1VFNA

Purine nucleoside phosphorylase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
270
Chain Sequence
b'GYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPEGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGQNPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDSQGKANHEEVLEAGKQAAQKLEQFVSLLMASI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE-NUCLEOSIDE PHOSPHORYLASE
publication title Crystal structure of calf spleen purine nucleoside phosphorylase in a complex with hypoxanthine at 2.15 A resolution.
pubmed doi rcsb
molecule tags Nucleoside phosphorylase
total genus 75
structure length 270
sequence length 279
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 1996-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vfnA00
2HSWA 1U1EA 4TTJA 1OU4A 5I3CA 4NY1A 1Q1GA 3F8WA 1WTAA 1T8YA 4JP5A 1Y1SA 5CXSA 5EPUA 1U1GA 3QPBA 4X24A 1JP7A 3UAXA 1PR2A 1V48A 1K3FA 3KUKA 1RXUA 1Y1TA 2H8GA 1PW7A 3FOWA 4D8YA 1G2OA 4WKBA 4TXLA 2RJ3A 3PHCA 1Z36A 2AI2A 3EUFA 4GLFA 3LBAA 4MCIA 4OJTA 1RR6A 1M73E 5B7GA 2OC9A 4DA6A 1V2HE 4TS3A 4QAQA 1RYZA 1V4NA 1Z5NA 4EB8A 2IQ5A 2BSXA 1ULBA 2PGAA 4GLJA 1A9PA 4ECEA 2GUWA 3E9RA 1Z37A 1K9SA 5F7XA 4E1VA 3T94A 4EARA 1NC3A 4P54A 1U1FA 1ODLA 1B8NA 4GKAA 1Z5OA 1TGVA 4D98A 5IU6A 1T8WA 2AI3A 4D8VA 3ONVA 1TGYA 3D1VA 2HWUA 4DA8A 3DDOA 2QTGA 1Y6QA 4BMXA 3OZDA 1JDZA 3NM4A 4BMZA 2HRDA 3BSFA 4R2WA 3PNSA 1Z34A 1C3XA 1LV8A 3K8OE 5DK6A 1TD1A 5F7JA 1RXCA 3DPSA 1JYSA 4LZWA 5CYGA 4G89A 4PNPA 5F78A 3OPVA 5CCEA 3KVVA 3OF3A 3NBQA 4OGLA 1Y1RA 5F7OA 1Z33A 5ETJA 1JDUA 1PK9A 3P0FA 1ZL2A 1PBNA 4R31A 4JOSA 1PKEA 2XRFA 4OY3A 3KVYA 4L6IA 4U2KA 1RXYA 4TS9A 3PNPA 1A9SA 3NM5A 5FAKA 4MCHA 3OCCA 4DA7A 2OECA 1A9TA 1RSZA 1A9RA 4PR3A 1ODJA 1VMKA 3BL6A 4WKOA 4DA0A 3FUCA 1VHWA 3LA8A 3FNQA 2QSUA 4KN5A 4L0MA 1PR0A 1RXSA 4MARA 3U40A 4DAOA 1V3QE 1JDSA 1OUMA 1Z5PA 3OZEA 5K1ZA 4WKNA 3IOMA 4F2WA 4LNHA 3BJEA 4QASA 1T8RA 1XE3A 4BMYA 1RCTE 3BGSA 3P0EA 4JWTA 2B94A 1ODIA 3MMSA 4R2XA 4LNAA 2A8YA 3KU4A 4F2PA 4LDNA 4UC0A 2QTTA 1RT9A 4D8XA 5JPCA 4G41A 1JE0A 5KB3A 4YMLA 4WKCA 1U1CA 1SD1A 1A9QA 4YNBA 4QATA 4F3KA 2HN9A 1OVGA 4TXJA 3E0QA 1FXUA 1TCUA 4M3NA 3MB8A 5CXQA 2I8AA 5C80A 4YO8A 1ODKA 1A69A 3EUEA 4TYMA 3DF9A 1CG6A 3LGSA 5B7NA 1JPVA 4YJKA 3ODGA 3EMVA 4QEZA 1B8OA 3UAWA 4QFBA 1V41E 4TXNA 1U1DA 1RFGE 5F73A 2A0YA 3O4VA 4GMHA 4D9HA 1ZOSA 1JDVA 4TTIA 1PR6A 1SQ6A 4F1WA 4TXHA 1T0UA 1PR1A 5F76A 3INYA 1YR3A 4K6OA 3GGSA 4OF4A 1Y6RA 1SJ9A 3UAZA 4M7WA 3K8QA 4TTAA 5EUBA 1YRYE 2AC7A 1LX7A 3UAVA 3UT6A 3OZCA 1SD2A 2AI1A 4I2VA 1PR4A 4NS1A 3OOEA 3OZBA 3ENZA 1OTXA 3FB1A 3UAYA 1TCVA 4BN0A 4DARA 1V45E 4TXMA 1CB0A 3DJFA 5F7ZA 3FWPA 3KHSA 4LKRA 2OC4A 5IFKA 1A9OA 1PWYE 1PF7E 4RJ2A 3E9ZA 3TL6A 2I4TA 2P4SA 4F3CA 5B7PA 1ECPA 1NW4A 3SCZA 1Z35A 4DANA 4L5YA 1YQUA 3GB9A 1JE1A 1QE5A 1K27A 1LVUA 3C74A 3NM6B 4L5CA 4G8JA 2QPLA 5CYFA 4DABA 4OEHA 4L5AA 5EFOA 1I80A 1YBFA 5CCDA 3IEXA 1OTYA 4OGKA 2OXFA 3PHBE 2ON6A 4H1TA 2A0XA 1T8SA 1YQQA 1ULAA 3FAZA 4NSNA 4QARA 5B7QA 3OOHA 3O6VA 1PK7A 2Q7OE 4IP0A 4M1EA 2A0WA 3KVRA 2ISCA 1Y1QA 3EEIA 1PR5A 1Z39A 1VFNA 4WKPA 1NC1A 1JDTA 3DP9A 1N3IA 5F77A 4DAEA 4FFSA 1OV6A 1VHJA 2QDKA 1Z38A
chains in the Genus database with same CATH superfamily
4CTJA 5C35A 2REOA 3H84A 4MVJA 2WJ4A 3ORHA 3WZ2A 3FBTA 1U8AA 4AZWA 1U11A 2FW6A 2Q1TA 3OESA 2C2GA 4G1BA 4WV3A 4DOMA 5CFRA 1U0NA 4QREA 2YW9A 3F8SA 3U7JA 3N70A 4YQFA 3FA2A 4GOKA 3LNTA 1NVKA 1Q6YA 1ECJA 3A1SA 2PRJA 3VKFA 1RRMA 1XHLA 2C77A 3AHJA 3G8DA 3CKKA 1IB0A 4GEGA 3ESQA 3NXKA 4MHSA 2QMYA 4L50A 4NMXB 1QK4A 5CYPA 5AMXA 1GEEA 2AF4C 1DBPA 1JP7A 2D3WA 3ZK9A 4XTRA 2R6DA 3N8NA 1RE1A 1QIHA 1PQUA 3KWMA 2QLBA 1NMSA 2IEGA 3K0EA 3OO1A 1J0CA 1RXUA 3TQFA 1FFCA 2NGRA 3DTYA 2UZ1A 5AXCA 4LG1A 2P2DA 2ZJZA 2DWPA 3M2PA 3WGOA 3WGTA 4WKBA 4B71A 1JMYA 2OXTA 2HW8A 4BKRA 1NX9A 1WJGA 4GW3A 1J00A 2NNWB 5CLGA 2FPPA 3SR0A 1R4NA 1QCZA 1VIAA 1YRBA 5C9ZA 3L6RA 4WRRA 2ZJAA 4LEIA 3R41A 1EFKA 5ENDA 4D42A 2GD0A 2XNHA 4HF7A 1IAVA 4XVHA 3UQZA 4B5KA 4CLHA 1FDOA 1D07A 4OHKA 2QGNA 4XGRA 3QKRA 1VZ2A 3FCCA 4GLFA 3A1DA 3SWWA 3FPJA 3CUTA 4B5LA 5KAMA 1H1DA 2VP9A 2ZWVA 1Q84A 1FXSA 4JU8A 4OM7A 2DPHA 2OZVA 3IV7A 2QTFA 4NIMA 1NBOA 3HKCA 3VYRB 1V8ZA 4AJEA 5K8CA 3I0NA 4YRTA 1NUUA 3ABOB 1HT1E 1W19A 2XZOA 3IIMA 1U3GA 2XBUA 1R0LA 3DOIA 1HOTA 4JWKA 4JJ8A 4TQ9A 1MUUA 2PL9A 3CJQA 1EGAA 3MAJA 3MWJA 4ZYVA 1Z0SA 4EYGA 3ZGZA 1EFAA 1VBKA 4MW0A 1O95D 2FW1A 3KQYA 4IJUA 5A7HA 2H16A 1VI2A 4KSYA 1P75A 4CKXA 2NZ8A 2ADMA 1RZRD 4RTKA 1VMDA 2BEWB 3TRIA 1XZHA 4IRXA 4UJ3A 3ZH9B 2WSSD 4M1QA 2WY2D 4LC9A 3N2GB 3WOVA 4EEKA 5DW0A 3LGAA 2A57A 1XWIA 3FYCA 5KVCA 4BBAA 3GHYA 4GI7A 1IQ0A 1FTYA 1SAYA 3BREA 4CV3A 4NK4A 2JFOA 4O4JB 3VI4B 3B7PA 1W46A 3IEIA 2DHRA 1IQUA 1R5NA 3KUXA 4OMDA 2HF2A 3R20A 2ERYA 1MHTA 2EKLA 4LQ4A 5GOTA 5BV8A 2ODWA 2ECQA 4RTNA 2G5PA 3HY6A 1R0ZA 1FLDA 1O6GA 2ZROA 3KR9A 4BNTA 1IZ8A 1AS0A 5K2MA 5TT0A 4MGKR 4QPPA 1N75A 1YWGO 5DI3B 3FPLA 3VKVA 3OLVA 4OX9B 4R7GA 4U7TB 4L27A 3MWKA 5DHUA 1C8BA 2B8TA 5TSDA 4BE7B 1KJJA 1OIVA 5JRJA 1XDUA 2VA8A 1A72A 4H31A 3SGLA 3TYXA 1BMTA 1KP3A 2JCVA 3IXLA 3LYUA 3HDQA 1MO3A 1AGPA 2W7TA 