1TZBA

Crystal structure of native phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
301
structure length
301
Chain Sequence
b'SQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLYISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDGLLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQMGVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPEGLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEFNENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEHQERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLAEIRGVNPLATPRIDALKRRLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glucose-6-phosphate isomerase, conjectural
publication title A novel phosphoglucose/phosphomannose isomease from the crenarchaeon Pyrobaculum aerophilum is a member of the PGI superfamily: structural evidence at 1.16 A resolution
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Isomerase
total genus 113
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10432 bact-PGI_C Bacterial phospho-glucose isomerase C-terminal SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1tzbA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1tzbA02
2UXCB 4JI2B 2XHZA 1VI5A 2PGIA 2CXNA 5A2QA 4LFAB 1N32B 4DR7B 2DECA 1X92A 2DF8A 3OOJA 4GKKB 1N33B 1X9HA 4B3MB 4LF6B 3QKIA 4OX9B 5BY2A 4DV4B 1NUHA 1C7QA 3Q88A 3J80A 1VIMA 4JI6B 5FLXA 3T1HB 1IBMB 1TK9A 4JV5B 5BR8B 4B3RB 2VF4X 4DR1B 4LF8B 2HHHB 4DV0B 1X9IA 3NBUA 4DV6B 1GZDA 1Q50A 1MOSA 2O2DA 3G68A 4X65B 3BCHA 2F4VB 1N34B 2ZJ3A 5LMUB 2V4MA 5LL6P 1C7RA 3BJZA 2O2CA 1VIVA 1XMQB 3JAMA 2WU8A 3UJHA 1HM5A 4DV5B 2E5FA 1MORA 2PUTA 3HBAA 4LF7B 2CXQA 1XMOB 2I22A 4JI1B 2VQFB 2UXBB 1HNWB 3J81A 3SHOA 3OTOB 4B3TB 4LF4B 3FXAA 4JI0B 4M0DA 2VQEB 1HNXB 4DR4B 1U0EA 1TZCA 2E5LB 4DR5B 1XNRB 4EM6A 4GKJB 3PR3A 4YHHB 5I01A 1G98A 4LF9B 2UUAB 2I2WA 3EUAA 1XTBA 4JI3B 4TOIA 2UUCB 3CVJA 2CXSA 2CXTA 4B3SB 2CXUA 3IFSA 4AMVA 1JLHA 5IT9A 1JXAA 1WIWA 1ZZGA 4DUYB 2ZM6B 3TRJA 2CB0A 3HJBA 3LJKA 4JI7B 2XBLA 1XNQB 2PUWA 2PUVA 2POCA 4JI4B 1U0GA 1IBKB 2CXOA 2J6HA 1N36B 2UXDB 4IVNA 4JI5B 4DR3B 3M5PA 1JIQA 1NRIA 1HNZB 4NXMB 4KHPB 2A3NA 4AQYB 2Q8NA 4LF5B 1J5XA 4YY3B 1U0FA 3I0ZA 5LMNB 1I94B 1TZBA 4S12A 3J7AC 3KNZA 1DQRA 4DUZB 2UUBB 1N8TA 2VF5X 4DV2B 1B0ZA 2AMLA 4DV7B 3T1YB 2UU9B 1GZVA 4K0KB 4LFBB 4DR2B 1MOQA 3C3JA 4JYAB 3FJ1A 1JEOA 1T10A 2CVPA 3ETNA 3Q7IA 1HR0B 4LZJA 4X64B 1IRIA 4X66B 1VI6A 3FKJA 4X62B 4DV3B 1J5EB 1X94A 3ODPA 1IBLB 3TBFA 1M3SA 2CXRA 4LFCB 4NXNB 4U6NA 1IATA 4DR6B 5IWAB 4DV1B 2ZJ4A 3FF1A 4JI8B 1FJGB 1HOXA 2X3YA 1KOJA 2CXPA 2YVAA 3JX9A 4S1WA
chains in the Genus database with same CATH superfamily
4H16A 4NLLA 1T3TA 3K5IA 2H17A 1TMOA 5M7EA 1F17A 2C5GA 3C3YA 3LD9A 1CUWA 4V1CI 5JNVA 3BUSA 1L5OA 1A7JA 4LSZA 5M04A 1X9HA 4KVFA 4GS5A 1Q3HA 3H13A 1T35A 2W2LD 4NCNA 2FW6A 4ETMA 4QREA 4JXXA 1ZK4A 2B94A 4OI4A 4DMRA 2P2CA 5DE3A 2ORVA 1T4CB 4ICIA 4KN6A 5HF8A 3VR6H 5DO9A 3T3GA 2FEAA 3X3HA 3VR4H 5HZGA 4Q47A 5K9ZA 5KVSA 5J2UA 2G0AA 1TDJA 3MG9A 3TVDA 1X1EA 2B1GA 3NAQA 3K6SA 1PP4A 2PRKA 3LNCA 1VIVA 3BCUA 1O7JA 3FN4A 3NRCA 4K9LA 1S8NA 2Y76A 3FB1A 4JOSA 1C4WA 2X4DA 1I01A 4WKBA 3WBFA 5HSGA 4KBGA 4B2LA 1OV6A 3DHNA 3ID6C 4UFNA 2RAUA 2VG8A 5BN5B 4EUNA 2C88A 3OAAA 5HM6A 1Z2AA 5A4JA 2G09A 4YUZA 4DLRA 4PZYA 1MQSA 5EJMA 3OP1A 3NI2A 1JG4A 3NYIA 2R6DA 4MVXA 1D4OA 4DR5B 3DZIA 2Z5VA 3LC2O 1UM8A 3V32A 1L7EA 3K0KA 1GFZA 3L0BA 1V1RB 3JQFC 1SFRA 5JR3A 2CXSA 1JSXA 2A88A 1CY1A 2OVFA 4R8MA 1YZFA 1M1YA 1TM7E 4B5LA 4A36A 2I76A 2WMDA 1K7CA 5IJ0B 3PC8A 1U2DA 1PJ4A 4HB3A 3SYLA 2C92A 5ER9A 3C1AA 3MPOA 5L6MB 3GF4A 2FPIB 4YDHB 4FJ0A 2FPXA 1CZRA 3I42A 4F6RA 5CA1B 3ZIDA 4CGZA 1JIQA 2TS1A 1QNLA 1ZIDA 2Q5HA 2E49A 1YOVA 2C8KA 4QUBA 2RAPA 3PPWA 5E7MA 4BIMA 4D3XA 3PUZA 5BMVF 5B1HA 1TZBA 1XZQA 2IDKA 4GF5A 2ZYDA 4INAA 1LK0A 4AVYA 4BE7B 3RS8A 5HTOA 1HMPA 1MGPA 4K1XA 5FPTA 5KJEA 2ERYA 1L5NA 1H2AS 2GHRA 2PM8A 3DEJA 1EBFA 1JQKA 1YZ3A 4ZI2A 4XWTA 4AG3A 1GZHB 3ZDXB 2XGJA 1T2FA 1SC6A 2X6RA 3VTZA 1YL5A 4QYSA 4QSHA 5IC6A 3VO9A 2NP6A 3X2FA 3GGCA 3OCYA 4D8UA 1QONA 4GX2A 1FU8A 1NBEA 2GYWA 4YH1A 5CBPA 4FFSA 3DC7A 3I1FA 1AGRA 1DEXA 3HJAA 4YMGA 1OVGA 2NVUA 3LUDA 4Q3OA 3FUVA 1Y9DA 4X6UA 3F47A 2GM9A 1NQAO 4XDZA 1NYTA 2DC1A 4MVJE 1B26A 4RVHA 1P80A 3ZBTA 1GTZA 2Y9MB 2AK2A 3QX7A 3B53X 1QHHA 2YXLA 3QQPA 2A5FA 3D7MA 4PZUA 1V43A 1FNCA 5A4MS 5GPBA 3GEDA 1W52X 4CMIB 4KRFA 4Y2JA 4DMCA 3NB0A 3M70A 1IEXA 1Y8RB 3IUNA 4IOMA 4D82A 1ECGA 1FW8A 1DOAA 2IDMA 1DKRA 3BE5A 3OKFA 3O26A 5KSPA 2VQFB 2B37A 2C61A 3RREA 3BULA 4PLZA 4NX2A 3UAWA 2CK3A 3F46A 4EG6A 1U9CA 1W5BA 4HOYA 3CH5A 3EFOA 1IRXA 3NFRA 2OCIA 1DI0A 1HQYE 3EOBI 3OMLA 5D8DA 4D57A 3EC2A 2JLZA 1LNZA 1NVWQ 1N7GA 1SWVA 1W75A 3KKPA 4HMPA 3L8ZA 3T9CA 1N2JA 2IEDA 4PRKA 1ZNQO 3LY8A 3O4HA 4HDMA 5LKRA 4L50A 1JF8A 1EEXB 2C54A 3F6BX 4MIKA 2J0VA 3ESYA 2JIBA 4MAMA 4PZPA 2PSJA 4DWVA 4YMVA 1SG6A 2X5KO 3RYIA 1Y9JA 1SU4A 2ATVA 5CB4A 1B73A 3KQSA 1SUPA 2BGUA 3H5TA 1Q1AA 2ZB3A 1RM0A 2CLCX 3L93A 4UBMA 4UOQA 1P0MA 2Q8PA 2PVSA 2EFCB 3QLJA 2IY9A 4L1KA 3SQDA 4ZZ2A 3AEKA 4MLPA 4C89A 3EDOA 3CTMA 2PD4A 3KR9A 2QM7A 4NBKA 3HFRA 5LB4A 1D1PA 2V7BA 3E7DA 4BVAA 2J9YB 4DLZA 