1XRJA

Rapid structure determination of human uridine-cytidine kinase 2 using a conventional laboratory x-ray source and a single samarium derivative
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
b'PFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine-cytidine kinase 2
publication title Structure of human uridine-cytidine kinase 2 determined by SIRAS using a rotating-anode X-ray generator and a single samarium derivative.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xrjA00
3VHLB 2A5YB 4NYIR 5KDLA 1QBKC 1W48A 3IKJA 4D4LA 1QG4A 1G3IA 2QG6A 2ZSDA 1T9HA 1G8GA 1G3UA 1Z0JA 3ZLJA 2OCYC 4C0AC 3EARA 4MYCA 2XB2A 1XXHB 2WM9B 3K0CC 1ZUNB 2RGGA 2OHFA 3QKSB 4IVPA 4JLBA 4KYIB 1NMZA 1IOZA 5K8UA 1COWD 1KDPA 1E2QA 4FD2A 1Z22A 2H1LA 2J0QA 4TLAA 1LW7A 3U2QA 2D06A 2WJVA 4UNSA 3TJZA 1E4VA 4QM6A 1KI7A 1L4YA 1NY6A 3LBNA 2NOAA 3KX2A 1I2DA 2BMJA 4M9XA 3QNUA 2IX3A 4QOSA 1G8PA 4LJ6A 1S96A 1TPZA 2XJ4A 1UBGA 1JBKA 2IYRA 1WCV1 4BFSA 1DAHA 1GOTA 4HLUC 3U7GA 1GRRA 2CXXA 3BWDD 1N5IA 2F1RA 4ESHA 1X6VA 5EE3A 1K5DA 3B1YA 4R98A 1I4TD 2GESA 4IDQA 3T61A 1NNEA 1HA3A 3K09C 1FL9A 1S1MA 2QY9A 1MO3A 3I72A 2O8DA 3ETLA 2AKYA 2JASA 2XX3A 1KO8A 2H8KA 4Z1MD 5AUNB 1FTNA 2FG5A 5KU1A 1A4RA 1OT3A 2FF7A 4OK3A 4KVAA 2OAP1 5FPHA 1YZGA 1JEDA 3IPYA 2F55A 2Q9BA 1LTQA 1E2DA 3LQQA 4YONB 4MUAA 3RWOA 4AURA 1EXMA 5CDFA 3UG6A 1UJ2A 2GXAA 2C8VA 3CIOA 1RRCA 1XTSA 5JSZB 2V6JA 1ZNYA 1SHZA 2OILA 1UKZA 2P0EA 2OLKA 1XTJA 3T15A 4DJTA 1NVVQ 3FFAA 3IQXA 2BIFA 4QKQA 4IOKA 2YOFA 3T5DA 1BIFA 1NLFA 1VCNA 2YOGA 2NG1A 1GWNA 1C9KA 1WXQA 2OBLA 3EZ9A 1G20E 2GEUA 4V0LA 4OI0A 3A36A 4KFTA 3OE7D 2KBFA 1QHXA 1AM4D 3CWZA 4MQBA 3PENA 3C16C 2G77B 3V00A 1D2EA 3O8BA 4A0GA 2PCJA 2RGAA 1E9DA 1Q22A 3TR0A 3BGWA 1ZNWA 2FFAA 4HDCA 4V0MA 5C18A 5DSZA 1U0JA 4A8JA 2O8EA 5P21A 3GLIA 2FSGA 4WZAE 3ZD6A 3EWSA 2K5UA 1KI4A 4Y0VA 4Z8YA 2R6CA 4HAVA 2P3SA 2PL3A 2GZAA 4P0TA 4GMXA 4F7WA 1NIJA 3CR7A 5BQ5A 3B5JA 5KTYA 1LV7A 1PLJA 1KI8A 4E09A 2VRWA 4V0KA 2BWJA 2GNOA 3LBIA 3QE0A 1NKTA 2J7KA 4ARZB 4LJYA 2QZ4A 4Q1DA 2D4HA 4MITA 2W2XA 1KAOA 1F3OA 2ZTSA 2ZI3A 4PSKA 2BEJA 2GCNA 1XFAA 1OH6A 4JSTA 1E32A 1CRPA 3U4QA 2VBCA 2REBA 2ZRPA 3BH6A 4ZI3A 3K70D 2RGEA 1VKJA 4BZQA 1WB9A 4O2RA 2FV8A 1Z06A 2ODEA 4IFBA 1P2UA 3TRFA 1KSJA 3TAUA 3CB4A 4JBYA 5EE1A 4NBSA 2O0HA 2ZJAA 1DO0A 2Q3HA 3VR2A 3GJ0A 1DPFA 2WZQA 2WSMA 3AVVA 3PUZA 5F9FA 3L8YA 2O8CA 3THXB 2IYYA 1RRFA 1NJFA 2JLWA 3CPEA 5J47A 2AXNA 2HLDD 3GFOA 4MKIA 5D3QA 3CNOA 4TQ9A 3EZ2A 4LBWA 2XTNA 1VCMA 4JT4A 5KNDA 3SHFA 2YNMA 4XD7D 5DYIA 4OHYA 1AGRA 1YZTA 3RNLA 1E79D 4MKFA 2NZJA 5EXSA 5JS7A 3BB3A 1DAKA 5ANRB 4FW9A 3CX6A 5FUXA 3K0FA 5E7IA 5F9HA 4QXAA 1BYUA 2ZROA 5LPNA 2FE4A 3H84A 4Q00A 1NMYA 3KUCA 1NJGA 5BXQC 1GSIA 1G16A 2VA8A 3C14C 5CK5A 5B64A 3TBKA 2ASEA 4BLTA 4JL5A 2FEMA 4DKXA 3OIYA 1E3MA 5HZKA 1JAHA 2J0SA 1J99A 2R6AA 1XD2B 3AH8A 1LF0A 1XDBA 2P67A 1KK2A 4AD8A 2YKGA 4WVFA 3CLVA 1NVVR 2N1BA 4HAWA 2EYUA 1YR9A 1JJ7A 1US8B 3OFND 4B71A 3QPVA 4HB2A 5LDDC 5KNCA 2AWNA 2FSHA 2GCOA 3PUWA 3UXMA 1Z28A 4JSYA 4UJ3A 1GILA 4ZO4A 1DE0A 4LHXA 3QIAA 4Q02A 4ABYA 2VHJA 4CZ2A 4DB2A 4EPTA 2A78A 2ZRKA 1LVGA 4YMSA 1U94A 2Z4RA 2ODBA 4BFYA 4G1UC 4V0NA 2OLJA 5CYPA 5GJWC 1VG8A 3MFYA 3C4JA 1CTQA 3KQKA 1SHKA 4LUCA 2BDTA 4NCJA 2IK8A 5LB2A 1S9DA 2OEPA 3CKLA 4BFZA 4QRHA 3KKNA 1P6XA 4W7SA 3B8HA 1GP2A 3CRVA 2J0VA 5CJ2A 2QSYA 4KBFA 1QDEA 2CMKA 5FR1A 5JZVA 5KSYA 2WKPA 4IW3B 1E9SA 1NBMD 4LV5B 1NN1A 3JZAA 2PZFA 4PC1A 4DLVA 1SZPA 1U90A 1JR3A 4B32A 1ZM7A 4B47A 1VYUA 2P5SA 4ZCMA 1G17A 3VHXA 2ZVPX 2CHQA 4M22A 3ICEA 1XXHA 5JHGB 3QKSA 1AK2A 2ZYTX 2HDNB 3BE4A 4Q4AB 4W5HA 5K8TA 1KK3A 4X8HA 1VIYA 2HYDA 1Z3IX 3A1WA 3EC1A 3TE6A 5JI3E 3BERA 3S1AA 5J4VA 5FOSA 1OH8A 3QXXA 1J8MF 3H1TA 4WA7A 2E9SA 3CRMA 4JS0A 5L8VA 2J59A 4A2WA 4NYMR 3V4FA 1KY3A 1CJUC 2DHRA 4Q18A 1E9BA 2D2EA 5AJXA 5DIFA 3RSLA 3HPRA 3LA6A 4F91B 1QHNA 1W2HA 2DFTA 3H86A 1M7BA 1IY2A 4HZUB 4M9QA 5E7MA 1JI0A 4NU0A 2JEOA 4RD1A 2V7QA 1SULA 1TTTA 1R6BX 3SBEA 1XMSA 1JR6A 4AYXA 2E1RA 1KDRA 3GPLA 3PFIA 1A1VA 4JL8A 4YDSA 3RVBA 1E0AA 2FX3A 3QG1A 4DLYA 4QJ5A 2BMEA 2BC9A 3ZS8A 3NHBA 4TYPA 4TTPA 1G3RA 4FCTA 1N6OA 1EX7A 5CK4A 2JIZD 4FI3C 5GJVC 3I62A 1D5CA 1YVDA 2FA9A 2BM1A 1OXUA 3QKTA 2D7DA 3WP0A 2KJQA 1N6PA 3DHWC 3SJAA 2A2ZA 1IY1A 2JGNA 4X8MA 1MRNA 4B74A 1JPNA 4P4TA 4IXMA 1W0JA 1E2EA 2PH1A 1OV4A 1TQ2A 1ZW6A 3MG9A 3E2IA 2PZEA 4FCWA 2EFGA 4Q1FA 5GJBA 4NH0A 2G9NA 1W4AA 3N5CA 1S3SA 3T12A 3QSYA 3GD7A 1MT0A 2RGNA 4AKHA 1J70A 2IWHA 4DDVA 1T3LA 3DOFA 4IDHA 3MMPA 2XITA 3WXMA 3AVQA 4Q1CA 1TL7C 3O8CA 2PEZA 1RJ9B 1XTRA 2AK2A 1DO2A 1LF5A 2AD1A 4WZBE 3EA5A 3SFZA 3GLGB 1UADA 3U7FB 2C9OA 5AJVB 2WJGA 2NQ2C 1GZSA 2FFBA 4GI7A 2IXEA 4A92A 1E94E 3QJYA 1P9NA 2JATA 4LHZA 2FZ4A 2QMOA 1G8HA 3KJGA 1EFRA 3KQHA 1KOFA 3VR1A 2ANCA 2J9RA 4AG5A 3A1UA 4HLUA 1D9XA 2HCBA 4B6EA 3HU3A 1IQPA 1FQJA 1RPZA 2C9CA 3EPLA 1CS4C 3OIUA 4ARZA 1RZ3A 1OJLA 3CX7A 3K09A 5B58C 3ADKA 1P60A 2ZVQX 3ND9A 4Q9LA 2GEDA 621PA 3LH5A 3RABA 3RC3A 1Z0DA 1E9CA 1N5JA 4TYWA 2W58A 4LBVA 3WRXC 2VTKA 1W36D 1KMHB 5JI2E 2VP6A 1DEKA 4WIAA 3PEWA 1U99A 4M1YA 1OF1A 4LHWA 