4DRZA

Crystal structure of human rab14
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
160
Chain Sequence
b'YNYSYIFKYIIIGDMGVGKSCLLHQFTEKKCPHTIGVEFGTRIIEVSGQKIKLQIWDTAAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-14
publication title Crystal structure of human RAB14
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 54
structure length 160
sequence length 170
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4drzA01
4RCYA 5KDOA 2QBYA 1YRBA 1FPMA 4M1KA 1ZNZA 2VSOA 3GLHA 1BIFA 3LLUA 1XPRA 2ZE8A 4MKGA 5HTKA 1MO4A 4PQYA 2G3YA 1P2VA 4KODA 2BV3A 4I1OA 1NG1A 1X8JA 2F1JA 2WOJA 2XOKD 5C4MA 1BMFD 4D4KA 2GNOA 1E2QA 3MUFA 3OAAD 1WBDA 1F2TA 1ZW6A 2CLDX 4F91B 1Z5ZA 2YOFA 2W58A 1T4GA 2CLCX 5B2ZA 4V0ME 1VIYA 1SXJB 1A5TA 3FPAA 1MO6A 4CW7A 2WAXA 4N0DA 5E95A 4K46A 1FNMA 3CWZA 4KSCA 3PITA 4LBVA 2G88A 1G5TA 3FKQA 5GJCA 4A2QA 5CYOA 3ND8A 5AJVB 5J4LA 3KQKA 1YR6A 4TT3D 4E09A 5CIWA 4Q7LA 2G1JA 3SFZA 2XTMA 4TQUS 5CK4A 1VTKA 2FEMA 3B1ZA 4P33A 1GM5A 2P67A 3HPRA 1X1SA 4O25A 1R10A 3Q5EA 4URYR 1SXJA 3GFOA 4MITA 4QJ4A 1NVVQ 2H16A 3A1UA 5TV2A 5C2JB 5HPYB 1XTIA 1UBCA 4HI0E 4ASUA 4NYIR 2DFKB 2AXPA 4BZPA 4DHEA 2VF8A 3PUWA 1GL9B 2QPAA 3AVTA 2ZRJA 1VDZA 1ESNA 1ZNYA 3BRWD 3V00A 2WWYA 4DUGA 2IWRA 4NTZA 2FJUA 5E7JA 2ZM5A 1T5IA 1JQLB 2RGEA 4G5SA 4CRWB 3P4YA 1GKUB 4Q1AA 1KI1A 1US8B 1HT1E 4A36A 4UXHA 4A0GA 1M34E 1G9XA 1M2OB 5UKDA 2GK7A 4Q9JA 1QVRA 1A82A 3ONWA 4JBWA 4RZ3A 3TAUA 2VHQA 4GP6A 3K70B 4LC1A 1XJCA 2GJKA 1DAIA 1VYTA 4EPTA 2C03A 3P1JA 2GDJA 4UJ3A 2ZUBA 2YC4C 4PZLA 5EP3A 4X8MA 2B7BA 4DLTA 1KI6B 4QBHA 2CVHA 3BAFA 1M7BA 1US8A 2FG5A 1AS0A 4TMKA 4MRVA 4EPWA 2JGNA 2BMDA 4PANA 4BZQA 1IN4A 3MWYW 1LVGA 2B92A 3C8UA 4OBEA 1GNQA 2CHQA 2AFIE 3TGPA 3A1SA 1O87A 3UPUA 3GJ8A 4R9UC 5KSYA 1R6BX 4FMCB 4U5XA 4DCNA 4HSEA 2YHSA 1Z6TA 4IEIA 1KI6A 1U8AA 1NJFA 2IS4A 1KOFA 4IOMA 5JEDA 3KTAB 5L3SB 2RGNC 1VHTA 3GJ5A 3BFXA 1OKKD 3OEEA 1NBME 1N0WA 2BJVA 2K5UA 4JLJA 2KB0A 2H57A 2NO7A 2OCPA 2WJVA 3W34A 4H9GA 4GZLA 2QMEA 3DZDA 4I1UA 4NCNA 3RHFA 2RAPA 2G83A 2IBMA 1J90A 2PZGA 3LO5A 1YJ5A 3F5FA 4OQNA 2H5EA 4ZCMA 1SULA 5SZJA 4LWZA 5DSZA 3KTAA 5L3SA 3ADCA 4Z54A 2ZRFA 1G20E 2Q9CA 4LPKA 1EG7A 1A2KC 1HE8B 1W36C 4A9AA 1HV8A 2Z43A 4OYHA 5HE9A 2A30A 1E9AA 5E7MA 3GLIB 3B5JA 3SJZA 4AG6A 3BK7A 2BVNA 1Z8FA 3BOSA 2IYXA 4TQAA 4KI0A 4DDUA 3AVQA 2O8CB 1Z29A 2ZEJA 1EFHA 4LCBA 4RKFA 2WHXA 2ZRAA 3I73A 1YRAA 1W44A 5C46F 4GOJA 2LKDA 1CKEA 4Q4AB 4Q4JB 4DEYA 1Z3IX 3THXB 1Z0FA 3BH7A 2Z4SA 4FCVA 2CXXA 4O2LA 3N5CA 1P9RA 4L9SA 4IKEA 1HY3A 1OH8A 1Z47A 1G8GA 4PO1A 2O5VA 4Z1MD 2BCGY 2YWGA 1E2FA 3GLIA 2WPDD 4HAWA 3SQWA 2IYWA 2XAUA 1DADA 1IAQA 3IHLA 3QKSB 4DZZA 3IDQA 2Z4RA 4Q7KA 1CR2A 2BM0A 2O8CA 4IDHA 4LV6A 2CL7X 1PLLA 3WNCA 1CP2A 4UQOA 4Q4JA 4Q4AA 3K1JA 2QAGC 3THXA 1QHHB 2QY9A 2C5LA 3E1SA 2QA5A 4OI1A 4TYNA 3OEHA 4JT4A 1EXMA 3T34A 5DLQC 5JSZB 2ZREA 4JVSB 1WDTA 1L8QA 1P62B 2R6CA 1G8YA 2VP9A 3ZDQA 3U7FB 5JWOA 1T0JB 4NYMQ 3BH6A 4QHTA 1E96A 4FMCF 4JLNA 3THWB 3QKSA 3PUYA 3C16C 4PC3A 1HYQA 2F43B 3GJXC 3M0EA 2UKDA 1OYYA 4TMWA 2ZRCA 2GBLC 1R8SA 4JLMA 3LXRA 4BWYA 5BN3A 4US2R 1DAKA 3EX7C 2QQEA 2QRZA 4JL6A 5FH9A 3ZVMA 2VP6A 2ZRKA 4Y0AA 2FFAA 2C96A 2OLJA 3QPUA 2EFCB 1G6HA 2EYUA 5AJYA 4CT4B 2FSIA 2N1BA 3LW8A 4BEJA 1GNPA 3A4NA 4JLKA 1MABB 8OHMA 3CZPA 3LY5A 4Q1FA 3THWA 5JCPA 4EFNA 1U8ZA 5KYKA 1FQJA 2ASEA 2V1XA 5C4GB 2F43A 1IJFA 4NKRA 3VR4A 3D8BA 4OQLA 3L0IB 2QM7A 1SVKA 3TUJC 4WXPA 1KY2A 1YZKA 1Q1QA 3Q72A 4NP6A 1VCOA 2AL7A 3ECCA 5G40A 1J8YF 1KI8A 2ZRPA 3X1WA 1AGPA 4C0QC 1NRJB 1IN7A 4BFYA 1C9KA 1E2NA 3GJ6A 1BKDR 4ON9A 3S1AB 3TSZA 3EWSA 1N6KA 4RZXA 1W2GA 1MABA 4FCTA 4XSHA 3L0SA 1XRJA 4JS0A 3B85A 3EZ7A 3I5YA 2OESA 2HCJB 3NBYC 3LA6A 5EE3A 4YMTA 2FOLA 1G18A 2DWQA 3ZZUA 4DKXA 3QKRB 2WIBA 3UWKA 2YV5A 3OE7A 1D9ZA 3QY0A 3ADBA 1QG2A 1AZSC 1E1QD 2J87A 2IL1A 2X77A 1PUJA 2X2EA 1LNZA 4KFRA 5FPKA 4PQFA 1G8PA 2IYUA 4AKGA 1W46A 4B6EA 2ZE5A 1N2CE 4LRWA 2KWIA 3S1AA 4ESVA 1I2MA 1CIPA 1S2MA 4B3GA 3GLGB 1QHIA 2RGNA 2ODBA 4P3YA 4QGHA 1SVLA 3AF1A 1YVDA 4Q1EA 3MGCA 4ARZB 3EW9A 3QKRA 2PH1A 1OIXA 4HDCA 4Q02A 4X8LA 4C0AC 2GZHA 1GRRA 4M1OA 2FGKA 3A4MA 3BD9A 3LVRE 5HKKA 2IYSA 3AH8A 2W6JD 3QG5A 4YXWD 4A2PA 1AS3A 1U94A 4LK2A 3MLEA 2J7KA 4M9SA 1GP2A 3CNLA 4BLQA 3VAAA 3SBDA 3PJRA 2E9SA 2R2AA 3T1TA 3RANA 1SVWA 5EUQB 3BFKA 2WSSD 4MRRA 3DOEA 1R4AA 4NDZA 1MV5A 3RS5A 4ARZA 4XWAA 4A92A 4BLPA 3AP3A 3TK1A 1GRNA 2XNSA 1A7JA 4KFTA 3ETLA 4KU4A 2JAQA 1JAHA 1JPJA 4GOKA 2WKRA 1I4LD 3CRW1 1N0UA 1TADA 4D26A 1AJEA 1EFTA 3FHCB 5L3QB 4DSNA 4Q4HB 3GJ3A 4GT1A 3QBVA 3EASA 1M1YE 3LXXA 1KO4A 2IA5A 4UNSA 1JNYA 4KFUA 1G41A 2ZI3A 3W3AA 2IYQA 3HYRA 4POAA 2YC2C 4QBIA 2WJYA 5JCZA 1XPUA 1EESA 2OFWA 4XSGA 3W5JA 3ASZA 1HEIA 1TUEA 3SJBA 3D7MA 3AF4A 4TN1A 1OXUA 2QE7A 2JLXA 2OBNA 2PCJA 1WB9A 4HAXA 3VR3A 4BRWA 4TL9A 3UMSA 3P4XA 4W5HA 5L3QA 2F3TA 1KJYA 4Q4HA 1OSNA 1OHHA 3W6OA 3CKLA 3SDZA 2GZDA 4PAQA 2QAGA 5EXTA 2GK6A 1L2TA 2KBEA 3KKQA 3G5UA 4HLDA 4WAUA 4MH0R 1MRNA 2VH5R 4XTCS 5KDLA 4D0NA 4LJ4A 4LX0A 1Z07A 1VYVA 1V43A 3FB4A 1S0UA 5FUYA 4Q9IA 1M7HA 3LV8A 2OXRA 5DH9A 2XNDA 2X2FA 1RRGA 4HZUB 