O8EB 3H8VA 1R8QA 5D7NA 2RAPA 3E84A 1VHDA 3MRSA 3BN3A 3LFUA 3SI7A 1HYGA 1EE9A 4ZCLA 3JYNA 1V5WA 1CEYA 1MP0A 5LN1A 2IY8A 1MAVA 4KMMA 4BNLA 1T9GS 5HF9A 3VKHA 4F5YA 1ISGA 1F0NA 1U0JA 4B33A 2GK6A 5KTPA 1AJEA 1AIPA 4M8IA 1R4NB 4XASA 3A37A 4I5EA 1Z5ZA 3FZGA 3EDMA 2F1KA 2A1IA 4KWIA 3VYVA 1WP4A 4DHWA 3G17A 3NOOA 2J31A 4DSZA 2EFYA 4MS4A 1A97A 3A9TA 1OI2A 1ZMTA 4M9UA 1Z45A 3VDQA 5JCXA 4C3VA 2H5LA 3QXCA 4ZC8A 1LV8A 1FOEB 2Y27A 2O3QA 3VR6A 1ONOA 3MRXA 5E7JA 1OAKA 3JATA 3QX9A 4WNIA 2YVQA 1G5IA 5DM2A 4EW6A 1ZQ1A 2CK3D 4DSAA 5H82A 1AG9A 2I62A 4TLAA 2HF2A 1KFKB 1CY6A 1N5RA 1FYEA 2WM9B 2PWZA 2VSXA 4UCWA 4BZZA 1XMQB 3IEKA 1KHHA 2QY9A 3CB4A 3OOYA 4X45A 4CDMA 1U3WA 5TIIA 4NYJR 1Z6QA 1H1LB 1N9ZA 2IYTA 4H0CA 4H7KA 2VDUE 4LIPD 5BNZA 1UKZA 5LSAA 2P90A 2HF9A 1YFJA 1JIKA 2DQZA 1XWIA 1C30A 2H85A 1CX9B 1N6NA 4RMIA 2HNBA 4O4HA 4Q6WA 1TTTA 2Z2YA 4TYYA 1OWLA 5CYPA 2XEXA 3HQ4O 3EGIA 3JW8A 1MRSA 1DO0A 4OL9A 1K4YA 2Q62A 3F2VA 2CWDA 3HCDA 4H3HB 4KQ9A 4ZCQA 4ZMRA 1T9GR 3GLVA 1PZMA 2GZSA 3T5MA 2DETA 3BE5A 2H3HA 4FFBB 4HGNA 1Q0UA 3HLKA 3RVJA 1GYRA 1JHDA 2ZAYA 5ED0A 2DC1A 5C1IA 3CX3A 4IH4A 3T0GA 2P4SA 3LOQA 1EUQA 1M1NA 4CN9A 4KV9A 4PGHA 1OZGA 1TLLA 2W9XA 4R1LA 1E58A 2GPBA 1YJCA 5CVTA 1HFEL 3GQBA 2VCEA 3AOEC 1HFKA 5T41A 1Z7GA 2DT5A 4J94A 4MEAA 5DNCA 3W8NA 1N9GA 1R6DA 3C7CB 3ADOA 3AJDA 2FDRA 2FPRA 1Z37A 2XUJA 2BGNA 4H1HA 2ZRJA 4R3NA 4J7UA 1C80A 4GKVA 4M9ZA 5IDVA 1BXZA 2ZIGA 5EWJA 2QVZX 1Z5OA 4GBJA 5K3DA 3WBJA 3G2QA 3KT6A 1WUYA 3FFBA 1U5AA 2VBGA 2Z1DA 2FFRA 3T99A 1OLUA 5AIAA 2NWQA 2QXTA 3N6VA 1Q5PA 5KAPA 4WHMA 1P1KA 3TQQA 1MQ9A 3U80A 1ABFA 2QY6A 4MVWA 4K40A 4JYPA 4WBNF 1QRTA 3HZHA 3G02A 1E2FA 2MCFA 1SXPA 2HQSA 2O2ZA 1GNVA 3TR6A 4C5AA 4UFNA 1NZJA 3ICQB 4ODIA 2IGBA 4RM3A 1QCZA 4TV9F 1SIOA 1X39A 3JR7A 1YDMA 4WADA 1EZ4A 4X3PA 1N6HA 1UFVA 3X2EA 3SHVA 2ZCUA 5LB4A 5JY1A 3LKZA 1ZYUA 1MJNA 1JEJA 1M2NA 3NKFA 4WZBB 3RYIB 3I30X 2GDZA 3R0VA 4YYEA 4ESEA 4CCSA 5KWVA 2VJPA 4ITRC 5K0GA 3GLIE 2JCSA 3KYCB 4UTOA 3AB3A 4YUXA 2P4QA 1XTRA 2FKAA 3AI1A 3LUFA 3E22A 3PJRA 4Y6LA 2B20A 1GAJA 1KJ8A 1T3ZA 2PUJA 4RVUA 3D4NA 3IQHX 3PFHA 5KZMB 1G21E 1ZGJA 3N58A 5DXJA 2XIQA 4B79A 1X7WB 2RDMA 2H4XA 5D1HA 1I1HA 1ZO8A 3EGVA 3BXZA 2OCXA 3GJ7A 4N5DA 4RU1A 1BU5A 1L7MA 3RAPR 9MHTA 2QN9A 4RKRA 3OT4A 1L1QA 1XMOB 2CUTA 1ECBA 1SCDA 1DCFA 5TEVA 1IN1A 4QLOA 2J6HA 1ZG3A 2AH5A 4MWSA 5A5VA 4IWNA 4IOMA 1X74A 3WYGA 1MX5A 3HNOA 4GE0A 4V03A 2C1EA 3V7WA 3FX2A 4DT1B 2IS2A 4FVTA 1ULUA 5DM60 1W2HA 3UKJA 3OLQA 4MNTA 2A5LA 3QBJA 1G19A 4EY6A 3ZDAA 