1XRJA

Rapid structure determination of human uridine-cytidine kinase 2 using a conventional laboratory x-ray source and a single samarium derivative
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
PFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine-cytidine kinase 2
publication title Structure of human uridine-cytidine kinase 2 determined by SIRAS using a rotating-anode X-ray generator and a single samarium derivative.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xrjA00
2FPMA 1E9AA 1BYUA 1U94A 1EGAA 5IK2A 3LXXA 4QBGB 1V5WA 5KSZA 4WZ6A 3TR0A 1XEWX 2W6IA 2CNWA 3WMFA 4O3MA 3R20A 1KJWA 2PZFA 4HSEA 2FSFA 1FW6A 1A7JA 1GKYA 2WAYA 3LFUA 4MGYR 3LX8A 1U8ZA 2P5TB 1Y63A 1KZGB 1T91A 3QOFA 4NYMQ 2QENA 3NHAA 3IBGA 1UEIA 1NN5A 1VG9B 1TQDA 2VP9A 3H86A 4GOKA 3AV0B 2FV8A 3C14C 4PPFA 3QF4B 2WKQA 4TN1A 5AK0A 4C0LA 4AY2A 4JL8A 2Q3FA 3VQTA 1QZXA 3T61A 4TSFA 4C7OA 4RCYA 2IWHA 4O25A 1N2CE 3IIJA 5BN5A 2C98A 1N6OA 2GXSA 2QNRA 3CRRA 2GJAA 2CJWB 1VMAA 5H70A 4YXWD 3GLHA 5BW8A 2F1IA 4LBWA 2NIPA 1DTSA 4EPYA 5BYJA 1W36C 3MG9A 1JEEA 2PCLA 4C0HA 1GWNA 2FFHA 821PA 3OF5A 4UJ5A 1W44A 1C1YA 2E87A 3L82B 5KOYA 4AK9A 5CIWA 1XU4A 2FPKA 1XTQA 3SFZA 3UK6A 3K9NA 3LV8A 4TYWA 3RRZA 4WA7A 4BASA 2C03A 3CF2A 4DCNA 4QNRA 1OKKD 1G1MA 4XH9B 5P21A 1DVRA 4EJSC 4A6XA 1CULC 4M0LA 5EZ5A 4B43A 3K0AB 4G5GA 4B35A 5J40A 3FDIA 4NYMR 3I62A 2QN6A 4E22A 1UEJA 2WIBA 2OXRA 4EPWA 1GAJA 4M21A 2GCPA 3ZZ0A 4Q9KA 3K0CC 5HZKA 3U6KA 3U4QB 4TLCA 3U44B 2D62A 4DB4A 4L9SA 2NQ2C 2B92A 1G64A 2G77B 1E2EA 1VHTA 4PC3A 4BFUA 1ONBA 1KMHB 2XOKD 1K8RA 2LKDA 2EFGA 4G0NA 2IYQA 4TL7A 4L5BA 3W8NA 2ZSEA 2ODNA 1J2JA 5JI3E 1ZIOA 3HR8A 3S1AB 2P6RA 2ASEA 2IS2A 2HXSA 4B6FA 4QBIA 3W3AA 2WOOA 1AKEA 3KDSE 2GWHA 2C77A 1W0KD 4MRSA 1QBKC 4ZDIA 4IDOA 2O8CB 4YMUA 3EARA 1P9RA 2AD1A 4TYPA 3RRYA 4IVRA 2QT1A 1IHUA 1DPFA 3A4LA 3OAAA 3RANA 4KITB 4C2UA 1I2MA 3RS2A 3CW2A 1A2BA 1AA9A 2O0HA 4NMMA 4PFSA 4EFMA 1P9WA 1SVLA 4BFXA 1E1QA 4XTRA 2WKRA 1HQYE 4ZDWA 1E79D 1T6NA 2Z43A 2ZE6A 3OE7A 4D26A 1CJVC 2B8TA 2GDJA 1E9DA 1ZW6A 2PMKA 4NCJA 1LF5A 5AJYA 1TEVA 4WZBE 1M7HA 4LV8B 3AGPA 1ELOA 1P62B 2F6RA 3KFXA 2ZSFA 1N6NA 1XF9A 4XD7A 3DKPA 3MWLA 2BKEA 1PV4A 4OI4A 3IIKA 2GK7A 3BH7A 3CR7A 1YZQA 1CIPA 1TF2A 1I4LD 3K70C 1NKTA 5FTMA 3VR1A 3QVUA 3W6PA 2O8EB 2Z4RA 3AKYA 2DFTA 1Z5ZA 1NBME 3W5IA 1DEKA 1A4RA 3GEEA 4QGAA 1MKYA 4EAQA 1B0UA 1FP7A 1KI1A 4OBEA 3HR7A 2ZR7A 1GIAA 3P32A 4P3YA 4BRUA 2ODEA 3GJ3A 4IEIA 5KNCA 4HDCA 2CE2X 2HCJB 3Q72A 4IKEA 4PQRA 2ZAOA 1JJ7A 1QVAA 2ATVA 1Q44A 3SYNA 2CVHA 1R7RA 4ESVA 1ZM7A 4A92A 1KSGA 1ZJ6A 4BZPA 4AC9A 4BGDA 2ZE8A 5DIFA 4GZMA 4MUBA 2IBMA 2F3RA 5J4LA 4DLUA 2GKSA 2WICA 2CXXA 3C41J 4DEYA 2W0MA 3AVWA 1X8LA 3QKUA 5AUQA 1TMKA 1HEIA 1W49A 3MMPA 4JSTA 3B85A 3L0SA 5L8VA 1LTQA 1SHZA 4DSTA 2RGEA 1FQKA 2AWOA 2BJWA 1OXUA 3QPWA 5HE8A 4HUQB 5GADl 3LVRE 3OEHA 5DI9A 1S96A 1YZLA 2BEJA 2IYUA 4QNMA 2BJVA 1UBEA 3B1WA 3KJGA 4OHZA 1XNJA 2ANBA 1DAEA 3THYA 4DLTA 1P72A 2I4IA 4Q00A 2FPLA 3KQKA 2BBSA 2P5SA 2QGZA 4G5QA 3X2SA 1W2HA 5DHAA 1KY2A 1V43A 2FU5C 3LBNA 3QEJA 3LQRA 4YDSA 2OBNA 1KK1A 3IHLA 5TY0A 2OCAA 4PR0A 2GZAA 5FOUA 2FA9A 2OAQ1 4M1OA 2ZXUA 2GESA 1TTTA 1E9BA 1PVOA 2GCOB 3RLFA 1KI8A 1UJ2A 1CLUA 4KSBA 1NI3A 2WJIA 3GJ4A 4G1UC 3N70A 2C9OA 1DAGA 3HPRA 5L3QB 2DYKA 4Z1MA 1XWIA 4GMDA 4RFSA 2ZR0A 1S3SA 5B58C 1RZ3A 2P6UA 2Z5FA 3FHCB 1P7CA 1JXOA 2W2TA 3EWAA 4PQFA 3C8UA 3KKPA 2QZ4A 2EWVA 3T35A 3TUJC 3VTKA 4Y0VA 2WWXA 2OT3B 4QGHA 2C2HA 2A3RA 2W2XA 5J5CA 3VAAA 3B2EA 5UKDA 2CK3A 2D2EA 1A82A 4HLDA 5J4KA 2H5EA 3ZZUA 1YKSA 3D7MA 2KBEA 3AF4A 2C95A 5TVKA 4B44A 4AYWA 4F93B 3VU9A 1WBDA 4F4IA 3WMGA 1S1CA 4IHQA 2JAQA 3B78A 1Z6YA 2XTNA 3AUXA 1P9NA 1SVOA 3GFPA 3NVAA 4Q1BA 2XZPA 4M9SA 3SI7A 3KJIA 5GJVC 4HATA 1T5LA 4NCIA 2GEDA 3A58B 2LKCA 4HAUA 4MRRA 4TLDA 4B2LA 2P6NA 3VR6A 1Z0DA 4JVSB 4NKRA 5JJLA 3KJEA 4DUGD 3JVVA 2ZSBA 3EAQA 3K0CA 4WXPA 4XOIA 4GMXA 3RDPA 2C99A 5BXQC 2ZTSA 2O8DB 1ZCAA 1KO1A 1ZD1A 2FGKA 2ZSDA 2QAJA 1RPZA 4Q7KA 4B47A 2FNAA 3W9YA 1HE8B 2BV3A 1JPNA 2J87A 1AGPA 4FCTA 1UKVY 4RSGA 5DH9A 5FR2A 2YOHA 4FWTA 2J45A 3WYAA 1KSHA 3VR5A 2EW1A 3ONWA 3OEED 4OI0A 3K0FB 1W36D 3KTAA 4HDOB 1NN3A 4Z8XA 3L0PA 3QKRB 3UATA 2W0SA 2ZRNA 3QY0A 5BQ5A 2IEYA 4IFEA 2VQSA 4ZKEA 1PJRA 3GLFB 1N5JA 3FOZA 1TPZA 1UPTA 4XWAA 3WY9A 2FOLA 4ZO4A 4NHOA 4BFZA 1X6VA 1BH2A 1YZNA 2XB4A 3AVPA 4Y0AA 2BMJA 4NCKA 2ZYTX 1D6JA 4D81A 3FMPB 1XMJA 2VF7A 1KKLA 1FP6A 1W4CA 1H8HA 3SHFA 1ZD8A 2V1UA 4R71A 1JXMA 1Q57A 4D0NA 2QTFA 2RGBA 2XITA 2BOVA 3IIMA 4TLAA 4EPRA 4OQMA 4EIWA 1MH1A 3K09C 3UWOA 4X8MA 1YR9A 4FMCF 1P5ZB 4MKGA 4LC0A 3H0KA 2W58A 3DVLA 3QF4A 3TKLA 1VECA 2JJ1D 2QE7D 2V9PA 2R2AA 5A5GA 1Q1QA 3LNCA 1NJGA 3K9GA 1XTIA 1YHNA 3CRVA 1ZCBA 4MA4A 2JDIA 2D7DA 4WW0A 3GEIA 2P2LA 4W5HA 2CCJA 2BWJA 2XTZA 3FKSA 4JYBA 1Z29A 2W6JD 2CJWA 3T12A 4C0SA 3SJBA 4LJ8A 3GPLA 3QXSA 1NBMD 2IYZA 3GMTA 3AVYA 1JALA 1FUUA 3NH6A 1M8PA 2KE5A 1S8FA 2NO6A 3C7KA 3AF1A 1VYTA 2O8FB 1KDTA 2GXAA 4OKSA 1BYIA 5SZJA 4RKFA 2W2VA 3NG1A 1JECA 2ZSAA 3BJIC 3ECCA 3KB2A 2QUZA 1WF3A 4CVNA 1NSFA 3U7HB 4JLDA 1YR7A 3U60B 3L0OA 2XZOA 4XJXA 