1TZBA

Crystal structure of native phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
301
structure length
301
Chain Sequence
SQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLYISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDGLLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQMGVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPEGLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEFNENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEHQERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLAEIRGVNPLATPRIDALKRRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glucose-6-phosphate isomerase, conjectural
publication title A novel phosphoglucose/phosphomannose isomease from the crenarchaeon Pyrobaculum aerophilum is a member of the PGI superfamily: structural evidence at 1.16 A resolution
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Isomerase
total genus 113
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10432 bact-PGI_C Bacterial phospho-glucose isomerase C-terminal SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1tzbA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1tzbA02
3T1HB 1X9IA 4DR1B 1IRIA 1JEOA 3PR3A 4JI7B 2CXPA 2HHHB 5LMUB 4JI4B 4JI0B 1IBKB 4K0KB 2POCA 4JV5B 2UU9B 1XTBA 4U6NA 4LF5B 2VQEB 2I2WA 3J81A 2A3NA 2VF4X 3BJZA 4DV4B 1HNWB 1TZCA 4LZJA 5FLXA 2UUBB 1DQRA 2PUTA 2UUCB 1TK9A 2CXUA 3OTOB 1GZVA 3BCHA 1NRIA 1T10A 3FKJA 3HBAA 2XBLA 4DR7B 2J6HA 1HNXB 3T1YB 2CXQA 5IT9A 2PUVA 4NXNB 1WIWA 3Q7IA 3OOJA 3ETNA 1C7QA 2WU8A 1ZZGA 4DR6B 1MOSA 1U0FA 1VIVA 2DECA 1G98A 1B0ZA 1VI5A 3TRJA 2XHZA 1HR0B 1JLHA 1VI6A 2VQFB 4DR3B 1HNZB 1IBMB 4LF6B 2UXCB 1VIMA 4TOIA 1C7RA 1I94B 3QKIA 4GKKB 4X65B 2PUWA 4DR4B 2CXNA 1X92A 1MOQA 2E5LB 4JI5B 5BR8B 2O2DA 3IFSA 2ZJ3A 4LFBB 3FXAA 3J7AC 1N32B 1HOXA 1XNQB 4EM6A 2PGIA 2DF8A 1NUHA 1IATA 2CXTA 4DV7B 2UUAB 4GKJB 3KNZA 4NXMB 1IBLB 1N8TA 4JI3B 5LMNB 5LL6P 4LF9B 1X94A 3G68A 4DUYB 2CB0A 4AMVA 2O2CA 4LFAB 2Q8NA 1J5XA 3Q88A 5I01A 1N34B 1U0GA 1HM5A 2CXOA 3FF1A 4YHHB 4DV3B 4B3MB 1MORA 5BY2A 4DUZB 4DR2B 3CVJA 4M0DA 2X3YA 4YY3B 4X64B 3FJ1A 4KHPB 3JX9A 1JIQA 4S1WA 4LF8B 2CVPA 4DV1B 5IWAB 4JI1B 4JI8B 1X9HA 2ZJ4A 3HJBA 2ZM6B 4LF7B 4DV5B 3NBUA 4S12A 2VF5X 4IVNA 3M5PA 1XMQB 1FJGB 1XNRB 2V4MA 4B3RB 2AMLA 4DV2B 3EUAA 1J5EB 1TZBA 3LJKA 2F4VB 2YVAA 4DV6B 4JI6B 3JAMA 4OX9B 1U0EA 2I22A 3C3JA 3I0ZA 1KOJA 4LFCB 3SHOA 4DV0B 1XMOB 3ODPA 4AQYB 1N36B 4B3TB 4B3SB 3UJHA 1Q50A 4X62B 1M3SA 3J80A 4DR5B 4LF4B 2CXSA 1GZDA 2E5FA 5A2QA 4X66B 2CXRA 4JYAB 2UXDB 2UXBB 1JXAA 4JI2B 1N33B 3TBFA
chains in the Genus database with same CATH superfamily
2FW9A 4IIVA 1N77A 1GNLA 2HU2A 2JFUA 3OUZA 3MMXA 2J3HA 1JSRA 1XDWA 3DF9A 3PC6A 3OLZA 4HXEB 1EX1A 2XRYA 3DXZA 2J3LA 3KKMA 1H2AS 1WPXA 1NATA 4H7PA 5BMVB 3TSCA 4XR9A 4F6RB 2BELA 1SOUA 2ZSUA 3HA7A 4AJKA 2MR6A 2Q07A 4FC6A 1D07A 1SB9A 1YS6A 1AQ6A 4AUEA 4WBNA 1G9TA 1RMQA 1A7UA 1U65A 3ACBA 5JJCA 5DYYA 4FJ0A 2W00A 4XIFA 4JLMA 3RK4A 1ONNA 5CA0B 3BMCB 3KYDB 4JXXA 2H1CA 3DMHA 3BORA 4FILA 4R1LA 2B1GA 2D3WA 3PXAA 3D59A 3OWHA 3HH8A 3MMZA 1DTEA 5AVOA 3FLMA 3OC0A 2BMWA 1BEUB 1UQRA 3KL2A 4MV8A 2JFQA 4QUEA 1P2DA 5K0NA 5U4QA 4BAGA 3WMGA 1PV4A 4DQKA 3L18A 4N76A 1LSJA 1PHRA 2RHGB 4UUMA 3OO0A 1SXJC 2GFIA 4Y9DA 4FONA 4ROSA 5TQ2B 2TS1A 3HYLA 5JUWA 1L6RA 1UBRS 2XNHA 4JI5B 5EESA 4LFBB 4LV6A 3CB2A 3D4OA 2CE2X 1EDDA 5AHRA 1M2NA 4HMQA 5E4JA 5G3YA 3ZXUB 5JCPA 3LSTA 3LTNC 4TKMA 1BX0A 3Q41A 3GLVA 3AVPA 3WIBA 4C9BA 4RIGA 2DPGA 4HL6A 4TLMB 3FOBA 3CZMA 3OF5A 3KRTA 3HZRA 3BULA 5CFQA 3C6ZA 5EXPA 1QZ3A 1NOIA 1KR5A 1VJ5A 1GG9A 2I6UA 2G9RA 5GZ3A 2XGSA 1S89A 4H17A 3LWBA 5DK4A 1JR3E 3L8DA 3MJDA 2P9FA 4HUTA 3CW8X 1QYIA 3P9NA 1I1QB 3EARA 1I36A 1MQ8B 1THZA 2Q6OA 4M87A 1C41A 2B20A 3OZGA 1NPDA 2XEDA 1CQXA 2RHMA 3WKEA 1OYOA 2W6IA 2JIZD 3V4LA 3HP1A 3IP8A 4AJOA 1V4VA 1M1YE 4JI1B 4N3NA 4GZMA 5FWYB 4WXYB 3AJEA 2XKBA 1XQXA 1HY3A 3EXFA 2IVZA 4LSMA 4IS2A 3CXUA 2QVZX 2Y1GA 4KAFA 3V32A 2IHZA 4YI5A 2R44A 1QH1A 4ARVA 3P0IA 1A9XA 1ODJA 5C5DA 4HY3A 2BKUA 4QXAA 4U1RA 2F4VB 4CF4A 4QFDA 3R23A 5DI9A 5AOAA 1CNMA 1PQWA 2WHPA 4KDCA 1VE1A 2A33A 2OCKA 3PRHA 4XWOA 5ALQA 1QM5A 7MDHA 2L42A 1ZGJA 4Q0MA 5KYWB 5AI5A 4Z9YA 1ZEMA 1LF0A 2PA0A 4HD8A 3U5TA 4HJRA 1O8CA 1O77A 4RM2A 4C05A 3KEGA 3N2ZB 3BWMA 1JVNA 2ZRPA 3MMNA 2I7DA 5CT8A 3BD9A 2VHWA 1QDUA 5DHRA 1TM3E 5C1PA 5A62A 5HILA 3X2SA 1U9IC 1P5RA 4WXHA 3N6RA 5TR9A 2SKCA 3WK7A 3Q0TA 2B8WA 4RD4A 4W1RA 4QTZA 2IHKA 5D86A 3VPAA 3QMWA 3RK0A 1ZAKA 4ZC8A 3OPYB 2NT3A 4E46A 2BFAA 2DMRA 4HG2A 3DVRX 2EZ4A 4GKBA 4BB9A 1QSGA 4KXMA 1KC3A 1OXKB 3DO5A 2Q5OA 3JALB 3D6FA 2JLUA 4WKOA 4AJLA 4R2LA 1EXNA 1Z0ZA 3UN1A 5HNKA 1KYTA 5LQDA 2PKQP 3NBXX 1QFJA 4GNKA 3U3KA 2OSVA 4U9HS 3RJZA 4G4SO 4OSOA 4YROA 2AZTA 1F06A 4TL7A 1IJEA 2V6IA 3PLNA 1GGKA 3MSCA 2QVYX 1COWA 1ZIYA 4ZEOA 4FB4A 3R7DA 2I9PA 1ZBQA 1IHDA 2GCOB 1I3OA 1E1CB 1NVFA 3V8EA 4EMUA 1BXGA 2C8JA 3AEKB 4YQFA 2WPDD 1P77A 3G9TA 1UIMA 2GF2A 4FMDF 1ZH0A 5M3BA 4E1VA 1YVRA 2N42A 4TRRA 1PZHA 3VYVA 3FPHA 3IODA 2KS6A 2ADOA 3D8UA 3EUEA 4MUIA 2GXSA 5IN4A 3U37A 2GTHA 2V03A 4MKRA 2GLXA 3FNHA 4H27A 1P80A 3PG5A 4FLEA 5BR4A 1EGMB 5HUHA 