1XRJA

Rapid structure determination of human uridine-cytidine kinase 2 using a conventional laboratory x-ray source and a single samarium derivative
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
PFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human uridine-cytidine kinase 2 determined by SIRAS using a rotating-anode X-ray generator and a single samarium derivative.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Uridine-cytidine kinase 2
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xrjA00
3AQ4A 4D0LB 2WVJA 4LX0A 3SI7A 5JRJA 1UADA 4HLUC 1CU1A 4KODA 4LSGA 3OIYA 1RKBA 5C2JB 1S96A 2FFAA 5A0FA 3ZVLA 2J0UA 4Q9LA 1CBUA 1M8PA 3AH8A 1T91A 1GTVA 2CCGA 2H18A 1HURA 2ZANA 3FGNA 5JJKA 4JYCA 3L8YA 2DFTA 2F7SA 4OJKA 3U3MA 3ZIAA 4C0BA 4G3XA 4I1UA 3REFA 1FQJA 4A82A 3RWMB 2Z83A 1T3SA 1IN4A 1QZXA 4JL6A 1N6HA 2C98A 3JZMA 1SXJD 2WWFA 4EPTA 4ZCIA 2EWVA 4GRAA 3I1FA 2QBYA 2P6NA 2C9OA 1UDXA 3DOFA 3CIOA 5TDHA 2KBFA 4UQOA 3GLIB 1D2MA 3CRVA 1P72A 3C16C 1D8TA 2IBMA 4XOIA 2V7QA 2YVUA 4LBZA 1NVVQ 4D0GA 2FEMA 3CBQA 1Z0FA 3PUZA 4V0NA 5J5CA 3R7WA 4FWTA 4OHYA 5EXPA 1S9DA 4M9SA 4GMXA 4Q4AB 5GVRA 3EX7C 3EG5A 2VP2A 2WHXA 3MJHA 1W46A 2CL6X 4UXIA 4TTPA 2QTFA 3VHXA 1RYFA 1G20E 1P9NA 3FKSA 5SZJA 4FCWA 5BYKA 4URXR 4JIMA 4C3ZA 1KK3A 1OYWA 2ZAOA 3X1YA 1JNYA 3CR8A 1XTJA 2F1JA 1QHXA 1T5IA 2FH5B 2I4IA 3P32A 4P3YA 3CNNA 3T61A 4B33A 2EFGA 5KYKA 2F55A 1T8UA 5IK2A 2EFCB 3TBKA 3K9LA 2DPXA 3O47A 3PEWA 2YNMA 3CRQA 4RCZA 2QY9A 4PPFA 1ZVQA 1A82A 3ETLA 1NKSA 3B60A 3EXAA 3MWJA 4NL4H 5FOTA 3W5IA 4A0GA 2GJ8A 2KB0A 3Q85A 3VKWA 4C0QC 1KNQA 1Z07A 1SXJC 4HDQB 3PG5A 3TGPA 1MV5A 3I4LA 2J3EA 4DVGA 1JQLB 3B8HA 4A0RA 5EQTA 2B6HA 2CK3A 2C99A 2FGKA 4TT3D 2LKCA 4URZR 2R2AA 3EIEA 2VP0A 2BVNA 1GNRA 1I2MA 4AKIA 4L5BA 4RZ2A 3EWAA 4PC3A 4BFXA 221PA 4TLCA 3SBDA 2R6FA 3WRXC 4BEBA 4LBVA 1XTSA 1Q44A 3EZ2A 2J1LA 4HB3A 4A9AA 4B76A 5HZHA 2L0XA 1PUIA 5J4HA 2PJRA 5P21A 3P4XA 4QNRA 3SHFA 3CLVA 2ZPTX 2D06A 3BB1A 2IS6A 3AF1A 1G8GA 4EUNA 3IBGA 4UJ5A 5E95A 4YONB 3GLFA 3GLHE 5JLJA 1G8HA 2V8OA 4PC7A 4HSEA 2IF2A 3DO6A 1G291 5G3ZA 1NL3A 1II9A 3QOFA 4A6PA 2J59A 4LV8B 2IUTA 3W6PA 3SZRA 3ZVMA 3QXHA 1MR3F 2X77A 1GRQA 2EU8A 4CF7A 5LD2B 1OYYA 1YZQA 1FUUA 4R9UC 2PCLA 4YXWD 1XU4A 1ZNYA 1OHHD 4DLZA 4ZCMA 4C7OB 2JDIA 1DS6A 3K0AB 3C41J 1R7RA 1OH7A 1U98A 3QKTA 5CIWA 1RRPA 2VP5A 1N0VC 5DHFA 1VYUA 2HF8A 4HAVA 4Q9JA 4KVGA 3I5XA 1Z6GA 4US1R 1D9XA 3GFTA 4ZCLA 4Q5IA 3THYA 3ZVRA 1FFHA 1KSJA 3VQTA 1COWA 1J70A 2PH1A 4A8JA 1EWQA 3FKQA 1F60A 4NYMR 3THXA 3REGA 1JAHA 1JI0A 2NO6A 2B21A 3DPUA 1W47A 2EWWA 3RSLA 1KIMA 1RRGA 2AR7A 1JB1A 4KJZA 3T35A 2WMNB 3CPJB 3HPQA 5LBIA 2UZ3A 5BN5A 1X8LA 2JCSA 4LPSA 2O8CB 3BERA 3IO3A 4DLVA 4GOJA 3OAAD 1XEFA 5KDLA 3ZS9A 4UNRA 2P2LA 3I8XA 3GLIA 4RFSB 1E3MA 3RNLA 3EA5A 1AS0A 2JGNA 2JLSA 2WAYA 3ADKA 3SBEA 1YRBA 2ZUCA 3CNLA 4D4JA 2ANBA 4U5XA 3MAAC 3SFZA 2X19A 3AVQA 2IYTA 3L8ZA 4WZ6A 3WHKA 3NVAA 1HUQA 2IYVA 3PEUA 3CPHA 2WKQA 1FW6A 3LW7A 3FFBA 3K70C 1Z08A 4NCKA 4HLDA 3NWJA 2IXGA 4Q4JB 3QEJA 2C96A 2OFWA 4LDJA 3CZPA 1TAGA 4HI0E 1T5LA 3GLGB 3FPAA 2WAXA 1EGAA 4KU4A 1TU4A 1E9EA 1TX4B 5E7JA 2Q9AA 4LV5B 3KQNA 1OE0A 4MYTA 4QKQA 1YR8A 2G1KA 3LRPA 5B58C 3GEEA 3FMIA 2ZVQX 3B2EA 1V43A 5LB4A 2C77A 1KK0A 3W6NA 1HH4A 3QJYA 1XEXA 3CKLA 5JCZA 2NO0A 4HDCA 3PJRA 2FEOA 1BOFA 1EG7A 2ZJ2A 3LDAA 2CBZA 1N5LA 3NBZC 4KITB 1NVUQ 2NO9A 1G18A 3ZLJA 3FVQA 1W5SA 2WPDA 4GZLA 4KYUA 3LXXA 2FWRA 4KHZA 2B7BA 1E0KA 2P5SA 4QL3A 3CM0A 521PA 5KSZA 2ZAMA 3W3AA 1NKTA 1U0HC 3MG9A 3OIUA 1UBCA 1R5OA 2G0NA 4F4IA 5IHPA 3K0FB 1YR6A 2CEAA 1CR0A 1LTQA 5JWHA 2ASEA 4Q66C 4PZZA 1CF4A 2XSZA 1YKSA 2EYQA 4OQFA 1M74A 4TQAA 2RKOA 2XEXA 1KNXA 5JMTA 1GWNA 1IY1A 1U9IC 4DKXA 1I4LD 2CHVA 3HJNA 3AKYA 4JZKA 2PL3A 3AEZA 3EZ7A 4MRNA 4RKFA 2ZI6A 5FOSA 1KDPA 5DLQC 1F6BA 1GZSA 3BH6A 1GVNB 1VCMA 2ZSFA 5KDOA 4O2LA 3NC1C 3WBKA 2PX3A 4DDTA 4MDFA 4TL8A 1TEXA 2VHJA 1XD8A 4QHTA 4JLOA 2O8EB 3TSZA 4EPXA 3DVLA 2OAP1 5KOYA 3LX5A 5TB5A 2NO1A 1AA9A 3C8UA 3X1DA 3OIWA 1Z6TA 3ONWA 1VYVA 2UZIR 2DYKA 2CL7X 1G1MA 3C5CA 4DUGA 4AWXA 1GG2A 3QKRA 3WHLA 3PUVA 2ZI4A 1DVRA 4DB4A 2VP9A 3UWOA 3A1SA 3GCGA 2Q0HA 2FPKA 3ADBA 3L0PA 1TADA 2ZE6A 5AUPB 1UEIA 2AXNA 5FOWA 2QM7A 4IVPA 5HKKA 4I4LA 2ZREA 2LKDA 3D31A 5FUVA 4AK9A 4LUCA 1CR2A 2JASA 1P61B 4NCIA 2A5YB 2HF9A 3JVUA 4NZYA 3AVYA 3FMFA 3QF4B 1T0HB 2DFLA 4KV9A 2KSQA 5FBRB 4OQXA 1GL9B 2QAGB 4C2TA 4UNQA 1BH2A 4PO8A 2OFOA 4YDHB 2F1IA 2JAQA 5DHAA 1JXMA 5G53C 1HV8A 1N3BA 2FOLA 3VTKA 3AP2A 4MKIA 3AV0B 5DISB 4UKDA 2GCOB 2VA8A 2ONKA 5EE9A 2A9KA 1SVLA 2NZJA 4N3NA 5LPNA 5F3WB 3U61B 3R9WA 2N42A 4BEJA 1ZD1A 1CEEA 3I92A 2XJ9A 1GUAA 3MD0A 2ZI5A 1H8HD 1IXZA 2RH5A 3CH4B 1E9CA 4EPWA 1KSHA 3K53A 5AUOB 4LOAA 3QEOA 3WMEA 1CRQA 3SJAA 2R8RA 3RS5A 4RKEA 1QVRA 1W48A 1ZIOA 3PEVA 2QRZA 1KK2A 2AWOA 1SKQA 1OXTA 4B75A 5FBQB 3IIJA 1E98A 1G6HA 1Q21A 1SVWA 4OHXA 3THXB 1YE8A 2ZJZA 4A6XA 3MWLA 5IRCD 1SKYB 2O8DB 4U02A 3LVQE 1VHTA 1JPNA 3M4YA 3TW4A 3VX4A 5L8VA 2AFIE 1KZ7B 3FB4A 1M34E 2OCYC 1T8TA 1FX0B 3X1XA 3JZAA 1N6RA 1SXJB 1Z06A 4B47A 3A6PC 5DI3A 2QAGC 3FHCB 1G7SA 2YWFA 1DARA 