4DRZA

Crystal structure of human rab14
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
160
Chain Sequence
YNYSYIFKYIIIGDMGVGKSCLLHQFTEKKCPHTIGVEFGTRIIEVSGQKIKLQIWDTAAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-14
publication title Crystal structure of human RAB14
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 54
structure length 160
sequence length 170
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4drzA01
3P20A 3E70C 2ZRPA 3A1VA 2YNMA 3GEHA 1TQ6A 2NZ8A 5H70A 4OK3A 2QA5A 5A5GA 1U0JA 4YLGA 2RCNA 3TSZA 3U61B 1F3OA 4OQXA 1ZYUA 4Q9KA 3IKJA 1FL9A 2GEUA 2LKCA 2QAGA 4NE2A 4TQUS 5KYKA 2FG5A 2CE2X 4Y0VA 2ZI9A 4DDVA 5EP3A 4D82A 1C1YA 2IA5A 3ETLA 4ZV4A 3LBNA 1R0ZA 4ARZA 1MO6A 4B3GA 3RNLA 4IDNA 4B3BA 4BRUA 4ABYA 1IN5A 5SZIA 2OCAA 2ORVA 1KAGA 4QBIA 4HZUB 4A0RA 3TUIC 1W0JD 2EW1A 3NG1A 1VDZA 2B7BA 4PC7A 2JLSA 3CNOA 2XSZA 4WVFA 4C2UA 1KO5A 3ADDA 4LUCA 4DSNA 2GJAA 2WJIA 3UMRA 1C9KA 2W6ID 4W7SA 2ZJBA 3BAFA 1IQPA 4PZYA 3MUFA 2ONJA 5L3QA 3P27A 5GJWC 1E69A 4MRRA 3GLGE 3L8YA 1Z6TA 2O8CB 2FPMA 3L43A 1GITA 3NHAA 5DE3A 3FGNA 4ZIRA 2ODBA 4Q9LA 1W36D 2EFHB 4M1SA 2C98A 3Q72A 4YXWA 1HH4A 4LGMA 3CLVA 1N6KA 3K09A 1WMSA 4TTQA 5IHPA 3UPUA 1GNPA 2IEZA 2VLIA 2G88A 1E9EA 1ZCBA 2B7CA 3ZQ6A 4F7WA 1ZU4A 4H9GA 4ZDJA 2D4HA 3UK6A 5EP4A 2FMXA 2RH5A 1E94E 5FBQB 2FJUA 1AJEA 2QT1A 4M9XA 1LFDB 1S9HA 2VP6A 4PANA 1KYIA 4P4SA 1DBSA 2ZAMA 4KBFA 3CRMA 4TN1A 1UKEA 4A8JB 2BMFA 3THYA 2F1HA 1BMFA 3BXZA 3LAWA 1OH7A 5JJKA 5AJYA 5EXSA 3PEWA 2AKYA 2CHQA 1US8A 2CVHA 5JS8A 1N5LA 3QXCA 1U9IC 3H1TA 4QNMA 4QM7A 5FOXA 1IN4A 2ZROA 4CEIA 3SYLA 2GTPA 5HCIA 2ANCA 4NONA 4R71A 3PEUA 2KB0A 2OG2A 2QMOA 1H8HA 2CCJA 3VX4A 4BZXA 4NYMR 1BO6A 2H92A 3P32A 1ZM2A 2C9YA 2A5DA 3F8TA 4C0LA 1B23P 1SVIA 1TF5A 2OFWA 3MWLA 1YZNA 5FUXA 5KDDA 4W5WA 1EX7A 2DYKA 1R0WA 2IYLD 3T12A 4GOXA 1C4OA 3K70D 1R2QA 3KZ1E 3GMTA 3TAHA 2FOLA 3RS3A 2D3WA 3VU9A 5JJLA 1ZNZA 2KJQA 4DKXA 1XMJA 4MDEA 5EUMA 4DC9A 2CL7X 3BFKA 4LYHA 4IRUB 1DAGA 3NH9A 3QENA 5B64A 1KSGA 3I5YA 4EPVA 3TSWA 2FZLA 4AWXA 1MO3A 1P3JA 2NO9A 1UAAA 1T3SA 5FUWA 1M1YE 2ZRKA 1U8AA 2ZREA 1NBMD 2BMEA 1G8FA 2P5SA 2GKSA 3MD0A 4KVGA 3W8NA 3ZS8A 4EPXA 1NI3A 3UWKA 5HZHA 3FHOA 1KSJA 4FCVA 2ZITA 2FGKA 4ZI2A 1XFAA 4LOAA 1XJQA 1OW3B 3PIRA 4CGZA 2GZDA 3C41J 3U7HB 1FTSA 1Q57A 4B74A 3U4QA 1P6XA 2J0VA 5G40A 1BIFA 2WMNB 1RJ9A 2OUKA 4AYWA 3QPUA 5FOWA 3QUSA 1R5BA 2CCGA 2IWRA 5HKKA 3L82B 2AHOA 2V4ZA 1PLLA 3G5UA 2UZIR 3IQWA 2DFTA 1HE8B 1EFTA 2O52A 3SHFA 4TLAA 1EX6A 4DT1B 3RRNA 3TR0A 1P2UA 1E2FA 2YOGA 2FV8A 1MR3F 5FUVA 3BJIC 5KUTA 1G8GA 3F0TA 3P4XA 5DYIA 4DDTA 1ZD8A 3OESA 5K8TA 3EZ9A 4NPHA 3B6EA 1LV7A 2BEJA 1DO2A 2GDJA 5JJIA 3R20A 4MYHA 2GVZC 4JLAA 5J5CA 1W4RA 1ZU5A 1DVRA 1G21E 2GZAA 3LD9A 4BEBA 4URUR 3QQ5A 1N6HA 1LY1A 1ONBA 1S0UA 3GLHE 4GMDA 4P4TA 5E7JA 4BLTA 2V6IA 3LDAA 3QKUA 1XTRA 2J87A 2R2AA 3QJYA 1DELA 1Z29A 2J45A 2IW3A 5L3VA 2ZJYA 1E0SA 2W6IA 2OV2A 3CNLA 4JBWA 4JT2A 3OAAD 1FZQA 4FMBB 3EA0A 3VR4A 3ZJYA 3VAAA 3A1SA 3JVUA 2AXNA 5JWHA 2ZJ2A 4LI0A 2REBA 4NCKA 1GG2A 3AUXA 3T5DA 5EE1A 1ZBDA 2PH1A 2Z5FA 2O8DB 1G5PA 1T9HA 5HE9A 4B3FX 1OH5A 1PZNA 4PHHA 4R98A 1Z0IA 3EAQA 2CNWD 1G17A 2QSYA 1SVMA 3QXSA 4I1VA 4V02A 1NN3A 1UEJA 3TGPA 1NJFA 2VHTA 4JLNA 3A58B 5FL7D 5JSZB 2GXSA 2W2XA 1Z0FA 2GAAA 4I4LA 3DO6A 2AWOA 4RJLA 3NC0C 4B6FA 2O8CA 2BM0A 3EX7C 2OHFA 2RGCA 5KDLA 1R8SA 1ZUNB 2EFDB 5DHAA 1OXTA 4RSGA 4D0LB 4E09A 5KHOC 4IOMA 3Q5DA 2CLDX 4D4KA 1N0VC 3CX8A 1M34E 4MKFA 4OQFA 2WBLC 3MFYA 4YMSA 3EARA 4UQOA 1AGPA 5H68A 4OHZA 5CYPA 3W9YA 3SZRA 3K0SA 3ZH9B 1X8LA 2N42A 5DN6A 4LC0A 1MO4A 4AYTA 3BE4A 4EJSB 2IYSA 3TR5A 2DFKB 2C03A 1EXMA 5FBVB 1ZIOA 2P5TB 2KBFA 2ZE5A 4FCTA 3GPLA 4N0EA 4HDQB 1FPMA 3AGQA 5HTKA 4M0LA 1X86B 4A8JA 1JXMA 2C9OA 3HR7A 4AIIA 2EFCB 4FMDB 4NYJQ 2FGJA 4E22A 5JRZA 3KB1A 4P31A 1VECA 2QRZA 3CX6A 3BOSA 1WA5A 3OFNA 4K46A 4MRNA 5LDDC 4PC3A 4BASA 2O8EB 2VBCA 1HV8A 4KFRA 3DKPA 3PEYA 1GTVA 2QTHA 4JL6A 4NYIR 2VSFA 2FX3A 4PPQA 4G01B 1Y63A 4TT3D 3TMKA 4Q66C 2Q3FA 4PSKA 1NVUQ 3RS2A 4HB0A 1WBDA 3MWJA 3R7WA 3GD7A 1OLOA 5J4YA 3TIFA 1YZTA 1YZLA 3CF2A 4DZZA 2FA9A 1R0YA 1ZC3A 3O8BA 5EZ5A 1KIMA 4CT5A 3W6PA 3CPEA 2XJ4A 1G7CA 4N0DA 4M4SA 4WIAA 4HAZA 3PXGA 4C4PA 3SHWA 1CJTC 1TADA 2JDID 5CIWA 1NKTA 3LNCA 1T3HA 2IF2A 2ZRGA 3U3RA 4MKIA 1A5TA 4YC7A 4URYR 4RZ3A 3RS7A 2EQBA 2EWVA 3D8BA 1XJ0A 4OK5A 2HLDD 3RWOA 3B1YA 4HLUC 1IM2A 1NP6A 4D4JA 3D3QA 2DR3A 4L4UA 2QBYA 4NCJA 1E2HA 4FI3C 3ZZ0A 4S2EA 1T0HB 3LW8A 3JZAA 5HZKA 3Q3JB 5LB2A 1OF1A 2AFIE 1OYYA 1G18A 2ZSFA 1Q0UA 2DWQA 2PCJA 4MGZR 1H8ED 3UIEA 1SXJB 3UWOA 1E6CA 5D3MA 4RY2A 1U94A 4RZUA 5IK2D 3DVLA 1OB2A 1CLUA 1G291 1JNYA 2D06A 2IX3A 4F38A 4JLJA 3FWYA 2QM8A 2VP5A 4LV5B 2O5VA 4TMZA 3NXSA 3DEFA 2WTUA 4TL9A 4F4CA 3MGCA 4OKSA 2UKDA 2VP2A 5KSOA 2V6JA 3WMEA 4N3NA 1FMLA 3TAUA 121PA 2A5FA 4YONB 1KK2A 1XTIA 821PA 3CF6R 2VP4A 5H1YA 4Z54A 3OIVA 4TMWA 2BWJA 1S8FA 3DKVA 2N1BA 5CK4A 3QXHA 3WNCA 4HUQB 2BBTA 3SFZA 4Z1MA 4KVAA 3GEEA 3AVTA 4DSUA 1HT2E 2VHUA 4B73A 2CNWA 4IOKA 2F3TA 4FMDF 2QUZA 5TDHA 3TW8B 3BS4A 2ZI3A 2HF9A 1IXZA 2IWHA 3REFA 4RVCA 1COWD 2DWPA 