1TZBA

Crystal structure of native phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
301
structure length
301
Chain Sequence
SQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLYISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDGLLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQMGVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPEGLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEFNENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEHQERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLAEIRGVNPLATPRIDALKRRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel phosphoglucose/phosphomannose isomease from the crenarchaeon Pyrobaculum aerophilum is a member of the PGI superfamily: structural evidence at 1.16 A resolution
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Isomerase
molecule keywords glucose-6-phosphate isomerase, conjectural
total genus 113
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10432 bact-PGI_C Bacterial phospho-glucose isomerase C-terminal SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1tzbA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1tzbA02
1M3SA 4LF8B 1G98A 3UJHA 4LFBB 1N32B 2F4VB 3HBAA 3Q88A 2VF5X 1TZBA 5LMUB 1U0FA 5LMNB 3J7AC 1C7RA 2O2CA 2CXRA 2O2DA 4DR2B 1VIMA 5BY2A 4X66B 1XMQB 2PGIA 4DV3B 4OX9B 3BCHA 2E5LB 4X65B 5BR8B 1JXAA 1HOXA 1B0ZA 3BJZA 3I0ZA 1U0GA 4DV1B 1XNRB 1XTBA 1KOJA 4DUYB 1IBLB 4JI3B 2CXNA 2POCA 1HNWB 1N34B 2UUBB 2E5FA 4JI5B 1JEOA 1MORA 1TK9A 1VIVA 3CVJA 2CXUA 3ODPA 4DR5B 1HNXB 4GKKB 2XBLA 4DV7B 1I94B 1NUHA 2UXDB 2UUCB 2CXQA 5LL6P 2CB0A 4JI4B 4JI8B 3FJ1A 3SHOA 3C3JA 3J81A 4B3TB 3TBFA 2VF4X 4LF5B 5I01A 5FLXA 4B3SB 1MOSA 4B3MB 4S1WA 2UU9B 2A3NA 4NXNB 1JLHA 4JI1B 4JI7B 3M5PA 1U0EA 3ETNA 1HM5A 3FKJA 4LF6B 5A2QA 2ZM6B 2UXBB 2X3YA 2PUTA 1X9IA 4DV5B 4LF7B 4JI0B 4YHHB 4S12A 2J6HA 1IRIA 3OTOB 4TOIA 4LZJA 1ZZGA 4K0KB 1TZCA 2PUWA 1IBMB 2ZJ4A 1Q50A 4DV2B 2I22A 3T1HB 2CXTA 1XNQB 3NBUA 1GZDA 3FF1A 5IWAB 1VI5A 1FJGB 2DF8A 4IVNA 2YVAA 2CVPA 1DQRA 1WIWA 4LFAB 2AMLA 4YY3B 1J5XA 2DECA 3J80A 1T10A 1X92A 4DR6B 3T1YB 2HHHB 3EUAA 3IFSA 4AQYB 1HR0B 1C7QA 4B3RB 1JIQA 3QKIA 1IBKB 2UUAB 1VI6A 2PUVA 3JX9A 4DV6B 3JAMA 4DR1B 4JV5B 1GZVA 3TRJA 4GKJB 2Q8NA 4X62B 4JYAB 2VQFB 3Q7IA 2CXOA 3PR3A 1J5EB 2CXSA 4AMVA 3OOJA 1N8TA 1MOQA 4LF9B 3LJKA 2VQEB 4NXMB 4DR4B 2UXCB 4DV4B 4JI6B 2WU8A 2XHZA 4EM6A 4KHPB 1N33B 2ZJ3A 4DV0B 2CXPA 2V4MA 1HNZB 4U6NA 4DR3B 4DUZB 3HJBA 1IATA 3FXAA 5IT9A 2I2WA 4LF4B 3KNZA 1X9HA 4X64B 4DR7B 1X94A 1N36B 1NRIA 4LFCB 4M0DA 1XMOB 4JI2B 3G68A
chains in the Genus database with same CATH superfamily
3MXTA 4LFBB 5TVGA 2DTEA 1KRHA 3PGJA 3UB4A 3PXXA 5FWDA 4C3UA 3A36A 1N57A 1Q1NA 1ZRHA 2BFPA 3DD5A 4FCVA 1PW5A 1EG2A 1PFVA 3RU2A 3WRYC 1JPJA 4EBFA 5M5BA 4BMNA 1JU9A 2QIPA 3DMYA 4IY1A 2Q3CA 1PNVA 4X1YB 3Q9LA 1OXUA 5F51A 5C18A 4IDQA 1FP1D 2Q5OA 3VDRA 3K0KA 1LDMA 3TR6A 3ZOZA 5JHGB 4OL9A 1GPWB 1G3IA 3OKCA 5FOXA 5TPZA 5LPNA 3AINA 2VYVA 1I2MA 3M7IA 2O2SA 3AUAA 3QNWA 4LSMA 1GOTA 2ZRHA 1PIWA 3A6KA 1NDHA 4G01B 4B0PA 2BMVA 3EZNA 3ZY4A 1WSDA 2EZUA 4BX8A 3K2QA 3RC9A 1MW8X 1TO6A 1GG2A 4JASB 1I01A 1JX6A 4XJSA 3TB4A 2DGDA 4R1NA 3TVTA 5JR3A 4OOFA 5A4IS 3GJYA 3IELA 3MJDA 2PS9A 2CLLB 4ZAYA 3B20A 4KZKA 3OTQA 4ZVKA 1Z28A 2P9JA 4K0RA 2MSNA 4PYOA 4EF6A 1E2UA 5KYUB 1CR2A 3ZV7A 1JL3A 1WHSB 2QYTA 4ZAXA 5GZ3A 1LWOA 4LHXA 1U0LA 4AQ7A 3KR9A 1VKHA 1MC8A 3DNMA 4FHFA 2FETA 2HGSA 3EXIB 2GRJA 3ESZA 3HKDB 5FBZA 5TV2A 4KIGA 4D9NA 5BUZA 1L7EA 3FF4A 3JTMA 4K9OA 4ND7A 5C80A 3PEYA 3DC7A 2W8BB 3FSGA 2J3IA 4KR3A 5A2QA 3OT1B 4O4HB 3NI2A 4EZIA 5KJ6A 2ZIXB 3PZRA 3SXJA 3ILVA 1PT7A 2VK2A 3FNIA 2Y1EA 4P9NA 2FRDC 4MP3A 1BX0A 5KDLA 1DBWA 2IYOA 5DNDA 3RJ9A 4LWOA 3RUHA 3UJPA 4KAAA 1R66A 2VUTA 1FFBA 1XCJA 3AHDA 5CX1A 5EY5B 5CEEA 1RCUA 2EDAA 4M1QA 1IMJA 5ALNA 4Q02A 3RAPR 3DLHA 2C4KA 1BDBA 1WW3A 1G8KA 3ZD8A 7ABPA 1KDRA 4G3XA 2BKAA 5IDQA 3C24A 4QPZA 3KSBC 1B6GA 1GNVA 1K8YB 3AJ9A 3ZHVA 4UDNA 1M83A 2FUG6 1OBFO 3W05A 1OX4A 1XZDA 3LW7A 4K2AA 4WGGA 4YIHA 3SR3A 5CFRA 4G4IA 1I51A 1L4NA 3ADDA 3I9LA 3WFJA 4Y18A 2MU1A 2FJPA 3DHWC 4IS2A 3W5IA 5HGXA 4W5TA 4DR1B 1KXZA 4JB2A 4Q7QA 4OHYA 1QUFA 3EZGA 1L5HB 3GLGE 1V2HE 4AKIA 1P18A 1OJLA 3GJTA 4N8SA 4G23A 5TQ0A 1ZCBA 5HR5A 3HWX1 1A9XB 3V9PA 3TDMA 4EVIA 4F85A 1GTRA 1W48A 2WNHA 3RSLA 4ETIA 5I9SA 3BB4A 1AVTA 4PO8A 1WKVA 4PBSA 4MYHA 2A1UB 2W2LD 4QRIA 4S2UA 4ENQA 3E27A 4MW2A 2IP2A 1JIUA 2CHGA 3PFBA 4K6KA 3N7UA 4YMIA 1FFXB 1KJQA 5DGDA 4A7PA 4C0WA 5C5EA 4HI0E 1L5QA 5CK5A 2VTEA 1RAAA 4JL6A 5EMHA 4CTKA 4CU2A 5LWHA 3M70A 1DAMA 4UVDA 3RAGA 3M9XA 4CTOA 1KI9A 3A32A 4NCJA 2HF9A 1NJSA 1DKMA 2UZ4A 3WGQA 3M34A 4R2XA 5KOHA 4EP1A 1B76A 2C3OA 2X2EA 2BGTA 2LR0A 1WCIB 5B3JA 1DIBA 2H7YA 3M5DA 2QM7A 1E1LA 3DPIA 3EN0A 4TXLA 3AF4A 3R7WA 3UKDA 4G1UC 3UWSA 1WAMA 2EATA 2I8LA 4XYEA 5JXGA 3Q8KA 1DCFA 3NYRA 4G89A 2GJAA 4QHTA 2Q4BA 1N7IA 3A3YA 1F2DA 1O6FA 4CLDA 2ISSD 2O5VA 4IXWA 1CQIA 3JPYA 3MTGA 2NW6A 3CF4G 3GEDA 5JYEA 1FFHA 1KDTA 2H4HA 3QVUA 3QG5A 4G07A 3R3WA 1H0RA 2CHQA 3WQRA 1TYCA 5IULC 2P2GA 2HT1A 2B30A 2L2QA 4NBWA 3M4YA 4N7BA 1EFKA 1ZS9A 4ZARA 3JQGA 1GZ7A 5D2CA 1DINA 