4KYIB 1KY2A 4F93B 2WV9A 4QGAA 2QE7D 2NTYC 4D6PA 2FSGA 4U00A 3WYAA 2QNRA 4D82A 1PJRA 4KFSA 1W44A 2XAUA 5EZ6B 3TAUA 3VR6A 4A92A 3TH5A 1HEIA 1NI3A 4MGKR 5K8LA 3DZ8A 1NBME 3R8CA 4C7OA 3OF5A 2WJIA 4Q1CA 1L4YA 1MT0A 4L16A 1R0ZA 3QE0A 3IQXA 1N6LA 1Z2CA 2IYQA 2WSMA 4LJ5A 4IDQA 2NQ2C 5L3QA 4PXAA 1J99A 1KK1A 4DT1B 3BC1A 4JBYA 5EUQB 3UG7A 1X3SA 1Z2AA 4CT5A 3AF3A 4KI0A 3QENA 1B0UA 1QG2A 2QP3A 4E09A 4H1UA 1E2LA 4M1MA 5C18A 4A0FA 2GBLC 5KHOC 1RRFA 3QXJA 1IM2A 3W9YA 3RS2A 1N6OA 1E0AA 1M7HA 3B13B 4HB4A 3A4LA 4JLNA 4TT3A 2BMFA 4BASA 1Z6AA 4FD2A 4B74A 3MRSA 1HYQA 1O3YA 3R20A 3TQFA 3CPEA 2AKAB 2HCJB 4DDVA 3LLUA 3Q5DA 4PTLA 4QGFA 2BC9A 1CKEA 3LQRA 4AYXA 4GL2A 1Z3IX 2AHOA 1MH1A 1S4QA 4B3CA 1MO6A 4Q7KA 1JR6A 1DE0A 1QHNA 1Z29A 3NEYA 2ZYVX 3ZH9B 1W36B 1RJ9A 1OXUA 1Z0IA 3LW8A 4QG7A 1YR9A 2OEPA 2GZHA 4BFWA 2Q3MA 4HAZA 4W5JA 1XEWY 4HLQB 3VU9A 4DCNA 1HT1E 1UBGA 5BXQC 3F3YA 4Q4JA 2BJWA 5JCPA 3NXSA 1QHHB 2QE7A 4K46A 1PLJA 4IFEA 3NDPA 1T6NA 4C0JA 2OFXA 1P62B 2ZSEA 3ADDA 4UXJA 1TU3A 4ARZA 1G5RA 3QKRB 4PR0A 4DLRA 2UKDA 1DAEA 2AK2A 1E79A 1G3UA 1GKYA 1H8HA 3RABA 3RC8A 3I3SR 4QGGA 3LBNA 2YZ2A 1AIPA 1FNMA 1JJ7A 2HT6A 2ZSAA 1GL7A 4A2QA 1NSTA 3PFIA 1U8YA 2OBNA 4XJXA 3U3KA 2XGJA 2G3YA 4GP7A 1A2BA 3CWQA 2G77B 2GWHA 2O8CA 1VCOA 2ODWA 3H84A 4RD6A 1E2DA 2IS1A 3A36A 5FUXA 1QHHA 1ZM7A 1KGDA 2BJVA 1LW7A 4IOJA 1AZTA 1IHUA 2H17A 2RGGA 1BKDR 3CF2A 1U94A 1W49A 3QPUA 2VSFA 4R7ZA 3MCAA 4TLAA 4W5HA 3RS0A 4ASUA 4R71A 5FOXA 4URYR 4ZIRA 2ZM5A 4KLZA 1UKEA 2VHQA 4N0DA 1VG1A 1UAAA 4OHWA 4GI7A 1Q1BA 3AF4A 1L4UA 2IYZA 2ZS7A 4LYAA 1OHHA 2K5UA 1W2HA 2QQEA 2XNDA 3NBXX 3A1TA 2QA5A 2J7PD 4DDWA 5BW8A 5CB8A 2CHQA 3WNDA 1PLLA 5DYIA 3QVUA 4U7DA 1CS4C 3RRNA 3SFVA 2OO7A 3VHLB 3RYTC 3W8NA 1ZMXA 4EJSB 2YJTD 1DAIA 1EK0A 2W6IA 5JEEA 3W6OA 2XOKD 1FNNA 3GEIA 4PSAA 2C9YA 3K0FA 1ZM2A 2CLDX 1TF7A 2GK6A 4M1YA 2GVDC 4TYQA 3WP1B 821PA 1Q3HA 4Q7JB 2IS2A 1MABA 3B9PA 4DCTA 3OE7A 3P27A 2GESA 4ON9A 2OCAA 3B6EA 5EP1A 5JI3E 5GADl 1JXOA 1AK2A 3BE4A 1H65A 1G3QA 2CNWD 4QJ3A 3OESA 5F98A 4WW0A 2GKSA 1SGWA 1NG1A 2GDJA 4DSOA 2ECKA 4M1KA 5KSOA 5FFMA 621PA 2ZJ8A 2IWHA 4YMVA 1ZNWA 1L2TA 2DFKB 3R9IA 1IAQA 2HCBA 4WZBE 3U5ZB 2YC2C 5FTKA 3ZJYA 1SXJA 2IEYA 2QU8A 2WWHA 3AB3A 2XZPA 4IDHA 4F4JA 4TLBA 2OBMA 5FPHA 4IOKA 4LZZA 3R8FA 2PLRA 4M1TA 3SE0A 4E22A 2ORWA 4DT1A 4HB0A 4KLNA 5EP3A 4V0KA 3MMPA 4ZO4A 3NEJA 4OI1A 4W7SA 1GSIA 2XSZD 4DC9A 4TL9A 1FZQA 2QAGA 4C2UA 1SXJE 3ZYCA 1VIAA 3T34A 4DJTA 4MKGA 4B2IA 4V0LA 2DR3A 1MOZA 1EESA 2D2FA 4JMPA 1OKKA 5JRZA 5B64A 2W2XA 2Q9BA 4Q7MB 1BIFA 1KMHA 1E2MA 4X8OA 5JSZA 1EFRA 3FKSD 1JQJC 5CJPA 4WVFA 4BLSA 4XSGA 2W2VA 2ZRJA 2VSOA 4BGDA 1K5DA 3AVOA 4KFTA 4DRZA 4HUTA 1ZM4A 3BK7A 3EASA 4M9QA 5DO9A 4EFLA 3FTQA 3TE6A 3PQCA 1P2VA 3TQCA 2GCPA 1VKJA 3O8CA 4AKEA 1QF9A 2RGCA 2XOKA 2OG2A 2GAOA 2DHRA 3B78A 1F3OA 1W0JD 3VX3A 1Q1EA 1E94E 5AJZA 3BRWD 4DLXA 2D3WA 1X8JA 2ORVA 3S1AB 5EUMA 1VG9B 1EXMA 5H1YA 2V7QD 3QF7A 8OHMA 1CIPA 3TJZA 4JJZA 3NKVA 4PHGA 3LD9A 2G83A 5J4LA 3ZQ6A 3LV8A 4DHEA 4DUGD 4QM7A 2ZRMA 2PT7A 4PQFA 2V4ZA 1XTRA 1Y63A 3RAPR 1D9ZA 4B2LA 3SQXA 2ZETA 4KSBA 3QUSA 5JEDA 1GRRA 3K09A 1QHYA 4BLRA 2FDCA 1Z6XA 2HEIA 2C95A 1WBBA 4DSTA 2D62A 3DMDA 2X8AA 1YVDA 2ODBA 2QMHA 1ZYUA 3ICEA 2ZRDA 5KUTA 1Z8FA 4DLSA 3U4QA 1IOZA 2G1JA 2E87A 2OAQ1 2ZRPA 4TYPA 5JI2E 4A8JC 2ZRFA 3TIFA 1WE2A 2RGEA 1II8B 3LBIA 1E1RA 4BLOA 4Q4LA 4JLPA 2DFNA 4DZZA 3KKMA 2NO7A 1CULC 3AP1A 1KTVA 3IDQA 3U3OA 1JJVA 2IA5A 5FTNA 2REOA 1VCNA 3P1JA 4Z54A 3EPJA 2YOFA 2MSEB 3GMTA 3TMKA 1CJKC 4AKHA 2JA1A 1IXSB 4A0HA 2CE7A 4C0AC 4PQYA 2XXAB 2V1UA 1P9RA 1WXQA 4LHVA 2X1VA 4IRUB 1RZ3A 1N5KA 2PX0A 1W36C 2CNWA 2VP6A 4CZ2A 4G5GA 2WWIA 5KPDA 4G5RA 4KSCA 4Q9KA 2IUUA 3PUWA 1WMSA 2YYZA 3CRRA 4TMKA 1E2GA 4XTRA 2A2ZA 2E1RA 3EAQA 1P2TA 1YZLA 1B23P 1MABB 1NVWQ 1CJVC 2O0JA 3KUCA 5IDVA 1HQYE 4XIGS 1X1SA 4Q4HA 4B3DA 2BBOA 3P20A 3GLHA 2V9PA 3PUYA 5JBQA 1W0JA 1DADA 5FI1B 3SYKA 4IKEA 5A4JA 4HYYA 1VPLA 3OZXA 4DWJA 4Q02A 2PCJA 4RD0A 4HLUA 3OEHA 2FU5C 3N2IA 4YMWA 2BV3A 3U60B 1HTWA 2NOAA 1OIWA 1P7CA 2MMCA 2ZE7A 5L3SB 3ADCA 1QDEA 3BH0A 2WZQA 3PV0A 1SQ5A 2OUKA 1GKUB 3O8RA 2WJVA 2RGBA 4P33A 4Q7LA 4JL5A 4IW3B 4GDFA 3LWNA 4IVRA 3DL0A 4J0QA 3FYHA 4DIDA 2P6RA 1LY1A 2X2FA 5B30A 1W5TA 1W0KD 3F5FA 3EC1A 4ZPXA 3HU1A 2OBLA 4QGHA 4HAYA 1CLUA 2ZRKA 1ZUIA 2ZEJA 4XVQA 3KJHA 4D4LA 4YMTA 4WBSA 2H5EA 5JS8A 1RE0A 4DSUA 3GLIE 3EIQA 1PLKA 3UPUA 4JSYA 2GILA 3C4JA 2ZR7A 3RDPA 3UATA 1WB9A 1DO0A 2OCPA 2VH5R 3MGCA 2QT0A 3NG1A 4DLUA 3ND8A 4PHFA 1P3JA 1K8RA 3FDIA 4D80A 2XZOA 2BEKA 2ZS9A 1KDRA 2QBYB 4EFMA 1E1QA 1KI8A 1F2TA 4RVCA 1R0WA 2D74A 2IHBA 4PHHA 5EP2A 4OK3A 5SZHB 4BE7B 5KSYA 1T0JB 4A1FA 1L8QA 1ZIPA 2R44A 1JALA 2EW1A 1XJ0A 1XX6A 1OFIA 1T4GA 2A7QA 3VR4A 1F2UA 2W0SA 3CZQA 5CDFE 1P2UA 4CVNA 4LRWA 1DAGA 4LHYA 3AVTA 5JS7A 3AVWA 4LJ8A 4X8HA 3EARA 1KHTA 1HE8B 1IBRA 5CB6A 3K0CC 5DGXA 2AL7A 1XPUA 3EC2A 3QBTA 2F9LA 2ZIAA 4MRVA 2WOJA 2XB4A 4TQUS 2GCNA 1G7CA 3MUFA 1P6XA 3MWYW 1JECA 1G17A 1OSNA 5DIFA 2YV5A 2Q21A 2O52A 4JLAA 1E96A 1R8SA 2Q6TA 2WICA 1PUJA 2WMOB 3OIVA 5TV2A 3IPYA 3SEAA 3NHBA 2WWGA 3U7EB 2VHTA 1G7RA 4B32A 