4FQ7A 4NV0A 4S04A 3RFUA 4C0SA 1ODIA 1OT3A 5B2FA 3P0IA 1IHXA 2RK4A 3W8RA 5C2JB 3LOQA 2ADMA 2I65A 3LLVA 2NO0A 5H5JA 1XPOA 1EVKA 3NUZA 3B6KA 3E70C 1PR0A 3R77A 5ALQA 5JD5A 1FFGA 1G9SA 4J0JA 3L0CA 1DLIA 4NE7A 5K09A 1QHIA 1DB3A 1F3LA 5AVUA 3FW1A 2QPAA 4J9VA 1H9AA 1UIRA 1H5UA 1JWAB 1Z5NA 4OJKA 1UC9A 3M5DA 4FD3A 2X5NA 5DGIA 1F9AA 3L40A 3U62A 3FVQA 3WWPA 4C21A 4PC3A 1ESNA 1ZC3A 2OZLB 3PNYA 5FOUA 1OC2A 3HVUA 1M74A 3C4QA 2PKXA 5JH7B 4DQKA 2GD2A 3O73A 1GZ4A 4C07A 4CODB 1R7RA 3KVOA 4MRMA 4EP1A 3D1JA 2QX7A 4HGPA 4NV3A 2GFIA 2D2VA 3T0IA 1JJBA 1KQNA 7YASA 1I94B 3C1TA 3SZUA 4JQZA 1VGRA 1XK7A 3L7NA 4JUDX 1NXVA 3EIOA 3GAAA 5AVQA 3IAEA 4X84A 2DPHA 1OSNA 3KLOA 4ND8B 1ST2A 3QP9A 2DSTA 4UFOA 5DPMA 3R3HA 5F35A 1PE0A 4L51A 1WDLA 2Z6VA 4H4DA 1TVKB 1CERA 3QMMA 5COBA 1UDCA 2YVQA 1R0WA 1LTQA 2QM0A 2ZTLA 3LIIA 3Q7IA 4ZCQA 2P9YA 4M1KA 1Q0QA 2MIIA 2SBTA 5SYNA 5I7FA 4EW6A 5IM4A 4R2LA 4QGFA 5AWFC 5AJUA 3IAXA 3COYA 2EBUA 3AM3A 1COZA 3EQ6A 1L8OA 1RAEA 3O3CA 4MROA 4WL0A 3SHTA 1CS0B 1ICEA 1DBVO 3EF0A 4QJBA 4UUNA 4AY5A 1U3GA 4DCUA 3RYCB 2GH1A 1YB7A 3OZWA 3PGLA 2PEZA 3GGSA 3K0FB 4P54A 4W6ZA 2QQ0A 3O2QB 3UHFA 3DLAA 5BUCA 2ZT8A 4OBEA 5K01A 2GKGA 4EG0A 1XKLA 5IWAB 3L8CA 5K1ZA 3T3EA 2DY0A 4JBYA 1DMSA 1JX6A 1MX5A 1ONSA 2BFFA 1BCSB 2XNDA 3ZVRA 4RNCA 1QE3A 3GOHA 5JDIA 4JI2B 3WK7A 4EEXA 1TK3A 1L9XA 2XSZD 1RC8A 4BP8A 2IS1A 1Z12A 2VJYA 3EMDA 4BC0A 2SNIE 1Q3KA 2UYOA 3DBRB 4NECA 4C6HA 4CM5A 3SBEA 5B57C 5BV1A 3OO1A 5JO0A 1NW7A 1VE1A 3PF9A 4EB8A 5K0ZA 2EW2A 1YE8A 4B74A 3T5PA 1T25A 1PL6A 5DCWA 2E82A 2D5IA 3ZX5A 1G5RA 2C0PA 2C5LA 4I14A 2Y27A 4ARAA 4N18A 1BH2A 2YZGA 4RCVA 1AURA 4L7QA 2BN4A 3HWRA 2XH8A 3LM8A 4ZI7B 2BC9A 4ZRMA 1NSTA 1THZA 3G59A 4COOA 1J1IA 1N3LA 3MS7A 3P19A 4ALMA 4UHEA 2Y05A 5DHFA 1OLUA 2CNKA 2RAFA 4Y0NA 2YH2A 3KOMA 1E7YA 3D8RA 3C24A 2M2IA 3EQZA 3C15C 1F8XA 4F97A 3VV2A 1CY2A 3ZW9A 2WA1A 2OZEA 3TFWA 2E0IA 3I5AA 2WK1A 3N59A 1IIRA 3INYA 4HDCA 1TCUA 2C1XA 2HTFA 3MT7A 2I99A 4OYLA 1XL1A 1PG0A 4R9VA 5HE8A 4KR7A 1CJUC 3GJ6A 3G8CA 3G79A 1TC2A 3NHWA 4TKZA 1Q12A 5EE5B 4KWTA 4MB0A 2JIZD 1D2EA 2RHJA 2ZI9A 4LHZA 5JFGA 2AQHA 2ODTX 5LZ9A 1NKSA 3FRJA 1CRZA 1VIDA 4FXOA 4OB7A 1ZH8A 2JK1A 1Y6RA 2B2XA 2FUCA 3RUDA 3SVTA 2ZM6B 3LBAA 1G59A 3CPJB 1NVAA 4HSGA 4MOWA 4KR3A 3AFIA 2NU8A 3BXGA 2C31A 4H17A 1EHYA 3DEFA 2BZ0A 2XHEA 3I52A 2YV1A 2BSXA 3V42A 3CLSC 2IUSA 3C3WA 5FUYA 2V58A 1JDTA 1ZCBA 3E5MA 4RYLA 5LBIA 1CF9A 5HUHA 3DFIA 1SCUA 4FZ3A 1KY3A 3HCDA 5LPNA 3LRPA 4WK4B 3O9VA 1X7XB 4FX5A 1JSRA 1ZIOA 1HTBA 3GFTA 2Q7DA 2WHQA 5B3AA 3HKCA 4ZHSA 4B47A 5H4GA 3EGEA 4XASA 1QYVA 1H5NA 1P5RA 2O48X 2AE1A 2Q3EA 1K5HA 3GNQA 4PHTA 1N77A 2WIAA 1UBNA 2NGRA 2WLSA 1U5CA 1K97A 3QFFA 3E9YA 4Q3EA 1CUYA 2ZAGA 3EUEA 1MB4A 3ZS8A 4HADA 1ND6A 1DKLA 5KTMA 5EJAA 4AI6A 1E3IA 1VLJA 2AEMA 4ER0A 5ELMA 1MEEA 1LWOA 3HM2A 3DVQX 3GNSA 3G8AA 4B43A 1PT6A 1U8CB 2XTJA 4CTNA 1U9IA 5DTMA 4AIRA 5JWHA 4FFPA 4RY8A 4E1BA 1HI9A 1SXJB 3AUUA 4JENA 1IXZA 5FOVA 2W6OA 3SJCA 1E3TA 3UBMA 4V0OA 1JHDA 2GF2A 1GGNA 1DHRA 4H27A 3RUAA 4WXEA 5C53B 4IDGA 3ILHA 1TT5A 2ATIA 1P62B 1P72A 3SYKA 2J0QA 5LQMA 4RPKA 3F5DA 4X93A 1DFIA 3BEOA 2ZQ5A 2NYUA 4KAJA 3QVOA 2IYVA 1AKRA 2B8WA 4O0MA 4PZDA 4AYWA 4RTLA 2QBYA 5F5XA 5F23A 2QDKA 5LM3A 1Z6GA 5IABA 2GASA 1GV1A 5FR2A 3LY5A 1QG6A 3B9BA 1C1YA 1XQWA 4KK4A 2XT9A 3LBIA 3MC1A 1G7SA 1V3UA 2ZT6A 3R0XA 3E61A 4N0DA 1O3YA 5EKDA 4AP6A 4CI0B 5EIEA 2CJXA 2R2AA 1TIKA 5ALYA 5GAJA 3PJFA 5ALOA 5DM1A 2XGMA 3OFND 1EUDB 3P9KA 2VCYA 2GZMA 3EJ6A 1NRWA 2C4HA 2D59A 3EIUA 4CV0A 4U3JB 4RTKA 1S3IA 2A94A 1Z5PA 1S3GA 1YVDA 4IX1A 3VJKA 4BO2A 3KQYA 3QVGA 1PFGA 2H1WA 1GZSA 3WJAA 4OOFA 4RFVA 3BQMB 4ALLA 4GLOA 5DGDA 3ZE0B 4D3FA 4B3FX 3RSQA 4HV4A 1U2RA 1BMFD 2AFHE 4L6IA 4MS3A 1FEZA 3II6X 3UCFA 3WS7A 4MR7B 4EHJA 4JOCA 3Q3CA 1V0JA 3A6GA 4OLAA 5F64A 4FLFA 1PJ3A 2XLCA 5HJ5A 2QVYX 3HDVA 4DAEA 3QM1A 2PBFA 1E6UA 1KYZA 1PDWA 1I5RA 1EUCB 1WCV1 4OTZA 4OGFA 3SYNA 2C7GA 5HW0A 2DRIA 1I3CA 1PS9A 3OH8A 3IALA 3FGOA 4MRAA 2A6PA 3I9NA 4LBZA 5EP3A 2R65A 3BXXA 1L5RA 2JD0A 2PAFA 1A9XA 2R8EA 4Q7KA 4U8HA 1YQWA 5TY0A 1VG9B 4D80A 4YAUA 4H2DA 4Z4FA 2W83A 3RR2A 1VJRA 4BL5A 1FLAA 1ZLYA 4O4LB 3FE2A 4MINA 4X1IA 1W44A 4WCDA 3B7PA 3RKSA 2JATA 1M0WA 1I10A 5J4HA 1I30A 3VNUA 4OQMA 1LC0A 1ZOSA 3N0VA 5L53A 3W1WA 4IO1A 1X19A 2FZCA 3U6BA 5EIFA 1AN0A 2GEFA 2NLOA 2Z3ZA 5AW5A 5WRFA 4BRWA 5KTTA 3CZ4A 4JELA 2D7DA 2HU7A 5HXAA 1YQGA 1D9XA 1W8DA 4FONA 2WU3A 6NULA 1DAOA 3INTA 4MVJD 5C1OA 1Z39A 2BL4A 2D2IA 4MQLA 1FDOA 2CF5A 1YQEA 2O8VA 4EOGA 1QK5A 5KINB 3T1YB 3IAM6 3SNHA 5JDCC 4KGVA 1TA0A 1A97A 4BQOA 2R7NA 1PSZA 1AXGA 4IMRA 4EO4A 1KSJA 2WYOA 2FETA 3AB7A 4FC7A 1SZDA 2VK4A 2AVDA 1V11B 3HYCA 4URWR 1MKYA 1SC1A 1CEXA 4IDHA 4UDNA 3X0DA 2AR0A 1XN1A 4AULA 4JSTA 4LJYA 3WV4A 1I51A 3ZWYA 2BH9A 2VTEA 1WKCA 3CF6R 1P0PA 2Q6OA 3I05A 4H6PA 4KAAA 2VP9A 3A4IA 4P98A 4PBSA 4EPRA 4CLOA 2F8LA 1M6EX 1UJ2A 4EG8A 3N0RA 4ZEVA 1WXQA 5JJ5A 4MV6A 1HETA 4RJJA 2PTGA 3EQ7A 4KLZA 2GN0A 2YN2A 1D3AA 4RMJA 3KWJA 5A3SA 3EVCA 1PYGA 4GEKA 2QP9X 1V1MA 2ZXEA 1TTQB 3WKDA 1YQXA 4MHOA 1KTVA 1Y5RA 3VR3A 3BHIA 2QIPA 3FUXA 4ZOEA 3L6UA 5DM2A 2B98A 2AF4C 2QRJA 1VSTA 2H29A 4B9AA 1OILA 4CL0A 1SD5A 4EL5A 1ML3A 2QYSA 4BNMA 3H2JA 