3DE6X

Proteinase k by classical hanging drop method after the third step of high x-ray dose on esrf id23-1 beamline
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation stability of proteinase K crystals grown by LB nanotemplate method
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3de6X00
1C9NA 4KPGA 1Y3FE 2XRMA 3CO0S 1OYVA 1SBHA 1TM7E 1S2NA 1Y33E 1Q5PA 1YJBA 4ZARA 3AJ9A 3H42B 4YN3A 1SN7A 1SBNE 1Y48E 5AVKA 2WUVA 2WWTA 1C9JA 3VTAA 5B1EA 3T41A 2PMWB 4AKSA 3SICE 1SUDA 3EDYA 1SCBA 2ST1A 3EIFA 3GCWA 2Z2ZA 5ARCA 1V5IA 1SUCA 3DWEX 3SQOA 1GTL1 1BE6A 4BWGA 2SBTA 2DUJA 3DVQX 1TO2E 2SNIE 3I37X 1CSEE 1CNMA 1SUBA 2ZWPA 3LPCA 5JMOA 1SCAA 1TM5E 3A3OA 3L1KA 3F7MA 1P7VA 1S02A 3LXUX 2PWBA 1MPTA 2XTJA 4AKTA 3WQBA 5ARBA 3AFGA 3BGOS 1C9MA 3PRKE 2HPZA 3BX1A 1WMDA 1YU6A 1S01A 1AV7A 1TK2A 1R64A 1P7WA 3DE7X 3F49S 3D9QX 4DWWA 1T1EA 4ZOQI 1SUEA 1WSDA 4CFZA 4DZTA 1AH2A 3GCXA 1PJ8A 2Z58A 2QTWB 3DE2X 2PKCA 4MZDA 1YJAA 2PYZA 2V8BA 1HT3A 5AMXA 3ZXYA 4Z2AA 1SBIA 4M1ZA 3QFHA 1Y1KE 1MEEA 2P4EA 3DW3X 3I2YX 1TM4E 1OT5A 4NE9A 3VSBA 2X8JA 3DE3X 2DQKA 1KDVA 1AQNA 1LW6E 1SCNE 1SBCA 2ID4A 3GT3A 4J94A 3TI9A 2PWAA 1GA6A 1DUIA 3DYBA 5ARDA 2IY9A 4C3UA 1TM1E 2W2QA 3GT4A 4KB5A 1TM3E 5FAXA 2WV7A 1OYOA 1BJRE 2E1PA 1GTJ1 1ST3A 4C3VA 5JXIA 1BFUA 1TO1E 2SECE 5B1DA 5K7SA 1SBTA 1SUAA 4GI3A 4K8RB 5CW1A 5AQEA 3ZXXA 5JXJA 1C3LA 1SIBE 1SH7A 1Y3CE 1EGQA 1V6CA 2Z30A 1XF1A 4JP8A 2ID8A 4H6XA 2B6NA 5FFNA 4WOCA 1Y4DE 2GKOA 3WIVA 1EA7A 1VSBA 1GCIA 1Y4AE 1KDZA 1AU9A 1T1IA 1T1GA 3I34X 1GA1A 1BE8A 2PRKA 1NDQA 4NE7A 2SICE 1JEAA 1DBIA 1WMEA 1SIOA 1IC6A 1Y9ZA 3DDZX 1WVMA 3A3NA 4NMXB 2WUWE 4OV6B 5I9SA 3Q5GA 1SELA 4DJ5X 3D43A 3LPAA 3DE5X 3OSZA 2X8JB 4FONA 4HX2A 3DE4X 4H6VA 1NLUA 1GT91 3UNXA 1SVNA 3VV2A 3I30X 5FBZA 3PTLA 5JXGA 3QTLA 1BH6A 3VYVA 2ZWOA 3DE1X 4OMDA 2W2OA 1KE2A 1ST2A 1R6VA 2ZRQA 3TECE 1SPBS 4I0WB 1R0RE 2G4VA 1ZVKA 5JXHA 3LPDA 1A2QA 3HJRA 1Y34E 2W2PA 3AJ8A 1AVTA 2HD4A 3EE6A 1SCJA 4OMCA 3TI7A 3QMPA 1BFKA 1AF4A 5AVJA 2DP4E 5SICE 4CFYA 2TECE 1PEKE 3WHIA 3DE0X 1SIUA 1TECE 1YJCA 1KE1A 1Y3DE 2PQ2A 3CNQS 2W2MA 1PTKA 3DW1X 4LVNA 4LVOA 3VV3A 4H6WA 2Z56A 4CG0A 1GTG1 3Q40A 1NDUA 1PFGA 1THMA 4KG7A 1SCDA 2W2NA 2Z57A 1KDYA 3WIUA 4B5LA 2IXTA 1GNSA 1AK9A 1TMGE 3P5BA 3A3PA 1ZVJA 3F7OA 4HVLA 1Y3BE 3DE6X 3DVRX 3VHQA 3DVSX 1UBNA 4RYDA 3BPSA 1P8JA 1GNVA 1GA4A 1IAVA 1WMFA 2Z2XA 1SUPA 2Z2YA 4WOBA
chains in the Genus database with same CATH superfamily
2PGNA 3MGBA 5KVQA 3CW2A 2JARA 3G59A 5CYOA 3EB9A 1I6LA 1QKJA 4OYRA 5JWHA 2FP4A 2GK7A 3HKDA 4AJ1A 3OEEA 5AK6A 3SF8B 1KK2A 1JT2A 2PMWB 5EPUA 5FBKA 1PT7A 3B5IA 4C4SA 2NAPA 2VRBA 2AZTA 1WDWB 2DH5A 1NR7A 4ND2A 4XGQA 4FS3A 3BRWD 2VPYA 1MC1A 3CN7A 1Z7WA 1ETUA 4N3AA 2QRHA 4BCBA 4CYMA 1FYEA 3U1VA 1QFXA 3VKGA 1PKEA 4UM5A 5L3SA 2VK8A 4N5LA 2I29A 5TLSA 1WABA 5GIPE 2P4QA 4FNAA 1U7HA 2C4MA 4OBWA 1SHTX 3EZ6A 4A23A 4HS4A 1UP4A 4OKSA 5I51A 3P0JA 4FQ7A 4X5OA 1G8KA 1DRUA 4O2BF 4XYBA 3AGQA 2GF2A 2J3HA 2W83A 2IH4A 1Q14A 1N2OA 4D43A 2V3CC 4L3WA 4ZDIA 4YJ2B 2FFHA 3ZXYA 1FVXA 2WZCA 4UUOA 4BS9A 3LTNC 3U56A 5I7SA 1K7FB 5JJIA 5AXAA 1FLAA 2RGUA 3JR7A 1Q19A 1KQGA 5J47A 1Y1LA 3C1AA 5DGHA 1S4MA 4BTVA 2JA2A 1RKQA 1NBMD 1TM1E 2N1BA 4F45A 3I1JA 4EYKA 3E82A 4QQKA 4XQGA 2P9TA 3TR6A 2Y1FA 5JXIA 1GR0A 1N2HA 3KWLA 3WHKA 4D8TA 4F11A 5LUBA 3OIUA 3VC7A 5BORA 1XNRB 1FNDA 4POAA 1WDTA 4BMYA 1PVDA 5AWFC 3R3UA 4F2HA 4YPFA 3KB2A 2NG1A 3QPWA 3AM1A 2CKMA 3OQIA 2JI4A 1SG6A 1H6CA 2XCTB 4FCCA 2IHTA 5D87A 2YOFA 5DTRA 1A98A 3I6ZA 3E3LA 3RNOA 4KE9A 3H9EO 4DM3A 3BGDA 4PAWA 4LC9A 3FVQA 2I6UA 1QH9A 5IDYA 4CMEC 4RAOA 3SSOA 1Q7TA 3LXRA 2WJGA 4IJQA 1RW4A 3NGMA 4YRLA 2BBOA 3FNIA 3RBZA 2KM1A 3ORSA 1Y7LA 2BGKA 2M6SA 2WKQA 3OPYB 1R00A 1KP2A 3WA7A 3IDSA 2ZJOA 1L5QA 3GRUA 2VAWA 4HRVA 5BRNA 3I05A 3SXPA 3VO9A 3CLKA 3MUNA 1OUMA 2I6XA 4I1IA 3QFCA 5HS6A 1TQ4A 1I30A 1U8TA 4L72A 5TQ2B 4FN5A 4B6RA 4P8RA 2QYTA 2GF9A 1NJ5A 1TO6A 2GZMA 3O8LA 3WGNA 4QUIA 2R97A 4NENB 3DVAB 2ZKIA 2FG6C 3FAKA 3OQ1A 1TKAA 1BS2A 2PX0A 3I5YA 4EM6A 2J87A 1F0NA 3FUVA 2DECA 3PDCA 1LDNA 4JJKA 2D2VA 2YRWA 1XHEA 4YAKA 5F2NA 5SZIA 1J0DA 4PS0A 3N5CA 2EFHB 4N9QA 4QLBA 2IP2A 1QXSA 4Q21A 4DUPA 2WWYA 3A7DA 5TPZA 2CNBA 2JD1A 1L4KA 4G9EA 2NM0A 3ZLUA 3ZHUA 4JP5A 4MW7A 4D25A 1YGYA 1Q0TA 4WACA 4RTNA 2I67A 4F4UA 1JIUA 1T0JB 2CXQA 2FXVA 3H42B 3E70C 2C4WA 3FVVA 3MJHA 5HKBA 1OREA 4A8JB 1IN8A 1PNVA 1U9CA 2FQXA 4H77A 3THYA 5M2QA 2PYIA 1Y9DA 3HFRA 4IXNA 2GEVA 1T36A 3LT5A 4TN1A 3IMKA 3TR5A 3VNSA 1ZJWA 3E9YA 3LJKA 3EZFA 3RYCB 3R5SA 2VQSA 1RZ3A 4JZKA 2FSFA 5JDCC 1YQEA 3WLIA 1DAOA 1TCBA 3RU3A 2XB6A 1PT6A 4KPUB 1XZBA 1ZOSA 3VR5D 1Q1EA 4LDZA 2HK7A 3GZJA 2ZI7A 1MPTA 2YXLA 2QMQA 4P6VF 4XD7D 1O5TA 3LRPA 5HYVA 1AKWA 5J2UB 3ZV3A 4UMFA 2PGOA 1C0LA 1WZEA 3PRKE 3PX7A 4B4WA 4XWYA 4MW0A 1JIQA 2P41A 2QDKA 4V0QA 4AWXA 4JXXA 4CKWA 2OVFA 3KPYA 3ONFA 5ALKA 3I2FA 5FA6A 1KYZA 1Q0RA 2X15A 1SNYA 3KU4A 1X9HA 3PVCA 3QKUA 4BVLA 1OH5A 1FFDA 3RV3A 3WLHA 2FGJA 3TW0A 3SVZA 4BFXA 3ASVA 4CLEA 2EVWX 1NWCA 5DASA 5KYGA 4QYXA 4MINA 4TL8A 3W90A 1MKYA 5JNRA 5F51A 1GZ7A 2ZRFA 2X8AA 1E0JA 