2GJSA 4DIEA 3R7WB 1Z0AA 2ZI7A 4LHZA 2RGNC 2AD1A 2HLDA 4AC9A 4WXPA 5CM9C 2KI5A 2Q3FA 4BFSA 5FBVB 5DI9A 1FUKA 3BD9A 3HP1A 1GKIA 1Q1ZA 1XZPA 3CRW1 2J41A 1Z5ZA 1SHZA 4Q1DA 2NPIA 1W1WA 2XTZA 4G01B 4HB2A 3KKQA 4HLCA 4IDPA 5KNBA 1KYIA 1U90A 3LVRE 4S2EA 2QP4A 3FHTA 1EX7A 2MSCB 2ODNA 2QP9X 3OFNA 1D2NA 1E2QA 1AS2A 1DAMA 2ZR0A 5EE3A 1E9SA 3HU2A 4KAXA 3U2QA 1YZNA 6Q21A 4C30A 2XB2A 4CEIA 2BWJA 4RZ3A 2PZEA 1VCIA 2QTHA 5FBLB 4URVR 1QHSA 5HCNA 1XJCA 3LFUA 4Q18A 3VAAA 3IKJA 2JLUA 1XMVA 1JEEA 5LDDC 2WWYA 2R6AA 1IJEA 1DPFA 2EFDB 4FCTA 5FPSA 2QG6A 1AKEA 4JBXA 4Q48A 4LGMA 4OHZA 4FMCF 4G5OA 3AKCA 1WRBA 1E79D 1NMZA 4F4CA 2I3BA 2F3TA 2FNAA 4V0MA 3W3ZB 2HV8A 1E9AA 1E0SA 1Z6YA 5CDFA 1DAKA 1SKYE 5AJWA 2C9CA 2BM0A 4M4SA 3X2SA 3QY0A 4JLMA 1ESNA 3V4FA 1Z63A 4CRWB 3IQWA 1G8PA 5DI3B 1XPRA 4ZDWA 2F1RA 3GJ4A 4ITRC 5FPTA 3ICQB 2W2TA 3SNHA 2GJAA 4XWAA 2G9NA 4LPKA 3AUXA 1NBMA 2YHSA 4M0LA 4KBGA 4DBLC 4NYJQ 3CB4A 5G41A 4AG5A 2GF0A 2PJZA 5J47A 3E2IA 3NBYC 3OE7D 4RD1A 3DDCA 4HAWA 3AUYA 3BFKA 5DE3A 4GMDA 1M6NA 3HR7A 2BBSA 3SJBA 4PSKA 3VR5A 2R6DA 1S1CA 2F3RA 3H0KA 2VEDA 1UKVY 1PVOA 4TQ9A 2GEDA 1E0JA 4MKFA 3I73A 1OJLA 3NIBA 2ZRIA 3A8TA 3QKSB 4MDEA 4Q19A 1RC8A 1TF2A 1GFIA 4MYUA 4IDOA 2PEYA 3IO5A 3OFND 1P73A 4B48A 1VMAA 4FN5A 3ASZA 1DG3A 1E69A 1DG1G 5EXTA 5FPYA 2D7DA 1KKLA 4GZMA 2JJ2A 2V54A 4Z1MD 2GVZC 4FW9A 5JWOA 1KSGA 3UIEA 2ZYUX 4BRUA 5EZ5A 2J0SA 1NLFA 4D81A 1KJZA 4O2RA 4DLWA 1YHNA 5DN6D 2H8KA 4US0R 2IYYA 4NDZA 4Q03A 4NH0A 2G6BA 4DSNA 4MYCA 1RFLA 3G82C 1NJGA 2RCNA 1XRJA 4KFUA 4PO1A 4TYWA 5AJYA 3I32A 3G5UA 2WJYA 3AKDA 1XFAA 3KQUA 1UBFA 4HUQB 1TNDA 1DBSA 1R6BX 2BMJA 3H2YA 4D4MA 2HYIC 2C5LA 1WCV1 3LA6A 2YOHA 4P4TA 1GM5A 1FP6A 4ZI3A 1NN0A 1Q20A 3LY5A 4NTZA 4P4SA 1ZCAA 3DEFA 2BIFA 1ESMA 3AVVA 2F43A 2RGXA 2A5FA 3LO5A 4JLJA 4D0NA 3AM1A 2R65A 3GD7A 5HE8A 4QRHA 4URWR 3TSWA 1W4AA 2IXEA 1S0UA 1G8YA 1NBMD 3CO5A 1S1MA 2ZE5A 1OT3A 4ERNA 4X8MA 1C1YA 1G7TA 2BHRA 4B3GA 4MRSA 2BDTA 2QZ4A 3C15C 3H1TA 2P6UA 2LCFA 1ZW6A 4LK2A 3RHFA 3OAAA 1GAJA 2GETA 3V4RA 5E4FA 2YC4C 1OKKD 4LJAA 4PZYA 4CYMA 3KL4A 421PA 2PMKA 2HDNB 4BRWA 3U3JA 2AXPA 1EFRD 2QEQA 3U7HB 1L7VC 4LY6A 4GPTA 4I1VA 4POAA 2BBWA 3BWDD 1E9DA 2F1HA 3WY9A 1OH5A 2XXAA 1E1RD 1GNQA 3AGPA 1S8FA 1YZUA 4LJ6A 3BXZA 3NTUA 1G3RA 3RANA 4Q9HA 3E5HA 3BJIC 3ZZTA 2JLZA 3B1WA 4TMWA 3QNUA 1XD9A 2YINC 5JHHB 2W6JD 3K9GA 4LI0A 4XD7D 1PV4A 2WIBA 2O8BA 4H1VA 2H7VA 4US2R 1XCMA 2ZRHA 4ILEA 4OKSA 2GF9A 4YMSA 1EFUA 3PIRA 3TVTA 5DYGA 2YKGA 4AG6A 2NZ8A 4JT4A 3TLXA 2B7CA 5D3MB 4RFSA 4OBEA 2Z4RA 1Q0UA 4TZ6A 3TK1A 3ZIAD 3D8BA 1EX6A 2Q3HA 3T1QA 1NNEA 3UXMA 4E5UA 1C9KA 1OH6A 3RRZA 4P4SB 4RZUA 5J4KA 1EFHA 1KMHB 1II8A 1QVAA 2FA9A 2YWGA 1F5NA 2JIZA 4B3FX 4QNMA 5FL7A 4BZXA 2CCJA 2ZS8A 4AY2A 1TTTA 2GTPA 3O8DA 4PX9A 2I1VB 4DDUA 4ZI2A 3ND9A 4L9SA 5KNDA 2ZXUA 1MRSA 4LYJA 1ELOA 3ZS8A 5HCIA 3I61A 5F9FA 5FI0B 1FL9A 2JJ8A 4C4PA 3GLGE 1U8ZA 4JL8A 3GEHA 3UK6A 2IYXA 4PAOA 2ATXA 1XD2B 1E2PA 3AGQA 1TEVA 4YMUA 1AJEA 4K8OA 1DELA 1X8KA 4UNNA 5CLLA 4BLPA 5JJIA 2BCGY 2IEZA 3DM5A 1YZGA 4IDNA 5C46F 2XNDD 2D4HA 1SVOA 5UKDA 1OV4A 3BGWA 5JHGB 1ZUNB 2O8EA 2GXSA 2KWIA 4QC2A 3AVXA 1XF9A 4NCNA 1W0KA 2VSXA 4HAUA 1E2KA 2ZI9A 5E7IA 2DB3A 2WPDD 4S35A 3WRYC 5AUNB 4I1SA 2GNOA 4QBGB 1ZM3A 4CEJB 3VFDA 1OFUX 2WOOA 2CL0X 4X8LA 1Q3TA 2WWXA 5D3MA 2QMUA 3K0EA 3J81k 4A2WA 2OE2A 2IS4A 2VLIA 2ZJOA 2C78A 3LQQA 3WXMA 2WM9B 4EPRA 4V03A 4XWKA 3AVUA 1XB2A 1NIJA 3B1XA 2OLJA 1G5PA 1LV7A 5EE5B 3TAHA 1KSFX 721PA 1SVSA 4ACBA 4ASUD 2GAAA 2J5XA 3A1UA 1GNPA 2VP4A 4M8NE 1AZSC 3A58B 3QVVA 2ANCA 2ZQ5A 2FMXA 2ZSBA 2FSIA 3THWB 2O8FA 1M7GA 1OLOA 1UM8A 3H86A 5GVSA 2ZJBA 3PR1A 2IT1A 2AWNA 3DKVA 3LH5A 2MMGA 3IBYA 3NDBB 4PO9A 4FIDA 4IVQA 1RJ9B 4N1AA 2HJGA 2DWPA 3SU8A 1LF0A 3EW9A 4A8JB 4DLTA 4ESVA 4UJ3A 1VG0B 1LS6A 1DAFA 3EZ9A 3PCRB 3UMFA 1MO5A 2ZJ5A 1VHLA 3CW2A 4NBSA 1KO5A 1TQ6A 2JATA 2REBA 2NMVA 5F2EA 1AN0A 3K9HA 1UBEA 3ZZUA 3GLFB 1U99A 1ETUA 2XZLA 5L3QB 2R9VA 3GJ6A 3Q8XB 5FL3A 1II0A 1VTKA 3KB2A 5JZVA 4PAQA 2GEUA 4V0ME 2ZUBA 1IY0A 1E1QD 4TN1A 3U44B 4B43A 3WP0A 2IXFA 1X1RA 3KX2A 2KBEA 3HYRA 5IF9A 1XWIA 1I4TD 4MRRA 3HU3A 4TLDA 1QHGA 4H9GA 4JLDA 3RWOA 5IT5A 1W7AA 1J7KA 3IIMA 4LJYA 2R62A 3ZD6A 1FX0A 4PSVA 3SQWA 2IYUA 4QJ4A 2Z0MA 4PPNA 3ZD7A 4GP6A 1R0YA 1GP2A 1CJMA 2OHFA 4MH0R 2EFHB 3Q5EA 4EQ6A 4L15A 2FPLA 1DEKA 1KZGB 3QG5A 1KI9A 3A37A 4XVRA 2QSZA 5CITA 1ANKA 1W36D 4G5SA 1HQCA 5ELXA 2GXAA 3FE2A 3PUXA 4TLEA 2KJQA 1NSFA 2VL7A 4JVSB 4EFNA 2QGNA 2W0MA 1Z83A 4EAQA 2AX4A 1LS1A 2EVWX 2BOVA 1Y3AA 2IHYA 4EJSC 2QN6A 1XBTA 2NIPA 1NJFA 3KB1A 4RZXA 4V0OA 3PITA 2WBLC 2ZU6A 3B9QA 1GDDA 3KQHA 1MRNA 2C8VA 3QBVA 4PC6A 5AUQA 2G0TA 2KE5A 4P0TA 3K8YA 2GBLA 4WA7A 1UDWA 3K9NA 3T06B 2ORIA 4KBFA 2C03A 3TVDA 1CJTC 3OEEA 4BQSA 4FXPA 2V6IA 1XMIA 3QSYA 2OZEA 5DSZA 2FJUA 2CE2X 1W4BA 4M1WA 2CHGA 1KKMA 5BYJA 5SZIA 1N6KA 4GT1A 4JYBA 3ZDQA 1JAIA 1IJFA 2JLYA 1OIXA 4OYHA 2WJHA 4B2PA 3PEYA 1N2CE 4FMDB 4P4UA 5L3SA 1ZP6A 2P65A 2J9RA 4AKGA 3RC3A 3TSOA 3L0IB 4JJKA 3KUDA 4BFVA 4M53A 3SC3A 1COWD 4I99A 4A4DA 3KKOA 2PZGA 3C14C 4Z8XA 1U81A 4TWZA 3N5CA 2DY1A 3KTAB 4LV6A 4DB2A 3UWKA 