1VFNA

Purine nucleoside phosphorylase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
270
Chain Sequence
GYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPEGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGQNPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDSQGKANHEEVLEAGKQAAQKLEQFVSLLMASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleoside phosphorylase
molecule keywords PURINE-NUCLEOSIDE PHOSPHORYLASE
publication title Crystal structure of calf spleen purine nucleoside phosphorylase in a complex with hypoxanthine at 2.15 A resolution.
pubmed doi rcsb
total genus 75
structure length 270
sequence length 279
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 1996-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vfnA00
4BMXA 1Z35A 2OC4A 4BMZA 4TTJA 1Z5OA 2IQ5A 2QTGA 4WKBA 3PNPA 2HN9A 4M3NA 4DARA 3KUKA 4D8YA 5EUBA 5C80A 1K9SA 4MARA 3UAVA 1C3XA 1PWYE 1Z39A 1Z5NA 2A0WA 4K6OA 1YBFA 4RJ2A 1SD2A 1JDZA 4TXHA 1JDSA 4EARA 1LV8A 3MB8A 3KVVA 1U1EA 4WKOA 5CYFA 1ODKA 3PNSA 4DA8A 4TXMA 4E1VA 4D8XA 1PR4A 4OJTA 1Y1SA 4LKRA 1PF7E 1TCVA 5JPCA 1LX7A 4QEZA 4YNBA 4EB8A 3K8OE 1JE0A 4R31A 1M73E 1ODJA 1CB0A 3OF3A 1PW7A 4TS3A 2I4TA 2QDKA 3D1VA 4YJKA 1YQQA 1RXCA 2HSWA 4JOSA 4DAOA 2P4SA 4F2WA 4QAQA 3P0EA 5F73A 3OOEA 1PK9A 5B7PA 3E9RA 1PR5A 5IU6A 1NC3A 3BL6A 4OY3A 4F3KA 1PBNA 5FAKA 3UT6A 3BJEA 1ULAA 1T8SA 1RXYA 2ISCA 3O6VA 4GLFA 1ODIA 5F7JA 1YRYE 1Z33A 3DDOA 1K27A 1N3IA 4G41A 3DF9A 2OC9A 4DANA 1U1DA 1LVUA 1I80A 1PKEA 4JP5A 1JDUA 1Z5PA 3K8QA 3P0FA 1SD1A 2XRFA 4DA0A 3KVYA 4NS1A 3LBAA 3GB9A 3PHCA 3BGSA 5DK6A 4F1WA 5B7GA 1ULBA 4QASA 4PR3A 3SCZA 4TTAA 2AI2A 3FWPA 3MMSA 4U2KA 3EEIA 2A8YA 1JYSA 4TYMA 2AI1A 5CXQA 5B7QA 1YR3A 1TGYA 1G2OA 3BSFA 4LZWA 2ON6A 4F3CA 4LDNA 3DP9A 5F7OA 1NC1A 4DABA 1PR6A 3FAZA 4G8JA 3OZEA 3KHSA 1V45E 1TD1A 3T94A 2QPLA 5CCDA 1TGVA 1V48A 1CG6A 3OOHA 1T8RA 3EUFA 5I3CA 4MCHA 1NW4A 1A9SA 1U1CA 1RXSA 4R2XA 2QTTA 2B94A 4JWTA 4L5AA 1Q1GA 4WKNA 4GLJA 4M7WA 4F2PA 1U1GA 3OZBA 5F7XA 3NM4A 3E0QA 1PR0A 3UAXA 4D9HA 2AC7A 4LNHA 2A0XA 3E9ZA 1XE3A 1V41E 3UAWA 2HRDA 4BMYA 4OGKA 1OTYA 1JDVA 1SQ6A 4P54A 1ECPA 3OCCA 1Z38A 4GKAA 4DAEA 1PR2A 1Y1TA 4H1TA 1ZOSA 3OPVA 1OV6A 1RFGE 5F76A 3IOMA 3DPSA 1RR6A 3OZDA 1SJ9A 1B8NA 2OECA 5KB3A 4X24A 3UAYA 4TXLA 1ODLA 1Z36A 5CCEA 4DA6A 1B8OA 4TXJA 1JP7A 4OF4A 3EUEA 1QE5A 4TTIA 3FUCA 1A9QA 1T0UA 1K3FA 4G89A 4ECEA 5B7NA 2GUWA 4L5YA 1PR1A 1Y6RA 3LA8A 4L5CA 1Y1RA 3NBQA 4QATA 3GGSA 3U40A 4BN0A 2PGAA 5ETJA 1T8WA 4YO8A 4UC0A 1A9OA 4QARA 4I2VA 3KU4A 1OUMA 1Z34A 4TXNA 1RYZA 1RSZA 1OVGA 1Y1QA 4WKPA 5CXSA 3FNQA 5EPUA 3O4VA 3UAZA 4NSNA 4L6IA 1RXUA 4FFSA 1RT9A 1V2HE 1ZL2A 3INYA 5EFOA 1U1FA 4IP0A 4L0MA 1JPVA 1A9PA 4TS9A 1FXUA 1JDTA 5IFKA 2A0YA 4NY1A 3LGSA 2RJ3A 2OXFA 2AI3A 1VFNA 1RCTE 1WTAA 3NM6B 1Y6QA 5CYGA 1TCUA 3ODGA 4YMLA 1VHWA 1A9RA 1VMKA 3EMVA 5F78A 4D8VA 2I8AA 3PHBE 2QSUA 2BSXA 3FOWA 5F77A 4PNPA 1A69A 1VHJA 2H8GA 1V3QE 2HWUA 4QFBA 3TL6A 4OEHA 3FB1A 3IEXA 1PK7A 3C74A 3NM5A 1V4NA 4OGLA 5K1ZA 1OU4A 4DA7A 3QPBA 3KVRA 2Q7OE 1T8YA 1A9TA 1Z37A 4GMHA 1OTXA 4WKCA 3OZCA 1JE1A 3F8WA 4MCIA 4D98A 4KN5A 3DJFA 3ENZA 4M1EA 4R2WA 5F7ZA 1YQUA 4LNAA 3ONVA
chains in the Genus database with same CATH superfamily
1NJ5A 4BEWA 1MTZA 2BFEA 2Q6IA 3KPJA 1Z5OA 1CE8B 2EX4A 4WKBA 1MF7A 1W5AA 3GEIA 4L02A 3PNPA 4YR9A 2ZCUA 4H60A 1ODFA 4UMFA 3BCUA 4G0VA 2VYFA 1K5PA 2JI9A 5CX4A 4XPIB 2HUPA 2ZSDA 5E8RA 3WHPA 1IN6A 3WB0A 3KUKA 5E0OA 1FA9A 1CJMA 1SK9A 1VZ3A 4XPZA 3U44A 3B85A 3K1AA 2QRJA 1MB0A 5I7FA 4FBLA 1EG7A 1ZKMA 4RPCA 3HDVA 3AP1A 3MF4A 2EHDA 3L0BA 1XRRA 4B4OA 1H2EA 4GE0A 4TWIA 4WXMA 2CHGA 4OYHA 2J4CA 1DAKA 4L9RA 2YDXA 3GJZA 3IMFA 4YJ3F 3P8ZA 2P2GA 1MDFA 4WOKA 1KZHA 1EX1A 1BZYA 1R9GA 1WUIS 3VI3B 4Q4AA 4DNFA 2Q1XA 2GN9A 4MB2A 3UFXB 2R9VA 1JDJA 1WTCA 3GGDA 3AJRA 3QEKA 3SXPA 1XQXA 3GRUA 3CZAA 3OVMA 4ARVA 1UZMA 1OX5A 3CNHA 4MS3A 3K4HA 4IJQA 3GLFE 3DLHA 1K4MA 1OWMA 1PJ4A 1YUBA 1FP4B 2OAGA 4R9UC 3FYSA 3RT1A 5GVSA 1JG7A 3STWA 4HZUA 1NYRA 1MT0A 5JAMA 2XVAA 3PG5A 2EG5A 3ZWBA 4CE6A 1OGJA 1UKAA 1AD2A 3H2HA 3KUDA 4J49A 3TNJA 2BM0A 4D44A 3EB9A 4Z9XA 4GF5A 3EDCA 3UUEA 3WJ1A 2GN6A 3WLNA 2C3PA 4YCNA 2KB0A 4UD2A 2J3IA 2B4RO 3PJGA 1J24A 4CPDA 4K6HA 3C3BA 4OQLA 3CXUA 3EF1A 4OQNA 4MW5A 2VUSA 5C7OO 2XMGA 3DMPA 4HQKA 2Q0SA 4TVSA 1KGDA 3H1FA 2EZ9A 1PBTA 3IAS1 1TK9A 2GWRA 1JQKA 1EQ2A 3GJSA 3VX4A 4TQUS 1GM5A 1G291 1IRIA 2IOFA 3PNOA 1UMKA 3FWNA 3OKFA 2FRVA 1Y8RB 2BSAA 3EFOB 1U8TA 4BZPA 5IF9A 3G2KA 3R3ZA 2C77A 1Z4OA 3A4VA 2ORED 5ULLA 3FAKA 1X1QA 3QOWA 5DHRA 5EIAA 1Y4ZA 4TS3A 3C7KA 3JATA 3P2JA 2B9VA 1R0BA 2FWRA 1USUA 1ZI9A 3M6MD 2JGKA 4JOSA 4TUYA 3U3MA 3STVA 3GBSA 2WUDA 1J0AA 4JOQA 5JNLA 2FR8C 3I73A 5IT5A 1FZQA 1TW3A 4HDNB 5GAJA 5J5VA 1L5WA 1GAQA 1K89A 3OOEA 1UFRA 1LW6E 3RAEC 4OL9A 2GRAA 1T2EA 2J07A 5AXCA 2YHIA 4CKBA 4RF4A 5B7PA 1H4TA 2TMKA 4TMTA 3PEFA 4BLQA 1U7PA 1LS1A 3C1AA 4I5IA 4OUDA 4PSUA 1NC3A 5TRTA 4QM6A 1R8JA 3CW2A 3HB5X 3HVKA 1BDHA 3PLRA 2XMBA 2Q5FA 5E6RB 2VPXA 3K31A 1DE0A 4MXDA 3RGWS 1ZJ4A 3AHFA 2IPOA 4IILA 4YB8A 2Q21A 3T1HB 2C2KA 4NBLA 2ISCA 4MR7B 5C35A 4ESHA 1RTKA 3TUZC 4GX5A 