4DRZA

Crystal structure of human rab14
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
160
Chain Sequence
YNYSYIFKYIIIGDMGVGKSCLLHQFTEKKCPHTIGVEFGTRIIEVSGQKIKLQIWDTAAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ras-related protein Rab-14
publication title Crystal structure of human RAB14
rcsb
source organism Homo sapiens
total genus 54
structure length 160
sequence length 170
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4drzA01
2J45A 2D06A 3CZQA 1IXRC 1CJMA 4AWXA 1OFIA 1E0AA 5IF9A 1NIJA 5J4VA 4KITB 2E87A 5SZJA 1P3JA 3LX8A 2TMKA 5CYOA 4DLSA 3QBTA 4F91B 3PVSA 1YKSA 4YC7A 1VHTA 1ZD1A 2GCOA 3OESA 3EZFA 1VPLA 3MJHA 1OXVA 1U0JA 1IONA 4YXWA 3HYRA 3UATA 1P60A 5D3MB 5FPSA 1VCOA 3X1XA 4EPXA 1XZPA 2JJ1D 3EA0A 4C0HA 4IEEA 2NOAA 3PUWA 1S96A 2GILA 4JVSB 1XP8A 4Z54A 4E22A 5DGXA 3CKLA 4FMCF 2X2EA 3K09C 2AHOA 3R9XA 2NGRA 3FKSA 4C30A 5KDLA 2ZIAA 5F3WB 2GEVA 4UNSA 1GRQA 1RRFA 2ZEJA 3I72A 4KODA 3AKEA 2IUUA 1RVDA 4BASA 2J9RA 2LCFA 2A5JA 5L3QA 1M7BA 3K70C 1W47A 1JI0A 1L4UA 1R0ZA 5J47A 3I92A 1ZD9A 2ZU0C 1P2TA 2N42A 4FN5A 1JPNA 4HAXA 4LX0A 4B6EA 1XJCA 4JYCA 1EX6A 4M1OA 3LAWA 4LPSA 1A2KC 4RJLA 2CE2X 1DEKA 1R0XA 3FGNA 4KSBA 3THYB 2F9MA 4FW9A 3CRQA 2IHBA 3LW7A 1PV4A 3GJ0A 3RYTC 3P20A 3AEZA 4Q02A 3TIFA 1KYIA 4TTRA 1E4VA 3L8YA 3D7MA 1TEXA 4UNQA 4NYJR 4DSNA 4EPYA 2R2AA 2O52A 2QN6A 1Q3HA 2J59A 3TSOA 2HJGA 3K9LA 4C0KA 2GXSA 2OV2A 3AF2A 2ERYA 2Z4SA 2IHYA 4XIGS 4ARZB 5P21A 4U7DA 1E79A 2HYDA 1E2PA 2AKAB 1P6XA 2BBOA 2GNOA 3QUSA 3M6AA 4G5RA 4AURA 5BWMA 3BAFA 2BOVA 5CM9C 3H84A 1ZYUA 3E5HA 3F0TA 3CIOA 2QMEA 1LY1A 3TR5A 4TWZA 4E5UA 1E1RD 1F60A 1C4OA 4KFUA 3VR4A 2OE2A 5FPYA 3GLGA 4DLRA 1ZU5A 2XNDA 4C0BA 1NN0A 1EFRD 4URYR 2DWPA 1G6OA 4PX9A 1F3OA 2CCJA 2HYIC 1L7VC 4TL7A 2BBSA 3NBYC 2XTZA 4ZI2A 3GMTA 1D2MA 4YXWD 5L3SA 1W1WA 4YMTA 3PXGA 2RGNA 4UJ3A 4AYXA 4B3BA 3WP0A 5DHFA 4NP6A 2VHCA 1DO0A 3I8XA 1WE2A 4HDQB 1Z63A 1GZSA 2CL0X 2UKDA 2ZPTX 2BBTA 3GFOA 3FPAA 3CH4B 3IDQA 4XSGA 4D2IA 1N6HA 1RE0A 2HLDD 3R20A 1OXUA 4LV6A 4JLBA 2ZYVX 4MKGA 5JSZA 3HP1A 1E2DA 2KJQA 2OLJA 4YDSA 621PA 3B1XA 1YQTA 1T3SA 4LCBA 4GI7A 1E99A 1N6IA 4TQUS 4TT3A 3CPEA 2XZPA 4JJKA 5JEEA 3R7WA 1W4RA 1KMQA 4PZZA 3BXZA 4IVPA 4MITA 1AK2A 3R8CA 1XD2B 1Y3AA 2GZAA 1HT2E 3A37A 1TQ6A 2V55B 1U8AA 2H1LA 4Q7KA 4Q21A 3V4RA 1KSGA 4B76A 2YOFA 3GJ3A 4EUNA 4QGFA 4CEIA 4JLMA 4US2R 1E4YA 4AC9A 1JQJC 5HCNA 4HEJA 4HB4A 1KSFX 2V1XA 3V9PA 4AKEA 4TSFA 4WZAE 1J8YF 1W0KD 2P0EA 5IK2D 1SKYE 2PMDA 5KTYA 4A0GA 1AZTA 4QXAA 5JS7A 1GRRA 3X1DA 4N1AA 1E2LA 3UK6A 4NPHA 1HE8B 1E79D 2GCNA 3IPXA 4S2EA 1XTSA 4DLUA 1H65A 1XTIA 3P4YA 2D2FA 3T1VA 2WJGA 3SJZA 1DOAA 1MO3A 2OLKA 2X77A 1XD8A 4CDGA 1NVWQ 3UG7A 4EFLA 1WDTA 3V00A 4V0KA 3OAAA 2ODWA 2C95A 3PUYA 1E9AA 3Q85A 2GDJA 1I2DA 2ZS8A 2ZANA 1ZNZA 4FCTA 5KYKA 1XXHB 3IBYA 2HCJB 3ND8A 4JLNA 3UIEA 4JBYA 2V3CC 4GSYA 2W6IA 1QHGA 5J4HA 1TF2A 5KHOC 1OB5A 1IQPA 2UVQA 2J7PA 1NG9A 4PFSA 1E69A 5EXXA 4B3FX 1FX0A 2VSFA 3L8ZA 2OCBA 4D82A 5UKDA 1P9RA 3SYNA 3HWSA 1Z8FA 3DOEA 2O8EA 1QF9A 2FEMA 3EPLA 2WIBA 3U61B 1MV5A 5TVKA 3ICQB 2J0QA 1YHNA 3MG9A 4IDPA 2CCGA 2PL3A 3OIVA 4I1SA 2R6AA 2JEOA 2ZRNA 3TAHA 2ZUCA 1XDBA 1DS6A 1KKMA 1SXJB 2NO7A 4TLAA 4V0NA 1UBEA 1RRPA 2WVJA 1AS3A 3T34A 1K6MA 4JLOA 1KNXA 2PH1A 4U00A 4A8JB 2QAGC 1KY2A 2A5DA 1OHHD 2D2EA 3PIRA 2A9KA 2KSQA 2FPLA 2IYWA 2RB4A 4BLSA 4LC0A 2QM7A 2G83A 4LJ7A 5G40A 1XPRA 4JSYA 1G7CA 4LHYA 3ZZTA 2FZLA 5TB5A 3PEVA 1XPUA 3CUEF 2VL7A 3SR0A 4B3GA 5F9HA 3QKSB 1VG9B 2BMEA 2ZQ5A 3IHWA 1E2EA 3A1WA 2FGJA 5BN4A 4QJ4A 4WZBE 3B5JA 3LVQE 4HLCA 1RZ3A 2IK8A 2W58A 2IL1A 1E96A 1FQKA 5LB2A 5EUQB 2W6JA 3CR7A 1NL3A 1RW4A 2QPTA 1IJFA 3CWQA 5CJPA 4US1R 4PO8A 5SZKB 3NC1C 4OQXA 5FL7D 2QNRA 4BRUA 1UBGA 4JZKA 3BB3A 1G7SA 1OT3A 4KFSA 4O25A 2FGKA 3K09A 1NN1A 1YU9A 2ZRHA 1BMFD 1NLYA 4WXRA 1RPZA 1FOEB 3B1ZA 2WJHA 1NBMA 4ABYA 5FI1B 4BQSA 4C0QC 2F7SA 2QENA 2C77A 4EJSC 5EE3A 1XBTA 1GNRA 3LXXA 2VQSA 2VHUA 3QE0A 2RGEA 5KSPA 4HUTA 4KSCA 1KAGA 3VKWA 1Z28A 121PA 1G3UA 2GVZC 1VIAA 1ZD8A 4PR0A 3AF3A 3EAQA 3AVUA 4OJKA 3AVTA 2W2TA 2YC4C 1EXMA 2REXB 4WW0A 1YJ5A 1GDDA 1TQ2A 2XXAA 2W83A 4G1UC 3KKPA 1F2UB 3C5HA 4TMXA 4ZCIA 3ZD7A 1OXXK 3PEWA 1MO4A 4NYIR 4A0RA 1U0LA 1XEXA 1ZMXA 3DZDA 1E2QA 3UMSA 1KSJA 5FOUA 4A0FA 5KSYA 5FBVB 1G8FA 3SHWA 3VNUA 4F4CA 1VCIA 4QBIA 3VR6A 4Q7JB 3TVDA 1VDZA 3P27A 5KOYA 8OHMA 3BWDD 4HZUA 2OAP1 4TYYA 2G1JA 2GJAA 4TZ6A 2ZRCA 2YKGA 4C0JA 3AKCA 4D26A 1QDEA 3FFAA 4I81A 1AN0A 4LUCA 3PENA 1W36B 4A6PA 3A6PC 2QMHA 5JWHA 3TAUA 3LVRE 4IXMA 3T61A 4YMSA 2IF0A 3QQ5A 3EXAA 4BEJA 1E2MA 4B47A 5IHPA 1N6NA 4RY2A 3BH6A 5GJWC 1S3GA 3KKMA 4V0MA 4QFMA 4A2QA 2G1KA 4HDCA 2I1QA 4Q7MB 4DSTA 3QNUA 4MRSA 1C9KA 3B1VA 2UZIR 4XJXA 5FI0B 4PPQA 2IYZA 1WF3A 5FBLB 1JXMA 2LKDA 5FUXA 2ZVQX 2OSBA 2AXNA 2FFQA 3LH5A 4XOIA 1G291 2CJWB 2HDNB 3IO5A 3R7WB 2AWOA 3SJCA 2BM1A 1H8HA 4F4JA 1Z0FA 1KI3A 2V6JA 1SVOA 2JLQA 1II8A 4EPVA 1P7CA 2F43B 5HTKA 3ZZUA 2HT1A 1YZLA 1E0JA 1CLUA 4V03A 4G5SA 4Q7LA 5FTMA 2QPAA 4OQMA 3Q5EA 4H9GA 2L0XA 3LWNA 2BKUA 2PCLA 2RGDA 2GXQA 1NBMD 3BJIC 1X86B 4HB3A 1COWA 3CPHA 3F3YA 4LOAA 4A15A 2OBMA 