2NU6A 4YCAA 3RG2A 1QOZA 1FLNA 1NZJA 3H1FA 2F1JA 3FJ1A 5K8VA 2J0SA 3I28A 2DBVO 2VJPA 1RJ9B 2VUUA 4URYR 3U1VA 1K66A 1UIRA 1FNCA 5E4JA 2DKFA 5L9AA 1PJSA 4OU5A 2QA5A 3F0TA 4QYIB 1KMIY 1L5ZA 1UT8A 5KHOC 1EJ0A 1Z0AA 2GT1A 1RPTA 1EP9A 2BMDA 2RHMA 4XGQA 1G7RA 4OH1A 4EHBA 4S0XA 2Q2VA 1HKHA 1E1KA 1JDBB 1YIDA 2ZBDA 1RAHA 3DUFA 3KEOA 4KN5A 4X9XA 5EG5A 1VBFA 3TDNA 4ZEMA 4HEA6 4RD2A 4UDOA 4S05A 4KO8A 3KKZA 3TE6A 2D8AA 2C5EA 4MMZB 1AOXA 1RM4A 1TT5A 2JF0A 4B6FA 4CEIB 4LF7B 4GR4A 3CNQS 2Q0SA 4ND2A 5CP8A 4ABYA 5JROA 4U02A 2B2XA 4PHFA 2ZBFA 3QVSA 3UY4A 4YK7A 4WJKB 3INYA 3AETA 3UV7A 5ALVA 1E4OA 3FM9A 3HGTA 4GPAA 2Y3IA 4XLZA 5IT0A 2JIMA 4K1LA 3V4ZA 1WQ3A 1ORWA 1UZUA 1ZOIA 4OQEA 3REQA 4E5VA 2V7UA 2CKDA 2CLSA 2AEMA 3I6YA 4G86A 5B1SA 4YT2A 4LVOA 4KLRA 1YS9A 2WB4A 1LNSA 3IQGX 7REQA 5JCJA 1C3OA 4BLSA 2FW0A 2G1AA 3HP4A 4LJ4A 4JROA 1FEZA 4QARA 1WPGA 1NC1A 2EHDA 3PDUA 2A1IA 3W6ZA 2O5EA 1YZKA 3A4IA 4HSGA 4LY0A 4E2WA 1RADA 1RPAA 4D2IA 3W8EA 1DG9A 1YRYE 2O57A 1Y6FA 2QS9A 1JILA 5J1SB 1C3OB 3MBIA 4B3XA 1FNNA 3E0XA 4O4LB 5FL7A 5BNFA 3UJ7A 4PRLA 4BP8A 1W581 3KTAA 4EHIA 1RI3A 4EKNB 5EGNA 4KLAA 2C54A 1YR6A 1K68A 1O96A 2GZAA 3HA5A 4BPBA 5DNAA 1N5MA 4FBGA 3PDIA 1TF5A 4MRMB 3MCWA 3M81A 1UK7A 2FFJA 4D4IA 5B7QA 2XADA 4LG1A 4NZ9A 1Z22A 5J3JA 2Z5LA 1C14A 3IUQA 4HQFA 4LXUA 2WV7A 3ZLTA 2V4MA 2Y1WA 2X13A 3CTMA 4IDPA 1SKYB 3JW8A 4GPBA 1N5KA 3GOHA 3O9MA 3S7ZA 4CEIA 1XTZA 3BE4A 1T91A 3DXYA 2QAIA 4X64B 5A3RA 1CEXA 3TFWA 5KU7A 4LOHA 1CUWA 4QSHA 1IAQA 1NRIA 3GRKA 3MS2A 2UKDA 1GQFA 4DDTA 3TOCA 3SX4A 3VKHA 1SVWA 2Q62A 3AWDA 5I8ZA 1NL3A 3CR7A 4PNPA 4HK4A 4Q3BA 3F8WA 2GZDA 2ZANA 4WUVA 2HHJA 1FYXA 1SVNA 2QM0A 5AHXA 5JRDS 1QP0A 1SELA 1YR2A 4IXNA 5I9LA 5M34A 1C7IA 1QMGA 2V54A 1E6WA 1F5SA 3RKUA 1EFAA 2E4ZA 2HIMA 5FHQA 3WB1A 1EUCA 3KR1A 5NLLA 3TIXB 4JZYA 3VGJA 2FP3A 2CDAA 3DEHA 3HWWA 3TGPA 1NVBA 4UU7A 2HA0A 2FHSA 3F5FA 3SJUA 2AYZA 1PSZA 1DI0A 1ZUNB 3C7DB 1BAPA 2QTNA 3E9MA 3IAEA 4L74A 4LRWA 2OC4A 1MVOA 1V9LA 1ZD5A 2Q41A 4NYMR 2HEGA 4HRXA 2AXQA 4DDUA 2WJHA 1ZJ4A 4M1ZA 2AFIE 4YQZA 1MJGA 1IUPA 1F38A 1LPMA 1M1YA 3B82A 1DAIA 3NKVA 4NU8X 2OM6A 3VR6D 2G5TA 3KJEA 1G16A 3KKLA 5IT4A 2C2GA 3GFGA 3NP9A 5GZ6A 4DFDA 1BGXT 4CMAA 2A9QA 4W7HA 1PK9A 5KQRA 3EAGA 2I65A 3OO1A 5JJIA 4JJFA 3R6DA 4UHDA 5FV7A 1UDXA 3OEHD 3RJTA 3TQSA 4HQNA 4X60A 5KUTA 3NTRA 1FSPA 2OWDA 3A9SA 1GAQA 4J9VA 2KE5A 1N77A 1QG0A 5KYTA 1H94A 2JKYA 1EAYA 5FBLB 4WRRA 3REQB 1GSIA 1YA4A 3ISJA 5LUBA 1QE5A 3D7MA 3RHSA 1ESDA 4HUTA 1GNSA 2JI4A 2CCKA 2ZATA 4QXOA 4YNBA 5AI4A 1K3UB 5DLEA 1XFDA 4I2VA 1N6HA 5KTKA 4F2WA 1ORHA 4Q3OA 2QLJA 4EB0A 3DAOA 4X8HA 8ABPA 3GA5A 3DAGA 5AVTA 1YJXA 4JLAA 4AJIA 2HPHA 3CKLA 3UPDA 1B41A 5A4JA 1XOIA 2IW3A 3IKTA 4GQBA 4PZAA 2BFNA 1HEUA 2DY0A 1MQ8B 3OU6A 3PHBE 4JB0A 4MZDA 4US0R 1RACA 3DDWA 1GLNA 4N5IX 3I8OA 1DC8A 5A9SA 4KC0A 1U1FA 1UUFA 1AXRA 1Y1KE 3K9GA 4KQHA 2FR1A 5GIPE 4MVJM 3LE8A 2D3WA 1EUDA 3GLFA 3ELYA 4L15A 1J39A 3ELUA 1SQ6A 5PGMA 4PBRA 1Q3KA 1Y1QA 1OI4A 2DWUA 5J58A 2AYXA 3NIBA 5KWSA 1NBAA 3P1JA 4XUCA 3EZYA 4AXXA 1K7YA 5EERA 3LTNC 1Z0UA 3BMOB 4RGQA 1D2MA 3I42A 1QV7A 3SWWA 1JDPA 4FGUA 4NBKA 5ALGA 4QL3A 1YDGA 3S4YA 3UAZA 3CBGA 4PSUA 5AJHA 4C0QC 2GF0A 4CV0A 3DW1X 1LQ2A 3NTXA 3ASVA 1GU1A 3C74A 3F90A 1Z7EA 3KKNA 3MT0A 4R9UC 3W0LB 4RVNA 3BKWA 3JQDA 3L7NA 4TL8A 5JXWA 4R01A 5AI0A 1TUEA 4FDUA 1Z7GA 5DDIP 2JKZA 2I3DA 4PR0A 4TQAA 2K6GA 2HUNA 2GPBA 4NJMB 4OAQA 1GQ2A 4OB7A 1BMDA 1DT3A 3BB1A 2JLZA 4OJYA 2QQEA 2QRVA 2ZZKA 2R7NA 3LZ6A 4FT4A 3S1LA 1XWWA 4ZTUB 1QF6A 1NUTA 1YC5A 2WYWA 3T3HA 2LBPA 1TFUA 2X23A 2FZCA 5JNVA 4GUDA 3COYA 2KWIA 5B64A 2QMQA 1U8TA 4U0KA 5LC1A 2GETA 2G77B 3ZE8A 4EGJA 5JDIA 1E2BA 2QWXA 2ACWA 1Z2AA 2YHIA 5EINA 2CNLA 3OZDA 1GQOA 1TB4A 2PQMA 2QLTA 4AF8A 4BHTA 1RRGA 1PR2A 1JKFA 5TE9A 4ZICA 1N75A 1Q0LA 3NKLA 1MIHA 4N7MA 3RARA 4E5DA 1M5TA 2E5FA 2PIAA 3L82B 1P39A 5DJ5A 5CDHA 5JZMA 5JECA 3IVCA 5KOYA 1SOWA 3T3GA 3B3AA 1WZNA 4FJ0A 2RI6A 1RAFA 3HLYA 2YJGA 1IDOA 3LPLA 3RTCA 3FHJA 3LWNA 4UPVA 4NONA 4DM4A 3QKTA 3VHQA 3OFNA 1SEVA 3HV2A 4FD3A 1WCIA 3OFND 5GQSA 1RMTA 1VXOA 2FEKA 1AY0A 2IPXA 2W4IA 2FSFA 1M66A 1K98A 4ATNA 1VA5A 1DFHA 4IHQA 2IPMA 3L05A 5EWJA 3B1FA 2J08A 4BVJA 2QN3A 3VAYA 4G26A 2VTDA 2YVQA 3LYLA 1BXRA 2BHSA 1GILA 4FGLA 3Q5DA 3KQMA 3KZCA 2JAQA 2EHJA 5KMGA 2WIFA 4BZXA 1A27A 2H6EA 2GK6A 4U6SA 5A5GA 1F60A 3M5WA 4H0FA 4Z1MD 1ZH8A 1SEPA 3CZQA 4RCZA 2VOJA 4Q1FA 2ZJ8A 1TIPA 4MEBA 4OQDA 3LUPA 3Q98A 2VSQA 1E5QA 1UJ2A 4FMCF 4HH3C 1OX5A 1HK7A 1NASA 3HFJA 4WV3A 5DO9A 5KYGA 4FR5A 3OJLA 1QQ7A 2XYQA 3ITNA 1ACLA 5JD5A 2BW0A 1N5DA 1Y9DA 3DEZA 3W3ZB 3NPMA 4ACBA 4TL9A 4L02A 1K5GA 5CA0B 3GPBA 3JX9A 4UJ5A 3CF2A 4ZAWA 4BYGA 3P97A 5E1DA 3UN1A 2R4UA 1I3KA 4ME6A 1ECBA 4MKRA 1NM5C 2COKA 1TAGA 1C1DA 3PCXA 2H2AA 2W2KB 2XVZA 2I1WA 1YI1A 3CNBA 3O4RA 4I0WB 3Q3VA 3PV0A 1JQEA 4NYJR 3LS2A 4PQEA 2UV8A 3N5CA 3VPHA 3AR9A 2WVHA 3SYKA 1XDGA 2I8CA 3B8HA 2GPWA 3HDTA 3LT4A 3TVYA 3V8EA 2WG0A 2WM8A 1RJWA 3RUFA 5HP4A 1PO7A 4LPSA 4DIEA 2WIDA 1Z7BA 1GL3A 4JOSA 5JEDA 2O3TA 2RCYA 4LOLA 1N4AA 4YMGA 2HC9A 5JS6A 3BWDD 2P35A 4GOND 3MTEA 1N2OA 5CD9A 4N54A 1KXJA 1O08A 2J6IA 5IP5A 4COKA 5CB4B 5I8WA 2W0MA 3GJXC 2APJA 3MWDB 4R8KA 1KSGA 1AQUA 3H9UA 