2BFOA 2SCUB 1C1XA 1WB9A 2O2EA 1IWPB 2O8EB 4ZPJA 5JZOA 2P9GA 4N0PA 1JKJB 2WNSA 4YAEA 3D6NB 5FOSA 1AZSC 1I1HA 4F12A 2QVCA 2RKOA 1NL3A 4TTPA 1TJ5A 3LNTA 5IG2A 5L3SB 4HAUA 4DANA 1O1YA 2AN4A 3WLFA 3E9QA 2I22A 2Q6TA 4M21A 2IP2A 4Y2JA 3DL2A 3QLVC 1CUXA 3K0EA 5LD2B 3ER8A 4DWVA 4OMUA 2CLMB 1EINA 1D6SA 3BMQA 3IDFA 3RS7A 1SD1A 5HKOA 2OB1A 3RS9A 2G72A 2VPQA 1KO5A 3CZ5A 3ZHZA 4F1KA 4ILEA 3LHFA 4NS1A 4NZYA 2PZEA 3EODA 1I8TA 3C39A 3WO1A 2QZ4A 2ZUVA 3F9RA 3I5MA 3R2JA 2GHTA 1T0IA 2V8BA 1TZ2A 4UCFA 3RVMA 3ELDA 5TLSA 4LCJA 2X9QA 1YVPA 2B35A 2J3QA 4DNPA 4A2QA 4ZCTA 2Q1YA 5HUQA 2DJ5A 1BIFA 1FLVA 1SHUX 1WCXA 5IVPA 4ETMA 1U94A 3NIWA 4H7IA 4PR3A 3CPSA 4LBYA 1E9BA 3TJRA 3VTAA 5B58T 2FWMX 3E7WA 2IEYA 2QSJA 1Q91A 2ZBPA 3HM2A 4J2HA 3MJ4A 4B76A 4OIFA 4DSZA 1E62A 1Q1EA 3HP1A 1X1SA 1C1DB 3EG5A 1C7RA 3KTOA 1C4XA 1R3UA 2YC4C 3T7KA 1KDYA 2DQ4A 4BLUA 5LN1A 1YB2A 1D2CA 2AXQA 4FGKA 2AHOA 2EJVA 1DB3A 4HVLA 5KYWA 3B5IA 2F55A 1KAOA 1OYWA 2BFDB 1QF9A 3BSFA 3C6ZA 3C8ZA 3JQFC 4XLZA 3AHGA 4YQZA 1MW8X 1Z6XA 1TTQB 1M8PA 1WUHS 1PR3A 3AJ9A 1XD2B 2NU9B 2AE2A 1Y33E 2VK4A 4NYIQ 1GAEO 3PUKA 3RASA 1JWBB 1F1JA 2EXXA 3BK7A 4BO5A 4YV0A 1AHIA 4R9NA 3GU3A 4MAMA 3UGJA 1IQUA 1UJ4A 2AZDA 1CR4A 2Z4SA 2ZR0A 2JIRA 1E9RA 3CPHA 3V34A 1FL9A 4BRZA 3QYAA 3QY9A 4CETA 1KQFA 3BIXA 3A1EA 3RJZA 2SNIE 1TQDA 4JLVA 2G25A 3JYHA 4LJ8A 1J49A 1Q95A 1OXUA 1U2DC 3OJLA 1T13A 4LRXA 4MUXA 3QG1A 1PJBA 2JZCA 1XZAA 2L42A 1ZNWA 4OJYA 3G7SA 3KZCA 2FSPA 4MV0A 1QFSA 1A72A 1D1SA 5G41A 3MTAA 4EYEA 1UBHS 1E1YA 3I9V1 3QPWA 4PE5B 4UM7A 4GR9A 4HNRA 4TMWA 3T0FA 3V3TA 4M8SA 2ZWOA 4CTNA 4ZI3A 5KVSA 2ZTLA 4JI1B 4J3NA 1G5RA 3HXLA 3PBKA 3P0HA 3AKCA 1RJ9A 3CNLA 3I34X 1H0SA 2X15A 3DNMA 2DHRA 3WLMA 4CEJA 2GB4A 2FP4B 3OTIA 2XT9A 4OCZA 3VHLB 1U3CA 2XCOA 4HDSA 1YIAA 3NHMA 4NPCA 5BN5B 2PD3A 3H04A 2VBGA 1DHRA 1LPNA 3OCVA 2VDWA 2OQIA 3SXUA 4HNGA 3ND9A 3I58A 4TYNA 4KIWA 3N6VA 5EERA 2RB4A 1E61A 1LI5A 3BXZA 1ZHFA 3A6GA 3KO8A 5AW1A 3ZOZA 2XMRA 4MI3A 4BVHA 4UOZA 1U1GA 1GU0A 4B31A 3O4RA 1F6BA 1ZY2A 3GJ6A 1K6MA 1IEQA 2AFIB 2NU7A 4O25A 1UFOA 1QPGA 5FUWA 1G2PA 4FFVA 2C78A 3I64A 4TKZA 2WD9A 4AP9A 4MGKR 3H8SA 5DGIA 2C20A 3KAJA 3RVLA 4YHHB 4K9QA 3INRA 3FMIA 2WJWA 1N6IA 4M89A 2WZCA 1OMOA 1LSUA 3D7MA 1BGXT 4L4XA 3R0VA 4RD2A 1PTKA 1RRFA 1O0SA 3WX0A 1UBKS 1NAHA 5IZCC 2PMCA 2OO3A 1BS1A 2XW6A 1FDOA 1NJ6A 3TLYA 4EGJA 5SYAA 1DDGA 3BGWA 2XRMA 3GCDA 1GDDA 1H6AA 2JFUA 4QYWA 2KLHA 2BMEA 3DBLA 3HS3A 4XCXA 5AJTA 1S2NA 3ZHCA 2DT8A 1RXIA 2CNWA 3IKTA 4RF5A 3V2GA 3TGLA 2Y71A 1R5BA 2D2XA 4YR7A 1UUFA 1H3EA 2BE7A 2N1BA 3OCCA 4ZOLF 3I23A 4FINA 3UQZA 2H2DA 2BFCA 3U9SA 3F3KA 4JYZA 4H9GA 3GW8A 1RRPA 2ZP1A 1DCKA 1F38A 2Y4NA 4GHWA 3A3KA 4PZYA 3PQ8A 4L76A 1OY1A 2OD7A 7AT1A 1KFEB 3ZD6A 1MAAA 1BEEA 4EF6A 1ZD9A 3H5NA 2HMYB 2AEFA 4HJRA 3S70A 4DCCA 2WHRA 3OBBA 2X0KA 1LX6A 1RJFA 1PJZA 3LNCA 5IAAA 1RC8A 3F5DA 5TS2A 3VZCA 3KLNA 2W2KB 2VF5X 1XTJA 2NZXA 2ODWA 1FNSA 1NUHA 1P7VA 3EEQA 2DJIA 3AHDA 4R71A 3KYJB 3IUMA 5HIJA 4DC1A 2DZDA 2JGFA 3QV1A 2HF8A 5KKCA 4JA2A 1RPNA 3CO0S 3QITA 4UD6A 2GD0A 2H1RA 4X24A 3A2MA 1R00A 2GBPA 2Q6LA 1L5HA 3MG9A 4DEYA 5I7AA 5KDOA 1SCNE 5KJFA 2R96A 3HN2A 3EUEA 4LRUA 1CUEA 1V8OA 4HDMB 4MROA 4PO3X 1Z8FA 3ROKA 5JI2E 2OGSA 1GCUA 3CH6A 4P22A 4F6LA 2ZRFA 1VL2A 4DVJA 3EXEA 1RI5A 1MBZA 3FPFA 4HLUA 1T5BA 1A9YA 3DA8A 1HG1A 1Y9DA 2VPPA 1P29A 3IV7A 4IJUA 2PNJA 5CPBA 1GNLA 2PS0A 3VM6A 3Q3EA 2D4HA 4ZQGA 2J85A 3EYAA 3ZWKA 5FULA 2FPKA 3HCEA 4OB7A 3WWOA 4UBLA 5BVHB 3EGWA 3WMEA 1R0XA 2IPNA 3SBXA 1ZUIA 1WSBA 3N2YA 1X9IA 2G5PA 1CE8A 5JJ5A 2OCPA 4PBSA 1N5MA 1PJCA 1UM8A 4FQ7A 1G8HA 1T0JB 2HCBA 3F6CA 2X2PA 1TQ4A 1PTJA 1Y7HA 2VHWA 3C1TA 3C45A 4XOUA 1YCGA 3QG5A 3TE6A 3GUYA 4C2UA 3DLTA 2X9LA 2M32A 4Q9HA 4BNDB 3V2UA 3K53A 3S40A 1YR9A 3MN1A 4N5NA 3RWBA 1ZRMA 1YXMA 1JR3A 4CM7A 4R3UC 5CB4F 4O1IA 5DFAA 2P2YA 2NU8A 4FT4A 1O96B 4OHVA 3RIMA 3UK7A 4KSBA 5I5GA 3F7TA 2FEXA 3F90A 4E5DA 4LC0A 1GA4A 4K9DA 4UW9A 4Q4CA 2I4LA 1TYZA 1FTYA 4HEA6 5A0FA 5IEJA 3L0PA 5JNWA 2VTKA 4HPWA 3PPWA 4PS0A 1VIYA 1Y1QA 1OH5A 1JAZA 2EWMA 3GG9A 1J2EA 3LV8A 5LD2C 1FSPA 4KQEA 1PK8A 5INTA 3K70D 3QKWA 1WY5A 3IDZA 3NTUA 4C87A 4FGJA 1T5SA 1KZYC 1XRSB 2XKAA 3A14A 2NN3C 3UTDA 1PL6A 4RD0A 1BKSB 2X8AA 3GO4A 5CT8A 3U1VA 1TD9A 5IM5A 2GJ9A 1U28C 2R7AA 2BLNA 5FCDA 1CYEA 5DP2A 3Q7IA 4V0SA 1JLLB 2O0HA 3H05A 4FOLA 6REQA 2UVDA 4ZAFA 1NVKA 2I7CA 3PPVA 1SD5A 5EYPA 4G5FA 3UWMA 4CVNA 1NW9B 2OXRA 3GT4A 3KQTA 1MABA 2I2AA 2PPLA 4QJ5A 4HZGA 3L7DA 1SXJD 3V7NA 2EKQA 5FA8A 3ZEIA 1RMQA 4Q1VA 2V1UA 2N9UA 4L8LA 5CM9C 1EFDN 1EVLA 2RJ3A 3JYLA 1FSZA 2RMKA 2QJRA 5DTJA 5FEUA 3RWMB 2E21A 3NDJA 3S7ZA 2EKBA 3BE8A 4KIGA 4DG8A 4MRAA 3UZUA 5SY9A 3C3CA 5CLLA 4S2UA 1RXEA 4AJNA 4HNHA 4F2HA 3EG9A 4AL4A 4H27A 4PYQA 1EWYA 1NVAA 1XQ9A 1G4AE 1I32A 2YYAA 1FNDA 1KDPA 3DOHA 3KB2A 1A9RA 3LI2A 1NZFA 1CJVC 1E5XA 1XRJA 3EMVA 4G4JA 1YC5A 3M4YA 5FUBA 3U7QB 5D7BA 2B5OA 2VSFA 3AIMA 4AY4A 4GPZA 2NZUG 4O02B 4WVLA 4QLOA 5LU9A 4UNIA 1UOQA 3HCOA 2QM0A 2Y2VA 2GAJA 2IOQA 3M3PA 4H35A 4BUCA 3K73O 3ORYA 4I9GA 4E4TA 4O8ZA 2HRRA 4WZBE 1E2JA 4PNPA 5LOVB 3ZVNA 1DRVA 5GIPE 4NV1A 2PKWA 4FX2A 1FVHA 4A6DA 2VKQA 1PT8A 2CK3D 4CV1A 1N2EA 