4I99A 3BBPA 3K9NA 2UZ3A 5BQ5A 3K0SA 2Q9CA 4NH0A 5HPYB 3NEYA 4YMVA 2R6GA 1YR7A 4JVNA 5E95A 2CMKA 3QF4B 4EAQA 3THWB 1WA5A 5TMPA 2XJ4A 4R98A 2C78A 4PAMA 2NIPA 2A30A 2LKCA 4TMKA 3GJ6A 2W2VA 4HAUA 2NO1A 3NBXX 2ZSBA 3CONA 4JT4A 3KB1A 2BJWA 2WWFA 4L9SA 3TR0A 3W5IA 4TL9A 2J87A 1KMHA 3A4MA 4HYYA 4PHHA 4Z51A 5CDFE 1NBME 1CJTC 3V4FA 3H4MA 4WXPA 1NIPA 4OK6A 5DLQC 1OB2A 4HB0A 5B57C 3NC0C 2H57A 2BV3A 2IA5A 4FMDF 4M1MA 3VMFA 3AVQA 2XEXA 1GAJA 1L2TA 2D7CA 2Q3HA 4BZPA 4ESHA 3L0IB 3MGCA 4L4UA 4NCNA 3QXSA 3EZ7A 5L8VA 1VYTA 3EZ2A 1E2HA 1ZUNB 3QF7A 3IILA 3AGQA 1WBBA 2O0JA 4DIEA 1UBFA 2WMNB 2IS1A 4CF7A 4CEHB 2XB4A 3OF5A 1E32A 3NDBB 2ZJYA 2ORIA 5KO2A 1MABB 1UBCA 1E0KA 4NTZA 5KUTA 3KZ1E 4QOSA 1SGWA 2IYRA 3I73A 3KUCA 3GLHA 4OKSA 1GWNA 2WZQA 1H8HD 4RVCA 2YYZA 4C3ZA 1A1VA 4HLQB 4Y0AA 2GZDA 3BC1A 3K9GA 2FWRA 1VYVA 3PR1A 3RS2A 2Q9BA 5B2ZA 2H8KA 1FUKA 3AV0B 2ANCA 2ZXUA 4I4LA 1EX7A 3B7GA 1XFAA 2VO1A 3TSZA 5AJYA 2JASA 1G7TA 4Z8XA 5E7IA 1IY1A 1XTJA 1NLFA 2A2ZA 2QAGA 3KXLA 3A36A 4DWJA 5BYJA 2RGGA 1T5IA 3K1JA 4D4LA 4LYHA 4H1VA 4LC1A 5AK0A 1XPOA 2FG5A 1KDOA 5G41A 4KU4A 2PZGA 4DLWA 1J90A 1FNNA 4JMPA 2F1JA 2JLZA 2F9LA 1IHUA 1W4BA 4Q1CA 5D3QA 1QHXA 4RD4A 2OESA 3DMNA 4URWR 4R9UC 1G8YA 5BN3A 2VBCA 4RD6A 4ZPXA 3IEUA 3K70B 1SHKA 1XMJA 1X8JA 2XNSA 1HA3A 2IYTA 3EIEA 1BYIA 4L16A 1BIFA 3QKUA 3WHLA 5DI9A 3U60B 4DDUA 3JVVA 2FFHA 4Q9HA 3HU2A 1E9EA 5H8WA 1IM2A 2P67A 3TW4A 5DI3B 3CF0A 1QVAA 2V6IA 3DL0A 2BDTA 3Q7QA 4PPGA 4UXHA 5FPHA 1DAHA 3WBJA 4CEJB 2QRZA 4O2RA 2WWWA 1KI1A 3BGWA 3NG1A 1N5JA 1OXTA 4CZ2A 4U02A 4IVRA 2WJYA 3K0AA 4HUQB 2P5SA 4JLDA 4M53A 3U2QA 2WMOB 2OFXA 3Q72A 4EFMA 2CK3D 2W0SA 4KV9A 1RJ9A 4AD8A 3J81k 1U90A 4EJSA 1S3SA 3U6BA 3VNVA 2PZFA 1KY3A 2QE7D 3GEHA 4HZUB 4OK3A 2GRJA 4MYTA 3WRYC 4NHOA 1E9BA 4EPTA 3DPUA 2YINC 1IY2A 4PC3A 2ONKA 5KSOA 1XCMA 2QSYA 1QG4A 2A78A 5JMTA 4ASUA 3EPHA 2JJ2A 1Z07A 1LF5A 2BM0A 2ZJ2A 4WAUA 4OHZA 3AP2A 4TYWA 2RGXA 2DYKA 1XCPA 1G17A 3GLFA 2J3EA 4PHFA 2DBYA 2H7VA 1N6RA 2Z83A 3NVAA 1KI7A 1U0HC 3ZLJA 1VTKA 2ODEA 5HCIA 4TLDA 1PLJA 1Z22A 4UJ5A 1FFHA 2B6HA 3ZQJA 3BE4A 5A0FA 4H1UA 3B13B 2O8FB 5JRJA 2XTMA 4IDNA 2P2LA 3IBGA 2OFWA 2PJZA 4AIIA 1KSHA 1JEEA 3NBFA 2ZJOA 2O8DA 2BKEA 1ZW6A 3QKRA 3QSYA 2DR3A 1P9WA 3GLHE 1JALA 1W0JD 4OHVA 3ZZ0A 4TQAA 2IXFA 3IO3A 4UXIA 2DFNA 5CIWA 4A92A 4DVGA 2KE5A 4Q9JA 1K8RA 3A1TA 2EFCB 5J5CA 3CPJB 4NL4H 4P4SA 4PXAA 4B2IA 1KOFA 5FOVA 4KYUA 5C1BA 3WYFA 3I8SA 1OYYA 1NVXQ 4YDHB 3ADKA 2H18A 1GKIA 4FCVA 1R0WA 1YZTA 3MSXA 5AWFC 3U3MA 2IS4A 1SVSA 1I4DD 4Q4HB 5EE1A 1E2NA 1N3BA 5K8LA 4HAVA 4I1OA 3L0PA 3GFTA 4Z1MD 4WOPA 5AJWA 1VKJA 3VU9B 4KJZA 1C1YA 4GOXA 4BZXA 1KO5A 2CL6X 5FOXA 4BLOA 3FHCB 1CEEA 2ASEA 3R8FA 1ESMA 5FTLA 3QVUA 4UNPA 3A1VA 5IRCD 1AQUA 3K0FA 1ZJ6A 2A5FA 1I2MA 2BMFA 4LHXA 4AYWA 2O8BB 4B3DA 1Z6TA 3SYKA 1JPJA 4RFSB 2ZJZA 2ZAOA 4AG6A 3RC3A 1KK2A 4NKRA 1XEWX 4V0OA 1FUUA 3IIKA 3RWMB 5DYGA 4B2PA 2AXPA 1KI6A 3LQQA 3Q9LA 4JL8A 3BH7A 1WP9A 4TLEA 4TL6A 4ZKDA 1OPXA 1E9RA 1PJRA 4X8LA 4ASUD 2AD5A 2JJ2D 1DTSA 4IDQA 1IY0A 1WXQA 2P3SA 1E1RA 3MWYW 3QY0A 2ZRBA 4KBFA 4L5BA 5EZ5A 3RRZA 4FWTA 4TMZA 1CULC 2QL6A 1IXSB 1NN5A 3MRSA 4R2HA 5FUVA 2IYQA 3U3JA 1S9HA 1EFRA 1P73A 4A4DA 1NP6A 3SS8A 2FE4A 4D25A 4LYAA 4M8NE 1T8UA 1UKVY 3DDCA 2QG6A 3PEUA 4TLCA 4ZV4A 2YWGA 2QMOA 3A4NA 2MMCA 4BLPA 1E3MA 2BVNA 3EPKA 4RD2A 3T1TA 3U6KA 1JAIA 5LD2C 4MRRA 4RD3A 2ZRMA 3ZGXA 3T1QA 3FB4A 4YLGA 1UADA 4DUGD 1AZSC 1QHHB 3SJBA 3UXMA 3U44B 4FCWA 4NZYA 2HLDA 2ZTSA 4FWIB 4ZCLA 1UAAA 2WHXA 3GLFE 3ASZA 4A36A 4W7SA 3R9WA 3MAAC 1NN3A 2GCPA 2GEUA 1M2OB 1N0WA 3QPUA 5JHHB 1G3MA 3HR8A 1ETUA 4Y0VA 2BCGY 5G53C 3OFND 4PSAA 2QT1A 1T0HB 4OI1A 2F1HA 5JWOA 3KQUA 4P32A 1IN5A 1N0VC 1TU4A 1AS2A 3EX7C 1IOZA 2GETA 2ZREA 1IBRA 3ASYA 5GJCA 1LF0A 4M0LA 4TMVA 5C18A 4PSVA 1R5NA 3P1JA 4P0TA 3WNBA 2ZJBA 3QXCA 3UKDA 3ZIAD 3NEJA 5L3RA 3SQXA 2PT7A 2ATXA 4J0QA 2G0NA 3B2EA 3VAAA 4Q4AA 4DZZA 1G20E 5IT5A 1Z0IA 2J46A 3CX7A 4DC9A 1ZUHA 1YVDA 1U9IA 1UKZA 4MYHA 3SFVA 1GILA 3LX5A 1MH1A 1QHSA 2XB2A 1W0KA 5IK2A 2QTHA 4LV8B 1KI2A 2PZEA 3KTAA 1IXZA 3EZ6A 1M7GA 3QIAA 3QJYA 1Q21A 5FTKA 4MRVA 3W6OA 5FBQB 1ZM9A 4D4MA 1HTWA 1CRQA 1X8KA 4F92B 1OW3B 2A7QA 3I3SR 3VFDA 3U7FB 5IDVA 2BWJA 3PEYA 1XCGB 1G5PA 2VH5R 3C5CA 5K8UA 4OL0A 3VTKA 2WJVA 1RYFA 6Q21A 2BJVA 4JVMA 1ANKA 3LO5A 1XJQA 2ZRGA 4C0AC 3W3AA 5FR2A 3UWKA 4MRPA 3EW9A 4DLTA 4Q47A 1A5TA 1TF5A 1YRBA 2OAQ1 2NO6A 4BLTA 1HUQA 4NCHA 2ZAMA 4JBWA 2IXGA 3S1AB 2OZEA 5AUPB 3IKJA 4YONB 1E2FA 2JDID 1OV4A 1XEFA 2IS6A 2E9SA 2CHVA 4N0DA 3AGPA 3MWKA 3VR1A 3K0CC 5EXSA 5DNYB 3OEED 5E7JA 3RS3A 1PLLA 1XMIA 5C4GB 3FE2A 2V9PA 3PITA 1KI8A 2Z0MA 3KDSE 1TUEA 3DKVA 3K53A 4PANA 2CL7X 1LW7A 5SZHB 2OBNA 3C15C 1OHHA 4D81A 3GJ7A 3TSWA 3PJRA 1F5NA 1DG1G 2FPKA 4IDHA 4DXAA 2XJ9A 3DM5A 4UKDA 1P2VA 3U7HB 2F55A 1XTQA 3M4YA 3X1WA 2ZE6A 4LBYA 4NCJA 2EVWX 4QM7A 2F6RA 1RIFA 4NCIA 5DYIA 4DB4A 1E2IA 2GBLC 5EE9A 2ZROA 1G8HA 2PLFA 2RAPA 4ZCMA 1VHLA 4DDWA 1EWRA 1WMSA 4W5WA 4EQ6B 1KK3A 4L15A 1UF9A 2AR7A 2ZJAA 3W6NA 2AFIE 5TV2A 1E9FA 4JLKA 2RMKA 1CP2A 5FL7A 3O47A 5J4LA 3LLMA 4HI0E 3THXB 3VHLB 4D0GA 4KLNA 2BMDA 1XMVA 