1TZBA

Crystal structure of native phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
301
structure length
301
Chain Sequence
SQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLYISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDGLLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQMGVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPEGLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEFNENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEHQERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLAEIRGVNPLATPRIDALKRRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glucose-6-phosphate isomerase, conjectural
publication title A novel phosphoglucose/phosphomannose isomease from the crenarchaeon Pyrobaculum aerophilum is a member of the PGI superfamily: structural evidence at 1.16 A resolution
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Isomerase
total genus 113
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10432 bact-PGI_C Bacterial phospho-glucose isomerase C-terminal SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1tzbA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1tzbA02
3I0ZA 3HJBA 2XBLA 3C3JA 1HR0B 3JX9A 4JI7B 3FXAA 3OOJA 1IBKB 1IBMB 1XTBA 4JI2B 3ETNA 4X62B 2CXOA 3CVJA 4DUZB 4KHPB 2CXSA 4IVNA 1JXAA 1ZZGA 1KOJA 5A2QA 4DV0B 2PUWA 5FLXA 4DV6B 3T1HB 4AQYB 4B3TB 4DR7B 2VQFB 3HBAA 2UUAB 4LF5B 4DV1B 1JEOA 1TK9A 2ZJ3A 5IWAB 4DUYB 3PR3A 4LFCB 2CXUA 1JLHA 1TZBA 4B3MB 2E5LB 3J7AC 2I22A 4LFAB 1NRIA 2DECA 2VQEB 1VIVA 4JI4B 3IFSA 4LF8B 4AMVA 4YHHB 1WIWA 3FKJA 1HOXA 4LF9B 5LMUB 3SHOA 2J6HA 1HNWB 2F4VB 3QKIA 3EUAA 1XNQB 1X9HA 1IBLB 2CXPA 1VI5A 4JI6B 5LL6P 1XMQB 3Q7IA 1N8TA 2XHZA 4LF7B 2WU8A 1U0FA 4JV5B 1MOSA 4DR2B 2CXRA 2VF5X 3UJHA 4B3SB 4YY3B 4B3RB 3J81A 4LZJA 4DR4B 2CXTA 1N34B 4DV2B 4DV5B 1C7RA 1C7QA 1X94A 3NBUA 5BY2A 2CXNA 2POCA 2PUVA 2O2CA 2YVAA 4S1WA 3OTOB 4X65B 2PGIA 4DR6B 1B0ZA 4LF6B 4JI8B 1XNRB 1IRIA 3TRJA 4TOIA 1TZCA 3FJ1A 1MOQA 2UU9B 4JI1B 4JYAB 1DQRA 4LFBB 4M0DA 2E5FA 2ZM6B 2Q8NA 4JI5B 4U6NA 3J80A 3FF1A 1X92A 2PUTA 3KNZA 3T1YB 2CVPA 3M5PA 2HHHB 4K0KB 2X3YA 2ZJ4A 2CXQA 1N33B 2A3NA 5LMNB 1VI6A 2CB0A 4DV4B 1HNZB 1X9IA 4DR5B 4X64B 4NXMB 4JI3B 1VIMA 4EM6A 1GZVA 5BR8B 4X66B 4DR1B 4OX9B 3G68A 2UXBB 3LJKA 4DR3B 1N36B 2DF8A 1JIQA 1FJGB 1MORA 4LF4B 1N32B 4S12A 4DV3B 2UXDB 4JI0B 1Q50A 1J5XA 3BJZA 1U0GA 1I94B 2VF4X 1G98A 5I01A 1J5EB 1M3SA 2O2DA 1HNXB 1GZDA 2UUCB 4GKKB 3BCHA 2AMLA 3Q88A 3JAMA 5IT9A 1XMOB 1IATA 4DV7B 1T10A 4NXNB 2I2WA 2UUBB 4GKJB 2V4MA 3TBFA 2UXCB 1NUHA 1HM5A 3ODPA 1U0EA
chains in the Genus database with same CATH superfamily
4HSEA 1KI4A 1FXWF 2FWIA 5DXAA 1QGDA 3R7BA 3PE6A 1I1OA 3E5MA 1XHEA 2WIAA 5BOVA 2J45A 2UYYA 3TEFA 1ZK2A 4P4GA 2FEOA 2R4TA 1N5MA 3FWNA 3KUUA 2WWRA 1MAHA 3GZNA 3NM4A 2NTYC 2O5RA 3MWGA 4A2WA 5KOIA 2RKOA 4OI0A 1VMDA 2BHLA 2FPMA 1GFZA 2BUAA 1X15A 2CFOA 1H22A 4OXIA 5CA1B 4H3HB 4IJWA 2XVMA 4ME6A 1SUPA 3T12A 2VUUA 4A0QA 3HN2A 2FEMA 4ZT5A 2Q3DA 4RVUA 4BUZA 4H1TA 2N0SA 3FUVA 1R8SA 1LBHA 2JBAA 5AKJA 3UWKA 2QL9A 3MUFA 1RYEA 2GASA 3O0DA 3K7EA 4YJ3A 4G0PA 1DJQA 1ZXLA 3DMTA 4BCDA 1JSCA 1CQJA 1SBIA 2XH8A 4JODA 5EFZA 3TPZA 1YUBA 3U3XA 4XWTA 4BJ6A 4FYYA 1XVUA 1VJTA 3K3PA 3ZWAA 1LC0A 5E1DA 4S1PA 4YXWA 4XASA 3U7EB 2VTKA 5J43A 5KINB 1SZPA 3FYUA 4FCVA 4M54A 1E2EA 1APBA 1NXXA 3QVGB 4CWAA 3A4IA 3NHRA 3VKHA 3SLGA 1G6HA 3M1AA 1EE1A 1ACMA 1UT5A 2XAAA 3AUYA 3K35A 3L84A 3TRIA 2JBAB 3ZDFA 5E3HA 1CF9A 2HSGA 3P9KA 4ZYXA 4ZGGA 1CC1S 2W71A 3DP7A 1QLJA 1CVLA 4P7BA 1H2XA 3EZXA 1CV2A 4XZ3A 1C3LA 4NH0A 1QK4A 2NQ2C 2JBHA 1UXGA 2NZ2A 4R71A 1KNQA 2I3GA 1R4AA 3T3EA 5CM9C 1YOBA 1E69A 2GXAA 4GMFA 4F8JA 1S2OA 1JIUA 1G8YA 1VL2A 3CX3A 3EAFA 3HKCB 1Z8NA 3B9RA 3Q4GA 3U80A 3PGMA 5GVSA 3Q87B 3ESYA 2ETXA 1JQKA 3DLPX 3RJ5A 1PEKE 3EDMA 5FBHA 3TLXA 3O1HB 1CJCA 3RKUA 2WWXA 3PGA1 4MPPA 2ZJOA 2GTIA 2WHYA 1C3OA 5AI0A 2UKDA 3NEAA 2Z30A 5JDCC 2C7OA 2NO5A 5FFFA 1ONOA 5KX5F 1G9TA 4CKCB 4R84A 4C78A 3PLAE 3NBZC 1OX4B 4IQ8A 5HF6A 5BOSA 5HNKA 3GLIE 4GDFA 1BQ4A 4E08A 5A03A 4MLDA 2X14A 2PCJA 3FNGA 5AM2A 1EBUA 4BMCA 1TFUA 3EFOA 3IOMA 3UZUA 3ZV5A 1K8RA 2PUCA 3RYHB 5A3VA 2NSLA 1T34A 2IYYA 3PI7A 2P0AA 1Y33E 2C2ZA 3A3PA 1JS1X 1EK6A 4ESEA 5LXTB 4ARCA 2ZYRA 1TRKA 1JA0A 3KAJA 2C20A 2ZTVA 3F47A 3KRTA 1FX0A 3D4LA 3QHAA 1GPMA 1XLUA 5KKCA 1A88A 5TDHA 4IGIA 1C3OB 4PZZA 4JT4A 1JIKA 1MEJA 1UWLA 2NTNA 2ZSJA 4MUJA 4PRYA 4G84A 4WHMA 4GX1A 4FMBB 4ZYVA 4Z6KA 4LCJA 3LUAA 4QD3A 3B6JA 4C76A 2V7UA 4MUFA 2VHUA 2N3ZA 1XD2A 3AU9A 3FYHA 3NM5A 4TTSA 5EXEA 5KMGB 1NZFA 3U7IA 1XCGB 1ZJYA 1W85A 2EJWA 3O2QB 5F9MA 4BNVA 4XWKA 2ZZNA 1L5ZA 2PGLA 1V5GA 2CN1A 1QH1B 3M3PA 2HK9A 1ZBDA 3HVKA 3NORA 3GDHA 4UE3S 5EJIA 2V4UA 1M2WA 2VHYA 2ZAGA 3SIPA 2I3DA 3MELA 4FEYA 4L57A 4Y98A 2ZPUA 4CE6A 1MZPA 3BERA 4FW9A 2QWXA 2DKFA 3CX7A 1AC5A 2WRZA 4P3YA 4PGMA 3O75A 4XUEA 5AW1A 5FLXA 2BZ0A 2D0OB 2QA5A 3FCEA 3CX6A 5AOAA 1KVTA 4EHAA 4HNQA 1MB3A 1A5AB 5A5EA 4NQZA 1XD2B 2B0CA 2EX0A 1GUDA 3WRVA 1U9YA 4RY0A 1V8PA 1KSFX 1IG3A 1W85B 1XZEA 1RRFA 3V1NA 1QU2A 1DC7A 2NZXA 5A05A 1XX6A 5FLEX 2O8BB 1PJ4A 1DT5A 1PYOA 2F8LA 1G5TA 2QG6A 2YNMD 3FW1A 3PT9A 4HLUC 