4DRZA

Crystal structure of human rab14
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
160
Chain Sequence
YNYSYIFKYIIIGDMGVGKSCLLHQFTEKKCPHTIGVEFGTRIIEVSGQKIKLQIWDTAAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human RAB14
rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-14
total genus 54
structure length 160
sequence length 170
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4drzA01
4D80A 3BB3A 2QM8A 2FFAA 1E0AA 5EP4A 3K70C 2O8DB 3QXHA 1G18A 3OZXA 4PSVA 1E9EA 3GLGA 3NBYC 5JHGB 5DE3A 4M9XA 3I32A 3UG7A 4UNQA 1XPUA 3A1VA 3OAAA 5FTLA 3PUYA 2ASEA 3IDQA 2PMKA 2NMVA 3AVVA 5BW8A 3L2OB 5CIWA 2CE7A 2Q3HA 3OIWA 1KJYA 1QF9A 4F38A 4US0R 4S35A 3L43A 2HYIC 2EYUA 1ZCAA 2Q21A 4JBYA 3IBGA 2GJAA 5DYGA 3S1AB 4B34A 1YRAA 2C99A 3CLVA 4IVPA 1M6NA 221PA 4HDQB 4BUJA 1NJFA 4XWOA 4G5QA 4BFTA 1U8YA 3THYB 3DZDA 3CH5A 4IOLA 1M34E 1D2EA 1N0UA 4MYCA 3A1WA 2DWOA 4GNKA 3N5CA 3UK6A 4LUCA 3LBNA 5FPYA 5FOXA 4MKGA 4GZMA 4XOIA 1SKYE 4FCTA 1GZSA 1MO3A 5FFMA 2OCPA 3VX4A 4GZLA 1TQ4A 1X8JA 5J5CA 1JPNA 2HUPA 4F93B 2QN6A 1ZNWA 4TLCA 3DM5A 4Q02A 4UXHA 3H4MA 3V4RA 1GVNB 1YZGA 2CCJA 1IY1A 4BZPA 4W9MC 3UKDA 2EWVA 3A36A 3UMSA 2VHTA 3RSOA 4OHZA 3TVTA 2ZSBA 4MYHA 4DSOA 2O8CA 5JWHA 2OZEA 2A30A 4HAVA 3PQCA 4YMWA 4AI6A 2V6IA 1DAHA 4B44A 2FH5B 3RRZA 4JSYA 4US1R 2H5EA 2CLSA 4ACBA 2W2VA 5K8IA 1ZAKA 2C95A 3LXRA 4MGZR 5FUXA 5LDDC 2A9KA 3GLIB 3OAAD 1NSTA 1PV4A 3P20A 3U44A 3CRQA 1OFUX 4TQAA 1PUJA 1U90A 4DUGA 4EIWA 3SOPA 2ZJ5A 3KKQA 4BLSA 3EX7C 2ZRBA 4DIDA 4NHOA 4OYHA 5CDFE 1UDWA 1UEIA 4IXMA 2VRWA 1OKKD 1JPJA 1T9HA 5TMPA 1SXJB 2ZIAA 5JLJA 2RGCA 3PJRA 2R6FA 1SXJD 1G5PA 3SE0A 4NU0A 4DDVA 1CR2A 1MO4A 1RJ9B 1P9RA 4Q4HA 5FPTA 2F55A 2ZJBA 2WSSD 5F9FA 4B32A 4UKDA 4UXIA 4ILEA 1N6OA 4G5RA 1U8AA 1MO6A 2GDJA 1F5NA 2HXSA 3L0IB 4CDGA 3AGPA 4EPYA 2ODNA 4A1FA 1AM4D 4Q03A 2OE2A 4QBFA 3EXAA 4B33A 1QRAA 1Z6XA 3AKCA 4KSBA 2R8RA 3VFDA 3LXXA 3SZRA 4TL7A 4C9BA 3U7GA 1E0KA 1TUEA 4L4UA 1S3GA 1T3LA 4TMXA 5HKKA 4B73A 2HCBA 2W58A 1ZM7A 4CEIB 1E9RA 4KCGA 2WZQA 4Q9JA 2LKDA 1P73A 5E7JA 4ZDJA 4XTRA 1EFRA 2GCNA 2WVJA 2C03A 3K09C 1NG9A 1TEVA 1W46A 2XX3A 3KQKA 2C04A 1SHZA 3IIJA 4I1VA 3ZVLA 2VSFA 3GLHB 3M1IA 1Q3HA 2ANBA 5GJCA 4QGGA 1FQJA 4LX0A 4NPHA 4V02A 2AK3A 3BOSA 4B71A 4JLNA 4NYIQ 1IAQA 1XMSA 3N2EA 4JS0A 2GCOA 1X86B 2GF0A 2OCBA 2Q9CA 2WJVA 3MUFA 1FTNA 1OPXA 5IHPA 2QMOA 1DAKA 4MDFA 1IY0A 5EZ6B 4NYMR 1E1QA 4MRNA 3T15A 3OEHD 2YWFA 2P67A 2W6ID 4C0BA 3I3SR 3G5UA 4BLQA 8OHMA 1XF9A 2UZ3A 5LB2A 1OJLA 1XEWX 2OG2A 1XZQA 3LWNA 4TMVA 3LW8A 1ZUIA 4B3BA 4YMSA 4ZV4A 3SI7A 1P9WA 1SVSA 1T8TA 2ZRJA 4XVQA 1GILA 2IYTA 1SVMA 4XD7A 4PANA 2AKYA 3V9PA 1JNYA 3OIUA 5KDLA 1D6JA 4BLTA 5TB5A 2A5GA 4URUR 3SQWA 4A0GA 1WCV1 3LW7A 4GP7A 2N1BA 2WJYA 3VAAA 3W6PA 4KVAA 1DAGA 3GJXC 4BFXA 1X6VA 1YR7A 4TQ9A 4OJKA 1U0LA 2A5JA 1E9BA 4DRZA 1ZNYA 4FMBB 2QUZA 3A4NA 5C4GB 1U8ZA 2HDNB 3BFKA 3LNCA 4JL8A 4JZKA 1GNRA 3TQFA 3A37A 3P4YA 1BMFA 1S1CA 3O8DA 3W90A 1P61B 1C9KA 1KI3A 5DLQC 2YNMA 5K8UA 1W47A 1G4UR 3ZQJA 5EXTA 4RSGA 3AVXA 4C0JA 2F1HA 4M8NE 1W4AA 5C4MA 4NTZA 2WJJA 4O3MA 3BK7A 1ZVQA 1CJUC 2GJSA 1JR6A 5FOWA 4WW0A 4AIIA 2IWRA 1TQ2A 2FEOA 3U44B 3ZIAD 1EXMA 3K0CA 3RRMA 1N0VC 2A3RA 2GK6A 2GZHA 2XNSA 3DMDA 1FQKA 3Q7PA 1EFTA 4EPXA 1XMVA 1II0A 3EIQA 5L3SA 5HCIA 3D3QA 1TX4B 3KB1A 1XRJA 2FN4A 2ZYWX 1LF5A 1UM8A 4OI4A 4G5OA 2P6NA 3QNUA 2DR3A 3L8YA 2F1RA 1EG7A 2ZI3A 4LY6A 1FX0A 3ZS9A 5CM8B 3KXIA 4G1UC 2OSBA 1VPLA 2ORWA 3KTAA 4D0GA 2FFHA 4P31A 2GHIA 1IXSB 1R10A 1UF9A 3HJNA 1FUUA 4M9SA 4LDJA 1WRBA 1T3HA 4I81A 3T1OA 3THOA 1GM5A 1SXJE 3O8BA 3SBEA 4HYYA 1CS4C 2ZAMA 3QEOA 3BJIC 4OI2A 4OK3A 3NH6A 4QKQA 1TTTA 2ZUCA 5CK4A 1E9CA 1NVVQ 2IF0A 3EZ2A 4JLVA 2WKRA 4TT3D 4DWJA 1NI3A 3EC1A 5HZKA 3I72A 1VIYA 2F1IA 4QG7A 4EFNA 3DVLA 5D3MB 3GJ3A 4FW9A 1R0ZA 3C5HA 4M9ZA 4HAZA 2QSZA 2ZSFA 3SJCA 1KGDA 1XXHA 2GJ8A 4DCVA 1Q57A 2W0MA 2REXB 2CNWD 2W83A 4QM6A 2OBMA 2QPTA 4R9UC 2AD5A 4ESVA 3EIEA 1N5KA 4RZUA 5JEEA 1MKYA 1XB2A 4ACAA 5L3QA 5GVRA 2CE2X 1G8YA 4QNMA 5ELXA 4XSGA 1CULC 3QF4B 3R7WB 4CGZA 1CR4A 1CRQA 1Q3TA 2G9NA 4C7OA 2IS2A 1OH5A 4DZZA 2O52A 1N0WA 3A8TA 4Q00A 4A2PA 4EJSA 1W36C 3OIVA 3U3JA 1SULA 2AD1A 3OEED 1RFLA 2WBLC 4QJ3A 4DT1A 2PEZA 3GLHE 3Q3JB 3Q5DA 1KKMA 4URYR 1UBCA 3X1YA 2GXQA 4RCZA 1G3QA 5BN5A 3GJ4A 3QOFA 3LQRA 1Z3IX 4EPVA 5AUNB 2IYVA 2NO6A 4NBSA 3WP0A 1SKQA 4M4SA 5AUQA 2VH5R 3A1SA 4E07A 5FPKA 1NLFA 2DFTA 1KI6B 1G7RA 1T91A 4Y0VA 2ZI4A 2F7SA 3SJBA 4DCSA 3VTKA 3C14C 1UPTA 4KV9A 5EUMA 2ZI7A 1I2MA 1HUQA 1BMFD 1M7HA 4IFBA 3U3RA 4EDHA 1VG0B 2G83A 3KQUA 3MD0A 5KSPA 3OIYA 3WBKA 2BMEA 1G8HA 3B5JA 3BORA 3QVVA 1V5WA 1W48A 2QEQA 4RZ2A 2QMEA 1U2RA 1KY2A 2QENA 2RGDA 3AM1A 3GLIA 1IN8A 1RIFA 1KDRA 4U7DA 3B1WA 3RSLA 1CXZA 5P21A 5LB4A 2BBWA 1HV8A 2Q9AA 4JLAA 1W1WA 4TL9A 1D8TA 2FGKA 2FPKA 3R8CA 2IYQA 4PSAA 5E7IA 2J0UA 4PPGA 4BLPA 3T34A 2VEDA 5DH9A 2FNAA 1UJ2A 1A5TA 1SQ5A 2ODWA 3FFAA 3ZVMA 2JGNA 1YE8A 3VKGA 1A7JA 1J90A 3QQ5A 2BCJQ 3VNUA 1Z2CA 1TEXA 1M7GA 4JL6A 4LCBA 1ESMA 2XNDA 4MA4A 3AVYA 2Z43A 2AFIE 4UNPA 5FUWA 1ZCBA 3MFYA 4W5WA 4XWAA 3K0EA 1GDDA 2V7QA 3B1VA 1XEXA 3PFIA 