3C4JA 1BMFA 2C2HA 2J0UA 2N1BA 1CR0A 4URUR 4Q19A 4DEYA 4R2IA 1Q44A 5E4FA 4NCKA 2SHKA 2WBLC 4BECA 4ZI3A 2BEJA 5AUNB 1U8YA 2IBMA 5CYPA 2CHGA 3U3RA 3GLIB 1L8QA 3TRFA 3U4QA 4OBEA 4PSKA 4S35A 4O3MA 4M1YA 1FL9A 4M1WA 1E9SA 2HXYA 2Z5FA 3PG5A 4A2PA 5C2JB 4IVQA 2YV5A 3F5FA 2A3RA 2B92A 3CZPA 4TN1A 1LS1A 4PHGA 2FU5C 2PCJA 2ZRIA 3EWSA 3REFA 2J5XA 2Z4RA 4GMDA 1RYHA 1S8FA 4OI2A 4LY6A 2MSEB 3LW8A 4A0HA 2X2FA 2CLSA 1JB1A 1W2GA 1EFTA 3KUDA 4RFVA 1F6BA 1GL7A 4KVGA 2C96A 3A4LA 1ZBDA 2FEOA 1WQ1R 2GCOB 4IOMA 3WYAA 3EASA 2VP0A 2X8AA 2RGAA 3C14C 2KBEA 1P75A 2GESA 2IWHA 3FTQA 4KI0A 4LHVA 1D6JA 2Q9AA 4LJ8A 5JCZA 1HEIA 1YR9A 2I3BA 3AKDA 4G5GA 4JL5A 4Q00A 2MSCB 2O8CA 2DWQA 1N6LA 1FTSA 5H68A 3B8HA 5ELXA 1W49A 4RCZA 2QT0A 1N5KA 4US0R 5JEDA 1GUAA 2IC5A 2ZSEA 4K46A 5L3QB 2HEIA 2JLSA 1SKYB 4FMBB 3D31A 4LBWA 1JXOA 2GAOA 2QROA 2Q21A 1XX6A 1XZQA 5JZVA 1TNDA 4EIWA 4IFEA 4TZ0A 3X2SA 1GL9B 1DARA 3H86A 2OM2A 4GNKA 4MGIR 4CT5A 3D6TB 3ZD6A 1AS0A 1NVVQ 1CF4A 2YNMA 1A82A 1KDTA 4KFRA 4RD0A 2X1VA 1D9ZA 4OQFA 5FFMA 2ZSAA 2IW3A 4BUJA 4XWAA 1G4UR 1OE0A 3GJ5A 5CDFA 1CKEA 3C8UA 3R9IA 3TQFA 1ZM4A 5JJKA 3F8TA 3FFBA 1VMAA 3TK1A 3AQ4A 3KJEA 3RS5A 3WP1B 4K8OA 3TNFA 5JBQA 2ZI4A 2R44A 3QBVA 4C7OA 3SOPA 3AVWA 2PX3A 3RSOA 2FSFA 3AKYA 1OKKA 4BFWA 2WIAA 5FBRB 2B7BA 2ZYUX 3ZVMA 3PUZA 2WTUA 5ANRB 1AKYA 2D4HA 2R9VA 2NO0A 4F93B 2V1UA 3AF1A 2VLIA 2OXCA 3HYTA 3TLXA 2FOLA 2VP4A 5F98A 1JEDA 2ZI9A 4D80A 4NONA 2W0MA 2W00A 3GLGB 3WNCA 4K81B 5JCPA 2FFBA 5L3VA 3QOFA 4XVUA 1KHTA 4W9MC 5E3HA 4D6PA 1VG1A 3QENA 1QHNA 3FDIA 3EIHA 4GOJA 1P72A 2Z43A 4PC6A 2QORA 3WY9A 5BW8A 3KQHA 5L3SB 1UKEA 3HPRA 1Q1ZA 5F9FA 3DM9B 1ZIOA 3BIFA 5EZ6B 3RRNA 3KX2A 2PT5A 4N0EA 3ZQ6A 1Z0AA 4C0SA 4KLZA 3AF4A 1EFHA 4II7A 3WXMA 5A4JA 1O87A 1OH8A 2VP9A 1XNJA 1U94A 2RGCA 5JSZB 2YWEA 2ZRPA 1JR6A 3BFKA 3QKTA 1PVOA 1FNMA 4AKIA 4GP7A 4GP6A 3ZJYA 5HE9A 1G4AE 2ECKA 2DY1A 3A1SA 3X1YA 3CRW1 3OE7D 3SBDA 1U99A 4NDZA 3RWOA 1UEIA 4TLBA 2XGJA 5DN6D 4LJ5A 3RLFA 1QZXA 1G1MA 3NHAA 4P4UA 2OBLA 2ZI3A 3OHMA 1V5WA 4TL8A 4BE7B 4CVNA 4DHEA 4ZIRA 2ZJ8A 3K0CA 5EE5B 3LRPA 2QI9C 2WJJA 3B60A 3FMPB 221PA 3SFZA 4CEIB 2H5EA 1R5OA 4B6FA 4HDOB 1WBDA 3T5DA 3QEOA 3K0EA 2EWVA 4Q4LA 5AUOB 3DVLA 1NNEA 3RHFA 1R0YA 3AP1A 1KO7A 2JIZD 2ZI5A 2GZHA 4GMXA 2BIFA 4JLVA 4Q03A 3SC3A 2DFKB 4PZYA 2Q3MA 3IEVA 4XH9B 1OKKD 3AH8A 2ZRKA 4FD2A 5A5GA 1W2HA 1D2EA 1EFUA 2DHRA 2VP6A 4W5HA 2GBLA 2IXEA 5FUWA 3MWLA 3EARA 4PQFA 1CS4C 5AJZA 4LYFA 3MCAA 5EQTA 1G19A 2ATVA 4DIDA 1SKQA 4TTPA 5JI3E 3W6PA 2JLYA 5E7MA 1UDXA 5GJBA 1YE8A 2OT3B 2IF2A 3DMDA 4TMTA 1FX0B 1B0UA 5LBIA 4B33A 1X1RA 4ZDWA 5C46F 2FN4A 3C41J 5DHAA 1E2KA 2IYYA 3TUJC 4DT1A 3CB4A 2O8EB 4LBVA 4QRHA 2BCJQ 1M34E 1CXZA 1R6BX 2CK3A 2AL7A 4UQOA 2VF8A 3BORA 3SZRA 4V02A 1R5BA 3BD9A 1F2TA 3NH6A 1G64A 3GEEA 5KPDA 3T06B 2FSHA 2HJVA 2QE7A 1AJEA 4JBXA 5EP4A 1ZM7A 1CRPA 2ZRFA 1QHYA 1GM5A 4A8JC 3QXJA 4KCGA 1FP7A 1E1QD 1US8A 3VKHA 4MGYR 4M1TA 1P61B 4ERNA 3QVVA 2JLWA 1DAMA 2GF9A 1CBUA 1XTKA 3QI2A 5SZIA 5FTNA 1NLZA 2NO9A 4HATA 1Z0KA 5JRZA 1ZNXA 3P26A 4PQRA 4GZLA 721PA 3GEIA 4JYBA 1E98A 2QSZA 4F7WA 4OHYA 1SVMA 1ZM3A 2OILA 1UM8A 1AIPA 4PPNA 2QTFA 1JECA 4BLRA 1PZNA 3A1UA 1TQ4A 4XWKA 4AKHA 4IRUB 3B1WA 4RCYA 1U9IC 2MSDB 3SYLA 3NWJA 3CBQA 2Q3FA 3RVBA 3ADBA 2R6FA 4JJZA 1AA9A 1JR3D 4BPBA 1J99A 1LVGA 2GAAA 3D8BA 4ACAA 3LV8A 3SJAA 1ODFA 2ZR7A 2NPFA 2WSMA 4GRAA 1BS1A 1DPFA 3THOA 1ELOA 2G3YA 2EFHB 1W0JA 1P9NA 3VHXA 1FPMA 5KNDA 2ZUBA 2KBFA 2EFGA 2VSOA 2JA1A 2ORVA 4EPRA 2ZYWX 3LBHA 2MMGA 1W5SA 3D3QA 4MUBA 3W90A 3DHWC 2GJSA 2G77B 2ZRAA 1JNYA 2GXAA 1G21E 1KK1A 2BEKA 2JLRA 2OFOA 3GCGA 4A82A 4GT1A 4Z1MA 2F1IA 5B58C 4ZDJA 4UXJA 3VR2A 2HF8A 3Q5DA 5J40A 5GVSA 5HZKA 3OIWA 1XWIA 3Q3JB 3MD0A 4MRNA 4RKEA 3U5ZB 3TGPA 4E07A 1DG3A 2XXAB 1SHZA 3ADCA 3P4XA 3THYA 3LY5A 2ZYTX 4LI0A 4Q1EA 4QC2A 3BH0A 3IUYA 5LB4A 1XEXB 2REOA 4XVRA 3NBZC 5HE8A 1LS6A 1R8QA 2ODBA 3O8BA 4JLPA 4DBLC 3B1YA 2HUPA 3B85A 4QJ3A 5J4YA 5FOWA 1OXSC 2ERXA 4ARZA 2VP2A 1R10A 1Q1BA 3EG5A 4HLUC 3ADDA 5CK5A 3LLUA 1Z06A 2VTKA 2DB3A 2ZI7A 3CRVA 5EP2A 2ZJ5A 4F38A 4PO9A 2CVFA 4LJ9A 1NMXA 3MMPA 4AYTA 1KK0A 3EZ9A 2IEZA 2R65A 1BKDR 3L0SA 3AVYA 2XSZD 4A9AA 4XTCS 4B34A 1TL7C 2WOJA 3L0OA 3NH9A 4GPTA 2QPOA 4IDOA 4LJAA 3FWYA 5G3YA 4MYCA 3T5GA 1Q12A 4NYMQ 5LDDC 4BGDA 2I4IA 2PX0A 4HSEA 1GNQA 3UPUA 1H8EA 4LHZA 4BLQA 3T35A 1JQLB 1Q1QA 4IHQA 3TQCA 2ZM5A 4BFZA 1TQDA 3N70A 4DDTA 5EJEA 2YOHA 2GVDC 3AB3A 1II8B 3LXRA 4IEIA 1VIYA 5EXTA 4DUGA 4PTLA 5BN5A 1Q3TA 1FQJA 2E1RA 2R8RA 1GL6A 5JLJA 2WWXA 1R8SA 3SEAA 3KJIA 5CB8A 1KI9A 1KJYA 2D7DA 3KKQA 3WBKA 1FP6A 2J1LA 1W7AA 4RD1A 4ZKEA 1T0JB 1JJ7A 2VEDA 2RHDA 1BYUA 4CGZA 2ZI6A 3LA6A 1DO2A 3OFNA 3ZDQA 4JS0A 2OEPA 1Z6GA 2FPMA 3LD9A 4EFNA 1JJVA 3DKPA 5FL3A 1Z6XA 4XTRA 3W8NA 1SZPA 1E9DA 4QJ5A 1ZM2A 1XD2A 3ZIAA 3CNOA 5KNCA 1LFDB 1PUJA 1E2JA 3RDPA 2PEYA 1X8LA 2FFAA 1GOTA 4WA7A 4LJ4A 3O8RA 1NKSA 3KQLA 3RABA 1EGAA 1XB2A 2XZLA 1TU3A 3QXXA 1KMHB 4AK9A 3CWZA 4FXPA 1TTTA 4OI0A 3CM0A 2V7QD 1A7JA 1YZQA 2G88A 1FTNA 3JZMA 4X8HA 4URVR 5KDDA 5KPJA 2R6DA 5FPTA 5JECA 3TMKA 4U5XA 3MLEA 3OEHD 2FV8A 4G5QA 1NY6A 3GJ8A 4FMCB 