1ESEA 1GILA 2UYOA 3K9WA 3E22B 3KWMA 4MVJP 2NVOA 3RSZA 3Q5EA 5LQAA 2PUJA 3PEWA 2R00C 3QV1A 4KTTE 5JQGF 3ZY3A 2OAQ1 3DV9A 3LL4A 2JFXA 2PSFA 4CTKA 4JNCA 1RTKA 2P0EA 1I32A 3N75A 4L8WB 5EIWA 4YMVA 3CF0A 3L8EA 5FHRA 1U7UA 1SN7A 3BIOA 3FN4A 3ESRA 3WBBA 1IXYA 4UAJA 2XUFA 4U2KA 2EX4A 1Y3DE 4I5IA 3I5UA 4BLQA 5EIBD 4DV3B 1Z2PX 2ONYA 1KXJA 2JFVA 3H5VA 3IAAA 3L6DA 3LO8A 1ZWKA 2HRRA 1E0SA 3I58A 4MPJA 5AICA 3JQAB 4Q9LA 4ANFA 4CT0A 1SA0B 1CS4C 2VC2B 5AESA 4HGQA 4Z3KA 1GAXA 2HFKA 3GXBA 4JR1A 4M9SA 4RY2A 4Q7QA 3ZWKA 3H5OA 3NH9A 2OAGA 4XGKA 4PFKA 2F3SA 2ODNA 4KV7A 1O57A 1Z73A 4EMBA 4DAOA 2BT4A 3LA6A 2FZEA 4QG3A 3SIPA 4OUKX 4P2GA 2VVTA 4C1BA 4BKMA 2R7NA 1VJTA 1ZI8A 5ESXA 3SIXA 1G38A 3ELDA 1AQLA 2EBWA 3AR6A 1IULA 3TKYA 5FWNA 5TIIA 1LUAA 2J85A 4Y6OA 1GKLA 3AHCA 4KUEA 1CNEA 1QX3A 2QNIA 2DZDA 5F4BA 3HR4A 1F9AA 3IRUA 2IYTA 1Z13A 2NZ8A 1T13A 2PM8A 3G8AA 4KVZA 1Q0PA 5CM8B 3WRYA 1DHRA 2I34A 3LUKA 5ALJA 5TGZA 2PZEA 3L0OA 1QP8A 1R0RE 2ACWA 3DE6X 2AFHA 3FFAA 3VSDA 3PDIB 4FSDA 4YCBA 5TQJA 4XA8A 2OGWA 1R4NA 2O6LA 1VCMA 2O9JA 3D6JA 3QX9A 4MUHA 4KQKA 5LXTF 3SBXA 5G0WA 1WU7A 3DOHA 3IPYA 4OREX 3PR1A 4BVKA 3KCQA 3LNCA 4BVLA 1JQDA 3D0QA 1J70A 2XTAA 4KV9A 1KBZA 4Q4CA 5JS6A 1G2OA 3V9AA 3FBGA 3QBVA 2B78A 3KB6A 4AJ4A 5JWRA 4QOSA 3M6AA 5JU6A 2Q4DA 1BMDA 4BBAA 3HFSA 4H3KB 3AVYA 4U6NA 2DT8A 2XH8A 3C6YA 3RPEA 1DQNA 2Z98A 3ZXSA 1W94A 1HDOA 1P1RA 2A7QA 3LCMA 1RYYA 3LLCA 4EI9A 2ARKA 3LUHA 1JG7A 1R8SA 4ABYA 4CVNA 4N12A 4HVLA 2UUBB 1CC1S 3QKSB 2PJZA 1L6IA 2XZPA 2ZDQA 2Z0MA 2Y8EA 4MA5A 2NP6A 1DEAA 1ORHA 2R6AA 2RBKA 1A2BA 3QVMA 4NPCA 4PSAA 4F45A 2R1VB 4UOEA 5DLEA 3WGUA 2L82A 3KPWA 4Y2GA 1PR1A 2WAYA 2VAVA 4A6XA 4TYYA 1ZZGA 1EXVA 1NBMD 1S2DA 2VDQB 3NRJA 3BS4A 3SVLA 2HF7A 2RHTA 3EXHC 5DHUA 4MUGA 3HXQA 3HU5A 1F1JA 3HS3A 1QC5A 3MWYW 4H6VA 3QUBA 4RHTA 2X5OA 1IHUA 2RGBA 1U94A 4QJ4A 3ZHQA 2PXHA 2D00A 1GWNA 3IRVA 4X1KB 5A3VA 3GARA 3RSOA 1FVOA 1BQ3A 1CR0A 4J16A 1JA9A 2HWUA 2MTBA 3EGOA 2BZ1A 2PGIA 3H2YA 1WD5A 2Q9AA 3DULA 3RS4A 3ZDRA 1QVWA 1UEXC 3TZHA 1BD3A 1GKYA 3BE8A 1P4GA 3FVTA 5F2NA 4R2MA 5GM1A 2ZOSA 4R5HA 1RYNA 5F3DA 2P9ZA 1MAWA 5C1IA 1JDBB 3BCRA 3BXZA 3F67A 1EUDB 5DHTA 2R62A 4V0RA 5HJ7A 4KIFA 4X1IB 3U7IA 4FIZA 1YZNA 5A5FA 2L0XA 5JJKA 3Q4GA 3E6AA 4IMPA 2FK7A 2XYHA 3R3SA 5F51A 4KOEC 1O08A 2NW6A 4CETA 3HYSA 1F5SA 3P7MA 1Z5OA 5EP3A 4JLSA 3V2HA 4MCJA 4TTPA 2GN1A 1DAGA 1QPGA 3VC3A 3TXYA 4M0DA 1BNCA 1H1DA 2C5AA 2K7ZA 3O92A 4IDCA 5CITA 2CK3D 2QD1A 2EQBA 4AZSA 3I45A 3TLGB 3CLTC 1EP1B 3KVOA 1C81A 1ZOIA 2FRXA 1E7QA 1M10A 4IH4A 4PLCA 3TAHA 3WV4A 2FKAA 3NIWA 4RMNA 3BXEA 3MJFA 2XTZA 5KU7A 1CIJA 4LXIA 3LAWA 4EVSA 5K8IA 4MVJG 2ZVJA 4HDOB 1XMQB 2GCEA 4UD2A 4DBVO 5IKMA 3D7LA 3O4IA 4BNDB 4EFKA 5CB8A 2W11A 2RARA 3C3KA 2I2FA 3ZU5A 1PD0A 3E8MA 4NBWA 5FADA 4EJSC 2IH5A 1PLKA 2QPTA 2WUDA 1Y5IA 5BN3B 4QZVA 1L1RA 4Z53A 3T7RA 3FVQA 1MU0A 2R6ZA 3I8OA 1DKUA 5BR7A 1NXOA 1VL8A 1F4PA 1SJ9A 3LTEA 3UUFA 1TL7C 3DEYX 4E33A 4CR7A 4M7RA 5A2GA 3OZUA 2L69A 2R8YA 4H6PA 4MPPA 4IHJB 2PPLA 1IJFA 2WG0A 4PG5A 4RVOA 3I6BA 3REQB 3UWPA 4JU9A 3WKBA 3QVKA 4ZAZA 5ER9A 1E1QA 1SG0A 2FOIA 3LVFO 1W4ZA 3N28A 4G63A 5C7OO 3BYZA 4RANA 3IILA 4NCNA 1G59A 4EEZA 3ECCA 1L4GA 4X93A 5KINB 4RHEA 2AUTA 4I5GA 2POCA 3PUWA 2SICE 3JTMA 3LT0A 1E89A 3MRTA 2IYVA 2WWYA 3EIQA 2Z6QA 4F2GA 5TMEA 2Z5VA 5JO9A 3DPUA 1DQRA 5ALYA 4C0JA 1AXGA 1E79D 4KQ2A 1OGYA 3R5HA 2POQX 1N2EA 1NVBA 1UH5A 2JVJA 2XCLA 1ZJ5A 2AKYA 2C7RA 3DAOA 3NBMA 3W78A 3QVJA 5A5DA 2ONZA 2IF0A 5F35A 3R0QA 3SMQA 4BP3A 4TXHA 3ZCXA 1E0JA 1Q22A 3C3PA 4U0KA 1LTKA 1OBCA 4X3CA 3TIIA 3UFXB 1GPJA 1C7QA 2WIAA 1WZEA 7YASA 3TX2A 2C94A 1RYHA 3L06A 5FJJA 2CDCA 2EIHA 4CTOA 1HR0B 4X8LA 1VHWA 2FWRA 2ZYSA 1GDDA 1I1NA 3SOPA 2HADA 5EHZA 5AVSA 3GDOA 2QZSA 4LOKA 3G2MA 2J9ZB 4GSYA 4UAGA 4EKEA 4XQGA 1IG0A 3PVZA 1VHTA 2ZSHA 1YACA 1GNVA 5CAEA 4I8IA 1IN8A 3QJGA 2ACKA 4A0GA 6GPBA 3MILA 3CY6A 5EKUA 1GPAA 1QO0A 2QTVB 2XCUA 4JIMA 1EK2A 4B8ZA 2AW5A 3R3HA 2WWWA 1WHSB 1UK9A 4OGKA 3IX7A 5IW8A 4CQMB 5BV2P 1E7MA 3KKOA 1OX5A 4F8YA 1F8GA 5JI2E 1OFHA 2PBFA 3E4DA 4Q7LA 4PCLA 1GAJA 3W3ZB 4QYTA 4HHEA 1KI3A 1T43A 3EPRA 3W5UA 1R00A 2ATVA 5CFLA 1HLPA 3M49A 3HUFA 6REQA 2ODWA 3IQIX 4JXKA 4OAPA 2XT9A 4BNJA 2GXQA 5JNTA 1UZLA 3CQ9A 4JLDA 3HJCA 4MV6A 1NA5A 1J42A 2OORA 4YP6A 3BD8A 3DZGA 3VX4A 1ZMTA 1WCIA 1WV1A 1NL3A 4IX1A 2F59A 4JSYA 1ONSA 4C4YA 4CLOB 4ZYZA 4L74A 1KQ3A 3PNSA 1L7OA 3HI4A 5IWAB 4E5DA 4MAFA 2XEXA 3IT2A 2ZM6B 2XRFA 3Q8KA 1OLUA 2AN3A 5KWJA 5CXUA 2GN4A 4DPKA 1XI2A 1TK2A 4NYIR 2QPAA 4JJFA 1FJGB 2A88A 1WZUA 1E1RA 2M6RA 2YXDA 4V0SA 3LY9A 2FAXA 3T3IA 2I67A 3DTVB 3HUUA 3NRCA 4QODA 3B6MA 4UCXA 3AETB 4RXMA 5A6SB 1XTTA 3A6DA 5EMKA 1P9LA 3DDOA 3NEYA 3UANA 5JR3A 1FLNA 1YCDA 2Y05A 4G1MB 2QQ0A 1F60A 2H7CA 2ZBRA 1SXGA 2VEDA 2IBSA 3H5LA 4XQCA 1X1SA 2ODPA 1SC3A 1TA9A 2R0QC 2R48A 4M6WA 4N39A 3INNA 3UJHA 3NKFA 4WFJA 5I8WA 3SWWA 1PX2A 3DR3A 1ZWLA 3S28A 1YFJA 4DOMA 2RGNA 1DV2A 3P9PA 2W71A 1G7TA 2CLKB 4I1SA 4LZNA 3O95A 3OT5A 5EWLA 2HK9A 4XEHA 5HIJA 3RFVA 4QARA 4EX7A 3MXTA 4LTMA 4GP9A 3U4DA 3K7EA 1Q5PA 2Y1LA 4RYLA 1BRTA 1DC5A 2G6BA 5CX1B 3USCS 2HHHB 2GAFA 1SXJD 4NEHB 3QIVA 4R71A 1GUDA 3FCSB 5DHSA 2EZ8A 1MVLA 3T15A 1KO4A 3EIFA 4UJ3A 