3AF1A 2IEYA 2ORIA 2ECKA 3H84A 4JIMA 1XFAA 2J0QA 1U81A 5JS8A 1LB1B 2HT1A 2J41A 2OXRA 1L2TA 2QGZA 1CLUA 4X8OA 2DFLA 3AKYA 2B7BA 3F3YA 4LJYA 4PHHA 3AVPA 1ANKA 4Q1FA 2JLRA 1ETUA 2GEDA 3W3AA 5EXPA 1E1RD 1KJZA 1NP6A 3CX6A 1FPMA 4ZCMA 5EP3A 1NY5A 1QHNA 4A92A 4PX9A 1QDEA 3CR7A 4MGYR 4HUTA 2YJTD 2O5VA 2AWNA 4OI0A 1US8B 1E79D 1HQYE 4JVMA 4O25A 5GJWC 5IT5A 1RZ3A 1IQPA 1E2QA 2YOFA 5G53C 3LVRE 3GLHA 3NDBB 2C9YA 2FA9A 4FXPA 3QVUA 4B48A 3GJ8A 4C0SA 3UPUA 4A8JA 2EFHB 2B8TA 1ZIOA 1GFIA 2FF7A 5CLQA 5KNCA 1W36D 4BRWA 3VU9A 2ZRLA 1TADA 4GOKA 2F43A 2WICA 5E95A 5J4HA 3KFVA 3ZDQA 4QBHA 2J7PA 4D25A 3DEFA 3MGCA 1Q0UA 2DCUA 1XMJA 1DG3A 1NLYA 2IC5A 2CHQA 1DO0A 3CIOA 4XVRA 1LV7A 3AF4A 5FUYA 2AXPA 4ZKEA 2GEUA 3K9GA 3AEZA 1UKVY 1GRRA 1ZM2A 1DE0A 3EG5A 4Q4AA 1W7AA 5EQTA 1KHTA 4AYXA 1NY6A 1PJRA 3J81k 1IONA 1OYWA 4GMXA 2A5YB 4U00A 4QFMA 1JJ7A 1P62B 1JECA 3KX2A 3THWA 2EFGA 2CNWA 3FHCB 5IK2D 1EWRA 3FWYA 1E2MA 1E2NA 4LBZA 821PA 3LX5A 3TQCA 2HLDD 3IIMA 2H57A 4AKHA 4NL4H 3B9PA 4RJLA 3U60B 4GOJA 4KLNA 1XJ0A 5DSZA 2D4HA 4LHXA 4PXAA 1KNXA 1F60A 2J1LA 1KYIA 1E2EA 5AJVB 1G6HA 3L0OA 1E2HA 2JLQA 3BE4A 1Z08A 3IPXA 3SBDA 3WP1B 3LD9A 2P6RA 4X8LA 3HR8A 1Y63A 4IDHA 5HE8A 4RD0A 2WSMA 5D3QA 3F8TA 2P6UA 2YOGA 3BH6A 3CRW1 4BFUA 4PC2A 1NMYA 1YZTA 5JFGA 3GFOA 1W4CA 3JZAA 5AUOB 5JMTA 1G64A 3AF3A 2CJWB 4TL6A 3WRXC 4H1UA 1TPZA 2WPDA 1OIVA 2X77A 1VG1A 5FPSA 5IK2A 3WY9A 5AUPB 5CLLA 5KYKA 4PQRA 2ZR9A 2G6BA 1S9HA 2O0KA 4ITRC 4DKXA 4BZQA 4Q1CA 1FX0B 2RHDA 4YDHB 2ERXA 3ZVNA 1OH7A 4Z54A 1RE0A 2QE7A 1NNEA 1JXMA 4CT4B 1HT1E 2XEXA 3PXGA 3A4LA 4YONB 2VPPA 1NRJB 1A4RA 4LRWA 3CONA 4P0TA 1ZUHA 3EWAA 2E87A 4RD6A 2ZM5A 4IDQA 1S4QA 4MKIA 5KSYA 1JR3D 2ZS8A 4B3XA 4M2LA 1R7RA 1G41A 2ZUBA 3CNOA 4QHSA 1KI4A 3VHXA 1NN5A 2XSZA 4L5BA 1NKTA 1Q21A 4MUAA 5D3MA 4YQFA 3QPVA 1KZ7B 4MRRA 2NZJA 3QBTA 5FTJA 3AF2A 3KZ1E 5FBQB 2GF9A 4Q5IA 4FMDF 3NDPA 1XBTA 1TU3A 3AVWA 1N6NA 1FMJA 4IJMA 4PAMA 4DVGA 2BBOA 4KFRA 4GSYA 3KQNA 5LPNA 4NCKA 4F91B 3IQXA 3TNFA 3RABA 4XVUA 5HKKD 3RWOA 2ZRAA 1ELOA 3CNLA 3CPHA 1U9IA 2JDID 4LK2A 1RRFA 3DO6A 2VIIA 5TARA 3S1AA 1G3RA 3RDPA 3FKSA 3B78A 3MLEA 3OHMA 3GLGB 4MUBA 1PLKA 2WAYA 2R6DA 1KK1A 5HZHA 1LNZA 2BKUA 3QKRB 4R71A 3RNLA 2I3BA 3AQ4A 1HT2E 3Q9LA 1IN6A 5BWMA 1PUIA 3ECCA 4KSCA 1CU1A 3GJ0A 4LJ8A 2CLDX 3QKTA 2C5LA 1GKIA 3CB4A 4RKEA 2PT5A 4UNRA 1EFHA 3IPYA 4FN5A 5K8LA 3CZQA 5AJWA 2IWHA 1UBEA 2V1XA 2IEZA 4YMVA 3F0TA 1R0YA 3U3KA 4B6FA 5JSZA 2F3TA 1KY3A 3NVAA 2W6IA 4A82A 3K09A 2IYRA 3LBHA 4TSFA 2C9CA 4TTRA 3GJ6A 4DLWA 1IXZA 4LV6A 1HEIA 1G6OA 2F3RA 4JBXA 1ZW6A 3CF6R 3Q7QA 4R2HA 4BPBA 5JZVA 1UKYA 2XAUA 4TYYA 4HDCA 3E2IA 4M53A 2BMJA 3NBXX 3ZVRA 4DUGD 5HPYB 2C78A 2LCFA 2J87A 1U9IC 4WA7A 1ZMXA 3TUIC 5B57C 1Q20A 4IVQA 1RRPA 3X1XA 3HWSA 4OI1A 3RWMB 3HP1A 3AVOA 4R7ZA 4KO8A 3LAWA 2V6JA 4IOJA 3VKWA 1N5LA 2XJ4A 1VMAA 1VYUA 1L7VC 1SVKA 2ZE8A 2IUTA 1KSGA 4IKEA 3RRYA 3PITA 1VG8A 4EAQA 1VDZA 3LDAA 2GXUA 3I92A 1Z0FA 2OBNA 1DAFA 4LJ4A 5FL7A 4DEXA 3IHWA 2WMOB 1ZD1A 2JJ1D 1XJQA 3FDIA 5JCZA 1XXHE 4LHVA 2J5XA 5AJXA 4IXNA 4TYNA 1OHHD 3NH9A 4PC3A 1V43A 2N42A 2XTNA 2BV3A 3PEVA 1N6PA 4DIEA 1JQJC 1NLZA 2G3YA 2JLSA 4FMDB 2NZ8A 6Q21A 4EUNA 1DAEA 2P2LA 4B3CA 2J0UB 4MGIR 2KSQA 4JLPA 3GQBA 1YZKA 4TLBA 4B3FX 2KBEA 1VCMA 1KSFX 1XZPA 1JQLB 1IY2A 1E2GA 1CIPA 4DLVA 1VIAA 4US2R 2W0SA 2RGEA 4ZO4A 3B8HA 4BE7B 4X8HA 3QSYA 1WBBA 3FPAA 1AGRA 2J3EA 1E94E 1SXJA 3AH8A 3B1XA 1RYFA 4IVRA 4C0AC 4E03A 1MRSA 1P2VA 2Q0HA 3AP3A 1QHGA 4QGAA 1BYIA 2RGAA 3FE2A 3TKLA 3WBJA 2FJUA 4WAUA 1KNQA 1IN5A 4JLBA 4NP6A 4NZYA 4LGMA 1DAMA 1W0KD 2ZI9A 3VR1A 4XTCS 5E7MA 4FWTA 3IQWA 3M6AA 2WWIA 3L0PA 2QORA 3GLGE 3BERA 1KK3A 2ZE5A 1BO6A 4MGKR 1AKYA 2OFWA 3EA0A 4A0HA 5JWRA 4DC9A 3ADCA 5FOTA 2H17A 2EVWX 3REFA 4EPRA 1SVOA 3FYHA 4QJ5A 2YVUA 4QGHA 4ZCLA 2R62A 2ZAOA 5HTKA 3K53A 4BRUA 2KJQA 3U3OA 2VBCA 3K9LA 1GAJA 2V9PA 2HEIA 4C0KA 4CEJA 1Z0KA 3TK1A 4Z1MD 3MMPA 1Z6TA 1P7CA 1X8KA 3LRPA 3ICEA 4HUQA 3FMOB 4URVR 3ZQ6A 3EPKA 2H1LA 2GEVA 3KL4A 3FVQA 1U0HC 1R8QA 3SFVA 1H8ED 4TN1A 1MH1A 2N46A 2ZSDA 2F9LA 1VECA 1KDOA 2PX3A 2GILA 3EIHA 4PPFA 1T4GA 4W7SA 4XD7D 3WMFA 2Z4RA 4FMCF 3OE7A 1XXHB 3ETLA 1VHTA 2D7CA 3QEJA 4N1AA 5HE9A 4P4SB 1E4YA 4Q66C 1YR6A 1XEFA 2QBYA 1OYYA 4HAWA 2O8BB 1SZPA 3TSZA 2REOA 4CEJB 4B2LA 4IW3B 4JJZA 3TW4A 3IBYA 2OAQ1 2OCAA 4Z8YA 1Q1QA 1WDTA 1QHSA 1Q12A 3FB4A 2WWGA 3L0SA 3IEVA 1IJEA 4PO8A 2I4IA 2VP4A 1G3UA 3BXZA 4JVNA 2NGRA 4HLQB 2O8FA 1KI8A 3CKLA 3K8YA 2QPOA 1S1MA 2EQBA 3FGNA 3OF5A 1W5TA 1MABA 2J7KA 1AKEA 2GA8A 5SZIA 1GOTA 1XD2A 1UBFA 4TMZA 4BGDA 5H68A 2IYXA 4NE2A 4NYMQ 4TLDA 3SR0A 1XD9A 5FOSA 4KYUA 2VSXA 1VTKA 2OFXA 5H8WA 2QU8A 2BVNA 2Z6VA 2WWHA 3KJEA 3P27A 4ZDKA 4PPNA 3T5DA 4JT4A 3HPRA 1XNJA 2GXAA 4H1VA 2CXXA 1N3BA 2GZDA 4BWYA 4M1MA 1NMZA 3CR8A 5DIFA 2A7QA 2VA8A 2CBZA 3B82A 2H7VA 1E6CA 1W4BA 4FWIB 5EXSA 2ZR7A 4PZZA 5FBVB 3X1WA 1CEEA 1ZU4A 1NSFA 4ZIRB 3K0AB 1ZJ6A 1W0JA 1JJVA 2WIAA 4O0MA 1ZNZA 2DFNA 2WPDD 3T35A 1VG9B 2RAPA 3Q5EA 1E2PA 3DL0A 4V0NA 4AD8A 3GLFA 5EP1A 1D9XA 4AURA 3MG9A 2R6GA 5FL7D 4D4LA 1R0WA 4YMUA 1GITA 2QT1A 5KHOC 2NPIA 2ZJAA 2ZANA 1LS1A 2NQ2C 