4M9ZA 4TLEA 2C95A 3EPLA 1XCMA 1QHYA 4FWTA 2V8OA 2R6DA 2WOOA 5FL3A 2YYZA 4GI7A 1JXOA 2ZJAA 2IYYA 2WHXA 5AJWA 1CEEA 1XXHE 3EZ6A 2GCPA 3NH6A 2GF0A 4QJ4A 3DDCA 3M6AA 3CB4A 1E3MA 1II8B 2YC2C 1WCV1 2AD5A 5J47A 4M21A 3QKSA 1ZD9A 1UJ2A 2OBMA 5D3QA 4ITRC 1LS6A 1HYQA 4UNQA 5FH9A 4M1KA 1AN0A 1BOFA 1O87A 1XTQA 5GVSA 1G20E 1SVSA 2DHRA 2WICA 4M2LA 2VF8A 2W0MA 3KXKA 2WPDA 2ZRAA 2Z6VA 1EFCA 2Z83A 4QFMA 5C46F 4OI4A 1Z2AA 5C2JB 3GLFE 4DLRA 1G3RA 4Z8YA 3QVVA 1XD9A 4DXAA 1G8PA 4WXPA 3AVUA 1BS1A 2IT1A 2ODEA 2HXSA 2QAGB 1VCOA 3BB4A 4IHQA 4ASUD 4CEHB 4LV6A 3SJCA 2NGRA 2O0HA 3I5XA 5EE9A 4I99A 4MGYR 5JHHB 4S35A 1EWRA 1WBBA 2KWIA 1E9DA 2IYVA 2PCLA 4F4JA 5BN5A 1P7CA 4Q7LA 4ARZB 4D2IA 2KI5A 2ZRFA 3I92A 2OCBA 2JAQA 4X8LA 4F91B 2XITA 1OKKA 4P33A 3I1FA 4OQLA 2ZSEA 1GDDA 1J99A 1N5IA 3AP2A 4B2PA 4LJ6A 1G3UA 1VG9B 5FI0B 4EJSA 4RD6A 1JR3A 4TQ9A 1ZM3A 3B9QA 2IYWA 3SEAA 2ZR7A 4EUNA 5AK0A 4QHYA 1N6NA 4KBGA 3RRZA 2WWXA 2ZI4A 2BMDA 3KJGA 2X1VA 1KDOA 3NTUA 2GBLC 2ORWA 1HT1E 2P2LA 2ZRLA 4Q9JA 3SU8A 5DHFA 1QZXA 2CXXA 4GMXA 5E4FA 3ASZA 3CZQA 2XTZA 5JECA 1W4BA 1X3SA 2OEPA 5HE8A 4D81A 4OHYA 2ZRCA 4ZIRB 2JLRA 5TXGA 1QVRA 2MSDB 4US0R 4P4UA 3V00A 4HAXA 3MWKA 4PC6A 5CB6A 2O8EA 4G3XA 5UKDA 2R9VA 2FSFA 4V0OA 4WOPA 1DAEA 2WKQA 1XWIA 3TJZA 3Q5EA 1N0UA 5KSYA 3GFTA 4IDHA 4XD7D 1EG7A 1MO5A 3THXB 2QTFA 2HLDA 3RDPA 1GL6A 1OHHA 2WAXA 3IUYA 2ZSBA 3QKTA 2A5YB 1II0A 3QF4B 3VKWA 1U9IA 3K70C 5CB8A 3OZXA 1KMQA 1KK3A 2A2ZA 4JKIA 2F9MA 4JBXA 3GJ6A 4DLYA 4IVPA 5FR1A 3QVUA 2XTNA 421PA 4PZZA 4AG5A 2ZRJA 5CK5A 3QEJA 2HXYA 5AR1A 3AVXA 1I2MA 4P4SB 1R4AA 1WXQA 4QJ3A 3O8CA 4US1R 3QPWA 3KDSE 1E79A 2VPPA 5CJ2A 5AWFC 1GNQA 1AA9A 1NIPA 2QT0A 1NLZA 4NDZA 4TSFA 5KSPA 4LJ9A 2AFHE 4M22A 5B2ZA 3UKDA 1CJMA 3B1WA 4Q1DA 3N2IA 5EE5B 3LH5A 1US8B 2C77A 2ONKA 5BQ5A 2B8TA 3IIJA 4PSVA 3NDBB 2RGDA 3K9HA 1UKZA 4CZ2A 2NMVA 4GT1A 4LSGA 3D6TB 3UG6A 5GADl 3HU3A 4OYHA 1MRSA 2XOKA 3T34A 1Q3TA 2JJ1A 1T0JB 4LPKA 1G5RA 3LWNA 4H1VA 4EPTA 1SXJA 1M2OB 2VRWA 3W5IA 1P9WA 2CJWB 2ATXA 2CK3A 2WSSD 2ZUDA 4JJZA 1NG9A 2OFXA 2J0UA 4A0FA 2D74A 1MOZA 4YQFA 4MYTA 3VU9B 4DB4A 4UXHA 2QPAA 1NN0A 3LX5A 1N3BA 3H84A 1Z3IX 2EFEB 4LHZA 3MLEA 4Q1AA 4XWOA 4LY6A 1JECA 3R9IA 3U6KA 1TX4B 2E9SA 3L8ZA 2WIBA 3RRMA 1CBUA 3OIUA 1Q1BA 5KU1A 2QG6A 1P60A 1G3IA 5EP1A 1RYFA 1CULC 3QPVA 4HUQA 1M8PA 1UDWA 3SN6A 5CM8B 1ESNA 1QBKC 1KJWA 1MH1A 3U5ZB 3TUJC 4O3MA 5CDFE 4NMMA 2L0XA 4LPSA 1E0KA 1KKMA 1J8MF 3AVOA 1Z6GA 4A82A 2FZ4A 1CR1A 2Q9BA 4MYUA 2CE7A 3AV0B 5IDVA 4ACBA 3W6OA 5FOVA 2FPKA 5F2EA 1KI9A 2XEXA 1FFHA 3GCGA 4FINA 1QHHB 1N5KA 4HLDA 1G41A 2EU8A 3KJHA 4WZ6A 4JLVA 2IXEA 4ACAA 2IS1A 2GK7A 2ERYA 2VIIA 4PPFA 4TYWA 4A0HA 3GJ8A 3X2SA 1X6VA 4OI1A 4B33A 2ZS9A 3JZMA 3K9LA 4V0MA 1JB1A 1S3GA 4PAQA 2XNDD 1T91A 3VFDA 3OE7A 2ZYWX 4DCSA 3LXXA 3FMOB 1JQLB 4TLDA 3IDQA 3G82C 1G7RA 2GCNA 4XIGS 2ZS8A 3THOA 3E5HA 1Z28A 3THWB 1VCNA 4DIDA 2B92A 1P9NA 4CEHA 2QE7D 1GRRA 1XTKA 4PC1A 3LQRA 4ZKEA 2KBEA 3HPRA 5GJBA 3B1VA 4NYMQ 4B6EA 2VA8A 4GDFA 2LWIA 2OILA 5DIFA 1DAFA 2JJ2A 4PTLA 1Z08A 4Q48A 1WQ1R 3H86A 4Q7KA 1W1WA 2ZAOA 5TY0A 2C8VA 1KSFX 2CL0X 3VKHA 2GNOA 2OCYC 5KDOA 3ZIAA 3GLHB 5JCPA 1W36B 3KXLA 3ZDQA 4BEJA 4R9UC 5JEDA 3WBKA 3QBTA 4B35A 3WRYC 2CDNA 1YR9A 2PZEA 3B78A 3Q7QA 4W5JA 4KU4A 5AJVB 1D2EA 1KY3A 1E9RA 2I1QA 3U44A 3PJRA 3DZ8A 3QY0A 1SVLA 3Q85A 4GPTA 5DGXA 1E9SA 4PX9A 4MA4A 3SNHA 4G5QA 1GL7A 4KLZA 4CT4B 4DSOA 1GUAA 3FMPB 4JYCA 1FNNA 3QXJA 1E2JA 1XPUA 4WAUA 1FTNA 3U7EB 3H0KA 2H8KA 2ZQ5A 4D4MA 2RKOA 3THXA 4GBMA 4Q9IA 5SZHB 1KGDA 3QF4A 4QNRA 2X2EA 4J0QA 2AWNA 3GLGA 3FVQA 4QXAA 2REOA 1S3SA 8OHMA 2HCBA 3CX7A 1NF3A 3T15A 3AKYA 4IXNA 4E07A 3K0AB 4L16A 1KMHA 2IUTA 1R8QA 3L2OB 4JLDA 2FN4A 2P3SA 1R10A 1R5NA 2HCJB 2V54A 3O8RA 2R44A 1Z6AA 3K0CA 2NO7A 4PO8A 3UXMA 3ZYCA 1KI1A 3CRRA 1YE8A 1P2SA 3I8SA 5FFMA 3IHLA 1CRPA 1VTKA 2WSSA 1S96A 4Z8XA 4MRVA 4FD2A 4O25A 5CLLA 3IEVA 1D6JA 4V0NA 4YMVA 4HAWA 1WP9A 4B3DA 1T8UA 3NBYC 2JLQA 2GVDC 3BC1A 3KJIA 4HYYA 1KK1A 3B60A 2JJ8A 2RB4A 1TF7A 2HDNB 5AUQA 3B1ZA 4M1OA 1CS4C 3X1XA 4BWYA 4PAMA 4LBYA 2D62A 2PT5A 2CJWA 3HPQA 4Q4HB 3T61A 4A0GA 4HLUA 3ONWA 1TU3A 2H5EA 4HSEA 3R7WB 1CRQA 2NPFA 2BM1A 2E87A 1SHZA 1V43A 1KDRA 1Z6XA 1G6HA 3OEEA 3IO5A 1W0KD 3OHMA 2ZVQX 3A1TA 1LTQA 1RYHA 2O0KA 5KNDA 3KQHA 1PV4A 4NP6A 3RYTC 3LBIA 3VR3A 4W9MC 2I1VB 2D7CA 2DFLA 3I4LA 3IGFA 2YC4C 3KKMA 1VCMA 4PQRA 4DBLC 1TNDA 3N2EA 4YDHB 4A6PA 3WNDA 2YV5A 1T4GA 4TMTA 2QBYB 1DADA 3TH5A 2J7PA 4TLBA 1SHKA 3A4MA 3P4YA 1GP2A 3AM1A 4TMXA 2ZANA 3EC2A 3H2YA 2ZIAA 1ZAKA 2H57A 2ZI7A 3L0IB 2RGNC 3GJ3A 1XBTA 5B57C 3BORA 3IO3A 1E2KA 4WZBE 5EQTA 3HR8A 3EPKA 1U0HC 5D3MB 2GXUA 3SQXA 2H18A 3KQUA 3T5GA 2Z0MA 3PEVA 4AG6A 4A92A 1QHHA 1OFHA 4NZYA 1A2KC 3CRVA 1FQKA 1OIVA 1NSTA 2ZI6A 2YKGA 4IKEA 2FSGA 4IOLA 1L4YA 3CW2A 3ZD6A 2JIZD 4URZR 5JS7A 5K8IA 3TBKA 3IQXA 1DAIA 1HEIA 1Z0DA 2DY1A 2ZUBA 5FPSA 4B48A 1RKBA 4F4IA 1KSHA 2P6UA 2R65A 1YZQA 2VSOA 4RFSB 4EPWA 3THWA 4B2LA 1W0JA 4IJMA 4DLTA 4C0HA 2ZJOA 3NC1C 2GXAA 3PUYA 3K53A 2AX4A 2WWWA 4HLQB 1MT0A 1A2BA 2IHBA 2DB3A 5BN3A 2P6NA 4JJKA 4ZO4A 1Q1ZA 4GZMA 4Q4LA 4FMCB 2ZYUX 4A15A 4JLBA 