1TZBA

Crystal structure of native phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
301
structure length
301
Chain Sequence
SQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLYISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDGLLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQMGVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPEGLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEFNENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEHQERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLAEIRGVNPLATPRIDALKRRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords glucose-6-phosphate isomerase, conjectural
publication title A novel phosphoglucose/phosphomannose isomease from the crenarchaeon Pyrobaculum aerophilum is a member of the PGI superfamily: structural evidence at 1.16 A resolution
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 113
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10432 bact-PGI_C Bacterial phospho-glucose isomerase C-terminal SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1tzbA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1tzbA02
3FXAA 4M0DA 1MOSA 3HBAA 1JXAA 4LFBB 1I94B 5IWAB 1N34B 4LF6B 1IBKB 2I22A 4LF7B 1VIMA 1GZDA 5LMUB 1JIQA 1G98A 2I2WA 2YVAA 3C3JA 1VI6A 4JI2B 2CXPA 2VQFB 3T1HB 1J5EB 4EM6A 2O2DA 3QKIA 2CB0A 4DV3B 4NXNB 4NXMB 3JX9A 1NUHA 2CXOA 4DV4B 4GKJB 3ODPA 4DV5B 3M5PA 4B3MB 4YHHB 4U6NA 1B0ZA 3I0ZA 4JI5B 1WIWA 4YY3B 3J7AC 3G68A 2Q8NA 4DR5B 2UUAB 2PGIA 1HOXA 4X65B 2DF8A 4DV0B 2CXQA 3HJBA 1J5XA 2ZJ3A 3FKJA 4B3TB 2VF5X 3ETNA 4KHPB 2V4MA 4DV2B 1TZBA 1MORA 2CXSA 1U0GA 4JV5B 1TK9A 3CVJA 1N32B 4OX9B 1HR0B 2UU9B 2HHHB 4DR7B 4LZJA 4DR2B 1T10A 2XHZA 2UXBB 2CXRA 4LF4B 4DR6B 1X9IA 1X94A 5BY2A 4LFCB 5LMNB 4K0KB 4DV7B 2CXTA 4DV6B 4IVNA 2DECA 3FF1A 2CXNA 2PUVA 4X64B 1U0FA 5BR8B 1XMOB 4JYAB 4DUZB 1HNZB 3TRJA 2CVPA 4AQYB 4JI1B 4JI7B 3Q88A 4LF5B 1IRIA 1X92A 3BJZA 4JI3B 1N33B 3OOJA 1NRIA 3J81A 3SHOA 3PR3A 3NBUA 2UUCB 1Q50A 2AMLA 3OTOB 1N8TA 2A3NA 1HNXB 4LF9B 1JEOA 1HM5A 3JAMA 3IFSA 2PUTA 4JI6B 4DUYB 4S1WA 1IBLB 2UUBB 5A2QA 2J6HA 2VQEB 2CXUA 4JI4B 4DR1B 1IATA 1X9HA 3KNZA 3J80A 2ZM6B 4B3SB 2POCA 4TOIA 1C7RA 1XMQB 4GKKB 1XNQB 1C7QA 1N36B 3LJKA 3UJHA 2WU8A 4JI8B 5IT9A 1KOJA 4X66B 4DR3B 2XBLA 1FJGB 1ZZGA 4DR4B 1U0EA 1HNWB 2O2CA 1VIVA 4X62B 4JI0B 2UXDB 1TZCA 3FJ1A 1IBMB 1M3SA 2E5LB 4AMVA 4DV1B 2VF4X 3Q7IA 2ZJ4A 1MOQA 4B3RB 5I01A 4S12A 3T1YB 4LF8B 2E5FA 1JLHA 1VI5A 5LL6P 2PUWA 2X3YA 5FLXA 4LFAB 3EUAA 1XNRB 3BCHA 3TBFA 1DQRA 1XTBA 2F4VB 2UXCB 1GZVA
chains in the Genus database with same CATH superfamily
1FFCA 1NR1A 5EKXA 2RGAA 1P73A 3OHSX 4LRUA 1G17A 1NQOA 2I22A 4BY9E 3D7NA 4XIFA 3DYIA 4FM9A 2B1QA 3AERB 1M1XB 1UPXA 1WUYA 3HGTA 3QJGA 5CNKA 5H3LA 4BJ3A 4CODB 2H1OA 2FUKA 2ZULA 2QI9C 4QA9A 4RVGA 4ZAYA 1NI4A 4EO7A 3ZE2B 3TEFA 4L4RA 3CKYA 3ZVKA 1BXZA 4BNIA 1E9AA 5KYKA 1BHSA 1PWYE 1TUBA 4NMXB 3OT1B 1E2KA 2CDBA 1RYYA 1U8TA 4TQ9A 1D2RA 1EGMB 1R00A 1UMCB 3D3KA 1XAGA 4LZAA 4PO8A 3R7WA 1N1DA 2CEKA 2VCHA 1WCWA 1RLOA 1SB9A 4B79A 4BX0A 2WKRA 1JDTA 4F5YA 5JYBA 5LLDA 1Q77A 4NYIR 2UZ4A 4Q9DA 4G1VA 4ZOLA 3STXA 2Y67A 2LDBA 5B3LA 2IZ5A 4FD3A 2VPQA 3W7BA 4FHDA 3BTOA 1GFSA 2VK2A 5FUBA 3W06A 4EA6A 3V1KA 5LQNA 1WF6A 5MGNA 1C29B 2EJTA 3R7LA 5ALXA 1G2OA 3G2IA 1E62A 1NBEA 4MVJD 3VA7A 3DAFA 4B73A 5L7YA 4UTVA 3RTDA 2P7HA 2ZIUB 5DYYA 1ZL2A 5DHPA 2LCIA 1NMYA 1QUFA 1MC5A 2EBFX 1ULHA 3EFBA 3QUCA 4ITVA 4S2UA 1V35A 3C6KA 3W9YA 5FCDA 2KLHA 4P6VF 4GBED 1A9PA 1P4GA 2VXYA 2OSVA 2ZIGA 3AP1A 5FHQA 3RVQA 1ULSA 3ZU2A 3AUYA 2MR5A 1QZ3A 4BBAA 1Q20A 3FF1A 3WWZA 2YHSA 5J2UF 5JD6A 4KPEC 4BBPA 2YX1A 3QX9A 2NXCA 1YRBA 4MVJH 2X2EA 3FFWA 3ELBA 3OLZA 1B8VA 4B3XA 2JIMA 1M6VB 1XBTA 3BAZA 4G8DA 3ZHZA 1N5MA 1LSOA 1P29A 1U6KA 2ZE8A 3B1KA 4FIDA 4ICIA 5JROA 1YZUA 3G2OA 4GOKA 1NJ2A 1TQ6A 2G5PA 2MYUA 1U1IA 4LISA 4PZLA 2ODQA 2PKWA 4LNUA 1J90A 3U4IA 5D85A 2V0GA 2C31A 1QJ4A 2I2BA 1CUYA 1N3BA 1XDWA 4Q4LA 4QJ3A 1P7PA 1XWWA 4A7PA 4QVGA 1MZVA 1PR0A 2Z9CA 1T1JA 3LY8A 4Y2VA 5CP8A 1NYLA 4EGQA 3ER9A 4DG8A 1CX9B 1L5YA 1SU8A 3JRWA 3OJXA 5FLEX 4RHFA 1QRTA 1Z7BA 4KGXA 3DPIA 3UC9A 3IYLW 2G5TA 1CEXA 4QWWA 4R2JA 5J5AA 1IAQA 1L5NA 3CMCO 4MAFA 1MIHA 3MQ4A 5EXSA 3AFOA 4CCWA 3LDFA 4UQLA 4GUAA 3DYVA 3HCEA 1FTQA 1PUIA 121PA 4HYYA 4JA0A 3AHCA 1ODLA 3TD2A 5A02A 1X86B 1WDKA 3DM5A 3VOAA 1Y6FA 1Z6GA 4I50A 2HQSA 3PEFA 2H51A 4YUWA 2IDKA 3GCXA 1GCOA 3IPYA 1IMJA 3O8OA 1F38A 5IS2A 1GNVA 2WZDA 3DVSX 5KKAA 1KRWA 1G3QA 1KDOA 3ONNA 2YIDA 4RHTA 4OUDB 4ZV4A 1PJQA 3H7AA 1XTKA 1BCRB 2G1KA 2ZRIA 5IH7A 4XYEA 1R4AA 4QQNA 5KREA 4XJVA 5HOQA 5LJLA 2I3ZA 1AF4A 3OO0A 2BM0A 1LDYA 4BNFA 3NTXA 4QUKA 2C1ZA 1BA2A 1I5RA 1R9JA 3HFRA 4AJ9A 3H7IA 5ICGA 2W70A 4HGZA 1RMYA 2Q2WA 4MRAA 3LVQE 2WMOB 4AZ3B 2YXEA 4CVNA 2J4CA 5TT0A 1BSVA 3PSAA 2JEZA 1LSSA 2JHFA 4E1AA 1VMDA 4TQGA 1QU3A 5IT4A 4W7HA 1NBME 5KOIA 1EIWA 1HDGO 1D7OA 2PZGA 1I3OA 1KAQA 4ZEVA 1ZNWA 2BDEA 2PD4A 3EIUA 4JY7A 3U17A 5JMTA 3KT0A 2XGGA 1BOFA 1CHDA 1NAIA 3OLCX 3ENKA 4H2DA 2XOEA 3TAHA 4TWJA 5CDFE 5DTEA 3CHYA 3CE6A 2WT4A 2DGDA 5EE9A 2O2EA 4UE6A 4DY6A 1AQYA 3NT5A 2AJTA 2CNKA 5JLAA 5B7NA 3KQMA 