4O08A 1L5NA 4ZCRA 2VTBB 5FULA 4O0MA 1NBWB 3G68A 3PB3A 1Z2PX 2FJUA 2PWAA 3R7NA 3LK6A 3OLWA 4G1MB 4I3GA 4PX5A 4BO9A 1IE3A 3ZJUA 4L0DA 1WTCA 3FPKA 4V39A 3L0YA 4V0MA 4CM7A 3KDAA 2E4VA 5LMUB 1E9AA 4RVDA 3UFBA 3GUCA 1ZRMA 3SN6A 2BGGA 4B46A 3DOHA 1RBZA 3S70A 1UBJS 1JH9A 2HSWA 4LE0A 2NADA 4AJNA 2V6BA 4DQXA 3AZOA 4UCFA 1XMVA 3H6HA 2G5GX 4MV7A 1VL6A 3O26A 4Z99A 5HGJA 3H1BA 1JQJC 4UAGA 4CCSA 4ZOLA 2JFWA 3T5GA 3L77A 1AK1A 5F12A 2ZB8A 3TOXA 4Y6RA 3HVRA 3AUFA 4LHYA 3FPCA 5CEJA 5AH0A 3EF1A 3HH8A 4QAJA 5AJVB 1KVRA 3LVQE 1G2OA 2EJTA 4L1KA 4E3WA 1FP2A 3ANLA 3L0IB 4UQOA 3UW3A 2W6JA 1Q0HA 3GZNA 1JHOA 3SM3A 2BSAA 3LKZA 1ZL2A 3V8RA 1M0EA 1QYCA 1P1RA 3N2NA 5IMSA 1YC2A 2QX7A 1E1QA 3F78A 1PK8A 5G1OA 3RANA 1UK8A 3I9V1 3FE2A 2FPXA 4TKMA 5EIFA 1MRSA 4HEA1 5LLTA 2AMVA 4W8OA 3QELA 2DBRA 3N8IA 2V7EA 4UZSA 1UDAA 2J5RA 3G9QA 4YJDA 1DRKA 1UT6A 5B6IA 1IAVA 5FQOA 4DLUA 4D41A 4FFRA 3B3QA 3INGA 2YXLA 4FOOA 2Q45A 3PLAE 3RASA 4BO0A 2Q5FA 1P3JA 4R1SA 3WMGA 2I7DA 3B3GA 4JLVA 3D4BA 3TSYA 5A4DA 3HPQA 3PNSA 4KJZA 6Q21A 1G5TA 3UXMA 3ZG6A 1XX6A 2R86A 1SPXA 2TS1A 4MWCA 2C78A 2PEZA 3P9QA 1MEEA 3ZBPA 4N6NA 2IQ5A 4CMIB 2WICA 1H6BA 5BV8A 4C7XA 1SUWA 4EI2A 4FW9A 1BS1A 1GPYA 3B1YA 1UDBA 5B2ZA 1KY3A 3BJEA 2B3TA 3MFYA 6PFKA 3UOWA 3BM5A 5IT9A 1OHHA 1O3YA 3VTZA 1VLJA 1NI4B 4GD3Q 4B7ZA 1KJ8A 3R5FA 1DQPA 1I8TA 1R6XA 1SUPA 3Q72A 5CHYA 4ZVLA 5DVZA 3HVUA 5DW0A 3W4JA 4EHJA 1NX9A 5CDTA 3LX5A 1Y5MA 1NN1A 3F8TA 1RQRA 4JBHA 4LYHA 1E61A 3JZIA 4P2BA 5LZ8A 5IJ9B 4L0CA 1I7PA 1DVRA 2VK4A 4KLNA 2ZQ5A 4KFSA 4AZ3A 2XUHA 3OIWA 2IOYA 2MSKA 2YQ4A 4YMHA 1Z39A 1SU4A 4NATA 4YDHB 1PSDA 3C45A 5DU2A 5BRNA 2HPAA 1E89A 3RS7A 4CLRA 3WQBA 4A6XA 1JJFA 3I4CA 3NDJA 4FZ5A 4QM7A 3PEWA 3ZLJA 5EHGA 2PN1A 3G0OA 1BW9B 3V48A 3M89A 1M2OA 2DZDA 3FOWA 3K0CC 2QP4A 4FSHA 4RMHA 3UJ8A 3GA7A 3AVWA 4C0JA 5FL7D 4CEHA 3ZE9A 1P4AA 2PVSA 1ZUD1 4KBFA 1TYBE 3HXQA 2QSJA 1HGXA 2I6GA 1KQGA 3MLAA 2XE6A 1GKLA 4GE3A 3EIFA 2WJPA 1XCGB 5DM70 2CYAA 1MR3F 4C7OB 1UPTA 1Z5ZA 5EOVA 1PR4A 2GJ8A 2O20A 5G4KA 2QX8A 2AFHE 2C83A 5JCJD 2NZUG 3DOFA 3DP7A 4WA7A 4N12A 5DIFA 3NEAA 4BFUA 3BGVA 3EXG2 4RJJA 5SV2A 1OHHD 2PH7A 1PTKA 2D5LA 1AQIA 1ZJJA 2XPCA 2YUTA 3MD0A 1COWD 2H00A 1CQWA 1C2TA 4C4SA 2FOIA 1D1QA 2AQIA 3ZDAA 2H5JA 4GSKA 4WA8A 3O3OB 2G1KA 4MVJF 1Z36A 2VDJA 3HQ4O 5KYWB 1VL1A 2XDQB 5EZYF 3O8OB 2VQ6A 1X13A 3FDJA 2E9SA 1XRJA 4XJVA 2QBYB 2VDKB 1RQLA 2PEYA 1W1WA 4KKXB 1R6TA 4ZGBA 3N2KB 4Q9NA 4ER5A 5T4EA 1V8PA 3T9FA 2XE4A 5BN5B 3RSGA 2F3SA 3IL2A 4C0SA 1QHEA 2NO4A 3PJFA 1L7BA 1S2LA 2JI8A 1GXSB 5KVQA 1QRAA 3TXXA 3OSUA 1G2QA 5DBEX 2GO7A 2AXEA 1T6YA 3HKCA 4GX5A 1OBOA 5FOTA 3UBTA 2DFKB 4RKQA 1BYUA 3HHPA 3BEDA 4LDJA 4UHJA 3MJVA 1EM8B 3R5SA 4G5HA 4REOA 2ID8A 4TTAA 1PZHA 2EP8A 3ZHRA 4C89A 1AKUA 3OZTA 2HI0A 1XZFA 2Z8YA 3FCOA 2OBMA 3BILA 3F6YA 2WZQA 2NT4A 4GP7A 5TMBA 1OB2A 1GTJ1 3RRYA 3WSWA 4TKVB 1P9WA 1PFUA 4Q19A 1WVMA 1NBME 2VHJA 3RV4A 3ZDQA 3ULKA 2PUWA 1JR4A 1IBMB 4YAWA 1X0VA 2XYRA 2HA4A 4B84A 4D45A 4ZODA 2JLWA 2XI4A 2ZRNA 3N1UA 5CA0A 2CEAA 4FFBA 2VNHA 3BXOA 4PIPA 5ILOA 4DM3A 1KMHB 2H1SA 3BXGA 3ZIUA 2FVXA 3FPHA 2OORC 4WE3A 1J5XA 3HBMA 3WY9A 2O19A 2ZJ7A 1GPLA 1Y1TA 4ZQGA 2ZEJA 2P0EA 3P2EA 4IPTA 2XMRA 1NSTA 4GHWA 3B51X 2H1IA 4PXAA 2ZYRA 4P36A 2GFIA 2JEZA 2QY6A 4QASA 2HJRA 3UYLA 3O73A 1YB6A 4HN4B 4QVGA 3PHJA 2FWNA 4PLYA 5E6RA 3ENNA 1FP4B 4Q05A 4OHPA 3H1TA 3H4VA 2PZGA 2BUBA 2P65A 4FHEA 4M53A 4RXMA 1VCIA 2IXDA 2ZRJA 3DTVD 4BV3A 4EB8A 1E3JA 3IAS1 3R2JA 4Q3CA 3VC1A 2B7BA 3G5TA 1YVPA 4KQGA 1T1JA 1GQYA 1JMYA 2FW9A 2HMWA 1YGYA 2WUVA 3LL4A 5AKYA 1MA3A 3ZE2B 1WHTB 4CIXA 1C7JA 3LHDA 4DV4B 3KU1A 1KGDA 4P5DA 4OHOA 2X6QA 5FCDA 3V34A 1W9MA 1CY0A 4I8DA 5A5VA 1CDZA 4O2BA 1XQWA 2WVGA 3A3PA 2R8OA 4CKXA 3PLNA 4A2WA 3LPDA 4EG7A 2OE2A 2AXPA 4MLZA 3GLFE 2UXDB 5CFZA 3LT2A 3TBKA 5K8UA 2R2AA 4EOGA 5EL0A 4POAA 1A4RA 1SR8A 1T2CA 3KQTA 5JXJA 5AMXA 1CWUA 1G7TA 3AFIA 5F7JA 1PHRA 3AIMA 1XMJA 4JVMA 1RAGA 1XLUA 3N7AA 1AKEA 4N5HX 4QJIA 1MRNA 3IEUA 4MJLA 4RDIA 1EZZA 4E94A 5ICMA 2R6JA 3G8AA 4J16A 4QNNA 1EWVA 5EMMA 5KDOA 3JWIA 1BH6A 1QHSA 4OI2A 5I7FA 3FHCB 3SJCA 1GCUA 1ZJ6A 2JFBA 3GCGA 4LGYA 2NXWA 2BMWA 1IM5A 3PI6A 1B14A 5EJ2A 1BE0A 121PA 1ISRA 2ASEA 3NXSA 3PD7A 3ZHZA 2BRUC 2C5SA 1FNMA 2QM3A 4XI9A 5IBQA 5BPHA 1XNRB 1X7WA 1UKCA 2BCEA 3ABZA 2R25B 5KYUA 4QLAA 2AE2A 4ZHQF 4F9TA 2J3KA 3LDGA 1JEOA 5TS2A 1F2TB 4B4VA 2W2QA 3U48A 1ODTC 1J4AA 2JAPA 3WGGA 2O6HA 2MR5A 3M6AA 2UUCB 5HDBB 1W0JA 1SPBS 2QTFA 4A6PA 4LVNA 4HNAA 3G8BA 2QPAA 3SBOA 5DHTA 3PGA1 1N8NA 5BQOA 4ARCA 1TJ4A 3RVMA 4CF4A 4FWBA 1T9ZA 3RRFA 3ZXXA 2RAPA 5JTTA 3QVJA 1GDHA 3AF3A 3H5NA 4OJKA 2GNPA 4GLBA 5IDYA 5IUNC 3B6KA 4IW3B 1F8GA 3O0DA 2M6KA 4D81A 4OLAA 5FD8A 1JU4A 1HY3A 4S04A 5IDWA 3TRIA 2RARA 2WWGA 3IDOA 3JTEA 3RAEC 1UXKA 4C14A 3AKEA 4ID3A 2VJBA 1SY7A 1YK1A 4K3VA 4OM7A 4DL9A 4K40A 1EWRA 1P17A 4IXMA 1IY2A 4ZVNA 4ZVRA 4KVFA 3OI7A 2L0XA 4CTMA 5IF3A 3EEBA 3IBCA 1B15A 2WHYA 3H1EA 4K9DA 5KINB 3IUSA 3OPNA 4G0NA 2H52A 1RXWA 4KXVA 1MGPA 4I50A 1T4DA 4NK5A 5CVJA 3OEYA 3DT6A 3VH3A 2ISQA 1E2KA 2IYQA 4F21A 1QZXA 1R4AA 2WKSA 5C46F 5LQKA 4L16A 1KK3A 2E4AA 3EQZA 1DKRA 4NZOA 5KOIA 2AKEA 3OETA 3PCRB 1L3CA 4D7AA 2YJ6A 1Y6ZA 3HO8A 4RSGA 1P6XA 1NVWQ 