1NW8A 1Y3CE 3AUSA 4YAEA 1L7PA 4V1CA 3ZNNA 2XR1A 1UFRA 1ULBA 5FNZA 4FZJA 1HLGA 4EB8A 1Z2NX 5H1YA 2C3MA 4UU8A 4EM6A 4RANA 3I1JA 1HM5A 5JS8A 3DP7A 2HIMA 1K7YA 1E1CA 2JJ1D 2VJYA 2W2KA 3HUEA 5L3SB 4PYQA 2O0HA 4JQSA 2BF4A 3DC2A 1KEEA 2E6KA 2O7VA 3G8CA 5D2CA 3QWFA 1QWOA 2QLLA 3RADC 3I5AA 1UJBA 1PYOA 4XIFA 4ZTUB 1FJHA 1KBZA 2PSEA 4ER0A 3F5MA 3QBDA 4D43A 1BWRA 4H2DA 2Q1UA 2JFPA 4S1OA 2OSBA 3AI7A 4YECA 4CNQA 4ANFA 2V58A 1ZWKA 4MIYA 1KH3A 3T4EA 2GZ2A 4W99A 1KDYA 1WMSA 1T91A 3QZUA 3MN1A 1V45E 5WRFA 2IOYA 3ENZA 4PNHA 3VHRA 1A04A 2X86A 1N5JA 3DFIA 4AWBA 1TO1E 2VH5R 4BAUA 1C3XA 4L8GA 5BPHA 4MUMA 3P27A 1YS9A 4EHFA 3PGJA 4HXFB 3S8EA 3QMMA 5I7FA 2NO5A 4UHBA 2AQIA 4H7IA 4LBZA 1SBQA 2BKAA 2GN6A 2QW8A 4YJ2B 3I0NA 5KNBH 3KQPA 2RGCA 3MFQA 2ZJ3A 4IHKA 3GHYA 2G9NA 1F20A 1USUA 4L4YA 5EHNA 3FRJA 4GYKA 3RV4A 5EZYF 3ZZ1A 4C0AC 2JD0A 5BUSA 4HTFA 1BMFA 1UOOA 4JC0A 2ID8A 3AFGA 4X3OA 4Z3DA 2A6PA 1TT5B 2VCYA 4DR7B 3QA9A 1KSFX 4GVLA 5BVHA 4JMLA 4OM8A 1IMJA 2OEPA 5L3QB 1J2EA 2OHGA 1LVUA 4C4YA 1I5EA 3ESAA 2I6UA 2QE7D 5KREA 5EVJA 4CL8A 2G0TA 2UDPA 4OBEA 5K3CA 2D0OB 3GPDG 2HB6A 1XZJA 3H1GA 1PJRA 4E33A 2Z2KA 3PHCA 1ZK3A 1PYDA 1H2FA 4U4AA 4COKA 4Z51A 1AMOA 3ZIDA 2XX3A 3ZQ4A 1SMKA 4MHOA 3X1MA 2NX2A 4A2WA 2AW5A 1ZX1A 4R6WA 4GZLA 2DSTA 1G1AA 1GZSA 1XU7A 2X8JB 4I50B 2WTMA 3ZGOA 4CG0A 3BQ9A 1U0BB 5GONB 1EFPB 4MKZA 2EJWA 3JQ8B 4CFZA 2AA3A 1ZFNA 1S2GA 4N0EA 5C34B 3NPAA 2XT9A 1CJBA 5DSZA 4RZ3A 5E4FA 3RIYA 4GOKA 4A5OA 4G07A 2VQ6A 4F4DA 1EEXB 4NIMA 1N4AA 2ZLBA 3HVUA 2AFHE 5T7BA 3CRQA 4ZYLA 1BGXT 4HUJA 3RRXA 1GZVA 3AHHA 4LJ7A 4XX0B 5JVDB 4EHJA 1VRVA 2DCMA 2O5VA 2PL5A 4AMYA 2OBFA 4EG7A 5HSGA 4FOSA 2W4MA 2Z4TA 4N0PA 3IPXA 4PEVA 1SPXA 4TKUB 1HV8A 1KYYA 3O6VA 1SUAA 3QYAA 4W82A 1IAVA 3KLNA 4GP7A 5HS6A 4F60A 1PG5A 3CJRA 4KQIA 3BMOA 3OQMA 5EWLA 1H05A 2V8OA 3R44A 2GLXA 5G4KA 1U2TA 4LJ4A 1IFXA 2V4ZA 3KWLA 4D92A 1WPGA 4DE5A 1LSJA 4OCZA 5FWXA 4N3GA 2QV7A 5JLAA 3BWMA 3LLCA 4GS5A 4HQLA 1PUIA 3PUZA 4TXNA 4XR4A 2P30A 3TTVA 3B20A 2AOUB 3O73A 1XZKA 3QPWA 1N0IA 4FMBB 3VMFA 4DM7A 2NTYC 3F1KA 2JAXA 3WWOA 1QB7A 3LUCA 4LVOA 1AKQA 4TTAA 1JGTA 1G60A 2X1LA 1DKOA 2J46A 1Q1AA 3L1UA 4JDUA 2DKNA 4O63O 3VNVA 1S7GA 2YVLA 4PC3A 3PNQA 4DY6A 1NX6A 3PFCA 3UUEA 4G86A 2B4RO 2D2IA 4J3NA 3PZRA 3KJQA 1OYOA 2H2HA 2OGSA 4HB4A 3L0YA 5KKAA 3AL0C 2YY5A 4ZOBA 1ZU5A 2ZBPA 3GFRA 3URMA 1RKXA 1TB4A 1U3UA 3ADPA 4TWBA 3C6MA 4C1BA 2JVKA 4RD6A 5T3UA 3WYDA 5DCLA 3NC1C 4GU5A 4QPZA 4WEQA 2EWWA 2VPWA 2IEDA 3F5QA 4HFMA 4EPYA 5AOAA 3B3AA 4NYIQ 5FCDA 2IV7A 2XXAA 