1VFNA

Purine nucleoside phosphorylase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
270
Chain Sequence
GYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPEGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGQNPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDSQGKANHEEVLEAGKQAAQKLEQFVSLLMASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE-NUCLEOSIDE PHOSPHORYLASE
publication title Crystal structure of calf spleen purine nucleoside phosphorylase in a complex with hypoxanthine at 2.15 A resolution.
pubmed doi rcsb
molecule tags Nucleoside phosphorylase
total genus 75
structure length 270
sequence length 279
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 1996-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vfnA00
4MCIA 4QFBA 1YRYE 1U1GA 2A0YA 4L5CA 1A69A 4RJ2A 5EUBA 2AC7A 1JDVA 4OEHA 1SQ6A 5F7ZA 3BSFA 3NM5A 4DAOA 4LKRA 1V41E 5CYFA 4GKAA 4H1TA 1VMKA 1Z5OA 3K8QA 1Z5PA 4LZWA 3PNPA 4X24A 1T8WA 3FB1A 3DPSA 4F3KA 1PR1A 1ECPA 4GLFA 3O6VA 3NM4A 1PR5A 4JWTA 4GMHA 2OC4A 3E9ZA 4R31A 3OZEA 1ULAA 3UAXA 1A9PA 3OZCA 5EPUA 4BMXA 1Y6QA 1CB0A 4OJTA 2H8GA 4WKOA 5JPCA 4YMLA 1ODIA 1LV8A 3KU4A 4QATA 1OVGA 4DA7A 1JPVA 5CYGA 3GGSA 4YJKA 1K27A 1PR6A 1RR6A 4G41A 3IOMA 4TS3A 1Z37A 3E0QA 1Z39A 4QASA 1T0UA 5F7JA 4R2WA 5CCEA 4M7WA 4R2XA 3OZDA 1JYSA 4WKPA 1K3FA 3LGSA 2A0WA 2QDKA 3EUFA 1JDTA 4NSNA 1VHWA 1TGYA 2XRFA 3FNQA 1ZL2A 3KVVA 3MMSA 1B8OA 1TCUA 3EEIA 3NM6B 4MARA 2OC9A 1PK7A 3BGSA 4TXHA 3UT6A 1PR0A 3OCCA 1Z36A 4F2PA 5F7OA 3FAZA 3LBAA 3UAVA 1YR3A 2AI1A 4D9HA 4DA0A 3SCZA 1JDUA 2OECA 4NY1A 1Q1GA 3PHCA 1PWYE 4OGLA 5B7QA 5B7PA 1V3QE 1CG6A 1JDZA 1Z5NA 4F1WA 4PR3A 4TXLA 1LX7A 5IFKA 3K8OE 2HSWA 1NC1A 1T8RA 3INYA 3DF9A 1NW4A 2QSUA 1T8SA 2BSXA 4JP5A 4LDNA 4DARA 2I8AA 3OPVA 2QPLA 4LNHA 4L5AA 4F2WA 3KVRA 3PHBE 1TCVA 3T94A 3LA8A 3P0FA 3KHSA 1YBFA 1V48A 3UAWA 4NS1A 4K6OA 4TXMA 1OUMA 1V45E 1OTXA 1QE5A 1V4NA 3EMVA 4JOSA 1V2HE 1XE3A 1FXUA 1Z38A 1A9TA 2B94A 1SD2A 4PNPA 4L0MA 4P54A 4D8YA 1A9SA 1RXCA 3UAYA 5KB3A 5B7GA 4WKCA 1Z35A 1ODJA 4QEZA 1TD1A 4LNAA 4U2KA 2OXFA 3UAZA 4D98A 1ODLA 4G89A 2Q7OE 1ODKA 3D1VA 3TL6A 1JE0A 3QPBA 4UC0A 4QARA 5EFOA 5CXQA 4L6IA 2ON6A 3U40A 2QTGA 2A0XA 4ECEA 4KN5A 2HN9A 1RXSA 1JDSA 1U1FA 4OY3A 3BL6A 1NC3A 3C74A 1VFNA 1C3XA 4DA6A 3NBQA 4TTJA 3FUCA 3FWPA 4QAQA 1ZOSA 2HRDA 3ODGA 5DK6A 3BJEA 3KVYA 3OF3A 1G2OA 4OF4A 1PBNA 1U1DA 2AI3A 3EUEA 4TXNA 1PK9A 1Y6RA 4BN0A 4DANA 4FFSA 1M73E 4M3NA 1TGVA 5CCDA 3OOHA 4L5YA 1U1EA 3ONVA 3MB8A 4EB8A 5F7XA 3E9RA 1T8YA 3OOEA 2ISCA 5C80A 3FOWA 3GB9A 1RFGE 5F76A 1SD1A 3IEXA 2PGAA 1OTYA 3DP9A 4D8XA 4EARA 3OZBA 4IP0A 2I4TA 1PF7E 4DABA 2RJ3A 3F8WA 4YNBA 4TS9A 1OU4A 1PW7A 4WKBA 1LVUA 2HWUA 1RT9A 3KUKA 1RYZA 1Y1SA 4DA8A 4F3CA 3ENZA 1K9SA 4TTAA 1JP7A 1Y1TA 4OGKA 5I3CA 1JE1A 1A9OA 1B8NA 5K1ZA 4MCHA 1PR2A 1PR4A 3PNSA 4TXJA 4YO8A 1YQUA 5IU6A 1Z34A 2GUWA 5FAKA 4BMYA 1WTAA 1VHJA 3DDOA 2A8YA 5F78A 5ETJA 1SJ9A 4GLJA 1RXUA 4D8VA 3P0EA 1PKEA 1Y1QA 3DJFA 4M1EA 5F73A 2QTTA 5F77A 2IQ5A 1I80A 1YQQA 1U1CA 4I2VA 1ULBA 4DAEA 4BMZA 5CXSA 1A9QA 1OV6A 4TTIA 1Y1RA 2AI2A 4TYMA 4WKNA 1N3IA 1Z33A 1A9RA 1RSZA 2P4SA 1RXYA 4E1VA 5B7NA 3O4VA 1RCTE 4G8JA
chains in the Genus database with same CATH superfamily
3QU2A 3IDQA 1Y4UA 2V5UA 1P8JA 1Z6GA 4LY3A 1TAHA 1E1QD 2FPXA 3BMCB 3VO8A 1A69A 2ZR8A 1UBNA 5EXDA 3AG5A 3D43A 3DOIA 1ADYA 3NDJA 5AI0A 1VA5A 1VJ5A 3CH5A 4CQLA 2C2XA 5JS1A 2JLAA 4YQEA 1L7OA 1R6VA 1K7SN 3MW8A 4TRNA 4CMCA 5BVGB 4E07A 4MUGA 3OQ6A 1T3SA 3JAWB 4X3CA 4RPKA 3FCUB 2WT4A 5L3QA 3S8EA 1YTUA 1LK5A 2QIPA 2HF2A 4BMPB 4XD7A 4GT1A 2LCQA 3JD2A 2ZT6A 1PS9A 1PJ8A 1KC1A 1TQ8A 1Z3CA 3MF4A 3I28A 3PNBA 4CV0A 3RRJA 4EBFA 2XRYA 3F1LA 2AXQA 1E6LA 3D8HA 1Q6ZA 4PBTA 3ED1A 5G0TA 4PQFA 1HMYA 1T43A 2RGNA 3FB1A 2MYTA 1KAEA 4QHYA 3PRYA 4I5EA 1FMCA 1ZWLA 2PZMA 3ZCTA 3EULA 1PN3A 2WYVA 4NU5A 4J6EA 3D7RA 1CJMA 3RFFA 2B37A 4BB0A 3X1KA 4X85A 1XQVA 3WOHA 3AG6A 3VGPA 4Z4EA 2F8MA 3NIFB 4C6HA 4YJDA 4X95A 4AB1A 3L6OO 4D42A 1ZP6A 1K3TA 1JA9A 1CCWA 1TK3A 4C7MA 1YI8A 4ZT6A 3LC2O 3VR2A 3KZCA 5K2MA 3KX2A 5BWOA 2JANA 1CKEA 1Z22A 1LBEA 4LXUA 2L19A 3EIQA 3RVSA 4B2LA 2FZCA 4D5EA 1GNTA 3CW2A 3LO5A 4PSKA 3DTNA 1POWA 1LS1A 2W6JA 1FMJA 1T26A 3IKMB 1U8XX 4NBRA 1PWZA 4YJ3B 5DISB 4LJ9A 4XRRA 1DJMA 3H75A 1NI4A 1LV8A 1JG3A 2Z4RA 3GYBA 3MS2A 3OZIA 4NU8X 2I4LA 3IL2A 1RI2A 3PQ6A 1Z5WA 4BWFB 4CBVA 3SDBA 1QP4A 2FFRA 4J0HA 4ZVRA 4AMVA 1IUPA 2OZPA 3RUIA 2JGMA 1OAOC 5H1YA 5BT8A 3DNMA 2IYTA 4KQKA 1RHJA 3D3EA 4I9GA 1GRCA 1HFKA 1ORDA 4XWGA 3FNRA 3GDGA 3IOMA 3TQQA 2Q49A 1PJZA 2WWWA 4Y9UA 5B58T 1JLHA 2LUOA 1ONBA 3U5ZB 2B2XA 3DL4A 2X42A 5FUXA 1W36D 1HEUA 2MCFA 1Z39A 2FMUA 1EK0A 3Q15C 3Q7IA 6AT1A 3FE2A 1N8SA 2ODNA 2J5QA 1KJ8A 2YVLA 3JWJA 1M2OA 3DDZX 5LYJF 4FXOA 1PX2A 5HKLA 5TVGA 1G1AA 1JU3A 2NUPB 2RHJA 3ICQB 3VDQA 1CS0B 4L8LA 1SUAA 2AE1A 4M7WA 5I9MA 2W6ID 1O6ZA 4INJA 3RE1A 1DAMA 2GO7A 3TIXB 3TZHA 3UYKA 1D4FA 4IMRA 5D7BA 1E3LA 4B6FA 1PYGA 1Z5ZA 4D80A 4DDTA 4TV8A 5LQMA 5ISMA 4ARAA 1H5NA 4EZBA 1GA6A 1XTJA 1YA6A 3F9CA 4GX0A 3R6WA 4LBZA 5TJHA 4LF9B 3NATA 1XYGA 4H3HB 4RIFA 5KNCD 2G04A 3M9XA 3FSJX 1SEPA 2AGVA 2DTXA 