1XTRA 2JLZA 4Q7MB 4EKDA 2PEYA 4PO9A 1KO5A 1P75A 4QM7A 4I1OA 2MMGA 1D2NA 1T5LA 3U3MA 2BM0A 4Q4JB 1ZP6A 1RW4A 2P65A 2PL3A 3X1DA 3P26A 3NEYA 2OUKA 4OQXA 1XWIA 3SN6A 3EWSA 3QUSA 4YLGA 2IA5A 3KQHA 1KMQA 4PHFA 3UIEA 3OE7D 4C2UA 3HPQA 4LI0A 3K9HA 2XSZD 4B76A 1Q22A 3K0CC 4NMMA 1NIJA 2V54A 5F3WB 3TBKA 1NN3A 3SJZA 2ZRGA 3O47A 3IO3A 3BWDD 1DOAA 1Z07A 2IL1A 4JLKA 1X1RA 4JSTA 5CDFA 2ZSAA 3UATA 3UWKA 3EPLA 3OEEA 1EGAA 2EFDB 4RFSA 4WIAA 3E1SA 3LY5A 2W6JD 3KXLA 1G9XA 2FE4A 3CNNA 4Q4JA 2ONJA 2JLXA 1T6NA 3QG1A 4KODA 1B23P 1EFUA 2OFOA 2W6JA 3A6PC 3THXB 4CVNA 2X8AA 4IFEA 1KOFA 4S2EA 1LY1A 4B47A 3WRYC 5BYJA 3MJRA 2HJVA 1EK0A 4CEIA 1GP2A 3UXMA 3TR0A 1E2KA 3B1ZA 1ZNXA 3ZD7A 1E2FA 3CX7A 2OO7A 4G5GA 3WYAA 3EPJA 1FNNA 2IYLD 3LV8A 4D82A 3VQTA 1NJGA 1X3SA 1T5IA 3CPEA 2O8EB 3QIAA 4UNNA 4JVLA 2WM9B 2QL6A 3IO5A 1E9AA 3DM9B 1E2LA 3TLXA 5CJ2A 1K8RA 2J59A 2VHCA 3BB4A 4F92B 3D31A 1DPFA 2O8FB 2FPLA 1NBMD 2WJGA 3C16C 4BLRA 2FX3A 3PR1A 4RD4A 5TDHA 3EAQA 5JRJA 2ZYUX 3HYRA 4OHYA 1FTSA 3BFXA 3P32A 4LPSA 4U5XA 4V0MA 4URXR 2GAAA 1D2MA 4OK6A 3CF2A 4LYAA 2EU8A 2ZRPA 4AYTA 2D2EA 4V0LA 4A36A 5HCNA 3LLMA 3SS8A 1NF3A 4QGFA 4MDEA 1OXXK 4MKFA 1TF5A 2C2HA 1MABB 4TMKA 3ZLJA 5SZHB 1WP9A 3FKQA 4DB4A 2QQ0A 2IYYA 3EPHA 2VF8A 4JT2A 1OFIA 1S0UA 1X8LA 4Q1AA 3BH7A 1Z22A 1ZUNB 2OM2A 2VO1A 1S3SA 4A6XA 2KWIA 4DLXA 1QBKC 2ODBA 3NWJA 4KFSA 4RCYA 3GLIE 3VKHA 3CM0A 1SVWA 1JBKA 3GCGA 3KDSE 1KMHB 4LHWA 3W9YA 4Q21A 4X8MA 3W5IA 3QPUA 1CKEA 2ZI5A 2RMKA 4NDZA 2VSOA 3GFPA 1JAHA 3MAAC 4Q7KA 1FP7A 1ZBDA 3KKMA 5CYPA 2VP0A 1HY3A 1F48A 2HXYA 3MRSA 5GJBA 1YVDA 4JLOA 1OIWA 2IYSA 1E2JA 3W8NA 3R9WA 2V8OA 2ZTSA 3RAPR 1PLLA 2P3SA 2QAGC 4KBFA 2VP9A 5FOVA 621PA 5AWFC 4DSTA 3ASZA 4C2TA 2HCJB 3ZZUA 4OQLA 1Q1ZA 3BIFA 5BXQC 2VYFA 4E09A 1GNQA 3SHWA 4EPWA 4D4KA 4NCNA 4KJZA 3F5FA 1BYUA 1XX6A 3BRWD 3IKJA 2JIZD 2ZPTX 1BH2A 4M21A 4V0ME 1IBRA 1VYTA 2VP6A 4ERNA 1DADA 1KK2A 1E32A 1Z6YA 4LBYA 3U7HB 4NCHA 5KSZA 1AQUA 1Z83A 3TUJC 5KOYA 3RS7A 1AZTA 2XOKA 1NVWQ 1P4SA 3I61A 3RC3A 2ERYA 3DKPA 4D81A 3T1TA 1P3JA 3GEIA 5EP2A 1AJEA 4ABYA 4DCUA 1QHHA 4FI3C 2ONKA 1LW7A 1ONBA 2IT1A 1JI0A 1F2TA 3KJGA 1UADA 2R6CA 2RKOA 1OSNA 4DHEA 3CX8A 1ZU5A 4OK5A 4A8JC 4KITB 2XB4A 3KUCA 4HDOB 2BEJA 3EASA 4HATA 3VMFA 2G0TA 2YKGA 3U7FB 2RB4A 2WAXA 2RCNA 1P9NA 2QP3A 2Q9BA 1DARA 3M4YA 2IS1A 5F9HA 2BMDA 1E96A 3HYTA 1NVUQ 3T61A 1B0UA 2FWRA 2GAOA 4Q4AB 2PCLA 2B7CA 3QE0A 5KSOA 4M22A 1KI1A 1DS6A 4JMPA 3BBPA 4LV5B 2G1KA 3N70A 1G3IA 3PV0A 2CLCX 2GRJA 3I4LA 5JSZB 2O8DA 2OBLA 4CEHB 1N5IA 3IEUA 3ND8A 2EFEB 2QSYA 2GJ9A 3CUEF 2FFBA 4BZXA 3WYGA 1LVGA 3TJZA 2B21A 4F4IA 1TQDA 4TL8A 4PZLA 4QBGB 1OH8A 2O8EA 1UKZA 1EWQA 1NVVR 2NG1A 1WE2A 1JAIA 2DPXA 2QAJA 1XD8A 1AS2A 4RFVA 1OFTA 4D0NA 4EJSB 1NN1A 5B30A 4A8JB 1CP2A 4ZI2A 2HT6A 2W00A 1F2UB 1GKUB 4NYJQ 1ZC4A 4KAXA 2KE5A 3EZ9A 3FFBA 3P1JA 1G16A 4TWZA 1MRNA 2RH5A 3FHOA 3NKVA 2JLYA 1G21E 1CJVC 2SHKA 4G0NA 4AKEA 1Z2AA 1Z47A 3VNVA 3I5XA 1T8UA 3H0KA 3UMFA 1XJCA 3RYTC 2OILA 3B6EA 1U0JA 4TLEA 2ZETA 1HYQA 1KI2A 3QI2A 2QAGB 1I4LD 4BFWA 1YU9A 2X2EA 2CL7X 4M1OA 1XPOA 1II8A 4A15A 3IHLA 4OJQA 2AHOA 2GBLA 4WXRA 2NO1A 4YXWA 4DSNA 4W5JA 4IEEA 1JEEA 4WVFA 1KI6A 2CEAA 2IXFA 4LV8B 1BOFA 1AQYA 1E2IA 4LSGA 5JWOA 4CZ2A 4IDOA 4DLZA 2MSDB 1II9A 1J99A 5EXXA 2QMHA 1QG4A 1VCNA 3H86A 3HDTA 1WB9A 2CCGA 2JATA 2BM1A 2HF8A 2YC2C 4JYBA 1RKBA 2X1VA 3AF0A 2BDTA 3HU3A 3R8FA 1ZD8A 2BEKA 3B2EA 4ZIRA 2XZLA 3RHFA 5BN4A 5J4VA 3NC0C 2FDCA 1C1YA 1R5OA 4RFSB 4Q7JB 5SZJA 5TVKA 4D6PA 5BN3A 1E9DA 5TXGA 3BAFA 5L3RA 4HLUC 1G7SA 1I4TD 5JCPA 1VYVA 3CZPA 1AS0A 2IXGA 2O0HA 3PG5A 3LBIA 4Q48A 2XZPA 1IXRC 4C3ZA 3VR2A 3I1FA 3GLFB 1FUKA 2VLIA 1NG1A 1SGWA 4URZR 3DOEA 2PLFA 4WBSA 4JYCA 3RANA 2ZJ2A 2C9OA 1PLJA 4LYHA 1J8YF 4A0FA 2ZI6A 1FNMA 2ORVA 1JEDA 1M74A 1ODFA 2A2ZA 2PX0A 5BQ5A 4AKIA 2ZRHA 1L4YA 5JHHB 1DTSA 2GKSA 2CCKA 4B74A 1A82A 3QXJA 1DVRA 2FSFA 2QP4A 1QG2A 2OV2A 2Z83A 3DPUA 4ZCIA 2JDIA 2VL7A 3JVVA 4URWR 2JEOA 4DCTA 1KI9A 4QL3A 4OQMA 4POAA 2I1VB 4HEJA 4E22A 2G0NA 3ZIAA 4DEYA 2GWHA 5KTYA 5DI9A 5LBIA 4QBIA 1H8HA 2RGXA 5J4KA 1GWNA 1LF0A 5DN6A 1E4VA 1E69A 2ZR0A 5DHAA 2VF7A 4NYIR 2JCSA 2FU5C 2J46A 3AUXA 3RLFA 3NEJA 1YHNA 4K46A 1Z0IA 4A9AA 3C41J 4OHWA 4DB2A 3SFZA 1S96A 1TNDA 3R7WA 1N6KA 2ZE6A 4M1SA 4QC2A 3EZ7A 2BBSA 3C8UA 1KJWA 3ONWA 1EX6A 1KO4A 1G291 1Q1BA 3HU2A 3ZJYA 5DO9A 5DYIA 5SZKB 2KBFA 1R2QA 2HF9A 2J45A 4OL0A 2PH1A 3GPLA 2RGGA 1DG1G 1JB1A 2DY1A 3CWZA 1US8A 2CHVA 4PAOA 5A5GA 3R9IA 2ZREA 1HE8B 4EQ6B 4JJKA 2QNRA 2JA1A 2WWFA 1UAAA 5H1YA 3P4XA 3TRFA 5JEDA 2QZ4A 2ZUDA 4B75A 4UXJA 3REGA 3QXCA 4M1WA 4RZ3A 4BECA 2D2FA 2ATVA 1TQ6A 4V03A 4CF7A 1SVIA 2D3WA 3H1TA 2ZYTX 4MYUA 1DAIA 1U98A 4WZAE 2ZVPX 4JBWA 3K0FA 2C77A 2BC9A 1Z63A 5L3VA 2O8CB 2J9RA 5KDOA 2NO9A 4DT1B 1FZQA 4RD2A 1J2JA 1II8B 2JJ2D 3AP1A 2BJWA 4D2IA 3K0SA 4O2RA 2NTYC 3C5CA 5KPDA 4GRAA 1QVRA 3ADKA 5CB8A 4I1SA 1GL9B 1Z28A 1YZUA 4LJAA 4ZDWA 4IDNA 2YYZA 1XCPA 2Y8EA 5BYKA 2GVDC 2JAQA 2BBTA 4PC1A 1TU4A 5L8VA 4B6EA 1MR3F 1XDBA 4YXWD 1S8FA 3GLFE 4DSUA 2WHXA 4AG5A 3VR6A 2ZRFA 2YOHA 1Z8FA 4JKYA 5A4JA 5UKDA 1QHHB 2OCYC 4I99A 5IDVA 2ZRKA 2H18A 