4WAUA 1RRGA 1IXRC 1IY0A 4ILEA 3K0AA 4BLRA 4QHYA 2V4ZA 1I2DA 3ADBA 1RYHA 3RC8A 1Z0IA 2V6IA 1E1RA 4URUR 2FGJA 4BEBA 3TUZC 3U4QA 1DADA 1JEDA 2VHJA 3V4FA 3A4MA 3CKLA 3EPKA 3U44A 3ADKA 2J0SA 1LV7A 3O8CA 1J99A 2EYUA 1Q20A 1Z07A 3FWYA 4IOKA 4YQFA 3TE6A 1E3MA 5AR1A 1BOFA 2AL7A 2UZ3A 1KMHA 1E32A 3NBYC 1MO4A 5LB2A 4BLTA 2EWWA 1WMSA 2FG5A 4HDQB 2JJ8A 4PQYA 4AYXA 3T5GA 3B6EA 3TJZA 4PO8A 2GZHA 3T1TA 3S1AA 4US0R 5KSYA 3K70D 1WA5A 3DO6A 3MWJA 2AK2A 4N0EA 2EU8A 1UM8A 1ZNXA 2J3EA 5AUNB 2TMKA 3Q5EA 1E2DA 2BBWA 5C1BA 1G7RA 4QGGA 5LD2B 4CDGA 2NTYC 2WJJA 5DHFA 2HV8A 2VTKA 4TWZA 2O8CA 3A1TA 4MDEA 1E2PA 5CLLA 4HEJA 2YOFA 1T8UA 2G83A 4TTPA 2QRNA 4PC6A 2HDNB 1ZU4A 2V6JA 2IXGA 1FTSA 2OLKA 4TT3D 3AH8A 1OXSC 4EDHA 3IEVA 1SULA 1E4YA 2GNOA 4LJ5A 1AM4D 1FTNA 4JLPA 5DYGA 5H1YA 4BFYA 3R9WA 3PVSA 1XP8A 1KY3A 3ZD6A 3DDCA 4EPXA 2BM1A 1FOEB 1G7TA 2AKAB 1N6IA 1ZM3A 1KI2A 1MO3A 5E7JA 1YU9A 4U00A 1TNDA 2J7PD 2XX3A 5G3ZA 1OB5A 2IS1A 2VRWA 1RC8A 1R6BX 3PUVA 4PAOA 4GOXA 5ELXA 1G4AE 1G18A 2WWFA 1NSTA 4JLKA 3SHWA 3BXZA 1E9FA 4BZQA 4PHFA 4D4KA 2QQ0A 5SZKB 4BRWA 2JLZA 2FZ4A 1LNZA 2IS4A 2IF0A 2C9YA 1L4YA 1G3RA 5TARA 1Z6XA 2ZU6A 2O8EA 2VHCA 4QOSA 3QSYA 3WRYC 1ZINA 3B13B 4BFTA 3OIYA 4RD0A 1M7GA 3BRWD 4DLRA 1ZIPA 3K1JA 2OM2A 2J9RA 2G0TA 3CX6A 2DFLA 3ZVLA 4QL3A 1XJCA 2HJGA 5FPKA 2HT1A 2B7CA 1C9KA 3GLFE 4M4SA 1BMFA 1IN5A 1OW3B 2NG1A 2VIIA 1MV5A 1F60A 2ZR9A 4IDQA 4LHVA 1TU3A 3TGPA 1GSIA 4ASUA 1TAGA 4F4CA 2WZQA 4JVMA 4MKIA 5KYKA 3EZ7A 1US8B 4HLUC 4R2IA 3GEHA 2V7QD 4PHHA 1KAOA 1XMVA 2P65A 2HCBA 3K9LA 4F91B 4A0RA 3KL4A 4JVLA 4L15A 2VL7A 1OFHA 2QPOA 4DC9A 3NH9A 2ZJ5A 2BEKA 5DI3B 3RS5A 2IXFA 4CEHB 1OFUX 3KFVA 2ZYVX 3WYGA 3CBQA 5FPYA 5HR5A 4HUQA 4O2RA 2B6HA 5FOWA 3ZQ6A 5G41A 4M53A 2R9VA 4XVQA 4E03A 4ZIRB 2AFIE 1WCV1 3ICEA 2EFDB 4B2IA 1XX6A 2XZLA 2F43B 1YJ5A 1AQUA 2G6BA 4JT2A 1AS2A 2OHFA 1JAIA 2FWRA 2FSGA 1X3SA 2AR7A 3SBEA 5K8UA 3CZPA 4CZ2A 4B6EA 3AF3A 2DWOA 1DS6A 2OZEA 3EPHA 1W4BA 3SC3A 3D6TB 2GCOA 3AB3A 1OJLA 3Q7PA 3P27A 2GXUA 2RMKA 2OXCA 1VIAA 1HH4A 3PCRB 4LYAA 4C2TA 1W36B 2UVQA 4JS0A 5L3QA 2J1LA 3FTQA 3I8SA 1GM5A 1AZTA 1RIFA 4LJAA 5JJKA 5CYOA 1OIVA 1OIWA 4KYUA 4MGKR 4R7ZA 3V9PA 3BFXA 3IEUA 3O8RA 3DOEA 1G291 4IVPA 4HB4A 1NLFA 2IYSA 5L3SB 1IY1A 2OAP1 3NC1C 4IJMA 4NBSA 4UNSA 2ZJAA 2DPXA 1KDOA 4EJSB 3QG1A 3H4MA 4RVCA 2ATXA 3K8YA 4YMSA 2JLUA 2ORVA 4D80A 2RH5A 2RHMA 2GEUA 3O8DA 3FGNA 1TQ2A 4PPNA 1VHLA 1Z47A 3BGWA 3F3YA 2ZE7A 1DG1G 1GRRA 3VHLB 1BO6A 1XEFA 2RGAA 2JLWA 3LDAA 1ZP6A 1D2MA 3T34A 1G8PA 4Z51A 4B3DA 1ZM4A 4KO8A 3K0SA 3CNNA 3I61A 2J0VA 3B7GA 1JQJC 2YKGA 3NTUA 4YXWA 4DEXA 4HZIA 3HP1A 1EFCA 2O8DA 4TYNA 1KK0A 1E2JA 1NY6A 4V0ME 2REOA 1D8TA 3K53A 2FN4A 3QEOA 3SR0A 4Q4JB 2GILA 3TUIC 1NVWQ 1C4OA 2AN9A 5SZIA 4D0GA 3ZD7A 1VCIA 3W34A 3CNLA 5BYKA 3ZQJA 2QA5A 4LHWA 1HYQA 1TX4B 2W00A 3K0FA 1NRJB 4R9UC 4D25A 2IYRA 2QM7A 3QKRA 4FXPA 1VYUA 1OKKA 2EFEB 5EE3A 2GAAA 2EVWX 2WHXA 1FZQA 3GLFA 2VHUA 4Q03A 4RKEA 1J70A 4KLZA 4GL2A 5EXXA 1DELA 2ZU0C 2XNSA 1GZSA 4V0OA 3IPYA 2ZRIA 4XVRA 3RRMA 4DLSA 2F7SA 4B3BA 4DDTA 3AVVA 3WBJA 3B82A 3PITA 1N6PA 3AKDA 2QROA 3BS4A 1Z06A 2UZIR 2XOKA 4Q1AA 2QMOA 5FOVA 2OG2A 3G82C 2IA5A 3A1SA 4KFSA 2PCJA 3TR5A 3EPJA 1XPUA 5G53C 2ZRCA 3QF7A 5LB4A 3W6NA 3K70B 2DFKB 3CR8A 4GP6A 5FFMA 4E5UA 2IYWA 4HAXA 2OCYC 3SQWA 4BLPA 3D31A 3SFVA 1G3UA 1UFQA 4DBLC 2PH1A 1N6LA 1W0KA 3M1IA 2ZJZA 4CEIB 3UMSA 3MWKA 3TH5A 2A5FA 4QHSA 1W46A 4JLNA 2IC5A 1E2KA 1NLYA 1O3YA 4A2QA 4IVQA 4LHYA 4JLOA 3ZH9B 4B74A 4RJLA 3L43A 1IBRA 1ZNYA 3FHOA 4AKEA 3BERA 3T06B 4H1UA 2E1RA 2ODBA 2GBLC 2VP4A 1E0SA 4AD8A 1G5TA 4LY6A 1FUKA 1RFLA 3MD0A 1E79A 4NYJR 4DLZA 4M22A 2XSZD 2I3BA 4UKDA 4NZYA 4B32A 4FIDA 2O8FA 1Z22A 4JZKA 1UKEA 5F9HA 4K81B 4FMCB 3X1WA 1ANKA 2ZI4A 4YLGA 4LHZA 3TK1A 2P67A 4D4MA 3BC1A 4D2IA 1JAHA 4QC2A 1JNYA 2ZIAA 5F3WB 3KKMA 1W48A 4RD2A 3HU3A 2JCSA 4G5OA 2A2ZA 5A4JA 4HZUB 2O0JA 3KX2A 3EA5A 3TBKA 1XPOA 3HU2A 2HYIC 1KDRA 4KVAA 3QE0A 3RSOA 4BFVA 2BMDA 1D5CA 4XIGS 2ZVPX 1JQLB 1VTKA 4B75A 3FMFA 1U90A 2YINC 3EG5A 1SVIA 2LWIA 2NO1A 4GPTA 3IHWA 4ZDJA 1LW7A 3VR2A 4OI2A 2CE7A 1TQ6A 1GP2A 4IOLA 2VF8A 2QBYB 4A8JB 1F5NA 1QVRA 2CL6X 5IRCD 1XEWY 4A15A 3WYFA 2IS6A 1CF4A 1G7SA 5FOTA 1RKBA 2QP9X 1TEXA 2VSXA 3X1YA 4JLJA 2QAGB 2HLDD 1HTWA 4LI0A 4TYQA 2ZRKA 1A5TA 3SN6A 3AF2A 3WHKA 4LYJA 1N3BA 1U0HC 1I4TD 2QMUA 3LVQE 3MJHA 1DE0A 2JLSA 4RZ3A 3O8BA 3BWDD 4UNPA 5E3HA 1RRPA 1WQ1R 3OIVA 1WB9A 1UBGA 2H92A 4Q19A 4V0MA 3THOA 3I5YA 1G20E 1LVGA 3RWOA 2OV2A 2JLQA 2F9LA 5FPSA 3A1VA 2ZM5A 3JZMA 3PUZA 4OI1A 3LBHA 3Q3JB 5BN4A 1T8TA 2IXEA 2MSCB 5HKKD 1OH8A 5KSOA 1Z6TA 1GKIA 5FTJA 3QENA 3U5ZB 4MDFA 1OH7A 2GA8A 4F7WA 2EFHB 1CJMA 5LPNA 1MABB 1Z6AA 3F5FA 2F1HA 4MYCA 2R6DA 2RGNC 3B8HA 4XVUA 1XZPA 2WSSD 1SVWA 1ZC4A 2GZDA 4DWJA 2R65A 4QXAA 3U3MA 5FBWB 3G0HA 3MRSA 5JSZB 1JI0A 5FL7D 4LJ9A 3QXJA 4M1YA 4DCVA 2ZRMA 5B2ZA 1PUJA 3AVOA 1NL3A 1NVXQ 2RB4A 1Z8FA 2QI9C 1SXJC 4PHGA 4OHYA 3PEVA 3TNFA 1EFHA 5FL3A 1AZSC 1KSJA 4PPQA 3UMFA 2F9MA 2JLYA 1S9HA 3DEFA 3L2OB 1S1MA 3NEYA 5KO2A 5EUQB 4OHXA 1X1SA 3UIEA 5K8TA 3V00A 1YRBA 2IL1A 4JKIA 5FUYA 1US8A 1OT3A 2IW3A 4FI3C 