1XRJA

Rapid structure determination of human uridine-cytidine kinase 2 using a conventional laboratory x-ray source and a single samarium derivative
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
PFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine-cytidine kinase 2
publication title Structure of human uridine-cytidine kinase 2 determined by SIRAS using a rotating-anode X-ray generator and a single samarium derivative.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xrjA00
4LJ9A 2BBTA 3U7EB 4EQ6B 1CBUA 2AFHE 2IYWA 3KJHA 1IY0A 3WP0A 3G0HA 2IYXA 3ZIAA 2WWXA 4OHVA 3FE2A 2YVUA 3MUFA 1P2UA 5E7JA 4LDJA 4Q9LA 4JLKA 2WWIA 4A0RA 2LKCA 3VNUA 1Z83A 3L0SA 1DADA 3OHMA 4EFNA 3A37A 3PR1A 3ZZTA 3QKSB 1OPXA 4L5BA 4ZDJA 2BV3A 3K8YA 5CLLA 1XPUA 5KSOA 1XJ0A 3JZMA 4G5RA 4DC9A 2F9LA 4QM6A 1R0YA 4HUQA 2QRNA 2GESA 3U44B 4PX9A 2VL7A 1E9RA 3FMIA 4MKGA 4BWYA 3B60A 4QGHA 2ZJYA 2CCKA 2OZEA 4Q66C 3TH5A 2WKRA 3KTAB 1QF9A 5HE9A 4W5JA 4AURA 3AVVA 4AY2A 1OFTA 3BE4A 2ZETA 4TMTA 3A1SA 1JECA 1P9RA 2X77A 1VKJA 1W36B 3RWOA 1SVIA 4HLUA 4C0JA 2WMNB 4M21A 1KO5A 4LPKA 4GDFA 4HDOB 5E7IA 5JI3E 4RY2A 3CKLA 2J5XA 2VP6A 4X8OA 1E69A 1XCMA 4EQ6A 3UPUA 3GQBA 4M0LA 5IHPA 1II0A 1ZM7A 2ZJAA 1CIPA 2QU8A 1VG0B 3O8CA 3NC0C 1UBCA 2WWFA 1N0WA 1DVRA 3FKQA 4NYIQ 2BM0A 4XH9B 4PPFA 3QKSA 1AM4D 3P20A 3KZ1E 1W5TA 1T6NA 3PUXA 4GMXA 1IONA 2WVJA 3MJRA 1U2RA 3Q85A 4C4PA 1KDOA 3LXXA 4LRWA 4KVAA 4QBFA 1RZ3A 4NCJA 3U44A 2QPTA 1T9HA 4A82A 1Z6XA 3UMRA 3X1WA 4QHSA 3NTUA 2YKGA 2JIZA 2QA5A 1KZGB 1CRQA 3HU3A 2DFTA 3FOZA 2ANCA 2C95A 3KTAA 1Q20A 4TMZA 4DCVA 1DAEA 1J90A 2XB4A 4B73A 3AVXA 4BQSA 1UAAA 3KQHA 3OEHD 4BFWA 4NZYA 1M6NA 4LJAA 3RRZA 4BLQA 2OM2A 4PSVA 4IEEA 1G6OA 4BLRA 1QVAA 2AKAB 2J0VA 4JKYA 1R8SA 3W6NA 4TYNA 3O8DA 1LTQA 3TSZA 1OH6A 1X6VA 2IUSA 3UMSA 2WM9B 5AUNB 3LX8A 1KZ7B 4NCNA 1XNJA 2G1KA 2MMCA 4RZ2A 1VYTA 1N5JA 1GDDA 3AF3A 2ZVQX 4DVGA 421PA 4BLPA 2QUZA 4M1MA 4G0NA 1OIWA 4JBYA 5LB4A 3PUVA 4AK9A 2W6IA 4FMDB 3CX7A 3OFNA 4GT1A 4ERNA 4W5WA 2RH5A 2IK8A 2IUUA 3BD9A 1HE8B 4TYPA 1OFUX 3BJIC 1CLUA 3IBYA 1XD2A 4GPTA 5LD2B 2FFBA 2I1VB 2H57A 4HLDA 4Q1FA 3K0CC 4IDOA 3QXCA 2AWOA 2P2LA 5IT5A 3CRW1 3QY0A 2RHMA 3Q7PA 4F92B 4FMBB 3IIMA 2D3WA 1EFUA 3BK7A 3B7GA 2C9CA 4JLDA 1M7GA 1X8LA 3N2EA 4I1UA 1YZUA 5JFGA 2VHTA 2QBYB 4FIDA 5L3RA 2ZRPA 2VHJA 5C4GB 1W2GA 2R65A 1Q1BA 4B6EA 4JBWA 4R9UC 2K5UA 2REOA 4K46A 4NCKA 4HB3A 1XTRA 2IS6A 1MO6A 4B3FX 3G5UA 4WOPA 2DB3A 1Z0JA 2OEPA 1XWIA 1ZP6A 3T61A 3B1VA 4WZAE 5EP2A 1GNPA 3H0KA 2JJ8A 3I8XA 3WBJA 4IRUB 4ASUA 3NXSA 2R6CA 4XD7A 2YC4C 1NSFA 4PC2A 1LF5A 2WJIA 2FSFA 2DYKA 4MYCA 3THYB 2ZJBA 4C7OB 2ZREA 2V6JA 4Q5IA 3U2QA 2GJ8A 3W5JA 5KTYA 1R5NA 5FBLB 1G8FA 1RRPA 2F55A 1G5RA 1G3QA 3U6KA 4AG6A 3P1JA 2O0HA 2G77B 1G64A 4URUR 3T06B 3SHFA 3NHAA 2Q0HA 3CF2A 1E2MA 1RC8A 1LB1B 1YKSA 4G01B 3PUWA 2XSZD 1P75A 5HPYB 1H8HA 2ZYTX 3K0FB 1R0ZA 5JLJA 2W6JD 1MV5A 2RGDA 3WMEA 4URYR 1U0LA 2QI9C 3T1QA 4GMDA 1ZRHA 3F5FA 4CRWB 4TYWA 4D0LB 2QBYA 2CLDX 1FZQA 3RS7A 4A2WA 4E07A 1YU9A 4BEBA 1ZJ6A 3PQCA 4P31A 2GBLC 3GMTA 3DKVA 2DHRA 4POAA 1UFQA 2AN9A 4I1SA 2GZDA 1FTSA 1YE8A 1XJCA 1SZPA 4NDZA 4B75A 2QTVB 2O8DB 1R0WA 3EZ6A 3CR8A 5EUQB 5F3WB 5KHOC 1IOZA 1OYWA 2AX4A 1CU1A 4NKRA 4CEJB 4JL5A 3A58B 3THYA 5L8VA 4C7OA 5K8LA 2BM1A 1QHSA 1VECA 2RGXA 4KLZA 5FL7A 2H17A 1PUIA 5JWOA 4FD2A 4S2EA 5KPDA 2WWGA 1IY1A 1MRSA 2B7BA 2YJTD 4DLWA 3WMFA 1CP2A 5KNBA 2A30A 1FP7A 2WWWA 5FTMA 3VX4A 3L0PA 1G17A 2NO0A 3NVAA 1FL9A 3LAWA 4HI0E 4M9ZA 3K0FA 5FPSA 5HKKD 3TQFA 4TTPA 4MRVA 2JLQA 4DWJA 2JCSA 1E2FA 5TXGA 3TE6A 4EKDA 2XGJA 4U00A 2WKQA 4YXWA 5EE3A 4PAOA 4QC2A 2J9RA 4LOAA 3MMPA 1HUQA 4PQRA 6Q21A 1NVWQ 1Q0UA 4G3XA 4L8GA 1NVVR 1MABB 5FUVA 2IBMA 3OIVA 2WJGA 2CDNA 2RGAA 3CRMA 1OKKD 2YOGA 4XWOA 1IN4A 5FTNA 4PC6A 1CR4A 1P7CA 3A8TA 4LHXA 4I99A 3KQNA 1FTNA 1XMVA 3ND9A 1FX0B 1TX4B 1K8RA 4P0TA 4DLSA 2FEMA 4S35A 2O8DA 4ESHA 1ANKA 4DCTA 4EPWA 5IF9A 4JSYA 4JZKA 2J87A 1D2NA 3DMDA 4CEJA 1E98A 1II8B 1NLFA 2F9MA 1I2DA 4V02A 1UJ2A 2ATXA 2CL6X 5CDFA 3TAHA 3VR6A 4V0MA 4MYHA 4JKIA 2NO6A 1SGWA 4B3CA 1YZTA 1CKEA 1FNNA 4DLUA 3IIJA 1BYIA 2OFXA 1KK0A 2Q6TA 2KB0A 1XEFA 4PC3A 1KJWA 5CJ2A 3DM5A 2C03A 3JVVA 3AVTA 3IKJA 1E2PA 4RD6A 4RCYA 4B2PA 2FEOA 2RCNA 1HT1E 3CH5A 3WHLA 3ZZUA 4MH0R 1Y63A 1BIFA 1E2JA 2GRJA 1KO4A 1B0UA 1G6HA 4M1SA 1QVRA 1Z0KA 2VEDA 3SYLA 1MABA 3R7WB 3UK6A 4U7DA 1GP2A 5JMTA 1T91A 3KL4A 1UPTA 4IFEA 4IJMA 1ZCAA 4AC9A 1XPOA 2GXAA 1KO7A 2GVZC 2GJSA 3X1YA 4BRUA 1KDRA 1ESMA 2P5SA 4GZMA 3LBIA 1FX0A 3QG1A 3GLGB 2DPXA 3MGCA 4RKEA 2HYDA 1GOTA 4EJSC 3L8YA 2DCUA 2GETA 3M6AA 2JAQA 3O8BA 4OI2A 4PHFA 3A1TA 5EXTA 4LJ5A 1TPZA 3B82A 3NBFA 1II8A 4O2RA 4D26A 5IK2D 5FBWB 5TDHA 4JVNA 3VR5A 5EP4A 1W1WA 1TEXA 1UDWA 1NVUQ 3BH6A 2JLRA 2P6UA 2WKPA 4FINA 2X2EA 5AJXA 4RD3A 2NMVA 1Q1EA 1VG8A 3CW2A 4ZO4A 1FMJA 2PZFA 4GP6A 2DFNA 1ZMXA 2PEZA 4TLBA 2V1UA 1OSNA 1UKZA 2HLDA 1MO4A 4URXR 1S96A 3ZS8A 2FPLA 5BW8A 2IYQA 1G1MA 3B2EA 3FMPB 5A0FA 2FDCA 5FOSA 3R7WA 4UXIA 3EIHA 2V1XA 3HR8A 2VQSA 3CZPA 5CIQA 2QORA 2Z4SA 2VPPA 1XXHE 3Q3JB 4IHQA 2ZRAA 4Q00A 2AL7A 2A5JA 3LWNA 1NMYA 