3ZG6A 1U99A 4O4JF 2ZDHA 4BFUA 1P2SA 3VVMA 3RUEA 4HVCA 5BNZA 1ZEMA 4LSZA 3JVUA 4G0OA 1MX3A 4B6EA 4U2FA 1PSDA 1KWGA 1JIJA 1EA5A 4GM0A 1ADJA 4L5JA 1F0YA 5K4AA 1TLTA 4MKHA 4V38A 1C0PA 3DEIA 4ZGBA 1U3DA 4KMMA 5IC6A 5HQTA 1H9CA 4OX9B 3NWPA 4X62B 3DUWA 1XKQA 4KMOA 1NE2A 4TPKA 1ENZA 4KTTE 4DSAA 3U81A 3LCCA 1AQLA 3LUGA 2WT8A 1ZIDA 3COWA 3HU2A 2YXDA 3QPBA 1U2SA 5GZ6A 2O8FB 4V0RA 121PA 1HNWB 3K9NA 2ET6A 4M2LA 5TJHA 2FPIB 3VKWA 3H99A 1T1GA 3WB9A 5LQJA 3QVSA 3NHRA 4YUVA 3L05A 2QRNA 1F3OA 1HRKA 2ZR7A 3CLRC 4Q3AA 4PIVA 2OVBA 2CFOA 1RYHA 4LDAA 3KB1A 1FJHA 1XCGB 2RG1A 1D6MA 4KFTA 2EHJA 3T52A 4PSDA 1P7ZA 4FCTA 1KKMA 2FOXA 4I3GA 1LBHA 1R4MA 2Q3LA 4R2KA 4ENRA 4FZVA 5LZ7A 4EWLA 1A88A 4M1EA 2F3QA 4Q9KA 2WZQA 1Q1NA 1C7ZA 2YL2A 2GGSA 3O93A 1JSZA 4NRDA 5DHUA 4CKYA 3NJ8A 4KO2S 2NV0A 3P2MA 1UOOA 2E4UA 3KRTA 4GZ5A 3JASA 1QX4A 3KYBA 4IGFA 4KRYA 2AC2A 4B8ZA 1K63A 5CTJA 4HBZA 1AS3A 4V24A 3CJRA 1FFGA 1VG8A 9MHTA 1ZPDA 3CWQA 4DPMA 3N8HA 4HQ0A 4HLCA 3ADBA 2C31A 3T3HA 4AY6A 1JLSA 1FXWF 1Q74A 3E0XA 4DLYA 1NVGA 4KXFB 1THZA 2QVGA 4CM8B 1EVIA 3PJEA 8MHTA 1K98A 2HCRA 2RK6A 2QVBA 4NK4A 3A9VA 4OLJA 2NOAA 4PW0A 1GZ3A 4YDSA 4F4FA 2C96A 3Q5DA 1EH5A 4GVPA 2BFBA 4NP6A 3AEQB 3VJRA 4IKPA 2CXSA 3A9UA 3CE9A 1L7BA 2ZYRA 4ZYWA 3QBJA 4W1PA 2JLSA 2OE2A 4XB2A 1G5QA 4LTMA 2AC4A 4ABYA 4FYJA 4F5WA 3QQPA 5JXWA 2FWAA 2IXFA 3FHTA 3HTXA 1XHFA 2GZHA 1W87A 2XKJE 2W6ZA 3L8MA 4IICA 1A7AA 4OMFG 1L3IA 3O4JA 4PZPA 4B2PA 4XGQA 3HNOA 2ZIWB 3S2UA 3WKBA 1E6KA 2KYRA 1K5HA 3LQFA 3ZU4A 5IK2A 4IF6A 2HLPA 2WIKA 4H17A 3MOIA 1Z2OX 4OQ4A 5FI5A 1H4SA 4ZT7A 1E0DA 4YRDA 1XMVA 2WMOB 3BEDA 2XQIA 4NE7A 2AJBA 4AWAA 5BMVF 1G7SA 1GUFA 1E0KA 4JBYA 4S04A 3RVSA 1WB4A 1CQXA 1CUAA 1QIGA 1OFGA 3GAMA 1XF1A 2CFSA 2W22A 2OLKA 2F8LA 1CFJA 2QLFA 3L6CA 4RA9A 3U2QA 1QMGA 2ERXA 4ITUA 2RGUA 4WLEA 1ZGAA 4PG8A 3IQFA 1V95A 5IWAB 5CLIA 1GZSA 4EGSA 2AJDA 4ZAXA 5HIMA 1KMCA 3CUEF 3NHYA 1ZD5A 4R0NA 1AB6A 3KJNA 1ND6A 3I52A 5D5PA 3ASYA 4CR7A 1P60A 1P0QA 2HLDD 3VOBA 7ADHA 5ISMA 2V6BA 2QXUA 1A77A 2OFWA 3FHLA 1SY7A 2AD1A 3AL0C 2B37A 2H31A 2WF9A 5CNJA 1KJYA 1F2UB 1W4RA 1NY5A 2CLIB 5AUQA 1BKDR 2A3NA 2Q8PA 4Z9AA 4C6HA 3KOWA 1NIPA 4TYQA 5ALRA 1ZINA 1D2GA 4PLYA 1YK1A 2Q8NA 3TJZA 5CX1B 1J9ZA 4QDUA 4G84A 1IVSA 2HA7A 4C1BA 4XW2A 1XRLA 2GD1O 3IUPA 2HSWA 4QQNA 4DAOA 4LDRA 5ED4A 1Z73A 3AYZB 3V80A 4YCSA 4DB4A 1ULUA 4PAMA 1FYFA 2H54A 1YOBA 1KDVA 5BPFA 3L9XA 1ZH4A 4GOJA 2Q1TA 1WB5A 4IMPA 1U7OA 1C2YA 1YNOA 3LECA 1ZVKA 3Q3VA 1UR5A 5ALDA 4BATA 3S7TA 5JH7A 4BPBA 4YJGA 1C9KA 4YVFA 3M9LA 2IGBA 4Y0NA 1ZD4A 2OHGA 1KSGA 4HP8A 1X8KA 3IAM1 3W9BA 4AUEA 4EAQA 4LE0A 1BRMA 4DIBA 1UKBA 2DE0X 1SCIA 2I29A 3AEUA 3M3DA 1KC1A 1N5KA 4N5MA 3N8KA 1YRAA 3QKUA 2OFPA 4W9NA 4CMEA 3AXTA 2XE8A 3WNBA 2QQFA 3WJ7A 1ZNXA 2R84A 4FZ3A 4YTEA 2E1RA 3KUXA 4RH1A 4AMYA 3O6VA 2OHXA 2Q4RA 4MUYA 2Y1WA 4OQEA 4NYIR 4QYIA 4HDRB 4Y2VA 5F7JA 2NO0A 3G79A 3O8BA 3WGQA 2V7EA 1GSOA 2ENUA 5FOTA 2HSDA 3CLUC 4TKLA 4ZYYA 3J7TA 5LU8A 3ETLA 3BKXA 5JQWA 2JBAA 1RWPA 4C08A 2UUPA 4AS3A 2VHCA 1ZVVA 4QX6A 5E0KB 5NLLA 5JD4A 2OZLB 2WIFA 3F7NA 2HDHA 4C78A 2O8BA 4MUHA 5LSAA 3Q1KA 1SKMA 3A2LA 4DSNA 2BFPA 1AQJA 1C7QA 3LUCA 4B3HA 3OM1A 3BG5A 2R751 5DGCA 4ERXA 2OVFA 5L51A 4DMUB 1T8PA 3GEHA 2WTMA 3EZXA 2JJYA 5I48A 5HMMA 1P3Y1 1GLNA 1L7NA 3CMCO 2VJPA 4HXEB 3HVIA 2RK4A 3CVWA 1ONPA 1YB7A 1X1EA 1CLEA 2I6FA 3BF7A 4YCDA 4BMPB 4ER7A 2QW0X 2C82A 2X8BA 2WC1A 3WRXC 2UZ1B 1VCNA 4LSMA 3CVOA 4I0WB 3TL2A 3AKDA 3FKSD 2NXEA 2D8MA 3LFTA 3QUAA 3KK0A 3PXGA 2JD2A 3BRQA 4IS2A 5CXQA 2PKEA 2YR0A 1E60A 3PNQA 4HRXA 4C3ZA 3HJHA 4B3TB 4O08A 5DOVA 1TGYA 2B0CA 1C3LA 1IQRA 1E0AA 4L9AA 1A7KA 1HQYE 2HM7A 3FWZA 2PLRA 4GR4A 4EG4A 1N32B 2XNCA 4E08A 1Z0JA 1EE1A 1GNVA 4NDNE 2GDZA 3IOYA 2TYSB 1HNNA 5H16A 3W5VA 4F3CA 1AXEA 1Y1LA 5I9IA 1C8VB 2F90A 3DP9A 2C9OA 3PQ5A 4KPUA 3IXQA 2P62A 3L84A 2FZVA 3G9ZA 1NC1A 1QRAA 2FG6C 4HYQA 1KDZA 3L1HA 1VI5A 1TYDE 2PPVA 3SX0A 2RGNC 1VE9A 4G8JA 5I5EA 3BWEA 4PX3A 4NS4A 4Z51A 3LWZA 2WZBA 2VSYA 4O6VA 4M1MA 4RTNA 1VHQA 3T94A 1U8ZA 4W8OA 3BQMB 3FVTA 5MHTA 4YP9A 1RS0A 1V3TA 3QPCA 4OGWA 1KH2A 4EUHA 3TXXA 1Q15A 3GWGA 2ZJBA 4RFSA 2O7RA 2FV8A 1JPJA 2YN2A 4MRSA 3K94A 4V02A 4KQHA 3A6KA 1L5OA 16PKA 2YJ3A 4JJ6A 2H52A 4RF3A 1VRCA 1DGQA 3B70A 4GPIB 1LJLA 2CHVA 2ZBFA 2HJRA 3GLHA 4P58A 3ZKWB 5BOSA 3KQVA 4QGSA 2FDCA 1FTQA 1W29A 2H3HA 2F3TA 3L1KA 1W85A 3A1WA 4KNVA 2BFMA 4C05A 4TLBA 2OFOA 1F5SA 1ETHA 1NX6A 3PUZA 5KYXA 1PNTA 1GGMA 5HJ2A 4EKGA 1Y7PA 4NCIA 5EWMA 2J9GA 3PSHA 3HUDA 4MJLA 2APJA 3M3HA 4F2PA 2ZIVB 3NRJA 3CX3A 1DU4A 4A2WA 3N0TA 4I1IA 1WCWA 1IN1A 3PL1A 3LK7A 3W8NA 3NV9A 3LA6A 5E1OA 2JAPA 3SQOA 1TMKA 5CK4A 5JZBA 1M1YE 3UXHA 1WXIA 1JA1A 4M46A 1CJTC 3OZVA 1QH8A 1HOXA 1VKJA 1Z4PX 3SLRA 5C52B 4DBZA 2B30A 2WHYA 5KQLA 4N0DA 2WHXA 4DCUA 4DUGA 1OCEA 2ZT6A 4MRRA 4BB0A 2OORA 4QUIA 4EA9A 4OQXA 4RW0A 1IN8A 3HCFA 1UC5B 2ZIUB 1IN4A 4J1NA 3VBEA 1C7EA 3ITKA 1P1BA 4YREA 4X00A 4RENA 2CLCX 4X0EA 5L7YA 1CY2A 2ZULA 4G5OA 3VBCA 2L17A 4E70A 3VNUA 2QZJA 3LCRA 1R0CA 1UBEA 3L0YA 4LZNA 1YZGA 2EG9A 2CHFA 4I1YA 5CHEA 1O7JA 1WA5A 3LLVA 3ESDA 4DR6B 1P7WA 1N34B 5CK5A 1AQ6A 3QEMB 1IL0A 1RZRA 4GKAA 4IQ8A 1FQWA 3K05A 