2EFDB 4C4PA 1KKLA 4LK2A 1D2NA 2ORWA 1CJUC 2JLXA 2C9CA 1KAOA 2AKYA 1U81A 4IKEA 4QHTA 2VHTA 1PUIA 2IUTA 3BK7A 3O8CA 4RSGA 2QP4A 2RGBA 3EA5A 4LV5B 1P4SA 1UPTA 2GKSA 4RKFA 4BFUA 4BZQA 1E9CA 1Q1EA 2QP3A 4DCNA 4G01B 1XXHA 4O2LA 4TYPA 2ZR9A 1GRNA 3HPQA 2FF7A 3B9PA 3KJHA 1GG2A 4GZMA 1FZQA 4B35A 2G6BA 4CIDA 1P5ZB 1QBKC 1H8ED 4DDVA 4LWZA 1KZ7B 5JFGA 4KYIB 2JDIA 3GLHB 1T4GA 2DFLA 3TH5A 4OYHA 2CHQA 4NBSA 2WAYA 4B75A 1R7RA 5HZHA 4DCVA 3PUXA 2G9NA 3OEEA 4HB2A 2WSSD 2IYVA 1B23P 1J2JA 3N2EA 1SXJA 3I61A 4RZUA 3EWAA 5TARA 3NXSA 2WWIA 2CCKA 2C03A 2AWNA 3L43A 5FR1A 4A8JA 1AQYA 2CNWA 4DJTA 1EESA 2QAGB 1W48A 2O0HA 2QUZA 3L82B 3QEJA 4FINA 4QHSA 2ONJA 3EIQA 1NMZA 3WYGA 2JLVA 2W2XA 1FMLA 3UG6A 2XAUA 2NTYC 4B3XA 4DCTA 4YMUA 2J0VA 3FMFA 5LPNA 1TX4B 4XD7D 1YZKA 1SVLA 3QKSA 4AKGA 4YQFA 1Z29A 4URZR 2WWHA 4Q18A 4R71A 2CLDX 2RH5A 1OIXA 4OK5A 1GNPA 5KNBA 4BFTA 3MFYA 1GKYA 3N2IA 1G8PA 4X8MA 2EW1A 1N6PA 3LQRA 2B7CA 4WZ6A 2NMVA 3NDPA 5JJIA 4GDFA 1MO6A 1XJ0A 3A8TA 1OFHA 5DE3A 3SBEA 3HDTA 3E1SA 4D0NA 1S9DA 2OUKA 2GEDA 4XVQA 2QY9A 1DAKA 3K0AB 2HXSA 1SQ5A 1YZNA 5F2EA 4PC2A 3VKGA 5FOTA 1Y63A 1VCNA 4RZ3A 2ZE8A 1RJ9B 2HV8A 1ZCBA 4EJSB 1G41A 1O3YA 5CIQA 1HQYE 1N0UA 2RCNA 1T3LA 1KJZA 2XTNA 4PO1A 4V0LA 1NKTA 4DCUA 4Q48A 4HZIA 5CJ2A 1ZNYA 3IQWA 2WKRA 3A58B 1HY3A 1Z08A 1ZINA 1A4RA 1W44A 5FBWB 1RRGA 3ZYCA 5HKKA 3FMIA 3G82C 2QP9X 1OLOA 2KI5A 3SN6A 3ZVLA 5KU1A 3ONWA 2VSXA 3EC1A 1F2UA 1XEWY 4QG7A 4P33A 5CLLA 5DIFA 3GLFB 3X1ZA 4QNMA 2ZRJA 4GOKA 3RRYA 2YJTD 3PFIA 2ZUDA 4UNNA 2LWIA 4N3NA 2PMKA 3SE0A 4CW7A 5JS8A 2H92A 2WKPA 3VR3A 1CJVC 1P2SA 2QRNA 2ZU6A 1SXJD 3TW8B 2ZS7A 4LHWA 2J7KA 3VR5A 3U3OA 4DSOA 1XXHE 3GLIE 3HU1A 1Z2AA 2P6RA 1NY5A 3AVVA 1ZVQA 2O5VA 4HLUA 2CNWD 1J8MF 1T8TA 4Q9KA 3BB1A 4QNRA 3WMFA 5DH9A 1HYQA 4Q1FA 2O8DB 4BFXA 3QKRB 3EC2A 2F3TA 4Q4JA 3ZH9B 4D0LB 3GPLA 1D9XA 3FKSD 5H1YA 3WMEA 2VA8A 3RS7A 2WJIA 1NVVR 2QGZA 3EPJA 2O0KA 3I32A 1E2GA 4P4SB 3SHFA 4UNRA 4G3XA 1ZC3A 1VCMA 4JL6A 4ZDIA 3BB4A 2DCUA 3RSLA 1KGDA 1LB1B 3LFUA 1DADA 1KO1A 1ESNA 1SXJE 2AD1A 2C8VA 2RKOA 2EWWA 2CJWA 3TBKA 3K8YA 4M2LA 3W5JA 3CX6A 3KQNA 4B73A 1T6NA 1BH2A 5KSZA 3G0HA 1MRSA 1Z6YA 3W3ZB 2OCPA 4B48A 2WPDA 2QA5A 1Q57A 2F43A 4WIAA 3CW2A 4QBFA 2YC2C 3I62A 1IN6A 1X1SA 2GTPA 4KVAA 4IOKA 3CRRA 3K0FB 2AN9A 1OH6A 5BYKA 1GSIA 4JLJA 1Z0JA 5G3ZA 2ZE7A 1Z6AA 1NMYA 4CYMA 3DOFA 3SNHA 1VECA 2IUSA 2WM9B 3FYHA 1Z5ZA 2QAJA 2WAXA 1Q22A 3WHKA 3QF4A 4HAZA 1NF3A 3THWA 1FW6A 1CTQA 1KI6B 5HKKD 3HU3A 1M7HA 3RRMA 4ZO4A 4AY2A 1D8TA 1UKYA 3DEFA 4NYJQ 2QMUA 4P3YA 4JIMA 1UEJA 3KQKA 4LRWA 1MOZA 1G8GA 3CLVA 1X3SA 5H70A 2VP5A 2P6NA 1DBSA 4OQLA 2XNDD 4KHZA 3ZVRA 2Z6VA 4ESVA 2FH5B 4OHXA 4AI6A 1G5TA 3MUFA 3SI7A 3KXIA 4L9WA 2A5GA 4ZDKA 2AK3A 1J7KA 1X6VA 1TMKA 4QGAA 2XOKA 3B82A 1W36D 4PZLA 5JHGB 1E0SA 5EP3A 1J70A 3RS4A 4RZXA 4BFYA 2R6CA 5DSZA 3CR8A 2Q0HA 3KL4A 3TKLA 1OH7A 1CR4A 3FHTA 1OYWA 1OJLA 2QEQA 4X8OA 3C7KA 4YMWA 4D4JA 4MDFA 3RC8A 4CEHA 4JLAA 3GLGE 1I4LD 3E70C 3W34A 4OI4A 1MABA 3KKNA 1FMJA 3NIBA 1EWQA 5HR5A 1DAGA 1W46A 2WWGA 2FJUA 1DAIA 4TT3D 2P5TB 3QPVA 3E2IA 3OE7A 2D3WA 3CX8A 3U3KA 3CH5A 2FZ4A 4QKQA 2WWYA 1ZUIA 2IT1A 4Q1DA 5DN6A 2I1VB 1XF9A 1S0UA 3QXHA 3P32A 2Q6TA 1T5LA 2EYQA 2XZOA 4B32A 2JJ8A 2WPDD 3ZVNA 1GITA 2C9YA 2ZSDA 4PQYA 521PA 2GWHA 2FA9A 3BRWD 1G3IA 3GD7A 3IIMA 1KI4A 4Q4AB 3VX3A 4C2UA 3U7GA 2CBZA 2WICA 5FOSA 2GXUA 3CRMA 1IN7A 5FPKA 2GF0A 1RRCA 3I5YA 1KNQA 4M1KA 4MKHA 3DO6A 1AM4D 2JIZA 3KTAB 4LJ6A 4TSFD 1M6NA 2J0SA 1OIVA 1TADA 2H16A 3T1OA 4MH0R 4TTQA 1E6CA 3FKQA 4XWOA 1N25A 3TE6A 3SQWA 4PAOA 2V54A 1GVNB 4TYQA 2RHMA 4AG5A 1GKUB 4IXNA 2QU8A 1U98A 1Z3IX 1OF1A 5TDHA 5K8IA 3RS0A 3GP8A 2QBYA 2ZRLA 3OIUA 3OAAD 4MGZR 4I1UA 4Q9IA 3VQTA 3BS4A 1QVRA 1II0A 3UMFA 4DEXA 1HQCA 4DLVA 1WB9A 3WRXC 2YVUA 4A6XA 1AGRA 1HURA 1SULA 3I5XA 5FTJA 2CEAA 4JVLA 2W6ID 1ZU4A 4JT2A 3BFVA 1F48A 1GFIA 5EUMA 1EFCA 2D74A 5DI3A 4DCSA 1Z2CA 1GP2A 2J7PD 2R62A 4CEJA 4IOJA 1XU4A 2JGNA 4E03A 2XOKD 1II9A 4PC1A 1OIWA 1GTVA 4F4IA 2QM8A 4HUQA 4M9QA 4RZ2A 4M9XA 2P6UA 2PEZA 5GVRA 4TQ9A 1NJGA 2VHJA 5JWRA 5DISB 3NKVA 2YHSA 2IWRA 2B8WA 2B8TA 2WKQA 2ZITA 1RKBA 3UANA 4DKXA 5FUYA 2C04A 4A1FA 5CITA 1VG8A 2EYUA 1E1QA 3AUXA 4C0LA 4EPWA 5TXGA 3W8RA 3TUZC 2ANBA 3U7EB 1YZUA 4QGGA 5TY0A 2C98A 4Q4JB 1OFUX 1TAGA 2C99A 2GJKA 1PLKA 4TYNA 1Z0DA 3N5CA 4HAWA 3AVOA 1YZGA 5CK4A 1W5TA 4OHWA 2GK6A 3AF0A 2F3RA 2GJ8A 4ITRC 4DB2A 4Z8YA 4FMDB 1JR3A 2NQ2C 1LNZA 2K5UA 1RC8A 4Q5IA 2O8FA 5AJVB 1OFTA 1LV7A 2W6JD 4M1SA 4C2TA 3B78A 1SVWA 4L8GA 2FSIA 2ZVPX 4MDEA 2H17A 2VRWA 3I1FA 2REBA 1Q20A 1KZGB 4PAQA 5KDOA 2IS2A 3ND9A 3QG5A 4Q9LA 4NE2A 2VYFA 3ECCA 3PV0A 4QGHA 5B64A 821PA 2J0UB 2VF7A 1HE1C 1NI3A 1CR1A 1CR2A 2OG2A 1SVKA 2J41A 2JAQA 3RANA 4ON9A 1R4AA 4E09A 3OZXA 2QZ4A 3K70D 1TF7A 1G3RA 1N6KA 1S4QA 4Q4HA 4PPFA 2NG1A 3BERA 3U4QB 1QRAA 3KFVA 1MO5A 4B44A 2V4ZA 3VU9A 4BWYA 3ETLA 1AGPA 2PBRA 3LDAA 1S1MA 3QG1A 5DO9A 2EFEB 1OH5A 4Q1AA 3L2OB 4XSHA 5C4MA 3LNCA 3GQBA 2BHRA 2OHFA 4Q66C 1XTRA 3JZAA 2O8BA 3FMOB 2YWHA 4TMWA 2C5LA 4EKDA 1SXJC 4DSUA 2CLCX 4RFSA 1G6HA 4OQNA 2FX3A 4WBSA 3AVPA 3RAPR 4M9SA 2NZJA 3HJNA 4FIDA 