1W46A 4QJ4A 3GLGA 2CEAA 4OK3A 4XWKA 3VKHA 1P62B 2ZS9A 3TKLA 2GAOA 5C18A 2F3TA 3TRFA 1U81A 3RSLA 1IM2A 3TAUA 2QZ4A 1NKTA 1PZNA 1NP6A 4JYCA 821PA 2ZSBA 4QFMA 1DO0A 1G4UR 1VCNA 4ITRC 3U4QB 5EXXA 1XMIA 5FI0B 4NU0A 3GLHB 2C96A 3QEJA 3MJHA 1KK1A 3GJ8A 1I4LD 3FVQA 3AUYA 4OHXA 1GKUB 2V55B 1Z0AA 3IUYA 1EESA 3QKTA 2PZEA 4MYTA 4WA7A 2W0MA 1AQYA 1FMLA 3FFAA 4UNNA 3TK1A 4N0EA 3EZ7A 5E95A 1N6OA 3QBTA 2ONJA 2EFGA 4NPHA 2KJQA 1KDPA 3PEYA 3U3OA 3ZLJA 3OIWA 1SHKA 3HU1A 3SBDA 2FSIA 4OBEA 5L3QB 4M1YA 2J0UB 1Q12A 2LWIA 1S4QA 2RGNC 5BYJA 2IYLD 3U3JA 2Q21A 2Q3FA 3F0TA 3UATA 2PLFA 1G21E 2ZU6A 1NN5A 1VYVA 2QMEA 3B1XA 4XVRA 4MYUA 5KSZA 4TYYA 1XBTA 3UMFA 2FOLA 4I1VA 4I81A 1YJ5A 1IHUA 2R6DA 3SZRA 1KSJA 2DWPA 1J8MF 4G5GA 1EWRA 1IBRA 1E1QA 3U4QA 2GCNA 3IEUA 1W0JA 1S1CA 3LLMA 2FV8A 1SKQA 3GLHA 3W5IA 1B23P 1JXMA 3U7GA 1M8PA 3QSYA 3DOEA 1E2KA 1X8JA 3RS4A 4M1OA 5ANRB 3HYRA 3K70C 2F7SA 3X1ZA 2ORVA 2OCPA 2X2FA 4UJ5A 5CYPA 2NTYC 3K70D 4W5HA 4EPTA 1AZSC 1MO3A 5H1YA 3REFA 5DIFA 3T1OA 5L3QA 3K09A 4CDGA 2J0SA 1NY6A 1N6LA 4HSEA 1JB1A 2FFAA 2J0UA 3D31A 5SZJA 3CPEA 1IN7A 2R2AA 3F3YA 4KLNA 4PQYA 2GXSA 1Q1QA 3I4LA 4R98A 2ERXA 3NEJA 4B43A 2MMGA 1GNRA 1MT0A 1HA3A 4MKFA 2PZGA 4LBYA 1T5IA 1NN0A 1CEEA 4H1UA 3K09C 1KI8A 4Z8YA 2PLRA 2G88A 4TSFD 3WRYC 4Q9HA 1L2TA 4ZDWA 1PLKA 3HP1A 2CLSA 1DAIA 2FJUA 1M34E 2IHBA 4TYQA 2GJAA 2IEZA 1GTVA 1A2BA 2V3CC 4A1FA 5BXQC 2ZANA 4KO8A 3CF0A 4LYFA 2KI5A 3IQWA 5LB2A 1T3SA 1OHHD 2IYTA 4AI6A 2EFCB 4A0FA 2ZUBA 3TSOA 1XEXB 2G6BA 2HEIA 3RRMA 4GSYA 4B47A 4MRSA 1D2EA 4QNMA 5KDDA 1E2HA 3H84A 4JLJA 2P6NA 4CW7A 1RFLA 3B85A 3FKSA 4NYIR 2QSYA 3SJAA 1VIYA 2JA1A 4A9AA 4QJ5A 1ZD9A 3HJNA 5TARA 1YR8A 1GWNA 3R9XA 3OAAA 3AF1A 4QOSA 5BYKA 4B2IA 4F4CA 3L8ZA 3QNUA 1Q57A 2Z43A 4BFSA 1JEEA 2OXRA 4XOIA 2XEXA 3X1XA 2J7PD 2ODEA 4PXAA 1CTQA 1E2GA 3WNCA 2WWYA 1HH4A 3MG9A 4GL2A 2CLCX 4Z1MA 4FCWA 1XTJA 4LPSA 5JS7A 1JR3E 3CBQA 2GDJA 1LW7A 2IF2A 3PXGA 2VYFA 1U8AA 1OH7A 3NHBA 2WWHA 1OE0A 1Z28A 4TL7A 1VG1A 1OV4A 1S9HA 4OI1A 2GK6A 1E79D 2X8AA 2I1QA 4XJXA 1CULC 3LD9A 1AN0A 2VIIA 3OE7D 1QHHB 1XEXA 1KI1A 3N5CA 1KSGA 4C0QC 1KIMA 1Q3TA 1KHTA 2VO1A 4HDCA 2W2VA 4DLTA 1T3HA 2FA9A 1UEIA 2VSFA 2V54A 3KXLA 5G3YA 4C3ZA 4LBVA 5JJIA 4IOLA 3A36A 2BMFA 1HE1C 1VHTA 4Q9KA 3UG7A 5AUPB 1W0KD 1TQ6A 2NPFA 4F91B 1ZAKA 5FPYA 1SULA 4LBZA 5KSPA 1Z2AA 2O8BB 2D2FA 2IS1A 4UNPA 3CNLA 3WRXC 2Q3MA 3EASA 2F1HA 2WBLC 5GJCA 3I73A 1NNEA 2IW3A 3ZVRA 1IN8A 4Q18A 3LLUA 5IRCD 2FPMA 2ONKA 2AXNA 3Q8XB 1NBMD 2JJ1A 2YOFA 2OLJA 4I1OA 2YINC 4HAUA 3BH0A 3TUJC 2G3YA 3CZQA 1XMSA 2ZS7A 1RYHA 5DHAA 2XNDD 3ZDQA 4NYMR 2B6HA 1CR2A 1OFHA 3TQCA 2ZAOA 5JS8A 1QHHA 2PL3A 4Q47A 3FB4A 1N0UA 2BMEA 4P4SB 3U6BA 1OXXK 3FGNA 4LI0A 4KCGA 4TT3D 4LJ7A 5C2JB 3WBKA 2XB2A 1ETUA 1BOFA 3B5JA 4HAYA 1E9SA 1J70A 3FMOB 3PENA 2ZROA 2OBMA 5G40A 2FH5B 2P67A 3GEHA 3SJBA 4K81B 3SHWA 3QJYA 1E4VA 1E9CA 4TZ0A 1U94A 1XEWX 1H8EA 3P32A 5HR5A 1OH5A 3ZD6A 1D9ZA 2ZRMA 1IJFA 1N25A 2ZRLA 3IHLA 1T0HB 1N5LA 4MGYR 4BZQA 5DI3B 2AXPA 2EWWA 4DLVA 5BN3A 1OJLA 2B7CA 4C0LA 1G8HA 2XOKD 1E0JA 2CE7A 1ZM2A 2PJRA 3L0IB 4DLXA 3V4FA 1TQ4A 2QENA 5H68A 1E99A 1NBME 3SBEA 3TSWA 2VHCA 1LV7A 2JDID 2Q3HA 1EX7A 3K1JA 1QHGA 3GFPA 3I1FA 1G19A 2A3RA 3SJZA 1KMQA 5F98A 4MGZR 1XF9A 4HB0A 2JASA 4P4SA 4Q48A 2FG5A 4MA4A 1L4UA 1T8TA 5FR2A 1E9FA 1AIPA 1Z06A 3GJ0A 4B2LA 4BE7B 4D4JA 2D74A 1RIFA 3CNNA 4HLCA 4OQFA 3TIFA 2MSCB 3MWKA 5JCPA 1KMHB 3GLIE 1ZIOA 1V43A 3THOA 2FX3A 3LXRA 3KXIA 2CMKA 4X8MA 2O8FB 3U3MA 3GFOA 3OEHA 1KJZA 4L16A 1XCPA 1WB9A 5KOYA 1GITA 4OQLA 5TY0A 5JRJA 3SN6A 3IHWA 4JBXA 1WF3A 5EE0A 1G8GA 1W2HA 1XD2B 2OCBA 3CF6R 5DI3A 1RVDA 3UANA 3QF7A 4LX0A 2IYUA 5CYOA 2JLVA 4Q1DA 1XZQA 2OCYC 5J4YA 1GKYA 1G5TA 1HURA 3QXJA 1Z0IA 3LFUA 1NMXA 3LQRA 2JGNA 1TU3A 4WIAA 2FGKA 4TWZA 2HYIC 3C16C 4D80A 1TUIA 5JWHA 1OH8A 3AF2A 2NZJA 5JECA 4C0KA 2D06A 3CRQA 2VP5A 1P60A 4QGAA 1OIVA 5FFMA 4LGMA 1JI0A 1IQPA 2C78A 3SE0A 2IX3A 2SHKA 3MLEA 5DNYB 3BIFA 4Q03A 5KUTA 1KMHA 3K0CA 1M74A 2A5GA 3KKMA 2ECKA 4HB2A 5FUXA 1N3BA 1WQ1R 1XX6A 3MRSA 3MWYW 3NC1C 4BFTA 4GFDA 4DIDA 4PQFA 5IDVA 4FMCB 1T3LA 3SU8A 3X2SA 5AJWA 5JWRA 2ZI5A 4NYJR 4CEHB 2ZE8A 2NZ8A 3TLXA 3WYGA 4AD8A 1F48A 3KKPA 2R6FA 3ZJYA 2NO1A 2ZYVX 4DB2A 2VP0A 1LS6A 4BFVA 3NIBA 4II7A 4LBWA 1W4AA 2XTZA 3MAAC 2A5FA 3O47A 4W9MC 2ZYWX 3IIKA 4R2IA 2CBZA 4GRAA 2CL7X 3T1VA 4Q4LA 4IFBA 4QNRA 2CNWD 1MRNA 2ZR9A 3IQXA 3P27A 5AK0A 2AHOA 5FH9A 1N6IA 2IYRA 1GKIA 4IOKA 4LYAA 3ZVLA 2FN4A 5BN4A 1DG1G 2PMKA 4M1TA 4M9SA 4Z8XA 2YZ2A 5FL3A 1E1RA 3PITA 1EG7A 1JJVA 2PCLA 2DFKB 4ARZB 1E2QA 2IYZA 2YHSA 5A4JA 1G291 3P26A 2XSZA 4UJ3A 1DE0A 1U0HC 5GJBA 4XVQA 4H9GA 2YWEA 2W6JA 4YC7A 3HU2A 3HPQA 4JLMA 1GRRA 2OG2A 3SYKA 1HY3A 1SQ5A 1RE0A 1SVWA 1ZCBA 2J7KA 4DIEA 4E09A 2XITA 3D7MA 3OFND 1IXSB 4CEHA 3IILA 1TEVA 3BC1A 4TMXA 1IXZA 2O8FA 1BYUA 4U5XA 2LCFA 1NG1A 2O8EB 1Z6AA 2GBLA 1YRBA 4KITB 3K9HA 4HDQB 1L8QA 2OAP1 3QXHA 2H5EA 2QRZA 1NF3A 2ZRCA 2P5TB 2XZLA 1CR0A 2BBOA 2VP9A 4V0OA 4FCTA 5DHFA 2UZIR 2QAGC 1VTKA 3CH4B 2ZSEA 4TL9A 1JR6A 4JLBA 1Z8FA 3RDPA 4XVUA 2WPDD 4YQFA 1S9DA 1ZVQA 1BKDR 3QE0A 4ARZA 5TV2A 3UXMA 3NBXX 