3WNVA 3TLAA 3HWX1 2GRAA 2WM8A 4NCIA 1U98A 2VNHA 1E2LA 1VLQA 2ODPA 3IQFA 3QHQA 5EFZA 3WE7A 4Q1EA 3BWBA 3PFBA 1DUSA 5G1NA 3X2SA 2W4MA 2XUZA 1V45E 3AZPA 3Q9SA 1QTNA 4WV3A 4B9EA 1CS0B 2FSSA 5E8RA 1EAYA 2ZRCA 1SO8A 3P0JA 1NONA 2O2IA 4UEKA 4BNTA 3OPMA 1SXQA 1P4AA 1JQKA 3VZCA 2IU3A 2JLWA 1D2GA 1K5PA 5ALHA 1CF9A 1TO2E 1OBOA 2ODEA 6ADHA 5IM5A 3DKIA 3RSSA 3U4HA 1VYHA 3BMCA 3KLOA 2LCFA 5TVKA 1X7ZB 5HZHA 3V55A 5AESA 1GU7A 1E3EA 1J8VA 3GH3A 2A7QA 2A2ZA 2PZMA 3NBAA 1K8XB 5JSKA 1A9RA 2GASA 5FR2A 1X39A 3DDUA 3W6ZA 3MILA 4MYCA 3TUZC 4EW1A 1OBCA 1GA6A 4G63A 3HJCA 2E7ZA 2YV4A 5F64A 1ISPA 1EMDA 1K27A 1OPRA 1T9ZA 3MBKA 3OWXA 1LLCA 2OV8A 4R0NA 4J0DA 4RF2A 4AKSA 1KXZA 4OHOA 4D6XA 4KLAA 4YRJA 2P62A 3W5AA 1KKUA 3QGMA 3E7FA 4IEIA 1Y82A 4BJHB 1SU7A 3JVVA 4UTXA 5TF4A 2BFMA 3LT4A 3K4QA 5CDSA 3H11A 2VBCA 3Q7TA 4GOJA 3T99A 1IY8A 1CUCA 1P7VA 4TGLA 2VSQA 5KQRA 1GU1A 2MYPA 5FOXA 3QVKA 1FX1A 4CN9A 1WD7A 4ADSG 4DABA 4DLLA 4BQNA 1KU0A 1RW4A 2GPWA 5JDCA 3TQHA 1GYRA 4B76A 4BQPA 4ER5A 1XG5A 2R1VA 2WU0A 3EH2A 4IJMA 5E3IA 5I7FA 1XTJA 4QBHA 1QIEA 4D3XA 4PO3X 1U3CA 4M76B 3ETDA 1SC1A 1Z8DA 4NCAA 2FDRA 5EJFA 1QGAA 4Q1DA 4UUPA 4BO8A 3ROXA 1MVNA 2FMTA 1LPSA 1QC5B 5CJJA 521PA 1AKUA 2IHUA 1EFRD 3T9BA 3L82B 4WFQA 5EXTA 5FPPA 4IXMA 2WPNA 3VR5A 1Z82A 2BZ1A 2ZUDA 5DXJA 5A3SA 4XPZA 2BTQA 1OKKA 2XE4A 5BMVF 4KNVA 3A4VA 1HDOA 5T4BA 1BH2A 4WY5A 3U3MA 4BYGA 1O94D 2J9FA 3E3AA 1WF3A 2EU8A 2FH5B 4ND4A 1M6EX 1AZLA 4UBOA 1OE0A 4LOHA 1KO1A 3CGWA 1JQLB 2XUIA 3F6RA 5BN4B 4P31A 4IZIA 4RF3A 1NOIA 3L7IA 4NX2A 5FOWA 3SIRA 4D4HA 3KAKA 1R4NB 1IZ9A 4BVKA 2CLEB 1US8B 1X80B 5TR9A 2C9YA 3THSA 2XMSA 4BECA 4YCSA 2QVBA 3L6RA 1QQTA 1P2UA 4Y2SA 5ALDA 1PYDA 5E6RA 5KUTA 1X15A 3C3KA 4P4TA 2B0JA 1T5HX 4RSGA 3NFYA 2BM8A 4Q4AB 3UWPA 5JSZA 2PGJA 4CMCA 1L3BA 1KZGB 1UQUA 4LZOA 4OMDA 2BSXA 4I9UA 5LFAA 1XVIA 1FNMA 2YJTD 5U9CA 3HFSA 3WK8A 3V7YA 4HN2A 2OENG 2ZSEA 4FBLA 1ADJA 4NEQA 1IJEA 4DC1A 1NNSA 1Z28A 2QUZA 3Q3CA 4FCTA 4J0KA 4X20B 3M3PA 5TEVA 4CF6A 4DDUA 4LF4B 1G8AA 1INLA 3BS4A 4Q01A 4YUVA 4XVUA 1R5NA 3FTPA 1YH3A 1W47A 3J7TA 4RAQA 4XB1A 4IVNA 4IDGA 3T7EA 1KPIA 2DT8A 4KN9S 4KWHA 3MGBA 4EKNB 2IVFA 4BN4A 4NZ9A 2GGSA 2B94A 4JGBA 5HZGA 3TFQA 3KK0A 1QGZA 3QI7A 4HDOB 4G9EA 1XMOB 1R16A 4MWEA 4EG4A 1CQWA 3OTQA 1O94A 4L9WA 2F3SA 4PYOA 4BCCA 3WMFA 4EP1A 2QPAA 2WHPA 5UKDA 3UMYA 2A30A 4ERNA 4KE9A 3EXHB 4MWOA 1WNTA 4P84A 1EEHA 2FWMX 1KSGA 4LYHA 3BF8A 2QD2A 4PX5A 3FNGA 4MRSA 2WMDA 4HLCA 5KOHB 1HT1E 1O97C 2B37A 2FDXA 4K46A 4R05A 3A6FA 3FGNA 1P7YA 1XMXA 1XD2A 4MV7A 1HM5A 2YN0A 1FK8A 1FFGA 1ZUHA 1ZXLA 5AHRA 3C87A 1HTTA 5JUWA 1OBVA 1XQ6A 2C5FA 4NBSA 4UNSA 1QIKA 3FCXA 5IBCA 4ZYTA 2GPAA 2AQIA 3RYIA 1NJSA 4KX5A 3JWPA 4OQLA 4RTOA 4RA6B 2WJZB 1QP4A 5B3KA 2E4YA 3BE6A 3AR3A 4JNCA 5CLIA 1RKBA 5CT9A 3SJZA 1R8SA 1HPLA 1XKXA 4BLVA 2V8OA 2CY0A 4FEAA 1H1DA 3QVOA 4LJRA 4YUXA 4QDTA 1NT4A 3OFNA 3K09A 1HNWB 3QLJA 2BEWA 2VZ0A 4WFIA 4MUBA 3ROTA 1IN1A 1UPCA 2J3MA 3UMBA 3TNLA 5JZMA 4D7AA 5E9JA 4BTVA 1FFSA 3LXRA 4TZ6A 5AKYA 1MAWA 1CETA 5JZSA 4A8JC 3EZ7A 5ESDA 2C83A 3DW1X 3OAAA 4FFWA 4QGAA 4XQ9A 3OQOA 1C1DA 1HT2E 3N53A 1IXSB 4P32A 3SGLA 2REOA 1VYUA 1L4BA 4D46A 1LNQA 4ESHA 5CITA 4RF5A 3ZU6A 1JHOA 1OREA 2ZYSA 3EMDA 5EE3A 5F4BA 2OPHA 3A32A 2B5WA 3TOSA 1WOYA 4KZPA 3C14C 1HG0A 3GJ8A 1U2TA 1DC7A 2IS4A 1URPA 2MYTA 1PI3A 4HN4B 1IBRA 2EATA 4H1HA 4AS2A 3SHQA 2ZP1A 4H6XA 3AERA 4IIVA 1CJKC 3T5AA 4C07A 3GT4A 4CT0A 3BIJA 5AW1A 2GR9A 4OREX 1T8SA 2G7ZA 1YAJA 2NXNA 3IQWA 3L0BA 5HBRA 5DDIP 3FDJA 4Y1GA 2X6TA 4OBBA 5K09A 4NABA 1L6IA 1RYFA 4PN3A 5FH9A 5ECWA 1Q0QA 2F3QA 1GGFA 1WG8A 1KIFA 1GGVA 3OT1A 4G1UC 2R0QC 3NI2A 4DV4B 4O0MA 3L6EA 3G9XA 4UXJA 2JFGA 1W6RA 1Z5NA 2ZQ5A 4JVOA 5DTRA 4U7PB 4FZRA 1GPLA 2O5EA 2P4EA 1OLUB 2FPKA 3CCFA 2QN6A 5JPDA 4NSNA 3RUCA 3NEAA 4GHWA 3X1ZA 2X9LA 5KQSA 4XX0B 5G0TA 1TVKA 1UXIA 2OMKA 1N5JA 4HR7A 5ER6A 4AWAA 4DIFA 1MORA 4NPCA 3RYHA 1W5SA 3HWRA 1ST3A 2AX3A 3ZZ0A 4QG3A 2A88A 1TVEA 3U61B 2ZBVA 4OO3A 1U2ZA 1S96A 5A06A 2W2NA 3CUKA 3EOZA 4UDXX 1COWD 2ID8A 2ZYRA 1JIJA 4CV1A 3DXYA 3FI9A 5BV1A 4F4JA 4G4GA 2YN4A 1P4HA 2V1XA 3GG2A 1A2BA 3EH1A 3R0VA 1MB2A 2CNWA 3FVTA 5IN5A 4ALIA 4EO4A 1SCNE 5K8VA 3DMRA 4GGMX 1RADA 4JLOA 5BNWA 1L7MA 2OKGA 3DR3A 2XUKA 2B35A 2HUPA 5KS2A 3LPAA 4FYXA 5FB3A 2FW8A 4EENA 2R84A 4JXZA 1SVIA 1W88B 4NAVA 5DXFA 1M6VA 4MUHA 3PUWA 1DC8A 2DYKA 1J2EA 2CLSA 1RKXA 3GX1A 1LWOA 4IGFA 4J0CA 4RXTA 2RCNA 1H65A 2KSQA 3GLHE 1DPFA 2ODAA 1D8TA 3WQHA 2X4LA 1M2JA 3CX7A 3DO8A 4YIHA 1XVUA 1SXPA 3COVA 4IXWA 1SQGA 1TCAA 3T0GA 2IHNA 3HR8A 4W99A 2E49A 1Y7LA 2NYRA 4I9FA 3TVDA 1VCHA 2BMEA 4TYWA 1MIOB 3HCDA 3WIUA 5IANA 1V2HE 4OHVA 2OHHA 1XNHA 5L6MB 1IVYA 3BXPA 4CT4B 4H4DA 1LBEA 3V3KA 4PTZA 3GVCA 4X90A 5DLQC 1P91A 8ATCA 5K3DA 2OGTA 3AVVA 4H3KB 4N18A 3IQDB 3AOGA 3OLYA 3EDYA 1OX4B 3P94A 4BLOA 5KWEA 2PE5A 1N36B 2Q6TA 2ZT5A 2XCQA 5IM4F 4RM2A 4Y3UA 2A78A 4TRMA 821PA 3B70A 3DV9A 4KBFA 5CTAA 3OSZA 4AJNA 4DQUA 1BXGA 4BGDA 2BN4A 3TQFA 2DWPA 3JARB 4Z2YA 1TZCA 2GF2A 4LOJA 2VXBA 4Y7CA 5KYVA 4D8YA 2BRUA 5JFTA 1V9LA 4HWPA 3VR0A 4A2PA 3GLKA 3IBSA 1AQ6A 2X42A 2WSSD 5DV9A 5HG0A 4OUDA 3ZS8A 4L9RA 4D57A 1BCRA 3D3JA 2HBYA 2X7JA 3MJEA 1B8UA 3LC7O 2QQFA 1XJ5A 