4BMXA 1DJMA 3FNGA 3QEOA 4HN4B 4BMZA 4D7AA 3D3WA 5K8VA 5JD4A 3BSFA 4LRUA 3SPXA 1W6RA 1ADFA 3GLSA 1O0SA 4OJQA 1UM9A 2HHJA 3IQDB 5LYJA 1A27A 1KQPA 2BBSA 1MEOA 3C6QA 2MYTA 1KMIY 1XZLA 3PNOA 5DULA 1P9OA 4LYFA 4Q39A 1WETA 3PL1A 4DR3B 3V32A 1OWNA 1MH1A 3OD5A 3QVVA 2N3ZA 5AW5A 3NNDA 4UUNA 4I55B 2VH2A 4BQNA 4L8GA 5C5EA 3GEGA 1E60A 1TKBA 4J0EA 4J7XA 4EYEA 1N2OA 3WLTA 2JDIA 5DBOA 5HJ2A 4B3CA 1TLFA 3ZYZA 4DUZB 4I3HA 2I3ZA 1UBKS 1Y6JA 4LBZA 4P08A 3REQA 3AESA 3H17A 4NJEB 4N5LA 1H94A 4BO4A 5TQJA 3LKZA 2QTHA 3MTJA 2P9HA 4NULA 1X3SA 3HCWA 3OE7A 2X76A 1CVRA 1AK1A 1WD5A 1KAQA 2ZYTX 4F21A 1E94E 3KQPA 2OCAA 2FR8C 4WEOA 4UNRA 5JU6A 2BGWA 2RIRA 1WD7A 4KXQA 4R8SA 4L2IA 3UWKA 2LV8A 1H2FA 5A9SB 5U9CA 4OJNA 2PEYA 4MJLA 2VQFB 2XRMA 4MUJA 4ROTA 5F2EA 4QUDA 4EABA 4CMBA 1TECE 1TMKA 3KXIA 3DT8A 4H6VA 2ZREA 4PPYA 4YDRA 3R44A 4WXRA 1AC5A 1OFUX 4MKFA 2E2WA 3DCNA 5H59A 5B53A 3V9PA 4GLLA 1OFUA 3CEHA 4XRRA 5DISB 3EQZA 2IOQA 1RI2A 5JHHB 1RSZA 1S7CA 1SCNE 2QUBA 4K9RA 4B3BA 3KZMA 4B75A 4RTSA 4U3JB 3KYCB 2ERCA 3CG4A 3W6OA 3Q8KA 2IEBA 4RH1A 2BMWA 4M54A 2GK7A 3FSGD 3UC5A 3C6BA 4NCXA 4OGWA 3SX4A 4BEBA 3OU2A 3TLKA 2JNWA 2ICAA 1YR1A 2NVUA 3O91A 4BWFB 2W2OA 4XH9B 2W8ZA 3VR3D 4DEXA 3QWIA 4UHDA 1NVGA 1UR5A 1BDBA 1WV1A 3FCOA 3HBAA 3SVLA 5DSZA 3DLTA 3IODA 1T1GA 4QU9A 4DRXB 1SUDA 3VPCA 4R98A 5CFQA 3T99A 2PUBA 5EJFA 2RGWA 4N6NA 4O2AF 5JDIA 5LP6C 3DQZA 3U0BA 2BM9A 1WUYA 4EJFA 1ML4A 1AUQA 5K3BA 4U2CA 4JIMA 3F7OA 3HDVA 1A5BB 1Y3DE 3D81A 3GPCA 3NBAA 1RJFA 4IQFA 4LECA 4WKNA 3V8VA 4CRWB 3IOMA 4DDHA 2P41A 2FSFA 2H9IA 5LN1A 2VK1A 3NHMA 3VNAA 1PT5A 3AR8A 4MO9A 5FV4A 2J9FB 3RJTA 1UKCA 1TJNA 1NR5A 3AQIA 5EYPB 2FMXA 3U4CA 1JAIA 3ZJ4A 5LKAA 2B30A 2IXTA 4D81A 1WKCA 3CR3C 2PN1A 3K0AB 4V02A 4ZAYA 4EF5A 1WW3A 3K70D 4CGZA 5ITZA 2JIZA 2C4UA 5JXGA 3IA2A 3KP1A 4ZVPA 4H1WA 2ZI4A 2F67A 3M3HA 3DMPA 5AR1A 4S24A 4FWIB 2B6HA 4TKUA 4LNAA 1E2NA 1JQBA 4MEAA 3T5GA 3MS7A 4ABTA 1ZH6A 5H4HA 1XZQA 3EVBA 1M6EX 4RA9B 2B4KA 1OKKA 3MWLA 1D2CA 3ZHYA 4PZAA 1KVSA 3O74A 4G4SP 3RWBA 1JT9A 3WDMA 5TC4A 2WVGA 2QBYB 2ID7A 1MX3A 4DDVA 5BWNA 5IN4A 4D8XA 3UG6A 3SQOA 2NG1A 3G68A 3OT5A 2FQYA 3PD1A 1YBVA 4WOKA 4KYUA 3S3TA 1Y3HA 3A37A 1J1IA 2X0NA 3B6KA 4BASA 1ZOOA 1ISFA 1XG5A 3IAS1 4UE2A 1XVTA 4WZAB 3V1LA 3O7WA 2DC1A 1KYTA 2PGOA 2UZ1B 4GP9A 2HSGA 4HWTA 4BL5A 4YCMA 5LP6B 5MDHA 1L5MA 1SCDA 1PU2A 1SB8A 1XTVA 3B78A 3DE7X 1ZN9A 5I7OA 3AY3A 2C5LA 2FPPB 1H0RA 1OZFA 1T36A 2XUZA 3BIFA 2PZMA 4GI2A 2H31A 4RETA 5DFAA 5IAAA 1QDLB 2X15A 1X2BA 3N8HA 2CKMA 4ZCLA 4F5WA 3BFXA 5CTJA 1FFEA 4B8YA 4E11A 3QEAZ 3EXG1 3KS9A 1MENA 3RVBA 2OO7A 2PV7A 5JRDS 4M3NA 2IXGA 1FOEB 2W8BA 5M04A 1K2VN 2WMOB 5J2UA 3EFOB 4LX0A 4S12A 4M89A 4OFBA 5JVDA 4OXIA 1MQAA 1NVVR 2O7SA 3KLNA 1XTBA 5A2GA 3AI1A 2EZTA 2VPZA 4HNUA 4MWGA 4B84A 1FSZA 3HCOA 3IVXA 1PAUA 4UHEA 2J45A 4JLJA 2WWTA 3CLSC 3FFXA 1KJYA 2GJ8A 2JKZA 4IV5A 2HLDD 2AVNA 4EYKA 1FNCA 1HSOA 3BRSA 2ISQA 2HHHB 4E1BA 3IJ5A 2H6EA 1B8OA 2FW0A 5EKXA 4DM4A 1XDBA 1V41E 1OHHD 2YHBA 1U1DA 3QF4A 1RFGE 1LS1A 3H87A 4N0QA 2XT9A 3UYLA 3VOSA 2J7PD 2JEZA 4OB6A 2XH8A 5ENZA 5IKXA 3NHAA 5JC1A 1USWA 3VC7A 4FCCA 3OX1A 3ZCPA 4D79A 3THWA 3NIBA 1G5FA 3UJCA 1ZOSA 5G2OA 4QLOA 3PYLA 4C9BA 5I7EA 2R1ZA 2R8PA 1DB3A 2W2LD 2HK6A 1Q19A 2JJ2D 5KSYA 5KOHB 1MJGA 1NA5A 1PZFA 1HQCA 3UXEA 1BC5A 1DCMA 1J42A 4PY2A 4BO7A 2IQIA 2ZKIA 1W34A 1GGMA 2CL6X 1XMQB 4URXR 3F9IA 1P2FA 3BHIA 1T3ZA 1QF9A 1WLSA 4K6OA 1X19A 2DTXA 4LMAA 3IP6A 4D3DA 1V7PC 2WUWE 4RKQA 4RV5A 5MHTA 3VTZA 3RUIA 2ATVA 2DGDA 4JDUA 3PFCA 3VZQA 3ITKA 1E2IA 1QO0D 1SJ9A 1WRBA 4DCPA 3RKRA 4TKVA 2D8MA 3L7AA 1ESMA 1YZHA 2BHTA 2BOVA 1I10A 4PHTA 1I3CA 4HPJB 1OOEA 4NE7A 2QLJA 1I5RA 1GPMA 2QRZA 3LSYA 2CVOA 4Q3LA 5JSHA 1ZJ5A 4UDOA 3UXHA 4JS0A 3CT6A 5JS1A 1NYLA 1O9GA 4HWPA 3I32A 1L4YA 4YWJA 2OGZA 1PR4A 2CXSA 3GFGA 4NS1A 2GEFA 3BGOS 3P0HA 4MWZA 4EZBA 3H6KA 1TAHA 2OD9A 3FUTA 4LPSA 5E2BA 2YJZA 3RT7A 5JPDA 2GM4A 4G0VA 1VKOA 3ZD9A 2HU7A 1XZCA 2WVJA 1KEUA 1KC3A 2BD0A 3L6EA 3TXYA 5L3SA 4DARA 2WNSA 5IK2D 2QT1A 2HQBA 1UUFA 2H1VA 2CLKB 1QU3A 2EP7A 2I2WA 4GWKA 1IWPB 1G1AA 4CQLA 3AK4A 3FSJX 3FW1A 4LOJA 4O1HA 2NU8A 3KTAB 2ZUFA 4P33A 3HRKA 3E9DA 2VDUE 2ZLBA 3PC3A 3RTCA 4AY4A 1A9OA 1C7QA 3R7WA 1FRQA 4IVPA 4MR8A 2VYND 2W4IA 3ER9A 2CY0A 2KWIA 3SJBA 4FQ8A 4HH4A 3CVOA 4Y9RA 3TL6A 4C4PA 5JO0A 3RB8A 2HIHA 1T5DX 1XWFA 2MINA 2VQEB 4LZOA 4Q3KA 4AZ3B 1YDMA 4OHVA 4IHAA 4IOMA 5TQ2A 2FR0A 2QUAA 1GTL1 2VBCA 5SZKB 3VRHA 3OLQA 4E5NA 1ADYA 1ILWA 1H1LA 2GESA 2VDWB 3PQ3A 3RSQA 2B0JA 4EGSA 3E9NA 1FDRA 3LCCA 1Y8AA 4F12A 2GN6A 1NKVA 1Z35A 2ONJA 2J31A 5FOUA 1MOPA 4YAWA 4XYGA 4HVCA 4DDTA 3D8BA 3KBOA 2D1FA 2JD1A 4JCOA 3D8HA 1JE1A 2MSKA 3DO8A 4IJ5A 3ZWVA 5K7SA 1OXVA 1MAAA 3TVYA 5FTMA 2ZDGA 1Z4IA 1RIIA 1BO6A 2FEKA 2GK3A 3JZIA 4KN8A 1QZUA 2BT4A 1BMFA 1ONPA 3CYFA 2LUOA 3GT4A 3W77A 4Z3DA 3L0BA 3R3JA 1U65A 3QX8A 5L4LA 1QYCA 4ZGGA 1Y4AE 3OAAD 4MDEA 3BXZA 4RNCA 1GOTA 3H5AA 3ZN2A 2FNAA 3ZVKA 4WUVA 2V9CA 1H2RS 2VRCA 3PRJA 2QI9F 1X2EA 3HUUA 1KO4A 2AXNA 3PS9A 4C06A 1KF0A 2OO5A 1NULA 4GVPA 4B6OA 5CLFA 3T3OA 1HE8B 1L8AA 1MO2A 1NZJA 1YE5A 1XMJA 2R3SA 1HF3A 1HT2E 3MSXA 1T1IA 1J9EA 4NNJA 3S5JA 3VUFA 2CFIA 