2HRZA 1C14A 2R97A 1N4AA 2QLNA 1XOIA 5J58A 3U61B 4R7GA 1U8EA 2EW1A 3ZY3A 5C7YA 2GLUA 2A67A 3L0SA 1QJ4A 5AIBA 4AMZA 5L4LA 1DL5A 3SC6A 3D5EA 3H9BA 1R18A 2EF1A 2ZTUA 3HB7A 5C1IA 3ZHRA 2DHCA 3UWPA 2V4MA 5IDWA 1KS2A 5H9VA 1NR1A 1M5UA 1E4VA 4JROA 3AMVA 1CIPA 2NWQA 2H4ZA 1OZFA 4YRFA 3DL7A 3NETA 3B9PA 3VOSA 4YRNA 1E3EA 1FP2A 1QFXA 3HBAA 4LISA 5KEIA 5FFNA 3RK4A 4ZZ3A 3UTCA 3BJRA 4K6GA 4RFSA 3AR9A 1JG2A 2ZRJA 3IBFA 1GGHA 4J3NA 1VHWA 3AU9A 1WS6A 1V3TA 3O1LA 1HNWB 4OA5A 2HIAA 3BZBA 4U39A 5FNVB 1II8A 4DCJA 5E3HA 4CEIB 2GPJA 4OK5A 3KETA 3DTYA 4GOMD 2E3JA 2WIJA 5JNRA 2SICE 4GMHA 3C3DA 3A10A 4C7KA 1C9NA 1GAXA 1EVLA 3REGA 3KSUA 4XW2A 1B8NA 1K86A 2VPWA 3R8CA 1NBHA 3K8YA 4RTMA 2FFAA 4M7WA 4JYZA 4IF4A 3RS0A 9ABPA 1MJFA 5CFRA 1SAYA 2X1HA 3KSRA 3QKWA 1UBFA 2PLFA 2ZB2A 3NONA 3R7AA 1RJGA 2OBFA 4QYIB 3L4SO 4BNNA 2PIAA 3BBPA 4HTAA 3WHKA 3WWCA 1A9YA 3K7EA 3OBIA 1EFRD 2EU8A 2V6BA 3IDSA 3GR6A 4UNIA 4KIWA 4UJ5A 5IC4A 3PEWA 2JCXA 3PVCA 4M9RA 5I4BA 4H15A 3IHLA 3TDMA 2EERA 2J6HA 2II6A 4P82A 4PR0A 2B4TO 1O6BA 4OJMX 1N2XA 2X8BA 4KZKA 4XH9B 3ZWAA 2JAHA 2YUTA 2ZFUA 4NXMB 3GELA 3WIUA 2G08A 1GG9A 2OBNA 2FMUA 1RCFA 4FSXA 4CQMD 5C9ZA 3KQOA 1RWBA 2AJ8A 1PJLA 1GU1A 3ITKA 3O8DA 3K8ZA 4PHCA 1GQ2A 1RZRA 3PHBE 2YZ2A 3K5WA 2X4LA 1AZWA 4LDRA 1DAEA 1UXGA 3GJ5A 2CDAA 4YJFB 3ZKWB 1TM1E 1MDFA 4PAMA 3V80A 1DAMA 2AFIE 4MGZR 3ZJYA 1L3CA 1QMGA 3DDZX 3C3AA 5DNVA 4L5JA 3ZZ1A 1KI9A 1OJ7A 2VIIA 1YRLA 1SRQA 2PGXA 3ETNA 4BBAA 1QRUA 1KO8A 2BBWA 5ICSA 2B4KA 1B1CA 3AKCA 2PLWA 4OATA 1IXYA 1CRPA 1RIFA 5D1HA 1II9A 2RGDA 2WSMA 2JEOA 1AGXA 1MQ8B 3OJCA 3P9ZA 4HCJA 4BDSA 4A0GA 4R9RA 1JPVA 4J4HA 1JPUA 3LPLA 1RAGA 4KOEC 4G8JA 2FP3A 2IYXA 4ZU3A 2AJDA 2OLEA 4X90A 3W2HA 4F6LA 5HJEA 1VSBA 5THKA 1VL6A 1NQ5A 4PXYA 4Z3KA 4QOJA 3JD3A 1MX1A 2AQ8A 4HPWA 3FNEA 1Q0PA 5G4LA 4BWGA 2X8LA 3D2AA 3WGTA 4PZLA 1P17A 5F7ZA 1TPZA 3VHRA 2WOOA 2PNFA 2A9KA 4F8EA 3OQIB 2G4LA 3UMBA 4GOKA 5SY9A 4IGKA 4Z1MD 3TOCA 1TK9A 5KYWB 2Q5IA 3H1PA 5AR1A 3D3QA 4WBSA 4YN3A 5LA6A 4IF6A 3UPDA 1E96A 4BEVA 4DV0B 2DETA 1TUGA 4E5UA 4XUEA 3UT0A 6ABPA 3PTAA 3QX3A 3GFQA 4I9NA 1F3OA 5DBGA 2E4UA 1PBNA 1BHJA 3AI1A 4BNJA 2I6FA 4H9GA 4AJHA 1N5IA 1IK6A 3EBLA 2I9KA 1K5GA 3VNAA 2XGGA 3HUFA 2FE1A 3M5WA 2OLJA 2R6FA 1MHPA 4P4LA 3SYTA 3ZEAA 3DAOA 3GV0A 3EEBA 4IQ4A 4L22A 1ORVA 5AUNB 1VJTA 3WL7A 2QSJA 1FP4A 3UAXA 1GGJA 1Z2NX 4L78A 2FPGA 3H6HA 2ISSD 4F85A 1R6AA 2IS6A 3OZDA 4R2JA 1TGVA 1MQ9A 2XKAA 4PG7A 3S6JA 3HVRA 3RODA 1SXJC 1YASA 3LK6A 2UZ0A 4DWOA 5DULA 2ZYVX 5FR1A 4AZSA 4NCHA 3SDBA 3OJXA 3RT1A 3WGLA 1KPHA 1PV1A 2I2XB 1WQ1R 2RC6A 3LCVB 4B6RA 1P8AA 3DE1X 2QE7A 1M34E 1A77A 4INJA 5ERXA 4Z49A 5CVVA 1C30B 4ZAVA 3I73A 4FOTA 3GHYA 1BXKA 2Z4SA 5BOSB 1IBKB 2O54A 4BZZA 2IK8A 1A5TA 2NN3C 2DJIA 2FGKA 1Y3BE 2V7QA 3EASA 2X7JA 3EGVA 3F7TA 3FYSA 3ND8A 2ZUVA 1R4MA 2HHAA 4LYGA 4DBZA 3ICOA 4WBNF 3GLGE 2LZ0A 2K87A 3DEAA 4MR9A 4G0WA 1LDEA 2OKGA 4HH0A 1WZCA 4A2WA 5DNWA 4WLOA 1O5OA 1O95C 2JFNA 3G2KA 4D26A 3GWZA 3QU2A 2NZYA 2Z1DA 5JS2A 1UJBA 4G23A 2HJWA 1NF3A 4F72A 3CUWA 2KE5A 1IDOA 2QMYA 4EATA 2D00A 1TVEA 1FMTA 1B3RA 3X43A 1AQJA 4L16A 1NR7A 2CMGA 3PFNA 1T0HB 1Z4PX 1AKNA 1RE1A 2WVAA 3FM9A 1OPRA 4R1TA 5K0LA 2J85A 1L4KA 5ESXA 1T8SA 4MVJF 1UFKA 4UMFA 3ZCXA 5B3LA 1STOA 1ZCZA 4WCVA 4FW9A 1EXVA 4OQYA 4CMEA 2JFFA 4Z1OA 2MMCA 2I71A 3BRWA 3A2NA 3E5HA 2HJ9A 4NPHA 2HDNB 4ZQGA 1FSSA 1LJ8A 4L27A 4B3IA 4D25A 2SKCA 1QYWA 2YWCA 1B14A 3I3OA 3OE7D 3Q98A 4H1HA 4MQ6A 4RELA 5E3JA 4D8YA 4EBFA 1E2BA 2JAOA 3GPDG 3MOSA 4NG4A 1Z7WA 2JGMA 1YA4A 3D02A 4GAEA 5I9SA 1NMXA 3IX7A 4MQEB 1J42A 4AD8A 4B31A 2GN4A 3A6FA 1TM3E 3H1AA 3PD0A 2GAIA 3C3PA 3K71B 1KI2A 1M72A 2DECA 3S2UA 1M6NA 4KOAA 4CIBA 5FTLA 4L02A 5JAUA 5KMGB 3WSVA 3HO8A 3OA0A 1QGUA 4HYTA 1VSVA 3VR2A 4EJSB 3W7BA 4G1CA 4YLGA 2FSGA 4A2CA 3W2TA 2IUFA 3CEPB 2BKUA 3FY4A 3RRNA 3ZN2A 4B44A 2Z9BA 4R1OA 2WABA 1K5PA 3QG1A 1PZFA 1YS6A 3KKEA 1SHUX 1LLDA 2ILTA 2JANA 1P6QA 3AW8A 3O03A 4TWZA 4YS6A 5GM2A 5A5DA 3VC7A 4G01B 2AK3A 4A8HA 4BP9A 1QP7A 3EA4A 2QLJA 1NBMA 3Q7QA 4KI7A 3V6MA 4V0QA 2ECQA 3L3BA 3LUKA 5TQVA 1KO1A 1KQOA 3VU1A 4EFDA 4OHYA 4B32A 1L0BA 4HBZA 4NS1A 5KX5B 4YUWA 1H0RA 3A9SA 3GN1A 2C8JA 4LVUA 1U0SY 3TTWA 3QWHA 4RK1A 2AYYA 3FTCA 1SCNE 2JZNA 3TYXA 1CD5A 1B0PA 3BC1A 2JKYA 3PJGA 2GAAA 1V6CA 3LP8A 2QN8A 2X4GA 4NCKA 1AK9A 1KZ7B 4UCXA 3V7WA 4MVJH 3V00A 3KPJA 3F9CA 2GPWA 4QVKA 2I66A 1GUFA 2WKPA 3C3XA 4HWTA 2CV0A 1G63A 4YR9A 3GLIB 1EDDA 3PQ8A 2RGGA 1W2HA 3WLQA 2P68A 1QYCA 1X1SA 5L3SA 1RYFA 4LCBA 1FDVA 1N2CB 1EZ4A 1S1MA 2A0FA 2Q28A 1E5QA 5HILA 3DUFA 2JCGA 1YMUA 3GL9A 2XOEA 1VKJA 1Y8CA 1OCEA 2EP5A 2O2SA 3PI6A 4HS4A 4BO1A 1JLLA 3BWBA 5H68A 5I9TA 3DTTA 2RGBA 5JAPA 1F2TA 3P94A 2P2GA 1V16A 3LTEA 3WJ2A 4MUHA 4DIFA 4IUBS 3H2HA 2XJ9A 2R8BA 3JW8A 3NOXA 2QAGB 4QBTA 1K9SA 5KYGA 5HTKA 4TVKA 4RD4A 2XYVA 3F73A 2QP3A 1FNSA 1OLXB 4IS3A 5IJAA 5KJFA 1PF7E 3LGAA 2QRMA 3R5SA 3ROGA 3MMXA 5DF1A 2Z43A 2YN4A 3VNSA 2HDOA 1IBRA 1E0JA 2JC3A 2ZKIA 3AF4A 1UXKA 1IONA 1QH1B 1L8LA 1VSQA 4W8HA 3QUAA 1NN1A 4C14A 4IWXA 1YA8A 1OXMA 4HAXA 4DWWA 1VB5A 2FOLA 1FMLA 1W1IA 1UPUA 1LPSA 2W6NA 4NAUA 4KUGA 2F43A 3PU6A 4Q9DA 3DH0A 1T0UA 1PZHA 4TLCA 1H9CA 4DKJA 3UMVA 2ZUDA 3PJEA 1D4AA 2IEYA 2J9GA 