3KT3A 4F6RB 5IYZB 3S44A 2EZUA 1SVUA 4CMJA 1OXKB 2RH9B 2J3EA 4K7JA 2V59A 3GA7A 3UXHA 3AF4A 1M6VA 3MBKA 4TV8B 4XIGS 3USES 4UNNA 4PBTA 2V7QD 3P5BA 3NBQA 1GY8A 1MX1A 1SZPA 2PKCA 2YV4A 4Q4HA 1KOLA 4AP5A 4BMXA 4ML3A 1ZD5A 1FXWA 5DX8A 2YZNA 2QAIA 4LHSA 1LD3A 1CUGA 1G7CA 1YBHA 2QRJA 3GUHA 3ICPA 4PS1A 3VYUB 5K0BA 1RKBA 1EFAA 3SCZA 2W2LD 3O38A 3KZVA 3VKUA 1HYHA 1ESDA 2IGTA 5HCUA 1G8AA 1I36A 2GWRA 3T9FA 4BFWA 4E7OA 4C22A 3WWZA 1A7JA 2Y0CA 4UU7A 3O3MB 3AJ8A 5A4JA 4G0MA 1P62B 2H2AA 1TQ2A 4NHEA 4POAA 4GBGA 3IBYA 4QQKA 4P0PB 5FNVF 5KPJA 1TYAE 2FTKE 4IFBA 3UUWA 1DLIA 1EXMA 4QUKA 1PEAA 3UG6A 5LMUB 1MUUA 1UDAA 3UYLA 3P9PA 4F9EA 3ZLJA 3KJFA 4BTEA 2FPXA 3BL6A 5BN3B 1UJMA 3E05A 1IMOA 3BTUA 4E3ZA 1NUAA 1O5TA 1ORTA 1ZOPA 2XHZA 1WPXA 3DEJA 4QJIA 4KQ6A 5HK8A 5HVNA 1KGSA 4H16A 1CJMA 4B71A 2AEFA 2B5OA 2QRPA 4XQCA 1KY2A 1HFJA 4OXNA 3WLPA 3S1AA 3IOCA 2Y99A 3THRA 1TMGE 2NV0A 5KDOA 1DZ3A 5AXBA 3DTVD 3UXMA 4UVDA 1E2HA 621PA 1SXGA 1Y4SA 2F9MA 3FOBA 3KBOA 1SM4A 4QASA 1UC9A 3SLGA 3I6ZA 3SE7A 3WSVA 1XV5A 5BNFA 2A5JA 4XSHA 1H2ZA 1XR3A 1DG3A 4HF7A 4AO7A 3GB9A 3IP1A 4GSLA 2AC4A 3BZBA 4NCBA 1MTZA 1PR9A 4ZVMA 3DLBA 4BLQA 1E5XA 3W5UA 4QOEA 5BN4B 4K9NA 5B7NA 1D7AA 1TFRA 1HKUA 4U7DA 3HCWA 3IP6A 3V34A 4MW9A 1IK6A 1FP4A 3UC5A 4DA8A 3KDPA 3UJNA 4Q7JB 2ZBUA 4MW7A 2J8ZA 1SAYA 4M87A 2BGGA 1BHSA 5IAEA 4YT8A 1Z0SA 3BFJA 3EC1A 4EGQA 3REFA 4L15A 4N49A 3OZ7A 4BMYA 2J9YB 1LQTA 2ZCJA 5FJIA 1ZVVA 2BTQB 4FYXA 1JFTA 2NZWA 4AU1A 1DQRA 3ESRA 3H05A 4IS3A 3FVVA 1F2TA 3RSLA 3B1KA 3NT4A 2G9QA 1R4ZA 3Q3VA 4K6HA 2NN3C 2IWHA 3QFRA 2WSLA 4RW0A 4D57A 2J0SA 4NATA 5CB0A 2WWIA 1YAJA 1ZITA 4L74A 5IKMA 1KXJA 1NPTO 4OJMX 3D54D 3NPMA 2EGHA 3H5WA 4ZD6A 3ZY3A 2X14A 4K26A 1R9GA 1HTBA 1YQUA 4FQ7A 4P58A 2ZG6A 2RD2A 3TNFA 5HP4A 4MJLA 4WWHA 4ETNA 2XJ9A 1TPYA 2PX8A 3ZNPA 4IGIA 3H9EO 2NSHA 3EY4A 2E55A 3ZHCA 1HMYA 5FLYA 3S6JA 2VWHA 3PC2A 4D4GA 2Q6TA 4HDNB 1ZD8A 4LEIA 1TT7A 4HUQB 4XD2A 1N8NA 4ZOEA 2V7PA 5TGZA 421PA 3BH0A 4RK4A 5DDIP 3HL4A 1CR4A 1HH4A 2JAHA 2NXJA 2WVGA 4G8BA 4JN6B 2OAEA 4LJ9A 2M1ZA 3KDSE 3VR6D 5DLQC 4EL0A 3CRW1 3I45A 2VYFA 1PGPA 2HEGA 1B0PA 1V8FA 1GPYA 2ZETA 3P4YA 1USGA 3B3FA 4ZALA 2AXNA 4URUR 4CKZA 3GEPA 3PEEA 4UEWA 1DVRA 5D51S 2Z2ZA 3MIZA 1WR8A 3INTA 4LRXA 4E5NA 2XCTB 3ORSA 1K86A 3OZUA 4WRRA 5EUCA 4AX8A 4JNKA 2IUEA 4AY5A 1R9NA 1OXUA 3T1TA 2VQFB 4LMPA 2PH3A 1AHHA 2QTZA 2W6PA 3E5RA 4ADSG 3BRWA 4CIVA 1LWNA 3KOZA 2RB4A 2Y6VA 5A02A 3LT1A 2QTVB 4DGQA 4EELA 4I1PA 1TKCA 2BHRA 2WW8A 2HBRA 3CLTC 4KGVA 3TUJC 1KJQA 5CR9A 1UXGA 