1FQOA 2EKDA 3G7UA 4N4AA 1QGDA 4OGKA 4OQZA 4GI3A 1YQ9A 2H00A 4P3KA 1F17A 4Y1GA 3K0FB 4KQHA 4YMUA 2H54A 3T4EA 1AU9A 2I62A 3CCFA 3GP3A 4J0DA 1T8SA 3V3TA 4EG0A 2JGNA 1PLKA 3MJHA 2OUIA 4G9BA 4ZIRB 2D1YA 2I76A 4DADA 1EAYA 1I6WA 5BQ5A 4CF3A 2W5UA 5B7QA 1P73A 2G17A 1H2HA 2ZR9A 5ALRA 4DIUA 2F2TA 3ESRA 1SVOA 4ZU1X 4CKCA 4AS3A 4EUNA 4MIEA 4B6QA 1ADJA 2PZLA 3GN1A 2EJVA 4L76A 3CF4G 4EPYA 4LFAB 1ZRNA 2B69A 3DO5A 1XEFA 1LPSA 3DD1A 5T67A 3G88A 3VPGA 3VX3A 2DKNA 3T7SA 4MKIA 4IG9A 3DAOA 3HDTA 4TKUB 3CCCA 4H7DA 5CITA 1JIJA 1NBIA 1TKAA 4DLUA 2EKZA 4R2IA 2C7GA 1H0HA 5CA0A 4BP8A 4CM6A 1YBMA 1CF2O 4KXXA 3Q85A 1CFZA 2XEXA 3QNWA 3R0IA 3IESA 3ZEAA 2VOEA 3GYBA 4IV8A 3VZPA 3W9YA 4DAEA 5JZVA 3RIEA 1MW8X 2VJBA 2JHCA 1OI7A 2VDKB 2XSZD 2V7UA 5L51A 1CT9A 1ZUNA 3IFSA 4TTJA 1N5RA 1VPVA 1ZSNA 1ZK1A 3Q0EA 3L06A 2WYOA 3VR6H 1C2YA 2PKYX 4NY1A 5JARA 4H08A 3BC1A 3A1TA 1RLTA 1G5RA 2UYOA 3SDSA 4W5OA 5JECA 5AJXA 1VPEA 1YRQA 2FSHA 1VG9B 2OZLA 1I24A 1T36B 3DWGA 3U9SA 5CDSA 1KI2A 3ND9A 3COJA 1IQRA 1PVDA 4HAXA 4X20B 4KEAA 2C2OA 2Q29A 2HAEA 3KVOA 3PA8A 2XYQA 5EIBC 4URZR 5K45A 4M9ZA 3L8ZA 5G0VA 3W8FA 3B3QA 3ZHXA 1G3MA 4L5JA 4A27A 3V7FA 3CRW1 2ERXA 3Q12A 4DC1A 1F1JA 3QU5A 2ZXUA 1F9AA 1PVVA 5J2UB 3CEPB 2ZIVB 3F7MA 3OFNA 2KE5A 1ZW1A 2ODEA 1V11B 4QHYA 5JVDB 2XGJA 1ICEA 3P2EA 3OEYA 1C0PA 3WFZA 4BVEA 4CIWA 1IHDA 2G1AA 3Q87B 2RHWA 3SNKA 3VPFA 5ADHA 1UP4A 1OXSC 1L7MA 1M3SA 1TVKA 3ZWWA 1EG2A 1GV0A 3FVRA 4L0QA 1N33B 2VTEA 3PX3A 3QUCA 2O14A 4YJ2A 4FDLA 1DG3A 1FQKA 4LF5B 1Z4MA 4UBMA 1X3LA 4ERNA 1XRRA 3QF4B 3H1PA 2GOYA 4YUXA 1YRHA 3AU9A 5DYGA 5LR6A 4EJ6A 1MA3A 4HC4A 2HK9A 2IZOA 4EMSA 1F7VA 4YV1A 1I4DD 5EJEA 3ITDA 3BCUA 1HZZA 4BJ3A 4MB2A 4RWEA 3V8EA 1JLMA 1A2KC 1IWOA 1SD5A 1DX6A 1U2EA 3CXRA 1DTEA 2PWYA 3JALA 3U4HA 3EGDB 3FCAA 3WADA 4E5KA 2CDCA 2WJ6A 4JVSB 3VA7A 3Q7RA 5J58A 4GZ5A 1IXSB 3G2PA 2XZTA 4ECEA 4OSOA 4E1AA 2BFDA 2CNLA 1ISHA 5EOVA 4BCCA 3WMEA 5E8RA 4HADA 3BXPA 1JEDA 4RCYA 4NOLA 3UY4A 1CF9A 3EARA 5CVVA 3OIUA 4FFBB 4YV2A 4S1TA 2RK3A 4Q47A 3L1JA 2ZVQX 1S2OA 3PNBA 4WIAA 1C3EA 4NYMQ 5LQJA 4LJAA 3LQKA 3ROZA 3ROFA 3IDZA 3WLNA 4C20A 2XCRB 1W1UA 4M60A 5IVKA 3G23A 1SPXA 4JA0A 5DP2A 2VHEA 1W581 2JATA 4ZMSA 5IULC 3G49A 4IDEA 5ECYA 1L6RA 2PJUA 3L2OB 4YAKA 5DNUA 3KD3A 4D8VA 5E6RA 3ONVA 3UV7A 2Q28A 1KQ3A 2NW6A 3LAWA 1P7WA 3JD2A 2XB4A 1DXOA 3CLTC 3FRJA 5L3SB 3L1IA 1QIDA 1SEVA 1XFAA 2J09A 3U7GA 1IM5A 3ZBTA 4Q6BA 2CF5A 1WXDA 3OD1A 3OX3A 4ISBA 1PHRA 4NARA 3OQJA 5D3MA 1KDRA 2B8WA 3CKMA 2MDTA 3I9V6 4JY7A 3RK1A 3LC7O 5BV1A 2ZUCA 1P7ZA 2ZFUA 2VPPA 4RYDA 2XNDD 2A0UA 4YP0A 5EE0A 1Q0QA 4K6HA 3ZIAA 1M54A 4AN4A 1S8AA 4HDMA 4C3ZA 3NBMA 1SVNA 1OZAA 1LV8A 3K8OE 4X6YA 1H6CA 2VUTA 3MINB 4J75A 2NU8B 1JT2A 1C81A 3I2IA 4LV6A 5EWMA 4C88A 4EI8A 3JQ9A 5KYXB 1T9DA 3QBEA 5CYGA 2Q99A 1B7GO 4EKYA 1E1RD 5EGSA 3UNXA 4MI1A 3S4YA 1F4PA 5CA1F 2WIJA 3AL2A 3ELYA 3UGJA 2QRQA 2XDYA 3MMNA 1Q17A 4C7KA 1YQDA 3OF3A 1P7CA 1Q3TA 1QOQB 3KB1A 2AMJA 5K0EA 2C5HA 1VG1A 3A9SA 1TF5A 4MIOA 3UMSA 3OECA 5F7OA 3WR5A 1C30B 6GPBA 5F9FA 4MV3A 1V8PA 1J2JA 3EGEA 5AVRA 5LOVA 1FU8A 3SS7X 2NWQA 2QW1A 3LE8A 2Y0DA 3HBMA 5J43A 4NCAA 3QE0A 4FJ0A 4FQ7A 3STVA 3DE2X 1OX6A 1PBNA 1YZGA 3IAFA 4W5RA 4PZPA 1TM1E 3A06A 3PIRA 1DAIA 5GWXA 3FZNA 5C32A 2HHCA 1ACMA 1JU9A 1E5DA 1Q14A 2ASVA 3MOSA 3TZEA 4L6IA 2FZKA 1CJMA 1CQWA 2H0AA 4MV1A 4WK4B 4ZI5A 3VR2D 3PNPA 3K1YA 4ZGWA 3ZDZB 3ILSA 5JZOA 2ACKA 5CDGA 1ZUHA 2Q46A 4Y2YA 3WL6A 4YREA 2FEMA 3ZVRA 3L0PA 4EG5A 1D7OA 3DM5A 4AWAA 1MABA 1ZK3A 4G4GA 4R9UC 3QPUA 1I30A 1R0WA 3NIWA 3V2IA 2H5LA 3G5UA 4IDPA 2G82A 2JCYA 4NBVA 4OQFA 3EF0A 5T8KC 1NOIA 3IR5A 1J1ZA 2PBLA 4ECAA 4KR2A 3R9XB 4F3RA 1E9AA 5LQNA 4QRDA 3DF7A 4NOJA 1M2OB 2R4TA 3SZRA 5JFOA 3C6MA 1DIGA 2ZIWB 2R6CA 2VCYA 2CT8A 3SX0A 1MV5A 2WM9B 2QP4A 1ZD4A 3KE8A 2GNPA 3PPIA 4LXGA 1DFHA 2ZS7A 5DBIA 5K8JB 5U4XA 1TKCA 3RC3A 2PKRA 4EITA 4OHMA 1OXMA 1JSLA 1CB7A 2WWWA 1SVKA 1SKQA 4HQLA 1E69A 2Z30A 1E62A 1OFHA 4G85A 5HUJA 2BZ0A 3T9FA 4FR5A 5JAUA 2V7PA 3PNQA 1SVUA 1PNQA 4QTXA 1Z6TA 5TNXA 1E1CA 3DTTA 4C30A 2ZBRA 4A10A 1J4AA 5K3EA 4RF3A 3KO8A 3Q10A 3VU9A 1TCBA 1G3QA 1HQKA 1ZX1A 4C4AA 5CA0B 1D2GA 2V6BA 4BYGA 5DM0A 4M55A 2WSLA 2V7WA 3ROPA 1O94A 1D9XA 1LV7A 2LP4Y 3RROA 2YMPA 2JB9A 1T3TA 1VCIA 3BGVA 3H7AA 4Y2HA 5D3QA 3FTQA 4R8MA 4AMYA 1E8MA 4QELA 4XX0A 3V00A 3ZV4A 1RCTE 1ENPA 3P4YA 2P35A 4KBYA 4NC9A 4YUWA 3FPSA 5T6BA 5IWCA 2XKJE 4B2LA 4BU0A 2O0JA 3BHNA 2MCFA 5SY6A 1ODIA 2WK1A 3C6YA 3DNFA 1NNUA 4QOSA 4PN7A 2LXNA 1L4FA 3R9WA 5LFAA 5CLLA 1YL5A 1DBIA 3I05A 4CEHA 1VGRA 2HD4A 1UZLA 1HBJA 3CH5A 1L5HA 4F2PA 4FTWA 1A82A 5JD3A 3GJZA 3T3EA 5BV2P 3PWKA 2ZOSA 3BK7A 3OPYA 4G36A 3DL4A 4LRXA 4Q21A 3ICCA 5K6AA 4ND3A 3MCZA 2QZPA 5GZ6A 3DPIA 2EFJA 4JLVA 5HF9A 5C34B 1R0XA 3HB7A 4LF8B 4FLMA 4IH1A 3ECSA 1GLGA 1JAXA 4WZBE 4MLDA 4MV4A 1KVQA 2FWRA 1G7RA 4FDAA 3OQMA 2EZ4A 4QIHA 2TMKA 5U4QA 5EP1A 3A9UA 5CDYA 2C96A 2C9BA 5HKLA 1S01A 4ZQHA 1FXWF 2P1DA 1LQ2A 4Y2VA 4OU5A 1FP2A 2NPFA 3V4ZA 2XRZA 2IEIA 4H1VA 2L0XA 1UMCB 5AUQA 1T6XA 4QYWA 3DXXA 3KLPX 4NG4A 3DYIA 3O8DA 2CXNA 2TSYB 5H9WA 4PZYA 3CZMA 4EVIA 2JH9A 1J25A 4LRQA 2ZIGA 3MB8A 3ZTTA 2XA2A 3H9EO 4IIVA 2K5UA 1L4UA 