3BB1A 4E7OA 2PYZA 2R1UA 3JQFA 4H59A 4N40A 2UYQA 1Q0RA 4GI7A 5CT9A 5AVSA 1B8PA 1VFPA 2VP4A 3TUIC 3ADOA 3CMCO 1ECJA 1SHUX 1U0JA 4CMKA 1BJTA 3UJ6A 3RSOA 3O8QB 3PR2B 1QP7A 3RQSA 4F12A 3LQRA 2VJAA 2EP8A 4B5LA 3UK0A 1S89A 1TLFA 2DUNA 2PUTA 1OROA 3CO0S 3D2LA 3IT0A 1YVEI 2PD4A 3N6XA 4FINA 4J16C 5A05A 4ZIRA 5KKCA 5J3JA 1QBKC 2BKLA 1DG9A 1KGSA 2VAWA 4OATA 4RSGA 2CHEA 3JQ8B 1SOVA 4ONEA 1LQUA 4BFZA 3CVJA 5A4AA 1FPMA 4FNOA 2ZPTX 1IG3A 2E2WA 5DIFA 2H00A 1DV2A 3AY0A 4YRQA 3B53X 1FMLA 2H07A 3WRYC 3LQKA 4Z3OA 1PX0A 2ISSD 2P1ZA 1H1DA 1QK3A 1U3VA 5JO9A 1XXHB 3MEQA 2KMLA 2SICE 4Y6SA 4JXXA 4YTEA 4G1CA 3O2SB 2NT4A 2BHRA 2GX6A 4ZWNA 3PUYA 1TQ2A 1KYXA 2DH5A 2E9SA 3ZCSA 4HDCA 3EPHA 3WP1B 1BRTA 2IPXA 1I1OA 3RS4A 2ZTVA 1NT4A 3EXIA 5GONB 3UMVA 2BE9A 4CMJA 4DIBA 1IY2A 5CA1F 5HOEA 1JQJC 4G8DA 5CLFA 1SU6A 3MJTA 2YIMA 2WLSA 1N2ZA 1FXSA 2VZ9A 1SC6A 1DOZA 1FNSA 2GQ0A 1KKLA 4H31A 3VVLA 2VK4A 1CG6A 1NBME 2VAXA 1JDZA 2AHOA 1PGOA 2WU8A 5C3UA 4JVOA 2H1RA 2JCYA 4KBFA 4RU1A 1HTTA 4I66A 4UASA 2WIDA 3JQDA 2IV3A 1V43A 5CD9A 3FPFA 1ZGJA 3W9YA 3ZDDA 4ZYWA 3KK0A 4WZ6A 1P17A 3EIFA 5C7YA 1RW4A 3I4CA 3EG9A 1D9XA 2WIAA 4OA5A 3HRKA 5IT5A 1LPMA 4AU1A 3O4JA 4YC7A 2PAAA 3F5MA 1F8XA 2ZR7A 4HGZA 3IUPA 5EHZA 3O0TA 1USIA 3KKMA 4E2WA 1T8SA 4HK4A 3CW8X 2ZRNA 3EG5A 2W83A 4UHFA 2ECQA 4QDZA 3PU6A 4YP1A 3OPNA 3ROXA 1F9EA 3RSZA 3S6JA 3PXGA 3W6UA 1C1XA 3U1VA 2XUOA 1L5SA 3GXBA 3JQBC 3RFTA 1HFEL 3QYAA 1ZH8A 3LY9A 2V96A 1KEUA 1QRSA 2WYHA 2ADOA 3LECA 3K31A 3NP9A 4YCSA 5A5FA 2QPLA 2B78A 4BZWA 5AD1A 4L5AA 4MLCA 1F12A 2KYRA 2O3QA 1SHZA 4OSEA 1VBNA 2RB5A 2D3TA 2ZTHA 4IDEA 1URPA 4OHYA 2VO1A 2WR8A 4BVJA 5E6UB 1Z0JA 4PCVA 4MVJH 2VTBA 2HDHA 2IBTA 1QX3A 1A2BA 3JR7A 2CMKA 2DAPA 2NZWA 2VZ0A 2BZ0A 4C3ZA 4NQZA 3EPRA 4RZUA 2QD5A 3H42B 2XZOA 3L9XA 5J5CA 4KB5A 5G3ZA 2VT3A 2ZUTA 4LTDA 1QF6A 1CUZA 1RWBA 1E6CA 2C95A 1FY2A 1YCGA 4F4IA 1RQGA 2W2XA 2G0NA 1IG0A 3LRTA 3ZIDA 4AZSA 1KFBB 4Q02A 4Q9NA 2O7QA 3EVNA 1OUMA 5AI5A 5EJGA 3PK0A 4XASA 2XJ4A 4BVFA 2Q2QA 5JNUA 1F2TB 1Z0UA 1RRVA 5ALYA 2MSEB 2QYTA 4YQFA 5K7SA 5K0GA 3L7MA 3WYGA 1LB1B 1CK4A 2QDXA 3BMOB 2Z8XA 1FLNA 5EMHA 1PCXA 3RT9A 1M8GA 2PLNA 2X22A 4UATA 3T1OA 4JGBA 5D5PA 3QU9A 5DWVA 3VKUA 4BVGA 6Q21A 2QB5A 3L0ZA 4R71A 3OJCA 5GM2A 1N0IA 4FBMA 5FF9A 1CUEA 2P4EA 1R64A 2UUBB 4WXPA 1RXCA 3SJZA 5JAUA 4PO1A 4LCEA 2DX7A 3EBOA 4OMFG 3IPRA 4JBXA 1RZUA 4LJ6A 4EPTA 3M33A 2C7PA 1QAMA 2ORWA 5DHPA 4Q4LA 1WPQA 2RGWA 4GR9A 2ZJ5A 4U7FA 4G6ZA 4WKCA 3W8RA 3HDYA 3U44B 1IMOA 3K7EA 4FQ8A 1HG0A 1POXA 3NYIA 2OSBA 2LW7A 4Y2UA 4F93B 1NUHA 2I55A 3OHSX 3V1YA 3NDIA 5CA0B 2RH5A 3EJWA 4TTTS 1M8KA 5GINE 4GO1A 3ZCUA 5TS2A 2PKRA 2Q2NA 3FZYA 2HMYB 4M1TA 6REQB 1LDBA 1AA9A 1M6VB 1A7KA 2YR0A 1RWXA 3SDSA 1YJCA 7ADHA 1QV6A 1RJDA 3VYSB 4JJIA 1U0BB 4TLAA 1UDCA 2H7XA 2IYRA 1P9WA 1Q0UA 5E7MA 4J75A 3FMPB 3WWEA 5A06A 1E2MA 1HTBA 1E3WA 2QRUA 1GUYA 2OVFA 3QXGA 4KN9S 3UHJA 2VQFB 3U40A 1GUDA 3CXUA 1AQ6A 1X13A 2GCPA 4RKFA 3F7NA 3GG9A 1LSSA 1UQTA 1Q11A 2J9GA 4WN3A 3RG8A 1SRRA 2IOQA 1G3UA 1LVGA 1UJMA 1TRHA 4P38A 4UVGA 4DMCA 2IX3A 4BJ5A 3AJRA 3IKLA 3BPSA 2FLVA 3FGNA 3GMSA 3ONFA 4POOA 1XF9A 4B3GA 3O3MB 4WOKA 1R0KA 4WOBA 2B1GA 3X2FA 4E2ZA 3N8HA 8LDHA 3IAHA 3NOXA 3K9WA 2R1TA 3ZZUA 4YONB 4D0NA 2ZAMA 3IAAA 4YWJA 1B6SA 1SPXA 4MGHA 1P4AA 1TUBA 3FVVA 1QE0A 4D4JA 4E5UA 2IEYA 4DRXB 5ITZB 1IHOA 5CDFE 3F78A 1F7VA 2X1VA 3MLBA 3U4AA 1EESA 5CH3A 4EPXA 2AR0A 1FDVA 1KO1A 1B4DA 4RL4A 1OCEA 2BKEA 4BLWA 2J0SA 4AJIA 5A5VA 3IPXA 4P92A 5H80A 3FKSD 4W7IA 5JADA 4TGLA 3H1EA 1ZVJA 3V97A 2LBPA 1FXWA 1MIOA 1TK9A 1TW2A 1UQRA 2OSVA 2PJZA 1QDUA 1U4SA 4DLBA 3I8XA 1WE2A 3QPCA 4RD2A 3WK9A 1S2GA 1U0HC 4ML3A 4OHCA 1M73E 1L5YA 1M7HA 1IN7A 1VL0A 2BMVA 2BKVA 5CUQA 3RARA 3FOEC 2YZMA 1VBKA 1FDUA 1L7MA 2A7XA 5HG0A 1GQSA 1KEKA 1GQQA 4CEIB 1WV0A 2G17A 2POCA 2YC4C 3PC8C 4OJKA 2OFXA 4B5KA 4EA6A 2P9JA 1E1RD 1IEQA 2BUBA 3V4SA 5I7WA 3L7JA 4I55A 3O7WA 1VMIA 3VR6D 3F73A 2Q4OA 4QSHA 3TEMA 3NH9A 4BEWA 3IUYA 4IDAA 5CFPA 1VE9A 1GSAA 1UQUA 3LRPA 3R77A 3OIYA 1PF7E 1PJRA 5BWCA 3B48A 1W47A 3WHIA 3Q0EA 1XZDA 1IIRA 4LVCA 2PMEA 2YUTA 3UV6A 1MG0A 2JAXA 2GH1A 1UZNA 5KNDH 5I7AA 2XE7A 4P7KA 1TM2A 1T9AA 2Q41A 2FX3A 3OD5A 1PZMA 4YRDA 3L49A 4RUKA 3T15A 4CIDA 1PW7A 2P79A 4DWWA 4F2HA 5IBPA 1KWKA 2PUBA 4M6WA 2DP4E 2O0KA 1MOZA 4E4TA 1Z7BA 1PQWA 2EKLA 2QN8A 5LP6A 1BA2A 2FOIA 2DGDA 4BQRA 1T3HA 3V00A 2RHTA 3CTMA 4AROA 4D1YA 2PGDA 2G1KA 1Z68A 2QLNA 1U80A 3MLEA 4MW2A 3V8RA 5LZ9A 2D06A 2QN3A 1HTWA 3B9RA 5JVDA 2ZBVA 4EELA 2C9YA 5CNJA 4P4NA 4ITUA 5HHTA 1G59A 1KEZA 4G07A 4M0PA 2EZ8A 1T10A 2IXAA 5E1MA 1M5UA 3CZQA 2CZQA 4X1KA 2H16A 3OJFA 1RQ7A 2NU8A 3WGUA 2VBFA 3R5KA 2MSWA 4D0LB 2VZ8A 3PPWA 1QPGA 1SCAA 4TMWA 2RGCA 1EINA 3GRZA 1X7XB 4KK4A 2F43B 4V2IA 4ZU3A 5AWFC 3TFQA 3TTYA 4EB0A 2AD1A 1H1TA 2AE2A 2PSSA 4FOPA 5EOVA 3ZK8A 5HZGA 4F84A 3QEKA 1FUIA 2XMQA 3GARA 2P1RA 4WTOA 3NTLA 1EZ1A 1XZHA 3NVDA 2ZS9A 4FFMA 1VGVA 2QN6A 3SZUA 4E03A 1S4MA 1Y9JA 4RF2A 5IBRA 1YACA 2GKGA 3ZV6A 5FAKA 5TPWA 4PZEA 4XVRA 2X9VA 3JD1A 5FTKA 5LOVF 2JAHA 3Q6NA 1W9MA 4OLAA 4CNQA 4IAOA 4JLOA 4X41A 4DV1B 3UFBA 1CQWA 2CWDA 1LF5A 4PW0A 1QGZA 1XCGB 2P9GA 3DBRB 2DR0A 1UT6A 1JHXA 