1QF9A 1Y3FE 3ESZA 2J0EA 2ODBA 6CHYA 3EIWA 4C6TB 4EJSA 5IBRA 3ONNA 5IH3A 2PH5A 3OPYI 1Y89A 1XTTA 2J0VA 3MWEB 4OLJA 3HPQA 1SU7A 1OB5A 2EEPA 1X7XA 3O3CA 2Q5CA 1FFHA 3TQCA 4M8KA 3V33A 4WBNB 2DJIA 2GX6A 2V97A 4P7FA 1LPSA 3UQZA 4ZYWA 5JNVA 2H9AA 1YACA 3M4XA 4ZJYA 3HWRA 3OECA 3OJOA 3QPCA 4LV6A 4LYDA 2GF9A 4M0MA 4TV9B 4EDHA 4RVCA 3A2KA 3RW9A 4UULA 3V7YA 3QVKA 4BWFB 1S96A 1SUDA 2RJNA 4F8JA 4IZIA 1ZCZA 2GAOA 3UMCA 1WHSA 1E9BA 1V41E 2XDWA 2C98A 4R2KA 3FKSA 4YS6A 5ALUA 2A8YA 3HVRA 3ROZA 4LVCA 5JNUA 2QJWA 1L7BA 2PY6A 4QLBA 4YRAA 1WXFA 3IEMA 4EKYA 1JAHA 3PBKA 1C3JA 4QQFA 3RGWS 1I2BA 2CMKA 1L5MA 1QS0A 2ZRMA 1NLMA 3L0IB 2KE5A 4OQFA 4WEOA 3RU7A 4A15A 4U3JA 3AKCA 1XDDA 1DAGA 1MB0A 1LVGA 3G7UA 1NVGA 4UM9B 1ILEA 4X90A 3EFEA 3E4CA 1H4VB 3OJLA 3ONWA 4FX2A 1G8MA 4F21A 3MJEA 2BFDA 1BQ4A 2FWJA 1JTFA 3TPCA 2VKQA 3KSAC 4RKQA 4IVPA 3W0LB 2PS0A 4GR5A 4R9VA 5ECGC 2JRLA 5BYAA 1RHMA 4E13A 4X7RA 5L4NA 1U1DA 1XF1A 3MUFA 1XTSA 5SZHB 3ANSA 4CZ2A 1LCIA 3CZMA 2XKAA 4LRWA 1F3OA 2XB9A 4P54A 4MUIA 4M7PA 1PL7A 1OTYA 1QZ3A 1VL8A 4TUYA 5CVUA 3IVXA 4GOXA 3HZRA 1H2RS 4TRMA 1WMBA 4P83A 1NQVA 1Q7TA 2PRZA 2QRVA 3EOBI 4H31A 4G5XA 1SBIA 1Q0QA 2O8BB 2V98A 3WMXA 1Z4LA 4DM4A 4QGFA 4B85A 5FPHA 2R6ZA 1HDOA 1YQQA 4LN1A 3P2EA 2GEDA 1XTPA 2O2DA 2YW9A 3GMIA 4GXRA 3VPGA 2VDMB 4TWRA 1SOVA 4CM4B 3OPVA 1RMQA 2X4DA 4KK3A 4TL6A 3LVQE 5DM0A 4Y1EA 2QJFA 3PFIA 4Z3OA 3WB2A 2IXBA 4NESA 4C3ZA 3L7OA 4KO2S 4RZSA 5CAEB 4D81A 5K3EA 4MUAA 1WB5A 3R3ZA 3OJCA 3IAXA 1NBEA 3NBXX 5JYCA 1B0UA 2OFOA 4DLVA 4I1OA 1JVSA 4RHXA 3SM9A 1CUBA 1GUZA 2AT1A 2XDQA 1SUPA 3DE1X 2AV6A 4WZZA 5DI9A 3UPDA 3GZNB 4M9RA 2PUVA 4JT4A 4MYRA 4NOMA 2QUAA 3R23A 4G01B 3IPYA 2WIDA 2F9LA 3KIPA 4S1WA 1H69A 5D1NA 3MJFA 5FXMA 1TYBE 3BWEA 1S8OA 2G5PA 1U0LA 1P4RA 2ZSJA 1H9BA 1SHTX 3EISA 3GT0A 3KTAB 4OQQA 1JDVA 3DW1X 5I3ZA 2A5GA 1DAKA 2G72A 3OJEA 4DDTA 3H3XA 4IEEA 5D6OA 2WWHA 3O2SB 5CEJA 5JLJA 4BMCA 1ZNQO 3VHXA 3FE2A 2XWJI 3C5CA 5KYWB 1CQXA 5EZYB 1GCGA 5E1BA 1KFBB 3ETCA 2JLYA 5C1OA 2C78A 4B45A 4XSVA 2MTBA 3LMKA 3FNBA 3VDNB 1JDNA 1XVTA 4RM2A 4C43A 2FRXA 1W4ZA 3JXEA 3RHZA 4BO7A 4AWXA 5AT1A 3GFTA 3LNTA 2FY8A 2JC3A 1Z56C 4I2NA 2ATEA 2IBTA 4JBXA 1CZLA 2NO0A 2PX4A 3V8EA 4CIDA 4EB0A 4D25A 1I9GA 1RRGA 1SHJA 4HAZA 4B6EA 1T24A 3HRKA 3C45A 4EJSC 2B8TA 1O77A 1PV2A 4YAFA 3RSZA 5LIRA 3DV9A 1AGRA 1FX0B 1MAHA 4OPMA 5AICA 4W9NA 3MBOA 4FGWA 1DHTA 3FTNA 1RWPA 2H06A 4Y2TA 4O5AA 2Y1OA 4BX3A 4X44A 2P27A 4YMIA 5KU1A 4PZZA 4EX7A 5JPCA 4KR2A 2CVFA 5FBKA 2LVBA 1BMFD 4DNPA 5JAUA 2ZI7A 3GRVA 