1CJUC 1JR3E 5E7MA 3N2EA 3W5JA 4HZIA 4D4KA 1ZNZA 1AQUA 3SYLA 1OB5A 3VMFA 1VYTA 4BZPA 1BMFD 1VG8A 5FR2A 4JVMA 2ZR9A 5CIQA 1A2KC 4TSFA 4CT4B 2J0UB 1KO7A 2IX3A 1TF5A 1ZC3A 4JS0A 2BKEA 4OQLA 2Z5FA 4MUAA 5HTKA 4AURA 3VU9B 4MGZR 3SHWA 2GA8A 4O0MA 1NVXQ 3M0EA 3T12A 1YQTA 2A3RA 3IILA 3N70A 1CP2A 2OESA 4L8GA 3B82A 1ZU5A 4XWOA 1AGPA 2RHDA 5FH9A 2JJ2D 4W9MC 2ZYWX 5HE9A 1BS1A 1XMSA 1IQPA 4BFYA 1VDZA 5M04A 2P0EA 3AF0A 2ZITA 4NKRA 1XTIA 1U0JA 4JKIA 3FOZA 2Z43A 4Q1BA 3D6TB 4B35A 2PMDA 5GJCA 4G0NA 2HUPA 5A5GA 1CRPA 2IYRA 1KJWA 4B73A 2WTUA 3NH9A 4Y0AA 1AQYA 1HA3A 1DOAA 3GPLA 4FI3C 3VNVA 2GJ9A 4ZDJA 1N6IA 1ZD9A 3D3QA 1XXHA 5FUYA 3IGFA 5H68A 4F38A 1E2FA 1S9HA 1BYUA 3BIFA 4NU0A 1E2EA 2DWOA 2P67A 3EPKA 5KO2A 4A15A 4P31A 1FTSA 1S3GA 2ZTSA 4GOKA 4MITA 4CIDA 4KFRA 1KI6B 3CRMA 4ZKDA 4LBWA 4TMXA 2OM2A 4B71A 4C0HA 2VIIA 3U4QB 1KI2A 5D3QA 3UG6A 2IUSA 1IXRC 2XX3A 1J2JA 4QM6A 3UMRA 1DTSA 1K5GA 3WYGA 3TUZC 1TMKA 1WP9A 4KCGA 3F0TA 1Z0DA 4FWIB 5DN6A 1XP8A 1Z0KA 3T1TA 2VF7A 1YJ5A 2HXSA 1IN8A 1FP7A 1XZQA 2OLKA 4F92B 2GXQA 1UEJA 3W34A 4TSFD 1R5NA 2VPPA 4R98A 2HYDA 1XDBA 3B1VA 1ZD8A 1WBDA 3VNUA 2XJ4A 3C5HA 2O0HA 3CX7A 5K8IA 5J4YA 3QPVA 3SDZA 3P26A 3GJ8A 4B44A 2WIAA 4MKHA 3DKPA 2OCBA 5HPYB 3EA0A 5C4MA 4EIWA 3A1VA 5BWMA 2F6RA 3NHAA 1KJYA 4AYWA 2OXRA 3HYTA 1HY3A 2WWWA 2QSYA 3U3RA 3GLGA 2DWQA 4B6EA 2B92A 4URUR 1QRAA 1G5TA 2ZVPX 2RGAA 3NBFA 1GITA 4PZLA 2QENA 3QXXA 3HPRA 4JLVA 1SVMA 1VIYA 1Z28A 4ARZB 5J4VA 4RD4A 1BYIA 4HUQA 4MRPA 2ZI3A 4JLBA 4WIAA 1W2GA 2V3CC 5B57C 4JT2A 1NLYA 1DAHA 1TUIA 2QUZA 1UKZA 4OHVA 5FPKA 3BBPA 2CVFA 3BS4A 3LAWA 5EE0A 5KTYA 3CX6A 2CMKA 4HDOB 1I2DA 2BMDA 4AYTA 1WQ1R 4M9ZA 4C9BA 3UMSA 1CXZA 2VHUA 4D26A 3B5JA 4LC0A 2GK7A 4LYFA 5H70A 4D2IA 1X86B 2C2HA 3SOPA 1Q57A 1NP6A 1D2EA 3CF6R 2QGZA 2IF0A 1KO1A 2JIZD 3SJZA 5HR5A 3V00A 1P60A 3IHWA 4NCJA 2J87A 3W8RA 1G6OA 1NMXA 2OT3B 3L43A 5CJ2A 5JECA 4IEIA 1N6PA 1E2HA 2NGRA 4YDSA 4BLQA 1MKYA 2BMEA 4PANA 2J0QA 1ZNXA 2N46A 2QPTA 1WDTA 3KZ1E 2I1QA 1LB1B 3DMNA 1ZRHA 1K6MA 4GNKA 4V02A 4E07A 5AWFC 3E1SA 3X1ZA 4HAXA 1IN6A 1NRJB 5GJWC 1M1YE 3VR2A 4C0SA 2FFBA 3H4MA 3MLEA 4M9XA 2YOGA 1KDOA 3IHLA 3HDTA 2XITA 4FINA 3KFVA 5FOVA 3SN6A 4C0KA 5FTJA 1R5BA 1W4RA 2CJWA 4HZUB 3ZGXA 1ODFA 4N0EA 5FL7D 1XXHB 1P9WA 2OILA 1SZPA 2Z4SA 3U44A 2BKUA 1FOEB 1CR4A 3L0OA 4OK5A 1KDTA 2O5VA 4Q1EA 5AJXA 4TMVA 5AR1A 5LB2A 4FMDF 1H8ED 3U6BA 1KMQA 5TXGA 4DEYA 1ZC4A 2XTMA 5J40A 1N0WA 3V9PA 2UVQA 4YXWA 2ZRLA 1E2NA 2JDID 3KJIA 5K8TA 2JLQA 2IW3A 3SS8A 4QBIA 5TMPA 3EZFA 2J45A 1AKYA 1US8A 2Q9CA 1E4YA 4EDHA 3Q3JB 3EIHA 4MGYR 1E2JA 3I5YA 4Q00A 4ACAA 4W5WA 1P5ZB 2GHIA 3Q72A 1NN3A 3KJEA 2A5DA 2JLRA 2OXCA 4LJ4A 5CM8B 1FPMA 2GXUA 2ZRCA 4MUBA 3W90A 4OK6A 4PHTA 4NE2A 1ZM9A 4AI6A 1IY2A 2W83A 1OH8A 3FWYA 1NF3A 3CWZA 2JJ1D 3QQ5A 5C4GB 2FFHA 3RRMA 1A4RA 1HT2E 3EZ6A 4LHWA 4TMZA 2A5GA 2QM8A 1J8MF 2VQSA 4Q4AA 5KU1A 1NY6A 4YQFA 1RRCA 4M1OA 1E4VA 1NN5A 1YR7A 5C1BA 1TQDA 4HATA 1Q1QA 4LYHA 4OL0A 2J7KA 4LJ7A 2Z6VA 3B7GA 4IXNA 1N5IA 1F48A 2AK3A 1KOFA 1U2RA 2FSHA 3K0SA 3Q7PA 4BECA 3THYB 4CEJA 1ZINA 1G41A 3GJ0A 3DM9B 3BB4A 4XH9B 2W58A 1S3SA 2AD5A 5KDDA 4R2HA 2TMKA 1QG4A 2J0VA 2WJGA 4NHOA 1DO2A 3T1VA 3GQBA 5JSZB 1XTKA 2IL1A 3RVBA 4II7A 4UXHA 3PENA 1AS3A 2A78A 1W4CA 3LXRA 3LLMA 2ZU0C 4E03A 2SHKA 4AD8A 3KKNA 2QL6A 3I8SA 1EFTA 5CLQA 2RGDA 4PC2A 4MQBA 4XSHA 4OJQA 4A36A 3FFAA 1GOTA 4Q01A 3UKDA 1I4DD 4TYYA 2QRNA 1OPXA 5FOUA 4F91B 2QPAA 4LWZA 2FF7A 4TZ0A 2VF8A 2CCKA 4R2IA 2FX3A 5GJBA 2LWIA 1ZJ6A 4K81B 4BZQA 3B1ZA 1MO3A 3QG1A 3F8TA 4BPBA 3Q9LA 2R6GA 2P3SA 1E9RA 3ZZ0A 3CUEF 1UF9A 4M2LA 5CYPA 5EP4A 1US8B 5G3YA 3DOEA 1G4UR 3KJGA 3THWA 1G16A 5FBWB 2E9SA 3THOA 1E2IA 2QAJA 3GLHB 4M21A 1U9IA 5IK2D 4NMMA 1X6VA 4I1OA 4RD3A 1AM4D 4NPHA 3BOSA 1RW4A 1ZUHA 4PFSA 4FMBB 1WF3A 4FMCB 2JJ1A 3CR7A 1UJ2A 3X1WA 1ZCBA 4BWYA 1Z0JA 3WMFA 1UFQA 1NIPA 4GOXA 2R6CA 2GZDA 4XD7A 5AK0A 1AGRA 2PBRA 1H8EA 4AIIA 2F43B 3KKPA 3IUYA 4M22A 4OI2A 3WNBA 2CK3D 4GSYA 4Q21A 4TTQA 3A4MA 1T9HA 2VRWA 3CF0A 1JEDA 2EQBA 1KI7A 2WKPA 4NYMQ 1BO6A 1YU9A 3I62A 2N1BA 1XMJA 1OB2A 3DZDA 3KXIA 3TRFA 4B3BA 1SHKA 4BFTA 3K0CA 3NC0C 1E32A 1XD2A 3TUJC 3U7FB 3LBHA 1EWRA 2FSFA 3IEUA 1KI4A 1M2OB 4IXMA 4B3XA 3OHMA 1YRAA 1Z47A 4QBHA 3TR0A 5JWRA 5EJEA 1R4AA 4EPVA 4WAUA 3K70B 4ZDIA 1IN5A 2G88A 3KFXA 3K70D 5F9HA 2PLFA 2D2EA 4YLGA 1GL6A 2ZRGA 3O8BA 2FN4A 5GJVC 3HWSA 1FMJA 3TW8B 4QJ5A 4TYNA 3WYFA 4MYHA 2MSDB 2ZRBA 3JVVA 2QQ0A 2FZLA 2AN9A 3TR5A 1BMFA 4ESHA 3GJ3A 1C4OA 3BAFA 4Q1FA 3KQKA 4HEJA 2BEJA 4ZKEA 5TY0A 1F2UB 1G8FA 5SZKB 3UANA 4WZAE 1N5JA 3S1AA 1KI1A 1GIAA 4L9WA 1LNZA 3GJXC 4GBMA 2O8FB 1SULA 2H1LA 2VO1A 3B85A 3AVPA 3D7MA 5HKKD 4BLTA 4Z8YA 1MO4A 2IYLD 3I72A 2CLCX 4RD2A 4OQNA 4QBFA 2FG5A 3KTAA 1G9XA 1U0LA 3VR1A 4OI0A 2CDNA 1JPJA 4LHXA 4I81A 1E99A 1O87A 1D6JA 1XJQA 4M1SA 1T3LA 5EXSA 5FTMA 5TARA 2XNSA 3DHWC 3K09C 4PPGA 1RIFA 1G21E 2VBCA 3RLFA 1GILA 2YWHA 2ZRNA 4Q9IA 5CYOA 2NPFA 3WMGA 1TUEA 1FQKA 2QROA 5EXXA 1Q12A 4IJMA 4TMTA 5K8UA 3TKLA 4NONA 4Q1AA 4CEHB 2ZE8A 1J8YF 5L3RA 4JSTA 3CX8A 3AF2A 3C7KA 2BBTA 2F9MA 3QKUA 4Z51A 4ZDKA 2GZAA 3MWKA 3AP3A 4QHYA 2VYFA 3GP8A 