1V9LA 2ZIXB 5DWDA 4KQCA 4EZEA 2GEBA 1U0BB 4OHBA 3CV3A 1J06A 1FXUA 4CMIB 3MJ4A 1VA4A 4PHCA 4TUYA 2CFRA 2EWVA 4LJSA 3UEOA 1O94A 2HZ7A 4XFDA 4B48A 3D7KA 3D31A 1NULA 1ZNXA 4FPXA 1EJ6A 1PFWA 2XBLA 1PIWA 5KAMA 5EJIA 4PLTA 4DXAA 2PMEA 4URUR 1DTSA 1I8TA 2C3OA 4RQAA 1U2GC 3EASA 3DNFA 2ZRFA 5EYPA 4JA0A 3ZWQA 5KVQA 4F38A 3VTAA 1CHNA 4GOND 5EEGA 5F98A 2ROQA 4FHCA 4RGYA 1VIVA 3Q9UA 4HN9A 2NU9A 4FMCB 3K1AB 2IVFA 4IWXA 4LXYA 4PZ0A 1M7BA 5EHNA 5B3LA 3LYHA 2YS7A 2B1IA 3E53A 4HPJB 3TTXA 4COKA 4ZU1X 4BQNA 5JS2A 4KITB 3ROQA 3IVXA 2HMVA 1VJDA 4ZOQI 2J67A 1VIYA 3B60A 3L1IA 5FPQA 3R77A 2CFTA 3O8NA 2EWMA 2JZOA 4HSEA 4RK0A 4WWHA 5KDLA 1QFSA 4ZV7A 1J22A 1ATZA 1KMIY 1N5RA 3K9LA 4H18A 3ROXA 2D0IA 3ZE7A 1TIBA 4OYYA 1NC1A 3DBVO 4UVEA 3OX1A 3RG8A 1FDRA 2J6IA 4PWYA 1EM8A 2V7VA 4MJ7A 1SPXA 5DSXA 3HA3A 1U3DA 4QBHA 4RIIA 4RW0A 5HA5A 2EQ5A 3U16A 1W8IA 3H19A 3RW9A 4HQ6A 1YR6A 3UGQA 2P0YA 3E9EA 5DYNA 4EL0A 3GA5A 2VJCA 3ZW7A 1LW7A 3AP1A 2NUPA 4HNUA 3OJLA 2P67A 4E15A 1ECCA 4TTTS 1DIOB 1W76A 1TU0A 2JD0A 3V4FA 3SZ3A 3Q10A 2NSJA 5IAGA 1DO8A 1EFVB 1TZ2A 3MTBA 4MUKA 2GSWA 5JQWA 2IKQA 3FJ1A 3U7JA 3VC1A 1JQBA 4IV5A 4Y7DA 1ZH2A 2JB9A 1TW3A 2NYRA 4O2AF 4CM4B 4Z7OB 2RH8A 2F1KA 2JJQA 4HYEA 1E3TA 1E4OA 1P0IA 2CEKA 2C1XA 3H5AA 3R40A 3LQYA 4NOKA 1E94E 4LRWA 4Q7JB 4DLSA 3ZGZA 5TPWA 5BSEA 5AHKA 4WLUA 2H6EA 3USES 3M5PA 1B74A 2HW8A 1FEZA 3HHPA 4M0KA 2I80A 3Q40A 2B6NA 3LXUX 1Z5UA 1MC1A 1K4MA 1XDZA 5JSFA 5M5BA 4MPDA 5IAKA 3T99A 4B33A 1LPMA 2VUTA 2R8OA 2B8JA 5I9TA 3STYA 4DM3A 1QVVA 4QPJC 1JQKA 3O2NA 1UC9A 4MB2A 2H2DA 2EFDB 4UBIA 2B4KA 4B3FX 2BCJQ 4GR5A 3C1TA 3KQUA 4U0JA 1Q0UA 1VL0A 4JZYA 3ANSA 5HKKA 2HNBA 1JEJA 1J8DA 1C3OB 1GDHA 2GN2A 3WLIA 2EKLA 2DERA 2G83A 3E82A 4BFUA 3U61B 2FX2A 4X20A 1O95C 1EGQA 1FP1D 3CUSA 4IDOA 3UK0A 5KOJA 3ONFA 4PRLA 3RM3A 3F8WA 3G5UA 4U8GA 3AERB 3BQMB 5HJ2A 1XNHA 1Z4NA 3MF4A 2PL5A 4FSHA 3NJRA 1QHXA 1OXSC 3U9SA 2PMFA 2OFXA 3V6MA 2BSXA 3QP9A 3KWJA 1H23A 4P5PA 3LFHA 3N3AC 4YMGA 1F6BA 2I76A 4LVCA 1KI1A 3T0IA 3F5DA 1GLVA 1RM4A 5F1PA 3W6PA 1NVEA 2WFLB 5IVKA 3OOWA 1A1SA 1VL2A 1R64A 3RU9A 1HA3A 3F78A 3QWIA 1H93A 1KK3A 5EPEA 3LRPA 1FRZA 1E6EA 1HF3A 1JTVA 1M1YB 2OKGA 2XOKA 1R88A 1MUUA 1KO5A 3DVSX 3GJ7A 1C1XB 1SKUA 4NYJQ 5J1TB 5KAPA 1QZTA 1GQFA 1R6BX 3WGNA 5IVIA 1YONA 2PAAA 1A04A 2XMGA 4TV9B 4AZ0A 2V65A 1X7YA 4Y6SA 3VVMA 2QRQA 4UHBA 2PH3A 5LNK6 5LYJF 4IXWA 2C92A 1ZRHA 2C96A 3R7LA 1NPYA 4C0QC 2BGKA 3D8HA 3PFFA 2GH1A 3ZI7A 1G60A 2XA9A 1XA4A 2VWHA 4PCAA 1R5OA 1GHTA 2LZ0A 1G41A 3WWYA 1EB8A 4Q6BA 4GNRA 4JN6B 3EW9A 2PFSA 3QXXA 4MUMA 3SC2A 2P90A 4QAQA 1NOJA 2QVBA 3D4NA 4NAUA 4B35A 3O31A 2YCLA 2P62A 4KRXA 5EZYB 2QUAA 4PONA 3ZJYA 5CIQA 1N2SA 4YJGA 4NF2A 4OFWA 4XTRA 2D62A 4DMRA 2QLTA 4MVYA 3V4PB 4BOYA 1PUJA 5L95A 2PKXA 2WJAA 3RVRA 3PPYA 3TM5A 3NV7A 1JEDA 1YKSA 1TVKB 1RWVA 4YRZA 1BH6A 2EX0A 3KDPA 2O0KA 1TUBB 4PPGA 2C7PA 3FYUA 2Y6VA 3BDAA 4GBMA 3KXLA 3SKYA 4UTOA 4IDDA 1T24A 1ZGHA 4BGIA 4BKRA 3JQPA 5JCXA 1CQWA 4KMOA 4NP6A 4C03A 3CEHA 1A2QA 3SSOA 4D8TA 1CE8A 4C78A 2AR7A 3HTXA 1P60A 2LE0A 5CCEA 1Y1RA 1YJBA 4LF7B 1CP2A 3IP6A 1HZZA 3EXG2 1VSQA 4HXYA 5G4LA 1DO0A 1M34A 5K3EA 5KYYB 1KZ9A 2XF8A 1NU6A 3QA9A 4KPEC 4DY6A 4B2PA 3EBOA 5T4HA 3NBYC 4DXDA 5D7BA 4C2AA 2DQZA 1IQ0A 1KAGA 3GQVA 1PI3A 1KI6A 3E5MA 2C4TA 3NUQA 4BVEA 4KFCA 3KD3A 3H83A 5DEOA 4PHHA 2LUOA 4F72A 4WZBA 2Q4BA 4F4CA 2IYFA 1YZVA 4MV4A 4TMXA 2GKSA 4C7VA 1NBAA 1ODSA 3EVBA 3HMQA 2NSDA 1EVJA 4RH1A 1Q0ZA 3CZPA 3GEIA 1E1MA 4O1HA 5EIAA 2BJVA 1P3JA 1Q84A 1V4BA 3BXOA 2WSSA 3AUKA 1L5NA 1U98A 4BRSA 4JLVA 1Q19A 3EUWA 1N2JA 2CFCA 2OWDA 1WXEA 4ARZB 4CG0A 2XVAA 2HSZA 4NEQA 3CRNA 3ZWPA 4F96A 1PTJC 4R0MA 2OV2A 3FSJX 4CI0B 4LF5B 2XA1A 1P73A 3MWJA 2ZSJA 1N9GB 4NK4A 2P9EA 5JDIC 4DV4B 4TL9A 4NYMR 3CNBA 3CNLA 1YJCA 3RC8A 5JJLA 2N9UA 1IN6A 2F1OA 2OVFA 3OX4A 3PQ7A 2G06A 3Q0EA 3GEMA 3M4JA 3OIUA 5JD4A 5E1MA 4YJDA 4KPYA 2QI9F 2P2NA 4L7VA 1QGUB 3DXYA 3G88A 3OTWA 4WKNA 2O8VA 2QX4A 2PX6A 2W2MA 3HV2A 4FKBA 1Z5VA 4J9VA 1XROA 2BL4A 2Z08A 4BMOB 3H8SA 3UJ7A 3T3EA 2HBRA 3EE6A 4U7JA 3WL5A 3MTQA 3QH4A 4FNGA 1O2DA 1HE8B 4G09A 4ID9A 1DBIA 1EVLA 4L9WA 1DU4A 4CKXA 5JTUA 1B0ZA 2ZXUA 1JHZA 5F1YA 1ABFA 1GPNA 2AEMA 1B16A 1ZOOA 2A67A 2JGNA 3PXUA 5G1OA 3S29A 5AVTA 4WCFA 2H2GA 3B6JA 2MMCA 4J91A 3ST7A 5EKSA 1QKJA 4CNBA 1I3CA 1NW5A 2ZIZA 3SNHA 1KFKB 4MW1A 3VAAA 3HY6A 2RGAA 2X5JO 5TGDA 3WC4A 1QQAA 3QX3A 2X4DA 1U0TA 1W87A 3NAZA 1I7LA 2A5YB 4UUNA 4G6ZA 2YW9A 1ZCZA 3M6FA 4TMYA 3ZDYB 1RJEA 3BXFA 1B3RA 5E6SB 3LYLA 2WUWE 2ZI7A 5KNBD 2IP1A 3WLFA 3M4XA 3GGJA 2J9FB 3L4EA 2WYOA 2LPMA 3HM9A 3OQPA 4NNPA 2FPSA 3PHJA 1M6YA 4U2FA 1Y5NA 1PDVA 1QONA 5AKXA 2PMDA 4G37A 3A32A 2NVUB 2DLNA 4F1JA 4U00A 2EU8A 4FEYA 1O0SA 1A5SB 4KQWA 4Q37A 3PI7A 5IZ4A 4ARCA 1JYFA 3AUJB 3C6KA 3DTNA 4RABA 1G5IA 1MO5A 4HGPA 2FETA 1NXTA 2FZVA 1NR5A 2WD8A 2WYVA 4YAEA 5IK2A 4DSNA 3NH6A 4MGKR 1EFHA 2G7MC 3DFMA 3H8VA 4KYIB 3RSFA 4AO8A 5HP4A 4ITUA 4RAQA 1TKCA 1YHYA 5EE3A 2B98A 5EJ5A 1BWPA 1JZSA 2ISSD 1IYZA 2D1QA 2EGUA 1R0ZA 1FUIA 3T7CA 1CDZA 5CVCA 3S8YA 4KWCA 1H6BA 3EDYA 1PZEA 3R41A 1WWKA 4EJ6A 4LY3A 2FEPA 3R09A 3ROZA 2JGAA 3NG1A 4PYRA 1VPEA 4INAA 2XT0A 5B1IA 2FYTA 4BZWA 3EXIB 1HG0A 4IHQA 3O1LA 5JY1A 4YAKA 