1RWMA 2XTAA 3FLMA 3TD9A 3IKLA 2DCUA 1IUNA 4Y2VA 1FRZA 2WB2A 1THGA 5EUCA 4OMFG 5H3HA 4TQ9A 3LRTA 1BN7A 5J9FA 4U0JA 3WYBA 4OJQA 2OHFA 9ATCA 1BE8A 2AHOA 5DASA 5J40A 3RHZA 1AKTA 4BUCA 4EITA 1VP3A 3ACBA 4R84A 4JLNA 4QRHA 1UXIA 2B92A 5KHAA 2I34A 3SMQA 3OCVA 1Z5GA 1FX0B 3S44A 2FPMA 5EFZA 4IOJA 1T0HB 4E03A 2ON6A 3RYFA 1WSWA 4R05A 2QD3A 1JXMA 1TGVA 2F7SA 1R0CA 3MXOA 4QYTA 5IHXA 4OV6B 4PANA 4GMXA 5I7AA 4ZOLF 4Z53A 3U09A 3CPSA 4L8LA 4OGWA 2XR1A 3EBOA 4ROTA 3VZRA 1I13A 1UBRS 2VUIB 1E1QD 4EVSA 3NDBB 1C0IA 1PEKE 1PFKA 3KQYA 1ULZA 1YS1X 4UBNA 3T7AA 3KOZA 5EI5A 2WQ6A 1XMOB 3EG9B 1WMAA 4TKUB 4J6EA 1KO5A 3OE1A 2R1VA 1NLZA 4DSZA 1XQ9A 3WZLA 2H2GA 3IHKA 3EIEA 1QIGA 1SUAA 4HWOA 4YECA 1N3IA 3DMGA 1E62A 4K05A 4B34A 3KWJA 1AQNA 3R23A 2QTVB 2QN1A 2KM1A 3FB4A 2FN8A 5IUKC 1C1DB 2WJVA 4LAFA 2AJLI 4N3NA 2QW8A 4OBBA 4A82A 1T24A 3WGLA 1MMFB 4RVCA 1WZEA 4GWKA 4GYWA 4OYHA 2R44A 1NJ8A 1UBEA 2NU6B 3R0VA 4FGZA 4XQGA 1P61B 3AF2A 4XVHA 4ZOBA 3WOVA 1X1TA 2IITA 3H5WA 4DWJA 4BNJA 3DLAA 3GP8A 5D86A 2IQIA 4E88A 3G2KA 5G4LA 1Z6YA 2F2TA 4ICIA 5GV8A 2CXUA 2F00A 3ZLUA 2GM5A 1BOOA 1DRVA 3GGCA 4C0HA 1J33A 1QGUA 2E1PA 1ATZA 2OSVA 2I1VB 1ONOA 2D2FA 3A9CA 4KDCA 2ZM5A 1U9ZA 4XX1A 2Y66A 5EQJB 4F4CA 2C82A 2H4YA 3KYCB 1RCTE 5FNVB 2SKDA 1E58A 3K9NA 4F1WA 1ZDMA 4JJGA 3PT5A 1K4MA 2JZOA 5D5PA 3RIHA 4F12A 4NCBA 1OROA 2GERA 2RH8A 2W6OA 3BX1A 4YA6A 1X14A 4QM6A 2XWQA 4CIAA 3HGMA 4G0ZA 2XTNA 4DN6A 3BVPA 5JISA 1KI1A 5KNDH 4RMIA 5SICE 1F20A 4DNOA 1UPXA 5EJ7A 1LBSA 3WBBA 4BP9A 3GZTB 3PJEA 4E3ZA 4BTLA 4TXJA 3G0GA 3EFOA 5E1OA 1M2GA 3RS4A 2JJ1A 1BKSB 2UYYA 4GRDA 1XA4A 3R5JA 1V8DA 2JC3A 3NAMA 1II0A 1QO0A 3UAYA 5JQWA 2XDWA 2H9AA 4MUFA 5JSYA 3WRXA 2O4CA 2VAXA 2QNRA 4K6GA 4HBGA 3STXA 5A4KA 1JFSA 2G7ZA 2B2NA 3ZHTA 3HSYA 3CLSD 3G9UA 2PZFA 1VFNA 1ZN9A 1XNJA 4ZT7A 3WQQA 3HYNA 3W1EA 3T7DA 4II3A 4P93A 2IZ7A 3B5IA 1GZ3A 1YRWA 4WACA 2C57A 4Z7QB 4BNXA 4KE9A 2FGJA 2QTMA 1BE6A 3EMKA 3GT0A 4Q01A 5BN4A 4NEGA 1T9GS 5C8YA 3THSA 4HXFB 2JAHA 5D85A 2UZ0A 2HJHA 4R51A 5DCYA 4MSUA 1G4HA 5H3CA 4UUQA 4ZD6A 2ZUTA 4CFYA 1OVMA 2W22A 1OFHA 4KSBA 4KN8A 3KOWA 1OAOC 2JJQA 4BKMA 1IUOA 1CUUA 3E5NA 3NJRA 1V3QE 5JU6A 5CG1A 1XMSA 2NYVA 4Q7EA 1MFPA 2HK9A 3O1JC 3KV1A 2PZJA 3QPVA 1JPVA 2XGJA 3A9WA 3EC7A 2PL9A 4C88A 1YZTA 1ZL0A 4HAOA 4MUMA 5KVCA 4U4AA 1JTVA 2BM9A 3TLAA 4NYIQ 4DR7B 1PJRA 4YUZA 1V3VA 3GU3A 1O97C 4HNUA 1DL5A 3KVYA 1N1GA 3LWZA 3IEIA 3HJHA 1SKAA 1RLOA 4EGSA 3IIJA 2FSUA 3DEIA 2C5BA 3B6MA 1L8OA 1L4KA 2HCTA 3DBHA 1GCGA 2VQ3A 5FO0A 2IWRA 1ISFA 2XTZA 1U0FA 3KE8A 2XBUA 1P4HA 4B4KA 2AG5A 4CM1A 2XWSA 3H04A 4LJ9A 3OE7A 3DWEX 4RJLA 3VU9A 2OQRA 2OUKA 1KE2A 3UTCA 3PQ6A 2DE0X 2WIJA 4CM4A 3R1IA 4K9QA 1J90A 3TOVA 4UBKA 1LS1A 1NG1A 1V4NA 1QP4A 3FUVA 2NZ2A 3ANTA 1TRHA 1K88A 5ALUA 4NCAA 2JJ2D 3AP3A 1DSSG 1B6TA 1L8AA 2RG1A 2Q4EA 2NUAA 2XUDA 3EXEB 4DTCA 5BV2P 2C07A 2O1WA 4E2XA 5EHZA 4MUJA 2C2OA 3LIPA 4Q1BA 2R62A 3R75A 4ER7A 4ENSA 2HR1A 2J9XB 4DV7B 1LF0A 1SKBA 2VPIA 2PX5A 3FZNA 3CZ9A 3DMTC 1WDMA 4N6OA 4PC2A 5AXDA 3U40A 3AVUA 2UUPA 4JI4B 1V5GA 1QCCA 2FSHA 1EA7A 3LP8A 2V98A 3LXXA 2BGJA 5MDHA 2FX2A 2QOEA 3D2LA 3QA3E 4Q4JB 5LZ7A 2P8SA 1TUGA 4F38A 1MOSA 4Z7JA 4ISBA 4HWRA 4OJMX 1MU0A 7GPBA 1W59A 5LDGA 4JLMA 3O5AA 3OZVA 3V42A 4H59A 4EUEA 3DZIA 1SK8A 1SHJA 3FCCA 1IZZA 1TQDA 5C31A 4P3OA 2PZKA 1HXHA 1X7ZB 3HYSA 2IHKA 3O31A 3MJHA 4CM6A 4ZQFA 3HSSA 4DG8A 5AUQA 4PTLA 3ED5A 5CDYA 1PYDA 5AK3A 3OPYI 2IV7A 2XA1A 1M0SA 5ARDA 2B1RA 4H6VA 4X91A 4D6XA 1CJBA 3H97A 2W48A 5KSWB 3T7KA 1OJ7A 3AOEA 3D6AA 3LHKA 3AY7A 1DIRA 4UOQA 1OX4B 1UBNA 1UDCA 3F74A 4DMLA 13PKA 1T8TA 4MAMA 2Z8XA 5AW7A 1ZJZA 2GX6A 2OZVA 3PCTA 1RXEA 4UULA 2JFYA 1AHIA 2VAPA 2ZCVA 1H2BA 1LPOA 3PC3A 2JCSA 4QGFA 3F73A 2DQYA 2RGRA 4RE5A 4EX7A 7ADHA 1W8DA 1OAAA 1K63A 2DSTA 5FT9A 4F5EA 4UEWA 1GPNA 1V4BA 3FNHA 3H05A 2TYSB 1IYZA 5H0IA 5REQB 3OCXA 3AB3A 1Z47A 3CA8A 3DBVO 4C08A 1MIOA 3ESQA 1D7OA 4BFYA 2VRCD 3G2OA 3PK0A 3I92A 1XQXA 1LC3A 3A6GA 5G0WA 4BNLA 1NHWA 3I32A 4X7RA 1UJ4A 3I73A 4RADA 1GADO 1NTRA 1XTSA 3BCRA 2PT5A 1JP7A 2VH1A 2XE8A 3CN7A 3GDGA 4OQLA 3RLFA 4C87A 3AL3A 1M2VB 1G7CA 1SFRA 1JEEA 4MVJD 5JUWA 4YJ2A 1JMKC 1CUJA 1Q16A 4AZVA 5K2MA 1N6PA 3E5MA 1Z0KA 4CMGA 5E3IA 3LUFA 3RSHA 4DUZB 4HQOA 5F64A 3DJFA 2JCYA 5HKBA 4QYMA 1F9EA 4FDMA 2ODAA 1P7VA 2YWJA 1A7JA 4CM8A 3CUVA 1NIPA 2O7NA 3SS7X 5KNBH 1HDXA 2ZB4A 5JH7B 4WFJA 3HU3A 5AKJA 2OC9A 1TZMA 2YV2A 1TDJA 2JHAA 4HNSA 2Y9PB 2FP4A 4BX2A 2XB8A 3DKIA 2CFTA 3FPJA 4R1MA 1DEKA 4ZEVA 3QBTA 4P84A 5MHTA 4TPKA 4BVBA 4CMEC 1YZGA 4ER6A 3YASA 1Q7CA 1BXZA 4QU8A 4RFSB 5CJPA 3RF6A 4FMCB 3M4JA 2UZ3A 3L6EA 5JPDA 4M1EA 4X8MA 4PR3A 1SULA 4DQ0A 4M8LA 4G5SA 4E51A 5ITWA 4MP6A 3LQYA 1E0KA 1U9YA 4JQOA 5DPMA 2XMGA 3T9DA 2P68A 1RPJA 3VDQA 5K6RA 1EDOA 2HSEA 1V8FA 1KARA 2QG9A 2QVBA 4OQMA 4WXPA 1U11A 5EIBD 3RC1A 4CDNA 2GEDA 1FJGB 3PNOA 1NOJA 1R8YA 3HCBA 1G9XA 1ZINA 4WL0A 5FBRB 3VR0A 3ADPA 4A23A 1JAXA 4LZLA 2JGRA 5AKXA 2H2WA 4I50F 1P1FA 1ZD8A 1HSOA 1G5FA 3DHVA 4CMCA 5C8XA 1PP4A 3MQFA 4PSAA 1KYVA 5B1DA 1REQB 1MX5A 2QSUA 2OLEA 1UBUS 2IYZA 3UB2A 3NIFB 2I87A 2BOVA 1BROA 1EQAA 2QD2A 3GH3A 1XZPA 2QTWB 4ZXFA 2F62A 1YFLA 1D2AA 4B48A 1IHYA 1SD5A 2EWWA 4AJHA 1P74A 3EMVA 3G5UA 