2ZYVX 3KTAB 1ZINA 2WOOA 4G3XA 4TSFD 4PZYA 1TMKA 2OESA 2MSCB 1N2CE 2PZGA 2D7DA 5AK0A 3ZGXA 1KKLA 2BHRA 2DYKA 3QPWA 2RGBA 5EE0A 3NHBA 1IN7A 4TQUS 4Z1MA 1OXSC 2XTMA 5F98A 2OAP1 2W2XA 4FD2A 5L3SB 3CF0A 2WWYA 4HZUA 4EFMA 4Z51A 2IXEA 3QY0A 1N25A 3L8ZA 2WKQA 4Q01A 3T12A 1ZYUA 2B6HA 2PZEA 4G01B 5CITA 2IHBA 4KU4A 1G5TA 1FL9A 3WMEA 5DHFA 4B3GA 4GPTA 4LHYA 3T5GA 2WWXA 1WF3A 2LKCA 4EPTA 1OXVA 5CJPA 2FSGA 4N0EA 4JLMA 2GK7A 3PENA 2VHQA 1NBMA 4PTLA 3MSXA 2QA5A 3UANA 1ZC3A 1F3OA 1N6LA 4Q9HA 3Q72A 3VR5A 4XWKA 2GESA 1WXQA 1U99A 3PEWA 4IEIA 1QZXA 4IOMA 1AN0A 1KO1A 1Z29A 1O3YA 2UZIR 4A6PA 1W2GA 1J7KA 5JBQA 4NCJA 4NKRA 1NIPA 4C0LA 4CEHA 4RD1A 5JECA 2EFCB 1RRCA 4Y0AA 4TYWA 2WIBA 1NVXQ 5G41A 4B3DA 1GL7A 4NONA 4IRUB 2ZU6A 4UQOA 5B2ZA 1KSJA 1HURA 1FOEB 2AFHE 2PJRA 5KDDA 2UVQA 3A4MA 5DISB 1E0SA 1TL7C 2AN9A 3E5HA 1FFHA 2LWIA 3ZZ0A 1J70A 4QXAA 3OESA 2YWGA 3X2SA 2ZS7A 2ANCA 2BIFA 1UBGA 3UWOA 3K1JA 3ZZTA 2Q3MA 2HYDA 3G0HA 1AA9A 4L16A 2ODEA 4I1UA 1VKJA 2CL6X 2PZFA 3FHTA 1OT3A 1G7TA 1E3MA 1T0JB 4LYJA 1Z0DA 2IHYA 1VCOA 4KVGA 2NO0A 5G3YA 1E99A 1YZLA 1BIFA 3SDZA 3VU9B 1S2MA 4DDUA 3K0FB 2UKDA 3NC1C 1XPRA 2FGJA 2ZEJA 3PEUA 4D4JA 2C96A 3IGFA 4R98A 5K8TA 1KO8A 4TTQA 4EJSC 2QPAA 421PA 1G3MA 4LZZA 1W49A 1EESA 2PLRA 2OXCA 2ZSEA 3W3ZB 3WHLA 1Y3AA 1T0HB 2XJ9A 1DEKA 1NMXA 2FZLA 3AVQA 4DLUA 2EYQA 2VHJA 1NBME 1SHKA 4HB4A 4AWXA 2JIZA 1CBUA 3BFVA 4LPKA 4F7WA 3ZD6A 2JJ2A 4TMWA 4YDSA 3ZH9B 4ON9A 2WJHA 1P5ZB 4P33A 1SVLA 2DBYA 2R9VA 3NG1A 2WMNB 1ZM4A 4IDPA 2IS6A 4HLUA 3SU8A 3LFUA 3ZYCA 1TF2A 2R6AA 4HB2A 3T06B 3QENA 3TMKA 2HLDA 2GCPA 2PJZA 3WNBA 1XMIA 4F4CA 1N6HA 1ZRHA 4ASUD 1CRPA 4MYTA 5EE9A 4B2IA 4TTPA 4HLCA 3KB2A 3QXXA 5J4YA 1KZGB 4XH9B 3FOZA 3NHAA 4WZBE 4E5UA 2C98A 3NIBA 4UNSA 3FKSD 4BASA 2G88A 3CWQA 5G40A 2OT3B 3T1QA 5JJLA 1HE1C 2IK8A 2GETA 4LHZA 4HZIA 1Q44A 5DNYB 3DZ8A 2REBA 2D06A 5EUQB 3SYLA 4Q19A 3VR3A 5KU1A 4MRPA 3CBQA 5FI0B 3TSWA 1MT0A 4QNRA 2ZRCA 2XB2A 2IBMA 2OEPA 4C0HA 1YZNA 1KK0A 2P5SA 5DGXA 1MO5A 4RVCA 2O0JA 3TE6A 1E9SA 1ZM3A 2RGNA 2Z0MA 2ZJYA 4P32A 5A0FA 3FMIA 3SHFA 1Z06A 4CRWB 2ZU0C 3GMTA 2VP2A 1P6XA 1OW3B 1R5NA 5KPJA 3PEYA 3TW8B 3IIKA 2QTFA 4GFDA 4GOXA 2Z4SA 4K81B 4PHGA 1PZNA 4GMDA 3WXMA 5C2JB 1H8HD 3U6BA 3UMRA 2CK3A 3AKDA 4GP6A 4WZ6A 4IHQA 3O8CA 3C15C 1RJ9A 5AJYA 1LFDB 3QKRA 3I73A 5DI3A 4QOSA 5FR2A 1R6BX 1I2DA 3W34A 3U5ZB 4AY2A 3W6NA 1PVOA 1M1YE 4J0QA 1Z6AA 4C30A 2FZ4A 2IYZA 3BD9A 2K5UA 3T1VA 4HAXA 3U6KA 4GL2A 4MQBA 1OF1A 1DO2A 1RC8A 1H8EA 1XTSA 4RKFA 1OHHA 3KFXA 2XOKD 3LA6A 2J0SA 2XNDD 4M1KA 3RRNA 3MCAA 3U2QA 2R2AA 1ZM9A 2XXAB 4II7A 3B60A 4Q9KA 4D4MA 2B8WA 3SYKA 2ZRDA 4AKGA 1G8FA 1HQCA 1KTVA 1NKSA 2ZRIA 1COWD 3EZ6A 2PT7A 5CYOA 1AS3A 5B58C 1QHIA 1P2UA 3QG5A 2X19A 1G5RA 2CK3D 4LYFA 5AJZA 3X1ZA 1ZD9A 3N2IA 2BOVA 2GTPA 2PMDA 3NXSA 4IOKA 4CYMA 1G8PA 2BCGY 2JLWA 3LLUA 2NO7A 5J40A 1GTVA 3AUYA 1CJTC 3GJ7A 1QHXA 1YZQA 4GDFA 4HB0A 2VHUA 4P4SA 3QF7A 2O8BA 2AKAB 1UKEA 3KUDA 3EA5A 4GBMA 2QG6A 1KO7A 1YRBA 3EW9A 3WNDA 2XXAA 2ZE7A 4ESHA 1EFRD 3K9NA 3LVQE 5FBRB 5FR1A 4R2IA 1IOZA 1M7BA 1W0KA 4LJ5A 4OQNA 4JL5A 3QBVA 2Q6TA 1W44A 2VTKA 1G17A 2IUSA 4LC0A 5FI1B 2JJ8A 4YC7A 1Z0AA 3GFTA 1VCIA 1CR0A 2F9MA 4HLDA 2B92A 3LH5A 4KYIB 4TYQA 2Z5FA 3KJHA 4TLAA 3PVSA 4MRVA 1P2TA 4YMTA 2R65A 3ASYA 3H2YA 3NBZC 2FOLA 1OLOA 4DJTA 1KSHA 1BKDR 5CB6A 3RS2A 4BFVA 3FMPB 2JLUA 1GL6A 3AVUA 1RYHA 5EE1A 3DOFA 2CJWA 3O8RA 3KJIA 3RC8A 2HJGA 3HU1A 4L9SA 5C46F 1KDTA 3UG6A 2WTUA 1K5GA 1OIXA 4G5SA 1N6IA 2QTVB 4LBVA 3B85A 2KI5A 1N6RA 1X1SA 3SNHA 4OHXA 2RGNC 2H16A 3TIFA 2KB0A 3B13B 2ZITA 1YR9A 1T3SA 4PFSA 3I62A 4BQSA 2V3CC 3K0AA 1E1RA 5HR5A 1TF7A 4Q9IA 3EARA 3TUZC 1P72A 4LC1A 2GZAA 4MRSA 4CIDA 4HSEA 1Z6GA 1GG2A 3MWLA 4QJ4A 4RY2A 3ND9A 1OFHA 1E2DA 1F2TB 3Q8XB 2YINC 3EZFA 1CR1A 3B9QA 1G1MA 3ICQB 1GNPA 5KNBA 4Q7LA 2XITA 1UDXA 3BC1A 3DHWC 1HTWA 2AX4A 1KI7A 4HAYA 3TAHA 4PC6A 4XSHA 3BS4A 2V4ZA 2IS4A 5EZ5A 3A58B 4V0KA 3K70D 3D7MA 4FIDA 3PUZA 1FMLA 1GRQA 1JR3E 1OV4A 3AB3A 4ARZB 1J8MF 2FPMA 2G1JA 2H92A 3IUYA 3RS0A 5KUTA 4AG6A 5TY0A 2ZXUA 2DB3A 2JLVA 2QROA 1E0JA 4PQYA 3ZS8A 4C0QC 2W2TA 2GJKA 2WV9A 4P3YA 3RS5A 3I5YA 5C18A 5GADl 2QMUA 4DLSA 2QBYB 3THYA 4DXAA 2WWWA 1NL3A 3KQLA 2FSIA 2DWQA 4LBWA 2WSSA 5B64A 1QHYA 3CW2A 5FTMA 4BFZA 1XU4A 1E79A 2JJ1A 5H70A 1S9DA 4UJ3A 1W4RA 2FSHA 2D62A 2ZJZA 4ZPXA 5AR1A 3E70C 5CK5A 3KKOA 4TYPA 5FBLB 3QKSA 4M9QA 2A78A 4KFUA 4Q1BA 4V0OA 5IF9A 3TVDA 1RRGA 1DBSA 5FPHA 1Q1EA 3ADBA 3C4JA 5JS7A 3QXSA 1D9ZA 3A1TA 4L8GA 1AIPA 3U7EB 4K8OA 4B35A 2V55B 4FCVA 4FMCB 4M1YA 1G20E 3CO5A 4LJ9A 4D0LB 1Z5ZA 1GSIA 2DFKB 4M0LA 4A0RA 4AYWA 1XCMA 1CJMA 3SYNA 2FMXA 4KFTA 3QF4A 1CF4A 4PSKA 3CH4B 5G3ZA 2AK2A 2AL7A 1JR3A 2ZS9A 4MH0R 3L82B 1KDPA 5LD2C 3GEHA 1KAGA 2CL0X 4HI0E 4KXFB 3CRVA 4PPQA 1IM2A 2QAGA 1GUAA 2ZJ8A 1COWA 4A2WA 2YHSA 2OLKA 2TMKA 4D26A 4P4UA 5EE5B 1AK2A 1DELA 2FV8A 4QHTA 3GEEA 4GT1A 4DLRA 4M1TA 2IW3A 2QRNA 1UFQA 2DWPA 2IUUA 2PCJA 1M8PA 4UJ5A 2WKPA 3V00A 2IX3A 5JJIA 3BH0A 3LX8A 2E1RA 4DLYA 4RD3A 2GVZC 2ZVQX 5E3HA 4PHTA 3FTQA 3WHKA 1LTQA 1FW6A 2NIPA 1AZSC 1Z0JA 2E9SA 2L0XA 4OBEA 2D74A 1XEXB 2ZRNA 1P2SA 