1UEXC 2XDQA 3L1UA 2JIMA 3I8OA 4LSMA 4CMHA 5BSKA 2O20A 4RK5A 1F2VA 4U7GA 5DGCA 3JZAA 4UQOA 4BDTA 3Q7SA 2OSBA 1R15A 3HDHA 5AVSA 3JQPA 5LLSA 2O8NA 4AS2A 1TA4A 1THTA 1XDBA 1WB4A 4AKEA 2CDRA 2QN2A 5BSUA 5IHXA 1H2BA 1BNCA 3GZNB 5FCDA 4HGZA 5DYWA 5JCJA 2O59A 3M89A 2FU5C 2ZIUB 4I55F 1X38A 4RS4A 4YQFA 3UAYA 2HFJA 1TMYA 3OI7A 3R41A 4OQXA 4P4GA 1C9YA 4R1SA 7ABPA 1G7RA 2HWYA 1DAFA 2ZSAA 3QLTA 1NXOA 1L8AA 4J75A 2ZG6A 1BE1A 3Q2IA 3M4ZA 1LK7A 1OB5A 3ZHUA 1G6OA 4MW5A 3L0OA 4M9CA 3AKYA 4WY2A 2V7TA 1YRBA 2GWHA 3WNVA 2BMJA 4MCIA 2VTVA 3F67A 4TTRA 3DOOA 1G3IA 3NBMA 1KYVA 5FB3A 2Q2VA 3NTOA 3JATB 4H60A 1OREA 2PU7A 3FVWA 4HQRA 5ALLA 5G0SA 1GNLA 1QRSA 2FZKA 3CPHA 4NFSA 2X76A 2J7PA 2Y68A 3CM0A 1SHTX 4BNKA 3QXHA 1F4LA 1DRWA 5CX1B 1AUQA 1J2RA 2F1IA 3ZHCA 1HEYA 3IXMA 3EE6A 1Z08A 3UMSA 5HBGA 2P0YA 3B3GA 3IUBA 4D98A 4WK2B 1V2HE 1VKHA 3L4BC 3BD7A 3BG5A 4J07A 1UP7A 5I7VA 2ZS8A 1GPAA 3QWIA 1LS1A 3FCEA 1TRHA 4MCAA 2J59A 1EKXA 5AI4A 5CHEA 1SZCA 1W88B 2WF7A 2GCGA 1Q14A 3JQAA 3CEMA 4DBVO 2Q6LA 2SHKA 4OHPA 5F98A 2RH9B 2FI1A 4R8VA 5F1YA 3MQ4A 5FKJA 1OFIA 5C35A 4L8FA 4J6EA 1WW3A 1L5FA 1Q1QA 2OXFA 1JLHA 1YZGA 2QTWB 2XNHA 2ZI4A 3O4GA 4J0KA 4JFAA 1ZW1A 3HUEA 4QUJA 3V2IA 3PX2A 3RRMA 3DE4X 2VPYA 2QU8A 1AK2A 4WINA 5ALFA 2C84A 4KJZA 1BW9A 1NI4A 1CQZA 3MD9A 4MNTA 4B8YA 1E62A 4UCFA 3W2IA 4IDFA 4JY7A 3ZKAA 5K8CA 1P4RA 3A58B 3OOEA 2QTNA 3DE6X 1MB3A 2WYVA 4IVNA 4WOCA 2OFWA 4HYQA 4H7KA 2A4MA 2B8EA 1YT5A 2Q9UA 1G5IA 1XQ1A 3G8DA 4GZ6A 5CVUA 4ZT7A 3DHEA 2VDJA 4DGQA 2CVOA 3BQ9A 2JCVA 2W8BB 3GFBA 1ZJ5A 2WJ6A 2C2YA 4J7CA 2BTQA 4EI8A 3F6EX 5DH9A 5TRTA 3PNMA 2BIFA 3OEYA 4JT9A 3K1TA 1ULTA 3QZUA 3T5CA 3NHKA 4QFMA 4PXAA 3UT6A 5HIAA 4FYJA 5JMTA 3QEAZ 3C3JA 2HCTA 2ZYWX 4E5KA 3TAXA 2VSOA 4U2EA 2GCOB 1B0AA 4OP3A 1A95A 2PJDA 4LDPA 3AFNA 1PG2A 5ALPA 1O89A 1NKVA 2P0EA 1QVAA 4UNPA 3PRJA 2OGUA 4Q1CA 1ZRHA 2C9CA 1A9OA 4HKTA 4DM3A 1SVNA 1GZ5A 4E30A 4F7WA 1XA3A 2XUGA 4ATNA 4DLPA 4LVCA 3OQNA 1ODTC 4KR9A 1ZD8A 2ZRLA 4E22A 1NQVA 5KVVA 1PKXA 4IILA 1QNFA 1BG6A 1Z25A 4FT2A 3DC2A 4XIIA 1RE0A 2KLHA 1VBFA 2Q0QA 3ELBA 5CVDA 3T7JA 5ALUA 2HK6A 2X2EA 1L5HB 2XI4A 1N9ZA 2GJKA 5EPOA 3ANLA 3TEMA 4DMHA 4P0QB 1Z0SA 2DBQA 1F0NA 3VBEA 4WAUA 4HL6A 5INTA 2J4CA 1PGPA 3ZGYA 3KP1A 1XZMA 1R8SA 2GD0A 5KAPA 5C5EA 4LF6B 3TRDA 2H0QA 4LWOA 3UC9A 1F6DA 2P6NA 4GYYA 5ICMA 2MDTA 4QJ5A 5BWNA 2O06A 4NYJR 2MCFA 1ND5A 4FUQA 4DREA 4ENPA 3IE1A 1X1RA 4YNBA 1TECE 3A70A 4KPUB 3WNZA 5C8YF 5EIHA 3KT0A 4HEJA 5CFMA 3SQXA 1ZVJA 2CHVA 4ZVSA 5MGNA 2WFLB 3IJEB 1TQHA 4UVIA 2FPWA 2CZQA 1WSAA 2GZSA 4MW7A 4QOGA 3AOEC 5EUQB 3SVZA 3SSAA 4H08A 1XAIA 3DS8A 3OKCA 1WXFA 3F8TA 4NATA 3I09A 2QR5A 5CNIA 1SEPA 3B5EA 5EHNA 1AHHA 4GPZA 3NR2A 1GU7A 1YK0A 5EUMA 1TO1E 4LPSA 3MFYA 5LCXA 3RRZA 4IXMA 5D5HA 3DBVO 1T8WA 2XDWA 5AM1A 4KRYA 4UU7A 1OH5A 2GAOA 4PHHA 3JQGB 5KOYA 5THXA 4I4IA 2HA2A 3U3MA 2GZ1A 2WV7A 7MDHA 5JXGA 1X7WB 4OK6A 1E2QA 3HV2A 3OLWA 4PSCA 3RTAA 4YROA 3TR6A 3SVLA 2YHBA 1EFLA 4M7RA 4YHHB 2EYUA 4URUR 3CKKA 1HGXA 2ZUEA 2WVHA 2UDPA 3LBYA 2I6QA 4JVMA 1LNQA 3O3OB 2O05A 3I58A 4Q7LA 3TL3A 4DC0A 4N01A 2PG3A 1G16A 4UMVA 1RI3A 3CZCA 1MZVA 2BI4A 3H5WA 3KJFA 3PXXA 1RRVA 3A27A 4GW3A 4X6XA 4UAGA 4NF2A 4X6YA 2VJKA 3ROEA 1J39A 1FPQA 4FGZA 4NU5A 4AURA 3I9V6 4D2IA 2XKBA 3VPDA 4CQMB 2C07A 4IDEA 2OYSA 1GGMA 5AKLA 3EZ9A 2FOIA 4F5EA 2BGNA 3HCNA 1K75A 4MKZA 5LYJF 1TW2A 1I1QB 2BHSA 2XKJE 1QKKA 4EJSC 3EY4A 1R9JA 4O2BA 5I8ZA 4YUXA 2KQUA 3FDIA 3OLXA 2R0QC 4O3MA 4L95C 3OMWA 3CZ9A 5KQSA 1I2BA 1X1CA 1VHQA 4Q93A 4BX9A 3G1TA 4JJ6A 3BMCA 1C7ZA 4C0WA 5K6AC 4BCDA 3T1TA 3AONB 4Q37A 1EU1A 1QUFA 1U7ZA 2HDWA 4Z0HO 3CX8A 1CDDA 2AXQA 2G1UA 3P0HA 4KRGA 2JDID 3TZ6A 5AHKA 4BO8A 2HQOA 5FUXA 4JYCA 3WGJA 3GP8A 3KEMA 3OX2A 3JVVA 1HL3A 4OVKA 5BNFA 5FEMA 5KHAA 3OE4A 1DWOA 2QLBA 4YLYA 3L7MA 4LQDA 2X40A 1L4UA 2QNRA 4KFSA 1HLDA 4LJLA 4AICA 3CF2A 1YC2A 2GBLA 1C9MA 5T7BA 2HBRA 1GAWA 1HH4A 1F38A 3DCYA 4OO3A 1CLEA 1L7XA 3BL5A 2GAJA 3EGCA 3I4CA 2R7LA 2SKDA 3RI3A 3VPGA 4CG2A 1WB6A 2WM3A 1TCVA 3NJRA 1O6ZA 2KMLA 4BEWA 5KI6A 4X44A 3MK31 3M81A 1P2DA 3QNWA 4EDFA 3IMEA 3ZY5A 4G5YA 2Z83A 1SNYA 2VDLB 4ZYTA 1M2EA 3NDPA 4J6FA 4TSFA 4ACBA 3E82A 2VJQA 5AW1A 1OXTA 1PN3A 1U1GA 1KJIA 3LW7A 2ORIA 4X41A 3ZCSA 1L3IA 4UM9B 2QP4A 1NJ2A 4X3CA 1QIJA 2UXBB 4CCAA 2PSDA 4PSKA 5CJ2A 1T24A 3TSWA 4I36A 1BN6A 4B84A 2W2VA 1FTGA 5C7OO 1NVFA 4H7PA 2C3YA 2JI4A 2QW0X 1IBMB 1YB1A 2XTZA 4JUFA 5JTTA 4J16C 3S7ZA 4DR1B 1LBQA 4OFXA 2IIBA 3B9QA 4K05A 2JLRA 3WLKX 1PTJC 4MP3A 3DXYA 3AJRA 1EAMA 4R68A 4ZEXA 1HPLA 1MOSA 1W19A 4DEYA 2G80A 4HNGA 4NCIA 1RYYA 2P41A 2QAGC 1JJAA 4IJ6A 2W11A 4PSAA 4WACA 5MF6A 2VP5A 2SKEA 4ZI3A 1QQ7A 1T4MA 2PRZA 3KZKA 3PYLA 4QULA 5G4KB 3RADC 2BFBB 1H93A 2P2NA 2FWAA 2OHOA 1E8NA 2Y0CA 5JAHA 5JVDA 3UF0A 1HKUA 1LSSA 3QKRA 5LU9A 1Y81A 2NW6A 3R4CA 3TM4A 3VOTA 4QUGA 4OFZA 1N2HA 4G4GA 4KYVA 4S1VA 2V7WA 2R79A 3CZAA 4BLQA 1BU8A 4V38A 4B48A 4OK3A 3LUFA 3V1TC 1XNRB 3N8DA 1E9FA 3R3JA 5FOSA 1P8JA 2ZRCA 4YAEA 5SYAA 1R6UA 2IITA 1SBTA 4HB2A 4E7OA 4MWDA 1KYIA 4FB4A 2GTIA 1EGVB 2G06A 3SZMA 4YMHA 3EWAA 3WL8A 3MRXA 3PB3A 2V9CA 1J56A 2C7PA 1OU0A 1X80A 3IFSA 1FTWA 2QRGA 4DQ0A 3QQ5A 4E2FA 5KKAA 3VDQA 4DSAA 2CY0A 4MR8B 2G4VA 5TMDA 1GARA 