3EG5A 3AH8A 3B8HA 3NBYC 4IDHA 2V7QD 4RZ3A 4GOJA 2AD5A 2QM7A 5HKKA 2PT5A 3AP3A 4NBSA 5E3HA 3R8CA 4LJ4A 2XJ4A 3T5GA 2L0XA 5B58C 4UNQA 1XEWY 3AP2A 5FBVB 2QTHA 4L9WA 2QAJA 2CJWB 2EFDB 1XXHB 4Y0AA 5GVSA 4N3NA 3IGFA 3FDIA 2HUPA 3PG5A 5FUWA 1Z47A 2B8WA 3FTQA 1VG9B 2P3SA 5KPJA 1XB2A 2IWRA 1OKKA 4RFSB 3THWB 5FR1A 2BJVA 2ZIAA 1H8HD 2F43B 2FGJA 2ZRBA 2O8EA 3PUYA 2EU8A 2H16A 3AGPA 3AKYA 3M1IA 4OHZA 4MGIR 1FNMA 4DDWA 4QRHA 5BQ5A 3K9LA 3KKOA 1W49A 4JIMA 5EE9A 2QE7D 4EJSB 5KNDA 4KFRA 4B3DA 1XFAA 2TMKA 2IXGA 1KY3A 3ECCA 4LK2A 5AR1A 1RPZA 1GL6A 2WIBA 1W47A 3LA6A 1SHZA 4FWIB 3VR4A 1W44A 2ZI9A 1U8YA 4L4UA 4B6FA 5FOXA 2WSMA 1KNQA 1Z6GA 1KJYA 2R6AA 2ZRJA 4PAMA 3EX7C 4JL6A 3TW4A 2QN6A 2KE5A 1EFTA 2OT3B 5TB5A 4KBGA 1MOZA 4G5SA 3KXKA 1K5GA 2CJWA 3LVRE 1LY1A 2I4IA 1XXHA 3PUZA 3Q72A 4TN1A 2ZS8A 4BFUA 5JI2E 1F3OA 3LNCA 3QENA 1COWD 2NG1A 1GILA 1ZNYA 2QEQA 3D6TB 1TNDA 4PHTA 5EE5B 4GI7A 4F93B 4XSHA 4RFSA 4FMCF 3RRYA 5EP3A 5J4VA 2FSHA 3THWA 3RS5A 5G3ZA 2F43A 4OQNA 1OB5A 2EFEB 1P61B 4MRPA 4JSTA 5TMPA 3EPKA 3BH7A 1S1MA 1XU4A 3MD0A 3A1UA 4GOKA 2Z6VA 2HJGA 1HYQA 1RRGA 1PLJA 1BMFD 4YXWD 3CB4A 4EJSA 4HATA 1NJGA 2VF7A 3ZD7A 4K8OA 5IK2A 3AVWA 1DOAA 2CHQA 1DARA 4B32A 4V03A 5AUQA 2IL1A 3I62A 2H7VA 2WSSA 1E0AA 1JQJC 4U02A 3EPJA 1E2NA 3TJZA 2RHDA 3I92A 1KKLA 4C9BA 1U8ZA 5K8UA 4LJ8A 3U5ZB 3GJ6A 3PEUA 1E96A 3W8RA 4A92A 4D4MA 4KV9A 4TZ6A 5JSZB 4A2QA 1Q3HA 1W4RA 3AM1A 3VTKA 4OQXA 2Q9CA 3REGA 1FUKA 1AS2A 4PC7A 1VCMA 2E9SA 1Z0FA 4EDHA 2FZ4A 1HEIA 1P6XA 4N1AA 1S3GA 5H70A 1KI4A 1NMZA 3BFVA 4P3YA 4IOMA 1WRBA 3T12A 5JHHB 4QKQA 2ZI7A 4QM7A 4J0QA 4TTRA 3AF4A 3EZ2A 4LSGA 3WP1B 3BBPA 1ZM4A 4WZBE 5EUMA 2BKEA 1KY2A 3A1WA 5KDLA 1N6NA 3SFVA 1DAMA 4G5QA 2ZE7A 3I32A 1N0VC 1ZUIA 3MWJA 1IAQA 1OXUA 4HAWA 2ASEA 4PTLA 221PA 4CYMA 2AK2A 4R2HA 2WJVA 2EYQA 2QPAA 4JMPA 4ESVA 4AKHA 2PBRA 4DBLC 3RVBA 2KWIA 4EPXA 3I5YA 2HDNB 3RWMB 1G20E 3TR0A 3C5CA 4HZIA 4PHHA 2EW1A 4JYBA 5DSZA 3ZQJA 1XTSA 1DG3A 4BZPA 3ND8A 4D0NA 3BWDD 3K70B 5BN5A 1XP8A 1F5NA 5JSZA 1T0JB 3AV0B 3GLFE 1X1SA 3BERA 3K0AB 5AJYA 4D0GA 4RD4A 1ZINA 4GP7A 4JT2A 3B1ZA 3W90A 1A82A 2ZE6A 3E2IA 2W58A 2ZRKA 1K5DA 1SVKA 1UKVY 5ELXA 2RGNA 3QF4B 4RZXA 1KK2A 4IVPA 4OL0A 2VH5R 4HAVA 2CK3D 3AUXA 1GRNA 3ADKA 4IW3B 1KGDA 2J41A 2QROA 2F3RA 4Z54A 2O0KA 1GVNB 5FOUA 1CJMA 3D3QA 1GNQA 4A4DA 4E03A 1DAKA 3QVVA 2AR7A 4Q19A 1Z6YA 5KU1A 1EFRD 1WXQA 1Z0DA 4C2TA 2WAYA 5HCIA 1DELA 3I72A 4OQMA 4GNKA 1U0JA 2H1LA 4NTZA 4DSNA 2AK3A 2NO9A 4FCVA 2BWJA 1SXJD 2V6IA 2YYZA 3G82C 3AVYA 1YHNA 1YRAA 1JALA 4EAQA 3A4LA 1X3SA 2YWGA 5EE1A 3VKGA 1NVXQ 1NY5A 1ZU5A 3VR1A 4EFLA 4O0MA 3HR7A 4Q1AA 5FTJA 3DPUA 4C30A 1FW6A 1ELOA 2NPIA 3AKEA 3K0AA 2YOHA 1G8PA 4YLGA 3BB3A 4WBSA 2ZJ5A 3HYTA 4B35A 1R5OA 4JLAA 3BGWA 3ICQB 3T5DA 1F6BA 3AVOA 2XNSA 2CVHA 3ZS9A 2ZM5A 2MSDB 1YZLA 2XX3A 3UIEA 1WMSA 1CRPA 4CT5A 3QF4A 1X86B 2D2EA 1UDXA 4MUBA 1R5BA 2IYSA 1KTVA 5FTKA 1JR3A 1UKEA 1SKYE 1UBFA 1N6KA 4JS0A 1KI6B 1E0SA 3SS8A 3EA0A 1E4YA 4TSFA 3W9YA 1IN6A 4FWTA 1KI2A 3X1DA 1OLOA 2XZPA 1TF2A 4OJKA 3SOPA 4A0GA 1SVLA 4NHOA 1DO2A 4E22A 3U60B 3LO5A 1AK2A 3GPLA 3SQXA 4L15A 5JEEA 2OHFA 1CXZA 1O87A 3RS0A 3RS3A 4H1VA 3HWSA 5CB8A 3B9PA 4WVFA 1AS3A 1OHHA 1KI3A 3NH6A 2IHYA 4V0LA 1ZW6A 1TMKA 1SXJE 1U9IA 4A6PA 4PO1A 3TW8B 4KFUA 5DLQC 1E9AA 1E1QD 1U98A 4B48A 3GJ7A 3ZVNA 1O3YA 1ZNXA 2F6RA 2C9OA 1EFCA 3VKWA 1Z5ZA 1TTTA 2GAAA 4JT4A 2Q9AA 4ZIRB 1XRJA 2RGEA 3NDPA 1UBEA 4G1UC 3CX8A 4MITA 1Z3IX 2OXCA 1RYFA 2C98A 3GCGA 2WIAA 3I61A 3EWAA 1U9IC 3EIEA 5JEDA 4HB4A 2N42A 1N6PA 5KO2A 2J7PA 3B13B 3SC3A 1WCV1 1EFHA 4LWZA 2JLWA 1G9XA 1KI6A 3DZDA 2OESA 3TBKA 1NI3A 5B2ZA 3LY5A 2I3BA 4ZKEA 4BUJA 2G9NA 4O3MA 1EX6A 3KJIA 1Y3AA 2ZSDA 2WOJA 3AVUA 1PLLA 3NWJA 4BRWA 3P4YA 5JZVA 4AG5A 2JLSA 4LHWA 4B44A 2FFQA 2BHRA 2ZRHA 3AVPA 3QQ5A 3RHFA 5D3MB 4JVSB 2KBFA 1E79A 3KDSE 1G5PA 1DS6A 2ZRDA 3KJEA 4Q7MB 1MH1A 2WJYA 1A2KC 2ZE5A 3TMKA 4R7ZA 4MDEA 3L82B 4WXRA 4ON9A 3BB1A 3WYAA 3BS4A 1P9NA 4D2IA 2ZJOA 2QGNA 1TL7C 1N2CE 2HCJB 4JLNA 1QBKC 2CCJA 3NKVA 1ZD1A 1U99A 3WY9A 4LY6A 2ZJ8A 1KSHA 2ZI6A 3GLIB 2B8TA 3BRWD 1KNXA 2A9KA 4ZIRA 2BEKA 4QGFA 2VP4A 3A4MA 1W0KA 4RD2A 5BWMA 2IWHA 1ODFA 5HCNA 4B3BA 2IEYA 1XCGB 3QKUA 3EAQA 3PCRB 2UKDA 1AS0A 1OYYA 2ZSFA 3QEOA 4TL6A 3SNHA 2GEDA 2RGGA 2HCBA 2ZQ5A 3L43A 4TLDA 1SVSA 4LHZA 1TUEA 1FQKA 521PA 3T15A 4DLRA 4Q1CA 2MSEB 2F1JA 2OFOA 2F1IA 3GEIA 4PSKA 4Q4AB 3RNLA 5H8WA 1NBMA 3C14C 2GZHA 3LH5A 5SZHB 5FI1B 1W4BA 1G7RA 2V9PA 3PVSA 3EC2A 5EP1A 2HT1A 2FF7A 5DO9A 1ZC3A 1VHLA 2XNDA 3JVUA 5D3MA 2VLIA 3FMFA 4F4JA 2D4HA 1Z63A 1TF7A 2OSBA 1XD8A 1BS1A 2ZEJA 1CJTC 1E6CA 4TLEA 1MR3F 4BPBA 4D25A 4OKSA 1WDTA 4TT3A 3VHLB 3GLIA 3KX2A 4CGZA 1FUUA 3BFXA 1QG2A 3C4JA 5J4KA 3KUCA 5SZKB 1CS4C 4UNSA 1J8YF 2B21A 4I4LA 4IOJA 2B92A 4TQUS 4Q9JA 3QUSA 4BLSA 1WP9A 3RS2A 4F7WA 3S1AB 1EXMA 1ZIPA 2BJWA 2G83A 5E7MA 3RRNA 2PCJA 5JJLA 2VHUA 3NBZC 1YZGA 4NL4H 1A7JA 2IXFA 2IYYA 4ZCLA 2P65A 4GZLA 4IVQA 4JLVA 1IY2A 2AKYA 1HQCA 1T4GA 3DMNA 2RGBA 4Q4AA 4Q7LA 3HDTA 1ZUHA 8OHMA 2IS4A 2XOKA 3RC3A 3WNDA 3UWOA 1Z2CA 1KI9A 2AD1A 4AYXA 1BH2A 1D8TA 1P73A 5B30A 2WHXA 5KSYA 4PR0A 