3MGKA 3BB1A 5FP0A 3TLXA 2RC5A 5ETJA 2PKYX 4H1WA 3QZUA 3GGSA 2JATA 2MR6A 1ADCA 1TLTA 4YV2A 1O1YA 1MJNA 1SPXA 2RONA 4L3WA 2I8AA 1J42A 4UXHA 3DWFA 3EC7A 2ZB3A 4FHGA 4M0PA 2IK8A 3HEMA 3SM9A 3WYEA 3QG1A 4HLNA 4BBZA 4ZYWA 1EBUA 2O1WA 1E8MA 5IAKA 4G09A 3WMGA 2QUIA 1PEAA 3A4NA 4AZ3A 1Z13A 2WAXA 3PK0A 1JIQA 2VP4A 3NIDB 3OEED 3H1BA 1TYCA 4PGMA 4M8SA 1T0BA 5C5EA 5HXAA 3EAGA 1Q92A 1MVLA 2EZTA 3AIOA 3L84A 4LSWA 1FUKA 2VH1A 4LPKA 1PDOA 3ZWKA 3OZBA 4WGGA 3JX9A 3PYMA 4M49A 3VSCA 3KE8A 1PS8A 5BOSB 3HDJA 1YHZA 2RBKA 4QE3A 4BB9A 4XWWA 2QVCA 4NE9A 3WRXA 5JASA 2HZBA 1YB5A 3WO1A 4DAEA 3B6KA 3ET5A 4FMDF 4KPYA 1UBSB 4JHXA 2VJPA 3HUEA 4C9BA 2IDMA 1NVXQ 4JBIA 1RWMA 3H6KA 3KB1A 4KIGA 1HSOA 3PFGA 3RTGA 3LWZA 3L0CA 2I1LA 2KJQA 4HLUC 5CAEB 5CA1F 4ZU1X 1OB5A 2AZMA 4RU1A 4IQ4A 2XGMA 3IUEA 3F2VA 1IUPA 3AFMA 1DEHA 2A1UB 3K72B 1DBIA 2Q41A 3ZWBA 2DXIA 2CCKA 3MTGA 1Z6XA 1JR3E 1RP7A 2A0FA 1KSHA 1RM3A 4TVSA 4XQCA 3KZOA 2CL0X 4M7OA 2Z2KA 2ZBFA 3L5KA 3NIWA 1AURA 2CHGA 4QU0A 2P7IA 1WXWA 4WY8A 2NT3A 4AY5A 1L5WA 4GX0A 4FMCF 2H85A 2A3RA 3RVNA 5TMPA 4KXXA 2GXUA 3RH0A 2IVZA 4IIFA 5BSVA 5K3SA 2RBEA 1Z0DA 2PUGA 3DB2A 1X7ZA 1K4KA 4NULA 2ZAYA 3AEYA 4REMA 4OU5A 3VUEA 2XCRB 4KR7A 4M9RA 4UDOA 1P6UA 4MP3A 4EEZA 4I4IA 3SHOA 4OP3A 4O3FA 3K70C 1WCV1 2AG8A 5LJIA 1RC1A 4WOPA 3BILA 3JXEA 1SUWA 3CWZA 4FN4A 1DT5A 1UK8A 2AE1A 3ABIA 3ETEA 5EXDA 4B7UA 3O8RA 1R8QA 4X9XA 3AHDA 3CW8X 4TYPA 5AH0A 3REGA 3RVSA 3U37A 4DDMA 4ND8B 4WIAA 3CH7A 1UBEA 3NIBA 2WHYA 3B1WA 3OHMA 1YD7A 3R9IA 1B0PA 4BWVA 4RCYA 1FE8A 3QNMA 5EMNA 4C04A 5C35A 4HB2A 2WILA 1U7OA 1T8RA 3H86A 1DUIA 2DJ5A 1FRFS 2VJBA 1C7RA 1BN7A 1VG1A 2ZR0A 4REQB 3BFJA 1YB1A 1WY5A 4L8FA 3R7DA 3EPHA 3N59A 2G04A 1A7UA 1FLNA 3IP8A 1D2CA 2DP4E 4L78A 2ZSBA 3QK7A 2F1RA 3GGGA 4XB6B 2A0YA 1MTZA 3DNFA 1ECPA 2W9XA 1E63A 3I45A 4YAUA 1XU9A 3L1IA 1QQ5A 5AXBA 5B55A 1M3SA 1GOTA 1C3JA 1Q5PA 1HEUA 1LCIA 2R6R1 4MEJA 1ZIYA 4S12A 1P5JA 1B0AA 5E9WA 5EMKA 5MDHA 4GSYA 1RE1A 4HYEA 4X1IB 2W2QA 3IOBA 1I0LA 3ZE0B 4B74A 4B6EA 2JVKA 5I7EA 1P7ZA 3FYUC 4MJ3A 4AO7A 1QU2A 4IFTA 1ZNQO 1A88A 1IEVA 3N5KA 2DBQA 4IW3B 4QUEA 2QJOA 4N41A 1GHTA 3KSZO 3SIPA 1BEUB 1DIBA 1JFFB 1FDRA 2GYYA 4REOA 4CIAA 1WABA 3EYAA 3MBOA 3VKWA 3ZNQA 1QP0A 1QK3A 1OXUA 1P8JA 5L9AA 4RTKA 4I55B 4JAVC 2GKOA 1RYHA 2WKWA 1G2QA 4FFBB 2A5FA 4FGKA 2KM1A 1YMVA 1VDZA 3AUXA 4LTMA 2OEPA 3E2IA 3MGCA 4N7BA 3KOMA 4WNYA 1CEYA 2H57A 1VE5A 1KAMA 3C41J 3IQXA 2FX5A 1ZNXA 1FOEB 2R62A 1Y4SA 2WHXA 1M33A 2ZDGA 4IDDA 5BN4A 2YYSA 1FP2A 3PENA 4Q9HA 3KM0A 3L9WA 1R4NA 1GPBA 2QG6A 3IH5A 2X1LA 4FC7A 5F35A 1SXGA 1US8A 3P9IA 2PSJA 4KVAA 3D8SA 1X80A 4ZRDA 4JC4A 1U2DA 2CMDA 3NVDA 2PR2A 4JSTA 5ICFA 3X2EA 4D9BA 2K7FA 1QF9A 1E1KA 4FHEA 1ZEJA 3KALA 2EHJA 2GFQA 4C0HA 3L8ZA 5A5FA 5GADl 1YGYA 1JEQB 2C3UA 3HKDB 3NOOA 3PR2B 3O4RA 3OD5A 1XWIA 4Q4AA 1YCFA 3OO1A 4XWTA 3UC5A 2I1QA 4RV9A 2V7WA 4Q1VA 5BWMA 4TXHA 1MC1A 3K2BA 2R751 1T5DX 4ZAZA 2IE0A 1I7PA 1YBVA 5CJPA 4AUEA 5HCNA 3BM5A 1FNSA 3DOIA 4X20A 4PX2A 1K5GA 1L1EA 2VJMB 3TS1A 2V7PA 4PPNA 3TXYA 3I5XA 1IL0A 3PC2A 4HDKB 3NAQA 4R1LA 4TT3D 3FVQA 3ROZA 3U4AA 4EW3A 3L7CA 2IZ7A 4NAUA 3KZ1E 4FNMA 4TXMA 3PNSA 4Q5IA 4XYMA 4FOPA 1WDLA 2QL7A 2ZIEA 3GDOA 4H7HA 4KRYA 3PBKA 4ZV7A 4AMBA 4GQAA 4YYEA 5CB8A 3WL6A 2F59A 4HXYA 3QWFA 3IDZA 2ZYDA 2JRLA 4UZEA 2IUTA 1XKLA 3FRIA 3GXBA 5FL3A 4I9NA 2IV3A 3PHJA 1O58A 1DRJA 4M9UA 3EXHA 4P4GA 5TC4A 1NVUQ 4KQKA 4ZI3A 5CH8A 3TR6A 1ES9A 2IF0A 2QNIA 3GCDA 5KOHA 4CKBB 2C8VA 1NV9A 5TIIA 4RACA 5I4IA 4RZIA 1I4TD 1K6EA 2BY4A 4MQFB 4YRLA 3ENQA 3O3CA 1L7EA 2Q6VA 1E5QA 3E3NA 2W6JD 5LDHA 2X0NA 4OHCA 5IVIA 2XQFA 5ALYA 1HF3A 1JUDA 1PFYA 5BWLA 1N75A 4NDAA 2NZWA 4PV7A 1Q6YA 1JP7A 2EFEB 4Z5XA 2VN8A 5HCUA 4JASB 1FU4A 2W2MA 4NU5A 1A8QA 1JHUA 4RA6A 4D41A 4YRMA 4ND1A 1U9IC 1I3KA 5JAMA 4DXAA 5EZ6B 1R4MB 4M4SA 5CDUA 3O9MA 5A3JA 1X13A 2JZOA 3BCRA 2F9MA 1EJ2A 2B21A 1DPGA 2QX8A 1HYGA 1W52X 1PK8A 2YMLA 3DXXA 4TT3A 4XJTA 5HTKA 1PNVA 4Z4HA 5ELMA 4J7AA 4KDFA 3DMTC 2ZUCA 5IW8A 1H1TA 3HM2A 3E58A 4EGFA 1KMCA 2XDYA 3ONDA 1UT8A 1HKUA 2MYNA 2WJWA 2X40A 3GRPA 4G84A 2GKGA 1Y81A 2O3SA 2PZBA 1JBKA 2HLHA 5EJ9A 3AR5A 2B9VA 3ZXIA 3RTEA 4RSHA 5JLJA 1QSGA 1O0CA 2RK6A 3PX2A 4D3FA 3EQ8A 1KA9H 1P9RA 4JUDX 1NOJA 2Y93A 1J97A 3WBFA 5A0TA 4LV5B 3H2GA 2WDPA 1TCVA 1YIDA 2GBFA 2Z4RA 3HVKA 3UMFA 2BEJA 4C5AA 4CPDA 2H63A 2R7LA 3CH5A 1ZH4A 1MA0A 5AM4A 4IZOA 1SUEA 2W6JA 2PG3A 5KTNA 4N0QA 5KNBD 5EIFA 2DCUA 1PTJA 4MRPA 1SQ5A 4J29A 4UBMA 4CDNA 1Z75A 4YV7A 2PLFA 5IJZA 3ZV4A 3R2JA 1VG8A 3A1UA 1W581 4UC0A 1UPBA 3D43A 4R6XA 4A0RA 1BS1A 2PVSA 2ZIXB 3HP4A 2H0AA 3N0WA 4JYMA 1RYBA 2GEVA 4Y2TA 2CE2X 3MCAA 5EPEA 5HUHA 3GJTA 2WUDA 2ZYWX 5H70A 4E4YA 3DZ8A 2EBUA 1OLUA 3LVFO 4Q82A 5H8WA 4X60A 5D01A 3V1YA 4F84A 4DARA 3TPFA 2OP0A 1EDZA 1KWKA 4DTCA 1GG5A 1YRWA 3HTXA 4XX0A 1VM6A 4O1MA 2DULA 3QNWA 4UTNA 5B7PA 3AVYA 2GUWA 4GI1A 4RS4A 1NQAO 3CJQA 2OFXA 2X1VA 4XSVA 1R6AA 1BU5A 2WYVA 3ETJA 1G3IA 4L7VA 2GJKA 4HUTA 2C8KA 3O38A 4DZTA 4FKZA 4URXR 1QDLB 3KBBA 3BMOB 3CWQA 4DC9A 3LK6A 4OQMA 1UC8A 4K0KB 3KXKA 5B58C 1T0IA 4RELA 3QKRB 1OIXA 4CG0A 2AX4A 2XEDA 3LRXA 2DHEA 6GPBA 4URYR 4PO9A 4TRJA 1U0FA 3ES9A 4IUDS 2AHOA 3VU3A 1ZLXA 1L5RA 4QX6A 1VXRA 2QAGB 3LWNA 