2ONJA 2V1XA 2O0KA 4TL7A 4WOPA 3BORA 3T1OA 4B6FA 1FMLA 1WA5A 1Q22A 3CNOA 3QI2A 1OFTA 3BH7A 3CONA 3L0SA 5FTLA 1TQ2A 3RRYA 4LJ9A 5H8WA 5DH9A 1JR3D 1KO4A 3M1IA 2B8TA 4KO8A 2ZSDA 3Q7QA 4KVAA 1N0UA 5KPJA 1G19A 3K0AA 3LNCA 2QTVB 1SVIA 2BCJQ 1KO8A 3SJCA 2ZROA 1D5CA 4Y0VA 4ZV4A 5L3VA 1YZTA 1V5WA 3ASYA 5BN3A 1E9BA 2CVHA 2Y8EA 2VTKA 4JLKA 4Q47A 4NP6A 4UNPA 1RPZA 5B2ZA 3T5DA 3MJRA 2QMOA 3WNCA 4DCVA 1OIVA 4QFMA 2ODEA 3FHOA 3BB3A 2V6JA 4B34A 5CK5A 3SR0A 2JEOA 2PT5A 2OV2A 3GFOA 3KXKA 2J46A 1KI6A 2B8WA 1E6CA 5HZKA 3T15A 1NY5A 5FR1A 1GRNA 5LD2C 2AFHE 2RHMA 4PAMA 1ZBDA 3NH6A 1R0XA 3E70C 5EE1A 2CLSA 3T5GA 4DEXA 1XCGB 1EFCA 3EWSA 1KY3A 1A5TA 3B1YA 5BQ5A 2IWRA 2FZ4A 3HR8A 4TTRA 2ZJAA 3RS7A 3SYNA 2WSSD 1G3MA 2C04A 4PQRA 4PPQA 2QPOA 2WKRA 3R9XA 1G3IA 1TL7C 1KI3A 1LF5A 3IIKA 4QXAA 2O8DA 2H57A 1ZU4A 1JBKA 4IFBA 1A1VA 4RY2A 4FCVA 4NYIQ 4RCYA 1T3HA 2FGJA 3FMOB 4MGIR 1PZNA 4OQMA 5CK4A 5JFGA 2HJVA 3P4YA 2H16A 3CH5A 3MFYA 4O25A 4TL6A 3ZQJA 4RFVA 4NCHA 4WXRA 1OFHA 1XEWX 3QPWA 2ERYA 1OW3B 2X2EA 1OXSC 3GJ7A 4LC1A 2QMEA 1RVDA 3G0HA 4YC7A 2RB4A 5ANRB 3A1WA 3TUIC 4CW7A 4EJSA 1ONBA 1RYHA 4XVUA 1OF1A 3L2OB 1XTQA 1UKYA 2IC5A 2ZRAA 4IHQA 4DCUA 1LFDB 2YWEA 2EFEB 1A7JA 2H92A 3L82B 4G5QA 1XEXB 2W00A 2AKYA 2GJKA 1TPZA 3VKGA 4Z1MA 1NMYA 1IONA 4BFUA 2GRJA 3OEHD 1FTNA 3QXSA 1R2QA 2NG1A 2QI9C 2WJJA 3QF4A 2V55B 3QKSA 1F2TB 4OI4A 4CGZA 3ZVNA 3IPXA 1XCPA 1NVVR 3M6AA 4IOLA 4EKDA 2HT1A 1OXXK 1TQ4A 3QIAA 2ZUDA 2HXYA 5BN4A 5TVKA 1M7BA 2VHCA 4JVNA 3EPHA 3TNFA 121PA 5G40A 1HE1C 3RS4A 4JKYA 1VECA 2IK8A 3KXLA 3OEED 3VR3A 2IYSA 4P32A 4O3MA 5AJVB 3ECCA 4UNSA 2GCOA 1ZAKA 4L4UA 1U8AA 3MSXA 3PVSA 2PEZA 2RGNA 1XNJA 3BFXA 4JBWA 4CEIB 1G64A 2DBYA 4G1UC 2O8BB 1LVGA 1P2SA 1R10A 2A5JA 2IYWA 1JR3A 4RSGA 2QORA 3LX8A 4EQ6B 4KXFB 3KQLA 2XTNA 2PZFA 1CTQA 1P75A 3K1JA 3BFVA 4EPYA 1E9FA 1N25A 2FV8A 2ERXA 5FUWA 4ABYA 2QT1A 2ZYTX 1R8QA 2BM1A 4BFZA 2P5TB 2W6JA 1J90A 4IOMA 4BUJA 4PC1A 4A2PA 4QOSA 1IN7A 2REXB 4LCBA 2JLXA 1NN1A 1SVKA 3EPLA 3IEVA 2EYUA 2CXXA 2GEVA 4JVLA 3QXCA 2JLWA 4QHSA 5E3HA 2JLVA 2CJWB 3A4NA 1OXVA 2ZJYA 4HZUA 3RS3A 1G4AE 4DXAA 2OSBA 1Z22A 1QHIA 4NYJR 2J7PA 4Q4HB 4DCSA 3U6KA 4CDGA 4DLYA 2D7CA 3AKEA 1CR1A 1N6NA 3KDSE 1S2MA 5DNYB 2RMKA 4XTCS 4IEEA 1QBKC 3GLFE 1YZKA 4ZIRB 1UPTA 4F7WA 2FFQA 3GJ5A 2W6ID 2FPMA 1NLZA 1XPOA 5KSPA 1NG9A 1KAGA 2WSSA 3FMPB 4LBYA 4C0LA 4RJLA 5KNCA 3GFPA 4CEHA 3U7GA 2DCUA 4MA4A 4GFDA 3WBJA 2RAPA 2FE4A 2ATVA 1XXHE 1P4SA 4NYIR 4D25A 3VKHA 1KAOA 5JJLA 2A30A 3PXGA 3RSOA 2HLDD
chains in the Genus database with same CATH superfamily
3CZAA 4HLUC 1CU1A 1E1CB 4KODA 2ZBUA 5DT9A 2RG7A 3RC7A 4LSGA 3SIRA 5IBCA 1H1TA 2HMUA 1RYEA 3BCHA 1MUUA 3K8ZA 5C2JB 3E6AA 3ZVLA 3Q3GE 3WK8A 5ENZA 4LY9A 3VR3D 1T29A 3AH8A 2G09A 5EXDA 1HURA 3I9KA 4N0QA 3LBFA 2WUVA 1NX6A 4C0BA 3REFA 1IMOA 1T3SA 1K66A 3R40A 4PLWA 1IN4A 1QZXA 4I36A 5LZ8A 3F6BX 4JL6A 4QLAA 1U2ZA 2C98A 4CIBA 3X2FA 1WMAA 4MA5A 3PDCA 4GHWA 4EPTA 2EWVA 4Z0PA 1M83A 1GGKA 2P6NA 2C9OA 5EMKA 3A6DA 4KQ1A 5A6SB 3SKVA 1M9NA 2XUPA 3VZRA 5C8ZA 5HZMA 1A88A 1C1HA 3OWXA 1JDPA 2BZGA 3FNQA 1YMQA 3Q3IA 1Z4OA 2IBMA 4ZZ3A 3QV1A 5GY7A 3LK7A 4TVKA 3BJEA 3PDWA 4GE3A 3KB6A 4V0NA 5J5CA 4KPGA 4OHYA 4BNIA 3A3PA 5IZCA 2XUHA 5D00A 4IMRA 4BEVA 1N8KA 2AJLI 3ONNA 1H23A 2MSNA 5E6RA 1GVHA 2VYNA 3G8YA 4LXTA 2NSDA 2NWQA 2XZDA 4M9SA 1JWLA 5IT0A 2XB9A 5K5EA 2C8KA 1JKJB 2QTFA 2GYWA 3KT8A 3K15A 4H17A 2OFFA 3K6SA 1G20E 1QS0B 2YXPX 2QL7A 3O74A 4AB1A 1CDZA 2WM3A 4C3ZA 3G0CA 1OYWA 3NHKA 4BXOA 3PXEA 4B40A 4B33A 3GVHA 4JX9A 3QU2A 5IAGA 3T52A 2GFQA 4KKXB 2DTEA 1FJGB 2OVFA 2N9UA 2WTNA 2EFCB 1ZBQA 2P9HA 2QX6A 3K9LA 3HKBB 4R40A 2IYOA 3CRQA 4RCZA 2QY9A 4PPFA 4FXOA 5DCWA 4YCCA 2BFFA 1QP0A 3EXAA 3KTFA 3MCTA 4X5OA 1MC1A 4C4SA 5FDFA 2W2KA 1QOQB 3NATA 1WVGA 1EJBA 1QCZA 3Q85A 4UDYX 2F48A 4XQCA 1MV5A 4B3HA 2B82A 3HA5A 4MHOA 4WASA 2BFMA 3QH4A 1MRZA 4TM8A 4TXMA 4D3DA 4HTAA 5EQTA 2ZDGA 4B4WA 2FN3A 2G4VA 5EIEA 2VP0A 2BVNA 3FWHA 1PS9A 3JQ8A 4MZDA 1CZLA 4AKIA 4RTKA 3AEKA 3RVSA 4JLUA 4BMVA 4U1RA 3FLEA 4W5TA 4ZK6A 2JD0A 4C1BA 3BKWA 1SHTX 3SXJA 3WRXC 1S2DA 4LBVA 4H7DA 2KX7A 1XTSA 1VL6A 5J4HA 1FDVA 1SU6A 2I80A 1PRYA 2H1SA 3QVGB 2Z8XA 5KTPA 2V7TA 4EUNA 3NDIA 3HMKA 4UMDA 3WSTA 3V2GA 3GLFA 5FULA 2AOUA 3HC7A 4RYDA 3OT4A 4JEIA 5JLJA 5I7OA 4RABA 5AJUA 3GRYA 2IF2A 2Q2NA 1G291 4FZRA 4C6TB 5I9IA 4FQ5A 1JEYA 1II9A 4A6PA 1QQBA 2PO7A 5CNMA 2AVDA 3IHKA 3OLCX 3CV3A 1PCXA 1X0VA 4ZALA 2FZWA 3HVUA 3JRNA 3QXHA 4LSMA 4EENA 2X77A 2EU8A 2I7DA 2QR2A 3FRIA 1OYYA 3S3TA 1NI4A 1X42A 1CUIA 3G2QA 4DMKA 4G0QA 1DTWA 1XU4A 3NHWA 4YXWD 3MPUA 3WGLA 2AMFA 3GZNA 3VYVA 1PS0A 4HTFB 1GTSA 1NOJA 3DMGA 4P7JA 1KZHA 3K94A 2FW9A 4RS4A 2PXCA 5IH3A 3RJ5A 1P3Y1 2Q8PA 4YUZA 5LP6A 1CC1S 1RLUA 4HAVA 1RXYA 4R54A 3N5KA 1Z6GA 3TQRA 3GYBA 1TDJA 3F47A 5C1DA 2WV7A 4BAGA 4QRIA 3TQIA 3ZWVA 4FCCA 1FIUA 3QEBZ 4TS1A 5FNZA 3IE2A 4FOPA 1FFHA 3VQTA 4GYKA 3ZXSA 1LDEA 3FYCA 2JJYA 2NV2B 2NZYA 4NEHB 1LC3A 3MT8A 4A8JA 1ZD5A 3FKQA 4QQ8A 4W5QA 1F60A 3H5TA 2ZUFA 3SPXA 1QXSA 3S2UA 1QJCA 2B21A 2Q4RA 3DPUA 3RSLA 3VU1A 2FK7A 5TEVA 4CF4A 1XLWA 1KETA 2Z5GA 4ZV7A 4DWVA 1VL2A 