2HYIC 2D5BA 2CKDA 1TF5A 2GNAA 2RBGA 3JAKA 3N2IA 3U5ZB 4RSRA 3HUUA 3L8HA 3T41A 1G7TA 2B21A 3TEMA 4DIBA 3SX2A 2WU4A 4C5BA 3KEGA 3TG8A 3DYVA 1ACMA 3I4FA 3ME5A 2DR2A 4PZLA 4CF5A 1GA6A 4PYIA 3TE6A 2CL5A 1QC5B 1SD1A 1VSUA 4IINA 3V4PB 3JAWA 4H77A 2VC2B 4BYMA 2G77B 1P1IA 3LU1A 3N2EA 3RC1A 3OTIA 1P7ZA 3QXHA 4B31A 2IHJA 2YMQA 1EVKA 2IYQA 5JJBA 2PKYX 4PNZA 1YA4A 5CGQB 2RGBA 4OB7A 3RVKA 3VPXA 3QYPA 3V42A 2UZAA 2B34A 5E6UB 1ZGHA 3KAPA 4RVDA 2QKYA 2BZ1A 4XEHA 3SVZA 5JTUA 5M5BA 4EHAA 2XA9A 1X70A 3OJ0A 4Z9BA 2F3TA 2XECA 2PUCA 1E61A 1G16A 3EDOA 2IYOA 4Z9YA 3BD8A 1OFUA 2DTEA 3PCTA 4GZMA 4XDGA 3TLEA 1VMEA 2B61A 2OB1A 3MRVA 3W1EA 4DAOA 1YBAA 2VDWA 5EP4A 3S2SA 4Q4CA 4AY2A 4J0QA 3V1MA 2BMWA 4PG6A 2I4TA 3TI9A 2O8FB 1A5ZA 3A25A 3GIDA 2CV1A 1JLSA 1ODLA 1K8YB 1ZW6A 3BL8A 5BRJA 2CXSA 2FMKA 1PSZA 3EPPA 3P20A 3FZYA 3K20A 3QITA 1NZDA 4X5OA 1DADA 2XD4A 3EARA 3H2JA 4JYBA 4KDFA 3ZWYA 3U7HB 1YA6A 2QP3A 3CVWA 1DFIA 2C2HA 1THZA 1IN5A 2D59A 2R4TA 1ANKA 4Z2AA 2IHKA 2WU8A 4L4XA 1TOAA 3OZEA 1P1HA 1ES9A 3TOCA 4TKZA 3HFSA 1YI1A 4B3BA 1KOJA 3PPVA 4TXLA 4D9NA 4MQFA 1LDYA 1SG6A 3M34A 2QX8A 3LSYA 5EQTA 1FTGA 1OTHA 4ZAXA 3UA4A 4B46A 5JNSA 1A9QA 1TQ6A 1G20A 2H7XA 3HB7A 3IQEA 4P22A 2RK3A 5J5CA 2CVOA 2E89A 3RIMA 4D4LA 5ABPA 5JT1A 5AHKA 1K9SA 2OA0A 3TIIA 3L4JA 1AKVA 4ESOA 3DE6X 2R96A 4HNAB 2WZBA 3L4KA 1YRBA 1F12A 1XEXA 4L9WA 5T4FA 1HLPA 2WHRA 5LQRA 4IS2A 5JXWA 1DQZA 3EPHA 1PQPA 2FMIA 1TAUA 3HY4A 1CE8A 2H0AA 1KERA 1SH7A 4I99A 3OA0A 4PONA 3D6MA 4XM1A 4Y2VA 3UUGA 4JX9A 1NVVQ 5DISB 4XR9A 2OVBA 2WM3A 3G0DA 3ZXYA 1X7YA 3WDLA 2ECOA 4NMXB 4R54A 2VYCA 1ITZA 3CSDA 3JRWA 4JQOA 5AI8A 5C46F 1KP9A 1DQPA 3PIDA 3LYHA 1SU4A 4DJDC 1RC8A 4I9HA 1AS2A 5HF8A 1SQ6A 4J9UE 4UQLA 5JYEA 4UBKA 1WHTB 3NNSA 1DTWB 2WHQA 2D5LA 3B1JA 3RRFA 4MQLA 4BQRA 2PZAA 5FNVB 5IKPA 2JBAB 1P1RA 3LX6A 3V80A 3F47A 2DQYA 2QT1A 2Q5HA 4TZ6A 2PZLA 2WG1A 4M9SA 4O2AF 3U44B 1LJ8A 1D0VA 2YJNA 2G04A 4CM8A 4IHJB 1FDTA 2EQAA 1V9LA 2P7HA 4W9NC 5B3JA 4ES6A 4NJOA 2FQYA 2OYCA 4EQ6B 1TKAA 3FR8A 5B4TA 1ZH0A 5JRDS 4RE6A 5K0LA 2Y3IA 1NFQA 3REQB 2WWWA 4PC7A 3SDZA 3W8EA 4EFMA 3LC2O 4IQ8A 4BMVA 4FOLA 4LWQA 3DLHA 1AZSC 3CLTD 4OK6A 4X00A 3KKZA 3B36A 5H81A 2X7XA 2BEKA 2LDXA 4QXRA 5K3OA 1TZ2A 2ZDQA 2FDCA 1DCKA 2ORIA 3A1CA 1N5DA 3CRVA 4EKDA 1SQGA 3IO3A 1TYDE 2A94A 1HRDA 1Y1RA 2WD9A 4Q7EA 1F0PA 4H4EA 1XLWA 5FI1B 3TB4A 5AI0A 1VBMA 4MGZR 1F8GA 1LC3A 2JIRA 4Z4FA 4IUBS 1JEYB 3LC1O 4HQOA 5JAPA 5H0IA 1S5PA 3WRYA 1E4EA 3C3PA 4PYRA 3BX1A 4GPZA 4YHHB 4QTYA 4TMKA 4DTIA 5E2AA 5BMVA 