4LYAA 4P4UA 4QODA 3MCUA 5H3CA 2JL1A 1ENOA 4GECA 5JH7A 2P1DA 3OUTA 4RGYA 2J46A 3GT0A 4ZJPA 3ACBA 3UW3A 1BN7A 4FYMA 2C5FA 5BSHA 3CUWA 5CB0A 4BN4A 2X3UA 2DM6A 3GVCA 3VV2A 3OX4A 2N46A 4FQ7A 4WJLA 2O19A 2CGEA 1FDVA 4DA6A 3SC2B 2ISSD 4LYJA 2JHPA 4NCXA 1G55A 4U5XA 3GT4A 2BBOA 1F06A 3JAWA 4NV0A 2I4MA 1YZYA 1H93A 2WVAA 3DF7A 1BS2A 2PZJA 3EHDA 3TZLA 2QMHA 3WL7A 3IO3A 2V6IA 4GR4A 5JYDA 1GZHB 3EJWA 2EP5A 4I55A 2BN4A 3DTNA 4OBEA 4F4FA 5L8VA 2BFEB 4X60A 5FLKA 3N2KB 1KARA 5A9RA 1ICIA 1B74A 1HT0A 4RO0A 1CJKC 1P60A 4UBIA 5FFNA 1OXMA 1GUZA 2OCXA 3NWPA 2QVXX 1JL3A 4IM7A 1K2VN 1TYAE 5D3KA 4Z4HA 2OE2A 4HTFA 5IF3A 4K9DA 3D6AA 4EI7A 1Z6QA 4JUFA 3JD4A 1QIMA 3L0ZA 3QPWA 4YUXA 3FIUA 2R00C 4WXPA 5E1BA 3OCYA 3VKFA 4PLPA 4CGZA 1B6GA 5FTJA 4GBMA 3OJEA 3HJHA 4DLLA 1WW3A 2PBLA 4ZOAA 3GZ4A 4JLSA 3FPSA 1YIDA 4O0MA 1EFTA 4CNQA 1GAXA 3A0RB 1YFLA 4KPYA 3P2JA 2IYXA 5ICMA 4DDTA 1T5OA 2P5YA 4BQPA 1PZEA 1EVZA 2VJCA 3DBHA 4O4IA 4YRCA 4EUEA 1Q19A 3GB9A 3KQWA 2BUBA 1V3VA 1CJMA 1RRVA 4HWKA 1N2IA 4XIIA 5LA6A 3PLRA 1MXFA 5IDQA 1Z34A 2A9KA 1I7NA 1OASA 4BLWA 2X19A 1X3LA 4UHJA 5DDIP 3VPXA 3K9FC 1THMA 4EL5A 4PAOA 2ZJBA 2G8LA 3N86A 1AKNA 2QXTA 4GKJB 3D3WA 2YYYA 2I8AA 2W11A 4MXDA 4ESOA 2R1VA 3C48A 3ZY6A 1L1RA 4J1SA 3I0ZA 4REQA 4A0GA 4G5HA 3QLJA 3OZWA 3CF6R 3EK2A 1S7GA 5DRYA 3RT9A 1LV8A 1DS6A 3MUNA 4BASA 4O4IB 3B1WA 2YHSA 5GOTA 5J2TF 3NHFA 3W4JA 2QRVB 2ZU0C 1DG1G 2VSYA 4WFKA 2HF2A 1R9JA 3EFBA 2G06A 4KGXA 3VAYA 3HO8A 3ZWWA 5LA6B 5D7BA 3PXUA 3B7WA 2GBLC 3D8UA 4FGZA 1ZZGA 3GEBA 3E4CA 3KSZO 4IL5A 4J4HA 4AN4A 5HQTA 1UOPA 1N1DA 1RJWA 4X71A 4DEVA 1EDDA 1A5ZA 5L95A 1ZPDA 2J9FA 2PZAA 3PUJA 4CMHA 4LK2A 3BPSA 2EF0A 1EFCA 3HCEA 3DO6A 1YNSA 3IURA 4F3CA 2GBCA 5FUVA 3D3WB 2FOLA 4BKOA 4K9NA 4GPZA 2RHLA 1TUGA 1VKOA 1W5SA 2Y27A 2ZJZA 3MMZA 4I8DA 2Z3VA 2XSZD 4REQB 3LCJA 4Z1MA 5TQJA 3K94A 4YVFA 2F1RA 4ESVA 1JEJA 1ETUA 1LX7A 3FGOA 3JQQA 3R3YA 1AZTA 1P2TA 1XTVA 2AZMA 3RU3A 1NC1A 4FFVA 3RWBA 2FZVA 3VU8A 5JH7F 2IEGA 4PAWA 4OV6B 4W7SA 4TMTA 2BE7A 1C8KA 2PXXA 3DZHA 4L0CA 4R7TA 4JBXA 2FPLA 2CYBA 1ZUNB 2R68A 4KUGA 1O95C 4UVEA 5GV8A 5KHOC 4LRQA 4EJMA 1NURA 3AL3A 4N8EA 4QUIA 4I5GA 2Q8QA 4JEHA 5ERGB 1JB9A 1JNXX 3V1YA 1BX3A 4F2DA 4TYNA 2ORIA 2XMPA 4QFDA 3BK1A 3L6RA 5K2OA 4QHTA 1XA3A 3WXMA 3AY6A 3NPAA 2W6ZA 1NBME 1GG5A 3Q3VA 1JIXA 1KZ9A 4KNVA 1KHTA 4LDNA 3PDIB 3A6JA 4XWGA 4X54A 5FI0B 1YGPA 2XTAA 4M7RA 4Q3AA 4BBJA 1D6SA 4P0PB 4I55F 2G28A 1C2YA 1BMFA 5IUKC 3VO1A 1IRIA 5K3FA 5ES4B 1KIFA 4FLEA 1TEHA 2JFPA 4ESHA 4RTRA 3GLHA 3O8NA 1DQRA 3BRCA 2F4NA 3M6XA 4KLZA 2H2GA 3QWHA 4P4LA 5GGYA 3UXMA 2CLDX 3WYNA 3QUBA 2NG1A 3TCKA 4ALIA 4K0KB 4I8XA 1KZ7B 2RJ3A 4PLGA 3ZY2A 1CZNA 1VBKA 3CZMA 3GEPA 5FR2A 1Z2EA 3TLZA 1I2DA 4B6SA 1EX7A 1CLEA 5INTA 4LC1A 1WXHA 1PD0A 2BL4A 2YV2A 2W58A 1AY0A 1Y5IA 2YZGA 4DDMA 2IU4A 4MLPA 5K3FB 3AFMA 2FN9A 2AEMA 4I4NA 4TM7A 5EZYA 3VPSA 2CT8A 1S3FA 1ENYA 1CRZA 1ZC3A 1TF2A 3R6GA 2VDPB 2XWSA 1M5UA 3FTNA 3GLHB 1X9GA 2WTAA 4FZ3A 3DSRA 2CJYA 5KDLA 2IELA 3E5NA 3GD7A 2EBWA 5D51S 4KXWA 2IS1A 3MCVA 2HWWA 1DFIA 2JFQA 5AXAA 3V7YA 2P4UA 5C46F 4F9FA 4DA8A 1VTKA 2WAAA 4ZCTA 1MC5A 2BELA 4RF4A 5LB2A 4IF4A 2AVNA 2G17A 2XGMA 4LJLA 4GKKB 1NZDA 2A5YB 4INZA 2Q6KA 1D6JA 1FUYB 4RULA 1JI3A 1QTQA 3OHSX 3CS3A 2D62A 1IXRC 1VLHA 4D8YA 1ZHHA 4M99A 4IHJF 1QDUA 1FX1A 3B6MA 4FUTA 4QBGB 1FYXA 2ET6A 2BRUC 4GZLA 4TXMA 3L6UA 5LD2B 3HRKA 3GG2A 5LWHA 4HAXA 3STVA 3JX9A 2F55A 1LCIA 5REQB 1Y8QA 2BH9A 1K86A 1NSTA 2OG2A 4F9GA 5J4YA 3USES 2VRCA 3ENWA 3FB4A 2IXAA 3K73O 1P1CA 3HO6A 4O2BA 3TCNA 2V7BA 4RTQA 3SR0A 2DSNA 5U1PA 2W2OA 5FPYA 4MWGA 4ZI5A 3WSWA 4JQCA 4MDYA 2OV8A 4PWYA 2RGRA 3N1UA 5K3OA 2QD5A 3EYWA 3LVBA 3WGJA 3M6MD 4CTNA 2BTQB 4ITUA 1N2OA 3I9MA 4ACAA 1D9ZA 1GLVA 2M6RA 4C4YA 4FB5A 5KSZA 1P9RA 3FWKA 2GHRA 1JLHA 3CUVA 3UK2A 4ARIA 3H9EO 2OBNA 1FTWA 3RADC 4H4DA 3LRPA 1NUSA 3ZUPA 1TIPA 3CY6A 3DT9A 2JGLA 3AONB 4WOPA 4Y0NA 3EPLA 5IAOA 1WIWA 1ZH6A 3D5EA 4A23A 4O2BB 3VYUB 2ORVA 3RPEA 4BVBA 1P4HA 2FGKA 1H2RS 4Q1EA 3ZNNA 3UJ7A 5C4IA 3ZGZA 1DG9A 3BEOA 1ZJ6A 1QOZA 2UV8A 3FFXA 5IVDA 2HU7A 3TXXA 3UK1A 4E0BA 2IDMA 4LJAA 3BGIA 1GLNA 3K6JA 1M83A 4ZEWA 4PXSA 3E7FA 3INYA 1E3DA 3GQBB 1V71A 2EC5A 4JKYA 5AK5A 2CDBA 4D46A 5JY6A 1B26A 4TMVA 1YJAA 2IF2A 5TQ0A 4K3VA 5IBCA 2ZI9A 1HY3A 1Z38A 3L02A 1A50B 4V24A 2HNKA 3LQ1A 1JMYA 2EQAA 1OYOA 1ZM3A 4DYDA 2A35A 4HL6A 1AGPA 3FJYA 3KLNA 4B4WA 1X0XA 3FFBA 1XWIA 2EZ4A 3U31A 1XHLA 4WBNA 1B1AA 2W2XA 2AJTA 3EC2A 4H17A 4BU1A 3BXXA 1W8DA 1FFSA 4P7JA 1IIRA 4UD6A 2X6TA 4HNRA 1SB9A 2WINI 1NNI1 1MEOA 1RRPA 2QUIA 2JF0A 5T4FA 4AI6A 4G1CA 2ZYAA 1W36B 2QPOA 2GYUA 3VR1A 1IJBA 4L27A 1YI1A 1AURA 3AW8A 5TQ0B 3AUUA 4PLFA 4KPEC 2ARKA 2NM0A 3BE4A 3VDXA 2AVDA 5HM8A 4FHZA 1E9EA 1KYIA 2DF8A 3NC1C 4PPGA 5LMCA 2DWOA 3GNSA 4P36A 4OQQA 1J2TA 1QF6A 4EKEA 1PG2A 2BW0A 4DRXA 4Y2SA 3DDWA 2Z9DA 2Y1LA 1Y6ZA 3RJMA 4ER0A 1G8GA 2GJSA 5I51A 4MO9A 5EHIA 1GZDA 3P2KA 4BN5A 1SUWA 2CB9A 2Y68A 3A3NA 4IMRA 2H4FA 2YHUA 5AJXA 3KSAC 4IEEA 2CMFA 3ZBTA 3UG7A 2FQ1A 1QQ5A 2WHPB 3L93A 3WNCA 1KY2A 2CF6A 1EVKA 3D6JA 1ODIA 3WIBA 2RDMA 2ZTHA 3IHWA 3OA0A 3KTAB 3QYPA 1FU4A 1IE3A 4HH4A 5JE8A 1T4MA 1VL5A 3WHIA 5EP3A 2ZT5A 2VDMB 1YUMA 4P38A 4ZDWA 3G85A 1QG4A 