1FSGA 2XZTA 1STOA 1SURA 3LBHA 5AQ1A 1RIFA 4C6RA 4F1KA 5JS8A 3K3PA 4S04A 1PIWA 1LX6A 1Z0AA 1WBBA 3DTTA 3D6VA 4I9UA 3RTEA 4ZKDA 4G24A 4UCQA 1DCMA 2CEKA 1WHTA 5YASA 3X3HA 3T7DA 3QU2A 1TA9A 1E5TA 2E4YA 1JHMA 4DWOA 1K4KA 4ETWA 5KYVA 3WFJA 4KR9A 1AKMA 3FI0A 5G4KB 1Z6ZA 3SZMA 1GRQA 4EG4A 3X2FA 1WM1A 2E18A 4TSFA 3FI9A 3WL3A 3KZKA 1YB2A 4H3SA 3VR3D 1NY5A 4OAPA 2ZT7A 4TTAA 4MS3A 2O3JA 2XRFA 2IXGA 1YZQA 4M2LA 1NJ8A 2CEAA 4X1OA 1OLSB 1PGNA 4RZ3A 1GT91 1UEJA 1AG9A 1JYFA 3PICA 2HBRA 1A9PA 4PLPA 4A8PA 3F6BX 2O2JA 4LMRA 4YUWA 2NN3C 1EVQA 4IHQA 3ZGZA 3LYAA 5IANA 2XB9A 1O1YA 5AM1A 5J2UF 5KVSA 5D86A 3VQTA 1KGDA 1SHJA 3T35A 2MSNA 4FIZA 1JQLB 2CL7X 1GUDA 2PFSA 3TZLA 3T1YB 5EZ6B 3LLVA 1ZIYA 1TAUA 5SZJA 1OQAA 3EGOA 5JRJA 3JZFA 5A62A 2XMQA 1QVAA 4UJ3A 4A27A 1W6UA 3VHRA 3QEAZ 5GJBA 4FB5A 1WQ1R 4HH4A 1T25A 4NONA 2R7LA 5EJMA 1YMUA 3SHTA 3TQOA 2TS1A 3COZA 5K0GA 4JJZA 3RU2A 4UU7A 4ESEA 2YJ4A 4RC9A 1HYBA 2AJLI 3F7OA 1CF2O 2PL1A 3HJAA 3B3QA 3X1KA 1M5UA 3OPXA 1KEUA 1N6IA 1THGA 4ARAA 3H4IA 3QV1A 3QNUA 2PRSA 3OE1A 3G8DA 4IHJF 3TSCA 2O8BB 1AXRA 4IINA 4BNZA 2DHQA 1DXQA 2FA9A 1GUZA 1ZSNA 1YULA 4ODIA 4U6QA 2ZI4A 1ZR4A 3BT7A 1UPFA 4OXXA 2HDOA 1KQ3A 2G06A 1G9SA 4L50A 4JUBA 2FZEA 1CD5A 5ECDA 5C3UA 2PDAA 4CKEA 4KJXA 1CERA 2OCPA 2C5HA 1QRUA 2BKEA 4LWQA 2BC9A 2YHUA 4RGVA 1YFKA 3GWGA 3PFWO 4QXMA 3DC7A 4IO0A 1BKSB 1KYWA 4EY7A 3HZOA 4NSNA 2MDTA 3FIUA 1A04A 4L8WB 1PNTA 1DC3A 4BOYA 1C7FA 4KE7A 2B8NA 3F3SA 4R2MA 4HP8A 4RS3A 1Q83A 3REQB 2A4KA 3OBIA 2Z8YA 1TQ8A 4M9QA 2DPGA 3W8DA 3ASZA 5G1OA 3WISA 4DILA 2VAMA 1L0BA 1WR8A 4JOSA 2PGXA 4QRDA 4ZEWA 1GARA 2ZYVX 1DINA 4JLUA 1GM5A 2PKCA 5EFOA 2QTTA 3O3OB 1ORTA 1Z12A 4OA5A 4OI1A 4BQQA 3CSDA 1XVUA 3MCZA 4KE8A 4ZOLA 4GD3Q 2IQIA 2KSQA 3FSRA 4HBGA 2DHRA 3LHSA 4LZOA 5ALXA 5G3YA 3RAJA 4B3MB 4CMAA 1PFWA 1N2GA 1XZCA 4NWIA 4W5WA 2XMZA 3C24A 5CM9C 5BSFA 1RWBA 1C3OA 3A6FA 4RMIA 3UXMA 4DEXA 2C4KA 1FUKA 4WOPA 4XEHA 4DAEA 2O06A 2ZDQA 3B1WA 3NHPA 4R81A 4WKPA 3ZXXA 3L4KA 4UUNA 1HEYA 5AQEA 5FTLA 1Y3CE 3IR5A 4ZMBA 3FHJA 4JP8A 4LDRA 4PX3A 5CVTA 3A2MA 5I4CA 2BYTA 4F4IA 2QXTA 3LNCA 4QG7A 5JDIA 2BH2A 1Z5PA 2HU7A 1AX9A 4MV1A 5FPPA 4PG7A 2OFOA 4RY2A 3RC7A 1AXGA 2J9FA 4EUKA 5IAKA 4MB2A 1NN1A 4J6EA 1P1FA 3PWSA 1FX0A 4MI1A 1VE7A 2P2ZA 2FWAA 3K5HA 3KJNA 4NJOA 4CL8A 4PCLA 4XAQA 3LBFA 5ALNA 2GM4A 4LOHA 2Z98A 2JK1A 4O4JF 4D4KA 1B15A 5JYEA 1UFOA 1LI5A 2LKDA 3P2MA 4FE4A 3IVCA 4K40A 4XJXA 1HQCA 2GM9A 3L6BA 5AR1A 3AI2A 4GICA 2QNRA 1U2QA 2GDJA 3TOZA 2ODTX 3KOXA 4QOFA 5EIBD 5C1OA 1H2ZA 1V2HE 3IQDB 3WWYA 3SVLA 4P08A 3KUUA 2LCFA 4FYYA 4IPTA 5L8VA 2X5KO 1DIHA 3GIDA 4MWZA 4A2WA 3IEMA 2BMDA 3TZHA 2HNAA 2DCMA 2ORWA 3IL2A 1USGA 3CMCO 3IUMA 1PW5A 1Q1QA 3ANNA 1YJCA 2CXXA 1FRQA 4Y9RA 1DMSA 3INRA 3KBOA 3KPVA 3S1SA 4H6WA 4RDCA 3SNKA 2FGKA 1JAZA 3HJTA 1U7UA 2WAAA 1VSQA 4XZ3A 5BN5B 1OXSC 3FE2A 3VDRA 2UYQA 1H6BA 3IJ5A 3CX8A 2I1LA 1XVAA 1Z3CA 4ER0A 2FE1A 3E8XA 1T9DA 4KSBA 2TMYA 4JLAA 3G0GA 3W5VA 3ZD6A 5DXJA 1GCGA 3CF4G 2YVAA 3DA8A 4LCJA 3ZIAD 4H15A 3S8EA 3OD1A 3PHLA 2FQQA 5CVJA 4QYSA 1RXEA 4DQUA 3ZU3A 3O74A 5IP5A 4ZAYA 4HRAA 2FOXA 1QG6A 3GPIA 4S1OA 5AHXA 3PPIA 1YIOA 5SY4A 1R8QA 3QPDA 3PFBA 2OP1A 3QXSA 4CQLA 3WKEA 2HQRA 4ND5A 3AF3A 3F6EX 5CFMA 2RD2A 2J5BA 1IBMB 2ZWPA 3O94A 3KKOA 2MWMA 4GU5A 2ZIZA 3ED5A 4Q3KA 3QWHA 1A88A 3LUAA 4F2PA 3T4XA 2QSZA 3S7TA 1WPXA 3C3XA 4FDTA 4QHTA 5CYPA 4HB4A 3X0DA 2YCBA 3TGWA 1H8EA 3I58A 1QPGA 1X8KA 1K7SN 5ALRA 3V4FA 2C0CA 4A15A 2XNDA 3IAS6 3DE2X 5IW8A 1UBGA 1IXRC 1WL8A 1NXSA 5DM4A 1QSGA 4LXIA 5CLIA 2JF0A 3MBKA 4BNJA 1X0VA 2FRDA 4OB7A 5JH7B 5J5CA 4GOND 2GZ2A 4MB0A 5DTEA 3EOZA 2PRIA 1L5KA 1T3HA 2A58A 2J3EA 2VAVA 4BDTA 4F85A 2XCRB 3M6XA 4UXIA 5A5DA 1O6CA 3KV3O 2H7VA 2V4MA 3ZQ4A 1T8UA 3PNSA 3K4HA 4H3KB 2XKBA 3RPEA 3OQHA 3CA8A 4YP9A 1E89A 2FR8A 5CD9A 1XTBA 1UXJA 2AMYA 2IWRA 2YIJA 4N39A 2RCNA 3WFIA 1A69A 3W1WA 4JASB 4ZVOA 4B71A 1SBQA 1I7LA 3IBCA 3RODA 1N78A 1SHUX 3KZCA 4D8WA 3KQOA 1RZRD 4ZVKA 3G1UA 3PIDA 3A0UA 1IN6A 3IAEA 1VOTA 2GTPA 1L5ZA 3AYXB 4IUBS 3KZMA 3EDOA 3EPRA 3IHTA 1U9ZA 5DT9A 1QAMA 3NP7A 4Q3EA 5KTNA 2AZ4A 3DB1A 4WL0A 1EBFA 3CRNA 4S05A 1YQQA 2BGRA 2CLLB 3CUVA 5FBZA 2IKSA 1UBLS 4GQBA 1GWNA 1W76A 3JQCA 3T9AA 2ZI9A 5K3FA 1GAJA 1M72A 2G72A 4OHOA 721PA 2WT8A 3I9KA 4Q3OA 5DNVA 2GHIA 1KBQA 2JJ2A 2O7VA 2GDZA 1CUYA 4AYWA 3E3AA 3F5FA 2B1GA 3LPNA 2IWHA 2GZAA 2Z0MA 4ZGGA 3RYIB 3RYCA 1C9DB 1GD1O 1G6HA 2PFKA 2GNAA 2APJA 4CTMA 3LLCA 4X1YB 2O6LA 4XQEA 2NO9A 1JS1X 1POWA 1T3ZA 2MYUA 1M8PA 3NHAA 4GPEA 1TT5A 1ZN9A 2CLEB 2H08A 4ZOBA 4ZCSA 1QX4A 5J2UA 2ASEA 4LDQA 3E7FA 2V97A 3M4JA 1W75A 4GXRA 4PZAA 4WOJA 2MMCA 1N2XA 3C3EA 3OI7A 4RYDA 1QIKA 3HZZA 2OWDA 3GPDG 5E9WA 7REQB 1P19A 3LC2O 1LD3A 1Z06A 2BZSA 2WAMA 3CONA 5GPBA 4DLPA 1ZFNA 3VR3A 5LQUA 4LFAB 4Z8XA 3QVMA 2CV0A 2HBYA 4YN3A 1FFXA 1DS6A 1Q77A 1AS2A 2ORED 4YXWA 2XUJA 2H0AA 1W6RA 1A27A 5DLYA 5TT1A 4YJDA 3T1HB 4NG4A 3ILHA 3DC2A 3GJ4A 2H1HA 5FTMA 2Y0DA 1LU9A 3UK6A 3WIBA 3KQLA 2ATXA 4LC0A 2B3TA 2MHCA 4XGNA 3ZIDA 4EJ2A 5KPJA 4HYTA 1NLFA 1YFZA 2PQMA 4Z5XA 5ICCA 5AM5A 3ROXA 3TBKA 1NN3A 1U80A 1XTJA 1X7WB 4PO9A 3RRFA 