5FOUA 4BECA 4NYIQ 3MCAA 4TYPA 3SC3A 2RAPA 1DOAA 1W7AA 3QBVA 1W4AA 3V4RA 4BFUA 3ZLJA 3W5JA 1T5IA 3TQFA 1IN6A 4PO9A 4U7DA 1OPXA 1W5SA 5JCZA 3UG7A 2OM2A 3GLHA 4LCBA 2AK3A 3SE0A 4H1UA 4Q1BA 3TVTA 3LXRA 2CHVA 3V9PA 5A4JA 4OHVA 1LF0A 3QKSB 4G5RA 4B71A 3KQLA 2FSHA 4DDUA 3S1AA 4MUAA 2C2HA 4RD3A 4X8HA 1OE0A 2FEMA 3PVSA 5GVRA 3U3OA 2NIPA 1OT3A 1VMAA 3BGWA 1I2DA 5L3RA 3TW4A 1E0AA 1BKDR 4JKYA 4TMVA 4NU0A 4CEJA 3WXMA 5DSZA 2OCPA 4C0KA 1E2PA 1G16A 5KNCA 1K5GA 3AP3A 3AVVA 4IVRA 4CIDA 1XTSA 1GILA 3RAPR 6Q21A 3M4YA 4C2TA 2GBLA 1JR6A 2J0QA 2A3RA 2GESA 1ZVQA 1CR2A 3AB3A 5E7IA 2WVJA 1FUUA 4MGKR 3DMDA 2WMOB 5C1BA 4IFBA 4AKEA 1KO1A 1P72A 2XAUA 4JIMA 3CBQA 3Q7PA 4ZKDA 4R7ZA 3K0AA 4DJTA 2IL1A 3LO5A 4V0LA 1IN7A 4LK2A 5FBRB 4Q18A 1N0WA 3R9WA 5FBLB 1HQYE 2FPLA 1E9CA 3FYHA 3NIBA 3FMIA 2AKAB 1CP2A 3Q8XB 2QM7A 3X1ZA 1NNEA 5AUOB 4K8OA 1QVAA 2BV3A 1JPJA 4URWR 1T5LA 3ZZTA 3AH8A 3CH4B 1DAMA 1PLKA 3C7KA 1HUQA 3DPUA 3RSLA 4HB2A 3TE6A 2F1RA 2EYUA 5JMTA 3AF3A 2IHYA 3KFVA 4CYMA 3QIAA 3BK7A 3EA5A 1XMIA 1HTWA 4EPYA 1GFIA 2VTKA 1XEWX 4F93B 1IN8A 4MQBA 1TUEA 4EKDA 2GRJA 2YOFA 5AUPB 2G3YA 4PR0A 4RZ2A 5CITA 4KJZA 1ETUA 4UJ5A 4Q4HA 2QI9C 4RD0A 1NBMA 3I3SR 2G1JA 1GKUB 3WMFA 1E1RD 1NMXA 1X8KA 4HEJA 2C99A 2O8FA 2BBOA 3A1WA 5EZ6B 3ASYA 1GOTA 2EFGA 2EVWX 1EGAA 3R9XA 4CDGA 5BN4A 4MKHA 1TU4A 4RD1A 5EXTA 521PA 1OFTA 2FH5B 2CCKA 5TMPA 2PLFA 3PUVA 4KYIB 2C5LA 1KAOA 4PO1A 4G1UC 5DISB 4FMCF 1CU1A 1M74A 3ZZUA 1BYIA 3LBHA 1ODFA 4JVLA 1YU9A 4DLUA 1CR4A 2B21A 4ZDKA 3EASA 1JAHA 4Q00A 1HE1C 4DUGD 3T06B 2IYXA 3HU2A 3GLIB 2WZQA 3B9PA 2BCJQ 2ZI5A 4EFNA 2ZE6A 3MJRA 4AK9A 1AKYA 2GEVA 3BH0A 4M1TA 5E95A 3TRFA 2RGBA 1E2MA 4KFUA 5CLQA 2A5JA 2XXAB 4BUJA 1EWQA 4ZCMA 1DG3A 3ZD7A 1II9A 5G3ZA 3B85A 1E1QD 1E2DA 2QGNA 3T1OA 2J41A 1SKYB 1R0XA 3PR1A 2DFNA 4KV9A 1SZPA 3FMFA 4M9QA 3FKSD 2XJ9A 1XJCA 1VYTA 3NBZC 1TTTA 1KO7A 4LJAA 1CKEA 2PMKA 2J0UB 3D31A 3QG5A 3I73A 2PLRA 4Q03A 4LJ8A 1RW4A 1T6NA 4B34A 3A36A 1RVDA 2XGJA 2XTMA 3E2IA 1DEKA 2PX3A 3P26A 1VCIA 1UBGA 2PEZA 2VHQA 4KFSA 5KOYA 1RIFA 3NDPA 4HUTA 2WKRA 3OF5A 3MMPA 1W4CA 4DCVA 1TMKA 4AKHA 3OAAA 5FI1B 1YRBA 2A30A 3KL4A 3CR7A 1D8TA 4V03A 4GP7A 2MSCB 2JASA 1R6BX 4IEIA 3G0HA 2ZETA 1FP7A 1QG4A 5H8WA 3OIYA 3K0EA 4RFSA 2JEOA 2IS6A 3A4LA 4BLPA 2GJ9A 4ESVA 1JALA 1AZSC 2IBMA 4UNPA 2TMKA 3TQCA 2J9RA 3BB1A 3A4NA 1KOFA 1CTQA 4DCNA 4R2IA 5FL7A 1XCPA 2A78A 1V5WA 3OEHD 1TL7C 1UM8A 2B8WA 3IBGA 4Q1EA 1P75A 3PG5A 1P9RA 2XB4A 1P4SA 1E2QA 2QEQA 1VHLA 2AK2A 4FWIB 4QHTA 5TV2A 3Q9LA 3CH5A 2GHIA 1VKJA 2ODWA 4PHGA 2OT3B 2F55A 3FFAA 3TVDA 4DCUA 2ZR9A 2BBWA 1HY3A 4MH0R 3W3AA 4QGFA 4HI0E 2NO6A 3WYAA 1QHSA 5BW8A 4FIDA 4YMUA 2FE4A 2A9KA 4JLMA 2BCGY 3C16C 2V9PA 4BGDA 4QG7A 2QZ4A 4TWZA 2VO1A 1P2VA 5B58C 3RRYA 3LRPA 1MABB 4D6PA 5SZJA 5JWOA 1I4DD 3U3KA 2ZU6A 3JVVA 4O0MA 5FPYA 4HAUA 1XXHA 1GL9B 4KLNA 4BFSA 2ZJ5A 4LJYA 5K8LA 5CIQA 2VF7A 3MG9A 4U5XA 1TQDA 2P6RA 2OAP1 2XNSA 1VIYA 1Z06A 4L15A 1G8YA 3CO5A 1HQCA 4XWAA 4D25A 2IYUA 5TARA 4Q19A 3KFXA 2CLSA 1MRNA 4Q9HA 2W83A 1QHXA 2CLCX 4G5GA 4ERNA 621PA 4BFYA 1JR3E 4ZDWA 3GLFA 1OH6A 1KK0A 3VR6A 1HURA 5CM9C 2W6JD 3N5CA 4PPNA 3NBXX 4QGHA 2YINC 4RKEA 1YKSA 2GZHA 3DZDA 4M9SA 1DARA 3O8DA 5EE3A 3AEZA 4TT3A 1LW7A 3VR2A 5EUQB 1E9FA 3CM0A 5FTNA 2IUUA 3BERA 2G77B 1GRQA 3U44B 4YMWA 3AVYA 3UMSA 4Q47A 3T35A 1RC8A 2PX0A 3PQCA 4DLZA 1W2HA 221PA 4ZCLA 1KTVA 2R62A 3C15C 3WP0A 2FSIA 2G0NA 2JDIA 1PUJA 2F1JA 3HDTA 2WWIA 1U2RA 3HJNA 4JBYA 1D9XA 1YR8A 4BRWA 4OQNA 1D9ZA 1DG1G 4LHVA 1XZPA 4XSGA 5KTYA 4DUGA 3CONA 3CKLA 1ZM9A 4GOJA 4TTPA 3CWZA 1YVDA 2H16A 4LHWA 4GRAA 3GLGB 1NVWQ 4MITA 4B32A 3OIWA 5L3SA 1UKVY 1UBEA 3EXAA 1PVOA 2W58A 4TL8A 4WZAE 1E32A 5ELXA 1KMHB 2Q0HA 1FW6A 1Z22A 5E7MA 4UXJA 3L0SA 1GVNB 1NVVQ 4JMPA 2XSZD 3BH6A 2ZVPX 4PPGA 1G19A 4OL0A 1GSIA 1H8EA 3DHWC 3ZVLA 2QU8A 4AKGA 2J46A 2J7KA 3CRQA 4WXRA 4A8JC 1Z83A 1J90A 4LBWA 1FQJA 5IK2A 1F48A 3GLIA 4IDQA 3AVWA 2ZUCA 1YRAA 4EPRA 4LC1A 3LFUA 1EFRD 1NKSA 2NQ2C 1YQTA 2XXAA 3CF0A 3SBEA 1KHTA 2F7SA 1KI7A 1CJUC 4YXWD 3CPHA 2KSQA 4LZZA 4GNKA 4ESHA 4NL4H 3J81k 1SXJE 3AKDA 4OI0A 4BLOA 1ZNXA 4CW7A 2JLZA 4X8MA 3PITA 4C30A 3F3YA 2HT6A 2D2FA 4Q5IA 4BE7B 4B3CA 4QGAA 1UADA 2G0TA 1CXZA 2J0SA 1WDTA 2Z4SA 2W00A 3LLMA 1PUIA 1DO0A 3NKVA 1EESA 2QPTA 4IDPA 4P0TA 3K9NA 1KO4A 2ZRIA 3CZPA 3PENA 4GFDA 5CYOA 2DCUA 3RANA 2RGNA 3SOPA 1LS1A 3QEOA 3I61A 1NRJB 5EXXA 1D2NA 1E2GA 4P32A 5FBWB 1ZM7A 4C0QC 1HA3A 1WE2A 1BMFD 1CF4A 1COWA 5J40A 5DLQC 2OO7A 5HPYB 3KTAB 5J4KA 1FOEB 2W0SA 4KCGA 2JLUA 2F6RA 1Z07A 2H17A 2ZU0C 2GETA 1KI4A 5BYJA 1U8YA 1Z0JA 4FXPA 4QL3A 4XTRA 1OFUX 1F6BA 2ZSAA 4RKFA 5EJEA 3QKRB 1P73A 4JSTA 1CJKC 1AS2A 2ZR0A 4FW9A 4N1AA 3RS4A 1H8HD 4HDCA 4JS0A 1XZQA 2VSXA 3W8RA 4AY2A 3DL0A 1NIJA 2JLWA 3X1YA 5IRCD 2I3BA 4M53A 4UNRA 2ZPTX 2F9LA 4HAVA 4XH9B 2QNRA 1OIXA 1F5NA 5KPDA 1G3QA 2NOAA 5TVKA 3BFXA 1XD2B 1JBKA 1Z5ZA 4DLSA 2JLXA 2IXGA 4BFWA 1OSNA 4II7A 2QQ0A 1OXVA 4ASUA 2ZM5A 3BH7A 1KZGB 2JGNA 3BWDD 4UNNA 3U7GA 3I62A 3ICQB 1Z6YA 5IF9A 3WNBA 2PJZA 1IXSB 4RD4A 1W48A 1ESMA 2R6CA 4JYBA 1DE0A 1A7JA 1KJZA 2IK8A 1G8HA 3NEYA 2G6BA 2ZJZA 3NEJA 1NSFA 3RC3A 