1TZBA

Crystal structure of native phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
301
structure length
301
Chain Sequence
SQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLYISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDGLLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQMGVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPEGLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEFNENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEHQERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLAEIRGVNPLATPRIDALKRRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel phosphoglucose/phosphomannose isomease from the crenarchaeon Pyrobaculum aerophilum is a member of the PGI superfamily: structural evidence at 1.16 A resolution
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Isomerase
molecule keywords glucose-6-phosphate isomerase, conjectural
total genus 113
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10432 bact-PGI_C Bacterial phospho-glucose isomerase C-terminal SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1tzbA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1tzbA02
4LF6B 2UXBB 3OTOB 2VF5X 4LFCB 2PGIA 1JEOA 2ZM6B 3BJZA 3FKJA 2V4MA 1VI5A 2X3YA 1MOSA 3FXAA 1JXAA 1G98A 3CVJA 1GZDA 1X94A 1TZCA 2I2WA 1TZBA 2O2DA 4X66B 4OX9B 3T1YB 2I22A 4JYAB 2CXQA 4S1WA 1HOXA 4NXNB 2O2CA 3Q88A 4JI0B 1C7QA 4LZJA 4X62B 1J5EB 1MORA 2CXUA 3PR3A 1DQRA 4DR4B 3HBAA 1JLHA 2CXPA 4DV5B 4JI8B 1TK9A 1XTBA 2VF4X 2UXCB 2CXOA 2PUTA 3OOJA 3UJHA 4X65B 4M0DA 2UXDB 4AQYB 4JI4B 4DV2B 1U0EA 4LF7B 2CXSA 3HJBA 4YY3B 3LJKA 3J80A 1HR0B 1XNQB 5A2QA 3JAMA 4LFBB 4IVNA 2UU9B 2F4VB 4B3SB 2PUWA 4KHPB 2HHHB 3QKIA 4LF9B 4YHHB 2DECA 2J6HA 1XNRB 3I0ZA 2CXRA 1C7RA 2ZJ4A 4GKKB 4LF5B 4JI2B 3ODPA 2DF8A 4TOIA 2CXNA 1IRIA 5LMNB 1X9IA 1NRIA 1X9HA 2YVAA 3BCHA 3TBFA 3FJ1A 2XHZA 4JI6B 1XMOB 4LF4B 3NBUA 2POCA 3EUAA 4DR5B 4B3TB 5BY2A 2UUCB 3JX9A 1U0FA 3ETNA 4GKJB 4LFAB 4U6NA 4DR6B 3T1HB 1N36B 1X92A 3FF1A 3Q7IA 4JI1B 4JI3B 4DUYB 1IBMB 2VQEB 3M5PA 1Q50A 1VIVA 3SHOA 1N8TA 4JI7B 5I01A 1WIWA 4LF8B 1IBLB 4DR7B 1IATA 4S12A 1IBKB 2A3NA 4DV6B 3TRJA 1T10A 2CB0A 1GZVA 1M3SA 2UUBB 4DV7B 2PUVA 4DR2B 5BR8B 1I94B 1J5XA 3KNZA 4JV5B 2WU8A 1FJGB 3IFSA 4DR3B 4NXMB 1JIQA 3J7AC 4JI5B 4B3RB 1N33B 1HM5A 2E5FA 3J81A 4X64B 2CXTA 1HNZB 5IT9A 5LMUB 2E5LB 4DV0B 4AMVA 4B3MB 4K0KB 1HNWB 1KOJA 1ZZGA 2ZJ3A 5FLXA 1U0GA 1VIMA 2Q8NA 4DV4B 4DR1B 4DV1B 2VQFB 1VI6A 2AMLA 5LL6P 1HNXB 2XBLA 5IWAB 4DV3B 3G68A 2CVPA 1XMQB 1N34B 1B0ZA 4DUZB 1NUHA 2UUAB 4EM6A 3C3JA 1MOQA 1N32B
chains in the Genus database with same CATH superfamily
5IKPA 1TUBA 1K6XA 1QYIA 5FDFA 2GBGA 5EUCA 4DIBA 4KODA 3UCFA 1GT91 3DUFB 3FTNA 3L7AA 3IUJA 3CCCA 1YXMA 5KKNB 3KC2A 3QF4A 1DPGA 4DPMA 2PZEA 4MQEA 5AW1A 1W30A 3BH0A 4Z5XA 2UZ1A 5HE8A 2A0XA 2H9YA 3NS7A 2Z2IA 4QJ4A 5A4MS 5AI4A 4D96A 3T4UA 2EWMA 5A4AA 4JYAB 1P7VA 1SKUA 4I5DA 3UVEA 3R7LA 4DRZA 3GFBA 4FKZA 1WXXA 4YAFA 3RS4A 4B4VA 3HK2A 2YNMD 4ZRDA 4F92B 3UICA 4CUJA 1HY3A 4TX1A 3JYOA 5TQ2A 1N7GA 2K2QB 4IYJA 1OYVA 2ODAA 3P9QA 4FOLA 3Q7QA 4CT0A 3DLTA 4ALMA 1R9GA 1Z63A 2N46A 5KVSA 1XKQA 1WXHA 2ZRQA 4H6PA 1OB2A 4FXOA 3DAFA 3OF5A 3U3DA 1E4VA 3L4BA 3MWDA 3LSTA 4GPTA 4Q4HB 5K8LA 1OGJA 2ZQ5A 2QVZX 3KXKA 2YWJA 4JP3A 1OZGA 4HEHA 4LOKA 5I7EA 1NIJA 2FJ0A 1ZX1A 3V34A 1TE2A 2JGFA 2WTBA 1XNRB 4L0MA 2V7BA 1KZYC 3RIEA 4GOJA 5DN6A 4M1KA 4B0PA 4I1YA 4MRMB 2JLCA 1GDDA 2AFIB 4JP1A 3W06A 1P6XA 5C8XA 5KBYA 3EFHA 4FQ8A 4AFNA 4HT3B 5JSUA 3R0XA 3AUFA 1AS0A 2IY8A 4L5CA 1A5AB 4YV0A 4CKBA 2FE4A 4JFRA 9LDTA 2B5WA 3VHXB 4O4IB 4QXQA 3BBLA 4JWKA 2F8LA 3GDOA 5SYNA 2GN6A 2WFMA 1Y33E 2Z3ZA 1LC3A 3ABIA 2Z9BA 2Z1DA 3I2YX 1UM9A 1MC8A 3AMVA 3CZRA 3K96A 4W7SA 5FWAA 3L7OA 5EJ8A 3NORA 2UZ1B 2QX7A 2R2AA 3WK6A 4P31A 4PW0A 2HMSA 1CWUA 4PZEA 2RGWA 4X8HA 4HNSA 3LXMA 4WZZA 1U3UA 1A88A 2QQ5A 5C5DA 4DR7B 3DTVB 1MC5A 4A6DA 4YJHB 4ZC1A 2ONYA 2WWRA 3FVTA 2X4DA 5HKLA 5BR8B 2B4RO 5T67A 2RGXA 4OHVA 4YJFA 4MQLA 2HBQA 1JDNA 1NVWQ 3T0FA 4YRNA 3TXXA 1G20B 1XEWY 5JQGF 3O8CA 4KUHA 1OYOA 3DBIA 3KETA 3ANTA 1P2GA 3ERCA 4XD2A 1AZWA 1SU6A 4LV6A 4MZDA 1FDVA 2D0PB 3HP1A 3KJEA 3DLHA 4QUAA 2OYCA 1PUJA 1SJ9A 4B5LA 3Q40A 5C8YB 3M9XA 4ZYUA 1CUBA 2GZMA 4R3NA 1T6ZA 3ZVLA 2EZ8A 2XEXA 1PR9A 1QH9A 3LOUA 3C3AA 3SQWA 1R4ZA 4C2BA 3QX3A 3RTGA 1JTVA 3LY7A 4KLCA 3NRCA 1RVDA 1SM4A 4UUBA 3ZNQA 4BKOA 1MB2A 3DFFA 3L0SA 3A1EA 3MINB 4GS5A 4WXPA 4A8PA 3AUSA 1QZXA 2V8OA 1NF3A 3GV0A 2BEWA 3LG2A 3NFYA 5KOJB 2WTAA 3O1IC 2N47A 2XOEA 3GPDG 3QLUC 4XH9B 2VXOA 5C31A 5AHOA 1XLUA 3U39A 1BNCA 2FHPA 2ZB8A 1QRTA 1ZVKA 5GZ3A 1X19A 4ER7A 3KZMA 5KYYA 1VBNA 1WF3A 4J2HA 1QKJA 3K5WA 2ZRCA 5TPWA 4WBNB 3Q3VA 1EYZA 3LUDA 4MTCA 2JCBA 4F2WA 5AW4A 2W2QA 3ZHCA 1KPIA 1H1DA 3SM3A 3IA7A 5IT5A 2D2EA 3BGVA 3HKCA 2DR3A 1AKEA 1J8YF 2Y0BA 4HFMA 4UXIA 4DKJA 2VDMB 4KDEA 2IQIA 2OZKA 3A36A 3GZNB 5B1SA 3H2ZA 1PK7A 2IUEA 2R6ZA 1G55A 4DPLA 3QFRA 5DLDA 5BSKA 1NNEA 1C8KA 1ES9A 4CMHA 1EAYA 4OAPA 1AHIA 4X65B 2ZIUB 1XHFA 3DXZA 1NUAA 2NLOA 4UW9A 1WDTA 3Q2KA 3QVKA 3L06A 1F3OA 1FF9A 1KMHB 3KR2A 4RKWA 5FOQA 4K9OA 3NDPA 4FOSA 3B48A 2I8CA 2FN4A 4WXRA 3WL7A 2FEAA 1U9ZA 