1M2WA 5LBIA 2YDXA 4E5PA 1RDFA 4FLFA 5IC6A 5BN5A 5DCLA 3UJBA 4ZCRA 1KR5A 3IO3A 3K8OE 1E5QA 2I4OA 4GOJA 5KJFA 1UBUS 4IX1A 3BSWA 1IHPA 3ITEA 3REOA 3UMGA 2JCYA 3LL4A 2Q5CA 2XLBA 2V8BA 3IDOA 3LQ1A 1C50A 2Y9MB 1QGZA 4RFSB 3MIZA 1E3MA 2J5RA 3RNLA 1OASA 3A4YA 4GKJB 4EMTA 2JLSA 4AZ0B 5JC8A 1PUXA 2V3VA 1CQXA 2ZUCA 5FNVA 4D4JA 2ANBA 2JVIA 4G25A 2RK6A 2HNAA 2BF4A 4JN6B 2XD9A 4X6YA 2IYTA 1CG6A 3CY6A 1EE2A 4ZVRA 3NVAA 1HUQA 3CNBA 4MVJH 4CV0A 3PICA 2WKQA 3FX2A 3ZJUA 1ZMOA 4Y8VA 3T7TA 3K70C 1Z08A 3HVHA 1U6IA 2XVXA 1BEZA 2GD1O 3CS3A 3NWJA 4EGSA 3F7NA 3JASA 1VMKA 3QEJA 4XX0B 2OFWA 4L4YA 4LDJA 2Q6KA 2ROQA 3CZPA 4YP7A 3I6QA 5J5VA 3WGHA 3WV5A 4NZPA 4C6HA 3GLGB 3FZYA 1HL7A 1E61A 1YB7A 2GR9A 4IXWA 1SZJG 4KU4A 1HQDA 2I67A 3BWYA 2BD0A 4XM0A 4LV5B 2WJPA 1OE0A 4LVUA 4MYTA 3LRPA 4UULA 3D4NA 4UCQA 5B12A 1EB9A 1F0KA 4ND6A 3B2EA 1EGHA 3H0EA 3PHGA 4R1NA 3W7AA 3ZWBA 5LB4A 1GSAA 3WLOA 1KEZA 1KK0A 2A9OA 3NHRA 4JASB 1EQ2A 4L73A 3NP7A 3QJYA 2JAUA 4LRYA 1KTIA 2PUAA 5CP8A 1EG7A 3HZHA 2H08A 4KITB 1NVUQ 3PTAA 2J4FA 4Y18A 4LZWA 4C06A 1G18A 2B6NA 1WSDA 4QDXA 6ADHA 1W5SA 1URPA 3LXXA 4YV1A 1Y8RA 5LOVF 2AH5A 5JNLA 1QO0D 5GZ6A 1C9JA 2B7BA 2CL5A 2HSGA 4N8EA 3OQNA 1E0KA 1GNVA 3TLGB 2BEWA 4GM0A 3LC2O 1E1YA 3IS3A 4IJUA 5JNWA 2IZ7A 4DWOA 3W3AA 1NKTA 2NZUG 3MG9A 1ECLA 1GD1O 1ZHHA 1H22A 3D1LA 3NKFA 5FA6A 3WQBA 1JZTA 2C7QA 1YR6A 4G24A 4M8SA 3NU1A 1LTQA 1N0HA 3R5HA 2ASEA 4Q66C 4PZZA 1N36B 2XSZA 3AW8A 1YKSA 1HT3A 1IEQA 1O8BA 1CY7A 3P2KA 1RHRA 1X92A 1M74A 2C5FA 2ATEA 4NFYA 2DE0X 2HGZA 2RKOA 2W9XA 2WUWE 4TQAA 5AKGA 5P8WA 3HXQA 2Y1WA 1KNXA 2GASA 1H94A 3H18A 2E89A 2P91A 1JGTA 2RGUA 2X5NA 3OZEA 5JS6A 2AEJA 3OLQA 2QLTA 3TQOA 3HJNA 1XDDA 4XVCA 2PL3A 1PYGA 3DUWA 4MUYA 1A9QA 4HEHA 4LN1A 2HMSA 4MR8A 1T8PA 5LZ9A 2HMAA 2H0QA 3TNJA 3OQHA 4BBJA 5K0FA 3A1EA 4OMDA 3HV2A 1LA2A 5DLQC 4ZVQA 3G2HA 4FKMA 1GZUA 1VCMA 3IEPA 3H2KA 1N7GA 2F59A 3GJTA 4YP1A 5D8DA 4BC0A 4MVCA 2HTFA 1HG1A 3RRBA 5CA1F 4J43A 2I99A 4RW0A 3OFJA 1U65A 4TWIA 1YQWA 3RFUA 2W37A 2Q29A 5JAMA 3EBLA 1CY8A 1KVSA 4CUKA 2J30A 4UOEA 4Z6KA 3DVLA 1HDIA 2RBKA 2CYAA 2V97A 3RFCA 5KOYA 3ZD9A 3BMOB 3NOOA 3WWOA 1PAUA 3ZI4A 3LX5A 1P1CA 5I7SA 5I9LA 5LQJA 3M9WA 1QK4A 1H2WA 1MJ5A 2H1CA 1MENA 3G9QA 5ECGC 1PWHA 3RKSA 3WGMA 3ONWA 2BZ1A 1T9ZA 2M9MA 2DYKA 2CL7X 1G1MA 3C5CA 1LVUA 1HBJA 4AWXA 1GG2A 2HAEA 2PY6A 2NNWB 4DB4A 5JAIA 4HNAB 4D46A 1EUQA 4C08A 5B3LA 3OO0A 1ZX1A 3B51X 4TWAA 3ADBA 1TADA 3DZHA 4WFKA 2GPTA 4I46A 3NBKA 4TT8A 2P9JA 3RU7A 3WL3A 2IVZA 1UT5A 3RVJA 4WKGA 1Q7BA 3PFHA 2LKDA 3D31A 4HBGA 5FUVA 4LUCA 1L1FA 3WTBA 4AK9A 5JV5A 2R7NA 2WJZB 3ZX5A 1GZ6A 2A5LA 1GYQA 1DCKA 3QEKA 4E32A 4QUJA 3AVYA 4DR1B 3ELDA 1D0SA 5ALRA 4S24A 3AW9A 3WS7A 4JJ8A 1EEXB 1Z2EA 2NT4A 1X7ZB 5FBRB 1EUDB 3TTXA 1QAOA 2J6CA 1K3TA 1GQSA 3IAM6 4HJXA 2C59A 3ETNA 2FWNA 1KEUA 5LZ5A 3QMWA 1ECBA 2B20A 1KA9H 2DQSA 1L4EA 2OFOA 3ESYA 4ZHQF 2JAQA 3PVZA 3DDUA 3RSFA 5EA2A 3ZGOA 1I7DA 1HV8A 1B74A 3M33A 4W6ZA 3VTKA 1GKLA 1H3EA 2B9EA 4J91A 3SM9A 3EXHC 4MW1A 3AV0B 2HFKA 2V96A 1JDVA 4UKDA 1W29A 3ABOB 4CM1A 1H85A 1UFRA 2NZJA 1S02A 1UBKS 4EMSA 3U61B 1O5IA 1ZD1A 3CLSD 5KJ1A 1V1MB 1YFZA 5CIYA 1GHTA 2BM8A 1E9CA 4HS4A 4EPWA 4V1CI 2EKZA 2RI0A 1KZ6A 1H05A 3IUPA 2PSSA 5ALFA 2R8RA 3QELA 13PKA 4KW7A 3ZWYA 1KK2A 4KZPA 1TO6A 2P8JA 1OXTA 2QRJA 3EA4A 3OCCA 4WERA 3HVIA 4D4IA 3Q2IA 1SVWA 3DS8A 3OHPA 3GXOA 1Z3CA 3NW9A 3THXB 1YE8A 4A6XA 2SECE 1YGPA 1U3UA 3LVQE 5C3UA 1OFGA 4E2XA 5HKOA 4HJRA 2AFIE 4IAOA 4F5DA 2OCYC 4D9GA 3ZGLA 4OP1A 3MJVA 3X1XA 1VSTA 5G4KB 2ZBFA 4UUQA 4DSAA 5DULA 3RW9A 4G5HA 3VKVA 2QMZA 4LWQA 3KWFA 4M36A 1NT4A 4XWTA 4YCAA 2YWFA 5BYBA 3RRJA 4BTVA 1D1PA 3KE9A 4F93B 1LK7A 3IJ5A 2ZSJA 2C2XA 3IUJA 2HDWA 3Q9SA 2E48A 1P1HA 1CT9A 1FLDA 2FQWA 2QNRA 4PG7A 4PGFA 2B37A 3ZC3A 4D82A 2UZ1A 2IH4A 4B3SB 2X76A 4N47A 2Z58A 1PK9A 2YCLA 3TAUA 2CLHB 2FP3A 3TH5A 1E5DA 3LPAA 4ZYZA 1NI3A 1V3VA 3KEMA 1JQ3A 1P5RA 5HBGA 3S99A 4IUYA 1A8UA 5IBPA 2QD4A 1YHZA 3I42A 4G0MA 5CXQA 1LRJA 3AILA 4CM3A 2REQB 3Q8MA 2QRKA 1SZDA 5K8JB 2IYQA 2I34A 2WSMA 3FJ1A 3F6YA 4LJ5A 2IHNA 2JGJA 3VC2A 4X1KB 1M73E 5GINE 4KQWA 2R97A 2BY4A 3D3WA 4UMFA 5I5GA 3GJZA 1XQ6A 1ZMBA 1BRMA 1C9MA 1KK1A 3UG7A 4E21A 1E7YA 1O6CA 2Q6VA 1K88A 1WB4A 1Z2AA 4DAEA 4K9KA 4KI0A 3QENA 2ENUA 2QP3A 4LMRA 4H1UA 1E2LA 2E85A 4DZRA 2A0WA 1IE3A 4Z7OB 4GU5A 4UM8B 5KKNB 1AMOA 1FDWA 1N6OA 4KLAA 2G17A 1E3EA 2KS6A 4JXXA 1EQAA 1T1SA 5AK5A 5BQ3A 1M7HA 3HO1A 1JAXA 3HVKA 5LUAA 1SG6A 2WVAA 2ZT5A 3KSUA 4BASA 4NVRA 5KKAA 1S3FA 4FD2A 4RU1A 3MRSA 5GIOE 4CR7A 3GMIA 3C4VA 1ZH0A 2PJUA 2PWYA 3V1UA 3VNRA 4YYEA 4NXNB 4QGFA 1KZ4A 3KQQA 1OYOA 1JLMA 1CKEA 4RLHA 1VHWA 1S4QA 2XWQA 3NFRA 2DHEA 3VR4H 1WV1A 1EFPB 3R3HA 4B3CA 3LF1A 1SXIA 2MYPA 3LGAA 3HNPA 1JR6A 2VRBA 3C6YA 4GXRA 4LXQA 1JHQA 1JS1X 1MJNA 4MQFA 1OXUA 5ESDA 3ZWDA 2X3UA 3CJTA 1QG0A 4CUJA 1Y5IA 3M3DA 1YR9A 3DQPA 2OEPA 2FDXA 2D5CA 3W1WA 1PQPA 3WL5A 1DQNA 2PIAA 1XEWY 1OROA 2H1VA 5F1OA 4GWLA 2GD2A 1K4MA 1NDHA 3NGXA 1LJUA 3TKAA 3VI4B 2UUAB 2BJWA 1VRWA 2HHLA 4NBUA 2UYCA 3NXSA 5IXJA 4U8GA 4RTSA 5LA6B 5LU8A 1DRWA 1T6NA 5E4JA 3TCNA 4Q7EA 4WBNF 1RACA 3A3NA 1G5RA 4QYXA 1TJYA 