2QX6A 3KFLA 5FLYA 1V96A 3U9SA 3IEMA 3NALA 1U1CA 1USKA 3NHAA 3UEOA 2HY7A 1Q74A 3JAKB 1MNAA 2GO1A 5HIKA 2H3EA 4UE6A 1SGWA 1P75A 1JHZA 1PHPA 3DKVA 4G5GA 2G1JA 3G2OA 1MRNA 4TYYA 2NT3A 3WGMA 1P4JA 1DPFA 1XX6A 2IYZA 4MJXA 3OBBA 3RQIA 4A73A 4M55A 4O4HF 1J5PA 1JEAA 1D5CA 3IAS6 5CPFA 1FQOA 2ZJ8A 3DHVA 1EZZA 3HO6A 4I9UA 5K3SA 4H35A 5KCMA 1BXGB 4S12A 2O8DA 4M99A 3P2OA 4HRVA 1DGQA 1FUUA 1CUFA 3K70D 1R0BA 2DTEA 3OPVA 2JARA 4Q1AA 3V7YA 3RWBA 1WKVA 3DEZA 1SMKA 4BU0A 2PGAA 3P2YA 3GAMA 2GF0A 2GBGA 4K9MA 4KXLA 1KK3A 2HMAA 4P8RA 2PUAA 4E21A 1K3UB 4BS9A 3R5FA 5JRDS 4CEHA 2QRVB 1LH0A 3AW9A 4GO1A 4A1FA 3W90A 1P9OA 4A91A 1N8NA 4E07A 2RD2A 3IUJA 4EY6A 3PL1A 1SVUA 1YSCA 5IBPA 3EVNA 3TUIC 4V1CB 2QAJA 3N9IA 4G0NA 5DM0A 5H83A 2C4TA 3ZLTA 4EYOA 2FG7C 4YUAA 5JSUA 3I4FA 4NEGA 1IB0A 4ZYYA 5IF3A 1UJ5A 3A9WA 5DBFA 2IP4A 3WNCA 4L6CA 3W3ZB 4KDEA 4UDYX 4KACA 3BFVA 1FTNA 1MGOA 1SHZA 4QQNA 1FDIA 3CLKA 1DWQA 5DT9A 5KQPA 1FRZA 1W93A 3K5PA 1WSWA 4JEUA 5AKIA 3ACDA 4I1UA 5E2BA 5KC8A 4Z4EA 3MRVA 1PEDA 3D5QA 4QUEA 1VZ2A 1B16A 2PGIA 3DNPA 4ZQCB 3E05A 3MUOA 5TARA 3U3OA 3KOWA 2J4DA 2ENUA 1GQFA 3KYBA 4P4TA 1CZUA 3V7FA 1RS0A 4RETA 5MHTA 3JXEA 2Z30A 2WIKA 1L8XA 2Z5GA 3O91A 1NLUA 2F7SA 2D0OB 2YMLA 1NPYA 3D43A 4EQZA 5J43A 3UBTA 4IYJA 3BTUA 4P7BA 1M1YE 1HTWA 1SWWA 3C5WP 4IXTA 4YRMA 2HHHB 1VXRA 1WW2A 3TOVA 3CV3A 5TPWA 2G40A 3IB3A 2EDAA 1BHQ1 4RX1A 4CKEB 3UUWA 2BCJQ 1N9GA 2WM2A 4IIGA 2GUGA 3O4IA 3PENA 5BVHA 2H7XA 2VK2A 2VPTA 3UJHA 1C5KA 2WWTA 1XTRA 1I8TA 2YINC 2VHEA 3DFKA 3NIGB 5JYDA 1YIOA 3AF5A 3T7IA 2Z2JA 3GJYA 3WDSA 3NAGA 4XUGB 1MO6A 3A1WA 5CDHA 1YB4A 3PFGA 2QUBA 4ZD6A 5KWVA 3RNLA 2JAWA 4MICA 2I2FA 4YPFA 2FWJA 4GI1A 4LC9A 2OCYC 3HGTA 1H2YA 3I32A 4YDRA 5ITZB 4DR4B 3L5KA 3W78A 2H5LA 1PX0A 4DRYA 4HWOA 3RIXA 1UP4A 2J3LA 2YIJA 2PSSA 4FQ5A 4TX1A 4RBNA 4BFZA 1RPJA 3R5JA 5H81A 4RTJA 2FLVA 4R0VA 2H1HA 4UW9A 2C5SA 4E4RA 4EKGA 2EAUA 3KTDA 3DZFA 4CFYA 4E15A 1XT6A 4D0SA 2JGFA 4CM6A 1HE5A 4GXTA 4RLSA 1AUXA 2AXNA 5ED4A 5L45A 2XCSB 3SS8A 1PZGA 3CUYA 2BFEA 3GLRA 2NUAB 4AJ4A 4BQPA 1LSUA 2R48A 3NATA 3ZIAD 2NTJA 4Y2RA 2HO5A 1KWKA 4QXQA 1R9GA 5IH3A 1I36A 1WBBA 4KO1S 1DPGA 5BWBA 1QAOA 2YHAA 2ZU6A 4TTAA 4N8DA 3IRVA 5K8IA 4XWYA 1WWKA 1Y6ZA 4OKNA 5GZ1A 1KH1A 3WZ2A 3UJ6A 4JP5A 1JPNA 4MI1A 3S5UA 3TBHA 5BRAA 1UBMS 3EY9A 3I8XA 2GJ8A 3VYUB 1UBSB 4RXUA 3AP2A 2VWGA 3GRCA 1RHMA 3CSSA 3D8HA 1KVUA 3VDNB 4QRHA 2EJVA 1E2EA 2XBUA 4X7MA 1ZJYA 4EKYA 2OV3A 1N1GA 2BPOA 1Y3FE 5CD1A 5JTUA 3ONFA 2GPYA 1UKAA 1U94A 4G36A 1FSFA 1Z2EA 3NBAA 1KI6B 1V1RA 5A5FA 4KV7A 4JYAB 3NHBA 3R9IA 2HA6A 3ZXUB 3ANNA 1P3JA 4BATA 1H4SA 2NADA 3ELWA 5KKNB 1F2UA 2R96A 4BKRA 2DHDA 2ZVQX 4NCJA 2VK1A 2N0SA 3GFGA 5ARDA 1KBQA 1ZICA 4HNAB 3GT3A 4MDYA 3AR6A 4MZDA 1O4WA 1ZFNA 3I6IA 4C4RA 1D2RA 3P4UA 5AUPB 1PNQA 5AW9A 4G86A 5LU8A 5CIWA 3T94A 4JFRA 2J30A 1ZUNB 3F3KA 3ZHSA 2XCOA 3GPIA 4EUSA 1Q2XA 1FVFA 2GJAA 2O6HA 2QJTA 2R8XA 3F1LA 3KB2A 5ERGB 1QV9A 2W70A 3T12A 3B1VA 1XMSA 2J46A 3DL4A 1WD7A 1GN8A 1G8MA 3VR5D 3LA6A 5C31A 3UM9A 4JB2A 2I4MA 2XRZA 4GECA 4MVYA 3ZTTA 1PR9A 2ORYA 3F78A 5J5CA 4LRXA 3KYCB 4YRTA 1QVZA 3GJQA 1T2UA 1ZHOA 5TMPA 3Q1KA 5J5VA 1NXTA 1QHYA 5JISA 4ZODA 2J3QA 3V4SA 4EBBA 1T5HX 3MCTA 3AEUB 1SUSA 3WFZA 3GRKA 1N6NA 3LQRA 4W9NA 3MJCA 1SU7A 4ZCTA 1R6TA 2J5XA 1XELA 4FJ2A 2IU3A 4RKEA 1TOAA 5EQDA 1LPAB 3KUCA 1JR2A 1PT5A 2G9UA 3NHSA 3KVNA 4EA8A 1FSPA 2HO4A 4IXDA 2OBLA 2QOEA 2I7XA 1ZD1A 2AE2A 4BQRA 2PLAA 2I4OA 2ZRIA 2FR0A 2Z2YA 3HJHA 2JFWA 2WPDD 4IAOA 4BTEA 4B3JA 5CFQA 5FUMA 2LXNA 4GYJA 4RIEA 3TNYA 2BF7A 2AW3A 1GGVA 4FSHA 4BNDA 1GAJA 4KDCA 3O7WA 1L4GA 1QZZA 4EF5A 1JQBA 1NR5A 1K9VF 1U0EA 4DXAA 3A6ZA 2OA0A 1Y5IA 4XSHA 1G20E 1QDEA 1XXHA 4DB4A 1IUNA 4LYAA 3A37A 3BL6A 2CJYA 4DLYA 4G65A 4OCZA 3G9UA 1J8YF 1NC3A 1OXBB 1F12A 1SK9A 1NVVR 1U7PA 1XROA 3CU5A 4JU8A 4Q66C 3N2LA 3WV5A 4ZDJA 1BIFA 3BK2A 4J91A 4UBIA 2UVQA 4P84A 3VNBA 4XYBA 3OE5A 5B5SA 3BZWA 5B7PA 2DHEA 3PHLA 4CL2A 3UGQA 3OF2A 2PRJA 2R3SA 4EY3A 1M2KA 4JJ8A 3L0ZA 4V3CA 6CHYA 2VSFA 1FK8A 4CG0A 1SUEA 2PYDA 1ZR2A 1XEWY 2Q3CA 3LKDA 4RVOA 3ZK8A 4RK4A 3K70C 4AS1A 4JI7B 2VNSA 4GGOA 3ZHVA 2AG6A 1WMBA 4LZPA 2J5KA 4N3AA 4MQFB 4UARA 1Y7TA 1J2YA 1SB9A 4R2KA 1DBRA 1O94C 2I4LA 2L2QA 3NV7A 2ZJYA 3FYUB 4XD7A 4IVRA 3HCAA 1YS1X 3UGTA 2RE8A 1R0SA 1US8B 4QL3A 1YS9A 2XMPA 4Q7EA 1C3OB 1PLKA 1R12A 4X54A 3CBGA 1DG1G 4HLDA 3TG2A 3VR6A 2YNMC 3VR4A 4Q03A 5DV9A 1NUAA 1ZONA 4D9BA 4HNTA 2AXPA 1AX9A 4WNAB 4M89A 3BORA 5ALVA 2DZDA 2G88A 2RFLA 3HN6A 1GR0A 3FH0A 1SCAA 2YS7A 4W1RA 1KVSA 3MCAA 1D1TA 4MKIA 4PS1A 3EQ9A 5AOAA 1XYYA 3EPPA 2H4FA 3SF8B 4NDZA 3MRTA 2EFDB 1FFBA 1A27A 1OWMA 5M34A 3PGMA 2CFSA 4IIVA 1P0IA 2EF0A 2HPVA 4XQCA 4Z0TA 1T6YA 2G67A 1CRLA 3BEDA 4NABA 1I1NA 1KPIA 4LHYA 1S3SA 5AM4A 1JQDA 1RHUA 2PO7A 2XWQA 2OZLA 1P9NA 4N12A 5GVRA 4QUKA 4LYYA 3T52A 3ZJVA 2Q49A 2OHIA 3LLSA 5GJVC 3MTBA 3OTWA 3SEAA 4XFDA 4L0DA 4R83A 5IEJA 2QNIA 3MILA 4O2RA 4IDOA 1A5BB 5SZJA 1CY7A 2H54A 2Q07A 3CS3A 3EEIA 3IP1A 4FI3F 1DXQA 4GOLD 3C1UA 2YJ3A 4XIYA 1PR6A 4MWBA 1NUSA 1LB1B 4Q00A 4RY2A 2QD4A 4OHVA 2DX7A 3TTSA 2O8BB 3L6DA 4R3UC 3MWEB 1U2QA 5DM4A 4ND8A 4ENSA 5JMPA 4RC9A 4URFA 1IOWA 2VK8A 4HVCA 4EO9A 3VU9B 5ICEA 3FDFA 5JV5A 4DUYB 