4O2LA 3BMNA 2IX9A 1UT6A 2C92A 2Q4OA 2IITA 4OFZA 1EEHA 4PC6A 4RNCA 3ZNOA 4KDFA 4RQAA 4GI1A 4WESA 4YRTA 1KYTA 4FM9A 2F4NA 1M5TA 4DWVA 4FWBA 3W3ZB 2COEA 1A7JA 5JJBA 3KUCA 4IS2A 2O3UA 4OVKA 3TK1A 1LK7A 2WU0A 1EJ0A 2Z1DA 1ZQ9A 3MRXA 4R8KA 5CDTA 3D7SA 2JAHA 3JPYA 4J94A 2WAYA 4HGZA 4Z3KA 3D8TA 2IY9A 3HU2A 1BVYF 1Z7GA 2VUSA 3NBUA 5INTA 4DA9A 1Y82A 1W0CA 4PHFA 3QPBA 3ZHXA 3MFYA 2CW5A 3RSZA 4B3DA 2DFTA 4FDVA 4J3NA 1XL0A 1ZMBA 3PKZA 3RUAA 4DARA 2FR0A 3ZWBA 5HBGA 3AT1A 1XCPA 3NVKI 2PA3A 4HX9A 3RS0A 3TJMA 4LGCA 1FP6A 3GJ8A 3L9WA 4G1FA 1LPSA 1O2DA 1F2VA 2J48A 2UAGA 3QTTA 4MYSA 3EGCA 5DRTA 4D4GA 3S2UA 2OXIA 2DUWA 4K05A 4R83A 3DOJA 3EGXA 4J76A 4YVFA 5ADUS 2ZG6A 1QDUA 3LWDA 2PXHA 1LWOA 3U9SA 4KX5A 2CWWA 3FZYA 1GAQA 2ODAA 1YZLA 2Q5FA 3O4GA 5KKCA 2WFLA 2A1UA 4XA8A 1NKTA 3A31A 5JSFA 4CQNA 4B3BA 2WU4A 4YCSA 1UBUS 2YWXA 3I6MA 4ALIA 3DEFA 4CLOB 2QSJA 4UEQA 4CZ2A 3AB3A 4W1RA 1N4AA 4KQCA 2WHPA 4AY2A 3O7WA 4MUJA 3CSSA 4WNYA 2QX7A 4LHYA 1R9GA 1BVUA 1RM3A 4FDLA 5I7VA 4ON9A 2G9RA 2IX3A 3K9FC 2AE1A 5I8PA 1C14A 2J9XB 1E4VA 3ZLTA 2P6NA 1YHNA 2E37A 4TT3D 3LX4A 5E95A 2CVQA 1OYYA 3C70A 4Q1AA 3RQSA 3F4KA 3U4GA 3A4LA 3CV3A 4IVNA 3P19A 4EQ6B 2AZMA 3GUVA 2Q9UA 1FDUA 3RASA 3ZIAA 3MOSA 1EZ1A 1GPH1 3UHPA 1E4EA 1X7DA 3Q3GE 1NUAA 2QAGA 5BUQA 5IJ9B 2WNSA 5DGIA 3X44A 1K63A 4YCJA 2ACWA 2FW7A 4C5BA 4CM6A 3ZNPA 5FNVF 1K0FA 3F3MA 4V3BA 4YV1A 1W88A 3WG9A 4EX7A 3K94A 5EC8A 5KKAA 2OXCA 2DG2A 1IJBA 3FKSA 3QE2A 5JG7A 1UF9A 2H11A 3BWDD 3BWVA 2VPPA 2QX4A 2FPGB 1TIBA 3AR6A 3BCUA 3HJFA 3U81A 1GAXA 2I9KA 4S2EA 3CCFA 4IRMA 4N0EA 1Z0KA 4QNNA 3WYGA 1I4DD 2AH5A 2D4AA 4MQEB 5JCJA 2JGJA 3PJDA 1FTQA 3PEVA 2ZQYA 4PLYA 1WTCA 1JP7A 2DWOA 3GLHB 4KLZA 4DCCA 3MA0A 2QT1A 4PQGA 4YECA 3HB7A 3I9JA 4DG8A 1FQOA 3CLRD 5KKNB 1OA1A 3UK0A 1CYDA 3DWEX 3JASA 5KREA 2ZRDA 3L8DA 4RPHA 2CK3A 2I9PA 4R01A 2O1XA 1I4WA 4EECA 2Y0PA 1Q22A 2V8OA 4YGYA 3LVBA 5EA2A 3WWOA 4ZJYA 2QMYA 2YNMD 4F3CA 2C99A 1NYLA 4KMRA 4JU9A 3SLRA 4YRSA 1IIRA 4B09A 2PKRA 3RIGA 4MI3A 4C0KA 5FWXB 5JCXA 1VPLA 3I61A 3WC4A 1O94C 5H81A 5TJ9A 3VR6H 1UC9A 1Z7EA 4G4IA 4G0QA 5KOHA 1XGKA 1UM9A 5FWXA 1BDJA 1SK8A 1SVMA 3T7SA 3GJSA 2ZYTX 5I9BA 2B94A 5GM2A 3WL8A 4BQEA 2BFBA 3IMEA 3ROKA 2XB2A 2UZ1B 1G63A 1ZH4A 3T9BA 2BBTA 4K2HA 4J0GA 3ZI0A 1I7NA 4BNTA 3W3AA 5LLTA 1SCNE 2PR2A 4K3VA 4Q9NA 1YKFA 3KVNA 1ATIA 2ZRKA 4ADSG 2RAVA 3JQAA 1ES9A 1ZD8A 3JQAD 4O25A 3QHAA 3WSTA 1E0DA 3H86A 4PPFA 3WB1A 4DC1A 4OUDA 1U1EA 2C04A 3U4DA 4CTOA 3ONWA 5EXEA 4W5HA 3TRKA 3JAWB 4B6PA 1R3DA 3H1EA 1V1MA 2EU8A 4KIJA 4E12A 5J2TB 2PVCA 5CA0F 3IYLW 2DZDA 1NN0A 5FFNA 2Q5IA 1M8FA 3TDNA 1EP1B 2P40A 2JAWA 4G41A 3EASA 4ZQIA 1S0UA 2HJSA 2OCGA 4HDOB 4KQ9A 3UJHA 4AJJA 2AT1A 4MKFA 4R9RA 1RHUA 3SYRA 4KR7A 3PC7A 3A37A 2CVPA 2LPMA 3N2YA 2MJLA 4GLLA 1N8SA 2FFBA 2FJPA 2W6MA 2NVWA 4JJ4A 1H1LA 2QN8A 3NASA 3HVIA 3R7SA 1HO3A 1P17A 4NBTA 2R5WA 3LYUA 4M98A 1WCIA 5JATA 1NLUA 3FMIA 3FFBA 5TJHA 1RJGA 1MJHA 3D31A 4YAGA 4LXHA 4GRAA 4CM4A 4IJVA 1JBQA 2HU5A 1Z82A 3RVKA 3TECE 1SPBS 3E84A 2B1QA 3DAHA 3I9LA 4IV0A 5JAZA 2QY9A 3A9TA 3DXFA 2YBDA 1AVTA 3UTCA 1YKGA 2AG8A 4P93A 2JIPA 4EB8A 2JJYA 4L28A 4YCNA 5B3JC 2Q3HA 5BSUA 4MLPA 3WGQA 4XUGB 5JCZA 1CS0A 2ISCA 3CNQS 2R6ZA 3H04A 3NHBA 2JW5A 2Q3DA 2VWGA 3ILYA 3SC4A 4D79A 1I9CA 1I94B 1IONA 1G55A 1V16A 3WLFA 2Q2OA 2RONA 5JPCA 4MRNA 3TLAA 3LHIA 2GHTA 2B9EA 5C52B 5CH5A 3ZWYA 4BECA 3O1LA 1K88A 1P8JA 3W6NA 5BSMA 2C5BA 4U7JA 1CR1A 5GIOE 3N58A 4QOGA 1ZUIA 1J21A 2Z2YA 3KTDA 3U37A 3VAAA 4G26A 4CUJA 1VKNA 4W9RA 1RZRA 3AWIA 4BTLA 1JFSA 4CCSA 5FOUA 3SXJA 2REOA 1EP2B 1SBNE 2LXNA 1C9JA 3HEMA 4H08A 1QZXA 1UBSB 4WZAE 3T41A 4GAEA 1C9KA 1F8UA 1G9TA 1HURA 4B6JA 1EVEA 1WCYA 1A8PA 4PW0A 3UK1A 2VTDA 1C3VA 2XUGA 4F21A 5E3JA 3BFVA 2Q5LA 1SUBA 3AR4A 1Q0UA 1Y3IA 3GJQA 1XQVA 1UP6A 4QECA 3VMMA 4CF7A 3GLIB 4Q39A 4LVUA 4LS3A 4N5HX 3KZVA 1I4EB 4J90A 2ZRLA 2FYTA 3O2SB 2OUIA 3A1VA 3UA4A 5D84A 3KCQA 4YV2A 5L9AA 2GN4A 1T2VA 3THXA 5EVCA 4A1FA 4E14A 1QRTA 2R8XA 5ES4B 1L4EA 1EG2A 4CF4A 4YMVA 4AJOA 1JPVA 2ODEA 4XIFA 1UXOA 4ESOA 3U7QA 3BEDA 2J0UA 4TV9A 4HAUA 2DFPA 1HFWA 3DXZA 5B6JA 1R12A 3VZBA 4RWZA 4G36A 3HXOA 1TUIA 3SBXA 4OMFG 1UBOS 3LTEA 2CXPA 3M2PA 3MJFA 3DBRB 3AJEA 4QEZA 5IDWA 1ODSA 3AO0B 1PL6A 1A8HA 3JQ9A 1MJFA 3P32A 2HIAA 1JBEA 4UCXA 4TVOA 4FDUA 2ZBUA 4JX9A 4IQ4A 4Q4JA 1F3LA 2ODNA 3GLRA 4ABYA 4B76A 2CL6X 1VYUA 3K96A 4FU0A 3S29A 1UZNA 4F86A 2WZQA 5CIYA 2XW6A 1WA5A 3BVPA 3UUWA 5KJFA 3N6RA 4RY0A 2NXEA 2IYTA 3GBVA 4Z51A 1T34A 4B74A 2RGEA 1J0CA 5ICMA 3WAJA 1Y9ZA 3K0AB 1KS9A 1CUXA 1BDBA 5E6SA 2QE7D 5BN1A 1T3SA 4CKCB 4GPBA 2GD6A 3LFUA 5BNFA 4XFKA 5LYJA 2RGWA 3WO0A 1Y6JA 4PZPA 3NYQA 4PLWA 4FSXA 2V96A 3DCJA 1W93A 3OU2A 4R2KA 1V9LA 3ZY5A 2EKPA 4NPHA 5T8KA 1C8BA 2ZJ0A 3RLIA 2UUAB 3IAXA 2ZRIA 1W85B 5LZ7A 2ZYAA 4OTZA 2FLWA 1J23A 3RJ5A 5BQOA 4PSDA 1RBQA 3EG9A 1N75A 1U7OA 1KAMA 1NUTA 1BD3A 1PR6A 3ASUA 2DWCA 1WXDA 3BSWA 1EIZA 5FUYA 1TC1A 2V3WA 3DL4A 2JAPA 1F5SA 5C18A 4WD3A 4HQOA 1N0VC 4AZ0A 5GVSA 2M2IA 2BKLA 3PNMA 3V1MA 2Q6OA 4WRRA 1HZZA 3AI3A 2YTZA 4JBWA 2BGUA 4D99A 1XNQB 4YAUA 4M7PA 2P9QA 4IIGA 1B8VA 