3KKPA 3E1SA 4UJ3A 2IYQA 2Q3MA 2BKUA 4NHOA 3EPHA 3CIOA 4DLVA 1MABA 3QSYA 3ND8A 1TUIA 1Z47A 3BFVA 2B6HA 1G64A 5BYKA 3BIFA 3AVPA 3SS8A 3X1WA 1N6IA 2RGXA 2P65A 2HT1A 4Q4AA 4TZ0A 4B47A 1IHUA 4JLKA 1U81A 1K8RA 4LJ4A 2NG1A 2CBZA 2J3EA 2HYDA 2OESA 3DM9B 5HKKD 1H65A 2QQEA 1NVXQ 1VG8A 1W49A 3FB4A 3NVAA 3VMFA 3ZS9A 1GIAA 1Q20A 4HDOB 1NN1A 2Q21A 3HWSA 1E2NA 2MMCA 1EK0A 4MUBA 1R5OA 2GILA 1XMVA 1IAQA 2QP3A 1D2MA 2OAQ1 3WHKA 2ORIA 1AKEA 3LW7A 4XD7A 4QKQA 2QSZA 1FX0B 4R2HA 2FFHA 2OZEA 1QF9A 1XDBA 1J7KA 1AZTA 3S1AB 3V4FA 3GJ0A 1AS0A 1G9XA 2IUSA 2I4IA 1NY6A 3EIQA 2WIAA 5JI2E 1RZ3A 2FEOA 4CVNA 1GKIA 1M6NA 2X2FA 1ZIPA 4AYXA 4BZPA 2WJVA 1UEIA 4LWZA 4CEJB 5FOSA 2BBSA 3PUXA 2GJSA 3UMFA 5LB4A 1XP8A 4KYUA 2YWHA 1GKYA 1XEFA 1KI8A 3T1VA 4L5BA 2GCOA 1XRJA 4QHSA 2WAYA 4NCNA 4OJKA 1XNJA 4XVUA 4F92B 1EFRA 1GZSA 4XOIA 3QOFA 4HATA 4MRPA 2VHCA 5FPHA 4A1FA 1XCGB 4UNSA 4ZPXA 2WJYA 4XVRA 4EJSC 4TZ6A 1Q21A 3MWYW 1RFLA 1WB9A 1F2TB 3FKQA 1PLJA 4PC2A 1P62B 1OXXK 3R8CA 4U00A 4NCHA 2XX3A 4C0SA 2IS2A 3X1DA 1ZINA 1ZW6A 2QL6A 4JVSB 1IBRA 4JSYA 1O3YA 4IDOA 5P21A 1Z8FA 1AIPA 3ADCA 2IC5A 3K70B 1LB1B 4G5OA 2O8BB 1F2UB 4BLSA 3I32A 2V7QD 1IONA 3LV8A 3ZGXA 3CWQA 1J2JA 2Q6TA 3B13B 4DEYA 3ZVMA 5LPNA 4GSYA 1Z2CA 5FPTA 2Q3HA 3GFOA 2BEKA 5IT5A 3GJXC 4Q01A 2OFOA 1E9BA 5E3HA 3VHXA 3W3ZB 3BD9A 5BXQC 4JT4A 2GXQA 4OJQA 3KXIA 1KI3A 2IYZA 3KB2A 3TSOA 3EW9A 4LYFA 4OQMA 4C0BA 5DNYB 1SULA 3T1TA 4BLRA 1IJFA 3QXXA 1JEDA 2O8FB 1Z0AA 2GF9A 3CRW1 5DN6D 4C3ZA 3KKNA 2FDCA 2NO0A 1XF9A 2VQSA 2FFQA 1NLYA 2WJJA 2ZRMA 3KUDA 2G1KA 3RSOA 4KSCA 4U02A 5DO9A 2QPOA 3VX3A 1XU4A 3REGA 2RGGA 1S1MA 2XZPA 1OXSC 4KODA 4TLCA 5G3YA 1D5CA 1SKQA 2VHJA 5HCNA 1XEXA 5CJPA 1XPRA 3KTAA 4Q02A 3I8XA 4MKGA 2NZJA 1FMJA 1FNMA 4AI6A 2EYQA 4G0NA 4PAOA 1NMYA 4LBZA 3R8FA 4KO8A 1RRGA 1CJVC 2HJVA 5DI9A 5EP2A 4TYYA 2X19A 2QMUA 2ZRHA 5FTMA 3OFND 3QKRA 5F9FA 3SI7A 1LNZA 3LX8A 1IY2A 1SVKA 3BBPA 4LHYA 2AN9A 4EAQA 1UBFA 1QRAA 4QOSA 3L0OA 3AKEA 1G3MA 2R8RA 2RGEA 1XEWY 5F9HA 2R6FA 2XNDA 1VG0B 1SXJC 2FF7A 2OBLA 4TL6A 1CR0A 4C0AC 4YMTA 1TEVA 1I4TD 1TAGA 4GP6A 1OJLA 1XD2A 4FN5A 3SBDA 4B75A 2ZS7A 3B8HA 2OXRA 2QE7A 4TMKA 1AK2A 1U8ZA 2IEYA 2IXFA 5FR2A 5GJCA 1E4YA 1AQUA 4EDHA 2Z4RA 1P2TA 1EFHA 3RHFA 3RVBA 2O0JA 5DI3B 4WW0A 4A9AA 1KNXA 1U98A 1Q12A 3LA6A 2QAJA 3FE2A 5JRJA 2ZYTX 2WWYA 1SVOA 3FDIA 2A5GA 4JZKA 1S2MA 3TK1A 2CEAA 1VHTA 2PMDA 3EPJA 4GZLA 2F43B 1W5TA 1E2EA 3VHLB 1YHNA 3SDZA 2QP9X 2WOJA 4I1SA 3CUEF 4ON9A 2W2VA 1ZNYA 5GJVC 4C0JA 2R6GA 1SVWA 4D80A 4EIWA 1QHGA 5KPJA 4M1WA 5L8VA 4A2PA 4ZDIA 3VTKA 3AF2A 3WY9A 4EQ6B 4PSAA 3FFBA 1AQYA 2HEIA 2JA1A 4FCWA 3TNFA 2QGZA 4AURA 2VL7A 3KQKA 3WYFA 4HZIA 1RRPA 1ZD1A 1GM5A 2ODNA 2WJHA 4HLCA 5DH9A 1OH8A 3VR1A 3SJZA 3QI2A 3QE0A 3W90A 3DOFA 1ANKA 1FX0A 1N6PA 4IOJA 3AP1A 2DBYA 3PUWA 2J59A 4NTZA 1GNRA 3AF1A 4X8OA 4ZCIA 4MRSA 5C18A 3K0FB 4POAA 1OFIA 2WV9A 4BFXA 3K8YA 5AUNB 3CR8A 1RRCA 1KI2A 1NN5A 2Q9AA 4HZUA 1M7BA 1E4VA 1W46A 1JPNA 5JZVA 1E98A 4M1YA 4MYCA 2H1LA 4Z1MD 1XXHB 1N5JA 1KKLA 2QAGC 1CIPA 3ECCA 5EE0A 3AKCA 4Q1FA 3O47A 4B3XA 2P0EA 2EWWA 3MRSA 2MMGA 2WWFA 3LQQA 1YR7A 3RS5A 2WWHA 3IIKA 2N46A 5ANRB 1AM4D 2YJTD 4B43A 4LV8B 4PHTA 4JVNA 4DDWA 2AL7A 2BKEA 5J4VA 3TKLA 4DCTA 2V7QA 2OE2A 2IYRA 3AGPA 3VNVA 2P67A 4B2IA 3GLFB 1F2TA 2LKDA 1UFQA 5KSZA 3C14C 1YJ5A 4WA7A 1G1MA 4TYNA 1F60A 2YVUA 3FTQA 3EZ2A 4UXIA 1OIWA 1W44A 2HUPA 4G5SA 5JFGA 4PFSA 1KI6B 4EFMA 4JL5A 3U3JA 1U90A 5TB5A 4DWJA 3UATA 2QP4A 3SJBA 1S4QA 5FTLA 5J4HA 2O8BA 1F2UA 4LYAA 3F5FA 3SR0A 4QBFA 1LVGA 1R7RA 2WPDD 4Q7JB 1ZJ6A 2PBRA 1T8TA 4URVR 2PZFA 1W0KA 1QG2A 1E0JA 4OHXA 4BPBA 3IPXA 2A7QA 1U0LA 3EWAA 5HR5A 4EFLA 2G83A 2Y8EA 1GWNA 5BWMA 1Z63A 3K09C 3HP1A 1YR6A 3KKQA 2FU5C 1NBME 3LY5A 2E1RA 2WKPA 4I1UA 1KNQA 3BB3A 2PJRA 1KDTA 2Q9CA 2XB2A 2BHRA 2RGAA 5FTJA 3TUZC 1OKKD 1OXUA 3U60B 5L3SB 1U99A 721PA 2FNAA 4I1OA 1G6OA 3H4MA 4XSHA 1XPOA 4OK6A 1JR3D 1MKYA 1TPZA 4PQYA 1M7GA 4DRZA 3RWMB 2MSEB 4V0KA 1L4UA 3C8UA 4LYJA 5DYGA 4A6XA 4BLQA 3K0CC 2YHSA 4BFTA 4Z51A 2F3RA 1JJ7A 2ZRBA 1E96A 2ERXA 3LVQE 5JLJA 2HV8A 4DLWA 1S9DA 2QORA 3ADKA 3AUYA 3QG1A 4LDJA 3SQWA 1G7SA 2PEYA 2RMKA 3EIHA 2Z43A 3QNUA 1G4UR 4IXMA 1K5DA 2AD1A 1TQ4A 4URXR 1Q1EA 1TF2A 3PV0A 3U2QA 2JIZA 1ZM4A 1QHIA 1X1SA 1ZRHA 2OSBA 4IFEA 2OLKA 1N6OA 1NLFA 1VPLA 1B0UA 1XX6A 4QC2A 4D26A 4MDFA 1IXRC 1OHHD 1Q44A 4DEXA 1N25A 3B1XA 2QRNA 2GEDA 2OXCA 4L9WA 2BVNA 4AKIA 3I72A 2QMHA 1P5ZB 1ZCAA 1E99A 2VYFA 5KNBA 2IS4A 4CF7A 2ZJ8A 4QBGB 2D2EA 3SJAA 3K9GA 2PZGA 2ZE8A 2NO1A 2GA8A 2DPXA 1A4RA 3QF7A 5DI3A 2WM9B 1JI0A 2YWFA 1E79D 4TSFD 1FUKA 4HB3A 5KO2A 5F3WB 5FOTA 2ZRDA 4BZQA 4BQSA 2GK6A 5B30A 2GJ8A 3WMGA 2F43A 4DT1A 5LD2C 4KHZA 5FPKA 4L9SA 4IVQA 1DAHA 5A0FA 2JATA 2VP0A 1VYVA 3ZVNA 4NH0A 1I4LD 1GAJA 3GJ7A 2W2TA 3EIEA 3MSXA 2XOKD 3IPYA 1DPFA 4NYJR 2JJ1D 2HYIC 3A6PC 2CHGA 2ATVA 2QROA 4EQ6A 2ZXUA 1SXJD 2YOHA 3BRWD 1KZ7B 2CK3D 2D7DA 5AJXA 1P61B 3GJ4A 1IOZA 1Q22A 1NL3A 3ND9A 4LRWA 3FPAA 5C4MA 3HU1A 5K8UA 1ELOA 2NTYC 2C9CA 2QENA 4C7OB 1N6RA 4K81B 2BIFA 2CMKA 4C9BA 2FFBA 2V1UA 2WJGA 2UZ3A 2GWHA 3K0FA 3WBJA 2ZE7A 3WP1B 4KFTA 4A36A 1OYWA 