4FMBB 3GFTA 4DZZA 1IXSB 1W1WA 5FPHA 3BFKA 1N0VC 5DSZA 4HI0E 3RAPR 2VP6A 1LFDB 2PEYA 2ZS8A 3IKJA 1II8B 4C30A 3VNUA 3AVTA 4FCWA 4EFNA 3ZS8A 5GVSA 4MKHA 1R8SA 5DI3A 4CEHA 4MYUA 4C9BA 2AHOA 2V55B 1G5RA 5FUVA 3QG5A 4I4LA 1UF9A 3GJXC 4HAWA 4WXRA 2VO1A 4ZIRA 1AK2A 2MSEB 2WMOB 2OLJA 2VHQA 4DUGA 2O0KA 1U99A 4Q5IA 2ZS9A 4Q7JB 3LY5A 2ZUBA 2F43A 3NIBA 4Q1CA 4BWYA 5TV2A 2V8OA 3TQFA 3RHFA 4A8JC 4HYYA 1U9IC 1UBCA 3EC1A 1GNQA 4KFUA 5TDHA 3KQHA 4PSVA 2WIAA 2QAGC 3HJNA 2A30A 5J4HA 3QBTA 3EZFA 1II0A 1ZNZA 1Q12A 4C0BA 4FN5A 1QG4A 4YONB 1ETUA 5JS7A 5D3QA 3Q7QA 1X8KA 1J8MF 1E2MA 3M0EA 1QHXA 2QT0A 2YV5A 2QP3A 3OEEA 1ZRHA 4QJ3A 1D2EA 1XPRA 3BB3A 3CRQA 3PUYA 2YWEA 1KAGA 3QVVA 1OF1A 3SYKA 1BIFA 1ZD9A 2WBLC 3FHTA 5CJPA 1F6BA 3QKTA 5EE1A 3CM0A 1XCGB 1G21E 3SE0A 4LV6A 4MRNA 2Q9CA 4TMKA 4PAMA 4RD1A 1K6MA 1G5PA 4D6PA 5BWMA 4LHXA 4KAXA 1NJFA 1G8GA 3PEYA 5L3SA 1GRNA 4II7A 4EJSA 1CR4A 1W4AA 4O2LA 3RRNA 3VNVA 5EJEA 2CLSA 4PC1A 4Q4HB 2J46A 2WJGA 3BFVA 1QHNA 1Q22A 2JJ2D 4QM6A 2WVJA 3NKVA 2CEAA 3AM1A 3NXSA 2YHSA 2ZRGA 2WOJA 1Z0AA 2JATA 4X8LA 5JI2E 2ZANA 1IOZA 1M34E 3R7WB 4US2R 3RS7A 2R6AA 1ZC3A 2JJ1A 1OSNA 2QE7A 2WWIA 1Z0KA 2KB0A 2ZJ8A 3U2QA 1NY5A 4LJYA 3DOFA 1KKMA 5GJBA 2CHVA 4MGZR 4PZZA 3ASZA 4BLSA 2VSFA 4FMDB 2ZYUX 4PSAA 4BE7B 3ZIAD 2W6JA 4GP7A 3FYHA 2BM0A 4NU0A 4P0TA 4V0KA 1NBMA 3CWQA 3TW8B 2QMHA 2ZUCA 1X8JA 2A5YB 3TLXA 2IYYA 2D06A 4Q4JA 2ZRBA 1P75A 4KCGA 3AVUA 1E99A 2ZAMA 3HU1A 4Q66C 2CBZA 4BFSA 1SHKA 2G9NA 3SNHA 3WP0A 3VHXA 3MUFA 4I1UA 4MGIR 2AD5A 1P61B 3I32A 3BB4A 3AQ4A 4WZAE 621PA 1COWD 3I73A 2CMKA 2DY1A 1QHIA 4FINA 5E7MA 2C8VA 5HPYB 2OFWA 2QORA 3E5HA 3UXMA 2O8BB 2WJHA 4HB3A 5HCNA 4CEJB 3NC0C 4QM7A 1MT0A 2RKOA 4KBGA 1KGDA 4AKGA 3QPVA 3RC3A 4ZV4A 5AJZA 1PLLA 1M7BA 2QRZA 3EIQA 5FBVB 1GVNB 1QHGA 3SU8A 5EQTA 2PL3A 3MWYW 3THXB 4GBMA 3EZ6A 1KTVA 1J90A 4A1FA 1YZTA 4FD2A 2ZRDA 2OFXA 3PUXA 2JIZD 3N2EA 2RGNA 5B30A 2EQBA 3DM5A 4TTQA 1TADA 5C2JB 3QXXA 5D3MB 4DDUA 2V54A 3CPJB 3C5HA 4NTZA 3D8BA 4CEIA 1R5NA 2NZ8A 2CL0X 3CWZA 4OK3A 4BFWA 3TMKA 1W7AA 1YE8A 3SS8A 2OBLA 3AKCA 5JECA 1EFRD 3LLUA 1Q3TA 4IW3B 4X8OA 5JWOA 2AFHE 3ZZTA 1FX0B 3BB1A 1NIPA 3OFND 4TT3A 3U7GA 3TSWA 2ZE5A 2PMDA 2XNDD 2V3CC 5FOXA 1VDZA 4B2PA 5JFGA 3DHWC 4TMTA 3CLVA 3GJ8A 5DNYB 2P0EA 4JJKA 1XD8A 2PT7A 2IK8A 4D0LB 3AVXA 1B23P 2B8WA 4LPSA 1N5KA 3WP1B 1IXZA 3ICQB 2J7PA 5BN3A 4Q9HA 1S4QA 2YC4C 4TL9A 4HZUA 3DM9B 1K5GA 2I1VB 2FEMA 2QU8A 4PC7A 3X1ZA 2PZEA 3A36A 4KLNA 2QSYA 3ASYA 4MITA 3GCGA 4LK2A 4YMTA 4C0QC 4RD3A 3AGQA 3UG6A 1ZUHA 4B76A 3C15C 1XD2B 4CRWB 5C46F 1U2RA 1VCOA 1ZU5A 4LWZA 2VEDA 4Q1FA 2NPIA 2GJKA 4PAQA 4DLVA 1HV8A 521PA 4ARZB 4IOJA 1KNXA 5K8LA 2Q3MA 4XSGA 3BIFA 1Z28A 3L0IB 6Q21A 2XXAA 4Q48A 2DFNA 1JR3E 1ZNWA 4LRWA 1XEXB 4QBHA 4Z8YA 4KXFB 2QBYA 4A8JA 3I92A 1U9IA 2ONJA 1ZVQA 4WBSA 1DOAA 4JLAA 4N3NA 5CIQA 1AS3A 4Q4LA 3TAUA 4M1KA 1SXJD 2ZQ5A 2CVFA 2QAGA 3TSOA 1Y3AA 2L0XA 4JIMA 1CR2A 2H1LA 1Z0JA 3ADDA 1GKUB 4LOAA 3WNCA 2WTUA 1J8YF 3THWB 2V7QA 1EFTA 3SYLA 2KI5A 5GJCA 1F48A 3FVQA 4A0GA 1KI9A 1OV4A 2J7KA 2Q9BA 1DG3A 2DWPA 4IOMA 4CIDA 4EQ6B 3ZDQA 2FEOA 5JBQA 4Q21A 1VG8A 2P3SA 2QPAA 2KBFA 3EASA 4JL5A 4JBWA 3LW7A 4RFVA 1YR8A 1Q0UA 1RRCA 2YJTD 4ITRC 4MRPA 3REGA 3ETLA 1N25A 1I4DD 4ZKDA 5CDFE 3CF6R 1R10A 2XB2A 1F2TB 3SOPA 1MABA 1KHTA 4JVNA 1Z2CA 4A82A 2OILA 4Q9IA 4A4DA 4DSNA 2G3YA 2OEPA 3DKVA 1UAAA 3EZ2A 4LJ7A 3NDBB 3E70C 3QI2A 5DISB 1DBSA 4NYIR 4AKHA 4ON9A 1HY3A 4K46A 2ZI3A 3CO5A 5FI0B 3IPXA 3RS4A 1N0UA 1WBBA 2KWIA 5JSZA 2ZUDA 5JZVA 2IYXA 3ZS9A 3KQNA 2AK3A 5FUXA 3EX7C 3U3KA 2O5VA 1VPLA 2H17A 4V0LA 2WMNB 4NDZA 2WWWA 1FMLA 1IN7A 1KI3A 3QUSA 3U6BA 5EE5B 1S3GA 3KKNA 4RZXA 1KO4A 5EP3A 421PA 4DCUA 1OH6A 4LBVA 2QMEA 2A9KA 1FNMA 4URVR 3AP1A 2X77A 4M9ZA 4B34A 3U7EB 4M9XA 5EP1A 4URXR 3O47A 4CW7A 3PEWA 3BOSA 2GHIA 3P20A 1F3OA 4IDNA 4PTLA 1XD9A 3PEUA 4P4TA 3GQBA 4LC1A 1GTVA 1T5IA 2PEZA 1RYFA 2VYFA 2HUPA 3B1XA 3EXAA 3M4YA 4URYR 1OXVA 2FSIA 5DLQC 2O52A 1II8A 5FH9A 4V02A 2IWRA 1GRQA 5KPDA 3FMIA 5FPTA 1YRAA 2AXPA 2VP0A 4BPBA 4DXAA 5F98A 4LJ4A 3W3ZB 1NG9A 3QKSA 1GITA 4TQ9A 2G1KA 3K09A 1GL6A 1XCPA 2GXQA 2QQEA 1EX7A 2Z4SA 3CRW1 1PZNA 1R0YA 3CNOA 5FBRB 1P2TA 1P3JA 5JCZA 3ZVNA 4DCSA 4OHWA 1XMSA 4M2LA 1E6CA 1SVKA 3B1ZA 3QIAA 3SDZA 5EE9A 2ZJOA 1WP9A 4QJ4A 3TAHA 3A6PC 1CR1A 3P1JA 5FR1A 4NE2A 1CS4C 2JA1A 4HLCA 4PX9A 1AKYA 2IF2A 3AVQA 3KUCA 1IN6A 1FL9A 4FMDF 2WSMA 1H8ED 2REXB 2EYQA 2OO7A 2IUUA 4Q01A 4JSYA 4Q02A 1KK3A 3MFYA 5B64A 4MUAA 4Q1DA 1E0AA 5JJIA 1L4UA 4XSHA 1NVVQ 3UMRA 3WMEA 4BEJA 4AI6A 2J0UB 2GJ9A 2X2FA 2XJ9A 3TQCA 8OHMA 5KSPA 5AUPB 4BZXA 1XDBA 4KFRA 5HCIA 1KOFA 5E95A 2IYTA 2OSBA 1T0HB 4TQAA 2FE4A 4WVFA 1GNPA 1KNQA 4DDWA 1XBTA 3OIUA 1CP2A 2H7VA 3LO5A 4Q4HA 1ESNA 4G5SA 3H1TA 1VKJA 5E7IA 4M1SA 1EFUA 1YZKA 4ERNA 3P4XA 4UQOA 4IFBA 4GNKA 3R7WA 4DDVA 2BBOA 2HEIA 3WXMA 3OESA 2AXNA 4WOPA 5CDFA 1NN0A 1AGRA 1IN4A 3KQUA 2JLRA 3BH6A 4Q9JA 2R8RA 2GF0A 2WPDD 4CYMA 4NCNA 5JHGB 5KU1A 3VX4A 2OUKA 3P26A 1X86B 1PLJA 4JKYA 3UPUA 2BHRA 4E09A 5M04A 4LDJA 3K9HA 1XJQA 3GFOA 3I8XA 2J59A 3M6AA 1VCMA 4B3CA 4M9QA 3W90A 4HB0A 1E2FA 2ZRHA 2ORIA 4FWIB 