5FOWA 3VU9B 2JJ2D 1E2DA 1E9DA 3V9PA 3RABA 3OEED 4HYYA 2O5VA 2IS2A 1G7SA 2HXSA 4TLAA 1GUAA 1RKBA 2QM8A 4JL8A 1ZD8A 3AB3A 3UWKA 1VMAA 2XTMA 3WMGA 1YVDA 3F8TA 4ACAA 1E2LA 1J2JA 1DAFA 2JJ1D 4HLQB 4B74A 3AGQA 2D7DA 2NO7A 4LYJA 3U7HB 4OHYA 1DBSA 2BMJA 3OF5A 2GWHA 4B71A 2O8BA 1UF9A 4RKFA 3QVUA 3CUEF 4P4TA 4ZPXA 3S1AA 3DL0A 1R4AA 4KVGA 5DN6D 1G8YA 4LC1A 2OLKA 3RANA 2E1RA 3N2IA 4DUGD 2QQEA 4P32A 5CK4A 4B76A 5JCZA 2IUTA 1KKMA 4WW0A 5LBIA 4KBFA 5L3VA 1I4TD 4QBGB 3WNBA 4AKIA 4DT1B 4URZR 2J0QA 3GJXC 3ZIAD 5HTKA 4TQAA 2CL0X 2PH1A 1QHXA 1WE2A 1W5SA 2AFIE 2ODWA 1E9BA 2W83A 2WV9A 2Z0MA 3W3AA 3DOFA 3DVLA 1NIJA 4P33A 4C0AC 3M4YA 2ZPTX 4R71A 4RZUA 3PV0A 3LQQA 5KDOA 1M7BA 2HXYA 3VU9A 4M9QA 2YV5A 2Q9BA 2GILA 1Q1ZA 3A1VA 4US0R 3B1WA 1H8ED 4URWR 3GJ4A 1U90A 4X8HA 3J81k 1V5WA 4A2PA 2QQ0A 4DSUA 1MKYA 2GXUA 1VCOA 2JLZA 4C0HA 3C15C 1P2SA 3TGPA 1R7RA 1WBDA 2QNRA 2PT7A 4MRRA 1XZPA 2WOOA 5F2EA 1R6BX 4HLUC 3EXAA 2GF0A 3K53A 4RD1A 3TNFA 2EFHB 5F9HA 2REBA 5GJWC 4PFSA 4QHYA 1UBGA 4IDPA 3BAFA 2XXAB 2NIPA 1LS1A 4JJZA 4Q9IA 2BBWA 4TMKA 2GNOA 4ZI2A 4BECA 2ZAMA 2OBLA 4AIIA 3QG5A 4ZI3A 2HT6A 3LW8A 3BOSA 4MKIA 1FP6A 1KDTA 4DT1A 2D7CA 4PANA 1XDBA 4HAXA 4Q1EA 2CXXA 4Q21A 3U7FB 4AYWA 2JEOA 2ZJZA 3OESA 5CITA 4P4UA 2BOVA 1NSTA 3TVDA 1NJFA 3ONWA 2FE4A 1QZXA 2P6RA 1R10A 2CNWA 1YZKA 2J46A 3V00A 1CR1A 1LVGA 5JHGB 1NL3A 1YR7A 1LNZA 2IA5A 4IKEA 3B9QA 1W7AA 2ZU0C 3PIRA 3RAPR 1K6MA 2QAGB 1P4SA 1S8FA 5AWFC 4AWXA 1N6RA 3CWZA 4UXJA 1JBKA 3DEFA 4LV5B 2JIZD 1PUJA 3BFKA 4YMWA 2E87A 1QRAA 1E32A 2X1VA 2CCGA 2A2ZA 5FBQB 1W36C 5GADl 1KI7A 4GOXA 3V4RA 4M1KA 2ANBA 3B1YA 4V0KA 2NOAA 1W36D 2XXAA 3KFVA 1US8B 2AWNA 4TQ9A 5A5GA 4HZUB 5FBRB 3CPJB 1T8UA 1W48A 2YC2C 1XTKA 4KJZA 3VQTA 3FHTA 2ZRIA 1DAHA 4DDUA 2NGRA 3ADBA 1KAGA 3P4XA 3EPHA 4NMMA 3MWLA 5GVRA 5AJVB 1I2MA 1AJEA 3ETLA 3A4NA 1Z08A 2R9VA 4IEIA 2G0TA 3CWQA 1Z22A 2GEUA 1QHIA 3SFZA 2GJ9A 4FXPA 4JVMA 4BASA 2V8OA 2W6ID 4QXAA 3KFXA 1OFIA 5GJVC 4CF7A 4CZ2A 1ZUNB 4UKDA 5FPTA 1L4YA 1TQDA 3ADCA 1HQYE 2A78A 4LYHA 1F60A 3SR0A 2WTUA 2QAGA 2QP9X 2GEVA 3KB1A 2W2TA 3C5HA 4OK6A 3VMFA 1P72A 2WPDA 2IXEA 4LV6A 1Q21A 4NYMQ 3GD7A 3RC8A 2R62A 2C77A 4DB4A 4PPQA 4M22A 3QOFA 2V7QA 3E1SA 1OXTA 2XZOA 2ZR7A 5E4FA 2ZRNA 5EJEA 2GHIA 5K8IA 3NEYA 1TADA 2DY1A 4M2LA 3IPXA 1GIAA 4D82A 1US8A 1JXOA 4ACBA 2HF8A 4HZUA 1G3RA 3CNOA 3KKNA 5DH9A 4BGDA 2QG6A 1NIPA 3VAAA 3KQKA 2UVQA 1AGPA 1E1RD 1ESNA 4US1R 2QP3A 5DYGA 1G7CA 5DYIA 4MGKR 5HZHA 4DJTA 5FOTA 4DSTA 2J3EA 3H1TA 2A5YB 4ASUD 4XD7D 4YDSA 4TMVA 2BCJQ 4BLOA 3GFTA 1WA5A 3CX6A 3RYTC 1GRQA 2QE7A 3BXZA 5EZ5A 1IXRC 4Q7JB 4DZZA 4OI0A 5DGXA 2KSQA 1HV8A 4QBIA 3IO5A 3SI7A 3CRRA 3EARA 5LD2C 5KNCA 3K9GA 2DR3A 4LJYA 1J99A 4M9XA 4MRNA 5EQTA 3CLVA 3GP8A 4IDQA 4BFZA 2N1BA 1P9WA 2ODNA 2WZQA 3FFBA 3EWSA 5J40A 3GLFB 4C0BA 3EPLA 3WYFA 5L3SB 2HJVA 2W0SA 1S3SA 1ZYUA 2ZUCA 5FPHA 3QBVA 4ZCMA 5LPNA 3QKRB 4YMSA 4DKXA 2QPOA 1I4DD 3DDCA 1QG4A 2G0NA 2VP2A 3MCAA 4O25A 2RAPA 3W8NA 5CIWA 4BZXA 1COWA 2OFWA 3ICEA 2QMOA 3Q7QA 3SDZA 5F9FA 1Z07A 5G53C 2D62A 2YWFA 3LBHA 4US2R 1GM5A 2BVNA 5B57C 3BB4A 2RKOA 2GCPA 1Z29A 4OHWA 4JJKA 3L2OB 3OIUA 1C9KA 3PJRA 1ZU4A 3DO6A 4MDFA 2ZR0A 2ZJ2A 1Q44A 2QP4A 1CJUC 2OBNA 4KSBA 4CT4B 2IC5A 1D5CA 5FTLA 1BMFA 2J1LA 2QT1A 5FL7D 4EPRA 4RFVA 3WXMA 3AKCA 2REXB 4RVCA 4C0SA 1OB2A 2ZXUA 3TUIC 4UXHA 3FWYA 1NRJB 3CR7A 3B6EA 4CIDA 2Z4RA 1S0UA 2ZRGA 1YQTA 4LJ6A 1UADA 1S2MA 2ZITA 4V0NA 4DCNA 1KO8A 4BFYA 3GLFA 1NLYA 2IF0A 3SJCA 5L3SA 3AKDA 1E2EA 1XD9A 2GJKA 2GA8A 2PEYA 2FPKA 3NG1A 1D6JA 4XWAA 1JPJA 4CVNA 5J5CA 4C2UA 4ZCIA 4OYHA 3QKRA 2QMUA 1JQLB 5CJPA 4PHGA 1E94E 3NH9A 1D9XA 1MO5A 3E5HA 4LUCA 5KYKA 3OIYA 5CM8B 4FMDF 1G7TA 4WZ6A 1KO1A 1XPRA 2VHQA 2C2HA 1NN1A 5HE8A 1SKYB 4YMVA 2WMOB 4PO9A 3W6PA 2OUKA 4NYJQ 5HZKA 4A36A 4PPGA 1NN3A 4FN5A 1H65A 2BKUA 3ZVMA 721PA 4AKGA 1E0KA 2GXQA 1T5LA 1FOEB 3EZFA 2Z5FA 5DISB 2RGCA 1E9EA 1M7HA 2VA8A 1TU4A 3GEEA 3H4MA 4Q02A 4A0HA 4DDVA 4YMTA 4WXPA 4XSGA 5C1BA 5J4LA 2CHGA 3LDAA 2HF9A 2OCAA 4IXNA 2KBEA 2PMDA 4JLPA 4DCSA 1E2IA 4DEXA 4KFTA 4Q1BA 4ZKDA 1SXJB 1EWQA 1KOFA 4XTCS 4KXFB 3R8FA 5TVKA 1F2TB 4QHTA 3RLFA 3CONA 3QI2A 2PX0A 5P21A 1UKYA 4LV8B 4MUAA 1GG2A 4O2LA 1VPLA 4BFXA 2XAUA 4LZZA 3CO5A 1UM8A 4DLZA 2RB4A 3I5XA 1XTQA 4F4IA 3THXB 1E3MA 2J59A 1ZNZA 2CE2X 4QJ3A 2FMXA 2QTFA 1JAHA 4FW9A 2OE2A 2WSSD 1RRCA 1R2QA 2BCGY 4M4SA 1NKSA 4IXMA 2QT0A 3AQ4A 2VF8A 3MFYA 3CPHA 4Z51A 1R8QA 3VR3A 2WICA 3SYNA 2CK3A 3MSXA 1FFHA 2DWOA 4LCBA 2FFHA 4D4LA 1ZC4A 1ZM3A 3VFDA 1DPFA 4M1WA 1G3IA 1AGRA 2LKDA 4QG7A 4KHZA 1RJ9B 5CB6A 1QDEA 4DCUA 1A1VA 4KU4A 1OIXA 1II9A 3OZXA 3DZ8A 1G3MA 1YR6A 4XTRA 3QIAA 3H86A 2WAXA 1EFRA 1LFDB 3PEVA 5EXPA 1DEKA 2XTNA 5CDFE 3ADDA 4V0ME 1GSIA 1OXSC 3H2YA 3I3SR 3WHKA 1F2UB 4Q4HB 3ZZ0A 1SXJA 2NQ2C 3TVTA 2VRWA 4CEIB 2ATVA 3VHXA 2C04A 1XTIA 3IPYA 4DSOA 1F2TA 1AKYA 1KK3A 3LBNA 4KFSA 2HLDD 4HEJA 1HT2E 1HTWA 5C4MA 1IJEA 4BLTA 4F38A 3CM0A 5JBQA 1JEDA 4KODA 4NP6A 1XMJA 2DWQA 4A6XA 5AUOB 3AVQA 3THXA 4TMWA 1SXJC 1YR9A 4RJLA 3D8BA 5CLQA 4B34A 2VSXA 4QL3A 3DHWC 2QMHA 4N0DA 4HUTA 3HPRA 3SQWA 3IDQA 1R0XA 3CRVA 4ZV4A 1AZTA 1G4AE 4D6PA 