2N1BA 4BNWA 4W1PA 1BSVA 5AVUA 4B3RB 1EK1A 4KZKA 3GBPA 2HJ9A 1AV6A 3KYDA 4Y0AA 1T13A 4M9UA 2Z4RA 5EE9A 2AWNA 5JJCA 2DFVA 4KL8S 1XZMA 3JALB 1J99A 4M86A 2G4CA 4KGVA 1IL0A 3K3PA 1G16A 1YT5A 2XJ4A 3AG5A 3W5IA 1H1TA 3U2QA 3AETA 1K2WA 3FCYA 5IBPA 2DSTA 3F2VA 3WXBA 4B0PA 1LSJA 1W94A 2BGLA 2YWJA 4JELA 3ONDA 4WLUA 2JAHA 1R4MA 4ISCA 1KI9A 2BFDB 3VSBA 5HZGA 3PXGA 3IEPA 2OCXA 4JODA 4XLLA 2C4VA 3U13A 1PDWA 2QG9A 1D6NA 1LVGA 4MHOA 5B37A 5J5VA 5B2EA 1FFYA 1R50A 5HPYB 2IHUA 1F12A 3CQ9A 4HNSA 3GBVA 4RENA 1PFGA 3JRNA 1TZJA 1XTRA 1TQ4A 4Q9IA 3SYTA 4BNDA 1C0LA 4DC0A 1PKXA 2WUVA 4HT3B 4NFLA 1DEAA 3JVEA 1LBIA 1RS0A 1T10A 1C9NA 4QUBA 5KNDH 3LL4A 1NWHA 3ILHA 4TSKA 3T3GA 1N5KA 3WISA 4AIRA 4DA9A 3EG9A 1IM8A 2AZXA 1N6HA 1YV9A 4L7VA 2BCGY 3VTFA 4DWVA 1X38A 1QPZA 3QFSA 3DAGA 4II2A 4NNOA 5EIFA 3KNZA 3TQRA 2AR0A 1DNPA 3CCBA 2EDCA 1BX0A 3AJDA 3K09C 4OQYA 3L0ZA 3RJZA 2FN4A 1K89A 3F3YA 3KFVA 5DHAA 1AT1A 5TPZA 5FUVA 4AL4A 2V6FA 1VIMA 3ZY3A 5DZSA 3CF2A 5AWFC 1L5GB 3K0CA 3K8QA 4TL8A 1S7GA 5D3MB 3TAUA 4AFNA 1N77A 4PZEA 3FUVA 1J0AA 2ZR7A 1OD6A 3EOBI 3G5LA 3UAVA 1NLYA 4D3ZA 2AG8A 1TW2A 1EZZA 3JYOA 4IJWA 3RGGA 3A2LA 3ZTWA 4HDMB 5A7FA 4G5SA 3NVDA 4LJ7A 4D82A 5ISMA 2IDKA 3ZHVA 1QIKA 3L92A 4YT5A 1KAGA 5EWMB 4UEJA 2Z8ZA 2YFKA 3TVDA 5IM4A 1G20E 2F90A 2B6NA 2WKWA 4HAWA 3OCXA 3DQQA 3PVSA 1MIOA 3EFHA 1B93A 1NDQA 2WTNA 4XIGS 4C43A 3FYUA 3RVRA 4ND1A 1K86A 3CRRA 4B7XA 4LYYA 5DLDA 2AN4A 5F98A 4ZV4A 2FSIA 4D9NA 4YQEA 2JLUA 1A7UA 1Z2PX 1TYDE 3TBHA 3T1TA 1WXXA 2LWIA 3E3MA 3ZWCA 4LKRA 2JGJA 4EPWA 1O54A 2ASEA 5BSGA 1X7ZB 5IFKA 4D8TA 1FS5A 2GNAA 5FOXA 3ZWKA 5LOVB 4Q4AA 1UZAA 2XIJA 2J4FA 2QNBA 4Q93A 1K3TA 1PF7E 1T0PA 1YQGA 3JYHA 4LJKA 5AKYA 3L8CA 1TEVA 2VEDA 2IXDA 1IOLA 2BRUA 4LOLA 1QFZA 1R1DA 2CD7A 3NEPX 4DSTA 2HSZA 1MAUA 4Q19A 3OKCA 5LJIA 2BBOA 2VBGA 4DCCA 3GUCA 1NW9B 5JZBA 2IYTA 3M89A 2JLSA 2Q3FA 3HU2A 3N58A 2YFHA 3ICQB 1PE0A 1V4VA 2JI4A 2VAVA 2VQ6A 3SKVA 4GRIA 1ORVA 3VPBA 4YAIA 4IPTA 3HK2A 2Q21A 1BXKA 3E0XA 3LUGA 5JYEA 4ERXA 1K6MA 5KCMA 1OBFO 1WG8A 3OC6A 4GVLA 2EHJA 2ZI9A 3F6CA 4UDXX 1ICIA 1LS6A 1XLUA 3KEOA 1U7TA 3TSOA 4IIGA 1J5EB 5BUCA 2OUKA 3GZTB 3VYSB 5COQA 1G5HA 1LTQA 1GGJA 1YI8A 4HX2A 2QDXA 4G8JA 5EP2A 5KDLA 3W9BA 3UQYS 2BFOA 1R7RA 1YONA 3WNQA 1P4GA 3OE5A 3GRAA 4CTNA 4XZ3A 1RP7A 4R40A 1BE1A 1CRLA 2CVQA 1KOJA 3DMTA 2A84A 1I80A 2BF7A 2VZ8A 4JUIA 4ZC8A 1KKMA 5KJEA 4BNKA 3QUTA 2PGDA 2GN2A 2JFXA 3IEUA 3VH2A 3CLUC 4JXKA 1FUEA 1YK0A 1I3OA 2Z0MA 3PF8A 4NKRA 5K4AA 3FI9A 3ZZNA 3IQHX 4M9XA 1CR6A 1FNNA 4ALIA 3R5SA 1XX6A 2R7NA 3K6JA 5D86A 4NECA 3O1JC 2QRJA 4G5RA 2QZ4A 2BL4A 3UT5A 4WNCA 4JI0B 2KPOA 4M0UA 3PICA 1GL6A 3VU9B 1UJ4A 1I4TD 4L16A 3VKUA 2O8CB 4XWGA 2PX3A 3FPKA 2O2EA 4RTLA 3FETA 4AZVA 2F1IA 4DLVA 1YR6A 1GZ4A 2B35A 4ASUD 2AT1A 5THXA 3AI2A 4I4LA 3I53A 3Q11A 1E4VA 1MGPA 4NICA 2NUAB 3PZRA 4KQWA 2Q7OE 1KETA 5JNSA 2B2CA 2FEAA 4FVTA 5CDFA 2E37A 2OXIA 5LZ8A 1RKQA 1U5AA 4RJIA 2UKDA 1BVUA 2JBAB 3N0RA 4C3UA 1QANA 2IP1A 3WNBA 1GLVA 5IJZA 3IRUA 1T1RA 3GXOA 4LJ6A 3DWIA 1UPUA 3BSYA 3IKJA 3VR6A 1GGVA 2M9MA 3ZNNA 4TMTA 3D02A 1R37A 1L5HB 1JN0A 2EARA 1W5FA 3C7TA 1UBMS 3EVZA 2JGKA 3L8HA 3KALA 4QOJA 1DJPA 4A3SA 3OPYB 3GR6A 4EEXA 3HB5X 1TUGA 2TECE 1D2HA 3V7YA 3G82C 2YXPX 4UE6A 4EG4A 1O3YA 5IXJA 1XU4A 4OL0A 1N2GA 4J7AA 4JQYA 5IDXA 3H6HA 3BT7A 2AYZA 2WRZA 5JZMA 4DZZA 2ISSD 1NT2A 3F8WA 3D9QX 3VNRA 1QH8B 5JC8A 2YIDA 2COUA 4KDRA 1KYYA 3BDAA 1P60A 4KXWA 4B47A 5CXSA 1WY5A 4ZDKA 1CJTC 5A6SA 3RE1A 1W48A 5KYYB 4UULA 1CJVC 4MKRA 2V55B 3TKAA 3VO1A 4DREA 4ER0A 4BMNA 2D8AA 1DMRA 1M74A 1A2QA 1SZDA 2NV0A 2PDAA 3DZCA 3E9QA 5HS6A 1JR3E 5T41A 2V9ZA 1W0KA 2PY6A 4LVNA 4XWKA 2EWWA 5A4MS 2FG6C 1L5FA 4QXMA 1LFDB 2YV5A 5CVCA 3RRMA 3BK1A 1UK8A 3A9TA 1P18A 2ZJBA 3F9RA 3G2OA 4JA2A 1X7WA 2ZJ6A 5EXDA 5FUWA 3FD8A 3R6TA 3M3DA 3UT0A 3O8CA 4LRSB 5HKAA 2YZ7A 3I5YA 3ZKAA 4JP3A 2ECFA 2C9OA 3A1NA 4C5CA 1O97C 3DDHA 5FBHA 3OLXA 3WK7A 3K6RA 4U6SA 4DPLA 8GPBA 2A67A 3KJIA 3J80A 3LOPA 4D46A 4M88A 3KQMA 3SLRA 1V6CA 1YJAA 3BQ9A 3G6WA 3PC7A 5JW6A 4ZO6A 3RNLA 4JGBA 3AH8A 3LHDA 4DN6A 3GLGA 1R4MB 2CCGA 2QAGA 2YJ3A 1T2VA 3OM9A 3SC2B 4OMUA 4Z4QA 3JQ8B 3AVUA 1RHKA 3OZWA 5BUSA 2Q8PA 3HCPA 1C1DA 2J3HA 1L5KA 1JBQA 1GPWB 1VLVA 3N6VA 4TRRA 1QMPA 5JWOA 1QAMA 4GE0A 1PFKA 1L7VC 5FL7D 1XAHA 2CE7A 4ZQFA 3CSSA 1XRLA 1O96A 2BN4A 4CM5A 8OHMA 1C8VB 3C48A 4OQDA 4Y98A 1V3TA 2X7JA 1ULBA 4WNAB 4OAQA 1KJNA 1Y3FE 1J7JA 2CNBA 3UICA 1MP0A 2L69A 3WGYA 4EVSA 5GGYA 3EG9B 1NXWA 2C0QA 2FFBA 4IFBA 1XA4A 3X2FA 3JQFC 4BGVA 3S1LA 4I08A 821PA 2OQVA 3NBFA 5KC8A 5AW3A 1FLAA 4AKHA 3GVXA 5BMVF 3CUYA 5A9TA 4WFIA 4DTCA 2ZRQA 2EV9A 2LKDA 1DKOA 4HMOA 2H18A 3FF4A 1EFRD 5K4GA 2BSQA 3LP5A 4GSKA 3W3ZB 1G9XA 5HCNA 5GONB 1VYUA 1YZLA 1Y63A 1ZN7A 4GI1A 1JR6A 3EQ6A 3DTNA 1P6UA 4GU5A 4QDOA 1KPHA 2P5YA 4LVOA 1P2SA 1SNYA 1GJRA 1Q7EA 2AJDA 1QHXA 3C1AA 3NUGA 3E22A 3DOOA 2UU9B 1E0AA 1J6UA 4FLFA 2C2XA 2MSEB 4WCDA 2R6FA 3NT4A 2JJ1A 3FYUB 5FOWA 1KDVA 2VF7A 3R3HA 4M0LA 2WM2A 4H7HA 4BQPA 4BWGA 1Z2CA 1PQWA 5C1PA 2PMKA 3H9GA 3IBFA 1LPMA 4FFLA 3N87A 3L1HA 2RONA 3QMWA 4NYIQ 1NBMA 2JF0A 4E7PA 2J5BA 2QVLA 3H18A 3H86A 1RCUA 3JZMA 1MC1A 2HMUA 4UNQA 