2FSHA 4KI0A 1DO0A 3SJZA 1JR3D 3I5XA 1E96A 2XSZA 4HAVA 3DPUA 2YNMA 4NYJQ 1NVVR 1P6XA 1Z2AA 4QBFA 4TMWA 1CJKC 4JMPA 3PUWA 3B9PA 5KDOA 3ZGXA 2YWGA 4DIEA 2Q9AA 2QEQA 2VP2A 4DSUA 3EA0A 4UXIA 4ZCLA 3CH4B 1IN8A 5DN6D 4OJKA 1UKYA 4HUTA 1G6HA 2CCKA 5FBLB 3VR3A 1NP6A 4YMVA 2O8BA 1KDPA 1TF5A 1TL7C 3IO5A 3FKQA 3NBFA 1RVDA 1VG1A 2ERXA 3GLGB 3CIOA 4CEJA 1OYWA 3R8CA 4P31A 2ZRLA 1LY1A 5JWRA 3EIHA 3IO3A 1BKDR 1NNEA 2PZGA 1GUAA 2A78A 4TTRA 3SJAA 3MGCA 5KPJA 1U98A 4OHVA 4W9MC 1EWRA 3THXA 4US1R 5E4FA 5JRZA 1D9XA 4EKDA 1KJZA 1JBKA 1MR3F 3KKQA 3LWNA 2ZJ2A 3V4RA 2ZRJA 2IUSA 1XZQA 4PZYA 1W5TA 2BVNA 4S2EA 5D3MA 1SXJB 3CX8A 2VPPA 3F8TA 2GETA 2RAPA 5TXGA 1OHHD 5CYPA 2HLDA 1E0JA 3SEAA 3I4LA 1OFIA 2OCPA 1D9ZA 4ACAA 4RZUA 3U3JA 4HAYA 1OYYA 2IYVA 2PJRA 1G41A 4OQXA 4X8HA 1FX0A 2OESA 1YQTA 3NWJA 2WV9A 2FX3A 1TF7A 3FE2A 4P4UA 3B60A 4ABYA 1SKYE 1FNNA 4GRAA 4HLUA 1W5SA 4Q4AB 5B57C 4A6PA 5AJXA 1AQYA 3MLEA 2ERYA 4F38A 2XGJA 4TMXA 5HKKA 1W0JD 2YZ2A 4URZR 4JJZA 3UG7A 3LLMA 4DB2A 4NPHA 5CM8B 5IK2D 1OH5A 2W6ID 2CNWD 3BK7A 4IEEA 1MOZA 3A1WA 5HZHA 1F2UB 2D2FA 5CB6A 2ZI5A 4J0QA 2WSSA 1A2KC 4URWR 1M2OB 5IT5A 5DYIA 2XXAB 3N2IA 1E2IA 2DHRA 1P2VA 3H2YA 4PANA 5CK4A 1OPXA 1XD2A 4TLEA 4JLBA 2GJ8A 5FL7A 2RGXA 3GP8A 5AJWA 1MRSA 4TSFD 2ZRFA 4C4PA 1DAHA 4DT1B 2IT1A 2XJ4A 4ARZA 4Q47A 2W83A 3FFBA 3QXHA 4N0DA 1G7CA 4P33A 4I81A 1XEXA 1G4UR 2I1QA 4MH0R 1XB2A 1TU4A 2YC2C 5ANRB 4QHTA 4F4JA 1QHHA 2BC9A 2ZJBA 4HB2A 4Q1EA 3TIFA 4EPTA 5KHOC 1GG2A 5A0FA 3HPQA 3RWMB 1WRBA 2DB3A 1Z0FA 1CU1A 1HE1C 1HQCA 1R0XA 3KXKA 4LBYA 1RJ9B 3JVUA 3THWA 4XWKA 1EK0A 5FUWA 5KNBA 1LS1A 5JHHB 1GL7A 3GJ0A 4U02A 2GJSA 2QSZA 3UANA 3Q8XB 4L4UA 4EQ6A 2R6CA 3KXIA 4TYYA 1GNRA 2VSOA 1R5OA 2LCFA 1XTSA 3U7FB 1G8HA 3CX7A 2VHTA 3IDQA 2WAXA 3AP2A 5SZHB 2WM9B 4DRZA 1EWQA 4LCBA 3GJ5A 4H9GA 4B33A 1F2TA 3ZVRA 2ZRPA 2NMVA 2B7BA 4UNRA 1CTQA 3NDPA 5EXSA 2ZJYA 1T0JB 1CRQA 2IUTA 1J7KA 4L9WA 2FJUA 3QNUA 3CH5A 2ZVQX 4EPVA 1IJFA 1MO6A 1IQPA 4Q7MB 1XXHB 2Y8EA 3DMNA 2NO0A 1SZPA 5EXPA 5KNDA 1RE0A 5LBIA 4OYHA 2GF9A 1R2QA 1W47A 1R0WA 3ZLJA 4FW9A 1GDDA 4PHTA 2VBCA 1E94E 2NO9A 3BBPA 2CL7X 3OAAD 2ZYWX 5F2EA 4ZI3A 4DKXA 2QM8A 2KSQA 1E1QD 3GLGE 3HYTA 2FMXA 3LRPA 4ZI2A 1DO2A 2NGRA 1XTJA 5GVRA 1NN1A 3RS3A 4B73A 5IHPA 3OE7D 3NBZC 1KSFX 3SBDA 4LJ6A 1OE0A 1CJTC 5CLQA 5EP4A 2X1VA 2GVZC 1OB2A 2OCBA 2CLDX 2JJ2A 3UWKA 2F55A 3R9XA 3B5JA 1ZUNB 3GJ6A 1ZYUA 3QKSB 4A2PA 4V03A 5IF9A 1E2LA 2XAUA 3C5CA 1N6HA 1M6NA 4LPKA 5JEDA 4XD7D 1P2SA 3MCAA 3PJRA 1Z3IX 4AG5A 4JYCA 1DAIA 3VR4A 2C9CA 1NF3A 1KMQA 1SXJE 2ZEJA 4C0KA 3OIWA 1E4VA 4BLOA 1JPJA 1KO5A 1OXXK 2D3WA 4E07A 1ZMXA 2BDTA 3AF0A 1O87A 1TQ4A 1Q1EA 2OE2A 2Q0HA 2RGGA 2G88A 3TRFA 4UJ3A 2GAOA 3CPEA 3AEZA 3ZIAA 1MRNA 3BE4A 3QPUA 5EZ6B 1CKEA 2MMCA 1N5IA 5KDDA 2NPFA 1ZAKA 2C96A 2REBA 1N6KA 2FZLA 4KSCA 4IDHA 4Q18A 3CPHA 5DGXA 3KJHA 1Q1BA 2J5XA 3Q5DA 1G17A 2N42A 2NO7A 3L8YA 3WNDA 1GOTA 2H57A 1R8QA 4XTCS 1T3SA 4W5WA 4B3XA 1S0UA 4DIDA 1HT1E 4FCVA 2DWQA 4UXJA 1E9CA 1L8QA 1ODFA 2G1JA 2GBLA 5JEEA 1VCNA 5TMPA 3HDTA 2NOAA 1COWA 4DLWA 5FBQB 1DAKA 2AWNA 2JASA 3VX3A 4NCHA 1W4RA 2A7QA 1YZGA 1P4SA 2CLCX 3GJ7A 3KXLA 2J0UA 3RNLA 1QF9A 2ZROA 2HXYA 2WKPA 5JLJA 1FFHA 2HT6A 1YR6A 4OJQA 2F1JA 3OEHD 3IQXA 4CT4B 1KI6B 2R62A 2RGCA 3MSXA 2PX3A 1OFTA 4ACBA 4YMWA 1KZ7B 2YOGA 4JBXA 2JGNA 1E9SA 1PLKA 3B1VA 3KUDA 5FTNA 4LSGA 1XTKA 2JIZA 5JWHA 4P4SB 3VFDA 4MYHA 2C5LA 1Q3HA 2HF9A 3H84A 1AN0A 3LW8A 5EP2A 1IJEA 2ORWA 3TVDA 5H8WA 1EESA 1H65A 1S2MA 2GEVA 3ND9A 5GJWC 1AIPA 2ZRAA 4G3XA 1MO5A 4YDHB 3UKDA 2QG6A 3RABA 3ZVMA 3GLIB 1EFRA 1U81A 1HT2E 4JLVA 2A5DA 3OFNA 1P60A 5JRJA 1CXZA 4Z1MD 1LS6A 1OIXA 1G19A 1E2QA 1G6OA 2XNDA 1KK2A 1SVSA 4GSYA 1E2HA 4OK6A 3DZ8A 2Q3HA 1SGWA 2XEXA 3AUYA 1X1RA 1TUIA 4CT5A 4LZZA 4PZLA 1NVUQ 5JCPA 1OXTA 1ZUIA 5JS8A 4RCZA 1E9RA 3LQQA 4D4JA 1EG7A 3EW9A 3QBVA 2CK3D 4QFMA 4TL8A 5H68A 1GL9B 3EWSA 3FB4A 1Z63A 2PBRA 4A0HA 4W7SA 2GCNA 1WDTA 1Z83A 3JZAA 4OQFA 4K8OA 3GLGA 5LDDC 1JR6A 3LD9A 1G9XA 2K5UA 2YVUA 3SJCA 4C0AC 1XXHE 3PIRA 4MYTA 2CHGA 3PENA 4QRHA 5G3YA 1QHSA 1IONA 3KB1A 4C7OB 1EXMA 1QHYA 4PO9A 4AYTA 1FQJA 1T9HA 2BIFA 4U5XA 5FTKA 1UBFA 2SHKA 5EE0A 3A37A 3CF0A 3NEJA 1GILA 4IXMA 4MKFA 3GLHB 4AG6A 1NLZA 2IYLD 4RY2A 5AUOB 1FMJA 4KV9A 1N5LA 1T3LA 1SXJA 1YVDA 1CJUC 5DE3A 4KFTA 1NMZA 2BCJQ 3WHLA 3BH0A 1SKQA 1KO8A 1LB1B 1XJ0A 721PA 4LGMA 3PXGA 3HWSA 4ZCIA 1RRFA 2IX3A 2FFAA 4GOJA 2RCNA 1Z08A 3WRXC 1E69A 2H16A 1XFAA 2PJZA 5CITA 2FFBA 1SVMA 3A1UA 5J4YA 3REFA 2CHQA 2X8AA 4OQLA 4Q4AA 5J47A 4KHZA 4GZLA 2V1XA 3X1DA 3U61B 4I1SA 4BECA 4PSKA 2ZPTX 5AWFC 4LYHA 3EC2A 4M8NE 4UXHA 1NKSA 4ZPXA 1CBUA 1SQ5A 2VP5A 3L8ZA 4M1TA 4TL6A 4Q9LA 4KYIB 2BCGY 1F2UA 4GT1A 2IHYA 1H8HD 3IQWA 4H1VA 4TMZA 4ESHA 1G16A 2CCGA 1FPMA 1L7VC 4W5JA 2Z6VA 3VKWA 4DSOA 3K0EA 4NYIQ 1QDEA 4IRUB 2OBMA 4AURA 5HE9A 1M1YE 1Q1ZA 4LV5B 121PA 5KDLA 3LA6A 3U3OA 3EPLA 3VMFA 1QHHB 3IBYA 1WE2A 2C04A 3W6OA 1ZBDA 1ZM9A 4DT1A 3R8FA 3SZRA 3PR1A 2CDNA 4NP6A 2JDID 1Q21A 2N1BA 3C4JA 3CONA 3PFIA 5EUMA 5FI1B 3AKEA 3DL0A 4PC2A 3FKSD 4KU4A 4Z54A 3RSLA 3X1XA 4F92B 4C0JA 1KO7A 2D7CA 3IILA 3U3RA 3TSZA 3ZYCA 2ZI7A 