3D8RA 5BSKA 5JADA 2VF2A 4EECA 2ADOA 2JI8A 3CEHA 1OHHD 1VMKA 4Q9NA 4MGZR 3RVMA 4IQFA 2BGMA 4O4HF 3RTCA 1DVRA 3MW8A 1DIBA 4GF5A 2BR4A 4BVEA 1H5UA 3PDWA 4CT0A 2FKNA 3AR2A 4IZIA 4OU4A 4PWZA 4XRGA 4C0JA 5TMPA 3GR6A 1LVGA 1M7BA 3LHFA 3MF4A 4B3TB 4MW0A 5JUWA 4Y9SA 1S89A 1Y42X 1OI3A 5M04A 2OZPA 2YQZA 3HHPA 4N6GA 2BTOA 3EDOA 2JH9A 4OQEA 1N5DA 2C5BA 1XTZA 4PSDA 3EMVA 1QP8A 4YRJA 4BAGA 3NQ41 4YRIA 2AQKA 2RHCA 4YRNA 2VHVA 3WXBA 1I2CA 2C0CA 3J7AC 4OLAA 1E2GA 2CLHB 1JLLB 1XLTC 4MW7A 4U2GA 3O8QA 1G8SA 1YDGA 3QNUA 5EESA 10MHA 2J8ZA 3DLAA 3HZOA 1P1RA 2WTMA 3TZ6A 1P7WA 1D5CA 1E98A 1JR3E 1OZFA 2VK8A 3AEYA 3F3MA 4JXKA 4LHVA 4X7MA 5ECWA 4IS3A 5H4HA 3V1TC 2O1WA 4F3NA 3DYIA 1N5IA 2DG2A 4BFYA 4A5SA 4B85A 4G0YA 1KYYA 3EMDA 2BI7A 5CBKA 1EUDA 1IDOA 4GWLA 5AKIA 5JPCA 2N47A 5EZSA 1R6VA 2RHGB 4MWCA 1JLSA 1C3EA 4Z9BA 1K27A 4B2PA 1ZESA 3AR5A 4QDJA 2EDCA 1AO3A 4ZOLB 3QE0A 5SV2A 3VXKA 5DLPA 3WI7A 1XYYA 2O2CA 2WF6A 3GO4A 3HYNA 5A4AA 1JALA 4EO4A 4WVLA 1S3IA 2F1KA 1I0LA 1RJFA 2B4RO 2CFIA 2X9VA 3OFSA 4A0HA 1B8UA 4CQLA 2RBGA 1YNOA 2JIZA 3ROXA 2WYOA 4DDWA 2QLMA 4M4SA 2M1ZA 4WBNF 5IULC 1K6MA 1M5TA 5K99A 2BF4A 1GZUA 4CM6A 2D1RA 2BV3A 4XYMA 3U7HB 3OF5A 3DLCA 4EUFA 9GPBA 3HKBA 4UFNA 4AJJA 4HNVA 4HATA 5KYKA 2DHRA 3KKQA 2EX1A 4DSNA 3F74A 4ENUA 1SVMA 4WA8A 1O96A 1CQIB 4N9WA 4RH0A 3WYFA 4NXMB 4CUJA 4RFLA 2W6PA 1BE8A 5MDHA 1ZW6A 4JI3B 3Q11A 2V3VA 5C7OO 3OT4A 4W1QA 3SBOA 4P4TA 4F11A 2DLCX 4ZOBA 1CZRA 1UFRA 2WBLC 2P78A 3ANMA 3EZ9A 4MWSA 2VDKB 1ESEA 5ALGA 4M0PA 4CQLB 1NPDA 1KAQA 4XIYA 3HWWA 4GRDA 1E6LA 2OWEA 2P75A 5DJ5A 4Q82A 2QTLA 3PCRB 3QEKA 4M38A 4YRFA 4P84A 4S3MA 1CEQA 4F5DA 4AY6A 3IBFA 3C6KA 3DGFC 3VPDA 1DJMA 1ZINA 2AH5A 3H0EA 1K0UA 1UJNA 2LKDA 1SUAA 2PYDA 3R3UA 4C0BA 2OXIA 2G25A 4LSWA 1XMSA 1UK9A 4MKFA 3REFA 1S9DA 4KE7A 3B85A 1RVV1 2P9HA 4WN9A 2UVPB 1Q92A 1PS9A 4EBBA 4I3GA 3CPEA 3OT1B 1ZOIA 2GZAA 2PUBA 1S2IA 4MS1A 1SD1A 2GO7A 4ARBA 1XEWY 2BE9A 2H06A 2ZE7A 3BQ9A 3G49A 1GA4A 3TE7A 4EL0A 4C7VA 1U94A 4V0ME 4M1SA 1WMAA 3G0HA 4Y2TA 2ABWA 2PQ2A 4GI7A 3WBFA 4U39A 4CKWB 4FX2A 4UJ3A 1HUQA 1SU7A 2NO4A 3GFBA 4J2OA 2QVGA 4YN3A 2XVZA 2YKGA 1I2MA 2MWMA 2I7VA 5EE5B 1I4WA 2G1AA 1D1SA 1EFVA 1WF3A 2DYKA 3DHWC 1GZ3A 4LHWA 1TKBA 1CUEA 3G0OA 3GX1A 3NWOA 1KPIA 5HRAA 1K9SA 3IBTA 4PBTA 5B53A 3SWWA 1HTTA 2OECA 2Y9PB 3BVPA 5DNCA 3CJRA 4ZEXA 1SWVA 9ATCA 4WOJA 2VUHB 3JQBC 1BNCA 3E7XA 3ELBA 1JDJA 3P8ZA 1N6NA 4DVJA 1CUXA 3RBXA 3B1ZA 3Q12A 4JP8A 3PQ2A 1ZO8A 4MW1A 4NE2A 1VC2A 1NLUA 3DOHA 3GAAA 4B84A 2R6ZA 3OAAD 1W5FA 1WZNA 2ONZA 4RCVA 4EHJA 1CZUA 2CNBA 2X9NA 4MI6A 5B6JA 3ZE6A 1M74A 3BGWA 4EJSC 2RC6A 4H27A 2YRXA 4X3PA 5D3ZA 5C8YF 3QYFA 1ACJA 3AF2A 4OIMA 2JCVA 2IA5A 1CETA 3PI6A 1M1XB 2HN9A 3QVWA 4H35A 2WHXA 2WMNB 1GA1A 4YQYA 3U62A 1P74A 1V9CA 4ID9A 2JRCA 4EMBA 3SDZA 1UZNA 2ZTLA 3NDPA 4TYPA 1Z13A 4E22A 4UBMA 1IN7A 1V7QA 3EJ6A 4F91B 5JDCA 4E70A 3AOEC 3RUCA 2EHDA 2PSJA 3O26A 2RCNA 3VHXA 2YZMA 3DP9A 3HSKA 1S96A 2AQ8A 2HMWA 1U99A 2FH5B 1Y4DE 2PL9A 2WNHA 4UEOA 4Z3DA 2JJMA 2ZJ1A 4BEBA 3VHRA 1ISIA 4FT2A 3W8EA 4LFBB 1MO3A 1E77A 3L40A 1UQUA 1NFRA 2VNJA 3G82C 3VJKA 2J6BA 1YJBA 2QLLA 1JJBA 3AHFA 3NRBA 4RK5A 6ABPA 3HR8A 4LZNA 1E0AA 2Q21A 2JLSA 1NLFA 2E6KA 4JZKA 1P91A 5D8DA 4ARSA 1H1TA 2VHTA 2AEEA 3CLKA 3RC2A 4EZIA 5C2JB 1GNRA 4BO5A 3BQMB 2BFBB 1EWRA 1V45E 2VHQA 4BQIA 3PC4A 3IBCA 4JGIA 4NBUA 4MTCA 1G5RA 3ZHSA 2EW2A 5HQ3B 1ADFA 1RSZA 3OCCA 3VHXB 4UTVA 3QLTA 5K8JB 3N59A 1JHDA 2OAQ1 2O48X 4GR5A 1G291 5DHTA 5JXHA 2ZTMA 3G7NA 1N5OX 1EXNA 1J1UA 4MSUA 2QD2A 5JNSA 4REOA 1IEWA 1GRQA 1TTPB 4E5KA 1SULA 1CY2A 4I1YA 3KHKA 4Y0VA 4D5GA 5KO2A 1V5WA 4JZYA 3VOTA 1KH2A 2JVIA 4JCCA 4JXJA 1EFRD 2CUTA 5FWXA 2DY0A 1EVJA 1QBKC 3RKSA 5HZKA 2GFQA 3CW9A 1M2VA 3DOIA 1XRNA 2D0PB 1WM1A 5ENZA 2P30A 1IPHA 3LWZA 4AW9A 4MUKA 2DTXA 2EIHA 4O1MA 4XTRA 5K6AC 1RR6A 3QEMA 3W3AD 4IXMA 3Q8KA 1Z6PA 3G5MA 3O03A 3K9GA 4IDOA 1DELA 5F3DA 3K6KA 1KK3A 1MX5A 3KBBA 4DLBA 4B83A 1FXUA 1N7IA 3WVNA 4YV2A 1Z5OA 4DIEA 5ADWA 2WJZB 3OQJA 4FBMA 4HLUA 3JZMA 4AJ4A 4CTMA 4YAOA 4D3ZA 2VTVA 2JCYA 4CG2A 2Q1YA 3O90A 1HT3A 3CUKA 5ALDA 2C92A 4M86A 1M34E 3HBNA 1ZJ4A 3NT5A 3OFKA 3O93A 1MC4A 1N2SA 3AETB 1TZJA 3I42A 4Y6OA 4E7PA 3DS8A 3H8VA 3K5IA 2R25B 3ICWA 1ESDA 3QEMB 4KQKA 4MITA 4EG6A 1FDTA 3G6KA 4W5NA 3D2BA 4NATA 4YWJA 4CM7A 1VIVA 4K28A 1NY5A 2ZJ8A 3BC1A 3CNHA 3R9XB 2EV9A 2FZEA 3M4ZA 2WVHA 4HAYA 3FKJA 1TCUA 2I4RA 3A9TA 2HXSA 3NOQA 4DCSA 3QZUA 4XYEA 4YCSA 5I9IA 1VDMA 1R6TA 3UATA 1H4TA 1OXVA 4M37A 4BX2A 3TG2A 1QCCA 4Y7CA 1HEYA 3UBTA 1ND6A 1XK7A 1PQWA 2EARA 3RAJA 2JGJA 2EZUA 3PQDA 2EGHA 3LPMA 4MV7A 4Q4JB 1RI4A 2EP7A 1TM4E 3HBMA 4HKTA 4XJXA 3GJQA 1JAYA 3B20A 4ZYTA 1D04A 1CY7A 1H1DA 3IXQA 4NCIA 3IAUA 4RS4A 4XGRA 3KAQA 4XUGB 5ES3A 1WQ1R 1COWA 1X7XB 4EA6A 3BIJA 1FQWA 4JCOA 4LQCA 4GR9A 3ZXXA 4MP3A 5EZ5A 4CLHA 2R00A 4RTMA 5IJXA 3ET5A 5L6LB 3LYUA 1YFZA 1SB8A 4ALJA 2ADMA 2ZTUA 3A14A 3G2KA 1BJKA 2OZKA 4R8KA 1QYWA 1P3DA 2AR9A 2B35A 1P3JA 1OZHA 3C3XA 4GBGA 4I19A 2DX7A 3PF8A 2DULA 5JZVA 2UU9B 4YONB 1HFKA 2COKA 4MAMA 1T1IA 3WKDA 5JCZA 2JNWA 2QGNA 2DJ5A 2ISQA 3CNBA 4XX0A 1YF3A 1NQWA 4DNOA 4CLEA 4WNIA 5GGXA 4UW9A 2V55B 2CXHA 3N3BC 3QMVA 2APJA 5AHXA 3LFTA 3B8HA 1T6NA 3OE4A 4BNGA 