1K5GA 1T91A 5CB6A 1XMSA 3FOZA 3KFXA 1ZRHA 1CU1A 1W4CA 4JSTA 4NYMR 3GJ4A 3M0EA 3CO5A 2O8CB 1N5LA 1ONBA 4NYIQ 2B21A 1M8PA 4MKFA 3TVTA 3KJGA 4KAXA 1UDWA 5BXQC 3B6EA 3AUYA 1V43A 3H1TA 2FMXA 3ZS9A 4ACBA 2XSZA 2ZSFA 4JKYA 2IYXA 1AKEA 3AVXA 4MUAA 3T15A 1LTQA 2V8OA 4MA4A 4M22A 3W9YA 1MRNA 2BBWA 3H0KA 4KFTA 1L4YA 2WOOA 4BFVA 3CF2A 3OIYA 5AJXA 1GIAA 4CRWB 3M1IA 1RFLA 2HCBA 5GADl 3KB2A 4LYJA 1YR6A 2OCYC 2QQ0A 4B3CA 1K5DA 1ZAKA 2ZS9A 3MJRA 1T9HA 5D3MA 4GL2A 1U8ZA 5FH9A 1ZC4A 5LD2B 2PJRA 1QHIA 2Y8EA 1QHHA 2CE7A 3U44A 3TUIC 1OSNA 3B9QA 4B74A 1YRAA 1NSTA 3NHBA 4V0ME 1EK0A 1IN4A 1WCV1 2CVHA 1DAEA 3C16C 3GFPA 1U2RA 3T12A 1G9XA 1COWD 4ILEA 3REGA 1G18A 2OO7A 3WNDA 3HR7A 4C7OB 1JR3E 1S2MA 1KJWA 1HV8A 4POAA 1QG2A 2C9OA 2IEYA 2GJ9A 4GBMA 5J4KA 4CT4B 4G5OA 4FI3C 1NVUQ 2X19A 1XD9A 3WMGA 2CDNA 5B30A 2YZ2A 4LZZA 2XITA 3IGFA 1IN8A 4GFDA 5M04A 1N6OA 1G5RA 3K9HA 4LGMA 1A2BA 4P4TA 4A2WA 2QBYB 4D4KA 2JATA 2ZRDA 3CNNA 1ZP6A 2V7QA 4IFBA 2AX4A 4OJQA 1ZIPA 2YOGA 1M74A 2VHQA 1KIMA 1NSFA 1G16A 1NG1A 3OEHA 2GA8A 4C9BA 4LSGA 4QM6A 2ZE5A 3AP3A 3PUVA 4NMMA 1DE0A 3JVUA 1VYUA 3VX4A 1G7RA 2RGNC 1D5CA 4DLYA 1W36C 5AUQA 3ICEA 2AK2A 2IYUA 3IQXA 4LJYA 4MYUA 4BFSA 1IJEA 2NZ8A 5EP1A 2DWOA 2IYLD 4DRZA 1Q0UA 2F1RA 1P62B 3CNLA 1I4TD 4KO8A 5JI2E 4QBGB 1CJKC 2ZR0A 1YR8A 3G5UA 1MKYA 3AM1A 2VPPA 2ZETA 4QL3A 3GJXC 1G3QA 2HT6A 5GJVC 1DELA 2GK7A 1TUIA 5AR1A 3PQCA 2WV9A 3TJZA 4QHYA 5K8TA 3MWJA 3S1AA 2G0TA 3FHOA 3LBIA 2D62A 3UWOA 1W4AA 1ZNWA 1KDRA 1TPZA 1HH4A 1T3HA 4B71A 1BO6A 4ZIRB 2GHIA 2WSSA 4P31A 4B43A 3FVQA 1MT0A 2OXRA 2ODNA 4LBZA 4IJMA 2FSGA 2P65A 4WVFA 3ZS8A 1KO4A 2OCAA 4HAYA 1M1YE 1UJ2A 1Z83A 1R2QA 3LBNA 4Q1BA 2JJ1A 2EQBA 4NU0A 1E94E 1NRJB 3SU8A 5CM8B 3I4LA 3O8DA 4JKIA 4M4SA 3KXKA 4QBHA 1IAQA 4DLXA 4EDHA 1WRBA 1TEVA 4XD7A 2QQEA 4O0MA 4R7ZA 4G0NA 2FNAA 1JBKA 2VIIA 2YWFA 3PCRB 2NPIA 2PLRA 5EXPA 4HLDA 5JJLA 421PA 2JLUA 3IIJA 2KWIA 4DLZA 4B2LA 4EQ6A 3RNLA 3BFXA 4LDJA 1VG0B 5CLQA 1P2UA 2HF9A 1DVRA 3NTUA 4URXR 3Q8XB 4PHTA 3QPWA 2DPXA 4MQBA 4Q01A 1S1CA 4IOLA 3UMRA 1DAFA 4BEBA 2JCSA 1N5IA 2A5YB 4I1VA 5EE0A 1KDPA 3KKOA 3THXA 2AFHE 2FDCA 1KTVA 3BOSA 2QGNA 4DT1B 4IW3B 4KXFB 4W5JA 3SDZA 3CF6R 3DZ8A 1SVIA 3Q7PA 4M21A 2IX3A 1KO8A 4PC7A 1Z47A 1MR3F 3IHLA 4LPKA 1UFQA 1CIPA 1F2TB 4KBGA 1NJFA 1ZCAA 2BMJA 2IYSA 2BC9A 4M9ZA 3GLIA 1EG7A 2CXXA 2KB0A 4MKIA 2XX3A 2EU8A 1JAHA 1N2CE 1US8B 1XRJA 2N46A 4MGKR 2QTVB 4BRWA 1HT1E 2DFTA 3H2YA 3IPYA 1BOFA
chains in the Genus database with same CATH superfamily
4MI1A 3DTNA 1MW9X 1IXRC 1HEUA 1TO6A 1L7PA 1CJMA 2Z95A 4F2GA 1E0AA 3GVHA 1TJ5A 5IF9A 1NIJA 5J4VA 5LMCA 4KITB 2HUNA 3UJ9A 1KAMA 2I62A 2DH6A 1C2TA 4JHXA 4WXMA 5SZJA 1N3YA 3EVZA 3UK7A 4B8WA 4XB1A 4J03A 1ESDA 2GYYA 5AW7A 1XHFA 4YC7A 3TTVA 4BXOB 1XDZA 1VHTA 3P9XA 4YASA 3EZFA 2AOTA 3LBFA 1W75A 3FOWA 1ZVKA 2DBZA 1PHPA 4BN4A 2QL5A 4EATA 4QO8A 1QNLA 4BP3A 1XCJA 3PDHA 3X1XA 1AY0A 1LW6E 4JCOA 4U6QA 5D5HA 3O3MB 4EPXA 4L4YA 4C0HA 1E5LA 4RTSA 4YRJA 1PSDA 2BJHA 2IYEA 1L7OA 5EIHA 4OX9Y 5ALUA 4ZO7A 3R9XA 5JAHA 3FKSA 4C30A 3VHXB 5BQXA 5KDLA 3OECA 1U2TA 2IY9A 4UNSA 1YJQA 5GZ6A 1K7CA 1QGDA 1J4AA 1XDUA 3UFBA 3I72A 5E9AA 1Y34E 3AKEA 1Z4KA 4COOA 1CT9A 2VDQB 2Z9DA 4BO0A 1NDHA 4WZAA 2BFDB 1PR2A 2CF5A 1QORA 1T9DA 3K70C 3KYCB 3ZV5A 2I2AA 2EXXA 4WXYB 1BXGA 4BMPB 4ND4A 3EGVA 4BJ1A 1P2TA 4HT3B 3KSBC 1NJ8A 2DRIA 4JA0A 1C30B 1I0ZA 3RHSA 4GM1A 1J23A 4HAXA 4W8GA 1KY5A 1XJCA 1DKOA 4ECAA 1GSOA 3S2EA 1TKCA 1Q84A 3MUOA 1N1MA 1A2KC 1DCMA 4RJLA 5D6OA 1DEKA 1ISPA 1NQOA 1FY2A 4KXMA 3OZDA 2A35A 1Z16A 3A3KA 2F9MA 4N5HX 5AI5A 3U17A 5KREA 2IHBA 1PV4A 1G66A 2CLOB 3AEZA 4WLUA 2WIDA 1B41A 4H4DA 1UCFA 3L8YA 3D7MA 1TEXA 4UNQA 5YASA 3U4AA 4R5HA 3RWBA 1QK3A 2QN6A 1Q3HA 2J59A 3TSOA 5DOZA 4C0KA 1JU4A 2OV2A 3O38A 2ERYA 2Z4SA 2IHYA 3DDWA 4IUDS 4X3OA 4XIGS 4EX6A 3A10A 2BSAA 1ZCZA 1E79A 2QJOA 3G68A 4B4DA 1P6XA 5D7NA 5H0IA 2GNOA 3UUFA 3QUSA 2CZCA 2I8CA 3UICA 3WB2A 3H84A 5E6RA 1Y3IA 2XQJA 3DTYA 4B3IA 1BU5A 3DBLB 4TWZA 1E1RD 4IMPA 4D02A 1C4OA 4XYGA 3VR4A 2OE2A 3AJAA 3B5IA 4DLRA 4KJXA 1CDEA 5ISMA 1Y1RA 1JKJB 2P90A 2XNDA 3WIDA 4EY4A 1G6OA 1NQ5A 4MJXA 5IW8A 1L7VC 4TL7A 1PS8A 2QMZA 2PQMA 5DOVA 2XTZA 1OAOC 4G56A 4ZI2A 1E7RA 3CO0S 4W9NC 3TLGA 3PXGA 4YMTA 1JKIA 2Y0PA 4S1PA 3HTXA 5DHFA 5IJ9A 3QVKA 3MTGA 4XX0A 4WLNA 4NP6A 1JHDA 4H6XA 4JC4A 2PXXA 2CL0X 2W2OA 1ZJWA 4AJ4A 2BBTA 3GFOA 4Y2RA 3CH7A 3QGMA 3FVWA 1WVMA 4UHDA 1ZAYA 4GLOA 2GZ2A 2HLDD 4H17A 1ARZA 3E9RA 3NRCA 4MKGA 5JSZA 3BA6A 1X2BA 2KJQA 3MLBA 1U2PA 2G04A 4N5DA 3GRYA 2NSHA 2AJCA 1Z8NA 2IZOA 2UVPB 3AEQA 3M5PA 1JIXA 2Y3IA 4FUTA 2OHXA 3D1JA 2XZPA 3WIOA 5JD5A 1ZA1A 3GGPA 3R7WA 4BKPA 3HI4A 1KMQA 4LHEA 4G9EA 2ZB8A 4JEUA 2OFPA 1AU9A 2B20A 4EKGA 4K26A 1RZRD 4UHBA 2GZAA 5B2FA 1BAPA 3A4TA 4D8TA 1CERA 1K2WA 1WHTB 3D4PA 4Q21A 2GERA 3JV7A 4IIHA 5JDCC 1KSGA 4B76A 5KNBA 3IH5A 4IIGA 4EUNA 3OPMA 4JLMA 1DBQA 4RETA 4CEIA 1U5BB 1DAPA 1WMAA 1JQJC 4UQLA 4KREA 3I12A 4Z7QB 4HDNB 5LQAA 1BCRB 1WM1A 4RQAA 1DTWA 4WN9B 3VH3A 1J8YF 2P0EA 1OLUA 5IK2D 4HEHA 3IV6A 2JHPA 4FX5A 3OZRA 1AZTA 3JAWB 1LBHA 1GRRA 4QXAA 1MDFA 1PE0A 2I9PA 3C6BA 3EZYA 3I1IA 