1O6FA 5CJ2A 2OG2A 3I09A 5CVUA 3NYRA 3KJNA 4HFMA 1SJ9A 2J85A 4R7ZA 5CW1A 1R9NA 1XTUA 4CW7A 2PVPA 2PQ0A 4GLJA 1MHPA 3MJVA 3TUJC 3LWBA 1VYUA 3Q4GA 1YFKA 2I3DA 3DD5A 3V2IA 3WGLA 1JKFA 1G1MA 3N0VA 3ZBUA 5EJ5A 2GN4A 1F4VA 1X87A 1C50A 2L82A 2Y1CA 4B3JA 5JZ9A 3QNWA 3VPHA 4D96A 2P2GA 1CZUA 2PZKA 2Q4DA 2YJ6A 4E32A 3T7KA 1I4WA 4LXHA 3VO1A 5LQAA 1U2QA 1TIKA 1JJIA 2EFGA 2AZXA 1EFRD 2E48A 4QVGA 3LO8A 2Y27A 3GJ0A 2V03A 4FP9A 3QX8A 4EKYA 3S8MA 5FULA 5JSFA 1WBBA 3AJ8A 3IUSA 1SCNE 3DONA 3I5AA 4WXYB 2P40A 1TEVA 3E3LA 1DCTA 5DZSA 3QP9A 2FR8C 3QYJA 2HYDA 5C8ZA 2JGDB 4GYWA 4FFDA 4E0BA 1EEXB 2Q3BA 4WKNA 4YMWA 3EH2A 4FYYA 3EQ8A 3TJRA 2CF5A 2JAQA 4PYMA 2GXAA 4P5PA 1NW6A 4TT8A 3BCUA 2JVJA 3HMKA 3L07A 4F5WA 4JYAB 4R9NA 5FUQA 1UOOA 3JQGA 4IRUB 5CB4F 2XA9A 2ZSIA 3ILXA 4EG1A 3LKZA 4IINA 4WNAB 3HY6A 1DL5A 3GGCA 5EMNA 5LWHA 2UUAB 2Z5GA 1GP2A 3MPOA 5C8YA 1U1GA 4L5CA 2VPWA 5EKDA 1B2LA 3D8NA 2O2GA 2UZIR 3HKDA 1WB6A 1Z8FA 2WUGA 3GJ6A 1BHO1 2A9VA 1Z2PX 1IBKB 4RJ2A 2JJYA 3R0ZA 5H83A 3PNVA 2CJXA 2FX5A 1QNFA 1DOAA 4OI1A 1KAQA 5HM8A 2VXOA 1J24A 1CUAA 1SFRA 2GD1O 1DJQA 3R20A 4UM7A 4DUGD 1EX6A 2C07A 3F3YA 4CM4B 9ABPA 3MZ0A 4NK4A 2FW7A 1FFWA 2HHAA 2FRVA 1KQ3A 1UBLS 4L4UA 3LXUX 3G0GA 3RC9A 5HRAA 1E7WA 1J2JA 3QBDA 4RA9A 1NXWA 4HNAA 2QZ9A 3OUUA 2YZGA 2VKTA 1XC7A 2XTAA 3DS8A 5F5NA 3KQNA 1GV1A 1Z5OA 2ORIA 2YN2A 3FBGA 4XDYA 5DWQA 4KFCA 1S7CA 4M9ZA 1WZUA 3PD0A 1R0XA 4OKNA 4EEZA 3THYB 3QWFA 2OXIA 1TT5B 2PGXA 3FFAA 2OA0A 3UKDA 1U8EA 2GN1A 3F1KA 3MGBA 1OA0A 4QO8A 4EW6A 3A9VA 3OPQA 4FYMA 4JWKA 3RSGA 4R2LA 4QOFA 3F47A 2XWSA 1HNNA 3DMGA 1K6JA 2IYLD 2OC4A 3GDOA 3JW8A 1UXIA 3OZGA 5P8WA 2D5IA 1GVHA 1PTKA 2V9ZA 3L6CA 2ERYA 4JI7B 1YO6A 2XYQA 5L9AA 2J0UB 1L7QA 3EOZA 3CZ5A 4GKBA 1KK3A 3WYNA 1G3RA 1TKRA 1Z9BA 1DC3A 2XWQA 3OIUA 4ZJUA 1UMBA 1B3BA 2I3AA 2W42A 4D2IA 2J08A 2WU0A 4FJ2A 3O47A 4RH3A 3K53A 2O05A 2QLTA 2PU5A 3LGXA 4PSCA 3GZNA 4ZEXA 3HCFA 4V0ME 2CXUA 4G0QA 2W48A 1T2FA 1V4VA 1Q0LA 4B82A 3R7SA 4EAQA 1Z6PA 2BHLA 1SXJA 2QJWA 4MYCA 3DMHA 1G9SA 4TQGA 1BHQ1 4TMZA 1V5EA 3L84A 1XU4A 1AQUA 3RAEC 1HYQA 1E9DA 3K09C 4FZRA 4FI3C 4ZOAA 3IVAA 3RDPA 2Q6TA 3VSAA 1CDEA 4MWEA 1HL3A 1OFUA 1SCUB 3HYCA 1RR6A 3AJDA 3KXIA 4RENA 1EK2A 5ALNA 4ZMRA 3U16A 1DJLA 1L4FA 4XJTA 4QDXA 4HT3B 3W8NA 5LL6P 4D4HA 4Q1FA 4LF8B 2ODWA 1XAIA 3HR7A 1F3OA 2VQDA 3G8CA 3OKFA 2WJJA 4L2IB 3E9CA 1P0MA 1C7RA 2EGUA 1U28A 1HT3A 3PBKA 4YRPA 1EIZA 2Z56A 3EZXA 3H6HA 1DVRA 4EZIA 4LA4A 5F7JA 2B1IA 3IB6A 4NX2A 3TMAA 2ODQA 2LVBA 3VYWA 2EWVA 4BFVA 3RWBA 3FHCB 2P68A 4JFRA 4MPDA 3RRMA 1TZBA 4DGSA 1U02A 3P9ZA 4R2XA 3DZFA 5HPYB 2VF8A 1H3EA 3LLSA 1I1HA 2Q3MA 3E3AA 5HK9A 3ZLTA 2NO0A 2H52A 4YDQA 2WJHA 1G2IA 5M7EA 5LC1A 3WFIA 1GGHA 4BPBA 4HD8A 3CFYA 4Q4CA 5FO0A 5JEDA 1QHEA 3ZHOA 4G0PA 2IPOA 2C5HA 1MJNA 2D1QA 2VOEA 4RA6A 3X43A 1JKMA 3FDIA 1UPBA 5CHEA 4DMKA 2OCGA 1HF3A 1MAHA 2SKEA 1L1FA 4ADSG 2FFAA 5IM4A 1OXVA 4UMFA 3AK4A 2XRFA 3JYOA 2IODA 4KMOA 4E3ZA 3FNQA 3IE2A 5TIIA 1P2DA 2PO7A 1RKUA 1G4AE 3WO1A 1VHQA 1JKJB 4BMDA 2OQ2A 3RH0A 2OCPA 5T8KA 1JMYA 4LYDA 2C4KA 3ROGA 5C53B 3SKYA 1MB4A 5FB3A 2QYSA 3VJKA 1I6KA 1JZTA 4MIEA 3ZZ1A 1UAGA 3ZZNA 4A6XA 3AM5A 3ND8A 2DTDA 4A8TA 5B1HA 4BN4A 1KYTA 2IVFA 4IQGA 3V2HA 4I1OA 3B6IA 5BUCA 2YWXA 2GPBA 3CRW1 4PAWA 2OBNA 1QRUA 3NTXA 3RS9A 3TNYA 4OIFA 4QPNA 4Z6KA 3ANSA 3HZHA 1X8XA 5E4JA 3AVOA 3FAZA 1EX1A 1CR4A 1R5BA 3I8OA 3EUAA 1XRQA 2VTEA 4K9PA 3FFBA 3TRFA 1X6VA 4KWIA 5A04A 1QF9A 5ESXA 3FNBA 4N7JA 4AM8A 1PL8A 2CL0X 4U2DA 4MKGA 3F71A 3MPUA 2IW3A 5FOWA 4K6HA 3LIPA 2ODAA 3HV0A 4I3GA 3V7NA 3ZXIA 4BVLA 2GPTA 1DRWA 1H3NA 2PA3A 2XB4A 2HMTA 1L8XA 4LY9A 4OGLA 3RSFA 4EVRA 2WWYA 3LIIA 1XDBA 4GD3Q 3EVFA 3GCXA 3OOWA 3RSHA 1XHFA 2AFIA 3KSDO 3L6DA 3AIIA 3REFA 2YDYA 1SUCA 4I1IA 3ILHA 4MW6A 4LY6A 1Z28A 1FYWA 1LX7A 1N2XA 3G2JA 4HI0E 4ZQIA 3UKOA 1EUYA 2PL5A 4CM9D 3FLEA 3WL3A 1NC1A 4H60A 4UBOA 1J8VA 3IDSA 4RVGA 3CLTD 5B3KA 5E6SA 1ZIYA 2BTQA 3D8RA 4M9RA 4XVCA 5K01A 5FFFA 3WAJA 1KYQA 1JR6A 2ZRGA 3BWYA 4KTTE 4F1JA 2QP4A 4QRDA 4JR2A 5HMMA 3Q3HA 1VRWA 3IHLA 2OZVA 5K9ZA 4QNMA 1DSSG 5DEIA 5L4SA 4UHCA 5JXGA 1PVDA 1NM5C 4Y7CA 2WK1A 2C9MA 5FH9A 3B20A 1VBMA 1VCOA 1VKRA 1YBFA 1DZIA 3PC3A 1M0SA 1U7HA 3LOPA 1K06A 1H22A 2V7EA 3KBOA 3Q0TA 4DYHA 1FRVA 3FUVA 4DLVA 3TIIA 5KYKA 1MX9A 1AA6A 4M0EA 1TUGA 1JT2A 1MR3F 4Q34A 4P3PA 4B74A 2CJFA 4IV5A 4ZZ3A 1XU9A 2HKIA 4L0QA 2AG8A 2NX2A 1P77A 2B9VA 3PXDA 5CX1B 2ROQA 3I4LA 1BFUA 4MVYA 3ZE9A 1K1EA 4A2CA 4DMMA 2JLYA 2TS1A 1A9XA 1YB6A 1D0SA 4DZZA 2AJDA 3FLAA 3OJXA 1WY5A 3THXB 1C3JA 4LV6A 3BRSA 5F1OA 1OE0A 1S8OA 1Z25A 3D1LA 4B81A 1OTXA 1RLIA 1V4NA 3EMVA 4KQ9A 5BR7A 3DFIA 1FUKA 4IVRA 5FQOA 4KR9A 3JZDA 4KQMA 2G9ZA 2CYCA 1OYVA 2NUBA 3LK7A 2O3RA 4O08A 3VHXA 4PQGA 3LCUA 1IXSB 1TJPB 2AOUA 1KC3A 2ET6A 2VPTA 4IW3B 1SBZA 1V3TA 3A36A 3K2BA 4MQFA 4TSKA 5BOVA 5TB5A 1NQTA 4IVNA 3TM4A 4TYQA 3I1JA 3ZE6A 5CLJA 1YNSA 1CS4C 2CFTA 5D00A 2ZB7A 3ZUGA 2GS9A 3FI0A 3PRHA 1UINA 3I2KA 4UOEA 2ZUCA 5I7OA 3ENQA 4C08A 2CSXA 2JZOA 3AM3A 1XB2A 4EX7A 2VPYA 3SS8A 3KOOA 3I05A 3S7TA 5AUPB 1QDEA 2V6FA 4IIUA 4L6CA 4U2EA 4B6RA 3AIKA 2KWIA 1IULA 3WA6A 4BMNA 1BGXT 1XFDA 3TQSA 1XD2A 1SY7A 4JU8A 4E5MA 5FOQA 