121PA 3RS4A 5FUVA 4Q4LA 3DDCA 4B43A 4MITA 3I8XA 1IHUA 2WOJA 3MWKA 4AC9A 3TH5A 2A5DA 4W5HA 4B2PA 1U94A 1P60A 2GBLC 3AGQA 2QY9A 1E98A 1OXUA 2BJVA 1GRNA 2F6RA 4O2LA 3WMGA 5JI2E 1GKYA 4NCIA 3TGPA 2QQEA 4PO1A 2V1UA 2C8VA 2CDNA 3CRRA 3WYFA 2MSEB 5LD2B 3HR7A 1A2BA 1K5DA 2YV5A 2RHMA 2AR7A 1CJKC 1XCGB 5GJVC 4ZKDA 2QTHA 3CRMA 3MJHA 4LJ6A 1HH4A 2QI9C 4OQFA 4P4TA 3A1UA 3NTUA 4XIGS 3TAUA 1G4AE 4HZUB 2ZQ5A 4FCWA 4WXPA 4XJXA 5GVSA 5DN6D 3LQQA 4GI7A 1UEJA 3U4QB 3PIRA 4HAUA 4ZI3A 4LJ7A 4PC7A 1D5CA 3THXA 4CW7A 3WNCA 3FMFA 1N5JA 2BMFA 3AKEA 2GNOA 3OFND 5DI3B 2YWEA 2JASA 4BLOA 1IJFA 1IN4A 1QVAA 2EWWA 2GCOB 4A4DA 4MKHA 1GIAA 5KNDA 2F1JA 3SEAA 1OB2A 2J7PD 4ARZA 4KLZA 2CMKA 1R4AA 5JRZA 1XTQA 4EFLA 5TV2A 5J4LA 1L4UA 3RS3A 1CTQA 2FFQA 4EQ6A 4TZ6A 5L3QB 2QGNA 2A5FA 2QM7A 721PA 2NPFA 2WJIA 2NOAA 4DDWA 3C7KA 1JXOA 1E9FA 3RVBA 1A1VA 1EFCA 2OHFA 1YQTA 3VX3A 1JALA 4Q9LA 3PCRB 4HB3A 2I1QA 4AK9A 2XTZA 4PR0A 4C4PA 2J0VA 1OKKA 3VHLB 3KKNA 3TSOA 5KO2A 2R44A 1LS6A 4TT3A 3BB1A 1OH6A 1XTJA 3QKUA 4JVSB 4L9WA 2GXSA 1G7CA 3GJ5A 3R9XA 3AVTA 4BEBA 4DCNA 4Q1EA 3IILA 4C7OB 4JLJA 3DMNA 3QKSB 2FG5A 4BEJA 3W8RA 2YC4C 1OB5A 2ATXA 5IRCD 2DHRA 3PUVA 3B7GA 2ZROA 1KIMA 2F43B 1TAGA 4QHYA 2IYWA 5C1BA 2IYUA 2FEMA 3THWB 1WA5A 1OE0A 1H65A 2CHGA 1W0JD 4OHVA 5FTKA 1EX7A 2V7QD 3LO5A 1K6MA 1XEWY 2AWOA 2P5TB 3NBFA 3MWYW 3V4FA 4PQFA 1XP8A 4KI0A 2X2FA 4PAQA 3Q85A 1KMHA 2VP5A 3D6TB 2VQSA 5EJEA 4I4LA 3U61B 2ZJOA 1C4OA 3OEHA 5FBWB 1YJ5A 4KBGA 1M2OB 1G8GA 1TUIA 2EW1A 4TMTA 4BFYA 4N3NA 1MV5A 4DLTA 1NN0A 3I8SA 2QP9X 3JZMA 3TR5A 4ZDIA 1G19A 2YWHA 1F2UA 5F2EA 5FL3A 4DDTA 2IF2A 2BWJA 1XD2B 3SQXA 2YZ2A 4A2QA 3JVUA 1HA3A 1R5BA 4ASUA 3M0EA 5FTNA 1ZIPA 1RPZA 2CVFA 4NYJR 4JLDA 3AP2A 3W5JA 1R0XA 3DKVA 3B1YA 3VR4A 2AXNA 1OXTA 2PBRA 3EC2A 4BFSA 1ESNA 1L8QA 2P0EA 4JKIA 1W5SA 1YKSA 1WBDA 3K70B 3PUXA 1RVDA 3GD7A 1W2HA 2OLJA 4LWZA 4F4JA 4CT5A 5CIQA 5JJKA 4Q4HB 4U02A 1FP6A 3KKPA 3SC3A 5ANRB 2QT0A 2G77B 4KHZA 2CVHA 4NH0A 4HUQB 3AV0B 3D8BA 1WMSA 4Q47A 1SKYB 4QRHA 4Z8XA 5E4FA 4N0DA 3BGWA 3U4QA 1BS1A 1VHLA 2BKEA 5FH9A 2MMCA 1F6BA 1YR8A 2H8KA 1SXJC 3QJYA 521PA 1MOZA 1KAOA 2ZRMA 1W36B 3PUWA 4DBLC 3SJAA 3W6OA 1XTKA 2XGJA 3G82C 4LOAA 5JI3E 4FINA 4RZXA 4TZ0A 5M04A 1AGPA 1XTIA 5J47A 1A2KC 2Q3FA 3CPJB 5EE3A 2HV8A 1R8SA 4H9GA 3MWJA 3R20A 3KXKA 1O87A 4Q1DA 5CM9C 3GP8A 2XZOA 2QRZA 4Q18A 1E1QD 5FOUA 3OFNA 4L15A 4OKSA 1WQ1R 1I4DD 3ADDA 4WOPA 2QE7D
chains in the Genus database with same CATH superfamily
2ILVA 4ENRA 3TVYA 2ZSKA 1BNCA 1ZGHA 2WZDA 4D80A 4OXQA 4JYAB 2FFAA 3C7DB 2G5CA 4UULA 3K70C 5AW6A 1E9EA 3GLGA 2M6KA 5K99A 1TJNA 3I32A 4JKOA 4CIAA 3NFRA 4WZZA 3AW8A 3DUFB 4IPTA 3UHJA 3C3WA 2NQ8A 3MS2A 3QX3A 4PLVA 2DMRA 4W5OA 2RK3A 3IDQA 5FADA 3VTAA 1K86A 2PMKA 2RGRA 5CIWA 2Q99A 1DT5A 4G0YA 2Q3HA 4RGVA 4JGGA 5REQB 5KOIA 4N65A 4QRIA 5EMHA 2GX6A 1IY9A 2YBDA 4GOND 1WHSA 4OV6B 3SAJA 4AZ3A 3N7TA 3L43A 4S35A 2OV8A 4F04A 1SOMA 4UDXX 1FJXA 4YV1A 2XBUA 4NBLA 3SE7A 3H4VA 4CV0A 4HDQB 5CG1A 3IUJA 4XWOA 4G5QA 3F4LA 3DZDA 4H6PA 1LU9A 4RAQA 2GN8A 4F96A 4IOLA 4JU9A 4MUJA 4Q3KA 4WN3A 2EP7A 4MYCA 3ITDA 2P69A 5CEEA 1RJDA 4GNKA 1UPXA 5JXGA 2DM6A 1LLCA 2MSKA 5FPYA 1KYTA 3IXLA 4OYRA 5D5HA 5TR9A 4GZMA 3TW6A 4U2FA 5B4UA 2LGJA 2Z3ZA 3VX4A 3KBBA 1X8JA 4Q16A 1RPJA 3ZW7A 1X9IA 1GYRA 2HUPA 4IXTA 4F93B 2I6TA 4ITUA 4Q02A 3H4MA 1J9ZA 2J5BA 4GPZA 4YBRA 4JJ8A 1SCQA 2CCJA 3E84A 2PUJA 2RGYA 2EWVA 3MS4A 3A36A 3PDIB 2ZIWB 2Y2UA 4PZ9A 5IJAA 5AMXA 1QYXA 3RSOA 3UMSA 3AJEA 3NPAA 2JFQA 1QRUA 3UMGA 3QNWA 5JS8A 4PLZA 3PQCA 1A3CA 4FOTA 5AK6A 3U5TA 1Y6FA 2FH5B 1MQAA 3DE5X 2BH2A 1TW2A 4L5AA 2OKGA 4FHZA 5ALYA 2CLSA 2EJWA 3A06A 1XR3A 4M54A 4JQCA 1ZAKA 2HTFA 3LXRA 3DCYA 2BEWA 5FUXA 1A96A 2A9KA 4P0QB 1Z2PX 4EHHA 3GFQA 1E8DA 3CRQA 1QJ4A 4EHKA 4OM8A 2R47A 2JFUA 4GE3A 2ID8A 2ZJ5A 3KQTA 1QQ7A 4XDZA 4DIDA 4OYHA 1D7AA 3K6KA 4KPEC 3K5HA 1P1BA 3NM5A 5CDFE 1M5RA 4I9HA 3LC0A 2F62A 3OJCA 3W1EA 4UHHA 4DRXA 4E5PA 4WCFB 1D6NA 1UMDA 4FYPA 4ZICA 2CNNA 4XGKA 3BXHA 5TMPA 1JJAA 1V48A 4JU8A 3MOSA 1NR7A 1ADBA 2ZIAA 3O3MB 3WDKA 4AZ0A 5JSUA 1SXJD 3WFIA 5ARBA 4OQZA 4GIBA 1UEXC 5TGZA 4IKOA 4L5CA 3SIPA 5EGSA 1AQLA 1CR2A 2VH1A 3K6RA 5K0FA 2F55A 1QGUA 3Q0TA 5E6RB 4BAGA 4C7BA 4B32A 2QJFA 1M2JA 1B14A 4N0MA 2HXSA 3T3OA 2Q3BA 4IDDA 5FLKA 3NI2A 5LZ5A 4CDGA 2XQGA 1T5TA 4XPIA 4EPYA 2ZIGA 3VV3A 3PRJA 4UHDA 4RQUA 2HM7A 3HCNA 4Q03A 3SHQA 3EXAA 3AG6A 4GSKA 1CZKA 1GTZA 4X1OA 3VSCA 2R8RA 4MARA 3FUXA 3KPJA 3S5JA 3SZRA 1FRVA 3TWOA 3NOVA 1QDLB 2FQ1A 3DKKA 3F9CA 4C9BA 1KRXA 1JTFA 1Y1QA 4LE2A 3CQ9A 4RTLA 2W70A 2FN8A 5BNWA 1KKUA 1S3GA 1L4GA 1T3LA 1WUYA 3HB1A 4O5AA 3F7NA 2ZIZA 4B73A 3T0FA 1CPYA 3U4GA 4Q9JA 3RT7A 4IJUA 2YWBA 1R6TA 3PZRA 1L4MA 1K3FA 1LKZA 4B80A 5HIAA 2A4MA 3V34A 1O57A 4IRXA 1FNSA 1FYEA 1IM8A 2GLTA 2IODA 3EG9B 3GRCA 4LXGA 5H3LA 3TM5A 4S2UA 3MCVA 3UCXA 1EUQA 1JEQA 1NW8A 4WUTA 3RHTA 4OFBA 2D3TA 2DT8A 5GQSA 3M6WA 3KQKA 3ANTA 3COPA 2XB6A 2DBZA 3NTOA 4KW7A 6GPBA 2ANBA 4I19A 3PTAA 2HPAA 2XNCA 1I9GA 3BOSA 1CYDA 1AQ6A 2PUVA 3QVKA 4LOIA 4J03A 4JS0A 3A3PA 3ZE7A 1XA0A 2HRBA 1RXUA 1J00A 2WM2A 1P7PA 2OCBA 2Q9CA 3DWEX 