1K2VN 1MEJA 1WQ4A 4Q39A 1XWIA 3RGGA 3D81A 4JGBA 1ZXBA 4P92A 1G9XA 2WHPB 4G97A 3REQB 5BN1A 4HMOA 2VJLA 5DNYB 2Q1WA 4MGEA 1DT5A 1CE8B 4AO8A 5D86A 1I4WA 3O4JA 3WL4A 1NY5A 1PG5A 3WMWA 2PX5A 1UBLS 5JXJA 4GP7A 1FXUA 1ZKDA 4JLKA 3HYNA 4OEHA 2WDPA 2NVWA 3HP7A 4JYBA 3ER8A 4PX3A 2A2ZA 1Q19A 1JQ5A 3YASA 3ZOZA 4M60A 1M75A 2RHTA 3ZXSA 3EW7A 4CQLB 2ZULA 7AT1A 3HBNA 3WKEA 4UAUA 1G3UA 1W87A 3MBOA 3N76A 3LKVA 3U1TA 5BWOA 1NQUA 2V7PA 3WLOA 4BIIA 5DLEA 4P81A 3EUAA 1ZGZA 1G3MA 4GZLA 2FW1A 2O8EA 6REQA 1U7HA 3H8SA 1XDWA 2CXTA 4D4KA 3KJIA 2YHSA 4KO3S 1FFXA 4Z9XA 3W6UA 1L7AA 4LYHA 4M83A 4BFLA 3ABSB 3IP5A 4IIBA 1CUJA 1NN0A 5KJ6A 1J07A 3N53A 2XX3A 3TDNA 4PM4A 4FE4A 5DYGA 1EFHA 1VXOA 2OHJA 1VJCA 1H94A 1VOTA 2HBYA 3MTQA 4QD3A 1JJVA 1EFVA 1MC5A 1DG3A 1Z5VA 3ASYA 1C8BA 1MG0A 2Z9CA 3DAFA 3IHTA 3ODGA 4U63A 4BFVA 4BMOB 5FBVB 1EIWA 5ALZA 4QQ8A 4GL2A 1Y7IA 2B1RA 2BKEA 5G1OA 3U5TA 2NX2A 4L5AA 4X1KA 2OFXA 2IT1A 2HIGA 2NV0A 3ADKA 1WD5A 1GNSA 1P1FA 4EH1A 1FRNA 5EJ2A 1O9GA 4GQAA 4RABA 5D3ZA 4MW2A 3HA3A 1IHUA 4DCPA 2MR6A 2J3DA 2R8PA 1QTRA 1T26A 2RBGA 2LGJA 3VA7A 3OM1A 3HKEA 4PIVA 5BMVA 1N2GA 2CVFA 2WT4A 1J33A 3GVXA 3HZHA 2WEKA 3QUTA 3UFXB 3KXIA 3EK2A 2XMZA 2P90A 2YICA 3EDYA 1RHQA 4OUDB 4QHTA 4HN4B 2D1FA 2BFOA 3IXQA 3SXJA 1S4MA 2GHIA 1NVMB 1YI1A 4BNVA 2YFQA 4FT4A 4N3BA 3WMEA 4BBJA 1JAXA 5KOJA 3OCJA 3OWHA 2FRXA 1NAIA 1RKXA 1Z5WA 4NDNE 3THXA 5CVTA 2IJGX 5FHRA 4DV1B 4BX0A 4EI9A 1G4UR 3IODA 1V3QE 1DBSA 1C8KA 2M6RA 2Q7OE 2C78A 4BMPB 3H9QA 4NQRA 5IFLA 1TJ4A 4N40A 4FHGA 2ZRPA 3CH6A 3E9CA 1AGYA 1GT91 2PWAA 2VHCA 3CNBA 5BRNA 4C87A 1XQVA 1PJZA 1XVUA 1P6XA 3GVPA 1KZ1A 4QUAA 1DC3A 1O6GA 3UJBA 3ZI7A 4CKWB 1U0NA 5I9IA 5CCBA 4R2HA 4HDNB 2PGNA 2AC7A 1WHSB 4TT3A 3HUTA 2CLIB 1MTZA 4JBLA 4XX0B 3PNQA 3UB2A 1YVPA 3O93A 5JPDA 3EB9A 3FLAA 3T7TA 4TRRA 3JQ9A 4IH1A 4J3JA 2ICAA 1R4AA 4P58A 3WQBA 1V5IA 4F3CA 3CVYA 3W9BA 1YZYA 1PT8A 2NVBA 1HDYA 2OO3A 4OB8A 1YR7A 4DA6A 5ECDA 1MRZA 1L5SA 1NURA 1V26A 1ZUHA 3CLVA 1WA5A 3F4KA 4K6FA 5E8RA 3AVOA 3E9NA 1FZQA 3I9OA 4JLPA 5ECYA 3AL2A 2XVMA 3KQWA 3WQSB 5D2CA 3AVUA 1ZN9A 2XTNA 2YZ7A 1XZNA 1FDRA 1W8IA 1U0HC 1VRCA 1UK9A 4X00A 3DPUA 1GRCA 1N1MA 5IAOA 5KNCH 2P30A 1IH8A 3KB6A 2WAAA 4MV3A 4P3NA 3WFJA 4HLQB 3AR3A 5JSZB 5F73A 3N87A 3F5FA 4O2AF 5HHTA 3GT4A 5LUAA 2VZEA 1IUPA 1UZMA 5E7QA 5CDSA 3VC1A 3GLFE 3X1MA 4EGQA 1CB0A 4KIUA 4DDTA 1D0IA 2XMGA 1ZUIA 2GLXA 1SOWA 1ATIA 4PXSA 4XARA 1UKVY 1J0DA 4B7CA 4WFQA 5CW1A 2J3JA 1JBEA 3DMNA 2ZDQA 3OWXA 5DYTA 1KDVA 3SLGA 3TKYA 4URVR 4RDXA 2X77A 1L6IA 4Z0PA 3BMNB 1SKQA 4KLCA 1JALA 2PZFA 2Q9CA 3S5JA 2Q1SA 1A1SA 1CT9A 2VN8A 5CNMA 1I2AA 1N75A 1W1UA 4BY9E 3V4RA 2P1ZA 3AKEA 1QP8A 1E2FA 2CK3D 3FTDA 4NBTA 4R8LA 4J49A 5DN9A 3RANA 3O7MA 3A3PA 4YGYA 3ZX4A 4B7UA 4TGLA 4YMUA 1O6FA 5ILQA 4EYKA 4MKXA 1YNSA 2QL5A 4AJJA 1B4DA 3LUAA 3S27A 4RM2A 1OXVA 5IAJA 4D9HA 5IN4A 2NV2B 1CETA 1JKMA 2TRSB 3PUJA 4Y1FA 2Q62A 5CT8A 1Y89A 2IPOA 2WHRA 1HYQA 3ZHQA 2EBHX 2GK3A 5C1BA 1U7TA 1XEWX 4MR7A 4F86A 3BE8A 3VR5H 4OKIA 2JA2A 3RV4A 1R6DA 4E7PA 1OKKA 2JLBA 4PWYA 4XWGA 3L7KA 4AU1A 4R1UA 2M1ZA 4KXUA 2APJA 2GXUA 2X0JA 2C7BA 3I5MA 3NWJA 4HDAA 4QBFA 1VMKA 3U4GA 1HT0A 3U39A 5KDOA 2O8FB 2WJIA 5JECA 5BW8A 3P27A 1IN6A 5TXGA 4CHTA 1TCAA 3W5CA 5B1IA 3ULKA 4Q48A 1YULA 1WUJS 1Z0UA 2C5BA 2H4WA 2PQ6A 2IWRA 2DKNA 3IQZA 1XRNA 3LH5A 4NZPA 1QMPA 2VLBA 2W37A 2JLQA 2R8ZA 5CB0A 4LV6A 3FZYA 3FMOB 1L7DA 2Z8XA 1VLZA 4HDKB 4O1IA 4Y2HA 3CX3A 5BNWA 1LPNA 3ZH2A 2AH5A 4ON9A 3M9LA 3DLBA 4WCFB 4PYKA 2PWYA 4YP5A 2IXEA 2GT1A 3MGKA 5MN4A 1U8AA 3LWDA 1S02A 2J0UB 2QTZA 3BCRA 2QRPA 3MAAC 5K51A 4PX9A 2EQ5A 2XRFA 1WV1A 4OGKA 4AJ9A 4XGNA 4NJEA 1H2ZA 5GM1A 2W6JA 4RVCA 4ZK2A 1FS4A 2PSFA 1E32A 3R23A 3ORSA 1JGTA 2HQSA 3Q72A 2BGMA 1P5ZB 2GESA 1P2SA 3I2YX 2YKGA 3FYUC 5DYNA 1DAIA 1EFPB 1MVOA 2MYPA 1NNI1 4G0YA 1NY6A 3W05A 5LSAA 3STHA 1V11A 2O2DA 4NBWA 2D5CA 1AQ6A 2ERXA 3WLAA 4BZXA 1N0UA 1OIXA 4LW8A 1Y4AE 4WLFA 3Q0EA 1Q0ZA 1X7HA 4GVPA 4DQVA 1DQPA 3W6ZA 1NBIA 1WVMA 5E4FA 2RGWA 5L3QA 2C1ZA 3PDIA 3M9XA 4Q4JA 4PIMA 4WESB 1CHNA 4P22A 3RIYA 4XSGA 1A98A 3C6XA 3DYBA 1P2TA 3A0UA 2XNSA 1OOEA 5IZCC 4HXGA 2CNDA 4WVFA 3LWBA 1W5AA 3R0VA 1S5PA 3NEAA 1Q6YA 2W2LA 1YCFA 4P4UA 1DHTA 1IIBA 3QW2A 1EJ2A 4L9SA 5EERA 4CKXA 1NUUA 2ZDGA 1PYDA 2P27A 3BREA 2X6QA 1DWUA 2K2WA 2ZIVB 1DUSA 1RBZA 1K3FA 5JSHA 5G3ZA 4CQNA 2GA9A 2D6FA 4WLNA 1PDOA 3U4QA 1IJKA 5G1PA 1XSEA 1ZG3A 4B4OA 3KYIB 2Q6TA 2XNDD 4O8ZA 3GRUA 5FA6A 2DKFA 1FP7A 5EINA 3F98A 4GT1A 5IRCD 1I7LA 1T9DA 1B1AA 2GTHA 3DFZA 3DF7A 4IJKA 4PF1A 5DHUA 4V02A 3HKBB 4L8WB 3U7IA 1ACLA 5B1SA 4WWHA 5EJEA 4RTNA 2V6GA 4R4JA 4GSKA 3NANA 3ZZTA 2CV2A 3PWTA 2FJUA 2OXTA 3ZIUA 1YB6A 3HC7A 3QMPA 2B34A 1JT9A 4GP6A 4KHPB 2F9MA 1SEVA 4W9RA 2VATA 4GBGA 1GPMA 4BASA 3WFIA 4P3OA 3RTCA 4NMHA 3D8SA 1BEZA 1SELA 3PX3A 1CUUA 2ZREA 1KGDA 2NSHA 2Q2QA 2V7XA 4OHKA 4N1AA 2PKEA 1M7GA 4A6EA 1KK2A 2QTVB 3K32A 3UUFA 3R7LA 4RANA 4E1AA 4TKVA 3T9EA 1MAWA 3LDGA 4O2LA 5CYFA 1D07A 4ZVUA 1PNVA 3UJDA 2VRCD 2YXEA 2DQKA 2UU9B 2Q4BA 2QUKA 1JG7A 1QTNA 3NV9A 1TTPB 1U3UA 3AFOA 13PKA 1NOIA 2FRDA 4GVLA 4I4TB 4DA7A 1OE0A 4ALNA 3A2MA 3GRRA 4WUTA 3HXMA 1GQSA 4ZYWA 4WZAB 4RCYA 4HAVA 3ETGA 4NK4A 1ZM3A 3GFRA 5KTOA 1Z4OA 2H85A 