4PPGA 4B3GA 4NH0A 3IUYA 2IEZA 1QG2A 4ZCMA 3I3SR 1R0ZA 1W2GA 1KYIA 3SQXA 1KJYA 1U8YA 3RVBA 2G0NA 3GD7A 5JMTA 5L3VA 3FFAA 1RJ9A 2JEOA 1YZUA 2ANCA 3WBKA 2A5GA 4S35A 1P73A 3FPAA 4BUJA 4ZDKA 1VYVA 4UNNA 4POAA 2F3TA 2QY9A 3E2IA 4KVGA 4A0FA 2MSDB 1K5DA 4PO1A 2Z0MA 2R44A 4I99A 2PLRA 3W5JA 2PLFA 1AJEA 2QP4A 4BQSA 1XRJA 4RD4A 1E2NA 3VKGA 3RYTC 3W8RA 4TZ0A 5FTLA 1JJVA 4O0MA 1E1RD 3QQ5A 2RHDA 3QXCA 3PQCA 4U7DA 4HAZA 3OHMA 3T15A 3MJRA 3P4YA 3GLIE 3T1VA 2FH5B 4D4LA 2FDCA 4P32A 2BKUA 2NZJA 2MMGA 2UKDA 4LX0A 1QRAA 3BD9A 5L3RA 1UDXA 3N5CA 3PG5A 2JLXA 2QTVB 2ZS7A 1G3IA 5FOSA 1VIYA 4DLYA 2QTHA 3ND8A 2R6FA 1XXHA 1GFIA 3D3QA 1G8YA 4RZ2A 3BORA 2YWHA 3Q85A 4UNQA 2QPTA 5CB8A 3DZDA 1AS0A 2E9SA 1H8EA 4JT4A 3J81k 1P2UA 1HA3A 2D4HA 2KJQA 4A36A 1NMYA 3I1FA 4CF7A 2PT5A 2ZITA 3LBIA 5DO9A 2DR3A 1KI4A 4KODA 1KIMA 1JB1A 3MAAC 2RGDA 1IM2A 1UDWA 1XTRA 2ZI6A 3EZ9A 2ONKA 3ADCA 3F0TA 3HYRA 3A4NA 4XWOA 1VG0B 3KZ1E 1EX6A 3EIEA 3A8TA 1G3QA 1SKYB 4TQUS 4TZ6A 2ZI9A 2XTMA 4B71A 1NMXA 1CR0A 4WIAA 5C4MA 2FFQA 5G40A 1BS1A 3TVTA 3NHBA 3T1OA 4IDPA 3THYB 2D74A 4NONA 2ODWA 1ZM2A 3GLHE 3R9IA 4V0NA 1E9EA 4B48A 4G01B 5K8IA 4AKIA 5C4GB 1E0KA 2YYZA 3WNBA 2ECKA 4DHEA 2PX0A 3LX5A 4PXAA 3Q9LA 4YC7A 2WPDA 4AWXA 2J0QA 1KI7A 4MRVA 4EFLA 1HUQA 4RD6A 1G3MA 1G8FA 1N0WA 2N46A 4GI7A 4KJZA 3B9QA 1E2GA 3PV0A 5LD2C 2HYDA 4CGZA 3I72A 4JL6A 1T3HA 4QJ5A 1DAFA 4RFSB 4B3FX 1ESMA 1PUIA 4M1MA 2FF7A 2F1RA 4TMVA 1JR3A 3DMDA 2AKYA 1BMFD 3E1SA 3G5UA 5CM9C 2BBTA 3QJYA 3NBXX 4IXNA 3OZXA 1U8AA 4DJTA 2J41A 5CJ2A 3LXRA 4ASUD 4LYFA 4TLBA 1IY2A 4DCTA 4R2HA 4HLQB 1L2TA 1D2NA 3FMOB 2ZREA 4JBYA 1TUEA 1NIJA 5DN6A 4BLQA 1E98A 2H18A 3RS0A 5AJVB 3VKHA 3VU9B 1RW4A 1IAQA 4QGFA 2HF8A 2YWFA 2OFOA 4A2WA 3CRMA 2H8KA 4LBZA 2WJYA 5HTKA 3AP3A 4I1OA 2DCUA 4L16A 3ZJYA 2Q6TA 1KI6A 2GTPA 2X19A 4QG7A 3CB4A 4D82A 4KBFA 4EUNA 2IHBA 2R6GA 3C16C 1DAMA 2BMEA 3CZQA 4LUCA 2A5JA 4OK5A 4R98A 2VH5R 3T1QA 3T5DA 2ZETA 4GFDA 2Z83A 3TW4A 2B21A 3KKOA 1U0LA 3B1YA 1CRPA 1T4GA 4N1AA 5TB5A 1XCMA 4P4SA 2X2EA 1WXQA 1Z6GA 1HURA 1R5BA 4Q7LA 5IDVA 2BMFA 5KTYA 1S9DA 2C78A 1OLOA 2QL6A 4JLMA 1UKZA 4M1WA 5EXTA 4AIIA 4L8GA 1OHHA 5C18A 2WWGA 4A9AA 1M74A 3IGFA 2WWYA 4G5RA 4DVGA 4I1VA 1UADA 2QGNA 5F9FA 2GK6A 3GLIA 3BAFA 1NG1A 221PA 3CUEF 2WJVA 3KQLA 2DBYA 3KTAB 5J4VA 2EFCB 3LH5A 1DARA 2AX4A 4OQNA 2Q21A 2WWHA 2HJVA 4GDFA 4DLXA 1N6RA 1CEEA 4C3ZA 5KUTA 4QKQA 2VA8A 2GVDC 1II9A 2VLIA 3LAWA 1R4AA 1A1VA 4NL4H 4MQBA 5CK5A 2JLVA 1W0JA 2GRJA 1LF0A 1U0JA 1XMIA 4OL0A
chains in the Genus database with same CATH superfamily
2R7NA 2WUGA 1BYUA 1MQAA 2GSWA 2HWWA 4LXIA 2OFPA 2PKRA 3WMFA 1KP9A 1R0KA 2CNWA 1QZZA 3DCIA 3LHIA 4HRVA 1V39A 1KJWA 2WU3A 1N3YA 3R3XA 4J9UE 4NS4A 3FRIA 4HSEA 4RXMA 2BHSA 5JCXA 4XASA 4WKPA 1JSZA 3LFUA 1GKYA 1XHFA 4X71A 3UHJA 3LX8A 4BMNA 2P5TB 1BDJA 1KZGB 2GF2A 1X7GA 3V8MA 1LI4A 2OZKA 3NKLA 3UFXB 2QENA 2Z6UA 3UGTA 4MPJA 1P1KA 2Y1EA 1NN5A 1VG9B 4GOKA 2VP9A 4WPGA 3C14C 2BSAA 2R85A 3K0HA 3NVMB 2WKQA 4KVZA 2BYTA 3PXXA 2CXUA 2CNKA 2Q3FA 5AM4A 3VQTA 4BVJA 1QZXA 1LI7A 1R9NA 2EZUA 4TSFA 1ZITA 4UAGA 3T61A 3W6ZA 4KPEC 3FDZB 1WULS 5DK6A 2IWHA 4ZRNA 3W79A 1JDVA 1LJ8A 1SUFA 1TW3A 1N2CE 1OX4B 3GO4A 4GOLD 4PG7A 2C98A 5EAIA 5BN5A 3QVGA 4IXDA 4QO7A 2RH8A 4OM7A 1ISJA 1GQOA 3CRRA 2GJAA 4YXWD 3W2HA 4R1UA 3QLUC 3S5JA 3OHSX 1FCJA 1MFPA 3D8NA 3MINA 2NIPA 3N0VA 4IFTA 4RHFA 2D54A 5AVTA 5ARCA 4B8WA 4D9JA 1W36C 3JWJA 3FPGA 2FXVA 2WU1A 1H0HA 1DAOA 1L5SA 3IR7A 3ZWNA 1KGSA 2OCLA 2ATEA 4ZI5A 1P5RA 3TOCA 5FA5A 2ECOA 1W44A 1C1YA 2GHQA 3BMCA 3JAKA 4J03A 3UK7A 2QOEA 3KVOA 5KOYA 4WLOA 2Y9MB 2UU9B 2EKQA 3EDMA 4YJ2B 3SFZA 3KZXA 2YN0A 1KXJA 3LV8A 4MLPA 4CE6A 1J8DA 3QKWA 2C03A 1U11A 3EE6A 4I2NA 2EXXA 2VJBA 4JIGA 1OKKD 5JMPA 2Q99A 2J09A 1W581 4EJSC 5P21A 3WLSA 4E7PA 4M0LA 1XO1A 1IBKB 3A11A 3N39C 4QUKA 3K0AB 5AMXA 3FDIA 4NYMR 4BHTA 4BRSA 2QN6A 3NV7A 2XDWA 3I62A 2WIBA 3HLKA 2OXRA 4YX9A 3ZZ0A 3MZ0A 5HZKA 4Q9KA 3K0CC 1Z0ZA 3S7ZA 5JQWA 1AUPA 2GN4A 1JA9A 5ESWA 5DBFA 3PVCA 4RUKA 4DB4A 3RTEA 4CLOA 5D51S 2B92A 1QRDA 2REQA 3EUWA 4MKXA 1JBEA 2I8CA 2WHYA 4O5OA 3CZ4A 3KTFA 4DPKA 3BDIA 1JDPA 4HQ6A 4PVCA 5A6VA 1UMBB 2A0UA 4X45A 2ZSEA 4Q3KA 4II3A 1ZVJA 5CDUA 1L5HB 1FP4B 4YQYA 4PLFA 1ECFA 2VKQA 1O94D 4DG9A 2WOOA 1AKEA 1ZMRA 2GWHA 4H7JA 3ZGNA 1DBWA 1GHTA 1XRRA 1EIWA 1I1NA 3PWZA 4QD3A 4UTXA 4RGQA 3R3UA 4Q39A 2O1SA 3KO8A 4RQUA 4EHIA 4PHCA 3OWXA 3L4KA 3NHMA 3ILVA 3HBAA 4GYJA 4CKWA 4BU1A 3RANA 4DTIA 4OKNA 3UN1A 1A2BA 1E92A 1Y9ZA 4QXOA 2JFBA 4DARA 1P9WA 1CUDA 4LS3A 4UVHA 1XAGA 4L6CA 1E1QA 2QD1A 4XTRA 2WKRA 5E8RA 4ZZ0A 1FFAA 3W4IA 2O3JA 2R97A 3U1VA 4F5YA 1RAGA 5MFZA 3OE7A 4PXYA 1THGA 1YJCA 2HWUA 2B8TA 1T0BA 1E7QA 3OLQA 3ZCRA 3GXBA 4L5JA 2PMKA 3WYCA 1JV2B 1C80A 5ARDA 6AT1A 5AW3A 1TEVA 4P7KA 4QUDA 1M7HA 2X0JA 4LV8B 1XQXA 2Q4BA 2QRJA 4OHCA 3BCRA 4KXXA 4P86A 2ZSFA 1TC2A 3UV7A 3QUCA 1XF9A 1O8BA 1ULAA 1W6RA 1WOYA 3GDHA 2ZUUA 5B12A 2PKCA 2JAXA 5H3CA 4GVPA 2BKEA 2XD4A 4A5OA 4ALIA 4PYKA 4IFIA 4OI4A 3T3HA 1U65A 5ALDA 5F7OA 2QW1A 3BH7A 1YZQA 4AFNA 1CIPA 1EUDA 1ZD3A 2I2FA 1G2QA 4EJ0A 1I4LD 3P9CA 2IOFA 5FTMA 4OPMA 2O2SA 2N3ZA 3R0QA 