2OK8A 3MUFA 3QA9A 4P5EA 5IHPA 1JIUA 2I66A 1EJBA 1O94A 2XWPA 3NHFA 5EZ6B 3MINA 3QUBA 4NYMR 4JNCA 3T15A 4PZDA 2O2YA 2WYIA 1SEVA 3RHZA 3UBMA 2FZCA 3RIHA 3WL6A 4HH0A 2HA7A 2B98A 3I12A 3GRKA 1XZQA 5FDFA 4TMVA 5HIIA 2QYOA 4F5ZA 5BQ3A 3W05A 4ZV4A 2HRRA 3R5HA 3ZCRA 4XVQA 2ZRJA 4EITA 4JXJA 2IYTA 5DHQA 5HKBA 4QT4A 4ONEA 3ZEIA 3R75A 1ZOPA 3PRKE 4DGSA 2HLPA 2ZM6B 1D6JA 3DOOA 3NHMA 5GV7A 4GWGA 5LWHA 2A5GA 1DTWB 2OD2A 1AVTA 5P8WA 2Z04A 2A0FA 4CR6A 4A0GA 1GPYA 3GY0A 1Z3CA 5K7SA 1JG7A 2I65A 2XECA 4I6JA 4G24A 1B6SA 5CDTA 3E7DA 2X1HA 4OXIA 5EIWA 4XX0A 3W1VA 2L82A 2JGJA 1M1ZA 2X5OA 1CHNA 2A5JA 2IGBA 5C4GB 1U9CA 1U8ZA 2HDNB 3LNCA 4P8RA 5A1TA 2ADOA 3P4YA 1E62A 4Y3UA 3O8DA 1O0CA 1P61B 3DWFA 1C9KA 4JLSA 5CLGA 1KERA 4MCHA 2D1YA 3IE0A 2K4MA 5K0GA 4FIZA 3PVZA 1FIUA 3OEWA 3SYRA 5EXTA 2G5TA 5JNTA 5AVTA 4C4AA 3M83A 4RDXA 1SQFA 1YIAA 1NDHA 3JRXA 4W7HA 4YP9A 3WKDA 1I6LA 1O54A 4KTTE 4OXRA 4W9NC 3WYDA 3OQ6A 3RAGA 4V1CB 4Z7QB 3OUZA 4KQEA 1ZVQA 4YUXA 3G2OA 5JMWA 4ARIA 4DE5A 3L7OA 3VISA 2X3YA 3WADA 5BV8A 2VT2A 4I3FA 3I45A 1BFUA 3PQEA 1LK7A 4LEIA 3T7SA 3SYMA 3UO8B 3ZWXA 2OAGA 1GKKA 3AZPA 2GZHA 2XNSA 1OVGA 1FLVA 1FQKA 2F59A 3DP9A 1X1DA 4KPUA 4MW9A 1EFTA 3STWA 3ZU6A 3AC0A 5I7UA 3EIQA 5JZ9A 1EG2A 1CC1S 2I9PA 5HCIA 4GXNA 3KYIB 1ORHA 2UYCA 3TI9A 1SBQA 2OK7A 4D9KA 1UBMS 4RH0A 2JHPA 4G5OA 2QTMA 1K0FA 2HRDA 2QVXX 4MS1A 4N6GA 3BA6A 5BRNA 4M9RA 4IYJA 2F1RA 3PVCA 2DQYA 3QRWA 4MQ5A 1JQ3A 1S2GA 1UMCA 1YBVA 2A1UA 2FHPA 2P9CA 3GA7A 2BFWA 3ZS9A 1TECE 3WWDA 3AHEA 3AIMA 3GDWA 1VPLA 3JWIA 2QX9A 3KTAA 5CT5A 5KMGA 4XYMA 2EATA 2IZ1A 1UF9A 1VIDA 4J49A 1AUVA 1B0AA 3ORYA 3T1OA 3V1KA 3THOA 1GM5A 4X9XA 5AW4A 3O8BA 1RLOA 2AH5A 3RVLA 3HXMA 1VHQA 2ZYRA 3LHDA 1NRWA 3QEOA 4ZARA 5AVJA 2V1UA 3NH6A 1R4MB 2MHCA 1C41A 3RRFA 3UB2A 3A6KA 5F21A 1WZEA 1NVVQ 3H18A 1K4YA 2OZLA 4LQCA 5AM0A 2WKRA 3KQYA 5JQGB 2QUKA 1NI3A 1CY7A 1E3DA 1Y7HA 2VBIA 3WL5A 5DBFA 1SUEA 2BM8A 1KEZA 3ZHXA 3DVLA 4FW9A 4ENWA 2Q41A 1KA9H 2QSZA 2QDXA 3E6AA 1KGDA 3EZXA 3PNSA 4QJBA 3P2OA 8AT1A 5F7XA 2WW8A 3F7TA 4DCVA 1Q57A 5I6DA 4EYSA 3FTDA 4XCXA 2CNWD 4B87A 4OQPA 4U5QA 5EEHA 3WG9A 2PV7A 1Y34E 2JFBA 2PSHA 2OBMA 2BKXA 4HGNA 4RZUA 2BONA 4ZOAA 1VKOA 4M8KA 4DV5B 1SEPA 1XB2A 5KQPA 4ACAA 1SELA 1T6YA 2NUPB 2PAFA 2WZCA 1NUTA 2XYVA 1M2VA 3EDCA 4X95A 1CULC 1OQAA 4ZRNA 5AOBA 2BDUA 3LDGA 3R3HA 5B53A 1Q3TA 3T4EA 3VU8A 4C7OA 2JEZA 1G9TA 5AVSA 1WNFA 4OGWA 3B48A 5ELLA 3UCFA 1K2WA 1FYXA 3FOCA 4ER3A 1NXPA 1HSZA 1WSWA 1JB9A 3S68A 2F2TA 3ZR4B 4F3RA 1BWRA 1SKUA 2EL9A 3L7LA 4O2BB 1U0BB 1C9MA 2H4XA 3C1OA 3OEED 4URHA 3LOPA 5FWXB 1RZUA 2WBLC 3CKYA 4QJ3A 2ISQA 3GLHE 2QOEA 2VP3A 3BXXA 4PGHA 5LJLA 1L7EA 2PLNA 2CW5A 3KSMA 4URYR 5DM1A 3LQ1A 3OFJA 4FE3A 3RC7A 1ODIA 2C3MA 3E82A 1IZ0A 4K9NA 5DOVA 3RTBA 1FFBA 4NBSA 3WP0A 3PHJA 4PLWA 1P1HA 3PT5A 4JQZA 4RPKA 5AUQA 1O6BA 1FSSA 1J56A 1T91A 2DFTA 1V7PC 2CYCA 1U6IA 1WS6A 1RYBA 3AI2A 3OZDA 2JBHA 3C6ZA 4QXQA 3OKCA 3U7QA 5EUMA 2ZI7A 1I2MA 1M7HA 4B83A 1Q7CA 3U3RA 3ZJVA 4WFQA 5JYDA 4PGFA 2QKYA 4RVGA 3TX2A 1WULS 4IDAA 4OAOA 1GNSA 2IVZA 4BO7A 4XIYA 2VHZA 2BMEA 4NBKA 1G8HA 1J22A 1USKA 4MO2A 1K1EA 3C48A 3IP6A 3L4SO 4HXGA 4K9QA 3B5JA 1UMDB 4Y18A 2QEQA 1DLIA 1NRXA 4OFXA 2X9QA 2IZ7A 1AHIA 5KYXA 3BCUA 1RIFA 4U7DA 3HSYA 1M2NA 1B93A 4GKAA 1NURA 4AZ0B 1VGVA 3OIDA 5G0VA 2MDTA 1X0VA 1T9BA 2H0RA 1L5RA 4KQWA 3JQQA 4JJIA 3E7WA 4MWOA 1D8TA 1DNPA 1JYSA 2Z2YA 3GZNA 1CZNA 3C3EA 3C4VA 4PSAA 2J0UA 2OL4A 1BD4A 4GR4A 1XKQA 3TINA 4PPGA 5BVHA 4OHKA 3HXOA 3T9EA 2EKQA 2V9CA 3A9SA 4I1PA 5FEMA 1A5TA 1G2QA 4Z7JA 2JGNA 1H5NA 3PWSA 4HAIA 2HSWA 1A7JA 3RV4A 1DKLA 3QQ5A 4L1KA 3L9WA 1XRMA 3VNUA 1UL1X 1Z2CA 4OHUA 4ZAFA 1M7GA 2O8VA 4CQJA 2ZZNA 2XNDA 1F8FA 3AVYA 3ABZA 1D4AA 3T6KA 4KNYA 2V0NA 4UNPA 3ANLA 2WU3A 5DYYA 4B6OA 4DCOA 3PGXA 2A0KA 1P8JA 2V7QA 3L84A 4RCVA 5EMJA 4BJ1A 5I7AA 3RUFA 4EVQA 3H9EO 5JT1A 2XKKA 2AKEA 1GL3A 3AF1A 5FCDA 2IZ5A 5HIKA 2J0QA 2EDCA 1LB1B 4OAQA 1EUCB 2XY4A 2OXRA 2QGZA 3ZI4A 3EG9A 5JDCA 2HT1A 1W8IA 2IX9A 3KD3A 2OZLB 4LJYA 3F3YA 3ISTA 1N2EA 1ANKA 3ANSA 4YAJA 2FWAA 3G59A 3FUUA 2XE4A 3LC7O 3P7MA 4Q1FA 2GEDA 2PA0A 5EXPA 5JXHA 5NLLA 5SYNA 3LRXA 1KJZA 4Z3KA 4R7GA 2CMHA 4DANA 2AX3A 4ZCMA 5BW4A 2GLXA 3F46A 1Z39A 3PGMA 4ZVVA 1T29A 4RPCA 1LFAA 1R16A 5JCJA 1CQIB 3VNRA 4EHFA 1V5FA 1K63A 1QGUB 1W93A 4RGBA 5LMUB 1S8NA 2HQRA 3JWPA 1V39A 4NEHB 3RSZA 1W59A 3IHKA 3O4IA 5AJHA 2CLKB 3MTIA 4JVMA 4O25A 4C7KA 3O84A 4N03A 1RCFA 1IQPA 3HDQA 4LOKA 4KKXB 4QNNA 4XB2A 5DNUA 1X7ZA 2PFGA 1T8WA 2FP3A 2G08A 2CVPA 5EWJA 2VOEA 4B48A 5KTRA 1FBNA 5CCXA 2CNLA 4AMZA 3UPUA 2EFHB 3USES 2B8TA 1KMNA 1ZIOA 1DIHA 3ABOB 5KNCA 1W36D 4BRWA 3VU9A 2ZRLA 2F43A 2WICA 5J4HA 2E4ZA 3ZDQA 1GLGA 1SK9A 3DEFA 3BCRA 2FQWA 1X94A 2FDXA 2PO7A 1PGJA 2YHBA 1DG3A 1MFPA 3I53A 5TMDA 1QFJA 2IC5A 3Q7IA 2LVBA 1K3TA 3AUUA 1DO0A 1YS9A 3K5WA 4IGAA 2VEOA 4I8DA 4UBOA 2PUDA 2AXPA 3U39A 4LE1A 1BD3A 4LSMA 1Z16A 2GEUA 1USGA 2E82A 2HADA 2O1SA 1UKVY 1KGSA 3L1HA 3LPLA 3G7UA 3OTWA 4OF4A 4Q4AA 4WECA 5EQTA 3R76A 4WCVA 5JSFA 1E3QA 3GA5A 1BXZA 4AYXA 1MAAA 3WRYA 3I39X 1LLUA 1L9KA 1JIXA 4NMHA 1P62B 1YUMA 1VOTA 3KX2A 3WMWA 2EFGA 2FWMX 