3A6KA 2IX3A 4C7OB 4O6VA 3H1TA 4OI2A 4WJZA 3WR5A 5KNBA 3ECAA 1YZFA 4FQ5A 1UDCA 2I7TA 3ZEIA 2ZE7A 5AM2A 3G9ZA 1RJWA 1LPBB 1N7GA 4K6OA 5ITSA 3CNHA 3K32A 4S2EA 3HCBA 5F7ZA 4EUSA 3RUPA 3GBPA 5TVKA 1Z29A 1YB7A 1WMEA 1ZR2A 2PRZA 3NU1A 3TFQA 3OOEA 2O8EB 1RYFA 2YJ3A 5FO1A 4BTEA 4X9XA 3TNLA 1UBGA 3NWEA 1X7GA 2MU1A 1K6MA 4GF5A 3RIEA 4KO1S 1T3SA 2O59A 3DHVA 3D4IA 3OP1A 3QLVA 5FOUA 1JQJC 1BMFD 1SULA 1XP5A 4PYNA 2YMMA 2QX6A 4YDHB 3I53A 3JQDA 1Z08A 4GU5A 1Y8QB 3WL8A 3AYZB 3GIDA 5JYDA 3GCDA 3L9WA 3IP1A 2AG0A 5NULA 1P0MA 3L7KA 1A1VA 2IS1A 1Z35A 1LH0A 2VXBA 3GDHA 1N5MA 5HFJA 2F8SA 4EY5A 1E6KA 4LDQA 3IQZA 1HURA 2ISCA 3FOZA 4ALJA 2AR9A 1OXUA 4WGGA 5GQSA 2C78A 4I4IA 2CZCA 3TW8A 2WA2A 5KSOA 2AXEA 2WW8A 3T3NA 1PJTA 3O8QA 4EFLA 4W1PA 1IIRA 2ZB3A 3CXRA 1U90A 3CKLA 1HTWA 2QTCA 4KZPA 1RKBA 2GI4A 2PYIA 1X2BA 3PXCX 3LF2A 5JALA 2ODAA 1HEIA 5AM1A 3WDKA 1NUQA 4GFDA 3QVUA 5AKYA 1QQ5A 2R2GA 2W2QA 3UHOA 1SMKA 4G5RA 4M0MA 3GUZA 5EGSA 1S8NA 3RAGA 1WHTB 4MRMB 3HXOA 3BD7A 2KBEA 4QLAA 4RTOA 2D54A 3NGXA 4LISA 2FXIA 5AJWA 5JISA 1GFWA 4WOPA 5LMZA 2QTAA 2AF4C 3ER9A 1LBSA 3ZWAA 1N32B 2BW0A 5IG2A 1K9VF 2FPXA 4ZVMA 3A31A 3HJFA 3I09A 1PFUA 3NP7A 5KNLA 1I5EA 3KJFA 3NBFA 3PTLA 4ZT3A 2P0AA 1GV0A 2OYCA 3TGWA 5JD6A 1A69A 3MQFA 2VA8A 5FFNA 3KSDO 3WB2A 5DNYB 1GN9A 2IPOA 2B1RA 4HLQB 3N8NA 4MW7A 1F20A 2ODQA 2P6OA 3BMQA 5EQTA 3ZZ0A 2IT1A 4M53A 5CYGA 2F8LA 1Y5RA 4J90A 1A7AA 3OOSA 3P9IA 2P4EA 2VPQA 5IF9A 4ZVRA 3N58A 3OT1B 3CLSD 1PO7A 5A71A 1QAQA 4KR3A 3T5AA 2H7XA 2DR0A 2H07A 4X61A 3SJCA 3U3OA 3ZLBA 1A4RA 2RB4A 3WA6A 4MTLA 4C01A 4YRLA 1SC6A 1S01A 3NHAA 2DKOA 5C5IA 4H60A 3RS8A 1GL6A 5GTDA 1J56A 2RG1A 2ZWVA 3ZI0A 3QE2A 4Z4FA 2P4HX 1FRQA 2QRKA 3HDGA 4GLBA 2W2VA 2I8LA 4RADA 3BG5A 3CR8A 1DDIA 4HFRA 4Q05A 1GSAA 5LZ9A 3QVWA 1ZK4A 1ZP6A 1H8HA 2WJJA 5EUMA 4KPGA 3UMJA 5K45A 2O8BA 4AY4A 4RM3A 2XKJE 2FJ0A 4GGOA 3TIVA 1TYCA 1W6UA 2ZK7A 2CHFA 5BURA 5AVWA 3RFFA 1WY5A 1RP1A 4GMKA 3WL3A 1R37A 3S2UA 4IVRA 2XCTB 4K2HA 5A02A 3IQGX 4UZFA 3IERA 3GJZA 4NPHA 1MW8X 2M9MA 2E6UX 3A2MA 3TLBA 5FEUA 3TEFA 4NCJA 4W5JA 4DE5A 1GPUA 3AW9A 3FOEC 4HS9A 1Z2CA 2HCTA 2ACEA 1MDFA 1W0JD 2HSEA 3LT2A 1UK7A 1D2NA 2GNOA 2NTNA 5DDIP 4BLUA 2XUKA 4E5MA 1XCMA 2A4MA 5DRYA 3FHTA 2CV1A 2G72A 4OXYA 2PD3A 2WJGA 4X1YA 2DCUA 4TV8B 2P9TA 4EBBA 2FB9A 2GPJA 3ETEA 2HLNA 3QOXA 1QP0A 3E23A 2FUG6 4G0PA 4KI0A 2OD2A 4LHEA 3KU4A 5C3MA 1EX7A 3D54D 4GPZA 2XVZA 4DANA 3PE6A 1Y8CA 4B43A 3LCRA 4C5CA 1H85A 4P4GA 3M2PA 1QFXA 4PLWA 1Z2AA 3O3CA 3BE5A 4N8SA 3T3DA 1QQ7A 5AI6A 1T0UA 4TSFA 4BO3A 4DJ5X 1J33A 3RBZA 4DUGD 4ZRDA 1W34A 4G1VA 4F4JA 2ZLBA 1W5SA 3VX3A 5L6MB 1RWPA 1OX4A 1WXFA 5LNK1 2V3CC 1TK9A 1FFXB 1UXKA 5DHAA 1N2HA 1R8QA 1XZLA 5H8WA 3PHCA 4N3BA 1XP8A 4BMZA 1E5LA 4QULA 4B3CA 2XWJI 4IVPA 5LQJA 1M6HA 2OP0A 3H6GA 4HH4A 4AT1A 1GNPA 4E5KA 4MR9B 1KZHA 1XNGA 2HI0A 3IHKA 4RPLA 1QORA 3RVLA 4NXNB 3G8YA 4X97A 5D3MB 4ZCRA 1T5SA 4MR8A 1KAHA 3LCCA 1NLMA 1JX6A 2CJYA 3JXEA 1OH8A 2W93A 3LUDA 4UDYX 5KTNA 2F1HA 1VL6A 3RUDA 1FP4B 1C4WA 2CNBA 2N0SA 3UY4A 1EVEA 1UBSB 4ZCSA 4GS5A 4A5SA 5JDCC 1A2KC 3SC3A 4ZYXA 1JQ5A 4HDKB 4Y1FA 2HO4A 1KAEA 4BBZA 7ABPA 4Q3AA 4OV6B 4MUYA 1MA0A 2F8MA 4DVJA 1GJRA 3KTFA 1L5ZA 1RM3A 3HR7A 1HZJA 2ZB8A 3VU1A 2C57A 1BHQ1 5IWCA 3H3XA 1N6HA 4UMDA 1E8MA 3MGBA 3O2JA 1S3SA 4IBOA 1DMRA 2Q5EA 2WBLC 3JPYA 3ILYA 4MIKA 4BFWA 2HIHA 2QK4A 3KJHA 4XRRA 4CQLA 1ML4A 1K7CA 1T1EA 3T38A 4ZVTA 3V2UA 3IB6A 3G5MA 1WS6A 2OBNA 3ENQA 2OMEA 3ABOB 4TQGA 1YCHA 3VPDA 4DYHA 3BKXA 1PJBA 4KQMA 3UFBA 3WB0A 4L5AA 1UJNA 2A78A 1I4LD 1LLCA 2Q5QA 2VTBB 2ZUEA 1X77A 2GPNA 2C4MA 1DNPA 1DBWA 1WUYA 5BOSB 1YHZA 2QN8A 2X6RA 3ML1A 2ZBEA 1T9BA 4U9IS 3VDRA 3RIMA 2J32A 5SZHB 2VDRB 4X91A 2O6HA 4DNPA 1P2UA 1X7HA 4WNAA 3T5BA 1GA1A 4L0CA 4OMUA 1RHKA 4P4TA 4EI2A 2QUKA 1XU7A 3WRYC 4L4YA 4ZAFA 3UV3A 1F51E 2A9JA 4EB6B 4F71A 2I6XA 5C52B 1O95D 1I7QB 4R0VA 2O7NA 3QELB 4I1UA 2D5LA 3F3KA 3GFQA 1WX1A 3HJAA 4LYYA 1E9CA 1JLRA 4NSNA 2PG3A 3GEGA 1BU5A 5F52A 4UJ5A 1Q0QA 4QBKA 3TSWA 1EBFA 4QPCA 4R2IA 3S68A 3ZKAA 5G0UA 4LCEA 3TMKA 2O20A 4IO1A 1YCFA 5HS4A 2IEGA 4RCVA 5HQ3A 3PITA 4CEJB 2HBZA 3FFTA 2W2KB 1PVOA 4RZXA 2CDRA 5DGTA 5TT1A 1W75A 4PS1A 1ND5A 3TOCA 5CLJA 5KJEA 1JE1A 3HEAA 2XBUA 5CNIA 4Z2YA 2Z5LA 4HRYA 4KZKA 4GQIA 1MIOA 4RTQA 2OHGA 4P81A 521PA 1C3EA 1FRVA 1WEKA 2E1PA 3Q7PA 1CHDA 1FUEA 1GR1A 4TROA 1QHEA 4CMJA 4YV7A 3KVNA 1GO2A 3DDNA 1S7CA 1A77A 3RBAA 5CLHA 4ENRA 4M1EA 4TKZA 3P27A 4M2LA 2P7HA 5DMXA 4O33A 4W8HA 4KRFA 1JFRA 1JHAA 2X9VA 4QGHA 3TJRA 4BVJA 4JT2A 1BS9A 3UM9A 1IG3A 4MGHA 1P8AA 1GL9B 4LYDA 3WIDA 2EFEB 4O2AA 3TD2A 2WZCA 4URWR 2QXTA 121PA 4F92B 5HOQA 5K9ZA 2GARA 4CLRB 4EO9A 3LDUA 1W19A 4LZLA 2B6HA 2C5BA 2XBMA 1H69A 3ZJ5A 1HBJA 5EVJA 1R8YA 1OGIA 3OCZA 3OEED 3WLEA 3EISA 1KRWA 2W6NA 3U13A 3UWDA 1SBIA 4YP7A 4O2BB 3KUKA 3OIYA 1YO6A 3RSGA 1JG2A 4DLRA 2LCFA 1SAYA 3ZLTA 4HOYA 4BKPA 1TVMA 1XA3A 5ALXA 2FJPA 1TCAA 1N1DA 2Y1CA 4IS3A 4U4AA 2HZBA 2QT9A 4TVBA 2PR7A 2XHZA 2ZUSA 2I6GA 3OMXA 2FWJA 2VBIA 1E2NA 3DC2A 3NHWA 1JHQA 4WBSA 4YXFA 4OGWA 5B7GA 2B94A 4LNAA 4MLCA 1XD2B 3TW4A 1OWMA 4FT2A 2EEPA 3AXTA 2O05A 2IE0A 4Y1GA 3RYTC 3ZC3A 4B47A 4QXRA 4P33A 4BB0A 1M9NA 1G8MA 1G8JA 3ZCSA 4JBGA 4FHZA 4R7TA 2BIFA 