4DEXA 4LDJA 3VNVA 4URVR 4EQ6B 1E2JA 4Z51A 1GRQA 4BLSA 2A5JA 2ZI4A 3NBFA 4IRUB 4NL4H 4C7OB 1G4AE 4OHVA 5FTJA 4B76A 5IF9A 1CR0A 1XF9A 3C7KA 3NBYC 3THXA 3EPKA 3VMFA 4PC2A 1WBBA 1GNPA 4HEJA 1LS6A 4JLMA 3OZXA 1Q20A 2V4ZA 4GNKA 5DI9A 2EFEB 1XMIA 5TMPA 1GM5A 5H8WA 1VYVA 5FBQB 4TT3A 1YE8A 2YWFA 3EA0A 3NBZC 2QEQA 5F3WB 1X8KA 1OFIA 1E6CA 1GL9B 2JJ2A 4NONA 4A8JC 5F98A 4CVNA 5KUTA 4PFSA 5LD2C 2AR7A 3F8TA 5KSZA 4OKSA 3ZVNA 2EFDB 5C4MA 1A82A 1TEXA 1T5IA 1TU4A 2BBSA 4QBHA 5IRCD 1WQ1R 1GAJA 4L8GA 4W5WA 1E4YA 1E98A 1F6BA 1QHGA 1SVWA 2QQ0A 1KO4A 4G0NA 5G3YA 1I2MA 2XSZA 4I81A 4Q4JB 4NHOA 4KSBA 2BKUA 2FEOA 2WVJA 4ZV4A 2D2FA 3TVDA 1XD2A 3A4MA 3PEYA 1SKYB 3WMEA 1GIAA 2KWIA 2YV5A 4POAA 5TB5A 3LRPA 4XSGA 2GK6A 4BLPA 5EXXA 1T6NA 1TX4B 2ZSAA 3FHOA 5FOXA 1DG1G 3WMFA 4ACBA 4MDFA 3A58B 4G01B 3CZQA 4JLAA 2P2LA 1NVWQ 1VG0B 3L82B 5H68A 1D9ZA 3RRMA 3O8RA 3X1ZA 2J41A 1IN8A 3EAQA 2LKDA 5FI0B 2ZRIA 5FPSA 3OEHA 2CJWA 3CH5A 5DH9A 4A36A 1EFCA 4PC3A 4DCUA 3T5GA 3QVUA 1L2TA 4TL9A 1PVOA 2ZRBA 2ZQ5A 3ND8A 1G8YA 2ZRJA 2XNSA 3BK7A 4OYHA 5BN5A 2ZETA 2XTMA 2EWVA 3EW9A 1T8TA 3U3KA 2OESA 2VSOA 4D4JA 1D2MA 1XTKA 3U60B 2EW1A 2PT7A 1V43A 2PBRA 1OXTA 4OQXA 1ESMA 2OFXA 2RHDA 3QBTA 2ERYA 4RY2A 4HUTA 1T3SA 1F2UB 4Q4AA 1W36C 3HWSA 3RANA 3RS4A 2WWFA 1QHSA 1WMSA 1SVMA 1UPTA 4OJKA 2DFNA 5CLQA 3LNCA 1AIPA 2QROA 2ZS8A 5ELXA 4JZKA 4ZDIA 1WE2A 4RD4A 4DWJA 3SN6A 1LFDB 1Q1ZA 3IO5A 1W0JD 3CF0A 2EQBA 3PUYA 3QF4B 4YXWD 1UKVY 3T1QA 4QL3A 1GUAA 4PAOA 3GLFB 2ZE6A 5GVSA 4RD3A 4Q9IA 1Z63A 4C0JA 3QKRB 1MOZA 1CF4A 1E2NA 4RZXA 4KAXA 1TNDA 2VQSA 1X1RA 2R6GA 3E70C 4AKIA 4NMMA 4D2IA 2W83A 4CEIB 2Z83A 1HT1E 4TZ0A 4WZ6A 2I1VB 2C9YA 1FTSA 3SHWA 1CP2A 4MGZR 2GILA 4C9BA 3E5HA 4LY6A 3QG5A 2HF9A 2G83A 4G5SA 2IT1A 4PPGA 1P2SA 1G1MA 4PPFA 4GDFA 1E1QA 4GOJA 3EC2A 5CM9C 1EFRD 2ODWA 2GKSA 2EU8A 2DFLA 2HV8A 2JCSA 2MSDB 3SQXA 4D26A 3CF6R 2GEVA 5DN6A 2IA5A 2B92A 2AFIE 3UPUA 1N6KA 5TDHA 4IDPA 4EPWA 1BMFA 2ZU0C 3MD0A 4I1OA 3OF5A 1II9A 4R71A 1NSTA 3IEVA 2QL6A 3ICQB 4KSCA 2OT3B 1ZCBA 3TUIC 4EPRA 2NTYC 1Q12A 3IEUA 5L3SB 3NIBA 1XPOA 1X8LA 4LWZA 4C0BA 4PAMA 1RJ9A 3LX8A 1OIVA 2G88A 4DRZA 3W9YA 3DDCA 2ZJ8A 3GLGA 4UXIA 2WSSD 3LXRA 1ZC3A 4I1UA 4C0QC 5C1BA 3WY9A 1C4OA 2GVZC 1YR7A 4IDOA 2VP0A 4WXPA 1U9IA 4ZDJA 1IXZA 4PTLA 5FBLB 4B3BA 1HQYE 5HCNA 4KJZA 4PC7A 5BWMA 4QNRA 1P72A 1JQJC 3MJHA 4II7A 3L0PA 3GEEA 3W8NA 1V5WA 4BGDA 3L43A 4TT3D 4KFUA 1KO1A 1XJQA 2JJ2D 2IYVA 2Q9CA 4C0LA 2HYIC 1KI6A 4BLQA 1P73A 3BJIC 4LI0A 2X2EA 4GOXA 4TMKA 3ZVMA 1CBUA 2HF8A 5FUVA 4B2IA 2FH5B 1ELOA 5HR5A 4PR0A 1KMHA 2XZPA 4DUGA 5AK0A 2ATXA 1TEVA 1ETUA 4M9SA 4EQ6A 3X1WA 1BKDR 2AD5A 2QT1A 3HYTA 3NG1A 1NBME 3CONA 4M8NE 5GJCA 1DTSA 4C7OA 5J4YA 1Q3TA 1Q1EA 2W2VA 1I4LD 2H18A 2FFQA 2RGNC 4DEYA 4LPKA 3Q9LA 4OI2A 5TV2A 5IK2D 3RC8A 4OQNA 3PVSA 3REFA 1KAGA 4GFDA 3SDZA 2YC4C 2QM7A 4FXPA 3V4RA 5FUYA 3GJ6A 2OM2A 3PR1A 1MO5A 1XP8A 1Z83A 3SYNA 2MMGA 5CDFE 2MMCA 2AKAB 1Z6GA 2JLSA 1UDXA 4JKIA 1YR6A 3LFUA 1E0SA 2DBYA 2ZREA 4PSVA 3NH6A 2CE7A 4B3CA 3RRZA 2YVUA 3QF7A 2FPMA 1GL6A 3JVVA 4LPSA 2IYWA 2ZUCA 4A9AA 4DZZA 3UKDA 2QAGB 2FMXA 3W90A 3AVPA 4A2PA 2IS2A 1HY3A 2CDNA 4TL8A 5UKDA 1E9EA 1KI2A 3THOA 4Q4JA 2RGBA 5FFMA 1G4UR 3UWKA 4KLZA 4NZYA 2C78A 3VKHA 2QRZA 1RRGA 3I1FA 5HE9A 2AWOA 4QG7A 1HH4A 5FBVB 4LC1A 2ZS9A 1F60A 4RD2A 3KQLA 1YRAA 1YR8A 5HKKD 4NP6A 3I8XA 3SOPA 4A15A 4V0ME 4B2PA 1U8ZA 4LYFA 3W3ZB 4EDHA 1MH1A 3LXXA 1ZD8A 3PIRA 2XB4A 1BO6A 3THYB 3AQ4A 1FQKA 4EFNA 2FDCA 4DLZA 1EWQA 3AUXA 4Q01A 2F3TA 4KU4A 2ZRDA 1G41A 1II0A 2GF0A 2OBNA 1GFIA 1W4BA 2OG2A 3HPQA 3AF4A 3KDSE 4ZIRB 4W9MC 2QBYB 1C1YA 1ODFA 3B9PA 3GLHE 4JL6A 4DLRA 4EKDA 3D7MA 2ZRLA 4OQLA 5KSPA 3K9GA 3F3YA 5C4GB 1GRNA 4OHXA 3OEEA 1M34E 1S2MA 1U81A 2H57A 4EUNA 4F93B 3O47A 5HE8A 5JWHA 3P1JA 2C96A 4OI4A 4BWYA 2REOA 1IJEA 2EFHB 3CNLA 3N2EA 4MDEA 4LBYA 4O0MA 3NTUA 3IHWA 5JRJA 4DSUA 1H65A 3BFXA 2IYTA 2ZI7A 2W6IA 1Z47A 3BBPA 4DXAA 2Z0MA 4B3XA 1OKKA 3BAFA 5SZKB 2ZSFA 3RDPA 3R9WA 4K8OA 2UZIR 3LVRE 2ZI5A 3PUXA 4EJSB 3LDAA 3AVUA 3SYKA 1F2UA 4CRWB 2ZITA 3EZ6A 5FOTA 2X1VA 1E1QD 1JNYA 3QQ5A 4E5UA 3KQUA 5EXPA 4QJ4A 1N0UA 5FBRB 2CCJA 4Q1BA 2G1JA 5KO2A 1UKEA 2OFOA 5DN6D 3MLEA 4BPBA 2ZRAA 4DLTA 2PMDA 1RRPA 1SXJB 1A2BA 2ZJOA 1AS0A 1BMFD 3QF4A 4MRSA 5EUMA 3BFVA 5TVKA 4PHHA 1ZUHA 1IBRA 3GLFA 1ZU4A 2BBWA 2JLZA 1G5PA 3TMKA 3QKRA 4A6PA 3SBDA 1NN0A 3K0SA 2CL0X 4NYJQ 4AYTA 2AL7A 3CO5A 3T1VA 1W4RA 4QBIA 1EESA 4EPXA 3M4YA 5K8LA 2PJZA 4CEIA 3K8YA 1PZNA 2B7BA 1JALA 1SVSA 4NYMQ 3BXZA 3ZDQA 3SR0A 1DAIA 1P2TA 2H17A 1TQ4A 3UG7A 4XWKA 3NVAA 1VG1A 2REXB 3NBXX 3IILA 2NPFA 2Q0HA 3ZQJA 5FTLA 2FZLA 2HJGA 5FTMA 2FN4A 1IXSB 3I5XA 2ZE5A 4FMBB 5E3HA 1R4AA 3HYRA 1YZKA 2JDID 3D8BA 4TYQA 4F38A 1KKLA 3T35A 3SQWA 1GKUB 2ZU6A 5BYKA 2BOVA 2OE2A 1PLLA 3MWJA 3I73A 2DY1A 4GP7A 2RGCA 3EXAA 4MA4A 2XEXA 2R8RA 1JAIA 4IVQA 4HLDA 4BZXA 5L3SA 1KI9A 4Q9HA 1SVOA 3L8ZA 1BH2A 4HI0E 4I1SA 2IUSA 4DUGD 2AFHE 3KXIA 4QGFA 4FMCF 4D82A 3QXHA 2V1UA 3NDBB 3Q8XB 2IEYA 2EYQA 1H8HA 3K0AB 2FPKA 3EX7C 3AUYA 4TL6A 421PA 3ZZTA 4DDTA 2Z5FA 2Q6TA 5G40A 1EFUA 1E0JA 1TADA 2KI5A 4Q9KA 1VDZA 3Q85A 4XTCS 