2OO7A 2VYFA 1E3MA 2WKQA 3ZIAD 3CR8A 2ZXUA 3GEIA 2OCYC 2NO6A 3R20A 2WSMA 5JHGB 1HTWA 4PPQA 2IS2A 1E9CA 2C2HA 4QGFA 4EJSC 1YZNA 1PLKA 5B58C 3JZMA 1EFRA 3GQBA 3B60A 2XGJA 2ZUDA 5JZVA 5IDVA 3VU9B 1I2DA 1W0KA 1W0JD 3K9HA 3MMPA 3O8CA 3CRMA 3KFXA 1GDDA 1N5KA 4HZUA 1DOAA 3NBZC 3CX8A 4D4MA 4BFZA 4DSOA 4GMXA 1QVAA 1G3MA 3NH9A 2VO1A 3W8RA 1XNJA 3VX4A 2RKOA 1KNQA 2QMHA 4RFSB 4URWR 4D6PA 1IQPA 4IXMA 4F93B 1NP6A 1ZU4A 4NYJQ 3VU9A 4OHXA 4Z51A 1KI4A 2IS6A 1W2HA 1X3SA 5EJEA 1JR6A 2OHFA 4R98A 1DG3A 2J3EA 121PA 3RS4A 3Q7QA 3W3ZB 1NN1A 1TPZA 2V54A 3SHWA 5K8LA 3KB2A 1VG9B 3KDSE 1T91A 2JCSA 3KZ1E 4HB3A 3CIOA 1EFUA 2WWHA 3X1ZA 2X19A 6Q21A 4GRAA 4RFSA 4R2HA 2O52A 4V0OA 1WRBA 4F38A 2Q21A 4LYHA 4XIGS 1Z0AA 5A4JA 4HAVA 2IYZA 3AF2A 1T3HA 3C5CA 1ELOA 5TMPA 1E9FA 4CGZA 4G5OA 1Q22A 3OIUA 4IJMA 3SN6A 4ZDKA 1G4UR 4ZI2A 1FZQA 4CEHB 4RVCA 3EAQA 3KQUA 1ZM3A 5EP4A 4YONB 3W6PA 1OB5A 1D5CA 4QHSA 5BYJA 1S1CA 1KI2A 1GKIA 2VEDA 3C15C 3MD0A 3PVSA 2O8EB 1OFHA 1SVSA 2R65A 2PEZA 2P6NA 2LCFA 2E87A 1JR3A 4GSYA 1K5GA 1SXJC 2F1RA 3H2YA 2IEZA 1N6OA 2PJZA 2XSZA 2MMCA 4CEHA 3BFVA 5FTKA 1AIPA 3W5IA 4XWOA 5JBQA 3TKLA 4C9BA 1SXJD 5D3QA 1VYUA 2ZJYA 3CX6A 3EZ6A 1MO3A 2WJJA 3GCGA 4ZI3A 4ASUD 2FX3A 4K8OA 4S2EA 1UKVY 2O8EA 1A4RA 3O47A 2DYKA 1ZBDA 4CDGA 1NMYA 1JEDA 1SVOA 1ZJ6A 2BWJA 2GJ8A 3CZQA 5FBLB 2VSFA 4B74A 3REFA 1NMZA 3N70A 5DHAA 4DUGD 5FBQB 4OI0A 3T1QA 4OK6A 3NXSA 2SHKA 4BRUA 1Q1ZA 2GWHA 4LYAA 4B3BA 3U5ZB 2AXNA 5JS8A 3WYFA 2YINC 2ZVQX 3KUCA 5ELXA 4C2TA 3GLFA 2OEPA 4ERNA 1XEWX 5H1YA 1XCPA 4QG7A 3U7HB 1KDTA 3QF7A 1NN3A 3I92A 3EZFA 3FWYA 1PZNA 1HQCA 4OQXA 3UATA 1ZAKA 3VTKA 2HV8A 3I5XA 2WWFA 4XVUA 2Z83A 1XF9A 5CM8B 2PLRA 2VHJA 2OBMA 2ZJ2A 4GNKA 2P3SA 2FSGA 4NMMA 4F7WA 3TAHA 4MGKR 4U02A 1EWQA 5J4KA 1CJMA 1UFQA 2RGCA 4EJSB 1WP9A 2IF0A 3GJ0A 4YMWA 4EQ6B 2HJGA 3ZZ0A 4WZBE 1KSGA 3F3YA 3SJAA 4MKHA 5AJXA 4JMPA 4EUNA 5FPSA 4RD2A 5J47A 3EPLA 1Z6XA 2YWHA 4H1VA 3K70D 4HAUA 3H1TA 4P0TA 2Q0HA 2WICA 3DO6A 2O0HA 5KSOA 1BYIA 1F5NA 4Y0VA 4V0KA 1ODFA 1Z0JA 1VMAA 1G5PA 4XD7A 4CT5A 4DCSA 1FMJA 4RFVA 4BFSA 3QSYA 4M2LA 1NSTA 3PG5A 4EJSA 3DMNA 2D06A 4QNMA 3EA0A 3A6PC 3OEED 4B33A 3AVUA 2NMVA 4RD6A 2RHDA 2O8BB 1QRAA 2H18A 2Q9AA 2V7QA 3K8YA 2GRJA 4IVQA 2NTYC 2ZI9A 2FSFA 3BWDD 2WBLC 2C9YA 1E9SA 2XXAB 2ORIA 5EXPA 1QHSA 4IVRA 1P60A 4MGZR 4UNRA 3R8CA 3U2QA 3BJIC 4AK9A 3TW8B 4BPBA 5HCNA 1I4DD 1G3UA 2CCKA 4L8GA 4JLOA 4EKDA 1FQKA 5CIQA 4QL3A 1EX6A 2O8BA 1XEWY 5CJPA 4TLCA 4IHQA 4MGYR 2OSBA 3IIMA 2BMEA 1Z6YA 3V9PA 2XXAA 1L4UA 3CO5A 3QEOA 1HURA 2V3CC 1G3QA 4BFTA 2MMGA 2GJAA 5GJBA 5L3RA 4I1SA 5IRCD 1P2SA 4RD4A 4GDFA 4KLNA 3OFNA 2V55B 1JXOA 3EIEA 3UMFA 3DZ8A 5AJWA 3IPYA 5FBRB 3TMKA 1D2EA 3R7WB 1FOEB 3HR8A 4IVPA 5F9FA 2BKUA 2EFHB 4L5BA 1ZNWA 1JI0A 3IBGA 3KXLA 4Q21A 1E0KA 4AC9A 5SZIA 4KYIB 4NL4H 3QF4B 5TDHA 3G82C 1B0UA 2YJTD 1DPFA 3KJIA 4PO9A 1ZCAA 4DB4A 1PV4A 4DLSA 1NIPA 4BQSA 4IFBA 1Z83A 5L3VA 4IDOA 2QM8A 1ZMXA 4TMTA 1G1MA 4Q19A 2KJQA 2CE2X 4LV8B 3L43A 4CVNA 1S9HA 3MCAA 3OEHD 5DISB 1XFAA 3HWSA 521PA 4FN5A 1R0XA 4RD0A 4I1VA 1UEJA 5FI1B 4B2LA 3HDTA 3TLXA 4BECA 4US0R 1E79A 1CR1A 3TSWA 4QC2A 1E99A 2CK3A 3CM0A 1OXSC 4DXAA 2YOHA 4ACAA 1E94E 2AFHE 2UZIR 3C7KA 1QDEA 4LJ6A 3QF4A 4PPNA 2VP5A 2Q9BA 3QOFA 3BORA 3AKCA 1J7KA 1FP6A 2V9PA 2Q3HA 4V0MA 2ZRNA 2ZITA 4BEBA 3GFTA 3KUDA 4Q01A 4UXIA 5J5CA 3EZ9A 2QSZA 2REBA 2ZJOA 4M4SA 4M53A 4RD1A 2J59A 3AQ4A 1XBTA 3G0HA 3CLVA 3CX7A 1HE1C 3WXMA 4C3ZA 1AKYA 4B43A 2FE4A 1NL3A 1BS1A 1E4YA 2H1LA 4TSFA 5AK0A 4KBGA 3PEUA 3LW7A 621PA 4G0NA 1AZTA 2B7CA 3MG9A 2AWNA 3H0KA 2QP9X 3FDIA 3SNHA 3RVBA 1G291 4AKHA 3A1VA 4P4UA 4HUQB 2OXCA 3U3JA 3CR7A 4EFLA 3T35A 3U4QB 2QTVB 3LAWA 2ORWA 2KI5A 4P31A 1U8YA 1Y63A 1Z28A 3IO5A 3LNCA 3BS4A 3CONA 4IDNA 1EGAA 4WXRA 1S3SA 1N6RA 2NZJA 3UKDA 3LLMA 4C4PA 3C14C 1N0VC 2OAP1 1AM4D 4DVGA 3R9IA 2J9RA 5JLJA 4QFMA 1Q57A 2WWGA 2C9OA 2EWVA 3EZ2A 4OI4A 3VR1A 2WWXA 2ZAOA 4ZDWA 4D82A 3OE7D 4YMSA 2JLQA 2FPMA 1Z08A 2C95A 4HUQA 4L4UA 3U4QA 2JLWA 5KDDA 1TU4A 4TYQA 1N6LA 1CLUA 1TQ6A 2FZLA 5CDFE 1KNXA 2HT1A 1SKYB 1JXMA 1Z6AA 2DPXA 2ZYTX 3L0PA 3NKVA 1BOFA 4LI0A 3NEYA 1XB2A 4GL2A 1U0JA 2J0SA 3RS3A 1EX7A 3ADDA 4LBWA 4ZDIA 4Q48A 4UNNA 2CEAA 5JHHB 4NCHA 3ZVRA 1CULC 4AKEA 2YYZA 3BGWA 2QG6A 5FUWA 3SZRA 4CYMA 5HKKD 3UIEA 4Q9HA 1T6NA 3PUZA 4G5RA 5AUQA 3UXMA 3VMFA 4LHVA 1VCNA 1NLFA 4URXR 1HT2E 3RSLA 2H8KA 1SZPA 2FFBA 2QAJA 4JVMA 4MKFA 1G3RA 3L8YA 4W5JA 2WMOB 3D3QA 4DSTA 3U3MA 1BH2A 4ESHA 4DCTA 1WXQA 1W36D 4BFUA 2ZRMA 5G41A 4Q1CA 1RE0A 5BWMA 1AQYA 4WW0A 1J2JA 1W4CA 4B6FA 5EE0A 1Q44A 1S8FA 3IIKA 1NBMA 4IRUB 2ZYVX 3MWLA 4XH9B 3AB3A 1KIMA 4A0RA 4C0JA 3FHTA 2B21A 4HB0A 1G7RA 5FOVA 1UKYA 2QGNA 2WV9A 4N1AA 2QROA 4IDQA 4C0SA 5JS7A 1Q21A 1TUIA 4PHTA 2D2FA 2OLKA 5E4FA 1MKYA 3VR5A 1KI9A 1GITA 2WWWA 1P2TA 3AP2A 3JVVA 3LRPA 5KNBA 3WNBA 1S1MA 1MRSA 3AP1A 5F9HA 4YMVA 1PJRA 5J4HA 2W83A 4MGIR 1E2HA 5JI2E 2RH5A 2ZYWX 3FKSA 2ZJAA 4NCKA 2DCUA 4M9QA 4LSGA 1KDRA 1P73A 4B3CA 1SHZA 3F8TA 4A15A 4Z8XA 2ZI7A 3NC0C 2QE7D 4B47A 4QGGA 4TZ6A 1KK2A 2ODWA 2WJHA 3SE0A 5G3ZA 2WTUA 1KY3A 1D2NA 1NKTA 4AY2A 1KGDA 5IK2A 1E9BA 1OFUX 1OHHD 