4MGIR 2K5UA 4TL7A 1SGWA 1Q3HA 4RD2A 2RHDA 2V1XA 2VH5R 2AXPA 4W5HA 3T1QA 3C5CA 1IY1A 2X77A 3KJEA 3MJHA 3FOZA 2O8DA 3KQNA 1L8QA 4XVQA 4AC9A 2XZLA 1Q1QA 1N2CE 2RHMA 3C5HA 2LCFA 4NKRA 3PUZA 1Z0KA 4Q4AB 3RLFA 2J1LA 2IYTA 3SYKA 1TQ2A 2GJKA 4BFZA 1J70A 5JSZA 2ANBA 3WRXC 2BDTA 5G53C 1M7HA 2YZ2A 2HF8A 2OBNA 4Q4JB 4RFVA 3EWSA 3GQBA 1DS6A 3IILA 1UF9A 4M1MA 2ZTSA 4A2QA 1TEXA 1ZNWA 4TQAA 3A8TA 4E5UA 4O2RA 5SZKB 4DIEA 4CRWB 1W36C 1LF5A 1RE0A 4LX0A 4Q1CA 2OLJA 1XTJA 2BJVA 3PFIA 2JLYA 2CL6X 3RS0A 4XTCS 2QN6A 3EC1A 2BC9A 1KI6A 4RZXA 4JVMA 4Q7MB 4JLPA 3ZVRA 4KITB 5FTKA 1E1RA 3IIMA 4HB4A 1YZGA 4KXFB 4PQFA 4PXAA 4TTRA 3GP8A 1W47A 2PT7A 1QHNA 2FWRA 3B7GA 4TYQA 4GL2A 3OE7D 4RCZA 4A4DA 1JAIA 2NPIA 3GEIA 1GRNA 2CVFA 2JCSA 4JL8A 3NWJA 4B44A 2C04A 5C4GB 2F1IA 5AJZA 1KJYA 2IF0A 1OV4A 5M04A 3AVQA 3U7FB 2R6AA 3EZ7A 1VYUA 4QM6A 2GCOB 1DAKA 5EXPA 5LBIA 1T3LA 2JLVA 2JJ2D 3DMNA 5L3QB 3NBFA 1SQ5A 1UDXA 2G9NA 4D4LA 5JEEA 4KI0A 1UKYA 5JHGB 2GAOA 3AQ4A 3ADBA 3ZIAD 2REXB 3RABA 3FHTA 1A82A 1E1QA 4UKDA 4Y0AA 4AD8A 4PHFA 4Q21A 3N70A 3W6NA 4XJXA 4QGGA 3FKSA 2QTVB 4DLXA 1KDPA 2ZYVX 4KSBA 2PL3A 1KY2A 3GLIE 1G5TA 3WYGA 2BMJA 2V55B 3PCRB 3CNNA 1G4AE 2ZEJA 4A2WA 2WWGA 1NY5A 3P1JA 1JJVA 2VEDA 3KUCA 3U6BA 2QMEA 4JLOA 1XD8A 1SKYE 1IY0A 3EG5A 4US2R 1AGRA 1G7TA 3NHBA 4I81A 3B5JA 1ZC4A 5JI3E 5G41A 1J8YF 3SYNA 3KX2A 4YDSA 3VQTA 3THYB 3VNUA 2XZOA 4KAXA 1NJGA 1W2GA 4DB2A 1E2IA 1EFUA 1K6MA 1S1CA 2C78A 4ILEA 3MAAC 1QDEA 1ZUIA 4CEIB 2BOVA 3VR5A 4BFVA 1A1VA 1E9AA 3GJ5A 1N6LA 1PJRA 3K1JA 1NMZA 4LJ5A 1ZP6A 1X1RA 1AS3A 2KE5A 1BH2A 4E03A 1VG1A 3L0PA 4IEEA 3IHWA 3HYTA 3OEHA 4LHXA 4DSTA 3HYRA 3GFPA 3CPJB 3W34A 1XEXB 2C96A 3TLXA 1X8JA 4RCYA 3LVRE 5FUYA 4OHWA 1ZMXA 1WF3A 2FFAA 4QJ5A 1DTSA 4L8GA 3M1IA 3ICEA 3ZQJA 1RRFA 3AF0A 3EZFA 4ZI3A 3UANA 2V3CC 3A1UA 3DM5A 4HAYA 1IJEA 2X8AA 2QY9A 3DOEA 4D0NA 2AR7A 1UPTA 4IW3B 3A37A 4OI2A 4QRHA 1L2TA 3SFVA 3KKOA 2BJWA 2H7VA 1E2LA 3B82A 4DVGA 5LD2B 4D0GA 2UVQA 2J5XA 4LBVA 2YWEA 2WSMA 4O2LA 1RPZA 3OEED 4OBEA 4QBHA 1JQJC 5JWRA 3FHCB 3RC8A 3IEUA 5CDFA 4C7OA 3U4QB 3M0EA 1RJ9B 2ASEA 2VP9A 2SHKA 2ZRNA 4LJ7A 1OB5A 4V0ME 1UBCA 1FP6A 1L7VC 3IBYA 1XB2A 3C4JA 2DWOA 2ECKA 1NG1A 2YWGA 1KO8A 4DHEA 1MV5A 1Y3AA 3VKGA 2HJGA 1WRBA 4M8NE 1BYUA 3U3MA 2W6JA 5JBQA 5F98A 2J7PD 1ZUHA 3AF4A 1NVVR 4XWKA 1II8A 3B2EA 5J4LA 4GOKA 4NBSA 1YZUA 4PZLA 1YZKA 3WHLA 2ZSDA 3D7MA 1XMSA 3LLUA 4B76A 4WBSA 1JEEA 4NCIA 4P3YA 4Q4JA 1VIAA
chains in the Genus database with same CATH superfamily
4FX2A 1ZISA 2QRPA 2ZRPA 4QOGA 2Y1LA 3HJCA 4XQEA 4IVNA 3GH1A 2NZ8A 3DYBA 2QN1A 5F1KA 5IDXA 3U61B 4NZMA 2Q6KA 4MW0A 1ZYUA 5K6TA 2XA2A 2PBFA 4HO1X 2YWBA 4TQUS 3BMCB 2O7SA 2XNKA 3IUBA 3FPCA 1J8QA 1QO0A 4M0KA 3HZOA 4Y0VA 1DQPA 1V95A 2WUWE 3MWEB 4PIMA 3UGQA 5HWSA 4QU0A 5FO0A 4PY2A 5AH0A 2ZI9A 3SIXA 5KWIA 3HXMA 2FPPA 1P4HA 2IA5A 1SZCA 2NV0A 3O4FA 5EQFA 4ARZA 3LTNC 2ZCUA 5IYZA 4NBTA 2ZJFA 3LS2A 5DBEX 3VHRA 4B3GA 4PLGA 2B9EA 1RC0A 1PFVA 4FGUA 3QU7A 4KXQA 1VBNA 2GPSA 4HZUB 4A0RA 4UEKA 5KQLA 4KWEA 1WLSA 2EW1A 1VDZA 2B7BA 1W87A 2XSZA 1VLLA 3N07A 4AF6A 4BVJA 3PX2A 4YALA 2APJA 2WJIA 1U8FO 1C9KA 1RWBA 3UAXA 3A2LA 4HWGA 1YV9A 4ITUA 3CLSD 3ETHA 5KTTA 4DQUA 1NW7A 4B8WA 1VRCA 1HXHA 4RVNA 4ENVA 4QOEA 2C2MA 1E69A 3O21A 3DEIA 4NICA 1Z6TA 4ZJZA 2O8CB 2VPTA 3MT9A 4K05A 1NQAO 3AUKA 5KTKA 1Z73A 4QUKA 1RQPA 2FPIA 2V97A 2B34A 3FZYA 4YAJA 1W36D 1JH9A 3E5MA 2C98A 3NRCA 1T2AA 5LZ8A 1ZOLA 1XVVA 2YFHA 3DTNA 1N6KA 3S44A 1JFFB 2FMKA 2ZKIA 5LQJA 2MCFA 1GNPA 1M8JA 2AJ8A 2IYNA 3VPHA 2WDPA 3ULKA 1O94A 3IEKA 3LF2A 4AMGA 5H9VA 2PO7A 3BSSA 2G88A 3E15A 5A0VA 1DIOB 1E3LA 5FWYB 1RAHA 3DLPX 1YMQA 4L0QA 4B85A 1M2VB 1UAYA 4ZDJA 2I7TA 3M6WA 3NAQA 1E94E 1RLTA 2FJUA 2OAGA 4P81A 1H66A 3ONEA 4CM8B 1TQHA 4MV8A 1B7GO 4CKBB 3EE6A 4X0EA 3GU3A 1MB0A 4J94A 1NC1A 5JR3A 4R7GA 3HV2A 4GHWA 5IJ0B 1FUYB 4GE3A 3KR0A 4A8JB 4B6SA 2F1HA 1COZA 4LVOA 3GFRA 1DXYA 3GK3A 4O3FA 4OGLA 5K3BA 4CETA 3PEWA 4QA9A 4QTZA 2AKYA 2HMYB 1ZDMA 1F5SA 1EHIA 3I2YX 5K2MA 2XB8A 1GXSA 2FSVA 2ZROA 5D51S 4MS4A 2FX5A 1OD6A 4M36A 1G8KA 1XZKA 2ANCA 4NONA 3PEUA 1ZIYA 2XYGA 3O91A 2VBFA 1UC5B 1H8HA 2CCJA 3PQ6A 4XYBA 2GUWA 2QX9A 2M2IA 4B2YA 4GD3Q 1ZM2A 3KOXA 3F8TA 4MVJD 4C21A 4OFXA 5C1OA 3VZBA 2B61A 5KVSA 2OFWA 1HKHA 5A5FA 1MH9A 3KYDB 3NVMB 1M2OA 1TEZA 5CH5A 3IVMA 4R40A 3EODA 4U6NA 4B3TB 3PIIA 3GMTA 2GJ4A 4E94A 1E1MA 1R37A 2VYCA 4KUHA 3C5WP 5B6PA 5KQRA 2VPWA 1A5SB 2FW1A 3ROMA 4RYDA 3UH0A 3G0DA 4MR8A 4TUYF 4BO5A 3N39C 1PJAA 4JOCA 2CL7X 4WK0B 5CLGA 3EF3A 3X3HA 4ARBA 4CM4B 1KF0A 2C8JA 3D3WA 3KFLA 4IRUB 3OO1A 2VZ0A 5B64A 2G9UA 3HSKA 3KUKA 4N39A 3I4FA 4D8YA 4HXFB 1XTBA 4CM1A 2H1WA 3TSWA 2FZLA 4BE9A 1P3JA 2NO9A 1I7LA 1T3SA 3NHZA 4XJSA 4AJ2A 1DBQA 1NBMD 1P0QA 1TT7A 1G8FA 1U5CA 4CMCA 3MD0A 5H02A 3H8JA 4MV3A 4EPXA 5HZHA 2XVYA 4UEOA 3FHOA 1KSJA 3IP8A 4OAPA 5ETJA 4JVOA 3ZW9A 3WAGA 1ZO8A 5EWJB 1VQ1A 4F3YA 4QRDA 4ZI2A 3AQIA 4LOAA 1PDVA 3O1IC 1OW3B 3WV4A 4CGZA 2GZDA 3C41J 3U7HB 3OBIA 3F5MA 1Q57A 1QGUA 1UPAA 1UIMA 4I6EA 3GFSA 1BIFA 1RJ9A 4DAEA 1YE3A 1EM6A 1QGOA 2JH3A 1P18A 4N03A 1DC5A 1K92A 4W82A 3RJ5A 3W7AA 1U5BA 3HS3A 2Q2OA 