3K70B 3EZYA 4IOKA 4X64B 1NUQA 1ZH4A 3GZJA 1SHTX 2F8SA 3OM0A 4UXJA 4HRYA 3BWCA 4QLOA 4DEYA 2CEAA 1J20A 1MO6A 2OLKA 2VUIB 3AESA 2EATA 3ROPA 1D5WA 4QRIA 1ZCFA 3SYNA 3NBQA 2WKSA 3OM1A 2NO1A 3OPXA 3VPBA 1XPRA 1E96A 3S70A 2N1MA 1G8KA 4YPVA 2XNHA 3OEHD 5G0UA 3OZIA 1N6OA 2AUMA 4LECA 1NBMD 3U1BA 3P2OA 4C4TA 2WM2A 3NOVA 2IBSA 1FRQA 1ZK3A 4XM2A 3R8CA 1NIJA 2F62A 4S1VA 3R40A 2HAEA 5I9TA 2O7RA 5B3KA 2GBLA 3ZGVA 3UN1A 2IE8A 3HUUA 2XZDA 4OQPA 1T5HX 4LMRA 4C14A 5BORA 4IDAA 1P7CA 4Z49A 2JFUA 3AB8A 3FYCA 4Y67A 1LKZA 1RP7A 1SU6A 2XNDA 1QAQA 4DMCA 2ZJ3A 4E94A 3WJ1A 1PEDA 2P2GA 2ZWVA 3T4XA 4CEJA 4AJIA 1RNLA 1DBPA 1I24A 4OFXA 5EXSA 4PZCA 3DE1X 5GJVC 2VXBA 1XTBA 2BM8A 2H1VA 2QRMA 3F6BX 2WOOA 5A7HA 2J9XB 3VYWA 5LCXA 2NADA 2QSUA 5AYVA 2QPTA 3Q2OA 1IONA 2R65A 4PIMA 1RFGE 1XZCA 3NTXA 3KVNA 4TTQA 3SZ3A 2CNOA 4I50A 3F98A 4I46A 3UMRA 2AOWA 4CL2A 4BXOB 5C80A 2VJPA 2QD3A 1VA5A 2J48A 1UKAA 4JLPA 1THZA 1AQUA 1O95A 3HYCA 2R8ZA 2ZUWA 4ZXPA 5IKPA 4H6VA 4QBIA 5JNLA 3LT4A 1IBRA 1AU9A 2W70A 3DHNA 1E3IA 2QI9F 4CEJB 2NYAA 4OY3A 1N5JA 1K5DA 3NHPA 4H7IA 2E7ZA 3R1IA 2WIBA 3G7SA 3OQBA 4ZQEA 5LVAA 2RONA 2VSQA 3GCXA 2NX2A 1TAGA 4FONA 4B3CA 2QTCA 5EP2A 5EN4A 4JL6A 3CRMA 5LR6A 3L7DA 3QLUC 1AV7A 5K3SA 2ZR8A 1DIGA 4EMTA 5BN3A 2G9RA 2CXPA 3H05A 5JISA 4DV6B 5ICEA 1W46A 2RBEA 3ISTA 1L6IA 2QTBA 5DXJA 4AULA 4DMRA 1OBHA 2VT7A 5LPNA 1PGPA 4HO1X 2C82A 5ICCA 2VP6A 3W77A 2C5LA 2A84A 1JTFA 3CRW1 3O94A 1IHUA 4Q9DA 4D25A 3ZQ4A 4QU0A 2QNBA 2GK3A 4DFDA 1V26A 1HWYA 3OO0A 3L4SO 3PGLA 5IC5A 2P9QA 2XECA 3H11A 4A2CA 3M4XA 5K3AA 3UJDA 2QXUA 3KT6A 4KTVE 5ALWA 4C29A 5CXQA 3CF0A 1OFVA 3LLUA 1PX2A 2P2ZA 3OCXA 3ZVNA 2P0YA 5JIBA 1Z7BA 4J3FA 4L15A 1IY9A 4PZLA 4DBVO 1KSJA 4HPWA 3TKLA 4EFLA 1PGOA 2CLIB 4MINA 4NCKA 1ZD2P 1H8EA 2QJTA 2PX3A 3HYRA 5DX8A 3TZKA 3A04A 2JDID 2Y0EA 5LKAA 2OGZA 3DZBA 4DPLA 5EIBD 2Y1XA 3GZTB 5CDSA 4FE4A 1AD2A 1E0SA 4DM4A 1HE8B 1HKHA 4BO3A 4EO7A 1R6BX 4NFYA 3EQ2A 2JAHA 2QN6A 1ZJ5A 3T0GA 4PQRA 5DSTA 2AOXA 2PS1A 2WFZA 4OYRA 2C4KA 5ALMA 4O25A 1QWSA 3BD7A 5TS2A 4NHOA 1T5BA 2J0UB 2R5FA 3TQRA 3T5DA 3ZE9A 3V48A 5DHAA 1R0SA 4OL0A 4Q3KA 5DNDA 2KLBA 5DYWA 3ONWA 5CDGA 3QBTA 4XFDA 1SVIA 2BRUA 1XV5A 3D9QX 5BNWA 5CB4F 5I6DA 1K5GA 5KU7A 2FUG1 3ZJ4A 2XYHA 4CLXA 3CWCA 1O8CA 4ZKDA 1QUFA 1QGZA 2R7NA 5EHNA 4R2JA 3QP9A 1OWMA 3VR3D 3ZDYB 1A8UA 3EXG2 3GLUA 1NY6A 3WLFA 3OFNA 4LXTA 3MFYA 2UXCB 2Z2ZA 3BE8A 1JQ3A 3LY5A 1OH6A 4L16A 1A4RA 4KU4A 5EVCA 3AO0B 3URMA 4F5YA 5A4DA 1U2QA 1ZD1A 1CULC 3T9AA 3FOCA 3GEHA 3LFUA 4QU5A 2OCYC 2I54A 4P81A 5DB4A 1XZIA 3BORA 2P68A 3VYSB 4WNAA 1V25A 3ITKA 5LIRA 5C1PA 4WOKA 4K6KA 3VR0A 5DCUA 4I50F 3RC7A 2E48A 3V8MA 4HMPA 1Q3KA 3A6DA 3OCJA 4HDNA 1KDVA 1Y1RA 3LUFA 3NONA 5EE0A 1XPJA 4U0KA 1OU0A 3S2ZA 4R3WA 1YULA 5A4JA 3FAZA 1JSLA 2CFSA 3V55A 1CDEA 1OU4A 1F20A 4G4GA 1JQBA 1A4UA 5BR7A 3D0OA 3U26A 3K9CA 4L5BA 3EISA 3TNYA 3SYTA 1YKSA 4LGMA 1HOXA 1NAIA 4C2BA 1NQVA 3CT6A 4H15A 3TQOA 4U8HA 5IUJC 2NUAA 1VI5A 3INGA 2WR8A 4ABYA 1NYLA 3P0JA 4FYVA 4MIEA 1Z6AA 3I3SR 3MJVA 1DKNA 2B2NA 1G20A 4JB8A 4KR0A 1QWOA 4KJXA 3VDQA 5JT1A 1SKUA 2G82A 1MVNA 2ZAYA 3AVOA 3IAXA 1QQ6A 1RW4A 3HBJA 4YLEA 4CKYA 2I3BA 2IYTA 5TRTA 2WJVA 3D2LA 2HHJA 3HFRA 1MA0A 4ZIRA 3I9FA 2J3IA 2OBMA 4PZ0A 1QO0A 4UHDA 5EFOA 2WEKA 3DLHA 4PLVA 1J39A 3B48A 3W2HA 5KTTA 1ZAYA 4IIUA 5KJ6A 1LDYA 4AMBA 2BEUA 4BLOA 2NUAB 2W6MA 1IIBA 2W0SA 3TCXB 4HAZA 2E82A 4MVCA 2O23A 5KBYA 3VC7A 1NBOA 5HP4A 3L4BC 5EWMB 4G1MB 1QO9A 3NP9A 1UJ2A 5DSXA 4FX5A 3B78A 3W5HA 4C4OA 3WHKA 3SVTA 3SC4A 2VBIA 2RE8A 2OZLA 3LDHA 5LB4A 1SBYA 4O4JA 1XZMA 3REOA 2YWHA 3KYCB 4NZMA 4QRHA 4XQ0A 1FP4B 3M2TA 2AG0A 3F8TA 3QIVA 3HM9A 1P0PA 5HKAA 4IG9A 2NZJA 4G81A 2WLSA 3RS3A 4AJPA 4V3BA 1JR3D 4FJ1A 5JD4A 2G1PA 3H4MA 1D7OA 4TS1A 1II9A 5LZ8A 5A9SB 1UOEA 5M7EA 4L07A 3WIOA 1XNJA 1ULSA 2QXYA 2PYIA 3DE0X 4TQUS 1UPXA 3ELDA 3HFGA 4D3SA 3BMOB 3UUWA 1JTEA 2X1MA 4Q93A 2OGTA 3BCHA 2CNWD 4Z9AA 1WDWB 3T9CA 4O4JB 3K96A 3DQQA 4NL4H 4Y2VA 2ECFA 2FWNA 2EJUA 4MR8B 1BHQ1 3ZWXA 4KBYA 3MHTA 4US1R 3TQCA 1JE0A 1QHIA 4ISBA 4Z4GA 5FBWB 2QAGC 3NAZA 3MERA 1B8NA 1I1NA 4JI7B 1IBMB 4OQYA 3OD1A 2R96A 4HDQB 2VDOB 4N5MA 4PQEA 2H0RA 4CRWB 1X1DA 1B0PA 4MYTA 3R0XA 1XLTA 2FFQA 2FPGA 2VT6A 2ZJ7A 5C37A 2YY6A 5A2QA 2OKGA 1N25A 4R98A 1NX6A 1OIVA 2MTBA 4P82A 1S1CA 3QXXA 1P2GA 4R0MA 2ZZMA 4UDXX 1J23A 3FGPA 5AVWA 1NVFA 4AJHA 4LZLA 5IZCC 3IDFA 4O4LB 1P2VA 4MGYR 4L4UA 3IE1A 4W63A 1XCBA 3DDCA 2QX9A 4X1OA 4XDZA 3FOFC 3KS9A 3FRIA 2BCGY 1DE0A 3MZ0A 4M1EA 1QPBA 3ZH9B 5K01A 4I9GA 5FOSA 4TLEA 3WYEA 2OT3B 5HDBB 4D9EA 1E1DA 2AFVA 1KDOA 4OCZA 4AWXA 2W6IA 3OSUA 3RBAA 5BUQA 4R9VA 4OA5A 4RTJA 2H1SA 4RGVA 1V6SA 1HT2E 2ZJFA 4M89A 1Q0SA 3IAS1 4RVSA 4TKLA 3BD8A 2VDJA 3GJ0A 3QVKA 4CR7A 1XXHA 3K4PA 2HA3A 2CV1A 1BHO1 4UTRA 1N7GA 1U9CA 2AN4A 1YS9A 4D8WA 3V2GA 3UMJA 4QASA 1N6PA 2VJOA 3MLBA 4WZBE 4ALMA 4MWBA 2XZPA 2Z57A 4EA8A 1VJCA 5HE9A 3EQZA 1XP8A 4BNTA 3FOWA 4GZ3A 4MB0A 4MVJA 3DT6A 2WAYA 2ZR0A 1YRWA 2QQ0A 4FS8A 1SHJA 1HDRA 2DU8A 2ID7A 3EGOA 3IE0A 3JYOA 4LSMA 3RVRA 1H9CA 2V7QA 5F35A 1UBMS 3LUKA 2ZKIA 4DANA 3SKYA 1XR3A 1Y80A 2JH3A 1UZMA 3CVYA 1D2NA 1CRLA 3HLYA 2AW5A 4C2AA 1VZ3A 5YASA 3S81A 4PYLA 2YWJA 2AXPA 1AX9A 4X7PA 4B7ZA 4L8YA 