2C2HA 2MIIA 3EBLA 3BWDD 3KB8A 1B0AA 1DBWA 2B0CA 3MGAA 4PEVA 4YI5A 5EWMB 5IPFA 1FFGA 5C1PA 2C84A 5EIAA 5FWYB 1JHYA 2IHYA 5HTKA 3MJHA 3VDXA 1UKZA 1JHRA 4Y6QA 4XDZA 1AQJA 1PKXA 1VL2A 3PDUA 2X0FA 1OB2A 1WL8A 1G5FA 2EDCA 2HU2A 3ICOA 3KEMA 3K9HA 4YXFA 5AW2A 3U4IA 3LF2A 4ECEA 2VF2A 5DOZA 4CODB 3D0QA 2JLBA 3R44A 4Q47A 4WK2B 4CLOB 5IJ9B 1G21E 1AGXA 2GTIA 4QWWA 3ECCA 2BMAA 4ZZ1A 1ES9A 1J7KA 1L4BA 2FETA 2J3EA 2EJVA 2JGFA 3PFCA 3QWHA 2ZOSA 4ZRMA 1SOWA 4HB4A 3TE6A 2XZLA 4RE5A 3PTZA 4M60A 5LBIA 2OAQ1 5IP5A 1XRJA 2PUGA 3ZD6A 4RZHA 2XNHA 4R9VA 4YJHA 2OGWA 1VP9A 4MS4B 4A9AA 4AMGA 3MXOA 4WI1A 4F2DA 3G88A 3RJMA 5L3SA 3D2AA 4LRUA 3AXSA 4BNDA 3K16A 5EJ7A 1DCFA 1FUYB 1N2OA 1JB9A 1JNXX 2ZYAA 2HWKA 3OPYI 3QBVA 2JLUA 1VBFA 2CLMB 3IR6A 2WJZB 1J00A 1EB9A 2QOEA 3B3AA 1QIEA 4UHBA 3S68A 2W9XA 3KYCA 4Z7OB 3GLFA 4IX1A 3P9IA 3WWDA 1FU7A 1QTIA 1VMAA 3FF4A 2NXNA 3AZPA 4G5QA 4JFAA 4TXNA 3RYIB 1TVEA 3WY9A 1EVEA 3HR8A 4BN0A 2CLOB 5L4NA 2AUNA 3H9QA 3IIIA 3BF7A 1SPBS 4HDKB 1O6BA 3NRJA 1N2CB 2VJMB 4KXWA 2QRNA 1Y8ZA 3IAXA 4P0QB 4ZDJA 3JWIA 4HLDA 5AVUA 2VQ6A 3CT4A 3TDNA 1T5LA 1RLOA 5EXXA 2P0AA 3CKKA 4I5FA 1K08A 5B57C 1BXGA 2XVXA 2VA8A 2RGBA 1N9KA 1I3OA 2AK3A 2I1QA 3G8YA 2HC9A 3IP8A 2YN0A 3D7MA 5IZCA 2G9VA 1G2QA 1NZFA 2GHTA 2OKGA 3CUWA 5EMLA 1JR3D 3KWJA 4L28A 5J9FA 3QVUA 1JN0A 2A1IA 2Y1DA 3CR7A 3QJYA 4BLPA 2OVBA 3G5MA 4Z54A 4EYOA 4HRYA 1GIAA 4AO8A 3N39C 4LV8B 5K6AA 4UQOA 3BIFA 2JA2A 3K8YA 4YNBA 4L4SA 4RGYA 1QH1A 5JARA 5JANA 3AEYA 3DFFA 3FR8A 3L0DA 3T0FA 3DKVA 4C0HA 3U7FB 5CLGA 1G8KA 2HWYA 1P2TA 3R5HA 4G0MA 3H4TA 2IOYA 3IURA 4NJMB 3A6GA 4BNVA 1EQUA 3C4JA 4I8XA 3M4ZA 3H2BA 3M6XA 2HWUA 4KNYA 3PLNA 4RD0A 3BIXA 3DTVB 1X74A 2C3PA 5GZ6A 2H63A 5ENVA 4B31A 2DU8A 1FC0A 4NOJA 4ODIA 3PEUA 2WEKA 3TQIA 4C1BA 5WRFA 4MRAA 1CY1A 3N2GB 1EVJA 4Q0MA 1ECCA 4S1WA 4MGEA 1B6GA 1E0DA 4HWGA 3MWDB 2ZG6A 2ETVA 1X1CA 4TSFD 2PS3A 4JXKA 1AMNA 1QZZA 1E2BA 1RS0A 3WGJA 1JE1A 3JRWA 4RZSA 1WP4A 1X7YA 3E7DA 2DHRA 3WIDA 1NV8A 1DQYA 2EATA 3ELDA 1IZ9A 3HA5A 4TQAA 5DCUA 5B3JC 1K8YB 5MHTA 3IIJA 1HQDA 1W2WB 3PUHA 1LD3A 3HU1A 4IDBA 1QIIA 5JFGA 1NBIA 2GN6A 4YAJA 5EJMA 5IH7A 2P9BA 2FZVA 2GNPA 2CHUA 1NKVA 4ITRC 5BPHA 2OP0A 1ZSVA 3KJFA 1QHGA 3HBLA 5HZHA 2IVZA 2FKAA 4OFWA 3VR4D 4DLYA 2HRBA 3AKCA 4RVFA 2Y71A 4B7XA 3PITA 3D0RA 3EODA 4W1RA 4LGCA 1A4RA 1EJBA 4BMYA 2BTOA 4DBZA 4N01A 1YMQA 2V5VA 3VR3D 2O8FB 1OKKA 2CD9A 3KJZA 3G1WA 1FK8A 4MK4A 3JD3A 3DWIA 3NUZA 4UD6A 3BGIA 4RO0A 3S55A 1SUBA 3WB2A 1MZVA 3C5VA 2ZUDA 1AGNA 1MC4A 3P0RA 2K6GA 5TSDA 4G65A 1BNCA 2XGJA 3RW9A 1OASA 2HGZA 5CVEA 3CRZA 3MRSA 2H2DA 3QEAZ 4RFLA 4DSNA 4XB2A 1E1NA 1K4KA 3ABIA 4HQFA 4JD5A 1DC8A 3DMYA 4D26A 4B47A 2IQ5A 1K6XA 2DG2A 2OXEA 2ZROA 4ETWA 5DNWA 1UDWA 4BP8A 1V8BA 1MMFB 1USUA 3BTSA 5CR9A 1SZDA 1ULBA 2A9PA 3QENA 1B3RA 1AKNA 1K98A 1T6YA 4BLOA 2B7LA 4C7JA 4D4MA 1KVUA 3SEFA 1ZUHA 2QTFA 5CXSA 4ON9A 1PE0A 4E4RA 3ZU5A 1JHZA 2WI8A 2F62A 4WWHA 4ER3A 5C32A 1RXWA 1EA7A 1NTOA 4A2PA 5F9FA 4QYIB 2AJCA 1Y1RA 3GLHB 1YDHA 1YAJA 2AC4A 1N5LA 2NYRA 2VP6A 4LG1A 4CDGA 2D1TA 3GYGA 3VH3A 3CKLA 2FWRA 2N9UA 1FBTA 3RU3A 2X15A 1V4BA 2W6QA 3D7NA 3K9GA 4F8JA 2G76A 4IFTA 2G8LA 3ZNQA 1NNSA 5K51A 2DPMA 5DHTA 4IZHA 2VCEA 1C9DB 5JD4A 2ZAYA 1KFKB 5EKUA 1F0KA 3SF0A 3LHFA 2QM0A 2CBZA 2PEYA 5DYYA 1ESDA 6NULA 5LIRA 2VP5A 3RSCA 4JVLA 1CRQA 2DUJA 1BVRA 2A0YA 4K0KB 1GAJA 3BMNB 2CE2X 1NJGA 1ADBA 2I2BA 3KS9A 4DQVA 4HMPA 3T9CA 2WG2A 3B1FA 2IYUA 5A1TA 5HE8A 5HKOA 1O5TA 3QU4A 4B79A 4F96A 3ESBA 1N4DA 1ZVKA 2W6IA 3S2ZA 2WUVA 4QECA 1UBRS 1SQ6A 1P4GA 3V4VB 3GGJA 1YC2A 4NMHA 5C34B 2JJ8A 2BYTA 2MOKA 4MWSA 3UUFA 3HFGA 4YY3B 4EY8A 2F6RA 2HQRA 2X1MA 1TAQA 3HJBA 4I9HA 3WO0A 5IZ4A 1JAIA 2VPIA 4EVIA 1QYIA 1W19A 3ORHA 3Q6IA 4GQAA 1XDGA 4MVJM 1C3OB 1K88A 4OQQA 1OFVA 3W6PA 1PR1A 2CYAA 2OLJA 1R8SA 1CV2A 2KLBA 1PAUA 3ICPA 4MO2A 2QJOA 3SSMA 4M8LA 4EJMA 1CJUC 3J80A 4L9AA 1H4VB 2R47A 3VZDA 4P0TA 4FDTA 2H1IA 4CV2A 2MYUA 4EHKA 1N5RA 2WB2A 3DDUA 1J2RA 3EF1A 4HNHA 4ND5A 4QOEA 4QPZA 5E1OA 5AVTA 5KQMA 1KDYA 2WZDA 4DDMA 1FVXA 2Q8NA 3L0SA 5KUTA 4DW8A 3HBJA 1E4EB 1CF2O 1D4ZA 3H1BA 5IK2A 3K30A 5EPUA 1R5NA 4R3NA 3W06A 3R5FA 3OEED 5ARCA 4A5OA 1JR4A 2EV9A 2FJUA 2GN0A 4YMLA 4JQYA 5SY6A 1XZMA 3ESQA 1LI4A 3ZCVA 1I1NA 4QUIA 2WF9A 3OETA 2BTEA 1MEJA 2GJSA 1BVYF 4BO8A 1AKTA 4RVCA 1E63A 1XAJA 1N6LA 2NZ8A 1EWYA 1S02A 2VK1A 4X94A 4MJLA 4CIWA 2B9EA 1P7PA 4QBGB 1H6BA 4Z0HO 4CMBA 5LA6B 2R1VA 3DOEA 2HCFA 2H4WA 5H5JA 2CUKA 5B53A 1EUCA 1W35A 3PVSA 2WDPA 3VPFA 1CQJB 1BSVA 1QH8A 2QTWB 3V6MA 4AJHA 2I80A 3E9EA 4E5VA 5FO1A 3DV0B 2WUFA 1NQAO 2HIGA 4N0DA 4NNJA 1RJGA 2KE5A 4RZIA 4NONA 1BAPA 3R3VA 1TJ5A 4MWGA 3DXFA 3F4LA 2YOGA 2JEOA 3FPKA 4Q9IA 1BKDR 4YPOA 1H3FA 4R05A 1JHMA 2OGTA 3RYHA 1X8KA 4H6XA 1GAWA 2QM7A 3PGLA 3BICA 2F8TA 4GR5A 2GA9A 3V42A 3ETJA 1J97A 4FJ1A 4LOKA 5IXSA 3NGXA 2AH5A 5A02A 2NAPA 1O0BA 2RH8A 5IDVA 1MABB 3A1VA 1FSGA 3KEQA 4W8HA 3V8EA 1AH2A 1LLDA 1IDOA 2QXTA 5HIJA 1ZXLA 1XMSA 2I7DA 5LMNB 4DR7B 5ECWA 5JHGB 2P35A 2XYGA 3NI2A 3ZGZA 4UVEA 3W5HA 2HOQA 1E1DA 1UZLA 2O1EA 4GOND 4LKOA 3A1DA 4E13A 2FEKA 2J3HA 2HEGA 4NESA 3V4OA 3K6KA 1IEXA 4DCMA 4ZD6A 5U9CA 4CT5A 1J21A 4D92A 3UXHA 