2REOA 1NN0A 1TNDA 4GFDA 1E98A 2DWOA 4F4CA 1E2LA 1XXHE 4B32A 3BERA 2C04A 1ONBA 1VECA 2DFNA 5GJVC 1EWRA 3LBIA 1FFHA 5JECA 2HXSA 2XNDD 2ZIAA 4YLGA 2P65A 1ZC3A 1N5JA 3BIFA 2AKAB 1GOTA 2ZI4A 3ZQJA 4DIEA 1N5LA 1QHHA 5DYGA 3HU1A 1DAMA 1W1WA 1ZM2A 3K0AB 1UADA 2EQBA 5FR2A 3MAAC 4HZIA 4KV9A 4DLYA 5DN6A 1PVOA 4FMBB 2HT6A 4JVLA 3LX5A 1EFRD 2N42A 2D62A 4PC1A 5JSZA 4S35A 2ERXA 1JALA 1UM8A 4UKDA 4URVR 3BB3A 5BN5A 3QE0A 4IDPA 1MR3F 4XVRA 3FTQA 4B35A 4B75A 3B2EA 4RJLA 2QTHA 2VP2A 3K0AA 3CPEA 2J41A 2H7VA 5CB8A 5J40A 5HCIA 1W7AA 3RNLA 2FH5B 3LD9A 3AVOA 5FFMA 4NU0A 1AGRA 1TMKA 1Z6GA 2XB4A 4F4JA 1SGWA 4FWIB 1UEIA 4QBGB 4NCIA 4RY2A 1KMQA 2LWIA 1U0LA 2IWHA 1Z0KA 2NPFA 1YZGA 1ZVQA 1D6JA 4IOLA 3U3KA 2IK8A 3KKMA 2NPIA 3LH5A 1G21E 3VHXA 1YQTA 2BEKA 1W49A 3REGA 1G4AE 2JJ8A 1WE2A 3PR1A 2XJ4A 1U0HC 4HLCA 1E4VA 2QMOA 1DTSA 1RYFA 1R8QA 2QN6A 3NDPA 1NIJA 5EE9A 3BB4A 2NOAA 1OH5A 1WF3A 2ATVA 3VNVA 1T8TA 2GJSA 3RDPA 2VPPA 4V03A 2FWRA 2F7SA 3KX2A 1FNNA 2IF2A 1D2MA 2DY1A 1OJLA 3SYLA 4DCVA 3EC1A 2QT0A 2RGBA 3AEZA 4KCGA 4RD3A 2ZSEA 2FV8A 3PQCA 5HZKA 4YC7A 3SS8A 5J4YA 3LFUA 4C0KA 1OKKA 2MSDB 4BFWA 2IC5A 1N6HA 4E5UA 1JR3D 2B8TA 1ZUHA 4LC0A 3RRYA 4HB4A 2PBRA 4MA4A 2QPTA 3QJYA 3GLGA 5C18A 2AKYA 2RMKA 4V0NA 2GXAA 2PX0A 5LB2A 4OJKA 2XSZD 5G53C 2FPLA 2WOOA 1TQDA 4OQMA 1ZRHA 1LS1A 3JZAA 2ZTSA 1P75A 1RRCA 4LDJA 1ZD1A 2FSHA 2QZ4A 4JL5A 3ZJYA 3P20A 2CL6X 2IEYA 3ZS8A 4JSTA 1NN5A 5GJWC 3MWJA 5LB4A 2J7PA 3ZH9B 4C7OB 1COWA 5M04A 2F3RA 5FL7D 3QXSA 3TW4A 4AG5A 1FW6A 1XD8A 1P3JA 4W7SA 3NHBA 4LV5B 1UKZA 5JWRA 4KJZA 4WIAA 4RCZA 3VFDA 1SKQA 4ABYA 3TVDA 2GETA 3ND9A 1U2RA 2AK3A 3SOPA 2W2VA 3T12A 3NWJA 5IF9A 4FWTA 2CJWB 2GCOB 1L4YA 4M1MA 3UANA 2VP0A 4OHYA 1FMLA 1KZ7B 1NLZA 1RW4A 3DL0A 4B44A 1CJKC 3CNOA 4ITRC 3Q8XB 4RSGA 1II9A 1XMVA 4RZUA 5KNDA 1GL6A 2JATA 3RS0A 3QKTA 2DB3A 4QJ5A 1U90A 2QEQA 2ZI6A 1P6XA 4IEEA 1NI3A 3IKJA 1RRPA 2W0MA 4C7OA 1A2BA 3TR0A 1ZD8A 1CBUA 1E2EA 1JB1A 4D2IA 1IJEA 5FTLA 2AWOA 4QOSA 3FYHA 4C0BA 1FL9A 2XJ9A 1E6CA 2QENA 2XEXA 3R9WA 2RHMA 4Z1MA 2ZRHA 4PHFA 3UK6A 4TLEA 1UBGA 1DE0A 1G19A 2CJWA 2GCOA 2PMKA 1P61B 4PHGA 1VG0B 3DHWC 2OAQ1 2VLIA 4MUAA 1T3SA 3FMFA 2HF9A 2JLSA 1ZD9A 3X1DA 5LD2C 4ILEA 1LFDB 3U6KA 1UJ2A 4CIDA 4WZ6A 4QRHA 4BLSA 2NO1A 1OIVA 2GVDC 5JEEA 2C99A 4ACBA 4A2WA 2Q6TA 1BYUA 1QHYA 3K09C 4CF7A 2QP3A 1GSIA 2I3BA 3IBYA 1E69A 1DVRA 3I8XA 2HLDD 2CNWA 4L9WA 3WHKA 1TQ2A 4MQBA 2P5TB 5FOXA 5EZ5A 3QXHA 4CZ2A 3B7GA 4NONA 4TLAA 2W00A 2YWFA 3AVXA 2R6DA 1E9RA 1CEEA 2QU8A 4UNPA 2J5XA 4PSVA 3FMPB 1DELA 2AD5A 3M6AA 4Q7MB 3U3OA 2I4IA 4KHZA 1YR7A 2PLFA 4JLBA 5KUTA 4DLVA 4ZPXA 2GEDA 3JVUA 3T5GA 3LBHA 2VA8A 3QNUA 2V7QD 2FU5C 1EFCA 1WA5A 3MJHA 4MYHA 4EFMA 2RGDA 1XZQA 1UKEA 5FTJA 4PC7A 3FHOA 3PXGA 4PAMA 4DC9A 5FPHA 2PX3A 1UBEA 1N6PA 4Q4LA 3X1XA 1MO5A 2GEUA 2VTKA 1OT3A 1XMIA 3KL4A 3W9YA 3ZGXA 1UPTA 5EE5B 3EWAA 2D7CA 3BBPA 1U98A 3IO3A 4B71A 1DO0A 1UDWA 5CLLA 2C8VA 3U60B 4DDTA 1Z0IA 4F92B 2PJRA 3THOA 4HB2A 4URZR 1XDBA 1W4BA 2NO9A 3LVQE 2R8RA 3C41J 3QBTA 1OLOA 1R7RA 1QBKC 4AIIA 4TQ9A 4Q9LA 2ZAMA 5JJLA 2BEJA 2GCPA 4ZCIA 3SBEA 1G16A 2FFHA 1JR3E 5EXSA 2XX3A 1WCV1 2GVZC 1JQJC 3K53A 1LS6A 4LHZA 1NSFA 2NZ8A 1D9XA 3AKDA 4MYCA 3WP0A 3K0SA 1ZUNB 4I4LA 3TE6A 2G77B 3FFBA 5FPYA 3OFND 1GRQA 3T06B 3ZLJA 2ZR0A 3HPQA 2AD1A 3R8FA 4PFSA 2I1QA 4GPTA 2GILA 1LW7A 4C0LA 3IIJA 2XZPA 2ZRDA 4CEJB 4OHVA 3QVUA 1XP8A 1G5RA 1Z22A 4HYYA 3W90A 3AVYA 2ZRGA 2VL7A 4JJZA 4LHXA 4RKEA 2HEIA 1U99A 3DM5A 3X1YA 1XEFA 5LPNA 1JJVA 1OPXA 1FX0B 1Z0DA 1CXZA 1VCIA 2HYIC 5A0FA 3DOFA 4TL6A 4EAQA 5KU1A 3EIQA 5KPJA 2CVFA 2QPOA 3WY9A 1Z06A 2EWWA 4A0HA 4LJ5A 2D3WA 2ZU0C 1YZLA 2VSXA 2WAYA 4NPHA 1GAJA 3RSOA 3AKYA 4AYWA 1DAGA 2CK3D 3KJEA 3WBJA 1YR9A 2VQSA 4CEJA 1D8TA 3GLFE 2OG2A 3I72A 1CU1A 1DS6A 2BJWA 4G3XA 1M7GA 5FPTA 3OIVA 4XWKA 2J46A 2WSSA 3IILA 2QP4A 3CRVA 1FX0A 3A1WA 4B76A 4WBSA 3PCRB 1N6IA 1YKSA 2GZAA 4Q1BA 4EIWA 5JI3E 3QIAA 2ZPTX 4A6PA 5BYKA 3AVWA 4BFVA 4PHHA 3TRFA 4BLTA 2IXGA 3U7GA 1E0AA 3CH4B 4DLZA 1DAEA 2QTFA 4IOKA 4KO8A 5F3WB 2HUPA 3B1WA 4TSFD 4LJ9A 4OL0A 3K9NA 1YZUA 3HR7A 1XU4A 3SC3A 4M1WA 1E32A 1ZM4A 3O8DA 4IOJA 5LD2B 2E1RA 3ZD6A 2OFXA 4HLQB 3SEAA 2IUSA 3Q5DA 2OM2A 2FZ4A 2JJ1A 2EVWX 2O0JA 2ZETA 2ODNA 5SZKB 3B13B 1H65A 3ICEA 1KHTA 3X2SA 1IBRA 1RVDA 4PTLA 2AX4A 2JJ2A 3ZS9A 4PX9A 1G8FA 4WVFA 2QORA 3O8BA 5H68A 5C1BA 5TB5A 2P6UA 3AVPA 4A6XA 3TJZA 5LBIA 1ZYUA 1CRPA 2Q3FA 2A5FA 4IW3B 3IUYA 2ZANA 3RRZA 4E07A 2J0UB 1VHLA 3WMGA 2FPKA 4R7ZA 3W6NA 4C30A 3I61A 4URUR 1E1RA 3K09A 2W2XA 3UMRA 2IXFA 221PA 3EPHA 4EQ6A 5FUXA 5JRJA 5GVRA 2FNAA 1GL7A 1VKJA 2ZVPX 2ONKA 3QXCA 4NCJA 4PC2A 5FOTA 5TVKA 5GADl 4Q00A 3ADKA 2VP4A 3SQXA 4EPRA 1AS2A 4FXPA 1JJ7A 1CRQA 1DARA 3KJHA 3KQHA 1SHKA 4HAYA 3VKHA 5AJZA 3H84A 3GLHE 1NG9A 1YE8A 5FL3A 2J0UA 2JLUA 3CH5A 1ANKA 4RZ2A 3VHLB 3IEVA 1K8RA 1E2GA 1Z2CA 3R9XA 4HLUC 1Z63A 4I81A 5DYIA 2GAOA 5CLQA 1ZCBA 4PAOA 4BE7B 1NJGA 3RABA 3AM1A 1S9DA 2B8WA 4W5WA 4D80A 4LBZA 4JJKA 2X1VA 3ASYA 2ZROA 1QHXA 5AR1A 1TEVA 1RC8A 1AA9A 2F1HA 1IXSB 3IQWA 3QPWA 5LDDC 1NBMD 4BZXA 5HE8A 2YNMA 1KSHA 1LV7A 1AN0A 5EZ6B 1HUQA 3I32A 1Q3HA 