3THWA 5JZMA 1Q14A 4R69A 3LHIA 4F5YA 4RMJA 3OVMA 4S05A 1E2NA 2Z6QA 3LX5A 2VJKA 3IC5A 4J3NA 4XJTA 3TQCA 4CL8A 2GA9A 4DR3B 3P2JA 1JS1X 3B5IA 2H57A 3ACCA 2XUGA 3UOAB 3W8EA 4RF4A 1GPDG 2PSEA 1SR8A 4X54A 1NW6A 4RJLA 4GOJA 4WNAB 4ZCSA 5KVSA 1XJ0A 3REOA 1Z7BA 3GRZA 1ILEA 5JO0A 1F60A 2J1LA 1SU7A 1Y8AA 1C3JA 1G6HA 2N9UA 1SJ9A 3GR6A 5GMOA 3PIIA 2C5GA 1QSGA 3WP1B 3LD9A 4RYLA 4X8LA 3H8VA 3HR8A 4IDHA 4E4YA 4EMTA 5DJ5A 2C7PA 3T9CA 5EJ7A 4E46A 3MT7A 4WZBB 4YK7A 1YONA 3CRW1 5JIBA 2XUHA 5K0ZA 4IQ0A 3AB7A 1DAPA 1YZTA 3FBGA 2VXBA 5CA0B 2P9TA 2ZJ6A 3VRHA 2QL7A 4TL6A 1OZAA 2I4OA 5HRUA 1ESZA 1VL5A 4EUFA 3FZGA 2WPDA 3DVRX 3IH5A 3L7NA 3WY9A 3HN6A 3MB5A 1ZD3A 1TAHA 1KPGA 4F3CA 1JUDA 4WI1A 3TF5A 4WLEA 1M83A 2G6BA 1S9HA 3U26A 3X1KA 4DKXA 4RK5A 2VAXA 4Q1CA 5CHEA 3PFCA 2ZXEA 2XUPA 4AT1A 1OH7A 4QQRA 1A4UA 2QE7A 1JVSA 1MB3A 1PHPA 2OTCA 2PPLA 5C8XA 2WU1A 4YPOA 1O96B 1LUAA 4BCDA 2H2WA 2FCRA 4P0TA 3WLFA 5IULC 3UJPA 2FUNB 5M7EA 1IPFA 2QRVB 1KJQA 4RGYA 4M55A 4UHJA 5ITZA 2ES4A 2CXNA 2WUEA 1JR3D 4N5MA 5KSYA 2OCKA 4HDSA 1CUHA 2GFHA 5TPWB 3NHZA 2PL1A 3LZ6A 4KGXA 1C3VA 4M2LA 1R7RA 2QTTA 2ZUBA 3DZFA 4QHSA 4BMDA 5HX7A 1NBOA 4K7JA 3MTDA 4YJ2B 4K1LA 4YQFA 5KX5F 1Y37A 3CW9A 1CRWG 1V7ZA 3F5DA 3UZUA 4KPGA 1E6LA 4GQAA 5LFAA 5FTJA 1HZZA 1ZMTA 2NW6A 3OKAA 5D8DA 3F3SA 2L19A 2V3WA 4R81A 1FK8A 4F6CA 1EQUA 3NDPA 2DLDA 2OPHA 3WLIA 2V7XA 3OHPA 3D4NA 3ITKA 3KETA 2B61A 1FMJA 4PAMA 3UUGA 4BGIA 1XL0A 4WJZA 3CKMA 2BBOA 3EMDA 4N5HX 4DVGA 1NVKA 2UYYA 4NCKA 2ZG6A 3IQXA 1Y5NA 5D3KA 1SRQA 3RABA 4D56A 4F91B 1G5QA 3CPHA 3A28A 3WKAA 1VBNA 1QPGA 1PK9A 4HVTA 5LYJF 3O3NB 3CT6A 2Q1WA 2SCUA 2VKQA 3ZCVA 3H2IA 3ZZMA 3GLGB 1PLKA 2WAYA 2R6DA 1KK1A 1LNZA 2AYXA 4AN0A 4Q37A 1E92A 3QKRB 3RNLA 1BAPA 4H59A 3Q9LA 4E14A 1YHZA 3JQFA 3LBAA 5IASA 3LY8A 1PUIA 2UXCB 3GJ0A 4R5HA 4XJSA 5K1ZA 5LDGA 5FNZA 1N75A 1YHYA 4FFMA 4L8WB 4O4IB 3CB4A 4TS3A 1UDBA 4HDKB 4FN5A 4YRNA 2JGDB 3INTA 4PWZA 1FRNA 1UXHA 4YMVA 4PCLA 1R0YA 3DBHA 3U3KA 4XCVA 5JSZA 1BGVA 1KY3A 1WF6A 3NVAA 5I4KA 4KO2S 2BMVA 5TMBA 3PFBA 3KELA 1V4VA 1UPUA 7MDHA 3OCVA 1PI3A 2QBYA 1WW2A 3FDFA 3UWSA 2IZZA 4D97A 3F73A 5C7OO 4WFIA 5KREA 2UVPB 1AN9A 1RJWA 3DA8A 4TS4A 1ZW6A 2VJYA 3CF6R 3Q7QA 3ZIDA 2C3PA 3G85A 5JZVA 1UKYA 4BPBA 5EMMA 3ZX5A 1W25A 3UT5B 1D8AA 2E18A 4LZNA 4HDCA 4TYYA 2VK1A 3HO8A 2X40A 2HIAA 1XVUA 1UMBA 2YJZA 4IVQA 2Z98A 2AV6A 4ZGBA 2JARA 1EK6A 1CEXA 5TX7A 2X4LA 2PX5A 2BR4A 4L85A 2YRXA 2OG1A 3EC7A 2PSSA 1RYDA 4WFJA 3KV3O 2WIFA 3TNYA 3VKWA 3EY4A 1OC4A 3INRA 1DC4A 3FCYA 1SVKA 5THKA 1UDAA 4GGPA 3SZMA 4IKEA 5HUHA 3UMCA 3PITA 3RNOA 3AFNA 4CKWB 2ZGVA 4EAQA 4BXOB 3L8CA 4JQOA 2PGOA 3ET5A 2OZVA 2OBNA 1AKMA 2B25A 2QUIA 3IP1A 3AQIA 3IHWA 4I66A 3BWXA 3N05A 3NFYA 2PBFA 1K6EA 3TLJA 3ZWBA 4ZHQB 3ZDYB 1OHHD 1JHZA 3L01A 3QVXA 1V43A 2N42A 1TC2A 1OXBB 1ENYA 1FFWA 1N6PA 3QOWA 2H51A 1HDCA 2G3YA 2HPHA 4DIEA 4N12A 1RCUA 3ECAA 2F90A 2R6ZA 2W4MA 1BXKA 4U2KA 4BIIA 1DBQA 1IEXA 2B2CA 3X44A 4XXHA 1S8OA 2J3LA 3H3JA 5FXMA 5AXDA 1ISJA 1XZPA 1BMQA 2ZYSA 1E2GA 4NS4A 5HJEA 2YMLA 2QRVA 2E4WA 3IVAA 5CA1A 5KKCA 5KVAA 1X1AA 1J0CA 1Q7EA 2RGEA 1W5AA 2W0SA 2Y3IA 3KKZA 3PB3A 4X8HA 1AGRA 4BE7B 1SXJA 2ZK7A 3TX6A 4C0AC 1RYFA 1QHGA 3UHPA 4QGAA 1TMGE 1IVYA 1BYIA 3AHCA 2RGAA 2BISA 3ONFA 2Z9CA 4IX1A 4Z3DA 1YB7A 3TOZA 1KNQA 3TL6A 5HDBB 1IN5A 5JE8A 4F9FA 2MSNA 2Q0SA 2YVKA 2YY5A 3MCWA 4GM4A 3UJ6A 1QX4A 3DFUA 1ABBA 3O9MA 2KHZA 5I4BA 1X0XA 4OCZA 3BUSA 4QOIA 1CQIA 1HI9A 1CV2A 4O4IF 1QTRA 2VZ8A 1DJLA 4K3VA 2QORA 5IBCA 5KTTA 3BERA 4IGIA 1NNSA 2J9GA 3T7EA 2ZE5A 3N8GA 3P2YA 1N5DA 4JFAA 1MX3A 4MS1B 1V7CA 1F5SA 2VHEA 2P30A 2HIMA 4A0HA 1WCIA 2IU3A 3G2MA 3DBOB 4BAUA 4DC9A 5EJ4A 3ADCA 3UMYA 4YRGA 3JATA 1JHOA 4PO3X 2PQ2A 1H2RS 2VDLB 3FYHA 4QJ5A 2YVUA 4B9EA 3U56A 4DA4A 3SR4A 5HTKA 3ACBA 3P2EA 2AFIB 5EMKA 2HH9A 2VBCA 3KJQA 3OCYA 2BFEA 3HEMA 2E55A 3F6EX 5E0KB 3OZWA 4GX2A 3TK1A 1HFJA 1I01A 1G8KA 1PEKE 1PNOA 1Q5PA 2GZ1A 2JAWA 2FEPA 1Z6TA 2WAOA 4GL4A 4LQLA 2Z2KA 4PEVA 4RF3A 3CJRA 5E1MA 5GONF 3PL1A 3Q9UA 1P77A 3UNXA 1N1DA 3FY4A 1XMPA 3CEHA 4G4SP 2H63A 3FA2A 4I7EA 3TTSA 2GEVA 3BIJA 1U0HC 1R8QA 3LM8A 4ND3A 3GDHA 4TN1A 1TZ2A 4MUEA 2HKIA 3CSSA 4JAVC 3BTSA 4YRMA 3AJ8A 2ZIEA 1PQWA 4IF6A 2NVUB 4BUZA 3AX6A 5C1PA 2AG5A 3P5SA 3OE7A 4O6VA 4H6VA 1VHTA 3DO8A 1WPRA 5H16A 2AZDA 3CX3A 3BGVA 1YR6A 3UH1A 3WWZA 3AZOA 4AULA 2V7GA 3NHSA 3TSZA 2REOA 3TRJA 4H0FA 3F90A 2DECA 3QPCA 4BWGA 4B6SA 2OAQ1 2Q5CA 1BN7A 3WGYA 2PGIA 1N9GB 1UJ4A 3QJ5A 1X1CA 3T7TA 1TYAE 1J0DA 1ISRA 2Y0EA 3Q5GA 4KEAA 1QHSA 5EESA 1CUWA 3FB4A 5CTAA 1T43A 2WWGA 1SCBA 3N75A 2AOWA 4RLHA 4G8DA 2HWYA 1R6VA 3E8XA 2VP4A 1G3UA 2FEAA 2I6XA 3GPBA 3VR4D 2BFDB 5BYAA 1R64A 1VRCA 3NYRA 1Z2OX 4XLTA 1S1MA 2Y2VA 3ZE6A 3ITEA 3OF5A 3LY7A 1ZJ4A 4HGRA 1AKEA 2RHGB 3I83A 3IESA 3PX3A 4Y9SA 1JMYA 2NM0A 4YACA 4KQKA 5ETJA 5KINB 4U8HA 1SUBA 4BGDA 1GGNA 3PNBA 2C0QA 4NYMQ 4TLDA 3VPHA 2DQZA 2CD9A 3B1JA 4GBED 3IEKA 1KE2A 4EB0A 2E4XA 3CSDA 4KAAA 1N2BA 1H23A 1P7ZA 1VTKA 2OFXA 2VSXA 4KYUA 3H5IA 1O6CA 3AHHA 3LQ2A 3G5LA 4DV4B 1Y9DA 3FDZA 3P27A 4TV9A 4JT4A 3WRVA 3F74A 4BQPA 3UWMA 4PNHA 3UJ7A 4Q6WA 3Q7SA 3TXAA 2WVHA 