4MNTA 3OOHA 2OFOA 4M7OA 3H65A 1E9AA 1F6DA 2FZ4A 4ZVNA 1EIZA 2QE6A 1OVMA 2VNHA 1RIFA 3PJDA 4DIOA 2J5RA 4QXMA 5GV7A 5TPWA 3C8MA 5T3YA 1G3UA 2QSZA 2Y0CA 1IOWA 3WRYC 4KGVA 1VIYA 2FEWB 1WCWA 4ZQBA 3ISVA 4MKHA 1G59A 5GVRA 2D2XA 4XM1A 1XLWA 3X44A 5BP7A 4LJ9A 1VSQA 4NY1A 3IVXA 1R0YA 1DINA 3BMNB 5FL7D 5FT9A 1ZN7A 2AKYA 4UQOA 3SIXA 4X61A 5HWSA 1AV6A 1U0GA 4I81A 4EYOA 1DAEA 1WR8A 2I6TA 4EWLA 2ONKA 5FOQA 1G5HA 3BTSA 3GIDA 3HFJA 4ZV4A 4F7WA 1YR2A 3U4QA 2VAPA 3OMWA 1NMQA 4UDNA 1VQ1A 2J08A 3LCRA 3ZKWB 2C94A 2YJ3A 3W8DA 5G4LA 1T10A 4WNCA 2UUBB 1A98A 5E95A 1GPWB 4G6ZA 1ZMTA 5K8VA 3PXAA 4RXUA 2M9MA 5FO1A 1F7UA 5ALKA 1FDWA 4AD8A 4LDRA 3ZLJA 2Z5VA 3FXAA 2J1LA 3VU1A 1MGPA 4DSUA 1GKUB 1Y63A 2CFCA 3JQBA 2REQB 4IQ0A 2WJ4A 2JAXA 4B79A 1BWSA 1PT7A 1K6XA 2W2TA 3BRQA 4A8HA 2NU6A 3Q3HA 3IBYA 1P29A 4CMEC 1UK6A 3HVRA 3LYHA 3HJGA 4DILA 5I4BA 5CIQA 3D4IA 3TUJC 1UWVA 4YFVA 4N6OA 2ZYWX 4K0RA 5E7IA 1I2AA 3SQDA 4B2LA 3D6UA 1CY6A 3MLEA 4BEVA 4RZQA 1GEGA 1OLUA 2HY7A 4Y9TA 4EJSA 2XE6A 3DE2X 1E3EA 4UCFA 5F1KA 2FMFA 2CXUA 3P0FA 4B3MB 2FSIA 4PVDA 4JR1A 1QGOA 1YRHA 1FNCA 4OL9A 4QSHA 2O1XA 2GAOA 4GLBA 5DP1A 2VPXA 4MV1A 4TXJA 1OXTA 3T5CA 1L9KA 4LF9B 4TN1A 3N0VA 1VXOA 3L79A 2ZBUA 4J4TA 4ZHSA 4CKEA 1P8JA 3AOEA 4WEQA 1UDCA 4LC0A 4LXGA 2VBFA 1YJQA 4Q18A 2XDYA 5G0TA 3STUA 4C08A 5A62A 4P08A 2NV6A 1HLFA 2G5TA 4HN4B 2C2OA 3I58A 4N8SA 2CY0A 5D3MB 4G9BA 4KI0A 5JMPA 3NHYA 4J7CA 2AD5A 5TVKA 4OA8A 3D4OA 4NMWA 2PBZA 3SXPA 3W9BA 2QAJA 4PIPA 2ID8A 1DTWA 3C98A 4ARZA 4I2VA 3DVSX 3PFGA 5JEDA 2ZSDA 1Z37A 2YXPX 3H1EA 4MVJF 3LHDA 5C9ZA 3IP3A 3PUHA 1WLYA 2IOQA 3KSUA 1BH2A 1V41E 4TKMA 4G85A 1BOOA 1ZCJA 1B23P 3JU3A 3HGTA 2ZREA 3U4GA 3NHUA 4PXAA 1IB6A 2Q8NA 2W8BB 1U8ZA 4D9FA 5KDDA 2NU7A 4FMDB 4KQMA 4UMVA 2K87A 4FFSA 4ZVUA 1RYMA 1WHTB 3K5HA 5JJIA 1VE9A 4R68A 1SCQA 4QJ4A 1KEUA 1X19A 4EARA 2FP4B 4OK5A 5FA6A 3ORFA 3QI2A 4KTTE 3RU9A 5EQFA 1BXGA 4DV4B 2P9YA 1D8TA 1GTSA 1VZ2A 1EK5A 1YB4A 1DTWB 1TK2A 3JWEA 4G09A 1T5SA 2F6RA 1KJ8A 1R0XA 3LLMA 4MVWA 2H07A 3RTBA 4A8PA 5HZGA 1O08A 2HDNB 2O57A 1EZZA 4UFOA 1OT3A 4UFPA 2H5JA 4R01A 2QKYA 3RFXA 5FPKA 4DLAA 3RR2A 5LOVA 1Z63A 3NU1A 3FPCA 3AUTA 3N0XA 1RWWA 3K0BA 1N32B 2QRKA 2AL7A 3BOSA 3JSXA 4UKDA 1XFDA 5K6AA 2PSHA 2YWBA 5FWYB 2YZNA 4ENTA 1QQAA 4B33A 3H5VA 4L3OA 1L5OA 2XUOA 1G18A 1PNVA 1RPJA 1X6VA 2ISCA 4BX0A 2XZOA 3RFUA 6CHYA 3GJ6A 3CO0S 5E9AA 1AQLA 1IATA 1X38A 4GPIB 5AP9A 4BVAA 3UWSA 1W1WA 5IU6A 4IX1A 4DRYA 1AUPA 4ZMSA 2PFSA 4R5MA 3AXSA 3RUIA 4YJ2B 1BC5A 3M6FA 4YREA 5CFRA 4I9FA 3D2AA 4LGCA 2GPWA 3G59A 4GE0A 4H9GA 4X7RA 1WSWA 2WF5A 3TMYA 3PDUA 2DPXA 2ZYDA 3NASA 4C22A 4RJTA 3KE9A 4J29A 1OFUX 4HADA 2QG9A 1E3QA 2YXEA 4FFOA 1GM5A 3NIGB 3FVWA 4B9AA 3PT5A 5K7SA 1CUYA 1CX9B 4L9SA 3ZHVA 2QTTA 2RGXA 3JPWA 3FBWA 3COSA 4RJIA 3K1JA 1IZ9A 3NIFB 3NALA 4EHLA 3DKVA 3GOQA 1AXGA 1PNQA 3VNVA 2P9CA 4PONA 4S1OA 2VWQA 2CWWA 2YQ4A 4LJYA 4NABA 3FOEC 2I9KA 3MLAA 4FGLA 4YAJA 1EBBA 1Q74A 5BW5A 2AFIA 2EERA 1R74A 3DEFA 1U7PA 1R3UA 2WM3A 1VPDA 4KV7A 3NG1A 1W1UA 3PE3A 3SZRA 5F64A 2V6GA 4MPRA 1LBSA 1Z2PX 3SVLA 2HRBA 4C7XA 2ZVDA 2PEZA 1A9ZA 2BFFA 4DGSA 1JDBB 1VGQA 1VPLA 2VPIA 3CGGA 3NTQA 2ZRCA 1U9JA 3LWBA 2XGSA 5LLSA 4EZEA 5K8TA 3TRDA 1JHMA 2C0QA 4JR0A 4B43A 1UKCA 2QPLA 3BXZA 4FVTA 1T1SA 1PGQA 3NGMA 1YQ9A 2XXBA 3ZCRA 3KEFA 3OM9A 4HAWA 3RIYA 3A1SA 3QFFA 1PV4A 5P21A 3WLKX 1Y82A 3EAQA 3RHFA 2HA6A 3KOOA 3BRSA 4H6WA 4DR6B 1WA5A 5BWNA 4TRJA 3COYA 2GF0A 2L17A 4Q15A 4DEXA 4V03A 3QYAA 4AJOA 3B1KA 1CU1A 4PTYA 2DBQA 2BFFB 4S1TA 3PQEA 1U2ZA 2GKGA 1MNQA 1ZIOA 1EFLA 1L7OA 3DVAB 1NF8A 1F0KA 3C1AA 4EHNA 3BDIA 1X39A 1R1DA 4PZDA 1PYDA 1EIWA 4A6PA 2B5VA 2OXTA 1YQTA 4DLXA 4R7GA 3OLVA 2B2CA 3SC3A 4Z4QA 4FD3A 1WPQA 4IH9A 3F6YA 5DBFA 5CCBA 4W1RA 3EY4A 1EUQA 2D06A 3K92A 4CFYA 4A9AA 5ALFA 4DWWA 3MK31 2GZRA 1NW7A 4PG7A 4ENQA 3I9KA 1FDIA 2HF7A 3EUFA 4KWEA 4XB6B 5TJHA 1GFIA 3V4OA 1ESMA 1RYHA 1FZQA 1ZX1A 2F90A 3CEMA 1IL0A 1WW2A 1FNSA 2P90A 2X42A 3D0QA 3HYSA 1PWZA 4IIDA 3RDPA 4XPIB 3T1OA 5KVAA 2B78A 2ZYUX 1GTZA 3ROEA 1CD5A 4KRGA 1I94B 2GCIA 1J5EB 4QXAA 3PDHA 4BBPA 4HEJA 3L1HA 4W5JA 3I6BA 4OP1A 2XRYA 3BD6A 3WLIA 3TXAA 1E5XA 2PH5A 1R50A 2M6LA 1BRMA 3DTTA 3LSTA 4KWCA 3SQLA 3OPYA 3PWSA 4M8NE 4R8LA 1M1NA 2GEKA 1KDRA 3DXZA 3GT3A 4QUBA 1XZLA 3CTPA 2VPTA 5A4FS 4NNOA 3BJRA 2PXCA 3FPBA 4WQMA 4YCDA 1DOZA 3INRA 5EL0A 2IL1A 3EY9A 1TVKB 4IEIA 5F5XA 1GARA 4GS5A 3F9RA 3HY4A 3QJYA 4FE3A 2P3OA 1R5NA 1ZUD1 5TPZD 4BYGA 5F5NA 3LQ4A 3NT2A 4YMIA 3WLTA 4F5EA 5KWSA 5DN9A 4UNNA 4B6JA 1YVDA 3EOAI 3NTVA 5KJFA 3A2NA 5LXTF 3OPYB 3Q2KA 3U3RA 3EIEA 4KBFA 1CDDA 4RZ3A 3G2LA 1G8HA 3QLUA 3PYMA 1FVOA 3GCDA 2ZGVA 4KRYA 5IHPA 2IY9A 3BL5A 4AJKA 1G16A 2XDWA 3I2FA 1XU9A 3O83A 4MUGA 4OHUA 4MPTA 4LFCB 3WNVA 5JSUA 2YVLA 2PGDA 4GYKA 1E0JA 4LNAA 5DM2A 1EI9A 5ABPA 3G8AA 3GBVA 1W94A 3N7UA 1M2OB 1ZD4A 4TKUA 2WMOB 1T5DX 2FPPA 5HBRA 5I5EA 5ALSA 4IOLA 4XWWA 8ABPA 2HTEA 4XQCA 1EHCA 2RIRA 4TTJA 4WLUA 1NT2A 2XMCA 1GKIA 2J6HA 2V6JA 2XUAA 4JJ4A 4BVGA 3NHMA 1X9HA 3H8SA 1VPVA 4IFTA 1HQCA 1YR3A 3Q9SA 1FRFS 5JD5A 5F9HA 2P27A 3MM4A 4FFWA 4D9HA 1XTTA 3I8XA 3KB6A 2FXVA 3ES9A 4PYMA 5E38A 4IYJA 3LW8A 3S5JA 4DJFC 5KYXA 2YS7A 1QMGA 2BEWA 4NYIQ 4XGQA 4MS4B 1PFUA 2FR8C 