3SM3A 4M9RA 1GU1A 3QH4A 5KX5B 2ADFA 2H4XA 4LECA 1J1UA 1UIRA 4N9WA 4ENWA 1T5LA 1KMNA 3FYUB 4KXWA 4RZIA 3U7IA 2PT7A 1IFXA 1ZD5A 5IASA 3SX2A 1BVRA 2PKQP 4NYJR 3C85A 1N2JA 2X23A 3AB7A 2FB9A 4HAYA 1U04A 3ZU2A 2ISQA 4ZCMA 4JZYA 2WSSD 2AV6A 3C1TA 3R77A 5I8ZA 2AFVA 3DAGA 4G07A 4II3A 3WQQA 1UKCA 5T67A 3R7DA 3MYRA 1XHLA 2G1KA 2G5GX 3DZCA 4HH3C 2Q4DA 2SNIE 2VZ8A 3MQ2A 2BBWA 1FRNA 4IH9A 4R3UC 1NVTA 5TE9A 2P67A 4ZU6X 2CLSA 1CDZA 5B1SA 5CDGA 4JI2B 2ZJAA 4UQOA 3JQ8B 2ZSKA 2QTFA 1UPCA 3D3JA 1GQFA 3VZQA 4NOMA 4TMXA 3RYTC 5TS2A 4H3HB 4ACAA 1B93A 3QPAA 3AL0C 4LV8B 4RE6A 1E6CA 3CPSA 2PNJA 2RBKA 3JQ8A 5ANRB 1SUEA 1YH3A 4UHKA 4ZI5A 3HB4X 1QPBA 5A06A 3A1CA 3V42A 2HA4A 5ESWA 2HMYB 5DT2A 4KGZA 5DGDA 1YD7A 1EB8A 1XMXA 4ZYYA 2L82A 3RD5A 5EQDA 3W8EA 1R88A 3U3JA 1QYDA 3RU9A 4D1YA 2ZGVA 3WI7A 1G8JA 3L8EA 4M6WA 2C61A 1NI5A 1XJWA 4W8OA 1G60A 1UBKS 3GJXC 1LPBB 3WY9A 4A9AA 3DNPA 5ICGA 3R3ZA 4TMKA 5K8LA 3T9FA 2EBUA 3UYKA 2HQ1A 1SBTA 2ZVDA 2QVCA 1MX9A 2H6EA 4S1TA 4V0LA 4Y1RA 1RRGA 1SD2A 2H1RA 2X9NA 1SKYB 3L40A 1JFVA 3QK7A 4E11A 2H2FA 2ZJBA 1IXSB 3PSHA 4GPD1 1FDWA 4Q01A 2VNJA 2X0FA 1B73A 1JRLA 5ISMA 2EP5A 2DRIA 3TFWA 2GXSA 2VKQA 3ORHA 3GNQA 5TV2A 1L4LA 1EQUA 3DMPA 1CNFA 3MPOA 4OQDA 4B9EA 1KK3A 5CEFA 5KBYA 2BCGY 1UQTA 1PL7A 1X7YA 3ESBA 1OF1A 4XLZA 2GERA 5AOCA 2C7GA 5JADA 2P8JA 1V5EA 2I3AA 2C9DA 2MIIA 2A6PA 1N2CE 1EK6A 4IBOA 3PU6A 2Y1GA 4B6OA 1LBTA 4E15A 2V65A 1XC7A 1WO8A 5JXGA 4M36A 3RUPA 4GR9A 4DGSA 5KAPA 1SCUB 2O7QA 4L5YA 4ERXA 1V5FA 2H5JA 4QM6A 4IYRA 3KOZA 1J2TA 3L7BA 5JHGB 3RAEC 4JI6B 2I6GA 3E7XA 4WJZA 1KI1A 3HCCA 2J6CA 1L5OA 2XSZA 3GELA 3I4FA 1AGPA 1YASA 4B4OA 5C8YF 5KWIA 2ZI6A 1CBUA 5DTIA 4JB8A 4I1PA 2QUJA 2QZ4A 3FCUB 4FMDB 5DULA 2W2MA 4EJSC 1CE8B 1J49A 1FUEA 1CIJA 4LXXA 4U2FA 3BF7A 3DLTA 1HZJA 1QO9A 1SQGA 3OCUA 1DKRA 4AAYA 4TLEA 1VMIA 3F5MA 4Z4IA 4I9NA 2H3HA 1M6HA 4QODA 4KR6A 1VGVA 3R74A 1X42A 3EC1A 4MVJI 1I2CA 4IQ0A 1MMFB 2EGHA 1IXZA 1J1ZA 2IYOA 4NATA 2R8BA 2GR9A 4DGQA 3SYMA 2GK3A 4IDFA 4P3OA 1UMBA 3BE4A 1N2EA 3HZHA 2BEWB 3R3WA 4LJYA 2AOUA 4WA7A 4AULA 4E30A 1Z4QA 3JVIA 4INJA 2P9JA 1DQRA 1P62B 2ZDGA 3RABA 1JLSA 4EMBA 1O6ZA 4D92A 2ZYIA 2I7TA 3H83A 3U4HA 1CYEA 4PIMA 2GD1O 3K6KA 2PG3A 5ECYA 1JHDA 3ODGA 4QGHA 3WGIA 2IZ7A 1HDOA 1YQWA 3CB2A 3O4FA 4UXJA 1O6FA 2JD2A 3QELA 5AJYA 1ZCJA 3NKVA 2WM3A 1UJBA 2I4TA 2BZGA 4L95C 4M1SA 2PH3A 1G21A 1O96B 2VDWA 4M8NE 1EUDB 4C7OA 3H6GA 3CKLA 5DBIA 2FSVC 4G8BA 2WC1A 2WK1A 1B1CA 1T1EA 3OQ6A 1A8SA 4NCIA 5CW2A 4BB9A 2DH6A 1LJ8A 1A9YA 4LHZA 5IAEA 4CEJA 1KJJA 2GN2A 3RF7A 1GN9A 4IIVA 4AZ3B 4NBUA 2RAPA 4LQ4A 2IPNA 3LUBA 4GG1A 3UJBA 5B3LA 4D9IA 4QJ3A 4LF9B 4YCMA 4C89A 2PTGA 1GZVA 4PHGA 5DLEA 2AC4A 1NMXA 2PT5A 2R8PA 3DTYA 4UBJA 2P4HX 1KEEA 1TM3E 3NOVA 4L6CA 4I3FA 4I3GA 4TRMA 5FEMA 4HNVA 2A59A 1GG2A 4TTPA 1GILA 3QXJA 2K5UA 5D3MB 3V1TC 1EQ2A 2BELA 3LPLA 4PTLA 1LZLA 3AUYA 1Q7GA 4N6GA 4X94A 3DFKA 4ND1A 3VDNB 2L69A 7ADHA 5KYYB 1G3RA 1VGRA 2AFRA 2HSWA 4JYCA 4YY3B 1HMPA 2QEQA 3ZHQA 2R0QC 2XNDD 4MW5A 5GP1A 3GLGA 1NIPA 1WLYA 4WFKA 5CURA 4UVEA 1TF2A 1I7DA 4OKIA 1JI3A 3O5AA 3T4UA 3UW1A 7REQA 1R0WA 5KNBD 1AY0A 5CVCA 3Q87B 2QW8A 1MX3A 5EE5B 2GZRA 4C76A 3HSYA 1A9QA 3IOEA 4NRDA 3WICA 2AOTA 1MRZA 2ODPA 4ZVPA 1GDDA 1PHRA 1XDSA 1WW3A 1W46A 4KFSA 4MO9A 3OE4A 5L95A 2ZSHA 3DE5X 2B6HA 1F3OA 1I3KA 2CNWA 3C5EA 4JYBA 4YT5A 1QR6A 1Y7TA 4J4TA 4TLBA 3FVRA 3R4VA 4UBOA 3TL3A 1KIMA 1JQBA 3UM9A 4ZYXA 4DV3B 5K9ZA 1ZICA 4U5QA 4DJTA 5LQRA 1UPTA 4PIPA 1VC2A 3DLBA 2QTGA 1R0XA 4AS3A 3JYOA 1ZGBA 1CDOA 5LIPA 1JE1A 1RZVA 2JIQA 1BWQA 4YUYA 1YR6A 4MV8A 4NI5A 3ETDA 1W30A 5DBOA 1QH1A 3UV7A 3H9GA 4A0FA 1OPXA 4BJHB 4CMJA 1T8WA 1ZJ4A 2VP0A 3O8QA 1SVKA 3CEJA 4HWSA 2PUJA 2X9VA 3MJRA 3ZUGA 5LMCA 3NBXX 1MHTA 2PUCA 4A5SA 1LKZA 3L9XA 3AUJB 1XQXA 2PS0A 3H11A 5CA0B 3FCAA 3NC1C 3CIFA 1GTG1 3QUAA 3W9BA 3CUEF 1UR5A 1R6BX 1UKVY 3GGSA 2NUPB 3LUCA 4I2NA 4HGOA 3WIUA 5HUQA 4RSGA 1DJLA 1JT9A 2FEOA 2HM7A 2YIVX 3D0KA 4MVJG 5KS2A 1RXUA 3LL4A 5JSYA 3OCYA 3ZV4A 4PZ9A 2DGDA 4PX9A 1NOIA 3DV0A 4YHBA 4OSEA 1A4XA 3HDQA 1DKLA 2C3PA 2XNCA 1Q5PA 2B34A 1WUJS 5KMGA 4P2GA 1C4XA 1SOAA 1OFIA 3BQ9A 4BQFA 4J2TA 3TLYA 1NQ5A 3MWLA 4E1BA 3K0FA 3I2JA 1DXHA 2H18A 4LE1A 4XUDA 3N70A 2VUUA 3ONNA 3QYJA 1T8PA 2VEDA 4AIIA 5M3BA 2OXEA 3I2GA 4AKEA 5JMOA 2V6IA 4CFSA 1EDZA 1W52X 3SS7X 1P4GA 3N2GA 1TMKA 3LO5A 5E4FA 3V00A 5F23A 5JI3E 3IKTA 2FFQA 1EP9A 3VJRA 4KFTA 4BX9A 1DCFA 3DE7X 2IEZA 3G2QA 3PUHA 3N05A 1PCXA 4JC5A 5E8JA 3A9UA 1IWPB 4AJLA 1RYBA 4B3JA 2OO7A 1BG6A 5A2GA 3OECA 4D8VA 3ZH9B 1WNTA 3DW3X 4HR7A 5IARA 1NP6A 2EW2A 2RK6A 3CR3C 2VAPA 4IM7A 4W5QA 3LDUA 1PYOA 2AG5A 2MINA 4ISBA 3T7CA 3T1VA 2GGSA 1V4NA 3WZMA 3AUSA 3EQ7A 3PI6A 4B6EA 2C03A 1JZQA 1FDVA 3IQHX 2O1WA 1ZGHA 2CFSA 1SO8A 2HUPA 3GN1A 3KO8A 3H4VA 4U5XA 3QOYA 5D5HA 3PL1A 1T0PA 5JI2E 2R44A 3OMLA 4E5PA 4Q15A 1E1MA 4C3ZA 1QNFA 3ONEA 3T9DA 3CO5A 1RLOA 2JA1A 3NEAA 4O2BB 1NF3A 1ISSA 2H1SA 2VUHB 3BMXA 3DBHA 4OGLA 1AKTA 3ZWVA 4OXIA 1GADO 1H9CA 4AMZA 2HX1A 1GQ2A 2BKAA 2FW6A 3CUSA 3EXG2 1CZNA 3SJAA 3EC2A 5LJIA 4H7PA 4FHDA 1DFHA 1NNLA 4KGDA 5BN3B 4A03A 5A4MS 2GD0A 