5CVEA 1ZHFA 2OZVA 2PH3A 4GSLA 4FDUA 1U7WA 3HO8A 4PLCA 3W6PA 2O8EB 1H2RS 2FYTA 1DEKA 1A4RA 5CB4A 4UC0A 3U7RA 2YIMA 3I12A 4EO9A 4GDMA 1OASA 1ND6A 3M1LA 4ZQBA 4F3TA 2RK4A 2XUZA 1GIAA 1LKZA 3EGIA 4L0QA 1IZ8A 3WZLA 1X38A 2P4QA 5JO9A 2IELA 4OQPA 5KNCA 4PQRA 2W2LD 4IKEA 4XFJA 4YRBA 2ZAOA 2OGWA 2WSLA 4J0HA 1JJ7A 4IIHA 1KVQA 3HTXA 1PG2A 4J2OA 1CDEA 3ZY6A 3DAOA 1RBQA 4ESVA 3ETNA 2LNDA 3AFMA 4HDKA 2W6MA 4JHLA 1N2CA 3P71T 3TN7A 4A92A 1KSGA 4BZPA 3NDIA 1IH8A 2ZE8A 2NO5A 5DIFA 4FOLA 4MUBA 2PSDA 1VHQA 2CVZA 3ZU2A 1YNOA 3UHOA 2BSQA 2WICA 5DEOA 4EENA 3A26A 2D2VA 2W0MA 4EYKA 3QKUA 1T1SA 1GA4A 3I4CA 1OR8A 4JSTA 4EY6A 5L8VA 1SHZA 4DSTA 4G0YA 4C4SA 3EPRA 4L7VA 3BKXA 1WTCA 2FW6A 4U3JA 3EW7A 3QHPA 4PGGA 5DI9A 1S96A 1YZLA 3TJRA 3K5WA 3F6CA 1IXKA 4OFWA 1D7AA 3VYTB 1QYCA 1LWNA 1OBOA 1MVNA 3OO0A 5CX1B 4C4YA 3DB1A 4IIJB 1KEEA 1Z4IA 3O0TA 3FD8A 3MXOA 3HY4A 3ONEA 3H2HA 1SK8A 2C07A 2VUTA 3BDAA 2I4IA 1YB1A 1HBJA 2FPLA 4HC4A 4RPHA 2Y05A 2VC2B 3JWGA 4G5QA 3X2SA 4ARBA 3AFOA 3QEJA 3LBNA 2X5JO 3EISA 2NAFA 1NQ5A 1SK9A 4YDSA 2OBNA 3GRVA 3IHLA 1GG5A 2C8JA 2OCAA 1T4CA 1ZSNA 3B1JA 1VA4A 2EERA 3LRXA 4RPJA 3QLJA 5TE9A 4UEQA 1MW8X 3SSMA 2GCOB 1W5BA 3WTCA 2EP8A 1CLUA 2HJSA 5J2TF 3EXHB 4DY4A 4G1UC 3N70A 1N3LA 2P62A 1KQGA 2C9OA 4KQ9A 4BBZA 2B99A 1QGZA 2J3LA 2X4LA 1S3SA 1IULA 3A31A 4RH1A 2QD3A 2WDPA 5ECGC 4ARCA 1NUAA 2FTKE 1C4WA 2Z5FA 4MR9B 4XW2A 1Z37A 4N3AA 4YRZA 2HM7A 3ESQA 2Z6AA 1WDMA 2C5SA 3U9SA 1JKJB 2BT4A 3GXOA 4KWEA 1J0XO 3DMYA 3T35A 2PMFA 1DZ3A 3BGIA 4EHHA 4QGHA 2PSEA 1NNSA 2A3RA 2C2HA 2W2XA 3F74A 5J5CA 1UBOS 1JQKA 2CK3A 2Z9BA 3EHEA 4RTLA 5BXYA 3ZZUA 3QFTA 2A9FA 5IVKA 4MI9A 1HDZA 1QQ7A 3MPUA 4MTLA 1T2AA 1R9GA 4JLSA 1ORTA 3MWGA 3G59A 3ZQUA 4AYWA 4F93B 1W94A 9LDTA 3U1BA 1VKOA 1WBDA 1ESCA 4HYEA 4KN9S 4IHQA 4BTVA 4RSMA 2LVBA 1P9NA 1SVOA 1RD4A 2HMTA 3JQFC 3NVAA 5KCZA 2C2YA 2XZPA 1RYZA 3BA6A 4X60A 1VQ1A 2IE8A 4O4HA 1OLUB 1Q7BA 2R84A 1F9EA 4EY3A 4ZVRA 2LKCA 4XDGA 4TLDA 1UJ6A 3AI2A 5DBIA 1N2SA 2P6NA 3VR6A 1P0MA 4NBWA 3IJ5A 5JJLA 1RWNA 3LY8A 3ZWBA 1Q7GA 2AMYA 3EAQA 3K0CA 4H31A 4R2KA 5LNK6 1ABBA 1CK4A 2IE0A 5CFLA 2ZTSA 4H3SA 3KOWA 4EARA 3MOGA 4X1YB 1ZD1A 2DECA 4E2ZA 5C80A 2LV8A 2UV8A 3WL6A 1HE8B 4YRLA 1XVLA 2FPIB 2BV3A 3DZKA 3E7XA 5DK4A 3I23A 3T5CA 4EHAA 5AVZA 1JPNA 5FR2A 5I45A 3HS3A 5DH9A 3UUFA 2YOHA 1VJCA 3WYAA 3QPCA 4GKVA 4GYKA 4WKBA 1ISGA 5DBGA 4U63A 2EGGA 3VR5A 5CLFA 5JAPA 3F9CA 1F4VA 4OI0A 3K0FB 2QRMA 4JJAA 1NBWB 5ADWA 2AYXA 1RMYA 3EWNA 1SURA 3IAS1 4LWQA 3LL4A 4Z8XA 4NVRA 4Z2YA 1ZA1A 2XVAA 2W0SA 1XJWA 2XUDA 2ZRNA 2XF8A 3E3MA 5B3AA 3I83A 4ZKEA 4BLWA 3T3MB 2I67A 1PJRA 3VTFA 4JT9A 3SFTA 5K0FA 3FOZA 3IB6A 4F8YA 3IELA 1TPZA 2OECA 3U4CA 2WVHA 3IAUA 1J5XA 3JASA 3NTXA 4NHOA 4Y0AA 4YJDA 4P3PA 2HHLA 2WAMA 5IX8A 3ITKA 1XMJA 4NABA 4TZKA 4YJ2F 5J23A 3N2GA 1KKLA 4Q37A 1G8MA 1ZD8A 1ULHA 1DT3A 3WJ2A 4JOBA 4EW1A 1FFGA 4D0NA 2RGBA 2FPPA 3B9RA 2BOVA 2C7GA 3IIMA 4TLAA 1B0PA 5DIZA 3O8LA 1YR9A 1VB5A 3NX4A 4LMAA 1HYEA 4MKGA 3OE1A 3SQMA 3H0KA 4PRZA 5EC8A 2ID7A 2E55A 3E1KA 1V3UA 2DFPA 3QF4A 1CG6A 3LM8A 4GOMD 2JJ1D 4DV3B 5FB3A 5IBPA 1MAAA 4LQ4A 5JZ9A 1MC4A 3NRBA 1K3UB 1D2AA 2QSJA 1FFXA 2AFIB 3CLRC 4QPPA 5CHEA 4RTOA 3UCFA 2JDIA 3B9BA 2P2LA 1ESEA 2NZWA 2BWJA 2XTZA 1ZOIA 3FKSA 3LCRA 4JYBA 4R9RA 4RJJA 5K3SA 2CJWA 3T12A 4X64B 4NPAA 4AY2A 3QW2A 3DFMA 1K97A 4Z4IA 4LJ8A 3HXPA 1MLDA 4BO8A 4B6GA 4HG2A 5DM1A 2V9CA 3OPYB 5EWMB 4QQRA 4WK0B 1E3QA 1ZD4A 4C6TB 3GCWA 4KE7A 1M8PA 1MXFA 2KE5A 3C7KA 3PJGA 2DHDA 1N8SA 1EWYA 1WCIA 1LCIA 1XZEA 3STWA 1GR1A 3PNMA 5LNK1 2Y1OA 1GARA 1DIOB 2W2VA 3NG1A 3K9FC 1Y6RA 2GO7A 2PFKA 4EDFA 2QUZA 2I7XA 1KBOA 4OHFA 2OK7A 1YR7A 3L0OA 3T3NA 4WK6A 4FP9A 5ALLA 1P2FA 4DTCA 5L7YA 1JXQA 2WIGA 1C2YA 1UBHS 2SKDA 1C41A 3HY6A 4L75A 1BS9A 4BVKA 4CLOB 4F8JA 4H7FA 1C9EA 3IALA 3EAFA 3CNBA 4DCJA 2PU7A 4TXMA 5BSGA 1XZKA 1USGA 1A4XA 3KOUA 4I3GA 2FGJA 3P9KA 4M46A 4FFBB 5GV8A 3ZI0A 4E94A 2VHJA 3ADKA 3ORQA 1N5OX 1E3WB 4MQEB 1Q20A 1Z07A 3GAZA 3IESA 3TE6A 1JJIA 2Y3IA 3DDHA 4OREX 4L51A 2PR7A 1L7EA 1KMHA 4MROA 4XM0A 1MO4A 5LB2A 4MCHA 3E3OA 4BLTA 3P9NA 4YUAA 4HDQB 3F7OA 1U3VA 2GUGA 4G09A 1UKAA 2AV6A 3ZW9A 3T5GA 3B6EA 3T1TA 3Q6NA 2HU2A 3UFBA 1JHRA 2XVMA 3K70D 4MW5A 4N0EA 2Q7DA 1UJ4A 1UM8A 4UD2A 1GPWB 4V0SA 1MH9A 4LZJA 1EVZA 2TMKA 3Q5EA 2BBWA 2JZNA 4QXRA 2BEWA 2WJJA 2HV8A 3D8UA 2QQ5A 1GPBA 5DTIA 1LK5A 4NENB 4MDEA 1Y3BE 5EL0A 5LCXA 4URFA 4HEJA 3GRAA 2NU8A 2ZWVA 1NM5C 4TTPA 4EUKA 1FUEA 4BEWA 1ENZA 2HDNB 1ZU4A 1EH5A 2IXGA 2QF7A 1FTSA 4RLSA 4TT3D 3RB8A 1UFOA 4W4TA 3DQQA 3IEVA 2EBUA 1SULA 2L42A 1BXZA 1OWOA 5D2CA 1C7IA 1LLQA 4IHKA 5IFLA 1SB9A 5KYWB 5DYGA 4BFYA 1NTOA 3C3KA 1JHUA 5I9IA 1JFSA 5BN4B 5HIKA 5JNVA 1RYMA 3DMPA 1FOEB 4REMA 1G7TA 2AKAB 1V8OA 5JJCA 1MO3A 5BVGA 1X1EA 1WSDA 2IVFA 4MO9A 1OAAA 4HOYA 3N7AA 4U00A 4YT2A 5G3ZA 1T4MA 2GLTA 2F00A 1MVLA 1QYWA 2VRWA 4XFDA 2IS1A 3MK31 1P18A 3STHA 5D3KA 3QV1A 4PAOA 3SQOA 3KYDA 5LWHA 2B36A 5D84A 5EMLA 5GWXA 1T2VA 3AESB 3BXZA 4Q3OA 2IEGA 3M89A 3EIXA 4PHFA 4Q6BA 3JQFA 4BRWA 4D46A 4TVOA 2FZ4A 4P58A 3KR0A 1G3RA 4IIJF 3N7UA 1M6VB 1RNLA 4Z0NA 2B8EA 3ZBPA 4CM9A 1CFZA 1NUHA 2ZKLA 