1RD4A 1GPBA 1GKYA 3PD1A 3I3SR 4QGGA 3OQJA 4L51A 3RYHA 2YZ2A 1FNMA 1NVEA 4H31A 4G2NA 4PZEA 4TS3A 4MS1A 1RR6A 5B1DA 5ABPA 2BFFB 3G0IA 1R6AA 4GO1A 2NU6A 3U3KA 2R84A 5EMLA 2G5TA 5ER9A 4KR0A 2XWJI 4MVYA 2HNKA 2HJRA 2I76A 5D7NA 2O8CA 1TU0A 3ZWPA 2IS1A 3A36A 1RWPA 4LW8A 4J1NA 1AKVA 1G63A 4IQ4A 3JQRA 3UF0A 4KXLA 4RDXA 3CSDA 3BWVA 1F38A 4M9CA 2P90A 1YIAA 2AFVA 1EK6A 2H17A 3M70A 1WZNA 2CNLA 2NLOA 3CF2A 1W49A 4HNAA 3ZHZA 4Y1RB 2ODTX 3VC3A 2XCOA 1VZ2A 1HMPA 2ZM5A 1UKEA 2SICE 3RIYA 5MF6A 4BMDA 4OHWA 2YS6A 2IIBA 2JHGA 2O3SA 1WKVA 2YMPA 5JT1A 1T2CA 4U7HA 1AO0A 2QUBA 2RAUA 4YY3B 1FU7A 2IYZA 4LYAA 1OHHA 3ZJVA 3IKLA 1FU4A 3NBXX 5AM1A 1BDMA 2J7PD 1JXQA 2G8LA 2CHQA 2IHTA 4FDLA 5KVAA 3I28A 4BVKA 1CS4C 2GLUA 2WSBA 3TZCA 3VHLB 4YP0A 4AJEA 2VDNB 3DCJA 3RAFC 5CA0F 4AZWA 4BU0A 2BUBA 3BGOS 5EKTA 1ZMXA 4EJSB 4DM7A 1GPYA 1EK0A 2I3GA 1IXKA 1TYDE 2JW5A 3MTEA 5M29A 3SWWA 1T2FA 3A6LA 3AJAA 3KHTA 1YD7A 3G88A 1QSGA 2C9YA 4U9HS 2W2LA 3KM0A 4CTNA 1ZM2A 2B94A 1NURA 2CNOA 2QRHA 3U19A 4M1YA 2DLNA 3DOIA 4NBKA 3GGOA 4QOGA 4DDMA 2AFHA 4DDKA 5HXAA 5LQKA 5LXTB 1Q3HA 4Q0MA 1ZITA 1KFCB 2VRCA 1D4OA 1QYRA 4OHUA 3P27A 3RVRA 3SZGA 2OCAA 4IF4A 4JC4A 4IV8A 4K8RB 3IKMB 4BKOA 3PQDA 4BNTA 2VNIA 1B16A 4NATA 1UDRA 3P9NA 1XKQA 1IIRA 1STOA 3UT6A 5K3FB 2HMVA 2NQ8A 3L07A 5HMLA 1UOQA 3S2EA 3LC7O 1SGWA 3GG9A 4DSOA 1T2NA 1A9XB 4RDCA 2HSDA 3DMRA 2J9ZB 3WAKA 1UXJA 2GTIA 4FNGA 5F23A 1DIRA 4IWXA 1BGXT 2GAJA 1WOYA 2I1LA 2KQUA 2D6FA 2HCBA 1MX5A 3IEXA 4ZOBA 2PKXA 1L4MA 1MB4A 1Y1QA 4EHDA 2QU8A 1REQA 2XZPA 1TI7A 3JAWB 2OBMA 3T41A 1QS0A 4LZZA 4RZIA 1VGRA 2GS9A 1DC8A 2Q1YA 3ESXA 1GPJA 4PLTA 4DT1A 1W6UA 1J7JA 3MMPA 1SQ6A 5C5IA 4KR2A 4IILA 4OI1A 1GSIA 5F64A 5BV7A 4W1SA 3VZSA 4TV9F 5J2TF 2EFJA 2ISQA 3Q0TA 4ARUA 3IL2A 1M2NA 1ISSA 3LUAA 5DP1A 4CKEA 3ZXUB 1EFVA 4MKGA 1YS2X 3V7YA 1EVZA 1MOZA 2DR3A 2QTZA 1IUKA 1R4NA 3Q87B 2D2FA 1ULZA 2WRZA 3FVVA 4KQMA 4RPJA 4D97A 4KACA 1KFBB 5DMXA 2Q9BA 5JRZA 1BIFA 1KMHA 1E2MA 1FY2A 4X8OA 5JBIA 1EFRA 4MP6A 4OXRA 2RGRA 1I1HA 2FPWA 1PFWA 3NT5A 4XSGA 3VKUA 2AJBA 1IPFA 2NUTB 2P9BA 2ZRJA 3BRSA 2VSOA 1K5DA 1H2AS 1UIRA 2QD1A 5EJMA 4DRZA 4BO3A 3BK7A 5IBQA 2FPPB 4DPKA 4M9QA 4MGEA 5DO9A 4EFLA 4JJFA 1E6WA 1P2VA 3FAZA 3BCRA 4YI3A 2GCPA 4UVEA 4DQXA 2MINB 2ZBVA 1QF9A 3LVFO 1JG2A 2FW8A 4WUVA 2DHRA 2JVKA 4FR2A 1U28A 1TZ2A 1UPAA 1NSYA 3ORSA 4Z2AA 1H0KA 1OGYA 2CNBA 3C39A 2W7TA 3SIXA 1T2AA 3BRWD 2D3WA 1AHHA 1PG5A 1D03A 4FHCA 3S1AB 3SKXA 2A67A 3USCS 3LFTA 5H1YA 1EXMA 1NXOA 1SUEA 2ESRA 3IJPA 4YA6A 4XDGA 3D8SA 3QF7A 4P5EA 3TJZA 3LRXA 4JJZA 4PHGA 2VQ6A 3LD9A 3EVNA 1L5HA 3LA8A 4QDUA 2BFPA 2FTKE 2PMFA 2WLTA 3LYAA 3LV8A 4NFLA 2YWJA 3ZQ6A 4DHEA 1OZAA 1VXOA 1AHIA 1Y63A 2EZUA 2BHTA 1PVDA 4B2LA 2PWAA 3FOWA 1TLTA 4KSBA 3QUSA 4NU5A 2IELA 3KSAC 2Q1UA 4FWBA 4IIHA 1EWTA 4ZCTA 3ETCA 1HC7A 3HKCA 4DSTA 4MMZB 1K5PA 1UJMA 5ALOA 3ACBA 2QMHA 4I4TA 4QEKA 5ALNA 2M6LA 3RYFB 1L5WA 3DXXA 3ICEA 5KUTA 4XJVA 1IVYA 4UDOA 1PHRA 2CBXA 3NT2A 2ZRPA 3S5UA 2E87A 2OAQ1 2XMPA 2AG5A 4F4FA 3UWMA 2X1MA 5CFLA 4LYGA 3RAGA 4YB8A 2E37A 1FVXA 4IINA 5JQGF 4J90A 3KKMA 2PFKA 3AP1A 1IH8A 3KDPA 2XBLA 1ZN7A 4NS4A 4IIJF 2Z3VA 1UL1X 5LZ2A 1VCNA 3OOYA 4K9RA 4XGRA 1WLSA 3PXAA 3EPJA 4AJ1A 2MSEB 1IWBB 2B83A 3RB8A 2R4UA 1NFRA 1RAFA 4A0HA 4REQA 3ZCPA 5DT2A 2V1UA 1WCWA 2XXAB 4FSHA 3UJ3X 5HIAA 1QBGA 3LT4A 4HDMB 2HSZA 1B00A 4OHFA 1SK8A 1TLLA 4JI3B 2R2GA 2PX0A 3CTPA 2VP6A 5BWNA 4RSHA 3R7AA 3QEMA 2WWIA 4G5GA 4G63A 4UAUA 1SC4A 4DXHA 4KSCA 5AD1A 1B41A 1UFOA 1E8NA 1ZRNA 4RLFA 1KBZA 1ADBA 1WMSA 3V80A 5IARA 3FW1A 3VPAA 1KDZA 5IJXA 1YZLA 1V6AA 4ZRMA 1H1DA 5DHQA 1MABB 3O26A 2CLLB 1N3LA 3HY6A 3KUCA 2C2WA 4DQVA 4Q4HA 1N5MA 3P20A 1DINA 3HFSA 2G28A 3IIIA 4B8YA 4ZQEA 2NZWA 3DVQX 4HDSA 1OCEA 4MO2A 1W0JA 4NJOA 1JILA 2PUCA 3NDRA 1D5WA 5FI1B 4CM7A 4IKEA 5KYYA 2IGTA 5JAHA 4DKJA 1W9MA 4DWJA 4KQXA 2PCJA 4HLUA 1ZR4A 5DM0A 4YMWA 2PV0A 2COEA 1Y9JA 2OPHA 4P2BA 3FPJA 4AWAA 1C29B 1Z6PA 1QDEA 3BH0A 5BRNA 3OF3A 1BTOA 3PV0A 4OXQA 1K7SN 5JNTA 3BSYA 2J3DA 3TRDA 4OO3A 4IF6A 3NUQA 3ZUGA 1FFSA 2HEGA 2GF2A 1TD9A 2WTMA 1AK9A 2HJ9A 1JIKA 2Y0DA 2ZTUA 3DEKA 1F4VA 3MNFA 1Q0LA 3ROXA 4DV6B 1FEZA 3CKMA 4U0KA 4DIDA 1YIOA 1P1BA 1YBFA 3PPWA 1W5TA 1V26A 2E5FA 1ZXBA 2K2WA 2QTWB 2XT0A 3FRHA 3JQGB 3O82A 1TCCA 4MV4A 1AZLA 4KWTA 1JDTA 4MNTA 4XCQA 4BQIA 4F04A 1NRWA 4CWAA 3HU1A 3QKWA 4W7IA 5A1JA 5IABA 4C4AA 3HKBA 4HAYA 4QPNA 2ZEJA 3KZCA 4TKUA 3WKDA 3T38A 4BO1A 4D4LA 4F4UA 4YMTA 5K20A 3O5AA 4KAAA 1C8LA 3D8TA 4DY6A 5I8PA 4JSYA 2EGGA 3RYCB 3C4JA 2QTLA 4A23A 4YRSA 1DO0A 2QT0A 4DLUA 2BUCA 3FG9A 3ND8A 3FDIA 1W5FA 4QRDA 4MEJA 4D80A 4KRGA 5C5CA 1L1QA 1TC1A 3A4TA 2ZW9A 2QBYB 4HG2A 4R83A 1ARZA 2C4NA 1KI8A 2I6GA 2XCTB 4RVCA 1GSHA 1KYVA 1R0WA 2D74A 2VBIA 1AUQA 3L8DA 2VOJA 4L95C 5EP2A 1CUAA 4A8TA 3R7DA 2HBYA 3RIMA 4A1FA 3KZKA 1Z36A 2VQDA 3NETA 3OI7A 4DE5A 2FZKA 4PNEA 2J3IA 2PAAA 3E0QA 3VGJA 1JALA 2VEOA 4U7TB 1XJ0A 2D4AA 1T4GA 3LCMA 3TLEA 1IB0A 1XR3A 4CVNA 4LRWA 2P2DA 1DAGA 3AVWA 2C5AA 3ZWWA 3AT1A 3RG2A 3HDQA 4BNYA 3ENVA 4QUDA 2MWMA 4AMBA 3I0MA 4ARVA 2YJNA 4ZEVA 5G02A 3ZWKA 1UEXC 2AL7A 3JQPA 5DGXA 1KBQA 4PIPA 5DIZA 4C3UA 