3UKDA 5FUYA 4M53A 1P2VA 2QGZA 3VNVA 3I8SA 4DLYA 3EA5A 2H8KA 1RJ9A 1C1YA 1OF1A 621PA 1A5TA 1Z6TA 2A7QA 4HAZA 1AA9A 1W4CA 2QSZA 2C8VA 2R8RA 4MKHA 3AP1A 2ORWA 2GK7A 4JLOA 3KKQA 3EC1A 3T34A 4E5UA 1QHNA 3DM9B 2EWVA 4YMUA 4EFMA 1F2UA 4Q4HA 1PVOA 2FSGA 4PC1A 4DRZA 5FPKA 2GVDC 1C4OA 5SZIA 4CEIA 5D3QA 1DTSA 1NVVQ 3PEWA 3R9IA 3KQUA 4KI0A 3O8RA 4KYIB 2FU5C 2G1JA 4EIWA 4FI3C 2J45A 5DI9A 1GL7A 2Z83A 1Q22A 3C41J 4Y0VA 2QY9A 5CK5A 1RRFA 2BDTA 3GJ5A 4TLCA 4NCIA 1D2MA 1OXVA 3ZQ6A 3L0OA 4PZLA 2R44A 3T35A 4RD0A 1GFIA 5B64A 4AYTA 3ASZA 1DAGA 1G41A 1GL9B 1PJRA 2QL6A 1TF5A 2DBYA 4WAUA 5M04A 2GZAA 5JJKA 4G5OA 1TAGA 1X8KA 2ORIA 4NONA 2OO7A 1AKEA 1QHYA 2ZI3A 3GLGE 1KAOA 2DFLA 3U3KA 4D81A 2V4ZA 2XJ9A 1W0JD 1VIAA 2PJZA 4PSAA 2OAQ1 1VDZA 2FZLA 4B3XA 4DHEA 3K0SA 2VSOA 1CJVC 1ZBDA 3C8UA 1AQUA 3U61B 2W2XA 2IYVA 3VX3A 4L9SA 3IO3A 4TTQA 5G41A 2GCOB 1P3JA 3B78A 4AKEA 1PV4A 3W3ZB 2F1RA 3FHCB 3QPUA 4Q4JB 3FYHA 3CIOA 3QPWA 2N46A 4RSGA 3IEVA 4OI4A 5J4HA 1JR3D 4URVR 3FHOA 2WJJA 4ZDIA 2WJHA 3UG6A 2X19A 2EVWX 3QPVA 1TQ2A 2CVFA 3EW9A 2BBSA 4M8NE 2C9YA 1N6HA 5AJZA 3M0EA 4OJQA 4ABYA 4IDNA 2VBCA 2EQBA 1P5ZB 3VR2A 4TL8A 4DXAA 2FNAA 3PFIA 2ERYA 4NE2A 2ZRFA 3W6OA 2C5LA 3OE7A 5K8TA 1A4RA 4A8JB 3KB2A 3QXXA 2JLYA 3LVQE 2JLXA 2H18A 5CM9C 4DEYA 1WBBA 3ZYCA 3ZH9B 4IVRA 4LHVA 2O8CB 2EYUA 1OT3A 3LW7A 1N5KA 2O0JA 2A5DA 4X8LA 4UQOA 4PZYA 3FPAA 1SVOA 1N5IA 1RW4A 2GCOA 1CJKC 1KSFX 3GLHE 5EZ6B 4Q4JA 1YZNA 4B3GA 5JRZA 4QGGA 3BORA 4XIGS 1JAIA 4KYUA 5DE3A 4A15A 1UEJA 2C99A 3R9WA 4PPNA 4ZDKA 2IT1A 1X1RA 3FKSD 1VCIA 2H92A 4Q01A 4UNRA 1XJQA 2ZUDA 3DKPA 5C46F 2OILA 2CHVA 3R20A 4MQBA 3LRPA 2FWRA 4KAXA 3SEAA 1ZNWA 2BMDA 5FOVA 4B33A 4EPYA 4NH0A 4JVLA 2ZYUX 3OAAD 3U3RA 2GTPA 2VTKA 4YDHB 5EXSA 1GAJA 2PX3A 1OW3B 3Q5DA 2ZTSA 2UZ3A 2GKSA 1J7KA 1FQJA 4Q7KA 5J47A 1EGAA 3T1TA 3LV8A 3TUZC 1JPNA 1G3UA 1BO6A 3KJGA 3W34A 4BEJA 1NLZA 3K0EA 3ZGXA 3E70C 1GZSA 2OV2A 4A8JA 4Z1MD 3LX5A 1P2TA 3ASYA 4NCHA 3RSOA 2O8CA 1G18A 3EZ9A 1LF0A 3A6PC 2Y8EA 4OK5A 4PO8A 2R6GA 5UKDA 1M2OB 4RCZA 5LDDC 3TR5A 4EUNA 3Q9LA 4LHYA 1JNYA 2P0EA 4EPVA 3KQLA 3NDBB 2JATA 4A8JC 4PZZA 2JJ2A 1EK0A 4LC0A 3AF0A 3K9NA 3OEEA 1KYIA 4ILEA 121PA 4D4KA 3C7KA 1G16A 1NG9A 4HUQB 3JZAA 3Q5EA 2RMKA 2ZVPX 3N70A 2W00A 4PAQA 1IN5A 3AEZA 3GJ3A 1ONBA 1L7VC 2HV8A 2O52A 3EIQA 2ODBA 4QBHA 1M1YE 1FPMA 1SVMA 2ZSAA 4W7SA 4GBMA 2JLUA 1CF4A 2ZI4A 2BEJA 2GF9A 3IBGA 2YNMA 2YWHA 4YONB 4KSCA 1VYUA 4DDTA 2BIFA 5DN6A 3QXSA 1ZM9A 1JJ7A 2JDIA 4DUGA 1YZQA 3KUDA 2BC9A
chains in the Genus database with same CATH superfamily
4Y30A 1X7ZA 4C7KA 3HGMA 4EQ6B 3GQBB 3WSWA 4IIHA 4RPCA 2IYXA 4MVJE 1G63A 3FE2A 3U37A 1C2TA 3P2YA 1K3UB 1Y9EA 4NFLA 1KERA 2IHVA 1Z7BA 2A86A 3SNKA 1XZDA 2Q28A 2WWIA 4HNAB 4LRXA 1L7XA 2J9YB 1VRCA 2PY6A 1Z83A 5JSUA 5GY7A 3OHMA 4ZVMA 4EFNA 2IPNA 2PLNA 3A37A 3PR1A 1S8AA 1CEQA 2L69A 2R4TA 4KGDA 4NZ9A 3VPGA 3MJSA 3ZZTA 2VBIA 5T7BA 4BDSA 2BSQA 1XPUA 3K92A 1H2HA 3ORYA 1B2LA 4C07A 1K66A 2P9BA 3Q3VA 1ZEJA 3HXTA 4NI5A 5IXYA 5DYTA 3H83A 3PFHA 1DJQA 4I9FA 2ODPA 2QRNA 3CZ5A 3KZXA 1A95A 4EI9A 4BX8A 1V8OA 4H18A 4JEUA 4MVJF 5LNK1 5HJ7A 3FCOA 1CZNA 3B60A 2Q6OA 2CCKA 2OZEA 4Q66C 3OD1A 3R4VA 2ORYA 2QVZX 4CKBA 4CTKA 4RTQA 1EBFA 2WKRA 3KTAB 3D6FA 3OCJA 3QBEA 4EFDA 1FFYA 1SZDA 2ZSKA 4J1NA 5ALDA 4AY2A 4DWVA 3BE4A 1AMOA 1CY6A 1JECA 1NURA 1VHJA 1Z4LA 2IPMA 2J4FA 2O1WA 2WMNB 2IQ5A 1GPJA 4H1TA 4UHBA 2J32A 1YZ3A 4RY2A 2PNFA 1YQXA 1VSTA 3P0IA 4HRXA 4RTLA 3OTIA 4MR7A 4TS3A 4YI5A 3WK9A 2I91A 4KQEA 1PK9A 3UTCA 5IYZA 3N2KB 2WTMA 2PO5A 4LJKA 4BVAA 2PYDA 1CIPA 4OMDA 4DLAA 4X6YA 5E9JA 4EENA 3VOTA 4LN1A 3HK2A 3RWBA 1SAYA 4W5QA 5AMXA 3GDHA 2PRJA 4FGSA 4K0RA 4NYIQ 3R24A 3ZWQA 3IYLW 1MPXA 4J1SA 1GAQA 3EB9A 4P83A 2G4CA 1U8EA 3DMHA 3LRXA 3QKSA 3NIWA 2EF1A 1R0LA 2PKRA 2VSNA 3KZ1E 1TJ4A 4GMXA 4Y98A 3JQAB 1KYTA 1CUJA 4Q1VA 2DLDA 3Q85A 4HQKA 4IRXA 4XQEA 4JOCA 2YZKA 1KDOA 1PIWA 3BICA 3KU4A 2AUNA 1I1QB 1ZFNA 1T9HA 4D8YA 3ESZA 3DBHB 3NMUF 4Z3DA 3UMRA 3EODA 4EG0A 1YASA 2RGUA 1OX4A 1R16A 3OE4A 4L3VA 1AUQA 5CA1B 4X62B 4QTXA 5I47A 1QP4A 3HU3A 2WA1A 1TZBA 3IALA 1D6NA 3V2GA 1SK9A 4R0MA 1J90A 2G71A 3IA7A 4Z9BA 1EUCA 2OKGA 2HC9A 2FUCA 3AJAA 3L77A 3D4BA 4K7JA 4JI4B 4MWGA 4BLQA 4Q16A 4YPOA 3W5AA 4PSVA 3WFIA 2CMHA 3RJ9A 4Y1EA 3DUWA 1VI6A 4BLRA 2CUNA 3DEZA 1DUIA 4JLSA 1DKPA 1QVAA 4JKYA 4QYTA 1R8SA 4LS3A 4TYNA 1NBOA 1T0PA 4E21A 5ECYA 2GN2A 3C3MA 3TXYA 3TSZA 3W04A 4TYMA 4EARA 5AUNB 1G6Q1 3LX8A 3EE6A 4BO2A 1KZ7B 2PZ8A 1XNJA 1VSVA 1G5QA 3WDSA 3LHFA 1QAQA 1SCBA 2ZVQX 2QUZA 5K4AA 1QQTA 2GZ3A 2J5QA 2Z95A 3CWCA 1OLSA 3L1KA 4FMDB 1XRLA 4PZ9A 3CX7A 5J9FA 4ND3A 2IDJA 3D6MA 4X1OA 2P7IA 4X24A 3SD7A 3W9SA 6AT1A 3NVKI 1NMSA 4O63O 3BMNA 1KZ1A 2PVSA 3NP9A 2IUUA 1HE8B 4TYPA 5EYPA 3K6KA 3QH4A 4IJ5A 4NS1A 4G4JA 1N7HA 4BBJA 4GPTA 2FFBA 2Z8YA 2H57A 4Q1FA 3H99A 4EB8A 1RPNA 3C4QA 5CLJA 3DTVA 3QXCA 3AQIA 3V34A 4MROA 3SKVA 2UZ4A 3IUEA 1MCZA 5IT5A 3RYHA 3CRW1 4E12A 1DWQA 3QOWA 3QY0A 4KBYA 2RHMA 3I9OA 5J2TB 4F92B 2K7FA 3IIMA 1PL7A 2D3WA 2DJIA 3HYNA 1Y3IA 1YZUA 5LZ7A 1E7WA 3WYCA 4ZHSA 3A04A 2JBHA 3M33A 2R65A 2HZBA 3I53A 3R40A 1QFYA 1LLFA 4J49A 