3U3MA 3GUCA 2PX4A 4EHLA 3DDOA 2RGEA 1M76A 4ZGWA 1ZAYA 1A5BB 4NYMQ 1SC4A 2EJTA 2FMKA 3GW8A 3HYSA 3RRFA 3V8EA 5I3CA 1FS5A 3FMVA 1W36D 4B2YA 1V11A 1X38A 4UMEA 5L3SA 1JHOA 3LXXA 1JAIA 1K0FA 1J23A 2OPBA 1SU8A 2YFQA 2DF8A 3IDAA 2IV2X 5KYVA 2O8NA 2QYTA 3CYFA 5SICE 5THQA 2FPUA 2QOEA 2H5IA 4R1MA 2AI2A 3OURA 4IIDA 4IXWA 2I87A 3LUFA 2NNWB 5CPFA 2PA3A 4JOBA 4BO4A 3ZJ4A 2JASA 5CJPA 4BP1A 3GD7A 1OWNA 3ELWA 1VLHA 3HLYA 4YUAA 1NV9A 1L4UA 4JQSA 2O3TA 2VTBB 3VNVA 2XZDA 4DBLC 1Z29A 1I7SB 1RQGA 1BVHA 1ZM9A 5EWJB 4ENPA 2J0UA 2X58A 4A27A 4C4RA 3BA1A 3QQ5A 5F5NA 3TH5A 1M2WA 2PKQP 3EZ6A 3ITKA 5F5LA 3WKEA 3OBBA 3NIWA 5NLLA 4BNYA 1TKCA 4CM4B 4F86A 4YVFA 4HLDA 2OD7A 2Z08A 3KSRA 5B30A 1JFTA 1UK6A 5IKEA 2JLVA 1LBIA 3LBAA 4U6QA 4PSVA 1GCOA 4GLFA 1YZNA 3VPFA 2PUVA 5L95A 4BIMA 1J5XA 5CDSA 2XIJA 2VUTA 4MYHA 2E87A 2ZOSA 1XZ8A 4C4YA 2C4WA 4PC2A 4X1YA 4HMOA 1FLAA 4HGNA 1SVOA 4KAFA 1HM5A 4Z4FA 3JD4A 5BXQC 2F1IA 1KF0A 1VKOA 4D4JA 2I7DA 3CF4A 4GR9A 1XD9A 3FDFA 1QIDA 5FTKA 1B6SA 2HLDA 3RVJA 5AJYA 2PWZA 3AUYA 3ER8A 3CRNA 3V7FA 2CE2X 1V26A 4LV8B 1P9RA 7AT1A 5CD1A 3NV7A 1ESZA 1XK6A 2C88A 2O52A 2Q8NA 3BWEA 1SEVA 4ESHA 2AGVA 3MWYW 1NBHA 2OG2A 1C2YA 1IB6A 1PD0A 3G68A 1XGKA 4KDFA 2YHUA 1KAMA 1UP7A 2PT7A 3F49S 3OQBA 3CB2A 5B1DA 1J42A 1P4GA 3H9GA 3TXAA 1DV1A 4XGKA 1KQ3A 3LPCA 1UKYA 2VNKA 1XNJA 3E05A 3NEAA 3NTUA 2XAUA 4IL5A 3COSA 4EZIA 1YH3A 2I7CA 1HE3A 3AEZA 5CIQA 4BMZA 2ZJ6A 4CEIA 4GGPA 1KDZA 4CM8A 1KO8A 3A8TA 5IASA 3NANA 2IS1A 4KB5A 4XYBA 1BC5A 2FEPA 1BKDR 3I30X 4OFBA 3K6JA 1GZDA 1HQKA 2XTZA 5GJCA 4AD8A 4ESEA 2QE7D 3VPAA 1NY6A 1KS2A 3P0FA 4JBNA 2GPWA 4A8TA 3TEMA 4PNEA 1Y9EA 2INGX 4YJ3F 1UOEA 2OLEA 2Q5QA 2QUJA 3QH4A 4PYLA 4UU1A 5CB8A 3WGLA 2I78A 1NONA 3H3XA 4WK6A 5JCOA 2VK4A 5AUQA 2NUPA 3W6PA 3FYCA 4U9HS 1CW2B 2E4ZA 2CXPA 2GCNA 3KZNA 4L72A 3ZXXA 2G9ZA 1D4AA 2OGWA 4QTUB 2HCBA 1SQSA 3D5QA 1JVSA 3AJDA 1HQCA 2OC4A 1ZRMA 3OPXA 4D46A 4PIPA 4PTYA 4JUDX 1L7EA 3GRKA 4KVGA 2OEPA 3EEYA 5EYPA 4KREA 2Q5FA 1GITA 1U2RA 3MYYA 4YAOA 3D4NA 3BIWA 4N0QA 1S2DA 2QZPA 2TMDA 3E2MA 4QOSA 4LFBB 3CJTA 4GOLD 1B8VA 2DAPA 1C0KA 1MD9A 2ZFUA 1LB1B 3EEQA 4RFSA 4CT4B 3V2HA 2WSYB 2I5PO 1H9AA 1MEJA 4UTRA 5CD9A 1FFEA 1W25A 3IP3A 2QE6A 1KK3A 1XFAA 3W9SA 2TMGA 4EP1A 3C16C 1GAWA 1JJVA 4G0PA 4O1HA 4OQYA 4AJ2A 1JU9A 3B1FA 3WFJA 3LIPA 2X23A 3HZZA 4Z49A 1NL3A 4Y0AA 3TLYA 1RLJA 4NE9A 4CTKA 5ALTA 5B64A 4JROA 3MINA 1IY2A 1G9XA 2YYZA 1C9JA 4DQXA 1NHWA 1T4CA 2P65A 3B1XA 4WV3A 1Q1NA 4AN1A 4R71A 5EESA 2ODNA 3QUAA 2HPVA 3QMMA 4BCDA 4BFYA 2JI4A 3ETJA 3KXDA 3GLGE 4KRGA 5JJKA 4D0LB 2WKPA 1MJ5A 2XCOA 5EMHA 3ONEA 5JUWA 2NXJA 1MT3A 2XNDD 1DCFA 1X70A 3QENA 3PEUA 4BL5A 1OXUA 2CJXA 5CH8A 1DQYA 1VMEA 2OFWA 1HEUA 2KI5A 2ZUCA 3ANYB 4OKIA 4Q39A 4S1NA 5AVUA 2V6FA 3JR7A 5BR1A 4EY8A 3LP6A 3EK2A 1N2CE 2AXEA 3QG1A 1I4LD 1CK4A 2B7CA 4X6UA 5DASA 4AKHA 5JWRA 1JZTA 1L0BA 2WVHA 3T1VA 2Z2XA 4WLEA 2DJ5A 3JASB 2COKA 1MXHA 4DV0B 1JR6A 4GR5A 3Q0TA 4J0HA 1IVSA 1YRWA 2FP4B 2BBSA 3IPRA 4IF4A 2VRNA 1JMYA 5HBGA 2IU6A 3NNSA 4C0SA 4MVJM 4Y9SA 4BNGA 4LE1A 1XPOA 2O7RA 3C3XA 2DVMA 2RJOA 5KAPA 1GADO 4E2WA 1S2OA 2ZBGA 2AFHE 2I55A 4QTXA 1XMQB 1T3SA 3SPXA 1OQAA 4LYDA 3IBFA 5KMGA 2RGRA 3TKYA 4EHFA 2PXXA 5JBIA 2XGOA 1U5CA 2YS7A 4P4SA 4L3VA 1QGYA 3ETCA 5DX8A 3HJHA 4FKBA 3V4SA 3WL4A 3DV0A 1GGVA 1VFPA 5IHXA 3A1TA 4CM9D 5L4NA 2Q1SA 1NUPA 121PA 4CM4A 5JS6A 4M76B 2FEXA 2WICA 3G6KA 3P9YA 4FFVA 1E1QD 2B1GA 2X1MA 4N3BA 4XJXA 4JQOA 2J3QA 1CZOA 3I5MA 3OCVA 3SEQA 2XOXA 3ZIAA 4DB4A 1I2BA 5L9AA 3D7KA 3OESA 5E6RB 2J0UB 2OL4A 1QRAA 1SXJD 3D6VA 2XW6A 3ELBA 3RSLA 1IRXA 1NHGA 2AD1A 3BXXA 3QIAA 1YR2A 2PTHA 1MIHA 2X9GA 1CLUA 3WGVA 1OZHA 4MWZA 4B1FA 1RJWA 2ZTHA 1DO8A 3KHUA 4R5MA 4EK9A 4JSYA 5KNBH 1QYRA 1I3LA 1TK9A 2ZJ1A 3CONA 4IYRA 4PIMA 2Q0HA 3PXEA 4AYXA 1W2GA 1N2EA 2PH3A 1RP7A 2W48A 4EQ6A 2ERYA 4OLAA 3DO5A 4RTLA 4FMPA 4ZI2A 1FFAA 2O8FB 5KWEA 2CZQA 2PL5A 3H1AA 4H18A 1ESDA 3LVQE 2H85A 3MAGA 2QJWA 3PUJA 4N5LA 4LJRA 5JS8A 1OIWA 3OQJA 3VYWA 2FZCA 2ZUFA 2DBVO 5C8YF 1USGA 3DYIA 3EE6A 3IP8A 3WWZA 5A02A 4B47A 3ABZA 4RD6A 4L4YA 1A9SA 2FW1A 3GHYA 4TMWA 2R6R1 1F0YA 4U9IS 4HNUA 5K6AA 1GM5A 1T1IA 2NUTB 2RHTA 2D59A 2IDJA 2WD7B 3B60A 4XA8A 5TGTA 4AZVA 4F9EA 5F7XA 4Z4HA 4B34A 2RHJA 1BN7A 1QFSA 2VPPA 3SLKA 3NHBA 1ZZEA 2VYQA 2IYOA 4GM0A 1QGUA 2C5AA 1Z3IX 4I50A 1U0FA 4Z9YA 3ZU2A 3CBGA 4DA4A 3IPCA 4BJ1A 4Y6PA 1NI4B 2EDCA 1OT3A 3BMOA 3V4ZA 3LV8A 5HUJA 4GOMD 4Q9IA 1N75A 3NBAA 1KQPA 1AZLA 1EJ2A 4AMZA 4ZRNA 2P4QA 2C84A 2IW3A 2P79A 3G2PA 3VBCA 1NGSA 5CA0B 3BDIA 2OB1A 1E2MA 3MS7A 2WF6A 1L7NA 1BXKA 1SUBA 4MCHA 4R81A 2EAUA 3V9PA 1X7WB 1JVNA 2A1TS 3MK31 3QSGA 1Y7LA 3TXYA 5JI3E 1BVYF 4X1KB 1H0SA 2AEEA 2J30A 4IJQA 3NCTA 4E2XA 4EAAA 3AWDA 3OQNA 1QM5A 1TJPB 1CJKC 4B3RB 2DPMA 4IMIB 4JL8A 5AK3A 2QMQA 4QDZA 5C7IO 3EPLA 2HA0A 5B6PA 1PEDA 2A9FA 1REQB 1R4AA 1OPXA 1U81A 1U98A 2ZRNA 5A9TA 3MMXA 4KR0A 4QXOA 4U2KA 3FPGA 1F14A 3OETA 2Z2YA 5EE5B 4OM8A 5C51B 3WLKX 4RHXA 2CK3D 2ZDGA 3ONWA 3PDIB 5F5XA 5T4FA 4YCMA 1W34A 2V9CA 4FMDF 1OH5A 1MB3A 2VJCA 5F4ZA 4HDOB 1ZUWA 4Z99A 3VYVA 1YKFA 1R6UA 4FEEA 4N5DA 4V0QA 4UBIA 2YQZA 3KWJA 3NBYC 1OV6A 4QQKA 1V1JA 4EG5A 1JJIA 4NI5A 1ZHFA 4V0ME 1QWOA 1AG9A 4RPGA 2C9CA 4C04A 