1E2LA 3IAHA 4N1AA 1WSWA 1W96A 1WXIA 1E79D 5CH8A 5CNJA 1Y4AE 8GPBA 2ONCA 4UAVA 3HUFA 2F67A 2QWXA 2D2FA 3AR9A 1DOAA 2X77A 2OLKA 4AY6A 1XD8A 2FK7A 1NVWQ 2DP4E 4ITVA 3V00A 1OWPA 4OQYA 4MARA 4G25A 3OAAA 1AKWA 1IC6A 2B37A 3OCZA 3PUYA 5CYFA 1CRZA 1Z13A 1NFRA 2ZS8A 1SVNA 1ZNZA 1IQUA 4FCTA 5DCLA 1JQKA 1GGFA 3A9UA 2X6RA 3ND8A 1CUSA 1RJEA 4JBYA 4D0SA 2V3CC 3TOZA 4GSYA 5L7YA 1JJBA 4WNIA 5ALKA 3KSDO 2GS9A 1JB9A 1PGPA 2V9ZA 4OYLA 2UVQA 4HXYA 1IHOA 5TEVA 5EERA 5AVQA 2O3QA 1NG9A 5EXXA 1FX0A 1UBTS 4X95A 3HACA 3EXG1 2CLLB 1IOLA 3V8NA 4JC0A 1VKHA 5AM4A 2VSYA 3HNOA 2OO5C 3MM4A 5CFRA 3LK6A 2RJOA 4RDIA 1YH3A 4PLFA 2J0QA 4EZEA 2PLAA 1YHNA 3R7FA 3ZQUA 1GUDA 2FPPA 4IH4A 2PL3A 3BWBA 3OIVA 4Q6BA 4WACA 4DNQA 4IFTA 3EXHA 3ZUPA 4IDCA 1KKMA 1SXJB 1EP9A 2QX8A 2XWPA 3BXHA 4TLAA 4X84A 5FO0A 2XW6A 4W6QA 4Q15A 2ZIVB 3ONNA 5J2TF 1KNXA 3DE3X 4ZOLA 3DBVO 3QBJA 3A4YA 2A9KA 4G4JA 2IYWA 1QVWA 3F7OA 4KE9A 2YWXA 1VYHA 2G83A 4HFJA 4LC0A 4LY3A 4EVRA 1QAOA 3ONDA 2EIHA 1U3GA 1XPRA 4LHYA 2FZLA 3PEVA 2C2WA 2YJNA 5E6UA 5U4QA 1IIBA 3FMGA 3GEGA 5F9HA 3QKSB 3QY9A 4BV9A 3GVPA 4NPAA 3A1WA 5IAOA 2A33A 3MN1A 1S2GA 2EW2A 2NWQA 3LVQE 5BNTA 1OBFO 2AVDA 2IK8A 2BUAA 4HWKA 1E96A 5C0OE 2PANA 4M7RA 3ST7A 3CR7A 1PN3A 1ZG3A 1WXWA 3IT0A 1ZXLA 2OENG 3CWQA 1WY7A 4OEHA 5CJPA 1OR8A 2YJ3A 3CUKA 3EGOA 1J07A 4OQXA 4US1R 5SZKB 3NR2A 1E5XA 4QUHA 5EMNA 3ROKA 5C4MA 4QUJA 2FGKA 2XLCA 3ML1A 1U6JA 4XR9A 3HUEA 5NULA 5KYWB 1RWQA 4PLGA 1T5BA 1ZGCA 3HMKA 5F4BA 3UFXB 4E3WA 4E5KA 1EDDA 2WJHA 4JQCA 1NBMA 5TMDA 5IXYA 3PR3A 2IDMA 4BQSA 1OLSB 2OCGA 3IAEA 4C0QC 4E70A 3CJRA 3MOGA 3DMTC 4BV3A 4EJSC 1EP3B 2BGMA 5A2QA 1GNRA 3GG2A 2ZIEA 1FLVA 3PD0A 2VQSA 2WWRA 4YYEA 2ZYIA 3QE0A 3WKAA 8ABPA 4OYYA 1SBIA 4BMNA 4JYPA 1K5HA 2NXWA 3ER6A 2YZGA 2GVZC 3TTXA 1KFKB 1MNAA 1VIAA 3IV9A 3TRJA 3W5VA 2MHCA 2NV6A 3DT9A 3V7FA 4ESOA 5LQDA 4RTJA 3AVUA 2AMJA 1GDDA 3T54A 3W2TA 3PRJA 5ICFA 4DQLA 2WW8A 2BF7A 2KM1A 4NZMA 1IAVA 4TMXA 2QD1A 3O9ZA 4YHBA 4WECA 5E4TA 1Y42X 3PEWA 2JVKA 4IRMA 3ZEIA 4A0RA 1XEXA 4MUGA 3K72B 5FOUA 4HWRA 4L5AA 1G8FA 1QGUB 2WTXA 2PIDA 3BEOA 4QLAA 3SHWA 2C00A 1WEHA 2VZLA 3A6PC 3HWWA 5AJHA 8LDHA 5KOYA 4HEA1 3ORRA 2TYSB 4FE3A 3G2LA 2G1JA 2F1OA 2GJAA 1K7YA 3LXMA 4TZ6A 4C0JA 3UJHA 3AKCA 3FFAA 1AN0A 1GSAA 2YVLA 3DAYA 2GR9A 5JWHA 4C76A 2C7RA 1A0OA 3A3YA 4X1IA 1FSZA 4QXPA 1P1CA 4DIFA 1QFMA 4NFYA 1E2MA 2OMEA 1UMDA 3GGDA 2CLFB 3ZCVA 1A2QA 2CDBA 1GSHA 3BH6A 2ZCJA 1L4EA 1R6VA 2ZKLA 4L28A 4HDCA 2D1YA 5KJEA 2BZSA 5CVJA 5D00A 4DSTA 2Q46A 1EVLA 2GF2A 4MRSA 2HPHA 3NT4A 2UZIR 4FYKA 4HNTA 3I52A 4ZI7A 1IOVA 1G2OA 1S2LA 3F97A 2IEBA 1VFPA 1Y7IA 2EKZA 2OSBA 2ZVQX 3LPAA 3M6VA 5FUXA 2JIBA 3H5NA 1G291 1TYZA 2CJWB 3FLMA 1OC2A 2VOJA 4ZAGA 1I3CA 3EDQA 3GB9A 3H75A 2BM1A 3NJ4A 1A8UA 2I7VA 2V7VA 4H7IA 4F4JA 1FS4A 2D1TA 3MB5A 3W5DA 1FRZA 1H2EA 1MQSA 2H6EA 3LWZA 1AUQA 2PX5A 3GMSA 4NATA 3TVYA 1CDDA 5IJXA 3PQFA 2XDWA 3HBMA 5HTKA 3VNQA 1H9AA 3ZZUA 1I24A 2WHQA 1M2VA 2B35A 4CUZA 2P4EA 4AL4A 2OBXA 4G5SA 1W35A 1SCAA 4Q6WA 1X1CA 4RIGA 3ELWA 2HX1A 2XGSA 2VUSA 1DBPA 1SEPA 3B48A 2W71A 1X1DA 2XUAA 1C29B 1NBMD 2GXQA 3BJIC 3CC8A 3CUUA 3K1YA 5C9ZA 3VI4B 2HF7A 4Z4HA 4A15A 4FZRA 3CVUA 4I99A 1JLRA 3BBPA 3K9NA 5TJ9A 1G8JA 3K0SA 1A98A 4XGKA 1M1NB 4B79A 2W4IA 5HJ7A 1V1MA 2PVSA 1KH1A 1GZ6A 3MNFA 1YR7A 1PU2A 3DPSA 4JVNA 5E95A 5CTAA 3GARA 3OQJA 1Y4SA 2HO4A 4ZAVA 2AOUA 2QUIA 4LTNA 5KYYA 2VYND 3ZGZA 4R98A 2C78A 2JFNA 3G23A 2V8BA 1Q17A 4U1RA 3RCBA 3L6OO 4TMKA 5DNAA 2W2VA 4HAUA 2PBLA 2CVOA 3CONA 3FPGA 2R8PA 2BF4A 3U0BA 4KTVE 2Q4OA 1ZGGA 1SELA 2ZRQA 4KH0A 3FWPA 5A0TA 4KMOA 2FXVA 2J87A 2XCRB 3A4MA 4G5FA 4YI3A 1FBTA 1F8YA 2VRNA 2Q4RA 3LSYA 3C48A 5CMLA 3V7YA 3C7TA 3PQ3A 4ISBA 5T6BA 5KKNB 4EGQA 1NIPA 2I7XA 5JO0A 1HDXA 1SUIA 3K7EA 4NBVA 3U4MA 1WU7A 4M54A 4P5PA 4D7AA 1X2EA 2IA5A 3VMFA 4E32A 5JJCA 3P9CA 1X7XA 4RYLA 3K32A 4ESHA 3W8DA 3JVIA 1I1HA 1EJBA 1OI4A 3L0IB 4LSZA 4TSRA 5AHXA 5ITVA 1E1CB 3FG9A 3QXSA 2WB2A 2O14A 2XF2A 5L8VA 2ZSKA 5IAKA 2QM3A 3MJSA 1H2HA 2D1SA 1ZUNB 2V3WA 4YJGA 3AGQA 1TD9A 1WBBA 2PR7A 1E7QA 4DIEA 4BYMA 5I8PA 5FBZA 1VPVA 1T8YA 5HNKA 4OIFA 2AB0A 1TM7E 3KXDA 2VDWB 4MAAA 4V0SA 5CCDA 1B4DA 5IXJA 3K9QO 5KKCA 2DR2A 4BO8A 2ACKA 5KO2A 1DCFA 1MABB 3BL8A 1C0EA 2ZUWA 1UBCA 1HRKA 3MUEA 4G8JA 2PX6A 2G5CA 3CUVA 1X7WA 2B4TO 3EDOA 3KZ1E 4EFDA 4Z4GA 1CZRA 4EA8A 1Z37A 4XDYA 3JVEA 1EAMA 2BEUB 1SVUA 1WXEA 2IYRA 3I73A 4EHHA 3GLHA 4OKSA 1ZK2A 1JEYB 1GWNA 1EH5A 1ULBA 4RVCA 2OKGA 2YYZA 3FRJA 2JAUA 5JAPA 1P7ZA 1MZPA 2O2YA 3NTRA 3PUHA 1QTIA 3PR1A 1U7WA 1F0NA 3RC1A 1EX9A 1WU8A 2H8KA 1FUKA 2ZXUA 9LDBA 1V9SA 2C4UA 3B7GA 1XFAA 1T2UA 1Y6FA 1J39A 3TSZA 4NEQA 2I2CA 1VGRA 1TMOA 4IINA 2JASA 1NFQA 4FLMA 1IY1A 3ZHRA 3UF0A 3DTTA 4D3YA 1BA3A 1NLFA 1H2YA 4MVJH 3L7LA 3KXLA 3A36A 5C51B 4NV1A 3KZXA 4P83A 1E0DA 3JU3A 1V39A 1RQNA 3OJFA 4GOMD 4H1VA 1SU8A 4OFXA 4P6VF 1XPOA 3A0RB 4IJKA 1GEGA 4LNAA 4GG1A 5G41A 3NVKI 5IVIA 3DWFA 3VAZA 5DHUA 2Q8NA 3I01A 3VPHA 5ENZA 3WIBA 1C3XA 3IUNA 2VBCA 3KQSA 4FYXA 3RAJA 3WOVA 4RD6A 1C8VB 3IEUA 2K4MA 3FN4A 2DBVO 1X8JA 3MINB 4RXUA 4OLFA 3OIFA 2IYTA 3QPCA 3S1SA 2YW9A 5DI9A 2I65A 1E3WB 1NVGA 