5FTJA 4BEVA 4S05A 4E1VA 5KNBA 3LY5A 3N2LA 3O4HA 1TOAA 1V1JA 3C5WP 1E3QA 1W88A 3OJFA 1FFAA 4K40A 4AKTA 3D7SA 1NUTA 2VQ6A 4P58A 2QLLA 1E8DA 2VPIA 4URUR 3ZTYA 3T95A 3AL3A 1TYAE 1W36D 1V9CA 3R5TA 4JL8A 5EHGA 4LXTA 3T54A 4A0FA 4B47A 1WD5A 5J58A 1QB7A 2Y1WA 4QT0A 3CT6A 5DBFA 1X1TA 2QMQA 5F1YA 1D0SA 4L9SA 4CL8A 1S7GA 5BQOA 3K3PA 4X97A 1MIOA 1ECJA 5E9QA 3S8YA 3BRWA 1YONA 3JV7A 5AXDA 3JQQA 2GZAA 3EHEA 1HE8B 4RJKA 2CZGA 4JBYA 1N0WA 4KPUB 4YJHB 3OJEA 4FZJA 4DYDA 4EBFA 4G5XA 3LQKA 3FWPA 3CCBA 1OX4A 5H82A 3EVFA 2IU4A 1O96B 3JZIA 2PBRA 2X77A 3C7AA 4OA5A 4P8RA 5DVZA 2GB4A 3H19A 4KYTA 4D02A 1LS1A 2FW0A 3RSLA 1PWHA 4EFNA 1F4VA 1CFJA 4Z7NB 4LJ6A 1JTEA 1B3RA 2BBWA 3JARA 3MG9A 3HKEB 3IAAA 4LXIA 3LS2A 4Q12A 4Z9FA 3WGLA 2QP3A 5F3DA 1LNSA 2P67A 2X5XA 4GNKA 1V1RB 3T5CA 1YQGA 2NYAA 2Y1GA 1G8FA 2HGSA 3GJXC 3TOVA 1E9DA 2FN7A 3A9WA 2VYVD 5H1YA 1H8HD 3A14A 1E7RA 1FXWF 4ME6A 5ITZB 4KODA 2PUJA 1CUBA 4AICA 1KZYC 1PLJA 3DFKA 1UFQA 4Z4GA 2QTRA 1Q95A 1XHFA 2JGDA 2QE7A 1MHPA 3GWZA 4WY2A 4KNYA 4W5OA 4M8NE 5KVAA 4WOCA 3LM8A 3I32A 5ARBA 4BO0A 2YWDA 2NO1A 3ZPXA 1MBZA 1P5ZB 1YQUA 1CNMA 3VVCA 1UEXC 2WK1A 2B7CA 2CXPA 3EZLA 4G4SO 3IAFA 5D7BA 3G6WA 4DIKA 3FCEA 5CCDA 1YZTA 1FPQA 2C54A 2VO1A 2XD4A 5IBPA 1GFIA 1OFUX 3NHJA 4FNAA 3AEQB 4K26A 9GPBA 4H3SA 4PHHA 1BE0A 3WGTA 4W5TA 4AMGA 2GEKA 5BOSA 5EP2A 3DS8A 2GPSA 1RKQA 4PC7A 4F6CA 1RKUA 2GYVA 5A4AA 1Y8ZA 2XUQA 1B4DA 3AHIA 4AJ4A 4QPCA 3UQZA 5HP4A 1ATZA 3LUHA 2ZJ3A 1P0PA 1DQNA 4TS3A 5AKXA 4JLBA 3ZDAA 1R27A 4S1VA 4QOFA 1JF8A 2E5WA 3I2KA 3IE0A 3WBJA 2QGFA 5CAEA 5I7UA 1H22A 4JL6A 3NDJA 4DQKA 1AZSC 3WIVA 3W1EA 3F73A 4G0QA 4F1KA 2VYVA 5ALEA 5FOSA 4WEQA 5JSQA 1E3LA 1XQXA 1HE3A 2A1UA 2GYWA 3R3ZA 2IGTA 4Z9AA 1WCXA 1OROA 1G4UR 5BW8A 9LDBA 3PU6A 5EXXA 4CF5A 4ASUD 1C3OA 4DV6B 2X19A 2XYRA 3ZH9B 1R0BA 3EIQA 1XRJA 2OMEA 5EJ2A 4B7CA 1WPXA 2FSUA 3DO5A 2QX6A 1C3LA 2M6RA 2YHAA 1W5TA 1SUBA 3DDSA 3H5AA 4HDAA 3TSCA 4EI8A 5B6IA 2ZFUA 4YN3A 1CRLA 1H8EA 2AD5A 3EWSA 1YS4A 1SD2A 2GXSA 2NZ8A 3IB3A 3L6BA 4W6QA 1X3SA 2PIDA 1I7LA 4LXGA 4C05A 3N0TA 3OM9A 3OZIA 4JB2A 4YRPA 1OC4A 5KB3A 3FOEC 4CIWA 3RW9A 4IAOA 3PR3A 5HW0A 3FG9A 3IBTA 3ADPA 4KUEA 4XEHA 1C7JA 4IX9A 4OQYA 4PLTA 4BNNA 4A15A 4IUYA 4MR8A 4XOUA 1GILA 5KINB 1U7XA 3P9KA 4WMLA 3K6RA 4GZLA 1V3QE 2ZI3A 3ANSA 4KTVE 1NRJB 2XVYA 4ND8A 2FOXA 1H4TA 3GEMA 2PSHA 4NJEA 3UN1A 1D6MA 2RMKA 4J1TA 1ZVVA 1HRDA 4ZC8A 2YY5A 2O5CA 3DLPX 3HSKA 4REQA 3B2NA 4OL0A 3T94A 1Y6JA 1VSUA 1KZ9A 2G63A 2F9LA 4PFJA 1OU0A 4X66B 1SHKA 4LW8A 3K0FB 1DO2A 2BHRA 3NM4A 4OY3A 3THYB 3QU9A 4XE5A 1M2NA 1R9MA 4JJGA 2FR8C 2VPXA 2YVLA 3AUSA 3H5RA 4IBOA 3LT0A 4AJEA 1KYQA 4MZDA 4X93A 1Z26A 1TRHA 4XGKA 1JLHA 2DPGA 1TO6A 2R8YA 3HYSA 4YECA 5F2KA 5AT1A 3QTLA 3ETHA 4X1IA 4FCCA 3RABA 5LBTA 3AY6A 1TU0A 1N2JA 4MWSA 1KNXA 1EUQA 4KK3A 4EJ6A 1W44A 3SF0A 2C3MA 4TZ0A 2H9IA 2Y2UA 1Z3CA 1VG9B 3KCNA 5D2CA 3HDYA 4UQPA 1OGJA 3CNEA 1JFFA 4V02A 5HDBB 3UK6A 5B6PA 4RXMA 3TD9A 5BSTA 3KZXA 4L2IA 3TIVA 5HM6A 1SKYB 2V7XA 5DGHA 4I55A 1F8XA 2BGRA 3FVRA 3TRIA 4ZYVA 4UNNA 4TQAA 4F2DA 4FFBA 4Y6GB 3QVUA 4EFMA 5F33A 1W5BA 2Q21A 4EW6A 5F2NA 4G37A 3I8SA 4YO7A 2ZI4A 5EL0A 5J1TB 3TR5A 2BMVA 3TUJC 3PE3A 5L7WA 2NSYA 4FB4A 2J0SA 4AXXA 4E15A 4R7ZA 3LT2A 4I6GA 2POQX 5CW1A 3G8YA 1YDWA 3KKMA 2ZSJA 3ODPA 4P0TA 1DAIA 2PQMA 3LT5A 3PHBE 4K1LA 5M29A 4ZK2A 3GPIA 2WNIA 2IPXA 2XUGA 2HSGA 3F3YA 3LLMA 3OKCA 3ANNA 4FLMA 4RVNA 3ZCPA 2XUDA 1PK7A 3LCMA 1PNRA 3VPSA 3AFHA 3B1VA 4Z7QB 1W1UA 1JEQA 3OZAA 3BK7A 4HWSA 4KLCA 3AI7A 3HKDA 1TZBA 3R3SA 3RC2A 2JDIA 3RODA 3IQIX 5I8ZA 3VYUB 5HRCA 3G8AA 1UOOA 4CL2A 4LVCA 3TVTA 4OM8A 5KX5F 2JCGA 2GBPA 2VJMA 2GRJA 5IH3A 2ORWA 1YIAA 3DC2A 4G24A 2OR3A 2QDKA 3E8MA 4HDKA 3SICE 3DE3X 3DMNA 3QXXA 4MS3B 5EMMA 4UMDA 3A6JA 1JR4A 2QM8A 3SYTA 2NGRA 3FB1A 5DH9A 3AUKA 4BO6A 3ZE7A 2O8EA 2NNLD 2VBIA 3CUSA 3NUGA 2JJMA 3DWEX 4Q7JB 4U00A 2P6RA 2JCYA 2BZSA 2ZZMA 3L4SO 1H2HA 3PUIA 3L49A 2GM9A 2YRXA 3R0XA 4HJRA 1N1EA 1WV1A 3GVPA 5TQ2A 2OORA 2RIPA 5L3RA 1HH4A 4MA4A 3HU2A 3UW1A 4RK1A 1K7XB 2Q5HA 2YUTA 3UYKA 1JN0A 3H6HA 1RM0A 1SQSA 3FYTA 1WE2A 4CKBA 3L79A 2MMCA 1H2WA 5CW2A 2NUTA 4MQFA 1F8GA 1XU4A 1FRQA 4C0LA 2WZBA 2IEYA 4US0R 3ZVNA 2KBFA 1S8FA 3WNBA 2VQEB 4KHZA 1E59A 1M8GA 2AQKA 2HUNA 1V3VA 2Z5LA 4E2XA 1VRCA 2KW5A 4GPBA 2QV7A 1R6BX 1GZ6A 1PE0A 2FR0A 3RBZA 1QOQB 2GBCA 4D0GA 1TKRA 5LUBA 1XNQB 2WR8A 1J0XO 1GA4A 1T5OA 2EKDA 2HN9A 5FQOA 2NVUB 3T7DA 3VOBA 1BD4A 1VE3A 2XQJA 1TT5B 3K4HA 1QGUB 3S7TA 1ODIA 2VDOB 1R4MA 3JQDA 4W63A 3VR2A 2CL7X 1WUHS 2ZLBA 1F60A 3JQ9C 5C46F 1IK6A 3T6KA 3TSZA 1W4ZA 2CK3D 5TS2A 3NKLA 4QREA 4LRTB 1LJLA 3MAAC 4Z7OB 2GXAA 2ATVA 1KYWA 3HZHA 1N8KA 4PPQA 5I9TA 5T41A 2II6A 2ZYVX 3MIIA 1KEWA 4EB3A 5AW2A 2C7RA 1DX6A 2HRCA 3AZOA 4I3FA 1PJ2A 1TC2A 2CSXA 9MHTA 2G71A 1XTVA 4Q47A 1KK0A 5KVCA 5IMBA 3GB9A 4F92B 1E1QA 3TB4A 1VYVA 2IKQA 3DEIA 2K87A 3G13A 3LNCA 4Y9DA 4YCCA 1CYEA 1N0IA 2QU8A 3W5IA 1U9ZA 5JCOA 4JVMA 4AQDA 2NW6A 2X8LA 4KQIA 4AJIA 3C5HA 4AT1A 1K75A 1CNEA 2AFIB 2XA1A 4Z4QA 2ZS7A 3SZUA 5B1SA 1VI6A 2EYUA 2P9EA 5AWFC 4B85A 4QJBA 2REQB 5K20A 2Z57A 5SZHB 3ZV7A 4C0SA 3O7WA 3E5MA 2QMZA 2A5JA 1AVTA 3LFTA 3NCTA 1GR0A 1MO4A 2ZRQA 1QZXA 4PSVA 4C7BA 7REQB 5HGXA 4DNQA 