1JF8A 3LKBA 4H7PA 2I6GA 3JYOA 3W3ZB 4DAEA 3W5CA 5CPFA 3U4AA 1SRQA 4JLUA 1QC5A 2OXIA 2J0SA 4P81A 2ST1A 4P5DA 1AK2A 3F3MA 1EQUA 2A4KA 4MVWA 1QV6A 2IXGA 3N7AA 4S1NA 1ZOSA 5LQSA 1P19A 1XNQB 2FF5A 2J3HA 4X1KA 2ZJYA 3L4SO 3HFRA 1XKXA 1P9LA 3VPXA 1MJNA 1X42A 4GMXA 4IOKA 3GZJA 3GIDA 3NLLA 3KSBC 2O2GA 3DHEA 3O03A 1VLJA 1GTJ1 3DSRA 4MIEA 3FPBA 3VNBA 3RADC 2O8FA 2JPDA 3UWPA 1XCOA 2JDID 3R76A 4F4CA 2I8CA 1LZKA 1BCSA 5IPFA 4RVHA 4BP9A 3NGLA 4QDXA 1PQUA 4RVOA 5B3LA 4I9FA 3HBNA 4DLNA 4J91A 3FKJA 5ALEA 1SU4A 1GKIA 2WWRA 4MRPA 3RIHA 3UWKA 5C5CA 1PJ3A 1NDHA 5DTMA 1H94A 1AQIA 3RDPA 2FFBA 3DEFA 2ATIA 4OHFA 5DM60 2YX1A 2G9VA 3K6SA 3WGKA 2HK8A 4WD3A 3ADPA 3L7JA 3H1AA 4PY2A 2B8WA 5ALQA 4KLCA 1U4SA 2NVOA 1CR6A 2QP3A 1EM8B 4FFBA 2I2XB 4MVJP 3OLXA 1U9IA 3DEZA 3TNDA 4D0LB 1GL6A 5LQRA 1Y1RA 3JR3A 3ORQA 5GJWC 5JQGA 4K88A 4CTOA 4ND6A 4UZEA 3RVQA 1HPLA 3MJSA 3IPXA 1V5EA 1FPMA 4XFJA 2JAXA 4XDGA 2X1HA 4M49A 3EGXA 1XDBA 4PZLA 1YB1A 3IUQA 4DCSA 4MAAA 4DSUA 2G17A 3HKBB 3C6MA 3CW8X 3F8TA 4IX1A 5LMUB 1T8WA 1YASA 2XBUA 1Z56C 2IV3A 5KOIA 1DVRA 1GPJA 4FFPA 4YCAA 5JS2A 3C3AA 3A4YA 1Q0HA 3MJFA 4R5HA 3T1YB 4EZBA 3MELA 4XYGA 3QPAA 1PQ4A 3FWHA 3W5AA 2RCNA 4JKIA 1GXSB 2OK7A 4HB4A 3MGCA 3TRJA 1KY2A 1ZO8A 4TZ0A 5HIKA 3HE3A 4FZJA 3WIEA 2XZDA 1Z8HA 3IFSA 5HKLA 3RRBA 3E70C 4WKPA 2OCLA 1GQRA 2LR0A 1E4OA 4RIEA 1P73A 2J31A 2XUQA 1J0BA 5SZIA 5MN6A 2A35A 1UJCA 1BWRA 3CLTD 1E5VA 3NBXX 1J1ZA 5DSTA 5EPUA 1UXGA 3WK9A 4BO1A 4KR7A 4QUJA 4E0BA 3EDRA 2GN0A 2VJMA 2ANBA 3BJIC 3G9TA 2JCVA 1U80A 3R4CA 1C3JA 4EW1A 2XVYA 1KS9A 4QTTB 3U7FB 4YT2A 4MW7A 4MVYA 3EY4A 1KQ3A 4OHXA 1WW2A 4DSOA 4IP0A 4Q6BA 1JPVA 3NPMA 3NHAA 2RHWA 1YE3A 2ZRDA 3WWYA 2UV8A 2AOVA 5B5SA 3HB7A 3R24A 3B3QA 1ZUD1 4V0KA 3ZVMA 1Z4MA 2GF9A 4KLZA 2OV6A 4LY0A 2GJKA 3EJWA 1J0XO 4IIEA 1BHO1 1SR8A 3CVVA 4LWQA 1XK6A 3SBDA 2IL1A 1VI6A 2NAPA 4C4RA 2H2IA 2JFOA 1NPYA 4Q3LA 2BHSA 1BU5A 3QWBA 3JQ9A 4WMLA 4DHEA 4IDBA 4BVEA 2OHFA 4IZIA 1C7JA 3LK6A 4ARBA 3IS3A 5LJIA 5JI3E 2QTVB 1G19A 2FJ0A 5A5DA 3MLEA 2COKA 5EHIA 4YMLA 4RFLA 2ILVA 2EFEB 1E1NA 1VJ0A 2ZTHA 3A70A 4Y9TA 2ZQZA 3V8BA 1JQ5A 1N2CB 1QZXA 1Z5UA 3WZLA 4LJ6A 2F4NA 4X8MA 3S1SA 4IEEA 4KC0A 3FYUB 1CY0A 4GBED 3I32A 1C80A 3HBLA 2PT7A 1CUJA 5EG5A 3S5JA 3DONA 2KBFA 3PHBE 5CYOA 5LP6B 3OZSA 2PN1A 4YRKA 4B4WA 2N75A 3FVVA 5DIZA 3W3AD 1XZNA 1P80A 2JC3A 3WYCA 4B2YA 4IRMA 4GRIA 1W36B 4B6FA 2CJYA 1FMFA 3U39A 1L9KA 4MYSA 4N3BA 3QYFA 2DERA 1ABBA 2FG7C 3LH5A 5HSGA 4DDUA 1E3WB 3JD2A 3JQEA 4YRLA 5IXJA 3R5HA 3G9XA 1DL5A 1N3YA 221PA 4M9XA 3DKRA 4EZIA 3QX3A 3V3KA 3GMIA 1U3VA 3A6HA 1J7KA 3OAAA 4QREA 4UXJA 2OM6A 2OQVA 4BRUA 1US8B 4FCCA 3C15C 2EGGA 2G71A 3G49A 3GUCA 2A5GA 2IVFA 1FLAA 3OWHA 4Y2SA 3B2NA 5F52A 3D6AA 1PS8A 3NORA 1I2BA 4TL7A 3T7RA 3FYCA 5CNMA 2XGGA 4ZVLA 2X3YA 5H82A 2NUAB 3TLBA 4LFAB 5IWCA 2DRIA 3P9RA 4JB0A 4DCMA 1VA4A 2PUJA 2R2GA 2BZ1A 4NBTA 3P0JA 1MOPA 4GC9A 3WV4A 4Z3OA 1WZIA 4ZVMA 4GMHA 5C4IA 3WKAA 1TM4E 1ZRHA 2VJDA 3FYHA 5BN4A 3G68A 1PJTA 1NF8A 2P2ZA 2OZLA 1A8HA 2ES4A 3V1UA 5FBWB 4JYBA 3RRYA 3E6AA 3LYUA 5K3SA 2H65A 3RYFA 1B8VA 3VR6D 5AOBA 1XNRB 4KRGA 1R0SA 3VOTA 2G07A 4RZIA 4CG1A 1DXQA 3PC3A 2F1JA 1M0EA 2JIOA 2QTMA 4CJXA 4Z4EA 2B5VA 2CJPA 4H15A 9LDBA 1ZKDA 1H1TA 4I66A 2UYCA 1UZUA 2FW0A 1MNAA 1VIDA 1GNRA 3H13A 4WY5A 2AR7A 3WLAA 2JEOA 4IIXA 2JEYA 4PGHA 2RKWA 3CRNA 1GVNB 4BMZA 4D2IA 3TKAA 2XA2A 1JJFA 1Z18A 2WIJA 1IXKA 1USVA 2VS1A 1P74A 2KI5A 3IJEB 4I46A 1DJOA 2X8JA 3W9YA 4WCFA 2EBUA 5M7EA 1NM5C 4M3NA 5DBOA 4EUNA 1U02A 3SNHA 1QFYA 1TO6A 1F8YA 5AKGA 4DMKA 2Z2XA 3QJGA 5EUBA 5C80A 3HSKA 4JU9A 5DYIA 1KC3A 3UJNA 1HL7A 4WZAE 4M0KA 4KREA 5J5CA 3K72B 2YDYA 4AVYA 1E3SA 3C3MA 1XJWA 1T24A 2GLXA 5JRDS 3AUTA 1XN1A 3KOXA 4BRWA 2HPZA 5KSPA 4CFZA 3NTLA 4G1CA 4RJ2A 2AL7A 3PFKA 3EIQA 5EP3A 2R8RA 3DZJA 1DG3A 1OLUB 3ZHYA 3JYNA 4MDHA 5E9QA 2PYIA 1LV8A 1DPFA 1GTSA 1BDMA 2XWPA 3DP7A 1URPA 3LUDA 1TFUA 4ZCQA 5LBIA 4Z54A 4O4HA 4OM8A 3CZ9A 3RS2A 2XYQA 4LF7B 3HFJA 2QV0A 5IVHA 3B38A 1R16A 4AYXA 4X1YB 4J75A 5IFLA 1HFWA 1WUTA 2X5KO 3ONNA 1N7IA 4HEA1 3UVEA 3QFCA 2XMZA 3VV3A 5IYZA 1FQKA 4OAQA 1A4RA 4Y2HA 3LQRA 5B6JA 3OU2A 4QYTA 3VVLA 1D4AA 5BYKA 2GZDA 1S0UA 2HMTA 2H1IA 2HDOA 2WHEA 3BTVA 3FUXA 3Q7PA 3UHFA 2QQEA 1BN6A 1SHZA 1U7HA 5LOVF 1ZI6A 2WPDD 3VR4D 1DRWA 3LXMA 1VB3A 4HNVA 4E2YA 3K20A 3S99A 5BSMA 3D3WB 1LWOA 2QE6A 4LHWA 1QG6A 4YP6A 2VLIA 2QMOA 4LKOA 1DOHA 2JGRA 4LXTA 1YGPA 3TI7A 4ZQHA 2SBTA 1XZBA 3RI3A 3TWOA 2NV2B 3VYRB 4B5LA 5JASA 1V1JA 4RABA 3W0LB 3HXPA 2G40A 2X1VA 1QXSA 3PFFA 3U3JA 1SVMA 3WJAA 4CTMA 3LGAA 1MEOA 2O8VA 4C2AA 3FZEA 3PSAA 1L5MA 3CIFA 1DKMA 2F9LA 4BP8A 4D3FA 1KU0A 3OF3A 2Y9PB 2WWVD 1SB8A 3BFPA 5AOCA 3VU9A 1PW5A 2J6BA 1G5IA 1MAWA 2PXAA 1R4NA 1CB7A 3A1VA 3A06A 3HZOA 3KR0A 2VH2A 3PR3A 5AK4A 4OD0A 1U7XA 2CF6A 3DNPA 3E5RA 1FTGA 4UXHA 3TGWA 4QICA 3EZYA 1D2AA 4BE9A 4HN9A 3RVOA 4KNWA 4LOKA 2PG3A 3K9LA 4TSRA 3NBUA 3VUEA 2E4WA 1PVDA 1V37A 1E89A 3PDWA 3TQOA 5J2UA 2Z56A 3V2HA 3MOGA 5JTTA 2QD5A 2YY5A 4IF4A 1EHCA 1PK9A 1P4SA 1ZJZA 3PI7A 4H18A 4K3UA 1SUAA 4Q05A 5JSKA 4CLHA 4I50A 1KR2A 2GFHA 5BYJA 1GGNA 1PWXA 1MO5A 3C1OA 4BZXA 3ICPA 3K9HA 3I9LA 3NXKA 3OIVA 1USWA 1K88A 