1J4AA 2B7LA 2G88A 2YUIA 5DO9A 2W6JD 3AF3A 4XIYA 3ZGLA 1L5FA 1D4FA 2O4UX 1KERA 2HREA 1BMTA 3G2HA 1A9TA 4H9GA 1DI0A 1G6OA 2QB5A 3F2IA 1N2IA 3R6LA 4HNAB 4EGQA 1AX9A 4ZIRA 5JOQA 2C3UA 4R1OA 4RGQA 2JBHA 3HM2A 3B7PA 1B8UA 3DVLA 4L02A 5CT6A 2D7JA 5KOYA 1MX3A 3ICEA 1PGPA 1ECGA 2H0AA 5A5EA 2RHWA 1AG9A 1U0GA 2PRKA 4YHHB 2PK3A 3ZD7A 5LDDC 1Z34A 2BKAA 3NBAA 1RS0A 1HL3A 4PNEA 1G0NA 1Y7HA 2IZ0A 3TXXA 3Q7EA 4IZ6A 2R65A 3EG5A 2GXAA 1OLOA 3ORSA 4K28A 5DXAA 4YRNA 5JLJA 3AI3A 5K2OA 1HEUA 4P8RA 1B8NA 3QYJA 1CUHA 4MV3A 2QLFA 2DFDA 4PYLA 4TQUS 1LNQA 3A4TA 3TIGA 3B2QA 1BMQA 2JZNA 3I5AA 3RS7A 4CG1A 1EUYA 3WAKA 4B6SA 2NV2B 3L0DA 2G82A 5LYJA 5L9AA 3GLIB 1UKEA 1XVAA 3GFPA 1HQYE 4K7JA 3SDSA 4DJAA 1YJXA 3A1DA 4C6RA 3NC4A 2V3VA 3HZZA 2AJTA 2BTQB 1KWGA 3BFKA 2QX7A 2NUTB 1F8UA 1QUFA 4LNHA 3ZZ1A 4JC8A 4Q12A 1Y81A 2LCIA 1KF0A 4OFZA 4QDJA 5IVHA 3TB6A 1KPIA 5EHGA 4BJ6A 1H9AA 1E2KA 1X1EA 2EP8A 3OIGA 4OH7A 1WQ3A 1TGYA 4YJFA 5D51S 4DWVA 3HB9A 4B3TB 1FBNA 1M3SA 1PK8A 2IYYA 2LRHA 3FWHA 3OQHA 4LVOA 1ESNA 1P7WA 1IHOA 4W8GA 4B6PA 4JBHA 5A2QA 4O5AA 2PNJA 1YS1X 5DNWA 2TECE 3ZCTA 4P0QB 4B45A 3N2LA 2H1SA 4OKIA 3JVVA 4CM7A 3F6PA 4RPKA 1ND6A 3WO1A 4EM6A 3T1HB 1WB5A 1XRPA 1CG6A 2G1UA 1A96A 3V8VA 4C4AA 5I6DA 4RULA 1ESCA 3HUTA 4Q1EA 1Q2XA 2FE1A 4P7BA 2Y9PB 5CFPA 3OSUA 2ZI5A 1MABA 2PWBA 3LUFA 1MC5A 4RFLA 4Y9SA 2VCHA 1NQUA 4LTDA 2O14A 1HXHA 4X45A 3S99A 2CB9A 4DSUA 5ECDA 3MJTA 4LSGA 1F12A 1GNQA 1Y8RB 2FPPA 3PFWO 3O4VA 3HLTA 4RU1A 3M81A 4WDRA 3X1YA 2QJRA 1T9GS 4KR2A 3ADOA 2YINC 2LIVA 3SF0A 5JW6A 1R9NA 1ZCBA 1XAHA 3CLHA 4GI3A 3DMNA 4L2IA 1J90A 3GGGA 2J6BA 4AZ3A 4B4WA 4FB5A 3ZWWA 3EPKA 4JQYA 3K70C 3VSEA 1LI7A 4NK5A 1G98A 1QIFA 1YC2A 3A3PA 3BIXA 3JQ7A 3D3WA 5L53A 4P38A 3VUFA 1ZCFA 2GKGA 3WNVA 1P9OA 2HL6A 2DUJA 1B0UA 1YGYA 2ZETA 1IZYA 1OBHA 1H4SA 3NT5A 1KJQA 1IZ9A 3JARB 4NTZA 4TTAA 1T1IA 3GPCA 3WG9A 3L92A 1PS9A 4OHYA 4XB1A 1AD2A 1DWPA 4MV0A 1WLYA 1ZL2A 4KQJA 3UJ6A 4BNHA 4JKYA 5I5EA 2GLUA 3JU3A 1MA3A 3HKBB 4FFMA 4FE7A 1O03A 2CCJA 4K3UA 3AOEA 1JKXA 3P4UA 4FW9A 4KEAA 4QVGA 5EE5B 4BMVA 3LRXA 2MMGA 3V1NA 2OORC 1VHJA 1PN3A 1G5FA 1IFXA 1V6SA 2O2JA 2VSOA 5GVSA 1TYBE 2HY7A 5IM4F 5I8PA 4WLEA 4MKFA 5J2UB 1VE7A 5IM5A 3EY9A 4INPA 1P7YA 1IUKA 4JEIA 1PFQA 3ZHRA 5DM0A 3THYB 3M6UA 4YXWD 3WBKA 5CA1B 4ZJZA 2HCBA 3TEJA 4UQLA 4BTLA 3DH0A 1YSCA 2VHZA 5FOWA 4PZUA 1VBMA 5CCBA 3GJ5A 4Q7EA 5E9WA 3GRRA 4EZIA 4BLOA 3KQKA 2WP8J 5ANRB 5TMDA 3DFUA 2HMUA 3AX6A 1G9SA 4IRXA 4OQLA 4UU7A 1VIAA 3NBUA 4ZPXA 5BSTA 4RDXA 3ZVMA 2OCPA 4BRWA 1DCKA 5KDDA 5HZMA 4J7XA 2VP6A 4NU0A 3MTJA 4HQLA 5BRJA 3MWFA 1K3TA 1Z6GA 2RGNC 2ZR8A 5DZSA 4UUOA 1RM5A 5HKLA 4ETWA 3IOCA 5C34B 1W59A 2CCKA 4PSVA 2OHHA 5EXXA 2EZUA 1R6TA 3I0ZA 2Z2ZA 3PSHA 3B36A 1MB3A 4LJ8A 1P9NA 4FYJA 2ZSAA 3IOBA 2ZU6A 3I01M 3TYXA 3AVWA 1RWKA 1V5GA 1AUVA 3ROTA 1DX9A 4Q6WA 3ER6A 2NACA 1D2RA 2DWQA 3RF7A 5TV2A 3QU2A 1RT9A 1QHFA 5BVGA 2JKVA 4RZHA 2AFHE 1EYZA 2HHAA 3TK1A 1ZKDA 1DG3A 3G9QA 1JEOA 3MHPA 3GGCA 1NP6A 1O94C 3IDAA 3V9PA 4PEVA 1MN6A 1Y7LA 4NNJA 3TH5A 4ZK2A 1TQDA 1OBFO 4ML3A 4FS8A 5JFTA 2BGTA 5FUBA 1YA6A 4BE9A 3KUXA 2JIMA 2IDJA 2C3PA 2J9YB 2ZS9A 1C0IA 4KR9A 5EG5A 3NHKA 4L9SA 3LGAA 4HDCA 2H2IA 3QX7A 4JCCA 4RJKA 4WADA 2CXUA 1RQNA 2VTVA 2ZIAA 4HVTA 4DEXA 1X80B 1RRKA 5KNCH 2E1RA 1AY0A 5IUJC 3EG9B 3NTOA 2X41A 1PR0A 4Z8XA 4Q9KA 5BNWA 3ICVA 2UVQA 3LC7O 1RCFA 3BC1A 1XMXA 4I5EA 4IMJB 3TUJC 1H6AA 2FPRA 1Y89A 3SR3A 4P4SB 1LW6E 4ZVNA 2DPYA 1MH9A 1I0ZA 1SU6A 2AI3A 2RIRA 3FMFA 4WK4B 5DKFA 4C29A 4AX4A 1G8HA 3HZOA 1NBME 1BA3A 3C3BA 1SUPA 2V55B 1SZDA 3KJGA 3OJEA 1KE2A 3GN1A 3TZCA 1NWCA 1PWXA 1Z18A 2B9VA 2PLFA 2VF2A 4WN3A 3NOVA 4YR7A 1TRKA 4RC9A 4YIHA 2ZW9A 5F2OA 3EMDA 4N5DA 4NMHA 2PMCA 1JVBA 3VPSA 4EGCB 1MB2A 2P1ZA 3KYCA 4HNGA 4IDFA 5IRCD 3ZE1B 4PRZA 4Z4GA 1IY8A 2IBMA 1N1EA 2GJ4A 3DEZA 1AKUA 1X7ZA 2F2TA 3GUHA 4N0DA 1IBCA 4LPKA 4BP1A 3SJUA 3VKFA 1R2QA 2J9RA 3TN7A 1YMQA 4JQSA 3V97A 4D57A 3E58A 3L0CA 2NP7A 2WTNA 4JBXA 4KXXA 1L4LA 2IEZA 3C1AA 4GVLA 4D02A 1WVMA 2CYBA 4JXZA 3PKIA 2BEKA 3ACCA 5A3JA 1DJOA 3GVIA 1UT8A 1F0YA 5K3FB 3TUZC 2OZLB 4UPVA 1JSLA 2QUJA 1Z26A 3AZQA 2W2NA 3FNQA 3E8XA 4FBMA 5TE9A 4H7EA 1A27A 5L51A 1T9ZA 2Z2XA 1M6VB 2PCLA 3DBLA 4A1FA 2FQQA 3FDZA 1NR7A 3L0BA 4UVHA 3ZIAD 4D9HA 4LE2A 3FPJA 2QRNA 2DHDA 2I62A 4IHJF 2WDPA 4XM0A 3I61A 1YJ8A 2BTOA 5CTJA 2AGVA 5MFZA 2CDNA 1V35A 4UDNA 1VQ1A 2FPMA 5KMGB 1DC6A 1E60A 1M8GA 3L1JA 3RG2A 1T6XA 3E2PA 4DMFA 5KPDA 1Z12A 3KEQA 2C31A 5EUCA 5CFNA 1JF8A 3DD1A 3O2SB 2EBUA 2GZDA 1EFRD 4LQCA 5J9FA 3L2OB 1DEXA 2H16A 3T7IA 10MHA 4X44A 3RJTA 4D9JA 5ICFA 3SHVA 5ADWA 1G7CA 4R2WA 5DPMA 3OE7D 1HYGA 2GJSA 4U5XA 3TZ6A 1R0YA 1TC2A 3AF0A 5ALUA 1DJQA 1G2PA 2FZGA 3B38A 3CVVA 4P7GA 4NMWA 1RKUA 2H7YA 4O1IA 4UMFA 3V7UA 1Q0SA 4WZ6A 3CVUA 3QHPA 1WM1A 2BLLA 2NPOA 3HRIA 4DA8A 5I7UA 3A4LA 3V6LA 1XPOA 3ERCA 1AH2A 1P0QA 3D0RA 4DPLA 5KTOA 1CS0B 3U7EB 3EF0A 1EP3B 2QZ4A 1FQWA 5DX0A 2D0PB 3E7WA 3FHCB 3H0KA 3OZRA 3AU8A 5LB2A 1J0DA 1G19A 2YYAA 4MRVA 1P44A 5K3OA 4FFBA 2Y3IA 2C5EA 2VNSA 2O2SA 3ES9A 1G16A 3FFWA 5B53A 4NARA 1C5KA 1I10A 1DRVA 1T4MA 2IYSA 4KDRA 3ZXIA 1NURA 2ZIVB 3G2QA 2J8ZA 3NKVA 2VJNA 4KPUB 3Q85A 2AFIE 3R6GA 2X76A 3L8GA 2H0RA 2YXEA 4HDRA 1M7GA 