4BX0A 4KIFA 4M1MA 1NMZA 3JQ9C 2QUHA 4PRZA 5HRAA 3OHSX 3JWGA 4QGSA 1IHXA 4FWIB 5EXSA 4W5RA 3ZK9A 4AKHA 1CEEA 4OJNA 3K0AB 4IVNA 1ZJ6A 3PPYA 1JZTA 4HWGA 3S1SA 1RI5A 5LDHA 4F1JA 3B38A 3RIMA 2ZT8A 1EVIA 1WP4A 1ZNZA 2DFNA 2WPDD 3T35A 4IIJF 1GZVA 1ACJA 2YN2A 1EVEA 4OG2A 1CJBA 3DL0A 3C6XA 3V7UA 5LU8A 2HDHA 3HMQA 4PRYA 2O3TA 2HD4A 3PL5A 4JUIA 4RA6B 4ZVOA 2D1TA 4HCJA 5K3SA 5JNLA 3L0DA 4UVHA 4DYVA 1N7GA 5JYBA 3LHFA 4IINA 1J23A 1T8YA 2PWYA 2YICA 1GITA 4IR7A 4U39A 4D4LA 1JF8A 4P5DA 3GJRA 1AK9A 3EUFA 3F96A 1X7DA 2VBGA 3IAEA 5DPMA 2GO1A 3UH0A 5I7HA 5JCJD 2O3RA 5BW6B 2PUAA 1ZQ9A 7ABPA 1RI1A 3N87A 4IHJF 1JR4A 1D2NA 3U3MA 2CFCA 4Q4JB 1GPH1 1FJ2A 1VKZA 4X3OA 1KHHA 1QO7A 2F8LA 4ZQCB 2PPVA 5KYUB 3DG9A 3SN6A 2PFKA 3QUSA 2IA5A 4HMPA 3OE7D 3HPQA 4BE4A 4BQOA 4F7DA 3K9HA 2DJIA 4N82A 4B76A 1Q22A 4NMMA 1NGSA 3BCSA 3B5EA 5F3WB 2VOJA 3TBKA 4E5YA 2Y1OA 4INJA 2EBUA 2VUSA 1YTUA 4XYEA 1C0EA 1KFJB 2P78A 1A97A 3IO3A 5EIBD 5KNLA 4YCDA 4A1OA 1JEOA 5DHUA 2IPOA 3ZNOA 1DHRA 4RFSA 3QELB 4PLYA 4FFRA 3KJZA 3OSUA 2YVAA 1B23P 5T4BA 2PK3A 4OU4A 1L3BA 3G6KA 2OVBA 3JQ6A 2PYDA 4K5QA 3IBTA 4PLGA 1OD6A 4JVOA 5HJ5A 1ZJZA 4YMLA 1MIOA 1N7HA 1YIOA 1MQ8B 3I01M 5DTEA 4XWYA 4P6VF 4CMEC 1EK0A 1RWXA 3KZVA 2RHOA 3KAPA 3RUPA 4F46A 4RANA 3CEAA 3QLVC 3TR0A 1CZHA 2QGFA 3GUHA 1E2FA 4EY6A 3FCSB 2VNJA 3H9QA 3CX7A 2FWIA 1C7FA 2OO7A 3EPJA 2Q5HA 4NU8X 3LV8A 3EXHA 5LQKA 3E3NA 1PR9A 1X3SA 1T5IA 1XDUA 1OX5A 2DUMA 3CPEA 4NJOA 3FGOA 3ZWCA 2O8EB 2C8JA 1HE5A 2C2MA 2QL6A 2XT0A 3IO5A 5E4JA 3PQ2A 5BUZA 2B9EA 3DM9B 4ND4A 4NE9A 5AJTA 3BT7A 1IOWA 2CKMA 4EO7A 1BGWA 5LSAA 3E7FA 4MTLA 5CJ2A 5T5QA 1ML4A 2J59A 3AUAA 2WT9A 4PZAA 1L5NA 9LDTA 1N1GA 4F92B 1BJKA 2DG2A 2WIJA 4KX5A 4Z0NA 3HNOA 2JFFA 4HDRA 1U04A 2B69A 2FX3A 2AN5A 3PR1A 4RD4A 1VSUA 3KEOA 1NXTA 3L7YA 4RYDA 1AUXA 1ADYA 4LPSA 3P32A 4V0MA 5BY2A 4GEGA 3SIXA 3SX2A 3U80A 2GO7A 5AW1A 3BL5A 1V11A 3O8LA 4B84A 1MD9A 5HBGA 3WTBA 2HLNA 3A2LA 3M2PA 2CXQA 1T3ZA 3IAHA 4A36A 3NP7A 4KLCA 4MP3A 4MDEA 3HE3A 3WMXA 1J8FA 4WEOA 3QVWA 4TMKA 1MABB 4O3FA 4EG6A 3SJUA 4IIEA 4GLBA 2IDMA 3EPHA 2YZKA 3R3JA 1DP4A 3K7EA 3W8FA 3PJFA 2PS0A 1Z22A 1ZUNB 2ADMA 4FSHA 4QELA 4A6XA 5EJ9A 1U0SY 3DHYA 4DLXA 3SNKA 2ODBA 3L8GA 3LT1A 2FQXA 3JRWA 1JBKA 1NSYA 1KMHB 2Z8XA 1IG3A 1PIWA 1VE7A 1JHRA 4CF4A 2JFHA 4Q21A 1LWNA 1UBNA 2ZI5A 2CMFA 2LP4Y 3A1NA 1YI1A 3FDXA 3GFPA 4G85A 1L5SA 3PGVA 5ALSA 3WJ2A 4CCWA 3NRJA 1A69A 3DT8A 2VP0A 5TQ2A 3KSRA 3SLGA 1HY3A 4UOQA 4OFWA 4FOLA 1QU2A 1F48A 3MRSA 3EBLA 5GJBA 1YVDA 2JGFA 3MHTA 1A50B 3W8NA 3A6LA 4OPMA 5LP6A 1BN6A 3R9WA 4E7PA 2D4AA 4JELA 3MJCA 3P9CA 3U1BA 4KBFA 2AF4C 2BSQA 3ESRA 3ROXA 3KC2A 4DSTA 2BL4A 1SUWA 3ASZA 1E4OA 3G5AA 2HCJB 3OOEA 3ZZUA 4AB1A 4BU0A 2FMFA 2VYND 2JEYA 4LXUA 3ZDAA 3BMXA 3WHIA 4FC7A 1RFGE 3ENQA 4XPIB 2AEFA 2PKQO 4PV7A 3SHWA 1NLMA 5BSRA 1BYUA 1Z8HA 3KUUA 3GB9A 1TFRA 3LT5A 3RT9A 3NGXA 1DADA 4CKCB 1KK2A 1ZO8A 3DB1A 4PYLA 4AS2A 2OZKA 2P8SA 1Y5LA 3SQNA 1OXKB 5CCBA 4K3UA 1K7XB 3U7HB 1AQUA 4S0ZA 5JVDB 4U0KA 4XGQA 2IY8A 3AYXB 2XOKA 4N5LA 3I61A 3QLJA 4FXOA 3RC3A 3WGLA 1NYRA 1P1RA 2WZBA 2ERYA 5B55A 4GKBA 5JXWA 1PNTA 1L3CA 2XUJA 1EFAA 1U0RA 2YVLA 5HNKA 3DEAA 3ED5A 2GCEA 3E3OA 1YA4A 2D8MA 1IHYA 1KE1A 1MA3A 2ROQA 1DJPA 1H1DA 3CX8A 3OF2A 4MWGA 4UVDA 4A8JC 4KPYA 2XVXA 2FMHA 5EJ6A 3KUCA 3ROMA 1YI8A 1JDZA 4HATA 4QVGA 4DZTA 2G0TA 5D00A 3ZPXA 4HWKA 1EGMB 2Z08A 1R66A 2FR0A 2IDZA 2RCNA 3G23A 3MTGA 1USWA 3G0DA 4QFCA 1RLMA 2PUEA 1PFYA 2CMDA 4TTTS 1X7HA 2A9VA 3DOCA 2IS1A 2I76A 2WB2A 4ZEMA 3QV1A 3MWDA 3T61A 1B0UA 1OI7A 4N8DA 1DS6A 5DBIA 2EZUA 1XQYA 3ELDA 1EDDA 1P9LA 3QUAA 4DV3B 3N8DA 4X61A 3BF7A 4OSPA 5DHRA 3ZU5A 4CNBA 5IBPA 1G38A 2OBLA 5JAHA 1I7LA 1G8SA 5A5EA 3A6HA 3M81A 1K8XB 2FOXA 3MA0A 2PUTA 1P5RA 2W6NA 4G63A 4BZXA 3VKUA 1CY6A 1DJNA 4DBZA 2D2VA 4H16A 3IV7A 5I8ZA 1O95D 1DBRA 4FBGA 4ZI5A 2I4RA 5U1PA 4F4IA 1RLUA 5KQRA 1OILA 4HDKA 2O5EA 2G71A 2JI7A 4F45A 3EEOA 2DKNA 1EWQA 5KWJA 1K8QA 1HBJA 1HOTA 1ULAA 3G5MA 4QXRA 2OD9A 4DSZA 2NU7A 1YZHA 1OFTA 1JWBB 1NJ6A 1V2HE 3KNZA 3R5TA 5ALUA 4CDMA 3DGEC 2RIPA 3WC4A 1SU8A 1YD7A 2W00A 3T5TA 5HZGA 5LA6B 5K0JA 2REQB 5CYGA 4NYJQ 4REQA 1CUYA 5IABA 4I8IA 2NP6A 4KAXA 2KE5A 3T3IA 1OBOA 3ENNA 1JQBA 3FD8A 3P1JA 4PLFA 3ZU4A 1MRNA 2RH5A 2YXDA 2WABA 3JQGB 3IERA 3NKVA 1G21E 9MHTA 4HQLA 4PXSA 1IUNA 3KLNA 3OURA 4G0NA 1Z18A 3W5VA 4C4SA 3LOQA 4MRMA 4K6MA 1ES9A 1T8UA 2X15A 3Q6NA 1RHQA 3CLSD 3RUIA 2EIHA 2OILA 4CL0A 3ISJA 4TLEA 6AT1A 3DSRA 3JQBC 4CKEB 4OLBA 1E3IA 1HYQA 2R5FA 2QTCA 3H6GA 3QI2A 1I4LD 2ZLBA 1YACA 2XOEA 4MDYA 1YU9A 3TZKA 4EKYA 4D9GA 2OGSA 4A15A 2AHOA 4II3A 1T4MA 1I3CA 4IIVA 5EZQA 3TB4A 5BMVB 2Z1MA 5DW3A 5TQVA 1NVFA 3ONVA 4DSNA 1LBHA 2C5FA 1KI6A 2OMEA 2CEAA 2B82A 2WD8A 2A9QA 3SXPA 2P9FA 4DLZA 3KU1A 3UYLA 2IPNA 3BQMB 4MIOA 2BHLA 5EXXA 1UK8A 5EKUA 5LKRA 3HDTA 3UYKA 1BJTA 1VJDA 3N2GB 2CCGA 3BGIA 5T3UA 1N8NA 1JIQA 2H2HA 4AVYA 4TLLB 3N53A 2O3QA 5T6BA 2IUEA 1CB7A 3OLVA 2YC2C 1XL1A 1UFVA 4P3KA 4KFCA 2X1VA 2VDNB 2COUA 4CLRA 3N58A 1QAQA 3B2EA 4TVKA 3C3KA 4KAJA 3RHFA 2R6R1 5J4VA 4XYLA 2BLNA 2OSVA 1R5OA 3V1NA 3HVUA 5SZJA 1BGXT 1BX3A 1V96A 2XQVA 4TLMB