3RK0A 4INOA 3ZHZA 4Q9HA 1E9EA 1MRZA 1T2NA 2HFKA 4MP6A 2BDTA 4RPLA 2YX1A 1U4SA 4RLSA 1KI1A 3ZK9A 1NLUA 3PFCA 2BHSA 2V7XA 2XYRA 3LQKA 4LRYA 3BGWA 3HN2A 2FPSA 4CZ2A 1T13A 3LKDA 4U02A 5F23A 2WTNA 4LNUB 3PDIA 4RK6A 3ESBA 5CVEA 1RXYA 2WMOB 3K3PA 2CFRA 5AKLA 2SECE 5IH7A 3CEAA 5JJ5A 1RJ9A 3F6YA 3J81k 2H2WA 2WM8A 4JR0A 2HQRA 1O89A 4UTZA 5GAJA 4F6LA 1C4WA 3EMVA 4K3UA 1AGXA 2PZFA 1KY3A 2YJ4A 1AMNA 2JARA 4HZUB 3GRFA 5HIKA 1E9BA 2YINC 3Q11A 3KETA 1Y8RA 2BFWA 2XF8A 4OA8A 5A3SA 2GQ0A 2IDKA 2QSYA 5GONA 3I2JA 1QG4A 4HS9A 4U6SA 4L76A 2A78A 1TA0A 2P6OA 3B1FA 1YZ3A 3VH2A 6LDHA 4Z6KA 5K0GA 2P3OA 1LF5A 3F74A 4RDCA 4OHZA 3UNXA 4TYWA 2RGXA 2DYKA 4H4EA 1UZNA 1UOPA 1QTRA 3RHTA 5FI3A 2J3EA 5C8YF 1KGSA 3G89A 4PSCA 4TKMA 2IGBA 2Z83A 3NVAA 1U0HC 3ZLJA 5LP6F 1DXHA 3GU3A 1YBAA 3ZJTA 5DNUA 2DPYA 5BMOA 3DDUA 5HCIA 1GG8A 5E7QA 2BMVA 2NLOA 1I80A 3BE4A 1RADA 5IN5A 4CHTA 4B6JA 3LHDA 4MCHA 1LNQA 3J81A 4PLZA 1EQ2A 1W25A 4Q9AA 3IBGA 2OFWA 4GQIA 1R37A 4LJRA 1MN6A 3O03A 2ECFA 4FFPA 3T1NA 2CXSA 5CVCA 5AKZA 1I1OA 1KSHA 3HJRA 1BVYF 4KQKA 4ZEVA 1M10A 1Q7CA 1S8AA 2DPGA 3FYCA 3PUKA 3QKRA 3TFQA 3RG2A 3BJRA 3PEEA 3B8EA 1P9WA 3H3XA 2NYUA 1B0AA 3Q7EA 5CA1F 2L2QA 4OHVA 3O82A 5KNDD 5CIWA 3D5TA 1LPNA 1ZD5A 4JXKA 3ZWMA 4EG0A 1DIHA 2EFCB 3FPKA 1Z82A 3JATA 4FDUA 4PAWA 5KVQA 4MW9A 4FW8A 3UUEA 4WBNF 5C1BA 1RABA 1ID8A 5LZ9A 2D0OB 2HLPA 1OYYA 1TLFA 2VF4X 4CKWA 5IMSA 4FCVA 1ODTC 1KVUA 3MSXA 4WXHA 3V8PA 2QUHA 4A8HA 5MFPA 3U3MA 2IS4A 1EP1B 4MO2A 5AKIA 1I4EB 3TIGA 5EE1A 5EFOA 3MC1A 2AG5A 5IAEA 2ODAA 3HE3A 1PFKA 5T4HA 3L0PA 3B3GA 3WLKX 4WOBA 4WOPA 1IRXA 5EC8A 4GOXA 4I9NA 4WNYA 4L07A 5EKTA 4KXUA 3ERCA 2AZTA 3PC6A 1ESMA 4U2DA 2RHLA 3QVUA 4OAPA 1VM6A 5IFKA 2LV8A 2NV2B 2HI0A 4P2BA 1AQUA 3K0FA 1A7UA 3HUUA 3KU4A 3WWDA 1FE8A 5TNXA 1GTMA 2A5FA 5JVDF 2GLXA 3ITNA 1JXQA 3UAOA 3I4CA 4L0QA 1BVUA 2JW5A 3AM3A 4CM4B 5CG2A 2O8BB 1Z6TA 3EQ8A 3ZZ1A 3X1JA 3VC3A 4JR1A 2FY8A 3D6HA 4IP0A 3I23A 1M8KA 3D6AA 4GKBA 5K3FB 1Y8QB 4OQDA 1KK2A 4NKRA 4CCAA 1PZGA 2BD0A 3I6IA 4EENA 3QVGA 4LN1A 1EDZA 4K6FA 7AT1A 1KI6A 2YHBA 2DPMA 3HGTA 4FILA 2NP7A 2GH1A 1T6XA 2KX7A 3RC9A 3ZY6A 3PDJA 3ZWDA 1NBEA 2BI7A 2F8TA 1UZUA 1NXPA 4JB3A 2FMIA 3MWYW 2P2CA 2WD7B 2HSZA 3E8MA 4FGWA 4KBFA 5AP9A 4DQDA 3G6WA 2QL6A 5TPZA 2IYQA 1S9HA 1GQFA 3JXEA 2PXCA 3Q7TA 4Y9UA 5DNWA 3OA2A 3QZUA 1NP6A 4E7PA 4IJQA 2X0KA 4M8NE 4ZV4A 3PEUA 1FJGB 2NXEA 2QMOA 3A4NA 3QMWA 3V7NA 4BLPA 5E6SB 1VGVA 4NS1A 1HDCA 3EPKA 3JQ8A 2XNKA 3MELA 4YV0A 4LA4A 4C88A 3KQWA 2JFQA 1QUFA 4TV9A 4RD3A 3GG9A 2ODQA 2PJDA 3IT1A 3JPWA 4MDHA 4WY2A 3FB4A 1UADA 1J56A 2BZ0A 1QHHB 1Y1KE 2J3HA 2X0DA 4TV8F 3OCWA 4NZYA 2HQOA 5ERYA 1UMBB 4AROA 1UAAA 1IHDA 1XLTC 2VQ6A 2WHXA 2V9CA 3PNPA 1G1AA 2UZ1B 3ASZA 4RKYA 4W7SA 4E1AA 3MAAC 4EMBA 1E3JA 3D3EA 1WB4A 3TL6A 1M2OB 4YPOA 3HR8A 1ETUA 3BGSA 4ISCA 1UUFA 5ALOA 1C3LA 1T0HB 2B98A 2NUTB 2QT1A 2JGDB 3F47A 3IXMA 1LBQA 3OQBA 2HSWA 5LNK6 4KPYA 2ZDGA 1E5VA 3ZKWB 4P32A 1IN5A 3V8MA 2H2DA 3LWDA 5KNLA 1HFWA 3PC4A 1M6VB 3NFYA 2FG6C 2F3PA 1VOTA 1U2EA 4ZGGA 1KU0A 4Y9SA 1RI5A 3PGKA 3RVJA 2C31A 4P0TA 3EXG2 2IQ5A 4U4AA 4XSVA 3QXCA 3NEJA 3SZGA 3P9QA 2PT7A 3VAAA 2G7MC 3B20A 2WZDA 4KQEA 1Q19A 1ABFA 1EFDN 1ZUHA 1YVDA 2HSJA 2PWYA 3SFVA 3E9ZA 3QI7A 1QHSA 2AC4A 1R64A 3JS5A 3U80A 3WK6A 1HK7A 2XB2A 1N2CB 1XHEA 1QAQA 3F6SA 3STYA 1IXZA 4EA7A 1AQ6A 4HFNA 1UMKA 1ZKMA 3LPMA 4XJTA 4UOEA 4ZJZA 3B9BA 1SWVA 3QLJA 4JDPA 3J7AC 2QDKA 2OYSA 3OF2A 4QBKA 3W6OA 2FN8A 4HPWA 1NM5A 1GUBA 3AETB 3MD9A 4D4MA 4BO5A 1X8KA 1OW3B 2CFTA 4EG1A 3I9FA 3VFDA 3U7FB 3JQ7B 4PX2A 2V74B 4IG9A 3IMCA 2VH5R 2GD1O 5DLPA 2B1GA 2O3TA 1G6Q1 2FPGA 1RYFA 5TPZD 4AX8A 5CFZA 3K31A 3KYDB 4L8YA 5BV1A 3EW9A 2ZIFA 3PI6A 4WXEA 4Q16A 3CCCA 5I7RA 2NO6A 3AM4A 1X7HA 2WTAA 3FFTA 1FXUA 4DLLA 3S1AB 4Y6RA 4CQLA 4XQCA 1MB9A 5AUPB 2FPOA 2HMUA 2JDID 2TSYB 4YONB 2VTBA 1N3IA 3TOVA 1PSZA 1XEFA 4EABA 4AAYA 5L40A 2E9SA 1T2DA 2QB5A 3AGPA 2H9YA 1V5FA 4MCIA 5KTPA 1R50A 4FHZA 3OEED 5E7JA 5DHTA 4JSRA 5AQ1A 4YJHA 5B3LA 1GA6A 4MV8A 3E5MA 3OE5A 2G72A 2XKKA 2NUBA 4G1MB 1SC1A 1V16A 1GJRA 2CL7X 1AHPA 4L7QA 3AHJA 1LW7A 5K8CA 1OHHA 1TYAE 2Y0CA 1PK7A 3IE0A 3TSWA 3H4VA 5HVNA 1J0BA 1C8LA 3W1EA 1DG1G 3CNQS 1QGAA 1X1AA 2XJ9A 1MQAA 1Q50A 2R8EA 2LNDA 3DM5A 2LP4Y 3ILXA 4K9QA 4YJ3B 4JB0A 5CX1A 2F55A 4UVDA 5EZSA 3GCWA 5M34A 4B4UA 3D6NB 2F4VB 2Q1UA 2EVWX 4AUKA 2F6RA 2FWNA 5DYIA 4KOAA 3ZJ5A 2GAFA 2PLFA 3SQNA 4UZFA 3HUTA 3N9IA 3PC8C 4ZCMA 1VHLA 4DDWA 3T4EA 3A9VA 3LUGA 1EWRA 4TUYA 3HKDB 1FEZA 3IEMA 2X0JA 4YO7A 2ZUEA 3BFPA 1KK3A 1MX9A 2DX7A 4L15A 2P9QA 4ZFNA 1AHNA 4RY0A 3SS9X 1UF9A 1Z5GA 4OGGA 4FK8A 2AFIE 1XRLA 1UMCB 1I3KA 3M2PA 3PQ7A 5FL7A 2CFIA 4C4XA 1E4EA 1SZJG 1Z4QA 4XZ3A 4MUYA 1A76A 1O6CA 3LFTA 3BEDA 3IPRA 1M54A 4E5DA 5KVAA 5LYJF 3VHLB 4D0GA 1B43A 3DT6A 5CPBA 1GUFA 1W59A 2BMDA 2FRXA 1WUIS 1Z0SA 1TLTA 3U26A 3CCFA 2E4UA 3I1JA 4KO1S 3TSCA 2OO3A 4M6WB 4FFWA 2PXHA 3CJTA 3JASB 3EBLA 3WL4A 1NYQA 5AM2A 1JHRA 3WLPA 1O77A 1NAIA 4B3RB 1I6MA 3NW9A 4I9GA 1QLWA 5REQA 1TQ8A 3P5SA 1IEWA 5EQJB 1WO8A 3RQSA 4DNFA 5AUNB 1RXIA 2ZQYA 3AWDA 3ZBTA 1UBUS 4B45A 4DHWA 1W4LA 5IF3A 3GLIB 5LKRA 4GXNA 1EK5A 