4KLZA 4OHWA 1HA3A 2JDIA 1XTRA 2BOVA 2KSQA 5FTMA 3GFPA 4TYYA 1P9WA 4TLBA 3TQCA 5SZHB 4JSYA 1Q3TA 5D3MB 1NVXQ 2W6IA 4M0LA 4B3DA 1GILA 5KSPA 4C0HA 1OV4A 1G17A 1KI3A 1G7SA 2OE2A 4PPFA 1S4QA 4FCWA 1SXJE 4W9MC 1KO8A 2GKSA 3N2EA 4FW9A 2FDCA 1ESMA 1KK1A 2CE7A 1WMSA 3FKSD 4B34A 4WZAE 1ZNXA 5DHFA 1GG2A 1IOZA 2FN4A 2PL3A 3OESA 4LOAA 4TTPA 4DLRA 5KTYA 4BLOA 2RGGA 3A4LA 3U3RA 3RWMB 3GP8A 1CR4A 3DVLA 1VCMA 2ZJ5A 3PV0A 3I8SA 2JIZA 5FOSA 4QHYA 2OT3B 3KQLA 2V6JA 5TXGA 4O3MA 5IK2D 1XTSA 1KJZA 2UVQA 5D3MA 3BB1A 3PIRA 4M1SA 4DB2A 2WMNB 3R7WA 1PUIA 4IXNA 4DSUA 1XD2B 3SU8A 1CR0A 2XZOA 2OCBA 5AUOB 3ZD7A 5FBVB 3NG1A 4A8JB 4EDHA 1IHUA 3F0TA 2HYDA 3U6BA 2GXSA 5CM9C 2CCJA 3VNUA 2R44A 1VG8A 1VPLA 3LDAA 4JLAA 5EP1A 1T9HA 2ZR9A 4HUTA 3CF6R 1MOZA 4HAZA 2ZJZA 1RJ9B 5DN6D 1E2PA 4KSBA 2ZRBA 1YU9A 1H8HA 1ZUIA 2G6BA 4Q5IA 1FP7A 3W8NA 4D4LA 2CHVA 5CITA 4LGMA 3RC8A 5KO2A 2AN9A 5KHOC 1XD2A 1NLYA 3VX3A 2QSYA 3CBQA 3WNDA 2YZ2A 4LHYA 1HQYE 3MJRA 3A1TA 3B78A 3K0CC 3V4RA 4A8JA 2QQ0A 4NBSA 5JJIA 1ZP6A 3GD7A 3QQ5A 1TF5A 5BQ5A 2IYRA 1CJTC 4I99A 1X86B 2ZSFA 3TUZC 2EYQA 4ZO4A 5IT5A 3WMFA 2QI9C 4YDSA 2YVUA 3EXAA 1O3YA 1RJ9A 1UBFA 1R5OA 1IY2A 3SI7A 2HF8A 2ECKA 2VIIA 1KSJA 5AUPB 3Q7PA 5CYPA 1H8EA 1N5IA 1Y3AA 3VR2A 1S3GA 4GOXA 1XPOA 4JKIA 2WM9B 4R71A 4LPSA 3MFYA 1IY0A 1QZXA 4L16A 1T3LA 4OKSA 3CF2A 1M6NA 3WMEA 5BW8A 1QHNA 3B8HA 1OH6A 1JEEA 1XD9A 2NIPA 2WVJA 4A0FA 4G5GA 3TBKA 4QM7A 4MUBA 4MKIA 2G0TA 4DLWA 3D31A 1TEXA 2GAAA 4LJYA 2OBLA 5G3YA 4D4JA 4YMUA 4AI6A 3BXZA 4V02A 4X8HA 4IFEA 1XJQA 3T5DA 3QXJA 2ZYUX 1J8MF 1SKYE 2OILA 2FA9A 3B6EA 3FFAA 3T1VA 1RFLA 2NO0A 2R9VA 2D4HA 1II8B 1ZC4A 4XTRA 4Q03A 3I62A 3AF0A 3PEVA 4DT1B 3AUYA 2FF7A 3ZZTA 2V6IA 1UDXA 4QKQA 3CW2A 5EQTA 4PC6A 4DIDA 4TYWA 4B3XA 4AYXA 5FBWB 3KXKA 2F55A 4V0LA 3MWKA 2QNRA 5K8IA 5F98A 2GXUA 1DBSA 1U9IA 3QG1A 4PO8A 1LB1B 3CWQA 1KO7A 2D7DA 2NQ2C 1IN5A 3I4LA 4HLUA 5FUVA 3O8RA 3Q85A 1M74A 4EPXA 3T61A 1A1VA 3FOZA 2CCGA 3LWNA 1NY5A 4AURA 4MRNA 2A3RA 1II8A 3DMDA 1P5ZB 2H92A 2IYLD 2ZS8A 1WQ1R 3DPUA 4DT1A 3SYKA 4E22A 5CDFA 3GLIE 1KJWA 1Q12A 4L15A 4NZYA 2F9LA 4KVGA 1NVVR 2HJVA 1KDOA 2JEOA 2QT1A 2J7PD 3EIHA 3IQXA 1COWD 4HATA 4LY6A 3QUSA 2N46A 3GJ7A 3QI2A 2GESA 2GA8A 3A58B 4HEJA 1E2IA 2XITA 1W47A 2ZS9A 2JLYA 5JJKA 1NVUQ 3FVQA 3EPJA 5IHPA 5H8WA 3AVVA 4KITB 2PCLA 3N2IA 1KK3A 1OFIA 2I1VB 5KOYA 2BBTA 3OIWA 2XOKA 1R0ZA 2Q3MA 4JT2A 1BMFA 1OYWA 1FUKA 3KJGA 2CMKA 4PSKA 2OZEA 3OAAA 1R5NA 1F60A 1QG4A 2R6AA 5EE1A 4DCUA 1IONA 1XJ0A 3E5HA 3LX8A 2ZE7A 1RPZA 3NBFA 1CJVC 2MSCB 4KVAA 4OK3A 2WJGA 2YOGA 3C4JA 1ZINA 1OIWA 3HU2A 4DLUA 3SHFA 4F4IA 2F9MA 1AKEA 3DDCA 1XMJA 1X8KA 3VKWA 4Q9KA 1KMHB 1J70A 1TU3A 2C78A 2D74A 2DR3A 4TT3A 3TIFA 1DG1G 4M21A 2F1IA 3PFIA 2IW3A 3CPJB 1TQ4A 3EG5A 5AUNB 1IY1A 1ETUA 4D0LB 4TMZA 1ZM7A 1U81A 3AGQA 1Q1BA 1TTTA 3B1VA 4HDOB 4PPGA 1XCMA 2XTZA 4GP7A 1XXHB 1G7CA 2QL6A 1OXXK 2MSEB 2CNWD 4M1TA 4WA7A 1QHGA 1OB2A 4D25A 1ZM9A 3K0FB 1E2KA 1W0KD 1GFIA 1I4TD 3L82B 3K9GA 4G1UC 2ANCA 2YKGA 1KMHA 4QXAA 1G64A 3A8TA 1CS4C 2RCNA 2BBSA 2CLSA 5FR1A 3OF5A 4KFSA 4AKIA 2A5YB 2AK2A 4KYUA 4HDQB 4ZKEA 3RAPR 3TR5A 3K0CA 2ZE6A 1XXHA 1KYIA 2R62A 3RRNA 4PQRA 1DAFA 1G3IA 1G8HA 4MYTA 2ZUCA 5EP2A 2FEOA 4M9XA 2HXYA 5FTNA 4H1UA 4DEXA 4X8OA 4XVQA 2C9CA 3K0FA 4OJQA 3B1YA 3NTUA 5ANRB 5P21A 4AYTA 2ZJ8A 4ZDJA 3PUVA 2W0SA 2ZQ5A 1W4AA 1M8PA 3U61B 5KNCA 1QF9A 2HDNB 5KPDA 2VF7A 3P26A 1X8LA 1GNRA 4QNRA 2B6HA 2IYTA 3I3SR 5BN4A 4Z8YA 1MT0A 3KKOA 3HYTA 1XZPA 3B1XA 5DI9A 2JLZA 1NNEA 3THYB 1NY6A 3NH6A 1R0YA 2JLRA 1KTVA 2P0EA 1E9DA 4K81B 2BC9A 1II0A 4MDFA 1TL7C 2QGZA 1IN6A 1VG1A 3SFVA 2Z6VA 4TL7A 4UNQA 5E7IA 2QMUA 1R0WA 3VR6A 1IXRC 4FINA 5DE3A 3GLGE 1W48A 3KXIA 3P32A 4ZCLA 4DDWA 4U7DA 2GTPA 3IHWA 2OCAA 2YWEA 2QRNA 3NVAA 1R2QA 2BMFA 2JLVA 2GJ9A 2VHTA 2J0VA 3RRMA 3Q9LA 4PZZA 5JFGA 1XWIA 3WBKA 3THYA 2BCJQ 5FOWA 1T0HB 2WWIA 5HR5A 2ZU6A 1X6VA 2IT1A 1MH1A 1OH7A 4D81A 3FE2A 3QPVA 1F6BA 3NHAA 2LKCA 5KSZA 2A78A 3J81k 3RLFA 2VRWA 3KFVA 2VHUA 1R5BA 1W36B 2IS1A 1C4OA 4TTQA 1SVIA 3WRYC 2CBZA 3H4MA 3HU3A 2IYVA 1X1RA 4QM6A 3E2IA 1NKSA 3WP1B 3AKEA 4KXFB 4B3FX 1RZ3A 1P72A 2H17A 4LJ8A 4LYFA 4LHWA 2QUZA 4P4SB 2ODEA 4OHZA 2G1KA 1JAIA 4NYMR 4GBMA 2GCNA 2WZQA 821PA 5FOUA 4PSAA 3U44B 4QGAA 4TZ0A 1T8UA 2W2TA 4G5QA 1YHNA 2AHOA 1Q1EA 4A1FA 3QKUA 1KKLA 2ANBA 2D2EA 2A5JA 3A37A 3Q3JB 3M1IA 5DGXA 1KSFX 5TY0A 3UG6A 5J4VA 5GVSA 1KAGA 4FI3C 2ZSBA 4YQFA 1E0JA 3IEUA 1GZSA 2G9NA 4P32A 2REXB 3D6TB 4DBLC 3EARA 4P4SA 1XEXB 1DEKA 4FMDB 2BKEA 1Z2AA 2EFGA 4BGDA 4LZZA 3DKVA 4OK5A 5B64A 5CB6A 3U44A 2O8DB 2QAGB 2O8FB 2CL0X 3DEFA 4PZYA 2DHRA 2VHCA 2JJ1D 4DLXA 5A5GA 2WPDA 4BLRA 3CRQA 3GEEA 3TNFA 5DNYB 4QBFA 1WBBA 4B2PA 1E2DA 4EPYA 1KK0A 1ZU5A 1GKYA 2JJ2D 3IGFA 3QENA 4LBYA 1IXZA 4OQFA 3EPKA 2NG1A 1OXTA 2Z5FA 4MDEA 2IUTA 2ZS7A 2BDTA 2DBYA 4U00A 2Y8EA 1RIFA 1XMSA 2XZLA 2A9KA 1GVNB 3I1FA 4B73A 1XEXA 1LTQA 5BXQC 2V1UA 3CF0A 2O8DA 1YZTA 2EFDB 1RYHA 3K9LA 4TMXA 2O8FA 3CB4A 2GF9A 3AGPA 3ZYCA 2C77A 1E1RD 3A36A 4XD7D 3H86A 4O2RA 2ZSAA 2BIFA 3UG7A 3AUXA 4JZKA 2HCBA 2IYYA 2G0NA 1GTVA 2BM1A 3GPLA 4TLDA 1E2MA 3GJ4A 5H70A 2ZRIA 2FMXA 