1YACA 3IESA 1KI9A 1IN7A 2QENA 1TNDA 3DEJA 3MEQA 3BIFA 3PLRA 1AC5A 1E7MA 1N5MA 3C3DA 3E5HA 5C46F 4F6CA 1MNQA 2GUGA 2O52A 4KGXA 5I45A 2IYWA 4JMPA 3EHEA 4NG5A 2FF7A 3B9PA 4E33A 1M2VA 4HWOA 5JE8A 1N6OA 2K87A 1S1MA 5DMHA 2P69A 5H4GA 4MV3A 1H3EA 4F6RB 3CF6R 2BUCA 3KDSE 3Q0IA 2XCOA 2XF2A 2IXDA 3REOA 3S1LA 2R6FA 4FMCF 1RVV1 2W2PA 1PSDA 3CVJA 2QLJA 4J0CA 5CB8A 3B12A 4KU4A 5K6TA 3KTOA 4N41A 3JYLA 3O9VA 3NETA 2DBYA 4Y6LA 5IBRA 3SK0A 4ZAZA 4LHXA 1OBVA 4W63A 2AEMA 3MNFA 1D2MA 2WWFA 5AI6A 5JNTA 2LUOA 1IOZA 4L8VA 4ND7A 2RIPA 2ZE6A 2VJNA 2DUMA 4OBEA 4CN8A 2N42A 3FJ1A 4JD5A 3AVYA 2WQ7A 3QVJA 2C7VA 2QRVA 5BOSB 4W1SA 1E94E 4OX9B 1EESA 1GTMA 5E0KB 4LHWA 3CVYA 3SY8A 3PQFA 5CX1B 2PMDA 4DWJA 1QFJA 3A1SA 3R8CA 3JAWA 1AK2A 1DWPA 1MIHA 1V1MB 3ZD9A 4PRZA 5E6UA 1XCLA 4O0LA 4RZQA 3S2GA 2RGDA 1M2WA 1R10A 1ZH8A 3B6ZA 3WL5A 1APBA 1V95A 3ZI7A 2GYYA 1CR6A 3IUNA 2DLCX 2HA7A 2YNMC 2ZIEA 2ZPUA 2Q6VA 4Y6OA 2WPDA 5K0SA 4EGFA 5F5LA 1LTQA 1CXZA 1FFBA 1X1EA 2CLDX 4L4UA 5JZMA 4P7GA 2A9JA 1PJAA 3AEKA 3AJAA 3BFKA 4KLAA 4OQQA 4RJIA 1H1LB 4KBFA 4MK4A 5DIFA 4UNRA 2RKOA 1WSBA 1PJCA 2VH1A 1UXGA 2DBZA 2I3ZA 2PCJA 3BERA 3NC0C 5LMNB 1IRXA 3HVHA 4B6QA 4A6DA 2I4OA 1XP8A 3GX1A 1QUEA 4NBKA 2HHHB 1NZFA 3TLBA 4AY6A 1HSZA 1CR0A 1SUFA 2V03A 2O59A 1VXOA 1L5MA 3SEZA 4IILA 2R96A 4RGYA 1VZ2A 3FF1A 1XJQA 1RACA 1J9EA 5AMXA 3S1AA 1M2KA 3D0OA 1QQBA 5CT4A 1LLUA 1Y1KE 3AUUA 5KNCA 3FGOA 4ZC8A 3GT3A 1GXSB 1GKKA 2OGWA 5BYJA 3OX1A 4NICA 2IOFA 2CJPA 1XQ6A 4HGQA 4EVQA 3EXG1 3QPCA 3IELA 3HCEA 2GAOA 3T3EA 1M1NB 5BUSA 1PFUA 2X4LA 1NBHA 5DWVA 4O4HF 3L0BA 3K9HA 1NW7A 1U7WA 4DJAA 5HOQA 4YRDA 1T6BY 1PSZA 1VHJA 3ZDFA 1O7JA 4PO3X 1ZM9A 2HWUA 4ZMRA 3ABSB 1A5AB 4BV8A 1U4OA 1YK1A 2ZS9A 2ZR0A 3JZAA 2H4ZA 2LDBA 2RG7A 3FJYA 4QKQA 3CLTD 1B8PA 2NQ8A 3IEIA 3VPSA 2AXPA 4XRGA 1XTUA 4N76A 2ZJ3A 3GU3A 2FPLA 3DDZX 4BLPA 3KKEA 5COBA 3W04A 1O8CA 3OQNA 1YRYE 3FIJA 4BGUA 3R9XB 3PJRA 3AG5A 2O5CA 2NNWB 2ZRCA 4B84A 2B5OA 2JCVA 2REQA 5DFAA 4KV7A 2CBZA 2IRWA 2H8GA 3AF4A 4PICA 4FC7A 2QLLA 4MEJA 5AXBA 4W5OA 3Q11A 4G5FA 4OYLA 1J0BA 1WVGA 1CDDA 4O4HB 2X4GA 5E2IA 4E6EA 4JBIA 3I01A 2G5PA 4BFTA 2JLBA 3I76A 4E32A 1E32A 5JEDA 1RRPA 3GFQA 5A3SA 1MAUA 1NGSA 2VN8A 2YW2A 2AG0A 1KVQA 1OCEA 2HBQA 5JD3A 2B7LA 3GXOA 4YMUA 1BH2A 4N6OA 5FUVA 4CFYA 1M9NA 3U39A 4CV0A 2TECE 4IR7A 4JYAB 3LWNA 1K3TA 1T43A 2WJ4A 2X58A 1ZXXA 3IERA 4R1OA 4Z4FA 4RW0A 4OHBA 1PTKA 2H85A 4TYMA 5JS6A 2AS0A 3ZE9A 2HV9A 2I2WA 4GO1A 3BGSA 4KG7A 4BRZA 1EKXA 3U13A 3TIVA 4PBSA 1G5TA 3P5BA 4P38A 1CJKC 2OV6A 4DQDA 4LYGA 5C4GB 4B3GA 1GNVA 1OKKA 2Y0BA 4K6OA 1DHRA 4YXFA 1JG2A 3LV8A 4O33A 5LQNA 4RF5A 4ZQEA 2AHRA 4ED9A 4L9RA 4MVJH 4TV9B 1M5RA 2OBXA 2YW9A 4EAQA 3MINA 2WOJA 2XEXA 1UMDB 2YOHA 2GCOA 3UXYA 4RK7A 5SZKB 1A2KC 5GV7A 3B6EA 1RCUA 2Y1XA 2Y2VA 3VNRA 1A4RA 4EARA 2DVMA 1VECA 3LS2A 4EJ0A 1QMGA 3A9SA 3OTGA 2CLKB 3H2KA 2B78A 4XTRA 3PGA1 4PSCA 2FSSA 3U7JA 2UZ4A 1CRWG 3DMDA 1BSVA 1QGZA 2LBPA 1IZ7A 2D5IA 3R3SA 4BFWA 4CM5A 3FSGD 1E6WA 4KXNA 1IQUA 4XI9A 4ZQBA 4FNOA 1A72A 1QHGA 2CHGA 2QPAA 2R4TA 4NBWA 2C5SA 3V2HA 2ZS8A 4BNIA 5HFAA 3W5CA 4UULA 3EQ8A 3GQVA 5HQJA 4EYQA 4F92B 2WFAA 3ETHA 3MCTA 1RU3A 2BOVA 3QMVA 3DDHA 4ZPXA 1K27A 2B3DA 3ZEIA 4XWAA 1UDCA 1ARZA 3M33A 2R7KA 2JGKA 1EBUA 3Q3CA 4PC2A 4PFSA 4L7VA 3ZGLA 2R47A 4XYGA 3NH9A 2NT4A 1DUIA 4I19A 1ZN7A 4HYQA 2BMFA 4NU5A 3V3KA 3CPEA 2DE0X 4CW7A 4F7DA 2BEJA 3M3HA 3RSHA 3KEOA 1YRHA 2MMGA 2XRYA 4C43A 5LA6A 3DD5A 3RHTA 1C3LA 3TR0A 3WOHA 1MABA 1V6CA 3MTBA 1Z17A 4RELA 3RS9A 3HI4A 4X61A 1G5PA 5EJ4A 4QWMA 1MVOA 3HV2A 4EW2A 4MARA 4AUNA 3AY0A 2ODWA 1DRKA 3FXAA 2Z3WA 4EUNA 5ENVA 2EQ5A 1IN5A 3VR5A 1QM5A 2D7JA 3N86A 5ALSA 5BV8A 4QUKA 1H0RA 2H2GA 4PN7A 1E3WA 1WPRA 2VH5R 3LXXA 3PS9A 2VHJA 4FFBB 4JKOA 4MRAA 3EPJA 2W6CX 2XVAA 2QN2A 4NZZA 4NE2A 3TM4A 2HWYA 2B4TO 1ZU5A 4FNGA 1N6HA 3AZQA 4KXFB 2XE6A 1K6IA 3UXHA 5CFQA 5LKRA 1DEHA 3B51X 1RMYA 1ONOA 1M6VA 2X2EA 4LDNA 4W8GA 4YYEA 1BXRB 3NBAA 1LPOA 4RZ2A 4YXWD 3F8TA 4HZGA 1NUQA 1OXKB 2B35A 4UNSA 5FBLB 2AR7A 2QD4A 2RI0A 4N1AA 4DM4A 3Q8KA 3TTWA 1U65A 1IUKA 1L4FA 2PPLA 2KLHA 2W8BB 3BWCA 3FPHA 1RRMA 2VHVA 1R5BA 4X8HA 3LT0A 1E2DA 3SZLA 4BVHA 4E21A 5J43A 3H9CA 2DQYA 3QKIA 3H2GA 4YRJA 1FS6A 3S2EA 1BVHA 5F78A 2Z9BA 1QZTA 5JW6A 4L07A 3I83A 1E7RA 3EVAA 4DCPA 3A8TA 2QNBA 4R6XA 2OV2A 3W2IA 5HW0A 2O2XA 3QVWA 2ZVQX 3OICA 4LJ7A 3AJRA 2CDBA 4FSHA 3AHFA 5E4TA 4A8JC 1BEEA 2EZ9A 3MT7A 3RM3A 1ZL2A 2UKDA 2VO1A 3K5WA 3FOZA 1H2YA 4HNAA 2AQHA 2WFLB 2B4YA 4QUDA 4R5HA 2D1TA 4DDKA 4LHSA 3HDVA 1QO7A 4V2IA 5JQGF 5A7HA 1KI3A 1Q0LA 3W2TA 4BLWA 1WMFA 3GZNA 1EXNA 1L4GA 4QVKA 1SOMA 5F2EA 3IQFA 3U61B 4P0PB 4JCOA 3P9XA 1DTWB 1S7CA 1O94A 5DCYA 4RHTA 3ZDDA 4OUKX 4QVIA 3OJWA 1N1MA 1SN7A 1BQ3A 4HN2A 1XRPA 4ILEA 1BJTA 1WCWA 5EP4A 3EDYA 4MI9A 4MKIA 3PUJA 1UJ5A 4DMCA 4UFNA 1PJ3A 4BV2A 1VE5A 4EEZA 2AZDA 1H2AS 3AUAA 2FPWA 1FYWA 1Z0IA 3TSZA 1ZJYA 3TGLA 2FN4A 2ZIVB 1PUXA 3RB8A 4DIKA 1JDNA 3NCTA 4FLMA 1JLHA 4WNAA 3LOQA 1M54A 4Y30A 1ZC4A 1XDUA 4IDOA 2VATA 3UT5B 1F8XA 1Z37A 2PLWA 2YIMA 3BGOS 3QU5A 2VG8A 5AKJA 4CUZA 4YJ2A 2ZCJA 3HNPA 2OAP1 3KJEA 1Q1AA 3I28A 