3FHLA 1QYCA 2DTDA 4D5EA 3PLAE 2NU8A 5AW6A 4IJVA 5B1EA 3B5IA 4ALJA 2WWYA 2XD9A 3D2LA 4LHWA 3EPKA 4ER3A 5LD2C 3RTGA 3RV3A 2UVPB 1RBZA 1T9CA 5TEWA 2DFPA 2DE0X 8MHTA 4YTEA 1TC1A 3K73O 3LV8A 4ETIA 5BVGB 3WGOA 3O9MA 3ZEAA 2OWDA 4RGBA 2FEMA 1R7RA 1CRLA 2MOKA 2OV4A 5HIIA 2VDLB 5BWNA 1P0CA 1I3KA 1SKQA 3M2TA 3Q11A 2COEA 2JH9A 4RCVA 3F7TA 4RKFA 1H0RA 3LGAA 4C7XA 4CKCA 1CVIA 1Z38A 3UJ7A 1C1XA 5DHFA 1H8EA 1MORA 3BJZA 2A9RA 1FCJA 4DMCA 1YZUA 4ZQIA 3MM4A 2WIKA 1QH1B 3QEOA 2B1JA 1SELA 2SCUB 3KM0A 3OY2A 4JVOA 2GXUA 5L45A 5JSKA 5TS2A 4A82A 3LK7A 1NVDA 1MKYA 3DOEA 4U7JA 1VHQA 2JCXA 1CVLA 3DT6A 2Y2VA 3FYCA 4H6WA 4BNIA 4QQNA 4X84A 4JI8B 4XQGA 4OI2A 1CJSA 3AF1A 4E5PA 4M1MA 4XB6B 5JQWA 2ZYAA 5DYIA 4BZXA 4OBXA 2XGOA 4ZCMA 1J20A 2PKQP 2WUVA 3MCAA 1P29A 5G1PA 5ALVA 1JG4A 2KI5A 4K6CA 1KZGB 5BWLA 3ZD7A 3V1KA 2Q99A 4YB8A 3DMPA 1QLHA 1QH9A 1CP3A 1L3IA 2GEFA 2GILA 3L0BA 4JSRA 2E5LB 1EB9A 2G1KA 1T2CA 2QMEA 2ZAGA 3F3SA 1SOUA 3AETA 1SKYB 5BO5A 3DAFA 1HUQA 2C5EA 1Y4ZA 1SKBA 5KTRA 1EK2A 1X2EA 2GM5A 2Q1TA 2CLIB 4FDVA 1S3SA 4DUGA 5J58A 3U56A 4BO5A 4HDCA 2Q4OA 2QRKA 4DQUA 4HWKA 3GBVA 121PA 3HR4A 3HDJA 1JAIA 2QPAA 3KKKA 3NZEA 1GHTA 3CF4G 4RHEA 4AJIA 5A1JA 3DV0A 3DTYA 5H5JA 2B98A 1Q84A 3U60B 1RBMA 3OCCA 2PSDA 2AJ8A 1JKJB 1KWGA 3KQUA 1YOVB 2H4YA 1A98A 1K06A 2J7PA 3B48A 3TDKA 1JWLA 3FVRA 4JBHA 2EJVA 1GQSA 5JD5A 4DV1B 4CCAA 1U3TA 3P19A 4Z5XA 3IOBA 3H19A 4QBIA 3RSSA 3ET4A 4TL9A 4OXYA 3TNLA 4A1OA 4AUMA 4V0MA 2F43A 4YDQA 3SNHA 1JF8A 2ZBFA 2HA5A 1NUQA 2FA9A 3AEKB 3H99A 4WLOA 2OCDA 1FSZA 4R9RA 4WGFA 1V1RA 2BMVA 4QWWA 3ZCSA 1GPKA 1XQ6A 4HHEA 4J4TA 3M5CA 4P35A 1US8B 2QG9A 2GARA 1UK7A 3ESCA 3RYFB 4AG3A 2UYHA 1XNRB 1PW5A 2DFDA 3RSOA 4ZT2A 1POXA 1YJBA 5ALZA 3G2PA 4HZIA 4C87A 2FZWA 3MINB 1WU8A 2ROQA 3DO6A 1KP2A 2CCKA 2J0UB 2M2IA 3BRWD 1JDBB 2VNIA 3TL3A 4RTPA 1JB9A 4OXIA 2R5WA 2OP1A 4RNCA 3UT5B 2IIVA 4LJKA 5E6RA 2HU7A 3Q98A 1G4AE 1P75A 1Y7IA 4M54A 1RLTA 3ISVA 3VX4A 3Q7RA 1M2VB 1PFQA 2OGWA 4L78A 1EFHA 4QPDA 3GJ3A 4X1IA 1HDCA 1JX6A 4C3OB 4J6FA 4BZQA 4O4JA 2X58A 5BY2A 1KZYC 2BE7A 4JGIA 5DLPA 1S2MA 4GBED 1M1YB 4FCVA 5JJ5A 4FYMA 2JJYA 2QN7A 3O1LA 4BNGA 3ZS9A 4MWEA 3SR0A 2OR3A 4NJEB 1XQXA 3DL4A 3AONB 2R1TA 3HJGA 3X2FA 4V1CI 1R8SA 2G0AA 1QMPA 1P9RA 1E32A 3KOYA 3ITKA 5TRTA 5FO1A 1P45A 2QAGB 1JJFA 3F8TA 4YT5A 1B8OA 1M0WA 5TQ2B 4W5JA 1GIAA 2D62A 1ZK0A 4B7XA 3GWGA 3PYMA 1KFJB 4LYGA 4R8LA 3WK4A 2WQZA 1TGYA 3FKSD 1HF3A 4FHGA 4K1LA 3GVCA 5THKA 4WDRA 3U19A 3H9QA 3IULA 3LUHA 1TQ8A 2QM3A 4RV4A 3R75A 3O8OB 4C4PA 3N7AA 