4JIMA 3B9QA 3K0EA 2ATXA 2RB4A 4G01B 4AD8A 4TTRA 1JBKA 5E3HA 2A5DA 2IHYA 2DFLA 5DIFA 1AQUA 4TYPA 3RC3A 3U7EB 5F2EA 4LJAA 1BO6A 2GBLA 2PT5A 3MSXA 2R6FA 1Q0UA 2CDNA 3PEYA 2OUKA 1UF9A 3RYTC 1JECA 1KO1A 1N3BA 5CJ2A 3DKPA 1NF3A 2RGXA 1SVMA 4C2UA 3UWOA 3OZXA 4R2IA 3CUEF 4N3NA 1C1YA 2ZR7A 3M4YA 4BFXA 3ZQ6A 3NEJA 2J0QA 3T15A 3CNNA 5HZHA 3KB1A 5JWHA 4Q7JB 4UXJA 2F6RA 1JPNA 2EU8A 1E0SA 4M1YA 2ERYA 4JLPA 1IM2A 2ZJBA 5DI3B 4PXAA 4JLDA 3LQRA 2Z0MA 3OIYA 3GMTA 3KKNA 4II7A 3EC2A 3WRXC 1E9EA 3TSOA 3P27A 2JDID 1HH4A 1XTKA 2BBWA 1YZQA 2GF0A 1E1QA 3CRRA 4Q18A 3HJNA 5EUMA 4FD2A 2W6ID 1OFTA 4KBFA 4E03A 2IX3A 2RGAA 3E70C 2P2LA 3VQTA 3QVVA 1K6MA 4FMDF 4US1R 3QEJA 2FFQA 2ORVA 4O0MA 1CJUC 2BHRA 5DI3A 4JKYA 4P4TA 3NIBA 1GUAA 3TUIC 4A4DA 1TF7A 3WYAA 5EXXA 5B57C 3FGNA 4GMDA 1J99A 2JIZD 4Q1DA 1XTQA 3RWOA 1G7TA 2EFEB 2PT7A 4ZV4A 5JMTA 2L0XA 5TARA 3AV0B 4DRZA 2TMKA 4MRSA 4GZMA 5L8VA 4YXWA 2W6JA 4KAXA 1E79D 3BH0A 4N0EA 1VIAA 3CPHA 1LF5A 1KI7A 2A5GA 1DO2A 2OFOA 4LYJA 4OI2A 5CK5A 2AR7A 2PEYA 1GIAA 4TMVA 1GWNA 1UAAA 2XTNA 1P2UA 3V4FA 4UJ5A 1V5WA 1LF0A 3OHMA 4JBYA 5AWFC 2R6GA 2V4ZA 4JVNA 5FI0B 4QJ3A 1F3OA 3DM9B 1W4RA 4J0QA 3GLFB 2O0KA 3L0OA 1H8HD 3PENA 4A8JC 1KAOA 3C5HA 1RRFA 2A7QA 1KO5A 4JBXA 1TX4B 3NBXX 3T1OA 3BC1A 1P7CA 5FL7A 1NMXA 1XTJA 2PZFA 4TWZA 3TH5A 1T5LA 2UZ3A 4XOIA 1N25A 5JRZA 4LJ7A 2IHBA 3TQFA 2ZRLA 1TAGA 4JYBA 3LBNA 3NC1C 3KKPA 1P4SA 1DAHA 2ZI5A 1B23P 3L2OB 1F2UB 1CF4A 2EW1A 2ZSDA 3RS2A 4CEIB 2PMDA 4LUCA 2FGJA 3PUXA 3SYNA 1TF2A 4FIDA 4ZIRB 3ZVLA 1PLJA 3SR0A 4EPVA 5B30A 1FTNA 1YR8A 4MRPA 4JYCA 1H8ED 2J1LA 1KKMA 2GHIA 2V8OA 3QXXA 4NYJR 1W5SA 1F48A 2WKPA 2ONJA 4A82A 3VKGA 1XCGB 2XB2A 4XJXA 1G6OA 2A2ZA 3B9PA 1OW3B 4DDVA 2KE5A 2JA1A 4DWJA 3RS7A 4Q47A 1Q20A 4MYUA 1F2UA 4B48A 1EK0A 2WIAA 4CEIA 2X8AA 2KBFA 5DO9A 1P9NA 1S96A 4B2IA 3K70C 4ZKDA 4Q66C 4ZIRA 2DFTA 2DWPA 1CTQA 4NE2A 4PR0A 5K8UA 3AF3A 5K8TA 2P5SA 721PA 3ZIAA 4M9ZA 3SJCA 1RKBA 2IXEA 2NGRA 3FMIA 4AWXA 4BASA 2OV2A 1IN8A 2CHGA 3WHLA 2HLDA 1ZIPA 2BMJA 4NYIQ 1U9IC 4BUJA 2C98A 1FTSA 4M22A 1NVWQ 3TVTA 1W0JA 4GI7A 3L8ZA 4DJTA 3WYGA 1ZIOA 2P6RA 4JLVA 2J45A 1E2JA 2IUUA 3ZVNA 2QBYB 3GEHA 3MRSA 1FUUA 1LY1A 2GEVA 3BE4A 3GLHB 4NHOA 3KQNA 4TL8A 3EA5A 2PZEA 1W5TA 4D0GA 421PA 1OE0A 2GXQA 2WJIA 3HP1A 1K5DA 1L7VC 4YDHB 3B82A 1OF1A 2JASA 3FMOB 1N6NA 1SQ5A 4JL8A 4M8NE 2VBCA 3NDBB 1F2TB 1OXVA 4NH0A 3LQQA 3IPXA 3PEWA 1KDPA 1KZGB 3ICQB 1XX6A 1AK2A 2BBOA 4WOPA
chains in the Genus database with same CATH superfamily
2Q1XA 5KDOA 2QBYA 4DQXA 1PWXA 4YMLA 3A1EA 5JXJA 4O4HA 1P0QA 3RVKA 4PIVA 3DPIA 4KMMA 4Q16A 3WRXA 4ARCA 1T6BY 2EJUA 3SIXA 3MM4A 3M6FA 1KRHA 4HJXA 1B8NA 4N39A 4XGQA 5FXMA 3ZV6A 2NXCA 1P2VA 3U19A 1ADYA 2J85A 5A5EA 2F1JA 3NASA 4AZ0B 3OMXA 5H4HA 1NW8A 2P0AA 4RMGA 3OJLA 3TZ6A 4F2WA 1I1QB 1F2TA 1ZVJA 3UV6A 2XUHA 3DOUA 2C1ZA 2YOFA 2EKPA 3FCUB 2V0NA 4WLNA 4DV7B 2AMYA 2C07A 3PGXA 4OY3A 4XGIA 2MCFA 1VFNA 1XR3A 4XRRA 4KE9A 3PDHA 2NU6B 1MO6A 3L0DA 4POOA 4N0DA 3A4VA 3PC2A 4ZYYA 3H5WA 3LU1A 3RTCA 3AJ9A 4K46A 1GZUA 4ZAZA 3F73A 3CWZA 4KSCA 2FMTA 4XLTA 2G88A 2B20A 3FD8A 5GJCA 1HZJA 2Q4TA 3IEPA 1ONPA 3ND8A 3AUKA 4J4HA 3U4GA 1IEWA 3KQKA 3MOSA 3N1UA 4S05A 1NYQA 2VT2A 3PQEA 3O3CA 4J3NA 3C6YA 2WD7B 1Y5NA 4F5EA 3OPYI 2GX6A 2I7TA 3BE6A 4TX1A 4FFPA 5DNCA 3ZXIA 5B3JC 1Y5IA 4OEHA 4IGKA 2FWAA 2W2MA 3I5UA 4WKBA 4DR6B 1SQGA 1VTKA 4JU8A 1GM5A 2A33A 1X1SA 2Y6UA 5IH7A 1T35A 1W76A 3FSGD 3GFOA 1B7GO 3ORQA 2MR5A 1QG0A 1PO7A 3A1UA 1RYNA 3Q0IA 1CY4A 4QBTA 1IPFA 4P3XA 5HGJA 4DBZA 1XTIA 1UBCA 2HMWA 4WZAA 3WYDA 3IT2A 4WMLA 3QE2A 5CGQB 4DHEA 1KGSA 2VF8A 4KW7A 2PRZA 3PUWA 1LC0A 4L5AA 1M6HA 4HSGA 2VHVA 5IXSA 3KSAC 2AB0A 2SKDA 4QDJA 2P6MA 3P2MA 2Q8PA 3C5VA 3EHEA 3BRWD 4HDKB 4NTZA 3UMMA 1PNQA 2E5FA 4EI9A 1Y7LA 1NYLA 3JASB 1GYQA 4IJVA 5EJMA 4PSCA 3Q12A 1GKUB 3WKAA 2R00A 4UXHA 4A0GA 4MVJM 1H6AA 4N3BA 4AP6A 1WZCA 2X1HA 1QVRA 1JEAA 1V48A 3G5MA 4QYSA 3TAUA 3VVLA 4P0QB 4ZVTA 1UDAA 3ZE7A 1DBIA 1U28C 1XJCA 2GJKA 3DFMA 3B1KA 4MW4A 4U63A 5FT9A 5F1YA 2VQ3A 5CNJA 3P1JA 4O1IA 1MOSA 5THXA 2O3TA 4UJ3A 1QJ4A 1JH9A 3EAFA 5L7WA 1A8HA 1IRXA 2Y1GA 1WLYA 3BULA 2D7JA 3EFOB 1VI2A 5GONF 4LDQA 2WRZA 1DKMA 2V7UA 4NZOA 2V7VA 4H4DA 5KVQA 2C7OA 3ADPA 5IXYA 1SCJA 2NZVG 1M0TA 3ABZA 3CC8A 3HA7A 2CFCA 3G13A 4MRVA 4TMKA 5ERGB 1PCXA 1GA1A 1N2XA 1YWGO 4QA9A 3T4EA 2SNIE 2Z9DA 4R3NA 1GR0A 1UBKS 5F5LA 2D3TA 1BA2A 5IG2A 2VHYA 2HXGA 3EG9A 3A1SA 3MA0A 2GYVA 3UPUA 1QRSA 1I32A 4IF4A 2IHTA 5EJ5A 3GLTA 4BBPA 4J3JA 2HHAA 3KEGA 4NWIA 3LY8A 3PHJA 3RTEA 1YL6A 4ES6A 3GGCA 4O8ZA 1WXDA 1EE9A 1NJFA 4FEAA 4FUQA 4P3NA 3RREA 3W05A 1XQVA 5L3SB 4LHEA 4J1TA 3BT7A 4R8RA 2XY4A 3OEEA 1LPPA 2BR3A 4EFDA 2K5UA 1DMSA 5TEWA 4J0GA 2BYTA 4CL2A 2FR0A 2AA3A 1YDFA 2PUEA 1E2BA 2NO7A 4L2IA 5LDHA 2NYAA 1GV0A 1MT3A 4B45A 3FR8A 1EEXB 1NJSA 2FUCA 4H9GA 3W34A 2QMEA 3OFSA 3DZDA 3Q6NA 1U7DA 3U7FB 1YDGA 2ZPAA 4NCNA 4C5CA 2DTDA 3K5WA 4JEHA 2G83A 2YHAA 4U39A 4IICA 1J0EA 1W75A 1X9GA 3CWCA 3WIUA 1KZHA 4N65A 4NG5A 3DFIA 4U3JB 3STHA 5ILQA 3LF1A 1ZA2A 4E32A 5FWYB 3IAXA 3VOBA 5DSZA 2OPHA 1HRDA 1CV2A 1SA0B 4OPMA 3ADCA 3CSUA 1C7IA 4Z4GA 1G20E 