3WGQA 3PYMA 2QRVB 3I2JA 3LOQA 4C05A 1I3KA 1ZIPA 2O7RA 1LDNA 2PM8A 3C7AA 2JKVA 3N2KB 4IMIB 2NTEA 4G6ZA 1RWQA 1MIHA 3BJEA 4IO0A 1FYDA 2QXTA 2V4MA 3FLBA 4JP5A 3SHTA 3WGKA 4G0VA 1XJCA 2Q1UA 3QKIA 3NVKI 2HT1A 2FZ5A 1N9KA 1E5DA 1FW8A 4RMJA 3OFKA 4RHCA 5L3ZA 2XMRA 2BI8A 2GK3A 2PT6A 2FR8A 2VIIA 4IDQA 2ZR9A 1TU3A 4MJXA 1TAGA 4F4CA 4MKIA 4ATNA 4EW3A 4R2IA 1XF1A 4RTJA 3A9CA 4F5EA 4JODA 1I0IA 4MIKA 1B16A 1YSCA 2DOKA 3PFHA 3QU5A 1KAOA 2DBRA 2C8KA 4Y6RA 1XMVA 4BIIA 2HCBA 3OJLA 3RBAA 4B4UA 1MB0A 1YA8A 4L15A 4A0RA 1EM6A 4DC9A 5IUNC 1TVMA 2BE9A 2BEKA 5DI3B 5A3RA 3AL2A 4OG2A 3LC7O 4E6EA 3W5HA 1UT6A 3WYGA 3X2FA 4N7MA 3JX9A 5HR5A 4HUQA 2B6HA 4YIKA 2V8BA 5G41A 4KOEC 2XYRA 1SOMA 1UT8A 4F85A 2VDPB 3P2OA 4ZRMA 4F6LA 1GGVA 2F4VB 2QN7A 2O4CA 4B2IA 1XX6A 3I0ZA 5HK8A 1HLDA 4N47A 1JSXA 1NBOA 5A3JA 2G6BA 1AQUA 2OKGA 3EFOA 2C4KA 2QJTA 3FOBA 3EEBA 4UCFA 1JAIA 2A5LA 3ZWXA 5BSVA 1YIDA 3W7BA 2FSGA 1K4MA 1ZH4A 2XF2A 2XT0A 5TS3A 5HJ7A 1VMIA 3QIVA 3SE7A 3JYLA 3AL0C 5TQVA 1Q17A 2AR7A 4MVCA 3CZPA 3EZXA 1IE3A 4AICA 3AF3A 4N6GA 3QEAZ 2DWOA 1UMCA 1FFYA 5LQKA 3K3PA 2WM2A 4TUYF 5D7BA 3WGUA 4KDRA 3P27A 3FOWA 5EHNA 3MWDB 2B4YA 2VRCA 1CQXA 1MC1A 5HIIA 3H6HA 2PRKA 1W36B 2UVQA 1T9AA 1JG3A 3ROTA 2J1LA 3AFHA 2BGMA 3FTQA 4FBGA 1RIFA 1JFFB 4ZVUA 4LJAA 3VKUA 2YS7A 1OIVA 3TI7A 4WQMA 3R7AA 4GICA 4DIUA 2NACA 3PC3A 5I3CA 2ZR8A 2YXEA 4R7ZA 5E6UA 5JALA 4KR6A 2UUBB 3LQ1A 3O8RA 1A7AA 3IUQA 5CPFA 4BQPA 4JUBA 3HACA 2IYSA 3F8SA 3R4VA 3MT9A 2VPYA 2XNJA 2OAP1 4E21A 2CNNA 5HBGA 3N9IA 2VHZA 1Q16A 4EJSB 1XMPA 1DJLA 2ATXA 1AQLA 1L5MA 1XAHA 3K8YA 4CDRA 3CH7A 5BPFA 3WLJA 1DMRA 3L6RA 2RH5A 3TDNA 2GEUA 3O8DA 5HKKA 1TQ2A 2WD7A 1EVJA 1R50A 4PPNA 4LXTA 4FX5A 1J2UA 3SX0A 5C8YB 3DLAA 4LFBB 1VIVA 2AT1A 3NM5A 3BT7A 1C2TA 4HDMB 4R1MA 2Z2KA 5KTOA 2ZE7A 1GL3A 5JJ5A 5KQLA 3KIPA 4ZZ2A 4MQ5A 1ZD5A 2FXIA 2RGAA 4U39A 3T34A 1B15A 1D2MA 3AJDA 4ZQHA 4KP7A 1Y42X 4YRPA 4NBRA 1ZM4A 4KO8A 3CNNA 2P9GA 2J0VA 3OZEA 3U37A 1V7ZA 3MF4A 4OYYA 1AQIA 5BQOA 2JFZA 5AI0A 1YZHA 3NTUA 4OQYA 4INOA 1SPBS 1EU1A 3IP9A 4IGKA 2XR1A 3DTTA 2IYEA 1EVYA 2REOA 1NXTA 3VKVA 3WAJA 1USUA 2FN4A 3W9BA 3T7EA 2GILA 1WMEA 1BMQA 1P7ZA 2GK4A 1E6LA 1C4OA 1K8XB 2QUHA 3C7TA 3FWNA 1NRIA 2C8LA 2FQ1A 3HWX1 3KEMA 3CNLA 3KLPX 3VC3A 3T1YB 4FDTA 3HU5A 3KSUA 1TJYA 2I03A 4JYPA 3VHXB 4AJOA 3ZQJA 1RJFA 3I9NA 1NRJB 4AS3A 3ACDA 2IYRA 4PLHA 5A4FS 1ETHA 2Q3CA 2QZSA 1VYUA 1XVTA 4FXPA 1VBFA 5EE3A 4NG5A 1QU2A 1H6CA 1BKSB 4ZPJA 5DBOA 1NM5A 1NI5A 1ECGA 4PIVA 2FZVA 4FEYA 3DBLA 4E5MA 1GTMA 4Q03A 5LKRA 3GZ4A 2WSBA 4LKRA 4N7JA 1WOMA 2ZU0C 3NV9A 3GA0A 2O50A 3EEYA 3WLLA 3ICPA 3NHWA 4FGSA 3QX3A 3HA7A 2L17A 4MUXA 1E8NA 1SELA 1U5BA 2AEMA 2BGJA 2JRLA 1Q11A 2J5KA 2R87A 2XOKA 3AUAA 3C3MA 1OVGA 1A5BB 3IOEA 4Q1AA 2OG2A 1K5PA 1MPXA 3A1SA 3TR5A 4A0QA 1LK0A 2IZZA 1BHSA 1YK1A 1QYDA 2PX5A 2ZRCA 3LC0A 2DFKB 3AR6A 3CR8A 3HCBA 3Q7RA 5FFMA 3H16A 2O14A 1FRZA 3BK2A 1BDMA 3OTGA 5IBQA 5LQNA 4WY2A 2BFNA 4C5BA 3FCEA 1D07A 3UAGA 3W3AH 1W0KA 3EQ2A 2ONYA 3M1IA 3MWKA 2C54A 4QHSA 3SYTA 4JLNA 2JFXA 1UC8A 2HR1A 1GLVA 1SKUA 1Y3CE 1TRKA 1PYGA 2C7BA 3R6TA 4LHYA 3RRXA 2D0OB 3EDQA 3N8NA 3NJ4A 2C4NA 4NU8X 3PXUA 4RJLA 3HWRA 1EP3B 3TZEA 1J2TA 4FGKA 1I3OA 5LZ5A 3BERA 2IU6A 4D3SA 1ONSA 4YJHA 1CQZA 2RKBA 5I7RA 2GBLC 1ZH0A 2ZUFA 3DOJA 1RZUA 3OQ1A 4K8RB 4DLZA 5KQRA 5I4KA 4FHCA 3FNBA 4L27A 3MRTA 1JUDA 4JUFA 4K81B 1Z6PA 4FMCB 2P79A 3KQSA 3UJ9A 4OAOA 3LF1A 4D2IA 3EVEA 4UHJA 1JNYA 1UXKA 2ZIAA 1EFVB 3P2MA 2BFPA 5ILOA 4RD2A 1EUCB 1E5LA 4OQEA 5BN3B 1JVBA 4NOLA 5ICCA 4QDJA 2OXTA 2HIGA 1FDUA 2A2ZA 1NMEA 5EZYB 1TGVA 2C83A 2WM8A 3NWPA 4I5IA 1VE1A 3JQRA 3OQJA 3B52X 1EDDA 4X3OA 1YE5A 1IQUA 2X40A 3HU2A 3QU7A 5TGZA 5K8CA 4L1KA 4KVAA 3N2NA 4CL0A 4GPAA 3LYLA 5DX8A 4EG4A 1D3AA 4UUNA 2WA2A 1VTKA 4HDAA 3W7VA 1OZHA 1U90A 2IEAA 3EG5A 5LXTB 2LWIA 1Y37A 1C30B 3IHWA 3ZNNA 2CVPA 4ZDJA 1U8FO 2J07A 4OXXA 2WPNA 2PMEA 4UBLA 3VR2A 2OD9A 1W4ZA 3AI3A 1GYPA 4PS1A 4Z0HO 3UWPA 4BV9A 4RW0A 4CV1A 5GOZA 4IOLA 3FUUA 3PHLA 4F6CA 3AW8A 4A8JB 2OL4A 4FKMA 4ZICA 2DERA 3O95A 2I2AA 1XEWY 4JDPA 4H16A 4ZAZA 2JZOA 2YIJA 5FOTA 5JYDA 1FC0A 2C94A 4YCCA 1CF4A 4B4WA 3TZHA 2RHOA 3HGTA 4KQHA 3UYLA 4LI0A 3OFJA 3GZTB 3WHKA 4FGZA 4RZSA 1I4TD 2QMUA 1DE0A 2PMWB 5D1HA 4UOQA 3C6BA 1S8NA 1NW3A 4B2YA 4GD3Q 3C4VA 4R8KA 1AF7A 1UBGA 1N2EA 2H92A 4Q19A 5AKHA 1GFWA 5ELLA 4PLZA 3DAFA 4F3KA 5E0KB 2OZLB 4EPVA 4R31A 3DE6X 1I5EA 3PUZA 1JE0A 4EHKA 4RK1A 4HH0A 5HUJA 1T8TA 1OXBB 1KJ8A 4AQYB 3HLTA 4Y9DA 3PXAA 1WP4A 1PS9A 1F8YA 2V96A 5B58T 5A7FA 3Q8MA 4QFBA 4AP9A 1OH7A 4J1NA 3Q9UA 2I6TA 5CEJA 1Z6AA 3CRZA 5K51A 1I9GA 2F1HA 3KL2A 3IL2A 2RGNC 4I1IA 1MGPA 1XQVA 1Z13A 1Y8ZA 3RV4A 4YVFA 5IM5A 3SAJA 2GZMA 3D9QX 4QARA 1HI9A 2C4TA 2GCGA 5JAUA 4JITA 1NQOA 1NW4A 3I04M 4F56A 1EWTA 4L85A 2WP0A 4C04A 4QXAA 3U3MA 2HN9A 2W98A 3F7NA 3CZ9A 3GC6A 3GEDA 3MRSA 1JI0A 5JSZB 4LJ9A 5K6RA 2ZRMA 5FEUA 5FA8A 3D0QA 3AVOA 1QDUA 4OTZA 1U1FA 4PHGA 1U3CA 1Z8FA 3R3HA 5B37A 1SXIA 3WWDA 5L9AA 4LF4B 4C4RA 4OHYA 2R1UA 2QN1A 2VDVE 4NDNE 1EFAA 1BMDA 1EFHA 2Q6LA 1A76A 4RVHA 4R7TA 1AZSC 3HCNA 2OP0A 3QI7A 2GN0A 1S9HA 4XX0B 5BV0A 1S1MA 3F5QA 