4J4BA 1EP9A 1HDOA 2DFTA 1TKBA 1ZU4A 3TRHA 4CF3A 2C20A 1PFQA 3HB9A 3N58A 4OGGA 3KSZO 1HYBA 3EXEA 3V4ZA 4JZKA 1PTKA 2FEXA 2WF9A 1ONPA 2A5YB 3R3ZA 4MI9A 4U2DA 4TN1A 3DZDA 3ZDAA 2FY8A 4OHXA 5AJYA 3MUEA 4RHUA 1RFGE 1WXDA 2J07A 1GSAA 1RXVA 4R6WA 1CEEA 3D0QA 3CT4A 1VZ3A 2VJOA 4YRJA 4Q4HB 2Q5FA 1NJ8A 4RPHA 3GUUA 4IIFA 4X95A 2V45A 4CKCB 4R05A 3A25A 5E7JA 1EDOA 6ADHA 5L6LB 2MU1A 2AI2A 2HA7A 2QRLA 4YCDA 1QIGA 3CMCO 1RPNA 4FK8A 1OX4B 2AR9A 5IUJC 1PR1A 1GCOA 4BVFA 3TX2A 5TF4A 3WGZA 4GOJA 3ZV4A 4BGVA 5J59A 4E14A 1GZ6A 1P2VA 3TG8A 3OOSA 5AUOB 3SKXA 4WXYB 4N47A 3AJ9A 4IIXA 4N7JA 3B36A 4DA0A 2AV6A 4JEIA 3TTYA 3FETA 1RQLA 1KZGB 3WBJA 5CH5A 4KMRA 5JARA 4ZT6A 3A1UA 5KUTA 3RSZA 3K70B 1CPYA 3H5NA 1Y1TA 3L1JA 1SKMA 3TMAA 2B99A 2ZQYA 2IH5A 4P7KA 3DT9A 5LFAA 5EEHA 3PE3A 1YL7A 4JBIA 2HJSA 4UHCA 4BNXA 3OEHD 5JSKA 1PGNA 4IFBA 1UMCB 1OX5A 1GG5A 3RSLA 4E2ZA 4LZWA 5A9SB 2PJUA 1ICIA 2WW8A 3ST7A 2QXYA 2HCBA 2V97A 1ONBA 3P9XA 3LO5A 4RZHA 1UZAA 2JB9A 2Z1NA 5FWXB 1CR1A 1CK4A 4U1RA 3W2EA 4DPKA 1UH5A 4B76A 3VH2A 1NVDA 4G1FA 2QMQA 1XNGA 2EWVA 3DVSX 4KPEC 3KZOA 3HFGA 3P0JA 1W36D 1GUYA 5BQ5A 2QZSA 3A1FA 2JLWA 3ADOA 2CMDA 2DQ4A 2JFOA 3KJXA 3PXDA 3IR6A 5EYPB 821PA 1R0CA 4DMFA 3DTVD 4BVHA 3IH5A 3H75A 3GRZA 2GF9A 4C03A 1E3JA 3MMNA 4LNHA 1YMVA 2LCQA 4CG1A 1T1JA 4I9HA 4P2GA 2EIHA 4DRXB 2D13A 3DMGA 1HDCA 3ORYA 3QLVA 5FA8A 4KWCA 3E7XA 1EFKA 3KE8A 1NVKA 2IA5A 2W6ID 3H8WA 3H9EO 1Z4NA 3VPXA 4D0NA 3GW8A 4H4EA 4AJOA 4P53A 5GJWC 1YJAA 2QLLA 2P91A 3PFKA 5A4AA 3JYQA 1YAHA 5E4JA 1PIWA 1E7MA 3QKUA 4QTXA 5SZHB 2B4AA 3P9IA 5LLDA 4U2KA 4QT4A 1Z8DA 3ND6A 4JA2A 5LB2A 1IZ7A 3LQYA 5H02A 4N7BA 1QZTA 2CBXA 1GAQA 2X42A 2VSQA 1BS2A 4LC1A 1MABA 1AVTA 2YWXA 4OQPA 2QTFA 3C5HA 4QXRA 5JSQA 1K0FA 1KEEA 3UMGA 2NXJA 3W2FA 1M73E 4NZYA 4RKQA 1TJNA 5BXYA 2C7VA 3S2SA 3DQPA 1EVIA 3IMKA 5KYKA 1RQRA 3I9JA 4FYVA 3WXBA 1GCAA 2VUSA 1ZU5A 2YY5A 5ALIA 1E0SA 4ZAGA 4TROA 1WKBA 5ADWA 4P93A 3D3WB 3MM4A 1T8PA 3N2GA 5G0VA 4K8RB 4B83A 1SM4A 3HXKA 2M6KA 1ZBQA 1D1QA 1JEJA 5CB4F 1G66A 5KCZA 2Y1EA 4PAOA 3QU7A 3DOCA 4MUJA 5KSOA 4I5FA 3WK5A 3QTTA 2P67A 3NX4A 2UXCB 1RYDA 4JQYA 5LQDA 1GFWA 1FFAA 3E48A 4PN3A 5LMZA 4V2UA 1VRWA 3DMYA 2O2XA 3L18A 2X9VA 4PAWA 4W7HA 4ZAFA 3VZRA 1HT2E 2FZLA 1JHXA 2XRYA 3NHJA 3UVEA 3ZV6A 3KKZA 1E7QA 4QBHA 1NUQA 3N6XA 2WWWA 3QJYA 4FCWA 1GD1O 1PLJA 1YAJA 4KAFA 5EHQA 1LNSA 1Q2UA 4MYUA 3E03A 3UXHA 3KZVA 3PEVA 5DN6D 2ZPUA 3CLRD 5AI5A 3F6YA 4MQMA 3S70A 3GRVA 4HUJA 2PXXA 1GZDA 2MYNA 3LU1A 4WA8A 1PFWA 3TLGB 1YR3A 2YJGA 2EX4A 3ZW7A 5BP7A 1TQ8A 4AY4A 5B58T 4C2BA 2PT5A 5FFMA 3R5HA 3OPYA 4HGOA 2NNWB 4EVIA 1R2QA 3P9NA 3CF4G 4LHVA 2P2YA 3BHMA 1SKUA 1RZ3A 2ZS7A 5DEOA 3UJCA 1MO2A 2FPPA 2PUTA 2AGVA 2XSZA 1QSGA 1Y3AA 3SR3A 4N7RA 1QAMA 4RJLA 3V4LA 3LK7A 2UZ4A 3BAFA 4XM0A 3UAZA 4ZMSA 2RAVA 2K7FA 3CISA 3W5DA 4YRGA 4G4IA 3H11B 1QIDA 4ZEMA 4BAZA 3NWOA 2IVFA 2KYRA 3Q40A 4PEVA 2PFSA 5D5QA 2VDNB 1GIAA 1H5QA 1KZHA 1CULC 3ONNA 5JRJA 2CJWB 1Z4IA 3IEIA 3AILA 4Q3BA 3SQNA 5BNIA 1U3CA 2HIHA 3GX1A 4J1TA 4LJ7A 2A59A 1N6KA 2PMKA 3WK9A 2PUDA 4OI0A 4JLAA 4EJSA 1AGPA 2FDCA 2GPBA 5DGXA 4URXR 3NMUF 2WJGA 1WUKS 3ICPA 4RZ2A 4DARA 1XLWA 2MINB 5HYVA 4P80A 4CETA 2E7ZA 4WCFC 4CLRB 3VR3D 5F7OA 1HTTA 2D8AA 3DMTC 1XLTC 2BHRA 3IRUA 1VLVA 3VSDA 5HP4A 2ET6A 1OLSA 4Q18A 1SG9A 2DR2A 1HUQA 2I0FA 2RI0A 3Q8MA 1XVLA 1PCXA 3B7GA 1FOEB 1XMVA 4NR0A 3SI7A 3VR0A 4MLDA 1JMYA 1HG1A 3BSYA 3MIIA 5AFSA 4YCLA 1CR0A 3SAJA 1YI8A 1NE2A 1E1LA 1JR6A 3FRIA 1ZRSA 2O50A 2JIZA 1XKTA 1JZSA 1X15A 2ANCA 2HOQA 3GJSA 3OPQA 2WYIA 2VWPA 1KDRA 5EPUA 1KDYA 4BLSA 3C87A 4U02A 3PA8A 2HMUA 3QIVA 3AM4A 5CLIA 4L6AA 1WU8A 5ANRB 1UM9A 2OENG 1OFGA 2R6GA 1U0TA 2FR8A 2PMBA 4GFDA 4J3FA 4P4SB 4YV0A 5EIXA 3MJEA 5AVTA 1KQPA 1AKEA 1ENOA 2TMKA 5AJZA 5DMHA 3ADBA 3EQ8A 1CJVC 1Y7PA 2GYYA 1XCLA 5G0UA 3KR2A 3OCZA 2XF8A 1LRLA 3HJTA 5EGSA 1T0PA 2ZAIA 5A9RA 3U80A 3CNOA 4HATA 1RXYA 1XO1A 4M1ZA 5IW8A 2XB4A 1ZUD1 4JB3A 3KZNA 3T3DA 1MLDA 4HK4A 2FPMA 3SC2A 2QD2A 3B89A 1A8QA 4UHBA 1A4RA 1HOXA 2YMMA 4UTRA 1J6UA 4UHFA 1K7XB 1PTJA 5AXAA 4DGSA 3U1BA 4YJGB 2VWQA 4DOMA 1FDSA 1DC7A 1TD9A 3SFVA 4U6QA 4DYVA 1M2OA 5JBNA 4UASA 3RWMB 3G0IA 3R7FA 4BCCA 3ZCUA 3RT9A 1SCKA 1LW7A 2ZRBA 1DXHA 3MWKA 3OCVA 3PIRA 5DX8A 4DR3B 1G42A 1PSWA 3ORHA 1MIHA 2JLUA 3RSSA 4MJ7A 5FWDA 4RHXA 4TV9B 5J9FA 1VBNA 1E58A 4BGEA 3WGVA 4WXHA 4PX2A 5EWJB 5EHXA 3L5OA 2YYAA 3AFGA 3NIBA 1C3JA 2W2QA 4IO0A 1DUVG 4MYDA 4ESVA 4RGBA 2NU7B 3M6IA 3BGDA 5HIMA 4UBJA 3WNBA 5F3DA 1U81A 1XV5A 4N49A 3TD2A 4B45A 1Z6QA 1W0JD 3R9WA 4DVGA 1B8OA 3NHLA 2NZ2A 4CHGA 4HWKA 4WFKA 1Z16A 1ZESA 3A1NA 2JGDB 4TL7A 4U7FA 1EESA 3B6MA 1BMDA 2WG2A 3OZFA 1S8OA 1PVVA 3MSXA 4MDEA 1RJDA 4XZ3A 4KQIA 1L7OA 2I4RA 2WRZA 4WXPA 4B3TB 3RU9A 5HZHA 1E7WA 1V7CA 2CHQA 1VIYA 4GKVA 2Q50A 4Q4LA 1J25A 2V4ZA 4FBLA 5E38A 4TLMB 1UODA 4ZV4A 2FUG1 3G88A 2VH5R 1Z3IX 3GZNA 3PL5A 3IBYA 3PGKA 4HNQA 5DBIA 1O9HA 4YAJA 3AZQA 3FZGA 4AF6A 1VLQA 3CVJA 3GLSA 4DYHA 4PQRA 4JD5A 2JRLA 2GILA 1GTL1 1OZGA 2GN1A 1H6DA 1NOJA 1U8TA 1VGQA 2EARA 2Y77A 1RJ9B 5E2IA 1UKZA 3FROA 2EWMA 3HP1A 4IY1A 1QU3A 1Z6PA 1F1JA 4LTMA 4QGGA 4RADA 5FAXA 1DJPA 1DC8A 4QECA 5DHTA 3FUCA 3QXGA 4S1TA 1PGOA 2PUFA 2FV8A 4MKGA 1BMFA 3PE4A 3K73O 