2O5RA 1FFXA 1REQB 3ME5A 4LPKA 4PLYA 1EWVA 4M0EA 1HE8B 3ZGNA 5AI6A 1J0BA 1W36C 2PKEA 3M9LA 3R2JA 2WA1A 1KZYC 2Z43A 4N82A 4NENB 1QUFA 2Z3WA 4A9AA 1YA6A 1DDOA 1F3LA 1YB2A 2V03A 2WYVA 4ITVA 2Z3VA 2C58A 3BRSA 5AM4A 4CLDA 2JCGA 1YB6A 2P1DA 3LC2O 3EY4A 5TE9A 1SXGA 4FNMA 4F7DA 3IAAA 2BVNA 1GTJ1 1Z8FA 3BOSA 4QXMA 4KI0A 2OV3A 3OZEA 2I8LA 4MUJA 4WLVA 3KB8A 4LCBA 5ALWA 4N0QA 3G88A 3GG9A 1ZW1A 1CKEA 5BPHA 1XZNA 5JCJA 1Z3IX 3IRUA 1Z0FA 1H4QA 3DXYA 4ICIA 2Z4SA 3NUGA 2J09A 1AUOA 4DV2B 2WP8J 3LPCA 3ST7A 2XRFA 3TSYA 1OH8A 3P9ZA 5F21A 4EMTA 5BR7A 1MPTA 2XD4A 5ICFA 1G8GA 2O8NA 3U4IA 1ADCA 2QM3A 4BATA 2LCIA 2BCGY 4Z1MD 5F7OA 1JAZA 4AFNA 4GX2A 3D5TA 3W5UA 4XWTA 4QZVA 4DZZA 3IDQA 1CD5A 2Z4RA 3CKMA 3OUTA 1ZMBA 2FWMX 2O8CA 4WKGA 1U0OC 3MBKA 4LV6A 1EDDA 2I6XA 3K1JA 3LOUA 1K0UA 4GYKA 2VQFB 3BD6A 3KO8A 4Q4CA 2AOXA 2C5LA 3QJGA 3VGPA 5MGBA 2QA5A 3OX2A 4HQKA 2IHNA 3PTZA 5B3JA 4CKEB 4D3SA 5HK9A 1VHDA 5JQGF 4PICA 4AG3A 2ZREA 4HDNB 4CL0A 1G8YA 3FH0A 1KPIA 1R8YA 3WTCA 1LK7A 2Z2KA 1TK2A 4O2BB 3BH6A 3ROPA 4FMCF 4TXLA 3VYUB 1SCDA 3QKSA 2POQX 1SD2A 1AF7A 2WHEA 5EKSA 4F8EA 1Z38A 2CL5A 1ZCZA 4A0SA 3IA7A 1R8SA 4EGJA 1O54A 5KWEA 1I7PA 3EDYA 2YUIA 1ZFNA 1PZHA 5BN3A 2BR4A 4US2R 2PAFA 3JW8A 5JYCA 5I7WA 3W5HA 3MTDA 5FOQA 2H2IA 3DT8A 1KMMA 5FH9A 1DB3A 1S2DA 2PKQP 3LGSA 5LP6B 2UYCA 4Y0AA 1ZJWA 3O4HA 2Q9UA 2C96A 1EFLA 5BSGA 1G6HA 1PHPA 2EYUA 4WLFA 3WV4A 2I6QA 2FI1A 3DB1A 3LT2A 2UZ0A 3H5OA 1QS0A 4ZT3A 4Q1FA 1B2RA 2G4LA 2PQ0A 1AT1A 5JCPA 1SBNE 1U4NA 5KYKA 2V1XA 3TJMA 3AERB 5C4GB 3WK5A 1RI3A 2F43A 3FOBA 3BWMA 1BTOA 2VZEA 2DKNA 2HWXA 2ZIZA 1PGPA 3OPYB 2X58A 1U3CA 3D8BA 4YDRA 5FHRA 1P1JA 4O2AB 3BWYA 4JXZA 4D79A 1BXZA 5BUSA 3W2HA 4AUMA 3F9RA 1TO2E 2J3JA 3UYLA 4M86A 2ZRPA 3WMWA 3FCEA 4PYRA 2WNSA 3ZGXA 3ER6A 3NJRA 4A7PA 3GJ6A 1PGNA 4AXBA 3QHQA 5D6OA 1YDWA 2W2PA 3EWSA 4U4AA 3MHPA 3I2HA 4JQZA 4RZXA 3UCEA 4BDTA 1K92A 4X92A 2PD6A 3L0SA 1KEVA 3WIBA 1L7PA 3EZ7A 5FEMA 1JB9A 2OESA 3EY9A 5K3OA 4IZ6A 2HCJB 3QI7A 3OP4A 1A4IA 3HVHA 4C7MA 2DWQA 2XBMA 4HQ0A 3M6MD 3UWKA 2YV5A 3OE7A 3ADBA 3WFJA 3QX7A 1U5BB 4AWBA 1PUJA 3HNOA 4FSDA 1G8PA 5CX1A 2IY8A 5CVDA 5SYAA 5A5VA 3UH0A 2H1HA 2YYAA 4CN8A 1F5SA 2FQXA 2DULA 2MDTA 4GXRA 4WJZA 4PG4A 5DYTA 1GSOA 1NWHA 3G0OA 4P3KA 1CIPA 1JSXA 1S2MA 4UBKA 5CUQA 3L5KA 2JZNA 3FTFA 1JHVA 4MUHA 2DC1A 2EJCA 4UZSA 2WSLA 4LOIA 1QHIA 3G8AA 3FN4A 1SXIA 2I2WA 3NONA 3C98A 1Q14A 3LIPA 5DXAA 3N53A 5EPUA 3SZUA 1SIOA 4ESOA 1RM0A 1YVDA 3HFRA 4K9KA 3A1FA 1QRUA 4IV0A 4Y2SA 2PH1A 1OIXA 4X8LA 4YRLA 2HA3A 1ZAYA 3QE4A 3S2GA 2EL7A 2FGKA 3ZOZA 3ZWVA 4CJXA 4MIOA 4F8YA 1FTQA 2W6JD 2W4IA 5HKKA 2EATA 2GD6A 1U94A 2OBFA 3PDCA 4I3FA 4MWGA 3MLEA 3ROGA 5K7SA 3CXUA 2J32A 1GP2A 3CNLA 3K30A 4PS0A 3ZZ1A 3PJRA 1XTPA 2E9SA 2IP4A 2DZDA 3EOZA 4DG8A 5JR3A 5KYYB 1UFRA 3A06A 4N12A 5E2AA 1SN7A 5EC8A 5KYWB 4X7PA 1R4AA 4D1YA 1MV5A 3RS5A 3UMYA 4UM9B 2BFBB 1XDDA 5IW8A 1QTRA 2C9ZA 4BLPA 5C37A 1W6RA 3K4PA 5ALMA 2X0EA 3TK1A 1GRNA 2QTBA 4BZZA 1A7JA 1K5HA 3M82A 4KFTA 1U2TA 3DZGA 3F2VA 4KO1S 2X9QA 4KEAA 3T3GA 1CE8B 2C5EA 2FPUA 2WKRA 3KE9A 1U1IA 1C1XB 1XRQA 2BGIA 3NVMB 1AJEA 1W94A 1EFTA 4MR7B 3FHCB 4NZZA 1T8WA 5F5XA 1QQ6A 3RTGA 3GJ3A 4GT1A 4RXMA 1Z4KA 3IBFA 3QBVA 4WKPA 4QGSA 4BXOA 3LXXA 4IXDA 4XEHA 4CQMA 1MZVA 3DWIA 1JNYA 2ZM6B 2FAXA 1O5IA 3GGPA 2BEUB 4KFUA 4TV8A 1E0DA 3V1KA 1PJAA 2W37A 1DX9A 2PD4A 1WEHA 4A8TA 1OI3A 3IJPA 1TQHA 5IKMA 3VJRA 1PK8A 1F51E 1FLNA 4XSGA 1L8XA 2WTEA 1URPA 2R7AA 3C6MA 3DXZA 4K3UA 3RVRA 1HDYA 4GYJA 1TUEA 3KU4A 4MV4A 5JLAA 1LGYA 1V95A 2YIVX 3HKEB 2ZTMA 3LVFO 4BB0A 5CDHA 1VXOA 1PVDA 4TL9A 5FV7A 4W5HA 5L3QA 4BMSA 1ZPDA 4BX2A 5ADVA 5IWAB 3OE4A 1JP7A 2D5CA 1RMTA 3CB2A 1I2BA 3CKLA 2KW5A 3IQEA 3MERA 4OA5A 4MW1A 4PAQA 5EXTA 3KKQA 1L2TA 2KBEA 4WAUA 3UIEA 2XADA 2VOEA 3LGAA 2VH5R 3ORSA 4HLDA 4D92A 3AOEA 1K75A 4YRRA 4DRXB 4ARIA 3NHZA 1MQSA 4RKQA 4Q9IA 1M7HA 1Z13A 3E4DA 5K03A 4YT5A 4NE9A 1ZZGA 4F4FA 2JIQA 1E3MA 1SKMA 3B20A 3ZBTA 1E3WB 3CR8A 3M7IA 5FB3A 3VISA 5DMHA 3GEIA 4XPZA 2N3ZA 3GUUA 3ZU3A 4KR3A 1O89A 3LWZA 1YO6A 3GH3A 3R20A 2PH5A 2ZBPA 3KXDA 5T6MA 3LYUA 2GTHA 3PQ8A 1HTWA 2ADFA 5AI0A 7REQB 1CX9B 4QECA 2ENWA 1YZNA 3A9SA 1I4EB 1PLKA 2NUBA 3EEYA 1Z6PA 4K9SA 1EFRA 4EW6A 5I7HA 1SQSA 3B60A 3GQBA 3ZE0B 2J5QA 3OUUA 3ROKA 3VU9B 1DC7A 1I3NA 1W0KA 1XA3A 2ID4A 2N0SA 1D03A 4LOJA 2EGHA 4W5TA 3CRMA 2XWJI 4F72A 3U4DA 4BLWA 1UR5A 4HGYA 1HSZA 1IBSA 1VZ3A 3DUFA 1R4MA 2QUBA 4CF5A 1MZPA 3V8EA 3P9PA 3DCNA 2EZ4A 4QSHA 4BX3A 2J67A 3NYRA 1PG2A 2CNDA 3AEKB 1AQJA 4LXUA 1DIAA 2Z95A 2VTBA 3HUTA 2BFNA 4PLCA 3E8XA 3U7RA 2HGSA 3REQA 2XE6A 1MJNA 1XNJA 2HIHA 2QMHA 3D4BA 3I64A 3VX4A 4AJJA 1IB0A 4IXMA 3WAKA 1AOXA 1P29A 4U6QA 4BEVA 1V47A 4RCVA 3ZV7A 1VA4A 4EYKA 1Q83A 4H7EA 4RVGA 4ZODA 1KRWA 2JRLA 4ZAWA 1YGPA 1L1RA 4R98A 3HCPA 1DG3A 1DUIA 3IAM1 3WLIA 3ZHBA 5BOSB 1GFZA 1RE1A 3Q7QA 4M37A 4UUOA 4ZCPA 1KOJA 1RVV1 1LJ8A 1UMKA 3AL2A 4ODIA 1ESCA 4MI9A 5J1TB 3SHWA 5K8LA 4AY3A 3KDSE 3ZGZA 5DGTA 1T5BA 1I94B 3W5VA 2BAGA 2IYPA 1XQ9A 3KZ1E 1Z2NX 1QORA 2Q4DA 2D5AA 3OQIB 3R3ZA 1YDMA 3DOHA 4GRAA 2CB9A 1Y9AA 4R2HA 2O52A 4M6WB 5DHUA 1Z7BA 3WMRA 4C14A 3IE0A 3SZMA 