3R6LA 2ZYWX 2V6JA 4RADA 1J2UA 2H6EA 1CWUA 3V3KA 1DRJA 4DG9A 3FPBA 4PR0A 3RVJA 4HVCA 1TGYA 2J9RA 4F91B 1HYHA 5HRCA 4TZ0A 2P2DA 4EUHA 3IPYA 1K92A 2I3BA 1KI8A 2RK6A 3B6JA 3WKEA 4NEHB 2FUG1 5KQLA 4CQMD 3EFOA 3R9IA 1KP2A 3AFOA 1TYBE 2F1JA 3GT4A 2WJ6A 4FGKA 3NV7A 3RJZA 3S29A 1I3LA 3K72B 4DMLA 1R8QA 3EEIA 4LYYA 4MUEA 4UKDA 4XFJA 5ER6A 3THRA 3UG7A 4DV4B 2RSLA 4I8DA 5B3LA 3GJYA 3NHRA 4UDOA 4LRYA 1GL9B 4YCCA 5F2OA 2O8DA 5FWXB 1FYVA 1XCPA 4KLZA 1JALA 1P5ZB 2C3UA 1KDOA 2N47A 2QZPA 4LDQA 4CF4A 4NAHA 1SVMA 1BEZA 1YJQA 1BMQA 4PHCA 3WNDA 3WWYA 2PSFA 2HK9A 3FPGA 4NCKA 2H2AA 1V9LA 4Y30A 1ZJZA 3JU3A 3FHJA 2ZPUA 4XB6B 5GPBA 1UT5A 5JALA 1G18A 1Z47A 2HWXA 1LBSA 2E18A 1G4UR 2PLFA 2X6TA 3AOEA 5K3FA 4MAAA 3ZCQA 5KDDA 2UUCB 1LSJA 1OIXA 7MHTA 1MQ8B 5AKZA 2P2CA 4Z3DA 4R2HA 3U4QB 4EO4A 4Q3DA 1E1YA 3C16C 3PSAA 1X9GA 4L16A 3WB1A 1Z08A 1RHMA 1PL6A 3OLVA 4FYIA 4ZCLA 2CNNA 2Q8PA 3KRTA 3GCGA 4XR4A 4X63A 4BC1A 4EHAA 1E77A 1JZSA 2FPGA 4XJSA 4BKRA 5TEWA 9LDTA 1JV2B 4IJMA 3FVQA 3ESYA 2PX6A 2YJTD 4CETA 2BSQA 1RJ9B 3OZAA 2QY9A 3ZXYA 2ZSAA 5JSYA 5IUNC 2I8AA 2N0SA 4BKOA 4V03A 1JQKA 3FTQA 2GZ2A 2PFSA 5BN3A 2NP7A 4Q1DA 2JIPA 3DVSX 3ZUPA 1K2WA 3B5IA 2A1UB 2GO1A 5I8ZA 1US8A 2NTYC 4IH4A 4QTUB 1IHPA 1TT7A 3K0CA 1GN8A 2VHYA 2FQQA 3NS7A 1JVNA 1U2DC 1JQLB 5ERXA 3C3YA 2CC2A 3VUFA 1UZUA 4A5SA 2EX0A 2VUIB 4MXDA 1CRWG 4RV4A 5AW7A 2EL9A 1RJFA 5HCIA 3E1SA 3C3KA 4RANA 4AECA 3GX1A 2EDAA 1UBHS 1YZNA 2C4VA 2ONCA 1Y3HA 4PAMA 3H0CA 3TWOA 4HNQA 5KQRA 2QD4A 2X2PA 1W59A 4X1IA 1P75A 1Q7BA 4YFVA 5A0FA 2HIAA 4DJJA 4E5NA 1UKYA 2IZ5A 2ECKA 2C78A 4R54A 3VZSA 4BGEA 4PO8A 2IPMA 2E87A 3RTCA 3AIOA 1BU5A 1YA8A 3PUWA 5IW8A 1CEEA 2QMYA 4WJZA 5DFAA 5A7FA 1DKPA 5JC1A 3ELUA 1EU1A 3FPCA 1ABEA 2IUTA 4RMGA 2MSLA 4UU1A 3LL7A 4KO2S 3GQBA 1D6JA 3LXXA 4PS0A 1ISSA 4D3XA 4BLSA 2DHCA 3QKIA 2BM8A 4U7HA 1PTJC 4C4YA 3GA7A 2UZ3A 2IL1A 1NYQA 2P2LA 1NMYA 4Q7JB 4N76A 4P7JA 5A3SA 1ZHFA 4GBED 5D3MA 3DW3X 1MNQA 3ZU2A 3DJYA 5IKPA 3W5AA 4MA0A 1NQ5A 2H8KA 4UXJA 1EUZA 1UANA 3UG6A 2PXAA 1M74A 3VR6A 1JECA 5ICGA 2FW9A 4X71A 4QHTA 3LW7A 4W5HA 4DNXA 4U2KA 5JQWA 2PV7A 2ZE7A 5D5HA 4YCDA 1YMVA 1GU7A 3DSRA 4KO4S 3RWMB 3ER9A 3CLUC 2P4QA 5HKAA 4Q4HA 3OM9A 3FZGA 1EDZA 5G0VA 4XFKA 4MIYA 3D1VA 1T5HX 3K70D 1JXOA 2RMKA 3OFVA 1QNLA 2B8TA 3QPBA 2HFJA 4U0KA 4WZAA 1PVOA 4TZKA 2XVAA 2R44A 4N41A 1IOVA 5DSXA 3HB9A 2C9CA 1VSTA 3TXAA 3R0XA 3GLIA 3N2IA 1GARA 3OA2A 2N1MA 3DUFA 3PR3A 1GGVA 1WW3A 2WTMA 5FL3A 3RVBA 2FMFA 5ICSA 2HN9A 1AUQA 4JBYA 4PFSA 1FMTA 3O2QB 2NTEA 4X7RA 3PKIA 3SZMA 3W7BA 4FYJA 3ZJTA 4OY3A 3WGZA 2Z6AA 1VB5A 4G86A 1ZN8A 3PR1A 1FE8A 4LNUB 3DLHA 3NOOA 2HU5A 1NBEA 3MILA 1IATA 2Q6OA 3NBQA 1N1GA 2QSYA 4QPJC 5IT9A 4L7VA 1EH5A 4QAJA 2CKDA 2ZAIA 1JPUA 1JW9B 4EHLA 3WGHA 3QVSA 5I9LA 2QTNA 2XLCA 4A23A 4DDKA 4RD3A 3HFSA 2EQBA 1X1DA 3M6VA 1GL6A 1ZITA 4I5IA 1MU0A 5FLYA 7AT1A 2ACVA 2BKUA 5KCZA 3PEYA 1QV9A 2C9DA 4FDUA 1YC5A 3LX8A 4KH1A 1RVDA 1W4ZA 1J0CA 3MCZA 2F9LA 4AZ0B 4PYNA 4RLQA 2G83A 4C0AC 4DTCA 2AMYA 1DMRA 4RHEA 1M3SA 3BJIC 2XCSB 2X7XA 1E60A 3NC4A 5KHAA 1I2AA 3QV1A 4QTZA 1C1DA 3OUTA 4LRTB 3SQLA 1W4LA 4Q3NA 3LHDA 3ZWYA 1YOBA 1Z6XA 3MJ4A 1AZSC 2QVZX 3KKEA 1YE3A 4DL9A 5IAGA 2ATIA 4DIEA 2VP2A 3TTVA 4FVTA 4A10A 1YF3A 3FTEA 1U6KA 1UM8A 1Y81A 2PTGA 5KU1A 4ZVOA 2W90A 1XKLA 1TGVA 1G7RA 2JHCA 1NWHA 4C5AA 3JYLA 1ECLA 4N9QA 4ZOLB 1CR2A 3OKPA 5DKFA 3CE9A 4EJ2A 1T5SA 5DNCA 4B3XA 3W6OA 2P0YA 3OQPA 1GLVA 4O4JB 4IIJA 4RMNA 5G3YA 3FTNA 1OLUA 2Z2YA 4TV8F 1W29A 1RFGE 1T4MA 3HXLA 3IDZA 3BGVA 2P9QA 1QGUA 2Z5FA 3ILYA 2WY2D 2FX2A 1AM4D 3M7IA 4OXNA 4BX9A 4HKTA 2PGAA 3DQZA 1AK9A 2WABA 1Y9ZA 1WQ3A 1YK1A 2Q0QA 3P96A 1R0ZA 2Y1OA 4N47A 4ENQA 3IHKA 3KZOA 1RWKA 1E92A 1W4CA 4Z9YA 1AG9A 4DR1B 3NCHA 5FI5A 1OY1A 3NHWA 4CUZA 1JWLA 1P0QA 4UOQA 5F3DA 1T35A 3B9BA 4AKIA 3C3DA 2AKYA 4J0DA 3BXZA 2WAYA 3PD7A 3ZYCA 3ZY3A 1AK1A 1HOXA 1C7JA 1YE8A 1YMUA 3PDCA 4KKXB 3NIDB 1E2IA 3VX3A 1PJSA 5BVGA 3B1YA 2I66A 2PPVA 1EIWA 3R5TA 4G97A 2HTEA 4UQPA 5P21A 3ESDA 4ETMA 3T4UA 4AUMA 2FZ5A 4H1HA 2DQYA 2X3FA 1OXKB 1NOIA 1COZA 5AQ1A 4MR8B 4NENA 5I7HA 3ZJUA 3GXOA 4F1KA 2QNRA 5JWHA 3S3TA 2NPOA 1RVV1 4O59O 2M6LA 2XBMA 3PQ7A 4MUKA 3B52X 5MFPA 2VDKB 4AK9A 2DTEA 1E6EA 3KUDA 3VYUB 3GFSA 2JHGA 1QYRA 4EEXA 5G4KB 4AI6A 2GT1A 4AFNA 1Y1TA 1ESZA 3TIFA 3WQHA 5I3CA 3GJ7A 3VR1A 1Z8NA 4HYYA 1YS7A 3BGWA 4QWMA 2G0AA 1A9OA 4R2IA 2OCDA 5FI1B 1B8NA 5CXUA 3LBNA 2Z8ZA 1IRIA 3KFXA 1PR4A 4XM2A 1JL3A 1NNUA 3U3XA 4IYRA 4WA7A 5BRAA 1L4EA 3HJCA 4KVFA 2A92A 4EY3A 4FKBA 4KWHA 4BTVA 4JQOA 3AWDA 4D8TA 1BCSB 1JF8A 2VF7A 3D6JA 4GRAA 2IYPA 2J3LA 1L5GB 4EYKA 3ILVA 4YP6A 2N75A 2VAVA 2V7UA 1SQSA 4JGGA 1M0TA 1R0YA 4O4HB 2O1SA 3RUAA 3EXHB 4FR0A 4L5IA 1N2GA 3Q2KA 1QGED 3E7XA 2G7MC 1Q77A 4RS3A 4WNYA 2BGGA 1IQUA 3BBPA 1FFSA 3I2GA 1H65A 2HO5A 4QJ4A 5J63A 3FOCA 3Q1KA 4H2DA 3A58B 2RGYA 3CZCA 1C0EA 3FNGA 2ONZA 3W34A 3W6ZA 3LX5A 1BWQA 5I8PA 3ZY4A 1XLVA 3A6JA 2FXIA 2ZI7A 4OAOA 3COJA 1EVQA 5CNKA 3OQIB 2RBKA 2R6GA 2WKQA 1YOVA 3BA1A 4EKNB 4OFXA 2JFOA 4PQEA 4MAFA 3RTDA 1WBDA 3LV8A 3VYRB 1PGQA 1CUDA 5BWMA 3BTOA 3W8EA 1UPUA 2WAMA 3HWWA 2HPVA 5EP3A 3L05A 3B3GA 3GIWA 1IVNA 1PW5A 3AB3A 1CZNA 3E84A 