1A95A 3UKOA 1W4CA 3DOEA 4XVCA 4IDOA 2C2KA 3TZBA 2ZIXA 5CURA 5H02A 4NBKA 3L77A 3ZXSA 1EZ1A 2JJ1A 3KPUA 1T3TA 3IUYA 3HB1A 3MTDA 5ARDA 4ZHQF 2X4GA 5AW4A 1NXSA 2ODNA 3HA7A 4C6TB 3U7HB 4LRYA 1LBIA 5GJBA 2FP3A 4IP0A 5ENZA 1P3Y1 1RABA 3LFHA 3BZWA 3SR0A 4E4TA 1NNI1 4DVGA 5DTQA 3HB7A 3PFFA 1W19A 2IX3A 3LBYA 2IA5A 3OETA 3RYCB 4V39A 1T10A 4NCXA 2VP0A 4Q3AA 5A4IS 2B69A 4D4LA 1E2FA 1QZTA 3CEMA 1WSAA 1YT5A 2GEDA 2WUGA 3ZEIA 4EB0A 4OHXA 4OX9Y 2E4WA 4L6AA 3BMOA 1TA4A 1CLEA 1U2PA 3DG9A 4DQDA 2QVYX 2VPTA 1KRHA 3EDMA 2J09A 3QKRA 4JT8A 2PU7A 1SQ0A 3GO4A 4L0MA 3ASYA 5IK2D 3JU3A 3D7LA 4HWGA 2BPOA 1IC6A 4FXOA 5E4FA 3LPLA 3Q3GE 2O8EB 2EQ5A 2QAGA 1RCUA 3GLGE 2BSQA 4QGHA 5I9BA 1W87A 2FHSA 1UIMA 4ZI2A 5K9ZA 1K5HA 1Y5RA 3R8FA 4B2IA 2YW2A 3EF0A 3QU7A 4KQFA 4YEDA 4CMIB 5JFOA 1H94A 1RXYA 4IYRA 3NTQA 4CGZA 2G9QA 1MO6A 3ON5A 4Z53A 1J0EA 1T9AA 4K9LA 2FUCA 4RDIA 5ED0A 1QFXA 1U0SY 3ICQB 3I6BA 1YRAA 2HT1A 2H4ZA 1ZJ5A 3EDOA 1GZHB 3GJZA 1IJFA 1EVEA 2BUBA 1IATA 1YMUA 1ZGJA 2CW5A 2PLNA 2Y1LA 3W6PA 4BEBA 4DPKA 1SU4A 5AI8A 1CF2O 2H2AA 3HJHA 2V7BA 3T12A 4UVEA 4YJHA 4KPUA 1GM5A 2AG1A 1T5IA 3JWGA 1OXKB 4XD2A 2QY9A 4G5QA 2CSUA 3ME5A 5AR1A 2E21A 3GRCA 4NEGA 4A82A 1XGKA 1O96A 3JR3A 1W93A 2W2XA 2QAJA 4P3KA 3P0RA 4QGGA 4U0JA 2J30A 1JNXX 5JJBA 1FBNA 3BN3A 4POOA 2XGJA 1DKQA 3HKEA 3M3DA 5BV7A 3PTZA 4RETA 4DM7A 4IMIB 1LLUA 5FTWA 1V1RA 2QX7A 2ZKIA 2QIOA 3EPPA 4XAQA 4CG1A 4CYMA 2ZROA 5C1OA 2HI0A 5TARA 3H5NA 1VA4A 2PFSA 4HVTA 4WK6A 2JI4A 1AB5A 3TG8A 4D5GA 5ITZA 3AL2A 1V5IA 5FX2A 2F4VB 1W46A 2HJRA 3MT7A 4X5OA 4OATA 1JKMA 1UMBB 3P1JA 1N3YA 4UBJA 2Z4SA 4BEWA 1JMKC 1X8KA 5ALGA 2R4UA 4DF3A 1YACA 2PYIA 3EGXB 3JASB 5AK6A 3VYSB 3KLPX 3AVUA 2I2CA 3M4YA 1PR6A 3DP9A 1N2BA 1ZY2A 3DMYA 4LG1A 1FSGA 3CVOA 4C03A 5JYCA 3QFTA 4GOOD 4R54A 3GZ4A 1ZOPA 3HJAA 3LH5A 4GP9A 3A4MA 4HI0E 3EA0A 4FK8A 3ROFA 3UCEA 1CT9A 1PNTA 1RQLA 2OXCA 3HKCB 3GFRA 2FU5C 2VJDA 4L76A 1GTSA 2GJ4A 2XDWA 5E7JA 3DLAA 2I4MA 2RGGA 3AEQA 2O8DA 2VSYA 1K68A 1UK9A 1XCBA 4NONA 1ML4A 4NPHA 2R1ZA 3KXDA 6REQB 5KKNB 4FGWA 2QRNA 4U0KA 4WDQA 3PGLA 1G3RA 3DXZA 1JJBA 1FPMA 1HFWA 1LDMA 5HFAA 3L7LA 4KP7A 5KYWB 4KSYA 1WCYA 1FBTA 1QRSA 2ENWA 2B4TO 2CCJA 1A7AA 4X8OA 3HVHA 1XJCA 1P1IA 1YK0A 1E79A 1JZTA 4I14A 1P44A 2ARKA 2CD9A 3PDIB 4RIIA 4IOMA 3FDIA 1OAKA 2JIQA 3QSGA 1JA0A 4DEXA 2YNMD 3KD3A 3C8MA 2EJCA 3I39X 4X1KB 4XD7A 1XP8A 1RZVA 2HMSA 1K0FA 3RRYA 1SMKA 4EG0A 4DJFC 1MOZA 3UHPA 3QPUA 1C50A 2ZT7A 1Z4NA 2P6UA 4BNMA 3M81A 3QFFA 3EVNA 4YJ3B 3C8ZA 2H2IA 2WIDA 5C3UA 4LS3A 4UU1A 4E09A 2HAEA 2VQ3A 2PMDA 3I12A 2BE9A 2P6OA 1UC9A 2FB9A 2A0WA 4K9QA 1TAQA 3UB2A 1W48A 3I73A 3G5TA 2CXXA 1J23A 1X2EA 5CUQA 4F3YA 2ZRLA 1SBTA 1VL8A 4TUYB 5JDCC 5SY4A 1CEEA 4OLFA 1RWPA 2PFKA 3HXOA 2YBEA 1S1MA 4PX9A 1UC5B 2G09A 5IU6A 4MTCA 3JZDA 1D2EA 1N4AA 1PDWA 3AKCA 3SVTA 2I2XB 3K1YA 2PZKA 1XDZA 3WHKA 1J24A 2YWBA 3FJOA 1WB9A 4Y30A 2QUHA 2ENUA 1XRRA 3DOCA 3V4OA 3KL4A 5AW6A 4QBKA 2EARA 3SI7A 2AQ8A 3WB1A 3UJHA 3RSQA 3PC3A 3FPJA 3FOAA 4CN8A 3KSBC 3BT7A 5CU7A 1DJLA 4R5HA 3Q8LA 1W9HA 3K0FA 1Y98A 4O0LA 4RMIA 1STOA 4BKQA 5J5VA 4BTEA 2IXTA 3K1AB 1EX1A 1YR9A 3THYA 2BLNA 2XIJA 4AMVA 3WADA 5B12A 1DCMA 1I2AA 3HCRA 1JE0A 5A4JA 1Z7EA 2JI6A 3NPMA 4JP8A 1XTTA 3CLRC 4G23A 1M5TA 2BFOA 4JT2A 3IR5A 4MUAA 1XLWA 1ADFA 3R20A 4AJ1A 4BMSA 2Q27A 2BUCA 1VIAA 1T4BA 2JD1A 4Q4JB 3TX6A 1PZHA 4OMFG 4R2MA 1F2VA 2GAJA 1OYVA 3DWGA 3UMGA 4U7HA 4YMVA 1QIDA 4LGYA 3WA7A 1NG9A 4XM2A 5JATA 2B8NA 1AUXA 4RNCA 1J1UA 3PICA 4O2AB 4JOSA 1KZ7B 1EIZA 2EP5A 2ZRNA 3L43A 2WBLC 2ZI9A 4EY4A 1LKZA 2GHTA 2PTHA 5A5VA 4FR5A 4HQ0A 2HCJB 4L73A 2C4WA 1HLFA 1SUCA 2ZSHA 4EPYA 4N47A 3JYLA 3DEAA 4MYTA 3F0TA 2EJBA 2QUJA 2J85A 4R9SA 4V3BA 4B4KA 2ASVA 3BL8A 1BKSB 3HACA 1EFTA 4HN9A 1I94B 2WJ6A 1O95A 3BFVA 4FKBA 5GPBA 2GESA 3HN7A 1E0DA 3SFTA 2D62A 4INJA 2ECKA 4WLVA 1OF1A 1TYBE 2JVIA 1NTOA 3LLVA 3EZXA 2ZYGA 4W5QA 4C14A 4TM7A 2D4AA 2LCQA 1XDUA 2D5BA 2QD1A 1XVVA 2R6FA 2WF6A 1WDTA 4JB3A 3KG2A 3GLQA 1ZU5A 2JGKA 2ID4A 2QRVA 4ZMSA 3N8NA 1KS9A 1O94C 1OVMA 1IN5A 3EC2A 3USES 5JDIA 4S0XA 2Q3LA 3LBHA 3IQEA 2CLLB 4KO3S 2Y8EA 1YVDA 3I2HA 2NG1A 3GPCA 5ALVA 2OD7A 1D03A 1PGOA 3BIWA 5A0FA 5IMSA 2QLNA 2X0IA 3SZLA 2H06A 1HQYE 2BF4A 4KI7A 4YRNA 4MICA 3WQBA 5AUQA 2OXRA 3OZTA 1C4KA 3LHFA 3ZY5A 4MS3A 1T4DA 4PX3A 4PR3A 5KQPA 4GDFA 3LXUX 4FFNA 2HXSA 3DVRX 1IZ8A 1XRPA 3L7BA 4M1WA 1KR2A 4KPGA 3QWHA 5DBIA 3GR6A 2D8AA 4IDNA 2Q7DA 2CVPA 3QUTA 4I7EA 3SFZA 3UJDA 4FCVA 2P3QA 2A9FA 3S0JA 3TL3A 1I7SB 4KKVA 2W4IA 4TKZA 3F47A 4C2TA 2I2DA 1KJNA 4GKVA 3TBHA 2FK7A 4R3WA 4YMWA 2BM1A 2QW1A 2ZU6A 1HQDA 4J49A 3K09C 3M49A 2HBRA 1LBQA 2HCBA 1E1RD 3RLIA 1IMOA 3MHPA 3ZQKA 3BMNB 4BAZA 4NH0A 3GQBB 1MABB 1XEAA 3S68A 1MJGA 1OI4A 2H59A 1UPUA 2HRQA 4OLHA 2CLFB 4V0KA 2RKOA 4V0QA 5G53C 4NENB 1UBRS 3NTLA 2JLUA 2V7VA 1PKEA 1UJ4A 3A1SA 3QVTA 1NMEA 4LY9A 3TIIA 2ZR9A 2NVUA 3S4YA 3DE4X 1KP3A 2ILTA 4K6GA 3KQUA 1I4OA 4ND5A 1TT5A 4W82A 1QGUA 3WTBA 1BWPA 1TGYA 4JLDA 1VBKA 4MLPA 4WLOA 4B09A 1A1VA 1SVLA 3B12A 1J2TA 1S6YA 1U1FA 2PV0A 4F8JA 3QEBZ 1P3JA 3FY4A 2R6GA 5TGZA 1NJ6A 5K8JB 1U5CA 1RRMA 2IZZA 3HUFA 3KVOA 2FFAA 5JS2A 2C0QA 4B7ZA 4C4PA 5E0KB 5K4AA 1A9XB 1N77A 2BMFA 4AKIA 1KK2A 1M83A 1Q12A 5LL6P 