1OGIA 1QVVA 1ZESA 3P2OA 4X90A 4DBVO 3LT1A 5G1NA 3GLSA 1XPUA 1DV2A 1ZGZA 4B1FA 1QLHA 1DEAA 4LXGA 1OJ7A 3AWIA 6LDHA 2XDYA 2I4IA 1IOZA 4R05A 1JTEA 2ZRHA 2VTBB 4ARCA 1JSRA 1Y3IA 2R48A 2H51A 4WAUA 1ADBA 5CDFA 1F20A 1Y5RA 3D5TA 3ZE1B 1HURA 1U0JA 1Z6TA 2P4HX 4J16C 4BMNA 1QU2A 4K2HA 5JY6A 3LDFA 2XOXA 1LNSA 2QIPA 1KMHA 1XLVA 2AQKA 1VE6A 1U1DA 3D8SA 4MULA 4O2BB 1AKYA 1AKMA 4F6RB 4TSKA 4K9OA 5AK0A 3BTOA 2XTMA 2HPVA 2FWNA 3PUYA 3BIWA 3L40A 5M3BA 1ZW6A 4JD5A 1MIOB 3FTDA 4GE3A 3V7WA 4EVQA 1A1VA 2YMPA 5EMHA 5FUYA 4DEXA 4F3RA 1K66A 4CUKA 1RJWA 3DBOB 1BMTA 2F64A 3FYUC 2QMUA 3GCZA 1AZWA 1QOPB 2O2YA 3O1HB 2PSEA 3ZCTA 3DBHA 4C0JA 3THXB 1Z2PX 2O57A 4OYYA 3N2IA 4B4VA 4GC5A 5LP6C 1EFVB 3LCMA 4IDDA 2BELA 3QUBA 2C1EA 2PA0A 3MMSA 4HY3A 1LA2A 3ZV3A 1CX9B 1ABFA 1NGSA 2PH5A 3R5KA 1ZGCA 1P17A 1OBCA 3EQ2A 3ZWPA 4JS0A 5DXFA 2HK9A 1PZNA 3LPDA 3T3OA 2H2HA 1EG2A 3I9NA 1KFCB 1EM8A 3WLHA 1R9MA 1AXGA 1K7CA 3LU1A 3GUVA 1QOQB 2Q0QA 1HLFA 1HI9A 5CXXA 4LE1A 4PZCA 4QU0A 4Y67A 1DARA 2C7VA 2FVYA 4EEXA 4BQQA 1MH1A 3P1JA 2PUCA 4CIYA 1CQWA 5DIFA 1ORVA 1T26A 2I8LA 5AI5A 2WF6A 4HTFA 5DI9A 1AJEA 1EKXA 1K8RA 1EJ6A 2YQ4A 2JLWA 1EYZA 5G3ZA 2J08A 1GPYA 3OJ0A 3UMBA 4M1QA 1HE5A 4LQ4A 1YJBA 3P9XA 4GWLA 4N3NA 5FNVB 3HKBA 5TF0A 3VNRA 2BGMA 1TB4A 1LB1B 4L4UA 5HF5A 5H9WA 1JALA 3RTCA 1VCMA 2YWXA 4UJ5A 1ECCA 4XYBA 5BNTA 5KVCA 2A7XA 2Z3VA 1RYYA 3MSXA 4S1WA 5ESRA 5TPWA 5C9ZA 4B2IA 5CH8A 2A5FA 1GXSA 1G21E 3TMYA 2RAPA 1O95D 5EHQA 1UP6A 2JFBA 3G0BA 4QPZA 3U3DA 2IC5A 3KTAA 3AETB 2CNLA 3DZBA 3NCHA 1KYYA 2AA3A 3UEOA 1VIAA 2PFSA 1XZIA 1LXCA 1Q16A 1R9JA 4V39A 3K71B 4DNQA 4B46A 2WYOA 1B74A 5JSUA 1M6WA 5KPDA 3OWOA 4GEGA 2WR8A 3EMKA 3O4FA 1XTQA 4H4EA 4AN0A 5BSTA 1XAGA 3D7SA 2EJCA 3KQMA 2PFGA 3TNLA 1YZUA 1GYPA 2QSYA 5FTLA 1HT3A 3RUIA 1DTEA 3CR7A 1AUOA 5BP7A 1UL1X 2XXBA 3D4NA 3JALA 4UCQA 2FI1A 1RACA 2RBEA 3VZQA 1VMAA 3ZJYA 4ER6A 2AQHA 4BO0A 1G3MA 1NXVA 2OBXA 2GFQA 3AKEA 3PK0A 3PNBA 4LTDA 3G13A 3GK3A 3KEOA 1E5TA 4HDCA 1R4ZA 3CUUA 4MA4A 4J0EA 3D6VA 5KNCA 4B7XA 4X66B 4PLPA 3TSCA 3A6PC 1A0OA 1O97C 3D0OA 2VF8A 5A3VA 3C97A 3MWYW 3P19A 3D3KA 3G2IA 1GPMA 1VPVA 2CLEB 2UVQA 1JAHA 3HEBA 1RJDA 2G1JA 4U6SA 2VF4X 1T25A 2AC7A 4WERA 1TK2A 4J43A 4RVGA 1OR8A 3ICEA 2J9YB 4HGRA 1D9ZA 1G8JA 1ZH6A 3N8DA 1VI2A 2J3JA 3B5JA 3H2YA 3U80A 4LWPA 1OFVA 3N53A 2PGIA 4ZMSA 1V41E 4P4LA 1F6DA 1FFXB 1LTKA 2C1XA 4P36A 2VAMA 5HG0A 3T61A 3PF8A 1KNXA 4DLLA 4DA9A 5J47A 2XD9A 4K87A 5CEJA 3SBEA 5AKEA 2JFFA 1JHXA 1Z74A 3WGLA 2PTGA 1BTOA 3OLQA 4U3JB 1TE2A 2I3ZA 4ZHQB 4YAWA 5CB8A 1J97A 1G18A 1MC1A 4XUCA 2A1TS 2AVDA 1OHHD 2V74B 5I01A 2H1OA 5AVZA 4YO7A 3AR8A 3PTLA 5BWCA 2KJQA 2YOHA 4KAAA 2EFCB 1IJBA 2DY1A 2QD4A 3RBZA 2AOUB 2GH1A 3ZE8A 2ZAYA 5F76A 3KVNA 3IKMB 5BY2A 2X4GA 1XAIA 3JS5A 4RD6A 1NIJA 1B42A 1TUBA 2FWBA 2NGRA 3DEHA 5F1YA 5JATA 1TTTA 1NLMA 3ZDDA 4X44A 4DF3A 1PYOA 2NUAA 3PUHA 1XKLA 1TCCA 2CKDA 4N5HX 2GBLC 4QXOA 2OECA 4X95A 4XIYA 3VI4B 1JU4A 2V3VA 1QVRA 3CUWA 1K9VF 3F4BA 3NQ41 5EGSA 4UTRA 3IBGA 1C9MA 3NONA 1IAQA 3L0CA 3TBHA 4JR1A 4R1MA 4KI0A 3REQB 1YTUA 1PT5A 4M7PA 2I2CA 4OF4A 5LQCA 4G8BA 1E0JA 3NYWA 1WXHA 4OUKX 4B47A 3OE4A 2G6BA 2YNMA 3CCFA 3CISA 4X20A 1W30A 3A6EA 3TB6A 3F97A 3VV2A 3R9XA 4ALLA 2XA9A 1JFVA 1KP2A 2VXCA 2WTBA 4LYGA 3H1EA 4PG6A 5A71A 2A6PA 4N65A 1ZVMA 1E2FA 2O2IA 1R6TA 1Y6RA 1EK6A 3H97A 4JCOA 1XLTA 3D4IA 4ZT6A 3X1KA 4KAFA 1LEHA 2HRZA 3C6KA 1ISHA 3ISJA 1K92A 3WGZA 4EKYA 4TWJA 5JNVA 1U0TA 3Q0TA 3V00A 2MSKA 1EJ2A 5AVKA 4OK3A 2QENA 3SVLA 2CVQA 3IEMA 2NO7A 2A1UB 2XTNA 5C5EA 2DFVA 4CMGA 4E13A 4ALMA 1VG0B 2CVOA 4GMDA 2VDKB 4MZXA 1QG2A 2H8KA 3QVOA 2HRCA 3U7IA 3QVMA 2R25B 4HVTA 4LXIA 1U8EA 4CIWA 1A5SB 3W06A 1CVRA 2C00A 2NTJA 1YZYA 4QD3A 1D7OA 3ETCA 5L3RA 2OD2A 2H0RA 3IHKA 3NHUA 5C1IA 1XEXA 2QQ5A 3HUTA 4II3A 5JC8A 1HE8B 4I08A 4NZNA 2R5NA 3QI7A 3IQGX 1T1SA 2YV2A 2Z04A 2QMHA 4E6EA 4H1WA 3L1IA 3MTDA 4R8SA 4F1JA 5DBHX 5DYWA 2XUKA 4C01A 1UWVA 3JQBC 2Q4BA 3UTCA 4IMJB 2B4QA 4PG7A 3V4SA 5HX7A 4EY7A 5DTEA 3HBMA 2KWIA 1M8KA 5K45A 4MW9A 5HPYB 1DUVG 4CKXA 2VQ6A 4R98A 1RT9A 2BBSA 2ECOA 5AKJA 1D4ZA 3HBJA 3P0RA 4JU8A 3DS8A 4EHAA 1TVKA 2BEKA 2OOKA 4BWGA 2HLNA 3CX4A 4RGBA 4BV3A 2MSDB 2VXBA 1FSGA 2OQRA 2YASA 3MCUA 4BTVA 1XMQB 3EF0A 2QX9A 4URUR 1W88A 4PPQA 1L4GA 5F9HA 1A2OA 4BGEA 3G5TA 1WQ1R 5FX2A 3Q98A 5B3JC 2CXNA 2REOA 4YJFA 4D7AA 1LK7A 1G7CA 4Z3DA 2F1RA 1T2CA 5JSZA 4L9WA 1VGRA 2HA0A 3B1FA 3BVPA 4JFRA 3BM5A 4XOIA 4IW3B 1TU0A 4A6XA 1NHWA 1S4MA 4GL2A 4ZDWA 2OYRA 1TIBA 3DZIA 3CRZA 1NRWA 1GNQA 5HE9A 8GPBA 1NW3A 4ZALA 4CMKA 5DNDA 4YMGA 2J9XB 3CNEA 3BXXA 1SIWA 3N05A 1XIVA 3I42A 3HG7A 3MS2A 1IVYA 4HGNA 2C3OA 4C0LA 4DNOA 5IMSA 5JECA 3E4DA 4IWNA 5LP1A 2VQFB 1GZDA 1B3RA 2JFGA 1OU0A 3R3UA 5KPJA 3CNNA 1ZJ5A 2O6HA 1SUPA 4XDYA 4KO8A 4DSTA 5LKRA 4J0HA 1NMXA 1XDDA 1NJFA 4K6MA 2ESRA 2XOKD 4QFBA 1MJHA 2CNOA 4FBMA 1DAGA 1DZIA 3MCAA 2OLEA 1SXQA 4DR5B 4XTCS 2ZTUA 2O1WA 3CGWA 4ND5A 4HWGA 3L5OA 1AN9A 2W7TA 3LZ6A 4A36A 1HR0B 5GZ3A 1JEJA 2IS2A 4A26A 3O26A 4HZIA 2ZSKA 1QYRA 2PWAA 2VYQA 3PKZA 2IXDA 2XMCA 5DRYA 2C4MA 2Q2WA 3Q7SA 4DQ0A 5EIBC 4M9RA 2DHQA 3A11A 3K09C 4DA7A 2X2FA 3AI2A 1UDBA 5FNZA 3SYLA 1M67A 1JR3E 2CVZA 