1V47A 4D4LA 2Z1DA 1M10A 5K1ZA 1L1QA 1RKXA 1WOMA 2DHRA 2VTKA 4DCGA 3VFDA 2J3EA 2RHBA 1KP2A 1P4GA 5T5QA 4BQEA 5T57A 4OHMA 3P96A 2X0FA 3BJMA 4ZK6A 4ZYZA 1HRKA 3HKCB 4PYLA 1E4VA 3TTSA 2PBFA 4W5HA 1S7CA 1VLVA 2Z95A 4AN0A 2ZROA 5B5SA 5TPZD 5CFNA 1FPQA 1Y98A 4LWQA 4IDDA 3BWEA 5ADVA 2TMDA 4XPIB 1QAMA 4XWOA 3FYHA 4YUYA 3FFXA 5IAJA 4IUDS 4C4OA 3PNPA 2W6IA 2OWEA 3TIFA 3RS3A 3ZX5A 4CEHB 2RJOA 4CODB 2W4MA 2QQFA 3T9AA 3T15A 1CZHA 2EP5A 1X6VA 5P8WA 2C2XA 3E23A 2Q5JA 4K9RA 4OL0A 3TX6A 1NVTA 1Z6TA 4HH4A 1KI7A 1PR9A 1SBZA 3FI9A 5C35A 1NW3A 1A9TA 4MI1A 2JDID 2G6TA 2GCOB 4A5OA 4LHEA 5FUMA 2I2DA 3N39C 5BSVA 3K9FC 1QQAA 3SDBA 1YVEI 2JH9A 8AT1A 4GF5A 4I46A 3EF3A 4MGYR 4U63A 3WMWA 1NF9A 2IZ5A 3C98A 4MWBA 3VKFA 4FNOA 4JQSA 3LOUA 3W3AD 4GLJA 4XWTA 3FVWA 3QVMA 4NPCA 5HZKA 1N2GA 5EE5B 2DBZA 5BQXA 3OC0A 4Z4QA 2CBZA 3C5EA 4MIYA 2BI4A 4JJKA 4ZVUA 3T4PA 1ZHOA 1YS4A 1XTQA 3A1DA 4DA9A 3PF9A 4DW8A 4IJKA 4DUGA 4DR3B 1P1IA 2RMKA 2XRMA 1YJQA 4S35A 2NV6A 1JFTA 1IN5A 3G5MA 1X8XA 3BS4A 2C5GA 1TM7E 4ZU3A 3RT9A 4LC1A 4PTYA 5AVJA 1KO1A 3WDMA 1IJFA 1DJOA 4FLMA 3C3EA 1EFPB 1P81A 1JYEA 4RLHA 4HRYA 4IZOA 3EY9A 2BKLA 2QVYX 3F1LA 4BECA 1QF7A 2IL1A 3D4LA 1VYTA 2JLRA 2V7VA 3D1JA 4WZAB 4K2HA 3ONEA 5EMJA 4FGSA 4K5QA 5FQNA 3DBIA 2ZI7A 1RQ2A 4AY3A 4F86A 4EMUA 2A33A 3RJMA 4H9GA 1FSSA 2RGUA 3SZUA 1QRTA 2JKVA 2ZUVA 3WBJA 3WLPA 3L7JA 2FSVA 2GHTA 3ESAA 3FBWA 3IESA 5FR1A 1AZSC 3R74A 5HUQA 2OD7A 1MB3A 2I2BA 4HQ6A 4UM8B 5IF9A 2IZ6A 1G42A 4HXGA 2VSOA 3GJ5A 3IPXA 1ULTA 4YAGA 3MJ4A 4DOMA 2VH2A 2ZSHA 4YN3A 4ALNA 2ST1A 1VIYA 4UNNA 2I3ZA 2MWMA 2Q3MA 4Q3EA 3HHEA 3VC3A 2BM8A 2DWPA 3MJFA 3WLMA 4UFOA 1WZIA 1XCOA 2CXQA 3AKDA 1DS6A 4W1RA 1EK0A 4FYKA 2X5NA 3A31A 3QVWA 1KHHA 1GAWA 4O4IF 4AVYA 3PWSA 4IFEA 1MX3A 1CE8A 1EZ1A 1Z62A 3UMMA 2RBGA 3PSAA 5HPYB 1FMFA 4TMZA 1ZU5A 3K9LA 4N7RA 4WZAE 3WYEA 1CUSA 3DNFA 5LLSA 1EDZA 4L4UA 5LXTA 1C80A 5J47A 3NETA 4JBLA 2I6SA 5ALLA 5JC1A 2UZ1B 4E6PA 4J4BA 1GD1O 3DXXA 1FMTA 3F6BX 4H4CA 3EPKA 5LD2B 2O8VA 2R65A 1E0JA 3Q12A 2DLCX 2O8BB 1WXHA 3IOYA 5CCXA 1JDZA 2B3DA 3P9ZA 1I4WA 2IC5A 2OKCA 4KL8S 4MKGA 5IANA 4MKZA 4QO7A 1RYDA 5FI0B 1FPMA 1COZA 2OXIA 3ZU4A 1F12A 4BP3A 4MCHA 1VJTA 4E21A 1DTSA 4Z4HA 1CY2A 5ELMA 3QX7A 5GTDA 2R8XA 3SIXA 3EBPA 2R6AA 4MNTA 4JXJA 5J4VA 2PJDA 2ORWA 2Y1FA 4M9RA 3E48A 4PC3A 5K3FA 3CSDA 2YDXA 5C53B 5K6TA 3WLJA 3JVIA 4K9MA 4RBNA 4N5NA 4KO1S 1MPXA 4LOAA 4YMLA 4L08A 1G3UA 1KTIA 4C01A 1MX1A 1K3FA 2ZRKA 3IV7A 3OD1A 4PHGA 4RV5A 3ZUGA 4B3FX 3CTPA 3D6MA 1MJFA 5K8JB 2ZTSA 1B1AA 1E18A 3B6JA 4HHEA 1NJGA 2ZXEA 5DW3A 4RTNA 3I4FA 3N2KA 1UBTS 3IQIX 1IBRA 3BZWA 4RK4A 1LY1A 1B2LA 2ZK7A 4HYYA 4X6YA 2CVFA 5EJ8A 1VL5A 3D8HA 3DV0A 2AJCA 1CHNA 2DTXA 2JZNA 2GR9A 4F96A 2Z09A 1S96A 5DEIA 4DAOA 1LZLA 5A5EA 1BDHA 2OT3B 3TGLA 3E15A 1CQXA 2VYFA 3HMKA 1XK6A 2BD0A 1ST2A 3QWIA 5HS6A 2GD1O 1U7UA 2RGCA 2KB0A 2CXPA 3M3HA 4DLNA 3HB0A 5L45A 1WWKA 4LHSA 5JLAA 4GBMA 1FLDA 4JAVC 1RYEA 2O06A 3V32A 3OF3A 3UQYS 1RTKA 3AZQA 4I3FA 1WBJB 5BOSA 5GZ1A 1G6OA 2E4UA 4EF5A 2IJGX 4PLVA 5J23A 1WMDA 3DULA 1G7SA 5KDDA 3FNFA 3PNBA 2GEFA 1DCTA 3DYIA 1W94A 2F8LA 3MWEB 4DVGA 5CVDA 3GCZA 3BL6A 5IMBA 4TX1A 4PXYA 3REOA 5E6UB 2ZTVA 1HE3A 3N05A 1Q0ZA 4K6MA 2HK6A 1U8UA 2VA8A 3JASA 4L5AA 4ZP1A 2QD5A 1JLLA 2WE8A 4J7UA 3OEED 4UHFA 2QVXX 3V3TA 4N0DA 4LRQA 2CMFA 2A57A 2VZ9A 4LYEA 2VNSA 2ZBQA 4MJXA 1DZ3A 1WXIA 3LD9A 1GKUB 4Z3OA 3K6SA 1YQ9A 4GKKB 3H8SA 2PS3A 1Z34A 5AICA 1S8NA 3RRXA 1A5AB 4CLEA 3QSGA 5KYWA 4F91B 5IDVA 1KR2A 3WYCA 4A10A 3TECE 1K0FA 3FVRA 3N3AC 4WLFA 1KJIA 4DEVA 2HK8A 3QKUA 4EMBA 4AY4A 1W6RA 2PMEA 4YCNA 1QVZA 1WEHA 2ZJOA 3QJGA 3KAQA 1THMA 3KS9A 2ZAOA 4IF4A 4E5PA 3RVSA 3QG1A 1ND5A 1EVZA 1E3DA 2JGMA 2JS7A 2PCLA 3LY9A 4ZU1X 4AKSA 4CRWB 4DVJA 4M0FA 3M0EA 1OLSA 1JPUA 1TO1E 1WL8A 3WNDA 1CUGA 4MEJA 4NH0A 1U8CB 3LUJA 3G0IA 1UKAA 4GR9A 1O95A 2MYNA 3IHTA 1A2BA 2NVBA 1S4QA 4ON9A 1KZYC 2ZVJA 1I5EA 4QKQA 3ED1A 1X9IA 2BHLA 2ZJBA 1FUUA 3TQRA 1NIJA 2MYPA 1OYVA 2X1LA 5BRJA 4PO9A 1YZYA 5ECDA 4LXTA 1IQ0A 3I9MA 4BV8A 2YJ4A 3FNGA 1ECJA 1H0KA 3GUZA 4CMKA 2A0UA 4EYKA 4QPCA 4KK3A 3OCCA 1G6KA 4Y7DA 5FPYA 2Q7XA 1QYDA 4URFA 4QBGB 3CE9A 4PBTA 4NV3A 2ZRIA 5KQLA 5JYDA 3O8RA 1D1SA 5G1NA 3KLPX 5DZSA 4M6WA 1NVXQ 5EHIA 3WWYA 5I4BA 2QU8A 3IFSA 3VI3B 3KLMX 4IXTA 5JAZA 4ZCMA 5BW5A 1LDGA 5CM9C 4ZZ3A 2GRUA 2PU5A 4X8OA 4RIEA 4E1VA 3CW9A 1JECA 1Z6XA 3OHSX 5JZBA 1V7ZA 2HIHA 1BU8A 5AIAA 1J2TA 1M67A 2YYYA 1U02A 2B6HA 4OKSA 2WZDA 4LRUA 4G97A 3PXEA 1KJ9A 5AW8A 1H9CA 4ZDWA 1CR6A 1AUXA 1LVGA 2AG6A 1GN8A 4U7WA 4AYTA 1FTSA 4PFKA 2BEKA 1X80A 3DFUA 4KDFA 4K9KA 3F9IA 4JI6B 4Z9FA 3VYSB 2J5BA 3BUSA 5GVSA 1LDNA 1IWOA 3HCEA 1T0IA 3HFSA 2PL1A 1YFKA 1I6LA 5ENVA 3KUXA 2OHOA 5AXCA 3ZCPA 4X5OA 3KOYA 2W8BA 4RV4A 1Q14A 3JS5A 1Q1QA 1HTBA 2M9MA 4N0MA 3LLCA 3PD0A 3E3NA 4EEKA 4E1BA 4NCIA 4NPAA 4OFBA 2OQ2A 1IXRC 1PVOA 2BCGY 1A9OA 2IUUA 1F48A 1E7YA 2GHIA 1UC5B 2ZDGA 3U3RA 4DSUA 3CVUA 4Q4AB 3DBOB 2BP7B 2HRRA 2O1XA 3QOYA 3QVVA 3FOBA 3FTFA 4CUJA 4UTNA 1PWHA 2WHXA 4IKOA 4RANA 3WADA 3I30X 4M6WB 4A8HA 3KEQA 3DUFB 3D5QA 2VG8A 1IDN1 3ILHA 2QLBA 1NMEA 2I6TA 3LLUA 3OKPA 4KVAA 5K6AA 1FTWA 1XDWA 1G3RA 2Q50A 1ZVKA 1Y42X 3NHRA 4PWYA 5DP1A 3FYCA 5LZ2A 2R85A 4KQ9A 2AXNA 