1AKRA 5KO2A 4NDAA 3A05A 1EAMA 4IG4A 5JASA 2VNAA 3UIEA 3HABA 4B7AA 5CVDA 5KYUB 5FAXA 4YRRA 2K87A 3TTUA 4FOTA 1YR2A 4INJA 4AUMA 2E1PA 5FUYA 1ZGZA 1QDLB 4FI3C 5BR8B 4F3RA 1LXCA 2VT3A 5ER9A 4ZVSA 3N59A 3BFKA 4WJLA 4OA8A 5ABPA 4CG1A 2DX7A 1HG0A 4HI0E 2Z9DA 5HOEA 1LFDB 2O1WA 1SU4A 3E9MA 3ZX4A 1UINA 2DVMA 5IM4A 1U3DA 2QL7A 3IDOA 1PI3A 4FOOA 4JR2A 3AVTA 3PUIA 4YYZA 2RBEA 5E6SA 3OZGA 5FIUA 5TS2A 1R8SA 1T9ZA 4MQUA 2AC7A 4RPIA 4Y98A 9ATCA 5HFAA 1CVRA 4C9BA 4Q34A 3P9RA 1SUDA 2DQSA 2V55B 5K0LA 5IMSA 3H3FA 1YIAA 3NANA 3A28A 2DTXA 4KH0A 4R9VA 1SQ0A 4WXRA 2GBPA 5LQDA 1AK2A 1FYVA 4RHEA 4OLBA 2XB9A 1PFKA 4M9CA 4L0CA 4GGOA 1X7ZA 1MO2A 3IP5A 3W1EA 3DV0B 4FYPA 3L07A 3B3QA 2D5LA 5D3ZA 1KR5A 4X1KA 2V8OA 4F9FA 3EC1A 1GNQA 3Q7EA 2NXCA 5IAJA 5K0CA 5LIRA 5C8YF 5TDHA 2LBPA 1X1QA 4KL8S 2W2MA 1IZ9A 2WIAA 1YOVB 3DONA 5AOCA 3QJGA 2WJWA 1YCGA 2PQMA 1Q74A 2PA0A 3BMOA 3QBTA 2AZDA 4FN5A 1QG4A 1YS2X 4JOSA 5JS7A 4MJLA 3JQEA 5D3QA 4YUZA 3D7SA 1WDLA 1X8KA 3Q7QA 4GPZA 1E2MA 3HJTA 1QHXA 2TMYA 3GUYA 4YP5A 1WB5A 2QP3A 1ZRHA 1TTHA 1CR6A 1YQUA 3DVQX 4BB6A 1Y1LA 3BB3A 3PUYA 1XPRA 2YWEA 5KNDD 2B1JA 1HNNA 1KKUA 1CY7A 3JQAA 2JJQA 2CV0A 2G8NA 2IKSA 1M2HA 1ZVMA 1ZI6A 2ECFA 5LUBA 3S2GA 4YA6A 3TNLA 4MQFA 4B9AA 4LV6A 2P6OA 4MRNA 3VUFA 1F6WA 2NLOA 3EGXB 4EZIA 4F86A 2OV3A 1G5PA 2WTEA 4LHXA 1DIHA 1IFXA 3HB4X 4MEAA 1NJFA 3T9FA 5HUHA 4LNAA 4AXXA 5LYJB 1YZ3A 2BN4A 2Y0EA 4NE7A 4L08A 5L3SA 3FAKA 3MJVA 3Q2KA 1C0IA 1MC5A 1JAZA 2VXCA 2INGX 4II7A 1CR4A 1RQGA 1ISSA 1IBSA 1T43A 2HK6A 2Q1XA 1DKRA 3BFVA 3JR3A 4PC1A 4WKCA 2CSUA 2XCSB 2ID8A 4QOJA 3VC1A 4MW7A 2ZRGA 2WOJA 2O4UX 3LT5A 4QICA 2NSYA 5J2TA 3LQ2A 2B37A 4RKWA 5B4TA 3ANTA 7REQA 3DKRA 3NJ8A 3OOEA 1WZNA 1RWWA 3ZTTA 5LOVB 3R7WB 4PPYA 1V1RA 5AHXA 5LQSA 2Y27A 4C6SA 2J30A 2R6AA 3VR4D 2QE7A 1GPJA 3TZCA 2W6ZA 1Z0KA 2KB0A 1KMIY 3U2QA 5AQEA 1S4MA 2PRIA 1FK8A 3DOFA 5GONB 4CM8B 4GG1A 3NATA 2EX0A 1Y3IA 1KKMA 4F1WA 4UUQA 4MGZR 3ZIUA 4LTNA 2WAOA 4DRYA 1N0IA 1TZMA 5E3JA 1TYDE 3S2YA 4ER7A 4CBVA 2B3TA 4GP7A 5KB3A 1YA6A 5C53B 7MDHA 4V0KA 1NBMA 3HCAA 3ESCA 3ZWMA 3TW8B 1RYYA 3ZJ4A 4K0KB 1FP1D 4Y2XA 4D4IA 4RK6A 1JMVA 1U1EA 1V5IA 2ZRBA 4F12A 5K9ZA 3AVUA 1WB6A 2GRAA 1E99A 5E2BA 1IEQA 2ZAMA 3CZRA 2Y9PB 3DCJA 3F1LA 3V6LA 3CRNA 2CBZA 5IKPA 1EHCA 4BFSA 1Y4AE 3ND5A 4LDQA 4C89A 4D9FA 3SNHA 7AT1A 1PVVA 1T5SA 4KWIA 5ES4B 2JVJA 4N49A 3EJWA 4YAFA 4K6OA 3ZHBA 1VC2A 3N0TA 3E5MA 3HB9A 3QVSA 3FDXA 1Z9BA 2GBCA 621PA 5HNKA 4FINA 4CLXA 1ML4A 1M33A 2IUEA 3E5HA 2W6OA 4CLRB 3GP5A 4FK8A 2Y76A 4TV9B 4HB3A 5TQ0B 3TLJA 4NYJR 1N2OA 4YTEA 2VZLA 1MT0A 3D8RA 1A9OA 3NC4A 4KBGA 1E3SA 3AETA 3QPVA 5FTWA 3RC3A 4AMZA 3B7PA 3C6XA 1PLLA 2QRZA 4OBXA 5C1IA 3AYZB 3ZCXA 3C6ZA 1XRSB 2XUGA 4F04A 1LLDA 1VSQA 3KEOA 4JJEA 2YICA 1QHGA 4FW8A 1PZEA 3SU8A 1RACA 2IU3A 1QONA 2PL3A 2DCMA 1RP1A 2OHGA 4Y9SA 4QXMA 3Q98A 1FUIA 2EP7A 4GBMA 4W1RA 3RK1A 4A1FA 4DREA 3REOA 2XLCA 2A59A 2E0IA 5EZYF 2QL9A 1SXPA 1IMOA 3PUXA 4H3KB 4UPEA 2RGNA 3VC2A 2EQBA 2NP7A 2Q45A 3DM5A 4KLRA 5AKIA 4CF3A 3C5WP 2PO7A 1FLVA 1A9YA 3SCZA 5T41A 4KDEA 5JCJD 4QPNA 1P0FA 4NTZA 4CEIA 1BCRA 1EVQA 1I5OA 1L5OA 1R5NA 3HYSA 2NZ8A 3CWZA 4KRGA 1Y3HA 4BFWA 5LXTF 4DMKA 2H1CA 5EHIA 1A5AB 4OJYA 4RTRA 2OBLA 1ACLA 1RFGE 3LE8A 1Q3TA 4WNAA 1MJHA 2AFHE 3FOCA 5IWAB 3OFND 3BCHA 2YZGA 4Q9DA 3I37X 1QRSA 3F67A 5KMGA 2XYQA 1VZ3A 5DBHX 4YXFA 1ZA2A 4MWZA 3UCEA 3ZWOA 4ZQCB 4CMEA 2V3CC 2RARA 4DSZA 1BZYA 5IASA 3GCZA 5BQFA 2E4UA 3DWIA 1V16A 2Y4NA 3CLVA 5DNYB 3RHSA 1BVHA 3WWCA 4N8SA 5A4MS 1XD8A 2PT7A 2IK8A 4YJGB 3HKCA 4UD6A 4LPSA 1TJ4A 4A03A 1QYRA 3IJPA 1IXZA 2CHUA 2QTGA 4ALJA 1N7JA 2J7PA 3VHRA 3ICQB 1K8QA 5T67A 3VH2A 2ZUVA 2H59A 3WK4A 5KPJA 1JQ3A 2IEIA 3FM9A 3IBSA 3PFCA 3PGMA 4TL9A 5FUBA 3PUJA 4GLLA 4HZUA 3DM9B 5EGNA 4IDEA 1K5GA 4QUBA 3UO8B 1VXRA 1U0FA 3A36A 4LY3A 2P1ZA 3PWTA 1L7DA 1WTAA 2VXBA 3GCGA 4YMTA 4C0QC 4B76A 1RAEA 2I6GA 5C46F 2PJUA 1ZU5A 2XKBA 4DGSA 3TFOA 1ZL0A 1PNVA 2NPIA 1ZN7A 2GJKA 2QKYA 3E0QA 3C5EA 3GMDA 1L4NA 3JW8A 1FYWA 4FWBA 3H2JA 4MVJE 4DLVA 4ARZB 4IOJA 1XLVA 5E2AA 1DUVG 3AUSA 3BIFA 3VAZA 3FFTA 1JG2A 1UR5A 3DVAB 4IMJB 2DFNA 3TO5A 2IODA 2HHAA 3I9JA 2WU0A 3OLWA 4LRWA 2ZUTA 5IC5A 1GNSA 4FD3A 3KT6A 3IDZA 4N0MA 4C22A 4YRKA 3K5PA 4P3XA 3LSTA 1ZRMA 3U09A 2DQZA 3K9WA 2BL4A 2QBYA 3DT9A 2ONJA 4LXUA 4PAWA 5CIQA 4KBYA 1N7GA 3PF9A 4XUEA 4Q4LA 3K0BA 4M1KA 3SMVA 4U2KA 3URKA 2ZQ5A 3DAGA 2D0DA 2BEVB 3LJKA 4JIMA 2E85A 3D2CA 2H1LA 4LOIA 3X3HA 1JWLA 2W8BA 4U4AA 4WJKB 5GJCA 3QA3E 1FFWA 3RJ5A 1KI9A 1ZXBA 4HH4A 1L3IA 5WRFA 1VPTA 2Q9BA 1DG3A 1U9CA 4IOMA 4GE3A 5HM8A 1U7ZA 3P9YA 3ZDQA 2FEOA 2KBFA 3EASA 4JL5A 1PL0A 2PLNA 4JBWA 4NESA 4E1BA 4CMAA 2YJTD 5FO0A 4G2NA 2M9MA 3SS9X 1K63A 4JWTA 1JFLA 5CDFE 1E1MA 1VLLA 4HX2A 1R10A 2XB2A 1M10A 3BGSA 5L45A 1DMSA 3ND6A 1UPBA 4JVNA 3SOPA 3L6UA 1Y7IA 3CVYA 2OILA 2G3YA 2I3DA 3DKVA 3DEZA 3JWIA 3NDBB 3BMXA 3E70C 3HWWA 3P7MA 3QI2A 2JCBA 1YS1X 1DBSA 2H85A 3IULA 3OJFA 2BZSA 4TM7A 3V1LA 3ZW8A 3GDGA 4ON9A 1HY3A 3MQFA 1D04A 3CO5A 3RYFA 2FUCA 3BE5A 3BGOS 3E1GA 4FDAA 3HR4A 1EFKA 1RVV1 4BZZA 1ZX1A 5A0VA 3EWIA 2BFCA 1PJ2A 4OMCA 3OT5A 2Z8ZA 3R7SA 2KWIA 2FUNB 1LQTA