3PB3A 3Q3IA 3WB1A 4F5WA 5L40A 1ECGA 1NW8A 4CQLB 4QGFA 3EBOA 1RLMA 2FW9A 3HRKA 1O95A 1NM5C 5I7RA 2FWAA 4M36A 4UM7A 1V47A 2HRRA 3DZJA 5IVIA 3W2FA 4AWXA 5CT4A 1HYGA 2XGGA 4LRYA 4HDRB 2GBPA 3PXUA 3GLFE 1NBWB 2UVDA 1CPYA 1DEHA 3OHSX 5GPBA 5LLSA 3WYDA 1K06A 2GF2A 4QUHA 1M67A 5DGDA 4A2CA 3L92A 2DZDA 1DQPA 4HKTA 5MFZA 2A9RA 4KXXA 2WR8A 1JILA 2GVNA 2RI0A 1F5SA 3C45A 4ZZ0A 2W6PA 1DCTA 1KYYA 2OCKA 3GRUA 5ALXA 1OSNA 3VHRA 3ZJVA 1XTQA 1YA4A 4D0NA 3Q9LA 3IAAA 4FFOA 4GG1A 4K3VA 4KR2A 3I1JA 2BH9A 2CWDA 4Y7CA 4YDRA 2XZOA 1IVYA 1JXMA 2WIGA 1J4AA 1NQWA 5E6UB 2D74A 1U8YA 3BEOA 1KVTA 5FBLB 1UC4B 2VTKA 4H4EA 2OFFA 1OTYA 2G5PA 3S2ZA 4B3CA 2E85A 2GJKA 3WLFA 3IKVA 4LF9B 3UGJA 1WMBA 4L73A 2HL6A 5H4HA 3GRPA 4OHUA 2C61A 2C8LA 2QORA 4B3XA 1GPJA 4GDFA 1AKQA 4EO9A 5AR1A 2PMBA 3NGLA 5DTQA 2QI9C 1MJGM 1M1YA 2DM6A 4Q00A 5EP1A 5GJWC 4DARA 1GKKA 5JMTA 2VO1A 4CLXA 4G5FA 4DNXA 5KMGB 3VKFA 1TU3A 2BZGA 2XRZA 3NAZA 1JUDA 5JVDF 3K9WA 3ZX5A 2YMPA 4IMJB 2D00A 3GCDA 4Q82A 4XYEA 1T2VA 3OZIA 4AIRA 3ZWBA 3AVTA 4ES6A 1ND5A 1UZAA 2JJ2A 2QJRA 4IINA 4IQ4A 3ZY6A 5FB3A 3NBZC 1OXKB 3OOHA 4DGSA 1YZHA 4F84A 2QJFA 3DW1X 4WJLA 5LOVF 1KFEB 3W5IA 4QNMA 2PU5A 1TLLA 4WW0A 2OGUA 3D0OA 4AX8A 2V7VA 1J0CA 1W52X 1TYEB 1FYDA 4IDBA 4L4RA 5K51A 4EYEA 3B1ZA 3BEDA 4H17A 3THRA 2OCXA 2ZQYA 4WXMA 2XMPA 3L2OB 2NPOA 3E22B 4CKXA 4UQLA 3FRIA 3AUJB 4ZO6A 2MYUA 3DNFA 5KSOA 2AZXA 5CPBA 2OCDA 1WRBA 4ID3A 4OOEA 4V39A 3G5LA 2QBYB 5F73A 4W1PA 4U0KA 3P96A 2OV2A 5T57A 1OLOA 2I1VB 3OTHA 1RM5A 3OQ6A 4MUKA 4A0FA 4E5KA 1B4DA 5YASA 2PZKA 3K15A 4M1MA 4Q3NA 3JZMA 4DYDA 3N6RA 4R2IA 3HZRA 4DC9A 2A14A 2A1TR 3U6KA 5G4LA 2O2HA 2Y76A 2QTWB 4O08A 4KXWA 4JVMA 2R62A 4OHFA 1FPQA 4MVJD 3DDCA 5KAMA 4OQ4A 5K3EA 3I4FA 4MW1A 3HB7A 2O1EA 2XMQA 4P2BA 1EUCA 1CQZA 5IU6A 5KNDA 4QFCA 3PU6A 2ET6A 4UMDA 1UC5B 4MYTA 2BEUB 2P0AA 4WY8A 5U9CA 3EPPA 3AEUA 4RZQA 3OECA 5AK0A 5H68A 1QG2A 2I22A 4R1SA 1MFZA 2G1UA 3E3NA 3HJNA 2CXHA 2A92A 4EHBA 2ZWVA 4EFLA 1SG6A 3LLSA 5GGYA 3Q88A 4HDAA 1V71A 1F8GA 4KEAA 1PQWA 1BCRA 3H11A 4IRMA 1B14A 4L6IA 1Z35A 1U1GA 2YJ6A 2YWDA 1L8XA 2AOTB 3PG5A 4NBVA 4OPMA 2AZ4A 4LA4A 4FLMA 3TL3A 1ZXXA 3N2KB 2BRUA 4R8VA 5K7SA 1U7WA 3D7RA 3DBHB 4H1TA 3BJIC 3QGMA 1YFLA 1EIWA 2Q2NA 3BCRA 4MUYA 2PQ2A 3GJSA 4LVNA 3K2IA 3ISJA 1I3OA 1X86B 2FPGB 2Q0QA 4JEIA 2VSFA 1OY1A 1O58A 1W85B 2R8YA 1KMMA 3DL0A 1W47A 3WQSB 1ZOOA 4MW2A 3IV6A 3D0QA 4X85A 3DE1X 1VZ3A 3QKIA 4KN6A 3VH4A 5BQ3A 1KO1A 3T1NA 3U61B 2E18A 4FBLA 1TQDA 2QD5A 1K88A 2C9ZA 4NRDA 4ICIA 1J2YA 1WKBA 3TFOA 5IBPA 3GOQA 5D85A 4NL4H 4EUFA 4B84A 2QR5A 2ZSDA 3QWIA 1U0SY 2QQFA 5C9ZA 4N03A 1XX6A 3SG0A 5KYYB 1WCV1 5IH3A 3LDGA 2IGBA 1V39A 4ECEA 1BDMA 3O4IA 1BGVA 2QRNA 3W8DA 2IU4A 3GCGA 4IHQA 3G9TA 2PH1A 5D6NA 4EX7A 4KOEC 1FVOA 1XRSB 4AY5A 1T3ZA 4JYPA 2QN3A 5DXAA 1Y6QA 4EVIA 3WV4A 1JIJA 1PBNA 4TSKA 4TV8B 1N8TA 3UATA 4QOIA 2XY4A 1EX9A 3M5DA 5IUKC 3KQLA 2GPTA 2XR1A 2I4RA 1ISGA 2C0PA 1EFLA 2QRVB 1MCZA 1SD1A 2D8AA 1IDOA 2J4FA 1T9GR 2OP1A 2TSYB 3DHNA 3ENKA 1TT5A 2JKVA 5A7GA 5TQVA 1SBNE 4O33A 3LM8A 4KJXA 4YI3A 4MWDA 5T5QA 2YMMA 3V1KA 1HLGA 5D87A 5BRJA 5K6AC 1G7RA 1MJHA 2J41A 2YIVX 5TR9A 1EI9A 1GPNA 1VL8A 3FB4A 3FGOA 3OPYI 2H3EA 2ZB2A 1E1MA 1NXWA 5CLHA 721PA 3KQKA 1OBFO 3MJVA 1SBIA 1HNZB 1UAYA 3OJXA 1DEAA 3HA5A 3J7TA 3SSNA 4PC7A 5HJ5A 3AFGA 4LRQA 5FPYA 4RVUA 1QQ5A 4J03A 2VH2A 5HVNA 5IUJC 2QR2A 3I72A 5EJ5A 4E14A 2RMKA 2XBLA 4B79A 3P94A 4C20A 3MTBA 1EM8A 1QTIA 3MC1A 2UUAB 1NAHA 3QVOA 4RYDA 4BO6A 1YS1X 2AFVA 4OQDA 4JYZA 5LB4A 1XAJA 3AM3A 3S1LA 1J2TA 2GH1A 2YV1A 4TM8A 4ODIA 3C8HA 1V8DA 4MLZA 1EFDN 1YHNA 4TUYF 4UUAA 5J47A 5T7BA 3VH1A 1NF2A 1D03A 1S2LA 2K4MA 2Y9MB 3P2YA 1QHHB 1I2ZA 2L17A 1EDDA 3TECE 1ZD3A 4HR7A 4IIJF 4WERA 1X1RA 3U40A 4JLBA 4BP9A 2SKDA 3I9KA 4CF3A 1Z6ZA 3HSKA 1Q95A 2HHLA 3HKDB 1S9HA 4K2HA 3K94A 3W5CA 5B36A 3PX3A 4HZGA 1QPBA 4LPKA 4LYAA 4YFVA 4BMOB 3R9XB 1J25A 2E89A 1A4UA 4A7PA 4RACA 5M04A 3LVBA 1FSGA 5F76A 5HF8A 1OYYA 4OB7A 3OICA 2B8NA 1UXOA 2WWXA 2HIGA 1P9WA 5LYJF 2NTVA 4EUHA 4PZCA 4FFBB 3AKCA 4ERXA 1FYWA 2D5IA 5L51A 2YOHA 3I28A 4Q37A 1CS0B 4BLVA 2A67A 5K0EA 1RQXA 3KLPX 4I5GA 4M1WA 3QMWA 4MLPA 2A58A 5FFMA 2AF3C 2ZE8A 1M8FA 3AM5A 3KOUA 2XWQA 3S40A 2C4VA 4P4UA 1O95C 4UXHA 1NM5A 4C01A 3GEBA 4CLOB 2GVZC 4GWGA 1UZNA 1ATZA 1IN4A 2FPPA 3WJ2A 7ADHA 5JPDA 3HYTA 4D4KA 2CLKB 5LWQA 4BO7A 1D09A 4TL7A 1TTTA 2DH5A 2OYSA 5CNKA 1YDMA 4ZVTA 3AETB 4P53A 2IBTA 4Z4GA 1K86A 2ZZKA 3LRXA 5FOXA 5GONA 3H2KA 1FS4A 3LBHA 1FRQA 1KEVA 3OPYB 4CIVA 5CCXA 1RWQA 2EJWA 1GL7A 5I4KA 2FA9A 4QZVA 4RA6B 1QYXA 5FPTA 1NBMA 1HYEA 1GQQA 4DQKA 5ITZA 4FJ1A 3FZNA 4BKMA 2VZEA 3ACDA 3CZ4A 4CRWB 3M4JA 1TT7A 3O38A 3ICQB 2G71A 2EWVA 4PPYA 1H2HA 5HW0A 1JFSA 4QPZA 1JPJA 2NPFA 2NXCA 3FNFA 2PYIA 4DKXA 5LU8A 1CRQA 5BN4B 1E1DA 4I1VA 1EFPA 5J4KA 5HIMA 4G0VA 3IUNA 5F2KA 1JQEA 3FOEC 3CUVA 3M3HA 4ARIA 2XKAA 1YVDA 1A9PA 1L5QA 2ZE6A 3ABOB 1T5DX 2XCUA 3H8JA 4DIEA 1O97C 1YQGA 1H4TA 4R7ZA 4BQIA 1R8JA 3KV1A 4P5EA 2OR3A 1BCSA 3B70A 5KOYA 1POWA 3FYDA 1EP2B 3ZDQA 4YXFA 4RHFA 2W98A 4QHTA 1TF7A 5EJ6A 3D8HA 3AVWA 4M1ZA 4MUXA 2IWRA 3PEWA 2Z1MA 3A2LA 4I2NA 3DBHA 1CQJA 5EHIA 1CFJA 1VTKA 4HBGA 4NECA 3X1XA 1K8RA 2PWPA 1G5QA 2R4TA 2KLBA 4HUQB 1DMRA 