3WLOA 2P1RA 4K6GA 3H5RA 1USGA 3F5QA 4GEKA 4RY0A 3ROPA 4Z7JA 4X64B 3G5UA 4DLLA 3GGJA 3BWEA 1XWIA 1ZP6A 1U7HA 4TVOA 3WZMA 3TZKA 5HXAA 4IDFA 4QPJC 5T4EA 3GG2A 4XD7A 1Y1SA 2DOKA 3RVQA 5CX1A 2H2GA 1NQVA 2GM4A 4J0CA 2WJIA 3FG9A 5JLAA 1B8VA 3S0JA 1YXMA 2DYKA 3THYB 1A9XA 1EFVB 2ZKIA 2V6JA 2GJ8A 2I4RA 5KTYA 1R5NA 5FBLB 1F12A 1G8FA 1RRPA 1SC4A 1UWLA 1Z62A 2JGFA 1IHOA 2Y0PA 1CEXA 1JAZA 2X8JA 5IC5A 3MYYA 3PGMA 1G64A 1U9YA 2XTJA 1N4AA 5T3YA 1UIRA 1NJ2A 3CLTD 3IEMA 3T3NA 3AHCA 4XI9A 1RC8A 2OYSA 2COKA 3COVA 1W19A 3AEXA 1L1FA 4X3CA 2I4LA 1LRKA 1IWBB 4ECEA 4ESHA 4EG4A 2YXDA 2JNWA 3GMDA 2QUHA 1CCWA 3V1KA 2FWIA 3DE3X 4WPGA 3T1QA 3LY9A 1BX3A 1ZRHA 3R6LA 1LBEA 3GJYA 3KDPA 3QLUA 4UBNA 3VSAA 5LZ9A 4GX0A 4FYXA 4K28A 4RUKA 4U63A 2G7MC 3Q7TA 3IAUA 3RS7A 5CVCA 4A2WA 4M0EA 4RJTA 3T0GA 1ZJ6A 4BEBA 5KOHA 1OX6A 3M4XA 3PQCA 4M87A 2DHRA 3RREA 2F4NA 5IT9A 1XLTA 2R6HA 2QXTA 5I9SA 1NBEA 1YE8A 1V3QE 1SZPA 2OQIA 1VHWA 4LQCA 4B75A 3FTCA 3L9XA 2NADA 3WK4A 4CM7A 2O8DB 3LDUA 1P74A 2FUKA 4ER3A 5KHOC 1ZBQA 2AX4A 1CU1A 3UW1A 1ONNA 5HMMA 1PDWA 4NKRA 4A0SA 3A4IA 3GBPA 4CEJB 2M98A 1QYWA 4B4WA 2CFSA 3NYIA 4D3ZA 5L8VA 4O5OA 4MHSA 5K8LA 4BVFA 4KLZA 4NJEA 4UUMA 3KOXA 3HL0A 2H17A 3QFFA 3OIFA 4GXTA 3ZJTA 1B76A 3SPXA 2A1IA 3M3DA 3KVOA 4YAWA 1IY1A 1S7CA 4RIHA 3IEIA 3L8EA 3VMMA 4DLWA 3WMFA 5IASA 5JD6A 2JBAA 4PZEA 2DULA 4PGGA 2EDAA 5E8RA 5KNBA 4OHRA 1FVXA 2HF7A 4UBMA 3PLRA 5CEEA 3CLHA 4FHCA 2NO0A 3NVAA 1FL9A 4CTNA 3EC7A 4QAQA 4M9ZA 3K0FA 4KWCA 3RO7A 1UDBA 1J22A 3AZPA 4TTPA 1YZHA 4KYVA 5HKKD 3ZU3A 1P5FA 5HE8A 5LXTA 1OWNA 5E9WA 2PQ2A 4DR4B 2YCBA 2QTWB 3CEPB 4EKDA 1SB9A 1E7SA 1U3GA 1QFZA 3B6ZA 4JN6B 4PAOA 3SHVA 1E58A 2J9RA 1YCGA 1AF7A 4HFNA 4LOAA 6Q21A 1NVWQ 2HA7A 4L8GA 3NRBA 4I8DA 3SQNA 5KNCD 1Z4PX 2VPQA 2RGAA 5K0JA 1OKKD 4XWOA 5FTNA 4QRIA 5HEKA 4X6UA 4NULA 3RUDA 3DLCA 2QLFA 1FX0B 2FUEA 2Z08A 4PS0A 2QTVA 4P0TA 1J8QA 2PR2A 4R31A 4UREA 3S28A 4OOEA 3E9CA 1ANKA 3H11A 3N53A 1ONPA 2Q4BA 2QLNA 3BMCA 3HUDA 5ED0A 4CG1A 4G0MA 5IVHA 1RYNA 4JZKA 2WVHA 3P2JA 3T7AA 3EVTA 3HCFA 2C5GA 1NLFA 1C80A 5DBFA 4FOLA 4MW7A 5CDFA 1UJ2A 2D54A 4LE0A 4XQ0A 3VR6A 3FTDA 3WRVA 5ERYA 5JH7B 1CY8A 2FR8A 5FP0A 3Q7RA 3KUXA 1EK2A 1CKEA 1PU2A 2FKNA 3LWBA 4HDSB 4FYMA 1RU3A 4J0FA 4YP9A 3T5BA 1WHSA 4RXUA 3HXQA 1DBWA 4NBTA 2YWRA 2OFXA 4HGZA 1J33A 4BU0A 5E1BA 5E1OA 4TXHA 2POCA 5D8DA 1CQJA 2BFEB 2Y77A 3F2IA 2C03A 3G1TA 3BQ9A 4HDRA 3IKJA 4S1TA 4RCYA 1L5GB 3VSBA 2VDQB 1LGYA 2VNKA 4NARA 2VHZA 4FFNA 5EIBC 1Z5NA 2X14A 4LYGA 5A7GA 2FR8C 5BVHA 2C5BA 2RHHA 1TKAA 4BKMA 3DA8A 4LHEA 4CNBA 3VVMA 2CZCA 2FSSA 2XADA 1QVRA 3H75A 1A4UA 1H93A 2ZYSA 1O8BA 1ADCA 1WV1A 3A28A 4TRRA 3EXHB 1GP2A 3BE6A 5JIBA 1UPTA 3ESAA 3KKKA 1AZLA 2ZJ0A 4IFEA 3RIHA 2GXAA 1IRXA 2GVZC 4FE3A 1O6CA 3X1YA 4BRUA 4DMMA 3PNMA 4GZMA 4IDAA 3ZX5A 3LBIA 4AJ1A 3DZGA 1XCJA 3QG1A 4HDNB 4MRMA 3TX6A 3GLGB 2ZUFA 3ZW9A 4WCDA 4PYRA 2Y1CA 2H2DA 1CR6A 1GOTA 4FYKA 4H1HA 4EJSC 2JC3A 3CKKA 3M6AA 3BA6A 4P53A 3TCXB 2Y0BA 3OX1A 4FOPA 5E8JA 1TPZA 3B82A 1ID1A 2Q50A 3NBFA 4QYIA 3D4NA 1W76A 1E3TA 5CP8A 4WASA 3LQ2A 3GYBA 5EFZA 4DV5B 3MJEA 4UPVA 1WLYA 2GX6A 1HBJA 2W98A 2WKPA 3KKLA 2X1LA 3MZ0A 4PQEA 4IIUA 4UBOA 2GA9A 2SKEA 3OTQA 1D7AA 1KYZA 2YZGA 3CW2A 5C53B 5AVJA 1B43A 3GA0A 3S2GA 1PJ2A 1T4CB 2HLDA 3S2EA 5TIIA 1AA6A 4P3PA 4TLMB 4AX8A 4BNGA 3E1KA 3KRTA 4G89A 5LJLA 1CETA 2XKJE 1KQ3A 5JOQA 5K3FB 1WUHS 1X42A 3CV3A 3T7SA 2IIPA 5BW8A 3B2EA 3E5RA 4U39A 5T41A 4MUXA 1T2AA 2FDCA 3R7WA 4MPTA 5KVAA 3EIHA 1YVUA 2V1XA 1RM4A 3HR8A 4LNAA 3GARA 1ZJ5A 4O4IB 3SVTA 4UHFA 2JVIA 2FQWA 3ROFA 1Z6QA 3I2IA 4MQ6A 2AL7A 3JXEA 3D8SA 2VNSA 4ZO9A 4H4EA 1ZH4A 2RCYA 4QJ4A 4R1PA 1PJQA 2AYYA 2JI9A 5CDYA 3VKHA 1XUOA 4CMKA 2F3TA 3DMTA 3BTUA 3TRFA 4MLZA 1IM2A 3TAUA 4F9GA 1M2FA 1PZNA 3WMWA 3VKFA 821PA 4LE1A 2QQ5A 3GN2A 4ITRC 3BREA 1O95C 1T9ZA 3G6KA 1Q91A 3WWYA 1M1UA 5FI0B 3AJDA 2BP7A 1N8NA 4NU0A 2J48A 4MI6A 5ED4A 4NLLA 3D8RA 1EINA 3H5LA 1O95D 3DULA 2J3MA 2WU8A 3BGVA 1VB3A 2RK3A 3FNRA 4EK9A 2AOTB 4U8GA 5H81A 3C6YA 3OUTA 5B1SA 5C1PA 2JGLA 3VNAA 1M10A 5BOVA 1BKSB 1HE4A 1CZUA 3VOSA 4CHTA 4UNNA 1XN1A 2QVCA 4J0KA 4N0EA 1QRUA 2ONJA 3B1JA 1NUTA 2D1RA 2CDRA 4F11A 4NQRA 1ZD2P 4OLAA 1KPGA 1T6ZA 2KJQA 3IDFA 1TVCA 4KDCA 3SIPA 3UICA 3ZLJA 4I2VA 5BOSA 4NOLA 4I6JA 3VZPA 4K9OA 1JEYA 1AY0A 1O54A 2OFFA 5MFZA 4M1YA 2CLLB 5D01A 5EJIA 3QVTA 2J0UB 1Q12A 5FI3A 5ALMA 3LMKA 3EQZA 4DYVA 1YNSA 1QIIA 3F0TA 3NGLA 1U1CA 3OU7A 2PLFA 1XTPA 2PKEA 2PV7A 1NN5A 1VYVA 2QMEA 3JS5A 3VDRA 4MYUA 1AOXA 1Y8QB 2JI4A 4FOSA 4KSYA 5KSZA 4S2UA 3C3WA 3ZLVA 4I1VA 4IIXA 5H3LA 5FJIA 1EVJA 2R6DA 3C39A 1KSJA 3ACCA 3E8SA 1M33A 3ZV4A 1J8MF 2ZM5A 3H5IA 4PYIA 1EWRA 3A0UA 3CRNA 3Q2IA 1U7PA 4DQXA 1E1QA 5LQUA 1GTJ1 2DSTA 1W0JA 3JYNA 3DZJA 1S1CA 2BE9A 3OTHA 3FZGA 3VI4B 3HVJA 4L4XA 4EBBA 1SG0A 5ISMA 5AVRA 1FBNA 4QNNA 3RAGA 2P9FA 4RA9B 3SM3A 2NVOA 2CDAA 3FLEA 5EZYA 1Y6GA 5JVDF 2GO7A 1RWQA 3CMCO 4D3YA 1UPBA 5BSGA 1SU8A 3RS4A 1T5BA 5DTMA 2XE8A 2GBPA 3NR2A 3AJEA 4G1BA 5TQ2B 2BY4A 4UJ5A 3RBVA 4YRKA 2QRVB 1Z68A 2WMDA 1V39A 3H42B 4X63A 4A5SA 4F96A 4AROA 3S2IA 1KFEB 3KAQA 4EHLA 3K31A 1MF7A 1AZSC 2FWMX 1MO3A 