4RDXA 2ZE6A 4RABA 1HDGO 3C8ZA 1MRNA 1RXSA 2ZXFA 4YALA 4LWPA 5U9CA 4IIYA 2XUQA 3GJSA 1B00A 4D0RA 2FR8A 1DEAA 4OUKX 1OOEA 5MFZA 1Z6AA 2PBLA 1WCIB 3F7MA 4AO6A 4QDJA 2FSIA 2P67A 1YZTA 5J9FA 2AHRA 3B2NA 4GG1A 1Q7RA 1ZRMA 4N3BA 5HDBB 4AMGA 2HADA 4G5HA 4L0DA 2NU9B 3KAQA 3TMAA 4GDMA 1BTOA 3LCVB 1H42A 1YC5A 4WLEA 1P61B 5ES4B 4LXYA 3ZZUA 2TYSB 3NHFA 3OSUA 4PVDA 1ZW1A 4A2CA 2C4MA 4URWR 5CLJA 3D31A 1WETA 4PLCA 4B2PA 3WA7A 5JDIA 2QD3A 3AVQA 1KI6B 4GSYA 4RLQA 5KTMA 3WX0A 4QPJC 5KSZA 1WKCA 2GEJA 3DKRA 3I39X 2ENUA 1LI5A 1UUFA 2HSGA 4S1TA 3COYA 5L7TA 1DB3A 3PSHA 4BNMA 1Q2UA 3EZYA 4XA8A 5L3VA 1RC0A 2QL5A 4LXTA 1K1EA 4EAQA 4YR9A 2WAXA 2ID9A 2VSNA 5K3BA 4H1TA 2VLIA 1HDZA 1RYYA 4MB6A 1HKHA 2OHHA 2IXFA 1WQ1R 2LV8A 2IFTA 3DEHA 3ID6C 4MUNA 4RIEA 1GDHA 1NMYA 1X15A 3HKDA 2P77A 5C37A 4FCTA 3OEHA 1LPMA 1B1AA 2XGSA 1LLFA 5ERGB 5KHAA 4M55A 1VJ0A 2AJCA 4LFCB 4MGYR 4G3XA 4CIWA 4KAAA 3Q12A 1FLVA 1KEKA 1Y8CA 5FL3A 1BDMA 2GNPA 3D02A 4JP8A 2HCBA 2V3WA 3BULA 4ZVLA 3TOVA 1U1CA 1OY1A 3GAMA 1WV1A 5ALFA 4UEOA 2MSNA 1ZOIA 2RKBA 3OZTA 3AERB 1N7JA 4JOBA 3LIPA 1E5QA 5DBHX 2O3SA 2I9KA 1FQWA 4QGBA 1ISJA 1JHOA 4JI3B 1KAMA 3L7IA 2PLWA 4LOAA 2I67A 4HWSA 4IPTA 4IDAA 1Q44A 1UAGA 3BJMA 4JP2A 3KALA 3STUA 1RLUA 5ALEA 5HR5A 2VSQA 3N7TA 2C83A 3SZRA 3OMWA 5JEDA 3AU8A 3IESA 5IEBA 4Z7JA 2IOHA 4NE2A 1K5HA 2PZMA 2NYRA 2GK7A 1QJCA 4Z8XA 3C16C 4JXKA 4BS9A 3AVXA 5EQDA 3RVSA 1L8QA 4JCOA 1EUCB 2B36A 3KK0A 4NU0A 1HX7A 4JBLA 3DULA 1EB8A 1ZMRA 1NQAO 3A2MA 1I3CA 1OIXA 3B13B 4KWCA 4ED9A 2D8MA 4CG3A 2X6QA 4AAYA 2P2CA 2Q6KA 5GZ3A 1DRWA 2GFQA 3K8YA 1QDUA 2I3DA 3FB4A 5AVKA 2XQJA 3LCMA 1E7WA 2BGRA 4OFZA 1MJ5A 1GU1A 3J7TA 1NN3A 1VHTA 4XIJA 4N4AA 4L8WB 4DW8A 1WDTA 3ZTWA 4ZIRB 3M82A 2X2FA 2QUIA 4R2LA 2Y1FA 1B8UA 2GCOA 3SMQA 5CXQA 2QZZA 2FX2A 3S8YA 1QTRA 3T7AA 4C0XA 3EXHA 1K4KA 2V1UA 1FTYA 2WHEA 3BWDD 2QDKA 4DB2A 1FDRA 5JNWA 1DCMA 1KR2A 1H5NA 1WD5A 3ECAA 3EGDB 3PV0A 4REMA 5J2TF 4NBUA 4UNQA 4UMEA 1XZMA 4Y2UA 4MIKA 1EKXA 3DEKA 4PQEA 5AM0A 5DN6A 5FD8A 4ZQFA 1L5FA 2I6GA 2WBLC 1JR4A 1Y9ZA 2R85A 3MTDA 2X2OA 5HDQA 3UKOA 1N57A 3ZUGA 1OKKA 3TLCA 5DW0A 5CA1F 1CU1A 4XIYA 3KB1A 2J08A 4Q7KA 5CDFE 3I8OA 1WF3A 2LNDA 3TW8B 2I0FA 4BN5A 1LQUA 1IONA 4C6TA 4B2IA 4CM1A 1J5PA 5HGJA 1XTQA 2AJDA 2VHJA 3ZIUA 5JH7A 1TJYA 1MAUA 1WB4A 4U63A 4B6FA 3B8EA 1P4JA 2FR8C 3CEMA 5C8YA 1M1XB 4IJ6A 2X8BA 3UM9A 3BXEA 4HX2A 3ZS8A 3UZUA 3TK1A 3SYTA 1RI1A 4KXFB 3WMEA 5BW5A 4TWIA 1F0YA 3HBNA 5FTKA 3ZHOA 1G8YA 5A5EA 1A5AB 1QOPB 2VK2A 1W34A 4QDOA 4LNUB 2QIOA 4B48A 4DA7A 3ILYA 