2JCXA 1COWA 2BKAA 1RZ3A 2D1FA 2Z56A 1K2WA 5LL6P 5AKKA 2VJBA 4YH1A 3BA6A 5C2JB 3DBRA 4NTZA 4DQ0A 2C1XA 5C1DA 2QHXA 3A9TA 1E7RA 3G5UA 4D92A 5KSWB 2R8RA 3QY0A 2PUHA 2C97A 1NSTA 3CVOA 4K03A 1MVOA 4LYHA 2X7JA 5JDIC 2ZRJA 2CNLA 1Y1QA 3HY3A 5AKYA 1FEZA 3UAOA 3QE2A 5GMOA 4GMGA 3QKWA 1JIKA 2NVUB 2H11A 5IBCA 5JDCC 3FXAA 2OSVA 4I36A 4YO8A 6ADHA 4PBSA 3RD5A 1R6TA 3RVLA 4X66B 4D4HA 1N0IA 1P1FA 2CV0A 3EGEA 1V6AA 2Q3DA 1JT2A 5EP3A 1AT1A 1KL7A 3NOQA 3UT5A 5FXMA 1A7KA 1UZMA 1NR1A 2G9QA 1CIVA 1IPEA 4F93B 2LVBA 1KO5A 2DWPA 4L16A 4QG7A 3B2NA 1EG7A 3Q9NA 3A9SA 3A05A 3KE9A 4KQ1A 3ZTYA 1KYVA 4CCWA 1VG1A 3GLHE 2JJ2D 4KKVA 4OTZA 3M2PA 1UBKS 1P8JA 4XARA 2GHTA 3D3JA 3LLUA 4DCNA 1D8AA 1D6SA 4X1KA 4DWJA 4MWTA 5A5VA 3E5MA 3KDAA 5I7WA 1XMPA 3C6ZA 3DP7A 4PZUA 4KGZA 5MFPA 4G2TA 3VO2A 5CDHA 1WDWB 1XR3A 3IUEA 4FYYA 1E0SA 4QGGA 4GAEA 4POOA 5ELLA 1REQA 3BE5A 4QBFA 4F8YA 3GD5A 4AS2A 2O20A 3EUFA 3MLAA 1XTKA 4UEOA 5F35A 3UYLA 1FSSA 2XOKA 3FI9A 3JVVA 1COZA 1GNVA 3KQQA 3C3MA 4RL6A 1XXHE 3RVRA 1GJRA 3GEHA 5EI5A 2VJMA 1K68A 2V7XA 4L08A 5IN5A 2N3ZA 1XAIA 5A2GA 1PKEA 3KX2A 2AL7A 4RD3A 5ER6A 2XBMA 1YV9A 3WLRA 1DHTA 1K8XB 1I0LA 4WI1A 4KXUA 4OL9A 2BRUC 2ZIWB 2F59A 5FEUA 1L8AA 1UZUA 1AN0A 3C3BA 4DBLE 3TQOA 4B4OA 1GZ7A 2BP7B 5E4FA 3V7WA 2FQWA 5I7SA 2EOAA 4MIYA 3ZBQA 3IKLA 4EGFA 1HBJA 1BDHA 3EIHA 4M0FA 4BZXA 4E4RA 2CMGA 3I1IA 1FP1D 5FLYA 2HUPA 1E62A 2RHRA 3SVTA 2PZLA 3M6XA 2OB2A 3RRBA 3IELA 3IE0A 4UNSA 1XQXA 2NUAA 1BE8A 1JE1A 1HI9A 1KY2A 4GQBA 1V3UA 1WVGA 3EGCA 3JPWA 5BRNA 2I4NA 4M7OA 3G82C 1P1JA 2QM0A 2CSUA 3BXFA 4XZ3A 1R3DA 1N6RA 2E5FA 2F9FA 4EMTA 4G37A 3ZQ4A 2HH9A 2P9FA 1ZD9A 4W9NC 3PXDA 4YRCA 3CIFA 3C98A 1SY7A 4B87A 2J3KA 1TXGA 2C2GA 2ZJ3A 3P5BA 3LY9A 5KC9A 4LYJA 1XP5A 3GO4A 1JJAA 5GADl 1ZLYA 2J5RA 1VYHA 1RAIA 2O6LA 2VHTA 3UJ9A 2QN9A 1IWPB 3FUWA 4MKFA 3EYAA 4C0KA 1PNRA 1OH7A 3SS7X 5IEBA 4NMWA 4YECA 4W9MC 5KS2A 4EI2A 4QUJA 2H8KA 4FGSA 2C29D 4R7GA 5EAIA 1IIBA 2WYVA 3OA0A 3TLMA 3P27A 4QSHA 2B3TA 2BM1A 2J7KA 4K9SA 1CY0A 2P90A 2VF5X 3BWXA 4EVRA 2CLLB 3KKOA 3C1AA 3AVXA 1J21A 1HC7A 2ZK7A 2X3YA 1PSZA 1SHJA 2GVDC 1EAMA 2PZMA 1PJQA 1RE1A 2L42A 4FD2A 2GA8A 4RY9A 3LI2A 3OLZA 1L5HA 3UV6A 4DN6A 2DR2A 2YS6A 2WLSA 4Q1VA 1AY0A 5M2QA 3ICCA 1GXSB 3BF8A 4JUIA 5BSFA 3SC2B 5GINE 4PLTA 2R60A 3EIOA 3S3TA 1QHIA 4HXEB 2BDTA 3E58A 4LK2A 2EBHX 2IYFA 5DBIA 3KPVA 2IIPA 5DSTA 2ADMA 4BAGA 2JA1A 4V1CB 1NBEA 3CUYA 3ISVA 3VR4H 4B33A 2HQOA 2JH8A 3PR3A 5E6SB 3A6PC 3EIXA 4NPCA 2G4CA 1CEQA 1T3HA 3AC0A 3CKLA 1OWMA 2DJIA 2HMUA 3K7EA 4LZAA 4PLFA 5TQ0A 2B6NA 3V1MA 3W4IA 1SBCA 5A3JA 5IAAA 4DZTA 1SIWA 3EY4A 2O8FA 3EY9A 5CBPA 3CZCA 4KXYA 3UENA 5F4BA 4UHDA 1ST2A 4LTNA 4ZT2A 4Q1EA 5E9JA 1TO6A 4MUGA 1PEKE 1ESNA 1NVEA 3K4QA 1L4LA 3W2GA 3K09A 1ISJA 1BD4A 1FDIA 2ZJ8A 2YWRA 2I6FA 2BFFB 1RI1A 3ESDA 3OCUA 5C34B 3RR2A 2J7PA 1ZISA 2R751 4C5BA 1F1BA 1T43A 5FUBA 4AL4A 4UBOA 4E4TA 5BVGA 4BWGA 4PSUA 5JBQA 1DC6A 3D7MA 1DNPA 2R68A 2C3OA 2BGTA 2JHFA 2QGFA 3BRQA 3QUTA 3PWKA 4DUPA 3LTEA 4CV0A 4DT1A 4EW2A 3AF4A 3EVZA 1XCGB 2IHNA 1U0HC 2V7PA 3LC1O 2AI3A 4BLTA 4E5YA 1RXWA 1ZH2A 3WK7A 3F98A 3N86A 3B12A 3NBXX 1TI7A 2GHQA 4AYTA 4G9EA 2YYYA 2XMDA 1A2KC 4DYHA 3FH0A 4BNKA 1QH8B 4FGKA 1G4HA 4FFDA 4TL6A 1JEEA 1GQSA 4PF1A 4UD6A 1W1IA 1NMEA 4FHDA 4DFDA 2JBAA 2I4LA 3DVSX 3ZIUA 4RTKA 3M8KA 4P81A 1W5TA 2JLWA 1Q3KA 2VBFA 2C4MA 1ECFA 3ITDA 4R9VA 3V1UA 2DEUA 1T15A 3H4IA 2V97A 1H22A 4FCTA 4NZNA 3V46A 3TOCA 2E0IA 2G06A 2ABWA 4KI0A 4TL9A 1BS2A 5IVDA 2GLTA 3NT4A 4KP7A 3EZ7A 1KKMA 5DM70 1KSGA 1T5LA 3AHFA 1SCIA 3ZD8A 3L7LA 3FLBA 5B6JA 5IT4A 5KTOA 4TLAA 2VQ6A 3RS5A 4TWRA 3TPFA 2X5KO 3SF8A 2QL6A 3IH5A 5I9TA 4JYCA 3ST7A 1HURA 2VRBA 1IAQA 3CG4A 4MPRA 1OC2A 2O0MA 3N6VA 3OSUA 3TLZA 4ZJYA 3G5MA 4TT8A 3VTZA 4I3FA 3E35A 2ICAA 2X77A 4V0OA 4CMEA 4X6LA 1CIJA 1WZNA 1Q7CA 4DJTA 2JFWA 4B3GA 1AGYA 3FCXA 3T5TA 5BV0A 2R5WA 3IDQA 3KOWA 4ZI5A 4EKDA 4ZQHA 1JYEA 2LIPA 2VF2A 3PZBA 5AVJA 1YI0A 3ZZUA 1B8OA 4FLFA 4ALKA 1NUTA 3LKBA 2PO7A 4CMCA 3ORFA 3GGCA 1E58A 2XGSA 1O77A 2Z8YM 3F6PA 4PC3A 4L75A 4Q6BA 4TXNA 4UFNA 2BCJQ 3ZI0A 4F4IA 2ZWOA 1OHHA 4NU0A 4FUTA 3RSZA 4YGYA 1TX4B 4MO9A 2NO5A 5E9WA 3L1HA 4KMRA 2QR3A 3WZLA 4EW3A 9GPBA 4OBEA 5K6TA 1OBOA 5LZ4A 1O57A 4AZWA 4CUZA 4HQRA 4RNDB 4US0R 4YLEA 4RGQA 4CKCB 4RF2A 2E6KA 1N4AA 4EY3A 1LDMA 2HQBA 4GRIA 4G0WA 4DLUA 4TS1A 2AVNA 5HKKA 4BATA 4Z53A 2PL9A 4FR2A 3NALA 4XJVA 2P6PA 2P77A 2WAYA 5EJFA 2HA3A 4JIGA 1NPYA 3H7IA 3IE2A 1EH5A 3W1EA 2B4YA 4JC4A 5IK2A 4NESA 4KV9A 3RUEA 3K70D 5GAJA 2CXOA 1QIMA 1HT3A 5ALFA 2HCRA 1UL1X 2GGSA 2E2WA 3ITEA 1E0AA 4J0QA 1SC3A 4ZZ2A 4F11A 3C0KA 5JDIA 1I30A 4E2ZA 2YWHA 4GPBA 5LA6B 3J80A 2PRIA 4LNUA 4WKOA 1TPYA 2CKDA 1IY1A 4I14A 1RJGA 1YQDA 2HIAA 4MW9A 1F5NA 4R2MA 4B6JA 5JDCA 2FDCA 4PYKA 2HRQA 4IP0A 4TKMA 3HXKA 1P80A 3VZQA 4BBZA 1MTOA 4YUZA 4Q34A 5LMCA 3GRAA 3LQYA 3ZWQA 2QLFA 2V65A 1G1AA 3LBNA 3VAYA 4ENTA 3KO8A 5K0GA 2IDKA 4K7JA 1QJ4A 2XXAA 2A8YA 5FEMA 1P60A 4BGIA 3HV2A 2HC9A 1SB8A 1QIFA 2BFBB 2YJ5A 3HNPA 3UMSA 2XWPA 4EBBA 4NNJA 3VMFA 1ZVVA 1NWCA 2QI9F 1JWAB 3PXCX 1H2XA 1HLDA 3EZGA 1NNI1 3N2GB 1QO7A 3UHAA 4X6YA 5G41A 3H7AA 2AJLI 2HIMA 1TQ2A 2WYWA 5E4JA 2DKFA 2G1AA 4D3DA 1VCHA 1IK6A 2P1ZA 4PX9A 