1E0KA 4BQSA 1SVIA 2IS6A 3LQRA 3B82A 1DARA 3QI2A 1NY5A 1DVRA 2V3CC 1QHHA 3U6BA 3F5FA 1W7AA 1XXHE 1Z2AA 1EGAA 1OHHA 2ERXA 3TW8B 4BFTA 1FX0B 1D6JA 1P9WA 4XWOA 1Q1BA 1E9FA 1Q3HA 4GBMA 4EAQA 2D74A 3DL0A 3KL4A 4DBLC 1U8YA 3AP1A 1KSGA 4B33A 2C77A 3KTAB 2C04A 3W34A 1CJMA 2CVFA 2IF0A 4KCGA 4URUR 5BW8A 3CNNA 1J90A 3TUZC 3OIWA 4TMTA 1S0UA 3M6AA 3NH9A 4EPYA 3FMFA 3IGFA 1IN4A 1ZAKA 2DWOA 2NO0A 4CW7A 6Q21A 1MKYA 1WBDA 2XZOA 2BVNA 2ZRCA 3U44B 1ZINA 1PV4A 3AKYA 2FSFA 5TY0A 1B23P 2IEZA 1AZSC 1OB5A 1JECA 1UEJA 3QPUA 3GJXC 3P20A 4PZYA 4B35A 2F3RA 4X8OA 3GEIA 3KFVA 4BECA 1XCMA 1KNXA 3SJCA 3RAPR 1RC8A 3GCGA 2WV9A 1TU3A 1EG7A 3EPJA 3LV8A 2WAYA 5AUPB 1IN7A 2QNRA 2YINC 4NYJR 3WNBA 1NRJB 2VSFA 2J45A 4ESVA 4I1VA 2QTHA 4JVNA 2VPPA 4A1FA 1JXOA 3QY0A 1R0ZA 1U0HC 4LV8B 1U9IC 4MUBA 2OCPA 3MWLA 4NE2A 3VX3A 3B2EA 1N6IA 1YQTA 3ADCA 1YRBA 2PX0A 2QN6A 4IOMA 4TLCA 2ANBA 2QAGA 5HPYB 5JJLA 3OEED 3LVQE 5DYGA 2RGDA 4B3GA 2P6NA 2BHRA 1EFTA 2ZE8A 2H92A 4AKGA 1ZM4A 3VX4A 1Z5ZA 4YLGA 3THWB 1VHTA 1M7HA 3EASA 3KZ1E 4N0EA 3CR8A 1OKKD 2IUUA 2NO6A 3A1TA 1VTKA 2W0SA 3CBQA 4U00A 2O8BB 2CVHA 2V54A 2ZJBA 1KK1A 3RRNA 1ZCAA 3LLMA 1XCGB 2F6RA 1R5OA 2GTPA 3GJ3A 3P26A 3AGPA 1X1SA 4L16A 4MYHA 3DKPA 5JSZA 4URWR 4ZIRA 2QBYA 2O0KA 4M1OA 5J5CA 1ZM9A 1J2JA 1UF9A 4PANA 3B1XA 1ZC4A 1NG1A 4RJLA 4BRUA 4FINA 4P3YA 3KKMA 2WWHA 1UKYA 3HR8A 2X19A 3SE0A 4IXNA 5FBWB 5BYJA 4IJMA 2ZPTX 2AHOA 1EWRA 1S8FA 2XOKA 3QVVA 3UMFA 5JCZA 3PJRA 4M2LA 2GHIA 4BLOA 1HUQA 1YZLA 4LYAA 2PLRA 1DS6A 1KK0A 4KLNA 1R5NA 3FMOB 3BC1A 1XMVA 1FNMA 1HYQA 2CNWA 4HAUA 4IOLA 5FR2A 3Q7PA 4GOKA 4UQOA 2O52A 4YMWA 4EJSA 4F92B 3SC3A 4U5XA 4C3ZA 4A2QA 1Z6XA 2N42A 1ZNZA 2GA8A 3IUYA 3W3AA 4RZ3A 1G3QA 5DI3B 4D4MA 3CPJB 3EIEA 4FMDB 4BEBA 2IYZA 4C2TA 4L9WA 2BJVA 1PUIA 2QU8A 2QTVB 2GAOA 3BH0A 1UBFA 5TARA 1OXSC 5DHFA 3REGA 3K70B 3AF3A 1NVXQ 3BRWD 4ZDWA 4US1R 1SXJA 5KHOC 4IEEA 4G5RA 1BYIA 1T0JB 2WHXA 2YWHA 2QAJA 1NLYA 3KQNA 1LNZA 2QUZA 3DZDA 3G82C 2CHVA 3FDIA 1UEIA 2G1KA 1TQ6A 2FPLA 2JLUA 1W5TA 2OAQ1 5CJPA 4DIDA 2B6HA 3UATA 4JT2A 2J3EA 1A2KC 1RW4A 1ZVQA 1Y63A 3OIVA 1S4QA 1W47A 3PV0A 4GMDA 4TWZA 2ZI6A 1HEIA 1LS1A 1VYTA 1QVRA 1TUIA 3MJRA 4N3NA 4B6FA 4OQFA 3WNCA 1MV5A 2X2FA 3BIFA 2PT5A 1LB1B 3AF1A 1OYYA 3K9HA 4OK6A 3PQCA 4UNQA 3VR5A 1E1RA 1G5TA 4JBXA 4KYUA 1DAMA 2D62A 4AKEA 3AP3A 5CB6A 2ZJ2A 4YMUA 1FPMA 3R7WB 2FOLA 3W8RA 1NKSA 3RS2A 1XPRA 4OL0A 5FTNA 1XBTA 1ZM3A 2QQEA 1PUJA 2VF8A 5A0FA 2RKOA 3PCRB 3TSZA 3ZQ6A 1NP6A 1Z8FA 2DCUA 1BS1A 1DAEA 4IOJA 1XEXB 3TQCA 4TYNA 2ORVA 4TMWA 4AG6A 4CEJB 4BFWA 2BM0A 4J0QA 4MYTA 3MUFA 2ZRGA 2B8WA 4EFMA 2IYXA 1KTVA 5A4JA 5M04A 2D7CA 1E2KA 4CDGA 1R0XA 1UDWA 4MGKR 4RFVA 1KDTA 5EZ5A 4RCZA 3K0AA 4JLKA 2QGNA 5J4LA 3AP2A 2DWQA 3GFTA 1OB2A 2N46A 4YQFA 1JR3D 2ZR0A 4F4IA 3GJ8A 4N1AA 3ZVLA 1QZXA 1US8A 2KBEA 5EP2A 5GADl 4Q03A 4JBWA 2RH5A 1FW6A 3B13B 1GKYA 5DO9A 3AVOA 2JAQA 2CCKA 4KODA 4D6PA 8OHMA 2VO1A 1AKEA 1FX0A 3VR6A 1HURA 3PEVA 2NO7A 1G7TA 4D25A 4LX0A 4Q7JB 1W2GA 1XD8A 4PAQA 5CB8A 3B1VA 3T06B 1CR2A 4QBGB 3KTAA 2YHSA 5SZIA 1OE0A 3UMSA 3K1JA 3GFPA 2QGZA 2IWRA 4CEHB 1X3SA 2J1LA 1J8YF 2CHGA 1N5LA 1FNNA 2C95A 4CIDA 1OFHA 4NCNA 2BMDA 2VL7A 3KJEA 4N0DA 5IDVA 2YOHA 4G5QA 4TZ6A 2V7QD 3FMIA 2VP4A 4PO1A 4B48A 3A1SA 3AF0A 3FWYA 4NCIA 1U98A 5KDDA 4KXFB 4MRVA 4LCBA 3GEHA 3VFDA 3BORA 4NKRA 4ILEA 4KI0A 3ZIAA 1Q0UA 3N70A 4TLEA 3RS5A 1GNQA 2F1IA 3ZZUA 1R8QA 4LGMA 2GXSA 1XPUA 4Q1EA 4OBEA 1KO7A 2P5TB 2H5EA 4B3DA 4LBZA 2WMOB 4R7ZA 2WJIA 3VNUA 5JLJA 2F7SA 4LK2A 5FPKA 2FFHA 2OO7A 1Z07A 2RAPA 1IHUA 1F5NA 2ORIA 4Q7LA 4R9UC 4RZUA 4Z1MA 3TGPA 1N6HA 3RRYA 3O8DA 4H9GA 3AVWA 4PQRA 4HZUA 2WJHA 1AN0A 4JIMA 1XCPA 5AJWA 2QENA 3TR5A 4Z54A 3A4LA 5LBIA 1ONBA 2ZUDA 3A4NA 2ZR7A 3B9QA 3THWA 3T1OA 1UM8A 3J81k 3GLHB 2CNWD 5AWFC 2O8BA 2IS1A 1IM2A 1ZD1A 2PX3A 1L4UA 4PSAA 4C2UA 4DCSA 2FNAA 4TLDA 2XXAB 3PG5A 4JMPA 3OE7A 3KB2A 4DC9A 3ASZA 4Q19A 3QENA 1II8B 4GZMA 1E2PA 4P32A 4E03A 2HT6A 2PJRA 1U8AA 4HYYA 5EQTA 2ZRMA 5FL7A 2LKCA 1XZPA 1SXJD 2WAXA 1CR1A 2Y8EA 3LBHA 3LWNA 4DLUA 1OLOA 5KSOA 3U3JA 3EIHA 1XTIA 4A0FA 3U3MA 4A82A 2RCNA 3AKDA 3TW4A 3H0KA 4B44A 5DNYB 2ZAOA 1R10A 1YKSA 3IBGA 1KI1A 2ZSBA 4RFSB 4P4UA 4TN1A 3KFXA 1CJTC 4K81B 2OCAA 3LX5A 4DSTA 5JEEA 4YDHB 4MYUA 4I99A 2OXRA 2IXFA 1KKMA 2ZJZA 1JXMA 4KHZA 5EZ6B 1RVDA 4BZPA 2OZEA 1G18A 4H1VA 1EK0A 3ZS9A 4WBSA 4RZ2A 1E1RD 2R65A 2FWRA 1DBSA 3ZH9B 2JLRA 3KJHA 3HDTA 5AJYA 2NGRA 5EE0A 2RMKA 3NDPA 4MRRA 2Q21A 5DI3A 1CEEA 2QAGC 4M1WA 1N25A 3MSXA 2V6IA 2VHTA 4HSEA 1YZQA 3IQWA 1XEFA 2UVQA 3JZMA 2AXPA 5LB4A 4CGZA 4XJXA 1VCOA 4U02A 1KI3A 2NPIA 1S9HA 1Z0IA 2WKQA 2W00A 4HUQB 5DHAA 1X8JA 1ZNXA 3VAAA 2CLCX 2KSQA 2PCLA 4BUJA 4ASUA 2DPXA 2NZ8A 3SZRA 1E2FA 1CJKC 1W1WA 1AS3A 2IYQA 3C5HA 4LC0A 4LJ5A 1PLKA 1OPXA 3UWOA 3VR3A 1VHLA 4TTQA 2OV2A 4AWXA 1N6LA 1E2LA 2QPOA 3U7HB 2HLDA 5JEDA 2O8FB 2ZI9A 1T5LA 5F2EA 4JVSB 5KDOA 1N0VC 3DM9B 3IO3A 3KJIA 3TSWA 2YC2C 4Q48A 4P31A 1JB1A 2XSZD 5IT5A 5EE5B 1GDDA 3W5JA 3ZZ0A 2YWGA 4LHVA 2O0JA 4BASA 4ZKDA 1E79A 1E9AA 5J40A 2FSIA 5JMTA 3FKQA 2EFCB 1L8QA 3QUSA 1CLUA 1RKBA 2WTUA 3BS4A 1AGPA 4ACAA 3KB1A 1AS2A 3W6NA 