1CQWA 1OBHA 3QF4B 3U3XA 1KA9H 4XB1A 4PFQA 3SIPA 4QOIA 1WZ2A 2VSFA 1EGHA 1WB4A 1YE3A 2XAAA 4TROA 4X54A 4CDRA 1JZTA 2F3QA 3TJRA 4UHCA 1NLYA 5KJ1A 3DBLA 3I53A 4G01B 4G4SP 4LXGA 4WY2A 4BP1A 4FTWA 3I2YX 3PITA 2DQKA 5CDFA 3PLNA 1RP7A 1YB1A 2J30A 4IHJB 1QB8A 4W6ZA 2ZYDA 5C34B 3WL6A 2O8BA 1S9DA 3TQHA 4QGAA 4ZZ0A 3IPCA 3FG9A 2CXRA 2JATA 2ZJZA 4EKIA 2P6OA 2YJTD 2HXGA 3KK0A 4X45A 5GVRA 3JASB 3ROTA 1XRJA 2AGVA 1Z13A 4FFVA 3VUEA 2NU9A 2GA9A 3CQ9A 4RXUA 1BROA 3SZOA 1R4ZA 1UAYA 2C31A 1KTVA 2DLNA 3GUCA 1ESZA 3GCGA 3RUCA 1B76A 4XRRA 1ZA2A 4HEA1 1XLUA 1L8QA 4QQNA 4RIGA 3Q15C 1I1OA 3SU8A 2JLYA 2Y71A 2V6FA 3FTQA 3N28A 4PLCA 2R86A 1II9A 1TCUA 3IE2A 4M37A 4AT1A 2C42A 4KYTA 2CFTA 1L3CA 3NGLA 2VCHA 4C4PA 5AW0A 2PWZA 5I3ZA 1OFGA 2XB4A 3WFZA 1GPNA 5HIIA 3OSZA 3CF0A 5ALPA 4TLCA 1PV2A 4RVHA 1WW8A 1S1CA 2VJDA 1XMQB 3HBNA 1I8TA 5TQ2A 4UUPA 4R4JA 1AMUA 3V4RA 1WDKA 2H2WA 3D8NA 4L76A 5IAAA 1ZRMA 3RC8A 3NDIA 2OC4A 2ZWAA 5KOJB 4PLTA 3UGQA 1NNUA 3T7EA 5EI5A 5ITVA 1W87A 2XVXA 3EDCA 2IS4A 1KJYA 3ICVA 1C50A 3WWZA 5H16A 1G9XA 4LRXA 4B3XA 5FHQA 5D7BA 1GPJA 1OWMA 4YMTA 4PU0A 4B3HA 3LQYA 1K9SA 4L4XA 3TNJA 5BNZA 2OZPA 1RLMA 3K2BA 4BX2A 3B6JA 1MO2A 4LW8A 2ZQZA 1TYDE 4PIVA 4IICA 5F7ZA 3P2JA 2ZTMA 4IV5A 5BR7A 8AT1A 1E18A 3WLLA 1TUGA 4A0HA 2A67A 3R1IA 4LSWA 2VDUE 1Z4KA 2YJGA 5H02A 4QG3A 2IPLA 1YKSA 3HGTA 2OCXA 4MOWA 1KSFX 4ZO6A 3U0VA 3ZE7A 4B0PA 2V1UA 2P2LA 1U31A 5CNJA 2V45A 1GVNB 4XTCS 4EMSA 2QRMA 4ARUA 4AJ4A 3FY4A 3H4TA 3PR2B 3KCNA 4I8XA 5BMOA 3KJIA 5LIRA 4OKNA 1NJ6A 1QVRA 3FJOA 5LFAA 3K05A 4XFDA 3ROZA 3ZDQA 3ZDAA 1YOVA 3SXUB 5CH8A 4BL5A 5DXAA 4UM7A 2YY7A 1RCTE 1K9VF 2ADMA 3MLBA 3Q2IA 4BKUA 2NW6A 4LV5B 1P4HA 1Z6PA 5DRYA 4FR0A 1YRWA 3IPAA 4J75A 3WL4A 3EMKA 4XM2A 2HHAA 4HADA 3KUKA 1M7GA 1VSVA 2YASA 5CFOA 4JQCA 4K46A 3A05A 2W11A 3WNVA 3NTLA 3UZUA 4EHHA 1JQ3A 3IPRA 3NUZA 4PPNA 3EMVA 2OP0A 2BLLA 4GOKA 4MRMA 4R54A 4H9GA 1EZZA 3BXGA 4JA0A 3VZPA 4DLAA 5ESDA 5AJHA 1V41E 2HH9A 4IYJA 4ND8B 5FWNA 4UHBA 4BMNA 2OHFA 1I5OA 1J2JA 4IUYA 4EK9A 1D8TA 5J23A 1PJ8A 2Y76A 1LS1A 1Q50A 3IV9A 3PHIA 5FWYB 4QL3A 4Z86A 2D8AA 2LZ0A 2X8JA 3VR4D 2RARA 1KI6B 4XW2A 5EWJB 2K2WA 4Z49A 5I47A 1C4OA 1H2RS 1UKYA 2G82A 1GYQA 1CQIB 3ELYA 3P96A 4WUTA 4WZBB 4B79A 2PS1A 1M0EA 2A4MA 2I8AA 2J0SA 4B8ZA 5IWCA 1PQWA 5KTYA 3KL4A 4TGLA 4CG2A 1LEHA 2FJ0A 2JH3A 2WM8A 4NJMA 1B1AA 1Y9AA 4G8JA 4DCMA 3D3EA 5C31A 5G4KA 4DHEA 3ABZA 3KZNA 4WBNF 3QUCA 2NTEA 3JALA 4LQLA 2I33A 2RH5A 4U1RA 5ALJA 3BTOA 5TPWB 1WLSA 4ZANA 3M1AA 3E9NA 4YRMA 1QLWA 2O8FB 1ZRNA 5IDVA 4XXHA 1RD4A 1LSUA 3UAOA 3HY6A 1OZHA 4WESB 5LUAA 1WQ3A 3KE8A 3LOUA 3G3EA 3KX2A 5HM8A 2PJUA 3Q6NA 3IP5A 4L15A 4HSEA 1TB4A 4AJKA 1R9NA 2VPQA 3EX7C 3PA6A 2C8VA 4PRLA 2Q49A 3NIBA 4FONA 4L7QA 4Q3BA 1NVMB 3D8BA 3E2MA 2GPBA 4Q3AA 1BRTA 4MHTA 3AL2A 4CLRA 1CZKA 3JARB 2PMCA 1XO1A 3BRWA 1ZUNB 3UXEA 4Z2YA 2NVBA 5BOVA 1ONSA 3LRXA 4OFXA 5L6LB 1BHJA 2YR0A 4QU0A 2G9NA 1M73E 2IL1A 2OXRA 2GCOB 1QP8A 1YI1A 4MUIA 3TH5A 4O2AF 3WL7A 4AYXA 6PFKA 3QMPA 4URXR 2QMHA 4X62B 1UBJS 1QGYA 1PQYA 3TQIA 3B8HA 1KZGB 2WG1A 2PT9A 1S2IA 1FVHA 1QV9A 3DJFA 3JD3A 1BCSB 3UPDA 5I7EA 1FIUA 1NDUA 2C78A 1UT5A 4EHNA 4FX2A 1RYDA 4EFDA 3ZZTA 1NBAA 2OEPA 3RF6A 4GKKB 5LQCA 2C59A 3KYBA 4NLLA 1YDGA 1TL7C 3MCUA 2P2GA 2YZ2A 5FCDA 5JSUA 5HIJA 1J42A 3IKMB 5KSZA 5AKGA 2WIKA 3K1AB 4C30A 2VHYA 5C1IA 1BX0A 3ZV6A 2FZCA 3C7TA 3LD9A 1WD7A 3RG2A 3WO1A 4EJFA 1S3SA 1P2BA 4NDAA 1QHXA 3WXMA 2JD0A 3PFGA 4ALNA 3T3OA 2FETA 4PYMA 4R68A 1QU3A 1EEXB 1PHPA 3GOHA 3LP8A 5IJ9A 1CHDA 4FYMA 1MC8A 3OT4A 2E5LB 4YI5A 4WKGA 4BQPA 2H2AA 3HSKA 1VL1A 3W9SA 3DBHB 1TJPB 2ORVA 1P8AA 3KVRA 4P4SA 3E53A 1T3GA 2RHJA 1SVOA 1QKKA 3FZEA 2QOEA 3QWAA 2YL2A 4PXSA 3WYCA 2ZPTX 2A88A 3D4BA 2QLFA 3HKEA 1QF9A 4H0FA 1MO6A 4IZIA 3RK1A 3DUFB 1CS4C 1T4CB 3UJDA 3VBEA 3VRHA 1YR9A 1INLA 4OFWA 1QQ5A 4TUYA 2QYSA 3VH2A 3IJEB 4YYZA 5K3CA 3LVFO 1RHRA 1FFSA 2ZRNA 5LR6A 4QGGA 4J0QA 1T2AA 1P1RA 3IAM6 5D6NA 4RTPA 4X63A 2XEDA 2C00A 4I5GA 3T1TA 1I0LA 4FGKA 2GVDC 3EZNA 4DXDA 5A4JA 3QMWA 4E88A 2BM9A 2P0AA 3OF5A 1UPBA 2WWWA 4ZYTA 3AP2A 4HEA6 4BEVA 3MGGA 4BATA 3B1ZA 1L1RA 2DR0A 5SZHB 4E51A 4KQKA 3C3MA 1UJ2A 2HHLA 1R74A 1N1GA 3PEUA 2Z6UA 5KVVA 3PQ5A 2REBA 1Q44A 4P4NA 3TQCA 4DPLA 4ZHQF 4X1KB 1FZQA 2V98A 3MJTA 3R6WA 4KDRA 4R9SA 3RS8A 1DC8A 5I5EA 3KQKA 4BO3A 2Y66A 3WSWA 3BSFA 3LOPA 3QKTA 2VJAA 1E2HA 1UM9B 5TR9A 3N6XA 1XZAA 1JQKA 4TQ9A 4DSTA 4P53A 1LBQA 1OXBB 4DFDA 1GUAA 3PXEA 1GKLA 2B82A 4WQMA 3AF5A 1XCBA 2GM5A 3AX6A 1XRRA 3K0CA 3AEKB 4LCEA 5KNCD 3C3AA 2EP7A 1W47A 1C1HA 2H17A 1EWKA 4UZEA 4AF8A 6ABPA 1RMTA 4Q1BA 3MUOA 4A6PA 5AVYA 1RTKA 1OA0A 4FZJA 5CDYA 2H31A 1W35A 1ZRSA 2WSYB 2X0DA 3RRZA 3TMKA 1VLVA 3IP8A 5CTAA 3QNMA 3UV3A 1HNXB 5DNUA 1GR1A 3B82A 3BDAA 3FYCA 3QUTA 1DP4A 4UEOA 1KVSA 1E1QD 2X19A 4KODA 2W0SA 4DEVA 5K8TA 4U63A 3E4CA 3ETLA 3GUYA 1VJRA 4ZV9A 2R8RA 5IYZF 3ZHVA 2Z9CA 3T7AA 2HWWA 4OK3A 1E9BA 1Q1GA 3GQBB 3MD9A 4G84A 3DTVA 3H5RA 4LIPD 1P7PA 1ODCA 4AX8A 1Y6GA 2QP4A 1OR8A 2X13A 4JOBA 1W2WB 5CB4F 4B7CA 2P4SA 2CDCA 5I9LA 2SHKA 4L5IA 2KI5A 2IU4A 4QQFA 1KMIY 1Z2CA 2Q0SA 3ETCA 2EF1A 