5FD8A 5C9ZA 4J1TC 4V0QA 5JSQA 1ORWA 3L7CA 3OF2A 4OL9A 4H15A 2NUPA 4X6UA 3A9CA 3RANA 1Q95A 4UEKA 4E5DA 4MH0R 4ENVA 1NG1A 1A9QA 1NXSA 4FFLA 1QGDA 2PRSA 2YYZA 5TARA 5LQJA 1QVVA 1A8UA 2GBFA 1Y8AA 2ZPAA 4K81B 3VBEA 1YR2A 2GR9A 1KQOA 4LVNA 4WCFA 1EB8A 2GN9A 4PLTA 3C6KA 2ZSHA 3H5RA 4ND4A 2YNMD 4AX4A 3CUUA 3N87A 3VPSA 4ASUD 1QYVA 2C7GA 4GM0A 5DT2A 4G0WA 3IEIA 1RCTE 1C2YA 5EE9A 2Q0HA 3AHFA 4MV1A 3QXHA 2GZ1A 4Q9AA 1B1CA 4U7PB 3RYFB 1TM1E 5D3KA 1YL6A 1T4BA 4LV5B 5AW8A 4X7MA 2VBIA 3JQPA 1IOWA 1KDTA 1G41A 2KBFA 2ZQYA 3GG2A 1M9NA 1PLJA 3KKKA 4KWEA 3C70A 5I9TA 5IKMA 5DULA 3K5IA 2G70A 1KP3A 4P36A 2HR1A 2QTRA 4LX8A 5DGHA 3CEHA 1R9GA 4L9WA 4MP3A 1I94B 1O96A 1CB7A 3TPCA 3VNBA 5F9MA 3WMXA 2PTHA 3Q3GE 1OBFO 2XD4A 1NVTA 3WC4A 3BSFA 5I01A 1ZU4A 3DEIA 3NM5A 2NVUB 3HU5A 1V41E 2HT1A 4RSMA 1HE5A 3AUJB 2FSUA 3QEMB 3OSUA 1GPAA 4BGIA 5HS4A 3SP1A 4MMYB 2VF5X 2ZBEA 1YL7A 4BEBA 4ENWA 3TZEA 1NP7A 1Z5UA 3PC7A 2V58A 3F3SA 1XXHA 4WZAE 1C8LA 1Q74A 4JGIA 3PYXA 3QNUA 3LC1O 1DCMA 3EGIA 4Y1EA 5TX7A 5DYWA 3TZLA 1J8QA 2QMZA 3K9LA 1QYXA 2CDNA 2Z8YM 3LUAA 1AHPA 2A30A 2WJYA 3G0HA 3A1SA 2BSAA 2V0CA 3IJ5A 3DE2X 3S2FA 1MOQA 4QICA 4EH1A 5MN4A 3PX7A 5GONA 1P31A 2BW0A 5JMWA 4EMBA 4LTMA 2AF4C 5AW6A 5TVKA 3OC6A 2AJLI 2JBAB 4TKVA 2CWWA 1H0HA 1YQ9A 5BV7A 5B4UA 2BH9A 2VDNB 5CFQA 2IS1A 4BTEA 1GRRA 4WBNA 4BWVA 4RPIA 2W2OA 1RXIA 3OX1A 1R74A 4OJTA 1H42A 4IUBS 3TO5A 5JJBA 4YDSA 2VH1A 3BYZA 2PUDA 1T8TA 2P9ZA 3HC7A 4EW3A 2X9GA 5C51B 3W2EA 5KYXA 3V4RA 3F5QA 5TPZD 1XZIA 1PGPA 1CDDA 1DV1A 4IO1A 1EQAA 1MGOA 1OI4A 2BEVB 2E21A 2FK7A 4GICA 5FPQA 2Q5IA 3QMMA 3CWCA 1JDJA 1TB4A 2V6MA 4RMIA 3GLGB 1EKXA 2B21A 5A71A 3M6IA 3A37A 2B1RA 4M36A 1O95D 2VDOB 1OLOA 4QJ5A 4QO7A 3O94A 3G9TA 1GZ4A 2DFPA 3FY4A 4X6LA 2EIHA 3FDZB 4HDQB 1D8TA 3DZHA 5AK5A 1ENPA 3V7FA 4JX8A 3ITKA 2EZ9A 1M6WA 1KYWA 3STVA 3PRKE 3IAS6 3DOHA 1Z6QA 5CITA 5BT9A 3PEVA 2VP3A 4J0JA 1FXWF 1KHHA 3HJTA 4ZOCA 2OMKA 2QL9A 4PZAA 4GMDA 4RKRA 2C4MA 2P41A 2W2KA 4CM9A 4QNNA 2B92A 2WWIA 4A0SA 4PVDA 3SIRA 1EFVB 4L22A 3EVBA 3ICEA 1DIGA 4CVNA 6CHYA 1RKVA 4JBLA 2OORA 2GEVA 1KZ1A 5EPOA 3I6ZA 1WY7A 1I3MA 3W5UA 3AVPA 4QM6A 5CVJA 1RWNA 2Q5EA 1ZQ9A 3LLUA 3UJPA 2B34A 2REQA 4XQCA 2PM8A 3HKCA 1FZQA 2IE8A 1I7PA 2GPSA 4UM9D 1REQB 1XQ9A 3DM9B 5AK6A 1V5GA 2BFAA 1JVBA 2PUHA 4S2UA 5FHQA 4C05A 4I55F 2QZJA 4RVOA 1BMDA 4JR0A 5JQGB 2PL3A 1L6RA 2AS0A 2HUNA 2WZCA 3EPKA 1F51E 1ICIA 3IEUA 3RGGA 1BE0A 1K2VN 1CPYA 4GRIA 2WIFA 3DF7A 3FG9A 3O92A 4ZVUA 4BGVA 4C4RA 1K6MA 3ZE1B 4L72A 2R86A 4MMZB 4Y6OA 1ESCA 4X90A 4R1OA 2ORVA 4RIHA 2IXBA 1AKRA 1QV7A 1U3CA 1DNPA 3CX7A 3CUVA 1QMGA 5EYPB 5B3JA 1DC5A 4RDHA 1N5KA 2GWRA 1F2UB 2PZBA 3OP4A 2Y67A 4S1TA 2D00A 3E5HA 2XCUA 1EP1B 3U44A 4AKHA 2M32A 4QYSA 4AJ1A 4W5TA 2GCGA 3OQBA 2L0XA 3QFSA 2J6HA 3MIIA 2OAEA 3PNYA 4MMXB 5CP8A 4YCBA 5LP6F 1II9A 5LNK6 1PG0A 1GZVA 2VHXA 3CGGA 4AZWA 5CLIA 2JIOA 4ES6A 2QU7A 2Y76A 5AVQA 6REQA 4JB2A 3T3MB 3WV4A 3H8VA 3T7TA 2V54A 5JVDF 3HYRA 4JEMA 1Y3IA 1RXVA 2QUZA 4B4KA 1Z36A 5EGNA 2GCOA 1G38A 3PDIA 2IBSA 1Z8HA 1VQ1A 3PX3A 4H16A 1RQNA 5EG5A 4BMOB 3G85A 4CF3A 3SVTA 4OGWA 3H8JA 2ZE8A 5A6VA 4NBVA 2JASA 2FE1A 1GNRA 3OTHA 4YJ2B 5EC8A 2MSNA 2F3QA 5EXSA 2BI8A 4ZODA 1GGEA 3W3AD 2DJIA 1UK7A 3QKUA 4HDAA 3K0SA 1VIYA 5IFLA 4G5SA 4W9NC 2J3DA 5BNZA 1WB9A 1X42A 3NHAA 3OFSA 4KSBA 1LGYA 2AOVA 2NIPA 4GYYA 5CU7A 2AJTA 1O6CA 5DM70 3GRVA 4TXLA 4EHBA 2HDOA 3QI7A 3HUTA 1HDEA 3T9DA 3AHIA 2BFFB 2OHVA 1KO8A 3BMQA 2P11A 3GN2A 4JKOA 2C7VA 4M89A 2FY8A 4WESB 4OHZA 3TQCA 4PLHA 5KYUB 4MWOA 2DR3A 2ECOA 5AVWA 4WOJA 2XVZA 4B34A 1W0KA 3FSEA 5CH5A 4NCHA 1BTOA 1J9ZA 3G7UA 3DVAB 2JAOA 5J4YA 2CJWA 3H83A 4F3NA 5EJ8A 1HQCA 1SK9A 5FYQA 4D5GA 4CWAA 1KIAA 2WJPA 2YYYA 4EQ6A 3E8XA 3EA4A 3OD1A 3FLMA 4ACBA 1XXLA 2VNKA 4XTRA 3L0BA 2UVQA 2C2ZA 4TS4A 2UZ1B 1T1RA 4O4LA 1T9GS 1WUYA 2FE4A 2BIFA 3K6SB 1GGMA 1XOIA 2H06A 3KWMA 5IABA 2YRXA 3NXSA 4BGDA 4URUR 5DXJA 2A33A 2LDXA 3AV0B 4HDRA 4JASB 2YVKA 4MITA 4UBIA 1OR8A 1A9ZA 1SCDA 3IILA 1XVVA 1GPMA 3OHPA 4NS1A 1CQIA 5AQEA 3RBAA 5FOSA 3V8VA 3X0DA 3GLRA 1LI7A 5H4GA 4YMSA 1WUTA 3PWKA 5MN6A 3LUDA 1LA2A 3ZI7A 2O8VA 2O2EA 3BJRA 2C2WA 3LDFA 2VQ3A 1XDSA 1HFJA 3OVMA 5LZ7A 1T3GA 2ZGVA 4DIUA 3PUKA 4B87A 1V45E 4TVOA 1OMOA 2GBPA 2G09A 3IA7A 4LYGA 1UOEA 1TAGA 1YZTA 4QEDA 4UTNA 4GGMX 1VPVA 2XNDA 2G1JA 2PXCA 2FPRA 2I33A 3GJ8A 1P1CA 4MRVA 5HBRA 5C8YF 4RETA 5K99A 4MKRA 3VI3B 5EIBD 1WDLA 1EMDA 1RD4A 1H9BA 1JWAB 4EZEA 4P54A 3TAUA 1R5JA 1FQJA 3AU8A 3TZBA 3VOSA 4EDFA 3HM9A 2I1LA 3ZY2A 5A0VA 3PCTA 1KEEB 1XQXA 2C03A 4C7BA 1QPZA 2HCTA 1VYHA 3C6ZA 2FPKA 1XRRA 2Q4RA 1MP0A 3LQFA 1UF9A 4REOA 4C14A 1UPCA 1XXHE 5IM5A 2K7ZA 4F5YA 4JY7A 4UTRA 3I73A 4D99A 4CLRA 5IN5A 4DQ0A 4OMDA 3D0OA 5FLXA 1Y9EA 4WY2A 1L5MA 2HAEA 5FPYA 3MOGA 1P5FA 2X1LA 3CLVA 5IUJC 1T13A 1YL5A 3WADA 5FNVB 2A9FA 3MTGA 5EWLA 2O52A 1IY1A 3RHFA 4PZUA 1KPGA 3TL6A 1Y4SA 1JE0A 4E6EA 1GQRA 5IWCA 2AVDA 4I4LA 2F43A 3NJ4A 3OAAD 1BU8A 4HN2A 4GPTA 1TYEB 2PKYX 3SHVA 4KE8A 4L6IA 1VLMA 4QPPA 2IHNA 2VHZA 3VH2A 3V8NA 2GM3A 3GLSA 2X3YA 3MWEB 1C0LA 2HMVA 4YUZA 2GZRA 2B4AA 1E7YA 3C3JA 2AEJA 3BTUA 2R7KA 3NW9A 4ABYA 3LZ6A 4KMMA 1I32A 2B7BA 3CWQA 4NFSA 2G9NA 