1KS9A 1DARA 4YRCA 1R27A 1HNXB 4DR5B 2Y9MB 3ELWA 1AQYA 1PWZA 1CYDA 2W7TA 1GPAA 2CL5A 3EVFA 1WUKS 3P9IA 3DM5A 1S02A 2NUTB 1E66A 4J0CA 5JSZA 1N1EA 1YZ3A 2HA3A 4W82A 1R50A 4DRXA 3CVWA 1EP3B 2X5XA 2HA2A 1RI5A 4KMOA 2JDIA 5DHPA 1S3IA 3ZWKA 3LQKA 3ZXYA 1ZVVA 5FBKA 3RYCA 2GEVA 5ENZA 2Q6IA 1MAHA 3GEMA 1UMCB 3OSZA 1IY1A 1QIJA 4M21A 5F3RA 5TF0A 2PUAA 2Q46A 1XU9A 4Y9RA 1H65A 1T9KA 1I7QB 2J3DA 2XB2A 3NHAA 4QOJA 3OQVA 4WJZA 4YO8A 1N3LA 3AR7A 4TM7A 3EK2A 4PGHA 1P7PA 5EGSA 3GVPA 3UJ3X 3PRYA 4ALMA 1M8JA 2ZIFA 1W4ZA 3N0WA 4IVPA 1TVMA 4KW7A 3WL4A 1QH1B 1Y8AA 5HE9A 4FM9A 4RO0A 3AF5A 5JI3E 3GEGA 3CZCA 1ZOPA 3GROA 3OM1A 4FZVA 2PXXA 5A3QA 3PPXA 4L72A 4M8SA 3RIMA 2H08A 4J0KA 1ZPDA 3LY5A 4Q9IA 4NZPA 5CNJA 2VDWB 2GNOA 2IHUA 1MABB 4TTSA 2G1PA 1R0BA 2F3TA 5BSKA 1M6WA 1YQWA 1FC0A 4TMVA 2Y0BA 4MJ3A 3LQQA 4DNQA 3PDCA 1RBYA 5ABPA 2AOWA 3KYJB 2XB6A 4QUKA 1PX2A 2SHKA 4PZZA 1BTOA 5IABA 1PJ4A 3GLIA 1RKUA 1VB3A 4D56A 4AICA 1MENA 1T4GA 3LVBA 1BEEA 2IH2A 3FMPB 3HB4X 2BTOA 5DT2A 1WCYA 2JFOA 3L6BA 1JJBA 4ZT6A 1UOOA 2DUWA 3IPRA 3N6VA 4RWZA 4RF2A 1Z9BA 1EB8A 1R64A 3C1OA 3WHPA 5BURA 1KK2A 4S1PA 2I2CA 5K4AA 1KU0A 4C1BA 2YASA 5CA1B 1FVHA 1P2SA 2YHIB 4AMGA 2FF7A 4DR4B 2PKRA 1UF9A 3GJ4A 3R3ZA 5KYKA 1E63A 1JTEA 2EIHA 3BQNB 3PC4A 3L02A 4J49A 3U39A 1ORVA 1YS7A 3V2GA 3IOBA 1E9CA 3WGHA 1FVXA 3OP1A 4PWZA 3VPFA 2NNLD 1GP2A 1POXA 4EW1A 1B73A 3GMSA 1P75A 2RJ3A 2FEXA 1RXVA 3X3HA 5HG0A 1GGFA 4Y2RA 5IEJA 1P1BA 3MWGA 3Q88A 1HRDA 3FLBA 3D6TB 5FH9A 3BF7A 2O0JA 4K6CA 2Q4RA 3QEMB 1LX6A 4QEDA 5BT9A 4BNUA 1T0UA 1KK0A 3FFWA 1VDZA 5A03A 2DB3A 3FAKA 4KVZA 3D3KA 5CNKA 4AROA 3ADBA 3DVRX 4C3ZA 2VDMB 3SDZA 4CR6A 4PLPA 1XQ1A 3P9NA 5G0SA 1UWVA 2QW0X 2G80A 1BQ4A 1AA9A 1ADFA 1W73A 4GPD1 4OVKA 2V7XA 4DGSA 1JYSA 4IMJB 2PPLA 4LC9A 4J6FA 4LZWA 3H75A 1XZMA 2ZSJA 5CLGA 2FN4A 4G8DA 4DIFA 5ISMA 4MUGA 4BNWA 4CM4B 3BMCB 3F5SA 4KWIA 1HETA 1BQEA 1XFAA 2XRYA 4AW9A 4BC1A 4B9AA 4D97A 3RUIA 5MGBA 8LDHA 4L76A 3ESDA 4X90A 5B37A 3DTYA 2CLKB 5AW2A 2OAQ1 1M34B 1PR0A 3AXTA 4RPKA 4CM5A 3CMMA 5DHSA 2O07A 4B6JA 4Y0AA 3EXFB 3F47A 2CUZA 4TN1A 3T9CA 4A6DA 3O75A 1Q3HA 4HYQA 5D84A 3FHTA 4D3FA 2I76A 1GHTA 4JODA 4JIMA 5AJTA 2YV3A 4MRRA 2QRHA 3TFOA 1CG6A 1V8OA 2KW5A 1DWUA 2I3AA 4F92B 2W9XA 1TA0A 2QRNA 3K53A 4Y2XA 1WR8A 4JB8A 4JGGA 3GBVA 4WBNF 2ZIEA 3VUEA 4KQXA 1Q2XA 1V8ZA 1CUHA 2YWEA 2AOUB 2BELA 4IVQA 2Z8YM 2VC2B 2Q5IA 3PR2B 5IPFA 2PGAA 3FOCA 1DADA 3T1HB 3OX2A 2HDNB 4RA6B 2EKLA 2O5RA 2V9ZA 1R8SA 3B78A 2YZMA 1RDFA 1ZXLA 4GDMA 3VMFA 3UA3A 1PU2A 3DFFA 4OCZA 5AW6A 4ANFA 4RTLA 3GDOA 1BGWA 1LS6A 3IDSA 2R97A 5IBRA 4CGZA 4DR6B 2VLBA 3OJEA 4YPVA 3D7SA 4JUBA 1Y89A 3AR4A 1VMIA 1XTIA 1ZMXA 2HQOA 2QAGC 2RHDA 3UWDA 4D99A 3FOZA 4QJBA 2JI7A 1GGJA 3BDIA 3KPUA 3KQOA 3NWPA 2AUTA 3GYBA 1H93A 1QFZA 1B3RA 2QRZA 2Y77A 1IVYA 3HVJA 4MULA 1I3NA 2CK3A 3ORQA 4Y2YA 4BGEA 3DBRB 2Z6VA 3PHHA 5HIIA 4D8VA 4RS4A 1MZVA 2O7RA 5LQJA 2J07A 2X8JB 3PFNA 4LDZA 4OBXA 1FYWA 2B78A 4X6UA 5JS8A 5KTTA 5GAJA 2VQEB 2XMCA 2GBCA 2GKGA 3C41J 3JQAB 4KCGA 2ZSFA 4KYTA 2WY2D 3X44A 2HWYA 2E4YA 3U9TA 4X3CA 4K28A 4JLOA 2RGGA 4N3GA 4XCVA 4D9HA 3E7DA 2EGHA 1XU7A 1QIKA 2XYVA 3E7FA 4OQZA 3UHAA 3WGZA 4FB4A 2NPIA 3CCBA 2NUBA 3I37X 4QU5A 1JVBA 1PL7A 5DSZA 2BFBB 4GEKA 3ZI7A 1FY2A 3A3OA 4RH1A 5FRDA 2WWIA 3LECA 3EOZA 2IYPA 3G8CA 5AOCA 1XZEA 4BNFA 2ROQA 1SG6A 2ZUWA 1FMCA 2BEWB 2QV7A 5GGXA 2EFGA 3KYIB 3RAJA 3QX3A 2BONA 5EPUA 3LMKA 4JP1A 3O4HA 4EUKA 2O2GA 4H77A 3PRJA 4INAA 2J85A 1M1NB 4V3BA 4GRIA 4YRPA 4DARA 4NNJA 1A98A 4II7A 3BCHA 4FBLA 5BR8B 4UHHA 5ERGB 2GZSA 2H1CA 1YKSA 3QHAA 4HCJA 3RBZA 5C8ZA 1KOJA 5H68A 1D0VA 1DOHA 1SCJA 2FSVC 5JI2E 2Q27A 5CGQB 2WFLA 3KSUA 1DDGA 3KKKA 4QICA 5CDSA 3LW8A 4OMCA 2IH4A 4LCJA 4DMCA 4QWMA 1EUCB 1I94B 4Z8XA 1LI5A 5LYJA 3VOAA 5KSPA 2M2IA 1EG7A 1ICIA 2G6BA 4HVAA 1GFWA 4REQB 3NOQA 3GRFA 1OTYA 2OD9A 2EFEB 1SH7A 1X7ZA 2YIVX 1M0TA 3PQ3A 3KV3O 5B6PA 3HO6A 3BIJA 1R6AA 4MR8A 3SGLA 4PFJA 4S1VA 3RBXA 3ZGOA 4DCPA 5LNK6 2OSBA 3GFQA 2J45A 4YH1A 1QANA 2EX4A 2F1RA 1CF2O 1W2WB 2AFVA 2OCAA 5SY9A 3W5SA 1HL3A 3NH9A 4A91A 4A3SA 1G41A 2DUNA 1PJQA 3IUEA 3PQEA 2Z1NA 4PICA 3F46A 2X0DA 2GOYA 3CO0S 4FHGA 1L5FA 4HLDA 4M88A 5IXYA 2P6NA 3OQHA 4WFIA 1GZSA 1ODKA 1JA1A 3VC2A 3QVGB 1MAWA 4LX0A 2CLEB 3I62A 1VJRA 4PEVA 4QFDA 3C39A 3ZWOA 2ZIVB 1M2OB 4NV1A 1OTHA 4KAFA 4FCTA 3WRWA 3IIMA 1YR8A 1Z45A 4IIBA 2J4DA 1YL7A 4LK2A 2Q3DA 3ZGYA 2CYCA 1SD2A 3IEXA 2HU2A 2Y92A 4P81A 3OOEA 3WAGA 2D1FA 1E96A 2IXGA 2ES4A 2R60A 1E5LA 1QOQB 1ESEA 2VK8A 4NDAA 1A69A 1Y6JA 2FCRA 3MC1A 3KPWA 5CVEA 1OQAA 3U80A 4BDTA 2VXBA 3IKMB 4WWHA 5CPBA 3KZXA 4XDYA 1BFUA 2FUKA 2C2BA 2DYKA 1R5JA 4DLVA 3NBYC 4FDTA 4IH4A 4V0NA 2XCIA 3IULA 3K0HA 4XW2A 1U2PA 3SLGA 5MGNA 1T13A 2QR5A 3C8UA 2ZU6A 3MPOA 4AMBA 3PQ8A 3H42B 5K4HA 3PGKA 1ZAKA 3MOGA 4K6FA 4AKEA 1WUIS 2R2GA 4EHKA 2P91A 5BSMA 4RA6A 5EJGA 1ESMA 2KMLA 2LZ0A 2VRCA 4U7FA 3EGOA 1TZ2A 1BWRA 1L4FA 1JFRA 1UKBA 2Q3EA 1B23P 1J1ZA 2JGAA 3C5VA 3LHSA 2JK0A 1APBA 2DULA 1KYXA 3IO3A 3Q0TA 1IZ0A 4AZ0A 4EL5A 2WWXA 1TUBA 1IN7A 1W7AA 4HWPA 1X1SA 4MICA 1GJRA 3OJ0A 1QPBA 4R3WA 2A5GA 3NWJA 1N2HA 3QFCA 4W5QA 1ABBA 4F5ZA 4UUOA 2SICE 4O63O 1PQ4A 2K2QB 1DIHA 2AR0A 4KIJA 1QTNA 2DQSA 2I6QA 3U7JA 5JTUA 