2GPSA 3DFZA 5KIAA 2V7VA 3IUJA 3KE9A 3A26A 1NG1A 1USGA 4E1BA 2WKRA 2DXIA 1GQ2A 1KJIA 4Q12A 4XLLA 4CMIA 3O7WA 4HN2A 3F3YA 4CFYA 2GKOA 2AMVA 3E5NA 2GLTA 1OKKD 3L4EA 4IXDA 2PH1A 3H0KA 4AURA 4CQMB 4FFNA 4KN5A 1GHTA 3CCBA 1SEPA 3QJYA 2A3RA 3NBAA 2DECA 4P2GA 2BONA 2H2GA 5AKHA 5HS4A 1CQIB 1K7EB 4WNCA 2YYSA 3OPQA 3CG4A 3GYGA 4DBLC 2OCXA 3DE6X 2YW9A 2ZWVA 3LY9A 4K8RB 4R2WA 5JSQA 4OHYA 1MJ5A 2C5HA 4NG4A 1X1RA 4D0RA 2J6HA 1ELOA 4W9MC 2ZGVA 1OX6A 3RHFA 4FMBB 3RLFA 3KD3A 3WB2A 1PGPA 1QGZA 3N8NA 4ZAVA 1AV7A 1JYFA 4IINA 4DJDC 4M88A 3NKLA 2LKCA 3WGYA 2HBQA 2TMDA 3M2PA 3TJMA 4CLOB 5IKMA 1KR5A 1VBNA 4GMGA 3GPIA 3WLLA 2ID4A 3P4YA 4FLMA 1VPDA 3AFIA 1OAKA 4R2HA 2Z09A 1JQ3A 1L8AA 1SG9A 1K9SA 4GXRA 3PFNA 4MARA 3UHPA 2XCTB 1KHTA 3F6RA 4YLGA 2VJNA 1IBSA 1C3XA 3G17A 5HR5A 1GZ7A 1PWYE 1GPLA 2F3RA 5JJLA 1Z39A 5G4KB 1V5GA 1NVTA 2A1TR 4G86A 2UYHA 2WAAA 3PXUA 1Y8AA 2H4FA 5EE3A 4UTOA 3EDYA 3N2EA 5JNSA 3HUEA 1C0EA 1DADA 2CMGA 5IUJC 1U6IA 2ZRIA 3E23A 3EPKA 1UJ6A 3UW1A 1IOVA 1XX6A 4TVKA 1ABEA 1AQNA 1BW9B 5C3UA 1ZWLA 3G2LA 3PNSA 2OCDA 1WE2A 4L7VA 1W2WB 4OPMA 4DA8A 1PEDA 4KI7A 5EHXA 1DELA 3ZIDA 1SVOA 3CZRA 2G5CA 2O54A 2X4DA 3PHIA 4H7DA 4N7RA 5ALLA 2GZAA 2EQAA 3HQ4O 1RKXA 5TB5A 5LP6F 3BWVA 1X15A 2J5QA 2JGLA 3KJZA 2VCHA 5CU7A 4CR8A 2AUNA 4MW6A 1NUUA 2WD8A 2NPOA 1IUNA 4CKEB 4CGZA 1NW7A 5IJ9A 3BCHA 4L2IA 4LC9A 1MMFB 1FFAA 3EIXA 5LZ2A 1RU3A 1Y9EA 1KORA 4G1VA 1L9XA 4R69A 3QFSA 2H4WA 3SJAA 1LV7A 4LRQA 3UB2A 3VYTB 3L8DA 2C7GA 3WSTA 1YJ8A 4I4IA 5C46F 5HJEA 2W2QA 1YJ5A 3S2FA 3ZHRA 4EYQA 5LYJB 3RWOA 3INTA 2EWVA 5CH5A 4DUZB 2V55B 4JT4A 4WESB 3T38A 4J0JA 4EEZA 3M1YA 4XRRA 3VPFA 4M0PA 4LIPD 4YBZA 4QIHA 1QYXA 2ATEA 1M10A 3IUBA 2VYND 3SDBA 1SC3A 1P1HA 2PMWB 3MCVA 3O75A 2YY6A 3ZBPA 1W4LA 1QBGA 2DHEA 3H11B 3GH1A 4QELA 1EVYA 1GUZA 4V0ME 4XGIA 3RSFA 4WUVA 3NATA 3VR5A 5J2TB 3K0FB 3MTEA 4FHGA 3V33A 2C8KA 4D6PA 1N2IA 4JGBA 2R11A 3X1YA 4YI5A 4FSDA 2C95A 2NTYC 3P45A 2G5TA 5CDHA 3HYRA 5CJ2A 1VMDA 3GBVA 2TS1A 3O9MA 3CKLA 3U31A 2Q5EA 5FB3A 4O1MA 4QAQA 4JYPA 4LTNA 2IZ1A 5FOWA 4LYEA 3JZMA 2IXAA 4O2AB 4UDXX 4OJKA 2GDJA 4DKXA 1NUTA 3O91A 1C14A 1J9GA 2G28A 1ZLXA 2XNKA 4WKGA 2H7YA 4YAKA 2X9NA 5A1TA 5IARA 3RVRA 4K1LA 3H9JA 3UJ6A 1FFXA 4IIGA 3TBKA 4F3KA 1ACMA 1ESCA 1Z5ZA 3FZGA 2X77A 5HKAA 2G0NA 3I01A 2QQ0A 4GXTA 2PMFA 3VDRA 2CDAA 2HYDA 3R3SA 5CMLA 5J40A 5BWNA 1ZGJA 1KEPA 1OROA 1WMAA 3S8MA 4E88A 3PDUA 3T3DA 3JWJA 4JFAA 2Q2VA 4ZHQA 1SUDA 1X87A 4LN1A 2OG1A 1RM0A 2IV7A 2MYTA 4MYTA 4Q3EA 3ZUGA 2V1XA 3AKZA 2FU5C 4RLQA 3IOCA 1K27A 3KAKA 4L3VA 3WRWA 3OHPA 3GNSA 4JDUA 4QJIA 4FCWA 3FKQA 1QHGA 2EDAA 4M38A 1DUIA 3HNRA 2XB6A 1RKBA 5DWQA 4BX3A 1WMSA 3PXXA 5CA0A 1DJMA 1EVKA 3BC1A 2QAGC 2HQOA 2CZCA 1RBQA 2G1AA 3W05A 4YAIA 3HWWA 1PLJA 5ALHA 1L8LA 3P0FA 1P3DA 3UBMA 4RU1A 3WGTA 3CU5A 4ZIRB 2QHXA 1JLMA 1K1EA 4KN9S 2TRSB 4H0NA 4GPAA 1RLTA 3LX4A 4LQCA 1G2QA 4F2DA 2VDOB 1JEYA 2DLCX 1ZU5A 1GZ4A 2AXPA 1RM3A 5ALFA 4PYRA 5BSGA 2IEDA 1ZH0A 3DLIA 4JI7B 1YZLA 4FGZA 4BFVA 1XK7A 4RTMA 2D6FA 4ZP1A 1VCOA 1CDDA 4BIIA 3HYLA 4PG4A 4Y18A 4D45A 5CITA 3BMXA 3OEYA 2VK2A 4RXMA 5C8ZA 3ZGVA 3ZCSA 3W3AH 1E7WA 4F04A 1MB4A 4E3ZA 1T1RA 1J4AA 4A8JB 2IH4A 1OAOC 4WBSA 2JGDB 5EWJB 4IIJA 3FLMA 4MVJH 4RTRA 5DTIA 3K2EA 2SECE 2NZVG 1F2VA 4HNAA 4E5SA 2HNBA 4JBHA 3WOVA 5LNK6 3VU3A 3I45A 4AP5A 5KZMB 3GA0A 4ZI5A 3B3FA 4RKRA 1KH1A 1OQAA 2WJVA 4M8NE 3C3JA 4P3NA 2VKTA 2JIZA 1YVEI 3KBBA 4R3NA 3UMVA 1NT4A 4D9NA 4KYIB 4J29A 2P6MA 2YINC 4QLAA 1E6CA 4KKVA 4Q7LA 2IIPA 4INAA 3QXXA 5IBQA 5JC1A 1PJ8A 4Q15A 1XZKA 4XM1A 2HPHA 3SKYA 4B6PA 1ZI8A 3PC2A 3OZEA 4ZICA 2BF7A 5KX5A 4HS9A 4UULA 4P8RA 1IBRA 2AFIE 2BF4A 2AHRA 3S2SA 3EPJA 4X6XA 2VYVA 4NYMR 1XJ5A 3BRSA 2CDNA 1W75A 4HYTA 2B20A 2AV6A 3EEBA 3KXIA 4EGCB 1RRCA 1DAOA 3HKCA 2O3SA 5DKFA 3TBFA 4DDKA 1JAXA 3DVQX 1WKBA 3HY6A 3KB6A 4JVMA 3T7JA 5LWQA 1JBEA 3QELB 4NE9A 4Z1MA 3VR6H 5K7SA 2NUPB 4HX9A 4W7SA 3CCCA 4E5KA 5B55A 1KZ7B 3QW4B 3KPUA 4Y6GB 1KVSA 2D62A 5EHZA 2CUNA 3GFRA 3IHLA 4UUOA 2YHBA 3P9NA 1M2JA 4W7IA 1UEIA 1MEJA 2VCYA 4AX4A 3CKMA 5IANA 2P91A 4K26A 3U19A 1G0OA 3ND6A 4FMCB 5FLKA 3Q3HA 4XWWA 1COZA 3FR8A 3QXGA 1WCYA 4RACA 5H5JA 3HDYA 3AIKA 3ID6C 3LT2A 3RK4A 2GTPA 3MJVA 1E4EB 1RHRA 3QLTA 3R23A 1OASA 1T2FA 3LGXA 4GOKA 1AKVA 3E1SA 1DBPA 1DT5A 2HQRA 2ZK7A 3NHPA 4I5DA 5GWXA 5TVKA 5F7XA 1V1MA 3NYRA 1J99A 1KPGA 2D3TA 2R44A 1QGYA 2IZOA 4O2BF 1UEXC 1GR1A 1L4KA 1VBKA 2NSDA 2HJHA 3CTPA 2HF9A 3HEMA 4MHSA 2VZEA 4Q3NA 4RPGA 3SFZA 4HADA 3R7LA 2K7ZA 4LNHA 4EEKA 5D3KA 5JCZA 3AHIA 2Q3BA 4PRYA 1P1FA 1QK5A 1XJCA 1IONA 3ETGA 3VNVA 4AI6A 4ZAZA 2P27A 3ZE7A 4ZVQA 4PLGA 2H1SA 3HLTA 2GEBA 1EXWA 2VA9A 3BSWA 4TKVA 1VZ2A 5ERGB 4P54A 3GUUA 1PGNA 2QJWA 2F9FA 4OHKA 1N9GB 4BNMA 3NV7A 5MDHA 3EQ8A 3NOOA 3R3WA 1G0NA 2VHUA 3A3NA 4XWYA 3RIYA 3GGCA 3FUVA 3B53X 5FOQA 4OHRA 4P3PA 3GLGB 3HVJA 3K9QO 3PGMA 4MLDA 1M8FA 2VHZA 1IHXA 2H5JA 3B9PA 3TW8B 3KSRA 5FWAA 3VR4H 4AWBA 4C88A 2IYAA 1Z0UA 4FQ8A 3WWCA 3BXFA 4HDQB 1YZVA 5CRIA 4HDKB 4R8LA 4KQXA 5G02A 2VNAA 4IJVA 2C1ZA 2M1XA 2PZMA 1B8UA 3AR5A 1DBVO 5FPYA 5T3YA 1YKFA 2XA1A 4MQEB 3DPSA 1T5HX 5KCMA 2GPNA 4FYMA 5IVDA 3VJKA 5CM8B 2ZVQX 2CB0A 3EXFB 5FNVF 1V5IA 