3RJ9A 2BC9A 2CVZA 2RHGB 3F5FA 2NO5A 1KDVA 2VC2B 5T4EA 4LJKA 4QBTA 2ZDQA 5C1DA 3QOYA 1DAIA 4TSFA 5JLJA 3AUFA 4QT0A 1C80A 2V9CA 3BE8A 3DR3A 1M54A 1P7WA 3CRRA 3CEJA 5JD6A 5CEFA 5K5EA 2IU4A 1JLSA 3QRWA 2G63A 1RQLA 2OV1A 4L27A 1PNTA 2BUAA 1P0FA 2HMSA 1PL0A 4MA4A 4IQ8A 2GASA 3W9UA 4OU4A 4B46A 2PYDA 1B15A 3CBQA 3FPHA 1ORHA 3EXAA 3K4PA 4PZYA 2ZWAA 2Y05A 4MZDA 4NE7A 4V0SA 3G2MA 3DVRX 2C99A 2J31A 4U3JB 3VHLB 2Y4OA 3GC6A 3UMCA 4AWAA 3BVPA 1Q2UA 1DG3A 2NO7A 5AI9A 1DKLA 3VR4A 2G72A 4Q19A 5EUQB 2DFDA 2FN4A 4N3AA 5BYJA 4YIKA 4IKEA 2XKAA 3SMVA 1FA9A 1E4YA 1JPNA 2J67A 4DRZA 1SU7A 5I7EA 1AB6A 1N25A 2IKSA 4JR1A 1QQ6A 4LQDA 5FOTA 1JX6A 1MOPA 2GLXA 4FFPA 4RXTA 5KSWB 2H3EA 2BBSA 1OFUX 2Z9DA 3R40A 4JUDX 5EN4A 3CZ9A 3U7GA 2XW6A 4WIAA 4HS9A 1H2XA 1MVNA 1M67A 3P32A 1RM5A 1SBIA 4P3XA 5DGDA 4NJOA 2O8EB 1XA0A 1SD1A 2J0VA 2FSFA 3CSUA 3H11A 3TSOA 1FU8A 4WNAA 3E1KA 4N5MA 3UMGA 3D6NB 3QEOA 4QU5A 3DP9A 2XYHA 3JARA 3R5SA 4KX3A 2QUKA 4AP6A 4RVNA 1VE7A 3F4KA 5FBWB 1GKIA 1UBMS 1NUAA 2EOAA 2Z2JA 4P33A 4PICA 1CRZA 5JIBA 1OXMA 2H48A 2Q5HA 1QRAA 2Q9CA 5LYYA 5IM4F 2AOTB 5H68A 4Z9BA 3CSSA 5HMLA 1QFYA 5AM4A 4ZCIA 4GNKA 1LWNA 1TM3E 3AEQA 1KI6A 2F1RA 4UCWA 1ZR2A 3AZQA 1ZZGA 4GLOA 5FA6A 5F21A 2G71A 1D09A 2JDIA 1UM9A 2PGIA 3GIDA 2PX5A 4LWQA 3ECSA 3TOCA 2O0HA 4DCSA 1IXYA 3I5UA 4LMBA 4L4RA 1GILA 1W1UA 2HNKA 2B82A 3CB4A 1RYZA 1YDWA 1BA3A 1MC1A 3D0KA 4NH4A 2VJKA 5JSKA 1DXQA 1PVVA 3RGWS 3OQNA 3KEFA 1Q19A 1VPEA 1PRYA 1Z2CA 4LHEA 1I4LD 3A4YA 3RWOA 4QT4A 3THYA 1A95A 1IUKA 1E9RA 2A9QA 3WMFA 2BY4A 1OFTA 1IFXA 1GTL1 1PQ4A 2VYNA 3IT2A 5LDDC 2BD0A 4OHVA 4MCJA 3VAZA 3VZCA 5K1ZA 3TIVA 2IXDA 4IHQA 4MUMA 3VO9A 1VPDA 1WCWA 5K4GA 1UXKA 2W71A 4ZCQA 5AXDA 4QRIA 1TF5A 2ZUBA 1DX6A 2A9RA 3RVQA 4JDUA 1RKXA 1KI3A 1S7GA 4M0DA 4KIGA 3GVXA 1QOPB 4EB6B 2QT9A 4GC9A 3QE4A 5BSTA 4LOJA 3SHFA 1USVA 1F5NA 1D3AA 1QC5B 2IY8A 1C4OA 2FFHA 2Q2OA 3GA0A 5ESRA 1N3BA 1NVEA 3LZCA 2Q5FA 2GWHA 4CL3A 4W9MC 3OJEA 4P7BA 1X80B 2C9BA 4D82A 3KVNA 2PKEA 2DBVO 3UWDA 3CCBA 1RJEA 3R4CA 3DEZA 4LS3A 2LV8A 3WYEA 4F04A 2EQ5A 1X19A 1Y3FE 2QR5A 1G6OA 4HY3A 5EVJA 2WUDA 5A4IS 3FAKA 5ETJA 5BW6B 5TQ0B 2POQX 4JSTA 3WVNA 1MA3A 4RQTA 4BCDA 1MAUA 4Y2QA 4YMVA 1F5SA 1KQGA 5DLPA 5AJTA 2HU7A 4XYEA 1Z83A 1ZC4A 3CPHA 3DGEC 4DB4A 3P0EA 4C2TA 4FMBB 1V0JA 3AEKB 3DV9A 1TTPB 3IIKA 4IDFA 1OLSB 3T34A 2P4UA 3HABA 1UBFA 4L2IA 5SZIA 3REGA 2WU4A 2QMEA 3I32A 4ZYLA 4AJKA 1XZGA 1U2RA 2B35A 1YQQA 1CQZA 1F8YA 1PEAA 2AYXA 2DUMA 2R8XA 4N8DA 2I34A 3ZIAD 4K46A 4MYTA 1RLUA 2OO5C 4B84A 4BMZA 3TL2A 3HP1A 1CDZA 4K1LA 3WGMA 2ZIXB 3CIOA 2HEIA 4ZREA 2ST1A 1JFFA 3WWPA 3RUHA 2NVBA 1X38A 2E4UA 1BXRA 1DDOA 4MRSA 1ENZA 2NG1A 4W9RA 4UNIA 5CK4A 1GLGA 2D8MA 3T5DA 1XLWA 7ABPA 4AIRA 1E3QA 4GXTA 1Z33A 2R65A 1T3LA 1RXYA 5NULA 3NLLA 1P91A 4C5CA 5JH7B 4RYLA 2X76A 3P9YA 3I9OA 3BIOA 4FMDB 4LHWA 4JT4A 3VU0A 4BRZA 1VJ1A 5HIKA 5TNXA 5I7FA 1U81A 3OTWA 3E9DA 3E5NA 3LP6A 3LT2A 5HQ3B 1MAAA 1VCHA 5D7NA 2IU6A 3GP8A 3I04M 2RB4A 3WRWA 1WM1A 2IYAA 2XNCA 3OQJA 1XELA 3UW3A 1U31A 1J0XO 5EUBA 1Y3AA 4AMBA 2AC7A 1O08A 3FTDA 3F46A 3WMWA 2J07A 1QFSA 4G8CA 2ZP1A 3Q0IA 2DUWA 4GZ5A 3ONEA 3QA3E 4RH1A 4NCBA 1ITZA 4HWKA 1TMKA 1MEOA 2AN1A 3VDNB 2QTAA 3HKBA 1DX4A 1GPBA 3WNQA 2GFQA 4XCQA 3UUGA 2FSSA 4H1TA 4RFVA 2GM4A 3BF8A 4QREA 4QXRA 2NLOA 3T41A 2WE8A 3KHUA 1U8YA 3VKFA 4HYQA 1I4OA 1PS8A 1RE1A 4HTFA 5IDQA 3OMXA 2BI7A 4RMJA 3AUTA 1E8MA 2FPIB 3QI2A 1DKQA 1XEXB 2B3TA 4NL4H 2YY5A 3U37A 3NHKA 3W7VA 3QU7A 1HLFA 4NI5A 1F48A 2OFOA 3NM4A 4NR0A 5EJFA 5I9BA 3RQIA 5IT0A 1UAYA 5ENZA 3YASA 1VG8A 3K1AA 4CQMA 4FYVA 3LT0A 3WXMA 4KSCA 3SC3A 2HLPA 2QPTA 3LLCA 1SOAA 4EB3A 4F4CA 1Q50A 4TLBA 3S99A 3V55A 2IP1A 3AUKA 2RJOA 5H7XA 3UAXA 1Z0DA 2WWXA 3GFTA 1TYZA 2GEUA 4C6TA 1FYXA 2WWTA 3KU1A 3ZHVA 1WXGA 4PZCA 5D8DA 3K0EA 3AVVA 2FSIA 2RHOA 3KSUA 3CW9A 4OQNA 4YAGA 1SM4A 1YT5A 3A1CA 4BNGA 2QMOA 1K75A 5KCMA 2UU9B 4RPCA 4R84A 4BV2A 1KNXA 1MDFA 3F6CA 3GRPA 2GSWA 5BNIA 1CUWA 1E0JA 1OVGA 3MTEA 3RK0A 4OBXA 3M5WA 5HFJA 1QSGA 4IDDA 1UJ2A 2R66A 4YJKA 1K27A 5F9HA 4Q1EA 4V2UA 4CFZA 4E1AA 3A70A 5A1JA 3BH6A 2VQEB 4DTIA 5B58C 5K8CA 1PJAA 1YRHA 4B4UA 3DBOB 3D4LA 1BX1A 1E9SA 4HDNB 4V24A 4S1PA 4JB0A 1Z56C 3KQVA 4BQEA 4TMVA 3X2SA 1P2VA 1OXXK 3ZBTA 1ZDMA 3EXHC 3GELA 3H19A 1UBCA 3WRXA 1I4EB 3KTAB 2Q46A 3PE6A 4X45A 1TKBA 1XROA 2V3WA 3O1HB 2HB6A 3AMVA 3QXSA 4BFCA 3DMTC 4MPTA 2XMRA 2BZ1A 4JX9A 3IT1A 3I12A 5KTRA 1SA0B 1UJ4A 2HK8A 2I3ZA 1PP4A 5CX1A 3JASA 2SKDA 5D3QA 2WA2A 3NHBA 5KOHB 3PVZA 3PUZA 2ASVA 1FVOA 1OQAA 1TJYA 3ZHTA 3QYFA 2WVAA 4PIPA 2O8NA 3THXA 4MGZR 3SOPA 4G5YA 4UUQA 4NMLA 4OFBA 4YRTA 2I2DA 2F3PA 3TBHA 3MGKA 4CKEA 2X6RA 3W90A 4DSAA 1N32B 1NJSA 3DTTA 1LK0A 3W6NA 4K2AA 2WKWA 1AF4A 5CM8B 2C82A 3UGJA 1RRMA 3IYLW 4GX2A 5AKLA 5JHHB 2H1OA 1DGQA 2VCHA 4HWSA 1V7CA 5EA2A 4DZRA 3GFVA 1CJSA 2JG3A 2RHBA 4MLPA 1EFLA 3A3NA 3ONNA 4A0GA 2P9FA 3BGOS 2ORED 4J7UA 3ZOKA 5GADl 1ZNZA 2Y0CA 2Z57A 2R6CA 4DUPA 2RGEA 3H6KA 5NLLA 3K70B 4G0UA 4UCQA 5TF4A 1WZNA 1ACLA 2QWXA 2DOKA 2XUDA 3K9CA 3QWBA 3M70A 4DKXA 1NAHA 2BKAA 1ZGBA 3R5XA 1J25A 1JH8A 1TO2E 1WCXA 1Y7HA 2HCRA 1FB5A 2WIGA 2YJ3A 2ZXFA 4J8PA 4L8FA 2VHCA 3TL3A 1L5KA 4MHTA 