1XRMA 2DPYA 2WYIA 5F1KA 4YRPA 1QHHA 3GJ6A 1KYQA 3UG6A 3WWOA 2NUPB 3NVAA 2NSJA 3RJ9A 3I5YA 2VQEB 2OZPA 3PNYA 2AEFA 2D1QA 4EYGA 2BWJA 3SE0A 3OKFA 4F21A 4CG0A 1WIWA 2VK8A 2ID7A 3PX2A 4GI5A 2HQ1A 5HM6A 2UUBB 1XQ1A 2HCJB 2ZZMA 4IKEA 1A9RA 1R16A 2NU9A 2IPNA 2DCMA 2FUNB 1LPMA 1SU7A 2XF2A 3SI7A 3IAFA 1VMDA 3MTDA 4MS3A 4ERNA 1L5RA 2QTMA 1II8B 4MI3A 1DG3A 1USVA 1VE7A 2NT3A 3V2UA 1MNQA 3OQIB 5H9WA 3HU5A 4IIFA 4TTTS 2DXIA 3I23A 3NU1A 4G5RA 4BNIA 4HWGA 2OK8A 1Z45A 1WSWA 4I8IA 5ALJA 3R7BA 4DOMA 1PV4A 1X77A 1K9VF 4PZ9A 1XDGA 1M2EA 3RIHA 2CYCA 1V16B 6NULA 2Y4NA 4NU5A 4FSDA 3RS3A 3AM1A 10MHA 3RAFC 1T2FA 3NHRA 5ALLA 5ELXA 1BE1A 2Q2VA 1OKKD 5A3SA 5ICMA 3VFDA 3DJYA 4RLSA 4YS6A 5E2BA 2HR1A 3WOVA 3C39A 3MB8A 4RMHA 3EDOA 4Z86A 5TDHA 2HJGA 4L3OA 4QDUA 4J3NA 2AFRA 5FORA 1XVAA 1MO5A 1WV0A 3MERA 3OCCA 5JNWA 2V4MA 3JYPA 3MFYA 1IXKA 3R0JA 3VU0A 3RGWS 3I9MA 1QAQA 3L93A 4J0FA 2QUBA 2XYRA 3F46A 4S0ZA 4C9BA 4LYGA 2ZIZA 3AEQA 4F7DA 1UBUS 2PUJA 1LNQA 1M10A 3KUCA 1FXUA 4RIIA 4W9NA 4CJXA 5L6LB 2V3VA 4L07A 4YYZA 3RFXA 4IQFA 1SXPA 1AZTA 1XDUA 3D59A 4LY9A 4W5QA 1H2ZA 1M7HA 4OXIA 2H5EA 2ZBVA 3INNA 5DLQC 2BSQA 3I0MA 4DXDA 3RYHB 1X74A 3VPGA 3W5HA 2Y99A 3UOAB 1GRRA 3G59A 3IP7A 5HIKA 2WILA 4DMGA 3TNFA 4M4SA 1K6EA 3JAWB 4G97A 4PBTA 1RT9A 3WGUA 1JAHA 1E9EA 2M1ZA 1FTGA 2GZAA 3EIQA 3WIDA 1JHRA 1SQGA 4D98A 2PMWB 2CF5A 2P91A 2Q1YA 2QX4A 3F67A 4RFSB 2H6EA 4F1KA 3LY8A 4KR6A 1YK1A 4YDQA 3B9RA 4M9SA 4W7HA 5JCZA 1P2DA 3ID6C 5FLEX 1G9SA 1URPA 4MA4A 4C0LA 3RARA 4QOGA 3G79A 3WRWA 4S05A 1YCFA 2VJOA 2ZW9A 4Y1GA 3GBVA 1I5OA 1I51A 4MUHA 5JNSA 1VHJA 3FPJA 3OTQA 4HUQA 2CCJA 1LC0A 2J8ZA 3A6KA 2W4QA 1HWYA 1N2JA 2YVAA 1G8JA 4LOIA 5EXPA 1U8EA 3C1UA 1W0KA 3MTIA 2HMTA 4OP3A 5FO1A 5AXAA 2YWCA 4KE9A 5FV4A 3RF7A 2WHYA 1R6BX 2XT6A 3GVIA 4DABA 4TWBA 1GZ3A 4M88A 1G7TA 1SBQA 1H42A 2NTJA 5LZ9A 1Y4SA 4TTVA 2ZXEA 1OX5A 2I80A 3T06B 2BEVA 1PR5A 2PH7A 4P86A 1SOMA 4Z2YA 3ZE6A 4EH1A 3T7KA 4N8SA 1E4OA 2IEZA 2G1PA 2PZBA 3R41A 5JD4A 3K09C 1MX3A 1NW7A 4ZV9A 1IPFA 4ND8B 1H0RA 1QO9A 2I3DA 4UAGA 1M54A 3OM8A 3RBVA 4EG3A 2NO6A 4LZLA 1HTBA 3EPJA 4AMBA 5L4LA 3L0YA 5FADA 5JROA 3FFBA 1UKZA 1BZYA 1JAYA 1F06A 4CG3A 4BVGA 4NCXA 2ZXUA 1Q7RA 3G8AA 1ZKMA 4N9QA 5KX5F 1UQUA 2LP4Y 1L7BA 3GY0A 1WMFA 3T4PA 2PJUA 2JGLA 4X92A 5DDIP 4EHDA 5AOVA 4XVUA 3EB9A 1VPDA 2AD5A 1E6KA 5K0SA 3CNLA 2WINI 1WMAA 3TRFA 4I8DA 4XGRA 3CLRD 3QOYA 4FB5A 1JHMA 4RKYA 5FF9A 4ZOLA 2WDZA 1ZA1A 3UOGA 3R3XA 1A82A 2H0QA 1B6TA 1MO4A 1D2EA 3DBLA 5CHEA 3WR5A 4RE6A 3AJ9A 3X43A 5LQUA 2R79A 2GQ0A 5IZ4A 1XPUA 1J8VA 3BFVA 2YFHA 4FUQA 4RLHA 5HJEA 2OM6A 3INYA 1YNOA 2X1LA 1GYPA 3K0FB 3C6QA 3QHPA 4RVHA 3Q8KA 1PZHA 4FI3C 2FQXA 3BMQB 3SX0A 3R5HA 2AK3A 1TM4E 1OA0A 2NXWA 1EX7A 3LOQA 1VI2A 2WAXA 4IKOA 4NJMA 4W82A 4Y67A 3COZA 3SSMA 3QOFA 3U7QB 3IMGA 4RF4A 3WIUA 2QX8A 1NI3A 3IA2A 2LTAA 4R9RA 2HMVA 2KE5A 4S1WA 2J32A 2QENA 3NBQA 2QXYA 3JAKA 4KLNA 2J9RA 2RJNA 4TTIA 2O2XA 2O2CA 4BMNA 2IZOA 4L51A 1QV9A 1PQYA 1Z7WA 4CMEC 3Q3HA 2DFKB 4B6EA 3SEZA 4DSOA 2FLVA 3WNDA 4C21A 4Q4JB 1RIFA 1XAHA 2GWHA 2RGDA 1N5IA 2XRMA 4GOKA 4RTOA 1FP2A 2IT1A 3F2IA 3EIFA 3DL7A 4ILKA 4QJ5A 1WXFA 4XVRA 3VPSA 4DC0A 5DYTA 6PFKA 4P5DA 2G67A 2V0NA 5FR1A 3KJXA 2YJTD 1CHNA 2BFEB 3F3YA 1BU8A 3K73O 4DV2B 1U7PA 2JJ1D 2XDQA 2ZI3A 4LMAA 3URKA 2ZT6A 5CDUA 1PYOA 3KP1A 4RHUA 4AU1A 1IZ7A 2DKOA 2PY6A 3LQKA 4LECA 3EXFB 4BX0A 2JATA 4GR4A 1YE8A 1OB5A 3QVXA 4Z1MD 2QLNA 3BIOA 5F9FA 3E3LA 2QPOA 1MV5A 1AKRA 2QW1A 4GX5A 4UQOA 4HC4A 3RM3A 3GLKA 3WP1B 4WIAA 3K1AA 3D3WA 2F8TA 1CRWG 4QUEA 5CA0F 3ZHTA 3VJMA 1C7RA 3MGAA 2AHRA 2C78A 2C5HA 3DEFA 1XRJA 4QOJA 5KDDA 4ZYZA 1UQTA 1X9IA 1G63A 3AH8A 1W5BA 2D1RA 1KERA 1VFNA 5DBOA 1MR3F 4P3NA 5AHWA 2ID4A 2XSZD 3OJFA 3HXQA 1FRVA 1YD7A 4URFA 5ARBA 2ZSFA 4NFYA 4RVDA 5JFGA 3JX9A 3ILVA 4MKHA 4FD3A 4C7XA 1GUBA 4IXDA 5G02A 3T5AA 1ZL2A 4Z7NB 1FTNA 1U2PA 2PR2A 4PE5B 4OHWA 1PTKA 3KAJA 1PT8A 5DNWA 1Z18A 4LY6A 3VKHA 2QV0A 2F3RA 4Z1OA 2BEUA 4FGJA 3DXFA 3K5PA 4OJKA 3DE3X 1ZN8A 1IEQA 3D2AA 4JBXA 4EJ2A 4LJ7A 4F5YA 1QORA 1GZVA 1MRNA 2G3YA 3F74A 1EXNA 2V9ZA 1KJWA 2FX2A 3TYXA 3OFVA 2PUEA 1N9ZA 3ZY2A 2ZR9A 4NOKA 1RAHA 4TVBA 4BN5A 1DIAA 2FDXA 3HCOA 4NH4A 5K03A 1Y1LA 3AIKA 1V43A 1LFDB 2HMYB 3UUFA 2B1IA 4FFLA 3FBWA 5EIFA 1F9EA 2B30A 4I4CA 3UGQA 1I7LA 3VZBA 2WIJA 4TXJA 4FBMA 4YGXB 4KYVA 4CL8A 1XL1A 3LIIA 5A71A 4PPQA 3HS3A 1Y3AA 4Q03A 3IEVA 2OAGA 1YAJA 2LKDA 4C6TB 4B40A 2I9KA 5CDYA 1CY6A 2EKQA 4GIBA 4E3WA 1IOLA 2UZ4A 2RKWA 2PS0A 2VWPA 3HY6A 4C88A 2Y27A 1WLYA 1JKJA 3DR5A 4U7HA 2I0FA 4V3BA 1BDIA 3LUJA 2GCOB 3E23A 1GFSA 3CG0A 2OHOA 4RESA 2W8BA 1B41A 1WUIS 2H2HA 1X0XA 3ZCXA 3TEJA 3UAXA 2ZRMA 4K6KA 1HE4A 4MW6A 1BJKA 1UZLA 3F0TA 3LT0A 1YJXA 3ODGA 3OX2A 1F20A 3L8DA 1Z5VA 1QSGA 4EMBA 4EIWA 3B7PA 1QOQB 2P6OA 4QREA 2WE8A 1N6OA 2WU3A 1PI3A 4ID9A 5BSUA 4D9MA 1U2TA 2ZYVX 2C5GA 3CX6A 3FNGA 3TL2A 4XUDA 3WXMA 1Y3HA 2J5XA 4V38A 4UREA 4M38A 1ZUNB 3KYJB 5KNDD 2JFPA 1QBKC 3KKEA 3EFEA 3R7WA 4INAA 2QAGC 3B2QA 3RQSA 4IV8A 5KTMA 4ZOBA 1HMPA 4YCSA 1P9NA 3R3UA 1S01A 3DFMA 3ZKWB 4EW6A 2B8WA 3EVGA 5ICEA 4GL2A 3P2JA 4WCDA 3QEKA 5F7ZA 3PSHA 4DREA 4CL3A 3D2BA 1HPLA 1EDEA 2V4ZA 4RK1A 3SR4A 4C22A 1B8PA 1Y9JA 4FSXA 4WVLA 4Y6SA 1R15A 4TLCA 