4X1OA 5EE0A 3CRQA 3E1GA 5HFAA 5IC5A 3V9AA 4B6OA 1NVDA 3LIPA 2BMDA 2JF0A 2XDAA 3GP3A 4Z4FA 2MT9A 4LNUA 3M4ZA 2J48A 5K8VA 2A0KA 3KSMA 3AVYA 4A82A 1AA6A 2I54A 1JHRA 1L5QA 1XXLA 2A33A 1QE5A 5KI6A 1DWUA 3UK6A 4CM1A 3TLEA 4E30A 4PF1A 3CRRA 4X64B 4BVKA 1P7YA 4JZYA 4L5YA 1F1BA 1QIEA 1SVIA 2W6CX 2PGXA 4LE2A 3I53A 3AEYA 2Y1KA 2ZYVX 1RWQA 1EIZA 2HRBA 2WIAA 4P6VF 5F2KA 4B3SB 1PFWA 1QJ4A 1VPLA 1YU9A 3L04A 3ND8A 4IJ5A 4ME6A 3TSWA 4D4JA 5C5IA 2DTXA 1E9EA 2FGJA 2I99A 4FDUA 1VJDA 2ZJ4A 2I66A 521PA 3MT8A 1WMFA 3HN6A 4M1WA 3ONWA 1UMCB 4CLOA 1R1DA 2G8LA 3FVQA 3IQIX 1M0WA 4GP9A 2XXAA 1YDWA 2V6FA 1U0GA 1PFKA 5ETJA 2B2NA 3EQ9A 1BYIA 1WXFA 4CKCB 3KHUA 3UUFA 5IJ0B 5JS6A 4CU2A 2Q5IA 2NNWB 3N2LA 3D31A 4FHDA 1O58A 1HRDA 2WJ6A 1I51A 4UHDA 2V0GA 3JVVA 1PZEA 4NZZA 3SF0A 3ZZMA 3PR1A 2GETA 1KEKA 5JRJA 3ESRA 4FYKA 3UJAA 1JA9A 4G0PA 4H1UA 4HN4B 1X2EA 3I05A 4L1KA 1WNFA 5JO0A 1ONNA 3C7AA 4HQ6A 1ZOPA 5KKAA 3DAOA 3D54D 3L9WA 1YUMA 3ENWA 4XD7A 2AOXA 2L69A 1ZRNA 1C8KA 1VJRA 2EAUA 4W5JA 3O4VA 4PANA 3W6ZA 1MQSA 4CIXA 2GTIA 1ISGA 2VO1A 3G23A 4B7ZA 1L7RA 5IH7A 5LQNA 1J5PA 1JFFA 1RXUA 3PDIA 3WL8A 3MGBA 1F8XA 1QE3A 3OLWA 3IIIA 4E7PA 4EJ0A 2BOVA 2OBYA 3ROPA 4B73A 3I30X 3IKLA 5EFOA 3T5PA 3E48A 1HK7A 3BH6A 4QZVA 2FR0A 1CHDA 3GP8A 4XX0B 2SHKA 4KE9A 4FEGA 1VKNA 4L7QA 4B7UA 2JAUA 1OZ0A 4C0XA 4CF5A 1JSXA 1SXJB 1SHKA 1DI0A 1GUYA 2WK1A 4WA8A 3VPSA 3STXA 4M9UA 2IVZA 4MCJA 4BO8A 1VL5A 3I6IA 4A8JC 4I1VA 1AX9A 1R37A 1BX3A 3N2GA 3O0DA 3RARA 2C2GA 4BLTA 4I4LA 1R5JA 2AI3A 4DMMA 4NZOA 2EEPA 4UAJA 1L3BA 5IAKA 1RI2A 4XLTA 4AG6A 3N76A 1NF2A 3D1JA 2BGUA 3EK2A 3GAAA 3EGOA 4DRXB 4D5EA 2B92A 4P9NA 4Q93A 4GKKB 1VKOA 1Q7BA 3KJGA 4E5VA 4WFQA 4EO4A 1WSAA 4W5NA 4BECA 2R4UA 3ZE0B 1N6KA 1V43A 4E07A 1CIVA 1G6Q1 1VLVA 2ZWAA 4RJKA 4U5QA 5J9FA 1DRUA 5A6VA 5HNKA 2WJJA 5J2TA 1V0JA 2AR9A 3H2SA 1T4CA 3IXLA 5AXAA 1RTTA 5HQJA 3R5FA 2M1ZA 4OBXA 4W4TA 2JJ1D 3Q6NA 5ER9A 1T4BA 5TMBA 3T9BA 3IDQA 1EUCB 1FPQA 4HUQB 2NYRA 4O1HA 2EU8A 3O82A 3D4BA 5DULA 3MWEA 1Z5WA 3JZFA 3AF6A 1PFYA 3NFYA 4L8YA 4MQ6A 1LBIA 3AJDA 3SFTA 2FX5A 4UU8A 2FB9A 3PE3A 4O2AA 2R97A 5HCUA 5BPHA 2B1JA 3E4CA 5JEDA 4YUZA 5LKAA 3I01M 2Y9MB 4QXPA 5FH9A 2RI0A 4BCDA 2OBLA 3NHLA 3FB1A 2IHJA 4LRTB 4MUAA 1RQ7A 1G8YA 4E32A 2G0AA 1QM5A 4DV3B 2IODA 3HB9A 2QRGA 3DFKA 4FYWA 2VRWA 4BNZA 4IDQA 2WZDA 3R3XA 1UT6A 1MU0A 2ZUDA 1Q92A 2XODA 3AJAA 4GGPA 3O90A 1ZNYA 3QUCA 3ZJTA 1COWD 2W6ID 3PD1A 5JS8A 3WNVA 5ITWA 3DZFA 3KCQA 4Q03A 3R7DA 2XZLA 4WK4B 2J5KA 3OFVA 4TV8B 1B41A 4ZOBA 3WFIA 4HNUA 5MN4A 4DR4B 4PVDA 3M5DA 4C3OB 4QECA 4EQZA 3PLNA 5KSZA 1FW6A 2H00A 3OFKA 3SHTA 3P52A 1R6XA 4F5EA 2GESA 4IJMA 3N1UA 3QLEA 2QR5A 3TLMA 2PHZA 3AV3A 4R7ZA 4EA8A 1YGYA 3S27A 4FNMA 4MUJA 4LSWA 1ORIA 4YX9A 1NWHA 2C4VA 3AIIA 3ZD7A 1IRXA 1G5HA 1YQUA 4ENQA 3PS9A 4DUYB 4MUMA 1CRPA 2W2VA 8LDHA 4FNAA 2DLDA 1RAHA 1PAUA 3Q1LA 1Y9JA 3N3BC 4IDCA 4PPYA 1C7IA 3A1UA 3N6RA 4BY9E 2DYKA 4ZYLA 1IPEA 1LPOA 3LX6A 3KLOA 1GPUA 4IQ4A 2H07A 1QRTA 2RGGA 2HN9A 3EQ6A 3C6YA 3X44A 1U2GC 3IP6A 2VNHA 3C5EA 4F6CA 1ZFNA 2BJVA 1HKUA 3E9YA 4C14A 1DBSA 5EMMA 3CB4A 2GZMA 2JIDA 4EMTA 1EFAA 1N5LA 4AF7A 1KMNA 3TQCA 3G0DA 3AESB 1WHSA 2ADOA 4JGGA 4ZAWA 3KM0A 4PCLA 4NC9A 3H5WA 2YWGA 1TA0A 2W2NA 1DWOA 1SC1A 1JHZA 1V26A 3WLOA 1JDZA 5PNTA 4ROSA 5T64A 1AUPA 1XWFA 2MTBA 5FIUA 1Z4LA 4FWBA 4DM7A 1JDSA 1YFKA 2GPBA 3TRDA 3UCFA 1VE5A 4MKZA 4RDXA 5LZ9A 2UUCB 3W5UA 3EIOA 2Z8YM 3RVJA 2F3SA 3MIZA 1RKQA 3QE9Y 5JD5A 1U8UA 4NZMA 4RJLA 1U81A 4B44A 1SHTX 3LQYA 4DV5B 4P7GA 1SBTA 2OFFA 3WGHA 3ZZ1A 4EDFA 1QP7A 2EZ4A 1M0SA 2JFZA 2PQ2A 3IBYA 1JTVA 2Q5OA 3QVXA 3CV3A 3V5NA 1PLLA 1U8YA 1E5DA 2QEQA 4CKZA 3KHTA 4UDNA 1DBIA 3HCBA 4ZVSA 4BGIA 3X43A 1GZVA 1WU7A 3B13B 3B6IA 3Q6IA 4HVAA 4UAGA 1QJCA 3OZWA 4BCBA 1KI1A 1PX2A 2PRYA 3VC7A 4AIRA 4DMCA 1FJ2A 1PF7E 3HCNA 1W1UA 3OHMA 3P32A 1THMA 1TCVA 3QYJA 3REOA 3VMFA 4MP3A 1WULS 2YMMA 1E3JA 2PVSA 2NUPA 3IJRA 4MWGA 5C4MA 3X1XA 3CLHA 1LLQA 2ZYIA 1DMRA 4YNBA 4ZVVA 4XVCA 1KO4A 4Z8YA 3T8YA 2QD3A 3LY5A 4Y0VA 5ALUA 2RGEA 4KB5A 3MERA 3A7EA 1KQGA 3C8DA 3VNSA 3IEKA 3GARA 4NG5A 3K8OE 3VSCA 5JT1A 3EPRA 1GQFA 3NHSA 1KK1A 3DCYA 3OUTA 4HFRA 4RANA 4EKDA 5AICA 1TT5A 1CB0A 1BHQ1 3GD5A 3IBCA 3RU7A 4I36A 4PGFA 2B61A 5BMOA 2NIPA 2O2HA 3AFHA 1R0ZA 5JJCA 1GPDG 1KTIA 3ZHTA 2BR5A 2CZQA 3ITNA 1JWLA 2Q4OA 9GPBA 1ECJA 2BEWA 2QDKA 3O9ZA 2P2LA 4WLNA 2IU4A 5IKXA 1IMJA 1CQJA 1NLYA 2VEOA 4M9CA 2FZWA 2Q99A 3BZUA 4RMGA 5K8LA 1CR0A 2CLHB 2ZW9A 3V32A 1C9EA 1P44A 2FTKE 3WYBA 5ICMA 2ZAOA 4ZD6A 1CEYA 1JTFA 4DMFA 1S3SA 1CW2B 2XMDA 1IJFA 1M76A 2E4ZA 1NSTA 2QPTA 2WABA 1X8JA 5L9AA 3L4KA 1GJRA 4GRDA 3E8XA 1GDHA 4HAVA 2Y67A 4QVIA 3K1TA 1V39A 1SZCA 3C8HA 3FF1A 4BN5A 3U4GA 1QIFA 2Q6OA 1R0YA 2CMHA 1Y5IA 2P2CA 3LUKA 3M49A 1HTBA 4JKOA 2QYOA 4C6SA 1LTQA 2PRIA 2P9FA 4MTLA 2VP3A 3EQ7A 4KQGA 4RHFA 5BR4A 4RK6A 3V7YA 2XAUA 3BJEA 3QMPA 4JQZA 4ZOQI 3F71A 4BQRA 3PEWA 4NCJA 4BQSA 4GYJA 3GLQA 1MHTA 2PD6A 5K09A 2E48A 3W2GA 3R9WA 1DLIA 2JIQA 5B57C 2WG2A 1I10A 2Q28A 1R74A 1SXHA 1OOEA 1PSWA 5EHNA 4FM9A 1J2TA 4J3FA 4MWBA 1VKZA 2JFHA 2UYQA 5JZVA 1NBME 3GLIB 1AC5A 1S9DA 3MFQA 4G41A 2QTFA 4XYEA 1NNLA 2WOOA 3ANSA 3ESQA 3OPMA 1FVXA 