4NBVA 4Y0VA 3TQQA 3PC6A 4NXMB 4LVCA 4F9FA 5JV5A 2FSVA 3DBLB 3MERA 3WGMA 4DHWA 1A9OA 2YUTA 3ANYB 3DAYA 4P7FA 4RM3A 4HLNA 3UANA 4GLBA 2QAJA 3TAUA 3V8EA 4ZCQA 1COWA 3NVAA 4OGGA 1VIDA 1Z2DA 4XVRA 1WCXA 4L5JA 5EERA 2GHQA 3ZZNA 3EXHA 4JVLA 2Y05A 3I2HA 1YT5A 1ZLXA 4WLFA 1E6UA 2MSEB 2RGAA 3M8KA 1U6KA 3PQDA 4HF7A 2QMOA 4K6CA 5GJWC 2W4IA 4GL4A 4GL2A 3OIVA 3UJAA 4CQMA 1Y42X 2XTJA 1KY4A 2BGJA 2Q2QA 1CE8A 4R40A 3UK2A 4BBZA 4UKDA 2ZBFA 1AA6A 3O6VA 3SX0A 1P3DA 4RCYA 3PC3A 1H94A 1DBQA 1G17A 3DNFA 4M8SA 4U7DA 1C8KA 3IRVA 2GZ1A 1P60A 2TMDA 3FM9A 1JTEA 2QTWB 3L0CA 4R1PA 3RUFA 4PPQA 3ECCA 3C48A 4MKXA 3GLGE 4FPXA 4IDBA 3BD8A 1CJMA 5IT9A 3EF0A 4I36A 3E7WA 3HHPA 3RS7A 1U0JA 3HU3A 3BEOA 2C5FA 1GLVA 3QA3E 3CKYA 1JEOA 3TEFA 1NFRA 4J7XA 1PZMA 4W6QA 5LXTF 2E1PA 4REQB 3AHCA 1W4LA 3GV0A 2BRUA 3CH7A 2CNWD 2H92A 3MWDB 4QJIA 4M1YA 4Y6GB 5MGBA 2F4VB 3DLHA 4D6YA 1ZC3A 2XGGA 4IXWA 3C3WA 1C41A 3NHLA 4MJ3A 4RMHA 5JVDB 5EIOA 3TUZC 2RHMA 3X1DA 2OECA 4OEHA 1DZIA 1VTKA 2CHFA 2WIDA 1UQUA 1PR1A 4B32A 2F6RA 2I1VB 1GT6A 5JVDA 1G3QA 2PZGA 1F2UA 2G09A 4Q18A 4ZAXA 3UMRA 5DK6A 3ZHBA 1DXYA 1SC1A 2VJYA 1PR2A 3Q1KA 3GYGA 4I4IA 1WVMA 3C3KA 1YSCA 5ALFA 3T5MA 3L5KA 3TX2A 5JPDA 5CIQA 1T8YA 4HDMA 3ZVRA 5JNVA 1ZPDA 2WWGA 3I39X 3K6JA 1HE5A 2P7IA 4CNBA 2FI1A 2FSHA 4JK3A 1HYGA 1CULC 1FUYB 4GI5A 5EHQA 3C7CB 1ZMRA 4WMLA 5K3FB 5TRTA 1TYBE 1V25A 3TB6A 4GC5A 3PTLA 3TNYA 5EMLA 2ODBA 1NAHA 1QK5A 5C37A 3Q6IA 1QQ7A 4KO4S 2CNNA 4F72A 4ZCLA 3D6UA 1XHFA 4YQFA 5B2EA 4EJ6A 1Q7EA 3DZFA 1L9XA 2PKYX 2PZAA 3OTWA 1H65A 1FFYA 4TYQA 1XIVA 1XLWA 5DLQC 2O9JA 2LD4A 3BZUA 3QP9A 2W2TA 5F1PA 3RANA 2I2CA 1DQZA 1Q2UA 3KXIA 5JASA 2GEDA 5B7NA 3V6MA 1B6GA 3CF4A 2RGYA 1DU4A 3FPAA 4H3VA 5KHOC 3NV7A 3IB6A 3E0QA 4A73A 1X15A 3TCXB 2EBWA 2ZE7A 4IMRA 1XWWA 2O7RA 5L7WA 4ZHSA 2QGFA 5AJWA 1WWKA 4G63A 3RYHB 1PG5A 1LPAB 1QQ6A 5BQ5A 4IIEA 2VTEA 3WRYA 4LZNA 5HGJA 2ZRHA 5DJ5A 1M75A 2ZRMA 3NJRA 3ZTWA 4C6HA 1J8YF 2OVBA 3SG0A 1AO0A 4GSLA 4EW3A 1WS6A 2XTZA 4LN1A 4PONA 3NOOA 3WYFA 3ELWA 4I6JA 3GFVA 5BR1A 4FQ5A 1J99A 4TV8B 4BO9A 3UPTA 1KGSA 1XD2A 4AL4A 3QEBZ 2FX5A 2ZSJA 3UAZA 3PNPA 4WGFA 3Q72A 2B4RO 4X3OA 4KR3A 1JG4A 5FL7A 2Y9MB 1B14A 1ZK2A 1QIIA 2BDEA 2F3UA 3QBJA 4R98A 2NZYA 1RWNA 6Q21A 5IKMA 3KAJA 4E22A 2IEBA 2G5CA 1IE3A 1OSNA 4JSYA 1MPXA 6REQB 1UOEA 4L5BA 5BWCA 1KTIA 1KXZA 1Q2XA 2FN9A 4OL9A 4HB3A 4KI0A 2AZXA 5ILQA 4X1IB 1G19A 2IDZA 1VE1A 1Y1RA 4OG2A 1L5GB 4E3WA 1POXA 4X0EA 2NIPA 3MIZA 4D46A 3AMVA 5EYPA 4BV3A 3BL6A 3WNDA 3JATB 2BEUB 1KDVA 4BMSA 4TL6A 4E2FA 5H80A 3AKYA 3Q9SA 1ODLA 3PQ8A 5KMGB 1E2LA 1P2FA 1EDBA 3LCCA 4KACA 5KYKA 3ZBUA 3EY9A 1S3GA 3JATA 4QTXA 4FILA 4MWSA 4ZD6A 2OBYA 3G0IA 4OH7A 1L5NA 1KMHB 1H3FA 2RAUA 3QLTA 5JZBA 2ALJA 3AUTA 4GP7A 1G64A 1K7XB 1K98A 1ZK1A 3TIIA 1ESNA 3D5EA 2ISSD 3F67A 3N2GB 4KRGA 4WK6A 1NVFA 1RRCA 4GVPA 2QVBA 5CXUA 1J8MF 4QAJA 1L8AA 2PV0A 4ARCA 1ORRA 4DDMA 2WMOB 3W7VA 4X6YA 3BTUA 3AIMA 3WYEA 3RFVA 5AP9A 4HUQA 2J45A 1PVOA 3GD7A 1P75A 3NNSA 1FSFA 3URMA 1I6MA 1F8YA 3D4OA 1IM5A 3P9IA 4K03A 5KNDH 3X1ZA 2GYWA 4PFKA 5JSQA 5HTOA 4TMTA 1C7EA 1H3NA 2PZFA 4Z9YA 1EUYA 1B6SA 3U7RA 2I6QA 3EXHC 2QZJA 4DCVA 2BM1A 5CMLA 5F7JA 2AXNA 3ISJA 1M1ZA 2QXYA 4JLNA 1G8YA 1WXEA 2C2XA 4L16A 5CHEA 3ZY4A 4C0QC 1IG3A 3USES 3ET5A 4KE6A 3I62A 4LF8B 2EJTA 1CY8A 1P3JA 3AFNA 3FCYA 2J41A 1AZTA 4QDJA 1X80B 1JB9A 1B3BA 1X7GA 4LK2A 3RWMB 2P68A 5DSTA 4QUBA 4UCWA 3EF3A 4B8WA 4CIXA 3VYWA 1C1XB 5AH0A 2L0XA 1IEVA 2R79A 2ZSAA 3B78A 3SC3A 3FMPB 5ALMA 4MGYR 4WBNB 2XITA 3BMOA 2GX6A 3T3DA 4C1BA 4BFLA 4C7BA 4CEHA 1SCDA 4Q48A 1Z8NA 3PHJA 4NMLA 3V1UA 2OUKA 5ALUA 3NUGA 1U5BB 1M6EX 2YYSA 4TV8F 4Z0PA 3OPMA 3OWHA 4TTRA 5ESRA 1EK0A 1F4VA 4LBVA 3ZZ0A 3LDHA 5G02A 3WB0A 1JEQA 4EG0A 1GZDA 3HKBB 3JQQA 2YKGA 4OATA 1ORHA 5JCJD 3G6KA 1DKNA 2P2DA 2QR5A 1FNCA 4A82A 1QF7A 4CT0A 4L4RA 4DNQA 4FT4A 4LY6A 2DXIA 1Z5OA 4GWGA 1JEQB 2DR3A 3O03A 5A9RA 3P9KA 1LGYA 1BC5A 1BYUA 3VSAA 3T3IA 5AVQA 2BW0A 1G2QA 4HDKA 2WHRA 1USWA 2W2VA 3W6OA 1JHVA 4ARIA 3E3MA 5FNZA 1ZZEA 3C1OA 5GMOA 3WV5A 4KWHA 5EHXA 4KVZA 6ADHA 4UVIA 1X86B 1U3VA 3GA5A 1YZUA 1V11A 1RFLA 2WKPA 1I7SB 1VBMA 3NAZA 3IB3A 2CUTA 2O8EB 2B30A 1ZWLA 3V1YA 3TTYA 2GKGA 5DYWA 3K09C 1TRHA 3F71A 3WBBA 4ARVA 3EEOA 3KU1A 3UFXB 1ND6A 1Q0QA 4PBRA 3EA5A 3R3XA 4EB3A 2F8SA 1T6ZA 1T1RA 1TEHA 2Y67A 3CRW1 3GDWA 2W2LD 3HJHA 1RE0A 1YBMA 1B6RA 3CRMA 1K6EA 1PL8A 3DB2A 4YA6A 4AN0A 2VRWA 5A3QA 1CVLA 2XUQA 5K6RA 1G8SA 4DV2B 1MH1A 3ZJVA 3G9XA 1OWNA 4UTZA 2AVDA 4CLXA 4DF3A 1YJQA 5IYZB 1TE2A 1G8GA 3G8CA 1I2MA 1CZOA 3RUHA 1IY8A 1J0AA 3Q5EA 1J0XO 4R2IA 4CG1A 5C4MA 4ZODA 2VNAA 4OHYA 1AO3A 1UK8A 2GZDA 2V7EA 3KKPA 3KQTA 1XUOA 4Q6BA 3KE9A 4HHEA 3E8MA 3PJFA 3TXYA 1Y8QA 9ABPA 2ZZMA 1SJ9A 2A5GA 1SVUA 2BR3A 2WYWA 3T4EA 3TRHA 3H3FA 5ALEA 4TKVA 1UP7A 3EGEA 1QRAA 2AL7A 1EA7A 1SQ0A 2PGLA 3ZDZB 3MIIA 1JHYA 2XT6A 4EPRA 5CBPB 1UDRA 4D9MA 5FUMA 2C9MA 4MS1A 4NE7A 3OZXA 3ZJ4A 3PXUA 1BA2A 4JNCA 4E2WA 2I4NA 1J5XA 2RB5A 2CUKA 5TX7A 1PR0A 1T6NA 1VYVA 4HCJA 1YDHA 2Q1WA 1YQ9A 1OI7A 1VA4A 4CHTA 3GB9A 3L7KA 2WW8A 1XLTA 4JI4B 3V34A 1XRLA 2ZKLA 3BQNB 3GT0A 1DRVA 