1LBQA 2Q9AA 1ARZA 1XHLA 3DLPX 5DK6A 5ALZA 1KHTA 3PRHA 4FTWA 2XUQA 4TVKA 3WL5A 1QVAA 3DJYA 3WNZA 4ESEA 3QSYA 2G1JA 3J7AC 2OKGA 1IHUA 1MJHA 1V2GA 3FDZA 3EGWA 2I03A 2H59A 2GWRA 4BS9A 4M1MA 4DANA 5AD1A 2ATIA 3NWEA 1LF5A 2RH4A 4RK7A 3WHIA 4Q7MB 4LRYA 2BGRA 4D43A 3VZBA 2G08A 3SZ3A 5KYYB 4DUYB 4JP5A 2G4VA 3COVA 1GDTA 1U81A 1Z4JA 3MTJA 4FT2A 3A0UA 4DBZA 2B5WA 2F48A 2OV8A 5M2QA 4CV2A 3A9UA 1NI3A 3ODPA 3Q4GA 4K03A 1V43A 3CIOA 4NCXA 4ZAFA 3PXDA 4NENA 4D6YA 2V7GA 1GRCA 3O2QB 1XALA 4GI1A 5ENDA 2JVIA 3TSWA 1QKJA 2QK4A 1T2DA 5I7UA 2YBEA 5IM4A 4FDLA 3QTBA 2C9ZA 4DCVA 2C77A 2QLLA 1JHXA 1I2AA 3L6OO 1PEAA 4NP6A 4BWVA 3HDHA 1J5PA 2O0MA 2ZKIA 3E35A 3IXLA 4G5FA 4GGMX 4TLAA 4X93A 4ZAZA 5B2FA 3HI4A 4PINA 3TF5A 2GN1A 4B3MB 4UBJA 2RHWA 3PEEA 4DCCA 1GPDG 2CWWA 3T1OA 3EX7C 4NXNB 2YY7A 5CM8B 1JDSA 3GLVA 2A7XA 2WINI 2YBDA 3ZWCA 4DJJA 1B8NA 4HB0A 3IBSA 4WEOA 5E2AA 1YULA 4CN8A 1V16A 3AB7A 3H84A 3WTCA 4ZZ0A 5CURA 5B3LA 2NM0A 4IX1A 1P7YA 5TNXA 3WWPA 4FCWA 4QQ8A 4BBPA 3GLGA 1MKYA 3LI2A 1FU4A 3NONA 5EMLA 2AEJA 2ZIXA 3M1AA 4YREA 4DRYA 3OOYA 2VSXA 1SXJE 4HAZA 4IIJA 3S8MA 2HGZA 1VLMA 1SC1A 2OO7A 4KOEC 1DKLA 4MHTA 2C7RA 4H7DA 4YP5A 2OFPA 1QIFA 4ZQBA 3RODA 2XBMA 2G9NA 3VJKA 1KMCA 2DM6A 4KGZA 4M0CA 2AFIA 4AD8A 3H5OA 4M87A 2HEIA 4DLPA 4UNSA 5ITVA 1P77A 2OXCA 4QTZA 5FBHA 2ZI3A 1P0FA 3RYCB 2ZJFA 1TC2A 4TMXA 4JN6B 4WFQA 3DLTA 4MYDA 2GO1A 3H86A 2P90A 4MPDA 3CLRD 4OQQA 4RM2A 1H4SA 3VJLA 1U3WA 5CAEA 4C0XA 2OA0A 3HUTA 1YA6A 1ZNYA 1US8B 5HE8A 1OPXA 1UPFA 2RC6A 2UAGA 3PGMA 4MO9A 3EG5A 1U0NA 2FFRA 5J4LA 2JRCA 3CUWA 3OLXA 1XRMA 5HQTA 4P7KA 2I7TA 3JR7A 5LP6A 1NRXA 1PS8A 1SXJB 4BO1A 4YX9A 1UQTA 3DQQA 1MB2A 5IC6A 4YYEA 1DXOA 3GX1A 2CVZA 4NU5A 2CV2A 3PC8C 3KHUA 3L49A 4G8CA 4HMPA 3P0FA 4PZUA 3THWB 1WV1A 3CN9A 3F98A 2LV8A 1L7NA 2GJSA 1ZP6A 2AJTA 4OAPA 4R1OA 3CC8A 1BIFA 1JSXA 3V8QA 5JWOA 1WPXA 1SZCA 3V1MA 4M76B 4C4XA 2ZB2A 4G1VA 3W7BA 4B4DA 4GVLA 5U9CA 2V8OA 4D4JA 1NDQA 2ZE5A 1EBFA 1GUZA 1UWKA 1Z7WA 2PYIA 3NC1C 3QZUA 4KMSA 5AUOB 5C81A 3LKVA 1JEYA 2P5UA 5LCXA 4C5BA 3SI7A 4US1R 3GARA 2VTBA 4JCOA 4LOJA 5BY2A 3MM4A 4BO4A 5AOAA 3B85A 3S1SA 3ZS8A 3D0QA 4G4SP 2YYSA 1T36B 3ZHQA 3TL2A 1XZNA 4GXNA 1J8FA 2EX1A 1HX7A 2CMDA 4BGDA 1NC3A 1RHJA 1YJ5A 2V7PA 1W8IA 1ZUHA 2GCOA 3NM5A 1NN5A 1YXMA 3H9EO 3KOXA 1F14A 4PE5B 4WZZA 2IWHA 3WAKA 1VMAA 6LDHA 4IMPA 4N0EA 1E6KA 1WNFA 1U8XX 1HFWA 2GTHA 2HXSA 4FU0A 4OA8A 3NM6B 4PV7A 4KXLA 3ZN2A 2VRWA 4BIIA 2OGTA 1WETA 4PX2A 2VDWA 1S9HA 3AKYA 3MIZA 4H1UA 3S2SA 1HLFA 1MB9A 1NQAO 1X7WB 2P2SA 1K2WA 4UFPA 1CZRA 2AEFA 5T4FA 2Z57A 1J9ZA 3ICCA 5J2UF 3OHPA 5K0TA 5EKSA 1ZWLA 5DFAA 5A7GA 3CUUA 1R4MA 4XX0B 2CFIA 2HUPA 1FX1A 1P1KA 5HQJA 4QT0A 3IDQA 1UBMS 1RWKA 3CRMA 4X1KB 1YV9A 4WK6A 5EA2A 3Q3GE 3E6AA 1Z08A 1PAUA 2FZVA 4I4NA 3OM8A 1SUBA 2A9PA 4LHWA 4DXHA 4EW2A 1RMQA 4EAQA 4MQEA 4OI0A 4GPEA 4JZKA 1A9XA 5LXTB 2GCEA 1X1BA 2OBNA 4G36A 3SKYA 3QU9A 1TZCA 4XWAA 1D6MA 3HGQA 1R37A 3UMVA 1VYUA 1JZQA 5DYNA 1TMYA 2I22A 2CUNA 2LD4A 3A6PC 4Y3UA 5JQGF 3L79A 5K0CA 3PQDA 4D9JA 4MB0A 1AUOA 2KSQA 3AXSA 5BSGA 5J43A 3GR6A 1FDRA 4BKUA 4DF3A 1NQXA 3VPXA 3ZZMA 4PRYA 1A8PA 3B8EA 3O8CA 4LFAB 3E4CA 3V9AA 4B3CA 1SHKA 2A92A 2HF8A 2OMKA 5HCUA 3K05A 5HCIA 4BVAA 3DONA 4AQYB 2JIPA 1V41E 3F3SA 3GLFB 3AEQB 4CWAA 5BN3A 1USGA 1UJMA 4Q03A 4DIDA 4AZTA 4I4TA 5JFTA 4C43A 1SO8A 2AZDA 2EFHB 2FZKA 3G6KA 3ZJYA 5L3VA 3U16A 1NQUA 1TTQB 1R6BX 1U6KA 2PMFA 4UDYX 3H2ZA 4KGXA 3CGGA 2BP7A 1Y4AE 1NW4A 2Q29A 1EJ2A 4FYVA 1BVUA 1UBFA 1UKEA 3R3SA 4IUBS 4PAWA 4N1AA 4ND5A 2QLNA 1EHCA 2ZWMA 4XD7A 3UMSA 3ZUPA 1UADA 2P9EA 2YR0A 3NATA 1E0DA 4NBUA 3LSYA 1JH8A 3JD2A 5UKDA 3UM9A 2Z6UA 2I7CA 2PX3A 1RR6A 4HYTA 2B8TA 3FUUA 3NHPA 3ZR4B 5TMPA 1COWA 2R3SA 3E8XA 5IDXA 1JA0A 3DMNA 1CEQA 4N65A 3Q8XB 2IPAB 2TRSB 4PCAA 4XM2A 3GXBA 2YN4A 1QK3A 4BOYA 2IHBA 1W6UA 3KBOA 4UEKA 4EL0A 1YHNA 1FFXA 1PSWA 1JEQA 2VN8A 3Q3IA 4KSCA 1WXDA 5H81A 4BY9E 1NVVR 3ZHBA 5K6AC 4N8DA 2ONJA 3HABA 1NQ5A 3FVVA 4I1OA 5HIAA 1UM9A 1TYAE 3N0RA 5IAGA 5FPTA 4XWKA 1I4EB 2GBIA 2YN2A 2DBQA 4ZWNA 1YNSA 3TW8B 2PSJA 5FAXA 4CTNA 1TVCA 2FW8A 1JDUA 1P1HA 2BBWA 2VOEA 3M6WA 3QLTA 2WLSA 4RD4A 2XKBA 1MO3A 4US2R 1DWOA 5DNUA 1R10A 3UK0A 3GNLA 3KKQA 1JAHA 5AOVA 5BXQC 3W5HA 4EPYA 4EB6A 3Q2OA 5F98A 4IR7A 4X00A 3VNUA 2FNAA 4DWVA 1BCRB 1H05A 4V0KA 4DRZA 1QHNA 3LYAA 3E9YA 3D02A 4N39A 3C7CB 4KK4A 5JJKA 1JDJA 1EFDN 2D2IA 5EE0A 1MLDA 1A9RA 1R3DA 4OH7A 5E95A 2IFTA 3SNKA 3ROKA 4U39A 2ZRDA 3SYTA 1H8HA 1EFVA 2AX4A 3QQPA 4ND8B 5B3KA 1MAVA 2II6A 4R41A 3R0IA 2D0IA 3G0CA 5CYOA 4BL5A 2WD7B 2VP4A 3LCRA 1T34A 2JANA 3OY2A 1U8YA 2ZCUA 1MCZA 1XB2A 3DWFA 3OCJA 2FGKA 4B8YA 1XGKA 2QRGA 3HB1A 3CPEA 4KFUA 1FU8A 5HILA 4JXKA 3GFBA 3A4TA 5IJ0B 5COBA 5FIUA 3RTEA 1DPFA 4QBIA 4NYJQ 3PR1A 4GRAA 2J0EA 1JEJA 1PR3A 1EP2B 2D8MA 3THRA 3VU3A 2MINB 1FTNA 4WXEA 3EZLA 4RDHA 3TJMA 1Z82A 1OFUX 2WQZA 2NAFA 3KWMA 1RI1A 4GGOA 4II2A 3A1UA 4YMSA 4BLRA 5FWNA 1CY7A 3WYDA 1EVIA 3NBQA 1G3QA 1OWNA 1VOTA 3EAQA 1TAQA 2V65A 3IAM1 1M6EX 3LDAA 2JIOA 5AHRA 1XCBA 4LMRA 4TTRA 4NDNE 3DV2A 1PK7A 3ETCA 3OZSA 3G17A 3R5TA 2KPOA 5G0UA 3MRVA 1I3MA 3VU0A 1RWVA 2C58A 3B70A 3C6XA 3DE3X 1PS9A 1Z0SA 1S2MA 3P9XA 3P9SA 5E4TA 3TD2A 3VDNB 3OCWA 4E5NA 