3TI9A 4MQ6A 3SEZA 3G8AA 2OC9A 4GPZA 1T0BA 1Z4KA 4MWBA 3LVBA 1G0NA 1ENOA 2JRCA 1ATIA 2EZUA 1PJLA 1Z07A 4NNOA 3DOFA 3UV7A 5E0OA 3HXPA 1HA3A 3PENA 4DSZA 4UJ5A 3HEAA 3H18A 4PU0A 3RFXA 1HURA 4F2PA 3MTQA 3B1XA 4L85A 3X1JA 1FS5A 1K7FB 1X3SA 3EVAA 1R18A 4EGSA 2WTEA 3O8BA 1TVKA 3NCTA 1H2ZA 4XOUA 3I23A 3LW8A 1OYYA 4XQGA 4NY1A 4A0HA 5AM1A 2CL6X 3T5AA 3FB4A 3SSOA 1PUJA 1QHNA 2C31A 3BULA 1UUFA 4QYMA 4EUNA 4C3VA 3AHDA 4PQRA 4PG6A 3T5MA 3USCS 2O2JA 4YRGA 5B7PA 5LJIA 3U4HA 3GVPA 2EZ4A 2OXCA 2RHHA 5BUZA 2OK8A 5A2QA 1NQOA 2FWJA 3GD7A 3ICVA 4AY5A 1CTQA 4J1TA 1KXJA 5FFMA 1YR6A 3D7KA 1OTHA 3ESZA 3K8OE 3QG5A 4DMHA 5IF3A 3EIHA 4JI0B 1T3ZA 1WOMA 3GF4A 1Q0PA 3VPDA 2C58A 3R09A 2DKOA 4H4CA 4IWXA 3ZWBA 3OM8A 1LZLA 2DH6A 2FHPA 4DJ5X 1H4QA 3HB5X 4KVZA 4OKIA 1BXKA 3QVLA 3ROKA 1KJWA 4FK8A 1EJ6A 1B73A 3SC2B 4GBMA 3DNFA 1HK7A 2I78A 1C7IA 4N0MA 1DQZA 3TINA 2PXXA 1UFOA 2JVKA 3AESB 3W8DA 4C0JA 5CA1B 2H1CA 5FEMA 1DMSA 2Y77A 2QAGA 1IBCA 3N8DA 4NLLA 3WGGA 4BO6A 4C0KA 1W25A 2NUTB 3QQPA 5FWNA 5GM1A 3MAAC 1MA0A 5T64A 4WY5A 3AFMA 3I2HA 3W2IA 1V1RA 2TMYA 2H4HA 3HFRA 4XGRA 2HMWA 2E4ZA 2IQIA 2Z08A 3DGFC 3MT9A 1RZRD 3STUA 1OGJA 1TYAE 3ROQA 2Q0SA 4IDOA 5KTSA 1HDZA 4OVKA 2QRLA 2G80A 5ADUS 5K0JA 4NECA 3HXTA 1V48A 1AO3A 1BDMA 2WMOB 3OTGA 4N65A 3MJFA 4NU0A 5E8JA 1M6YA 1PJ4A 2VJCA 4LXGA 4M0FA 4OIMA 5AM0A 5FUVA 4XQEA 3R7DA 3ZDEA 4CHTA 3L3BA 1GXSA 3BUSA 1QK4A 3BD7A 2XGMA 4IUCS 2WHPB 1U2PA 3N76A 4BIIA 4HNSA 1UXGA 3ABRB 3QEBZ 1HT1E 1KU6A 1FNCA 4N9WA 3AEUB 4J7AA 4JOSA 5KYTA 4KRFA 2QD2A 2II6A 4ROTA 1WHTB 1YQEA 4RHFA 5CFRA 1EUDB 1PZEA 4ZALA 4D56A 1WSWA 4DLLA 2PQMA 1A9TA 1DPGA 4JYPA 4RJTA 1E5LA 1GFSA 1SXGA 4XWAA 3VYVA 2BDEA 1SD2A 4WECA 3ZS9A 3IAFA 4CTKA 2QV7A 2XWPA 4XX0B 4GI3A 3E27A 4WGFA 3K3PA 4PFQA 5LUBA 5IHXA 2G82A 1FLAA 2V7QD 4W8OA 3W4IA 4AS3A 3OTIA 4LJRA 4BV8A 3DTVA 3T7JA 1ECGA 1EP9A 2QTZA 4TMYA 1QG6A 3B36A 2NVWA 5G1NA 2LTAA 1MBZA 1BN6A 2ERCA 3D59A 1VDMA 3N2GA 3FUXA 2ZI3A 4YHHB 3MWDA 2P3OA 2R60A 1G6HA 3CHYA 1N6HA 2X0NA 3P9SA 3P1JA 5EXPA 4KUEA 3R3WA 5CDYA 1NJ6A 1FDOA 3VHQA 3EZ2A 3UGQA 5JISA 1RAAA 2WSBA 1U9YA 2ID7A 4DQKA 2ZZNA 1F2VA 4E2YA 5KMGA 3BE6A 1G98A 3TX2A 3CEAA 4GPD1 2VHTA 5BN5B 3LPDA 2OILA 3P5BA 2QD1A 1W4AA 1U2TA 1BCRB 2JNWA 1HY3A 2IC5A 3VFDA 4HZIA 3OU6A 1QO0A 4G67A 4XJXA 3BEDA 4KN5A 5HOQA 4ZCPA 3K73O 3FYUB 2JCGA 3DBHB 1GFZA 2IYYA 1ZVQA 2VLIA 3E22A 4RF5A 5DX0A 2E4AA 4KRGA 2YY7A 3DCIA 3V5NA 3PCRB 3C8ZA 1FL9A 1KEVA 2GBIA 3T7IA 4Y6GB 2ECFA 1OGIA 1A5ZA 4ZQGA 4IDNA 1XEWX 5BSGA 5JCZA 1LBTA 5JI2E 1DCKA 4WFKA 2R8RA 2P69A 3AEZA 1DEXA 1RBQA 1IH8A 4KH0A 1UBUS 3HUDA 1L1RA 1TFRA 1ILEA 4OYLA 4HN9A 2IK8A 4DM3A 1QZUA 1ZD9A 1OAAA 1K86A 3NETA 1W2GA 3C8DA 1KPHA 4YV2A 1XTKA 3FRJA 4K1XA 4JL6A 1H69A 2X40A 1EEHA 4OHWA 1M1ZA 4RTJA 3B6KA 5G0SA 3DB2A 4XPZA 3LYHA 1R66A 1GSIA 2FWAA 1P29A 2VEOA 4LJ8A 1J1ZA 1YKSA 4PHGA 3URKA 3FNFA 3OX4A 4LOHA 1BO6A 3SC4A 2CLFB 3TOVA 4AUNA 2JFNA 1ZKDA 1VKJA 3DAFA 2A4KA 3JD0A 3NWEA 3GJQA 1H0SA 3BHNA 3Q2IA 5BN1A 2QQGA 2CFIA 1QO7A 3P2JA 3ZD8A 3ZDRA 3NAZA 4NZNA 4V1CI 1SBCA 1U7UA 4NG5A 1E3MA 2XZTA 1P19A 5I5EA 3SYMA 1ADGA 2VQSA 1ZXXA 4OH1A 4X84A 2HCBA 1OVMA 4FC6A 5ECDA 3L7DA 3ZHUA 1JHUA 4CM7A 4ZAFA 4ZVLA 4LUCA 5E1BA 1LDGA 3TKAA 2Y93A 3GT3A 2RGAA 4X61A 1I2ZA 1AUXA 2YHAA 2D1FA 3L8ZA 3NOVA 3VPCA 2WHQA 1WUHS 3A05A 1MX3A 2BV3A 3FFWA 4QHSA 1LJ8A 2E4XA 1NBMD 4JXJA 2F1KA 1NXTA 3N1UA 1UBKS 2H4XA 5KSPA 4PYRA 5CBKA 5H3LA 1CR0A 3T5GA 4YXWD 1LH0A 1UBGA 4S04A 4EUKA 4IEEA 3U0BA 5DHUA 1WMSA 2PA0A 4C22A 1OX4B 2OAP1 2ZATA 4RABA 1NZJA 4G1UC 2YNMA 1RRPA 3CZPA 4ASUA 1TPZA 4JENA 4EY4A 2NVOA 1P60A 3QMVA 1Y4AE 1V1MB 3S2SA 4BJ3A 1O4VA 4LC1A 4FM9A 2QLMA 3RI3A 1OB5A 4F38A 3C6YA 2NPFA 4M55A 1DEKA 3ROEA 4DEXA 4BBPA 4RGVA 8GPBA 1E1LA 2COUA 2OHHA 3QOWA 1QVAA 1YD7A 4U7DA 2DJ5A 1ZZEA 4P32A 5D2CA 3T1YB 2Z2KA 1FDWA 3U3ZA 5C4MA 1FFCA 5KWVA 4KACA 1IZ8A 1TYCA 2R8YA 2VH5R 3AR2A 3GJRA 4CMHA 2BMDA 3CZ4A 3FSGA 1GPJA 1JDBB 1A3CA 1FP2A 1N5JA 3F6RA 4FLEA 4ARZA 3H1GA 3IESA 3VI4B 1E9CA 2Q3LA 4ILKA 1F6DA 2AQ8A 4K6GA 5DCYA 5AHKA 3NIBA 1M8FA 2PS0A 1Z34A 1E4EA 2QP3A 4INAA 1SB9A 2XNKA 1FTQA 2I76A 4OXYA 2TMGA 1Q84A 3B85A 2XY4A 1DDGA 3C5WP 5FT9A 1FSSA 1M8JA 3CLSD 3CWZA 1E2EA 1M75A 4B0PA 3V4PB 1FLVA 3QEJA 4ZHQB 2DETA 3COWA 3KLOA 4YRAA 2EJWA 3IUMA 4G0VA 1KEWA 2CLDX 2XV1A 3W5IA 4V3CA 4KRYA 3RLIA 1JQ5A 1NKTA 4XGIA 3RRXA 3EA0A 1U8CB 2DHDA 5K3EA 4WZBA 3SE7A 1ETHA 4KXNA 1QCYA 2W2LA 4MW9A 4ZKEA 5L7WA 2PO5A 1DQPA 2NADA 1PFGA 2YZNA 1Z88A 2XZDA 3ID6C 1CJCA 1U7WA 8ADHA 1NSTA 2R87A 3I6IA 4D0RA 1CQJA 1VLHA 2E49A 4UEOA 3CKMA 2HXYA 2R8OA 3GFPA 4QDKA 4XB1A 4XIFA 1R1DA 2IUSA 3LKBA 1U2EA 4DNPA 5IF9A 1YBHA 5J4KA 3DV0A 3MWKA 2CKMA 4FOLA 5KJEA 3Q8KA 1N2CE 2BMJA 4XD7D 3TM5A 1P5JA 4UXIA 5HILA 1PFVA 4KFRA 2JC3A 4M98A 1E3DA 3UWKA 4KVGA 4W63A 3STWA 4RDXA 3T0GA 5JAMA 3BHMA 2ZRPA 1KVRA 4TV9A 1CIVA 1JG1A 1ORVA 3GQVA 4I2VA 2WSYB 1P1JA 1XN4A 4TWZA 4J3NA 4EA8A 5LBUA 2BGRA 4G5HA 2VPPA 1MHTA 1NQXA 4AYTA 1QJ4A 3K94A 5EINA 4TMXA 4EHHA 2CBGA 5ALRA 4H6WA 4NZZA 3RRBA 3A6EA 4OQLA 4CHGA 5HUHA 3KB1A 5DVZA 1RHUA 1QRTA 3LNTA 2AOWA 1L7NA 2C4HA 2YCLA 2O7NA 1GWNA 1N2IA 5AXCA 4M7OA 4E1VA 1IQ0A 4FSDA 5AKKA 4BAUA