2I2XB 2ZCUA 3BHIA 3KL2A 3T3DA 1BX0A 1LI7A 5HDQA 4EYSA 3LGXA 2BJWA 2ZSAA 2PMCA 3IA7A 1XZGA 5HEKA 4BE4A 4TKUB 1XJQA 3T7DA 4Q4HA 4LZAA 3K9WA 4E2XA 2GGSA 1OZGA 3O4FA 3R7FA 2WJ6A 4UJ5A 5EYPB 4BWYA 3RAEC 1C7FA 1N5KA 1QRTA 4Q48A 3MRVA 3UXEA 3KT8A 3EDRA 1KU6A 2PAAA 4QOFA 1XAJA 3FNEA 1OY1A 1WPRA 3CU5A 4G5YA 1I3KA 5MN6A 5H8WA 2HJ9A 4ERXA 1SNYA 2B3TA 2I7TA 3B60A 5BV1A 4NYMQ 2EEZA 3IT2A 2EG9A 2CHVA 2QM7A 2XQFA 4L5YA 2PWPA 3HPRA 1RWPA 4DDVA 4QLBA 2EFCB 5F98A 4MR9B 1RHJA 3TZHA 4P34A 3WFZA 2WJYA 3ANNA 3KHTA 3NW9A 3TOZA 4IXNA 5AW5A 5AW4A 1E4EB 1W5EA 3D5QA 4DLZA 4C0SA 1N36B 3IILA 4UTNA 3ESDA 4O2RA 2E37A 3ZKAA 1PW7A 1J0DA 1DEAA 3MWDA 1FMCA 1RHUA 1JG7A 4MS3A 2H2DA 1B14A 2J7PA 5FLYA 3IEPA 4M0CA 3AMVA 4ZHQA 1WETA 2ZFUA 3JWHA 1VYVA 2C9MA 5DM4A 2CUKA 5JPIA 4Z1OA 3P9PA 4G9GA 3Q8MA 2XBUA 5IJ9B 4YP7A 1DJNA 1FRVA 3MT0A 4B3IA 3DW1X 3E3LA 3QBVA 2G63A 1C8BA 3P4YA 5J5AA 4DCTA 4EY3A 1QRAA 4QM6A 1K3UB 1SBQA 3JYNA 4LQ4A 4P93A 1GGNA 1YR6A 1F38A 3MJRA 4BC0A 3ZIAA 2PA3A 2SICE 1HQKA 2RC5A 3ZW8A 3SK0A 2XEXA 3PDCA 3IVGA 3LTNC 3G1TA 1TA4A 3MWDB 1XKTA 4MWEA 4Y30A 2BBTA 2H00A 3GGCA 4MS3B 1O6FA 1OB2A 5DBHX 4ZHQB 3LCVB 4NEGA 2L0XA 2VHZA 3ZDEA 3MWEB 3G5TA 4ADSG 4D97A 1NV9A 1R64A 2PVSA 3ABQB 4DWVA 1UDBA 2WKWA 4XWYA 3R5SA 2I3AA 1DIRA 2GM9A 1HYHA 1MJFA 4NJEA 4OU5A 3CG0A 1JBKA 4MQUA 3EARA 2GEBA 1PHPA 2XCOA 4EW6A 4NSNA 3KUCA 4R2LA 1M0SA 3BJIC 3R2JA 2PH1A 3WR5A 3PL1A 4C6TB 1I7PA 4RFSA 4AK9A 1WSAA 4D1YA 4PBRA 1X80B 2RGNC 4EG1A 1KYWA 2I22A 3CZ4A 1J8YF 3ROMA 4ASUA 3RYIA 3UPTA 3ZCQA 1N2BA 3PUVA 2JEZA 4UZEA 5B1IA 2QTMA 2HPVA 2FKAA 5ECDA 1EFUA 1WUHS 2A9RA 3E9ZA 4JUDX 4KHZA 3ZOZA 4KACA 1CNEA 1YQXA 2Y0DA 2Z1MA 2X6RA 3AZPA 1JQJC 4GMKA 4IRUB 4Q4DA 3LCUA 3RV4A 3L0IB 3KETA 3PJRA 4YY3B 4NJEB 3I6ZA 4HYTA 2B5OA 4IILA 2GHTA 1QHFA 2BBSA 4WZZA 4ZAYA 2EWVA 4HQNA 3AB7A 4YJGA 2N42A 3Q40A 3VH3A 4YRAA 3R0ZA 1XCPA 5ALHA 1FTQA 1OI7A 4RNDB 1QZUA 2XLBA 2Z2IA 3M4NA 3HJNA 4X6YA 1PZHA 4QPNA 3L4BA 3V5NA 3WNBA 4BKMA 1U0HC 1OGJA 1G6KA 2C4MA 5HJ7A 1N34B 2P1ZA 1SM4A 5LLDA 3CVOA 3RYIB 2ILTA 3AEKA 1BDMA 3FUUA 3WP1B 1M2JA 3GI1A 4MUXA 2H5IA 3FLAA 4FNAA 4QO7A 1XEFA 4RA6A 5EJ6A 4WFJA 3GFQA 3R5KA 1T2NA 4GVLA 3W05A 3IV6A 2MSEB 2GMWA 3N28A 3JCZA 2WC1A 4HN9A 5C18A 9LDBA 3D7NA 1UKVY 4QXOA 1X1RA 1H23A 1ORRA 2RB5A 3LPLA 2GXSA 3VU9A 2ERYA 1VPTA 4A2PA 1EHIA 4FQ8A 1P75A 1FDUA 1TUBA 4G37A 5A0VA 2QMQA 4K3UA 1FJXA 4PRZA 1ES9A 3VYRB 2J09A 2O2JA 1JHYA 1F0NA 2JIOA 4Y2PA 3VOAA 2NXNA 5KDOA 5FA8A 2X15A 5EIFA 3ZLTA 5A1TA 3F6PA 4YR7A 3RVOA 5CLJA 2IFTA 5IXSA 4FCWA 3EH1A 3K09C 4D0GA 1H2BA 1RPTA 1TMOA 3A4NA 4OLHA 2IYRA 1VP9A 1ZSNA 2X58A 3OEEA 2IZ6A 4OXKA 3IUPA 2PLWA 4WESA 3CINA 2B9VA 1U7OA 1GQRA 2XUQA 2KMLA 3VU9B 3F73A 3ITDA 3LUJA 2QAGA 8MHTA 3CNOA 4EKDA 4S2EA 3N07A 5LP6C 1H42A 2C61A 2OHFA 2HIAA 2HF9A 3DMNA 5KNCD 4CF6A 3TOCA 2A14A 3FKQA 4ISCA 4RORA 5L53A 2VCEA 3SIWA 4N40A 4MJXA 3OZGA 2WKQA 2XMQA 1QYVA 4L73A 5JARA 1C8LA 3GEIA 2ON6A 4XQGA 4XJVA 1E5QA 1P6UA 1YACA 2ZB7A 3MWFA 1P2DA 3QM1A 3RHSA 4CM9D 4B46A 5CBPB 1N2ZA 1AHNA 2A7QA 4J3JA 3ZZUA 5DK6A 4P3PA 3MYRA 3QLVC 5C81A 2A6PA 4DDUA 3TX2A 3BMXA 3T99A 4HYQA 3MJHA 2ZVPX 1IBKB 2R1UA 1J97A 3WFIA 5IAAA 3R23A 2H1LA 4HWPA 3A05A 4KVZA 4YAWA 5ESWA 5HKLA 3V8BA 1NG9A 3IRUA 2QE7A 1SUIA 4L5IA 2VPYA 1TZKA 3HKEA 5ALNA 5EJ2A 3G0GA 1DSSG 2RBKA 4RSHA 2OPHA 3I9V1 1UH5A 1UPCA 1WXGA 1P19A 1J2JA 1HTBA 1K7SN 2PMDA 2YVQA 1F2TB 1WRBA 5AIBA 5E2IA 3N9IA 4MI9A 3MFQA 3RC3A 4JJAA 1Q15A 2L42A 2XNCA 3NHSA 2GM5A 1G3MA 4TL9A 4B8YA 5C7LO 1LLUA 3ZBUA 1WB9A 5FJJA 1WXDA 3EZ7A 3NFYA 3HE3A 3A3OA 4D56A 2F3RA 4RVCA 4LJ5A 1E7MA 5EKUA 5LUBA 1RADA 1IAVA 1C29B 2NQ8A 3HKDB 5AXCA 5B30A 1A2KC 5K8UA 1HNNA 3S1SA 2O9JA 2P65A 1DP4A 1WZUA 2KX7A 1NBWB 2BM9A 2VEDA 3GN1A 4KMMA 1M10A 1VYTA 4JT9A 4MLZA 3ROZA 2AI1A 1UBOS 1Y8CA 2JI9A 1CWUA 1WEKA 1Y4AE 2YS6A 4ATNA 2CC2A 1H9AA 1Y5MA 5THXA 3EBLA 5A71A 1X8JA 4MKGA 3QOXA 4UASA 3A36A 1IN1A 1WUKS 1BYUA 1KO1A 3DEAA 5BWBA 4E2WA 4DIKA 2K5UA 3OY2A 2P9EA 4NZZA 4P0QB 4HT3B 4G0MA 5CP8A 4Q7QA 4HQOA 1NR7A 2XA9A 2BKAA 2COUA 3RAPR 1WDTA 1E9VA 3FJ1A 3JZIA 4ZT2A 1L4YA 2NNLD 2QUKA 3WRYA 3R7DA 3BA1A 2BMDA 4QVIA 3Q0IA 1P9NA 3JD1A 2IEZA 5FHQA 3WLLA 4W9NC 1RAHA 4YXWD 1EWTA 1ORTA 3IVMA 4BMSA 3PX2A 3D3NA 4MYUA 3HU3A 3V2UA 5LWQA 3GLFE 1EP1B 1TM1E 4LBWA 3ZV6A 3UNXA 1YUNA 3AERA 4JGGA 5CEEA 3E8MA 1GU7A 1YDWA 4MA0A 5A9TA 2Z6VA 1DRJA 3JTMA 4UTPA 2VDUE 5HOQA 1UXJA 4G5RA 2FE1A 1UFOA 2YJ5A 1G38A 3FF4A 2M2IA 1U2SA 4Y7DA 2J3EA 5I9NA 2IY8A 4POAA 1AT1A 5E1OA 5E2BA 4JUBA 6Q21A 3BCRA 3GHHA 5AVQA 1RPZA 1CUBA 3P5SA 2DFDA 3G5UA 4TV9A 1S02A 4DJTA 2D1YA 1NN1A 5C1DA 3R4VA 3ZQJA 3CLRD 4PC2A 4FILA 1ULHA 1XQWA 4Y2XA 1N6KA 4CMEA 1SCNE 4TVKA 2ZDQA 3C70A 2DKNA 2RHBA 4TVSA 5E7JA 1OB5A 1DBIA 1T3GA 1YMQA 1MPXA 3Q15C 1FYWA 1A95A 4G26A 3ZDCA 2WV9A 2QQ5A 2X40A 4FMCB 3AIOA 5DASA 1YDHA 3HP4A 4BFUA 3K32A 2XKJE 2OD2A 1XGKA 4R8MA 2IWHA 4LYHA 3VZSA 5K0CA 1AVTA 1OC2A 4G0XA 1P61B 2REOA 2HQBA 3ROKA 3UMGA 2Q6IA 1T9GS 1M8JA 3GPCA 3O3NB 2BEJA 2GA9A 2Y71A 5IN4A 1G4UR 4MWZA 3IQIX 1SD2A 1XEWX 1ZVQA 2ZVQX 3E58A 3DD5A 1IWPB 1NASA 2C7BA 2PMWB 4DSOA 4IWXA 4JHXA 4K40A 4Z9FA 4ZI7A 5KNBH 3MCTA 2MYUA 4E32A 4OK6A 4EHDA 1CUIA 1EJ6A 3ZJ5A 3C6BA 2Y93A 1GSIA 