3SMVA 2R60A 2Z9CA 3CT6A 3DF7A 4BNIA 4MR8B 3UMJA 4NWIA 3PGJA 2RC6A 3ORQA 2ZLBA 3STWA 1MBZA 4BZZA 2ZPUA 2IZ7A 3GV0A 2WT9A 3R40A 4HTAA 3KJQA 2A3RA 1JSZA 5KQGA 4PHGA 2FU5C 2ZRIA 1JYSA 1LQUA 4TM8A 2OZPA 2VK8A 2AI3A 2J5XA 2XMCA 3REFA 4UCFA 4HVAA 4RACA 2MYTA 4FYIA 4PG8A 3U19A 2MSEB 4O2BA 3UH0A 4CWAA 3IKMB 2PVCA 4AY3A 2P41A 3OPYA 1EFTA 5F78A 1GL7A 4E31A 3AFHA 1P5HA 2C96A 2HGSA 1YJXA 3GBPA 5IABA 1SQFA 1ZFNA 1USKA 3SIRA 1K06A 2QI9F 2VDUE 2GCOB 4RGQA 1PJQA 1OC4A 4RNCA 3WYAA 2VP0A 1U63A 4LI3X 4BO6A 3P52A 3C14C 4R1QA 1VJCA 1SAYA 5HG0A 1SIUA 4KI0A 4RV9A 5JCZA 3E2MA 1YR9A 1T3ZA 4Q00A 3AKDA 3B3QA 1UBOS 5EZYF 1XYGA 2MSCB 3OWOA 4FXOA 4NE9A 4R8SA 2O8CA 1CY4A 4L6IA 1BE1A 1ZVVA 3K5IA 3QU2A 5F76A 1C1DA 2I3ZA 2EZ9A 3EGXB 4EJMA 5ELXA 1TZCA 3JQGB 4NESA 4HDRB 2FPIA 3Q10A 2VJOA 3RUDA 5IX8A 1K89A 2AZ4A 3DE6X 4RCZA 2QT0A 1N5KA 4GI2A 4US0R 2P8SA 1XZIA 1YDEA 4PZ9A 4WDRA 4YACA 3TZBA 1WUYA 5BR7A 4MV9A 1EIZA 1ZN9A 1QIIA 1V2HE 2D4AA 2HEIA 2JLSA 2Q5JA 4X66B 4JYZA 1UBHS 3WLLA 1GT91 1ODJA 3F9RA 4IYJA 1T1RA 4AT1A 4RHTA 4MW4A 1JXOA 1ADBA 3PFBA 1ZUD1 5JZVA 1TNDA 3UC5A 3S70A 4TZ0A 1IPFA 3HJGA 3TLEA 3X2SA 3RVSA 3H86A 4WT7A 3L8MA 1UDRA 5EMLA 4CV1A 4Z2AA 1IK4A 4XRGA 2W2PA 4P9NA 1AS0A 3ZD6A 3ZU6A 2YNMA 1KDTA 2F8MA 4KFRA 4L7VA 1QKKA 5IM4F 1OXKB 5FFMA 3EVTA 1Y3DE 3ZG6A 3P8ZA 1LPPA 5F21A 5BUZA 3TZHA 2E4WA 5CDFA 3I6ZA 3C8UA 3KAQA 3CNBA 4D9CA 3TQFA 3F8TA 1QTQA 1Y3BE 1KPGA 1VMAA 3FFBA 3HLYA 4FSXA 3RK4A 4NZ9A 3TNFA 3IRUA 3S7ZA 1P44A 3IR5A 4D99A 1PGQA 5C80A 3ZHUA 2JIDA 2JK1A 3PFKA 1VA5A 2QRGA 2OQIA 2X41A 1N75A 1RKQA 1CJCA 2H54A 3BULA 4RA6A 4IHJF 4ZZ3A 2ATEA 1KS2A 3NHJA 2WIAA 5D6NA 1TLLA 2B7BA 4BDSA 3PUZA 2WTUA 5ANRB 5JLAA 4ZU3A 1JG2A 1SXIA 4CMAA 3A9CA 4L51A 1TYDE 1VPEA 2DQ4A 4A2CA 2C83A 3OLQA 5A9SA 4GPBA 2KPOA 3FYTA 5LA6F 2ES4A 4NONA 2W0MA 3GLGB 2BGTA 1X13A 3QOFA 4XVUA 2C2KA 4UFOA 3CB2A 3HDVA 3VBEA 3QENA 2R1ZA 2JI9A 3EDCA 3FDIA 1AB6A 3BMQB 3BMOA 4I5FA 2A94A 1UQUA 2G71A 2QRVB 3GUHA 5T67A 4CLEA 2OGZA 4B3HA 5L3SB 3KQHA 5EVJA 4ZU1X 1QO0D 1HDZA 1U8CB 1DX4A 3P7MA 4P08A 2C94A 4MVJA 3DM9B 3G1TA 5F9FA 5EZ6B 4OKIA 3KX2A 3OC6A 4LZNA 3ZCXA 1E4OA 2BFBB 4HRAA 4C0SA 5KWSA 2RHTA 4KLZA 5C52B 1EFHA 4RVUA 3E27A 1O87A 1RWWA 3F7TA 2D1RA 2VJBA 5EGSA 3JZIA 1XNJA 3DYVA 3LCCA 2XA2A 5GOTA 2ZAGA 3KUUA 1BKSB 4I8DA 2RGCA 3O3CA 3RVNA 2ZRPA 1NUQA 3S40A 3W4IA 3BFKA 2QD2A 3QKTA 3U31A 1PVOA 1KOJA 3AU9A 2DTDA 1MNQA 1XO1A 2GDZA 3ROFA 3TD6A 4GP7A 4AKIA 1T24A 5CT9A 4PF1A 5SY9A 3ZJYA 2LPMA 5KYGA 4B6SA 1CQZA 1G4AE 2FUG6 3H5WA 2VHZA 1M3SA 2NU9B 5IVKA 2VDKB 3V1LA 3RJ5A 4LQCA 4JT9A 4EK9A 2Z30A 1RPAA 1U99A 3S68A 4Y2PA 2ZP1A 2XGJA 1TRHA 3GDGA 1G1MA 4TL8A 2G1AA 3FAKA 3OBIA 3YASA 4E2FA 1N8NA 2NZUG 1RLOA 3K0CA 5ALTA 5EE5B 1N7GA 1CHNA 4PY2A 4PYJA 3W5CA 2CNBA 3ZKAA 3SFZA 1K27A 4XI9A 4H6VA 3T8YA 1R5OA 2CLMB 2H00A 3QUQA 3HO6A 3K0EA 1ZONA 1QCDA 4NJEB 3ZWKA 2XE7A 4Q4LA 3ORSA 4YFYA 4ZYYA 4UBMA 5DULA 3RTGA 3CYFA 3AP1A 1IBKB 1MMFB 5KHLB 1EXDA 5LXTF 2R97A 5KCZA 2XECA 3V3KA 1YTUA 1FC0A 2DFKB 1Z7WA 2I33A 3BWXA 4I46A 1JEJA 4RX1A 1N5OX 4FS8A 3SF8B 5BY2A 4FD2A 5CVTA 1U4NA 2BP7A 2D2VA 4ETIA 2C2ZA 1B8UA 2KS6A 4MS4A 4Y1EA 1UC9A 2GBLA 3CRNA 1V7CA 3M6UA 5A4AA 1JH9A 4ARCA 4F3TA 3HA7A 4HNVA 1U8FO 3GAMA 3KHTA 2Q5OA 1KY4A 1P0PA 1NR7A 2X0EA 1R1DA 1X70A 1KAEA 1YQ9A 3B6IA 4WGGA 2XRZA 1ZEMA 2REQA 1G19A 5ADHA 2E2WA 3CXRA 2IY7A 3D8RA 3HRKA 2JLYA 4WN3A 2OD2A 5E7MA 1OBOA 4AN0A 3DMPA 4DBZA 4CDNA 3FUXA 1FCJA 1VLVA 4ETNA 4E2XA 1YE8A 2OT3B 2WFMA 4H08A 4TKVB 2IF2A 2FWPA 3H5RA 1B0UA 2ZG6A 2JCBA 5LBIA 1NULA 2C9BA 2FN4A 3C41J 1U1GA 1E2KA 4Y6GB 1ES9A 4MVJD 1SK9A 1DBVO 2R25B 2BCJQ 3RGGA 4G89A 1M34E 4WKNA 1IK6A 3OM1A 1B3RA 2CK3A 3INTA 2VVTA 1IZZA 4QWMA 4XYBA 5I9BA 3PFFA 1KE1A 3BORA 3FBTA 1PQUA 4RIIA 4GSKA 4DW8A 2FUNB 3LYHA 4OY3A 1W4ZA 5JW6A 3GEEA 1D4ZA 2OB1A 5JXJA 4WCFA 1N7IA 5BV7A 4JBXA 2VQ3A 3UEOA 1ZM7A 4ZAZA 2EHJA 3U09A 1V11A 2ZRFA 4K28A 5K6RA 1N78A 3ETEA 3OIGA 3HP7A 4A8JC 5FTWA 1ZITA 3V42A 4MS3A 1UK9A 2LZ0A 1ISMA 5LMZA 1DAMA 1RYBA 2GF9A 2JLWA 1Y5NA 2JNWA 2Z98A 4A23A 2J33A 4HATA 2H1IA 5JRZA 4EHBA 4NOLA 1XZLA 4WLVA 4JYBA 4GEGA 1E98A 4F7WA 5JCOC 4OHYA 5HKBA 1NWHA 2QRJA 1Q15A 2J48A 3JYNA 2OILA 2HF2A 2VDPB 4F1JA 3RBZA 3UBTA 4Z7NB 3A1UA 1U9CA 5KTMA 4HKTA 3OURA 4HZGA 4AKHA 4FGSA 1PL8A 5BQ3A 3ESYA 1U9IC 5G0WA 4DE5A 4BXOA 3SYLA 1FRNA 2K6GA 3CBQA 2Q3FA 4H6WA 1QTNA 1D1TA 2R6FA 4G4SP 4JJZA 3W4KA 4AW9A 3ADBA 3TL3A 1LVGA 2GAAA 4JUAA 4RIHA 7ADHA 1NZDA 3FROA 5JXIA 2EGHA 3QVWA 2FDRA 1GFSA 3LX6A 4JLWA 3THOA 3BSFA 3AJ9A 3FTNA 4CTOA 1MX1A 1P9NA 3VHXA 1JQAA 5IT4A 4C0XA 4Z9YA 3C97A 3UYKA 3DMRA 4LMRA 4EPRA 4RZSA 2ZYWX 4F3RA 4KWHA 3O75A 2MMGA 2BFMA 4MUBA 3W90A 1OXMA 3DHWC 3FR8A 1T5DX 3FJYA 1ZL2A 2ZRAA 2BFDA 2W2MA 4RA9B 5C3UA 2AE1A 3KYCA 2GXAA 3L41A 2GPTA 3L0BA 1NV9A 4QGSA 4QLBA 2BEKA 5CFOA 2B30A 2HIAA 4J4BA 1WZEA 3GCGA 4F04A 4A82A 3SC6A 5KS2A 1C30A 4I5GA 3I2IA 5B53A 5B58C 5FWYB 2HF8A 3Q5DA 3ZHQA 5HZKA 5IDYA 1DXQA 1RJDA 2QRKA 3UKOA 2YV4A 3MD0A 2VT6A 2VF2A 4EHIA 4F5DA 4MRNA 2HWWA 1NJSA 3WWZA 4ZOQI 2WV7A 3U5ZB 2XXAB 1QONA 2W2NA 4OBXA 4L8FA 2YV3A 2WLTA 3DBIA 3P4XA 3LY5A 2PUTA 3OCYA 4MVJG