1XU4A 4OGLA 4DANA 3C1UA 3R6TA 1EXNA 2RONA 2XTMA 5H02A 1TCAA 1KH1A 4RJTA 1FJXA 2LKDA 2QX4A 2ATCA 3P0FA 3NEPX 1N6PA 2X2EA 3G9XA 1A95A 4RTJA 3ZJTA 2IOFK 1K7FB 1BDJA 2B4AA 5L95A 2CEKA 3VNSA 2EJCA 3MYYA 1FLNA 2WAYA 5JDIC 5BSWA 2NV6A 2PYIA 4OHRA 3CVUA 1UPBA 2QN1A 2JKVA 3RUEA 4CM6A 2HRRA 3B89A 4FONA 4OQXA 4HAUA 1HE5A 1NZFA 4Z7OB 3L3BA 1DC7A 4V38A 3IKVA 2BFEA 2QXUA 5AI5A 3WSTA 4YUYA 4QFMA 3SJZA 3H5NA 4L27A 3K5PA 5FOSA 5AWFC 3KZMA 1ZAKA 4FNMA 4TYQA 1J0EA 1D09A 2QTCA 2NU7A 4MRPA 4WNCA 2ZUSA 2P5UA 4G1CA 4EY5A 2IHNA 3OPQA 1RWWA 1EG2A 4QIHA 1ECLA 3K70B 3TRKA 4UOQA 2EDAA 1C8BA 2Z98A 5BQ3A 1G6Q1 3NBZC 3UBTA 4RWEA 3S2UA 1XVAA 1HYEA 4EFDA 5GGYA 3UJHA 1C0KA 3N75A 1NHWA 3OVMA 3VZDA 4BNDB 1UIRA 3UMYA 5KYXA 1DO2A 3KQWA 4R83A 1XWWA 1Y6JA 3JASB 1TZJA 3KLOA 2C9DA 9ATCA 4B6QA 4LZAA 1E8MA 4DEVA 2IIQA 2QUZA 2X22A 2Y66A 3KTFA 3VNRA 5K8CA 4RF3A 3V7UA 4FBLA 5LJLA 5LMNB 3FPBA 3KZCA 4KO3S 1DUIA 3UOGA 1MFZA 1ZOSA 5LOVB 1M0EA 2B83A 4CEIA 1NMXA 1N25A 1C3EA 1YRLA 3V3KA 3F5FA 3YASA 4I2VA 4AN4A 3AHIA 3WGMA 4BFSA 3VO9A 3B7GA 3DPUA 4BGUA 3TSWA 3BYZA 3EASA 3KCNA 1N5LA 3SEAA 1VC2A 4UD6A 2B37A 4PO3X 4B4DA 2EATA 4EFKA 3F73A 2WFLA 4RQTA 3N74A 5SYNA 4F5EA 3PEVA 4FDUA 4MMXB 3IAUA 1GPMA 1IJEA 3ZR4B 3DMNA 1ZNZA 2E4AA 1U2DC 2OO7A 5K1ZA 2I2XB 3DG9A 4YRCA 4DBLC 2NXNA 4CM7A 2ZYWX 4NPCA 2YJZA 1RVV1 4DLXA 1T2UA 2EQBA 2I7VA 1SULA 4LI0A 4PAWA 3UBMA 4J2TA 2CD9A 1I0LA 3QXJA 4PXSA 3WK5A 1SB8A 4HDSB 4XCXA 1BVRA 4J76A 4OYHA 2I3GA 3PUXA 1EFRA 1RJGA 1AK9A 1L1EA 3EXHC 4IO0A 4WNAB 2XITA 5NLLA 3RDPA 1KQOA 5LYJA 2ZM6B 1YQXA 3GLGA 5D6NA 1OXVA 4IICA 4LHYA 3R3WA 2AD1A 3PRKE 4NONA 4R41A 1UKEA 3FD8A 5AR1A 4UMVA 4KREA 5J63A 1NQ5A 2ZB8A 3FCOA 3Q6NA 2ZUEA 4KQ1A 1K8QA 1H23A 3OIDA 4BB6A 4ZICA 4DBVO 1KI2A 1CW2B 4QJ3A 2CY0A 1MT0A 1PJ2A 1Y1QA 4TS3A 3HUTA 1TEXA 1YVRA 3LYUA 2CUZA 3I76A 3H2SA 2W6JD 4FIDA 1OTXA 4I8IA 1WCV1 3C5EA 4LSMA 3OHSX 1FMLA 3R6GA 4Y1GA 1W5EA 2ERYA 3NYIA 1XX6A 1TO2E 3K92A 1EX1A 1D4ZA 5AM4A 5I8WA 2YCBA 1GNPA 3ORYA 1YS2X 1A2OA 4D0GA 3T1HB 3ZPXA 1T8YA 1CR2A 3E2IA 2FH5B 5ILOA 3GEHA 2XCIA 2FGKA 4K9QA 1PG0A 3FPHA 3P9XA 2P40A 4DCJA 3VYRB 4NBKA 3M6LA 4IIJA 1AE1A 1W0JD 3FNQA 4RY2A 5TV2A 3FTEA 2IXDA 3PGMA 4MYHA 2PUHA 2ZANA 4L08A 1XFDA 4WCDA 3LO8A 4YJ3A 1L5OA 3MERA 3PT9A 5C7LO 1RHUA 2IBSA 2I3ZA 4ZV9A 2OLKA 2OBXA 3WBKA 1CRQA 2QT0A 3IUMA 2IYZA 1UEJA 1ZCAA 3R3VA 4OBWA 2NGRA 3KS9A 1W19A 3CS3A 4MS1A 3R5FA 4ND3A 1VG0B 5F2KA 3VI4B 3ADBA 1CYEA 1PJAA 3EOZA 4N5MA 3OLVA 2VXCA 5IN5A 2OOSA 1OZAA 5REQB 1L5QA 4YXFA 2KHZA 4UVHA 1QGAA