2PY6A 4AJ1A 4XIGS 4BJ5A 3NTVA 5AQEA 5LWHA 1BXGB 1O0SA 4MTCA 1R9NA 5TMPA 4CGZA 1E9FA 4QFCA 4HS4A 3ISVA 1ZVMA 1JYSA 4JJFA 3SN6A 4ZDKA 4CEHB 1QVZA 1FYFA 3K1TA 3PDWA 3TFOA 1XZBA 1LTKA 1B14A 1DV1A 2QE6A 3HADA 4QHSA 1D4ZA 1DCMA 1TAHA 1B4DA 3R0VA 3E7XA 4Y98A 3PVSA 4D42A 1RWXA 5BMVA 5IF3A 4HQRA 1JQBA 2C2WA 4WK0B 2HZ7A 3TLBA 4BCDA 4C03A 5IBCA 1HL3A 2ABWA 2LCFA 2V3VA 3JALA 3GP3A 2QW8A 3NRBA 4M0UA 3H97A 3EF1A 4EVIA 4NV0A 3HCRA 1CFZA 3VO9A 5K5EA 7ADHA 2O2CA 2QTWB 2X40A 3QV2A 4UE6A 2ZG6A 5B1EA 2XSZA 2MMCA 1P4RA 4HL6A 3BFVA 2PGDA 1ECJA 3W5IA 4XWOA 3WQSB 1YCFA 3GB9A 4LZJA 4EY3A 3EZ6A 2GHRA 3A70A 4UPDA 4LRXA 3K5HA 2QD4A 4L4YA 1C9NA 3CUKA 3HXPA 3VDMA 5LNK6 3B51X 1CVRA 1LDMA 3PDIB 4WCFB 1BMQA 1F4VA 4N48A 2GJ8A 1WSWA 4R81A 4IHJF 3R40A 3AI1A 3P9CA 1CDZA 4X65B 3REFA 1YOVA 3HFSA 4CU2A 5FBQB 2P9FA 4DUGD 4AT1A 3T1QA 3L7YA 1GTMA 2BFEA 2SHKA 4H31A 5KC8A 4RWEA 1Q1ZA 5G0SA 2GWHA 3ISTA 2AXNA 3TX2A 3KUCA 4B09A 5ELXA 3HVUA 1G2OA 5JSFA 2ECPA 3KSRA 3SIWA 4MPDA 2Y1EA 3FWYA 1BGXT 1EHCA 3RAJA 4D6XA 2YIDA 1XHEA 2E37A 2YS6A 3CJTA 3VTKA 4N7BA 4NBKA 4RPHA 3T3EA 3I5XA 1F7VA 2WWFA 1MMFB 2A1UB 3ZW9A 1EP3B 2PLRA 5KNLA 2PRSA 1O6BA 4B3SB 2FP4A 3K32A 4MS4B 3D2AA 1QPBA 1CJMA 3HZHA 2FWPA 5DCYA 3K2EA 2JGDA 3N2GA 3IP8A 1W29A 1SOMA 2REQB 3TL6A 2W93A 2C0PA 3N75A 1ISRA 4YRZA 4EQ6B 3WNVA 1OX4B 4ZYXA 3V9AA 2FMFA 4WZBE 2HPVA 4PF1A 3CXRA 3DFKA 3F3YA 3IR7A 4FX5A 4WINA 1VE6A 1NC1A 1G8KA 1YBFA 2V97A 1I51A 1VL0A 2EG5A 1NJ2A 3OJEA 4Y2XA 5AJXA 5IDYA 3HY4A 4C88A 2UZ1A 3K70D 1U4SA 5CFQA 4KQMA 5EJ9A 3UB3A 1Z4MA 3A10A 4NECA 2Q0HA 4EDFA 4R0NA 3GMIA 4RTSA 3BGSA 13PKA 3U6BA 1U0EA 4YJFB 3R9KA 3WZLA 3CZMA 1Y4AE 4NMHA 1FFAA 1OBCA 3MRVA 4CM4B 4LCEA 1YQXA 3UGKA 3NTQA 4DCSA 4RFVA 1P3DA 1M1NA 4BFSA 3DMNA 1V6SA 2D06A 4CM8A 1Z35A 5LQRA 3ZDZB 2VJCA 5B1YA 4UTPA 2IELA 2GI4A 3ZLBA 3OTQA 2RHJA 4ZYTA 1J23A 1FMTA 2PN1A 2XUIA 1I1HA 4NBUA 4Z4CA 2NMVA 2H18A 2Q9AA 1OBVA 1TZBA 2R8YA 4QTTB 4FDTA 3IVXA 3QPCA 4IVQA 2ZI9A 1LWOA 2VRBA 5DW3A 2ZTLA 2WBLC 1T9AA 3PC3A 1E9SA 3H1EA 4N49A 2ZIUB 2XXAB 1T8SA 1UP6A 5TX7A 4IVRA 1P60A 3BZUA 4I3HA 4UNRA 3U2QA 1F17A 3ICVA 3BJIC 4AK9A 4KAAA 2GKOA 3RYFB 3WWCA 1K8XB 5GOTA 4RHCA 1T4DA 3SZ3A 2BN4A 3OWHA 4FBMA 4KTTE 4BVJA 3UJPA 4EKDA 3F71A 3IT0A 3UAXA 2Q5CA 2VDWB 4HGOA 5FULA 2HHJA 2XRYA 2QKYA 2BHTA 4MGYR 2FUG1 2OSBA 1F38A 1Z12A 3MOGA 3G2KA 1IOVA 3C7AA 3V9PA 2WIDA 4BX9A 3CO5A 3LHKA 4D9HA 4UVHA 4KQKA 1P7ZA 1HURA 1JJFA 1SBZA 4DFDA 1E1MA 4QULA 4BFTA 3E2MA 2CUZA 3OBBA 7ABPA 1D0SA 2FG7C 2GJAA 5L3RA 1P2SA 1DFIA 1M0SA 3GFBA 4RD4A 2NV6A 2VJQA 4H3VA 3V6LA 1HE2A 1VE1A 3ELWA 1DIOB 3GFGA 3IXMA 4D4GA 4KLNA 1NNLA 5BWBA 3VPBA 4GQBA 2V55B 1JXOA 3EIEA 1RYBA 3UMFA 5AJWA 3UM9A 2VDPB 1XFDA 1D2EA 3R7WB 3HR8A 1N34B 4IVPA 1KIFA 2WIFA 4CODB 4IY1A 1U2DC 1SWWA 4UDXX 1JI0A 3KXLA 5EMJA 1TUBB 3ADOA 3M4ZA 1F6DA 3LCCA 3HCDA 3TKYA 2EIXA 3ESAA 3WWDA 1B0UA 3C4QA 3KJIA 5AK5A 9MHTA 1ZCAA 3D3EA 4ZCQA 4C6TB 5MFPA 4OMDA 5LA6B 1A04A 2GAFA 1EDEA 3EXHB 4XVCA 4BFLA 5LOVB 1A9PA 2QM8A 4RF3A 4WCDA 3C4VA 3ETCA 3KYIB 3H19A 4N0MA 1CF2O 2EJWA 3L43A 3KPYA 3H3XA 1Y7PA 2FMKA 1QTNA 2AVNA 3HUFA 3MCAA 1V4NA 3KJNA 3OEHD 5D2CA 2IEDA 4R2JA 5K2MA 4FN5A 4UMDA 2VVTA 3OE1A 2VC2B 1BD4A 1VIVA 5FI1B 3WX0A 1GZDA 2O2EA 4CE6A 4US0R 2OBBA 2GZSA 2PQ6A 1GPKA 2CNKA 1VL8A 1OXSC 4TZTA 5CXSA 5D01A 5ALHA 3E0XA 2EJBA 3A6DA 1FRVA 1L5FA 1N9GA 2AFHE 2C82A 1IU9A 2NSDA 4MIKA 2YFQA 4MGEA 1B73A 5HBRA 3V4LA 2VDQB 4O33A 3SC2A 2VP5A 3HJRA 1I2ZA 1E77A 3BORA 3QOFA 1J7KA 4WACA 2JBAB 1VL5A 2QVXX 4U7PB 4ZVLA 2H5IA 2VWPA 2HJSA 3KUDA 4Z0PA 3OCYA 4CKBA 5LVAA 3MHTA 3VPGA 4N47A 4RD1A 5L95A 4M53A 1ID1A 1UK7A 1VPEA 4G26A 3V6MA 1XBTA 3KJZA 2QZZA 4RO0A 3IA2A 5I47A 1PE0A 3VGJA 4C1BA 1O9GA 2WU3A 3N0TA 3HBMA 5LZ5A 1BS1A 2H1LA 3Q6IA 4L8WB 4WY2A 1E6UA 4TOIA 621PA 5JBNA 4ZOLA 3C3EA 4AUNA 3MG9A 5KJ6A 2EW2A 3FDIA 4ZV7A 3JYHA 2BFAA 1ML4A 1G291 4GGPA 5LP6C 4AKHA 2NU9B 4HYTA 3HKDA 1M34B 3M9XA 3BSWA 3T35A 3U3JA 5JNLA 3OPXA 4BQPA 3E0QA 4P31A 3FBWA 1U8YA 4FYYA 3JASA 3ZHQA 2Q2NA 2J07A 1YMVA 4QPZA 4PG6A 2FWBA 4CMIB 1EGAA 1ZH8A 1S3SA 4IX1A 2UV8A 4C4PA 1BDIA 1XC7A 2BY4A 3C14C 4QAJA 4YJ2B 3O95A 4GGOA 4DPMA 4EEZA 1YR1A 2OAP1 1GGJA 3C39A 3B6JA 3QVSA 4DVGA 3R9IA 3TNDA 2FF5A 4M1QA 3ND5A 4ZVNA 1GZ6A 3O7MA 2YZGA 2WWGA 4HNGA 4QXRA 2WWXA 1T13A 4DVJA 1YZFA 2HF7A 4B3TB 3VYSB 4E14A 2C95A 3VYTB 2P79A 3H6KA 4L4UA 5CVVA 3DKIA 2QRJA 2QTVA 3DLCA 3GMDA 4ZT2A 4G2TA 5P8WA 1Z2DA 2JLWA 1GNVA 4G25A 3TSAA 5JNRA 3R1IA 1CLUA 3QUAA 4I1PA 4QG3A 2FZLA 4FC6A 2D4AA 4WBNA 4BEWA 5EKUA 3INGA 2HIGA 2AFIB 4LZWA 5TJ9A 6LDHA 1SK9A 5IVHA 4MULA 3UCXA 3FHLA 2VJKA 4LI0A 3B6ZA 3A6EA 3K05A 4NEGA 1JHMA 5A9SA 2J0SA 4GL2A 1EX7A 2H4JA 4LBWA 3E3AA 4ZDIA 4Q48A 1RM5A 2P8JA 4NCHA 5K2OA 1XYGA 4LGVA 4GVPA 4FIZA 3VKUA 3ZVRA 3UWMA 1UBRS 2ZSUA 1JWBB 1TKRA 3DB2A 2EG9A 5EZYF 3OT1B 2DR2A 3SZRA 4ZU6X 5C3UA 1ECLA 2GKGA 5I8ZA 5F7XA 3PUZA 1P1FA 4IZHA 3UXMA 2BRUA 4LHVA 2WVHA 4IIGA 4XLZA 3PS9A 3RSLA 1ZJ4A 2QAJA 5A4DA 4CUKA 2F59A 3JVIA 4TS9A 4KMSA 3P9RA 3HLYA 4BN4A 2QY6A 4JT9A 3D3QA 1F7UA 4E5NA 4NZNA 1BH2A 4HG2A 4J9VA 2CLHB 2PVSA 2GASA 5CVJA 2NQTA 2C00A 1XRLA 4Q1CA 