1YHYA 2PG3A 3HE3A 5D01A 4R41A 1G6OA 1CUCA 3WQHA 2C5BA 1SK9A 4LTDA 4ZD6A 1AHPA 1RD4A 1RKXA 1RR6A 5DCLA 5CFOA 1OX6A 3GUYA 2XGMA 3I5UA 2VOJA 2HRZA 4MQBA 1FU7A 4P3KA 4YMSA 4OQPA 4BRUA 3OZGA 5EHNA 3W2TA 3Q8WA 4JI6B 5KTSA 4BB0A 3K0SA 2NU6B 4J0IA 1E6WA 5EE9A 4AXXA 3A6DA 3DB2A 3KT8A 4KQ9A 4QXAA 2G83A 4GM1A 1I3NA 5K0FA 2Q7DA 1Z0SA 3OPNA 4Q7LA 1U63A 4A36A 3SY8A 1G3RA 3FCAA 5PNTA 1NMSA 4I1UA 1SIBE 3AUAA 3TVTA 3HYCA 3AQ4A 5LLDA 4YXWD 1XQWA 2HD4A 4BUJA 4ZYVA 1FMLA 1MRZA 2BKXA 3CV3A 1ISSA 3FHOA 4XDHA 4Y2YA 3HJTA 1YA6A 2GPAA 3IP5A 2JD2A 3EVBA 1SOVA 4JP8A 2VSNA 5JZBA 5KTTA 3NHMA 4IKPA 4REMA 1JBQA 3M3PA 3P0RA 4IHJB 4CMBA 3HQ4O 1Z2PX 2CL7X 1AGPA 1GARA 3L8FA 1II9A 3ETGA 4N7BA 4ZEWA 4MB6A 3KPUA 1HXHA 3DE6X 2DCUA 2FPKA 4OUKX 2R8ZA 1UEJA 2OBLA 1A9TA 5DSXA 3C6XA 1MOPA 1XRRA 3UWDA 3UA4A 4FB4A 2B8TA 3R9WA 1YS4A 1V5GA 2B0JA 4OHRA 2PANA 1ULHA 4EMUA 4BPBA 1G3UA 1SVIA 3NT2A 2CSXA 2FZKA 3IEXA 2NX2A 1RAEA 1RNLA 3G2OA 3AR2A 3ZH9B 4AZ3B 4BY9E 3GLTA 3O7MA 1IBCA 4PQYA 1PVDA 1TAGA 2IZ6A 2P2SA 4RORA 3B5JA 2MYNA 3LHIA 4ME6A 3QQPA 3UK6A 1FB5A 5C80A 4MINA 3U56A 1DG1G 2B21A 3SC3A 3O74A 3CUWA 2P78A 3THXA 2G77B 1DAEA 2VTVA 3DLPX 521PA 1ZK2A 4L9WA 4NONA 3B9PA 5FT9A 1C7IA 3WWYA 1QLHA 1C1XB 4IOLA 4ND1A 4QTTB 1ZQ1A 1TMOA 1HKHA 1CUAA 2RAFA 4PAGA 1TKAA 1SVWA 4C4TA 1CZHA 4OREX 4B4WA 4I5IA 4PN7A 1DXQA 5L4SA 1WHSA 2C98A 2PX8A 5KJEA 4B82A 4BC0A 3LCCA 1KFKB 2AYYA 3IJPA 4GPZA 2B9EA 5D1HA 1U0TA 4GSKA 4KIJA 2Z6AA 2HXSA 1EE1A 4HLNA 4OMUA 2A57A 3L6RA 5FKJA 5H81A 4DDWA 4AT1A 4FFRA 1NN3A 2PFKA 3COPA 3WMEA 3U44B 2UXCB 2GI4A 2QG9A 2BGJA 4U7TB 2FMIA 4GF5A 1F0KA 1RCFA 5TQ2B 1RZRA 2QT1A 2HK8A 3NRJA 4HGYA 3LDAA 3NV9A 4R83A 4D9KA 1H0HA 1QG0A 2NO7A 1BWPA 1WZCA 4N7RA 4QGHA 5AK6A 4IS2A 3RE1A 1BE6A 3H5AA 3S2IA 3GGDA 4HATA 4MOWA 1II8A 2VXYA 3ONDA 4J2OA 1UDAA 2IGTA 3I9LA 2DT8A 3OQIA 3ZHRA 4EUKA 5BSGA 2WM3A 1Q0PA 3E9EA 3TSCA 1O97D 4Z3KA 4LMPA 1FU8A 4B74A 4X41A 2ZPUA 3U4IA 4EG1A 1CDEA 5DHPA 1RZVA 2JFOA 2PZ8A 2YICA 3ZVMA 4TTQA 3P0JA 3Q72A 4M21A 4CFSA 1RAFA 3BCHA 2G9NA 3FJ1A 1UBHS 5A5EA 3PITA 3AFHA 4N82A 2H4FA 1NVFA 3DEKA 3O9VA 1JLMA 1XL0A 4FBGA 4OY3A 5IDWA 2NYRA 3MYRA 4DMUB 1GTZA 3T3NA 4KBYA 4PSDA 1Z7EA 3HL0A 3I6YA 4TS9A 1W4LA 3JWJA 3UMFA 1LKZA 2Y1FA 1PZFA 1GL3A 3JQ8A 1ZPDA 3P52A 1X92A 1G6Q1 2X3UA 1EVEA 1P73A 1R3UA 3JQPA 3CO0S 5I9MA 1I5RA 1S3IA 2GCOA 4LAFA 3TDKA 1KPHA 3AESA 3ZI4A 5LIPA 1X2BA 1DC5A 3OFND 4F6RA 2UVQA 1WETA 4QIHA 3W6OA 2B99A 4QQRA 3O8BA 4GU5A 1Z74A 4DLAA 4RO0A 1XZQA 3UT5B 1U5AA 1M2VA 1ZVQA 3S4YA 2HT1A 1EWRA 4B45A 1P7WA 2JIBA 2F2TA 4LRWA 4M99A 4INPA 5A7HA 2J9YB 3PF8A 1F17A 1VIDA 2GNPA 4WOJA 1TF2A 4CMGA 2ZSHA 4NXMB 2BMEA 3UFXB 1NV8A 1FFCA 3OEHD 4DLYA 1OZAA 5TMEA 1OC4A 4ENRA 4YDHB 2FZVA 3GFRA 2Q5IA 1KP2A 5K3OA 2P1RA 2YW9A 4YJFB 5ANRB 4EGSA 4EELA 3CRVA 3PDHA 5AXDA 1JS1X 1AQYA 5DOZA 3G49A 1V1MB 2FOLA 4OXNA 3C85A 2GXAA 2JAPA 5DPMA 1K08A 3HXMA 3OFSA 1CZLA 1U0JA 4ALIA 3GLQA 3GPCA 5CDGA 2YYAA 2EKZA 3CLVA 2IRWA 3PC6A 5BOSB 1T91A 1NUHA 3DUFA 4MKIA 1KZ1A 2ZYTX 4JA2A 4R54A 1L7OA 3AEXA 1TKBA 1Z8DA 3OC6A 4ZZ1A 4RCVA 4F6LA 1YF3A 3AP1A 3WZMA 1LF0A 4DAEA 4ZAVA 1VSVA 1XZHA 4TLLB 1DIHA 5LQCA 2X86A 4YRBA 1CUYA 3K2EA 3NDRA 1TJNA 3A32A 4RK4A 2Q3LA 2PJDA 2JANA 3K2QA 4JNKA 2O07A 1L9XA 2GRUA 2JDID 3BGDA 5DTMA 3ZXIA 3HNOA 3VNQA 1K75A 2JFGA 2HO4A 1RPNA 2J85A 4JXJA 4X94A 3U26A 1JDUA 2QUAA 1LZLA 1YRHA 2ZU6A 2XCTB 1YR8A 3B1WA 2BFWA 2XODA 2CFTA 2QP3A 1L7RA 4G86A 2IHTA 1V9SA 3EVNA 4M3NA 1SCNE 1U1IA 4QASA 3PHBE 3VSDA 3DXYA 3VO8A 1JL3A 4CTJA 1MJFA 3N0WA 1DELA 2O7NA 1WB4A 3IKJA 1T6BY 3EGWA 4RHTA 2B20A 1CE8A 2OT3B 2X0JA 3A4LA 2WG0A 3EJ6A 3FSJX 4URYR 2JAXA 4LMRA 1IN8A 2BM0A 5G40A 4MV6A 1NSFA 2OD2A 2Q46A 1FDUA 1PJ8A 3EW7A 5F78A 3PC7A 3X1ZA 4CQNA 4OQZA 4RKRA 2FPPB 1KY4A 3FMGA 4DEYA 2OHJA 1YACA 5ENVA 3DAGA 1K5HA 4IV5A 4MGIR 4ND7A 1BIFA 5J2TB 8MHTA 2GWRA 1IQ0A 3CHYA 2IIQA 1LW6E 2A35A 2J45A 4JJFA 4GUDA 3GZ4A 4XFDA 4ONEA 5CITA 1MW8X 3L7DA 3GWZA 3R0VA 2JLUA 1AGRA 3WB2A 2X4IA 5AW8A 1XUOA 4MV5A 2MSDB 1K63A 4RA6A 3Q8MA 3EA5A 3UJ8A 5AFSA 4MW7A 4MGHA 2BL4A 3QFCA 4LQCA 1R0SA 3T3MB 1GPH1 1QOPB 2WU0A 2QAGA 1UMCB 2XRFA 4E4YA 1IBRA 2NZVG 5HHTA 2Y6UA 4RK5A 1N1GA 4AP9A 2XUZA 3B1YA 1OI7A 2X2FA 3DWIA 3OJ0A 2XA1A 4YRLA 2VATA 3A4NA 3RHFA 1WTAA 3NTXA 2OECA 4DSAA 3UJNA 3D0RA 2P9ZA 4QPJC 1CJMA 5KJFA 3UJ3X 5KU7A 2R1UA 2CLCX 3D43A 3L9XA 3QW2A 3RS8A 4UDXX 5BWBA 1E60A 3ELYA 4C0AC 1GOTA 3AGPA 1NLYA 1YIOA 4NK5A 4EECA 4JSTA 5HQ3B 4QEZA 2ZVPX 1P1IA 2I2BA 5BSMA 1Y1TA 3NIGB 2ZYIA 1WHSB 4NBWA 1NW5A 4L8FA 3AUXA 3ZX4A 2YWBA 2TMKA 3NKVA 1THTA 1FFSA 1V41E 4V0NA 2GUWA 1NATA 4QA9A 1XN1A 1YULA 2PFSA 2KS6A 3I3SR 5ALOA 4ABYA 2O1SA 1N8KA 2HV8A 4ARSA 3ESQA 3HH8A 4Z4CA 3ZOKA 4XM1A 2GZ2A 2EQBA 1Q0QA 1N7IA 4M0LA 4E0BA 4X20A 3INTA 1B00A 4MV7A 3IXQA 1BWQA 3R4VA 4TS3A 1GCUA 5BO5A 3MOGA 4QJBA 2CDAA 1KS9A 4HNGA 3UV3A 4Z6KA 1W0KD 3RK1A 4BV9A 4KWEA 3CUTA 2J3JA 3E9ZA 3AHHA 3JQEA 4HEA6 5CB4A 3WO0A 5HUHA 2Z5GA 3AJAA 2DGDA 3L6OO 4BQFA 3A25A 1Q19A 4MEJA 3N0XA 1JDVA 1STOA 2X19A 3X2EA 4D6YA 3HZOA 3EWSA 3G0OA 1SQFA 3O1LA 2X15A 3QIVA 4KQHA 4X0EA 1A8IA 3PPYA 1LX7A 1O2DA 2G9RA 4B4DA 4CMKA 2QJOA 3CBQA 4YJGA 1NW9B 1D8TA 1Q12A 2YFYA 3QV1A 4ZOCA 5FOSA 1G7CA 2BTOA 4AJIA 