5AICA 4F84A 7ADHA 1UPTA 1RYYA 1T5IA 1GPBA 1NW3A 1P39A 2DPGA 2GJSA 3OPVA 1UXOA 1KEWA 1MKYA 4HY3A 2ZI7A 2LRHA 4JLKA 4LWOA 2PZFA 4PAGA 3TD2A 4AJPA 5C8ZA 3QTLA 3L0SA 2PTHA 1E63A 5KNCA 4MV7A 3NBQA 2RH9B 2QU7A 1DOZA 1XEXA 1E6UA 1PS8A 5JQWA 1GUDA 2VHYA 4MKXA 3RVNA 4J1TC 1L4BA 3QNMA 3C5CA 2NAFA 4Q7JB 2QU8A 5A7GA 4CCWA 2II6A 1PZMA 2L2QA 3O83A 1XP8A 3W04A 1YB4A 1EUCA 4HPWA 4PANA 2BUAA 2EJUA 3QVJA 4YTEA 4MEJA 4Z8YA 3RG8A 1NE2A 5AOBA 2R1TA 5AQEA 4OSEA 5L3QA 3RQIA 2YYYA 4XB1A 4BDSA 1ZJYA 1G6KA 4L22A 1JFLA 2CZQA 1H05A 1WLYA 2TRSB 3R7AA 2CYCA 3AVQA 5AXAA 2QD3A 1SURA 4GC5A 5FI1B 3U6KA 1F6WA 3DR3A 3PJFA 1NF8A 2IIBA 2J46A 5JSFA 4IUYA 5B64A 2C5FA 2X9LA 4QOHA 1G42A 2MMGA 2DFLA 5L6LB 2K2QB 2QAIA 1ESDA 3EBLA 3L9WA 3REOA 2H4WA 3V7UA 1EXWA 1C9YA 5DXFA 1TCAA 1UDAA 3KOMA 2PL3A 4UQLA 4LIPD 1UKEA 1MJ5A 4XE5A 1DDIA 5TV2A 1MB3A 4ZICA 2CV1A 4Y6PA 2PJRA 2PV0A 1R9JA 2OGUA 4P6VF 4U0KA 2J9YB 1M1UA 2VAXA 1UAYA 2GN9A 4UNIA 3GJQA 3ITEA 2WQ6A 1UEJA 1ZMBA 3RHZA 4IXTA 4AECA 4JQCA 2HDHA 4X1KB 3SHTA 3AL3A 4UMFA 3IP9A 1LBTA 3AEYA 4Q1EA 5AO9A 4RXUA 5EE3A 3PGA1 1NR7A 3BB1A 1E9SA 3L7DA 1DX9A 1RXSA 3FWHA 3WWOA 5AUPB 1H2BA 1SOVA 4TSRA 4TT3D 5FUXA 5K0JA 1N2ZA 1P4HA 3HWSA 4M8IA 2EW2A 2XTJA 1QFJA 2G06A 5EUCA 3K0SA 1C7IA 1GYRA 1CX9B 5BSWA 1ZRMA 3O8NA 2UV8A 4HYEA 2Q2WA 4QC2A 1O6CA 1QHEA 1PR9A 5JPIA 1NJ8A 4ZAWA 1E1KA 4I6EA 2C92A 2BE7A 2GH1A 2N46A 1XPJA 4Q4DA 1JU4A 5KDDA 2P8SA 4QPJC 3W05A 4AF6A 3RJ9A 2C3YA 4R1TA 3IV9A 2DWOA 4UPEA 2OGTA 2NP7A 3WJ7A 1LPBB 3L7MA 4C0KA 5K0CA 4Q9KA 5H5JA 3H2YA 5LA6F 2UUBB 1JFRA 3A1CA 1LK0A 1WKBA 3SVTA 2Q07A 1N6KA 4JLBA 4BQEA 1BS2A 4JMPA 4W7IA 5AHOA 3KQKA 3HZZA 4KQ6A 3LLUA 1UBTS 1NFQA 4YS6A 3F7NA 2EIHA 2ZSEA 2FRDC 3ET5A 1FFSA 1Z15A 3OQBA 2IJGX 4ER3A 3BFKA 2O57A 3MHPA 3SX2A 3KPJA 2PZKA 2V1XA 1ATZA 2XODA 3GOHA 3HSYA 3LNCA 1EHYA 3OPXA 1SA0B 3N0XA 5A6SB 3S8YA 3FOZA 3BEDA 3ZLUA 3D4IA 2PSEA 1RT9A 4M6WB 4G8BA 4R6XA 5JLJA 1V7QA 2Q3EA 3ETLA 1RBQA 1RW4A 2FSUA 3AXTA 3EXG2 3FDIA 4GBJA 3WP1B 1I4EB 4NH0A 2ID8A 2ONZA 1X1DA 3HJBA 1MVNA 2FP4B 4ODIA 2O48X 4NMWA 5JPCA 1DV2A 4DYHA 2VTBB 1DBRA 1AK2A 1CVIA 2P2YA 2VXYA 4LXIA 2EX4A 1RRGA 1ZLYA 3BICA 4RAOA 3QHQA 4MVJE 4AZTA 2QX7A 2QLMA 3O84A 2Z5LA 1SVSA 3G3EA 1E0SA 4BV2A 2E5LB 2UUCB 2VR1A 1EK0A 4KQ2A 4EI2A 1QLWA 2C94A 2FZVA 4O2RA 4RD2A 1MT0A 3TB6A 1X15A 2GZ2A 2ZUUA 1TCUA 2ZWOA 2CXRA 4CKBA 4IGFA 5T7BA 3RABA 1SXPA 3D3EA 4N49A 4I4TB 4AKSA 4LDZA 4N65A 4HUJA 2FPKA 2WDZA 2ZRAA 5JCJA 3DVAB 3TOCA 3IPXA 2B3DA 4U02A 1DRUA 1K9VF 1VHLA 2ZPUA 4H15A 1ODKA 4QD3A 1WMDA 1RHRA 3GDOA 4K26A 5BN1A 4CDNA 1VPLA 1V9SA 4CL8A 2GHTA 1L0BA 4X65B 2DBRA 5NULA 2E9SA 3TXXA 4CU5A 2O3QA 5BV7A 3AR3A 3UPDA 3WJAA 2BFBA 4OXQA 721PA 4BFZA 1JBKA 5BY2A 4P7BA 1PCXA 1KHHA 1XAIA 2GX6A 3E1SA 4QEZA 1K63A 4Z0PA 5JH7F 3HCEA 5AM3A 2D0DA 2PGJA 3LVQE 2A0YA 5F73A 3RBAA 1JAHA 2XUKA 4PXYA 1E6LA 3K4QA 1M2NA 5K4HA 5KNDA 3UKJA 1EK5A 4JT2A 3W8RA 2A14A 5DNCA 1ZGJA 2WJPA 3TLMA 3B5IA 1YD7A 1Z73A 2ZGVA 4LYGA 4TX1A 4UAJA 1DKNA 4QUJA 3RT9A 1UJMA 2IDJA 5K01A 1TAUA 1AKTA 4UXJA 4OLJA 5DIFA 4IQ4A 3PJDA 3RU2A 1N0WA 3MWYW 1XIVA 5IZCC 2FOXA 3HNRA 1JZSA 3FJOA 5F76A 3AO0B 3E5HA 3U7EB 4LY6A 2EBHX 1F8GA 3W7AA 4HLQB 2UXBB 4K9OA 5CPBA 5LU9A 3QWHA 4Q16A 4WT7A 1WMEA 1QGUA 4HN2A 2HIGA 1UWCA 3GVHA 3RRFA 4N82A 1JXOA 2AC2A 1CUGA 1NI5A 1TI7A 4PFSA 2DCMA 3VSCA 3R0VA 3ZXSA 1FPMA 1T2EA 3O9ZA 3ANXA 2EZ9A 2DFNA 1U2QA 4XDYA 4QLBA 1I7PA 1DXQA 2FN7A 3LUKA 4GECA 5A62A 1P8AA 3UWSA 5IMSA 2OQIA 5JS6A 1NN3A 3CTMA 4WESA 4KO1S 4TRNA 5EUBA 2BJVA 1WXWA 2MSCB 4M1OA 4FDTA 3TZLA 3EG5A 4WBNB 5EJ6A 3KE9A 4XFJA 1XTQA 5C0OE 1LC0A 1NFRA 1BXRA 1R8JA 2ZANA 4XUDA 4AF7A 1WBBA 1HSZA 3G1WA 4M9QA 3OUZA 3T61A 2FVXA 3Q8XB 2B8JA 4NCNA 4A8HA 3MERA 4KHPB 4KE6A 4ZV9A 1VBFA 2AK2A 1YHZA 5AVZA 5IYZA 3PEEA 2YBDA 3COYA 2UZAA 3G8AA 3HCRA 3RODA 1Y5RA 4QPCA 5KTPA 3VOTA 2OCGA 4O4LF 5HEKA 1XEXB 1EVZA 1XMVA 3T5MA 4PSDA 2RHOA 2CSXA 4DE5A 5FOVA 5BNZA 2Q4EA 1M34A 3OFVA 1Z0UA 1EVKA 3KHSA 1DEKA 1S8NA 1V5IA 4COOA 2GXAA 1XQWA 4F3YA 3BKXA 3MRXA 4NRDA 5KWJA 3LD9A 1WDLA 2JAOA 1EFPA 1ZUWA 1EUCB 2PX4A 2VZ9A 2FMKA 2R1TB 3ELDA 4C7VA 3IUJA 4FOPA 1NXOA 3E6AA 1DZ3A 3MAGA 4EL5A 2CUKA 1M8JA 2NXWA 1VB3A 3BHJA 4CN9A 3FJYA 3L82B 2QRMA 2D2FA 1ATIA 3K9LA 1VSBA 2LPMA 4IXDA 2M6LA 1RWBA 1V1MA 4C5AA 4PFKA 1AGNA 2VF4X 1W2WB 2VLIA 4XYMA 1SVIA 1PP4A 2D74A 1PLJA 4FNOA 4QTTB 1E1QA 1ZCFA 1ADCA 1PJ8A 2QN1A 1A3CA 5AUNB 4K1LA 3IULA 4WOCA 1Y4ZA 1HLDA 3QENA 3HJCA 3H97A 4RMHA 5ALKA 4DJEC 4QYXA 2BFCA 1RP1A 4EGAA 2PUWA 5KPJA 2Q50A 1RJGA 5DHQA 4C0XA 1RJEA 3NHJA 1HDRA 1X13A 3TD9A 1JKMA 1XZNA 3HNOA 1NN1A 3ADBA 2J8ZA 3B1JA 5KX5B 1SO8A 1J2YA 4AG5A 5CFMA 3MJEA 1GPYA 5CFOA 1BH2A 4X93A 5A3SA 2F9MA 1JI0A 3TTTA 1EB8A 1KH1A 1OYOA 3FZQA 2GLTA 2IHTA 1G0NA 1XZBA 2Z8XA 2X7XA 1DQZA 1E1DA 2W58A 3H5RA 1I9GA 2J6HA 4IFTA 4QBFA 4Y7CA 3ZE7A 1RWXA 6REQA 1OXXK 1JHQA 2CUNA 4FNGA 3ZE0B 3SHFA 2MSDB 1N6LA 3RU3A 1Y6FA 3GPLA 3STTA 1P4RA 5COBA 1B0ZA 2GPNA 4XJSA 2FA9A 8MHTA 1TIPA 1QRDA 2VKQA 5DLPA 5EVJA 4BEWA 2GZRA 1NI3A 4IDNA 1XKLA 2WC1A 1NQAO 1Q1NA 5KCZA 2DR3A 4MQUA 1LSUA 1SHZA 2N1MA 3BH6A 3HMKA 5CYOA 1LTHR 1AN9A 1WCV1 3T5DA 1O95C 3D0OA 4HB3A 1JKJA 3T3PB 4UTRA 