2RHLA 4I6GA 1JT2A 2A30A 2R66A 5DMHA 3K6SB 3CCFA 1BVYF 3PJDA 2FG6C 2OXEA 4NR0A 5DN6A 4BQRA 4Z0NA 1BXZA 1SGWA 1QV9A 5AW4A 2GM5A 3K9BA 5JO0A 2YWEA 5LN1A 1UFKA 3JD3A 4V0ME 2HDWA 3OE5A 4XJSA 1XA0A 5DGCA 1TI7A 1XZIA 3BRWD 5CXSA 1SY7A 2QW8A 1J24A 3GRPA 4ROTA 3RV3A 4WOBA 4BP8A 4EHFA 2R96A 3KLNA 1O4VA 3HCFA 3P9SA 4OU5A 3CLVA 2UYQA 5AJVB 3TD9A 3NM4A 1SUFA 2BWJA 2WG1A 4ZKDA 3LHDA 3O8RA 5TXGA 2GZHA 3ADBA 5C81A 3M5CA 4UBOA 4MHOA 4HXGA 1JU4A 2X2FA 2XIQA 4E12A 1P5HA 1UMCA 1NXXA 3NNSA 1RBQA 4Z4CA 5BYBA 4F2DA 1E98A 2BEUA 3GELA 1I2ZA 1KH1A 5JYBA 1QHIA 2ECKA 2G9ZA 4OBXA 1B23P 1SCNE 4UEWA 1FSGA 2J07A 2V9ZA 2F64A 1DQYA 2SNIE 5DTEA 4UTVA 1YL7A 5I9NA 3CX7A 1NYRA 3ZV5A 1JNXX 4MYRA 2IUFA 4ZV4A 2X0FA 4C0WA 1J0AA 3BMNA 3FYUC 1REQB 2YMPA 1UAYA 2QHXA 1RADA 4ZAXA 1DC7A 1O96A 3HLYA 4UVDA 1E2EA 3EXEA 5BUSA 1IPHA 1ZVQA 2I3BA 3L8ZA 1ENPA 1GSIA 1U80A 2VWGA 5EJFA 2EG5A 4PPFA 4H0NA 3T12A 3WYDA 5IFLA 4JLOA 1T6BY 4IIJA 1Z0AA 5EXEA 4C6TB 3FF1A 4D6YA 4EA9A 4JX9A 3MS7A 5FLYA 3MWKA 3K6JA 3FGPA 4RGBA 1HZZC 2I6SA 2WINI 4N3GA 4WK2B 1GZ4A 2FHPA 2OAP1 4R8MA 3TD6A 4UPEA 2O3QA 4AYWA 4ESHA 4ZGBA 4YY3B 4Z4IA 5KTSA 1IY9A 2AG1A 2HA2A 3K0SA 2OGTA 2J3QA 2VPIA 1CZKA 2J5RA 4MOWA 1OH5A 1DX4A 1RXIA 3FKSD 3KKNA 1NTOA 1Z0JA 1CEQA 3N0VA 2HIGA 3JVUA 2KMLA 4OF4A 4KLZA 2DQKA 2MSDB 3UWSA 4C2TA 3I34X 3NOOA 3RJ9A 3TVTA 3AUUA 3CZ4A 1A9YA 3C3WA 2RK3A 1AGPA 1S7GA 3VPHA 1FFCA 2GB4A 5FR2A 4NS1A 2CV0A 1QRSA 4IO0A 5C8YB 3UWMA 5JFOA 1VCIA 2NYAA 4JS0A 2NLOA 4ZZ2A 5JHGB 4EW6A 4LCBA 5ECGC 3MWLA 4IIUA 1B43A 4XOIA 3MTGA 4YO8A 4XYGA 1XZPA 4CV2A 1KETA 3MK31 1TQHA 2F4NA 2GCPA 2PA3A 4KO4S 3DV0B 4L5IA 4O5OA 2AJ8A 5H9VA 3EEOA 2QD4A 1GCGA 4NJEA 2ZPAA 2ZBGA 1C29B 2NUAA 3H9UA 3M2TA 4HN4B 1GZDA 4DR5B 3B8EA 2JFOA 1V7PC 3UMBA 2YJ5A 2HV8A 3DE2X 1SCIA 4N40A 2YVQA 4RPGA 3WBFA 4ZAYA 2I1VB 1ZNQO 1KI7A 1LNSA 2O5VA 2JBAB 4FCTA 4FMCF 1NVTA 1ORIA 4YLEA 3DEKA 3O90A 5AUPB 2IW3A 1JBKA 2XD9A 4PO3X 3FPSA 2C3MA 1G21B 2O5RA 2R68A 4RK6A 4BWYA 4PGFA 3RTGA 4N0MA 3UBMA 4IFBA 3A1SA 5CM9C 1W88B 2HOQA 4PAMA 3LZDA 1QUEA 5L3QB 3U7QA 4FK8A 5GY7A 4FCCA 4N0PA 4FHFA 1WZ2A 1WZNA 2PIDA 5I7EA 4I9HA 5BMVA 2QUZA 1DQPA 4B17A 4WCFC 4CNQA 4F6RA 1TFUA 3D7NA 1LLDA 3OLVA 1BYIA 1IZ0A 4D6PA 2Q5IA 4ACBA 2IE8A 5COQA 1W29A 4JYZA 1J49A 2EATA 3PNOA 3VTFA 4FJ2A 2WZDA 5CDFE 2XRMA 3CTPA 4RWEA 5GJBA 2HLDA 3Q0IA 3JWHA 4CLEA 3E27A 4JJ6A 5FFFA 4CE6A 1ZC4A 1AN0A 5L3VA 4O4LB 4R0NA 1BCSB 3ZBQA 5JVDF 4MWBA 3HBLA 4PIPA 1XZHA 4INOA 5FBRB 5CA0A 3RH0A 3SJAA 3BMCA 4CODB 3KYDA 1OPRA 5IFKA 4X6XA 4PGGA 5EWMB 5DULA 3W8NA 3MAAC 2QSJA 5K20A 1WXDA 2A4KA 3GBSA 4N8EA 3UATA 4GWKA 1XZ8A 2XXAB 1ACMA 3CW9A 3G2JA 1AIPA 1TF5A 4NYJR 4ZYTA 5A06A 4FWIB 1K27A 3S1LA 4KLCA 3W34A 4J0HA 4KGXA 3REFA 4URXR 1KRXA 1LSUA 4CDRA 2FW1A 4I55B 4QOIA 3TLZA 3TEMA 2I2BA 3G79A 3DBHB 3KP1A 3RTEA 2QP4A 4X0EA 5LLSA 1HRKA 3EQZA 5TQ2A 4PTLA 4L4SA 2OXTA 3T9BA 1W1IA 4E5NA 5LL6P 1MP0A 3DLPX 4DDWA 4YDSA 1B6TA 1WZIA 5DF1A 5A4MS 1QLHA 1HFKA 3N1UA 3T61A 4CM8B 2NMVA 2PUHA 4HEA6 3LBIA 1E1QD 1XCLA 2Q4OA 1TCUA 1T36B 3AR7A 4IJWA 4R81A 3E81A 4ZARA 2Z8YA 2QE7A 3PEFA 4GRDA 5U1PA 1E6WA 2DFLA 4WBXC 4BC1A 4TZ6A 3IESA 1Q7RA 1DL5A 4FE4A 2B7BA 2WSBA 4Q3KA 1BG6A 1KEVA 2UV8A 3MMPA 2C97A 4MQ4A 2ZUTA 4BNZA 4EA6A 4CWAA 5JNWA 2P9JA 3L1UA 1QYRA 4AM8A 3DTYA 3A05A 2BHRA 2DKNA 2OBYA 4OAOA 3PQ6A 3DOIA 3D3JA 2EX1A 4HI0E 5BN1A 5CDTA 1MT3A 2J33A 1WSBA 4EFMA 2E89A 4JGIA 2OC9A 4PPQA 3SNKA 2BKEA 3QWFA 3ROEA 5IHXA 4IIGA 1Q7CA 3ZWDA 2BFDB 3ZJVA 4HAWA 5FWYA 3B82A 4V0OA 4BIIA 1F2TB 3QLVC 3ESCA 3DZCA 2AJBA 4LFCB 5KVCA 4DV0B 4QUIA 1Z0FA 2OT3B 2ZR7A 3O2QB 3OZDA 3C4VA 1H66A 2YY6A 3E03A 3A1EA 3NM5A 4LA4A 3A9RA 4EGSA 3TKAA 1IHPA 4L3OA 1XCPA 4QNNA 4RZUA 4DA7A 2Y1XA 5KIAA 1CVIA 2G4LA 3HC7A 1QO0D 1WPGA 2AHOA 3KKZA 3OTIA 4TSKA 4TV9F 2QKYA 4ITVA 3VV2A 1U2PA 1QGDA 3LBYA 5KYWA 2IF2A 4J4BA 3ZDCA 1JQAA 4A8HA 4JFAA 1G17A 2X8JB 3I6MA 3OM8A 4CM6A 4Y1EA 5ETJA 4HLUA 4A16A 2AN1A 5IEBA 3B1JA 1CRZA 3VZBA 4IY1A 2OAEA 2E21A 3UJ3X 2XVYA 4R2HA 2VJBA 3TE6A 4NOMA 5KOHB 1ZOSA 3OICA 1U0JA 3DE1X 4J7UA 2H2FA 3OPYA 5EZYF 5CLLA 4YRJA 1LXCA 3P71T 4OHPA 4RKRA 2M6KA 3VVLA 1U3UA 5E9QA 5BWBA 1O5OA 3DZBA 1TAUA 4HH3C 1OBOA 4V3BA 4CPDA 5IDWA 3F96A 4HTAA 4EECA 1KZYC 2PZ8A 4TMZA 3OFNA 2ZYHA 3JALA 1L7VC 4D3SA 1B15A 4IOJA 2DPXA 1U1IA 1G3RA 3OX2A 5KNCA 3RC1A 1JHVA 3I9MA 1B41A 4ZU6X 1E1RD 3AJRA 3RWBA 3WGLA 1H65A 4FQ8A 4DR4B 1Z22A 3DEFA 5D85A 3NM6B 1DKNA 1JJ7A 2I71A 3FIUA 4PG4A 3W4JA 2XWPA 1WP9A 3NIBA 5EHIA 1UPBA 2O48X 3E1KA 2GCOA 2XLCA 1NBIA 3L01A 1E1CA 3RKSA 2X5KO 1BOFA 1ULTA 1AO3A 1EWTA 1YI1A 3AEKA 4OHWA 5ENVA 3CJTA 1XQWA 3ZBUA 4B0OA 5IKEA 4HWSA 4NAVA 2P2YA 3EH2A 3IUSA 2WKQA 1L4UA 4KLRA 4M9QA 4TN5A 4WFQA 3WLQA 3BWBA 2EFGA 3TTTA 2F9LA 1FLVA 4D3FA 4B4DA 5LQMA 4AI6A 1A4IA 4KK3A 2Q8NA 1J5XA 2W2PA 3CZ5A 4QOGA 5B1SA 3E22A 1KP2A 4FYIA 4TTQA 3THOA 3ZPXA 4H3VA 3KSRA 4M55A 5CB0A 5LA6B 4B3MB 4E21A 4BN4A 4CKCB 1XJCA 5ALEA 1JAYA 5EY5B 4B8WA 5G0TA 1KJZA 3VMFA 3JZFA 1JAZA 3IMGA 4EBFA 3R9XB 2VTEA 3ASVA 2GAIA 4D97A 1W4CA 1BXRB 3ZHCA 1D8AA 3FVVA 3L7MA 1UKAA 1Z6TA 1XMVA 3UAVA 3IEMA 1KJ8A 3GV0A 1V96A 2PMWB 2I29A 4GMGA 3K0KA 1VMIA 2ONCA 3F9RA 1JA1A 5DLQC 2FPIB 3SQLA 2BR5A 3JQAA 1L3CA 1SA0A 1LPSA 