4RCYA 3TW8A 5CFNA 2VDMB 4YY3B 3C48A 1Q1AA 1XEFA 2XE4A 3E84A 4GR5A 3ANXA 1V9CA 2M6RA 2DMRA 1N5DA 1DCMA 2FSSA 2VWPA 4E09A 5H9VA 1XTTA 4H4CA 4WK0B 3TTXA 2YS6A 2ZSFA 1W35A 3WGJA 1M6VB 1XCMA 5CNKA 4O4IB 5ESXA 2Q1SA 2GBGA 5HQ3B 1OWOA 4JC4A 3MD9A 3PGKA 3H3XA 4S24A 3KOOA 5JFGA 2BYTA 4NXNB 3EXFA 3V4OA 4AZ0A 1F4PA 2DKFA 3LP5A 3UHJA 3KU1A 2OUIA 2X8LA 5KNBH 1UJMA 2G1UA 4R9VA 4AM8A 2H5IA 6AT1A 5K0FA 1P2UA 3KIPA 1L7EA 1ULBA 1FDSA 1I2MA 3UWSA 2JLCA 3ODPA 2A2ZA 2J3EA 3L4BA 1GL9B 1SUSA 1CQZA 2CEKA 4G67A 4K6KA 2ZUTA 1I6LA 4CM4B 5JEEA 3C4QA 1AMNA 4ADSG 1KYXA 2OO5C 4LBWA 1FEZA 1H05A 1PD1A 1AU9A 2OMEA 4G0XA 2XWJI 3JZAA 4DGQA 5D7NA 4II2A 2P9HA 4OAPA 4JSRA 2XYHA 4BMSA 4MS1A 1M7BA 5A05A 2FOIA 3E9MA 4AS1A 1N92A 2C94A 3QNMA 1UPFA 2IUEA 3C5VA 3K0SA 5LUBA 4V03A 1D7AA 2O06A 5KHAA 1UAYA 5LYJF 1W0KD 5K6RA 3COVA 2MOKA 4UBIA 3TR0A 1UBMS 1H5QA 4BC0A 2D2FA 3H2KA 4HGPA 5LUAA 2O50A 1LRKA 3MXTA 3KKQA 3AFOA 1HDXA 1FY2A 1PR6A 3HJAA 4KTVE 5AT1A 3O31A 4UEKA 2H48A 1SURA 4PNHA 4YASA 5E7IA 3J7AC 4JJ4A 4KQ6A 1HLDA 3E27A 4E2WA 3ZDQA 3W1EA 4A15A 4D81A 1DTWA 4PC1A 1WY7A 2P0YA 4R1OA 5CCDA 3MHPA 1BH6A 1P2TA 3UICA 1V48A 3CUSA 1CG6A 4IDAA 2LUOA 1RE0A 3IAEA 4F06A 2G63A 3KALA 4ACAA 3I9FA 2GILA 5I3CA 1P4RA 1VG1A 3B60A 1I14A 3CZCA 2NYUA 1NW4A 3FPKA 3UN1A 4KWTA 4M55A 4JDPA 3VHRA 1CZKA 4ZARA 3V1NA 5HGXA 5B4VA 2XIQA 4NMLA 4EKIA 4L78A 4UM5A 4K8OA 4XB1A 3GLGA 1V8FA 4MV8A 2MIIA 4BP1A 4U7PB 2GRUA 2NAFA 2D2IA 1RABA 2ZVPX 3MYRA 3R5TA 4G2NA 1AZLA 3WP0A 1N6OA 2ISQA 4NJEB 9LDTA 4P7JA 5DGTA 4D1YA 2A9KA 1Y4AE 2FJPA 4O0LA 1SXJA 1O3YA 4PYIA 1D6NA 2I34A 3EOAI 3A3YA 3WDSA 1V35A 4FKZA 3JQ8B 3VR3D 1V7QA 4EHBA 5CDSA 2GM9A 4L8FA 1P9NA 4ZQIA 4Y2PA 1TTHA 4GOOD 2ZSAA 3ZWQA 3OOYA 5JDIC 4L50A 2BI4A 3IQDB 4Q39A 4A0HA 5JPDA 4FFRA 4AMUA 3CSDA 1KXZA 1D4OA 1ZISA 4OI4A 4R1UA 2H9AA 4UQPA 1N6PA 3U0BA 2BKLA 1O94C 4MQLA 2Z4RA 4IMIB 4ONEA 4N3CA 3D0KA 3SZOA 3DWIA 1EUQA 1SZDA 1E96A 2VH5R 5EL0A 1L5GB 1NNUA 4H0CA 4WIAA 3ZY2A 1SB9A 3E9ZA 4FHCA 1XVVA 3ZZUA 1B93A 3UAWA 3UJ7A 2GOYA 1GPKA 2OAEA 2Q0XA 3OOJA 2O5CA 3DFFA 4UOQA 2NVUB 3KPVA 4B71A 3LE8A 1JRLA 4JL5A 5F9MA 2PXCA 3T5MA 4ZZ3A 1M2FA 1G42A 4B5KA 3A3OA 1OXSC 4EHFA 1MPTA 1W1IA 1SU6A 3C14C 2ZAGA 3D2CA 2PX3A 3LYLA 2CK3A 2BCEA 2BMJA 1E7SA 1Y1TA 1KEEA 3QENA 1WX1A 2PJZA 1NXWA 4CHTA 2X22A 4JYAB 3FCOA 5C8DA 2FH5B 3QFRA 4TZTA 5ERYA 4JKYA 3RABA 5JYBA 2QT0A 2YY7A 3DAHA 2QG9A 4TGLA 4YYEA 5ADVA 5JMOA 2QN7A 3FOEC 2WD7B 1FCJA 5FORA 5EAIA 5M2QA 2L2QA 2Z9BA 4JASB 5KYTA 2I2WA 3W2IA 2XLCA 2Y6VA 1OI7A 2J5XA 4RZXA 2V9ZA 4I4TA 4CV0A 2BCJQ 1P0MA 1RHMA 2B99A 1KO1A 1YI0A 3H9EO 4KR3A 2H4JA 1JIXA 3NXSA 3DD5A 5LXTF 1GNSA 4N0EA 5CURA 3WYGA 3QHAA 3X0DA 1EVEA 1ODLA 2BAGA 3CT4A 3P97A 3UMMA 4X1IA 3EGEA 3MNFA 3Q7RA 4KIUA 1S8NA 3I1JA 1U3WA 1J7JA 5DP1A 1M2NA 1CZUA 1T8TA 4H1HA 4ASUA 2D13A 2E1PA 5C51B 3TQRA 1O9GA 5FTNA 3OM9A 1MVOA 1QGUB 1DAMA 2ZYWX 2FRDA 1IQ0A 1XBTA 1Z6GA 3LSTA 1FB5A 2C04A 4AJKA 4L5CA 2LIPA 5L6LB 3HKDB 5BN3A 1RWNA 4MV4A 1YVDA 1A04A 1JX6A 5EZYA 3R6TA 2AR0A 2BC9A 5IH3A 2QVZX 4IY1A 3PIDA 5IUKC 3MS7A 4MUKA 3WGVA 2ZXUA 4HI0E 3BMOB 5EA2A 4A5OA 2A59A 3EN0A 4Y2TA 1Z88A 3IEPA 4G0MA 4LXQA 4BEVA 5EIXA 2QMYA 1NG9A 2NVBA 4UVDA 4UBMA 3NHWA 1D2NA 1C2TA 5E8JA 5BYBA 1UOEA 1FJGB 4J0QA 1R8QA 2WM3A 3FN4A 4C30A 3T9CA 3UHOA 1POXA 3NTVA 2BKXA 1X7XB 4IDEA 5DNEA 3JRXA 1YIDA 3T7TA 3GQBA 4Y6RA 5EUQB 4KUEA 2DPHA 5EJ4A 2QLBA 4KAJA 5D2CA 3FJ1A 1IJKA 2O1EA 3BJMA 3MJTA 5JZSA 2XQKA 3ZW8A 4NU8X 4W5QA 1ZN8A 3A28A 5BWBA 3W9SA 2EW8A 2C54A 3RV3A 1WXGA 3V4RA 4BS9A 4ZZ0A 2F17A 1FU8A 4QU8A 5KNDD 1N2CE 1ORWA 4DMGA 1JZTA 1OXBB 3L6DA 1XZPA 5J23A 5KOHB 4N6GA 2KX7A 3UT5A 1H9AA 2BFWA 2BDEA 3W6OA 1V2GA 3EYWA 3ZGNA 1E9CA 1B4DA 2I76A 5JAUA 4Q00A 1XC7A 3LBIA 5KYKA 5EZSA 4CCWA 3BHJA 2PRKA 2ATXA 3PITA 2X58A 5KAPA 2BUBA 1T9ZA 1CK4A 4D99A 3OZFA 1VYUA 3CNOA 3K8YA 3P71T 3T9EA 4QOGA 2VTEA 4M76B 5DISB 1UDWA 1VECA 3CJQA 1IB6A 2Q5JA 1EVJA 2F6RA 3ED1A 3MQFA 2PRZA 4PAWA 4AJ2A 3L8CA 4NL4H 4R0VA 1XF9A 4AUKA 4BO2A 3KP1A 1WMDA 1V9SA 1ZJYA 4GI2A 1Y3BE 2BDTA 1X7HA 1XQ1A 4MR8B 4JBXA 3PB3A 2F3UA 1VE1A 2PUDA 4OBWA 3UFBA 1ZVQA 2W8BB 1XQWA 2W2TA 2HLDA 4HAYA 3FBTA 5EE9A 5LIRA 3FWYA 1YB4A 3RFCA 2X3FA 3AY0A 1WJGA 5E6UB 1RRKA 3DAYA 4RMNA 1TO2E 5DF1A 1V11A 5CIQA 2DWOA 4CG2A 1N2XA 3G1TA 4OREX 4F85A 2Y93A 1APBA 3AG5A 1A4XA 1UEJA 2XWSA 4REQB 2PSJA 2JA2A 2Y0EA 3KWFA 5TDHA 3WDLA 3WRYC 5TQ2B 3SQNA 4RY2A 4GLBA 5DMHA 3WHIA 1SXPA 5A5VA 4REMA 3ZE6A 5E6SA 4P4UA 2R1VB 3GNTA 1SQ0A 4JELA 3QX8A 2OD9A 3QLJA 1GRVA 1HQKA 5DNUA 4CQLA 4IX9A 5CW2A 1H42A 2XJ9A 3MJHA 2J7PD 4Y1RA 4AU1A 1Z4JA 4OEHA 3QEAZ 4FONA 2F62A 3I9KA 3Q7TA 5F51A 1ZVJA 3CONA 3ZCPA 1ILWA 1SCQA 3SY8A 1YL7A 1QYDA 3ESYA 4EO9A 1TYAE 2WE8A 4COKA 4AY2A 4MV9A 1KJZA 3UIEA 1TT7A 2D0OB 3UY4A 1YQ9A 1XU9A 2W58A 2MR6A 4EJSB 1HDIA 1G20B 2ZIEA 2IUUA 1XO1A 1LSJA 2P2NA 3ZXIA 1GARA 2FLVA 3MWDA 4JJGA 4ENVA 5BVGB 1AGXA 4C7MA 3F3SA 3TIFA 4R6XA 2AH5A 1EGQA 5ECGC 1ZD3A 3KKNA 2A7QA 3UKDA 1FUKA 4BE4A 1QHXA 1ZGHA 2WFLB 4G5SA 4LGYA 5JJBA 2YWDA 1LC0A 1RKUA 3O2JA 2XQJA 1OFHA 2LE0A 1M6VA 3BB1A 4FN5A 4FJ0A 3VU8A 2H18A 3B6JA 5ALTA 4CV2A 5EXSA 1B8PA 4E46A 1F8FA 1FP6A 3PJDA 1CBUA 1DOZA 4I8XA