3C8ZA 1M1YB 5IDQA 3N8GA 4XSVA 2OGSA 3B7WA 5L3QA 1N6LA 1NY6A 4JGIA 3QKIA 4OBWA 1YRQA 2XE6A 3M5DA 3VYWA 4R9RA 3P0RA 5CD9A 3UH1A 2R2AA 3F3YA 4PRKA 1PBNA 2GXSA 1Z25A 3I4LA 2P2CA 1MORA 4R98A 3WQRA 3BRQA 4B43A 5JPDA 1JSCA 1YUMA 1E7RA 3DWFA 4U7HA 4YP5A 4E5YA 3FLAA 3N6XA 1T5IA 1DQSA 3T0FA 3KD3A 1TLTA 3KR2A 1T1RA 5B1YA 4RK4A 2PLRA 2G88A 3QHQA 3WRYC 3IL2A 4Q9HA 4R1OA 1L2TA 5HF6A 4RTNA 1PLKA 4D5EA 4CLOA 1MAHA 4KR0A 1DAIA 3ANYB 3DPSA 5AM5A 2Z2JA 4WKGA 2BLNA 2IEZA 1GTVA 1T26A 3A6EA 3NPMA 3JQCA 4LSWA 3TZEA 1RMTA 4A1FA 3ZDCA 2SCUA 4KO8A 4AY4A 4F4UA 3LL4A 2BTEA 2OZPA 2XQKA 4YNBA 2FWBA 4KH0A 1KZ6A 5KOJA 1NR1A 5FWNA 2EFCB 3ITNA 1Z5WA 2RAVA 4X0EA 1A5ZA 2QTZA 1XEXB 4IXTA 3VU1A 4B47A 1TVKA 1XL0A 1UOOA 5H59A 4QNMA 1I36A 1QHEA 3RUIA 3VR5H 5KDDA 1XZKA 5HRCA 2J30A 4YCAA 4UFOA 1RFLA 1VM6A 3FKSA 4R5MA 4TKZA 5F23A 1L7QA 1DMRA 3C6XA 5IWCA 2QSYA 3A25A 3JW8A 4YASA 4YP7A 4YDQA 3IAXA 3VOBA 1YB6A 2JA1A 1JG7A 4QJ5A 1VL1A 4F12A 4I46A 2PU5A 3GQVA 3MILA 4WZZA 1YR8A 5HUQA 5JALA 4IJQA 2WYHA 3I2YX 3L5KA 2AUTA 4E31A 3ZVKA 3R9XA 5HRAA 2JLCA 5BYKA 5CA0B 2JI6A 3DEJA 3L8ZA 1Q57A 2ET6A 5K05A 5ITSA 3MBIA 4H1WA 4ZZ1A 3CVUA 3IVGA 4TOIA 4D8VA 4XOIA 4EYEA 1FQWA 2J7PD 7MHTA 2WIJA 2C3OA 1CTQA 2YW9A 3BN3A 3PVCA 4MVJA 3WNCA 4Q6BA 2FPRA 2CBXA 4R3UC 5EHZA 1N78A 4GL2A 2CLCX 2SICE 1PW7A 1NJ5A 2HY7A 1KJQA 2JBWA 4Z1MA 4YRIA 1KORA 1U7UA 3P9PA 1LZKA 5KINB 4D42A 5KSWB 3V8NA 2IF2A 5J2UA 1U8AA 2D0IA 2HWYA 1B3BA 3E9MA 5E2BA 4D98A 1JQAA 3V4OA 3DQZA 3DE6X 1XKTA 1IULA 3W5CA 3SS7X 4DXDA 1GZ7A 4N76A 2NQTA 3RV4A 1NHWA 1TXGA 2E4ZA 3R5XA 3IVAA 4FP9A 4JAVC 4XZ3A 2HO4A 2X8AA 4O2BB 3WLFA 2NU9B 2PPLA 1A9ZA 3F5DA 4I5EA 1CULC 2VUIB 1QHHB 1GTMA 4P3OA 1PG5A 1E1CB 2M1XA 4L57A 2Q1UA 3GFSA 2ILTA 4IILA 4C0QC 1G4HA 1NYTA 1NP3A 4GKKB 3C3XA 2G4VA 2R68A 4LMAA 1X13A 1OD6A 1CQIA 4OQZA 8LDHA 2C00A 5E4TA 5CDSA 4ANFA 4MWTA 2B0CA 4FKZA 1UAYA 4XM0A 3WWZA 2CXTA 3TN7A 5EPUA 3K71B 2NPFA 2XQJA 1ZAKA 3OZTA 4MO2A 2CMDA 2D7JA 2H4WA 3EHEA 4F5EA 5DNAA 1XP5A 3CE9A 3OETA 2IS1A 5TNXA 4QGSA 4I5DA 4U0JA 2J6IA 2JPDA 1EFPB 5IUNC 2P2GA 2Q3MA 3EASA 4J3NA 4CM9D 3EQ6A 2O9JA 4KI7A 3WR5A 3ZVRA 2Q6LA 4DNFA 2A94A 3LLUA 2HJHA 5IW8A 4IZ6A 4YUWA 4LE2A 5GPBA 2GRAA 1YRLA 4FHZA 3V4LA 2JJ1A 3ZDRA 4U4AA 2OLJA 1VFPA 3O1HB 3ZPXA 3Q8WA 3BH0A 3MOIA 3SHQA 2Z9DA 4LY0A 4HNRA 2GZSA 4RVDA 6LDHA 3K1AA 3EHDA 5DHAA 3DBLA 3NGMA 2GH1A 2FEKA 4IWNA 2WPNA 4Q3BA 5D7BA 2AG1A 4P6VF 4NYMR 5LYYA 2B6HA 1N34B 3IP5A 1IZ7A 3NHFA 1Q0TA 4DPLA 1P0FA 2W4IA 3FYDA 4J0IA 2C9MA 3LF2A 2JFWA 4Q47A 3Q8LA 1QFMA 4HDKB 3GUZA 1U3TA 3DBVO 2L82A 1UK9A 4QUBA 4TT3D 4HGOA 1B00A 3IBCA 4V3CA 1QIDA 3DE2X 3HL4A 3DC2A 4AIRA 4D0RA 1IMOA 1SHLA 1ETUA 2DRIA 2FB9A 2P3QA 2QUJA 3BMOA 3GRZA 5JZMA 1KS9A 2AKEA 2BFNA 3TLKA 4HAYA 2CFCA 1E9SA 1R8JA 2Q46A 3K4HA 1PR6A 1PQYA 3PENA 4R16A 5G1NA 3HY3A 2P67A 5CB4B 2FHSA 3GEHA 4YP6A 1APBA 3RTGA 3CUSA 1E4VA 2X2PA 4AB1A 1E9CA 2NV2B 3JVIA 4BO1A 3D4LA 1D9ZA 4AAYA 5CFNA 3E23A 4WY2A 4C7BA 1IJFA 3QW2A 2ZRLA 1OR8A 1HDRA 1DIRA 1YS2X 2Y0DA 2HRRA 4QBKA 4RF4A 4B7ZA 5JC8A 3JAKB 3LX6A 2PFGA 5AKYA 4DLVA 2DM6A 1Z56C 1OJLA 1Y4AE 1QQ7A 3WGJA 3DR3A 4Y6GB 4O2AA 4YJHA 3X0DA 3DV0A 4KN9S 3BXFA 3G9ZA 3V4FA 1SELA 3OE1A 1TQ4A 5LYJB 1U5BB 2CUKA 2X23A 4MS3A 1E99A 3LHDA 3TLMA 2BISA 1LV7A 2NNWB 3HCDA 4FDVA 4OATA 2X0FA 4C20A 5KX5B 4Y8VA 3IOEA 4LQDA 5B7GA 1QGED 2Z8YM 4P4SA 5T6MA 4X1KA 2AG8A 4Q48A 2FG5A 4KQMA 1JNXX 4AUMA 2PUEA 1E9FA 1U3WA 1Z06A 1RBYA 2XMPA 3Q7SA 1T6BY 4RMHA 4DOMA 3PFBA 1PYDA 1RIFA 2D74A 2Z1DA 4JEHA 1H0KA 4OQFA 4V1CA 3TIFA 4YLYA 4TWBA 3VV3A 4YACA 3GLIE 4ML3A 5HIJA 5IJ9A 1ABEA 2FX3A 1EK6A 4CI0B 5CVVA 1PSDA 1ZHOA 4AWBA 1IHPA 4ZJZA 5CDTA 2H4ZA 2O5RA 4X8MA 4B6GA 3DW1X 3G79A 4F2PA 4CHGA 2FG6C 4YRGA 1NBIA 4QXRA 4LG1A 5E6UA 5KOYA 2BTOA 1R0BA 2HA2A 3L0CA 3OCYA 1WF3A 5KJ6A 1G8GA 2OCXA 4D99A 5CEFA 4O4JA 4BO4A 1ENPA 3UANA 1CD5A 5K2OA 3QF7A 1IEWA 1JRLA 1UK6A 3M81A 4LX0A 2IYUA 2R48A 4OJYA 5CYOA 1WCIA 2PGDA 3K73O 3NHKA 2I7TA 3W3AD 1GKYA 3Q0TA 2PS9A 4PLVA 5EWLB 5J4YA 1IHXA 3AEYA 1D7OA 1Z9BA 3LFUA 4IZHA 1SRRA 3HJAA 1TU3A 2PVCA 2FGKA 3LQRA 4WIAA 3PGA1 4CKCA 4D80A 1PP4A 2NM0A 2NUPB 4FS8A 4PSDA 3VYTB 4YAKA 3D5QA 3QSGA 3HHPA 5JWHA 3ROGA 4F97A 3LUGA 4FGKA 7AT1A 1YI1A 4B0OA 2MT9A 1PNRA 4WKPA 4YRQA 4E51A 5FFMA 4DTCA 4LGMA 1JLKA 4XEHA 2FW8A 2BFFA 1JI0A 4MUEA 2C78A 1I01A 1SOVA 1XWFA 4M0KA 1TCVA 5B6PA 1E4EA 3NHWA 4DABA 1VBMA 3UGJA 4CCYB 3FHJA 3ZE6A 3VI3B 3AEQB 2XCRB 1LJUA 4HB2A 1WQ1R 3MWYW 3UMBA 5I7HA 4QFBA 1R6UA 1ZRNA 4LXTA 3M34A 3B89A 4B45A 3X2SA 4DIDA 4EDFA 4Q93A 1GN9A 2CMGA 2VPZA 2X5JO 1UXIA 1NGSA 4CEHB 5DU2A 2ZE8A 2WD9A 4PBSA 3TLXA 3U49A 3ZZ1A 4AD8A 1F48A 3CPSA 2O7QA 1SC3A 1GCUA 4G8BA 1BD3A 3LCCA 2PT6A 2A9OA 5IN5A 2ZUUA 4UU0A 3NIBA 4CG2A 4UTRA 4JWTA 1U0SY 2I3DA 2XTZA 1KMIY 2A5FA 1THMA 3LJKA 4LBWA 4XD2A 5HUHA 1RXVA 3O47A 5JW6A 1Z2DA 4QECA 4MWBA 2VR1A 1L5QA 2CL7X 2I2WA 1OYOA 4KC0A 2QV0A 2TMYA 4PZUA 4IFBA 4Q4LA 2CNWD 4QNRA 3T1VA 5LMNB 4OFWA 3TG2A 4N3BA 5AK0A 1PT8A 2AHOA 4XQ9A 5FH9A 4NF2A 4GOND 4RHXA 1UDAA 5JCJA 2WG0A 2R1ZA 1NLMA 2VAPA 3O7MA 2PXAA 3DZHA 3EXFB 1ZHHA 2HWWA 1IPHA 1DG1G 4FGLA 3JPYA 2C3UA 1BFUA 