1K63A 1RXEA 1Z2OX 2OV3A 5FQNA 1GG8A 1T5IA 5JXWA 3A28A 1DLJA 1UFQA 2MINB 1J07A 2ZYTX 3M1IA 4M1ZA 3CRZA 1T34A 1M34E 1SBCA 3BREA 3NORA 2JFZA 3GCZA 4LZZA 4NCIA 4AX8A 1ZK2A 1P4RA 3AF2A 1GNRA 2WU3A 4UD6A 3SMVA 3JAMA 4AKTA 1CIPA 1R4MB 4KB5A 4L3VA 2DTEA 1O97D 2AZDA 1E3MA 2GJ9A 3HKDB 4KL8S 4TKLA 3ZD6A 5C4MA 4QNMA 1M2OB 4M8SA 3T0GA 2AX4A 4QO8A 3KKPA 1YZGA 4QDKA 3JSXA 4EX6A 1MCZA 4HSGA 3DDZX 3HUEA 3IJEB 5EUQB 1AHPA 5IM4A 4ARBA 4YYEA 1J20A 2IIQA 2A92A 2PGXA 1M8PA 2PKEA 3E4CA 3RC7A 1UBCA 2R6DA 2SBTA 3G85A 1AB5A 1FXWA 1XFDA 3ETJA 2EJTA 4JWKA 2X6TA 4YNBA 4C7MA 2BE9A 5IVPA 3TECE 2FEMA 3AKYA 3WSWA 5EUBA 3CX6A 3PUJA 1J97A 2FEWB 3M83A 4LDJA 4UNRA 4ARUA 3PDIA 3W5HA 1Z2NX 2AI1A 4K8RB 1NXWA 5P21A 5T3UA 2BFFB 1RJDA 2REQB 3JATB 4PG6A 1IBRA 3OJFA 3Q5DA 4XB2A 1VLHA 2OLKA 4PN3A 1SIOA 2A3NA 1BIFA 5JNSA 3FMGA 3LX8A 3AV3A 4ESEA 4P3PA 2JLZA 3I72A 3MLAA 1UKYA 2ZKLA 2FV8A 4NG4A 4XWYA 2HDOA 1JMVA 3M34A 1RWOA 1JAXA 3STVA 4I6EA 1QLWA 3C14C 5E2IA 3LQ1A 1NAIA 2F6RA 3NT4A 5I51A 1RRCA 1EUZA 4J1NA 1J2TA 4XM2A 3EZ7A 2LNDA 1WIWA 2FOXA 4YRQA 5B3JA 4WCVA 1Y4DE 2BMEA 1SZJG 3GRFA 1HQCA 2UUPA 2WU8A 4UOQA 3ILVA 4CV0A 3ZIUA 3QSGA 4NJMB 3DW1X 2JH8A 2IEYA 3FCYA 1W9MA 3R7AA 4DN6A 5LKAA 1N75A 1T2DA 3QBJA 2P2SA 4FDAA 1VI2A 2I54A 2R1VA 3EEBA 3P5SA 2BTEA 2VDLB 2FLKA 3VR6H 2WB2A 3ICOA 1NXSA 2C83A 1XHEA 3FMOB 2O8DB 5FV7A 5JS7A 4MGZR 1UPTA 3KJQA 2XYGA 3GLTA 5BWCA 1KY2A 2OQ2A 3HL4A 3PZRA 1OAOA 3RB8A 4QIHA 3E7PA 1DOAA 2H06A 4QDXA 2KBFA 5T4BA 4D9MA 4BFYA 3SVTA 4F1WA 5KTYA 2ZE5A 1OXXK 4GRIA 4Q66C 1I1HA 1K68A 1I33A 4QBFA 1NTRA 3BZWA 4X1KA 2X3FA 1R0XA 1N34B 5DNVA 1Y6JA 2JI6A 2A9PA 3K92A 3ITEA 4D26A 5JRDS 3DV2A 1XALA 1G8GA 3T8YA 2HCJB 1FYEA 3OTOB 1N0WA 4EW3A 4HS4A 3BWVA 4IOKA 3U4GA 5DTQA 4RMIA 1H2BA 1EUDA 3AONB 3FZQA 1TXGA 4X1IA 1NNI1 4RVCA 1GA6A 2H17A 4KE8A 4XCQA 5ADHA 3ZCQA 3F6SA 3JWJA 3H9GA 2ACVA 5FUYA 3QEOA 5FPKA 3DWIA 5LWQA 3RAEC 5KWEA 3PF8A 5MF6A 5AUNB 1OOEA 1NFFA 2QIOA 3LH5A 1XMIA 3PGVA 3IVCA 2PTHA 4LHVA 4QDTA 3TLGA 1FFGA 4ACAA 3T7SA 2XLBA 4CF5A 2IHVA 1Z2DA 2FZKA 4MWDA 5JCJA 1B8OA 1O6ZA 4OQXA 1KDOA 4DM7A 2V1XA 2VPPA 4U3JB 1JQ3A 3OPXA 1UJCA 3G0GA 1II9A 2QA5A 3D1VA 1BWRA 4JB8A 2ECQA 3F1LA 1I80A 1QR6A 3VR3A 4BNDA 4OP3A 3QE3A 3PWTA 1SKMA 3BIFA 3LGSA 3I9V6 4JSRA 1Q0HA 1CY1A 3FZNA 3R76A 2HMSA 2IU0A 4Y8VA 2QV0A 5KYUB 5BN3A 3NWBA 2ZTHA 4HK4A 1USWA 2DBRA 5A03A 3HACA 3EGEA 4IH9A 4RENA 1KGSA 2Y27A 3BILA 4IXDA 3CN7A 4YB8A 5DSTA 5FO0A 4CM3A 3PRYA 2ZCUA 1SBQA 4UU0A 4HPXB 2DTDA 3HB5X 4JJZA 4BQSA 2BE7A 4IHJA 3REQA 2A0YA 1U3GA 3OG9A 1G64A 4QFCA 4LXUA 3G0HA 1OSNA 1H6DA 4MDHA 2NV0A 1U2DC 3BF7A 3P2MA 2ORWA 3EA5A 3HEMA 3I12A 3R7SA 3WL4A 3FYCA 4EPVA 2JFPA 4N6NA 3VOAA 1OILA 4Q3CA 4ZDWA 5M7EA 4G0WA 2Z3ZA 4LX8A 5A3SA 3SXUB 5DASA 1EVQA 1YJQA 3R6TA 2I4LA 3WGIA 1ZN2A 2Q9BA 2Z2KA 3I2JA 5AR1A 3U3ZA 2CE7A 4JLJA 3GU3A 621PA 1RVV1 5IZCA 1K7YA 2PXAA 1IVYA 4UEOA 4HNSA 2BHTA 3OEYA 2ANBA 2CSUA 2YJZA 5EIOA 3WTBA 1U8YA 3B89A 2WJZB 2K7FA 1AS3A 2H5JA 3HE3A 3FIJA 4QA9A 4F4IA 4GEGA 2P77A 4G5XA 4PZEA 2JLYA 4RJIA 4BQQA 1T5DX 4U2GA 1ZXBA 1LJ8A 2VRCD 2ZVQX 3WGKA 4ZOAA 1E2IA 1JRLA 1HRDA 4A5OA 2A5DA 2WF6A 4IDNA 1TA0A 3KJIA 2AMJA 5FTKA 1NRJB 4XLTA 4HQNA 2GTIA 1NBWB 4R4JA 1W581 4ZCLA 3UFXA 3GT4A 4BEWA 1RLJA 2F8TA 3H11B 1AN9A 4YT5A 2V7BA 5AMXA 1GGNA 5KQPA 1XYYA 1THMA 3ZDXB 2OG1A 1TIKA 3QXHA 4MW0A 4BRZA 4DLXA 1XHLA 4DWWA 4JT4A 2JRCA 2ZJ1A 3GJRA 3T5DA 1CF9A 1RWBA 1RAAA 1UJMA 4J0IA 4L5BA 3TLMA 1JR2A 3COVA 4Z9AA 2AG5A 4KQXA 2GBPA 1Z37A 2WSLA 3RRXA 4FDTA 1WXQA 4RVNA 2XE7A 2JARA 4ZO8A 5BXQC 2FMKA 2NTJA 2I2DA 3P96A 1P6QA 4RL6A 3BWDD 4TTVA 4HUQB 5ELMA 2VRNA 1VCOA 3KDAA 3Q7SA 4QD3A 1Y9EA 1FZQA 5AVQA 3FUTA 1JLSA 3FOCA 3JD2A 3NHMA 1L4MA 2AFIB 1V47A 2JLBA 4JVMA 4YAWA 3RREA 4X8MA 1Z25A 3B1VA 1WMAA 4QRHA 4ZCPA 3ZDZB 4TV8F 4RETA 3B9QA 1FB5A 1MO6A 4BQFA 1E7WA 1GG5A 4CR8A 2JANA 2Q46A 1PJLA 3CUEF 1SVUA 4D45A 1YR3A 1T8WA 1IJBA 3LUPA 3ONDA 5LC1A 3H16A 4FDLA 1VSBA 4CLOA 4JBYA 1M54A 1AU9A 1MTZA 1ZGAA 3ZQJA 5A5VA 1YA8A 3D6AA 3DCIA 4ERXA 1MT0A 1YB4A 1YXMA 1N2CE 1WDWB 1FC0A 2XQGA 4G1EB 2R8RA 2HKIA 4FHDA 1O89A 3ME5A 1RW4A 2I65A 3T0FA 3I9JA 2WWGA 3I42A 3OCWA 3V1LA 4ENPA 1QU3A 4D9BA 2NTEA 2WMOB 2WVJA 4AP5A 4RA9B 2BM1A 3HP7A 5C35A 3DTVA 4TS9A 5A6SA 4GMFA 2FZ4A 2ZJFA 3A11A 3AETA 4B3GA 3D5TA 5IKPA 4BFLA 2Z1DA 4B4OA 2VWPA 1A4UA 3HPRA 1XZKA 3W2GA 1UAGA 3PCTA 4KAXA 2Q7XA 3USZA 1Y80A 1XVIA 2J3DA 2JI7A 3FTPA 5BV1A 3IB3A 2R6JA 2ZYIA 5JZSA 2LV8A 2IZZA 2IL1A 4IQGA 5EE9A 1ISRA 3C6XA 3UXMA 1VRWA 5DGDA 4LDPA 4G5SA 1V7QA 1BDMA 3ZWVA 2BR3A 4QX6A 4C7BA 3W4IA 1ZM9A 2GYVA 3IUEA 2FGKA 2ODBA 4JASB 2F1RA 5B4VA 4V3CA 4I1PA 1T5TA 2WVGA 4OD0A 3TL3A 3R5SA 4LQDA 3U7HB 4EO7A 2VQ6A 3GRKA 1RSZA 1YRHA 5KDOA 1KEWA 1L4NA 5IN5A 5AW0A 1HDEA 2BGWA 5C5CA 1WXIA 5CX1A 5FI1B 2NO5A 1FSSA 2FMFA 1F4LA 2PKWA 3IHTA 4YO7A 5DM60 4BDSA 3GOHA 3HA5A 4EKIA 2ZIXA 1ULSA 2EP5A 1AOXA 1LDBA 3Q7IA 5EQDA 2IS2A 1K6EA 1Z4LA 4CMIA 2B0JA 2BEWB 3CU5A 1B6SA 2C8KA 2RK6A 4DMKA 1BU8A 1SCAA 3FCXA 2FSSA 3E8SA 3HWX1 2IGTA 4UU8A 2PVCA 3IAFA 3AOEC 1NPTO 3P20A 1L4BA 1V1MB 4XWGA 4RCYA 3UB2A 1VIMA 1CEEA 2HEGA 3KIPA 3RAPR 1FX1A 1HSZA 1WMSA 4UEJA 5JMTA 4G56A 1TTHA 3T95A 3NTXA 3DBOB 1JVSA 2VRBA 5BW5A 3K2QA 3KJNA 