4DDWA 5HTKA 1HE1C 5L3QB 1XEXA 2O5VA 4FMDF 2ATVA 2IHYA 4QBFA 3LW8A 4AYWA 4EJSC 3FKSA 1AQYA 2BBTA 2CLDX 4HATA 1W44A 3R20A 1F48A 3OEHD 5B30A 2G6BA 1FMLA 2HXSA 4G5OA 3OFNA 2H16A 2DB3A 3NEYA 4LJAA 2GZHA 1DELA 1SKQA 4A6XA 1AQUA 2JJ1A 2WJJA 2QE7A 2QPTA 2VH5R 4KVGA 4XH9B 2WPDA 1SXJC 3DO6A 3VKGA 3S1AB 1W46A 3CPHA 2IXGA 4PZZA 3CUEF 2EVWX 3WHKA 1KMQA 3SYLA 3U61B 1XTQA 3ZIAD 2B7CA 5FPYA 1GTVA 4QHSA 5D3MB 3W5IA 2R62A 2CE2X 2SHKA 1SQ5A 1Z08A 4TL7A 1O3YA 1Z6TA 3GLIE 2GWHA 1P62B 3TVTA 4B75A 3SEAA 1NBMA 1KJWA 4URZR 4DHEA 2PZGA 1KZGB 1WP9A 4JYCA 2WIAA 1E2GA 1Z0KA 3AKEA 1D2NA 1TAGA 4HB4A 1P61B 4WAUA 4TMVA 1AZTA 2CLSA 2ZSEA 3FMPB 4CEHA 3P4YA 2XNDA 2AN9A 2I1QA 2D3WA 3TAHA 4NTZA 2VHQA 4ZDKA 3GLFE 4UNPA 2PLFA 4ZCLA 1PJRA 5CITA 1R0YA 5AUOB 1N5KA 1JQLB 4LJ7A 1G5RA 3DOEA 4DSNA 4DCNA 1YJ5A 3NHAA 3WYFA 3FHCB 721PA 1R7RA 3BOSA 4NCHA 2OUKA 4QGGA 4JYBA 2FGJA 2QP4A 2QP3A 2UKDA 3WRYC 1KDOA 1XNJA 1P4SA 4FIDA 3EIQA 3VR4A 4WOPA 4XVRA 3ZJYA 2WJYA 1S3GA 2GETA 3MCAA 4E07A 2OSBA 2H7VA 4RKEA 2J5XA 3CRRA 4LSGA 5FL7D 2ZXUA 5JJIA 5FPTA 1QHYA 1D8TA 3FTQA 1XEWX 4LRWA 3WYAA 2F43B 4C4PA 1T8UA 1G7SA 4G3XA 4MGIR 4M53A 1OXVA 4GL2A 1N6NA 4IFEA 2JIZA 4KBGA 5C46F 3KXLA 121PA 2CL6X 3RS0A 3ZGXA 2QI9C 4K46A 1FUKA 1P9RA 2WOJA 1EFHA 4YMTA 3FYHA 2BBOA 2RB4A 2C99A 2ZYUX 1ZUIA 2Z4SA 3GLHA 1KY2A 1FP7A 4PC6A 5FOVA 3UK6A 1XU4A 4HDOB 3X1XA 3X1YA 5TXGA 2DR3A 2XZLA 4OHWA 3RHFA 4V02A 1NG9A 1XWIA 2X8AA 3TKLA 1B0UA 1IY0A 4Y0AA 2XXAA 3OAAA 1Z2CA 1IJFA 1NN5A 5FOWA 3B1ZA 1K8RA 4PHGA 1P3JA 1II8A 3RS7A 1W49A 3U3RA 3NC1C 2TMKA 1M74A 3GJ5A 4JVMA 4B3FX 1KO5A 1XX6A 3TIFA 2Q3FA 2R6DA 4EIWA 3CWQA 1NF3A 2PMKA 5CIQA 4O3MA 4QGAA 2A5FA 3W6PA 4CT5A 2BEKA 3BFKA 3LO5A 4ASUD 1W0KA 3A6PC 3QPWA 4D4KA 4RFSA 4D0LB 2F9MA 3B6EA 2J46A 2QPAA 2A9KA 2GBLA 2IBMA 4WW0A 5CIWA 4DDUA 2QM8A 4CEJA 3HU2A 4M1TA 3P32A 2IYLD 3I3SR 3SJBA 1IAQA 1ZJ6A 1J7KA 5FH9A 4OI1A 1NL3A 1IONA 3BD9A 3VKWA 2BKEA 1MRSA 2VP5A 3ADBA 1FUUA 2F9LA 1KNQA 4ERNA 5KOYA 1JR3E 3K53A 2GJ9A 5EP3A 1XRJA 4D0GA 2WWIA 4HZIA 3CX8A 4URYR 2PEYA 5H1YA 3L2OB 1M6NA 5G41A 4MKHA 1DOAA 4HAXA 3AF2A 4HUQA 3DVLA 3K0EA 1QVAA 2V1XA 4KFRA 4B73A 3FVQA 2W2TA 4M1SA 3FB4A 2WMNB 2ZRHA 4IHQA 3FKSD 4S35A 5E95A 4TMXA 2ZS7A 3R9IA 2QA5A 4XSHA 2V55B 2A5DA 2F1HA 3AGQA 2BCJQ 4Q21A 1OFTA 3SU8A 3H2YA 3VU9B 2O8FA 4JVLA 5JWOA 2VSXA 2MSEB 2J7PA 2JJ1D 1P75A 1QHIA 2QE7D 2IYSA 3B60A 4ZI2A 1RE0A 2WPDD 2IC5A 5H70A 2LWIA 3RSOA 4EFLA 4F4CA 3C5CA 1JJVA 1QF9A 2HT1A 3NC0C 5AUQA 2JLQA 5JHHB 3A8TA 3ZYCA 1SVKA 1Z6AA 1U2RA 3BB4A 4LHYA 3QEOA 2CJWB 1S1CA 3MRSA 4HAZA 5JRZA 2IS4A 2CCGA 2ZE7A 4QNMA 4QFMA 2XTZA 1DAGA 4QHYA 2CL7X 3LLUA 3P4XA 1OYWA 4M0LA 5L3QA 3IIJA 3I5YA 4Q7KA 4NPHA 2JLYA 2YWEA 1R8SA 1UFQA 1M8PA 2Z6VA 5A5GA 4TTRA 1W5SA 2ZJYA 5E4FA 2RHMA 1GITA 4FCVA 1CIPA 4JJZA 3SI7A 1OH7A 3E1SA 1RYFA 3QEJA 4B34A 2GF9A 1JPJA 2WBLC 2XNDD 1KHTA 3HR7A 1P5ZB 2QT0A 3K70C 5BN4A 4L15A 4DLSA 2R6FA 1P2VA 4ZCIA 4C30A 2B8TA 2GJAA 4O2LA 4P33A 3M0EA 4RKFA 2QMEA 5CYOA 1HV8A 3UMRA 4DT1B 4JLNA 1MR3F 1RFLA 2W6ID 1QRAA 2NMVA 4QM7A 4OQMA 1KZ7B 2DFKB 2GJ8A 1ZIOA 2G0NA 4UKDA 5D3MA 4KITB 2I3BA 3THYA 2P6UA 3AM1A 4M1KA 2GZDA 1TF7A 1G21E 3PITA 4H1UA 3I61A 3WBJA 4BE7B 1WRBA 5DISB 3Q72A 2LCFA 4FWTA 1CRQA 2QRNA 3ASYA 1TQDA 1ZP6A 1Z0AA 2BV3A 2Q9AA 3CW2A 3QKUA 2ZYWX 1E2HA 5DLQC 4RVCA 1OW3B 2P65A 3RWMB 3DKVA 4NCKA 3AKCA 1MO4A 3A1VA 3CRQA 1VIAA 5L3VA 3G5UA 3WP1B 1SXJE 4PZLA 3AVXA 3F0TA 4Q4HB 4OHZA 1A5TA 2B21A 3TSOA 2JA1A 2OBMA 4OJQA 1UBCA 2J0UB 2UZ3A 3ONWA 2OFWA 3T1TA 1W4CA 2HCJB 4G5GA 3EPHA 2JJ8A 1LY1A 2ZRNA 5C2JB 5L3RA 3T34A 3U5ZB 2CK3A 4JLDA 4TSFA 4XOIA 1XMJA 4HB3A 4D81A 2R2AA 1G19A 3NEJA 4BLRA 3PEUA 4BFVA 521PA 3U7EB 4DCTA 4CF7A 4M1MA 1TUEA 2FJUA 1G291 1DG3A 4L5BA 1ZMXA 4ZKEA 5EP4A 1E96A 1G64A 4UXHA 2ZM5A 3Q5DA 1L7VC 3NWJA 1KJYA 4YXWA 1K5GA 4IVRA 1Q1QA 3C41J 4Z8XA 4LYHA 3GQBA 3OAAD 5SZJA 1H8EA 3B7GA 3TK1A 1MABB 1TMKA 3K0CA 5EE9A 1OFUX 4A0HA 1NLZA 2W0MA 3CM0A 4YMVA 1HTWA 4PQFA 2YYZA 1IN6A 2VEDA 4MRNA 1GNRA 5GVRA 2CEAA 2GK7A 2C98A 2F43A 4F4JA 2JLVA 1GG2A 3CZPA 4P4SB 2ZANA 1W0KD 2QTFA 3BB1A 2VHCA 2W6JA 4L9SA 1GVNB 1OIXA 3QXJA 1CULC 1DADA 4UJ5A 3TH5A 2JLXA 2KB0A 5JFGA 4US0R 3FFBA 4AIIA 1Q44A 1T91A 3HP1A 5SZHB 2IF2A 4KFSA 1UAAA 1H8HD 5CM8B 3KXKA 5B2ZA 3PXGA 1KJZA 1O87A 3FPAA 1T4GA 4GP6A 1TF2A 3R8CA 2ZIAA 4XTRA 4C0KA 5KNBA 3U6KA 3JVUA 1KI6B 4HB0A 5IHPA 1AKYA 4JLOA 1NI3A 2VYFA 1G6HA 4MH0R 1KYIA 4NDZA 4XWAA 2C03A 4JLPA 1F2TB 3QXCA 4JJKA 4AC9A 4YC7A 2BMFA 1ZU5A 3FE2A 4MRPA 4X8LA 3ZVRA 1OHHD 1N2CE 2WSSA 1A7JA 3CH4B 3LAWA 1IXRC 3MGCA 4DLWA 1G7CA 3ADDA 4BFUA 3SFVA 4Q4LA 2ODNA 4TQAA 1ZYUA 3AB3A 4DLXA 1WA5A 5DE3A 5EXTA 1ZM2A 4PPNA 1YHNA 3HU1A 2OCBA 3CRW1 5AJZA 3SS8A 2WWGA 4TQUS 1WDTA 2HJVA 4Q7MB 3SNHA 1EX6A 1KGDA 2ONJA 2HXYA 3VQTA 1OH5A 2J7PD 3KKOA 4FN5A 2ZRFA 1Z29A 2VF7A 4HLQB 3QBVA 2J87A 3GJ4A 4LOAA 4M9ZA 4B43A 3Q5EA 2WWWA 1QG2A 1VMAA 3B78A 4US2R 3I4LA 3IIKA 3TLXA 1NSFA 5HZHA 3PUVA 2AK3A 2IL1A 4FWIB 4URXR 3AVYA 5DGXA 2EWWA 3G0HA 3GP8A 1N6RA 2RGXA 1T3HA 4MGYR 4MKGA 4BRWA 4IEIA 5AR1A 3WYGA 2HUPA 5BN3A 2GXUA 5G3ZA 2ECKA 4RCYA 4HDQB 2A3RA 4S2EA 4BEJA 4TYYA 1KIMA 