5LD2B 3PFWO 4R7GA 4KVGA 1D1QA 1DCTA 2XCTB 4DLKA 5DLYA 4PSAA 4M86A 1A5SB 4J0EA 1TVCA 4A3SA 2Z8YM 3VU0A 1Y5IA 3HDVA 4O63O 4QG7A 3ZUPA 1GPMA 1H3FA 3GA0A 3V1MA 2H2WA 4J03A 4Y6LA 3WIDA 5DLDA 2C92A 3ZQJA 4C87A 2PUFA 4AS1A 4LWOA 3P9XA 1Z12A 3DFZA 3AR4A 3ESZA 3ICWA 5BT8A 2IYPA 1QG0A 2LDXA 3H4TA 3UUGA 3HO1A 1LUAA 2B7LA 2AEJA 2WIFA 2AFIA 4GUDA 4O2LA 3WV5A 3AF5A 2PRKA 3D3WA 4BX3A 4CV0A 1WVMA 1NAHA 2REQA 3MZ0A 5T6BA 1Y6ZA 4PLPA 1FQOA 2ZRAA 4R1UA 4DLTA 3GEGA 5FPTA 4CLRB 2GEJA 4UUOA 3H0CA 4B34A 1VCIA 4O08A 5FNZA 3ILVA 5C8VA 1HDXA 2PS9A 2B99A 4QTTB 1AHHA 1JXOA 1UWCA 3I28A 1I2BA 4G25A 3RG2A 4DADA 1ABBA 3PX7A 3BH0A 2P8SA 2OAGA 4NCKA 3IA2A 4DMFA 2PZJA 1BHQ1 1CY0A 1M34B 4RYLA 2YJGA 4C6TA 4FBGA 4HTFB 1T6ZA 3R7NA 4DCMA 1I8TA 1ZCZA 2G9NA 4F3KA 1EAMA 2AEMA 2ZJBA 3G49A 4JOQA 2FSVA 1T8YA 1UBMS 4HADA 1BOOA 4FYVA 3RYCA 4LOAA 3OE5A 1UBJS 1CG6A 4RABA 4S1OA 1S8AA 2ECOA 3OH8A 5I5GA 1WLYA 2C77A 4LC9A 3Q7RA 4OAQA 4DUGD 1Y4ZA 2CDCA 3F49S 3T3HA 5FUXA 3ZU3A 2Y0BA 1A1SA 4CW7A 2FRDA 3TGWA 1II8B 1RQGA 1SG0A 2DECA 3ABZA 4DJJA 1U4NA 4IVQA 4E94A 3UZUA 1T13A 1Z5OA 3D8NA 4MPPA 4Q7KA 1U3FA 4MW1A 3AC0A 4D8UA 4KBYA 1U0NA 3ZX5A 4UD6A 4WT7A 2I4IA 3PRJA 4OP2A 4YWJA 2IOHA 3LF1A 2DVMA 2OO5A 3G8DA 5DWDA 3N76A 4YYZA 3ZKWB 3AJ9A 4HNAB 3PB3A 5JE8A 2OZLB 2WAOA 3H9GA 4L0DA 4M9XA 2YVQA 3EQ7A 4UAGA 4HNQA 2D6FA 5A4KA 1ULZA 4CMIA 1N6OA 2JFXA 4XIIA 2BRUC 3CVXA 2B1IA 2D5AA 3H1AA 2YJ6A 1ZCAA 5JMPA 1P2DA 4GECA 3FHTA 5A2QA 4GM1A 4WADA 4B5LA 4WINA 3M1YA 2XRFA 3CZRA 4RJ2A 3I01A 1U6JA 1ZICA 4FPXA 1Y1SA 3ZQ6A 5LP6F 3LOPA 1XALA 5JD4A 2BFWA 4P3YA 3WIOA 1RWWA 1GTG1 1XMVA 3EF3A 4MPRA 5JY6A 3LLCA 1ZJWA 1SBNE 2ZJAA 3WDLA 2W6ID 3MTQA 4QUGA 2ID7A 3GFBA 3IJPA 4M0EA 1FYDA 3M6VA 4ACBA 1NLYA 1TYDE 3LQ4A 3R9KA 2XEXA 2W6QA 2Y66A 3W2HA 1FTGA 1U3WA 3ZJVA 4PYMA 4BU1A 4EFDA 3TJZA 1IWPB 1ZFNA 2D5LA 2R44A 5C1IA 4ARCA 1J07A 3AHEA 2EP7A 2Q2OA 1EA5A 1W8DA 2WUWE 3BFKA 4DMRA 3NV7A 4WFKA 4CTJA 1E0KA 3WKDA 4TV8F 5FFMA 1E3IA 3VHLB 2AUMA 2OHJA 3GRAA 3S81A 1P5RA 1Q91A 4IHJF 3ZZ1A 2QUKA 1XCJA 5EIHA 3WRXC 2IBTA 1BAPA 3FX2A 2X3UA 4JC0A 4TLAA 1UMBA 1Y6QA 2GCGA 3HVIA 5E2BA 3UJ3X 1FDUA 5DISB 4V24A 3JASA 3U1VA 4HMQA 1CZLA 1AO3A 5EIXA 1UEIA 2P78A 3TQIA 2B0CA 3E1GA 1IJKA 5E6UB 5JQGB 3LI2A 1XN4A 1G1AA 1YCDA 2DC1A 2O2YA 3OLWA 2JGNA 2G9VA 5TLSA 2XHEA 1EG7A 5TPZA 4HV4A 4JSYA 2HM7A 3EGWA 3HKCA 1H2RS 3VRHA 1O08A 3HPRA 2J5QA 2H8GA 4BWFB 4EYEA 2O8BB 2R1UA 1AN0A 1ZD9A 2IQ5A 2H65A 3OY7A 3VDQA 5FYQA 2AKYA 2WPDA 3LXXA 6REQA 1HURA 1F0PA 3OEWA 2DTDA 5KNCD 2EHDA 1UJMA 4C6RA 2H4JA 2Q3DA 4GC9A 4IQ8A 2VDUE 4OXQA 1G41A 2K7ZA 4Y8VA 5JAHA 5KYWA 2AC7A 4IV5A 2ZI5A 1SVKA 2GCOB 4YP9A 2JH9A 5E1BA 4IIJB 3PQ4A 3IQHX 2EEPA 5LU8A 1VC2A 2BH9A 3U56A 1H4QA 1DAMA 3PDIA 4D26A 5LVAA 4P81A 2A35A 5DMXA 3ZWCA 2WIBA 1Y6GA 2WF9A 5CNJA 4YUZA 5BY2A 4F46A 4JROA 4ZC1A 5KNCH 4X1KA 3GA5A 3AR7A 3QVVA 2H1LA 4GS5A 1BRMA 2FMKA 4C0QC 2H5JA 4LYGA 3H2ZA 3M70A 1G7RA 3HNPA 3KYBA 3CX4A 4WBXC 4YGXB 4MS4B 2ZBEA 5HF5A 3TIXB 3U7QB 2HCFA 1Q14A 1KP2A 2JK0A 1SOAA 4YJ3A 1TAUA 1O0BA 2HLNA 2LBPA 2P9GA 3ASVA 2XOKA 3NORA 1DMRA 2J7PD 3QEKA 1VECA 3BWDD 4JBNA 3SVLA 4WLFA 1P19A 4WASA 5FTLA 3H2BA 9ABPA 2SECE 3I62A 1QGDA 5K0CA 2F7SA 2G70A 3IDAA 1MKYA 2HA7A 3G7NA 3K9HA 3R6WA 4MH0R 4CKWB 1RI1A 4TUYA 2AW3A 4ECEA 4EVSA 5C51B 3EGEA 3TLYA 4UMEA 1D4AA 1ISJA 4LZZA 3LD9A 5KNCA 2DFPA 4KXUA 5LIRA 3FPKA 1GAEO 4I5EA 4IIDA 4U2EA 3R76A 1CQIB 3QXCA 2WE7A 2VP3A 1ARZA 1V4BA 2FEXA 3UF0A 3B1ZA 3GOHA 4JBHA 5C7OO 1DSSG 3P4YA 3EVEA 1E94E 1EP9A 1XO1A 3BXEA 3KJXA 3NJ4A 4JLUA 4N3BA 2KHZA 4BRWA 4DM3A 3WR5A 1GFZA 1VZ3A 2B4QA 3ULKA 3RHFA 1CSEE 1KAOA 1U02A 3IPCA 3TX2A 1RIFA 1BH6A 1HDEA 1L5KA 3T4EA 3MS2A 1WU8A 2Z83A 1W2GA 5ICMA 1K6XA 2ONCA 3MYYA 3GDGA 3K8OE 4RM3A 3S1AB 2XSZA 4Q7MB 1JG2A 1VLZA 3KLNA 4D74A 5JADA 1N0HA 2GF9A 4Z0TA 4B3HA 3BGIA 3E2PA 3V7UA 2ZOSA 3JVDA 1A9YA 5L4SA 2QYOA 4IOLA 4DLZA 2EGGA 4TTVA 5BYJA 1CZUA 4E21A 4QRHA 5JG7A 2YXLA 3HJRA 4BFWA 1AA9A 1R4ZA 3II6X 1E2EA 1LJUA 1ONBA 2GCIA 2J7PA 3KYCB 4XSGA 3VX3A 1OZGA 3DE0X 3ZY6A 4RVHA 1SVMA 2OFPA 1N7IA 1LBTA 3B36A 1JDNA 2J4FA 3FKSD 4RW0A 4MWGA 1SBCA 1FS5A 1U2DC 1VRWA 2NPIA 3X1WA 1JILA 4HO1X 2X14A 1NUPA 4O2AA 4F4HA 2K2QB 5DBEX 2FLWA 2PX6A 1M5UA 5C4MA 2CLIB 4LXQA 3ZUGA 1QZUA 2DHRA 1XLTA 3LXMA 4HDMB 3ZCUA 1O87A 2GNOA 1Z33A 2GFHA 3RUAA 3C6MA 1M1NB 2R8RA 1UUFA 2PXAA 3R5FA 3TAXA 3MT0A 3CRZA 3G7SA 4KMMA 2YMMA 5HHTA 5I7VA 1SR8A 3CEJA 4YQEA 1R12A 4B32A 4DPLA 5IABA 1T4CB 1W85B 4E7OA 4RHYA 5EPUA 3VVMA 4CBVA 1DT3A 5CDGA 2V98A 3NETA 5JMWA 3AF6A 2QT0A 3N8HA 4US1R 1F7UA 1V11B 4XLTA 4JENA 1ZVJA 3DL7A 1F3LA 5EWMB 2WA2A 3HJBA 3CMMA 1RZUA 7MDHA 4LE1A 3PNMA 3K71B 1J2JA 1QV6A 1EI9A 3IDQA 4UCFA 2JA2A 4OAPA 4FVTA 4CM9A 4BCBA 3EXHC 4OJNA 1WQ3A 5A5EA 2BKEA 4LZLA 3ADCA 2WJGA 3EXG2 3OZGA 4XDHA 2IGBA 5DU2A 2IXEA 4JYPA 1F6WA 4AO6A 1L5FA 4UATA 3A6KA 1N6PA 5TEWA 1CRPA 3LPCA 1CY7A 5G0SA 1SZDA 3G2LA 3ZR4B 5DLPA 4HEHA 2QD3A 3V4ZA 5HWSA 1JB1A 4OH1A 4RD6A 1KQNA 2R8EA 1E5LA 3KSDO 1NQWA 1VKNA 1QO0D 2QA5A 3IODA 4BO7A 4NJMB 4C7XA 1DV1A 1MAAA 3GJQA 2NM0A 3B51X 3KKLA 2CHQA 1KYTA 3RHZA 4E5UA 2HEIA 2ICAA 1CDOA 2HK8A 3OOJA 3A1TA 3HY4A 4RQTA 3UK0A 3KKZA 3EQ9A 3GF4A 5DHTA 2WMNB 3WDKA 1RRFA 4DIMA 