3LBHA 1V47A 2WAMA 3VQTA 3D8TA 1QHXA 2DBYA 4AX4A 5EKSA 5KYGA 2VOEA 4MPDA 2JARA 4ZK6A 2PQMA 4QDTA 3UTDA 1ZD5A 2VTBA 5A7FA 3BFKA 4AN1A 1DTEA 1EG2A 1IG0A 2GCOB 4JOSA 3ZU5A 3I28A 1A8PA 4DTIA 3PFBA 3Q8LA 1KI6B 1IJFA 2XCQA 3CR3C 1IXKA 1MOZA 1M6EX 4UU7A 2HRDA 2YIMA 2B7BA 1QOPB 1XMPA 1XL1A 2N75A 1FFXB 4X94A 3DPIA 2WIFA 1LDMA 4Q19A 2B34A 3AEUA 5IJZA 1PL0A 2CHGA 2UYCA 1HETA 1SG6A 4X6LA 4RIIA 3AVUA 2DOKA 3LAWA 5B3AA 1FL9A 1BDIA 1LSUA 4Z0PA 1RLUA 1XK6A 1KEKA 2QX8A 4KQ1A 1Q1GA 2GJ9A 2FUCA 3O1IC 2OGWA 5F1OA 1AM4D 1FP1D 3ZW9A 1VP3A 2B4TO 2ZT6A 4UEWA 2P2NA 2VTBB 1C7RA 2YVAA 4M36A 3A11A 4UUMA 4I9UA 3VDNB 2PWAA 5MFPA 4FNGA 4W6QA 4ZXFA 3BGOS 4G97A 3C41J 3OQIB 1YL7A 1PTJC 3O7WA 4FKBA 1TZCA 2FMUA 4YO8A 1I3OA 1WP4A 2FWJA 2A8YA 1UKYA 3R5HA 1GNPA 1JTVA 4U3JB 3F5MA 1HZZC 5EKXA 3AEUB 4O2AB 5DNAA 4C9BA 3N0TA 2QD4A 5K0JA 2GFHA 3GLRA 4NE7A 5AW6A 4LOIA 5IABA 2G5CA 2G6BA 3L6BA 1V5FA 2CB0A 5F5LA 1SUSA 1QFZA 2QMZA 2Y0PA 3AIKA 5G1NA 4DIUA 4IXWA 4DLNA 1HG1A 3RIEA 1GRVA 1RQNA 3F4LA 3HDHA 4XUDA 2XTJA 3UW1A 4BBZA 3B1XA 5BV8A 1J22A 1GZVA 1T6YA 5D2CA 3AC0A 4BWVA 3A9WA 5JQWA 4TV8A 2PDAA 2Q2OA 2GZSA 1GV0A 2BJVA 4ZO9A 2DQZA 4GO1A 2HJWA 4DADA 1FVHA 1Q0RA 4JP2A 3FETA 2I0FA 1JKJA 1ZONA 4PG5A 4L78A 1N8NA 2EFYA 3CNQS 2JIRA 2FX3A 4U6QA 3LDUA 1L5WA 1DOHA 1T3SA 1TMYA 4TV9F 2JATA 4RK7A 5F33A 2GEVA 2NT4A 5B12A 2ZCVA 4LY9A 1X13A 2SCUA 7MHTA 3EXIB 4URVR 1THTA 3DTYA 2H48A 2WTUA 1XN4A 4BAZA 3PWZA 3L49A 4X85A 4GX0A 1U65A 1KK0A 4IY1A 2PKYX 1VFPA 3GEEA 4H2DA 4KNWA 4KOEC 2B30A 3X1JA 1TLTA 1UT6A 3VX4A 3LQ2A 5CVCA 5TSDA 3HWRA 3IDAA 5DHSA 4EW1A 3QELB 3X43A 1W4ZA 2IYNA 1JJAA 5C5CA 2JLBA 1C1DB 1P80A 2E4AA 1NVVR 1KMQA 3NTOA 4DUZB 4IJ5A 4LY0A 3VTFA 3IPLA 3NBMA 1U0NA 1UBTS 2GZHA 4RA9A 5KB3A 4I5IA 5DMXA 1YZKA 5F4ZA 5TGZA 1MIHA 3BF7A 2J5BA 1RXCA 3DXFA 3K15A 2OV6A 5EP1A 4TSRA 4IAOA 1E1CB 4ZCQA 3T7EA 3S28A 1PU2A 1X1AA 2Q62A 3IDZA 4PSUA 5TC4A 1WCV1 5FDFA 2D13A 1Q21A 2J6CA 4PU0A 5B58C 2CFTA 1I6KA 1OPRA 1T4GA 2SNIE 5K51A 4J9VA 2NV0A 2FEXA 4L8GA 1BQEA 3VSBA 5GPBA 3V9PA 3WGKA 1K5HA 4B5LA 2WHRA 1KIMA 1G5IA 1MABA 1O6ZA 1QIIA 4TQ9A 5BVHA 1Z75A 4NDNE 4W1PA 2DWUA 1C2TA 5B1DA 5BW6B 2NWQA 2ZUCA 2FQQA 2PUAA 5BNFA 4HNSA 3PZRA 4HBZA 1UUFA 1E20A 1VL1A 3O4VA 1VECA 1EBFA 2WNIA 3H83A 3IPAA 1NR1A 2J5QA 2X0EA 4JT8A 5BSUA 2XX3A 3MCWA 2ZW9A 1Z07A 3EVCA 2FFBA 5KWEA 2V7PA 4X1KB 4MVYA 4XYBA 3WLOA 5JROA 1UBFA 2VHXA 5HK8A 1GA6A 1IN6A 1XNHA 2HPAA 1R8XA 3EUWA 4BRWA 4K6GA 1DC6A 2JJ1A 1VHQA 2BFDA 4Z1MD 1OZAA 2COEA 3DVRX 1GPJA 1PFQA 2BFNA 3KB1A 3IP1A 3N6VA 1C30A 1TQ6A 2HRCA 5E6UA 3PK0A 3F49S 2ZM6B 1ZVVA 1UBEA 4MRPA 4M8SA 3SKXA 1IXZA 2JD2A 2O14A 1DAGA 1E4OA 3USCS 2GK6A 3AZQA 3FB1A 4DIBA 5KYWB 3ULKA 3MYYA 1JBQA 1LRLA 4IDEA 1Z4MA 1MX1A 1Z6GA 4Y8VA 1W2HA 5BNIA 1MGOA 2ZBFA 2XRMA 2OCKA 3T1NA 2Q6TA 4D74A 3FVRA 1UR5A 4OQDA 1Z0FA 1W76A 2A9JA 3HCPA 2VRWA 3TD9A 1ECPA 2C9YA 4KR9A 4W9MC 5JWHA 1M5RA 5ICSA 2VNSA 2CVQA 3JALB 4HDKA 1RMTA 1V9LA 2LIVA 3R6WA 5FPQA 3U13A 4AMZA 4INPA 4RF5A 3FFAA 3IUJA 1J5XA 1BMFD 4FFNA 1A8IA 1TX4B 2VF4X 3EFEA 1SC9A 3PRKE 4Q4AB 5EIHA 3SXUA 4C4ZA 3QMMA 1PR4A 2GZ1A 3Q72A 2V8OA 4MLCA 4BB0A 4L9WA 5L3QA 3EUEA 5BYKA 4RTKA 3NVAA 1I9GA 4CLOA 1H6CA 3EEIA 4XSGA 1MIOB 1MRSA 4QOSA 4FKMA 4HGRA 5DNWA 3TNLA 4LWOA 3UMYA 1N0UA 3RARA 2GVZC 1R88A 4Q01A 4RM2A 1Q20A 5BVGA 5SZJA 4QNNA 2HQRA 3GYGA 5AJWA 1RACA 4BYMA 4JMLA 4URYR 1REQA 1J8DA 4CXMA 4LV5B 4ZO4A 3NRCA 2QLTA 2CMHA 1XTRA 3HNOA 1DRWA 4UPVA 1E89A 2PV0A 5C5DA 3ZLUA 3DHYA 2X23A 3TSOA 3L0DA 2WTNA 2O2SA 1JAZA 1YO6A 2C78A 1O03A 1O6GA 3HDQA 1Q14A 4J0EA 2OAGA 3AFGA 4EY6A 4C2TA 1TZMA 1OAAA 3Q5EA 3ZQKA 5K6RA 2LD4A 1TF5A 4AICA 1FFGA 2PM8A 4K6OA 1UDWA 1GUYA 3AR9A 3HBAA 1HYBA 1Y3IA 3K0SA 2DLNA 4WZ6A 1NVBA 2WSMA 3LXUX 2O06A 2AF4C 5B1EA 4DB2A 4CIWA 3CZPA 4RD4A 4JJ7A 3ZCPA 4HUQB 1ZGZA 1WDKA 3JVVA 3KOWA 5CU7A 3MPOA 1FF9A 4RPCA 2FR8A 1T0BA 2DWCA 2PGAA 3K0AB 2D3TA 4XJTA 4EUHA 1G5PA 2BI4A 3SU8A 4G63A 3UHOA 1E59A 4CN8A 4QJ5A 2BHSA 3TSZA 3W3ZB 5HJ5A 5DNYB 2H8GA 3WO0A 5KJCA 3JATB 3CLTD 3S2UA 3RG2A 4N47A 3F3YA 5I8WA 4U2BA 2VRCD 1E3WB 2K4MA 1JNYA 2YWCA 4G89A 1X1EA 3L0PA 3P9NA 2A9PA 4FFRA 3PQ4A 4B6QA 1F1JA 5KJ1A 4G2NA 4Z54A 3MJEA 5EP4A 3TB4A 3EEYA 4C87A 1KS2A 2O8CA 3QFHA 1PUJA 5CFLA 5FAXA 2OVBA 2OCGA 3BREA 1KERA 3CEAA 3FYDA 4FHDA 1VMEA 3THWB 3CHYA 4M9CA 4E46A 2V8BA 1GQSA 2XEDA 4ZVQA 1DAKA 2QSJA 1Q1NA 3NJRA 4R7ZA 1A9XB 3AG5A 4UM7A 1ZOOA 2PZ8A 4ZT4A 3IGFA 1Z2AA 4B45A 1OILA 2BCEA 2FLKA 2P3LA 5CB4B 5E4JA 4V0NA 3OE1A 2J5XA 4FINA 2HMVA 3R7WB 2CF5A 3CVUA 1Z8FA 3BWMA 3ILSA 2CVPA 2XYQA 3P71T 5I4CA 3CSDA 3HB0A 2LUOA 1QAMA 1R8JA 2NTEA 3H1FA 3PGXA 3ND6A 4QFBA 4IDPA 3HV0A 3WYGA 1IUPA 1R4ZA 4AJ2A 4JC0A 1U7WA 3AEXA 3ENNA 3OM8A 4NQRA 4UEQA 2JJ2A 3UC9A 2F3SA 3OIYA 2D0DA 3ENQA 1J2EA 3O8OA 2XCRB 4BY9E 4HJXA 4BLPA 3W34A 4MGKR 5HQJA 1B3BA 2CBGA 1UM9B 5J1TB 1PFKA 3JRWA 3IESA 2FLVA 3KQYA 1W36D 3JYLA 1ZS9A 3TTVA 2I6XA 121PA 1QH8A 5AUOB 4WXEA 4A26A 2Q9CA 3TJZA 1TGYA 2DHQA 2HU8A 3QG5A 4HD8A 4S12A 4DV3B 1B0UA 3U0BA 3MPUA 5GJWC 2I62A 3Q9LA 5UKDA 5JI2E 3E4DA 1YE3A 3KKKA 4U2DA 3VNQA 3QQ5A 5D5HA 1WTCA 1NBIA 2H4HA 2P7HA 3CZ9A 4RETA 3DDOA 1WPXA 3RWOA 1KBOA 5A7GA 2DFKB 3U17A 2HMSA 1RT9A 2ECOA 3JV7A 3QU4A 1SXPA 1GQYA 