3QUSA 4WKGA 1M1ZA 2VF5X 5EVCA 3IKMB 4BX9A 2V4ZA 3PKJA 3G5UA 5A4IS 3W78A 5ERGB 3JQGB 2AB0A 3EZXA 4MGHA 3EIFA 2DFTA 3W77A 1EFTA 4ALLA 4OMDA 3GAAA 3SHFA 1CYDA 4DT1B 2BFBB 3I9MA 4UFPA 5BV8A 3TR0A 5JALA 1XCJA 1P2UA 1QTIA 4RUKA 3VH3A 2Z56A 4F84A 3W7BA 4IDDA 2LVBA 5KUTA 4RV9A 3INGA 3L1UA 1KRHA 3N2ZB 1E1DA 3O82A 4Q9DA 2XBMA 1DFHA 5DWVA 3BQ9A 1PS8A 1UC4B 2G76A 3PE3A 2PZ8A 1PZHA 2BEJA 1N2EA 4HRVA 4R1SA 5JJIA 1QRTA 3U9TA 1L5SA 1R16A 2E37A 2QB5A 2VDMB 4JLAA 3RM3A 1ZQ9A 4G37A 1ZU5A 1DVRA 1JFSA 1XN4A 1MZPA 2OZLB 3IB3A 4QXOA 1GTMA 2J85A 1SIOA 3QQ5A 5U4XA 1EUZA 5IT0A 4P4TA 1BG6A 1C4XA 5E7JA 3EHDA 3KPYA 4BLTA 4XX1A 2D59A 4J0EA 1DZIA 2VBGA 3NM6B 3C6QA 1QTNA 1T9GR 2J45A 2OPBA 2P3QA 4GOMD 3VI3B 3VZDA 4TV9B 1HLDA 3HDQA 3V2UA 2WKWA 3NOVA 4PAGA 2W6IA 3AEXA 4MP3A 2VPXA 3EGDA 1CPYA 1CUZA 1FZQA 4FMBB 5JC1A 2DEUA 3HJUA 3VR4A 5KYGA 4ZODA 2D5LA 3ZJYA 4LSZA 4LK3A 3EOZA 3K8QA 1EGHA 5TLSA 3WLFA 2AXNA 3P8ZA 1FDVA 5HJ5A 5JWHA 4NCKA 1Q92A 2REBA 2JKVA 2H3EA 1FDWA 4Y9TA 3DZGA 2CY0A 1ZBDA 1TIPA 1VOTA 2AW5A 2B94A 2Z5FA 3LC1O 3NKLA 2DKOA 3O95A 3OY2A 4IQ4A 4QTUB 1QQ5A 2WWRA 2O8DB 4FC6A 1GPJA 3DXFA 4B3FX 4LE2A 3FF4A 1LBTA 1WHSA 3V7WA 3CW9A 2ORYA 3VMMA 1F0NA 1QZZA 1Z4QA 4ZT2A 4HVTA 4HQKA 2FZEA 2QSYA 1SVMA 3JALB 3EXG1 5DM0A 3IFSA 1PSWA 1WOYA 1NJFA 3F71A 5AKIA 1M2FA 3RYHA 3VPXA 2KHZA 5JSZB 1GAQA 3LHFA 1E5DA 1RXSA 2H85A 3IT3A 2AOTA 1BXZA 4L8LA 4M49A 3VYSB 3QE2A 3B53X 3LBYA 2BFDA 4MR7A 4ZTUB 2PUBA 3BHIA 3EDQA 1P1IA 1FMCA 3DR3A 4ISCA 3G2MA 3MCTA 5AMXA 3NHJA 1D04A 1R8SA 3RBAA 2TECE 1VFNA 3IOCA 1J0DA 4TTSA 3PC8A 3BL6A 4WY8A 4BNTA 3E58A 1RBQA 5FDFA 5KC8A 5KHOC 2PUGA 4P4GA 1G2PA 3W2EA 1CUYA 1B00A 3AI3A 1L5VA 9MHTA 1M34E 4YCDA 4OQFA 5C80A 4PYOA 1AGPA 1RQNA 2VJBA 1J33A 2XIJA 4YI3A 1LPBB 4O4JA 3RF7A 2LPMA 2UVDA 3ZH9B 4OJTA 3RRFA 3IP5A 2X9GA 3HMQA 2PGLA 1QGYA 3A28A 1Z45A 4LC0A 5LP1A 4DR2B 2GN8A 1FK8A 2WD8A 3BE4A 1XQVA 4J7XA 3G13A 3TR5A 4JSRA 3WSVA 3L46A 4F7DA 2C03A 4G1MB 2JFGA 2P5TB 4DC0A 2KBFA 2C9ZA 2VPIA 3GHHA 1EVEA 3KYJB 1RIIA 4HDQB 2I7CA 1FPMA 4HGNA 5HTKA 3LTEA 4M60A 5LXTF 3UK2A 1JXMA 2OGSA 3VOTA 4AIIA 4UTPA 1P2FA 4FMDB 1FEZA 4NZZA 1UJMA 2TS1A 1NOJA 2RIPA 4E22A 3PXAA 3R7LA 1JDUA 5KX5F 1WY7A 4BEWA 3BGOS 2M6RA 2QTTA 3CX6A 3MTQA 1WA5A 1QXSA 1YKGA 1A04A 1ICEA 3DDNA 1CV2A 3NANA 1PFKA 1ZEJA 3CUVA 4F60A 2FQWA 4KFRA 3KYCA 4MUNA 5CX1A 3BULA 3RF6A 5T6BA 5K09A 3EXIB 5E6RB 2QTHA 2UYYA 3OWXA 3OZSA 2GB4A 4P7FA 4PPQA 3A0RB 3M6VA 1NVUQ 2DQKA 3GD7A 5J4YA 2OSVA 1R9NA 5JROA 4FE4A 1YZLA 3CF2A 4MLDA 3LGXA 1DJQA 2EBWA 2Y2VA 4CT5A 2QN2A 4DRXB 3EDYA 5AKZA 3DV0B 1L5FA 2AOUA 4LYYA 4N0DA 4WIAA 3PXGA 3D0QA 1CJTC 4XPIB 4K0KB 2JDID 4R1OA 5B7QA 5HKBA 1YHYA 2WNSA 2NSYA 3SS7X 2IF2A 2ZRGA 3U3RA 1RZVA 1C9EA 1WW8A 4LF4B 5FEUA 2VKTA 5AK6A 2EWVA 3D8BA 4OK5A 8ABPA 1P5HA 2RONA 2GEJA 3B1YA 1DOZA 4KP7A 4HLUC 3QLTA 4YROA 4MPPA 1G42A 4MUHA 1NP6A 1MAHA 4KIUA 3D3QA 3CZ9A 4POOA 2UYHA 3H17A 4HDKB 4NCJA 4A8TA 1HQKA 1E2HA 2ZJ7A 4FI3C 4ZC1A 4F1JA 2IHNA 2NZVG 4Q16A 1TGVA 2PKRA 2PX5A 4BAZA 10MHA 2IOFK 1GUDA 2G8NA 5JDCC 2IYAA 3AR7A 4M7PA 3JY6A 3B1FA 5T41A 3SHVA 1T2FA 3N9IA 1A77A 3U39A 5CG2A 3VJRA 2JAHA 2JD1A 2RIRA 4EJ0A 2WF7A 2IW1A 3MOGA 1ZOSA 4RSRA 3WIDA 3WWYA 3IA7A 4AICA 1LBSA 3HA2A 3UWOA 5JMOA 5JVDF 5IDYA 4RZUA 1NR1A 2ERCA 3DE2X 3DVLA 3NHPA 4R68A 4PLWA 1BE0A 3H2IA 4GGPA 3E22B 1TIKA 2OQIA 3ZV5A 3TTWA 2RG7A 3WYCA 1XALA 5EJMA 4TL9A 2HBZA 4BP1A 4BP8A 1PR4A 4PNHA 1IK6A 3IV7A 1WY5A 2B98A 4D3DA 4TWBA 3HYLA 3ZY3A 1V1RA 4IAOA 3AEKB 5CDGA 2J9GA 4N3NA 2RI1A 4DQDA 3MJDA 1D2GA 1K4KA 1QRRA 2A5FA 4J0KA 4V0SA 3CF6R 3OIGA 821PA 4MWCA 2NUPB 3CQ9A 3OECA 1Z6PA 4NS1A 3OIVA 5F77A 1WZIA 3OCCA 1MDFA 5CK4A 5DT9A 3SFZA 1GG9A 4KVAA 1P5RA 3GEEA 3MS2A 4E5VA 3QOYA 4ALJA 3ILXA 2JCVA 4R54A 2VHUA 4IUCS 3BDAA 4GAEA 5P8WA 3LF1A 1NV9A 2XVAA 3WLIA 2YVAA 4CM5A 5DHRA 2ZOSA 4PS1A 5AXDA 3CLHA 5K6RA 3RW9A 1FC0A 3ZCUA 4C43A 3O2SB 1TM1E 1Z5GA 4MI6A 4Q37A 1YRYE 3TTTA 1L7MA 1COWD 3LYUA 4RQTA 5SY9A 3SIWA 4DQXA 3EPLA 2O5CA 2X8WA 1XCMA 3BWEA 3L1IA 2V8OA 3AHJA 3GRKA 4R2LA 4V24A 1DEHA 2R7LA 1SCNE 1JEYB 4DVJA 2YV3A 1CUVA 3CEAA 3V1NA 2XYHA 4FEEA 3NH6A 2XMPA 4HC4A 4J7UA 5A5EA 2JH8A 4KQIA 3OC6A 1KMMA 1QAOA 5CB4A 3JTEA 4ZRDA 4RMGA 2RKWA 5D3QA 5J47A 1UJ2A 3PHCA 1NHWA 3M49A 1O4VA 3LHKA 1E8DA 1MC1A 1UUFA 4GLJA 1ADJA 2WJ3A 3P0IA 1JHRA 4M1KA 2HQ1A 4UHKA 4B9EA 2JHFA 1Q84A 2QTLA 1DJLA 3BAZA 2W0MA 4AW9A 1JG3A 3CUTA 2Z6VA 4D42A 2G7ZA 5ALIA 1DQNA 2ZTHA 4FR2A 1UQRA 4HBGA 4KQCA 2FMTA 4ZQFA 1SUWA 4B5KA 5KVAA 1FLDA 4H7PA 5MN4A 1SUEA 3EBOA 2PMFA 4H3VA 1BS1A 4HP8A 4XJVA 2HXSA 3PNPA 3WS7A 4ASUD 2O7QA 4CEHB 1CY8A 3CLRC 1V7QA 2OC9A 3WZMA 2XCUA 2ZIUB 4MPRA 5EFZA 5GONB 4LHSA 4QECA 1S02A 4MGYR 1KA9H 3FRJA 5A2QA 1N33B 1WBBA 4PRLA 3R75A 4F4JA 1ZSNA 2C57A 4G0YA 2J0EA 1FFWA 3I92A 1D4AA 3BICA 3ROFA 2ZUEA 1YWGO 4X8LA 1DKLA 2ZSJA 1JAZA 2XITA 1EXNA 1BSVA 1SEPA 3B3AA 2CKMA 3QBJA 2CNKA 3I1FA 4K9DA 4B2PA 1J99A 2AZMA 5HRCA 4DCCA 1CY7A 1VG9B 1KPHA 2NO4A 3GOQA 3LK6A 3R5KA 2WAMA 4BN0A 3TTSA 1T6XA 2QIOA 2ZR7A 1JSCA 4EUNA 1FDSA 1P7PA 4HWPA 3W5UA 5I4CA 3EXHC 4GKVA 2D0OB 1G9TA 1PNVA 1N6NA 4ZJPA 2WWXA 2D54A 5JCXA 