5JG7A 4QXMA 4HWGA 3IP9A 2CYAA 3TIIA 2C2HA 3DL0A 1X1DA 3HSSA 3IPYA 1NW9B 3O8RA 1BEUB 5C8ZA 2P6MA 2BH2A 1H2FA 2O2YA 4J2HA 2R68A 2ZI5A 2IHYA 3T99A 2IZ1A 4WBNA 3FWKA 2A9OA 1W88A 2WJAA 4YJHB 4ROTA 4IEIA 2XD9A 5ALDA 3BK1A 1L7MA 1QQ5A 2IHKA 3PDJA 3R40A 5CMLA 3LVRE 3M6LA 2FMHA 3H2GA 2CLSA 4Y6QA 4YIKA 5JSYA 1YJ8A 3E0QA 4KFRA 4LXTA 3DCNA 4LN1A 1E92A 2B61A 2CNBA 2YYSA 5CLLA 1T3LA 3RU2A 1DXOA 1Y1RA 2RJNA 3OLQA 2CLDX 3MW8A 4W63A 2YWFA 1D09A 2PX6A 1XPUA 2WTXA 4LOLA 4P5PA 2AOUB 4Z7QB 2PUJA 4TQGA 5BXQC 3CSUA 3N6RA 4YJ2B 2BEVB 2OFFA 1T8YA 4JDPA 2PL9A 4JLJA 4D42A 2ZU0C 2VDWB 4MVJA 4I7EA 1EP2B 3EZ6A 3A4MA 4O0LA 4G8DA 5H82A 4LDJA 2QU7A 2VDKB 2QT1A 3ZZ0A 4JBNA 2WP0A 2ZWVA 1MVLA 3OOYA 4RGYA 3TO5A 2QTLA 2XZTA 2KW5A 4ETNA 1CQXA 1KMHA 5FDFA 3BHNA 2E4ZA 2QR3A 2A1IA 3K0AA 2OXEA 5AK6A 4WSOA 1ZI6A 3KKNA 2AX4A 1DQNA 3R3XA 5FP0A 3RVRA 3AHCA 4FKZA 3L07A 5H80A 2IUUA 4KVZA 5M3BA 1PR4A 3RBZA 4Q9IA 3EODA 2G0TA 4Y9DA 1ZP6A 1CCWA 3QFSA 2GCOA 4W5RA 3WRYA 1MAUA 3SJ7A 3LFTA 3NG1A 3KSDO 2RGYA 3LVBA 1P60A 2EG5A 4R2MA 4A6XA 4X5OA 4ZN6A 5FUVA 3UOAB 1OVMA 1V95A 1CUHA 1P3DA 3V2GA 1U3TA 1DEOA 4DUGD 3QH4A 1T6XA 2CB9A 4FFDA 1J7KA 4PLGA 4H3KB 1NN5A 4A92A 1Z4QA 1GPNA 2H1VA 3E5NA 1SRRA 3PYMA 3ZVLA 1IM8A 4J1QA 5DNEA 3ICEA 2HNKA 4R1NA 5FJJA 5I7SA 5EE3A 2JI9A 5EUCA 2PAAA 1SKBA 4OFWA 4BPRA 1F7VA 1LVUA 1L5HA 2H1IA 4BVEA 5B6PA 3ZWXA 3AEZA 1BS9A 5J47A 3Q0TA 3BRWD 5C18A 2NTEA 3L8FA 3M2PA 3PXBA 3TEJA 3VAYA 4Q4AA 4BFWA 4J0DA 4FDVA 4OHFA 4E3ZA 4E6PA 5SY6A 3T0GA 1LLCA 3E8SA 3WLJA 3KOYA 1FMFA 3DAPA 1PWXA 1BGWA 5CXQA 1GKIA 4Z9FA 2VP4A 1CUVA 4KPUA 4WTOA 4DEVA 1A9RA 4IXWA 4JVOA 2E48A 1I3KA 3QVVA 4KBYA 4EY7A 4CKZA 3IERA 4IKPA 1W94A 1A5ZA 3RC2A 4X61A 2OXIA 3WP0A 4LIPD 1CQWA 2RCYA 3BGIA 1XD2B 4KG7A 2NG1A 1RLUA 2RK6A 2UV8A 1KR5A 2JGLA 1UXHA 3JTEA 2IPLA 4JITA 4XPIB 2ID4A 4AWXA 1E1YA 4Z4CA 4QM7A 5B7QA 2W2NA 2B2NA 1K89A 4QT0A 2R6HA 2ACKA 5J2TB 4PPGA 3SFZA 5JCOA 2JFBA 1OZAA 2BBTA 3G2JA 1A9TA 4BECA 4DC9A 1WLYA 1X7WA 3WYCA 1B6SA 4KO8A 3WOHA 3ESZA 5HA5A 4DV2B 1R8XA 2RC5A 3TR0A 3HVJA 4TTPA 1EFRA 4RENA 1NW4A 4MW0A 2ID8A 2VXOA 1RBYA 5GONB 1YFJA 2X0KA 5AXBA 1EGMB 1JHQA 3ESCA 2VUUA 1U8FO 3L7JA 3KR0A 2NO9A 3H4MA 1P7ZA 1LEHA 3PDCA 2W58A 2FPSA 4CR8A 1R8QA 1GSHA 4UU8A 5ALRA 4CQMA 1GPBA 1UQTA 2BFCB 3NPMA 1QCYA 4YLEA 1UOQA 3G0GA 5EEGA 1KKUA 3W9SA 4QUIA 3CH7A 3AO0B 4MA5A 2IODA 5IUKC 3OIDA 3AIOA 2HLHA 4JLWA 3I6YA 4QOIA 1E4EA 1OWNA 1MP0A 2YFYA 1VPDA 4IBOA 4UAVA 2OWEA 3CNQS 3FFAA 3MZ0A 1JIIA 4KAXA 3RUPA 2VXBA 4U4AA 1MV5A 2B3TA 1PJSA 1X92A 2DGDA 4DJFC 1FE8A 4Z2AA 1RD4A 1XZFA 3AZOA 4X71A 4ENWA 5DI3A 5IKXA 1I9GA 3K6KA 4QASA 3JZDA 4ZC1A 2A84A 4RGQA 4TM8A 4ERNA 4MYHA 4WVLA 1ODCA 3UAVA 2AQIA 3GZJA 5DW3A 4FGJA 5I9NA 2G4CA 3G1UA 3MLEA 3EA5A 2PSEA 3NGLA 2Y6UA 4QATA 3TUZC 1VP3A 2R8RA 4EZEA 1R10A 4EG7A 1F06A 3C45A 4Q5IA 4N0MA 2CZGA 3LPCA 1XCBA 2GQ0A 1GNPA 1O5TA 1F5SA 2WM8A 2ZYSA 1Y9AA 4QDJA 3AHGA 4QYMA 3RVBA 1NJ5A 1E7SA 3LF1A 1N6LA 4B7ZA 4BJ3A 5HK9A 3B1WA 5LKAA 4M8NE 3B5JA 4PTLA 3E2PA 1ESZA 3RTGA 2FDXA 1XCPA 4RGVA 3VGJA 2J9ZB 2QZ9A 3M34A 4QU0A 4L75A 5HQTA 5EVJA 5EZ5A 3IIKA 1FNMA 3THOA 3REFA 3H1FA 1MG5A 4H59A 5F7XA 3SYRA 3CNHA 4Z1MA 1X1QA 5GJCA 5IJ9A 4JR2A 3OHSX 4XVUA 3BDIA 3CLUC 1XCOA 4C6RA 1ODFA 3MXTA 2YJZA 3NTVA 4FHEA 5FLEX 1U3VA 1G8AA 1GPKA 5AVKA 1XRLA 2BMWA 2VAWA 1W96A 1YS2X 2QEQA 1HDGO 1UFVA 2QZJA 1D6NA 1V4NA 1XTBA 3DTVB 1WDMA 2WIBA 5G40A 3WR5A 4AJ1A 3PRYA 1ZVQA 2Z2XA 3BTSA 4DZRA 3MWLA 1T2AA 3A9CA 1W0CA 3Q9UA 4JB0A 5CCDA 1BJKA 5E4YA 1E4OA 2VYCA 1FLDA 3AY3A 3EA0A 4P7JA 3JWGA 4G6ZA 4I5IA 3QHQA 2EC5A 4YMSA 3HXPA 2I6TA 3QVUA 4JJGA 5JCJD 1HE3A 2QUJA 1PS0A 1UZUA 4C3ZA 3DV0B 5DDIP 5TVKA 1H4VB 1RKBA 3IVCA 3QYAA 4D92A 2BFBA 1YQUA 5IBCA 3I9LA 3KZMA 1ZQ1A 2BFNA 4X85A 1XA0A 3UWDA 5CFNA 2BEKA 1IN5A 1V9SA 4K7JA 4LOJA 3THWB 1ZOPA 1ZW6A 2JLYA 1FYEA 1WOMA 3H65A 2QY6A 4HZUB 4JHLA 2C2OA 4L08A 4DLLA 3AJDA 4L8VA 2R9VA 1VCMA 3LY7A 3IJ5A 1VDMA 3EZLA 4JEMA 1CZKA 1TI7A 4MO2A 2RKBA 2ZQZA 5LA6F 4A7PA 4R84A 2PCLA 3WGYA 5LZ4A 3NWBA 2PX0A 4E5DA 2X0DA 4A8JB 1QYXA 1O5IA 2FZ5A 4US1R 4ZO6A 2AOVA 4E33A 3LGXA 5CDUA 1FS6A 2X8WA 3Q9SA 4OLJA 1C9KA 5E6UB 3ZDCA 3GH1A 4HN9A 5BSHA 4PQYA 5EQTA 3O1IC 2X1LA 5K8UA 4D9IA 1GUAA 1C0IA 3JAKA 1CUZA 2JLCA 3Q8XB 3CE6A 3S1LA 2AUTA 2A0UA 4A0HA 4U6NA 1WXEA 3TAUA 3TM5A 4OI1A 4IJQA 3FSRA 3CF4A 4FN5A 1SULA 4HT3B 5JPIA 1Z0DA 5EJ6A 1TEVA 3NBXX 3UA3A 5B7GA 3WKAA 4MUGA 5C1DA 4CPDA 1N5LA 2G72A 5GP1A 2JK0A 3ZU4A 3CWZA 4CW7A 5J4LA 2EQAA 3ZVKA 5CFPA 3W4JA 2C00A 1BXGA 1E99A 4EKDA 3A9VA 4BMDA 4MS4A 5PNTA 4R31A 1JQ3A 2YW9A 2UYQA 3IT0A 5CH8A 1J8VA 2PZBA 4B3MB 2R87A 3Q41A 3L0PA 2V3VA 4PTYA 4YA6A 3GWGA 5FLXA 3Q3EA 3RW9A 2W42A 3KFXA 4RVFA 5LYYA 1NJ1A 2ZYTX 4RQAA 4I0WB 1Z0KA 1SOUA 4TTTS 5BYBA 2YIMA 3H9CA 5J63A 3RYHA 1KDTA 1VKZA 1VL8A 2QRVA 4CZ2A 1KXJA 3X1JA 5EMLA 3UUGA 4PFSA 5EUBA 4PRYA 4GOND 1WUTA 3WYGA 4V1CA 4RTQA 3KHUA 1P1KA 3OE7A 3GN2A 1R9MA 1Y3CE 1A2KC 4U7HA 1XEFA 1GCUA 5I3ZA 2QGNA 1RLMA 5C8YA 3DBLB 3ZUGA 2B92A 2YJ5A 5JEEA 1C1HA 1E2PA 4JLOA 5G2OA 3MWDB 5IP5A 4K9NA 3WLHA 4G4SP 1OX6A 7ADHA 4KXWA 4BTVA 1NW3A 5DZSA 2QTCA 3FXAA 4FEAA 5BSMA 3A06A 2HRBA 1NXSA 2D1RA 2VHZA 3OUTA 7GPBA 1W4CA 2K5UA 1RMQA 2V9PA 1JFVA 5B53A 2Q4OA