3D6TB 4RD6A 5CLLA 3WMGA 4LJ8A 3AEZA 1SVLA 2MSCB 2XGJA 5JJKA 3GJ7A 1Z0FA 2GRJA 2R44A 1N3BA 4KO8A 5J4KA 1VPLA 3I8SA 3R8FA 4PXAA 2A30A 3K9NA 3D31A 2C2HA 3OHMA 1IN5A 2R9VA 3FGNA 3LW7A 3EG5A 4PPQA 3RS3A 1GL7A 2O8DB 2DYKA 3X1DA 4PX9A 4AK9A 5EP1A 1UBEA 1WF3A 1ZD9A 2C5LA 3HJNA 1SGWA 3I32A 4GZLA 4ITRC 1OSNA 3VU9A 2CBZA 4DIEA 4U7DA 5IK2A 3X2SA 4JLJA 1COWA 1M1YE 2Q3MA 3U44A 4PHFA 3K9LA 2G0TA 1NIPA 4GRAA 3H4MA 3SJZA 4DB4A 1XB2A 3FOZA 3P27A 3AVTA 1CXZA 1FMJA 4Q5IA 4RD0A 2G3YA 1T0HB 4Q66C 4TMZA 2ZR9A 4GT1A 5KYKA 1OXXK 2GDJA 5JWRA 1RYHA 3EWAA 5FUWA 4C0HA 2GBLC 2HEIA 1ANKA 4GPTA 3GMTA 4UNNA 4A0RA 2YZ2A 3WBKA 4QJ3A 5J4HA 4Q47A 1P7CA 3VTKA 3A37A 4M4SA 1CJVC 3MWKA 4PO9A 3TNFA 3DPUA 2XJ9A 4UNRA 1FZQA 4LV6A 4OK5A 1Q21A 4ZPXA 1HT2E 2Z43A 3UIEA 2GAAA 3CF2A 5HKKA 4EPVA 2WIBA 1KSHA 4LJ4A 4HLCA 4A8JB 2O8EB 3GLIB 1Z6YA 4C0SA 4HAYA 5LD2B 2XOKD 2ZUBA 2IHBA 5EUQB 3OESA 1E69A 3FHTA 1VG9B 4PQYA 2CK3D 3LD9A 3RLFA 4TSFD 4B2LA 4DT1A 2A5GA 3ZD7A 3IIMA 4V0OA 3KKQA 1TF5A 4QHTA 4QGHA 4UXJA 2V8OA 3DM5A 2A7QA 4NYIQ 5K8IA 1XZQA 4AY2A 1E9RA 3GLGE 3BH7A 5JECA 3RYTC 1CR4A 3B1WA 2VP9A 1ZRHA 4O25A 1G3MA 2NO1A 4I4LA 4FMCB 1ZBDA 1ZIPA 3N2IA 4L4UA 2NO9A 1H8ED 1R0WA 1E2IA 4WXRA 821PA 4D80A 1M2OB 1YZUA 2VLIA 2YJTD 3U4QB 4Q1AA 3R9XA 5JBQA 1AJEA 3DEFA 1G6OA 4V03A 3D3QA 4LJ9A 4M21A 3IHLA 1BOFA 4GSYA 4KV9A 5HCIA 4DVGA 2GVDC 4XVQA 4Q4HA 1GKIA 2WWXA 4D0NA 4QC2A 2BCGY 1N0WA 1XEWY 2J0UA 1Q57A 3IBYA 5EJEA 2ZEJA 5B57C 2ZAMA 3Q3JB 2QP9X 5FI1B 1AA9A 3KUDA 3Q7QA 2ORWA 2VIIA 5G53C 2W6JD 1K6MA 2GCPA 1CU1A 3L0SA 4AI6A 3MWYW 1RIFA 3C15C 2QSZA 1R2QA 1XD9A 3IDQA 4BFXA 2F1JA 2O8CB 1R5BA 3QOFA 2GXQA 4XIGS 1YZNA 4JKYA 1U0LA 2E87A 2AX4A 2WKRA 1I4DD 4DSOA 2ONKA 5FL3A 3MAAC 3L0IB 1E2MA 4LYJA 1E99A 3WHLA 1X86B 2GJSA 3W6OA 2QMHA 2FGKA 1OIWA 2QMUA 3EZ7A 1HE8B 4E22A 3U3OA 5JS8A 1MABA 4IKEA 3K0FB 2VHUA 4Q9JA 2OXCA 4W5JA 3LY5A 1W36B 2IW3A 3L0OA 2ZJ5A 3I92A 1KSFX 3TQFA 3WNDA 221PA 2V9PA 2IYUA 1MO6A 4IDNA 4R2HA 4P4SA 1FP6A 1M7GA 2P6RA 4PO8A 2WICA 5FTKA 5KPJA 4LZZA 2XAUA 3AV0B 1VECA 3M1IA 1NMXA 1Y3AA 1YU9A 5E7JA 1XJCA 1G8FA 4CT4B 5KPDA 4RSGA 3DMDA 2GCOB 4ON9A 1QHHB 2QORA 1HQCA 2VP2A 1NVUQ 2ZYVX 2JDIA 3TUJC 1ESNA 2WOOA 3DZ8A 5FOUA 2GJKA 2DWPA 3UANA 4XD7A 3NXSA 3R7WA 4R2IA 4A4DA 1VCIA 3C8UA 3B85A 4CYMA 4XVUA 2FU5C 1G7RA 3IPXA 4TLBA 1XJ0A 1SKYE 1FFHA 2IUTA 2X77A 4JLVA 2I4IA 1G9XA 4PHTA 1CKEA 1DAFA 1F2TA 3NKVA 1FOEB 2BJWA 3QXSA 2NIPA 2L0XA 5JCPA 3EZFA 2WWYA 1JEEA 3ECCA 3V9PA 4DCVA 2KE5A 1NN3A 3DMNA 3KKPA
chains in the Genus database with same CATH superfamily
3VHLB 1RWNA 2X0NA 2A5YB 3WKBA 3ZDYB 4LE1A 1W48A 2YZGA 2PFSA 2FRXA 4C6RA 1J5PA 2G1AA 1KYWA 4NE7A 3ROZA 1IIBA 1T34A 2OCYC 4C0AC 3OM9A 3TFQA 2Q5JA 2VYVD 2UXCB 5AFSA 2OHFA 5A1TA 3UC9A 2QVLA 4ZVTA 1COWD 1V1MB 1YBHA 3C3EA 1KDPA 2NWQA 3HCRA 3I9KA 2AKEA 4FD2A 4OJTA 2YH2A 1V5EA 4GI1A 2YYSA 1NVKA 2XW6A 1DOHA 1I7NA 3JARB 3JVEA 4QDTA 2OMEA 3WAJA 3TJZA 1EK6A 4RXMA 4F8JA 2RIPA 4H7IA 1L4YA 3S2ZA 4ZD6A 2H2DA 3LBNA 1DCTA 4UBJA 3KM0A 1L5MA 1YL6A 4XR4A 3ZHBA 4CIYA 1U6IA 1EU1A 4QOSA 4AP6A 4JLUA 1NZFA 1M2NA 1VIDA 3E7DA 4I2NA 4Z49A 1SJ9A 1WCV1 2V65A 4G37A 1DAHA 1C8KA 4CFSA 3OQIB 1BFKA 1XZBA 2J9YB 4K6HA 4OBBA 2F1RA 5K3SA 4BV8A 4EGCB 4R98A 1BQ3A 4OMFG 2GESA 1O95D 5LYYA 4B8YA 2QV0A 3T61A 2SECE 3UYKA 2Z98A 2WG2A 3EWIA 1JLHA 1UKBA 3I72A 3GPIA 1FFGA 1PS8A 1JT2A 2J4FA 2IVFA 3A3PA 2BE9A 3ETLA 3G0CA 4E5PA 3GVXA 1T24A 4ZVMA 2H4FA 3FOWA 1JHOA 3N2KB 1JQDA 1Q1AA 4M60A 1KBZA 2FG5A 3DOCA 4D44A 1A4RA 4DV1B 1A5BB 4OK3A 2OAP1 2H59A 3EVFA 3SR4A 4JYAB 1IPEA 2HH9A 2NSLA 3NX4A 3RO7A 3GLVA 4LXIA 5KJFA 1AHNA 3NOOA 4YONB 3RWOA 4FGWA 4IG9A 1OAOA 3DAYA 2H2AA 5CDFA 3RVJA 2CMFA 4E6EA 2C3MA 1O89A 1UJ2A 3L7JA 4GX1A 4P34A 2C8VA 3PJEA 3UG6A 3GEBA 1AGYA 2JCYA 4WBNB 1G55A 3BHJA 1SHZA 3RG8A 3U39A 3T15A 1F06A 2OLKA 2J3JA 1CE8B 1WZEA 2X3UA 3EF1A 1V7PC 3EQZA 3FFAA 3PL5A 2C29D 5CXSA 2BZ0A 2BIFA 3NHKA 4C22A 4MQ4A 4CKEB 4QKQA 2IOHA 1P3Y1 1W30A 1BIFA 4MWOA 2NG1A 1EFLA 1PSDA 2ZBUA 4HDNB 2CXUA 1X94A 2GEUA 4OI0A 4EL0A 4U6QA 4KFTA 3OE7D 4CMJA 1QHXA 3UT5B 4GGPA 3C16C 2QOEA 1D2EA 2WJAA 1YIDA 5EIFA 3BIWA 4XD2A 4A0GA 4F9TA 3FDFA 3KQSA 3IP3A 4YJDA 4ECEA 2YXLA 3TR0A 1MHPA 2JI7A 1BXRB 3GOHA 1FUEA 3E03A 3KYDB 2QR5A 3U4HA 1RBYA 5C18A 2P6OA 1Q3KA 2V97A 2XCIA 3ENKA 1RXIA 1JQKA 4X1IB 2WJ6A 3K1YA 2FSGA 3ZHZA 2N9UA 5DWVA 3L7LA 4BQPA 3GLIA 2F48A 3CVUA 1KI4A 2PWBA 2V7UA 4L76A 2ADFA 4HAVA 4P0TA 4Y0VA 5B1IA 3VJKA 1DX6A 4HDSB 1WU8A 1M1NB 1QBGA 1IHYA 1NIJA 2UVDA 4PLWA 1Z2NX 2XT6A 2R6JA 3QPCA 4RMNA 1SCIA 1PLJA 3RYIA 1HE4A 2AN5A 4L8LA 5C8ZA 1YDFA 3U4MA 4XUDA 4F96A 2BWJA 4YASA 4E1BA 3HH8A 3VTZA 1NKTA 2J7KA 3B2QA 4ARZB 1O94D 2GK4A 4B81A 1I9GA 1FC0A 1MJGM 1P2FA 4RENA 4Y2SA 5CDHA 1PK9A 3WE7A 1F3OA 1BKYA 2DWUA 3M5DA 1PZFA 1YMUA 1UFRA 4LYYA 5BORA 1NQVA 1SUSA 2FXIA 2GCNA 2I67A 1JE1A 3MBKA 4BKRA 1T15A 2VAWA 4RY9A 5L4SA 3AL3A 4JSTA 2IEGA 3DDOA 4LXQA 1YQQA 3BD8A 1DJLA 4R2XA 3SQDA 4A26A 5JBIA 3JX9A 3U4QA 4OLAA 1E3IA 2IOFK 2REBA 3AEUB 4RWZA 2CV0A 1JJFA 4ZI3A 5H83A 1HXHA 4BZQA 2O1SA 1WB9A 2FV8A 4AJLA 1Z06A 4C5AA 3RUFA 4FBLA 3KSBC 3TTUA 4BC1A 3PYMA 3AHCA 