3UCXA 4KFTA 3SF0A 3W6UA 5DV9A 3D4LA 2ECQA 3FYUB 3WMFA 4B7AA 2A2ZA 1UMBB 4U3JA 2ZG6A 1UR5A 3HKCB 4IM7A 5DBHX 5DVZA 2OD9A 4RLFA 1GL6A 4QDJA 1XHLA 2LE0A 4BU0A 3FUVA 2QMEA 2HXGA 2WP0A 4HD8A 4IILA 1FX0A 1V8PA 3LO5A 4WOKA 4H60A 1JQAA 1EINA 3ROQA 2BUCA 3W5BA 3AEUB 4NJEB 1NU6A 1MXFA 1A4RA 1TA9A 1JNYA 2WPDD 4KAJA 4MAFA 3FPHA 1DJPA 2BKLA 3PUYA 3OEED 3RJTA 4GPIB 3FIUA 1I7QB 5E3HA 4ZTZB 3IE1A 3ZE9A 1WPGA 2F8MA 1FUYB 1KNQA 2P3LA 2YY5A 2Z4RA 3S5UA 3TTTA 4CLEA 1U4OA 3ZHVA 4PGMA 4D3YA 2RHDA 1MB4A 1D6NA 1YSCA 2WIKA 1CY8A 1DO2A 1K0UA 3O3CA 4HSEA 4KVFA 4MPDA 4R2LA 4AN0A 2D1YA 2BGUA 3ETEA 2JBWA 2WNSA 3AI7A 3REQB 3ZWKA 4F46A 1Z7BA 2JKYA 5JVDB 1C8BA 1SKAA 1XFDA 4Z51A 4EFKA 3KEGA 3O4GA 1BWSA 4A9AA 3MW8A 1QZTA 3DHEA 4YJ3A 4S3MA 3W6NA 1ENYA 3IQIX 4JB8A 1QMGA 3OD1A 2PE5A 1B0UA 1JI3A 2ZYDA 2CXRA 4ZAXA 3W9BA 4RY0A 3M82A 4H6WA 4EKIA 1H2AS 2IS4A 4JLKA 2D2IA 2MMCA 1Q20A 3LOPA 4FS8A 4A0HA 2O5CA 1DAHA 1MQ9A 1HE8B 2OBMA 2P4EA 2PS1A 3E81A 3P2IA 4CM1A 2F17A 2ILVA 4HEJA 5KPDA 1DQSA 5FAXA 1NLMA 1EG2A 3GVXA 4YO7A 4M55A 5JS1A 1TVCA 3SQDA 1DLJA 3R75A 3TGWA 1LS1A 2HPHA 3QXCA 1E5VA 1JDJA 5T6BA 1V25A 3ED1A 4CG1A 2Y1XA 3IEMA 1D6MA 4P58A 3MOSA 3K5IA 3O03A 4UHKA 2NQ2C 2IYLD 1FYXA 1YDHA 13PKA 4DIDA 1E3WB 3PDJA 1D1SA 1TADA 2VPYA 5GOZA 3VR5H 3CT6A 5IABA 3KQHA 4E6EA 4KV7A 1M8KA 2MSEB 1PAUA 5JASA 3OKAA 3QLTA 4IZHA 1HH4A 2RG1A 3STXA 4FHCA 2QMOA 2A5YB 3GRRA 1Y7PA 3RRMA 4YRIA 4D1YA 2XXJA 2OQVA 1SZJG 1EEXB 1V8FA 3RG8A 3KT3A 1P2FA 4WRRA 4HB3A 4JQYA 1OR8A 3FCUB 4L78A 1JECA 4Y2JA 5B6IA 3OQMA 4HYEA 4PANA 4DMRA 3N28A 3VVMA 4XLZA 4BLSA 3LNCA 2C54A 1A5TA 4O4JF 1FYFA 1T0UA 3NHWA 1WF6A 4HI0E 4M0KA 4DRXB 1TEZA 1QUEA 4JEMA 4MUJA 3M2TA 2Y6VA 1OBVA 2X0KA 1YQEA 2K7FA 4Z7QB 2X9VA 4XB6B 4MV4A 3VSBA 4FM9A 5D3MB 1CJBA 2WSLA 2B3DA 3KL4A 4FOOA 3KDSE 2QRLA 2ATXA 1G19A 2FZLA 1XJ5A 2MU1A 3NVMB 3OO0A 4CQMB 2CD7A 1P5ZB 1PJ4A 3EDCA 1TZ2A 4J7AA 4PPNA 3RU7A 3SCZA 1MEOA 3TTSA 2AC7A 2IXGA 3EZYA 5FJIA 2QDXA 4RW0A 5J5CA 3KLOA 4DDVA 1YOBA 2V1XA 4EGQA 5FL7D 1L5MA 4KWIA 3QTTA 4Q48A 2IYQA 4JVOA 3GB9A 4V02A 1FDWA 3GQVA 4NVRA 2VH5R 1U99A 2WLTA 3STWA 5HXAA 3VC1A 1HV8A 2IYUA 3M70A 5EE1A 1AA9A 2VRCD 3EEOA 4TYPA 4W1RA 1JH8A 1O94D 3CLSD 2WI8A 1A3CA 3B6ZA 2VPZA 4PX5A 4QYWA 4WLUA 4XGQA 1IZ8A 2J46A 3G88A 4HDCA 3H4VA 1XNGA 3KXIA 3CLTC 3N2GA 5AW2A 1U5BB 2JIQA 3D8UA 1VIYA 3N59A 1U94A 3OTGA 2IYRA 4M87A 1BCRB 3H11B 4RIGA 2GA9A 1LH0A 5G0VA 5G0TA 1DUVG 4BV8A 2RD2A 3BWVA 3LU1A 1QIJA 2H1IA 3O47A 1C7QA 4LZJA 4OMFG 3SZMA 4JI0B 1YR6A 3FVQA 4R3WA 3KUXA 3M9WA 5EL0A 4UVIA 3AINA 4FONA 4ROTA 5C4MA 3CRMA 1J2JA 3B5IA 3MCAA 1WVIA 4Y0VA 2PL3A 1FMJA 1Q1AA 1OTHA 2GOYA 3BZWA 3QI2A 2DUMA 4G41A 4NULA 2YIMA 1PS0A 4OQEA 4UPVA 2IS2A 3SLGA 3UF0A 4BVHA 1TM5E 4ZN6A 4P0TA 1GEGA 5DNCA 3EXG2 1Y7HA 3I39X 3D8RA 4LZOA 3RVSA 4K6OA 4F72A 3RYIB 2YIDA 1IOWA 4H1VA 1GNTA 1YI1A 3X0DA 1RWBA 2LGJA 2FKAA 2O2ZA 2FEOA 3D6TB 1ILEA 4MRMA 1ODLA 4B3HA 4Z7JA 5JLJA 5L7TA 1DS6A 2GBIA 1AZSC 1SKMA 5JXWA 3DL2A 3RABA 4H77A 2E1RA 2C82A 1GTJ1 2Q3HA 3TNYA 3VPDA 4ARBA 3QWBA 3IMKA 1DSSG 1DQZA 3EXEA 3WTCA 3O73A 5C4IA 3FE2A 2D4HA 3WIEA 2C9OA 4C2UA 1XA4A 4A1OA 2PBZA 5JQGA 2VYCA 3ZJ5A 1WD7A 5GONB 2W71A 1TVKA 4LFAB 3ZE0B 1VOTA 2B69A 3PQEA 1QG4A 5IXYA 2G07A 2OESA 4WY5A 3UJPA 1PT7A 2WZBA 5AKXA 1D2CA 1SUSA 5E7JA 5AKZA 1X1EA 2GSDA 221PA 4RD1A 2DQKA 1G8HA 3MUOA 2Y68A 3PQ3A 1H5NA 1QQ7A 5CA1B 3QVMA 1Z73A 4D3ZA 4D5EA 3F1KA 1M1ZA 5IFLA 4R1UA 1Z5OA 3N05A 1XMIA 2JFHA 3T15A 4RGYA 3PF9A 4FDLA 2QN7A 1JPNA 4XFKA 4WVFA 4FX2A 4U7WA 5ED0A 2O5VA 3H8WA 3OT1B 1N2GA 2NIPA 3E7XA 3H5WA 4HGZA 4NQZA 1XZLA 2P41A 4C1BA 4IFEA 4D5GA 5BWLA 1JV2B 5JJLA 1Q14A 1BTOA 2EGGA 4ANFA 1J2RA 4BGDA 3M49A 5AM4A 2P68A 1QP4A 5LP6F 3KXLA 1N8SA 3ZN2A 4BV2A 3GOHA 1WL8A 4Y7DA 4MRNA 4YRAA 3WIOA 2IXAA 5EC8A 1IY0A 3AHDA 2H07A 1P74A 3DMFA 3JW8A 3U49A 2XCRB 3WLAA 4CKZA 3CIOA 2OGSA 3W2HA 1GNQA 2EW2A 2WF9A 5A9SA 1NZDA 2Q2OA 4FK8A 2QSJA 2R5FA 2IZ7A 3E9DA 2WTXA 4TT3A 2FLKA 1P18A 3L6BA 4WFIA 3U0VA 4JYMA 2A6PA 2F1RA 2E4XA 2QVXX 1EWQA 3AR9A 3G7NA 1T0BA 3TLEA 3CLTD 3ZTTA 4EKYA 2ZWAA 1CVRA 3MA0A 4HRXA 4CIWA 1WB9A 3S7TA 1M6VB 2ID8A 4ZOAA 3HHPA 4LTMA 1JXAA 3FNIA 1DG9A 2PX5A 3L7IA 5DNAA 5IHPA 3QEAZ 1AE1A 4HDMB 4RVNA 5CX4A 1YCDA 1E6UA 3SLRA 4ENSA 4YJKA 2VCEA 3TX6A 3DO6A 3R9XA 4QU8A 4X95A 5FNVF 1A8PA 4X8LA 5J2UA 4C4AA 2M32A 2IZ1A 2XE7A 3SIXA 1RKUA 1Q2XA 2FMXA 2ZB4A 4X7MA 2R66A 1H3EA 2QRQA 1SHLA 3QWHA 1LQUA 3TQIA 2BGLA 1K8QA 3WGMA 1MDBA 1FDOA 1ZGCA 5AKEA 1THMA 3F9RA 3L8EA 4PYOA 3T4EA 1JEAA 2GESA 3I6ZA 4ZGBA 2W2PA 5IN4A 2EHJA 4ZYYA 4OU4A 3BXZA 1THGA 4OIFA 4CUKA 2BKVA 1E94E 1U65A 2YY7A 4UVDA 2HU7A 3PI7A 4BNWA 4L7VA 2B9VA 2ZS9A 4EQZA 4EPTA 4F2GA 3BE6A 5LUAA 3U09A 3G9QA 4KQ2A 4G25A 3ANNA 4HMQA 1XMSA 4E94A 2PUGA 1DWOA 4BO5A 1QHFA 1KOFA 1T9KA 4HFRA 4QULA 5JCXA 1I2DA 1UCFA 3KKKA 1VE6A 4DDHA 2R3SA 4GNRA 3OT4A 5E38A 1E3LA 5EKTA 5C1OA 4WKNA 1ZS9A 5JWHA 821PA 4OLBA 3HCEA 5IVKA 3GFOA 3N8HA 1AUOA 4WBXC 5KYUA 4A73A 2CC2A 1N3BA 4XDZA 3PXXA 5K0BA 3N7TA 4R0VA 2VJMB 1DKQA 3I01M 1W6UA 4AAYA 4DEXA 3OA2A 4MIKA 3TW8A 5C3MA 3FDZA 4BFVA 2XMBA 4QL3A 3FF1A 3LNTA 1A7UA 2H63A 2E6UX 1JG1A 1R0YA 2HK7A 3C7AA 1YRAA 2X0DA 4AF6A 4B3FX 4BS9A 1M6VA 5FTLA 1SC6A 4TV8F 