4N40A 2EKBA 2P69A 4QAQA 2YHBA 4RL6A 3WV5A 2J0VA 1IWPB 2VJYA 3QMWA 4B1FA 4QUEA 4ZMBA 3EGCA 4BP1A 3FPAA 3S3TA 2IEYA 4IJWA 3SSNA 3R7WB 5TGZA 4IYJA 5A06A 4EFKA 2ZJYA 2B8JA 1U6IA 2P30A 2Q3FA 1U4NA 2VYCA 3AHHA 4UTXA 4EJ6A 5KKCA 1TAHA 2VDLB 4S0ZA 3MTQA 1JAZA 2DUUA 4KPUB 1KJWA 4Q4HB 1DIGA 1XJCA 3PIDA 2IOFK 2QI9F 1PTJC 3IMCA 4MUAA 5KPDA 5ALYA 1PT6A 4GIBA 2OILA 4JCCA 4JJ6A 4M0PA 1NBEA 1JG6A 3D2CA 3Q9SA 4GKAA 4ML3A 2ONCA 3WIEA 2CLOB 2GXSA 3LBIA 4DLYA 1DV1A 2HF2A 4HB3A 3OF2A 5GJCA 3P52A 4BNDB 4CKZA 4IEFB 5E3HA 1T9GR 2BGKA 3EYWA 2EW1A 4KG7A 3IQWA 2QZPA 1H4TA 2VL7A 3KKOA 3EHDA 2KBFA 5D5QA 4QYIA 1Z18A 2AIRA 3KYBA 1V7CA 1KYYA 2HCRA 2O2CA 4HJXA 4IH9A 5FFNA 2WFAA 3TKLA 1JUDA 1OLUA 1V45E 3HKEB 3IC5A 3LX4A 4NVRA 2M1ZA 3BHIA 5GY7A 1MHTA 1UPAA 4LJ8A 4RZSA 2QTGA 3RYIA 1ZVJA 4F45A 4WESA 2OXEA 2WLTA 1TKAA 1T5TA 3DE5X 1QYIA 2OYRA 1UZAA 3RD5A 2W2VA 3QXJA 2DERA 1WVIA 1MB0A 4P7FA 1Z75A 4H4DA 3VPDA 4Q3DA 3VOSA 1AGYA 3CX8A 1VIVA 4QOGA 5A6VA 1RZRA 1M33A 2H4WA 4G0XA 5T41A 5KX5F 2XW6A 3Q7TA 2FQXA 4IEEA 4RA9A 4FONA 4L07A 3OA0A 4IIJF 3FTCA 2H48A 4QPNA 1VHJA 3IXMA 2HWKA 1SBTA 1MQSA 3GN1A 4IIUA 2FW1A 3ZQUA 1V9SA 1H85A 1HZZA 1DOAA 1XSEA 3ORRA 1Z6GA 3U7FB 3AWIA 1E3EA 4NFHA 4P3KA 4WOKA 2DKOA 2FP4B 2NZXA 2IDJA 3KXPA 3K0CA 4IO1A 4OYYA 3SXUB 1XE3A 2BPOA 3HJGA 3LDFA 4IFIA 1M1XB 2HQRA 1TCVA 2RGYA 4L57A 3T9BA 5KQMA 1ZEMA 3F4LA 5J2TB 3NNNA 3UENA 3BZBA 3EIUA 5GV7A 2MINA 2IK8A 3A1SA 4PYIA 3DDHA 1ZWKA 2A8YA 2PSFA 2YOFA 2Q6TA 1DJQA 2PKQO 3BMOA 4UDXX 3T6KA 1KJJA 1SHZA 2Z8ZA 5AJYA 2UZAA 1CUEA 4A8JB 1EHYA 1KQFA 1GZDA 2J59A 1D6NA 3MNFA 4C30A 5BNWA 3UHOA 1QKKA 3BB3A 3FGOA 3D6NB 3JWJA 3EXHC 1QIDA 1CY1A 4UASA 3UJAA 5A0TA 1TKCA 1VKRA 3O8DA 1JIKA 1JVNA 2EJBA 3WIOA 3WGTA 5KZMB 3C1AA 2P9GA 3U0BA 4DA4A 3ZWMA 1UXOA 1EFVB 1O9GA 1UK9A 2C61A 2ZI6A 1CRLA 1V25A 4P5EA 3LUHA 1SCKA 3UK2A 2VHVA 1FYFA 1YL6A 2P4QA 4PVCA 2F55A 4TSRA 4XRGA 3RW9A 5IN4A 3ZS9A 4QBKA 3KSAC 1CNMA 2RONA 2G1UA 2PVCA 4FUQA 2KJQA 1QK5A 3FHLA 3PNKA 1N6IA 1NVVQ 2I91A 1IK6A 1XCPA 1UBKS 2HQ1A 5F3WB 1E32A 1QRRA 3FOAA 3PR3A 3KL2A 3PPIA 3WDKA 4BNNA 3KJXA 1ADJA 3O8OA 2Y71A 3NUQA 2QYOA 3G8DA 3S5JA 4UTOA 4C4PA 2IU6A 2P6UA 4YP9A 2IEIA 3QIVA 3MTDA 2VYVD 4P0TA 2TMKA 4IIJB 4A15A 2Z6AA 4TTJA 2WU4A 3GB9A 3Q7RA 1NFFA 1QCYA 1HDRA 2BC9A 4QOSA 4MIEA 3RTAA 3T5DA 4ENUA 1PFYA 5AT1A 2OQVA 3NDRA 3CX3A 1H42A 3I9JA 1DIOB 3KTDA 4CF5A 5B1YA 1HV8A 4I08A 1VE7A 2GKOA 4U2GA 3DCJA 2E37A 4YJ3A 2ZPAA 3G49A 4KQ6A 5FOVA 1OCEA 3VKVA 2Q1SA 4PVDA 2BMJA 1ZC3A 1ZBQA 1Y48E 3TNFA 4X1OA 2PLNA 1I1QB 3M6IA 1J22A 1HDZA 4KQWA 1SU6A 1VE5A 1XVTA 2PXAA 2BGLA 2WA2A 4MVJP 4YAJA 1V39A 4YV2A 4ZI7F 5KIAA 1YOVA 1VKJA 2QUAA 3PHLA 3L06A 1VKOA 1C7FA 4RDXA 2WSSD 2PSDA 4FMPA 4I1RA 2AK3A 1QX3A 1B2RA 4P3NA 1E3LA 5LN1A 4WH0A 3C3DA 1T4CA 2H51A 3TCXB 1E2MA 4DC0A 1D2NA 4EKEA 1J1UA 2WPDA 4B31A 3SQMA 4B7CA 2B98A 4C6RA 4ZDIA 1NQTA 1TEVA 2QE7A 4MROA 5G41A 1TEZA 2O59A 4PG5A 4QEKA 2X5JO 2ZYAA 4FMDB 4RFSA 4DLSA 2N1BA 1SK9A 4E5KA 1OXXK 5CX4A 1E9SA 1HT3A 3ONNA 1Z7YA 5EP3A 3U4HA 5JARA 221PA 4ERXA 2WVAA 5G0TA 3KQHA 1YHZA 3KZOA 3NVKI 1RLUA 2ZTLA 4IQ4A 4WTOA 3IR7A 4MI9A 3QKSA 5BSHA 2ZRMA 1AURA 4V24A 3SEFA 1QKIA 3P7MA 4GOLD 4KXQA 4XGIA 3C8HA 5BMVA 1U3FA 3HADA 1G1AA 1PYOA 5EKTA 3UO8B 3RYIB 1W88B 3SOZA 1J70A 1Q7EA 3QXSA 4IDEA 1GGNA 5I4KA 1HFEL 1U1GA 3EUWA 2VVTA 4UC0A 1JQ5A 4YDSA 4AF7A 5KTRA 1OXTA 1L7QA 2Q0XA 2YOGA 3QFRA 4ZCSA 4B4OA 3TWOA 2GYYA 4NQZA 1E9RA 1UDRA 2YHAA 3II6X 4YASA 3ST7A 1UKVY 1XD2A 3V6LA 3L7CA 3MCZA 3BYZA 2WZCA 3Q0IA 4PZYA 3TS1A 2H63A 2HLPA 3G23A 3OUZA 4MVJH 2FUNB 2HU7A 3QVKA 4LQLA 1IEVA 4M0MA 4UMFA 2JIQA 3SJZA 1RJ9A 1P7WA 4Q16A 1HFKA 3TB6A 2OR3A 2O4UX 3H1AA 3LPNA 4BKPA 5FWXB 3SQWA 1BEZA 3BJRA 2AJDA 4IJMA 4RFVA 4YVFA 3CEJA 3AEUB 4MGZR 5BO5A 4PZ9A 2HRZA 4L2IB 3VR6H 1T4CB 3GBPA 3RIXA 3JYPA 1HEYA 1Y3IA 3ENQA 3PHIA 5HSGA 1HO3A 2C2HA 1EVJA 3KPJA 2R6HA 2YUIA 3QTTA 4BVFA 3EODA 1GWNA 2NZYA 1I7DA 2BVNA 1C9JA 4NE9A 5C7LO 1PUXA 3LQRA 5HF6A 1W34A 2O23A 1C1XA 2DWQA 3CM0A 1VECA 2R1TB 3OTIA 1Z17A 5GGYA 4ZOEA 1BRTA 2VPQA 1T2UA 1R0SA 2CF5A 2PANA 2WJZB 3PQ4A 3ZWPA 2NT3A 4PHCA 5E0OA 3AETB 4UHBA 4GKVA 1J5EB 3URKA 3SEZA 3DKVA 4IDNA 4DBLE 2R00A 1G291 2QEQA 1SMKA 2C7GA 4U8GA 4G5YA 4Z4IA 1SBNE 1ULUA 1ZNQO 4MW7A 3W9BA 4CMIA 5DM2A 4B2IA 2ZJ3A 4H31A 3TZCA 1SBIA 4WECA 3HJBA 3A9RA 1T3LA 2DPYA 2QX4A 1R4ZA 3MERA 4H7KA 3RS2A 1N0HA 3KNZA 1X9HA 4H3VA 2C3MA 3BMQB 621PA 1N9KA 2A3RA 1PZNA 2ZT5A 3DKRA 4L85A 1ORIA 3JWEA 1MG0A 4B76A 2VRBA 5K3CA 3NHJA 3MT8A 1ZM4A 3I9OA 3K32A 3UJHA 4ZGGA 2LPMA 3C3CA 3G7UA 4B2LA 2XMQA 1W29A 2Z08A 5JANA 1F2UA 2G72A 4LDQA 4AB1A 3N2IA 4Z4EA 3NMUF 3ZGXA 1FFSA 2OGWA 2W6QA 1T1RA 1OREA 3DUWA 1C7RA 1DCKA 3EFBA 4J1SA 3HNPA 4H0NA 2IS2A 3CEAA 4FE3A 4KU4A 2Y67A 1GFSA 2EG9A 2YWDA 4BMPB 2FWJA 1H2ZA 1AZWA 3HY4A 1T1EA 4D9EA 1P4JA 1A71A 3OTGA 3K7EA 4G85A 1RLIA 1ORTA 3DL4A 3ND6A 5KYVA 5FDFA 4K9LA 1B6RA 1YHYA 1ZK4A 3RT1A 1V1RB 3HR4A 4QTXA 3PUZA 2D62A 4D02A 4M9ZA 2KLHA 1MW9X 5CH5A 2O9JA 5F33A 4JJEA 4PRKA 3F8SA 5A04A 1I9GA 3GJ0A 2H2IA 1I24A 1B8UA 2HRQA 1IQRA 4Z4FA 2A5DA 4QDKA 3T52A 4OHZA 1AMOA 3BXPA 4PSVA 2IUTA 4EYGA 4MTCA 2D2XA 4IS3A 4NBSA 3MF4A 1S89A 2ZI9A 5CNIA 1W19A 4HYEA 4C7BA 3M8KA 1QH8B 2F9LA