3OC0A 3CMMA 3TRFA 2E4AA 5SY6A 2FMIA 4OAOA 3CB4A 3ROPA 1Z4JA 1I1NA 2O0HA 2ZJAA 2Q3HA 1DFGA 3VR3D 3VR2A 1D1TA 5HOQA 3PUZA 1TT5B 3L8YA 4CM5A 1X2EA 5EVCA 1RRFA 2KMLA 1W8DA 4G4SP 1IMJA 3TNDA 5KOJA 3CNOA 4CQNA 1P1BA 1MZPA 2HNBA 3WWZA 4B4OA 1NYRA 2GI4A 4JI7B 3V8MA 3KVOA 4MULA 2YY7A 1TJPB 2HSGA 2V74B 2VUSA 1X7YA 2VK8A 1FSFA 3ZY2A 2DETA 5JS7A 1U2QA 3FUVA 4L9RA 2GN0A 5G4KB 4EW1A 1KEEB 2B8NA 1T5OA 3AYXB 3NHYA 5FUXA 4F97A 5JPCA 4HDKA 1U80A 1XWFA 2J5BA 3H84A 4MUNA 3RAEC 4MUIA 1GCIA 4K9RA 5BMVA 3T1HB 1EK5A 1JDPA 1NJGA 3RUIA 1NXPA 1BRMA 1VPVA 2H29A 1WIWA 4M1QA 1GSIA 4JDUA 1Q0HA 4HS9A 1OI4A 1H2AS 4CKWB 5A0TA 4YWHA 5B64A 1XDDA 4RLQA 3Q1LA 2P90A 4YBRA 3ZJ5A 4QIHA 4COKA 4DKXA 5HZKA 3EXHB 1J99A 4C5BA 1JDUA 1XD2B 2R6AA 3ER9A 1HDIA 1W34A 1KK2A 2FX5A 2P67A 4AD8A 5IH7A 3G79A 3CLVA 4Y1FA 3MB8A 3VKFA 4HAWA 3WICA 3U61B 3EUFA 3OFND 4G1VA 4P2GA 4HB2A 3W2EA 1FDWA 3I1YA 2DVMA 3VSBA 5LDDC 3FUTA 3AT1A 3IP5A 4FKBA 2AWNA 4EL5A 1SZCA 4D7AA 2O2SA 3D8SA 3L1VA 2Y1LA 1BMDA 1Z28A 3BXFA 4JSYA 4YS6A 1DE0A 2DBZA 5LBTA 3PJGA 1GSOA 3BFJA 4BJ6A 4HRVA 1KMMA 4ABYA 3UWMA 4CZ2A 1YRHA 1YQUA 2CVOA 2A78A 2VDOB 4IEFB 3RCBA 4V0NA 5CYPA 2OLJA 5GJWC 1CB0A 1VG8A 4KGXA 3U4CA 4P22A 1CTQA 5GGXA 1RJWA 4IHKA 1CUUA 2Z3VA 1PWXA 5LB2A 1Y6RA 4QRHA 3IEKA 2DBVO 3IV7A 4IMPA 3B8HA 4W7SA 4Z3KA 3CRVA 2J0VA 1C4WA 2EW2A 3HQ4O 5IJ0A 3R3JA 2P0YA 5FR1A 3EBOA 2I2XB 3W2FA 1Z0ZA 1Y6FA 1A4IA 3FIUA 1XYVA 1NBMD 4LV5B 1NN1A 3JZAA 4YPOA 5JFTA 4PC1A 2BKXA 4BNUA 2XCLA 5C5CA 1K2VN 4L02A 1YS7A 2YYYA 2ID8A 4B32A 4Z4HA 2ZDHA 4PG6A 1AZLA 1E6UA 2JAHA 3D7LA 3PVZA 4X1KA 5LQAA 1EDEA 2D54A 1O9GA 3KR0A 1G6KA 3DNFA 2ZXEA 3QKSA 3L9XA 2ZIGA 5CURA 3PZRA 3SCZA 4J91A 4WL0A 4P4GA 4Q4AB 4W5HA 5K8TA 1KK3A 4J0FA 2IPOA 4AP9A 1Q7RA 1ML3A 3K4HA 4C7XA 3ESRA 3EK2A 4E33A 1ONNA 2HYDA 3A1WA 3AI3A 2EF0A 3AUUA 3OU6A 1BDMA 4RS4A 1URPA 3J7TA 4R1MA 4TKUB 5FORA 1USUA 3QXXA 5FOSA 3S1AA 4F6RA 4JS0A 3AXSA 2JGKA 1L8AA 3GUCA 1A97A 1DGQA 3LPNA 2BPOA 2VTEA 4JFAA 2BL4A 1SZJG 4OTZA 1KY3A 2DHRA 5TQVA 2JK1A 3FFTA 2AZTA 4Y2TA 3A2MA 3LA6A 4M9UA 1QHNA 1NW9B 1W2HA 2YCBA 3H86A 3QMMA 1M7BA 3IQZA 2NV6A 4YRCA 4M9QA 3F1LA 5E7MA 1XMOB 3V4VB 5KYGA 1A7AA 4NU0A 1Y6GA 1IHOA 1SOUA 1X1EA 3IPCA 4DMUB 1JKXA 1R6BX 4NG5A 4IXDA 4O4JF 4JUAA 2F8TA 1Z2OX 2GO7A 1RQGA 2R25B 1A1VA 4C6HA 1Z15A 2CN1A 5IT9A 4GQBA 1IU9A 2HTFA 4DLYA 2XWSA 4P3PA 3ZS8A 3E58A 4Y1EA 1V4VA 1WM1A 4TTPA 4TYPA 3LF2A 4DOMA 1G3RA 1K0FA 2AOWA 3KYIB 2CJFA 3N2NA 4FI3C 1MFPA 1J0XO 1D5CA 1YVDA 2AMJA 2C3PA 3WDMA 1D04A 5SYMA 2KJQA 1OTYA 2V7VA 1N6PA 1EXNA 4DA7A 2A2ZA 4LHEA 1IY1A 1V5IA 2GEJA 2JGNA 2XVXA 2ASVA 4PFKA 1FY2A 1JPNA 2G67A 4PXYA 3K2QA 3VO2A 4IXMA 1JQAA 3S2UA 3ZE9A 3RVKA 4ZDKA 1OV4A 4XZ3A 2FQ1A 2QX7A 1HETA 2G9NA 2X5OA 2FUCA 3EEOA 4JXXA 1L8XA 1XDUA 1PJQA 5FUQA 4F2DA 3T12A 2P9GA 3R5FA 4Q15A 3KETA 3GRRA 4NQRA 4LZAA 2YN2A 1Z17A 4XIIA 2RGNA 1ODSA 1G63A 3ZGLA 5C5IA 3TTSA 2DQKA 3GT0A 4BLVA 4YT4A 3N0RA 3JVDA 4IIUA 3WXMA 1ENPA 1NWHA 1TL7C 2PPVA 4KZPA 2Q5FA 5EHNA 2FSPA 1MQAA 2AK2A 1UT6A 4NBLA 1RTTA 3LK6A 2APJA 4JP1A 3RIMA 5AJVB 4H18A 4HK4A 3A2KA 1Y1RA 1GZSA 2RAUA 3GDOA 4CCYB 1ISSA 4A92A 4O63O 1E94E 3QJYA 2TMGA 3NAQA 2AN4A 2FP4B 2FZ4A 3ICCA 3RUEA 2FN9A 4H16A 4HJXA 4F9GA 1MEOA 1G8HA 1ZK2A 1EFRA 4OL9A 3VR1A 2FZ5A 1AO0A 3A1UA 1U7TA 4HLUA 5ENVA 4D3YA 1X7XB 1DIHA 4PR3A 4B6EA 1NMEA 3UJ8A 2C9CA 4CM7A 3C5WP 4EO4A 4AICA 2F4VB 3OFVA 4RQTA 5B58C 3MZ0A 3AEQA 3LDHA 2VDRB 2JFBA 2R00A 3GUHA 1SIOA 4UEWA 4C0WA 3LH5A 5CG1A 1GRCA 3RC3A 4CV2A 2W2KA 1TYEB 1PNRA 4TYWA 2WD8A 4MNTA 2NU7A 3QWIA 1QM5A 4BNVA 1OLXA 4AB1A 2YFHA 5AXBA 1W25A 2Q2VA 4PBSA 1U8FO 1U3DA 2QF7A 2BH9A 1C29B 1G1AA 2WVAA 1DEKA 2XVZA 3A4YA 3I04M 3M6IA 5DYNA 3UB4A 3ZCSA 4YALA 4EI2A 4IFIA 2CNNA 1KC3A 1K5HA 1U0OC 1QFZA 1GPMA 2WU1A 3AO0B 2W2OA 3IBSA 1J49A 4ZOLA 4C4TA 2Z09A 4EQ6B 2IBSA 4BLSA 1K1EA 1P0FA 3F5SA 4LTNA 1X7HA 2XPCA 3NBFA 3WLRA 4CTNA 2OGSA 3IAHA 5FTJA 1YVRA 1JDZA 4DLAA 1N8KA 1YUBA 3CISA 5CRIA 3OPMA 2D4AA 2IZ1A 2IOYA 4V0QA 1HWYA 3VNRA 3ZXIA 4RTSA 2P4HX 1HK7A 2GYVA 3VMFA 3EPKA 1WBBA 1GNPA 1FZTA 1ZGHA 3ELYA 3EPPA 1JKJB 4MW1A 2QVGA 5FBQB 1YVPA 1JMKC 4MWZA 3SZ3A 1JILA 2ZZKA 3K0BA 2DJ5A 2VF4X 5KOIA 2QY6A 5TT1A 3AQIA 1E6CA 4K0KB 2BY4A 2GN9A 3GCXA 4UC0A 5KCZA 4NONA 3Q6NA 1QX4A 4A8JC 5JH7A 1QYXA 2ON6A 4CVNA 2AYYA 4MB0A 1KVUA 4PFSA 5LD2C 3HCCA 2AR7A 5HJ7A 5KOHB 5KSZA 3L46A 3AERA 4OKSA 2I8LA 3EUWA 5C4MA 4F9FA 3L5KA 1T5IA 2BBSA 4LIPD 5KYWA 5IRCD 2QG9A 4W5WA 4BS9A 1QLWA 1QHGA 1LI7A 2QQ0A 3AZOA 3HBFA 4BNYA 4G0NA 3MUEA 2ZIUB 3TLEA 1HE3A 4Q4JB 1CQJB 4H6XA 4NHOA 2FEOA 2G72A 4KUEA 4ZV4A 3BSYA 3FHLA 2VYNA 3JSAA 5JD4A 4L7VA 4U1RA 2IHJA 3PEYA 1W76A 3H1GA 1SKYB 3KT3A 2XNHA 2ID9A 3RVMA 4D9FA 4BO9A 1IZZA 2YV5A 4HCJA 4O4LF 4DPKA 5AT1A 5AXCA 1TX4B 4EA6A 5LNK6 4G9EA 2HPZA 2XYVA 3QVWA 4FFNA 2OECA 1MNQA 3FCAA 4H3HB 1NQTA 1EYZA 2C4VA 3UXEA 5FNVA 4GI5A 3USES 3OZBA 4V39A 3I04A 1NVWQ 4DR6B 1A4XA 2PYDA 4ARAA 2W42A 1D9ZA 4RKWA 3RRMA 1NBWB 5ALGA 3X1ZA 2BF4A 4X44A 1YE3A 2LKDA 2A86A 5FI0B 3THSA 5CVUA 1JHMA 3QIVA 5TT0A 2BN4A 2QD4A 3LOPA 4RKYA 3ZHSA 5IZ4A 3QH4A 3NATA 1WD5A 4IV8A 2LV8A 2W2LA 1RLIA 1WMBA 2A14A 4IVNA 