3OEHA 3EJWA 5TE9A 2BBTA 2H08A 3B53X 4MPDA 4UTPA 1EA5A 4MLZA 4AZ0B 1PTJA 3MTBA 2D1TA 3ESCA 5C52B 4PZLA 1FZTA 2J6BA 2BEUB 4EA9A 1XRSB 4FHFA 1M2EA 1ZMRA 5EEGA 2CDNA 1E0DA 3ESAA 1UC4B 1VE1A 1YXMA 2CDAA 5AP9A 3L6OO 1F48A 1YR9A 3IVCA 2FN3A 2D1SA 1C9MA 1PNRA 1WCIB 1GCUA 1HETA 1P80A 3GFSA 3F6EX 5JHGB 4Y2GA 3ACBA 5KNBD 1NC1A 1T24A 2VHTA 4FZ3A 1W5AA 4QOEA 4G5OA 5CU7A 5SV2A 3OQIA 4P5PA 5BSKA 2IF0A 1WSWA 2ZAIA 2ZQ5A 3HGQA 4YLGA 1JSRA 4J76A 4HFJA 1GTRA 5CG2A 4ZYTA 3MZ0A 2NZJA 2GHRA 1F2UB 2E4YA 4IOJA 4CM9D 5JQGF 1QYWA 4AMUA 3AUXA 1DAEA 4ZO7A 3VQTA 4DS3A 4DSNA 5JSZA 4MS4B 3CN7A 2I9PA 3HNPA 5I3CA 3O75A 5EQFA 4ID3A 1NXPA 2VJYA 2JLQA 4JC5A 3NW9A 4DDMA 4DL9A 1JG7A 4DNXA 1LI5A 4LZNA 1BXGA 4A8TA 3BILA 4XIIA 1LDBA 1QZ3A 2H7YA 4G23A 3KKZA 4E0BA 3B6JA 1T9ZA 1U1GA 2WLSA 1DEXA 4HTFA 3MCTA 2ZS8A 2N0SA 3D7SA 3KDSE 4DMMA 4COKA 3UAXA 1EQ2A 3TL2A 1A5TA 2FI1A 1T3LA 6CHYA 1V9CA 3B1YA 3KUKA 1VB5A 5AVJA 2Y27A 4GE3A 1KEPA 2H8GA 3VGJA 2WJVA 2V65A 3KKKA 1H42A 2XUPA 4IL5A 2QM3A 5EZ5A 2X77A 1AKUA 4DQKA 3C7KA 3HSKA 1BAPA 2NSYA 3NIFB 1QCDA 1UWLA 3AZOA 4Y2XA 3FYDA 2CK3A 2XE6A 2GB4A 3L01A 1WB5A 4XVUA 3BMQB 3WYBA 1XAGA 1WOMA 5E38A 1OAOC 1YTLA 1Z36A 1ZMOA 2GA9A 3AI7A 3C24A 3I1FA 3PK0A 4IWNA 4L5BA 4RAQA 2DPXA 3TZHA 3S7ZA 4F85A 2QR3A 5B57C 1Y5IA 1M76A 2YYAA 1B42A 3SBOA 3S2SA 3IOEA 1EFDN 2VPTA 4F5ZA 1STOA 5JXJA 3CHYA 4X41A 5B7GA 4BNYA 5BR8B 2E4ZA 3FR8A 3P32A 5CBKA 2PLRA 3AR9A 3NTOA 1VIDA 3C4VA 4P86A 5ALTA 3DL7A 4A0HA 3IKTA 3OJXA 1RYZA 4FFPA 4W5HA 3ROGA 3TOSA 2QWXA 2D00A 3A6KA 1ZJ6A 1XNJA 3CMCO 4MJ7A 5JSYA 3O4JA 2X2FA 1UMDA 5K2OA 1G60A 1TJ3A 1VKNA 3AF4A 1T9AA 2JA1A 2O8VA 2V4ZA 2XBLA 3NOVA 4A1FA 2CZCA 3PXBA 2WKRA 2XUJA 2GASA 3TNJA 1QGUB 2IEZA 4BFVA 1QRRA 4EH1A 4L3VA 5IX8A 1I2BA 2WU4A 2BGMA 4M0FA 2ZYAA 4E94A 5J4KA 1G5PA 5LP1A 1MH9A 4M0EA 3ED5A 6ABPA 1RIFA 2HMYB 4FD2A 4KV9A 4TV8F 1TVEA 1D0IA 2CNWD 2OOKA 3OH8A 1NP7A 4EHKA 1NQUA 3OBBA 1WDTA 2QP9X 2ZJ2A 4NPCA 2OK8A 4AG3A 4H7JA 1CQJA 2ZVDA 1XR3A 2XDQA 3G89A 4H60A 1VPTA 3PBKA 5EQJB 1RJ9A 3VXKA 4BN4A 3R3UA 3Q8LA 1KJ8A 1L8OA 2QZZA 4MCJA 1WVGA 2X6RA 4X64B 1KAOA 2JGRA 1TYEB 2ZYUX 2D7DA 4B3IA 1BZYA 1SH7A 1US8B 1UXHA 2G76A 2O2SA 2FPSA 2DX7A 4YCAA 1CEYA 1Q7TA 4FCWA 1L7QA 4A6XA 1AO3A 4ONEA 1PW5A 5LL6P 1PLLA 2AW5A 2PX6A 3R3WA 1FW6A 2C99A 2Q0QA 1M1YA 4ZU6X 4QXPA 2AMVA 3RFXA 4CHTA 2GEKA 4ZDIA 3ZJ5A 2AFVA 1NJ6A 1Y3AA 1S9HA 1WXQA 2X9VA 4P92A 1G17A 4QO7A 2AEMA 4XFDA 3HA2A 4LDAA 5AOAA 1PFWA 3E61A 3GEIA 1ZM9A 5CD1A 4RY9A 2A94A 4P4UA 1ZVMA 3CVJA 1QDEA 3R7BA 2Q5EA 2YMMA 4K9KA 1QVRA 1PG5A 5HZHA 3OE4A 1ZR2A 1Z7BA 4G1EB 1KJQA 1LRJA 3FRIA 2FCAA 3K2EA 5B4UA 3KQUA 1QLJA 3NAGA 2C42A 2ECOA 1R0CA 1I8TA 4O2AA 4NZNA 1XGKA 2ALJA 5FNVF 2SCUA 2E1RA 3RKUA 3RTAA 4J4HA 1V39A 1EPUA 5J3JA 2OBFA 4EMTA 5LCXA 1MTZA 3JD3A 3WQQA 2O5VA 2G9NA 3UUGA 3U1TA 2JVJA 1C1HA 3GUVA 5J23A 2DFDA 2FPMA 4ZCPA 2XWJI 5A4IS 1EP9A 3EVNA 1YSCA 5FHRA 2CLDX 2FN8A 2R5NA 3VGPA 4CQJA 1GTZA 3BZWA 4ID9A 4FD3A 4JBWA 3U49A 5JFGA 5E3HA 1Q44A 2BFCB 1HE1C 3CEAA 3ML1A 3RARA 4D8UA 2ZQYA 4C4SA 5BRNA 4MUIA 1QIJA 1VL1A 4QVGA 4AJIA 3IQGX 4IF4A 4K03A 1MXFA 4KGZA 1RZ3A 4I1IA 4UU0A 3JYLA 3VC3A 5AQ1A 5IHPA 1O0BA 2PQ2A 3SQMA 2WOOA 2LW7A 1XNRB 5BPFA 1KORA 1CZRA 1MC5A 2BAGA 1YACA 3AUFA 3VU1A 4OLBA 1KRXA 1N6PA 1J24A 3CRZA 4JK3A 1IY2A 2O2ZA 3JWJA 3HE3A 3GT7A 4Y2QA 6REQB 1E3IA 3ASYA 3A58B 2BR3A 4DV3B 3BMNA 1I2DA 4UVGA 3LOUA 5EZYF 4LQCA 4RDCA 2FPGA 3TQQA 2DY1A 4FYWA 1KEEA 2DR0A 3TBFA 2H1RA 3DPUA 2FRXA 1M0SA 2AEFA 1E4YA 3SXPA 2A9OA 4ZOLB 3SZ3A 3MNFA 1D09A 3H5WA 4HS9A 1EXMA 4AWXA 3UVEA 4MW7A 4ND5A 1JKJB 3MUFA 4C78A 4GL4A 2YVAA 1BX1A 2DR2A 3R2JA 5D3KA 1SOUA 2ATIA 1U7XA 1ZGZA 4YALA 2J3EA 4JYCA 2WJYA 3CZ4A 3I8XA 1BS9A 2QR2A 3QJ5A 4L4YA 1VI5A 3TDKA 4KR6A 4OREX 4F1KA 5FA6A 3CFYA 3LM8A 4PF1A 1M8GA 4N3AA 1QRTA 5BP7A 4LAFA 1D5CA 5CT9A 2YOHA 4OHXA 1GNLA 3H2IA 3HCCA 3TW8A 1QX4A 3ZNQA 1JMVA 3BJZA 4GR5A 4EB6A 2QMEA 2HJGA 1S2NA 5ALVA 3P0JA 5BNIA 2OXEA 2W42A 1YZUA 2I4LA 4NQZA 5LQDA 1U7HA 3DHEA 1PNOA 3MJVA 1IEXA 3DHVA 4WE3A 2P9EA 3W5AA 1NU8A 1VG8A 1NP3A 2G04A 4Z4CA 4WECA 4M38A 4OAOA 2PR2A 2IODA 4BZWA 5JNWA 1OC4A 4IIYA 1IIBA 3GDHA 1QK3A 1ZEJA 1I4LD 2CLSA 3HB0A 4GP7A 3H2SA 4ZHQF 5JNTA 1WHSA 4JKIA 5JSZB 3DZJA 3CZ9A 3K9CA 1UCFA 3PWTA 5C1BA 4Y1FA 2A8YA 3DB1A 2ZITA 4WY8A 1J0BA 3E9EA 3UOWA 1G9TA 1PS0A 3QVLA 3OTOB 5H16A 1G41A 1FDWA 3OIVA 5HCIA 1G4UR 4AJKA 3B6MA 3DL0A 3LQ2A 2QN6A 3DLCA 3VKGA 3G0HA 1PN3A 5KYKA 3U7FB 3HXLA 2P2CA 5KB3A 1ZYUA 4D6XA 4WKCA 1S1CA 1A9QA 1ZINA 4HWKA 3WBJA 1LJLA 1UT5A 4NEGA 3PL5A 4QUKA 1EUQA 1Z2DA 1H9CA 1TQ8A 1JAZA 1N5DA 2QD5A 1DBWA 3CNQS 3NWJA 7YASA 2VK2A 2ZT6A 4HJRA 4LVCA 4MR7A 1L3BA 1KNXA 3DLBA 3LBIA 2C3OA 1NJSA 2PRSA 1FXUA 4MYSA 2WILA 4DNPA 3OCZA 4J91A 4L9AA 4EAQA 2DPYA 1VL5A 2KJQA 4NMHA 3UGTA 1F3LA 3F49S 1U0EA 3GG9A 1F38A 3KQQA 3LUFA 4KX5A 3TEJA 1HA3A 2Q6LA 3D59A 4WL0A 2AZMA 4G37A 4B33A 4P22A 2OP1A 3KB2A 3GAAA 1XN4A 2J6IA 4EJ0A 2CDRA 4CKEA 5BSUA 1MNAA 4GGOA 3ONNA 1OYVA 1WZ2A 5GM1A 4UNSA 1SWWA 1SXJD 1TVCA 5JCJD 2VUSA 1TU3A 1C4KA 1P61B 1ZIOA 2I6GA 1NM5A 5ALXA 5BW4A 3NORA 3GBSA 4R84A 3W2GA 3FGNA 1ANKA 2C8JA 3L4BC 3PUYA 1M8FA 4PS0A 4PYQA 5DX1A 4YJKA 1P7PA 