4R16A 3MCZA 4PSCA 2JFXA 2NGRA 4GBED 3TYXA 1KZ4A 1J0BA 1M2FA 1M8GA 3KPVA 5BQPA 3V1LA 1CS0A 1LQUA 1SHUX 2HH9A 1XQ9A 3FNHA 2WUGA 1E79A 2KB0A 1TM3E 2XODA 1MTZA 1C9MA 3V8NA 2VA8A 4MWDA 1U8FO 2OCDA 1NI5A 1LRJA 2RGNA 3O3OB 4FEEA 4W8OA 2BZSA 4F7DA 5B1YA 3E2IA 1JF8A 2WJPA 3QVJA 4MMZB 3VR6H 4CCSA 4IDGA 3RUFA 1IHYA 5ESXA 1M6VA 2AUTA 3LD9A 1MDBA 2QVYX 3OFJA 1KJNA 4OJKA 2G4CA 3WV5A 5LDDC 2WJHA 2XA1A 1E6UA 1KJWA 1WCIA 2XCTB 4K9PA 4L9RA 3OURA 5BO5A 4TX1A 4ITRC 5I45A 3MT7A 2RG7A 4TXNA 2DTDA 3VKUA 3ZCTA 4BMZA 1ZN8A 1ETHA 4E88A 4CV1A 4PINA 1RQPA 3MOIA 5CW1A 1KWGA 5DPMA 2O07A 3PEVA 5NLLA 3I45A 4AQ7A 2YIVX 1JXOA 2PGNA 2XZTA 3QSGA 5COBA 3UXYA 4F86A 1NYQA 3F0TA 5EKTA 3IQHX 3PB3A 3GGJA 2JVKA 4GZ5A 1H65A 1KKMA 1FDOA 1EX6A 1M6VB 1MAAA 2A86A 2AXQA 3IPCA 4HDAA 1I7SB 2DE0X 2QVCA 4WFIA 2B6HA 1JDSA 2C57A 1P4GA 1DBWA 2O3TA 1KK1A 2C9CA 2IHTA 4PHTA 1D0SA 3T1VA 3D8HA 2V45A 1ILWA 4A8JA 4EQ6A 2PVCA 3I0NA 3L6CA 3R5JA 1HBJA 3QY9A 4MCIA 3TZQA 1P0MA 4DY4A 5K45A 4OLBA 3BAFA 2QN8A 2VPZA 4F1KA 4CKXA 5CG1A 1VSUA 3S40A 1OMOA 4NZOA 2R7LA 2FPRA 4UCXA 3VMMA 4RLQA 3SKVA 4URUR 1U1DA 1B8VA 1TUIA 3C39A 2XUFA 4H3VA 4HQKA 3TW0A 3ZCSA 2AG8A 3MTBA 4DC9A 5DBEX 1ZICA 1I3NA 1DIAA 1E2FA 3H5WA 3K30A 3DOFA 1OFUA 1BTOA 3KYDB 4YJFB 1BFUA 1QF7A 2XB4A 4DRXB 2CNKA 1ECJA 3QYJA 3K09A 4GM1A 1CVIA 1XA4A 3S0JA 1W88A 4GXNA 4KZPA 4B7AA 3REGA 1ZMBA 4YP1A 4D6PA 5LMZA 4AJ9A 4DZTA 4G1UC 1ILEA 2DUWA 4F97A 2B1RA 5F7XA 3BGDA 1EFHA 1PGJA 1R5BA 1SVUA 2NU9A 3DG9A 3CH4B 3B7PA 4HPJB 4YRGA 5BSGA 1TYZA 2YMMA 3EIWA 3UJCA 5LP6A 1QONA 3R20A 5KYWA 3G9UA 4ZOEA 1XOIA 3NKLA 4UCWA 3D7MA 4OB7A 2Y0BA 3KVOA 4ND1A 4ZODA 4EGJA 3R6LA 4MGEA 1NE7A 3AL2A 2A7XA 7GPBA 1N3LA 2FCRA 4NK4A 1GPAA 3WSVA 3PG5A 4OFWA 2VNIA 1KZ6A 2I6FA 2XAUA 1QKKA 2HD4A 3BTVA 3NDJA 4WFQA 2I66A 3MTJA 3LMKA 3QLVA 4FGWA 5G0SA 2FDCA 3DAHA 2AS0A 2FW0A 2IPMA 3QRWA 1ONBA 2JIZD 2PL1A 2HZBA 4I1IA 4N01A 2FQYA 5LP6B 5ALQA 1KGDA 2ZSKA 3EZ6A 4MH0R 1GQQA 2FOXA 2G83A 1ARZA 2F3PA 4E14A 4L51A 1D2CA 3JVEA 1JP7A 1PZMA 4WUTA 5A2GA 4OHRA 2NZWA 4XOUA 4S04A 4ICIA 1W7AA 4QBTA 4OHMA 2PKQO 5TLSA 2ZIFA 3A1TA 3KEGA 3DR3A 1UKEA 4Y2JA 3U6KA 1NVAA 5LQAA 4E4YA 5AQEA 2Y1DA 3RSFA 5EKDA 4Y2RA 3VHQA 4BFWA 4YAFA 4A03A 2BDTA 4AY4A 2CCGA 4YUWA 5LFAA 1KOJA 1P45A 4WKGA 2ZAIA 5DH9A 2WU1A 3EQ7A 1OD6A 3UENA 3LH5A 1FP7A 1NPTO 3T1HB 5CM8B 5C0OE 5A1JA 1RLTA 4AAYA 1RI1A 5CAEB 2Q6VA 3KFXA 1F8YA 3AHHA 5E4YA 4D0RA 5AUNB 2VNAA 4L8LA 2YQ5A 2NSHA 2V58A 4LVUA 4V39A 5AJVB 3HL4A 2QL5A 3H5AA 5AVOA 5IH7A 1DHTA 5GIPE 1NW8A 4HFNA 1MO5A 3B6KA 1EFPA 1UMDB 2FUKA 3PQ5A 4UC0A 2YHIA 4M1TA 4N7JA 3I01M 4YJHB 2OO5C 3RUEA 3TAUA 1M6NA 5K0TA 3GQVA 1O0SA 4O1HA 4II3A 5E4TA 4KXNA 4EB6A 3CNNA 4JUIA 3U09A 3ML1A 3KLMX 4K9SA 4ZJZA 2VJDA 2QG4A 2V9ZA 2C2BA 4KXXA 1VI2A 2DC1A 4GQBA 5JNUA 5J4LA 1PSDA 4ZOQI 3THYA 1XCMA 1X1TA 2IXTA 3EVNA 3GRRA 5DNEA 3LT2A 2G0TA 2YMPA 1NJ5A 3AILA 4NFLA 2YYSA 3SYKA 2VF5X 3AB3A 4BP8A 3B3FA 2IXBA 2BFCA 3SF8B 1U5BA 3MC1A 1KC1A 1JV2B 5KQLA 1TJ3A 1NG1A 3NM6B 1NU6A 5IFLA 5DRTA 4FFMA 4W9NA 2YHIB 4XIFA 6LDHA 5B57C 3OQ6A 1EDZA 3VPAA 4XB2A 1ODTC 3DOUA 3DZJA 4F4IA 1W25A 4TPKA 1P4AA 1TVMA 2HUNA 4KMSA 1NAHA 3RGWS 4TOIA 3UG6A 3S1LA 2GXUA 4JC8A 5K8LA 3W7VA 3HO1A 1S6YA 5HRUA 2X8AA 2R7AA 1YMVA 5EE3A 5FI3A 2X8LA 3BE5A 7YASA 4LWPA 1GQFA 4L3WA 4NCHA 1PL7A 4X7BA 4TT8A 1YB2A 4UMEA 3WE7A 2FUEA 3DKRA 1I4TD 3ZZ1A 4LHZA 1JG4A 1E6WA 4OHZA 3TTWA 5AVUA 2ODNA 4MW2A 4DXDA 1L5SA 3OLYA 4KOAA 3O8CA 1YTUA 1N75A 2SKCA 5LQCA 3QE4A 3HEBA 1J2UA 3GXOA 4FOTA 2LE0A 1P2FA 4N7MA 4XA8A 1AHHA 1J9ZA 2QX6A 3BFXA 4FE7A 3U61B 3T3HA 5CITA 4GQIA 4OAPA 1Y9DA 4DCNA 3FRJA 4CEIA 4AY2A 1QQBA 1SH7A 1ZW1A 4MR7A 3RF7A 1JDNA 3BWEA 3WKAA 4QPZA 4EG4A 1ZK0A 5PGMA 2V7VA 3OZAA 4IHKA 3TTUA 4B1FA 1E2DA 4ER6A 1NW5A 1YA8A 4CGYA 1SC6A 2ZWIA 2YFHA 4RQBA 3WOHA 2FG5A 5FBRB 1KA9H 4LSZA 4NXNB 1G19A 4TKVB 1KFJB 5EJ4A 3K05A 4G5SA 4KQEA 2XXAA 4F2HA 2RARA 3CLHA 3KR1A 5A3JA 1VJDA 5IUNC 5LQDA 4BU0A 4EG0A 2XUGA 3LTEA 4FFBB 1MDFA 3CJTA 4NIMA 2HQOA 1EX1A 4LXIA 4X62B 4KXLA 4HCJA 4CEIB 1FMLA 4E1AA 5KSYA 1QANA 3KOXA 2ZDHA 1LX6A 1IEQA 2PX5A 3AR3A 3FNIA 1RJ9A 2JAWA 2IITA 2FAXA 4BTEA 2VL7A 3V7WA 3UPDA 3WK8A 2A94A 3URKA 3TAHA 5LZ2A 2RI1A 3KPUA 2P9JA 1TT5B 4KI7A 4MEAA 2ZITA 5GONB 3HUFA 1DV1A 2R8XA 4ZFNA 2D2FA 2VA9A 1R9NA 3I73A 5B7QA 4YDQA 5FHRA 3BAZA 3IOYA 1QVVA 4KC0A 2Y05A 2ZPAA 1TU0A 2GAIA 4OEHA 4ALKA 3OA2A 2H1FA 3W5CA 1A9YA 1N2GA 3MEQA 5CA0A 3GELA 4WL0A 1ABFA 2J67A 2IQ5A 3P32A 1TAQA 1U1EA 2O0JA 4WINA 5H7XA 4BE7B 2V0GA 3U44B 1U6KA 3N6RA 5DLEA 1VG0B 2PEYA 1E63A 2FSPA 3L7CA 4FDLA 4PFQA 4DJAA 1JN0A 2AFRA 3UMCA 3L7YA 2WJJA 2WT8A 3PLNA 2PANA 2QP4A 1XL0A 4DDHA 2A1IA 2GKSA 4GPEA 3PRJA 1T2FA 1MCZA 1HZZA 1GYRA 4DG8A 4AKIA 4CHGA 3F9CA 2CV0A 4TKZA 1E61A 3C5VA 1JLRA 4RU1A 3NBUA 1STOA 5ARBA 4KO3S 5ITSA 2FF7A 3P2YA 3RIHA 1Z88A 1QVZA 3CUYA 4YXFA 2J85A 4O4LF 1R4NA 4TTAA 5CA0B 1PJRA 1Z82A 3OQ1A 5SYAA 2UVDA 2PQ0A 4Q1VA 1C1YA 3ROFA 3TF5A 1KY3A 2OESA 2V5VA 3BYZA 2FTKE 3IS3A 1KP3A 4JEIA 4UREA 3VH4A 1R18A 1USWA 4ZN6A 1E66A 2ZYVX 1Q5PA 3FDJA 4HR7A 3FF1A 4KLRA 1ZR2A 4LHYA 3WBKA 3HACA 3MGGA 1AXEA 3D54D 1TJPB 2BDEA 4C5BA 3AKZA 2KBFA 5F9FA 2A1UA 1TVCA 4F1WA 1NQAO 1B15A 2FZKA 2DUUA 3EW7A 1KI3A 1V4VA