3EC2A 2YV3A 1DFHA 2F9LA 2J9FA 4HL6A 3ODGA 3FUXA 4KWHA 2ZIFA 1TYEB 5F1KA 2WYHA 2GCNA 1G7CA 2Q28A 3OZUA 1Z6QA 5A6SA 1YT5A 1OSNA 4AJIA 3A2KA 4LTDA 3O4HA 5FYDA 1SUIA 1XRMA 1R0KA 2YV5A 2ZLBA 3Q9NA 1YFKA 1U2EA 1YL6A 3LHFA 1V1RB 2WICA 4XUGB 5TV2A 1F8FA 3C3KA 2WWGA 2X15A 3WIUA 2YVQA 3ER6A 4B32A 5CCDA 1E58A 4OREX 4YCLA 1HYEA 1N3IA 1M2HA 3KAPA 3QVMA 4LHZA 5JY1A 2WQ6A 2JS7A 2HLDA 5CM9C 2X0IA 2ET6A 4ENQA 1A95A 2Q3FA 1KWKA 5FBVB 2OBFA 2PGXA 4RGVA 3VGPA 3NM5A 4ZI7A 1QJ4A 3ST7A 3AI2A 2CY0A 3IPAA 2QV7A 3NCTA 5EWMA 1GKIA 5CH8A 3KLOA 1PQ4A 2WDPA 1XROA 2FXVA 3WOVA 1Z5ZA 1U8UA 4HV4A 5A2QA 2NPIA 2R00A 2XTZA 3BTSA 3GCXA 4G01B 4IDPA 5KNBA 3JD1A 4N48A 2FKAA 1DO8A 4CKBA 3GK3A 4DGSA 5JJBA 5HP4A 4A5SA 1D2NA 1AXEA 2NPOA 3E3NA 4EG1A 3HCWA 1AS2A 1Y1KE 3O1IC 4YT8A 5KYXB 1RPAA 4DV4B 1E9SA 1NFQA 3LGXA 2WT9A 4ML3A 4LQDA 1IUPA 2YIMA 3TIXB 6Q21A 2B2XA 5LBUA 5F73A 1C80A 2BWJA 1NVKA 2GFHA 4P58A 1RAAA 4R1QA 1RAGA 2C0QA 5JD5A 2XGOA 5FBLB 3T9BA 5HCNA 3CN7A 5THKA 4Q18A 4FEEA 1JBQA 1B8VA 4W63A 3QNWA 4EUSA 1TAQA 2CV0A 2WWYA 3S29A 1IJEA 2EFDB 1DPFA 3HUUA 2ZUVA 3LLCA 1AKEA 4BKRA 2JD1A 4OHZA 1FXWF 1H2YA 1QHFA 2E4ZA 2NYAA 2VAXA 3HCPA 4QFCA 4ND3A 1E79D 1NMZA 3U4GA 4EYQA 2F3TA 2FNAA 1R0RE 3W3ZB 1F17A 2HV8A 4D9KA 2GO1A 3SDSA 5DRYA 4KK4A 4DR5B 2HA3A 4WJLA 1EXVA 1B73A 3DTYA 3RODA 4A7PA 1DAKA 4RTJA 2G9UA 4Q4CA 1N78A 2H1FA 3HP7A 2JH8A 1F51E 3X2SA 3NDJA 1ESNA 1WUJS 1PSDA 1V5FA 3UBTA 1C14A 2GVNA 4CRWB 1G8PA 1MG5A 1Y7PA 4J07A 2F1RA 4Q3LA 5TMEA 2BGMA 2NYVA 1K2VN 1Y8RB 2DT5A 3H1GA 4TVOA 1G55A 3R7BA 3PHCA 2GJAA 3H13A 3SNHA 2G9NA 4EB8A 10MHA 1KEVA 4LPKA 5KHLB 1V9LA 3AUXA 5AH0A 3THSA 5TQ2B 1P0IA 2F00A 5K9ZA 4UOQA 2FR1A 1LX7A 2XNJA 4V1CA 3FXAA 4DBLC 4NYJQ 2JFHA 4HDMA 4DRYA 4B84A 2VDQB 5CEJA 4FI3F 1H4TA 4QXQA 1VPWA 2XCUA 4ZMSA 1HYHA 3JZDA 1C1DA 3AUYA 2VPIA 4EY4A 3E2MA 5DE3A 1R37A 4GEGA 4N39A 4OG2A 2BMAA 1GGNA 5LIRA 5AXDA 1N2ZA 2RH9B 4UUNA 1JEOA 1S1CA 3HWWA 3KT6A 3O4FA 3OOHA 3C24A 2JCXA 4EHAA 1WCIA 5CNJA 3TRIA 5MFZA 1AVTA 3QUTA 3A2NA 3NIBA 3BMXA 3UB4A 7MHTA 4D8UA 1ECPA 1ORWA 3OC0A 4Q19A 5E3JA 3P45A 4F72A 1GFIA 1VL1A 4NBWA 1J8VA 4MICA 4EHFA 3IO5A 1DSSG 4P84A 3CRZA 3URKA 2O7RA 2PPLA 4AZ0A 1LJLA 1YJAA 4S1WA 3VZBA 4B48A 1VMAA 2ACVA 5D3ZA 1DG3A 5FPYA 2ZJ4A 3EUFA 4MWSA 1U3CA 3AWIA 4DA7A 4GZMA 4B4VA 4G81A 2VJDA 3HYCA 4ZXFA 4PRKA 4Z1MD 4FW9A 4D5EA 2BGUA 2UZAA 4WOBA 3W9UA 4O2RA 4KPYA 4DLWA 5C34B 1QRTA 5K2MA 4B5KA 1GU0A 3QBDA 4Q03A 5A3JA 2CDBA 1KP9A 5CNIA 3EPRA 4MYCA 4O4HB 3G7SA 4NU6A 2HJSA 4IO1A 3G7UA 4DV3B 2VAMA 4KFUA 3PC7A 2IOFK 1HMYA 3INYA 2NU8B 3U17A 1A5ZA 2PKYX 3RAJA 3OSZA 3VPBA 4YO8A 4U9UA 4ZT2A 2WJYA 1GGMA 5J1SB 3TZLA 2VP3A 3EIOA 3AKDA 4Q4DA 5HEKA 4AY4A 2AOTB 4HUQB 4KPUB 5ALVA 1TNDA 1R6BX 2WR8A 3GGJA 4EQZA 5F12A 2FJPA 3N87A 4PO3X 4ZWNA 1WCV1 3LA6A 2YOHA 5DOZA 3TD6A 1FP6A 1FNDA 1NN0A 3A3YA 2ZZNA 1W85A 1X7XA 2A35A 4N03A 5FO0A 4P4SA 3SC6A 1DX4A 1K06A 1ZCAA 3DEFA 3V33A 4EHIA 1R8XA 3DPIA 4RK5A 3LHIA 3PDJA 2OAGA 1Z4LA 2F43A 1VE3A 2OCGA 3HA3A 2RGXA 2A5FA 3FTNA 1BMTA 5FA8A 4EA9A 3AM1A 3GD7A 4KQCA 4URWR 5E38A 4MQ6A 3TSWA 4OHPA 4YV7A 2Q8NA 2AR0A 1NBMD 3L79A 3P9IA 4DQ0A 1S1MA 3DVSX 4KUEA 1T9DA 1YDMA 2V7BA 3MTQA 4GX5A 3EVFA 1OT3A 1XZNA 3R3SA 2R11A 4MO9A 4RXMA 4EKNB 3BDIA 4ZJUA 4WXYB 1F4PA 3OLZA 3G1WA 4LOKA 2I66A 5LP1A 4GWGA 3S5JA 3BX1A 2BHRA 4B3GA 4MRSA 3FWZA 2CFTA 2QZ4A 2CXRA 3D4BA 3IMCA 3MWEB 2N0SA 1KQPA 1L0BA 1ZW6A 2P6UA 3COZA 3OAAA 1RWNA 4UEKA 4F8YA 5AIAA 4PZYA 3C8DA 2PLNA 4CE6A 1VJRA 2Y6UA 2F1OA 2P75A 1YRYE 1BN7A 4FGZA 3U3JA 1L5NA 2AXPA 1EFRD 4AICA 1Q3KA 5B3JA 2QUHA 4GPTA 4I1VA 3C3XA 3LHKA 3BFJA 3V32A 5BORA 2ZQZA 3KELA 2ZYRA 4Y6PA 1PEDA 1OH5A 3DAPA 3FM9A 3UJNA 4D3ZA 5C53B 3NCHA 4CKBB 2VDPB 5I4IA 1E1RD 2P41A 3DBOB 1D6SA 4J2HA 1ZWLA 3AGPA 3QMMA 5ES3A 1SC1A 3UMBA 2YRXA 1QWSA 3NRCA 4YP9A 3SJ7A 1LBTA 4K2HA 4UD2A 4CM4B 1PEKE 1VKRA 4KRFA 1GAQA 2ZYDA 3E5HA 2GEKA 2FVYA 3JWEA 3ZZTA 3BRWA 5I48A 1CY2A 1C1XA 3OTQA 3WBFA 1XD9A 2YINC 4LNAA 3SQOA 1Q83A 2UVPB 4LI0A 3NHYA 2I3ZA 2WIBA 5CURA 1XZIA 1ZN8A 3G5LA 4YJ3A 1P0MA 2H7VA 1PWXA 3A7DA 1R16A 4M0KA 2XA1A 3HDJA 5IP5A 3AESB 4EBBA 4MROA 4AF8A 1CSEE 2VDUE 5L45A 2JGFA 2EHDA 1O5TA 4BWFB 4PLFA 1PWEA 1C0EA 1W96A 4R2XA 4IGAA 3P4UA 4R1PA 5BR8B 2VI5A 4Z0TA 2W6PA 2DR2A 2ZXEA 2MCFA 4DDHA 2YFKA 1OH6A 2PZBA 1CY4A 1VE1A 2PA3A 1X8XA 1EFHA 1XAIA 1F20A 3OJEA 3JPWA 4Y9DA 2FR8A 4O29A 6GPBA 3O93A 4L08A 3BUSA 3TXXA 4B3FX 2DERA 5GP1A 2PTGA 2A9JA 3NFYA 4BZXA 2CCJA 2QVYX 1L7OA 3LE8A 4G1BA 4AY2A 1A9OA 1DXHA 1P0PA 2GTPA 1G59A 4XX1A 4CFYA 2QVLA 1I6KA 1NX9A 2EX4A 1DKUA 2J3MA 2QTBA 2Z8YM 4LYJA 1OWNA 2OYSA 4UU7A 3MERA 5HCIA 3RU3A 5F9FA 1K08A 2RHRA 4QOJA 4PFKA 2FW7A 3BRCA 4IEFB 4CKZA 5KX5A 3S8EA 2O4UX 2X58A 5JO9A 4HEQA 2VAPA 3M1YA 5ERXA 3SF0A 3ESDA 3FETA 2BJHA 2GERA 1ZLXA 2ATXA 1JFLA 2P69A 4LMBA 1NQWA 2B1JA 2FQXA 3H1PA 4N5IX 4UNNA 3RK0A 1WDMA 4IG4A 3DM5A 5CG1A 4BS9A 4N3BA 4UE6A 1OV4A 3BGWA 2YJ3A 2HCRA 5JHGB 5IC4A 1E18A 4FNMA 1XF9A 2BI4A 3E1KA 5AHWA 3DYBA 4NCNA 1NQOA 2QW8A 5CLGA 4BO9A 1E2KA 2ZI9A 3N2KA 4ITVA 2H31A 4YEDA 2HQ1A 1UZNA 4KIJA 1GZ5A 3WRYC 1F6WA 4CEJB 4BMSA 3B70A 2QVBA 1BDJA 2WWXA 2QMUA