4DYDA 2IEBA 2JD1A 3T5TA 2R751 3CMCO 5SYAA 3L8FA 3PS9A 4NBTA 1I4DD 4IFTA 3K1AA 4MS3B 4FGZA 2G4VA 5GV7A 2P5TB 1POXA 3B1ZA 1FRNA 3OEHA 4NBSA 1RQ7A 3VO2A 3GJTA 4D0LB 4KXNA 2IA5A 4NCHA 3H5RA 5GMOA 4F60A 1WB6A 2E48A 2H0QA 4KFUA 9GPBA 1G2IA 4LXHA 1FNDA 3L6UA 4XPIB 1IY1A 1CY8A 2WF5A 1VZ3A 3DZKA 4RNDB 4X54A 5H02A 4A26A 2PVPA 2OPHA 3WYNA 5J58A 3EHDA 4L73A 4C0KA 2WAOA 3K8ZA 4CMAA 1GPWB 1N2ZA 2NM0A 3G7SA 2I6TA 1CSEE 4PQYA 4ZTBA 1CERA 4LBVA 1JIQA 2AWOA 4JL6A 4OMFG 2PT5A 4R98A 4R54A 3OTQA 4X3PA 2ZJOA 3MBKA 1HDCA 4YK7A 3ZWMA 4OFXA 4TRNA 2XADA 1YVDA 3HXLA 3TZLA 4DKJA 4L5JA 5EMMA 3GDWA 1X7WB 4URYR 3X3HA 3SQXA 1HYEA 2PWZA 2IUEA 1QG0A 4QGGA 1EFVA 4TTJA 5JVDA 3KSBC 3DZIA 3MERA 1N9ZA 4KNVA 2ZQZA 1RWWA 3EWSA 3FUCA 2NN3C 1EX6A 2PPVA 4XUEA 1TT5B 1U9CA 2AMLA 1WL8A 3Q8XB 3V5NA 5KPJA 2W4MA 1I7DA 4CM4A 1L5YA 4FJ1A 1P17A 1GUZA 5GGXA 3SJZA 1JFTA 1NJSA 3LFTA 1C0LA 4M9UA 4HDMB 1QBKC 1U3FA 5DW3A 3IVRA 1DXYA 1X9GA 3COYA 4KE6A 1PJCA 3AY6A 1DB3A 2RH9B 3HI6A 4FZVA 4O2BF 4S1OA 1U7PA 1M83A 3NP9A 1LPNA 1PZFA 1NG1A 2E5FA 1VDZA 3O84A 4LRUA 4MYSA 2QXYA 4L5CA 5BSGA 2H4ZA 3U6KA 3UCXA 1K8YB 221PA 3L0SA 4D56A 4DCJA 6ABPA 3PHGA 1CYEA 2P8JA 3NLLA 4HWPA 5HZGA 1EX9A 1EFKA 3OQMA 2CUTA 4ESVA 4JODA 3WKAA 4F9GA 1RLOA 4B73A 1VHLA 1A5AB 3FPCA 4QQNA 4US1R 3RS5A 2FMTA 2XCSB 3UGKA 1E2JA 1SOMA 3MJSA 3URMA 1S3GA 1NMYA 2OQIA 1RIIA 2H48A 3VFDA 3C7TA 5AVZA 5IEJA 3TDKA 1VC2A 3GB9A 4L5YA 1C3OA 1NVWQ 2CL7X 1P29A 1GRCA 1UT5A 3QVSA 1CZUA 3T1QA 2GA8A 2PO7A 4K3VA 2O3SA 4MEAA 4EB0A 5KVSA 2AV6A 5AWFC 1ADBA 3ZBPA 1LDNA 3MS2A 3DE5X 4LGMA 4EDFA 3AERA 1KYVA 3LKBA 4MULA 4RTMA 2XPCA 1XE3A 2V7TA 2FZCA 4GIBA 3AVVA 1IY0A 2FPUA 1U04A 1WKBA 4MYHA 5LZ8A 3UJDA 1BZYA 4F4DA 1SC4A 4KGZA 4QGAA 4C88A 4M1SA 4RACA 1WG8A 2OENG 4B80A 4TLLB 2IC5A 3KPYA 4FYVA 2C2BA 1D09A 3BXXA 2OXFA 1Y6RA 2WFLA 4P08A 3RWMB 4LF6B 3UG7A 2ZE8A 3WYCA 1DPFA 2JCSA 2OHOA 3C3YA 4FYMA 5K09A 1HE5A 1M1YA 4DGSA 2DY0A 5K0JA 1C1XA 3FMPB 2IPAB 3UA3A 3A1VA 1FSPA 1Z3CA 2G09A 4AWAA 2BN4A 2CF6A 2O5EA 1IM2A 1D2EA 4TV9A 3PP8A 3IDOA 5FR1A 3PB3A 1SQSA 3GROA 2V7QA 2Q3JA 3P19A 1JJBA 4KN9S 5DBOA 4AN4A 1VP9A 2WIFA 1W36C 4B0PA 1IL0A 3BXHA 3OVMA 1F1BA 1AUXA 2XODA 3MT8A 4N5HX 4WKGA 5IAEA 5LUBA 3WL7A 4BLTA 4G1BA 4HH0A 1CULC 2C0CA 2FW0A 3DZ8A 4YIKA 3EGIA 3VR6A 1EE2A 5DTJA 1WQ4A 3L41A 1OFVA 2D1YA 3HB4X 3H4MA 5BORA 1Z28A 1Y1SA 4MX8A 5CJ2A 1H0KA 1Z33A 1L1QA 1Z47A 2X7HA 2W7TA 3CZCA 4Q82A 4DTIA 2HQSA 3EFOB 5EZYA 3A6PC 1P45A 1MPXA 3UQYS 4P54A 1L4KA 3B51X 1Z0UA 2ORED 4LIPD 1J8YF 2OBFA 3TQHA 3EVAA 3QLTA 2W8ZA 4ZCTA 3VH4A 1A0OA 1I6LA 3KAPA 3U56A 4BQOA 4AVYA 3ANTA 1TVKA 1ZIXA 3DCNA 2I8CA 4AXXA 1EDBA 2XKAA 1II8B 1TUBA 5LP6B 3ELWA 3I9V1 3N2KB 1ZNZA 3D8TA 4OSEA 1WKVA 4OJYA 4RK1A 1M2KA 3DQPA 1TJPB 1XTUA 2E18A 3FZGA 1NP7A 1BWSA 3CTMA 3GRYA 3M6XA 1JG6A 4RYDA 4Q34A 5GM2A 5B4UA 1UWLA 2YBEA 2P9HA 3R3JA 3B1XA 5ABPA 2PUCA 1D7OA 3WA7A 3NS7A 3R7WB 1N36B 3IBYA 5KYYA 3OE4A 1B1CA 5B58T 4TRJA 5AKEA 4AP6A 1B1AA 1P2FA 1P6UA 1QF7A 2HA0A 4JP5A 4DSOA 4LGYA 3FDXA 1QOZA 1JLMA 1T3GA 2REXB 3S40A 3VC2A 1XTIA 1D6NA 4KJZA 2KYRA 4XIGS 4BFTA 2BH2A 3H8WA 3MJRA 2WUFA 3SSNA 2QUBA 2JLXA 1JHUA 1GRRA 1AGXA 1CUJA 3CA8A 5L7TA 4F9FA 3IYLW 1KSJA 4BFVA 1WA5A 1U9YA 1NV9A 2ZSKA 3N5CA 2GS9A 1N1GA 5EAIA 3H1AA 4DCVA 2XZOA 4CQNA 1WDMA 3P94A 4UTPA 1Y3FE 5JC8A 5JTTA 2VQEB 4FOPA 3WL6A 5FRDA 3NHBA 4MYUA 4KC0A 1NUSA 1V9SA 3WMRA 3TGPA 4JUFA 2VK2A 3O26A 5DWQA 1YB5A 3B3QA 4KN8A 1PJ8A 4ARZA 3ND8A 1MB0A 3HN2A 3VHLB 5ALHA 4ZQGA 3IJ5A 3VI3B 4PC2A 4HDQB 1NBEA 1IN4A 5FULA 3ZCUA 3PNLA 1I4WA 1PK7A 1DFHA 2Y99A 3N39C 5BQPA 3Q1KA 1N9GA 4JJAA 4IRMA 1N6OA 4ZI7B 2OHVA 3D0OA 3M82A 3KQNA 1YB1A 3I6QA 3QMMA 4QQFA 5J2UF 1YAJA 2ODTX 2X77A 4ZDKA 4XVHA 4QPDA 1QGUA 3IMKA 4EDHA 2DAPA 2EEZA 3UNXA 1JKJB 2P6UA 5CA1F 1WTCA 1IWPB 3RO7A 4OHXA 2P79A 1MD9A 3IOYA 4QUGA 4LGCA 5DM4A 3H9EO 3D5EA 3NDPA 4EPXA 5HIAA 5LVAA 2RONA 4MQFB 1XPUA 1E99A 2CUZA 1F4VA 2KSQA 2FGJA 3OBBA 2CXTA 4OHRA 1USKA 5EZSA 3DAGA 4M7OA 3SXJA 2ZJ2A 4I46A 1GPDG 3CRMA 5HMLA 3ZH9B 2G5TA 3I83A 1G5RA 3Q3IA 4HB0A 1GZ7A 1HDXA 5BV8A 1P0CA 2EJBA 3W9UA 4UU1A 4DIBA 3WIOA 2G40A 3L0YA 3PQ4A 2BBWA 2XSZA 3K16A 5E6SA 3O82A 3ANYB 4Z3DA 3TSAA 1U8ZA 2PAFA 2PKCA 4DQDA 4QT0A 2BGGA 3W3AH 5ELLA 3T9CA 4W9MC 2J9FA 4ALLA 1Z6PA 1P5ZB 2GERA 4PXAA 4YCAA 2NVUA 1U81A 3C1UA 1FNNA 5CVTA 1UQUA 5ESRA 4EG3A 3GC6A 2JCBA 3F7NA 3ZNPA 4FDVA 3K9CA 1GLNA 2ZJ4A 1EK1A 1OIXA 4XDGA 3TAUA 3QNWA 6PFKA 4HX2A 1M73E 2I2AA 3KD2A 1JEAA 3C5EA 1FMJA 2FDXA 1W4AA 2PX3A 5G02A 3WRVA 4Z5XA 1TFRA 1XMPA 1ST3A 5EHQA 2DM6A 4UBNA 4ZQHA 4AU1A 3ABQB 4F9EA 1NUTA 4NY1A 4BFZA 4FWBA 3OZCA 4S35A 5J4HA 4HZGA 1TM5E 1X8JA 4KFTA 5ILOA 1BA2A 3HYCA 1XT6A 2FMIA 3QRWA 1T2VA 1U2QA 2VJQA 3DYVA 2J0VA 3QXGA 4QICA 3EXIA 3F71A 3RIXA 1KU6A 3EDCA 4C7OA 4XX0B 2OBLA 5LQKA 3K1TA 5TARA 3BCUA 3RVKA 1CUYA 5FTMA 1K8XB 3OKPA 4CKWB 4BUJA 4AMGA 1P1FA 2GRJA 2C4HA 4OYRA 4DABA 2GD2A 1C8BA 3PX2A 1HK7A 2YV1A 4YECA 4DNFA 1QH0A 4A03A 3CHYA 2VJPA 3RNOA 2PGJA 5K0BA 5JROA 3CX4A 4CCSA 3L40A 2ORVA 4AP9A 3VPCA 3RSHA 3MUEA 5G4KB 2O8EA 3WLMA 2XCOA 2HTEA 2JLRA 4ATNA 3N07A 1QF6A 3RT1A 2O2GA 5KU1A 3ZLJA 3EY4A 3LDFA 1Q3TA 3ENWA 2C95A 1T8RA 3NHSA 3LPNA 2H9YA 1NJ1A 1EFUA 1I3MA 2CUNA 3EVDA