5G41A 1LK5A 3JAKA 4U8HA 1RE0A 1Y80A 5BUCA 2VHWA 5F23A 1J2JA 1W4CA 2OV6A 4KUHA 2UUAB 5AHOA 4I4NA 1Q44A 2FSSA 1S7CA 1S8FA 1PJTA 3GT0A 1MC8A 3PRHA 3ZHYA 3AB3A 5FWYA 5JPCA 2QW0X 4HB0A 3UAZA 4EECA 4P3OA 2WV9A 3LY9A 4IDQA 4UEQA 2X4IA 3DDNA 3N0RA 1W581 1NI4B 3PXBA 4FC7A 2OLKA 3AESA 5D7NA 3ZE8A 3VBCA 5AKKA 1TMOA 3HB9A 4I36A 5AM0A 5EIEA 2QN8A 2R7KA 3G2QA 2H7YA 2Q0QA 3GIDA 3HUUA 3PTLA 3PWKA 4YMVA 2ZQYA 5IC4A 4MGIR 3RC7A 1E2HA 1T4CB 6AT1A 1MA3A 2GEKA 3CNBA 3FKSA 1D4AA 4B3CA 1KDRA 3VH4A 3F8TA 4A15A 4Z8XA 1GAQA 2BI7A 1LFAA 3PJGA 2QB5A 1DZIA 3EDOA 5JH7A 3HRIA 4PZPA 3VR3D 5DTMA 1U2GC 3ABQB 1TCAA 1ZNQO 1KAMA 3O6VA 1PJ3A 2ZATA 1KGDA 2OR3A 3R0XA 1OHHD 4Y1EA 2EX4A 4G5XA 1TNDA 4GFDA 3IEMA 3AFIA 4XOUA 1E2LA 1RZRD 1TA4A 2VDVE 2DFNA 3HCAA 4S1WA 4NF2A 3FVRA 4OF4A 2HXSA 2C0CA 1ECGA 1K0FA 4PZUA 4TV9B 4BVBA 2P65A 3PNKA 4DGQA 3I01A 2PD3A 1NULA 2AKAB 5TEVA 4KPEC 2ZI4A 1VRCA 3I3OA 5MDHA 3KFLA 3ZQ4A 1TI7A 1TECE 2Q3DA 2QVGA 2PUDA 1MAWA 4D0SA 2O2IA 4LF6B 2FEPA 2CXRA 1VMKA 3I58A 4KKXB 4W99A 4LECA 5DN6A 4FMBB 4Y2GA 3BJMA 4YCSA 4QD3A 5LXTB 1O4VA 1QO9A 2N42A 3SG0A 4BNXA 4LJRA 3ZV3A 1KXZA 1TGVA 2HH9A 3PUJA 2ERXA 2NM0A 1O58A 2QLBA 1VIDA 2OZVA 4UKDA 1YGYA 3IUMA 3N0VA 5FEUA 5EMLA 2WHPB 1YBVA 2B83A 1NU6A 4JI8B 4G36A 4M0CA 4IDPA 4CM3A 1MR3F 1T25A 1NPTO 1K7YA 4XVRA 3LSYA 1TLLA 1TYBE 3FTQA 2CNOA 4JQOA 4UUBA 4EJMA 1WPRA 4O4IB 2IXDA 4RJLA 4UTXA 3OKCA 3I1IA 1BG6A 5BN4B 3T6KA 1RXUA 1YHYA 1D4OA 2HO4A 2Z8XA 5HCIA 5K3CA 4EB0A 1CVIA 3LD9A 3AVOA 4RJTA 1WTAA 1Z5PA 4KN8A 4IWXA 3ZTWA 1TMKA 2CWWA 2XB4A 1V39A 2RK4A 4F60A 5FPQA 4BYGA 2AE1A 1QIFA 2BEVB 4NCIA 4QBGB 1KMQA 2HMTA 2LWIA 3IQZA 3MILA 3PT5A 5EJGA 2RAVA 2IWHA 5HKBA 1I1OA 1GJRA 4WLOA 4WOCA 4GGMX 1SJ9A 2HLNA 3SXUB 2IK8A 3TEJA 3L7LA 1N0HA 4KX3A 4YAUA 5HSGA 1EAMA 1QCDA 3CURA 1G21E 4LWOA 3MEQA 2JI7A 3PQFA 1Q7GA 1VB5A 1W49A 1G4AE 3KSZO 3N3BC 2Q8NA 3EBOA 2XJ4A 1U0HC 3Q6MA 1HR0B 4MQEB 1QRTA 2XUFA 1DTSA 3ESRA 4TRMA 4BJHB 1DWQA 2R1TA 5DX0A 4PRKA 4KPUA 3FHTA 2NVUA 3BB4A 2NOAA 3P96A 1UIRA 5LU8A 5KNCH 1WF3A 4V0RA 3SQMA 3EGXB 1PZGA 3NOOA 1Y5MA 2CNBA 2B1JA 2F7SA 4ARAA 2VYVD 1FNNA 1UJCA 1W0CA 1N2CB 2OWEA 4WQMA 2PGLA 5EWLB 2FW7A 4Q9NA 1KEPA 2OB1A 5BNWA 4KCGA 1IULA 4L4RA 4RD3A 3PQCA 4YC7A 4GE0A 3BUSA 3CSSA 1TYDE 3A3NA 1PFWA 1UT8A 4ENRA 1JR3D 3DTVB 4H2DA 4BTVA 4PCVA 3AHFA 5EKDA 1BOOA 3I23A 3VUFA 4HB4A 2PBRA 5AXCA 1BFDA 2QPTA 3S2UA 1V11B 5FORA 5KWIA 2G4CA 1YI1A 2RMKA 2GXAA 1FSFA 1U1DA 2PX0A 3GCXA 1DG9A 1NR1A 1ZK0A 2FPLA 1DHTA 2D1FA 1U31A 1RPTA 2DBZA 1A4XA 2Q4RA 3PNBA 4O8CA 4X71A 4OQMA 4GW3A 1H2ZA 1LS1A 2Z58A 4BBZA 5A2QA 3B7WA 5F4ZA 4UEOA 1MAHA 4LDJA 1ZD1A 4IG9A 4UBMA 3NDRA 1C7JA 3QITA 4JL5A 5CGZA 3P20A 3G2JA 5IWCA 1UODA 1PV1A 3HEAA 4JSTA 5GJWC 4LFBB 1J1UA 2BEWB 4KH1A 4WK6A 3OOYA 2B34A 5M04A 2XCQA 5FL7D 2O54A 1HK7A 3TVYA 3LHIA 2BGLA 1PFQA 3M81A 4W7SA 5B1DA 4MR8A 2XT6A 4MCJA 4Z9AA 2QI9F 1RJEA 3DEHA 3HDGA 4YP0A 4YUWA 1M8FA 3TVDA 3ND9A 2JKVA 4OU5A 5JU6A 2J3IA 4LGCA 3W6ZA 4HWOA 2JHCA 5IF9A 1L4YA 1KKUA 1YSCA 3QX9A 3DL0A 2AH5A 3CV3A 4KOAA 2OL4A 3MWGA 2HK6A 1C0EA 2WTXA 5KYXB 1II9A 1QF7A 3B89A 4GPIB 1V5EA 4GRIA 4WCFC 2CUNA 2X41A 4WXYB 4XQGA 2DB3A 4QJ5A 4ED9A 3UO8B 1P6XA 2CSXA 4L74A 1NI3A 3IKJA 2W0MA 4C7OA 1XMXA 1E2EA 4BQOA 5AM3A 1L5NA 4AJHA 5FTLA 1NQXA 2AWOA 1EUDB 3FYHA 1FL9A 1NRWA 1NZFA 4PM4A 2QENA 5FQOA 4CQLA 3N2KA 4TWJA 4L0QA 4UTVA 4R6WA 4Z1MA 2ZRHA 1DJPA 4MO9A 1U1FA 4H3KB 4PHFA 3MB5A 4ER3A 1DE0A 1G19A 2GCOA 4XLLA 1L9XA 5GINE 2VYND 1UH5A 5AI4A 3DHWC 4RS4A 4ZQHA 5F1OA 2BP7A 2VLIA 5C7IO 4I55A 4IJ6A 2Y0DA 1SCKA 4WPGA 4BMYA 2JLSA 2PZLA 4UTOA 1QSGA 3W9SA 5A5FA 3L9XA 1NUQA 1UJ2A 2QTCA 3DDWA 4WZ6A 4CIDA 4X3PA 4EYOA 5LYJB 4MRMB 4XX0A 2WYUA 1FXSA 4B7ZA 2C99A 3U09A 4A2WA 2Q6TA 3NVDA 2FWIA 3EIXA 3ZLVA 2Z4TA 1PBNA 1V3UA 4UASA 1T2CA 3IBYA 5TT0A 2ALJA 2XHZA 1I36A 3FZNA 3I8XA 3K94A 4XYLA 1TQ2A 5B53A 2V59A 4JB0A 1Z2OX 4MQBA 4YB8A 1KAQA 3GELA 2I66A 4NONA 3BILA 3BGIA 5DLDA 3TFWA 4H60A 1PIWA 2O7SA 4UPEA 4RTRA 1CEEA 3P0IA 1CEXA 2QU8A 4Z2YA 3ENQA 2BCEA 2J8ZA 3E48A 3OG9A 1DELA 1JDZA 1DQNA 2NLOA 4JJ8A 4H0FA 1YR7A 2PLFA 4HBZA 4ZPXA 2IYNA 5DM4A 1C30A 2GSDA 4XX1A 5FPPA 3LBHA 3QNUA 2V7QD 4EFMA 1EFCA 5KEIA 1R4NB 2XQGA 4MYHA 4F21A 5TGZA 3OZVA 3PPIA 4RV5A 1HDXA 1GPNA 2NX2A 3FHOA 4DC9A 2VNHA 4LYEA 2PX3A 2ZBRA 4WH0A 5GGXA 1NBEA 2P40A 3ZNOA 4BKPA 4WBXC 4WHMA 1MH9A 4ZO7A 1OT3A 5HP4A 3BMNB 5K4GA 3OOSA 1O7JA 4CLEA 3W9YA 1M6VB 1P4GA 4NBWA 3T7AA 5BYBA 3I6QA 2H07A 2RK6A 1UDWA 2I99A 4QU0A 1C8KA 1ORHA 1UT5A 1YQ9A 2C2XA 5G4KB 2C8VA 3DLHA 2WV7A 3AEKA 3GLQA 3THOA 1FXUA 4HB2A 3ZU6A 5MN5A 2GD1O 2Z30A 3T0GA 4B6QA 2OQRA 1OLSB 3ZQKA 3LDGA 2JGEA 1H6DA 1OLOA 1R7RA 1QBKC 3FRIA 1NQOA 1JFVA 4OVKA 2B94A 5JJLA 2AF4C 2YWXA 3BSFA 3SBEA 4I66A 4QUIA 4CV2A 4HNVA 2D2XA 3QVOA 2GVZC 1VRVA 4DANA 5CCEA 1QO0A 2J3QA 4P7BA 3K0SA 3V8QA 3P2IA 1ZUNB 4PV7A 1NUPA 3PICA 3OFND 5A5DA 3DZJA 4E2WA 5HJEA 1KZ9A 3U40A 1IE3A 1OCEA 5CTJA 4OHOA 5H3CA 9GPBA 1AX9A 4FR0A 3IB3A 1XP8A 2NV0A 1G5RA 4HYYA 4UBIA 5BV8A 2HCFA 2DAPA 2WEKA 2Y27A 1LDNA 4LHXA 1A8UA 5DLEA 1VKOA 5LPNA 2W2KA 3OVMA 1PWHA 4X63A 4ZICA 3F6EX 1FX0B 2AW5A 1ULAA 1VCIA 6PFKA