3GAFA 1JDSA 1GGVA 2GBLC 2ORWA 3DE3X 3QVOA 4JOBA 1XSEA 1ISMA 4AM8A 2P9BA 5DN9A 3ZOKA 2PGNA 1HG1A 1A9YA 1S2DA 1PEAA 4X65B 4ODIA 4FNOA 3VJKA 3O9MA 4MB0A 3GJRA 4MV6A 4TTJA 4D81A 5C9ZA 4UMFA 3MQ2A 3MAJA 1SOUA 5KS2A 1QVRA 3P5SA 3GPDG 2O8EA 5IAJA 1T36B 1GZ4A 3L49A 3QITA 5CB6A 5LYJA 4AF8A 2FSFA 3A1CA 3ANLA 4B0OA 3SFTA 4M55A 2NTJA 3BHMA 1N0UA 4M87A 5HK9A 4IDHA 1EG7A 4FJ1A 2O57A 3EQZA 3U40A 4F2WA 3RDPA 1J8VA 1RAIA 2ZSBA 5EJ7A 3QF4B 3IPLA 5BMOA 3K9CA 2RC6A 1MMFB 3OZXA 5A9TA 1KK3A 2A2ZA 1HO3A 4JKIA 3VUFA 2X4DA 4B8YA 4YAOA 4DLYA 4F46A 5MF6A 1AE1A 4B40A 2WE8A 4KXWA 1TEHA 3DE0X 4MW2A 4B7ZA 2X7XA 4MUYA 4BMPB 4D9EA 1DRJA 4M9RA 3QEJA 2HXYA 3AVXA 2F59A 1I2MA 2QX8A 1C9YA 1SQGA 4QJ3A 3UT6A 3FUCA 2ZYGA 3DMPA 4NAVA 3OFKA 1MAVA 4US1R 4G4IA 5FHRA 3NM5A 3RS4A 5CJ2A 5AWFC 1AA9A 4WQMA 4BMOB 3NNDA 2VXCA 4LJ9A 4Y30A 5B2ZA 2XCRB 2O4UX 4JI0B 2DUJA 5KJ1A 1WX1A 3LL7A 5E6SB 2NVUA 3WDLA 1USKA 4U0JA 3MTAA 1NUQA 3WGMA 2EC5A 5EIXA 1YBMA 2XQVA 4YUYA 2NMVA 3K9HA 4CZ2A 1UKZA 5EJ8A 3SVLA 1MTOA 1SBTA 5F23A 1XRPA 4AULA 4R81A 4FXOA 4S12A 5HILA 4TS4A 5IJ9A 2DC1A 3WYNA 3NEPX 2Q5LA 4DPMA 5C52B 2O07A 1I2BA 4TT8A 3QEBZ 3BTUA 4NMXB 2JJ1A 3PR3A 1NUPA 3ZNPA 1EZ1A 5IG2A 1PN3A 1HE2A 2ID4A 5FCDA 5JD6A 2L2QA 4DIUA 1K86A 1NVDA 2IZ7A 2QUAA 3DB2A 4E14A 1BCSA 3RC9A 3FAZA 1CY1A 2J0UA 3KT0A 3KG2A 1EP3B 3O31A 2SCUB 2VDRB 4EHKA 4FLMA 5I9MA 2W37A 2QUJA 1X7HA 3GUYA 3VU9B 2GZRA 3ZWAA 5CA0F 4DB4A 3JQ6A 3JWIA 2PGAA 1FQOA 4IQ8A 5IJWA 4RGQA 3GT7A 2QZJA 5TMDA 1XF1A 4LHZA 3CEJA 5KSWB 3MLEA 5LQAA 2X0NA 4Q1AA 2HN9A 4LY6A 4I2NA 5F64A 1JECA 3U6KA 3TS1A 1L7RA 2E9SA 3DP9A 3QX9A 3CT6A 2J3JA 1AB6A 3RJ9A 1XAGA 1YR3A 5BYAA 4IF6A 5DNEA 2AC7A 1PR0A 4EKGA 3VH1A 2QG6A 1P60A 3ZU4A 2QF7A 1VHQA 1CULC 2DFPA 3OM9A 4HUQA 3GCXA 4X1YA 1H2YA 1L7XA 4KO2S 5CM8B 3SN6A 3UJNA 4PEVA 2XWSA 3FPJA 4YYEA 4ENSA 4TLMB 3UHPA 3DW1X 1C8KA 3IUJA 4NMMA 1XQYA 4N7MA 1Q0HA 3CX3A 5JSYA 1KKMA 1EGMB 3C3YA 3KZKA 1Z6GA 4RS3A 4RVSA 3R76A 2VJKA 3TXYA 5AESA 4OF4A 3DWFA 4MYUA 5L6LB 4Q39A 5EHXA 2Z98A 1FLVA 1ST3A 3FMVA 3W6OA 5FOVA 2FPKA 1V9SA 2GM5A 3L6OO 3C3MA 3D7KA 3GJYA 4PYKA 1DBWA 2YICA 2GPBA 1XVTA 5ALDA 4RIHA 1EUDB 1FFHA 5J1TB 4FINA 1QHHB 1N5KA 2C29D 1G41A 4DIFA 4DLLA 4JLVA 2C31A 1ZHOA 2O48X 2IS1A 3EVZA 2EW8A 1RTTA 1MPXA 3UMVA 3ZYZA 1H2HA 1A9PA 5H5JA 1BWPA 3GJ8A 3O1HB 4G1FA 4WLNA 3X2SA 4B33A 2I7DA 3I9LA 3JZMA 5KMGA 4XR9A 2BTQB 1V3VA 4HQLA 2O2XA 5F1OA 4NESA 1JUDA 1HZZC 3RHZA 1FXWA 3B7PA 1JHAA 1M2WA 2DP4E 1T91A 3VFDA 5MGBA 3RG2A 2HB6A 1Z39A 3Q11A 2NV6A 5IC6A 3RROA 4KX5A 3EEIA 4XUCA 3ANYB 1I24A 5AFSA 3UJPA 4DIDA 4GXNA 4JXXA 1P9NA 1MC8A 5EIFA 1D8AA 2XMGA 1J0XO 1GRRA 1C7EA 2XUJA 4YV2A 5IWAB 4MVJM 3I12A 2Y0BA 3B1VA 4NYMQ 4OMUA 5LNK1 2OILA 1VLMA 1V8FA 1ZONA 2X7JA 4M3NA 5KYTA 1Z08A 3QLVC 4N7RA 1KTIA 4Q48A 4AX4A 2I34A 1WQ1R 4Q7KA 1Y8ZA 4ZRMA 2C8VA 1OROA 3VKHA 2GNOA 3SJUA 1YDMA 1T1EA 2AMVA 5J43A 4LIPD 3GRFA 3LCVB 3KWJA 4Q7QA 1HC7A 2ZBVA 3KXLA 3R3ZA 3V7YA 2DBVO 4FOPA 4D9MA 4B45A 1WKBA 2CDNA 4IIYA 3NP7A 4I8DA 3TXXA 2PZEA 4BKPA 4W5JA 1JLRA 4KU4A 4MQLA 1WXGA 3BXXA 1E9RA 1PYGA 3FLBA 2X3FA 3KCQA 3MELA 2X8LA 4M0FA 2J5QA 3PZBA 3AC0A 2HMAA 1PU2A 1RZRA 2XQIA 4MULA 3LOUA 1SVLA 3N87A 3PVZA 2JIPA 1U7WA 1G1AA 5HIIA 4YRAA 2VRNA 1A8HA 3B3QA 4KPUB 3BDIA 3SNHA 3LRXA 5AW5A 3LK7A 4QYIA 4CT4B 4CKEA 4DSOA 1NW5A 2H0AA 2ZYHA 3B36A 1E2JA 3H5RA 4GXTA 4UUMA 3LUCA 4IZ6A 3U7EB 3QEAZ 1XWFA 3ISVA 4QVIA 3ZLVA 1ZH6A 5EHGA 3WWOA 5HGXA 3LLSA 2BH2A 1FLAA 3R0JA 1KMCA 1F8XA 1LNSA 1WSDA 3G5TA 4J0QA 4NEQA 5ECYA 2QZPA 3O75A 2NU9A 5IAAA 1UOEA 4DMKA 3FOAA 2HWKA 5DW0A 4EG3A 3O4VA 1GNVA 1OILA 5ARCA 3OO0A 3CISA 4A3SA 1A5ZA 1BW9B 3DONA 3PE4A 1O0SA 3PNLA 2P3SA 1R10A 1L5WA 1KFKB 1OBCA 1R0LA 1JDVA 1T5BA 2GPYA 2QRJA 5HUHA 2R44A 2WWVD 1Z6AA 4JUAA 1VL1A 3ZYCA 3N8HA 1KI1A 1U2ZA 2O50A 1O9HA 1SXPA 1GGNA 3IHLA 1VTKA 1N2ZA 3FNQA 2GLXA 4Z8XA 7MHTA 2VK2A 4MRVA 3N6VA 3KPUA 1E3WB 1W96A 2R6HA 3MIZA 4YMVA 3UK7A 4LOIA 3ETJA 5I9BA 5BUSA 5DULA 1HFEL 4HAWA 2PBZA 2ASVA 1M73E 3L7DA 2XUGA 3NBYC 1GAWA 3NLLA 5KCZA 5CAEA 3PDJA 2NZXA 1CR6A 2O2DA 3AL2A 5JD4A 2RB4A 5LDHA 3RFCA 2HDNB 2I33A 3UY4A 4DV3B 2GHQA 1A97A 1YQDA 3B1ZA 1F7VA 2FWAA 1QH9A 2GM9A 1OLSA 3B5EA 4PAMA 3IOYA 3CN9A 2D62A 2F1OA 2PT5A 4AKGA 4TSKA 3T61A 4LA4A 3ACDA 4HLUA 3VV3A 4UTVA 3SDBA 3K35A 4C3OB 1YS2X 1YDWA 2P41A 3H8SA 2NPFA 2E87A 3GMSA 2RD2A 2HSDA 1X80B 3N86A 3NPAA 1V43A 3R0XA 5KYUB 3IKTA 1Z6XA 1G6HA 5JXWA 1P9OA 1S2IA 2JIRA 1E7RA 5J9FA 5JDCA 3O8OA 3P9ZA 3IE2A 4AU1A 1ORVA 2XHZA 2NSLA 2WQ7A 2ZVQX 1E1CA 1TJNA 5JYCA 5ED4A 3COWA 4R1TA 2OCXA 4QDXA 3R4CA 3RYTC 4KQJA 2HV9A 2BRUA 3HEMA 1L4MA 4RBNA 1VHDA 1IY9A 4PZ9A 2D7CA 5FTWA 3I4LA 3IGFA 2YC4C 4CR7A 1T1GA 4BCDA 5K3SA 1OLXB 4A6PA 1T9BA 2QZZA 4R8VA 2VQ6A 3WNDA 2VJYA 1PS0A 3TBFA 5L4NA 5CA1A 4ARUA 1T4GA 5AW2A 1O03A 3P52A 3I5AA 4IH4A 3SVTA 4GKKB 1JAYA 2BUAA 4IYJA 3CCCA 2XEDA 2ZANA 3H2YA 4U9HS 4LFCB 4PRZA 5LIRA 1G38A 2PZAA 1EVJA 5B57C 3BORA 1DT5A 4WZBE 5EQTA 4KQFA 1F8UA 3BQNB 2ZIGA 1KS9A 1EUCB 1UZUA 2WW8A 1R74A 5HGJA 4J2HA 2H18A 4CCWA 3C7DB 3H9UA 3HWRA 2CW5A 3T5GA 1LRLA 2Z0MA 1IAVA 4G8DA 4A92A 3E53A 4DNOA 4NZYA 4GPD1 3CRVA 3ZVKA 