3FOWA 2R96A 1V3VA 1RWPA 1WOMA 2PD3A 4D57A 3PYLA 4ZCTA 4R8RA 5I7VA 3CINA 3DOIA 1YGYA 4DA7A 2PRSA 3ZCPA 2VUUA 2QUHA 5EUBA 4AS1A 4BTEA 2AMVA 4M9RA 4TT3D 4W6QA 1BEEA 2GZHA 4YV2A 1EK5A 2J1LA 5LQDA 3OO1A 4C3VA 3GPLA 1UBCA 1Z6TA 2C07A 3Q2IA 3S8EA 2AJTA 2VDVE 3LBIA 4S1VA 4ER0A 2VAMA 3HPRA 4DBZA 3BSFA 4AZTA 5A6VA 1UK8A 2PLFA 5BNTA 2FMUA 5AI0A 1NQVA 3X1KA 3ZS9A 5K8JB 1IL0A 3ADOA 3WDSA 1G42A 3NBKA 5K4GA 2CBZA 4DANA 4B81A 5CB6A 1SIUA 2FSIA 3AKEA 4G9BA 2QN8A 1JIUA 3PDWA 1U80A 3VNUA 1JLLB 4F9FA 3A58B 2G7ZA 3WYNA 3MLBA 1MMFB 3KAPA 3K8QA 4R84A 3I42A 2YJ4A 2PSEA 4A91A 4DW8A 2D5CA 3PL1A 4GVLA 4IV0A 3QYPA 4X97A 4QUBA 1V1RA 3S2EA 3ZGYA 1ESCA 2HJSA 3C3PA 2EFGA 3RGGA 1TW2A 2UUPA 3QBTA 3ZY4A 1HQYE 5BUQA 2DULA 3PPWA 3DMYA 3T3HA 2FWNA 3NC1C 2M2IA 5F3DA 3LCRA 1W36B 3JVIA 1QFZA 3SHWA 1J9GA 3F9IA 1E9FA 4IEIA 1FK8A 4ZMRA 3KQMA 4LOJA 1RZRD 2BGNA 2CFIA 1KOGA 3L02A 3SDSA 4L74A 4RTPA 3CVWA 1N2IA 4PR3A 1RJFA 2WSSA 1DDOA 3FTEA 3K9LA 4WAUA 2D3WA 3DAYA 3VOSA 1C8LA 4QBIA 3JAWA 2CBXA 2ZVDA 3CNBA 4B83A 5B37A 4BEBA 4PG6A 5ARDA 3U13A 2GEKA 1G16A 4OHCA 2XAAA 1X42A 4W99A 1EVQA 4Y1EA 1RBZA 4HQFA 3G2IA 1TQ4A 1BQ4A 4O2RA 5JZVA 2UXDB 4P80A 1D6JA 4BXOA 4TXMA 1GSIA 3OEWA 4J1TA 4Q9LA 4UMFA 2AQHA 3DOOA 3JQCA 3UZUA 1KP3A 3P2OA 2IBSA 3CUSA 3IB3A 1OI3A 1EQUA 1QRRA 3FNQA 3JAMA 5DHFA 5A3VA 1SUAA 5EFOA 4B75A 2PMDA 3GCZA 4IG4A 1ST3A 1WPQA 3FIJA 1ZONA 4WZAA 3GPBA 2CE7A 1NURA 1RHRA 3UB4A 5HTOA 5AM2A 1XZJA 2BGKA 2H06A 3DUWA 3ODPA 1EFAA 3KCQA 2XUKA 2P2YA 4KXFB 2HW8A 5EHGA 4TRRA 3K1YA 1H2RS 1CU1A 2HRBA 2G25A 3BC1A 4FDVA 4GXQA 1A27A 5AM1A 3ZLBA 2DY1A 1FRFS 4C4XA 4PLYA 3LE8A 2MIIA 4I6EA 4RSHA 4BBPA 5EZYB 4E32A 3BQNB 3D2LA 2ISCA 1WE2A 3EN0A 4JLDA 4JUFA 4KMMA 3WE7A 5JAUA 4RX1A 3GJ8A 4N8EA 1PWYE 4G8JA 4WINA 2IYWA 4FVTA 1FNNA 4NP6A 1FBTA 2VZ0A 3PNKA 3PD1A 4IIJA 4TQ9A 2RHWA 2VDWB 3I58A 4HEQA 5EWLA 3T94A 2CLOB 2F1KA 3UAYA 4BVFA 2C9DA 3M5WA 3VHXA 4HNAB 3TM4A 4BO3A 1PJZA 1DIRA 5IMSA 1W2WB 4YMGA 3F7OA 3VTKA 3JQBC 3T3GA 2PX6A 1E59A 3TW4A 2UDPA 3P2EA 4BMXA 4HDMA 1ZK4A 4H08A 4GI1A 5HX7A 1YB7A 2DHDA 1ACMA 1PW5A 2IHZA 3V4FA 1I6MA 4IH4A 2DT5A 3FROA 3C2QA 1B23P 2J3HA 7REQB 1H6DA 4UOEA 2OAP1 1QP7A 2B8JA 1DIOB 1F4PA 3DHYA 5EQDA 5FTMA 1P72A 1KDOA 2LXNA 1IIRA 3J7AC 1P1BA 1L4BA 2WRZA 2ECOA 3A6HA 2C57A 2W6IA 3IS3A 5E7IA 2IWHA 5IJ9A 3L49A 3BF7A 2OAQ1 3QY9A 4WFJA 5E95A 4L50A 1E4EB 5FJJA 3T9CA 1Q22A 1ZR4A 1FMTA 1JRLA 2Q6LA 3A3OA 4TWZA 1T2NA 1JFFB 1YS2X 2OAEA 2XD4A 4E1BA 4ZMSA 1Q92A 3BILA 3JQDA 4KOAA 5FBWB 3ZUGA 3BQ9A 1IUPA 3QU2A 4LY3A 2AN3A 3HDGA 3I73A 4QKQA 4KDCA 1SWVA 5T4BA 1N0HA 3I04M 3NNDA 4FP9A 1U0BB 4KPUA 3IT2A 5JJBA 2UXBB 1LSOA 4D25A 5FUQA 4B6RA 4PXAA 2GB4A 3MCTA 4R8MA 1PHPA 4ZKEA 2W22A 1C3VA 3EXIA 1B0AA 1CUEA 1S89A 5BN3A 2HZ7A 1NJ8A 2PLWA 4ZDWA 4HNHA 5KTRA 4QJIA 5DM0A 4KR7A 1QTNA 4YT5A 3BH7A 2YKGA 2YL2A 3FWKA 4NDNE 4BQQA 1PFVA 2BJWA 4F4DA 5C8VA 1SWWA 5I4CA 2VNJA 2Y0PA 5HQTA 1B8NA 1ODTC 1XZBA 4F5EA 4XPIA 3CH6A 3OHMA 1NXPA 2ALJA 1PBTA 3COVA 4PVCA 3X2FA 1HOXA 4AKTA 2P0EA 5BV8A 4WKPA 4GMKA 2FPXA 4QPNA 4RPCA 4KQIA 4KMOA 1F2UA 1K6JA 1UFVA 4AN4A 5HKOA 1NKTA 1VJTA 2NADA 4C43A 1CNEA 3E5NA 3REFA 4ZHQF 3I8OA 4FFBA 4KPEC 3H5NA 4KZKA 4MS1A 4D42A 1MGPA 4HRYA 5ITVA 3V1TC 1KMIY 1Z36A 2Q45A 2O8CB 2CYAA 3CPEA 2QRUA 2QKYA 3B1KA 2ZUTA 4FE3A 5FIUA 1QK5A 2OCYC 3AY7A 3I2KA 4YJ2B 5AYVA 4X9XA 1NNLA 4K0RA 4F45A 3N2LA 1DTSA 1W8IA 2VBIA 5JBNA 2UYOA 4GP9A 4Y9RA 3RAGA 1YDFA 2H7YA 1HEYA 2ZETA 3NPMA 4JR1A 4UARA 2V03A 3LC0A 1XZKA 1AN9A 3ZY5A 2HHHB 2A84A 4PAMA 4GQAA 4WKCA 5G0WA 3PT9A 3H04A 3PA6A 1EUZA 5BXYA 3SN6A 1JJFA 5G1PA 3B38A 2C7VA 2ATCA 3QYFA 1JR2A 1T4BA 3F4BA 1P5HA 3LT1A 1E79A 2JGDA 3H87A 2OP0A 4ENWA 2PLNA 3DW3X 1RCTE 3ZLVA 3EPKA 1GQRA 4NAVA 4URUR 4U3JB 1GP2A 3WTBA 1FUEA 1GRNA 2WWYA 4B73A 1KDTA 1XALA 1SCJA 4ZC8A 5K8VA 4UOQA 2A9KA 4RBNA 3RTAA 2VJQA 1N36B 2CVQA 1KAQA 4RMJA 3Q5EA 1K7EB 3ZWYA 1GRVA 3EEIA 3U5ZB 4N49A 1U0RA 3IX7A 4JJIA 1AKNA 4WX2B 5FPHA 5DK4A 1PX0A 3NYRA 1JXQA 3DAHA 4X93A 4KJZA 1B2RA 1U7XA 3H16A 3OX4A 4PQEA 1IBLB 3TKAA 2R8EA 2VJDA 4AY6A 3ZDBA 3IC5A 4WQMA 3W79A 5BQXA 3HACA 5BN5B 5JO0A 1UMKA 4B8YA 4IF6A 4YXWA 1DX9A 3UTCA 2NXNA 3KKPA 1UODA 3TLCA 3WBKA 4EX6A 1C4WA 3BS4A 1YDWA 5ESDA 3EEFA 1BVRA 2GFHA 3CPSA 2N0SA 3UPDA 3H84A 4K9LA 3ER6A 4AF7A 1SOWA 2O3JA 4UNIA 2KLHA 2ATVA 3BRWA 4HH0A 5HYVA 5J3JA 3LUHA 4K9RA 2OZLA 5LMUB 4Q9KA 1QFMA 2HWUA 5EQTA 5A05A 1SXJB 3N8KA 1DARA 1R7RA 1XDDA 3PRJA 16PKA 5EJAA 2WKSA 5J2UF 1ONOA 2PM8A 1G4UR 3DBVO 1MTZA 2DUUA 4ZQFA 3AYXB 3LPNA 5ADUS 3FUCA 1W87A 4M8IA 3RYTC 3SDBA 2ZUWA 1O6FA 3EIUA 5F7OA 4RWZA 1BFKA 1UXIA 4J4BA 3R76A 4HPJB 2OHGA 3MQ4A 1ZXBA 3LGSA 2OCGA 4DG9A 1DRUA 2LKCA 2RKOA 1G0NA 3AR4A 1QONA 5C4GB 1T36B 3SFVA 1A76A 3T1OA 3ZU4A 2PIDA 2H1WA 3GI1A 2AN1A 5J2TF 4PG4A 4IIUA 5HR5A 4QUKA 1TZCA 1E98A 2MSKA 1KWGA 2R9VA 4KI7A 1JT9A 3T0GA 2HEGA 5ILGA 1L8LA 3CSUA 1LRKA 2ZSUA 3GZNA 3WYAA 4D4GA 5EWLB 1WP9A 4NX2A 5E8RA 3U1TA 4E5DA 3JQ7A 2BDEA 4N0PA 4ZHQA 2WVGA 5LJIA 2EU8A 1GKYA 4Y2RA 4WNIA 3GU3A 4RV5A 1DWQA 2EZ4A 5DU2A 3K6KA 2VK2A 2TYSB 1ABFA 2I6SA 4RPKA 5BWNA 1RYMA 4P84A 4QUDA 5CA1A 3PNBA 4KITB 1ISPA 3MIZA 4L6CA 5K3BA 3AB7A 2CD9A 3BL6A 3R5SA 5HS4A 1X80B 3FA2A 1E3IA 4IOJA 2J3DA 2QMZA