4LI3X 1UMDB 3WQSB 1WP4A 2QM8A 1ENYA 5DF1A 2J0SA 3GY0A 4TXNA 1Q2UA 2BWJA 2C03A 7MDHA 1TZCA 4IHJF 3RUFA 1NSTA 5C81A 5KSWB 1BX3A 1E3SA 3B3GA 4ZEMA 1WB4A 1G6OA 4F5EA 3O8LA 5F3RA 4CDGA 2PANA 3THXA 5CVEA 2CUZA 1Y8RA 3REFA 4F96A 1PFQA 1NW5A 2ZWPA 4BQIA 4TXHA 1I2CA 1CQJB 4RL6A 2QL6A 1GG9A 3CB4A 3OZVA 1NMXA 2B61A 2Q3JA 4R69A 4UM5A 2P7IA 3K1JA 5CNIA 5TF4A 3U44A 1J9ZA 4BUJA 3BKWA 2AK3A 1D2NA 2NTVA 2VK4A 4AY6A 1M7HA 4DY4A 5FEMA 4TWRA 1NYTA 2A9KA 2JZOA 4G07A 2NZYA 3U0VA 1I32A 2FFHA 3R24A 2I71A 3GLTA 3MTAA 3UJ3X 3ZE6A 4IKEA 3VH1A 4DLKA 3RQSA 1AM4D 2B9VA 1T6NA 2JEYA 1JILA 2EJCA 2A5FA 1BCSA 1C9EA 1T5HX 1XZPA 3UAZA 4KREA 3DZKA 2ODAA 1R66A 3AEQA 1E61A 1E9VA 3DKPA 2GZ3A 4LOKA 4TTAA 2G1JA 5DBGA 3PQ7A 3ORSA 3SFVA 4FYIA 3DBIA 5A5VA 2P62A 3HRIA 3MFYA 1VKZA 3LLMA 3OLCX 3GX1A 3I8SA 2FKNA 4WXHA 4WJKB 1JHYA 3F46A 4X9XA 3M9WA 3OJOA 3WJ1A 1D1QA 2P91A 1UMBA 2E55A 3JU3A 4QGHA 1GQQA 5CHEA 5F1KA 2HA4A 2ZB4A 2C83A 1TCVA 4KO8A 3J7AC 2VH5R 2ID9A 1JLHA 4BJ6A 3GEHA 1ADBA 2D4AA 1ZESA 4MWOA 3OCWA 4IYRA 4O2AB 3KTDA 3R5JA 5ELMA 2OMEA 3VHLB 1V4BA 4QTZA 2NU7A 5BR4A 2ROQA 3ASUA 4JBLA 4JSRA 1D6MA 2FSVC 4FXOA 3FMFA 2Q9BA 3HL0A 2GN4A 2VP6A 4LGMA 4U9HS 5FTNA 2OCYC 4D9EA 1O4VA 2WSYB 1CY8A 1EINA 1T1EA 4UZSA 2PIDA 4MRRA 5ALQA 3TJMA 4LY3A 2UYQA 5BPHA 3TZBA 2FZEA 2R6GA 3PYXA 5DN6A 5IMBA 5JMPA 4B4WA 3AM1A 1FC0A 2WT9A 1Z82A 1ZGAA 4FI3F 1Y9ZA 1HTTA 4H7FA 9LDTA 1OBOA 4N8DA 3T9DA 5DM1A 5SZJA 5IEJA 3M9LA 2OR3A 4IUDS 2P77A 3T5PA 2R8OA 2RGGA 4RTPA 3L93A 3OY2A 7MHTA 1BDHA 1R2QA 1GTVA 4AX8A 1NUHA 1LEHA 3UHOA 4MVJF 2XI4A 1YR8A 2K4MA 4QQKA 3NPAA 4PG7A 1IB6A 1PX0A 4LHWA 3WZLA 2YS6A 2PNFA 5JZSA 4BV9A 3MFQA 3L3BA 2Q45A 4GKVA 1QF6A 1XROA 1GITA 3RRYA 1FFXA 1PT9A 2FPGB 1KEEB 1U9CA 2AFIA 1Q1BA 2I22A 2VLBA 2W6CX 4MRMB 4ANFA 1NLMA 4BNZA 5KTKA 1KWGA 3VSAA 4W1RA 3HRHA 1XN1A 4ZTUB 3I58A 4MHTA 2ZE7A 2RAFA 2ZJ1A 4XJXA 4Z4GA 2CLIB 3I76A 4G67A 2FHPA 2V5VA 3MMPA 2ZUTA 3WLRA 2EEPA 5HQTA 4JU9A 5HJ5A 4ZCSA 1P7YA 3JSXA 1OGIA 1P17A 2UZ4A 3AZQA 3N7TA 2JLZA 3G9ZA 1UEXC 2AA3A 2B4AA 4CF6A 1GCOA 3EA5A 3FDZA 1Z7YA 1O9BA 3MTIA 4YB8A 1ZL0A 2Z2ZA 1R64A 3HBJA 5E1DA 1KS9A 3RBZA 1OJ7A 4OJYA 4WX2B 2VYQA 2WUGA 4UUMA 3IP1A 3JATA 3KEGA 3T7DA 3BCRA 1XJQA 5CM9C 1GVNB 4LZZA 1BYIA 5CX1A 5A71A 3WYDA 4PQGA 4A91A 2VCHA 1TM7E 2HWKA 4EFKA 2R25B 3IYLW 1JPUA 3RF7A 4EPTA 1S6YA 1Q74A 4DR1B 4AYWA 4TZ0A 3PEUA 4F4IA 3ZCXA 4BLVA 1WW2A 3U7HB 1WPQA 5HFJA 5IRCD 3PNYA 3CF4A 4FJ1A 4XWWA 3AFMA 5REQB 5T4EA 1XZKA 3DV9A 5ULLA 2XEDA 3R6WA 4KGXA 3HZRA 3EXEA 4CMEA 1PSZA 1HNZB 4IX9A 4M1EA 4UVHA 1GUZA 4BZQA 4LGVA 1LNQA 3EGXB 3EY4A 3EEIA 1WNFA 4GH5A 1V43A 3DNPA 2HCTA 1WHSB 1J1UA 2AOUA 4ZOBA 5FX2A 4DRYA 3CF0A 3LQ4A 3A9RA 3OMLA 2A0KA 3GPBA 3VJLA 1OLOA 1W5BA 4HI0E 3X44A 1EVEA 1GUYA 2H06A 2QMHA 2XWQA 4N3CA 5DNAA 3WFJA 3AVWA 4J29A 2WZBA 1LX6A 5AHRA 3V1YA 2P9TA 3C70A 3OOWA 1OV6A 2O3TA 2IP4A 4AO6A 4Q7LA 2NTEA 1OIWA 3LBNA 1YKGA 4MRVA 3V1UA 3ZXUB 1RPAA 1CW2B 1YASA 3EXIA 2WF7A 4MPRA 5K05A 2L17A 3DR5A 3URKA 3AYXB 1JQ5A 4YJHB 5E1OA 2PUCA 5B3KA 4K7JA 4GUDA 3GRCA 3MJTA 1ABFA 4BO9A 2PLNA 4X5OA 2FWMX 4BLPA 3MEQA 1M2VB 4HQOA 3KU1A 2GWHA 3AKCA 2ZAGA 2AQIA 3AB8A 3QA9A 5ICFA 4EG8A 2P78A 1JFTA 1N6RA 4BNHA 3H4TA 2KX7A 3HPQA 1KMCA 1QCCA 3P2KA 3UH1A 4GIBA 4XPZA 1B2LA 1V26A 2CHUA 2ILTA 4H7KA 4B46A 3G0BA 4TV9F 1EGVB 1BEUB 5EHZA 1IXRC 2E7ZA 3E9YA 3LS2A 3FOWA 3RVSA 2QE6A 2NQTA 1V71A 3F6RA 3I9JA 1G2OA 1Y7PA 1ODFA 3WLQA 1TUBA 4U2DA 7REQA 1PRYA 3PHCA 2V03A 3BD6A 4OTZA 2WIKA 3SZGA 4CKEB 2CHFA 3SM3A 5E95A 1KP9A 3IPCA 2DF8A 4WAUA 5B3JA 6PFKA 4P36A 3RC2A 3C3PA 5DGTA 3D5QA 4AJ9A 1H2WA 1RM4A 1LDGA 2M32A 4PONA 2CL7X 4LRYA 4N48A 2QE7D 4LZAA 2QW8A 3FDJA 2PUTA 1FF9A 1GNRA 4PO8A 3EVGA 1YMQA 1E3TA 3X1JA 2C2KA 3DTVB 1XMXA 2QI9C 3BCHA 5BOVA 3EC1A 3RCBA 1NMYA 1ZPDA 5B55A 1JVNA 3E70C 1EUYA 4QU5A 4AC9A 2XF2A 3KQTA 2C2WA 1YOBA 4GZ6A 3PHHA 1JG1A 1DAPA 3PI6A 2VUUA 5FTWA 4EA8A 1Y8RB 2OOSA 2Q0XA 3QYAA 1I13A 1V4NA 4W1SA 3NV9A 4W8OA 3EW9A 2ILVA 2JJMA 2WFMA 2L42A 1Q0HA 1WCWA 3HV2A 1P91A 3LI2A 4QWMA 3U44B 1LRKA 4FONA 2I65A 2Q2QA 4N18A 1H4QA 5G02A 1IMJA 1EMDA 1VCHA 2BISA 3M1LA 1YK1A 2PKXA 3WAJA 3OLWA 1IRIA 3WGUA 1S2MA 1VGVA 1D9ZA 1COWD 5CFZA 3RAJA 4ZWNA 1SFRA 3HG7A 3IQEA 1X1BA 4MX8A 4A03A 2ZSDA 4ESOA 3PD0A 1UINA 2GGSA 5FBWB 1LY1A 1GLNA 3AEQB 3QBDA 5CIYA 3IKMB 3KQSA 4X8MA 2OB1A 5CM8B 2RE8A 1I3NA 3HDGA 1BHQ1 1ZHFA 5FI0B 3R40A 4X8HA 5TS3A 1HC7A 4GKAA 3EOAI 4KQ1A 1P9LA 3LWNA 3I9OA 5KQRA 3U3RA 2RHDA 3DZHA 1U0RA 5B30A 1RLJA 2EJWA 3IAS6 4JT8A 3T3IA 4YMGA 2M2IA 4KJZA 1UMBB 4EY3A 5IVHA 4I19A 4EA7A 2NO6A 2O54A 1P0MA 2NLOA 3TNYA 4TSFD 4Y7DA 3PX7A 4MWBA 1PL0A 3EQ9A 5KSOA 3V8BA 4MYRA 1UOOA 3I9V1 4GGPA 2ZE6A 2RKBA 3QU2A 2Q1YA 4G0UA 7ABPA 1MJNA 2VTVA 3KKOA 1INLA 3EOZA 1C3XA 2IYAA 4P31A 4AXXA 5AT1A 3DZBA 5B58T 1HM5A 1TVMA 3N2KA 4BV8A 4ICIA 2PT6A 4Q4LA 3QLUC 5CFNA 1UOQA 3OHSX 1Z56C 4A2WA 3UGKA 1VGQA 4FMCF 3PEFA 1I3MA 3U09A 2WT8A 4BY9E 2NZ2A 2ZSAA 3IIJA 3F0TA 1QQ6A 3Q1LA 4ITRC 4YGXB 4YDQA 2ZEJA 4RFSA 1CP2A 3ZCUA 3MWDB 1DAKA 1JLRA 3LDFA 4RK7A 3SEFA 2QZSA 3UYKA 3O94A 3VNSA 3WWZA 4BIMA 1NKTA 2YWDA 4OKIA 5EN4A 3GP8A 2I3DA 4L4XA 2VQDA 1EE2A 1EGHA 3CE9A 1UJ5A 3CNOA 2Q3HA 