1V35A 3T4PA 4P2GA 3DMHA 4R5MA 2YWRA 4FLFA 4QLOA 4FK8A 5I7UA 2HRQA 1NSTA 2Q6VA 4O4LF 3O2JA 1MHTA 4MCHA 3PNMA 1IHXA 3OQIB 2WY2D 2FETA 4QGSA 3GWGA 2JIZD 1HZJA 4URZR 1C7QA 3FBWA 4X6YA 5IKXA 4BNHA 2IBTA 1X19A 1Z0DA 1OVMA 3E0QA 4B48A 5AICA 1FFEA 3N74A 1RPTA 2YDYA 3OZFA 1I2CA 2I6QA 3D4LA 2FWIA 1L4EA 1Y6RA 3H11A 4EPWA 3THWA 3MCVA 1ZH0A 4IJMA 5KNBD 3EFOA 2G9QA 1NW6A 3PUYA 2E5FA 4MVJF 3D1JA 4QWMA 4R31A 3CJRA 4IJKA 3T3MB 2COUA 2QV0A 1NGSA 3I9KA 2FPRA 1WUYA 3DTTA 4FMCB 2PIAA 4H0NA 4ZZ0A 4A15A 4I46A 3DP7A 4DLKA 4BECA 4RF4A 2HCRA 4R2XA 3SC3A 2CZGA 3DJYA 2L69A 1W4AA 1WO8A 1IUKA 2CWDA 3LXMA 1SBIA 1NQOA 4RNDB 4JJ4A 1T5IA 5D3ZA 3TQFA 4PO9A 4E5NA 2WFAA 4U7DA 1OPXA 1IYZA 1OI2A 4Q3KA 5EZYF 3QNWA 3UG7A 2PSSA 1GQOA 3WLKX 4TKVA 4CLOB 3JQDA 3LXRA 4P53A 4PXYA 2JFNA 2O3SA 4OHVA 1AK1A 4MW1A 3DFFA 4AS2A 3QM1A 3SLRA 4QICA 2AI3A 4L5AA 4G5RA 8ADHA 4B71A 1DKRA 1P0MA 5L3ZA 2QVLA 3H3JA 3S1AA 4HYQA 1CVIA 3ESYA 2IFTA 5GVRA 3U3OA 3V4OA 3BGWA 1VMAA 6NULA 2ZUFA 1EVQA 2YNMC 4IHKA 2NN3C 1EWYA 5F7OA 3GT4A 4ZEMA 3PD0A 4M86A 4YRCA 4NU0A 2IP4A 3ISTA 3WXMA 1AMUA 2OCPA 3UT5A 2C92A 2GSDA 1G16A 4R69A 1FTQA 3GD5A 2HUNA 1AXRA 4J9VA 4V1CA 5KNCA 2Z09A 3EXHA 2VDJA 1M5UA 1HEYA 5M34A 1W19A 3RAPR 1W8DA 1G8SA 4C2TA 4ZV7A 2EEZA 2GBLA 1ODJA 2B99A 5EXDA 3TD2A 4V2UA 2Q5FA 2Q1YA 3K0HA 2GM3A 4O2AF 1FUUA 3LY9A 3DMDA 1EUQA 5ABPA 5C1BA 5IUNC 3A2KA 1KO1A 1C2YA 1P72A 2Y2UA 3DBHB 3LPAA 2ZW9A 1AKRA 1POXA 2DH6A 3FVRA 2NU8B 3VBEA 4BX0A 4OHUA 2JPDA 4R9RA 2DT5A 5BSRA 1NTOA 5TRTA 3NKFA 3HBLA 4V0LA 2Y05A 4H77A 1IN7A 1JEQB 2DOKA 2GOYA 2XF2A 1IPHA 3IXQA 1N0WA 4FD3A 3MS4A 5FBLB 1HQYE 3NAZA 3FMIA 1M10A 3Q8XB 5MN5A 2QM7A 1ES9A 3E3LA 5AUOB 4K8OA 1QVAA 4H3HB 1DQYA 2GA9A 4ID9A 3U7JA 5THKA 2B1IA 3ZZTA 1DAMA 2BFCB 4QAQA 4WMLA 2IEBA 4DR3B 4CM3A 1IWOA 1HUQA 3RSLA 4HB2A 4RL6A 1FUIA 3QH4A 3WLPA 2Z2ZA 2DCMA 3ESBA 1TYZA 2WSBA 3Q41A 3BK7A 3N75A 4KMMA 5FBKA 2FSSA 3A3OA 1D2CA 1HTWA 3NETA 4MCIA 4EPYA 4RTKA 1TMYA 1PD0A 3SZLA 4IHJA 1TUEA 2VAPA 1CLEA 3V1TC 4ZMBA 1I7QB 2FLKA 1JR2A 1SUDA 4AJIA 1EX1A 3BHJA 3N0TA 4LMBA 4UJ5A 3VC3A 3FR7A 5CW2A 3II6X 3I3SR 4HL6A 3H1EA 3ZLUA 4U3JA 4D3SA 2YMQA 3I83A 1CX9B 1IATA 1P2DA 1GKUB 3GW8A 3MTDA 4LXUA 1NMXA 5EJ2A 4TVBA 3CH6A 3OQNA 2C99A 1GU7A 3EQ6A 3A1WA 3AETA 3DZIA 1GOTA 3E3MA 4H3KB 3S2IA 1RQXA 5AI0A 2GGSA 4LISA 5A3SA 4CDGA 2G0AA 5BN4A 5JQWA 4EEXA 3O9ZA 3H97A 5EQDA 1A9ZA 1IUOA 1Y3HA 1C7RA 1OFTA 4FFOA 2PS0A 4GPBA 1YQGA 4JAVC 3RYIB 1U6KA 3V33A 4F45A 5K0CA 4PO1A 4OAQA 2C5LA 3FSJX 4G1UC 5FBZA 4DTCA 4M1QA 2WD7A 5AHRA 4EA7A 3IR7A 4JVLA 1SUCA 4WGFA 3PXUA 1CR4A 1CZHA 3EASA 4Q00A 4XUEA 3DCYA 2IYXA 3A6KA 4CNBA 3M3PA 4LNUB 4P86A 1OZHA 2BCJQ 3MJRA 4AK9A 4GC5A 2C0QA 5CBPB 3IP7A 4HNQA 3KIPA 2H54A 2RGBA 2HREA 1PR9A 1CEQA 1E2MA 1BNCA 1UK7A 2PHZA 3F74A 3OCJA 4RHFA 4RULA 5B55A 2BTEA 2WYVA 1II9A 4KN6A 5LUBA 1E2DA 3GDFA 1IEVA 1SKYB 1P0CA 1RT9A 3DBOB 1R0XA 2BAGA 3G1UA 3PR1A 4KV9A 4MMYB 3SIRA 1VPWA 4BKMA 4E11A 2BI8A 1XJCA 3UXEA 3ZV4A 4UU1A 2G4LA 3HB4X 1WB4A 1X1EA 4WT7A 3PRHA 2KPOA 4HDNA 3WK9A 5F2NA 4I1PA 3NUQA 1KJQA 2Q0QA 2PLRA 1DEXA 4QYMA 4BO2A 4HX9A 1L4GA 4UQLA 4N40A 4QBKA 1X9HA 2BKLA 2PX3A 4FDAA 3P26A 1VCIA 2PEZA 5FP0A 1L8XA 2VHQA 3T9DA 1SBZA 3E9EA 3F8WA 1RIFA 5FNVB 2JJQA 1VJ5A 3NDPA 4LRUA 4HUTA 1BXRA 4P0PB 4Y2PA 1DPGA 3V2GA 5IBCA 5JANA 5LU9A 3ZGOA 4ZHSA 4KPGA 2P9TA 3CHYA 3WO1A 4OB6A 2VKQA 4DUPA 1O6FA 1VI5A 1D8TA 1C4KA 1WHTB 1WNTA 2HIHA 1YJCA 4V03A 3RS9A 4C7BA 4YMGA 2MSCB 2JASA 4N8EA 1Q6ZA 1LSJA 1XO1A 4EZBA 4HY3A 1QG4A 5EUCA 2ECFA 3OIYA 4RFSA 3RHSA 1Y6GA 4OM8A 4PR3A 1FYVA 1KAMA 2R00C 3AJ8A 4OPMA 1JALA 4Y9DA 4UNPA 1DQRA 3H0CA 2FZ5A 1JHXA 2TMKA 3AR5A 2AR0A 4NQRA 5JG7A 3S6JA 3TQCA 2NP6A 2EP7A 3WLHA 1C80A 3KJZA 4AJJA 1JI3A 4R3UC 2QD1A 3LWDA 4UNIA 2RK4A 3ZV3A 5ADVA 3TRJA 2Y77A 4YAUA 1BVUA 2IOYA 3IV9A 3D3KA 1KMNA 3M2TA 4MR9B 3SY8A 2GKGA 4FZ5A 2VYND 1DIGA 2CBXA 2CXUA 3LT5A 3P97A 1P9RA 1VM6A 2XB4A 5CD9A 5LMUB 2G1PA 1ID1A 2AK2A 4FWIB 2VK8A 1TUBA 1YCDA 1P7VA 1RYDA 4GEKA 4ROSA 4IJWA 4JP5A 2C7VA 2XLBA 2OT3B 1AF4A 3L4EA 1PYOA 1R0SA 2GEFA 1P4RA 1HY3A 2BBWA 2PZLA 2ZR9A 4M8KA 4MH0R 3W3AA 4REMA 1QCCA 2NO6A 1QHSA 4EY8A 1C0KA 5BXYA 4K88A 3C87A 1JU3A 2VRBA 2Q4BA 3OOSA 4JLMA 4YMUA 5AW8A 3IUPA 3UJ8A 2V7GA 3QLVA 4QX6A 2V9PA 4E08A 4HF7A 4HH1A 1XMXA 1WLYA 3ZDZB 4GF5A 3UV7A 4TWZA 1B43A 3SNKA 1R1DA 1TAQA 1P2VA 5IN4A 2AE2A 3FLEA 3NI2A 3RRYA 3N2KB 4N7JA 1E3TA 2I99A 4Z49A 4NABA 4YP6A 4LKOA 3TKAA 5JWOA 3ER9A 5AHXA 4J1TC 4MCJA 1XNGA 1X7XA 4ZVOA 3KU4A 4HAUA 4BFSA 4LJYA 4AWAA 3I9OA 4BMSA 2AOWA 5CIQA 3IMCA 3MG9A 5HZGA 2OHXA 1TQDA 3JX9A 2P6RA 3VTFA 4M8SA 4QTTB 1VIYA 3S7TA 1C81A 1VRWA 2HWXA 4MK4A 2QVXX 3AOEC 1HQCA 1C9DB 3AHGA 3GGDA 4UCXA 3RK0A 2Y67A 1KXZA 1NI4B 4MQFB 3DH0A 3ZHOA 1FZTA 2CLSA 3DMYA 1A0OA 1ZBQA 3ETEA 2BSXA 3L4BA 3BDVA 4G5GA 4DJ5X 4PZEA 621PA 4L22A 1HFWA 2ZK7A 4ZOLB 2OK8A 3SDSA 1X7ZA 1OH6A 4RHUA 3VVCA 2W6JD 5IDWA 1MDBA 3I2GA 4KK3A 4RKEA 3BRCA 3GNSA 1U0TA 3ZX4A 1AGNA 2GZHA 1IMJA 1GZ5A 2GN2A 3BSYA 3I2KA 1NBHA 4HSGA 3OQOA 2YFKA 1AKQA 2OG1A 3K5PA 5FTNA 3R3JA 2R68A 5AQ1A 2B4QA 3ESCA 4QEZA 4CKWB 2G77B 1F2DA 1RCFA 1TQ8A 3NTLA 2A7XA 4RMH