1V71A 2QM8A 3B52X 3COYA 3KQVA 4LZLA 2AB0A 2H4WA 4NAVA 4M0CA 3W5DA 2QR2A 3NZEA 2BWJA 4Q9JA 3ZCRA 4TTVA 3U4QB 4YEDA 2P9CA 4JVMA 2B9VA 2OE2A 3H8VA 2W90A 4XVUA 2ICAA 2PGDA 5KNBA 1TYCA 1M1XB 3G13A 4LOIA 2OENG 3FGZA 1IJFA 2AQKA 4PCAA 4JDPA 2PZJA 2FVYA 3R75A 2AUNA 2E7ZA 1P2GA 2H5LA 2HEGA 5EZYB 3D4IA 3K9QO 3LCJA 4U7GA 3RSCA 2CLOB 3M2TA 4JLSA 1SIUA 5TDHA 3UWMA 4BN4A 4DIDA 3O9ZA 3VAYA 1GUBA 4XJSA 2BGNA 4RORA 3CZRA 3PTZA 2I1WA 3VHXA 3RIXA 1XRNA 1R16A 4WY8A 3DZKA 2IF2A 1J70A 4C4OA 3NG1A 3BJMA 1DWUA 4EA6A 1JECA 1Y3BE 2FFJA 4RPLA 2NXJA 2PLAA 1H93A 4Y9TA 1D2GA 4LV6A 4OB6A 1B3RA 5AW7A 5C8XA 3U19A 3VUFA 3H5NA 1D03A 3PZRA 3NH6A 2R00A 2CCKA 2GN0A 1JG6A 1WAMA 3N0XA 4WXYB 3B2EA 5EE1A 3H84A 1SQSA 4KQ1A 4MSUA 3GJRA 1V1JA 3PPXA 4QBKA 4IFEA 1ZI6A 4KTVE 5FTWA 3W5HA 2GESA 3CLRC 3WK9A 1Z5VA 3U4IA 3GRYA 5GADl 3DBOB 3DKRA 2R2AA 2FEKA 2HC9A 5ED0A 3UF0A 1MT3A 3E3NA 4FB4A 3PRYA 5JXWA 1FJGB 1NRJB 2ZJ1A 3IP3A 1XU4A 2QUHA 4HFNA 3UWPA 4BXOB 4JKYA 1MCZA 4OM7A 2VYNA 1YVPA 4D97A 1UK9A 3TRDA 2FTKE 3WNCA 2IXFA 1DG3A 3AFGA 1OLSA 3IP1A 1RTTA 4MICA 1O94D 3WLNA 3IIKA 2D59A 2CD9A 1ONNA 3CZ9A 4QT0A 3P9SA 4Q1VA 4DCJA 4DE5A 1OLUA 3U7QB 3FAZA 3ICQB 3AR8A 3KFXA 1TVCA 3HB1A 3TVTA 2CBXA 2IZ1A 3G49A 1LQUA 2NZ2A 1ZJJA 1VGQA 2WDPA 4LYEA 4N7JA 2JFVA 5BR4A 4Y1GA 5ELXA 1SKMA 5DWDA 1Q84A 4KHZA 5I7WA 3L0DA 3MWKA 7MDHA 2QQFA 3QHPA 4P7KA 4XE5A 1Y6FA 3Q2KA 5GJCA 1QZUA 1FMFA 5KZMB 3DO6A 4NEGA 4BP3A 5FV4A 4IHAA 2BFCA 3ILSA 1Z2PX 3RFCA 4B2YA 4EVIA 2HIMA 2O6HA 3MXTA 1U8YA 4LOJA 4CL0A 5IK2D 2BGWA 3NW9A 1HLFA 1ICIA 1Z0UA 4HB0A 5EZSA 2HRDA 2Q28A 2R7AA 3E48A 4J03A 3UIEA 2GJAA 3ENVA 1FP1D 3B3GA 3H87A 5CD1A 2HF8A 2GKOA 4DKJA 2FDCA 1NXPA 1MAWA 3OETA 4YAJA 2DCUA 2DULA 2MOKA 5EFZA 5DIZA 3JQFA 3VNQA 3H0EA 1E0KA 2WJHA 3C43A 3IDZA 3RHZA 5IMBA 4BKRA 5KYUA 4PYOA 1KXJA 3EVZA 9LDTA 2VYQA 4DV0B 3BA6A 2XMPA 1D4AA 5KYXA 1NJFA 2PIDA 2UYGA 3AXTA 4H60A 3S44A 3UMFA 1VMEA 1KAHA 1KJZA 3CH6A 3TDKA 1XJCA 1QLJA 2BFEB 4HJXA 5JSHA 5J1SB 1LI7A 4QPDA 4XASA 1BMQA 2FN8A 2JKYA 3NHUA 4DLXA 4D26A 4BVBA 3LC0A 4LX8A 3DFUA 2VF5X 1S7GA 1SZDA 1SHLA 3TSOA 3AHIA 4KXMA 2XI4A 5LMUB 4DV6B 2XOKD 3FLBA 1ILEA 3GWZA 3N2EA 1XA4A 1T13A 3LPDA 2JHPA 2ZXUA 3EFBA 2VDLB 1D2NA 3DVLA 1L5LA 2VHUA 3TG8A 3A6PC 1SC4A 2C9ZA 1FL9A 1M6NA 3WGLA 5BQPA 5F9FA 1P7YA 2ZREA 3EEYA 3H5IA 1B16A 4Q9AA 3ZS9A 4LVNA 2F1JA 1XTKA 3BHIA 2IC5A 4X3CA 5JNUA 4V1CA 4FKMA 5BN3A 1DC7A 1J2YA 4RK5A 3PT9A 3EGDA 1OC4A 1IY2A 1E3WB 1K6XA 3OO0A 1TX4B 3A6KA 2OLEA 3NBQA 4I4CA 4HL6A 1C8LA 1JYEA 1P2VA 1ZSYA 7MHTA 3KUDA 3A9CA 5CTJA 1RJWA 1JU4A 2J9ZB 3GDHA 4QHYA 2CHVA 1XTVA 1XQYA 2SCUB 5GONF 4YLEA 3IMGA 2IHUA 3MMPA 1G6KA 3O8CA 1N0WA 1XNGA 4IH1A 1DTSA 1F48A 2HN9A 1ECJA 4RK1A 3ZZ1A 2YWCA 3B1XA 4IDAA 3LQ4A 4C2UA 5JMWA 6YASA 2DBVO 4B3IA 4E4RA 3ORYA 1GEEA 2FFRA 2CLMB 3B20A 3AZPA 3CEHA 4XIGS 4DLTA 1T6YA 4E5KA 4ETIA 1DGQA 1SBYA 5BSWA 4UDYX 1K8ZB 3R4CA 1SKQA 2PSEA 1AXEA 2QTZA 1QVVA 2C4VA 1ZWKA 4KVFA 4D0NA 4Y2TA 2XWSA 5DCWA 1X39A 5DF1A 4K6MA 3C2QA 5ELLA 3EOBI 4PNEA 3FOFC 3U9LA 1MBZA 3ZTTA 1G6OA 1MAAA 2A94A 1L9KA 2G88A 4NFSA 1E5QA 1B0AA 3RVJA 4CBVA 4OM8A 1BWSA 4Q6WA 5P8WA 4BMVA 3BC1A 4IGEA 1KZ7B 3AILA 2VIIA 5HCIA 3WKAA 3VU3A 2D5AA 1YVDA 5K1ZA 1GEGA 4DZZA 2W42A 5EXPA 1USKA 3V7WA 4IVQA 2IFTA 1H9BA 2DPHA 1MEEA 1XN1A 2B2XA 1IN1A 1LBEA 3SIXA 5F4BA 3UHOA 1Z6GA 5TQ0A 1Z6YA 5EINA 5FH9A 3K9CA 1NR1A 4E3ZA 4C3UA 1T2EA 3DZIA 4X7BA 3RS2A 2BFDA 3EXIA 3R0VA 1EFVB 2G25A 3HUDA 4WH0A 3OTIA 5I01A 4B6SA 4XR4A 4OREX 4DMHA 1JTVA 2G77B 2FW8A 1BS9A 1YOBA 3G1WA 3UMJA 3SD7A 1RR6A 3IP7A 3EW9A 4I5IA 1HR0B 2HMWA 1LS6A 2IYFA 3C3YA 4CV1A 1G8FA 1NXQA 4XUEA 3S55A 1G42A 3M70A 3VPBA 2YINC 2J4CA 1ULSA 1Z88A 4L8YA 4OJQA 1JHPA 4UAGA 5LQDA 1OX5A 2ZRJA 4FYVA 1LLFA 5DKFA 2MCFA 3K8ZA 3CT6A 2AFIE 3E18A 4KYIB 5FI1B 4DADA 4MQLA 1NNSA 5FOWA 4IIFA 1N92A 4WLOA 2H4YA 1HPLA 2FHPA 3SKYA 3I45A 1TAGA 5HK9A 2F1OA 1JMYA 3R5FA 4R2WA 4HXYA 1PF7E 1EFRD 4UE3S 2F3SA 4F7WA 2PS3A 1K75A 1Z26A 1XSEA 1TK3A 1Z38A 3CRZA 2NYVA 5IBQA 3E5RA 3L01A 5AM4A 2H06A 4XIIA 4Q4DA 1CJVC 2CN1A 1D2CA 2H00A 4FFPA 2VJPA 1TKCA 1NFQA 3L6RA 4Y8VA 4Z0HO 4RGBA 5KNDD 1W1WA 3CVVA 3P71T 4RAQA 4FHFA 3ETJA 1LZKA 4NQRA 4O1HA 1KI2A 3RREA 3ZZMA 4I55A 1JQJC 1PJRA 3E9QA 1DDOA 3C8UA 5JBIA 4EB6B 3FUCA 2FW0A 4BO0A 3LLUA 1UBTS 4JHLA 2V6MA 1CX9B 4KRXA 1LTKA 3HQ4O 1H8ED 1FS4A 4DMFA 1C2TA 1NYTA 4S12A 1TTHA 3TTXA 2GJ9A 1RKUA 2A57A 2XYHA 3JWEA 3UJPA 1TJNA 4JR2A 5G1NA 1AURA 4J3FA 2RC6A 2VK4A 4EFLA 4OQFA 1BMDA 3ZW8A 1CY7A 1ZGGA 2RKWA 1Y37A 3NFRA 4LY9A 2O57A 3VI3B 1DIGA 4MKGA 1D09A 1A7KA 3IAM1 4QELA 2ZDHA 3B3JA 1M33A 3QI2A 3F5QA 3BICA 1CRQA 3MHTA 1SRQA 2CB9A 4ZARA 1PK8A 1OGYA 3AJ9A 5AKLA 3RIHA 2FPIB 2PZBA 3UMMA 2IH5A 3LQKA 2XD9A 4P3KA 4Y6RA 4M54A 4QTZA 3M3PA 1F2UB 3NHYA 4JROA 3NBMA 4D9JA 1DG1G 4RA9B 2W8ZA 3Q9NA 1S3IA 1T5OA 1G21E 1SQ5A 1PO7A 1RPNA 3B6IA 3T7IA 4EVRA 3ZCVA 4C7OB 2RJNA 1M6WA 2GSWA 4FFSA 4KQGA 3BZWA 3BSYA 2JLQA 3HBJA 3LT4A 3MOIA 1XA0A 1NY6A 5FUXA 2JEYA 4M0PA 4DG9A 2DUNA 3HK2A 1S01A 3C14C 4B46A 3DG9A 4TKUA 5K0JA 2VDMB 1QAQA 3FX2A 5J2TF 4JR1A 1GYRA 3RRXA 5A4FS 4XCVA 2JHFA 3WXBA 3HLTA