2D5IA 2WHRA 2PYZA 3BMNA 3UJBA 1VTKA 4C06A 1NSTA 1ODKA 4RS3A 2O6HA 5ERXA 1CRZA 1MABA 3F5FA 3GQBA 3MLAA 4HQ6A 1ID1A 3V8PA 2GN9A 4G07A 3WAJA 1PT6A 2DUJA 2E48A 4CETA 1E7WA 3BJMA 4BVAA 2RFLA 3OEHA 4BFTA 5JNRA 4PQEA 1S4MA 3A3PA 2FJUA 2P9ZA 2PBFA 4EY3A 3AP2A 3U4MA 4C08A 3BA1A 3I3OA 3PWSA 5LXTB 2ZR7A 4FFRA 4UUNA 4PXYA 3RI3A 2J4DA 1EP2B 1QV7A 2WP8J 3PHGA 4DSTA 2BYTA 1UZAA 1KI4A 2MSCB 4Y2UA 1RP1A 1AK2A 1ZZGA 1OGIA 1E4OA 1Y4DE 1U0EA 2J08A 3E9MA 3B38A 4R31A 2QN7A 4O5OA 3MVEA 2HSZA 2FGJA 5AW0A 1KEEB 5FTNA 1PTJC 3ACDA 1SZJG 4XQEA 2WHQA 4AK9A 3F1LA 5J3JA 1Q7BA 1JDSA 1Z0UA 5EZ5A 4PGHA 4I36A 4B8WA 3CLTC 1A9XA 5JXHA 1R0WA 1QO0A 4D82A 1DWQA 1MJ5A 2DFDA 4PRYA 4Q7LA 3JZAA 1WA5A 3ZDYB 4YREA 1PZGA 1GN8A 3EMBA 4DA4A 5CGZA 3GRZA 4M0DA 3UT0A 3B3JA 3V6MA 4M38A 5KDDA 4MRVA 2BZ0A 1VE7A 1CJCA 3DPSA 5L3ZA 3EQZA 3UT6A 3THXB 4GXQA 2V9CA 2QZZA 5GZ6A 3BMQA 1ZM9A 4FR0A 2PZ8A 4KC0A 1E7SA 3JQ8B 3UK1A 4V0NA 4FNGA 4EZIA 1E3WB 1UPFA 4ZO4A 3TMKA 2ERCA 3GZTB 3HLYA 3ROEA 3EAQA 2FUG1 4XGQA 1OC2A 1ZW6A 4A0GA 1P1FA 2Z3ZA 3L7NA 1IM5A 1BMFD 4JMPA 5AW9A 1UMDB 1Z4PX 4AN0A 4ZT5A 1SD1A 4CLRA 2IWRA 2WJHA 1NYTA 2PVPA 3CPHA 3N87A 3VKUA 1ZX1A 1WIWA 5JNVA 3KCQA 2OBBA 1GAWA 5AK3A 3CN9A 4ZU6X 4X0EA 4AY4A 3AEZA 1B6TA 1W5AA 1UADA 1GEEA 4GKBA 5ALUA 2G83A 3VZBA 1M34A 3GMDA 3ANYB 4AYTA 4XWGA 4QEKA 2DY0A 4JV5B 3F1KA 2BMAA 3HU1A 4HTFA 1Q2XA 2WOOA 5EWLB 2AI1A 1CUZA 4P3PA 1OBFO 4AROA 4KQXA 6PFKA 5JCJD 1E2GA 1E9VA 721PA 4QBIA 4M3NA 1QH0A 3FNQA 1L9XA 4JXXA 4PLFA 1KE1A 2HDHA 1E2IA 3RIXA 5MFZA 1XZMA 5FPSA 4DN6A 1W1IA 3CF6R 3KVNA 3QA9A 1BKDR 2D1YA 1QBKC 2OK7A 2WOJA 4ZALA 3A9VA 1II8A 1VPDA 4R1MA 1KH2A 1JYFA 3OOWA 4B6RA 2X6QA 2OC4A 5JD5A 2HMUA 5CB4B 3OFKA 5IDVA 1J0BA 5J4YA 2R6DA 1UANA 1ZOSA 3G1UA 1GYPA 2YCLA 4NF2A 1DRKA 3PQ8A 4GU5A 2EV9A 2OHGA 3VDRA 3ZKWA 4Z3DA 3ZBTA 1N33B 2ANCA 2I99A 4HNAA 1XYYA 3P96A 2OZLA 3TXXA 1MO3A 2P2YA 2JLVA 2QR3A 4FOSA 1T24A 2G1AA 4HSEA 4C43A 3VI4B 2CVHA 1B8OA 1ZRHA 2JBWA 1X9GA 4N7JA 5P21A 5CBKA 3CXRA 3LKBA 3LSTA 4R71A 1VL5A 1WB5A 3G2HA 1IYZA 3Q0IA 4W5HA 5J9FA 2BGTA 1T4GA 2IDZA 3WB2A 4US2R 2VHCA 2PSEA 4KYVA 2QNRA 4XVRA 3GEHA 2OC9A 4Z51A 4NZMA 2HD4A 1ZM2A 2O2ZA 3GELA 3LHDA 3AGPA 3EAFA 4PZZA 3BXGA 4RJIA 5JCJA 5BVHA 1JECA 3WYDA 2E82A 1ISFA 2NUTB 3H5IA 2QRHA 1LZLA 4OBEA 4Q3DA 4YMSA 1Q21A 4OIFA 4YP7A 5IVDA 5KNDD 2IV2X 1W36C 1VL6A 3NEYA 4GBJA 3H5WA 1PD1A 3IPAA 1XJQA 1J7KA 3M83A 5JO0A 5CIWA 3JCZA 1WY7A 3DGFC 2HK6A 2NXJA 5HIKA 1T0PA 1KDPA 3HXLA 2CVOA 3Q6NA 2GILA 1NYQA 4LRWA 3T1VA 3W0LB 4E12A 3HRIA 2OQVA 3AMVA 4EPWA 2IBMA 4Q9LA 2IPMA 4KL8S 4FWBA 4RV4A 3MMZA 1XDBA 1M2OB 3ADOA 5IT0A 1PJZA 4MW7A 3PFNA 5CYGA 4DWJA 5KNDH 1JYEA 2V0NA 2HRRA 2VKTA 4L5AA 1WB4A 3IP5A 1LV8A 4JOCA 8AT1A 4X62B 2PMKA 3E9NA 3ANLA 3QNUA 5HS6A 5J4VA 3GW8A 4XRRA 3PEEA 2HC9A 1UAGA 1A04A 2I4TA 3M6LA 5REQB 1EUZA 3FAKA 4FKMA 4GVPA 4JBLA 3QQ5A 2P6PA 2AR7A 3N7TA 3T38A 5HNKA 2WQ7A 2C7OA 1Z7GA 3FYCA 4UBLA 4J4BA 5E6UA 4ZO6A 5H0IA 2WM3A 2YH2A 3K1JA 1UDRA 1YR6A 1TKAA 3M0EA 4EZBA 1DJMA 5EJ7A 1E60A 3RC8A 3OU2A 4RFSB 4NFLA 3SYMA 2IUYA 2O8BA 4E03A 3LUDA 4OB8A 2V7GA 5JWRA 1EH5A 2EBWA 2GK6A 2BKXA 2BFAA 3GGPA 1J49A 2E4UA 1X3LA 4X65B 3ZC3A 3LGAA 4GMDA 2V6JA 4GLJA 4RD4A 5M2QA 1A9TA 2JGFA 4PQYA 3FVWA 3IELA 1Z4LA 1BJKA 2B9EA 3Q5DA 2HFKA 3KU4A 4IIJA 2TSYB 3Q7EA 3TLBA 1SCIA 16PKA 3G9TA 3WJ1A 3W3AA 2H31A 1VL1A 1BWQA 2VK4A 1E2NA 4G5YA 3W8DA 2V1UA 1FFYA 4BP8A 1XTIA 4BLRA 5G0UA 1N57A 4CRWB 1PFKA 1K92A 1SOVA 3IMGA 4ZCSA 2BUAA 2D4HA 2BVNA 2SNIE 4WFJA 2L82A 3HHPA 1SXHA 3I37X 2PUCA 1HWYA 1I36A 2D7JA 4J1TC 3U7QA 5TVGA 4JP2A 1LSUA 1Q83A 1KEPA 4LDQA 4MS4A 4AY3A 3PEVA 1TJ4A 4DMMA 1XQYA 4A1FA 1V43A 1DRUA 4AG3A 2A57A 2C2GA 1ZUD1 3CLHA 5HFJA 3RJ9A 3QY0A 4RAOA 2D2VA 2CLDX 1IN8A 5GQSA 1DAHA 2XADA 2RH9B 5TGDA 2PWYA 4OSEA 1NVWQ 1PG0A 2EJVA 4RSMA 2LWIA 5AM3A 1TM1E 4CKWA 1KEVA 4R68A 3Q9LA 4BO1A 4DCSA 3RVJA 4DCJA 3COWA 1HEIA 3SXPA 5F2OA 2I6TA 5HUJA 4KB5A 3DDCA 1GG8A 3BRCA 3WLMA 2FZGA 2WJIA 4ZREA 1CQIA 4AY2A 4PXSA 2QRMA 4Z54A 2OD2A 1G5FA 3PGKA 3W6UA 2Y76A 1SVNA 2FPMA 2XJ4A 3LPDA 3O21A 5IARA 2VHJA 4KRXA 4OQEA 2VP2A 4POAA 3MN1A 4NZPA 3RVPA 5BSRA 4EMBA 4Q3EA 1Q1BA 2FZLA 4CHTA 2Q7XA 2EKPA 1VIYA 1GR1A 1VIVA 4I4LA 4PFSA 3V4PB 3W34A 3WLRA 4ZVUA 4WBNF 1N7HA 3LBAA 3SDZA 3S1AA 1UDWA 3BREA 1NG1A 1MLDA 1QQ6A 3BWVA 3EGIA 3I64A 4FC6A 4RZXA 2XXBA 4JQYA 5EJGA 2E4XA 2WWTA 3Q2OA 3KWFA 5FLXA 4FFPA 4LFAB 3KJEA 3FKQA 5CM8B 2J6BA 3EGDB 1W49A 5E3JA 4D5EA 1RYNA 5KYUB 4KXYA 5H81A 5JWHA 3KYCA 3RUPA 4UTPA 2IYRA 4KV7A 3IAM6 5EVCA 2Y71A 1A9SA 4GMGA 1JG7A 4YUYA 3QENA 1P8AA 4N0MA 5IC5A 5DIFA 5AXAA 3RSOA 3NHRA 3H2KA 1ZKDA 1WV0A 2HQ1A 2IUEA 4JJZA 3ND5A 2AWNA 3ZWOA 4HDMA 3C3JA 1V4VA 2Q4OA 4Q3NA 5AP9A 3X1XA 4JI2B 2G80A 3RDPA 1NP6A 5H3HA 3SZGA 3H4MA 3WLNA 2IC5A 2PUDA 3AY0A 2GN2A 3TN7A 1RD4A 2P27A 2YRFA 2FWAA 1NTRA 3KFXA 2CVFA 1JKJB 1O4WA 1LEHA 1KU6A 1M5RA 5C8YA 2C9OA 1I1QB 1F1JA 1T4CA 1W85A 4LJSA 3SMQA 1F5SA 3THOA 3UH0A 3JWHA 4UPEA 1GCUA 1XRLA 3J7AC 3ZCVA 2Y1KA 3HP7A 2NTNA 3TW4A 1V11A 5DCYA 3MBIA 4FFMA 4M1OA 4NU6A 2VJAA 1ILEA 1WMAA 3ONEA 5EWMA 3I1YA 1QYIA 4OJYA 3M5CA 3R7SA 4D43A 1E6KA 2P5TB 3TLCA 5DM70 1BWSA 1SXJD 1G7SA 2IYNA 4KNWA 3VR3A 1UMKA 1YULA 3NUQA 4PICA 5IZCA 