4ZVOA 3T5GA 3QVXA 4F60A 5IKXA 1U1FA 1L8OA 1C7QA 3V8RA 4B9AA 1LPNA 1MP0A 4ZYLA 2Z5GA 2PDAA 4FOSA 2XVAA 3ND8A 5KC9A 4WJLA 5CNJA 3LQ4A 3BK7A 2ZETA 4YJKA 1XZMA 2YNMC 3UJHA 2VSOA 2IQIA 2GCEA 2QRVA 2YMLA 1I30A 3O90A 1D2MA 1F4PA 3OOEA 1K98A 1T2FA 5HFJA 5K45A 3FFWA 1N78A 4YUWA 2ZKLA 2C00A 1V43A 4YJHB 5K0NA 2ZCJA 5FLEX 1OXTA 4OQXA 4RY2A 1U2GA 2RHDA 4B09A 3IB6A 5FLYA 1W36C 1AKVA 2VXCA 1QHSA 2O8NA 5ALLA 1XVUA 4RPKA 2NXEA 4OJKA 5CLQA 1M72A 2QROA 5CLHA 5CEJA 3QV2A 3RT1A 4RD4A 4ZDIA 4DWJA 1B74A 4ZZ0A 2J6BA 1TZJA 3QFRA 3DYIA 3AB8A 1I36A 3GNSA 1Q1ZA 2B61A 2PX2A 3HP7A 3IJRA 3CF0A 3IO5A 4BEVA 4D02A 3IMEA 3AFHA 3PUYA 3K6SB 5IAJA 5AW8A 1GPNA 3G8AA 2ZP1A 3BDAA 3S29A 2V8BA 2GT1A 1E2BA 1Z63A 4Q9IA 3SLRA 2N3ZA 1Z73A 3QHQA 1QS0B 1KJIA 1U31A 2AHRA 4RZXA 3GU3A 1J8FA 3VKVA 2R6GA 3WDSA 1ISPA 3RGGA 1DJMA 4XX0A 2CSUA 3DBHA 4O59O 3UF0A 2G4CA 1K89A 4GYJA 3IH5A 4D2IA 1EP9A 2CLIB 3GJZA 4FP9A 4BB5A 3TINA 3T3OA 1HT1E 4ISBA 4BNDA 4H7JA 4RHEA 2GILA 4EKEA 1CC1S 1WUTA 1YB4A 2JARA 3QG5A 2IT1A 1APBA 4PPGA 2KM1A 2WVHA 3TLZA 1ZGBA 1P2SA 3NHMA 1G1MA 1TCAA 4OXKA 2QUAA 2PGIA 4PPFA 4R69A 5JLAA 4GDFA 1TAUA 1E1QA 4OLHA 2IH2A 3EC2A 4EF4A 1EFRD 2RAVA 2EU8A 1RI2A 4WCFA 1IQRA 4BKPA 3NALA 4D3ZA 1TW3A 4HP8A 5JQWA 2HO4A 3TD6A 4HNGA 2B1GA 5B3JA 2B92A 2G4LA 3UPUA 3EVTA 4NXMB 1BMFA 4UHBA 4JQOA 3EUAA 2DFDA 3B1FA 4TTTS 4I1OA 4OQEA 2WSBA 2C5SA 2RK3A 2EL9A 2AG5A 1R12A 2BUAA 3ELDA 2FPPA 4M99A 4NE9A 5T67A 5LXTA 3IEVA 4PZ0A 3FOEC 1QZ3A 4IF4A 1U3CA 5BSGA 1D0VA 2WZBA 4ZVNA 3TLBA 2ACWA 3BILA 4M7WA 1XPOA 1X8LA 4LWZA 4IGEA 2FZGA 4PAMA 4OBWA 4I4TB 1LBTA 3W9YA 2FMTA 3KR9A 2G40A 2ZJ8A 4BVBA 3ZU3A 2YFYA 3RPEA 2WSSD 2NVBA 2WQZA 3BGSA 5C1BA 4C0QC 3GT7A 4TSKA 1QO7A 3CEHA 1DQNA 1XCOA 3WGKA 4B5LA 1EKXA 1YR7A 3KYBA 3HZHA 2JLCA 4P86A 4YBZA 1IXZA 5G0WA 3X0DA 5K7SA 2GM3A 4QATA 2ZTMA 1C50A 2BFEA 3JQGA 1K92A 4QNRA 3IP8A 2C9MA 3OPQA 2HFKA 3L0PA 4C0XA 2HK7A 1RSZA 2OGWA 3ABSB 1EVKA 2CXTA 1Y0BA 3AZQA 3G2IA 3NS7A 4YJ2B 1V5WA 2QJTA 1JKMA 4MMZB 4LI3X 3RYHB 3ND6A 6PFKA 3DOOA 4BGDA 5LOVB 1HDZA 4CMIB 4QAJA 3D3NA 4Z4IA 1T9GR 4YMVA 3RAGA 3F6RA 4S0XA 3W9BA 2QD1A 3WR5A 3ZQ4A 1N5RA 3ETJA 2O6HA 3RJZA 5K2OA 3REQB 4C0LA 3E5RA 3LRTA 2FK8A 4Q05A 3U7QB 5KS2A 5J2UF 2BEVA 5AI8A 2I62A 2O7QA 3FMGA 1Y4ZA 3S40A 3C97A 3LUCA 5CBKA 1GT91 4G1CA 1ELOA 3WQRA 1KMHA 4AXXA 4YPVA 1VE3A 4DMLA 2JIMA 3DULA 1ND5A 1Y3IA 4IILA 2OG1A 4S1TA 4M9SA 3X1WA 3IA7A 3VPSA 1BKDR 4UD2A 2QT1A 2XXBA 5EJ5A 3F5QA 4V2UA 3SM9A 2C4MA 2NUPA 4M8NE 3RTEA 2YBEA 2VYND 5AHWA 4KPEC 4ABTA 5K0JA 2WG1A 4PFJA 3IBFA 5HBRA 1T0UA 1XT6A 2H18A 4H15A 4EJMA 4REQA 4WOKA 3DHEA 4XM2A 2QZJA 4LPKA 2WP0A 3Q9LA 3VUEA 3RC8A 3ESBA 4MP8A 2IU6A 2GMWA 4Q16A 4MTLA 4OQNA 3PVSA 3VSDA 4GFDA 4GX0A 9LDTA 1XKLA 3EIUA 3A6LA 2YC4C 4DADA 5JD6A 1LPSA 1JE0A 1Y6JA 3KZKA 1PYGA 3HKEA 1HDRA 3SYNA 1FYVA 1MO5A 1WZNA 3IXQA 2MMGA 1RQLA 4RA9B 3I39X 2E82A 3DCNA 4CQMA 2MMCA 2FQWA 5BRNA 2YWXA 1E0SA 2RGUA 3MVEA 2ZREA 3ON5A 4KXNA 4TRNA 5KVCA 3OKAA 4XR9A 4KIFA 3PGLA 3M6FA 2G7MC 2W2LD 3QI7A 3PNVA 4ZHQA 2PO7A 3MUOA 3TGWA 1D7AA 3WGIA 3QVKA 2HA7A 4A2PA 4H31A 1PNTA 2IS2A 2CDNA 2H1HA 2YQ4A 3CVJA 3F7NA 1KI2A 1Y4AE 2E21A 3D4LA 2AI1A 3O8OA 4CIVA 1QIGA 2ISQA 1CW2B 3EIXA 4KLZA 4NZYA 4UREA 3P0HA 2V6BA 4DANA 3RIHA 1PE0A 4G2NA 3E81A 4Y9UA 5FA6A 3U3ZA 4E4RA 3EISA 1GYPA 5DTJA 3SGLA 1QOQB 2AN1A 4CHTA 4JXZA 1PX2A 1YR8A 2ZJ7A 4J3JA 1YBAA 2IPLA 4NP6A 4WJZA 3SOPA 1BEEA 3TNYA 3IODA 5HKKD 4A15A 5IASA 3GDFA 4OQQA 2XB4A 3H05A 3W9UA 3K8ZA 2FZEA 3IUNA 3H8VA 2V0CA 1Z68A 2BFCB 2X9LA 4RSMA 4DY4A 1FQKA 5H82A 5JANA 1L5HB 3WRXA 2FWIA 3JQ9C 1H42A 3A9CA 3ZCPA 1MB4A 2GGSA 3EXFB 3TW6A 1XZLA 2OBNA 4U3JB 1ATIA 2WDZA 4RIFA 1TZ2A 2VJMA 3WOHA 5CLFA 4DV2B 3SIRA 3GNQA 2CBXA 1ULUA 2ZW9A 3GLHE 1MVLA 1PT7A 2FMUA 3WL3A 1XZIA 5KSPA 4OQLA 4EKNB 1L4LA 2HSJA 1A9YA 1UBOS 2RH9B 1EK2A 4DMMA 1U81A 5KMGB 3FSJX 2ZB8A 1MOQA 4OI4A 2I65A 1UC9A 2ZJ4A 4DM7A 2QB5A 1UBJS 2FPGA 3IHWA 2XUPA 3N58A 5TEWA 2IYTA 2IYNA 2ZI7A 4FGSA 2IHVA 2Z0MA 1ECJA 3GGOA 1YBFA 3I6YA 1OKKA 5HKBA 3BAFA 4B0PA 3R9WA 3LVRE 2ZI5A 1Z9BA 1UWKA 2OP1A 2DM6A 3QE4A 5GGYA 2CFRA 1ACLA 1GTMA 3AM3A 3SYKA 3WWCA 1Z35A 4YHBA 1LQTA 2WYOA 1XHLA 4B8WA 1C9NA 3KPYA 1E1QD 3QQ5A 4KACA 2A88A 1WMEA 2HU5A 3TCXB 4B3IA 3KQUA 2VXYA 4G84A 4BCCA 4WKCA 2QVXX 1L5FA 5FIUA 3SJ7A 5KI6A 3ZR4B 3RIXA 2PUDA 1EDDA 1JEJA 4EUEA 2OFOA 3EXHC 4POOA 3EQ2A 3MLEA 3GX1A 2Y0BA 3AZPA 3N59A 1VLVA 4PIPA 1C30B 5BW5A 4BPBA 1FS6A 4LWOA 1V48A 2PMDA 1BMFD 1SKMA 1WXFA 4PHHA 5CA0A 5M29A 2HAEA 1ZW1A 2J0QA 3ZI0A 1E6WA 1WLYA 1NN0A 1MORA 3PQFA 4LQDA 1QQBA 2XGSA 3T1VA 1U7ZA 4XQGA 4IIEA 3BMQB 4JQYA 2OQIA 3JQAA 1AXEA 1EESA 4EITA 4PCAA 4EMSA 2PJZA 4CEIA 4ND6A 1KERA 4YI5A 2PUGA 1LPPA 4EVRA 3C87A 2IODA 3TQHA 3UK7A 2IZOA 1B6SA 3KZMA 1TZMA 1VL2A 2CB9A 3GZ4A 3M5PA 3T8YA 3UG7A 1Q50A 1V6CA 2GZRA 3NVAA 1XEAA 1YS4A 1VG1A 3IILA 2Q0HA 5FTLA 1GFZA 4HWTA 2FZLA 4XGIA 1RXSA 2Z1NA 4MW6A 2FN4A 2C1ZA 5KQMA 4RW0A 4Z2YA 5JISA 1MAVA 1R4AA 2NUTB 3C8MA 5KU7A 3UV3A 4LTDA 4F38A 5A4DA 1GKUB 3SXJA 2ZU6A 1ZOSA 5BYKA 2UYHA 3W5VA 4HFRA 4TT8A 5GONA 4FTWA 2QZ9A 1ECGA 3N86A 5EA2A 4EHFA 3GGSA 3PS9A 4P98A 2XEXA 