4CQMD 2O2XA 1CWUA 2IV3A 2WB4A 3M2TA 2DFKB 2ZYDA 4MQFB 5A7FA 1UMBB 3JQ7B 3P26A 1V47A 4W1RA 2XSZA 1ZWLA 2X2OA 3VJRA 1QM5A 3I5AA 5JG7A 2I2XB 5LQNA 2IH4A 5EQDA 1X7YB 1D4FA 2YWEA 4YC7A 5M2QA 2X0JA 5DMXA 1GRRA 3VPDA 4PN3A 1RHMA 1JKFA 1Y5NA 3AFGA 1SQ5A 1RE0A 1SVWA 1WMFA 2J7KA 3L1UA 4E09A 3OI7A 2VNAA 1UC9A 3OFND 2QMZA 2Z4TA 4MW6A 1QX3A 3OQJA 5C3UA 1WV0A 4Y67A 5ELMA 3LPCA 3ROEA 3TQIA 2VG8A 1TEVA 3UBMA 5BUSA 4B3TB 1RHQA 1VJ0A 1GPDG 1BYUA 3KTDA 3PUHA 2HGZA 3R0QA 3OZUA 4U5XA 2F3SA 4BX3A 4YAEA 4J3JA 4W8OA 1XC7A 1LZLA 1RABA 1V7QA 3C3CA 3DXZA 3ONDA 1K06A 2GUGA 2WHYA 3QXHA 3JWHA 3T7RA 3CF4G 1M0SA 1V37A 1G9SA 3R6DA 5JSKA 1CR0A 3BEDA 4V0OA 1ZGBA 3E1GA 2OYRA 3RHZA 4NU5A 1RTTA 5DHFA 5CCBA 4K9KA 1ST3A 3NT4A 3QWHA 3CH4B 4PG5A 5TT1A 4JLBA 3JQFA 3AWDA 3OLCX 3RDPA 3JYOA 3KYJB 4BP3A 1EPUA 5CT8A 5SYAA 3RV3A 3N3AC 1BKDR 2P2DA 3QE0A 4FGZA 2FFJA 1SCDA 1I3KA 2YS7A 4REOA 4BO7A 5A5VA 3IP6A 4KWIA 2PSFA 3RRXA 4ZEMA 4D96A 1PWYE 2AD5A 2QM7A 2HK7A 2C9BA 3AP3A 3R8CA 4DR6B 4ZTZB 4WBNF 1V16A 5FBVB 3L1HA 1KZHA 3HFJA 4EW1A 3MXOA 2QAJA 2CJWB 3QQPA 4MR8A 5AKLA 3VH3A 3WE7A 1XXHB 4RHEA 4Y0AA 1P3DA 1ZR4A 3SVZA 1WKBA 1BX1A 3PG5A 2HUPA 3CZRA 4XWWA 2P3SA 2VDPB 3C1AA 5KPJA 2V0GA 2EAUA 2IWRA 3V7FA 2P9QA 3THWB 3LUDA 1AMUA 3GLUA 4MHOA 2BJVA 2F43B 3EUWA 2H51A 2IIVA 2O8EA 4WN3A 1H0HA 4CDRA 3S8YA 4Q39A 4BP1A 1FNMA 3C7CB 5JAOA 5EHXA 4QRHA 3OSUA 4J91A 2FQYA 1V1RA 4A3SA 5HRUA 2X0KA 2WTAA 4IS3A 2ZUEA 3K9LA 3KKOA 1JE1A 1W49A 2COEA 1I94B 2QE7D 2D5AA 3QMMA 2AB0A 2B8EA 4O4LF 4XJVA 3TDNA 4B3DA 2IH2A 2V7VA 1XFAA 1TCCA 4GKVA 2TMKA 1KY3A 3ECCA 4U7FA 1H4SA 1H1LB 1ZEMA 4I9HA 4LNUA 1EVQA 4WERA 3WYEA 1CSEE 1GUDA 1NI4B 1RD4A 5FOQA 3OEWA 5L4NA 1QZZA 4ESEA 4G8JA 4O1MA 1MTZA 1D07A 1G42A 1O6FA 2WSMA 1E1MA 2HPAA 4H77A 2R6AA 3PC6A 4PAMA 2I34A 3B1KA 1RDFA 3WJ1A 4JL6A 3TW4A 4BWVA 2JD1A 2NXWA 4YFYA 1EFTA 5K6AA 2VJMA 2OK7A 1SC6A 2VSQA 2CMFA 4U2BA 4MX8A 5DRTA 1NI5A 4ZT3A 1XVIA 4WOJA 3PUZA 5BNIA 1VBKA 1ZNYA 1FDUA 1OPRA 2Q1XA 3D6TB 4Y9UA 2ISCA 4QU9A 1DPGA 1GQRA 4FMCF 1LI4A 3A4TA 2FSHA 3RRYA 4EUFA 5M34A 4W1SA 5HILA 1FP2A 1GZ3A 1OB5A 4OHOA 2A0WA 4TM7A 1S1MA 3ENZA 3UCEA 3IV7A 1I1NA 2Z6VA 4BQFA 5DWQA 1ZH6A 1HYQA 1PLJA 2FRVA 3IQEA 3L7AA 4F56A 1E5XA 3CB4A 1FVHA 1NJGA 1ECCA 3STWA 1QK5A 4YH1A 1XZBA 1MH9A 3AVWA 3K2BA 2CHQA 4P81A 4GVLA 4TTJA 4JC5A 3FDZA 4RF2A 2PLWA 4V03A 1TAQA 4R7TA 4L8LA 4W63A 5B7PA 2WSSA 1E0AA 4ZYVA 3BSYA 2Z5LA 3VC2A 3DT8A 1JDPA 3X3HA 3EPJA 1A7UA 2W6PA 3I92A 3WLRA 4C9BA 4IIEA 1JHZA 5D86A 4DM3A 4TXMA 1LBTA 1X94A 1E96A 1JHAA 4R2XA 3OTOB 4A92A 4D4MA 4KV9A 3SEQA 1OVMA 5C8VA 1KBZA 1D4AA 5JVDA 1HWYA 2QSUA 3C70A 4BGVA 2B34A 1FUKA 1W94A 2F2TA 4QXPA 4RXMA 4K6KA 2JLAA 3D6AA 4PC7A 1EGHA 1BGXT 1ULAA 4XGRA 3SY8A 5HF9A 4GKBA 1GPMA 1HEIA 1L5SA 1P6XA 2FZ4A 4I5FA 4CTJA 3EN0A 4IOMA 2J8ZA 3LYAA 4QM7A 2YFKA 4J0QA 1FSZA 1K7YA 1NVTA 3EZ2A 4LSGA 1ZM4A 2FPPB 4DUZB 1UPFA 1LQ2A 2C4UA 1N6NA 3JQ9A 2GEFA 5KDLA 1EE2A 8ADHA 3OA2A 1QXSA 4UBJA 1M34B 4UVEA 4RULA 5F76A 3VKVA 3MWJA 1I14A 1H6DA 4JJ6A 3ABIA 1EHIA 4P2BA 3LY7A 3UJCA 5M5BA 2G9QA 2WJVA 4W6QA 1SPBS 4K2AA 4EX7A 1OLXA 4E70A 1E61A 1EUYA 3EY4A 4KXMA 4EY8A 1YJBA 3IAAA 5I9BA 1CPYA 4ESVA 3G89A 4UEOA 4F9EA 5K5EA 3A27A 3I5YA 2HDNB 3EEQA 5F2OA 5H9WA 5ESXA 3TR0A 3ML1A 3C5CA 2BD0A 4HZIA 4LFCB 4PHHA 1I9GA 5IVDA 4JP8A 3Q1KA 4D9GA 1XTSA 2YFQA 2ZYAA 3NV9A 4BZPA 5H4GA 3BWDD 5L6MB 4MB6A 4YY3B 1IB0A 4U7PB 4W1QA 1FE8A 1QU2A 3U81A 1T0JB 1K3TA 1X1SA 4XA8A 3MINA 2O8VA 2YDYA 5DGDA 2XNHA 4YALA 1R1DA 3UXHA 5KC9A 1ZINA 2UAGA 1AF4A 2WSYB 1L3IA 2XPCA 4G0WA 2CC2A 5K8VA 1A82A 1ENYA 1Y81A 1VI5A 2QYOA 4BLUA 2ZRKA 3L4EA 4TPKA 1K5DA 1E2UA 4EI2A 1X7XA 2RGNA 3BK1A 4R40A 5IPFA 3EMDA 3NORA 3AUXA 3GOQA 4ZAYA 5SY6A 5IBCA 4GXQA 4R8KA 2Y3IA 2ZBFA 6ADHA 1GVNB 5EIFA 3KALA 3HJRA 4RH3A 2R5NA 2CJYA 2XI4A 1J8FA 2EBFX 1B6SA 4Q19A 3SZ3A 3G2OA 3X44A 3P2EA 5D3ZA 3G13A 2Z30A 2WAYA 3MB5A 1DELA 2VWQA 3FOWA 2FPWA 4NTZA 4TV9B 1H2BA 1QX4A 3TZLA 4JGGA 1ITZA 3RVOA 3D3JA 1CQZA 1GAWA 4FCVA 2P9JA 3G82C 4H59A 2IHNA 3EGDA 3E9DA 1YRAA 3R3UA 4IUCS 1WUYA 1YUBA 1RQLA 3FOBA 1X3SA 2YWGA 3OZEA 1FTYA 4JA2A 3TI7A 5JCOC 5KNDH 3VKGA 3I9LA 2CXHA 3PD0A 1ABFA 1UOEA 3VR1A 1GPBA 3HEMA 3N8DA 1AXGA 1Z6ZA 2WU1A 3L7CA 5FTJA 2Q1TA 5JDCC 4EUEA 3N87A 1FYEA 5ESRA 1FW6A 4DBLE 3I6MA 3Q0EA 1S89A 2FW7A 2ZQZA 3KZMA 1IC6A 3K0AA 3HA2A 1ATIA 1G8PA 2GLXA 2I8LA 4KUEA 4PHCA 3ZY6A 4LF8B 4JLAA 2CWDA 4Q3LA 3ICQB 4UM9B 1LTKA 2DTDA 4FNOA 2PJUA 1J0AA 1RE1A 1HRDA 1J0XO 3L7JA 2CVHA 1LQUA 2Y27A 1JUDA 2MSDB 2XX3A 3PC2A 4R1TA 4AJ9A 1WMSA 2XMDA 3V2IA 1CRPA 3QWBA 4OJMX 3QF4A 3VZQA 3KPJA 4WRRA 1FY2A 1D2GA 1VL8A 1KTVA 1ZNQO 1XDDA 1QC5A 2W37A 4YA6A 4D92A 4IYRA 3F96A 3EUFA 4JS0A 2W6CX 3JQGB 2WFLB 3SS8A 5LLDA 4KWTA 4B6RA 2FPXA 1E4YA 1T8SA 4TSFA 5J3JA 1IN6A 3U4DA 3OFSA 2OHHA 3D6HA 4CKWA 4WBNB 1J1IA 3MFQA 4XPZA 1GVHA 2C9ZA 4WDQA 5TQJA 3LO5A 2AOWA 1AK2A 2WHPA 1GRCA 1MQSA 4MP8A 2GVNA 2OHFA 4F6RB 1YL7A 5HIKA 2OAGA 1ZMBA 4OQEA 1ORHA 3IVCA 4XXHA 2M6KA 3U26A 2PRZA 3FFXA 3HUEA 1EKXA 4H1VA 4MCJA 5CB8A 1V8BA 5HG0A 1RYBA 2IHYA 4HWPA 2N0SA 2HMSA 2X0NA 5K9ZA 1ZW6A 1EVLA 4FB5A 4IL5A 1TMKA 1SXJE 2IZ5A 3ZJ5A