4RZ3A 4PLZA 2OORC 3TI9A 1VPTA 4O1IA 4EUSA 1ISGA 2C5LA 3HQ4O 4IO0A 5LNK1 3KUCA 1P60A 1TMKA 1ZXXA 1R50A 4PYQA 4M55A 1PN3A 3PJGA 4ZCPA 1IN4A 3EWIA 1U65A 1FUYB 2NTEA 4Y2JA 4BVBA 3ZDBA 2NVOA 4AAYA 1DKPA 4PZPA 1WWKA 3PXDA 4L57A 3UFXB 5ICCA 4J9UE 4DAOA 4AG6A 1DG3A 2WUVA 4OQFA 5AICA 1Y3FE 1E1CB 4U7FA 3WKCA 3NOQA 1L8XA 3DQPA 1W8IA 4YJKA 4F3CA 2QJWA 4NJMA 4RD2A 3U4QB 1SHTX 1TM5E 1J8MF 4HNRA 1N2XA 4TROA 3MD0A 4OMUA 4KVFA 1JKIA 1NJ1A 1CUVA 1T29A 4RVSA 4DMGA 3TM5A 3UATA 1AQIA 2VTVA 4JDUA 3WGOA 2WYIA 4EHDA 3ELUA 2I67A 3SHWA 3T9EA 1DXQA 3LX5A 5A4DA 1YE3A 5AI0A 4L3OA 1VBNA 5G40A 2NZ2A 2ZYTX 4FONA 1I51A 1AKNA 2OK8A 2QRPA 2UYGA 3LCRA 4TMTA 4J7UA 1G1MA 3AGQA 4EG7A 3NHBA 1SXJA 2CXHA 3Q72A 4TXLA 1ZM4A 2TS1A 3N58A 3PF8A 4PFKA 3V9PA 2IY8A 4KV9A 3FTDA 3W1VA 2OWDA 4MGZR 1JQ5A 1RJEA 2ZJFA 4MPDA 3GZNB 1VSBA 1QVWA 1U3DA 1B6GA 2FHPA 3G0DA 1CIJA 4URWR 3UGKA 5AVZA 2P40A 4RY9A 5H3CA 4C0XA 3U6BA 3FTCA 2CUZA 1B0UA 4LZNA 3FJ1A 3GEEA 5EP1A 4A8JB 1E77A 4M7PA 3ADBA 2ZVPX 2IS1A 4MV4A 4UHHA 1G8PA 4D8WA 5BSHA 1KEEA 1LU9A 3LX4A 1OA0A 1N7JA 2F3PA 3CRVA 3ZI0A 4KXQA 2AH5A 1CYDA 3BOSA 4FUTA 1PVVA 1DWPA 1SBHA 1I3CA 3DP7A 1WZIA 1DCKA 1K0UA 3KQPA 1D0VA 3N28A 5DX1A 1GVHA 2J0EA 2G67A 1QBGA 4OJQA 3OZFA 3A1VA 5J1SB 2YVUA 3THXA 4DKJA 1R0SA 1T5TA 3ZCSA 4UEQA 1YSCA 4UAVA 3JQ8A 3KOUA 4KACA 4P36A 2XKJE 5F78A 4H7FA 1UK7A 5I8PA 1H42A 1E3WA 2PH7A 3NB0A 3O1HB 4G8BA 4GVLA 4KO2S 4V03A 3RK1A 1DKRA 1CVLA 1QHHB 2HWXA 2ACKA 3V8RA 4C5CA 1RSZA 3DO6A 1ZH2A 2AEEA 2FI1A 1WVIA 1UMDA 2ONJA 3V8NA 2NSJA 9ATCA 1OUMA 2WWXA 3RU3A 1XDSA 1UQTA 5FF9A 4B45A 4URZR 1ZJ6A 4BMYA 5DM2A 2DLDA 3KKKA 4EY6A 4WNCA 1R0LA 4FYWA 2ZJ0A 4JJEA 4E70A 1KVQA 3QU5A 4LWQA 1R8JA 3L3BA 1P9LA 3BAFA 5CG2A 5JI2E 3OMLA 2QAGC 2OO7A 1Z0AA 4V0MA 5BSFA 1TKCA 5EAIA 3FWZA 4PZYA 3WY9A 4MUEA 5FHRA 2IY9A 2PKQP 4OXXA 4YLEA 5DI9A 5EWLA 4EZEA 1XLVA 4EECA 1N8SA 1PLKA 5HF9A 3WQRA 1Z4JA 4C4AA 1CY4A 5IFKA 1ECBA 1KFKB 5D1NA 2HGZA 3EIHA 4WESB 1Z56C 2JGAA 4X8LA 1YL5A 4M83A 3VMMA 2QM0A 1BWRA 3D6NB 4U8GA 1I1NA 3FRHA 5IULC 1BW9B 4GDMA 3U7RA 2OBYA 1D6SA 4O4JB 5JCZA 5JNUA 4G0WA 1DFHA 2GK7A 3TTXA 2YS6A 3SG0A 4PSCA 3VHXB 4DZRA 4ZANA 1A77A 1JDJA 3WLTA 5CB4A 1V3TA 1ADGA 3O82A 5GMOA 4EG8A 1K7YA 2XKBA 4Q6BA 1G19A 4F4UA 1PBNA 4ZZ2A 3HSYA 1H4VB 2ETVA 1L4MA 3EIFA 1BEZA 3MTJA 2QLMA 3P0FA 4R9RA 4MB2A 2FY8A 1SIBE 3ZV6A 1J5PA 2OCXA 3KT3A 2Q5IA 3QPAA 4TLDA 1H23A 1RPJA 3NGXA 4ZYLA 2C4TA 4TMVA 5F77A 4ZU3A 3RFUA 4KQ1A 3E5RA 5DNAA 3DAOA 3DKVA 1NKTA 3G9ZA 2DHCA 4FOLA 4I5GA 2Y0CA 4PC3A 3UWDA 4BNHA 3ZH2A 1OWMA 1X87A 2WG1A 4BNXA 4F38A 3VC1A 3I1JA 1N2GA 2WYHA 3F74A 3DXFA 3EXEB 3CB4A 3KPVA 5GONB 4DQLA 2Z08A 4YRZA 3T4UA 3ZD6A 1O9HA 3VDMA 3ZWVA 4EGJA 5LOVF 5BNTA 4V1CB 4QQKA 3S44A 2ZEJA 3A1NA 3F46A 1NVMB 4FHCA 2GN6A 2Z5FA 3DV2A 4K9SA 3MUFA 4UUBA 3I6IA 3TRHA 4E22A 1W5FA 3ESXA 1TPYA 1GRCA 3CZMA 3D8HA 5IUNC 4Y0NA 5AVXA 2ATXA 4KFRA 5JYDA 1L4LA 1S2DA 5HQ3B 4W9MC 1P0QA 1YRLA 1JWBB 3AVTA 3RFFA 2MSKA 4YT2A 1EUCA 1QHXA 4P5DA 5I01A 4HTAA 2AS0A 5FLYA 1NM5A 1H1LB 1DBPA 2HMTA 3OZVA 4PCVA 4Z9YA 4EL0A 3CW2A 3RRJA 3F5SA 3UCFA 2X4IA 3PNOA 1M2OA 3AF2A 1I6WA 2CKDA 3GJ7A 2R8PA 4LWZA 5LP1A 4KEAA 1S01A 2JANA 3PHHA 3W8RA 1LLFA 1TA0A 5AM0A 2ZTLA 3QW4B 3DCNA 3IHWA 2J7KA 4D3DA 3TZCA 3SPXA 1IEWA 1V6SA 2HH9A 1G9TA 4H6VA 5L45A 3G1WA 3P2OA 4O4IB 1U4OA 2A5YB 4MS1B 1G38A 1Y9EA 2GJ8A 3FIJA 4A26A 3NO4A 2VATA 2JI9A 3NC1C 4NIMA 3HBLA 4LJ4A 4UBKA 1UM8A 4UTZA 5FNVB 1G8GA 1C8VB 4CNBA 3O31A 5EJMA 4ZZ1A 1NF3A 3O84A 2QZ9A 4MINA 4WERA 1Z15A 2OHVA 2O1EA 4DA6A 4RFSA 4YH1A 1QF6A 4JBGA 1Y3HA 4AJLA 2O4CA 5LQJA 4W8OA 4OK6A 2EIXA 3I1FA 2EJUA 1W25A 3L7KA 2PKEA 1CRWG 1SKBA 2Q5OA 1N7GA 2AEFA 2JKVA 1NVVR 1YU9A 1LQUA 3B5IA 3HMQA 4UNIA 5E6SB 3LOUA 4RTRA 1B23P 3H5VA 4ZWNA 1GPWB 2FOLA 4A0HA 1X74A 2DPMA 2ZWIA 3CVJA 3KVRA 4QBGB 3QBEA 3IAXA 4CTMA 5JJCA 2V6BA 2X6RA 4KAFA 1GD1O 4DMKA 4Y6PA 2W2OA 4BE7B 3MC1A 1NC1A 1SVSA 3U09A 5TF0A 1DEKA 1NUQA 2CBXA 1MXHA 3ROQA 1YI0A 4AZVA 3RTAA 1CF4A 3QE0A 1FMLA 2XF8A 2JAPA 1YJBA 2DFVA 4J3JA 3PXUA 1SH7A 4N39A 4YONB 3QLVA 4OGWA 3O3OB 1W75A 3UAZA 4S35A 1JI0A 3OVMA 4PTLA 1HZZA 4U63A 4MW9A 2I55A 1M8PA 1BFKA 1Z2NX 2A86A 1LW7A 1DDOA 2QRZA 3L8FA 3ND8A 3NNSA 2PR7A 4QYIA 4B1FA 3NBZC 3T7KA 2HSJA 3PKIA 2GVDC 2WHEA 1YJAA 2WSIA 4D4IA 3CZQA 3SWWA 2P2LA 3ZJUA 4GH5A 2K5UA 2YXPX 5KYTA 2OP1A 4L50A 4B31A 3PLAE 2FEWB 2LV8A 3OI7A 1ENPA 4KJZA 4MW0A 5DASA 5EQFA 5EPOA 1WL8A 2H08A 1R5BA 5E2AA 5DIZA 5KWIA 1GARA 1H85A 4JLNA 2AXQA 1XK7A 3WLHA 3HO6A 3THWB 5KJ6A 4MKXA 3G02A 4DA8A 2QVGA 4QIHA 1ZR2A 1U8AA 1RQXA 1U5BB 1IZZA 1PL0A 2RGYA 3SX0A 4IF4A 2M6LA 2IRWA 3H1GA 1TQ4A 1OPXA 3OE7D 3STTA 3FCOA 2BGNA 4BV9A 1SCDA 3UJ6A 4MW6A 3ROGA 3RRMA 1VXOA 4F7DA 5BUZA 1M2KA 4BFLA 5IAOA 3CG0A 3SYKA 2Q3HA 2IZ6A 4AB1A 4E5VA 2Z6QA 1FMJA 1QPGA 2PRSA 5SZJA 1UDXA 3K1ZA 2BGGA 1MOQA 1XN1A 3D54D 1NV8A 3E3LA 1RPNA 3CLSC 4CUJA 1T2NA 2ATCA 2QSZA 4ZCQA 5KU7A 3KZVA 2ON6A 5I7WA 1E9FA 4Y98A 2C3YA 2QUBA 4PRZA 4F04A 1D8AA 2FUNB 4YMIA 2WD7B 1FTWA 1RLUA 5ANRB 4J4TA 4HAOA 4Q21A 4URHA 4F21A 1PR9A 2ZB8A 1FB5A 3ENZA 4PZ9A 5CLGA 5KYUA 1MD9A 2PX4A 3FB4A 2PSSA 4IJQA 3E35A 3KQVA 4F5EA 1Z0IA 3OQHA 1JXAA 4BUJA 2W42A 5HKOA 4QYMA 5EEHA 2IUSA 3GFQA 3ORFA 3CX8A 3CUTA