3FX2A 2GF9A 4OAPA 2FQWA 3P9YA 4BRUA 3ZXXA 3FVVA 3DLPX 1PK9A 4G0NA 5AKGA 1UJ6A 4RF5A 1K97A 4PYMA 4C1BA 2YY6A 1YDHA 1FFXB 5EE1A 1I1NA 1PFUA 2AFIB 4JR0A 4NK5A 3VV3A 1KEVA 2WF6A 3NBZC 5F9HA 4UQOA 4EJMA 4C3OB 1GSIA 1RPTA 4CEJA 2HWXA 4ZZIA 1U2TA 3DFMA 1JDNA 3MRTA 3NYQA 3U1VA 1ZD1A 1CQXA 5C18A 3SQWA 5COAA 2PWPA 1MC4A 4ARZB 1LLQA 3C3WA 3P71T 3T9BA 3QX9A 2PWBA 2XRYA 4CVNA 3UEOA 4WLOA 1W4RA 1M6HA 3FKJA 4XWOA 4ZTZB 4REQA 5DGDA 4RIHA 4B4UA 1I5EA 1YKSA 3FMGA 4G5YA 1DP4A 4Y9DA 4WKOA 4BNNA 4N3NA 3C3MA 4E14A 4CV0A 3OPQA 2PLWA 3EEBA 1I3LA 3R5TA 2PKWA 3B12A 3LA8A 2FPXA 4Q1BA 3I4CA 3ZEIA 4IWXA 5BYAA 3HZOA 4N0PA 3AUKA 4ND7A 3KRTA 5LU8A 4RQTA 5JANA 5JAOA 2AKAB 4UOEA 3UMBA 1P2GA 1FYFA 1AHHA 1XF9A 3KQHA 1GHTA 2PXCA 3D2CA 4M8KA 1ZW6A 5FYQA 5SY9A 1U5CA 4ACBA 1SHUX 1N34B 4YJDA 5M3BA 5G40A 2JC3A 1U98A 4FE3A 2IUEA 2V8BA 3GGPA 1RQLA 3AR7A 2ZIXB 5HX7A 1NVVQ 5J4YA 4HZUB 1MC8A 2YZNA 2QTAA 3NANA 4CFYA 4DG9A 1WY7A 2AOUB 3SLKA 2OLEA 2MOKA 1YU6A 3OZXA 2FPUA 1H2XA 3DDNA 2CMHA 3R3XA 5ALFA 3NKLA 1ZWLA 2Q7XA 3P0RA 2COKA 4MYDA 3P27A 2BUCA 2J9XB 1OLXA 4BLOA 4U6QA 3S1AB 4ZVMA 1QG0A 4W9MC 1RKUA 1N25A 4DUGA 2PSHA 3SC6A 1P2DA 5C1DA 2C97A 5EMNA 2Q5LA 3RT1A 2VJQA 1NY5A 4KBGA 2HUPA 3G2JA 3DAHA 4FGKA 3R76A 4I1OA 4OK6A 1Z16A 4MAFA 2X0EA 4FINA 2PSSA 3UK2A 1JNYA 1H6AA 1M67A 1SIOA 3MMSA 3R1IA 5CT5A 5CDFE 1PHPA 3P9IA 4TYWA 2CMGA 4AM8A 4RPLA 4UXHA 3FPAA 3L7NA 3C3BA 1M5TA 1GRNA 4K9LA 4I9GA 3NRCA 3D2LA 3EULA 3RSZA 1O77A 1IXZA 4LDNA 4DIDA 3O8OA 3TN7A 5GOZA 3GFBA 5CURA 4DW8A 2BY4A 2VQ3A 2IYPA 3CLSD 3ZKWB 4BVGA 3AB7A 1GU7A 4JEUA 4W9NA 3FHTA 3L8MA 4XI9A 1CS0B 2FZCA 3QGMA 4PBRA 2RHRA 3IEMA 3O4RA 4IDOA 1UFOA 2GBFA 4YASA 1ISRA 3K4HA 2OV6A 4YUYA 5HOEA 4LOIA 1YAHA 2RCYA 5IASA 1Z13A 4ZVQA 1CD5A 3IUQA 2Y1WA 4FHZA 1P2BA 2VJPA 5C5IA 2O8BB 7REQB 2VBFA 3VDXA 5GJWC 1ZBQA 1BOOA 2HN9A 2R8YA 3KXDA 4N6OA 4FB5A 2BHRA 4WXPA 5TMPA 3RVKA 1T8UA 2JDID 4RV4A 1JSXA 2XF8A 2OZKA 5L53A 3VI3B 4ZQCB 3JQQA 1PZHA 2ORVA 2Y71A 3AY0A 5CNJA 3I5XA 1FNMA 2CXUA 2GCNA 3PIDA 3EIXA 1MOSA 1VL2A 1XKQA 1WPRA 2ZJYA 3RBXA 1S3SA 2PEZA 3RYCA 3T5AA 1M6VA 1JA9A 4F7DA 4JZKA 1KFEB 4F9EA 1ZD8A 3PKJA 1JIKA 1C0IA 3DF9A 3K6SA 2HO4A 4S1VA 3T3DA 4OHZA 3JQAB 1DAFA 4RKFA 1MVOA 2V98A 3L05A 1UOPA 2CW5A 4KVZA 2XUGA 4K2HA 2PQ6A 3ROEA 1CUFA 3CUKA 3VHQA 1SRRA 5CA1B 3KOUA 2WFLA 1YKFA 1GWNA 3NQ41 1SHKA 5CG1A 1Y7LA 3VAZA 2YRWA 4BO5A 4B6RA 4BFUA 4X54A 4HLUC 4J4BA 3A4MA 2D59A 2B9EA 4M1ZA 3RS2A 2YZGA 3SQLA 1F14A 2AOXA 4FGUA 1EFVB 3GLGE 2CLFB 3ZHRA 1SQ6A 3RUCA 2X0FA 4RY8A 3C1TA 5AM2A 3NOXA 3HM2A 4IIXA 4ZJZA 5G0TA 1TRKA 5AKEA 3ABRB 4J0JA 2ZSKA 3A6ZA 3IHWA 4Z9YA 3PITA 5I3ZA 4JQZA 4L4RA 3MSCA 3P19A 2XW6A 4RY2A 4G4JA 2AXEA 3SYMA 3A1EA 3H75A 3L40A 4OI4A 2OM2A 3WRYC 4C4TA 2XCLA 4B7UA 4KFSA 4CM8B 4KK3A 4MTCA 4YXFA 1EWYA 3BGIA 3F5SA 3TLBA 2PYZA 3KUCA 3GNLA 2PX5A 4YA6A 1JEAA 3O3OB 5EWLA 4ZXFA 2AFHA 5LD2C 4DCNA 1R6XA 3S2UA 2DTDA 3VPSA 1CEEA 4D9MA 4D9GA 1ZJ4A 2FZ4A 3WGLA 1IHYA 2ZZMA 2G8LA 1IM2A 1QHGA 1PJSA 3Q98A 4BMDA 1UZNA 1U9IC 1IONA 1YE8A 3LO8A 4MYCA 2QJWA 3D7MA 3HR4A 3AKYA 5BORA 2E3JA 1T9BA 4Q24A 2QEQA 2X1HA 3RYHA 2V7QA 5FBQB 3EZFA 4K9NA 1UPFA 5ICGA 4WMLA 3M6LA 2J5QA 4JB0A 5BQFA 4M1KA 5FKJA 2FG5A 5HQ3A 2QX9A 1C4WA 1H8HA 1ID8A 1OTXA 4Q9NA 3UBMA 5CVDA 1MO4A 3JWIA 4G65A 4MVJI 2ZYIA 4ETIA 3WB2A 3H11B 3UC9A 1M0TA 1C3OA 1H0KA 1Q7CA 2JRCA 2NSHA 4ESEA 3Q9UA 4TXMA 2DWCA 5FO1A 4QDJA 1X7XB 5F1OA 3WMGA 1VM6A 3ETGA 2QVBA 3R3VA 1GTSA 2JFYA 4U6NA 4ZU3A 1SHJA 2ZCJA 1XNQB 2B8NA 1I4OA 1N6IA 2R1VA 4XUCA 2ORED 5AM4A 4BC1A 2JRLA 1XU9A 1OKKD 2YOGA 4XLTA 4CL2A 3E3LA 3GZ4A 5HM6A 2CYBA 3L4JA 1GQOA 1KVUA 1RLIA 1R6UA 1NBME 1NL3A 2G70A 2CUTA 5ED0A 4I9NA 2BHSA 3BDVA 4MXDA 4GOLD 3BF8A 3HLKA 2FDRA 1K4KA 3DVRX 3D6VA 4CM4B 1D2EA 2W93A 3WGQA 5C7YA 2I4TA 1M2GA 4RVDA 4F9TA 5LD2B 2IH5A 4OHUA 4R5HA 2UYGA 1TM4E 3IAEA 2X19A 1KDZA 3KETA 3WHKA 3IUBA 1YRWA 3WZMA 3F4BA 2J5KA 4QPDA 2RC5A 3QWFA 2RHCA 2IRWA 1SZPA 3LLCA 2WYWA 2P0YA 4H2DA 1TF2A 4KPUA 5CUQA 1P31A 4Y1RA 3HA5A 5HGXA 3KAQA 1ZGHA 2SKEA 2F43A 3EASA 4Q3EA 2WU1A 2HMWA 3B2EA 1G8FA 4NENA 4RA6B 4INZA 1Y5LA 2ZE5A 3IO3A 4YH1A 3T7JA 3ADOA 2WABA 3HVHA 2ZUBA 2Q6VA 4XW2A 3BMCA 1QSGA 2E6KA 3IO5A 2H7VA 1T26A 3AV0B 3O2NA 2QD2A 4PIVA 3SC4A 5LYJF 8ADHA 2AOWA 1ZK4A 3CZCA 4RHYA 4S35A 1RYHA 2LGJA 3A8TA 4QBHA 3KOYA 2Y8EA 4B4OA 4UQPA 4DV1B 2WAMA 4IZIA 5GTDA 1C9DB 4KRXA 1OT5A 4AXBA 3EAQA 2SNIE 5CBPB 1XDGA 1XQVA 3JS5A 5AKJA 3F6SA 4PC2A 1C4XA 2YN4A 2V7EA 3KK0A 5ALPA 4WVFA 3T1OA 3ZW9A 1PGOA 1TEXA 1DC4A 3FWKA 2ON6A 3LT0A 1QH1B 4LF4B 5H4GA 5AIAA 1IMOA 3MQFA 3GJ8A 2VYVD 1P5HA 4HNAB 2HBRA 1UFRA 4YJ2F 2H59A 4RD0A 2YHUA 5K20A 4RQBA 3P5BA 1B6TA 4EUKA 4Z4HA 5IUKC 4OHCA 3FSEA 1OLXB 3QEKA 1H5QA 2VHJA 4OK3A 2DPLA 3TGLA 3HJAA 2BF4A 1UKVY 2H1WA 3FUUA 2JGMA 3OOHA 5CIWA 3W90A 5EIBD 1RNLA 4LJYA 3RSHA 4KOEC 1MQ9A 4DIOA 2V7XA 1CK4A 1ZICA 3L77A 1KO7A 2XKBA 3ISTA 3M3PA 3U4IA 4LGYA 4AK9A 1XCGB 4LFBB 1UJ2A 2W6PA 4MS3B 1B73A 1Q7RA 4KACA 1XLVA 4ENUA 5CB8A 2X8LA 1PL6A 3IXMA 4YPOA 1U4SA 1BRTA 1H8EA 2JK1A 2WMNB 4Z3OA 5KTRA 3HYLA 3DWFA 1UT8A 4J9VA 1SM4A 3ABQB 3LL7A 4IZ6A 2ZRCA 521PA 4P0PB 1J8VA 3LF2A 4E5VA 4XR4A 3O8OB 1JSZA 5KVSA 3JQ7A