2YUTA 4DILA 3ZV7A 3DO5A 4Q24A 3BL5A 3P2OA 3H5WA 2WRZA 2JGDB 1VGQA 3WL7A 3EHDA 1JKIA 3TI7A 1SVOA 2OZLA 3G2LA 4E51A 3L8ZA 1BH2A 3RRXA 4I1SA 2VHXA 1YDWA 3NV7A 2PKQO 4QGFA 1GQFA 1GTL1 2PK3A 1NE2A 2O14A 3BFPA 3CTPA 1JR2A 2YL2A 4F86A 4D82A 3T5PA 5AKGA 3NDBB 3Q8XB 1JEYB 2EYQA 1H8HA 2I71A 3EYAA 2AOVA 2NVUB 3EX7C 3NDIA 4TL6A 421PA 4DDTA 4Q4CA 4NNOA 4QVIA 3NO4A 4H1TA 3U31A 1A3CA 2ROQA 3D6UA 2CFTA 3FPBA 3QEKA 4EGJA 5FOQA 3C1AA 1RFGE 3GLTA 3HL0A 2A7XA 1FXWA 2BSAA 1YDHA 1E0KA 2ZXFA 3JRNA 5F4BA 1SVIA 4B7ZA 2QM3A 1IVYA 3G02A 4P3XA 1M0WA 1N34B 2JI9A 1XXHE 5FB3A 1Y8CA 2VKTA 2ARKA 1N2CB 1EGAA 2V7TA 3IULA 3MWFA 4JR2A 4PYRA 3L6EA 4BFTA 4E15A 1R15A 4EJ0A 5AP9A 3GA0A 1SBHA 5F2NA 1YQDA 4R68A 5KYYA 1HTBA 3UMVA 2IU0A 2GTHA 3ZDZB 4R8SA 3IRUA 1SC3A 4K9KA 3D3JA 3W34A 1CJMA 2CVFA 4A1OA 2JA2A 1NW8A 3WLEA 2ECPA 2PKXA 1OFVA 1ECFA 3AFMA 3KUXA 3DB1A 3OIWA 4MJ3A 3WGHA 3OPYI 3HB7A 2IH5A 3FMFA 2AV6A 3CLTD 3M3DA 2GJ4A 3CQ9A 3PDHA 4MV3A 3E48A 3TMYA 1RJEA 3GUZA 4AMVA 3DHYA 3FRHA 2ZRCA 4CF5A 4CW7A 2J3IA 1CUSA 1PV4A 5TY0A 2P27A 2FN3A 1AZSC 1WV1A 4EY8A 3R3WA 3R3VA 1AC5A 2VWQA 2Z1DA 5LZ5A 4JHLA 5A5DA 3P20A 2BGRA 4GVLA 4B35A 2F3RA 3GEIA 1M66A 4MV6A 1K6EA 1R9NA 3UW1A 4QFDA 1CZLA 3AJDA 1HSZA 5IUJC 3SE7A 2IW1A 5BR7A 3LWDA 1TUBB 2HCTA 4I19A 4KR9A 5L7WA 2C7OA 1GGVA 1RPAA 1IN7A 4HXGA 1JB9A 4MTCA 1Q0QA 1RZRA 2YINC 2Y0PA 4ESVA 3OUZA 4HDAA 5TQ0A 3K9BA 5G0VA 4Y1GA 1WHTA 2QTHA 1EM6A 1VL0A 2ZBDA 2PT6A 4N49A 4L4ZA 1DEOA 1O57A 2WD9A 1P7VA 4OREX 4LRQA 1KH3A 2GPSA 1ZJWA 1AUXA 2X9QA 3OLXA 3FTCA 1FP1D 3ADCA 2MINA 3HJAA 1F0NA 2G36A 4PNHA 5JJLA 4KL8S 5C37A 4IX9A 4C43A 1M1YB 3G2MA 5LLTA 4XARA 5DYGA 4BP1A 1UK7A 3HCDA 5DBIA 4OVKA 5EWMA 1D07A 3OJCA 2C2YA 1FDSA 1WP4A 4LXUA 2JANA 1NUUA 3PEEA 2ZYHA 4TV9A 3D64A 1XLVA 3BIJA 4HGPA 1Z74A 3R7SA 5IZCC 5JUWA 1M7HA 3KZ1E 4MAFA 4F04A 5F7OA 4NH4A 1OKKD 4BO7A 1XAHA 1VTKA 2W0SA 1AQLA 4HNAA 4KXYA 4U2DA 1W19A 1QH8B 2Y92A 1YL7A 2CVHA 1ZGZA 2FQQA 3B3FA 2H2FA 1LQUA 3K6KA 3DLIA 1ZCAA 3QBJA 4RVFA 3RRNA 3UOAB 3QELA 1RACA 1IUKA 1SKBA 1ZCJA 4KGVA 2UZAA 3ZE1B 1DJNA 5HKAA 3ZW9A 2GTPA 3CTMA 3KJQA 4KPGA 1X7WA 3GFQA 3AGPA 1X1SA 3KJZA 4LXTA 4MYHA 4FFPA 5DSTA 1LD3A 2R4TA 4URWR 5CW2A 1FVXA 1PGPA 4RL6A 2G5PA 1UC5B 2O0KA 5J5CA 5IVIA 5K8CA 1UJ4A 1REQB 4MO2A 4PANA 2YHIB 1NG1A 3ZWDA 4RJLA 4A27A 3E8XA 4QARA 3P2EA 1KP2A 5DGDA 2BRUC 1J2YA 1KVSA 2X19A 3RARA 5H4GA 1TCBA 4XGQA 1RXWA 2D1FA 1UPXA 1VQ1A 3JASB 5HP4A 3DMGA 1ZNQO 4C7VA 5I6DA 3E2MA 3PJRA 3QVSA 4BLOA 1YZLA 1SQ0A 3LTEA 1DS6A 3HRKA 4WNAA 1R5NA 1XVLA 3DZIA 3FMOB 3JQAD 3NGLA 3FYCA 4ESEA 1XTTA 3W4JA 3UA4A 5FR2A 2GRAA 2GERA 4HKTA 4GOKA 3LWZA 1SRRA 2O52A 4MCHA 4UQOA 4U5XA 1KWGA 1E92A 4P36A 2N42A 2OXEA 1V37A 4ZYTA 4I55A 1F8YA 1Y1QA 3C3WA 4RZ3A 3E7FA 5BUZA 2Y0EA 3D1LA 3CPJB 3EIEA 2ACKA 1OOEA 5BP7A 2ZSKA 4E31A 2F1OA 2H1IA 4NJEA 2ZUUA 4C2TA 4BC0A 3QE9Y 4ARIA 2YMMA 1FLAA 1PUIA 4IJQA 2KLHA 2C7VA 1QIMA 5FPPA 5AXDA 3IAM1 5TARA 1CD5A 1OXSC 2C2KA 4EYEA 2G0AA 5A9SA 1NVXQ 2EZ9A 3BRWD 3K31A 4ZPJA 3UCXA 4XA8A 3TTYA 1MENA 1SXJA 2Y4OA 3M2TA 4IEEA 1BYIA 1T0JB 2EQ5A 3RC1A 2QAJA 1NLYA 2C2XA 3PCTA 3SDSA 5JT1A 3KQNA 2C1XA 3G82C 1JJIA 2CHVA 1LKZA 1NR5A 4PYLA 2DJIA 4C6TB 1NW3A 1RM0A 4DIDA 3LWBA 3JQ7B 2B6HA 2XKAA 4JT2A 4S24A 2J3EA 3E82A 3MBIA 4GLBA 4LK3A 1A2KC 3URMA 3UTCA 1QSGA 3X2FA 4A8HA 3E7XA 3R7LA 1VA4A 3VTFA 5HUHA 1S4QA 4TWZA 3PV0A 2WG0A 1NJ5A 3Q3VA 1HEIA 1LS1A 1VYTA 3EEQA 1TUIA 3MJRA 4N3NA 1ZK1A 2EKZA 1P2GA 1YFZA 3G2NA 1XL1A 2OCLA 4JEUA 4WT7A 4YJ3B 4RHUA 1E8MA 3A1DA 4EG8A 3QKIA 3ND5A 4Y98A 3T54A 3PQCA 5CB4B 4DWVA 2HX1A 2WFMA 2BH2A 4DQKA 1WVMA 5DHSA 5E2AA 2JGRA 1D7OA 2ZJ2A 5K6RA 1TM4E 4LTMA 4YAFA 3G7NA 3R7WB 4RDXA 1Z4KA 1NKSA 2JD0A 2E5WA 2O3SA 4H6PA 3RS2A 4L0DA 4XPZA 3MINA 1XPRA 3PVCA 2ZQZA 3PI6A 4PVDA 3DXXA 3OJEA 1E3EA 1UMKA 1XBTA 2QQEA 2XQVA 3KEGA 3M6UA 2IHZA 2JBHA 3PCRB 2JVJA 4LDRA 4PRZA 3WLLA 1W96A 1OI3A 3K6JA 4Z7JA 1IK6A 1N75A 3WV4A 1XDGA 5H9WA 4MUHA 3OPNA 1EJ6A 1R37A 1E5VA 2EARA 1BS1A 2NQTA 3D9QX 3NGMA 3MAGA 4P38A 5FWYA 3GJQA 2EZ8A 3F3MA 3FYUA 4Y7CA 2CD7A 2CLHB 1FNSA 2O7NA 2YHAA 3A2LA 3CEAA 3KE9A 3MUFA 2B8WA 1Q1GA 4EFMA 2IYXA 1KTVA 3AI2A 2D7CA 4BAZA 4BMCA 1TK2A 5LMNB 2A3NA 5HS4A 4RFVA 2JGFA 1JZTA 4P8RA 4RANA 1OZGA 5EZ5A 4H08A 4WERA 1VZ2A 2DH6A 2EJUA 4TM7A 3OT5A 2NUAA 2R68A 1ZEJA 3F7OA 4JLKA 2I8CA 3IPLA 1H9CA 4EVSA 3GFTA 1V8BA 2OL4A 4LCJA 5BV2P 2H11A 1XN4A 1XE3A 1JR3D 3K16A 3GJ8A 3ZVLA 3SLGA 3SEZA 2PRYA 1US8A 4FEAA 4CFZA 1T1IA 1XU9A 2X14A 4L3WA 4NZNA 5BSEA 5I3CA 2RH5A 1FW6A 3NT4A 3B13B 3GVPA 3IDSA 4A8TA 3LGSA 4OLFA 5DO9A 2OWDA 2JAQA 4OUDA 3WWEA 2WYHA 3B3QA 3I83A 4JU9A 4EF5A 2EX4A 1QV6A 1WUHS 2PVCA 1LRJA 3PEVA 2NO7A 1ZGCA 1FMFA 3OTOB 1ES9A 1CUJA 1M10A 1WXWA 3TZQA 4Q7JB 5L40A 1EM8B 1XD8A 3CZAA 2JH3A 2POQX 4DR7B 5KNCH 4EX7A 3B1VA 2OXFA 4QBGB 3LXMA 3T3NA 1JDJA 2VBIA 3L79A 1Z26A 2B6NA 4M8KA 1ECLA 2X0FA 2SICE 4ITVA 3UMSA 4MIOA 3GFPA 4M86A 1AF7A 4CEHB 1IATA 2XGOA 1J8YF 4OEHA 1IHPA 2XUGA 5ERGB 1VB5A 1TAHA 2P2CA 3SYMA 5JH7F 4YAKA 3ZG6A 3P9XA 3B36A 1OZFA 2WD7A 2YOHA 1I3KA 5KHAA 1E4OA 4R9SA 4LDPA 2CF5A 4KXFB 3STWA 5IBRA 3MLBA 5TQ2B 4KFCA 4EHHA 4ZHSA 4NKRA